2IIMA

Sh3 domain of human lck
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
GSPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase LCK
publication title Crystal structure analysis and solution studies of human Lck-SH3; zinc-induced homodimerization competes with the binding of proline-rich motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 62
sequence length 62
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2iimA00
2X3WD 4HCKA 3O5ZA 1NLPC 2PTKA 2O9SA 3EG0A 2CSIA 1W6XA 4JZ3A 1SEMA 1FYNA 1PHTA 2L0AA 1H92A 1YNZA 1SPKA 2JMCA 2CDTA 3M0SA 2ROTA 2KT8A 2FRYA 2GGRA 2LCSA 4M4ZA 2YT6A 5GJWB 4OMLA 1GCQC 1UHFA 1G83A 4AG2C 4LUEA 4CC3A 1RLQC 2BTTA 2ROLA 1WFWA 1IO6A 1X43A 2CSQA 4EIKA 3TSWA 2RQVA 1KSWA 2J6FA 1I0CA 4CC2A 3SEMA 1HJDA 3NHNA 2J6OA 2KXCA 4DEYA 2RPNA 4GLMA 2ECZA 2LQWA 5IH2A 2OI3A 4LN2A 4AFSC 2K7AA 5HCKA 1A0NB 3IQLA 2RN8A 1K0XA 4J9GA 1AD5A 3VS0A 2ESWA 1S1NA 1KIKA 2VKNA 5IHKA 2DL7A 2RF0A 3EG3A 2F2VA 2K6DA 2DVJA 2FPDA 2CT3A 4JJDA 2LMJA 1U3OA 5IXBA 2MOXA 2BZXA 3M0UA 1UG1A 4J9CA 1ZUUA 2LJ3A 2ENMA 2RQWA 2FPEA 2X3XD 1GBRA 4OMMA 3EG1A 1KJWA 2LQNA 5I11A 2FO0A 2L3PA 2DMOA 4Z88A 4LNPA 2LJ0A 3VS7A 1YWPA 1AOJA 2CH4A 2XMFA 1QKWA 1NLOC 2KGTA 1J3TA 2AZSA 2GTOA 1ZUKA 2IIMA 2V1QA 2AKKA 3REAB 1UECA 1T0HA 1ABOA 4J9FA 1ARKA 4OMQA 4RTTA 1JU5C 5L23A 3UA7A 4AG1C 2L3SA 2EYWA 2KT1A 1NYFA 1VYUA 1NM7A 2DYBA 2L2PA 4RTZA 3UATA 1K76A 2D1XA 4JJBA 1TG0A 3EG2A 1JQQA 3VS2A 1OEBA 1SRLA 1QWEA 2EBPA 2J6KA 2QDLA 2NWMA 4D8KA 1X6GA 3GBQA 1AEYA 3NMZC 5FWCA 4LUDA 2O2OA 1GFDA 3JV3A 2EYYA 2ABLA 3EHQA 2YUPA 1GFCA 1OPKA 1AZEA 3I35A 1Z9ZA 2HDAA 2EYXA 2KYBA 1EFNA 2LP5A 4J9HA 2O31A 3ZL7C 1NG2A 1WDXA 2EW3A 1Y0MA 1WXTA 1B07A 5IXFA 1CSKA 2HCKA 3U23A 2HSPA 2A28A 1QCFA 4OMOA 2VWFA 4ESRA 4HXJA 1VYVA 2AKLA 1PKTA 2SRCA 1E6GA 2KRMA 1AVZC 1UE9A 4QT7A 2C0TA 2JW4A 4IIOA 4AFZC 1AWXA 1RLPC 2J7IA 1K1ZA 2VVKA 2ED0A 2PZ1A 2O9VA 2O88A 4Z89A 3VS4A 2DILA 4E6RA 4KRTA 1X6BA 3RBBB 2HBWA 1B3QA 5ECAA 2AZVA 2DE0X 3M0RA 1NEGA 3ULRB 2CH4W 3M0PA 3EHRA 5IHNA 1MUZA 1NYGA 1YP5A 2OJ2A 3M0QA 4HVUA 4RTYA 1ZLMA 1M8MA 2PNIA 4D8DA 1ZSGA 2JXBA 1UJYA 3R6NA 2SEMA 2DA9A 1H3HA 2G6FX 2KR3A 4RTXA 2RMOA 3UA6A 2KRSA 2C0OA 1YWOA 1BB9A 4J9IA 3H0IA 1YN8A 2DNUA 2M51A 2CUBA 1SSHA 1E6HA 2FG0A 2FEIA 1BK2A 1AWWA 1AZGB 1GBQA 1ZUYA 2EGCA 1JO8A 4CC7A 2JS2A 5IHIA 4X1VA 2KE9A 3PVQA 2A36A 4JZ4A 1PWTA 2EPDA 1KFZA 1WYXA 1UTIA 2DL5A 1ZX6A 4IIMA 2D8HA 1VA7A 1X27A 4OMPA 4Z8AA 1K0SA 2KBTA 1Z9QA 3EGUA 2CT4A 3VS3A 1GL5A 2GQIA 5EC7A 1X2KA 1WXBA 3RNJA 2K9GA 3FJ5A 1WXUA 4F14A 3H0HA 2YSQA 2FRWA 1SHGA 1M27C 4RUGA 3REBB 1WIEA 1VYTA 2JTEA 2JM9A 1HD3A 4OMNA 2KYMA 1E7OA 2LX7A 2DRKA 1X69A 2RQRA 2KNBB 3TVTA 2YUQA 3THKA 2CREA 2JMAA 1AWJA 1I07A 1WA7A 3A98A 4J9EA 2CUDA 2DF6A 2LJ1A 2YDLA 3C0CA 2DBMA 4DEXA 2P4RA 4F16A 1K9AA 2JM8A 2EKHA 1CKAA 2RQUA 2EVRA 1PRMC 3TSZA 1RI9A 2GNCA 2E5KA 1OPLA 2C0IA 2YUNA 1N5ZA 3NGPA 4HVWA 2DM1A 1W70A 2A37A 3UF4A 2RQTA 2V1RA 1UUEA 1XOVA 1CKBA 4F17A 5FWBA 1WX6A 2GTJA 2YUOA 1K4US 1RUWA 2W10A 1X2QA 2DLPA 1ABQA 1UGVA 2AK5A 4RTWA 3VS6A 2A08A 1T3SA 2K79A 1T3LA 1OOTA 2I0NA 4RTVA 2GBQA 1V1CA 1QKXA 1GCQA 1M3AA 1OV3A 1QLYA 1TUCA 3M0TA 2F2WA 4CC4B 1GRIA 1SHFA 2FPFA 1LCKA 1MV0B 3VRZA 4WCIA 3LH5A 3H0FA 1UDLA 2JT4A 1SRMA 4AFQC 1FMKA 2EYZA 2DL3A 1YCSB 4GBQA 1H8KA 1PKSA 1PNJA 2KXDA 2W0ZA 2D8JA 3NPFA 2DJQA 3PE0A 4ZNXA 2JS0A 1WI7A 3VRYA 3I9QA 2EQIA 1JXOA 2DRMA 4J9BA 1MV3A 3VS5A 3KFVA 2F2XA 2DL8A 2EGEA 1JEGA 2LNHB 2M0YA 3QWYA 4JPBW 1PRLC 4LE9A 1UJ0A 4RTUA 2J05A 2D0NA 3VS1A 1M3CA 2OAWA 1G2BA 1M3BA 4A63B 1I1JA 2RNAA 5I22A 1AWOA 1BU1A 4K11A 1Y57A 2L3QA 4R0KA 4HVVA 2BZ8A 2LZ6B 1M30A 1GCPA 2DBKA 4ORZA 4J9DA 2K3BA 4JJCA 5GJVB 3I5SA 2DL4A 1ZBJA 3SHWA 2MCNA 4FSSA 2NUZA 1TUDA 3H41A 3QWXX 2H8HA 3CQTA 2DX1A 2K2MA 1W1FA 2EGAA 4Y92A 1QWFA 3I5RA 1UFFA 3PVLA 1UHCA 1NEBA 2ED1A 2KEAA 1U06A 1WLPB 2MIOA 2J06A 2KRNA 5FW9A 1HSQA 1BBZA 1U5SA 2KROA 4AFUC 2B86A 2BZYA 1T0JA 2HEQA 1JXMA
chains in the Genus database with same CATH superfamily
1N8RR 1G5VA 1NLPC 4JZ3A 1PHTA 1H92A 4J5YA 1SPKA 4P5NA 2CDTA 2ROTA 3RUXA 3OYYA 1N6AA 2FRYA 2GGRA 2LCSA 4M4ZA 4LDVA 3OSSC 1LJOA 3GP8A 4JS4A 3CCET 1ZSZB 2VGMA 1VQOQ 4LUEA 4CC3A 2QA4Q 1WFWA 3V7CA 4EIKA 1VQMQ 3AT1B 2RHUA 2RQVA 1G3WA 2J6FA 3SEMA 2J6OA 2KXCA 3URGA 4DEYA 2RPNA 2CS7A 4GLMA 5GAMj 1WJRA 1KD1C 4LN2A 4IUQA 2K7AA 3IQLA 1K0XA 1WPYA 3OS1A 2LRQA 2OAUA 3RMQA 2VC8A 1V76A 4KGZB 3H9NA 3JCMh 4J6WA 2DL7A 1QP2A 5KE3A 1WHLA 3EFOB 4F7UA 2MF2A 2IVWA 3WVEB 4C92F 2DVJA 2JOYA 1BI1A 4QQ6A 2RO0A 3QHSA 1U3OA 2LDMA 4M75A 3M0UA 4QVZA 4J9CA 2QYZA 2FPEA 2RHZA 1QMCA 1NJIR 3EG1A 1KJWA 2CKKA 2L3PA 4Z88A 4F04B 1ZQ1A 4YTLA 1B34A 3PIOA 1NLOC 2KGTA 3QZ5B 2P84A 2IIMA 2V1QA 1TU0B 4RKUE 4J83A 5GAOr 3OYCA 4AMCA 4BI3A 3V8JA 1T0HA 2LX9A 1M90C 3QYGB 5L23A 3MCAB 4PL6A 2EYWA 2VXEA 1NM7A 1Y71A 4RTZA 1M1KR 1K76A 2E3HA 5GMKh 2D1XA 1D0XA 2RB6A 2QTXA 3C95A 3CXCS 1Q82C 4C8QG 4JJBA 3VS2A 2EJFA 1MMNA 2YRCA 3OMCA 1AEYA 4M77F 2QEXT 1Y96A 3NMZC 5FWCA 3PMIA 3CCRT 1GFDA 2ABLA 2FL7A 1QCNA 3L2ZA 4LDYA 1GFCA 1YJNT 3I35A 4FU6A 3J81E 1RI0A 2LP5A 3OYEA 1NG2A 1G3YA 1WDXA 2HQEA 3MEWA 4XTXA 1UEBA 2OX7A 4E47A 3N5BB 4MZTA 3V7SA 4E7KA 1YFNA 3L42A 5KYXB 3E9FA 1QCFA 4OMOA 2C06A 3CCVT 2AKLA 2EQUA 1E6GA 2KRMA 3VUBA 2XG8D 3ER0A 4IIOA 1C6VX 4ELYC 2ED0A 2IPOB 4BI8B 2O88A 2L8DA 3OYFA 3MJXA 4L5GA 2RK2A 2K5FA 1YI2T 1GXIE 1X6BA 1B3QA 3CBMA 4KGVB 3M0PA 1MUZA 3G4ST 1NYGA 4HCBA 5GAOp 3JRZA 2OJ2A 3CCJA 1IZ6A 4HVUA 3CD6T 2PNIA 4D8DA 1DJ7B 1ZSGA 1UJYA 3R6NA 5GAMh 2R57A 2RI5A 2JTMA 2KR3A 4BACA 1VQ7A 2RMOA 2DD4A 1UGPB 2K3YA 3FB9A 4A54A 3OYDA 3LWIA 4ZN1A 1UGRB 2CUBA 1WHKA 1VQ6Q 1SSHA 2FG0A 2FEIA 3CBPA 1AHJB 3CC2T 1AWWA 1QVFA 3WXMB 2RI2A 4Y28E 1JO8A 3HP9A 5DY9A 4AT1B 2JS2A 2EFIA 1MMDA 1VQ4A 1TTHB 1WHHA 5IHIA 3GOXA 3FRNA 3G71A 3CMAQ 2A36A 4ZGEB 1KFZA 1ZSZC 1SF9A 4M75B 1C0MA 3CCEQ 2RHXA 2DYIA 1PD1A 1X27A 4OMPA 3CCQT 1X75C 1D0YA 1KG1A 2KBTA 2PVDB 2DK3A 1P92A 1I5OB 4ATOA 1VQ5T 4L6V5 1BIAA 2GQIA 5EC7A 3UWNA 1WXBA 1VQNQ 3SD4A 4F14A 3L2VA 3H0HA 1MMAA 2YSQA 1JJ2P 4RUGA 2NUTA 3REBB 5GANg 3JCMQ 1HD3A 4OMNA 2KYMA 2Y90A 1K8AC 2RQRA 4Y91A 3TVTA 3EG9A 2EAYA 1R0BG 1KD1R 3THKA 2QGGA 2JMAA 1HYOA 1M8VA 4J9EA 4ZGDB 2DF6A 5KCOA 2HQXA 3OYKA 1K9AA 3VKIA 4LD6A 4QVCA 4XQ3A 4OVAA 4MMLA 1M4ZA 4JRPA 4D6WA 4FT4A 2GNCA 2E5KA 4JLGA 3QZ9B 1K9MR 1N5ZA 1W70A 1SSFA 2QTVA 2LC4A 2V1RA 3F70A 1OI1A 1VQOA 2JVVA 3ASKA 1WX6A 2QA4A 1VQMA 3VS6A 3G6ET 3MP6A 3A5ZB 2K79A 1JJ2S 4NL3A 2PUOB 3GIBA 2GBQA 1QKXA 3M0TA 4KT0E 4CC4B 2E41A 1GRIA 2FPFA 1LCKA 4EDUA 3M54A 1IB8A 3CEYA 3I56T 1UDLA 2ZPGB 2EYZA 1MMGA 4GBQA 4UC4A 2D8JA 1Q82R 2QEXQ 3CCRQ 2GQVA 4HT9A 2YRDA 2OTLT 5GAOm 1D09B 1YJNQ 3VS5A 3KFVA 1XTDA 2M0YA 4XK8E 4C0DB 1W4SA 1M90U 2J05A 1YJ9T 3VV0A 1M3CA 2OAWA 1PG5B 4XTWA 1AWOA 5CKFA 2MYSA 1MNDA 4JLIA 2CP6A 4BY6B 1BU1A 2L3QA 2RK1A 4C8QA 3JCMd 4JDSA 2DIGA 1M30A 3CCVQ 4M75D 5EG2A 4ORZA 3CCUA 5GJVB 2NUZA 1W2BA 2DZCA 1WHGA 3HRSA 2DX1A 2K2MA 2EGAA 3RIRA 3HL8A 4PLIA 1YI2Q 1UFFA 4M75F 3E19A 1S72T 1VQKT 4NS5A 2ED1A 1U06A 4M7AB 3JCMJ 3L2UA 4LDUA 2KRNA 3G4SQ 1BBZA 1M9SA 3HRUA 5GAN6 4C5GA 1KC8U 3CD6Q 1Q86C 3O5ZA 4PFZA 2O9SA 4FSXA 1W6XA 1SEMA 1FYNA 1K73R 4FW2A 1I8FA 4L59A 1RAFB 2QI2A 5GAN2 1UHFA 2GCXA 2NUTB 4DOVA 2BTTA 2P4TA 4DA4A 4OGCA 3JSCA 4C92B 1YJWA 4CC2A 4ZN3A 4ANJA 3FJPA 2OI3A 4PJMA 1A0NB 3RR6A 3JB9G 4J9GA 1LNXA 1KIKA 5FU7B 1X6OA 3JCMe 1OZ2A 4E7ZA 1N27A 3CCQQ 3EH2A 2M16A 1VQ5Q 2LMJA 2RJCA 1UG1A 4M7DB 1QP3A 4C0ZA 4OMMA 5J3BA 3J80E 2K3XA 5GAOl 4JRIA 3OYGA 1QQJA 2LJ0A 3E1SA 3NTKA 2E4HA 1IREB 1WHJA 2WACA 1WHMA 5FU6B 1J3TA 1K8AR 3X26B 1TOVA 3JCMf 4HCCA 3S6WA 2GTOA 1ZUKA 4FM4B 2D0QB 1QVFP 4PJOE 4M77B 1V29B 2QG9B 4XTVA 5D6WA 4RG8A 1ABOA 3V7RA 1ARKA 5GAMd 5CKEA 3UA7A 2CZ0B 4QW2A 1NYFA 3CMAA 2CZ6B 5GMKe 3CCEA 4PKCC 1KHCA 4WTOB 1QWEA 2MMPA 2J6KA 2QDLA 4D8KA 3OSVA 2QQRA 1PCXA 2XHCA 3O8VA 2EYYA 5KYWA 5GAN3 2AHJB 2X4YA 3SWNA 5GANj 4IUPA 1VQNA 3X20B 4GY5A 3G6EQ 2OTJT 4M7AD 3TCJA 2YRVA 3CC4T 2HDAA 2KYBA 5LJ3g 4PJOC 2X4XA 3ZL7C 2G3RA 4N0AC 6AT1B 1Q7YU 3HRTA 2VV5A 1VQ8Q 1B07A 4M7AF 3VU3C 3EGDA 1QVFS 4KBMB 4ESRA 4X9CA 2RH2A 3EGXA 4KUIA 3ME9A 2OTLQ 2C0TA 3H6ZA 2QK0A 1TXQA 3FDRA 4M78B 1K1ZA 2PZ1A 4Z89A 3VS4A 2DIQA 4E6RA 4C92D 4KRTA 3RBBB 1YJ9Q 2HBWA 4KH1B 2AZVA 1M2VB 4BY6C 3JCMV 2XD0A 1H641 3CCMT 3OBWA 4LDWA 3CCLT 2EKOA 5KYUA 4PNOA 3G7ZA 3CXCP 3I55T 3VJPA 1YIJT 1ZLMA 1QVPA 4FYWB 4A4FA 5GAMe 5HY6A 3OQ5A 2G6FX 3PT9A 2DVEA 1X01A 2CP7A 2KRSA 1UB4A 1OX9A 2FYKA 4M7DD 3A8LB 2DAQA 2K4YA 2M51A 5KYYB 4C92E 4EMKA 1S72Q 1VQKQ 1OQKA 2X9HA 2QAZA 2QEXA 3CCRA 1E6HA 3HSBA 3DB3A 3M57A 1YJNA 2LCCA 4ELZC 1RACB 1RABB 4CC7A 4M7DF 1OYXA 1R77A 5GAMf 3CCUQ 2PU9B 4M77D 3EFRA 3JCMW 4JZ4A 3GPLA 2EQJA 5CIUA 5DLQE 5GAN8 2KI7A 1VQPT 1UTIA 1YHQQ 1VA7A 4FL6A 3CCVA 4C92C 3JAME 2Y4YA 3TQ7P 4OGEA 4BE0A 1X2KA 5GAN4 2K9GA 3FJ5A 3PMTA 1YI2A 3P8BB 1Q86U 5A0LA 2JTEA 2K57A 4PK4A 2PVOB 2CP3A 2KDSA 3H8ZA 4J8OA 3LGFA 4M77E 3VYGA 2YUQA 4BD3A 1ZBXA 1AWJA 3G4SA 1I07A 3QG1A 5GANh 2M02A 2CUDA 1KC8C 3V8LA 3OYBA 4MMKA 3C0CA 1BIBA 3LGLA 1XJWB 5J39A 3CD6A 2P4RA 4O5VA 2M1HA 4M7DC 4B6MA 2JM8A 5CKBA 2F69A 4N4HA 3DKMA 3A1PA 2YHTA 2RQUA 4C8QF 4XTYA 1I81A 1YJWQ 5C0MA 5KYWB 2M0OA 2COZA 3NGPA 4HVWA 4M78D 2DM1A 2K5IA 1BCOA 3OW2A 2RQTA 1XOVA 2RI3A 3A8HB 4FIBA 3CC2A 2YLCA 2GTJA 4M77C 1K4US 1RUWA 1OU9A 2DLPA 4N0AA 2YWWA 2AK5A 4HCZA 4M78F 2A08A 1T3SA 2DTIA 1OOTA 4RTVA 4R56A 3G1JA 4QVDA 5GMKm 2LTOA 4PJLA 4BE1A 2E10A 3EGXB 3OYLA 3VRZA 3A8OB 3P8HA 4O6JA 2A3LA 3H0FA 1JB0E 2E65A 2JT4A 1SRMA 1VQLT 2KQWA 3CCQA 2W0ZA 1NE8A 2VUBA 2BE7D 2DKGA 4N4GA 4ZNXA 1VQ5A 2NUPA 2XI9A 2NLUA 2P0PA 2EQIA 1JXOA 4EPCA 5KYUB 2OTJQ 1MV3A 5GAOn 1IGQA 4JUVA 3CC4Q 3M9QA 2EGEA 3SB2A 2DD5A 2LNHB 5L8RE 4RTUA 4F7UB 1VIFA 2XDDA 1M3BA 3T9NA 3E2UA 1I1JA 1Y7XA 2RNAA 5I22A 2JZ2A 3MP1A 1C1AA 1B7TA 4K11A 2RJDA 1OZ3A 2BZ8A 5CCAA 2EQMA 3OMGA 3OS0A 4OB2B 4Q5WA 2DBKA 4QQGA 2K3BA 1KHIA 1ZBJA 3SHWA 2MCNA 4FSSA 2R58A 1TUDA 3QWXX 2H8HA 1B34B 2P0QA 4Y92A 3I5RA 3M5AA 1R0CB 4C5IA 2V26A 3CPWP 1Q95G 3M55A 1RADB 5CVIA 3CCLQ 2KEAA 2MIOA 3CBOA 5LJ3j 1FX7A 1M1GA 1U5SA 2KROA 3I55Q 3S3OA 3G6EA 1YIJQ 3D7SB 3C94A 5HK3A 4DBHA 1D1CA 3WVDB 2ZPEB 2XK0A 3KXTA 2ZZDA 4RG2A 3X28B 2CSIA 2CP5A 3JCMP 2H3EB 2L0AA 5GAOq 5CKHA 1Q7YC 3BDLA 3UPUA 3A8MB 2X4JA 1VQ8A 3JB9H 1YITT 1Y96B 2EWNA 3I56A 3NTIA 3PTAA 2YT6A 1F1BB 5GJWB 4OMLA 4FCYA 2DERA 1GCQC 4AG2C 2JNGA 3S3MA 1NPPA 2VXFA 2RM4A 2OTLA 1IO6A 2HKQB 3QBYA 1RAHB 3KBGA 4JRQA 3BFMA 4RCCA 4V2SA 1HJDA 5DM7R 1Y07A 1YJ9A 5M9OA 4AFSC 2XDBA 5HCKA 2MI6A 2RN8A 3CPWS 1RAIB 3CCST 1M90R 5GMKl 3OYNA 1AD5A 3E9GA 3VS0A 3OYHA 3CMET 1S1NA 1N8RC 3QO3A 2FPDA 2CT3A 1WJQA 1NBEB 2VASA 2BZXA 2LCLA 2PVGB 1ZUUA 2RQWA 2ENMA 2X3XD 1GBRA 5I11A 4WF2A 2D6FA 2COWA 2DMOA 2H3JA 2L3RA 1YWPA 1S72A 1AOJA 1VQKA 3M53A 3QXEB 3BY7A 2XMFA 5C6SA 1RAEB 2VYTA 5KYNA 4M75G 3QSUA 1VQMT 2HL5C 4C0FA 2E6ZA 2O4XA 3REAB 3VUZA 4A4GA 1KK7A 3JCMX 4DQ2A 1O9SA 4RTTA 1KC8R 1JU5C 1OULA 2KT1A 2L3SA 1VYUA 1TS9A 4F7UF 3TEEA 1TSFA 2QQSA 2KAFA 5I2MA 1TG0A 3EG2A 1YHQA 4IKFA 1JQQA 1OEBA 4N4IA 2NWMA 3P8DA 2HSEB 1OU8A 3GBQA 2HQHA 2O2OA 3JV3A 1RAGB 1NJIC 4E7SA 2ZAEA 2YUPA 1N9SA 1OPKA 1AZEA 1PSEA 2JN0A 3MEAA 1ZSZA 2EYXA 2CYZB 1EFNA 2K5LA 4J7FA 4M75E 4J9HA 4ME7A 2O31A 2EW3A 1G3TA 1VQ9T 1Y0MA 1WXTA 2EQKA 1CSKA 3GNFB 5LJ3h 2HCKA 2HSPA 1UGQB 1VQLQ 3OS5A 4ZTJA 2A28A 1BCMA 1BI2A 9ATCB 3OY9A 1VYVA 2QXFA 2SRCA 3C12A 1AVZC 3CC2Q 1M1KC 1UE9A 4QT7A 2JW4A 4AFZC 1AWXA 2J7IA 2L89A 1D1AA 1FMVA 2VVKA 3EG9B 3EFOA 1AT1B 1N9RA 2FHDA 2O9VA 1JBMA 4IUVA 3FIFA 2BIVA 2FZCB 5ECAA 2DXBA 4M75C 4GLKA 1NEGA 4PJOG 2KY9A 3ULRB 3EHRA 2LNVA 5IHNA 3L2QA 3M58A 4KULA 1YP5A 5GANd 5LJ5j 2DXTA 1D0ZA 4RTYA 4PLLA 2KSSA 2JXBA 1ACMB 1ZA2B 3LWHA 1EIFA 3RKWA 3INZA 1M2OA 3LX7A 1BB9A 3DLLA 4J7IA 3GLXA 3M56A 3H0IA 3HTRA 1YN8A 5A0GA 1BI0A 2BUDA 3OYIA 2MWPA 1BYMA 2QQ9A 4FYVB 1D3BA 2FVUA 4E7JA 1BK2A 4EMHA 3EH1A 3CPFA 1BKBA 1ZUYA 2OTJA 2AT1B 3CC4A 4BDZA 1QVGA 2FB7A 4X1VA 5IT9E 3PVQA 4XTUA 3OW2S 2EPDA 2ZPHB 5FRNA 1Q7YR 1WYXA 4BUGA 2DL5A 1ZX6A 2ZGWA 3CC7T 2EIFA 4LDXA 2D8HA 4Z8AA 3QJ6A 4E2FB 4M7AG 2E1HA 3VS3A 3QIIA 1YBYA 1HK9A 4JJNK 3JCMb 5KYXA 4DOWA 4E7LA 7AT1B 1JJ2A 3RNJA 5FRMA 4XU0A 4PFPA 4A4KA 4C8QB 1VYTA 3V8KA 1TWBA 2JM9A 2DETA 2CP0A 2O4XB 1X69A 3CCSQ 3CCMA 3CCLA 2KNBB 1BI3A 1VQ6T 2PQWA 2CREA 3CMEQ 3I56Q 1WA7A 3I55A 5I21A 3A98A 5GANe 2LJ1A 4MDWA 2D9TA 1YIJA 2BE9B 2DBMA 4F16A 3HFOA 3OYMA 4LD9K 1KQSA 4C0DC 3JB9J 4C92G 1PRMC 3MPUB 3CMAT 4CRIA 1MHNA 3M4YA 1MGQA 1OPLA 3EFSA 2C0IA 4M7AE 5GAN7 1WGSA 1IRXA 2RJEA 3GNGA 2F5TX 3UF4A 3X24B 2CZ1B 4PFOA 1CKBA 3SFMA 2RD1A 4BE2A 5FWBA 2VGNA 2YUOA 4HT8A 3MKDA 3EAEA 1Q81C 1FWZA 1IHVA 2W10A 1KQ2A 1X2QA 1HXDA 5GANf 5CO7A 1ABQA 1UGVA 4IURA 5LL6S 4DBFA 2EYQA 1N8RU 1VQNT 2HD0A 1T3LA 4NOYA 2I0NA 2O01E 1V1CA 1OV3A 1QLYA 1TUCA 2XICA 2F2WA 2MAMA 8ATCB 4HKEA 1MV0B 4M7DG 4A4EA 4QKUA 3ZBDA 1VQPA 3UT1A 4AFQC 5LJ5h 4M7AC 2DL3A 1YCSB 2ZCFB 2KXDA 1M1FA 2MPXC 3NPFA 2L5QA 1PD0A 3PE0A 4OB0B 5GMKi 5D7UA 3VRYA 5KE2A 2E3IA 1K9MC 1IHWA 2DRMA 5AYFA 4M77G 1JEGA 4C5HA 3OYJA 4JPBW 4JRKA 2D0NA 5I2SA 5GAN5 2E5QA 2VB6A 1Q86R 1U8RA 3BE3A 3QDFA 4NL2A 1VQ9Q 2RA2A 2F1LA 3MP8A 4RMOA 2WSCE 1Y57A 4HVVA 2LZ6B 3RDVA 4M7DE 4MDXA 3LH0A 2PUKB 3TREA 4JJCA 4C0GA 3I5SA 2DL4A 4XU3A 4PJJA 1PSFA 5IN1A 1D3BB 1NJIU 3CQTA 2KMTA 2DPPB 3NTHA 4Z02A 1W2BP 1W1FA 1QWFA 1XNIA 5CQYA 3JCMc 3PVLA 5FU7C 2XKOC 4C8QD 1WLPB 1PC0A 4AFUC 1M5Q1 2HEQA 1FXXA 2X3WD 4FT2A 4HCKA 5CKDA 3PIPA 2GFUA 3OB9A 2PTKA 3LYIA 3EG0A 4XAXB 1M1KU 1JRIA 2GFAA 1YNZA 2CGHA 4M78G 4X9DA 4OMFB 2JMCA 3M0SA 4FYYB 2EJ9A 2KT8A 3SWNB 2EJGA 1VQLA 5FU6C 5A2QE 2HKNA 1G83A 4X34A 5A0DA 3DLMA 2LT4A 4PJOA 1RLQC 2ROLA 4C8QE 1X43A 2QGFB 2CSQA 3TSWA 1MNEA 1KSWA 1QW1A 1I0CA 2ATCB 3NHNA 1W2BS 2ECZA 3JCMg 2LQWA 5IH2A 4EMGA 3EGDB 5LJ5g 3C4SA 3GF5A 2MWOA 2ESWA 1SKUB 5LJ3d 2VKNA 5IHKA 1ZA1B 3CC7Q 2A0FB 4VUBA 2RF0A 4M78E 1YCYA 3EG3A 2F2VA 4II1A 4QQDA 1U1TA 2K6DA 3QUIA 1K73C 2HAXA 1LOJA 4JJDA 3OBYA 5IXBA 2MOXA 4C8QC 2LJ3A 4A53A 3BDUA 3QJYA 4OB1B 2LQNA 2X4WA 3HFNA 2FO0A 4LNPA 3VS7A 2CH4A 2RHIA 4CI0C 1QKWA 4IUTA 2LQ8A 2DXCA 2AZSA 1KQ1A 3A8GB 2AKKA 3CCJT 1TUGB 1UECA 4M78C 4BI4A 2ZPIB 4J9FA 4OMQA 4C5EA 4M7AA 4EMKB 2HZYA 4AG1C 1QVGP 1PM3A 4J6YA 2DYBA 4A4HA 4IUUA 2HL3A 1YITA 1VQ7T 1RL2A 2L2PA 3UATA 5CAIA 5CQXA 1SRLA 1VIEA 2Z0WA 2EBPA 5FROA 1X6GA 2QQBA 3CCMQ 4BDYA 4KUDK 4LUDA 3MHXA 3EHQA 3ZEHA 1Z9ZA 1Q81R 2V8KA 4KGXB 4ZGJB 1U1SA 2CP2A 1VQ4T 3NFCA 3CCSA 4PJNA 3G71T 4C92A 3L2RA 3CMEA 5IXFA 4E7HA 2DO3A 3U23A 3PNWC 5LJ3e 4KH0B 2IG0A 2VWFA 4HXJA 1PKTA 2X35A 3META 3VYHB 3JB9I 4XTZA 1Q81U 1RLPC 1QVGS 2GF7A 1KQSP 5D6XA 1RAAB 2DILA 3BW1A 2WSEE 2DE0X 2MK5A 5AT1B 3DB4A 1KD1U 3M0RA 4M7DA 4B9XA 3CXCA 5GAMg 2CH4W 5LJ3f 1VQPQ 2LVMA 4FW1A 5HK0A 3M0QA 3LW5E 5J26A 2DEUA 1M8MA 3MEVA 2SEMA 2XU8A 2DA9A 2BKDN 4TVRA 1H3HA 4RTXA 2A7YA 2P0KA 4OP0A 4PJOB 1K9MU 3UA6A 1VQ8T 2LQKA 3FLGA 2C0OA 4M77A 1YWOA 4J9IA 1O75A 1H3ZA 3PFSA 2DNUA 1WNLA 1LVKA 3ZFJA 4F7UG 1G3SA 1IGUA 4LXCA 1VQOT 4RCBA 5DLOA 2QA4T 1AZGB 2V8IA 1VUBA 1GBQA 2EGCA 2X51A 2K2VA 4JS5A 4MZMA 2AIRB 1KQSS 2HBPA 3Q1JA 2R5MA 3M59A 1NZ9A 1QCOA 2KE9A 3SWNC 3HPWA 2COYA 5FLXE 1VQ9A 1I4K1 3RERA 1PWTA 5IAYA 2NUPB 3J7AF 2M9UA 3RMSA 1VOMA 3QPHA 4IIMA 5LJ5d 3PGGA 1Q82U 2CZ7B 5HKCA 1EX4A 2I2LA 2KK4A 1K0SA 3EGUA 1Z9QA 4ZTFA 2CT4A 2NYSA 1GL5A 3AHUA 4F7UE 1I5LA 1WXUA 5KCHA 1WJSA 2DXUA 2FRWA 2FZGB 1SHGA 1M27C 3R6OA 1WIEA 2WSFE 4OF1A 3SDZA 1E7OA 2LX7A 2YLBA 3X25B 4B9WA 2DRKA 4M78A 3OYAA 2DEQA 2XIDA 8AT1B 3TU4K 1SG5A 2E64A 2YDLA 1R8OB 4DEXA 1M2VA 4HA8A 4J6XA 3KUFA 3LLRA 2EKHA 3CCUT 3RKXA 1WZOA 1CKAA 2DFUA 1WQWA 1XQHA 2DJZA 2EVRA 3L1AA 4MZPA 3TSZA 1RI9A 2LT1A 2JJ9A 2YUNA 2DZ9A 3UDCA 2QQAA 2V8JA 2A37A 1YHQT 1UUEA 1LPLA 3S3NA 3OW2P 4F17A 5D6YA 3HHTB 1EZZB 1OX8A 4BB7A 4DBQA 4RTWA 4E7IA 2DTHA 4EMKC 3MO8A 5KYYA 3CCJQ 2ZPFB 2FZKB 1K73U 4R55A 1GCQA 1M3AA 5CR2A 2KVQG 3HKSA 1SHFA 2QDYB 2Y4XA 1VQ7Q 1UGSB 4WCIA 3LH5A 4XU1A 3RKYA 1IXDA 2ZPBB 2XDPA 3CC7A 2QASA 3JB9D 4PJOD 1FMKA 5LJ5e 1H8KA 2E12A 1PKSA 1PNJA 1NPRA 2DJQA 2JS0A 1WI7A 3I9QA 2RHYA 2RJFA 4J9BA 3QYHB 3JB9F 3QDRB 1YJWT 2F2XA 2HNIA 2F5KA 2DL8A 4PJOF 3QWYA 1VQ4Q 1PRLC 2R5AA 4LE9A 1UJ0A 3L2WA 3RESA 3VS1A 4DBRA 4OB3B 3G71Q 1G2BA 1VQ6A 4A63B 1YITQ 1D1BA 4FYXB 5GMKj 1WQ7A 3FC3A 5LJ5f 4R0KA 1TH7A 5KH6A 1GCPA 2HMAA 4J9DA 4XU2A 3MEUA 5CK9A 2E6NA 3H41A 2JUFA 3FEOA 3CPWA 1FMWA 1UHCA 2DTOA 1NEBA 1K8AU 2YXYA 3QKJA 1ZHIA 3OA6A 2J06A 5FW9A 3OS2A 3M4GA 1HSQA 1G8XA 2JTFA 2B8AA 2B86A 2BZYA 2E70A 1T0JA 1JXMA
chains in the Genus database with same CATH topology
2X3WD 4HCKA 3O5ZA 1NLPC 2PTKA 2O9SA 3EG0A 2CSIA 1W6XA 4JZ3A 1SEMA 1FYNA 1PHTA 2L0AA 1H92A 1YNZA 1SPKA 2JMCA 2CDTA 3M0SA 2ROTA 2KT8A 2FRYA 2GGRA 2LCSA 4M4ZA 2YT6A 5GJWB 4OMLA 1GCQC 1UHFA 1G83A 4AG2C 4LUEA 4CC3A 1RLQC 2BTTA 2ROLA 1WFWA 1IO6A 1X43A 2CSQA 4EIKA 3TSWA 2RQVA 1KSWA 2J6FA 1I0CA 4CC2A 3SEMA 1HJDA 3NHNA 2J6OA 2KXCA 4DEYA 2RPNA 4GLMA 2ECZA 2LQWA 5IH2A 2OI3A 4LN2A 4AFSC 2K7AA 5HCKA 1A0NB 3IQLA 2RN8A 1K0XA 4J9GA 1AD5A 3VS0A 2ESWA 1S1NA 1KIKA 2VKNA 5IHKA 2DL7A 2RF0A 3EG3A 2F2VA 2K6DA 2DVJA 2FPDA 2CT3A 4JJDA 2LMJA 1U3OA 5IXBA 2MOXA 2BZXA 3M0UA 1UG1A 4J9CA 1ZUUA 2LJ3A 2ENMA 2RQWA 2FPEA 2X3XD 1GBRA 4OMMA 3EG1A 1KJWA 2LQNA 5I11A 2FO0A 2L3PA 2DMOA 4Z88A 4LNPA 2LJ0A 3VS7A 1YWPA 1AOJA 2CH4A 2XMFA 1QKWA 1NLOC 2KGTA 1J3TA 2AZSA 2GTOA 1ZUKA 2IIMA 2V1QA 2AKKA 3REAB 1UECA 1T0HA 1ABOA 4J9FA 1ARKA 4OMQA 4RTTA 1JU5C 5L23A 3UA7A 4AG1C 2L3SA 2EYWA 2KT1A 1NYFA 1VYUA 1NM7A 2DYBA 2L2PA 4RTZA 3UATA 1K76A 2D1XA 4JJBA 1TG0A 3EG2A 1JQQA 3VS2A 1OEBA 1SRLA 1QWEA 2EBPA 2J6KA 2QDLA 2NWMA 4D8KA 1X6GA 3GBQA 1AEYA 3NMZC 5FWCA 4LUDA 2O2OA 1GFDA 3JV3A 2EYYA 2ABLA 3EHQA 2YUPA 1GFCA 1OPKA 1AZEA 3I35A 1Z9ZA 2HDAA 2EYXA 2KYBA 1EFNA 2LP5A 4J9HA 2O31A 3ZL7C 1NG2A 1WDXA 2EW3A 1Y0MA 1WXTA 1B07A 5IXFA 1CSKA 2HCKA 3U23A 2HSPA 2A28A 1QCFA 4OMOA 2VWFA 4ESRA 4HXJA 1VYVA 2AKLA 1PKTA 2SRCA 1E6GA 2KRMA 1AVZC 1UE9A 4QT7A 2C0TA 2JW4A 4IIOA 4AFZC 1AWXA 1RLPC 2J7IA 1K1ZA 2VVKA 2ED0A 2PZ1A 2O9VA 2O88A 4Z89A 3VS4A 2DILA 4E6RA 4KRTA 1X6BA 3RBBB 2HBWA 1B3QA 5ECAA 2AZVA 2DE0X 3M0RA 1NEGA 3ULRB 2CH4W 3M0PA 3EHRA 5IHNA 1MUZA 1NYGA 1YP5A 2OJ2A 3M0QA 4HVUA 4RTYA 1ZLMA 1M8MA 2PNIA 4D8DA 1ZSGA 2JXBA 1UJYA 3R6NA 2SEMA 2DA9A 1H3HA 2G6FX 2KR3A 4RTXA 2RMOA 3UA6A 2KRSA 2C0OA 1YWOA 1BB9A 4J9IA 3H0IA 1YN8A 2DNUA 2M51A 2CUBA 1SSHA 1E6HA 2FG0A 2FEIA 1BK2A 1AWWA 1AZGB 1GBQA 1ZUYA 2EGCA 1JO8A 4CC7A 2JS2A 5IHIA 4X1VA 2KE9A 3PVQA 2A36A 4JZ4A 1PWTA 2EPDA 1KFZA 1WYXA 1UTIA 2DL5A 1ZX6A 4IIMA 2D8HA 1VA7A 1X27A 4OMPA 4Z8AA 1K0SA 2KBTA 1Z9QA 3EGUA 2CT4A 3VS3A 1GL5A 2GQIA 5EC7A 1X2KA 1WXBA 3RNJA 2K9GA 3FJ5A 1WXUA 4F14A 3H0HA 2YSQA 2FRWA 1SHGA 1M27C 4RUGA 3REBB 1WIEA 1VYTA 2JTEA 2JM9A 1HD3A 4OMNA 2KYMA 1E7OA 2LX7A 2DRKA 1X69A 2RQRA 2KNBB 3TVTA 2YUQA 3THKA 2CREA 2JMAA 1AWJA 1I07A 1WA7A 3A98A 4J9EA 2CUDA 2DF6A 2LJ1A 2YDLA 3C0CA 2DBMA 4DEXA 2P4RA 4F16A 1K9AA 2JM8A 2EKHA 1CKAA 2RQUA 2EVRA 1PRMC 3TSZA 1RI9A 2GNCA 2E5KA 1OPLA 2C0IA 2YUNA 1N5ZA 3NGPA 4HVWA 2DM1A 1W70A 2A37A 3UF4A 2RQTA 2V1RA 1UUEA 1XOVA 1CKBA 4F17A 5FWBA 1WX6A 2GTJA 2YUOA 1K4US 1RUWA 2W10A 1X2QA 2DLPA 1ABQA 1UGVA 2AK5A 4RTWA 3VS6A 2A08A 1T3SA 2K79A 1T3LA 1OOTA 2I0NA 4RTVA 2GBQA 1V1CA 1QKXA 1GCQA 1M3AA 1OV3A 1QLYA 1TUCA 3M0TA 2F2WA 4CC4B 1GRIA 1SHFA 2FPFA 1LCKA 1MV0B 3VRZA 4WCIA 3LH5A 3H0FA 1UDLA 2JT4A 1SRMA 4AFQC 1FMKA 2EYZA 2DL3A 1YCSB 4GBQA 1H8KA 1PKSA 1PNJA 2KXDA 2W0ZA 2D8JA 3NPFA 2DJQA 3PE0A 4ZNXA 2JS0A 1WI7A 3VRYA 3I9QA 2EQIA 1JXOA 2DRMA 4J9BA 1MV3A 3VS5A 3KFVA 2F2XA 2DL8A 2EGEA 1JEGA 2LNHB 2M0YA 3QWYA 4JPBW 1PRLC 4LE9A 1UJ0A 4RTUA 2J05A 2D0NA 3VS1A 1M3CA 2OAWA 1G2BA 1M3BA 4A63B 1I1JA 2RNAA 5I22A 1AWOA 1BU1A 4K11A 1Y57A 2L3QA 4R0KA 4HVVA 2BZ8A 2LZ6B 1M30A 1GCPA 2DBKA 4ORZA 4J9DA 2K3BA 4JJCA 5GJVB 3I5SA 2DL4A 1ZBJA 3SHWA 2MCNA 4FSSA 2NUZA 1TUDA 3H41A 3QWXX 2H8HA 3CQTA 2DX1A 2K2MA 1W1FA 2EGAA 4Y92A 1QWFA 3I5RA 1UFFA 3PVLA 1UHCA 1NEBA 2ED1A 2KEAA 1U06A 1WLPB 2MIOA 2J06A 2KRNA 5FW9A 1HSQA 1BBZA 1U5SA 2KROA 4AFUC 2B86A 2BZYA 1T0JA 2HEQA 1JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3W D;  4HCK A;  3O5Z A;  1NLP C;  2PTK A;  2O9S A;  3EG0 A;  2CSI A;  1W6X A;  4JZ3 A;  1SEM A;  1FYN A;  1PHT A;  2L0A A;  1H92 A;  1YNZ A;  1SPK A;  2JMC A;  2CDT A;  3M0S A;  2ROT A;  2KT8 A;  2FRY A;  2GGR A;  2LCS A;  4M4Z A;  2YT6 A;  5GJW B;  4OML A;  1GCQ C;  1UHF A;  1G83 A;  4AG2 C;  4LUE A;  4CC3 A;  1RLQ C;  2BTT A;  2ROL A;  1WFW A;  1IO6 A;  1X43 A;  2CSQ A;  4EIK A;  3TSW A;  2RQV A;  1KSW A;  2J6F A;  1I0C A;  4CC2 A;  3SEM A;  1HJD A;  3NHN A;  2J6O A;  2KXC A;  4DEY A;  2RPN A;  4GLM A;  2ECZ A;  2LQW A;  5IH2 A;  2OI3 A;  4LN2 A;  4AFS C;  2K7A A;  5HCK A;  1A0N B;  3IQL A;  2RN8 A;  1K0X A;  4J9G A;  1AD5 A;  3VS0 A;  2ESW A;  1S1N A;  1KIK A;  2VKN A;  5IHK A;  2DL7 A;  2RF0 A;  3EG3 A;  2F2V A;  2K6D A;  2DVJ A;  2FPD A;  2CT3 A;  4JJD A;  2LMJ A;  1U3O A;  5IXB A;  2MOX A;  2BZX A;  3M0U A;  1UG1 A;  4J9C A;  1ZUU A;  2LJ3 A;  2ENM A;  2RQW A;  2FPE A;  2X3X D;  1GBR A;  4OMM A;  3EG1 A;  1KJW A;  2LQN A;  5I11 A;  2FO0 A;  2L3P A;  2DMO A;  4Z88 A;  4LNP A;  2LJ0 A;  3VS7 A;  1YWP A;  1AOJ A;  2CH4 A;  2XMF A;  1QKW A;  1NLO C;  2KGT A;  1J3T A;  2AZS A;  2GTO A;  1ZUK A;  2IIM A;  2V1Q A;  2AKK A;  3REA B;  1UEC A;  1T0H A;  1ABO A;  4J9F A;  1ARK A;  4OMQ A;  4RTT A;  1JU5 C;  5L23 A;  3UA7 A;  4AG1 C;  2L3S A;  2EYW A;  2KT1 A;  1NYF A;  1VYU A;  1NM7 A;  2DYB A;  2L2P A;  4RTZ A;  3UAT A;  1K76 A;  2D1X A;  4JJB A;  1TG0 A;  3EG2 A;  1JQQ A;  3VS2 A;  1OEB A;  1SRL A;  1QWE A;  2EBP A;  2J6K A;  2QDL A;  2NWM A;  4D8K A;  1X6G A;  3GBQ A;  1AEY A;  3NMZ C;  5FWC A;  4LUD A;  2O2O A;  1GFD A;  3JV3 A;  2EYY A;  2ABL A;  3EHQ A;  2YUP A;  1GFC A;  1OPK A;  1AZE A;  3I35 A;  1Z9Z A;  2HDA A;  2EYX A;  2KYB A;  1EFN A;  2LP5 A;  4J9H A;  2O31 A;  3ZL7 C;  1NG2 A;  1WDX A;  2EW3 A;  1Y0M A;  1WXT A;  1B07 A;  5IXF A;  1CSK A;  2HCK A;  3U23 A;  2HSP A;  2A28 A;  1QCF A;  4OMO A;  2VWF A;  4ESR A;  4HXJ A;  1VYV A;  2AKL A;  1PKT A;  2SRC A;  1E6G A;  2KRM A;  1AVZ C;  1UE9 A;  4QT7 A;  2C0T A;  2JW4 A;  4IIO A;  4AFZ C;  1AWX A;  1RLP C;  2J7I A;  1K1Z A;  2VVK A;  2ED0 A;  2PZ1 A;  2O9V A;  2O88 A;  4Z89 A;  3VS4 A;  2DIL A;  4E6R A;  4KRT A;  1X6B A;  3RBB B;  2HBW A;  1B3Q A;  5ECA A;  2AZV A;  2DE0 X;  3M0R A;  1NEG A;  3ULR B;  2CH4 W;  3M0P A;  3EHR A;  5IHN A;  1MUZ A;  1NYG A;  1YP5 A;  2OJ2 A;  3M0Q A;  4HVU A;  4RTY A;  1ZLM A;  1M8M A;  2PNI A;  4D8D A;  1ZSG A;  2JXB A;  1UJY A;  3R6N A;  2SEM A;  2DA9 A;  1H3H A;  2G6F X;  2KR3 A;  4RTX A;  2RMO A;  3UA6 A;  2KRS A;  2C0O A;  1YWO A;  1BB9 A;  4J9I A;  3H0I A;  1YN8 A;  2DNU A;  2M51 A;  2CUB A;  1SSH A;  1E6H A;  2FG0 A;  2FEI A;  1BK2 A;  1AWW A;  1AZG B;  1GBQ A;  1ZUY A;  2EGC A;  1JO8 A;  4CC7 A;  2JS2 A;  5IHI A;  4X1V A;  2KE9 A;  3PVQ A;  2A36 A;  4JZ4 A;  1PWT A;  2EPD A;  1KFZ A;  1WYX A;  1UTI A;  2DL5 A;  1ZX6 A;  4IIM A;  2D8H A;  1VA7 A;  1X27 A;  4OMP A;  4Z8A A;  1K0S A;  2KBT A;  1Z9Q A;  3EGU A;  2CT4 A;  3VS3 A;  1GL5 A;  2GQI A;  5EC7 A;  1X2K A;  1WXB A;  3RNJ A;  2K9G A;  3FJ5 A;  1WXU A;  4F14 A;  3H0H A;  2YSQ A;  2FRW A;  1SHG A;  1M27 C;  4RUG A;  3REB B;  1WIE A;  1VYT A;  2JTE A;  2JM9 A;  1HD3 A;  4OMN A;  2KYM A;  1E7O A;  2LX7 A;  2DRK A;  1X69 A;  2RQR A;  2KNB B;  3TVT A;  2YUQ A;  3THK A;  2CRE A;  2JMA A;  1AWJ A;  1I07 A;  1WA7 A;  3A98 A;  4J9E A;  2CUD A;  2DF6 A;  2LJ1 A;  2YDL A;  3C0C A;  2DBM A;  4DEX A;  2P4R A;  4F16 A;  1K9A A;  2JM8 A;  2EKH A;  1CKA A;  2RQU A;  2EVR A;  1PRM C;  3TSZ A;  1RI9 A;  2GNC A;  2E5K A;  1OPL A;  2C0I A;  2YUN A;  1N5Z A;  3NGP A;  4HVW A;  2DM1 A;  1W70 A;  2A37 A;  3UF4 A;  2RQT A;  2V1R A;  1UUE A;  1XOV A;  1CKB A;  4F17 A;  5FWB A;  1WX6 A;  2GTJ A;  2YUO A;  1K4U S;  1RUW A;  2W10 A;  1X2Q A;  2DLP A;  1ABQ A;  1UGV A;  2AK5 A;  4RTW A;  3VS6 A;  2A08 A;  1T3S A;  2K79 A;  1T3L A;  1OOT A;  2I0N A;  4RTV A;  2GBQ A;  1V1C A;  1QKX A;  1GCQ A;  1M3A A;  1OV3 A;  1QLY A;  1TUC A;  3M0T A;  2F2W A;  4CC4 B;  1GRI A;  1SHF A;  2FPF A;  1LCK A;  1MV0 B;  3VRZ A;  4WCI A;  3LH5 A;  3H0F A;  1UDL A;  2JT4 A;  1SRM A;  4AFQ C;  1FMK A;  2EYZ A;  2DL3 A;  1YCS B;  4GBQ A;  1H8K A;  1PKS A;  1PNJ A;  2KXD A;  2W0Z A;  2D8J A;  3NPF A;  2DJQ A;  3PE0 A;  4ZNX A;  2JS0 A;  1WI7 A;  3VRY A;  3I9Q A;  2EQI A;  1JXO A;  2DRM A;  4J9B A;  1MV3 A;  3VS5 A;  3KFV A;  2F2X A;  2DL8 A;  2EGE A;  1JEG A;  2LNH B;  2M0Y A;  3QWY A;  4JPB W;  1PRL C;  4LE9 A;  1UJ0 A;  4RTU A;  2J05 A;  2D0N A;  3VS1 A;  1M3C A;  2OAW A;  1G2B A;  1M3B A;  4A63 B;  1I1J A;  2RNA A;  5I22 A;  1AWO A;  1BU1 A;  4K11 A;  1Y57 A;  2L3Q A;  4R0K A;  4HVV A;  2BZ8 A;  2LZ6 B;  1M30 A;  1GCP A;  2DBK A;  4ORZ A;  4J9D A;  2K3B A;  4JJC A;  5GJV B;  3I5S A;  2DL4 A;  1ZBJ A;  3SHW A;  2MCN A;  4FSS A;  2NUZ A;  1TUD A;  3H41 A;  3QWX X;  2H8H A;  3CQT A;  2DX1 A;  2K2M A;  1W1F A;  2EGA A;  4Y92 A;  1QWF A;  3I5R A;  1UFF A;  3PVL A;  1UHC A;  1NEB A;  2ED1 A;  2KEA A;  1U06 A;  1WLP B;  2MIO A;  2J06 A;  2KRN A;  5FW9 A;  1HSQ A;  1BBZ A;  1U5S A;  2KRO A;  4AFU C;  2B86 A;  2BZY A;  1T0J A;  2HEQ A;  1JXM A; 
#chains in the Genus database with same CATH topology
 1N8R R;  1G5V A;  1NLP C;  4JZ3 A;  1PHT A;  1H92 A;  4J5Y A;  1SPK A;  4P5N A;  2CDT A;  2ROT A;  3RUX A;  3OYY A;  1N6A A;  2FRY A;  2GGR A;  2LCS A;  4M4Z A;  4LDV A;  3OSS C;  1LJO A;  3GP8 A;  4JS4 A;  3CCE T;  1ZSZ B;  2VGM A;  1VQO Q;  4LUE A;  4CC3 A;  2QA4 Q;  1WFW A;  3V7C A;  4EIK A;  1VQM Q;  3AT1 B;  2RHU A;  2RQV A;  1G3W A;  2J6F A;  3SEM A;  2J6O A;  2KXC A;  3URG A;  4DEY A;  2RPN A;  2CS7 A;  4GLM A;  5GAM j;  1WJR A;  1KD1 C;  4LN2 A;  4IUQ A;  2K7A A;  3IQL A;  1K0X A;  1WPY A;  3OS1 A;  2LRQ A;  2OAU A;  3RMQ A;  2VC8 A;  1V76 A;  4KGZ B;  3H9N A;  3JCM h;  4J6W A;  2DL7 A;  1QP2 A;  5KE3 A;  1WHL A;  3EFO B;  4F7U A;  2MF2 A;  2IVW A;  3WVE B;  4C92 F;  2DVJ A;  2JOY A;  1BI1 A;  4QQ6 A;  2RO0 A;  3QHS A;  1U3O A;  2LDM A;  4M75 A;  3M0U A;  4QVZ A;  4J9C A;  2QYZ A;  2FPE A;  2RHZ A;  1QMC A;  1NJI R;  3EG1 A;  1KJW A;  2CKK A;  2L3P A;  4Z88 A;  4F04 B;  1ZQ1 A;  4YTL A;  1B34 A;  3PIO A;  1NLO C;  2KGT A;  3QZ5 B;  2P84 A;  2IIM A;  2V1Q A;  1TU0 B;  4RKU E;  4J83 A;  5GAO r;  3OYC A;  4AMC A;  4BI3 A;  3V8J A;  1T0H A;  2LX9 A;  1M90 C;  3QYG B;  5L23 A;  3MCA B;  4PL6 A;  2EYW A;  2VXE A;  1NM7 A;  1Y71 A;  4RTZ A;  1M1K R;  1K76 A;  2E3H A;  5GMK h;  2D1X A;  1D0X A;  2RB6 A;  2QTX A;  3C95 A;  3CXC S;  1Q82 C;  4C8Q G;  4JJB A;  3VS2 A;  2EJF A;  1MMN A;  2YRC A;  3OMC A;  1AEY A;  4M77 F;  2QEX T;  1Y96 A;  3NMZ C;  5FWC A;  3PMI A;  3CCR T;  1GFD A;  2ABL A;  2FL7 A;  1QCN A;  3L2Z A;  4LDY A;  1GFC A;  1YJN T;  3I35 A;  4FU6 A;  3J81 E;  1RI0 A;  2LP5 A;  3OYE A;  1NG2 A;  1G3Y A;  1WDX A;  2HQE A;  3MEW A;  4XTX A;  1UEB A;  2OX7 A;  4E47 A;  3N5B B;  4MZT A;  3V7S A;  4E7K A;  1YFN A;  3L42 A;  5KYX B;  3E9F A;  1QCF A;  4OMO A;  2C06 A;  3CCV T;  2AKL A;  2EQU A;  1E6G A;  2KRM A;  3VUB A;  2XG8 D;  3ER0 A;  4IIO A;  1C6V X;  4ELY C;  2ED0 A;  2IPO B;  4BI8 B;  2O88 A;  2L8D A;  3OYF A;  3MJX A;  4L5G A;  2RK2 A;  2K5F A;  1YI2 T;  1GXI E;  1X6B A;  1B3Q A;  3CBM A;  4KGV B;  3M0P A;  1MUZ A;  3G4S T;  1NYG A;  4HCB A;  5GAO p;  3JRZ A;  2OJ2 A;  3CCJ A;  1IZ6 A;  4HVU A;  3CD6 T;  2PNI A;  4D8D A;  1DJ7 B;  1ZSG A;  1UJY A;  3R6N A;  5GAM h;  2R57 A;  2RI5 A;  2JTM A;  2KR3 A;  4BAC A;  1VQ7 A;  2RMO A;  2DD4 A;  1UGP B;  2K3Y A;  3FB9 A;  4A54 A;  3OYD A;  3LWI A;  4ZN1 A;  1UGR B;  2CUB A;  1WHK A;  1VQ6 Q;  1SSH A;  2FG0 A;  2FEI A;  3CBP A;  1AHJ B;  3CC2 T;  1AWW A;  1QVF A;  3WXM B;  2RI2 A;  4Y28 E;  1JO8 A;  3HP9 A;  5DY9 A;  4AT1 B;  2JS2 A;  2EFI A;  1MMD A;  1VQ4 A;  1TTH B;  1WHH A;  5IHI A;  3GOX A;  3FRN A;  3G71 A;  3CMA Q;  2A36 A;  4ZGE B;  1KFZ A;  1ZSZ C;  1SF9 A;  4M75 B;  1C0M A;  3CCE Q;  2RHX A;  2DYI A;  1PD1 A;  1X27 A;  4OMP A;  3CCQ T;  1X75 C;  1D0Y A;  1KG1 A;  2KBT A;  2PVD B;  2DK3 A;  1P92 A;  1I5O B;  4ATO A;  1VQ5 T;  4L6V 5;  1BIA A;  2GQI A;  5EC7 A;  3UWN A;  1WXB A;  1VQN Q;  3SD4 A;  4F14 A;  3L2V A;  3H0H A;  1MMA A;  2YSQ A;  1JJ2 P;  4RUG A;  2NUT A;  3REB B;  5GAN g;  3JCM Q;  1HD3 A;  4OMN A;  2KYM A;  2Y90 A;  1K8A C;  2RQR A;  4Y91 A;  3TVT A;  3EG9 A;  2EAY A;  1R0B G;  1KD1 R;  3THK A;  2QGG A;  2JMA A;  1HYO A;  1M8V A;  4J9E A;  4ZGD B;  2DF6 A;  5KCO A;  2HQX A;  3OYK A;  1K9A A;  3VKI A;  4LD6 A;  4QVC A;  4XQ3 A;  4OVA A;  4MML A;  1M4Z A;  4JRP A;  4D6W A;  4FT4 A;  2GNC A;  2E5K A;  4JLG A;  3QZ9 B;  1K9M R;  1N5Z A;  1W70 A;  1SSF A;  2QTV A;  2LC4 A;  2V1R A;  3F70 A;  1OI1 A;  1VQO A;  2JVV A;  3ASK A;  1WX6 A;  2QA4 A;  1VQM A;  3VS6 A;  3G6E T;  3MP6 A;  3A5Z B;  2K79 A;  1JJ2 S;  4NL3 A;  2PUO B;  3GIB A;  2GBQ A;  1QKX A;  3M0T A;  4KT0 E;  4CC4 B;  2E41 A;  1GRI A;  2FPF A;  1LCK A;  4EDU A;  3M54 A;  1IB8 A;  3CEY A;  3I56 T;  1UDL A;  2ZPG B;  2EYZ A;  1MMG A;  4GBQ A;  4UC4 A;  2D8J A;  1Q82 R;  2QEX Q;  3CCR Q;  2GQV A;  4HT9 A;  2YRD A;  2OTL T;  5GAO m;  1D09 B;  1YJN Q;  3VS5 A;  3KFV A;  1XTD A;  2M0Y A;  4XK8 E;  4C0D B;  1W4S A;  1M90 U;  2J05 A;  1YJ9 T;  3VV0 A;  1M3C A;  2OAW A;  1PG5 B;  4XTW A;  1AWO A;  5CKF A;  2MYS A;  1MND A;  4JLI A;  2CP6 A;  4BY6 B;  1BU1 A;  2L3Q A;  2RK1 A;  4C8Q A;  3JCM d;  4JDS A;  2DIG A;  1M30 A;  3CCV Q;  4M75 D;  5EG2 A;  4ORZ A;  3CCU A;  5GJV B;  2NUZ A;  1W2B A;  2DZC A;  1WHG A;  3HRS A;  2DX1 A;  2K2M A;  2EGA A;  3RIR A;  3HL8 A;  4PLI A;  1YI2 Q;  1UFF A;  4M75 F;  3E19 A;  1S72 T;  1VQK T;  4NS5 A;  2ED1 A;  1U06 A;  4M7A B;  3JCM J;  3L2U A;  4LDU A;  2KRN A;  3G4S Q;  1BBZ A;  1M9S A;  3HRU A;  5GAN 6;  4C5G A;  1KC8 U;  3CD6 Q;  1Q86 C;  3O5Z A;  4PFZ A;  2O9S A;  4FSX A;  1W6X A;  1SEM A;  1FYN A;  1K73 R;  4FW2 A;  1I8F A;  4L59 A;  1RAF B;  2QI2 A;  5GAN 2;  1UHF A;  2GCX A;  2NUT B;  4DOV A;  2BTT A;  2P4T A;  4DA4 A;  4OGC A;  3JSC A;  4C92 B;  1YJW A;  4CC2 A;  4ZN3 A;  4ANJ A;  3FJP A;  2OI3 A;  4PJM A;  1A0N B;  3RR6 A;  3JB9 G;  4J9G A;  1LNX A;  1KIK A;  5FU7 B;  1X6O A;  3JCM e;  1OZ2 A;  4E7Z A;  1N27 A;  3CCQ Q;  3EH2 A;  2M16 A;  1VQ5 Q;  2LMJ A;  2RJC A;  1UG1 A;  4M7D B;  1QP3 A;  4C0Z A;  4OMM A;  5J3B A;  3J80 E;  2K3X A;  5GAO l;  4JRI A;  3OYG A;  1QQJ A;  2LJ0 A;  3E1S A;  3NTK A;  2E4H A;  1IRE B;  1WHJ A;  2WAC A;  1WHM A;  5FU6 B;  1J3T A;  1K8A R;  3X26 B;  1TOV A;  3JCM f;  4HCC A;  3S6W A;  2GTO A;  1ZUK A;  4FM4 B;  2D0Q B;  1QVF P;  4PJO E;  4M77 B;  1V29 B;  2QG9 B;  4XTV A;  5D6W A;  4RG8 A;  1ABO A;  3V7R A;  1ARK A;  5GAM d;  5CKE A;  3UA7 A;  2CZ0 B;  4QW2 A;  1NYF A;  3CMA A;  2CZ6 B;  5GMK e;  3CCE A;  4PKC C;  1KHC A;  4WTO B;  1QWE A;  2MMP A;  2J6K A;  2QDL A;  4D8K A;  3OSV A;  2QQR A;  1PCX A;  2XHC A;  3O8V A;  2EYY A;  5KYW A;  5GAN 3;  2AHJ B;  2X4Y A;  3SWN A;  5GAN j;  4IUP A;  1VQN A;  3X20 B;  4GY5 A;  3G6E Q;  2OTJ T;  4M7A D;  3TCJ A;  2YRV A;  3CC4 T;  2HDA A;  2KYB A;  5LJ3 g;  4PJO C;  2X4X A;  3ZL7 C;  2G3R A;  4N0A C;  6AT1 B;  1Q7Y U;  3HRT A;  2VV5 A;  1VQ8 Q;  1B07 A;  4M7A F;  3VU3 C;  3EGD A;  1QVF S;  4KBM B;  4ESR A;  4X9C A;  2RH2 A;  3EGX A;  4KUI A;  3ME9 A;  2OTL Q;  2C0T A;  3H6Z A;  2QK0 A;  1TXQ A;  3FDR A;  4M78 B;  1K1Z A;  2PZ1 A;  4Z89 A;  3VS4 A;  2DIQ A;  4E6R A;  4C92 D;  4KRT A;  3RBB B;  1YJ9 Q;  2HBW A;  4KH1 B;  2AZV A;  1M2V B;  4BY6 C;  3JCM V;  2XD0 A;  1H64 1;  3CCM T;  3OBW A;  4LDW A;  3CCL T;  2EKO A;  5KYU A;  4PNO A;  3G7Z A;  3CXC P;  3I55 T;  3VJP A;  1YIJ T;  1ZLM A;  1QVP A;  4FYW B;  4A4F A;  5GAM e;  5HY6 A;  3OQ5 A;  2G6F X;  3PT9 A;  2DVE A;  1X01 A;  2CP7 A;  2KRS A;  1UB4 A;  1OX9 A;  2FYK A;  4M7D D;  3A8L B;  2DAQ A;  2K4Y A;  2M51 A;  5KYY B;  4C92 E;  4EMK A;  1S72 Q;  1VQK Q;  1OQK A;  2X9H A;  2QAZ A;  2QEX A;  3CCR A;  1E6H A;  3HSB A;  3DB3 A;  3M57 A;  1YJN A;  2LCC A;  4ELZ C;  1RAC B;  1RAB B;  4CC7 A;  4M7D F;  1OYX A;  1R77 A;  5GAM f;  3CCU Q;  2PU9 B;  4M77 D;  3EFR A;  3JCM W;  4JZ4 A;  3GPL A;  2EQJ A;  5CIU A;  5DLQ E;  5GAN 8;  2KI7 A;  1VQP T;  1UTI A;  1YHQ Q;  1VA7 A;  4FL6 A;  3CCV A;  4C92 C;  3JAM E;  2Y4Y A;  3TQ7 P;  4OGE A;  4BE0 A;  1X2K A;  5GAN 4;  2K9G A;  3FJ5 A;  3PMT A;  1YI2 A;  3P8B B;  1Q86 U;  5A0L A;  2JTE A;  2K57 A;  4PK4 A;  2PVO B;  2CP3 A;  2KDS A;  3H8Z A;  4J8O A;  3LGF A;  4M77 E;  3VYG A;  2YUQ A;  4BD3 A;  1ZBX A;  1AWJ A;  3G4S A;  1I07 A;  3QG1 A;  5GAN h;  2M02 A;  2CUD A;  1KC8 C;  3V8L A;  3OYB A;  4MMK A;  3C0C A;  1BIB A;  3LGL A;  1XJW B;  5J39 A;  3CD6 A;  2P4R A;  4O5V A;  2M1H A;  4M7D C;  4B6M A;  2JM8 A;  5CKB A;  2F69 A;  4N4H A;  3DKM A;  3A1P A;  2YHT A;  2RQU A;  4C8Q F;  4XTY A;  1I81 A;  1YJW Q;  5C0M A;  5KYW B;  2M0O A;  2COZ A;  3NGP A;  4HVW A;  4M78 D;  2DM1 A;  2K5I A;  1BCO A;  3OW2 A;  2RQT A;  1XOV A;  2RI3 A;  3A8H B;  4FIB A;  3CC2 A;  2YLC A;  2GTJ A;  4M77 C;  1K4U S;  1RUW A;  1OU9 A;  2DLP A;  4N0A A;  2YWW A;  2AK5 A;  4HCZ A;  4M78 F;  2A08 A;  1T3S A;  2DTI A;  1OOT A;  4RTV A;  4R56 A;  3G1J A;  4QVD A;  5GMK m;  2LTO A;  4PJL A;  4BE1 A;  2E10 A;  3EGX B;  3OYL A;  3VRZ A;  3A8O B;  3P8H A;  4O6J A;  2A3L A;  3H0F A;  1JB0 E;  2E65 A;  2JT4 A;  1SRM A;  1VQL T;  2KQW A;  3CCQ A;  2W0Z A;  1NE8 A;  2VUB A;  2BE7 D;  2DKG A;  4N4G A;  4ZNX A;  1VQ5 A;  2NUP A;  2XI9 A;  2NLU A;  2P0P A;  2EQI A;  1JXO A;  4EPC A;  5KYU B;  2OTJ Q;  1MV3 A;  5GAO n;  1IGQ A;  4JUV A;  3CC4 Q;  3M9Q A;  2EGE A;  3SB2 A;  2DD5 A;  2LNH B;  5L8R E;  4RTU A;  4F7U B;  1VIF A;  2XDD A;  1M3B A;  3T9N A;  3E2U A;  1I1J A;  1Y7X A;  2RNA A;  5I22 A;  2JZ2 A;  3MP1 A;  1C1A A;  1B7T A;  4K11 A;  2RJD A;  1OZ3 A;  2BZ8 A;  5CCA A;  2EQM A;  3OMG A;  3OS0 A;  4OB2 B;  4Q5W A;  2DBK A;  4QQG A;  2K3B A;  1KHI A;  1ZBJ A;  3SHW A;  2MCN A;  4FSS A;  2R58 A;  1TUD A;  3QWX X;  2H8H A;  1B34 B;  2P0Q A;  4Y92 A;  3I5R A;  3M5A A;  1R0C B;  4C5I A;  2V26 A;  3CPW P;  1Q95 G;  3M55 A;  1RAD B;  5CVI A;  3CCL Q;  2KEA A;  2MIO A;  3CBO A;  5LJ3 j;  1FX7 A;  1M1G A;  1U5S A;  2KRO A;  3I55 Q;  3S3O A;  3G6E A;  1YIJ Q;  3D7S B;  3C94 A;  5HK3 A;  4DBH A;  1D1C A;  3WVD B;  2ZPE B;  2XK0 A;  3KXT A;  2ZZD A;  4RG2 A;  3X28 B;  2CSI A;  2CP5 A;  3JCM P;  2H3E B;  2L0A A;  5GAO q;  5CKH A;  1Q7Y C;  3BDL A;  3UPU A;  3A8M B;  2X4J A;  1VQ8 A;  3JB9 H;  1YIT T;  1Y96 B;  2EWN A;  3I56 A;  3NTI A;  3PTA A;  2YT6 A;  1F1B B;  5GJW B;  4OML A;  4FCY A;  2DER A;  1GCQ C;  4AG2 C;  2JNG A;  3S3M A;  1NPP A;  2VXF A;  2RM4 A;  2OTL A;  1IO6 A;  2HKQ B;  3QBY A;  1RAH B;  3KBG A;  4JRQ A;  3BFM A;  4RCC A;  4V2S A;  1HJD A;  5DM7 R;  1Y07 A;  1YJ9 A;  5M9O A;  4AFS C;  2XDB A;  5HCK A;  2MI6 A;  2RN8 A;  3CPW S;  1RAI B;  3CCS T;  1M90 R;  5GMK l;  3OYN A;  1AD5 A;  3E9G A;  3VS0 A;  3OYH A;  3CME T;  1S1N A;  1N8R C;  3QO3 A;  2FPD A;  2CT3 A;  1WJQ A;  1NBE B;  2VAS A;  2BZX A;  2LCL A;  2PVG B;  1ZUU A;  2RQW A;  2ENM A;  2X3X D;  1GBR A;  5I11 A;  4WF2 A;  2D6F A;  2COW A;  2DMO A;  2H3J A;  2L3R A;  1YWP A;  1S72 A;  1AOJ A;  1VQK A;  3M53 A;  3QXE B;  3BY7 A;  2XMF A;  5C6S A;  1RAE B;  2VYT A;  5KYN A;  4M75 G;  3QSU A;  1VQM T;  2HL5 C;  4C0F A;  2E6Z A;  2O4X A;  3REA B;  3VUZ A;  4A4G A;  1KK7 A;  3JCM X;  4DQ2 A;  1O9S A;  4RTT A;  1KC8 R;  1JU5 C;  1OUL A;  2KT1 A;  2L3S A;  1VYU A;  1TS9 A;  4F7U F;  3TEE A;  1TSF A;  2QQS A;  2KAF A;  5I2M A;  1TG0 A;  3EG2 A;  1YHQ A;  4IKF A;  1JQQ A;  1OEB A;  4N4I A;  2NWM A;  3P8D A;  2HSE B;  1OU8 A;  3GBQ A;  2HQH A;  2O2O A;  3JV3 A;  1RAG B;  1NJI C;  4E7S A;  2ZAE A;  2YUP A;  1N9S A;  1OPK A;  1AZE A;  1PSE A;  2JN0 A;  3MEA A;  1ZSZ A;  2EYX A;  2CYZ B;  1EFN A;  2K5L A;  4J7F A;  4M75 E;  4J9H A;  4ME7 A;  2O31 A;  2EW3 A;  1G3T A;  1VQ9 T;  1Y0M A;  1WXT A;  2EQK A;  1CSK A;  3GNF B;  5LJ3 h;  2HCK A;  2HSP A;  1UGQ B;  1VQL Q;  3OS5 A;  4ZTJ A;  2A28 A;  1BCM A;  1BI2 A;  9ATC B;  3OY9 A;  1VYV A;  2QXF A;  2SRC A;  3C12 A;  1AVZ C;  3CC2 Q;  1M1K C;  1UE9 A;  4QT7 A;  2JW4 A;  4AFZ C;  1AWX A;  2J7I A;  2L89 A;  1D1A A;  1FMV A;  2VVK A;  3EG9 B;  3EFO A;  1AT1 B;  1N9R A;  2FHD A;  2O9V A;  1JBM A;  4IUV A;  3FIF A;  2BIV A;  2FZC B;  5ECA A;  2DXB A;  4M75 C;  4GLK A;  1NEG A;  4PJO G;  2KY9 A;  3ULR B;  3EHR A;  2LNV A;  5IHN A;  3L2Q A;  3M58 A;  4KUL A;  1YP5 A;  5GAN d;  5LJ5 j;  2DXT A;  1D0Z A;  4RTY A;  4PLL A;  2KSS A;  2JXB A;  1ACM B;  1ZA2 B;  3LWH A;  1EIF A;  3RKW A;  3INZ A;  1M2O A;  3LX7 A;  1BB9 A;  3DLL A;  4J7I A;  3GLX A;  3M56 A;  3H0I A;  3HTR A;  1YN8 A;  5A0G A;  1BI0 A;  2BUD A;  3OYI A;  2MWP A;  1BYM A;  2QQ9 A;  4FYV B;  1D3B A;  2FVU A;  4E7J A;  1BK2 A;  4EMH A;  3EH1 A;  3CPF A;  1BKB A;  1ZUY A;  2OTJ A;  2AT1 B;  3CC4 A;  4BDZ A;  1QVG A;  2FB7 A;  4X1V A;  5IT9 E;  3PVQ A;  4XTU A;  3OW2 S;  2EPD A;  2ZPH B;  5FRN A;  1Q7Y R;  1WYX A;  4BUG A;  2DL5 A;  1ZX6 A;  2ZGW A;  3CC7 T;  2EIF A;  4LDX A;  2D8H A;  4Z8A A;  3QJ6 A;  4E2F B;  4M7A G;  2E1H A;  3VS3 A;  3QII A;  1YBY A;  1HK9 A;  4JJN K;  3JCM b;  5KYX A;  4DOW A;  4E7L A;  7AT1 B;  1JJ2 A;  3RNJ A;  5FRM A;  4XU0 A;  4PFP A;  4A4K A;  4C8Q B;  1VYT A;  3V8K A;  1TWB A;  2JM9 A;  2DET A;  2CP0 A;  2O4X B;  1X69 A;  3CCS Q;  3CCM A;  3CCL A;  2KNB B;  1BI3 A;  1VQ6 T;  2PQW A;  2CRE A;  3CME Q;  3I56 Q;  1WA7 A;  3I55 A;  5I21 A;  3A98 A;  5GAN e;  2LJ1 A;  4MDW A;  2D9T A;  1YIJ A;  2BE9 B;  2DBM A;  4F16 A;  3HFO A;  3OYM A;  4LD9 K;  1KQS A;  4C0D C;  3JB9 J;  4C92 G;  1PRM C;  3MPU B;  3CMA T;  4CRI A;  1MHN A;  3M4Y A;  1MGQ A;  1OPL A;  3EFS A;  2C0I A;  4M7A E;  5GAN 7;  1WGS A;  1IRX A;  2RJE A;  3GNG A;  2F5T X;  3UF4 A;  3X24 B;  2CZ1 B;  4PFO A;  1CKB A;  3SFM A;  2RD1 A;  4BE2 A;  5FWB A;  2VGN A;  2YUO A;  4HT8 A;  3MKD A;  3EAE A;  1Q81 C;  1FWZ A;  1IHV A;  2W10 A;  1KQ2 A;  1X2Q A;  1HXD A;  5GAN f;  5CO7 A;  1ABQ A;  1UGV A;  4IUR A;  5LL6 S;  4DBF A;  2EYQ A;  1N8R U;  1VQN T;  2HD0 A;  1T3L A;  4NOY A;  2I0N A;  2O01 E;  1V1C A;  1OV3 A;  1QLY A;  1TUC A;  2XIC A;  2F2W A;  2MAM A;  8ATC B;  4HKE A;  1MV0 B;  4M7D G;  4A4E A;  4QKU A;  3ZBD A;  1VQP A;  3UT1 A;  4AFQ C;  5LJ5 h;  4M7A C;  2DL3 A;  1YCS B;  2ZCF B;  2KXD A;  1M1F A;  2MPX C;  3NPF A;  2L5Q A;  1PD0 A;  3PE0 A;  4OB0 B;  5GMK i;  5D7U A;  3VRY A;  5KE2 A;  2E3I A;  1K9M C;  1IHW A;  2DRM A;  5AYF A;  4M77 G;  1JEG A;  4C5H A;  3OYJ A;  4JPB W;  4JRK A;  2D0N A;  5I2S A;  5GAN 5;  2E5Q A;  2VB6 A;  1Q86 R;  1U8R A;  3BE3 A;  3QDF A;  4NL2 A;  1VQ9 Q;  2RA2 A;  2F1L A;  3MP8 A;  4RMO A;  2WSC E;  1Y57 A;  4HVV A;  2LZ6 B;  3RDV A;  4M7D E;  4MDX A;  3LH0 A;  2PUK B;  3TRE A;  4JJC A;  4C0G A;  3I5S A;  2DL4 A;  4XU3 A;  4PJJ A;  1PSF A;  5IN1 A;  1D3B B;  1NJI U;  3CQT A;  2KMT A;  2DPP B;  3NTH A;  4Z02 A;  1W2B P;  1W1F A;  1QWF A;  1XNI A;  5CQY A;  3JCM c;  3PVL A;  5FU7 C;  2XKO C;  4C8Q D;  1WLP B;  1PC0 A;  4AFU C;  1M5Q 1;  2HEQ A;  1FXX A;  2X3W D;  4FT2 A;  4HCK A;  5CKD A;  3PIP A;  2GFU A;  3OB9 A;  2PTK A;  3LYI A;  3EG0 A;  4XAX B;  1M1K U;  1JRI A;  2GFA A;  1YNZ A;  2CGH A;  4M78 G;  4X9D A;  4OMF B;  2JMC A;  3M0S A;  4FYY B;  2EJ9 A;  2KT8 A;  3SWN B;  2EJG A;  1VQL A;  5FU6 C;  5A2Q E;  2HKN A;  1G83 A;  4X34 A;  5A0D A;  3DLM A;  2LT4 A;  4PJO A;  1RLQ C;  2ROL A;  4C8Q E;  1X43 A;  2QGF B;  2CSQ A;  3TSW A;  1MNE A;  1KSW A;  1QW1 A;  1I0C A;  2ATC B;  3NHN A;  1W2B S;  2ECZ A;  3JCM g;  2LQW A;  5IH2 A;  4EMG A;  3EGD B;  5LJ5 g;  3C4S A;  3GF5 A;  2MWO A;  2ESW A;  1SKU B;  5LJ3 d;  2VKN A;  5IHK A;  1ZA1 B;  3CC7 Q;  2A0F B;  4VUB A;  2RF0 A;  4M78 E;  1YCY A;  3EG3 A;  2F2V A;  4II1 A;  4QQD A;  1U1T A;  2K6D A;  3QUI A;  1K73 C;  2HAX A;  1LOJ A;  4JJD A;  3OBY A;  5IXB A;  2MOX A;  4C8Q C;  2LJ3 A;  4A53 A;  3BDU A;  3QJY A;  4OB1 B;  2LQN A;  2X4W A;  3HFN A;  2FO0 A;  4LNP A;  3VS7 A;  2CH4 A;  2RHI A;  4CI0 C;  1QKW A;  4IUT A;  2LQ8 A;  2DXC A;  2AZS A;  1KQ1 A;  3A8G B;  2AKK A;  3CCJ T;  1TUG B;  1UEC A;  4M78 C;  4BI4 A;  2ZPI B;  4J9F A;  4OMQ A;  4C5E A;  4M7A A;  4EMK B;  2HZY A;  4AG1 C;  1QVG P;  1PM3 A;  4J6Y A;  2DYB A;  4A4H A;  4IUU A;  2HL3 A;  1YIT A;  1VQ7 T;  1RL2 A;  2L2P A;  3UAT A;  5CAI A;  5CQX A;  1SRL A;  1VIE A;  2Z0W A;  2EBP A;  5FRO A;  1X6G A;  2QQB A;  3CCM Q;  4BDY A;  4KUD K;  4LUD A;  3MHX A;  3EHQ A;  3ZEH A;  1Z9Z A;  1Q81 R;  2V8K A;  4KGX B;  4ZGJ B;  1U1S A;  2CP2 A;  1VQ4 T;  3NFC A;  3CCS A;  4PJN A;  3G71 T;  4C92 A;  3L2R A;  3CME A;  5IXF A;  4E7H A;  2DO3 A;  3U23 A;  3PNW C;  5LJ3 e;  4KH0 B;  2IG0 A;  2VWF A;  4HXJ A;  1PKT A;  2X35 A;  3MET A;  3VYH B;  3JB9 I;  4XTZ A;  1Q81 U;  1RLP C;  1QVG S;  2GF7 A;  1KQS P;  5D6X A;  1RAA B;  2DIL A;  3BW1 A;  2WSE E;  2DE0 X;  2MK5 A;  5AT1 B;  3DB4 A;  1KD1 U;  3M0R A;  4M7D A;  4B9X A;  3CXC A;  5GAM g;  2CH4 W;  5LJ3 f;  1VQP Q;  2LVM A;  4FW1 A;  5HK0 A;  3M0Q A;  3LW5 E;  5J26 A;  2DEU A;  1M8M A;  3MEV A;  2SEM A;  2XU8 A;  2DA9 A;  2BKD N;  4TVR A;  1H3H A;  4RTX A;  2A7Y A;  2P0K A;  4OP0 A;  4PJO B;  1K9M U;  3UA6 A;  1VQ8 T;  2LQK A;  3FLG A;  2C0O A;  4M77 A;  1YWO A;  4J9I A;  1O75 A;  1H3Z A;  3PFS A;  2DNU A;  1WNL A;  1LVK A;  3ZFJ A;  4F7U G;  1G3S A;  1IGU A;  4LXC A;  1VQO T;  4RCB A;  5DLO A;  2QA4 T;  1AZG B;  2V8I A;  1VUB A;  1GBQ A;  2EGC A;  2X51 A;  2K2V A;  4JS5 A;  4MZM A;  2AIR B;  1KQS S;  2HBP A;  3Q1J A;  2R5M A;  3M59 A;  1NZ9 A;  1QCO A;  2KE9 A;  3SWN C;  3HPW A;  2COY A;  5FLX E;  1VQ9 A;  1I4K 1;  3RER A;  1PWT A;  5IAY A;  2NUP B;  3J7A F;  2M9U A;  3RMS A;  1VOM A;  3QPH A;  4IIM A;  5LJ5 d;  3PGG A;  1Q82 U;  2CZ7 B;  5HKC A;  1EX4 A;  2I2L A;  2KK4 A;  1K0S A;  3EGU A;  1Z9Q A;  4ZTF A;  2CT4 A;  2NYS A;  1GL5 A;  3AHU A;  4F7U E;  1I5L A;  1WXU A;  5KCH A;  1WJS A;  2DXU A;  2FRW A;  2FZG B;  1SHG A;  1M27 C;  3R6O A;  1WIE A;  2WSF E;  4OF1 A;  3SDZ A;  1E7O A;  2LX7 A;  2YLB A;  3X25 B;  4B9W A;  2DRK A;  4M78 A;  3OYA A;  2DEQ A;  2XID A;  8AT1 B;  3TU4 K;  1SG5 A;  2E64 A;  2YDL A;  1R8O B;  4DEX A;  1M2V A;  4HA8 A;  4J6X A;  3KUF A;  3LLR A;  2EKH A;  3CCU T;  3RKX A;  1WZO A;  1CKA A;  2DFU A;  1WQW A;  1XQH A;  2DJZ A;  2EVR A;  3L1A A;  4MZP A;  3TSZ A;  1RI9 A;  2LT1 A;  2JJ9 A;  2YUN A;  2DZ9 A;  3UDC A;  2QQA A;  2V8J A;  2A37 A;  1YHQ T;  1UUE A;  1LPL A;  3S3N A;  3OW2 P;  4F17 A;  5D6Y A;  3HHT B;  1EZZ B;  1OX8 A;  4BB7 A;  4DBQ A;  4RTW A;  4E7I A;  2DTH A;  4EMK C;  3MO8 A;  5KYY A;  3CCJ Q;  2ZPF B;  2FZK B;  1K73 U;  4R55 A;  1GCQ A;  1M3A A;  5CR2 A;  2KVQ G;  3HKS A;  1SHF A;  2QDY B;  2Y4X A;  1VQ7 Q;  1UGS B;  4WCI A;  3LH5 A;  4XU1 A;  3RKY A;  1IXD A;  2ZPB B;  2XDP A;  3CC7 A;  2QAS A;  3JB9 D;  4PJO D;  1FMK A;  5LJ5 e;  1H8K A;  2E12 A;  1PKS A;  1PNJ A;  1NPR A;  2DJQ A;  2JS0 A;  1WI7 A;  3I9Q A;  2RHY A;  2RJF A;  4J9B A;  3QYH B;  3JB9 F;  3QDR B;  1YJW T;  2F2X A;  2HNI A;  2F5K A;  2DL8 A;  4PJO F;  3QWY A;  1VQ4 Q;  1PRL C;  2R5A A;  4LE9 A;  1UJ0 A;  3L2W A;  3RES A;  3VS1 A;  4DBR A;  4OB3 B;  3G71 Q;  1G2B A;  1VQ6 A;  4A63 B;  1YIT Q;  1D1B A;  4FYX B;  5GMK j;  1WQ7 A;  3FC3 A;  5LJ5 f;  4R0K A;  1TH7 A;  5KH6 A;  1GCP A;  2HMA A;  4J9D A;  4XU2 A;  3MEU A;  5CK9 A;  2E6N A;  3H41 A;  2JUF A;  3FEO A;  3CPW A;  1FMW A;  1UHC A;  2DTO A;  1NEB A;  1K8A U;  2YXY A;  3QKJ A;  1ZHI A;  3OA6 A;  2J06 A;  5FW9 A;  3OS2 A;  3M4G A;  1HSQ A;  1G8X A;  2JTF A;  2B8A A;  2B86 A;  2BZY A;  2E70 A;  1T0J A;  1JXM A; 
#chains in the Genus database with same CATH homology
 2X3W D;  4HCK A;  3O5Z A;  1NLP C;  2PTK A;  2O9S A;  3EG0 A;  2CSI A;  1W6X A;  4JZ3 A;  1SEM A;  1FYN A;  1PHT A;  2L0A A;  1H92 A;  1YNZ A;  1SPK A;  2JMC A;  2CDT A;  3M0S A;  2ROT A;  2KT8 A;  2FRY A;  2GGR A;  2LCS A;  4M4Z A;  2YT6 A;  5GJW B;  4OML A;  1GCQ C;  1UHF A;  1G83 A;  4AG2 C;  4LUE A;  4CC3 A;  1RLQ C;  2BTT A;  2ROL A;  1WFW A;  1IO6 A;  1X43 A;  2CSQ A;  4EIK A;  3TSW A;  2RQV A;  1KSW A;  2J6F A;  1I0C A;  4CC2 A;  3SEM A;  1HJD A;  3NHN A;  2J6O A;  2KXC A;  4DEY A;  2RPN A;  4GLM A;  2ECZ A;  2LQW A;  5IH2 A;  2OI3 A;  4LN2 A;  4AFS C;  2K7A A;  5HCK A;  1A0N B;  3IQL A;  2RN8 A;  1K0X A;  4J9G A;  1AD5 A;  3VS0 A;  2ESW A;  1S1N A;  1KIK A;  2VKN A;  5IHK A;  2DL7 A;  2RF0 A;  3EG3 A;  2F2V A;  2K6D A;  2DVJ A;  2FPD A;  2CT3 A;  4JJD A;  2LMJ A;  1U3O A;  5IXB A;  2MOX A;  2BZX A;  3M0U A;  1UG1 A;  4J9C A;  1ZUU A;  2LJ3 A;  2ENM A;  2RQW A;  2FPE A;  2X3X D;  1GBR A;  4OMM A;  3EG1 A;  1KJW A;  2LQN A;  5I11 A;  2FO0 A;  2L3P A;  2DMO A;  4Z88 A;  4LNP A;  2LJ0 A;  3VS7 A;  1YWP A;  1AOJ A;  2CH4 A;  2XMF A;  1QKW A;  1NLO C;  2KGT A;  1J3T A;  2AZS A;  2GTO A;  1ZUK A;  2IIM A;  2V1Q A;  2AKK A;  3REA B;  1UEC A;  1T0H A;  1ABO A;  4J9F A;  1ARK A;  4OMQ A;  4RTT A;  1JU5 C;  5L23 A;  3UA7 A;  4AG1 C;  2L3S A;  2EYW A;  2KT1 A;  1NYF A;  1VYU A;  1NM7 A;  2DYB A;  2L2P A;  4RTZ A;  3UAT A;  1K76 A;  2D1X A;  4JJB A;  1TG0 A;  3EG2 A;  1JQQ A;  3VS2 A;  1OEB A;  1SRL A;  1QWE A;  2EBP A;  2J6K A;  2QDL A;  2NWM A;  4D8K A;  1X6G A;  3GBQ A;  1AEY A;  3NMZ C;  5FWC A;  4LUD A;  2O2O A;  1GFD A;  3JV3 A;  2EYY A;  2ABL A;  3EHQ A;  2YUP A;  1GFC A;  1OPK A;  1AZE A;  3I35 A;  1Z9Z A;  2HDA A;  2EYX A;  2KYB A;  1EFN A;  2LP5 A;  4J9H A;  2O31 A;  3ZL7 C;  1NG2 A;  1WDX A;  2EW3 A;  1Y0M A;  1WXT A;  1B07 A;  5IXF A;  1CSK A;  2HCK A;  3U23 A;  2HSP A;  2A28 A;  1QCF A;  4OMO A;  2VWF A;  4ESR A;  4HXJ A;  1VYV A;  2AKL A;  1PKT A;  2SRC A;  1E6G A;  2KRM A;  1AVZ C;  1UE9 A;  4QT7 A;  2C0T A;  2JW4 A;  4IIO A;  4AFZ C;  1AWX A;  1RLP C;  2J7I A;  1K1Z A;  2VVK A;  2ED0 A;  2PZ1 A;  2O9V A;  2O88 A;  4Z89 A;  3VS4 A;  2DIL A;  4E6R A;  4KRT A;  1X6B A;  3RBB B;  2HBW A;  1B3Q A;  5ECA A;  2AZV A;  2DE0 X;  3M0R A;  1NEG A;  3ULR B;  2CH4 W;  3M0P A;  3EHR A;  5IHN A;  1MUZ A;  1NYG A;  1YP5 A;  2OJ2 A;  3M0Q A;  4HVU A;  4RTY A;  1ZLM A;  1M8M A;  2PNI A;  4D8D A;  1ZSG A;  2JXB A;  1UJY A;  3R6N A;  2SEM A;  2DA9 A;  1H3H A;  2G6F X;  2KR3 A;  4RTX A;  2RMO A;  3UA6 A;  2KRS A;  2C0O A;  1YWO A;  1BB9 A;  4J9I A;  3H0I A;  1YN8 A;  2DNU A;  2M51 A;  2CUB A;  1SSH A;  1E6H A;  2FG0 A;  2FEI A;  1BK2 A;  1AWW A;  1AZG B;  1GBQ A;  1ZUY A;  2EGC A;  1JO8 A;  4CC7 A;  2JS2 A;  5IHI A;  4X1V A;  2KE9 A;  3PVQ A;  2A36 A;  4JZ4 A;  1PWT A;  2EPD A;  1KFZ A;  1WYX A;  1UTI A;  2DL5 A;  1ZX6 A;  4IIM A;  2D8H A;  1VA7 A;  1X27 A;  4OMP A;  4Z8A A;  1K0S A;  2KBT A;  1Z9Q A;  3EGU A;  2CT4 A;  3VS3 A;  1GL5 A;  2GQI A;  5EC7 A;  1X2K A;  1WXB A;  3RNJ A;  2K9G A;  3FJ5 A;  1WXU A;  4F14 A;  3H0H A;  2YSQ A;  2FRW A;  1SHG A;  1M27 C;  4RUG A;  3REB B;  1WIE A;  1VYT A;  2JTE A;  2JM9 A;  1HD3 A;  4OMN A;  2KYM A;  1E7O A;  2LX7 A;  2DRK A;  1X69 A;  2RQR A;  2KNB B;  3TVT A;  2YUQ A;  3THK A;  2CRE A;  2JMA A;  1AWJ A;  1I07 A;  1WA7 A;  3A98 A;  4J9E A;  2CUD A;  2DF6 A;  2LJ1 A;  2YDL A;  3C0C A;  2DBM A;  4DEX A;  2P4R A;  4F16 A;  1K9A A;  2JM8 A;  2EKH A;  1CKA A;  2RQU A;  2EVR A;  1PRM C;  3TSZ A;  1RI9 A;  2GNC A;  2E5K A;  1OPL A;  2C0I A;  2YUN A;  1N5Z A;  3NGP A;  4HVW A;  2DM1 A;  1W70 A;  2A37 A;  3UF4 A;  2RQT A;  2V1R A;  1UUE A;  1XOV A;  1CKB A;  4F17 A;  5FWB A;  1WX6 A;  2GTJ A;  2YUO A;  1K4U S;  1RUW A;  2W10 A;  1X2Q A;  2DLP A;  1ABQ A;  1UGV A;  2AK5 A;  4RTW A;  3VS6 A;  2A08 A;  1T3S A;  2K79 A;  1T3L A;  1OOT A;  2I0N A;  4RTV A;  2GBQ A;  1V1C A;  1QKX A;  1GCQ A;  1M3A A;  1OV3 A;  1QLY A;  1TUC A;  3M0T A;  2F2W A;  4CC4 B;  1GRI A;  1SHF A;  2FPF A;  1LCK A;  1MV0 B;  3VRZ A;  4WCI A;  3LH5 A;  3H0F A;  1UDL A;  2JT4 A;  1SRM A;  4AFQ C;  1FMK A;  2EYZ A;  2DL3 A;  1YCS B;  4GBQ A;  1H8K A;  1PKS A;  1PNJ A;  2KXD A;  2W0Z A;  2D8J A;  3NPF A;  2DJQ A;  3PE0 A;  4ZNX A;  2JS0 A;  1WI7 A;  3VRY A;  3I9Q A;  2EQI A;  1JXO A;  2DRM A;  4J9B A;  1MV3 A;  3VS5 A;  3KFV A;  2F2X A;  2DL8 A;  2EGE A;  1JEG A;  2LNH B;  2M0Y A;  3QWY A;  4JPB W;  1PRL C;  4LE9 A;  1UJ0 A;  4RTU A;  2J05 A;  2D0N A;  3VS1 A;  1M3C A;  2OAW A;  1G2B A;  1M3B A;  4A63 B;  1I1J A;  2RNA A;  5I22 A;  1AWO A;  1BU1 A;  4K11 A;  1Y57 A;  2L3Q A;  4R0K A;  4HVV A;  2BZ8 A;  2LZ6 B;  1M30 A;  1GCP A;  2DBK A;  4ORZ A;  4J9D A;  2K3B A;  4JJC A;  5GJV B;  3I5S A;  2DL4 A;  1ZBJ A;  3SHW A;  2MCN A;  4FSS A;  2NUZ A;  1TUD A;  3H41 A;  3QWX X;  2H8H A;  3CQT A;  2DX1 A;  2K2M A;  1W1F A;  2EGA A;  4Y92 A;  1QWF A;  3I5R A;  1UFF A;  3PVL A;  1UHC A;  1NEB A;  2ED1 A;  2KEA A;  1U06 A;  1WLP B;  2MIO A;  2J06 A;  2KRN A;  5FW9 A;  1HSQ A;  1BBZ A;  1U5S A;  2KRO A;  4AFU C;  2B86 A;  2BZY A;  1T0J A;  2HEQ A;  1JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...