2IIMA

Sh3 domain of human lck
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
GSPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase LCK
publication title Crystal structure analysis and solution studies of human Lck-SH3; zinc-induced homodimerization competes with the binding of proline-rich motifs.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 62
sequence length 62
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2iimA00
2NUZA 1U5SA 1OOTA 4AFQC 4ESRA 1UDLA 1YCSB 1FYNA 1WXTA 1RUWA 3REAB 1NG2A 3A98A 4RTZA 5I11A 1AZGB 2LJ0A 2C0IA 1SHFA 3RBBB 4OMQA 2JMAA 5I22A 1G2BA 3UF4A 3NMZC 2FRYA 1B07A 1SRMA 3EG0A 1ZUYA 1YWOA 1K9AA 1GRIA 1VA7A 1ZUKA 3O5ZA 3EHQA 3H0HA 3KFVA 2DRKA 2ED1A 2B86A 1PKTA 3I5SA 5FWBA 1WXUA 2LQNA 3PE0A 3SEMA 2DA9A 1V1CA 1W70A 3TVTA 3VS3A 2EPDA 3CQTA 2HCKA 3U23A 4M4ZA 1M3AA 1GFDA 2ENMA 4OMLA 3VS5A 1Z9QA 4F17A 2RQWA 2LJ1A 1U3OA 4ORZA 1Y0MA 2DL7A 4HCKA 2EKHA 2GQIA 1NLOC 1VYUA 2CH4W 1WIEA 4KRTA 1UHFA 1OPLA 2C0TA 2RF0A 2F2XA 1X69A 2KYMA 3THKA 1SPKA 2PZ1A 2ROTA 4AFSC 4J9DA 4R0KA 4JPBW 1XOVA 5GJWB 2CT4A 2LP5A 1KIKA 2D0NA 2EBPA 4JJDA 1I0CA 3TSWA 5IHIA 3UA6A 2DF6A 1WYXA 2DBKA 2RNAA 4RUGA 3M0RA 4LE9A 1OV3A 4WCIA 3M0SA 4JZ3A 2CUBA 2GTJA 2CH4A 2HSPA 3PVLA 1UGVA 3I35A 1T0HA 2YUOA 2ROLA 4AG2C 1RLPC 4J9FA 1WXBA 4EIKA 2KXCA 1ARKA 3JV3A 5FWCA 2P4RA 1MUZA 3UA7A 1K0XA 1KFZA 2L3QA 2CSIA 2YDLA 1GCQC 2DBMA 2VKNA 4IIOA 2PTKA 1WFWA 4FSSA 2AKLA 2EGCA 2SEMA 2HDAA 2O88A 1HSQA 1SSHA 1GCQA 2O2OA 4J9GA 1W1FA 3M0TA 1YN8A 3SHWA 5ECAA 4RTYA 1HJDA 2BZ8A 2EYXA 4X1VA 3ZL7C 3VS7A 2ABLA 1AWJA 1I1JA 3VS4A 1UFFA 1UECA 2I0NA 2NWMA 1BU1A 2DL8A 2CREA 1B3QA 2DNUA 2F2WA 2RQUA 1QWFA 2IIMA 4J9EA 2LZ6B 1ABOA 4F16A 1X6BA 2DM1A 2YUPA 2BZXA 2M0YA 3I9QA 4GBQA 2JS0A 1JXMA 4DEYA 2KYBA 2RQRA 2ED0A 2ESWA 2EYWA 2K2MA 2H8HA 2W10A 2K7AA 2JXBA 2CDTA 1TUCA 5IH2A 1NYGA 2FO0A 4Z8AA 3M0UA 2RMOA 1WI7A 4HVVA 2ECZA 3ULRB 4CC2A 1H3HA 1OEBA 1JU5C 4HXJA 1VYTA 4OMPA 2FEIA 3VS6A 2DL3A 2JW4A 1K1ZA 2DX1A 2YUNA 3TSZA 2RN8A 1UTIA 2RQTA 4J9BA 5HCKA 4LUDA 2JTEA 1GFCA 5IXBA 1BB9A 2LMJA 1J3TA 1UE9A 2DMOA 1BK2A 2K9GA 2KE9A 1U06A 2KBTA 1E6GA 2F2VA 2SRCA 4ZNXA 2KXDA 2PNIA 4AFUC 4F14A 4J9HA 2DE0X 4RTTA 4RTWA 1AWOA 1X6GA 1UUEA 2EYZA 2VWFA 4A63B 2KNBB 1Z9ZA 2X3WD 1AWWA 1NYFA 1CSKA 2J7IA 4OMNA 1X43A 1CKBA 2X3XD 2YT6A 1ZX6A 2LNHB 3IQLA 2HBWA 1YWPA 3NGPA 3QWXX 2D8JA 1QLYA 1W6XA 1JEGA 1UJ0A 3VS0A 4LN2A 2L3PA 1PRMC 2D8HA 1YP5A 2K6DA 3VS1A 2LQWA 1T3LA 2J05A 3EHRA 4LNPA 3NHNA 4RTUA 4HVWA 3R6NA 4CC7A 1M30A 1M3BA 1N5ZA 1QCFA 2V1RA 2FPFA 2YUQA 1PRLC 1YNZA 1PHTA 2FPEA 5IXFA 3M0PA 2KRNA 2EYYA 2FG0A 1HD3A 3C0CA 4D8KA 2J6KA 3EG2A 2LCSA 3REBB 2DVJA 4RTXA 2VVKA 3M0QA 2EGAA 4Y92A 1JQQA 1JO8A 3QWYA 2JMCA 1X2KA 1AWXA 1ABQA 2DL4A 3I5RA 1GBQA 2AZVA 2MIOA 1AOJA 2K79A 1SRLA 2OI3A 1BBZA 1E7OA 3GBQA 4Z88A 4K11A 2DRMA 2MCNA 2C0OA 2YSQA 4JJCA 3H41A 2KT1A 1AZEA 2KR3A 4J9CA 2DJQA 2KROA 1QKXA 2D1XA 1FMKA 1PWTA 4D8DA 1WLPB 1Y57A 5IHNA 2KT8A 2AK5A 3NPFA 2FRWA 4IIMA 2EW3A 2KGTA 1SEMA 1ZUUA 2JM9A 4JZ4A 2EGEA 2DL5A 1RLQC 4AG1C 1E6HA 1NEBA 4OMOA 4GLMA 2LX7A 4CC3A 5L23A 1TUDA 2DILA 4RTVA 1T3SA 3VRYA 4CC4B 1AD5A 1UHCA 4Z89A 1RI9A 2J6FA 2V1QA 1X2QA 2FPDA 1PKSA 1MV3A 1S1NA 2GGRA 1SHGA 2GNCA 4HVUA 1TG0A 2GBQA 1EFNA 2JT4A 3VRZA 1AVZC 3EG3A 1K0SA 1M27C 2A08A 1PNJA 2EVRA 4J9IA 1JXOA 1QKWA 2L2PA 1NEGA 1QWEA 3RNJA 1LCKA 2KEAA 4OMMA 2MOXA 1VYVA 1WA7A 3H0IA 5EC7A 2E5KA 2JM8A 1AEYA 2JS2A 1NM7A 1G83A 2AKKA 5IHKA 1ZBJA 2RPNA 2A36A 5GJVB 2OJ2A 1OPKA 2XMFA 1MV0B 1H92A 1CKAA 2DYBA 1NLPC 3EGUA 1UJYA 2CT3A 4LUEA 2L3SA 1GBRA 1I07A 1KJWA 3UATA 1ZSGA 3FJ5A 2O31A 1KSWA 5FW9A 2RQVA 1WX6A 2J06A 4E6RA 2QDLA 4DEXA 2CUDA 2A37A 2BZYA 2W0ZA 2LJ3A 1A0NB 2AZSA 1IO6A 2HEQA 2O9SA 1UG1A 2O9VA 2BTTA 1H8KA 2KRSA 2G6FX 2GTOA 2K3BA 4QT7A 2KRMA 2OAWA 3H0FA 2J6OA 1T0JA 1GCPA 1M3CA 1WDXA 2A28A 3EG1A 3LH5A 4JJBA 2M51A 2CSQA 1M8MA 1GL5A 2DLPA 1K76A 4AFZC 1X27A 1ZLMA 2EQIA 3VS2A 3PVQA 2L0AA 1K4US
chains in the Genus database with same CATH superfamily
1VQNT 4ZGDB 1U5SA 4NL2A 1FYNA 2YLCA 2M1HA 4PJOF 3CPWS 2JVVA 3S3NA 4JLIA 4DBFA 5L8RE 4C8QB 4HCZA 1XJWB 3JCMh 4C0DC 7AT1B 2ZAEA 4OMQA 2Z0WA 4OB0B 5KYWB 2KI7A 4V2SA 3RKXA 2HKNA 4M7AD 1ZUYA 5GAMg 4RG2A 2COYA 3QKJA 1ZUKA 4OF1A 4EMKA 1VQLA 3H0HA 2E6ZA 2KAFA 1PKTA 2C06A 1VUBA 1Q81C 1WXUA 1KC8R 1C1AA 4C0ZA 1RAGB 5GAOp 1YBYA 3MP1A 3CQTA 1NJIC 2HCKA 4FL6A 3U23A 1M3AA 3D7SB 5GANh 4OMLA 1GFDA 2JTFA 4HT9A 5CKFA 5CVIA 5C0MA 3URGA 1NLOC 2RB6A 1WIEA 3OYFA 4BD3A 1UHFA 1OPLA 2XI9A 2O01E 4JLGA 4M75B 3TEEA 2RF0A 4XTYA 3CCMA 1YHQT 2CP0A 1VQLT 3THKA 4A53A 4AFSC 4R0KA 1XOVA 5GJWB 3CPWP 4B9WA 5GAN4 1D0XA 2RJDA 2D0NA 2OTJQ 1JJ2A 3CCJA 2NUPB 4KT0E 3UA6A 1G3YA 2WSFE 1HK9A 1WHGA 4RUGA 1RADB 5LJ3g 3J7AF 2GTJA 5GAOn 1UGVA 1T0HA 2O4XB 1I81A 3QJYA 4M7DD 1WXBA 2KXCA 1ARKA 5FU6C 1VQ4Q 1MUZA 1JB0E 3A8MB 1ZHIA 4C8QA 3CCMT 1WHKA 2YDLA 1GCQC 1B7TA 3GF5A 1BKBA 2DBMA 2VKNA 5KYWA 4IIOA 1O9SA 2R5AA 5GAOr 2AKLA 3NFCA 1WQ7A 4M78A 2KMTA 2O2OA 2WSEE 3SHWA 3PNWC 1UGQB 3M59A 4X1VA 3M4YA 4E7LA 2DFUA 3CPFA 1AWJA 4EMGA 1M2OA 1MMDA 2DL8A 2RQUA 2X4YA 3M9QA 2X4XA 2A3LA 3I9QA 3WVEB 3JB9F 1PSFA 1VQ9Q 4MDWA 4A4HA 2ESWA 5CK9A 4J5YA 4B6MA 4C8QE 2K2MA 1TSFA 1UGSB 3JCMW 1VQMT 4M75A 2DTOA 2XDPA 1LOJA 4JRIA 2OTJA 1KQSA 3M0UA 1VQPT 2XG8D 4LDXA 2E5QA 4M78E 3RR6A 1BI2A 4GLKA 3E19A 5J39A 1PC0A 1WHMA 3ULRB 2CKKA 4QW2A 2NUPA 4C8QF 1K9MU 4RG8A 3L2RA 3PFSA 1H3HA 4HXJA 4OMPA 2FEIA 4NL3A 2DL3A 2DYIA 2DX1A 3PMTA 3TSZA 4M7DF 1WHLA 4M78F 1PG5B 3VUZA 1BB9A 2LMJA 2IG0A 1UE9A 2O4XA 1J3TA 1PD1A 2KE9A 1U06A 3L2ZA 1E6GA 3LGFA 4ZNXA 1QVGA 2PNIA 4X9DA 2QQ9A 1WGSA 4N0AC 1X6GA 3OMGA 4A63B 2MAMA 1NYFA 2K57A 3V7RA 4M75E 3PIOA 3GNFB 3QZ9B 1CKBA 3JCMV 5GMKh 1BYMA 3EFOB 2MF2A 4XTVA 4R56A 4HCCA 1VQOQ 2ZPGB 1QLYA 1JEGA 4WTOB 4Z02A 2D8HA 1VQ4T 3VUBA 5CR2A 2K6DA 2LQWA 1VQ9A 4M77B 1KC8U 3QJ6A 1WHJA 4RTUA 2AIRB 3E1SA 2R58A 1PRLC 4QVDA 2KRNA 4N4HA 1HD3A 3C0CA 2LCSA 3EG2A 2DVJA 4RTXA 3JSCA 4Y92A 3E2UA 4LD6A 2RD1A 1AWXA 3QUIA 3CD6T 1VQ7Q 4ZTJA 2EJGA 2DL4A 3BFMA 4KUDK 1GBQA 1Q82R 2MIOA 2K79A 1SRLA 3L2UA 1VQ9T 1QP3A 3M54A 1NPPA 5KCHA 4K11A 2ZPIB 3QG1A 5CAIA 1M8VA 2KT1A 2QK0A 1AZEA 4GY5A 4J9CA 2KROA 3CXCA 1FMKA 1PWTA 3GIBA 1BI3A 1WNLA 4D8DA 1S72Q 1Y57A 1WJSA 3JCMf 3EFSA 3MPUB 3OQ5A 2DIQA 4FU6A 1Y96B 4F04B 2CP3A 4JZ4A 1IHVA 1QP2A 3G1JA 3MCAB 1E6HA 2K5LA 4OMOA 2P4TA 3L42A 4JS4A 2DILA 4RTVA 1XTDA 1T3SA 4CC4B 1VQOA 1TWBA 2J6FA 2V1QA 3EFOA 1M5Q1 2XD0A 5J3BA 4DOWA 4HVUA 1TG0A 2FYKA 5LL6S 1EFNA 3VRZA 1AVZC 3EG3A 2EQJA 1PNJA 4E2FB 2RHXA 3UPUA 4M77A 1JXOA 4PJOC 5J26A 2L2PA 1NEGA 1QWEA 3RNJA 5LJ5j 1WA7A 2RO0A 4L59A 3CC4A 4ZGEB 4CI0C 4FYYB 5CCAA 2KSSA 1AEYA 2AKKA 2K3YA 2QQRA 2RPNA 3MO8A 4RKUE 2V8KA 5GAMd 2OJ2A 1MMAA 2XMFA 1PCXA 1W2BA 1IB8A 1VQOT 1CKAA 1VQ7A 2E1HA 1NLPC 1K73U 3OSSC 1GBRA 5GMKl 2XIDA 4C92G 5CKEA 2XHCA 4CRIA 2LCCA 3PMIA 4L6V5 1ZSGA 5FW9A 2LVMA 2X35A 2J06A 2QDLA 5GAN6 5CKDA 4Y28E 4DEXA 4PJMA 3OA6A 2LJ3A 2AZSA 4M77E 3OW2S 2BTTA 2BE9B 4ANJA 2OAWA 3Q1JA 3HL8A 2ZPHB 2J6OA 1T0JA 1M90C 4KULA 1WDXA 3CMEA 2V26A 2QGFB 1KHCA 1Y96A 1VQ7T 3JCMJ 3GLXA 2DJZA 4M77F 5FRMA 1WJRA 3JB9I 2EQIA 1Q7YC 2NUZA 1OOTA 4AFQC 1K8AC 1SG5A 1RUWA 3REAB 1NG2A 5LJ3d 4LDVA 4J6WA 3A98A 1S72T 2CYZB 4RTZA 5I11A 3H6ZA 2HKQB 4PNOA 3RESA 2JMAA 1G2BA 2R57A 3HP9A 3NMZC 4EMKC 3HHTB 1RAHB 3VYGA 3SFMA 3S3MA 3FRNA 3CCEQ 2OX7A 4ME7A 2LCLA 1VA7A 1R0BG 5GAOl 1O75A 3KFVA 2LX9A 2DRKA 5GAN8 1BIAA 5IT9E 3I5SA 2RHIA 2QTXA 4J83A 2IVWA 2LQNA 3SEMA 3OW2P 2LTOA 2GFUA 4M4ZA 4X34A 2ENMA 3VS5A 4HA8A 1NBEB 2LJ1A 3RUXA 2GQVA 1Y0MA 3OYJA 4RCBA 4EMKB 1RABB 2EAYA 2DZCA 4OB1B 2F2XA 3DB4A 4PJNA 1SPKA 5AYFA 2PZ1A 5AT1B 4M7AB 1QVPA 4JPBW 4II1A 2CP6A 2LP5A 2YRCA 1Y07A 2MPXC 2EBPA 4JJDA 4BE2A 5IHIA 2Y90A 3JRZA 1WYXA 3WVDB 3M0RA 4LE9A 1N6AA 3EGDA 2CUBA 1G8XA 2LDMA 4E47A 4QVCA 4ATOA 4C8QC 1IHWA 2ROLA 3I55Q 1LVKA 2OTLQ 3MEVA 1RAIB 4F7UB 5A2QE 1I4K1 3GNGA 5FWCA 2P4RA 1Q95G 1KFZA 1YITQ 4M78C 1KD1U 3CCEA 3OS1A 3HSBA 2PTKA 4J6YA 2WACA 1WFWA 5A0DA 2CP7A 2EGCA 2HDAA 2LQ8A 3MEWA 2QGGA 1YFNA 5CQXA 1OU9A 2BZ8A 2QQSA 3DLLA 2HL5C 3QBYA 3VS7A 1I1JA 3VS4A 1UFFA 4C0GA 2NWMA 2QASA 4YTLA 3V7SA 1QWFA 1ABOA 2DM1A 4DBHA 3SB2A 3SDZA 1U1TA 2JS0A 1U8RA 4M7DB 4M75C 4OGCA 3CCET 4M78B 2ED0A 4EMHA 2NYSA 2EYWA 1YHQA 2F1LA 4BACA 1VQMQ 2JXBA 3A8HB 3OYIA 1NE8A 2PU9B 5LJ3e 1VQPQ 3RDVA 4M7AA 2L5QA 1HYOA 4AMCA 4HVVA 1BI0A 2P0KA 1KQ1A 4TVRA 5GAMh 1TOVA 3JAME 4HKEA 3A8GB 2VGNA 3PTAA 1K1ZA 3BW1A 2RHZA 3P8BB 3HRSA 3I55A 3CMAQ 2YUNA 2OTLA 2RN8A 4XTXA 4J9BA 4KBMB 4LUDA 2HSEB 1RAFB 4E7IA 1YITA 2DMOA 2KBTA 4F7UA 2F2VA 2MK5A 3QDFA 3VYHB 3LWIA 4RTWA 1TH7A 2DD5A 5LJ5d 1D1BA 5FU7C 3HKSA 5KYYB 1X43A 1MMGA 2E3HA 2LRQA 2K2VA 4M7AE 3SWNC 1M4ZA 2LNHB 4KUIA 1YWPA 3LW5E 3G71Q 3QWXX 5GANj 2D8JA 3JCMX 3OSVA 3I55T 2OTLT 2L3PA 2RI2A 1YP5A 4L5GA 2VV5A 1VIEA 1VQKQ 2J05A 3EHRA 1YITT 1UGRB 2DD4A 4LNPA 2V8JA 5C6SA 4M7AF 2NLUA 5LJ3h 4PJOG 4HVWA 3TCJA 4J8OA 4F7UE 1NJIR 4M7DA 4E7HA 1OZ3A 3NTIA 2FPFA 2YUQA 3GPLA 1VQMA 1YNZA 3J80E 3RMSA 1PHTA 2FPEA 5FU7B 5IXFA 1N8RU 3M0PA 1VQPA 3MHXA 2PUKB 1QVFP 1QMCA 2KVQG 4IURA 3REBB 3F70A 4XTWA 5GAN3 3KBGA 1V76A 1Q86C 1WJQA 3SWNB 4XTUA 1JQQA 1JO8A 1ABQA 3CD6Q 3SD4A 3BE3A 1D0ZA 4F7UF 2ZCFB 3I5RA 1AOJA 4J7IA 2OI3A 3M4GA 3CMAA 1OX8A 3GBQA 4Z88A 2L89A 4FT4A 2C0OA 3QSUA 3DLMA 3PIPA 4D6WA 1IRXA 2DJQA 1K73R 1V29B 2FZCB 1M1KU 2DAQA 4J7FA 4M7DE 4JRPA 1ZUUA 3QIIA 2V8IA 4J6XA 4BE1A 4AG1C 4GLMA 4CC3A 5L23A 5KYYA 1TUDA 3G71A 3OMCA 3AT1B 3VRYA 4C92D 1IXDA 4Z89A 4ZGJB 3E9GA 3CMAT 2K5IA 1SHGA 3CCSQ 4M77C 1VQ4A 2L3RA 3A8LB 1VQKA 2JT4A 1K0SA 1M27C 2A08A 1UEBA 1JJ2S 4BDZA 4LDUA 3FB9A 4J9IA 3A5ZB 1Y7XA 1LCKA 2MOXA 1VYVA 5M9OA 5EC7A 4JJNK 2E5KA 4FW2A 2E70A 1PM3A 2JS2A 2F5KA 4IUPA 1NM7A 1Q82C 3G71T 1OPKA 2Y4YA 3PT9A 2VASA 3CD6A 2BE7D 3EGUA 1UJYA 2XDDA 2CT3A 2L3SA 1QCNA 3ZFJA 3SWNA 1KJWA 2CZ6B 1HXDA 1VQKT 2O31A 5LJ5e 3HFOA 2QXFA 1VQ8Q 2A37A 3OYCA 4E7JA 2ATCB 2O9SA 3TREA 1UG1A 1D09B 4R55A 2RI3A 3VV0A 5DLQE 3OYAA 3LLRA 2O9VA 2G6FX 3JB9G 2GTOA 2K3BA 3OS2A 3MEAA 3JCMb 3JCMQ 3HPWA 2A28A 3EG1A 1IGQA 3LH5A 4PKCC 2HZYA 2QTVA 3VJPA 5GMKj 1PSEA 1JJ2P 3QPHA 4C92F 2E64A 2E10A 1ZLMA 3VS2A 3CCSA 1NZ9A 1N27A 5CKBA 4ESRA 3V8LA 1ACMB 1IGUA 1ZBXA 1YCSB 1WXTA 3C12A 1RAAB 4XU0A 2EQKA 1KQSS 4C8QG 1D1AA 5LJ5g 1AZGB 2LJ0A 1W4SA 1SHFA 2C0IA 2OAUA 3PGGA 1RI0A 4FSXA 2COZA 3A8OB 2G3RA 3UF4A 5I22A 1YI2Q 1C6VX 4M78G 2DTHA 1B07A 2FL7A 1YWOA 1K9AA 2RK1A 1GRIA 3G6EQ 3RERA 3EHQA 2ED1A 3CCRQ 4FT2A 2GF7A 3GOXA 1NJIU 4JRKA 3DKMA 4XQ3A 1SSFA 3MJXA 3CCST 2KQWA 4A4KA 2CGHA 2DA9A 1QVGS 1KD1R 4LD9K 1V1CA 1X75C 3TVTA 3VS3A 2EPDA 4A54A 5GAMf 4KGXB 3VU3C 1VQ8A 1Z9QA 2RQWA 1U3OA 4FYWB 3FIFA 2PUOB 4HCKA 2EKHA 1VYUA 2DTIA 3CC7Q 4DA4A 1SF9A 4KRTA 2X9HA 4M75G 4FW1A 2M9UA 3CCLQ 2K5FA 2KYMA 2ROTA 2ZPEB 4J9DA 4OVAA 3RKYA 3HRUA 5HKCA 1KQSP 4BI3A 1I0CA 1YJ9Q 2DEUA 2DXBA 2VC8A 3M56A 1OV3A 4WCIA 1VQ8T 3M0SA 4JZ3A 4MDXA 2CH4A 1KG1A 2EYQA 2IPOB 3I35A 1S72A 3EGXB 4J9FA 9ATCB 1D1CA 2HD0A 1SKUB 4QVZA 3UA7A 2M0OA 1K0XA 4BY6C 2L3QA 1FXXA 1EIFA 2CS7A 2CSIA 3CEYA 1QVGP 3FJPA 3V8JA 4Y91A 1XNIA 2LC4A 5LJ3f 2XU8A 3G6EA 2MWPA 5GAN7 2O88A 1FMVA 3R6OA 1ZSZC 3N5BB 1SSHA 3C4SA 4JUVA 1W1FA 3M0TA 1ZA2B 3EGDB 4RTYA 2YRDA 5A0GA 3CXCS 2GFAA 3ZL7C 1OQKA 2EQUA 4KH1B 3AHUA 5HY6A 2QEXQ 3CC2Q 2HAXA 1BU1A 2CREA 5D6XA 1B3QA 2DNUA 4X9CA 5I2SA 2IIMA 4J9EA 2HQHA 2LZ6B 3O8VA 4F16A 3RMQA 1U1SA 2BZXA 3FDRA 2M0YA 3CC7A 1YI2T 4GBQA 1JXMA 4DEYA 2KYBA 2M16A 2DPPB 4BY6B 2HBPA 2HQEA 2RQRA 2RJEA 1MNEA 3G6ET 2H8HA 4M7AC 3OYMA 2FB7A 3CCVQ 3FLGA 3CCRT 2K7AA 2H3EB 2CDTA 5CQYA 1ZSZB 5HK3A 3CPWA 1NYGA 3QYGB 4Z8AA 2HMAA 2RMOA 4B9XA 2GCXA 3OYYA 3X28B 1WI7A 1KQ2A 1LPLA 1YJ9A 2ECZA 2YWWA 1MGQA 4CC2A 2WSCE 3L2QA 3I56Q 3UT1A 1OEBA 1JU5C 3VS6A 2VUBA 4E7ZA 1N8RR 1MHNA 1K9MC 1TUGB 3CC7T 2MYSA 2FHDA 3S6WA 1UTIA 2JTEA 3CCLT 5IXBA 1BCMA 4EDUA 1W2BS 3EGXA 1BK2A 4PJOD 3CXCP 2SRCA 2KXDA 2PVGB 1YCYA 1RL2A 4N4GA 4F14A 3HTRA 4J9HA 2DE0X 1K8AR 4RTTA 1UUEA 2EYZA 2RJCA 2KNBB 1AWWA 2D6FA 4OGEA 4PJJA 2EIFA 2J7IA 4OMNA 1YJ9T 3P8HA 2X3XD 1OULA 2EWNA 2YT6A 1ZX6A 1M1KR 2D9TA 3T9NA 3IQLA 1R8OB 3CC2A 4IUQA 2LT4A 4HCBA 1OZ2A 1UJ0A 3VS0A 4LN2A 4M77G 1PRMC 1NPRA 2CZ7B 3VS1A 5GAN2 3M55A 1VIFA 4FM4B 5A0LA 4M7DC 2K4YA 2RH2A 4OMFB 5D6YA 3NHNA 2F5TX 1KC8C 3R6NA 4CC7A 1M30A 4DBRA 1M3BA 3CCVA 1QCFA 1KHIA 4XTZA 1X01A 3P8DA 3QHSA 5GANe 2JNGA 3LGLA 3MEUA 5KYXB 2FG0A 4D8KA 5I21A 1ZSZA 4MZTA 2J6KA 2JJ9A 3M0QA 1JBMA 5FLXE 2QEXT 1W2BP 3CC2T 3QWYA 2JMCA 1TTHB 1X2KA 4PFZA 3I56A 1I8FA 1OI1A 3KUFA 4PL6A 2YSQA 4IUUA 3FC3A 1XQHA 2X51A 1QKXA 2JTMA 3CCVT 4Q5WA 3G4SQ 1WLPB 2JUFA 2KT8A 4AT1B 1FWZA 3H9NA 2VXFA 2KGTA 1SEMA 4NOYA 5GMKm 2JM9A 2YLBA 1BCOA 2DKGA 2DL5A 5GANg 3FEOA 1RLQC 1OU8A 4RCCA 2BKDN 2LX7A 4A4GA 2NUTB 5DM7R 2L8DA 3I56T 5LJ5f 1RI9A 3OY9A 1X2QA 1QVFS 4KGZB 5CO7A 1PKSA 1MV3A 1S1NA 1D3BB 2GNCA 4C92C 2GBQA 4VUBA 4KH0B 3CBPA 3X25B 2EVRA 2CP2A 1WQWA 2YHTA 3JB9H 1QKWA 5GAOq 2QYZA 5KH6A 3JB9D 4C0DB 1VOMA 2KEAA 4OMMA 3H0IA 3WXMB 1VQ6Q 2JM8A 2A0FB 2DVEA 3JCMc 2FZKB 4XU1A 2QA4Q 1G83A 1VQ5Q 1ZBJA 5GJVB 2RHYA 5KYXA 3M5AA 5GAMj 2DYBA 1WZOA 4BUGA 3UATA 5DY9A 2PQWA 4XK8E 4C92B 1K73C 1OYXA 2DETA 2RQVA 1WX6A 4JDSA 1Q81R 3G7ZA 4P5NA 4C8QD 2CUDA 2BZYA 4BE0A 2JN0A 2EKOA 1A0NB 5KYUB 2DZ9A 5GAOm 5KE2A 3G4SA 4M78D 3V8KA 3L2VA 3VKIA 1M90U 5KCOA 5FRNA 1MNDA 3H0FA 1GCPA 3EG9B 5D6WA 1F1BB 4JJBA 1ZQ1A 3TQ7P 4FCYA 2I2LA 1Q7YU 2DIGA 2QG9B 3CCJT 4N4IA 1K8AU 3CBOA 2NUTA 3JB9J 2DXUA 2L0AA 1B34B 3QDRB 1UDLA 2MMPA 2HNIA 1D3BA 4HT8A 2COWA 3G4ST 1P92A 2XKOC 5LJ3j 5GMKe 2CP5A 1LJOA 3QXEB 4M75D 3RBBB 3OB9A 3QZ5B 2E4HA 5FU6B 2E65A 2FRYA 3ASKA 1RAEB 1VQ6A 1SRMA 3CBMA 3EG0A 2QA4A 1VQ5A 1QQJA 4C5HA 3O5ZA 2B86A 1G3WA 2ZGWA 5FWBA 3BY7A 3PE0A 3NTHA 1W70A 1C0MA 4QQDA 1IZ6A 2LT1A 3TU4K 1M9SA 2EFIA 2DK3A 4DOVA 4FIBA 1R0CB 4F17A 1X6OA 4C92A 2RA2A 4ORZA 1OX9A 2DL7A 2GQIA 1Q86R 1G3SA 2CH4W 4C5GA 4ZTFA 1M2VB 1VQ6T 5IAYA 4IUTA 5KYUA 4BI4A 3QYHB 2QA4T 2C0TA 1I5OB 1VQ5T 2M02A 4PJLA 3L2WA 1X69A 3OYEA 4M7AG 8ATCB 3ME9A 2EJFA 4BB7A 4PFOA 1FMWA 2CT4A 1KIKA 3EG9A 2OTJT 3TSWA 1LNXA 2P0QA 2DF6A 2E12A 1YJNQ 4IUVA 2DBKA 2RNAA 3OS0A 4EPCA 2EQMA 2JZ2A 2DXCA 3META 2QDYB 2HSPA 3PVLA 1B34A 2YUOA 4AG2C 1RLPC 2LQKA 4F7UG 4C92E 1BI1A 5DLOA 1IREB 5FROA 2QQAA 4EIKA 1M1FA 3JV3A 4M75F 3OYKA 2RJFA 2ZZDA 4FSSA 4MMKA 1KD1C 2SEMA 4A4FA 1HSQA 4J9GA 1GCQA 4WF2A 1YN8A 3CC4Q 2YRVA 3C95A 5ECAA 2MI6A 2Y4XA 8AT1B 1HJDA 2EYXA 2K3XA 3S3OA 2ABLA 3OW2A 3E9FA 2HQXA 2RI5A 1UECA 4MMLA 2I0NA 4ZN1A 1UB4A 3EH2A 2F2WA 1I5LA 3OYDA 1X6BA 1WPYA 2YUPA 4PK4A 2LNVA 4JRQA 4M7DG 3GP8A 3X24B 3HFNA 2F69A 3X26B 1M2VA 3EAEA 1Q81U 2W10A 4QQGA 5LJ5h 1TUCA 5IH2A 3OYHA 2FO0A 2X4WA 1TXQA 4O6JA 2JOYA 2P0PA 2QAZA 3OYBA 1YJNA 4ZN3A 3CMEQ 2DXTA 4O5VA 2XK0A 2CZ0B 5HK0A 2PVOB 3ZEHA 1VYTA 2RM4A 3OYLA 4M77D 2JW4A 4E7KA 2VYTA 3JCMd 2BIVA 5CKHA 2X4JA 2RQTA 5HCKA 1GFCA 4OB3B 1YJWQ 1N9RA 2K9GA 5GANf 3LYIA 2XICA 2KY9A 1EX4A 4AFUC 1PD0A 1AWOA 2YXYA 2VWFA 4LXCA 1Z9ZA 2X3WD 2A7YA 3OYGA 3OS5A 1CSKA 3A1PA 1YJNT 1AHJB 4N0AA 3X20B 1M1GA 4BI8B 4ELZC 5GANd 2HBWA 2R5MA 3NGPA 4DQ2A 4QQ6A 1QW1A 1W6XA 3NTKA 2VXEA 4E7SA 4JS5A 3EFRA 1GXIE 2HL3A 1T3LA 4ELYC 1YI2A 1QCOA 3J81E 2QI2A 1MMNA 3CCQQ 4PJOB 5I2MA 1N5ZA 2V1RA 3CCUQ 3BDUA 3CCRA 4XU2A 2B8AA 3CC4T 2ZPBB 1TS9A 3LX7A 1Q86U 2EYYA 3OBWA 1YIJQ 3BDLA 2VVKA 1N8RC 2EGAA 3M53A 4OB2B 2E6NA 1G3TA 2AZVA 4IKFA 2CZ1B 5IN1A 1BBZA 1E7OA 4XU3A 1N9SA 3M57A 1AT1B 2DRMA 2MCNA 2AHJB 4JJCA 3C94A 3H41A 5KYNA 1VQNQ 2EJ9A 3LH0A 1YJWA 3CCLA 2KR3A 4PLLA 2D1XA 1R77A 2E3IA 5CIUA 2BUDA 5IHNA 3DB3A 2AK5A 2D0QB 3NPFA 3RIRA 2FRWA 4IIMA 4XAXB 5GMKi 2EW3A 3MKDA 1DJ7B 2ZPFB 4PFPA 6AT1B 4DBQA 1M1KC 1BIBA 3QO3A 2DERA 2RHUA 2FZGB 2DEQA 2EGEA 4OP0A 3CMET 3KXTA 1NEBA 3HRTA 1ZA1B 2H3JA 3V7CA 1G5VA 3INZA 1AD5A 1M90R 1UHCA 3UWNA 2FPDA 2QQBA 1JRIA 2GGRA 5GAN5 1UGPB 4A4EA 4LDYA 1YJWT 4RMOA 1FX7A 1Q7YR 2P84A 3L1AA 4BDYA 1EZZB 2MWOA 4UC4A 4KGVB 5KE3A 3CCQA 4NS5A 3LWHA 3CCUA 1Q82U 4PJOA 3H8ZA 2E41A 1Y71A 3EH1A 3JCMe 1QVFA 3ZBDA 5IHKA 1YIJA 2VGMA 3ER0A 1YHQQ 2A36A 1WHHA 1VQLQ 4C5IA 2QEXA 1MV0B 1H92A 4QKUA 5D7UA 4LDWA 4MZMA 4FYVB 1D0YA 4LUEA 1I07A 1TU0B 3UDCA 2DO3A 3FJ5A 2PVDB 1KSWA 2AT1B 1VQNA 4E6RA 4PLIA 3RKWA 2W0ZA 3CCQT 1IO6A 2HEQA 3CCUT 3MP6A 2RK2A 5GAMe 4C5EA 5EG2A 1KK7A 1H8KA 2KRSA 4FYXB 4QT7A 3OYNA 1RACB 2KRMA 3JCMP 3M58A 1YIJT 2KK4A 3OBYA 3CCMQ 1K9MR 4C0FA 1M3CA 3MP8A 4PJOE 1H3ZA 2M51A 2XDBA 2CSQA 2FVUA 3JCMg 1M8MA 1GL5A 3CCJQ 2DLPA 1K76A 4AFZC 1H641 1X27A 3PVQA 2VB6A 2KDSA 4MZPA 1K4US
chains in the Genus database with same CATH topology
2NUZA 1U5SA 1OOTA 4AFQC 4ESRA 1UDLA 1YCSB 1FYNA 1WXTA 1RUWA 3REAB 1NG2A 3A98A 4RTZA 5I11A 1AZGB 2LJ0A 2C0IA 1SHFA 3RBBB 4OMQA 2JMAA 5I22A 1G2BA 3UF4A 3NMZC 2FRYA 1B07A 1SRMA 3EG0A 1ZUYA 1YWOA 1K9AA 1GRIA 1VA7A 1ZUKA 3O5ZA 3EHQA 3H0HA 3KFVA 2DRKA 2ED1A 2B86A 1PKTA 3I5SA 5FWBA 1WXUA 2LQNA 3PE0A 3SEMA 2DA9A 1V1CA 1W70A 3TVTA 3VS3A 2EPDA 3CQTA 2HCKA 3U23A 4M4ZA 1M3AA 1GFDA 2ENMA 4OMLA 3VS5A 1Z9QA 4F17A 2RQWA 2LJ1A 1U3OA 4ORZA 1Y0MA 2DL7A 4HCKA 2EKHA 2GQIA 1NLOC 1VYUA 2CH4W 1WIEA 4KRTA 1UHFA 1OPLA 2C0TA 2RF0A 2F2XA 1X69A 2KYMA 3THKA 1SPKA 2PZ1A 2ROTA 4AFSC 4J9DA 4R0KA 4JPBW 1XOVA 5GJWB 2CT4A 2LP5A 1KIKA 2D0NA 2EBPA 4JJDA 1I0CA 3TSWA 5IHIA 3UA6A 2DF6A 1WYXA 2DBKA 2RNAA 4RUGA 3M0RA 4LE9A 1OV3A 4WCIA 3M0SA 4JZ3A 2CUBA 2GTJA 2CH4A 2HSPA 3PVLA 1UGVA 3I35A 1T0HA 2YUOA 2ROLA 4AG2C 1RLPC 4J9FA 1WXBA 4EIKA 2KXCA 1ARKA 3JV3A 5FWCA 2P4RA 1MUZA 3UA7A 1K0XA 1KFZA 2L3QA 2CSIA 2YDLA 1GCQC 2DBMA 2VKNA 4IIOA 2PTKA 1WFWA 4FSSA 2AKLA 2EGCA 2SEMA 2HDAA 2O88A 1HSQA 1SSHA 1GCQA 2O2OA 4J9GA 1W1FA 3M0TA 1YN8A 3SHWA 5ECAA 4RTYA 1HJDA 2BZ8A 2EYXA 4X1VA 3ZL7C 3VS7A 2ABLA 1AWJA 1I1JA 3VS4A 1UFFA 1UECA 2I0NA 2NWMA 1BU1A 2DL8A 2CREA 1B3QA 2DNUA 2F2WA 2RQUA 1QWFA 2IIMA 4J9EA 2LZ6B 1ABOA 4F16A 1X6BA 2DM1A 2YUPA 2BZXA 2M0YA 3I9QA 4GBQA 2JS0A 1JXMA 4DEYA 2KYBA 2RQRA 2ED0A 2ESWA 2EYWA 2K2MA 2H8HA 2W10A 2K7AA 2JXBA 2CDTA 1TUCA 5IH2A 1NYGA 2FO0A 4Z8AA 3M0UA 2RMOA 1WI7A 4HVVA 2ECZA 3ULRB 4CC2A 1H3HA 1OEBA 1JU5C 4HXJA 1VYTA 4OMPA 2FEIA 3VS6A 2DL3A 2JW4A 1K1ZA 2DX1A 2YUNA 3TSZA 2RN8A 1UTIA 2RQTA 4J9BA 5HCKA 4LUDA 2JTEA 1GFCA 5IXBA 1BB9A 2LMJA 1J3TA 1UE9A 2DMOA 1BK2A 2K9GA 2KE9A 1U06A 2KBTA 1E6GA 2F2VA 2SRCA 4ZNXA 2KXDA 2PNIA 4AFUC 4F14A 4J9HA 2DE0X 4RTTA 4RTWA 1AWOA 1X6GA 1UUEA 2EYZA 2VWFA 4A63B 2KNBB 1Z9ZA 2X3WD 1AWWA 1NYFA 1CSKA 2J7IA 4OMNA 1X43A 1CKBA 2X3XD 2YT6A 1ZX6A 2LNHB 3IQLA 2HBWA 1YWPA 3NGPA 3QWXX 2D8JA 1QLYA 1W6XA 1JEGA 1UJ0A 3VS0A 4LN2A 2L3PA 1PRMC 2D8HA 1YP5A 2K6DA 3VS1A 2LQWA 1T3LA 2J05A 3EHRA 4LNPA 3NHNA 4RTUA 4HVWA 3R6NA 4CC7A 1M30A 1M3BA 1N5ZA 1QCFA 2V1RA 2FPFA 2YUQA 1PRLC 1YNZA 1PHTA 2FPEA 5IXFA 3M0PA 2KRNA 2EYYA 2FG0A 1HD3A 3C0CA 4D8KA 2J6KA 3EG2A 2LCSA 3REBB 2DVJA 4RTXA 2VVKA 3M0QA 2EGAA 4Y92A 1JQQA 1JO8A 3QWYA 2JMCA 1X2KA 1AWXA 1ABQA 2DL4A 3I5RA 1GBQA 2AZVA 2MIOA 1AOJA 2K79A 1SRLA 2OI3A 1BBZA 1E7OA 3GBQA 4Z88A 4K11A 2DRMA 2MCNA 2C0OA 2YSQA 4JJCA 3H41A 2KT1A 1AZEA 2KR3A 4J9CA 2DJQA 2KROA 1QKXA 2D1XA 1FMKA 1PWTA 4D8DA 1WLPB 1Y57A 5IHNA 2KT8A 2AK5A 3NPFA 2FRWA 4IIMA 2EW3A 2KGTA 1SEMA 1ZUUA 2JM9A 4JZ4A 2EGEA 2DL5A 1RLQC 4AG1C 1E6HA 1NEBA 4OMOA 4GLMA 2LX7A 4CC3A 5L23A 1TUDA 2DILA 4RTVA 1T3SA 3VRYA 4CC4B 1AD5A 1UHCA 4Z89A 1RI9A 2J6FA 2V1QA 1X2QA 2FPDA 1PKSA 1MV3A 1S1NA 2GGRA 1SHGA 2GNCA 4HVUA 1TG0A 2GBQA 1EFNA 2JT4A 3VRZA 1AVZC 3EG3A 1K0SA 1M27C 2A08A 1PNJA 2EVRA 4J9IA 1JXOA 1QKWA 2L2PA 1NEGA 1QWEA 3RNJA 1LCKA 2KEAA 4OMMA 2MOXA 1VYVA 1WA7A 3H0IA 5EC7A 2E5KA 2JM8A 1AEYA 2JS2A 1NM7A 1G83A 2AKKA 5IHKA 1ZBJA 2RPNA 2A36A 5GJVB 2OJ2A 1OPKA 2XMFA 1MV0B 1H92A 1CKAA 2DYBA 1NLPC 3EGUA 1UJYA 2CT3A 4LUEA 2L3SA 1GBRA 1I07A 1KJWA 3UATA 1ZSGA 3FJ5A 2O31A 1KSWA 5FW9A 2RQVA 1WX6A 2J06A 4E6RA 2QDLA 4DEXA 2CUDA 2A37A 2BZYA 2W0ZA 2LJ3A 1A0NB 2AZSA 1IO6A 2HEQA 2O9SA 1UG1A 2O9VA 2BTTA 1H8KA 2KRSA 2G6FX 2GTOA 2K3BA 4QT7A 2KRMA 2OAWA 3H0FA 2J6OA 1T0JA 1GCPA 1M3CA 1WDXA 2A28A 3EG1A 3LH5A 4JJBA 2M51A 2CSQA 1M8MA 1GL5A 2DLPA 1K76A 4AFZC 1X27A 1ZLMA 2EQIA 3VS2A 3PVQA 2L0AA 1K4US
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUZ A;  1U5S A;  1OOT A;  4AFQ C;  4ESR A;  1UDL A;  1YCS B;  1FYN A;  1WXT A;  1RUW A;  3REA B;  1NG2 A;  3A98 A;  4RTZ A;  5I11 A;  1AZG B;  2LJ0 A;  2C0I A;  1SHF A;  3RBB B;  4OMQ A;  2JMA A;  5I22 A;  1G2B A;  3UF4 A;  3NMZ C;  2FRY A;  1B07 A;  1SRM A;  3EG0 A;  1ZUY A;  1YWO A;  1K9A A;  1GRI A;  1VA7 A;  1ZUK A;  3O5Z A;  3EHQ A;  3H0H A;  3KFV A;  2DRK A;  2ED1 A;  2B86 A;  1PKT A;  3I5S A;  5FWB A;  1WXU A;  2LQN A;  3PE0 A;  3SEM A;  2DA9 A;  1V1C A;  1W70 A;  3TVT A;  3VS3 A;  2EPD A;  3CQT A;  2HCK A;  3U23 A;  4M4Z A;  1M3A A;  1GFD A;  2ENM A;  4OML A;  3VS5 A;  1Z9Q A;  4F17 A;  2RQW A;  2LJ1 A;  1U3O A;  4ORZ A;  1Y0M A;  2DL7 A;  4HCK A;  2EKH A;  2GQI A;  1NLO C;  1VYU A;  2CH4 W;  1WIE A;  4KRT A;  1UHF A;  1OPL A;  2C0T A;  2RF0 A;  2F2X A;  1X69 A;  2KYM A;  3THK A;  1SPK A;  2PZ1 A;  2ROT A;  4AFS C;  4J9D A;  4R0K A;  4JPB W;  1XOV A;  5GJW B;  2CT4 A;  2LP5 A;  1KIK A;  2D0N A;  2EBP A;  4JJD A;  1I0C A;  3TSW A;  5IHI A;  3UA6 A;  2DF6 A;  1WYX A;  2DBK A;  2RNA A;  4RUG A;  3M0R A;  4LE9 A;  1OV3 A;  4WCI A;  3M0S A;  4JZ3 A;  2CUB A;  2GTJ A;  2CH4 A;  2HSP A;  3PVL A;  1UGV A;  3I35 A;  1T0H A;  2YUO A;  2ROL A;  4AG2 C;  1RLP C;  4J9F A;  1WXB A;  4EIK A;  2KXC A;  1ARK A;  3JV3 A;  5FWC A;  2P4R A;  1MUZ A;  3UA7 A;  1K0X A;  1KFZ A;  2L3Q A;  2CSI A;  2YDL A;  1GCQ C;  2DBM A;  2VKN A;  4IIO A;  2PTK A;  1WFW A;  4FSS A;  2AKL A;  2EGC A;  2SEM A;  2HDA A;  2O88 A;  1HSQ A;  1SSH A;  1GCQ A;  2O2O A;  4J9G A;  1W1F A;  3M0T A;  1YN8 A;  3SHW A;  5ECA A;  4RTY A;  1HJD A;  2BZ8 A;  2EYX A;  4X1V A;  3ZL7 C;  3VS7 A;  2ABL A;  1AWJ A;  1I1J A;  3VS4 A;  1UFF A;  1UEC A;  2I0N A;  2NWM A;  1BU1 A;  2DL8 A;  2CRE A;  1B3Q A;  2DNU A;  2F2W A;  2RQU A;  1QWF A;  2IIM A;  4J9E A;  2LZ6 B;  1ABO A;  4F16 A;  1X6B A;  2DM1 A;  2YUP A;  2BZX A;  2M0Y A;  3I9Q A;  4GBQ A;  2JS0 A;  1JXM A;  4DEY A;  2KYB A;  2RQR A;  2ED0 A;  2ESW A;  2EYW A;  2K2M A;  2H8H A;  2W10 A;  2K7A A;  2JXB A;  2CDT A;  1TUC A;  5IH2 A;  1NYG A;  2FO0 A;  4Z8A A;  3M0U A;  2RMO A;  1WI7 A;  4HVV A;  2ECZ A;  3ULR B;  4CC2 A;  1H3H A;  1OEB A;  1JU5 C;  4HXJ A;  1VYT A;  4OMP A;  2FEI A;  3VS6 A;  2DL3 A;  2JW4 A;  1K1Z A;  2DX1 A;  2YUN A;  3TSZ A;  2RN8 A;  1UTI A;  2RQT A;  4J9B A;  5HCK A;  4LUD A;  2JTE A;  1GFC A;  5IXB A;  1BB9 A;  2LMJ A;  1J3T A;  1UE9 A;  2DMO A;  1BK2 A;  2K9G A;  2KE9 A;  1U06 A;  2KBT A;  1E6G A;  2F2V A;  2SRC A;  4ZNX A;  2KXD A;  2PNI A;  4AFU C;  4F14 A;  4J9H A;  2DE0 X;  4RTT A;  4RTW A;  1AWO A;  1X6G A;  1UUE A;  2EYZ A;  2VWF A;  4A63 B;  2KNB B;  1Z9Z A;  2X3W D;  1AWW A;  1NYF A;  1CSK A;  2J7I A;  4OMN A;  1X43 A;  1CKB A;  2X3X D;  2YT6 A;  1ZX6 A;  2LNH B;  3IQL A;  2HBW A;  1YWP A;  3NGP A;  3QWX X;  2D8J A;  1QLY A;  1W6X A;  1JEG A;  1UJ0 A;  3VS0 A;  4LN2 A;  2L3P A;  1PRM C;  2D8H A;  1YP5 A;  2K6D A;  3VS1 A;  2LQW A;  1T3L A;  2J05 A;  3EHR A;  4LNP A;  3NHN A;  4RTU A;  4HVW A;  3R6N A;  4CC7 A;  1M30 A;  1M3B A;  1N5Z A;  1QCF A;  2V1R A;  2FPF A;  2YUQ A;  1PRL C;  1YNZ A;  1PHT A;  2FPE A;  5IXF A;  3M0P A;  2KRN A;  2EYY A;  2FG0 A;  1HD3 A;  3C0C A;  4D8K A;  2J6K A;  3EG2 A;  2LCS A;  3REB B;  2DVJ A;  4RTX A;  2VVK A;  3M0Q A;  2EGA A;  4Y92 A;  1JQQ A;  1JO8 A;  3QWY A;  2JMC A;  1X2K A;  1AWX A;  1ABQ A;  2DL4 A;  3I5R A;  1GBQ A;  2AZV A;  2MIO A;  1AOJ A;  2K79 A;  1SRL A;  2OI3 A;  1BBZ A;  1E7O A;  3GBQ A;  4Z88 A;  4K11 A;  2DRM A;  2MCN A;  2C0O A;  2YSQ A;  4JJC A;  3H41 A;  2KT1 A;  1AZE A;  2KR3 A;  4J9C A;  2DJQ A;  2KRO A;  1QKX A;  2D1X A;  1FMK A;  1PWT A;  4D8D A;  1WLP B;  1Y57 A;  5IHN A;  2KT8 A;  2AK5 A;  3NPF A;  2FRW A;  4IIM A;  2EW3 A;  2KGT A;  1SEM A;  1ZUU A;  2JM9 A;  4JZ4 A;  2EGE A;  2DL5 A;  1RLQ C;  4AG1 C;  1E6H A;  1NEB A;  4OMO A;  4GLM A;  2LX7 A;  4CC3 A;  5L23 A;  1TUD A;  2DIL A;  4RTV A;  1T3S A;  3VRY A;  4CC4 B;  1AD5 A;  1UHC A;  4Z89 A;  1RI9 A;  2J6F A;  2V1Q A;  1X2Q A;  2FPD A;  1PKS A;  1MV3 A;  1S1N A;  2GGR A;  1SHG A;  2GNC A;  4HVU A;  1TG0 A;  2GBQ A;  1EFN A;  2JT4 A;  3VRZ A;  1AVZ C;  3EG3 A;  1K0S A;  1M27 C;  2A08 A;  1PNJ A;  2EVR A;  4J9I A;  1JXO A;  1QKW A;  2L2P A;  1NEG A;  1QWE A;  3RNJ A;  1LCK A;  2KEA A;  4OMM A;  2MOX A;  1VYV A;  1WA7 A;  3H0I A;  5EC7 A;  2E5K A;  2JM8 A;  1AEY A;  2JS2 A;  1NM7 A;  1G83 A;  2AKK A;  5IHK A;  1ZBJ A;  2RPN A;  2A36 A;  5GJV B;  2OJ2 A;  1OPK A;  2XMF A;  1MV0 B;  1H92 A;  1CKA A;  2DYB A;  1NLP C;  3EGU A;  1UJY A;  2CT3 A;  4LUE A;  2L3S A;  1GBR A;  1I07 A;  1KJW A;  3UAT A;  1ZSG A;  3FJ5 A;  2O31 A;  1KSW A;  5FW9 A;  2RQV A;  1WX6 A;  2J06 A;  4E6R A;  2QDL A;  4DEX A;  2CUD A;  2A37 A;  2BZY A;  2W0Z A;  2LJ3 A;  1A0N B;  2AZS A;  1IO6 A;  2HEQ A;  2O9S A;  1UG1 A;  2O9V A;  2BTT A;  1H8K A;  2KRS A;  2G6F X;  2GTO A;  2K3B A;  4QT7 A;  2KRM A;  2OAW A;  3H0F A;  2J6O A;  1T0J A;  1GCP A;  1M3C A;  1WDX A;  2A28 A;  3EG1 A;  3LH5 A;  4JJB A;  2M51 A;  2CSQ A;  1M8M A;  1GL5 A;  2DLP A;  1K76 A;  4AFZ C;  1X27 A;  1ZLM A;  2EQI A;  3VS2 A;  3PVQ A;  2L0A A;  1K4U S; 
#chains in the Genus database with same CATH topology
 1VQN T;  4ZGD B;  1U5S A;  4NL2 A;  1FYN A;  2YLC A;  2M1H A;  4PJO F;  3CPW S;  2JVV A;  3S3N A;  4JLI A;  4DBF A;  5L8R E;  4C8Q B;  4HCZ A;  1XJW B;  3JCM h;  4C0D C;  7AT1 B;  2ZAE A;  4OMQ A;  2Z0W A;  4OB0 B;  5KYW B;  2KI7 A;  4V2S A;  3RKX A;  2HKN A;  4M7A D;  1ZUY A;  5GAM g;  4RG2 A;  2COY A;  3QKJ A;  1ZUK A;  4OF1 A;  4EMK A;  1VQL A;  3H0H A;  2E6Z A;  2KAF A;  1PKT A;  2C06 A;  1VUB A;  1Q81 C;  1WXU A;  1KC8 R;  1C1A A;  4C0Z A;  1RAG B;  5GAO p;  1YBY A;  3MP1 A;  3CQT A;  1NJI C;  2HCK A;  4FL6 A;  3U23 A;  1M3A A;  3D7S B;  5GAN h;  4OML A;  1GFD A;  2JTF A;  4HT9 A;  5CKF A;  5CVI A;  5C0M A;  3URG A;  1NLO C;  2RB6 A;  1WIE A;  3OYF A;  4BD3 A;  1UHF A;  1OPL A;  2XI9 A;  2O01 E;  4JLG A;  4M75 B;  3TEE A;  2RF0 A;  4XTY A;  3CCM A;  1YHQ T;  2CP0 A;  1VQL T;  3THK A;  4A53 A;  4AFS C;  4R0K A;  1XOV A;  5GJW B;  3CPW P;  4B9W A;  5GAN 4;  1D0X A;  2RJD A;  2D0N A;  2OTJ Q;  1JJ2 A;  3CCJ A;  2NUP B;  4KT0 E;  3UA6 A;  1G3Y A;  2WSF E;  1HK9 A;  1WHG A;  4RUG A;  1RAD B;  5LJ3 g;  3J7A F;  2GTJ A;  5GAO n;  1UGV A;  1T0H A;  2O4X B;  1I81 A;  3QJY A;  4M7D D;  1WXB A;  2KXC A;  1ARK A;  5FU6 C;  1VQ4 Q;  1MUZ A;  1JB0 E;  3A8M B;  1ZHI A;  4C8Q A;  3CCM T;  1WHK A;  2YDL A;  1GCQ C;  1B7T A;  3GF5 A;  1BKB A;  2DBM A;  2VKN A;  5KYW A;  4IIO A;  1O9S A;  2R5A A;  5GAO r;  2AKL A;  3NFC A;  1WQ7 A;  4M78 A;  2KMT A;  2O2O A;  2WSE E;  3SHW A;  3PNW C;  1UGQ B;  3M59 A;  4X1V A;  3M4Y A;  4E7L A;  2DFU A;  3CPF A;  1AWJ A;  4EMG A;  1M2O A;  1MMD A;  2DL8 A;  2RQU A;  2X4Y A;  3M9Q A;  2X4X A;  2A3L A;  3I9Q A;  3WVE B;  3JB9 F;  1PSF A;  1VQ9 Q;  4MDW A;  4A4H A;  2ESW A;  5CK9 A;  4J5Y A;  4B6M A;  4C8Q E;  2K2M A;  1TSF A;  1UGS B;  3JCM W;  1VQM T;  4M75 A;  2DTO A;  2XDP A;  1LOJ A;  4JRI A;  2OTJ A;  1KQS A;  3M0U A;  1VQP T;  2XG8 D;  4LDX A;  2E5Q A;  4M78 E;  3RR6 A;  1BI2 A;  4GLK A;  3E19 A;  5J39 A;  1PC0 A;  1WHM A;  3ULR B;  2CKK A;  4QW2 A;  2NUP A;  4C8Q F;  1K9M U;  4RG8 A;  3L2R A;  3PFS A;  1H3H A;  4HXJ A;  4OMP A;  2FEI A;  4NL3 A;  2DL3 A;  2DYI A;  2DX1 A;  3PMT A;  3TSZ A;  4M7D F;  1WHL A;  4M78 F;  1PG5 B;  3VUZ A;  1BB9 A;  2LMJ A;  2IG0 A;  1UE9 A;  2O4X A;  1J3T A;  1PD1 A;  2KE9 A;  1U06 A;  3L2Z A;  1E6G A;  3LGF A;  4ZNX A;  1QVG A;  2PNI A;  4X9D A;  2QQ9 A;  1WGS A;  4N0A C;  1X6G A;  3OMG A;  4A63 B;  2MAM A;  1NYF A;  2K57 A;  3V7R A;  4M75 E;  3PIO A;  3GNF B;  3QZ9 B;  1CKB A;  3JCM V;  5GMK h;  1BYM A;  3EFO B;  2MF2 A;  4XTV A;  4R56 A;  4HCC A;  1VQO Q;  2ZPG B;  1QLY A;  1JEG A;  4WTO B;  4Z02 A;  2D8H A;  1VQ4 T;  3VUB A;  5CR2 A;  2K6D A;  2LQW A;  1VQ9 A;  4M77 B;  1KC8 U;  3QJ6 A;  1WHJ A;  4RTU A;  2AIR B;  3E1S A;  2R58 A;  1PRL C;  4QVD A;  2KRN A;  4N4H A;  1HD3 A;  3C0C A;  2LCS A;  3EG2 A;  2DVJ A;  4RTX A;  3JSC A;  4Y92 A;  3E2U A;  4LD6 A;  2RD1 A;  1AWX A;  3QUI A;  3CD6 T;  1VQ7 Q;  4ZTJ A;  2EJG A;  2DL4 A;  3BFM A;  4KUD K;  1GBQ A;  1Q82 R;  2MIO A;  2K79 A;  1SRL A;  3L2U A;  1VQ9 T;  1QP3 A;  3M54 A;  1NPP A;  5KCH A;  4K11 A;  2ZPI B;  3QG1 A;  5CAI A;  1M8V A;  2KT1 A;  2QK0 A;  1AZE A;  4GY5 A;  4J9C A;  2KRO A;  3CXC A;  1FMK A;  1PWT A;  3GIB A;  1BI3 A;  1WNL A;  4D8D A;  1S72 Q;  1Y57 A;  1WJS A;  3JCM f;  3EFS A;  3MPU B;  3OQ5 A;  2DIQ A;  4FU6 A;  1Y96 B;  4F04 B;  2CP3 A;  4JZ4 A;  1IHV A;  1QP2 A;  3G1J A;  3MCA B;  1E6H A;  2K5L A;  4OMO A;  2P4T A;  3L42 A;  4JS4 A;  2DIL A;  4RTV A;  1XTD A;  1T3S A;  4CC4 B;  1VQO A;  1TWB A;  2J6F A;  2V1Q A;  3EFO A;  1M5Q 1;  2XD0 A;  5J3B A;  4DOW A;  4HVU A;  1TG0 A;  2FYK A;  5LL6 S;  1EFN A;  3VRZ A;  1AVZ C;  3EG3 A;  2EQJ A;  1PNJ A;  4E2F B;  2RHX A;  3UPU A;  4M77 A;  1JXO A;  4PJO C;  5J26 A;  2L2P A;  1NEG A;  1QWE A;  3RNJ A;  5LJ5 j;  1WA7 A;  2RO0 A;  4L59 A;  3CC4 A;  4ZGE B;  4CI0 C;  4FYY B;  5CCA A;  2KSS A;  1AEY A;  2AKK A;  2K3Y A;  2QQR A;  2RPN A;  3MO8 A;  4RKU E;  2V8K A;  5GAM d;  2OJ2 A;  1MMA A;  2XMF A;  1PCX A;  1W2B A;  1IB8 A;  1VQO T;  1CKA A;  1VQ7 A;  2E1H A;  1NLP C;  1K73 U;  3OSS C;  1GBR A;  5GMK l;  2XID A;  4C92 G;  5CKE A;  2XHC A;  4CRI A;  2LCC A;  3PMI A;  4L6V 5;  1ZSG A;  5FW9 A;  2LVM A;  2X35 A;  2J06 A;  2QDL A;  5GAN 6;  5CKD A;  4Y28 E;  4DEX A;  4PJM A;  3OA6 A;  2LJ3 A;  2AZS A;  4M77 E;  3OW2 S;  2BTT A;  2BE9 B;  4ANJ A;  2OAW A;  3Q1J A;  3HL8 A;  2ZPH B;  2J6O A;  1T0J A;  1M90 C;  4KUL A;  1WDX A;  3CME A;  2V26 A;  2QGF B;  1KHC A;  1Y96 A;  1VQ7 T;  3JCM J;  3GLX A;  2DJZ A;  4M77 F;  5FRM A;  1WJR A;  3JB9 I;  2EQI A;  1Q7Y C;  2NUZ A;  1OOT A;  4AFQ C;  1K8A C;  1SG5 A;  1RUW A;  3REA B;  1NG2 A;  5LJ3 d;  4LDV A;  4J6W A;  3A98 A;  1S72 T;  2CYZ B;  4RTZ A;  5I11 A;  3H6Z A;  2HKQ B;  4PNO A;  3RES A;  2JMA A;  1G2B A;  2R57 A;  3HP9 A;  3NMZ C;  4EMK C;  3HHT B;  1RAH B;  3VYG A;  3SFM A;  3S3M A;  3FRN A;  3CCE Q;  2OX7 A;  4ME7 A;  2LCL A;  1VA7 A;  1R0B G;  5GAO l;  1O75 A;  3KFV A;  2LX9 A;  2DRK A;  5GAN 8;  1BIA A;  5IT9 E;  3I5S A;  2RHI A;  2QTX A;  4J83 A;  2IVW A;  2LQN A;  3SEM A;  3OW2 P;  2LTO A;  2GFU A;  4M4Z A;  4X34 A;  2ENM A;  3VS5 A;  4HA8 A;  1NBE B;  2LJ1 A;  3RUX A;  2GQV A;  1Y0M A;  3OYJ A;  4RCB A;  4EMK B;  1RAB B;  2EAY A;  2DZC A;  4OB1 B;  2F2X A;  3DB4 A;  4PJN A;  1SPK A;  5AYF A;  2PZ1 A;  5AT1 B;  4M7A B;  1QVP A;  4JPB W;  4II1 A;  2CP6 A;  2LP5 A;  2YRC A;  1Y07 A;  2MPX C;  2EBP A;  4JJD A;  4BE2 A;  5IHI A;  2Y90 A;  3JRZ A;  1WYX A;  3WVD B;  3M0R A;  4LE9 A;  1N6A A;  3EGD A;  2CUB A;  1G8X A;  2LDM A;  4E47 A;  4QVC A;  4ATO A;  4C8Q C;  1IHW A;  2ROL A;  3I55 Q;  1LVK A;  2OTL Q;  3MEV A;  1RAI B;  4F7U B;  5A2Q E;  1I4K 1;  3GNG A;  5FWC A;  2P4R A;  1Q95 G;  1KFZ A;  1YIT Q;  4M78 C;  1KD1 U;  3CCE A;  3OS1 A;  3HSB A;  2PTK A;  4J6Y A;  2WAC A;  1WFW A;  5A0D A;  2CP7 A;  2EGC A;  2HDA A;  2LQ8 A;  3MEW A;  2QGG A;  1YFN A;  5CQX A;  1OU9 A;  2BZ8 A;  2QQS A;  3DLL A;  2HL5 C;  3QBY A;  3VS7 A;  1I1J A;  3VS4 A;  1UFF A;  4C0G A;  2NWM A;  2QAS A;  4YTL A;  3V7S A;  1QWF A;  1ABO A;  2DM1 A;  4DBH A;  3SB2 A;  3SDZ A;  1U1T A;  2JS0 A;  1U8R A;  4M7D B;  4M75 C;  4OGC A;  3CCE T;  4M78 B;  2ED0 A;  4EMH A;  2NYS A;  2EYW A;  1YHQ A;  2F1L A;  4BAC A;  1VQM Q;  2JXB A;  3A8H B;  3OYI A;  1NE8 A;  2PU9 B;  5LJ3 e;  1VQP Q;  3RDV A;  4M7A A;  2L5Q A;  1HYO A;  4AMC A;  4HVV A;  1BI0 A;  2P0K A;  1KQ1 A;  4TVR A;  5GAM h;  1TOV A;  3JAM E;  4HKE A;  3A8G B;  2VGN A;  3PTA A;  1K1Z A;  3BW1 A;  2RHZ A;  3P8B B;  3HRS A;  3I55 A;  3CMA Q;  2YUN A;  2OTL A;  2RN8 A;  4XTX A;  4J9B A;  4KBM B;  4LUD A;  2HSE B;  1RAF B;  4E7I A;  1YIT A;  2DMO A;  2KBT A;  4F7U A;  2F2V A;  2MK5 A;  3QDF A;  3VYH B;  3LWI A;  4RTW A;  1TH7 A;  2DD5 A;  5LJ5 d;  1D1B A;  5FU7 C;  3HKS A;  5KYY B;  1X43 A;  1MMG A;  2E3H A;  2LRQ A;  2K2V A;  4M7A E;  3SWN C;  1M4Z A;  2LNH B;  4KUI A;  1YWP A;  3LW5 E;  3G71 Q;  3QWX X;  5GAN j;  2D8J A;  3JCM X;  3OSV A;  3I55 T;  2OTL T;  2L3P A;  2RI2 A;  1YP5 A;  4L5G A;  2VV5 A;  1VIE A;  1VQK Q;  2J05 A;  3EHR A;  1YIT T;  1UGR B;  2DD4 A;  4LNP A;  2V8J A;  5C6S A;  4M7A F;  2NLU A;  5LJ3 h;  4PJO G;  4HVW A;  3TCJ A;  4J8O A;  4F7U E;  1NJI R;  4M7D A;  4E7H A;  1OZ3 A;  3NTI A;  2FPF A;  2YUQ A;  3GPL A;  1VQM A;  1YNZ A;  3J80 E;  3RMS A;  1PHT A;  2FPE A;  5FU7 B;  5IXF A;  1N8R U;  3M0P A;  1VQP A;  3MHX A;  2PUK B;  1QVF P;  1QMC A;  2KVQ G;  4IUR A;  3REB B;  3F70 A;  4XTW A;  5GAN 3;  3KBG A;  1V76 A;  1Q86 C;  1WJQ A;  3SWN B;  4XTU A;  1JQQ A;  1JO8 A;  1ABQ A;  3CD6 Q;  3SD4 A;  3BE3 A;  1D0Z A;  4F7U F;  2ZCF B;  3I5R A;  1AOJ A;  4J7I A;  2OI3 A;  3M4G A;  3CMA A;  1OX8 A;  3GBQ A;  4Z88 A;  2L89 A;  4FT4 A;  2C0O A;  3QSU A;  3DLM A;  3PIP A;  4D6W A;  1IRX A;  2DJQ A;  1K73 R;  1V29 B;  2FZC B;  1M1K U;  2DAQ A;  4J7F A;  4M7D E;  4JRP A;  1ZUU A;  3QII A;  2V8I A;  4J6X A;  4BE1 A;  4AG1 C;  4GLM A;  4CC3 A;  5L23 A;  5KYY A;  1TUD A;  3G71 A;  3OMC A;  3AT1 B;  3VRY A;  4C92 D;  1IXD A;  4Z89 A;  4ZGJ B;  3E9G A;  3CMA T;  2K5I A;  1SHG A;  3CCS Q;  4M77 C;  1VQ4 A;  2L3R A;  3A8L B;  1VQK A;  2JT4 A;  1K0S A;  1M27 C;  2A08 A;  1UEB A;  1JJ2 S;  4BDZ A;  4LDU A;  3FB9 A;  4J9I A;  3A5Z B;  1Y7X A;  1LCK A;  2MOX A;  1VYV A;  5M9O A;  5EC7 A;  4JJN K;  2E5K A;  4FW2 A;  2E70 A;  1PM3 A;  2JS2 A;  2F5K A;  4IUP A;  1NM7 A;  1Q82 C;  3G71 T;  1OPK A;  2Y4Y A;  3PT9 A;  2VAS A;  3CD6 A;  2BE7 D;  3EGU A;  1UJY A;  2XDD A;  2CT3 A;  2L3S A;  1QCN A;  3ZFJ A;  3SWN A;  1KJW A;  2CZ6 B;  1HXD A;  1VQK T;  2O31 A;  5LJ5 e;  3HFO A;  2QXF A;  1VQ8 Q;  2A37 A;  3OYC A;  4E7J A;  2ATC B;  2O9S A;  3TRE A;  1UG1 A;  1D09 B;  4R55 A;  2RI3 A;  3VV0 A;  5DLQ E;  3OYA A;  3LLR A;  2O9V A;  2G6F X;  3JB9 G;  2GTO A;  2K3B A;  3OS2 A;  3MEA A;  3JCM b;  3JCM Q;  3HPW A;  2A28 A;  3EG1 A;  1IGQ A;  3LH5 A;  4PKC C;  2HZY A;  2QTV A;  3VJP A;  5GMK j;  1PSE A;  1JJ2 P;  3QPH A;  4C92 F;  2E64 A;  2E10 A;  1ZLM A;  3VS2 A;  3CCS A;  1NZ9 A;  1N27 A;  5CKB A;  4ESR A;  3V8L A;  1ACM B;  1IGU A;  1ZBX A;  1YCS B;  1WXT A;  3C12 A;  1RAA B;  4XU0 A;  2EQK A;  1KQS S;  4C8Q G;  1D1A A;  5LJ5 g;  1AZG B;  2LJ0 A;  1W4S A;  1SHF A;  2C0I A;  2OAU A;  3PGG A;  1RI0 A;  4FSX A;  2COZ A;  3A8O B;  2G3R A;  3UF4 A;  5I22 A;  1YI2 Q;  1C6V X;  4M78 G;  2DTH A;  1B07 A;  2FL7 A;  1YWO A;  1K9A A;  2RK1 A;  1GRI A;  3G6E Q;  3RER A;  3EHQ A;  2ED1 A;  3CCR Q;  4FT2 A;  2GF7 A;  3GOX A;  1NJI U;  4JRK A;  3DKM A;  4XQ3 A;  1SSF A;  3MJX A;  3CCS T;  2KQW A;  4A4K A;  2CGH A;  2DA9 A;  1QVG S;  1KD1 R;  4LD9 K;  1V1C A;  1X75 C;  3TVT A;  3VS3 A;  2EPD A;  4A54 A;  5GAM f;  4KGX B;  3VU3 C;  1VQ8 A;  1Z9Q A;  2RQW A;  1U3O A;  4FYW B;  3FIF A;  2PUO B;  4HCK A;  2EKH A;  1VYU A;  2DTI A;  3CC7 Q;  4DA4 A;  1SF9 A;  4KRT A;  2X9H A;  4M75 G;  4FW1 A;  2M9U A;  3CCL Q;  2K5F A;  2KYM A;  2ROT A;  2ZPE B;  4J9D A;  4OVA A;  3RKY A;  3HRU A;  5HKC A;  1KQS P;  4BI3 A;  1I0C A;  1YJ9 Q;  2DEU A;  2DXB A;  2VC8 A;  3M56 A;  1OV3 A;  4WCI A;  1VQ8 T;  3M0S A;  4JZ3 A;  4MDX A;  2CH4 A;  1KG1 A;  2EYQ A;  2IPO B;  3I35 A;  1S72 A;  3EGX B;  4J9F A;  9ATC B;  1D1C A;  2HD0 A;  1SKU B;  4QVZ A;  3UA7 A;  2M0O A;  1K0X A;  4BY6 C;  2L3Q A;  1FXX A;  1EIF A;  2CS7 A;  2CSI A;  3CEY A;  1QVG P;  3FJP A;  3V8J A;  4Y91 A;  1XNI A;  2LC4 A;  5LJ3 f;  2XU8 A;  3G6E A;  2MWP A;  5GAN 7;  2O88 A;  1FMV A;  3R6O A;  1ZSZ C;  3N5B B;  1SSH A;  3C4S A;  4JUV A;  1W1F A;  3M0T A;  1ZA2 B;  3EGD B;  4RTY A;  2YRD A;  5A0G A;  3CXC S;  2GFA A;  3ZL7 C;  1OQK A;  2EQU A;  4KH1 B;  3AHU A;  5HY6 A;  2QEX Q;  3CC2 Q;  2HAX A;  1BU1 A;  2CRE A;  5D6X A;  1B3Q A;  2DNU A;  4X9C A;  5I2S A;  2IIM A;  4J9E A;  2HQH A;  2LZ6 B;  3O8V A;  4F16 A;  3RMQ A;  1U1S A;  2BZX A;  3FDR A;  2M0Y A;  3CC7 A;  1YI2 T;  4GBQ A;  1JXM A;  4DEY A;  2KYB A;  2M16 A;  2DPP B;  4BY6 B;  2HBP A;  2HQE A;  2RQR A;  2RJE A;  1MNE A;  3G6E T;  2H8H A;  4M7A C;  3OYM A;  2FB7 A;  3CCV Q;  3FLG A;  3CCR T;  2K7A A;  2H3E B;  2CDT A;  5CQY A;  1ZSZ B;  5HK3 A;  3CPW A;  1NYG A;  3QYG B;  4Z8A A;  2HMA A;  2RMO A;  4B9X A;  2GCX A;  3OYY A;  3X28 B;  1WI7 A;  1KQ2 A;  1LPL A;  1YJ9 A;  2ECZ A;  2YWW A;  1MGQ A;  4CC2 A;  2WSC E;  3L2Q A;  3I56 Q;  3UT1 A;  1OEB A;  1JU5 C;  3VS6 A;  2VUB A;  4E7Z A;  1N8R R;  1MHN A;  1K9M C;  1TUG B;  3CC7 T;  2MYS A;  2FHD A;  3S6W A;  1UTI A;  2JTE A;  3CCL T;  5IXB A;  1BCM A;  4EDU A;  1W2B S;  3EGX A;  1BK2 A;  4PJO D;  3CXC P;  2SRC A;  2KXD A;  2PVG B;  1YCY A;  1RL2 A;  4N4G A;  4F14 A;  3HTR A;  4J9H A;  2DE0 X;  1K8A R;  4RTT A;  1UUE A;  2EYZ A;  2RJC A;  2KNB B;  1AWW A;  2D6F A;  4OGE A;  4PJJ A;  2EIF A;  2J7I A;  4OMN A;  1YJ9 T;  3P8H A;  2X3X D;  1OUL A;  2EWN A;  2YT6 A;  1ZX6 A;  1M1K R;  2D9T A;  3T9N A;  3IQL A;  1R8O B;  3CC2 A;  4IUQ A;  2LT4 A;  4HCB A;  1OZ2 A;  1UJ0 A;  3VS0 A;  4LN2 A;  4M77 G;  1PRM C;  1NPR A;  2CZ7 B;  3VS1 A;  5GAN 2;  3M55 A;  1VIF A;  4FM4 B;  5A0L A;  4M7D C;  2K4Y A;  2RH2 A;  4OMF B;  5D6Y A;  3NHN A;  2F5T X;  1KC8 C;  3R6N A;  4CC7 A;  1M30 A;  4DBR A;  1M3B A;  3CCV A;  1QCF A;  1KHI A;  4XTZ A;  1X01 A;  3P8D A;  3QHS A;  5GAN e;  2JNG A;  3LGL A;  3MEU A;  5KYX B;  2FG0 A;  4D8K A;  5I21 A;  1ZSZ A;  4MZT A;  2J6K A;  2JJ9 A;  3M0Q A;  1JBM A;  5FLX E;  2QEX T;  1W2B P;  3CC2 T;  3QWY A;  2JMC A;  1TTH B;  1X2K A;  4PFZ A;  3I56 A;  1I8F A;  1OI1 A;  3KUF A;  4PL6 A;  2YSQ A;  4IUU A;  3FC3 A;  1XQH A;  2X51 A;  1QKX A;  2JTM A;  3CCV T;  4Q5W A;  3G4S Q;  1WLP B;  2JUF A;  2KT8 A;  4AT1 B;  1FWZ A;  3H9N A;  2VXF A;  2KGT A;  1SEM A;  4NOY A;  5GMK m;  2JM9 A;  2YLB A;  1BCO A;  2DKG A;  2DL5 A;  5GAN g;  3FEO A;  1RLQ C;  1OU8 A;  4RCC A;  2BKD N;  2LX7 A;  4A4G A;  2NUT B;  5DM7 R;  2L8D A;  3I56 T;  5LJ5 f;  1RI9 A;  3OY9 A;  1X2Q A;  1QVF S;  4KGZ B;  5CO7 A;  1PKS A;  1MV3 A;  1S1N A;  1D3B B;  2GNC A;  4C92 C;  2GBQ A;  4VUB A;  4KH0 B;  3CBP A;  3X25 B;  2EVR A;  2CP2 A;  1WQW A;  2YHT A;  3JB9 H;  1QKW A;  5GAO q;  2QYZ A;  5KH6 A;  3JB9 D;  4C0D B;  1VOM A;  2KEA A;  4OMM A;  3H0I A;  3WXM B;  1VQ6 Q;  2JM8 A;  2A0F B;  2DVE A;  3JCM c;  2FZK B;  4XU1 A;  2QA4 Q;  1G83 A;  1VQ5 Q;  1ZBJ A;  5GJV B;  2RHY A;  5KYX A;  3M5A A;  5GAM j;  2DYB A;  1WZO A;  4BUG A;  3UAT A;  5DY9 A;  2PQW A;  4XK8 E;  4C92 B;  1K73 C;  1OYX A;  2DET A;  2RQV A;  1WX6 A;  4JDS A;  1Q81 R;  3G7Z A;  4P5N A;  4C8Q D;  2CUD A;  2BZY A;  4BE0 A;  2JN0 A;  2EKO A;  1A0N B;  5KYU B;  2DZ9 A;  5GAO m;  5KE2 A;  3G4S A;  4M78 D;  3V8K A;  3L2V A;  3VKI A;  1M90 U;  5KCO A;  5FRN A;  1MND A;  3H0F A;  1GCP A;  3EG9 B;  5D6W A;  1F1B B;  4JJB A;  1ZQ1 A;  3TQ7 P;  4FCY A;  2I2L A;  1Q7Y U;  2DIG A;  2QG9 B;  3CCJ T;  4N4I A;  1K8A U;  3CBO A;  2NUT A;  3JB9 J;  2DXU A;  2L0A A;  1B34 B;  3QDR B;  1UDL A;  2MMP A;  2HNI A;  1D3B A;  4HT8 A;  2COW A;  3G4S T;  1P92 A;  2XKO C;  5LJ3 j;  5GMK e;  2CP5 A;  1LJO A;  3QXE B;  4M75 D;  3RBB B;  3OB9 A;  3QZ5 B;  2E4H A;  5FU6 B;  2E65 A;  2FRY A;  3ASK A;  1RAE B;  1VQ6 A;  1SRM A;  3CBM A;  3EG0 A;  2QA4 A;  1VQ5 A;  1QQJ A;  4C5H A;  3O5Z A;  2B86 A;  1G3W A;  2ZGW A;  5FWB A;  3BY7 A;  3PE0 A;  3NTH A;  1W70 A;  1C0M A;  4QQD A;  1IZ6 A;  2LT1 A;  3TU4 K;  1M9S A;  2EFI A;  2DK3 A;  4DOV A;  4FIB A;  1R0C B;  4F17 A;  1X6O A;  4C92 A;  2RA2 A;  4ORZ A;  1OX9 A;  2DL7 A;  2GQI A;  1Q86 R;  1G3S A;  2CH4 W;  4C5G A;  4ZTF A;  1M2V B;  1VQ6 T;  5IAY A;  4IUT A;  5KYU A;  4BI4 A;  3QYH B;  2QA4 T;  2C0T A;  1I5O B;  1VQ5 T;  2M02 A;  4PJL A;  3L2W A;  1X69 A;  3OYE A;  4M7A G;  8ATC B;  3ME9 A;  2EJF A;  4BB7 A;  4PFO A;  1FMW A;  2CT4 A;  1KIK A;  3EG9 A;  2OTJ T;  3TSW A;  1LNX A;  2P0Q A;  2DF6 A;  2E12 A;  1YJN Q;  4IUV A;  2DBK A;  2RNA A;  3OS0 A;  4EPC A;  2EQM A;  2JZ2 A;  2DXC A;  3MET A;  2QDY B;  2HSP A;  3PVL A;  1B34 A;  2YUO A;  4AG2 C;  1RLP C;  2LQK A;  4F7U G;  4C92 E;  1BI1 A;  5DLO A;  1IRE B;  5FRO A;  2QQA A;  4EIK A;  1M1F A;  3JV3 A;  4M75 F;  3OYK A;  2RJF A;  2ZZD A;  4FSS A;  4MMK A;  1KD1 C;  2SEM A;  4A4F A;  1HSQ A;  4J9G A;  1GCQ A;  4WF2 A;  1YN8 A;  3CC4 Q;  2YRV A;  3C95 A;  5ECA A;  2MI6 A;  2Y4X A;  8AT1 B;  1HJD A;  2EYX A;  2K3X A;  3S3O A;  2ABL A;  3OW2 A;  3E9F A;  2HQX A;  2RI5 A;  1UEC A;  4MML A;  2I0N A;  4ZN1 A;  1UB4 A;  3EH2 A;  2F2W A;  1I5L A;  3OYD A;  1X6B A;  1WPY A;  2YUP A;  4PK4 A;  2LNV A;  4JRQ A;  4M7D G;  3GP8 A;  3X24 B;  3HFN A;  2F69 A;  3X26 B;  1M2V A;  3EAE A;  1Q81 U;  2W10 A;  4QQG A;  5LJ5 h;  1TUC A;  5IH2 A;  3OYH A;  2FO0 A;  2X4W A;  1TXQ A;  4O6J A;  2JOY A;  2P0P A;  2QAZ A;  3OYB A;  1YJN A;  4ZN3 A;  3CME Q;  2DXT A;  4O5V A;  2XK0 A;  2CZ0 B;  5HK0 A;  2PVO B;  3ZEH A;  1VYT A;  2RM4 A;  3OYL A;  4M77 D;  2JW4 A;  4E7K A;  2VYT A;  3JCM d;  2BIV A;  5CKH A;  2X4J A;  2RQT A;  5HCK A;  1GFC A;  4OB3 B;  1YJW Q;  1N9R A;  2K9G A;  5GAN f;  3LYI A;  2XIC A;  2KY9 A;  1EX4 A;  4AFU C;  1PD0 A;  1AWO A;  2YXY A;  2VWF A;  4LXC A;  1Z9Z A;  2X3W D;  2A7Y A;  3OYG A;  3OS5 A;  1CSK A;  3A1P A;  1YJN T;  1AHJ B;  4N0A A;  3X20 B;  1M1G A;  4BI8 B;  4ELZ C;  5GAN d;  2HBW A;  2R5M A;  3NGP A;  4DQ2 A;  4QQ6 A;  1QW1 A;  1W6X A;  3NTK A;  2VXE A;  4E7S A;  4JS5 A;  3EFR A;  1GXI E;  2HL3 A;  1T3L A;  4ELY C;  1YI2 A;  1QCO A;  3J81 E;  2QI2 A;  1MMN A;  3CCQ Q;  4PJO B;  5I2M A;  1N5Z A;  2V1R A;  3CCU Q;  3BDU A;  3CCR A;  4XU2 A;  2B8A A;  3CC4 T;  2ZPB B;  1TS9 A;  3LX7 A;  1Q86 U;  2EYY A;  3OBW A;  1YIJ Q;  3BDL A;  2VVK A;  1N8R C;  2EGA A;  3M53 A;  4OB2 B;  2E6N A;  1G3T A;  2AZV A;  4IKF A;  2CZ1 B;  5IN1 A;  1BBZ A;  1E7O A;  4XU3 A;  1N9S A;  3M57 A;  1AT1 B;  2DRM A;  2MCN A;  2AHJ B;  4JJC A;  3C94 A;  3H41 A;  5KYN A;  1VQN Q;  2EJ9 A;  3LH0 A;  1YJW A;  3CCL A;  2KR3 A;  4PLL A;  2D1X A;  1R77 A;  2E3I A;  5CIU A;  2BUD A;  5IHN A;  3DB3 A;  2AK5 A;  2D0Q B;  3NPF A;  3RIR A;  2FRW A;  4IIM A;  4XAX B;  5GMK i;  2EW3 A;  3MKD A;  1DJ7 B;  2ZPF B;  4PFP A;  6AT1 B;  4DBQ A;  1M1K C;  1BIB A;  3QO3 A;  2DER A;  2RHU A;  2FZG B;  2DEQ A;  2EGE A;  4OP0 A;  3CME T;  3KXT A;  1NEB A;  3HRT A;  1ZA1 B;  2H3J A;  3V7C A;  1G5V A;  3INZ A;  1AD5 A;  1M90 R;  1UHC A;  3UWN A;  2FPD A;  2QQB A;  1JRI A;  2GGR A;  5GAN 5;  1UGP B;  4A4E A;  4LDY A;  1YJW T;  4RMO A;  1FX7 A;  1Q7Y R;  2P84 A;  3L1A A;  4BDY A;  1EZZ B;  2MWO A;  4UC4 A;  4KGV B;  5KE3 A;  3CCQ A;  4NS5 A;  3LWH A;  3CCU A;  1Q82 U;  4PJO A;  3H8Z A;  2E41 A;  1Y71 A;  3EH1 A;  3JCM e;  1QVF A;  3ZBD A;  5IHK A;  1YIJ A;  2VGM A;  3ER0 A;  1YHQ Q;  2A36 A;  1WHH A;  1VQL Q;  4C5I A;  2QEX A;  1MV0 B;  1H92 A;  4QKU A;  5D7U A;  4LDW A;  4MZM A;  4FYV B;  1D0Y A;  4LUE A;  1I07 A;  1TU0 B;  3UDC A;  2DO3 A;  3FJ5 A;  2PVD B;  1KSW A;  2AT1 B;  1VQN A;  4E6R A;  4PLI A;  3RKW A;  2W0Z A;  3CCQ T;  1IO6 A;  2HEQ A;  3CCU T;  3MP6 A;  2RK2 A;  5GAM e;  4C5E A;  5EG2 A;  1KK7 A;  1H8K A;  2KRS A;  4FYX B;  4QT7 A;  3OYN A;  1RAC B;  2KRM A;  3JCM P;  3M58 A;  1YIJ T;  2KK4 A;  3OBY A;  3CCM Q;  1K9M R;  4C0F A;  1M3C A;  3MP8 A;  4PJO E;  1H3Z A;  2M51 A;  2XDB A;  2CSQ A;  2FVU A;  3JCM g;  1M8M A;  1GL5 A;  3CCJ Q;  2DLP A;  1K76 A;  4AFZ C;  1H64 1;  1X27 A;  3PVQ A;  2VB6 A;  2KDS A;  4MZP A;  1K4U S; 
#chains in the Genus database with same CATH homology
 2NUZ A;  1U5S A;  1OOT A;  4AFQ C;  4ESR A;  1UDL A;  1YCS B;  1FYN A;  1WXT A;  1RUW A;  3REA B;  1NG2 A;  3A98 A;  4RTZ A;  5I11 A;  1AZG B;  2LJ0 A;  2C0I A;  1SHF A;  3RBB B;  4OMQ A;  2JMA A;  5I22 A;  1G2B A;  3UF4 A;  3NMZ C;  2FRY A;  1B07 A;  1SRM A;  3EG0 A;  1ZUY A;  1YWO A;  1K9A A;  1GRI A;  1VA7 A;  1ZUK A;  3O5Z A;  3EHQ A;  3H0H A;  3KFV A;  2DRK A;  2ED1 A;  2B86 A;  1PKT A;  3I5S A;  5FWB A;  1WXU A;  2LQN A;  3PE0 A;  3SEM A;  2DA9 A;  1V1C A;  1W70 A;  3TVT A;  3VS3 A;  2EPD A;  3CQT A;  2HCK A;  3U23 A;  4M4Z A;  1M3A A;  1GFD A;  2ENM A;  4OML A;  3VS5 A;  1Z9Q A;  4F17 A;  2RQW A;  2LJ1 A;  1U3O A;  4ORZ A;  1Y0M A;  2DL7 A;  4HCK A;  2EKH A;  2GQI A;  1NLO C;  1VYU A;  2CH4 W;  1WIE A;  4KRT A;  1UHF A;  1OPL A;  2C0T A;  2RF0 A;  2F2X A;  1X69 A;  2KYM A;  3THK A;  1SPK A;  2PZ1 A;  2ROT A;  4AFS C;  4J9D A;  4R0K A;  4JPB W;  1XOV A;  5GJW B;  2CT4 A;  2LP5 A;  1KIK A;  2D0N A;  2EBP A;  4JJD A;  1I0C A;  3TSW A;  5IHI A;  3UA6 A;  2DF6 A;  1WYX A;  2DBK A;  2RNA A;  4RUG A;  3M0R A;  4LE9 A;  1OV3 A;  4WCI A;  3M0S A;  4JZ3 A;  2CUB A;  2GTJ A;  2CH4 A;  2HSP A;  3PVL A;  1UGV A;  3I35 A;  1T0H A;  2YUO A;  2ROL A;  4AG2 C;  1RLP C;  4J9F A;  1WXB A;  4EIK A;  2KXC A;  1ARK A;  3JV3 A;  5FWC A;  2P4R A;  1MUZ A;  3UA7 A;  1K0X A;  1KFZ A;  2L3Q A;  2CSI A;  2YDL A;  1GCQ C;  2DBM A;  2VKN A;  4IIO A;  2PTK A;  1WFW A;  4FSS A;  2AKL A;  2EGC A;  2SEM A;  2HDA A;  2O88 A;  1HSQ A;  1SSH A;  1GCQ A;  2O2O A;  4J9G A;  1W1F A;  3M0T A;  1YN8 A;  3SHW A;  5ECA A;  4RTY A;  1HJD A;  2BZ8 A;  2EYX A;  4X1V A;  3ZL7 C;  3VS7 A;  2ABL A;  1AWJ A;  1I1J A;  3VS4 A;  1UFF A;  1UEC A;  2I0N A;  2NWM A;  1BU1 A;  2DL8 A;  2CRE A;  1B3Q A;  2DNU A;  2F2W A;  2RQU A;  1QWF A;  2IIM A;  4J9E A;  2LZ6 B;  1ABO A;  4F16 A;  1X6B A;  2DM1 A;  2YUP A;  2BZX A;  2M0Y A;  3I9Q A;  4GBQ A;  2JS0 A;  1JXM A;  4DEY A;  2KYB A;  2RQR A;  2ED0 A;  2ESW A;  2EYW A;  2K2M A;  2H8H A;  2W10 A;  2K7A A;  2JXB A;  2CDT A;  1TUC A;  5IH2 A;  1NYG A;  2FO0 A;  4Z8A A;  3M0U A;  2RMO A;  1WI7 A;  4HVV A;  2ECZ A;  3ULR B;  4CC2 A;  1H3H A;  1OEB A;  1JU5 C;  4HXJ A;  1VYT A;  4OMP A;  2FEI A;  3VS6 A;  2DL3 A;  2JW4 A;  1K1Z A;  2DX1 A;  2YUN A;  3TSZ A;  2RN8 A;  1UTI A;  2RQT A;  4J9B A;  5HCK A;  4LUD A;  2JTE A;  1GFC A;  5IXB A;  1BB9 A;  2LMJ A;  1J3T A;  1UE9 A;  2DMO A;  1BK2 A;  2K9G A;  2KE9 A;  1U06 A;  2KBT A;  1E6G A;  2F2V A;  2SRC A;  4ZNX A;  2KXD A;  2PNI A;  4AFU C;  4F14 A;  4J9H A;  2DE0 X;  4RTT A;  4RTW A;  1AWO A;  1X6G A;  1UUE A;  2EYZ A;  2VWF A;  4A63 B;  2KNB B;  1Z9Z A;  2X3W D;  1AWW A;  1NYF A;  1CSK A;  2J7I A;  4OMN A;  1X43 A;  1CKB A;  2X3X D;  2YT6 A;  1ZX6 A;  2LNH B;  3IQL A;  2HBW A;  1YWP A;  3NGP A;  3QWX X;  2D8J A;  1QLY A;  1W6X A;  1JEG A;  1UJ0 A;  3VS0 A;  4LN2 A;  2L3P A;  1PRM C;  2D8H A;  1YP5 A;  2K6D A;  3VS1 A;  2LQW A;  1T3L A;  2J05 A;  3EHR A;  4LNP A;  3NHN A;  4RTU A;  4HVW A;  3R6N A;  4CC7 A;  1M30 A;  1M3B A;  1N5Z A;  1QCF A;  2V1R A;  2FPF A;  2YUQ A;  1PRL C;  1YNZ A;  1PHT A;  2FPE A;  5IXF A;  3M0P A;  2KRN A;  2EYY A;  2FG0 A;  1HD3 A;  3C0C A;  4D8K A;  2J6K A;  3EG2 A;  2LCS A;  3REB B;  2DVJ A;  4RTX A;  2VVK A;  3M0Q A;  2EGA A;  4Y92 A;  1JQQ A;  1JO8 A;  3QWY A;  2JMC A;  1X2K A;  1AWX A;  1ABQ A;  2DL4 A;  3I5R A;  1GBQ A;  2AZV A;  2MIO A;  1AOJ A;  2K79 A;  1SRL A;  2OI3 A;  1BBZ A;  1E7O A;  3GBQ A;  4Z88 A;  4K11 A;  2DRM A;  2MCN A;  2C0O A;  2YSQ A;  4JJC A;  3H41 A;  2KT1 A;  1AZE A;  2KR3 A;  4J9C A;  2DJQ A;  2KRO A;  1QKX A;  2D1X A;  1FMK A;  1PWT A;  4D8D A;  1WLP B;  1Y57 A;  5IHN A;  2KT8 A;  2AK5 A;  3NPF A;  2FRW A;  4IIM A;  2EW3 A;  2KGT A;  1SEM A;  1ZUU A;  2JM9 A;  4JZ4 A;  2EGE A;  2DL5 A;  1RLQ C;  4AG1 C;  1E6H A;  1NEB A;  4OMO A;  4GLM A;  2LX7 A;  4CC3 A;  5L23 A;  1TUD A;  2DIL A;  4RTV A;  1T3S A;  3VRY A;  4CC4 B;  1AD5 A;  1UHC A;  4Z89 A;  1RI9 A;  2J6F A;  2V1Q A;  1X2Q A;  2FPD A;  1PKS A;  1MV3 A;  1S1N A;  2GGR A;  1SHG A;  2GNC A;  4HVU A;  1TG0 A;  2GBQ A;  1EFN A;  2JT4 A;  3VRZ A;  1AVZ C;  3EG3 A;  1K0S A;  1M27 C;  2A08 A;  1PNJ A;  2EVR A;  4J9I A;  1JXO A;  1QKW A;  2L2P A;  1NEG A;  1QWE A;  3RNJ A;  1LCK A;  2KEA A;  4OMM A;  2MOX A;  1VYV A;  1WA7 A;  3H0I A;  5EC7 A;  2E5K A;  2JM8 A;  1AEY A;  2JS2 A;  1NM7 A;  1G83 A;  2AKK A;  5IHK A;  1ZBJ A;  2RPN A;  2A36 A;  5GJV B;  2OJ2 A;  1OPK A;  2XMF A;  1MV0 B;  1H92 A;  1CKA A;  2DYB A;  1NLP C;  3EGU A;  1UJY A;  2CT3 A;  4LUE A;  2L3S A;  1GBR A;  1I07 A;  1KJW A;  3UAT A;  1ZSG A;  3FJ5 A;  2O31 A;  1KSW A;  5FW9 A;  2RQV A;  1WX6 A;  2J06 A;  4E6R A;  2QDL A;  4DEX A;  2CUD A;  2A37 A;  2BZY A;  2W0Z A;  2LJ3 A;  1A0N B;  2AZS A;  1IO6 A;  2HEQ A;  2O9S A;  1UG1 A;  2O9V A;  2BTT A;  1H8K A;  2KRS A;  2G6F X;  2GTO A;  2K3B A;  4QT7 A;  2KRM A;  2OAW A;  3H0F A;  2J6O A;  1T0J A;  1GCP A;  1M3C A;  1WDX A;  2A28 A;  3EG1 A;  3LH5 A;  4JJB A;  2M51 A;  2CSQ A;  1M8M A;  1GL5 A;  2DLP A;  1K76 A;  4AFZ C;  1X27 A;  1ZLM A;  2EQI A;  3VS2 A;  3PVQ A;  2L0A A;  1K4U S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...