5LJ3h

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3h00
4XTUA 3QHSA 2YHTA 5CAIA 4NOYA 5GAOr 5GANe 4PJOE 1KQ1A 1N9SA 4DQ2A 5DY9A 3RESA 5LJ3h 4A54A 5GANh 2DTIA 3V8KA 4M7AC 5LJ5j 3JB9H 2DXUA 4EMKB 2RD1A 1HXDA 3INZA 2DTHA 2E64A 1M8VA 1H641 1U1TA 3RKWA 2CGHA 4F7UA 5LJ3g 2ZGWA 4M75A 5GAN4 2VC8A 3EFSA 4M78G 4M7AD 4C92A 4M77G 4JRKA 1MGQA 4XTYA 3JCMc 4XTXA 3FJPA 1LNXA 1N9RA 2E1HA 2E65A 3M4GA 4Y91A 1I8FA 1LOJA 1Y96A 4XU0A 4F7UB 3FB9A 2RA2A 4M78E 5GANf 5LJ3f 3SWNA 1B34A 4C92B 1U1SA 4EMGA 4M77E 3AHUA 5GAMj 4HT8A 4C8QA 1D3BB 2RB6A 1M5Q1 3BDUA 1HK9A 4OP0A 3JCMd 3HSBA 4M77F 1Y96B 5GAMh 2QTXA 4M7DA 3JB9D 3L1AA 4C92C 2EAYA 2DJZA 5LJ3e 3V7SA 4J6WA 4J5YA 5GMKi 4PJOA 3V7CA 5GAMg 5GMKe 4N0AC 4M75D 3RIRA 5GAN8 3JCMW 4M7DB 5LJ5e 4C92D 5LJ5h 4QVDA 2YLBA 4M7AF 3EFRA 4C8QC 4PJOB 1WPYA 4J6YA 5GAOl 4HA8A 5LJ5g 4XU2A 4M7DC 4WF2A 4X9DA 2DZCA 1YCYA 4M75B 3V8LA 4XTVA 4C8QD 4M7AG 3QUIA 1JBMA 4PJOC 2YLCA 1JRIA 2JN0A 4M78A 3L2ZA 4X9CA 5GAOn 5GAOq 5GMKl 4NL2A 4M77A 4XU1A 1LJOA 1I4K1 3RKXA 4M7DD 1WNLA 1X01A 2DEQA 2DKGA 3JCMb 2VXFA 3VU3C 5GAMe 5LJ5f 2DZ9A 4M75C 5LJ3d 5GANd 4PNOA 5GAN3 3JB9F 4PJOD 3HFOA 4QVCA 4V2SA 3JCMg 5GAOm 3HFNA 1B34B 4M78B 4XU3A 3SWNB 5GAN2 2DTOA 4C8QB 3V7RA 4F7UF 2FB7A 4XQ3A 3JB9J 4M7AE 2EJFA 3BY7A 4M7AA 4EMHA 4C92F 3SWNC 4M78C 5GMKm 5GAN6 2EJGA 3BFMA 4JUVA 3JB9G 4RCCA 3JCMV 5GAMf 4NL3A 3JCMJ 3RUXA 5GMKj 4M78D 4XTZA 2FYKA 4J6XA 4EMKA 1TH7A 4M77D 4F7UG 1BIBA 3RERA 3JCMX 5GMKh 3JB9I 5LJ3j 5GANj 2EWNA 5GAMd 5GAN7 3JCMe 3QO3A 4C92G 3JCMh 3RKYA 4HT9A 4M7DF 4MMKA 2HNIA 3JCMP 3SB2A 4MMLA 3JCMQ 2E10A 1I5LA 4PJOF 3GIBA 4F7UE 1I81A 4M75E 5GANg 2E41A 3FIFA 2RM4A 2EJ9A 4M77B 4C92E 5LJ5d 5I21A 4C8QG 4JLIA 2DXTA 4M75F 1KQ2A 4EMKC 1D3BA 4XTWA 1BIAA 1WQ7A 4M7DG 4JRIA 4N0AA 3V8JA 5GAN5 3JCMf 2K57A 1WQWA 2VXEA 4M77C 4PJOG 4C8QE 3BW1A 3PGGA 4RCBA 5GAOp 3QSUA 4M7AB 2Y90A 4M78F 4A53A 4M7DE 2I2LA 4C8QF 2DVEA 4M75G
chains in the Genus database with same CATH superfamily
5C6SA 1Y07A 4LDUA 3JRZA 3QIIA 1WFWA 2DTHA 3QSUA 1I07A 2JVVA 3OQ5A 1K8AU 2QQSA 1D0ZA 1WXUA 3OMCA 3CEYA 1YJWQ 3FB9A 4IIOA 3I35A 4M78E 5GANf 3SWNA 1KFZA 1ZUUA 1XOVA 4Z89A 3JCMd 1ZSZA 4VUBA 2A3LA 2CUBA 1TU0B 3SD4A 2RJEA 4PJOA 4NS5A 3DB3A 3CCSA 3RIRA 1YJNT 2PVOB 2RO0A 2ED0A 5J39A 4ESRA 1VQPA 2FG0A 2AZSA 4PJNA 4M75B 1VQ5A 4X1VA 2R58A 5GAOq 5L23A 4NL2A 4XU1A 1KC8R 4M7DD 5GAMe 1U06A 5FU7C 2DBKA 2CP0A 4ORZA 1YN8A 3X20B 2ABLA 3HHTB 3A8LB 3DLLA 3VYGA 2J6OA 3CCEA 3BY7A 2X9HA 3JCMV 4C0DB 4NL3A 1E7OA 3UDCA 2DERA 5GMKh 2DO3A 3QZ5B 1E6GA 2PQWA 4N4IA 2V1RA 3CCST 3M54A 1PKSA 1XTDA 1I5LA 1UGPB 4M75E 1XNIA 2DILA 5HK3A 1VQPT 2EJ9A 1VQ4Q 1YJNQ 2PUKB 1WQWA 1VQKA 2QGFB 3OYYA 1M1KU 1K9MR 3LGFA 2HCKA 3CCQA 4C8QF 1YITA 3OBYA 2RH2A 3QHSA 5GANe 4DQ2A 1VQ8T 1NLOC 1X2QA 4BE0A 3M0TA 4A4EA 1D1BA 1X75C 4LDXA 1N8RR 1N9RA 1MUZA 3M4GA 2EW3A 1P92A 4KULA 2CP6A 2RHUA 2M51A 4E47A 1IRXA 3AHUA 1M9SA 4C8QA 2CZ0B 4MZTA 3DLMA 2RB6A 4LN2A 3BDUA 2CZ6B 1KHCA 3CCSQ 2VB6A 2YDLA 4F17A 4OMPA 3OW2A 1E6HA 4KUDK 2LRQA 1VQPQ 4M7DB 3HKSA 2LT1A 2CYZB 1VQKT 4O5VA 1VQ5Q 5IH2A 1SSFA 2Y4YA 1RL2A 2DYIA 2LQWA 3NTIA 3NTKA 1EX4A 2HEQA 4Y28E 2FRWA 1HYOA 4DA4A 5GANd 1OU8A 1C0MA 1X27A 1VQ6A 1VQ8Q 3CCEQ 3CPWP 1WA7A 1B34B 1OQKA 5GAN2 1FXXA 3ZEHA 2C0TA 2BZ8A 3JB9J 2CP5A 1QQJA 4ZN3A 4EMHA 4C92F 1YI2A 1W6XA 5GMKm 4PJJA 3MCAB 2KR3A 4QVZA 2MCNA 4FW1A 2QQAA 4JJNK 2ZCFB 3QDRB 4EMKA 4A4HA 4ME7A 5D6WA 4PFPA 3M57A 5GAN7 4IKFA 1X6BA 5IHIA 4L59A 1DJ7B 4KT0E 4OF1A 3GIBA 1AWJA 2E41A 2GFUA 4C92E 1RAFB 3N5BB 4LNPA 1VQKQ 2KK4A 1D3BA 3A8OB 1WHKA 1AT1B 3CCQQ 2V26A 1YITQ 4BI8B 3OS1A 1WJQA 3LWIA 2LX9A 3A8MB 3SHWA 1S72A 3JAME 3GBQA 2XIDA 1YI2T 2FZGB 2L0AA 1HXDA 3H8ZA 4OGEA 2RPNA 5LJ3g 2RQWA 2ROLA 4MDXA 2FPDA 2M0OA 2E65A 3E2UA 2RA2A 1G3SA 5LJ3f 3PE0A 3M0SA 5GAMj 5IT9E 3MEWA 3MEVA 2EQIA 4FSXA 2KQWA 2EGEA 3A5ZB 3X28B 5HK0A 3OBWA 1QWEA 2XI9A 2EAYA 3TVTA 4B9WA 1MMDA 1JU5C 2JW4A 3TU4K 4HKEA 1BI2A 3META 4J9CA 3M4YA 3GPLA 4BE2A 1LVKA 4XU2A 2I0NA 2EYYA 4X9DA 1QWFA 2C0IA 5FU7B 1S72T 1QVFS 5LL6S 2YLCA 1VQ6Q 4HXJA 1NZ9A 1QVGP 2DKGA 2CH4W 3LH0A 1WYXA 4PNOA 1PKTA 3M0UA 4QVCA 8AT1B 1I5OB 2L3SA 1K1ZA 1YI2Q 3DKMA 4O6JA 3KBGA 1BK2A 3FLGA 2YUQA 4FYXB 2K2VA 2PNIA 3OYHA 5D6XA 5ECAA 2OAUA 1JJ2P 4OGCA 1IHWA 2HKNA 2FYKA 5AYFA 4J9HA 5GANj 2QAZA 2MOXA 3OYIA 1RAHB 4EDUA 3R6NA 1Q86R 1G83A 4JS5A 1SPKA 1SEMA 2CS7A 2DL4A 3QG1A 4AMCA 4PLIA 4ZTFA 1AWWA 1KQ2A 3MP8A 2OTJA 1B07A 2ENMA 2NUPA 4N0AA 1EIFA 2VXEA 5FU6C 4R0KA 4HVVA 2NUTB 2RHYA 1S72Q 2E12A 3MKDA 4D8KA 1VQMA 2O4XB 3JV3A 3X25B 2HL3A 5DY9A 3PVQA 2DXUA 2LVMA 3OS5A 4E2FB 2D0QB 1AWXA 4MZPA 2R5AA 1ZA1B 2L3RA 5KCOA 2E1HA 1TWBA 3G71T 2XICA 1Z9QA 3MJXA 2MAMA 2JM9A 2LCSA 2XMFA 1WDXA 2GCXA 4RKUE 2CH4A 1Q82C 3V7SA 1M30A 1UEBA 5GAN8 4N4GA 4M7AF 3NTHA 3ZBDA 3OYNA 3EG2A 2FRYA 3CCMA 2HDAA 1VQMT 3L2RA 1VA7A 1FYNA 1JBMA 4PJOC 4X9CA 2JN0A 1RAGB 3QDFA 2KYBA 2KY9A 2DIGA 1RAAB 4JPBW 1H3HA 2DRMA 5LJ3d 1WXBA 1GCPA 2KYMA 1NEBA 3PTAA 1AZEA 2GTOA 3CBPA 4OMFB 2XD0A 3ZFJA 4M7AE 4M7AA 3QZ9B 2MMPA 3NFCA 3A8HB 2DF6A 3M53A 2D9TA 2JZ2A 2CKKA 1M27C 4LE9A 1MMNA 5CK9A 3QYGB 5HY6A 4C5HA 2OTJQ 2E4HA 4A4GA 4F16A 3MP6A 1V76A 4FT4A 3VRYA 1QKXA 2ECZA 3C12A 1GBRA 1VQMQ 4PJOG 1V1CA 3CMAA 6AT1B 1VQ7T 2K5LA 3PVLA 1AHJB 1FWZA 1G3TA 3RESA 3V8KA 4DEXA 1M8VA 1K9MU 1IHVA 1WHMA 3CCLT 3OYDA 5EG2A 4PLLA 4BB7A 2X4JA 2HQEA 3FRNA 3JCMc 2VKNA 3FJPA 1PSFA 2RQTA 5GJVB 1QCFA 1BI3A 1Q7YC 4M77F 4X34A 1N8RU 3L1AA 1UHFA 1YHQA 2CZ7B 2F5TX 2IVWA 5M9OA 1VYUA 4RTZA 3CCMQ 4N4HA 4C8QC 4JZ4A 1OULA 4MZMA 2KVQG 4ATOA 3OW2S 2KGTA 2J05A 5HCKA 3OS2A 1U8RA 2KBTA 5GMKl 4M77A 1KSWA 5FRMA 2K5FA 1UECA 5D7UA 4PJOD 4JZ3A 2ATCB 2ZPBB 4OMMA 5GAOm 2RQRA 2EQJA 2K3XA 3VUBA 2AK5A 5FRNA 3OYJA 1MMAA 1PC0A 1W2BP 1MV0B 1OX8A 3FC3A 3JSCA 1HSQA 1VQOA 4J7FA 5KYWA 2DD5A 2HMAA 5GAN6 3G6ET 4DBQA 1KD1C 1KJWA 2DL3A 4FW2A 2OTLA 3OYBA 1YHQT 5LJ3j 2EWNA 3ULRB 2GGRA 2CREA 3RKYA 2EPDA 3JCMP 1W1FA 5EC7A 5FU6B 4C8QG 5I2SA 4EMKC 3CMAQ 1B3QA 3MO8A 3CXCA 3P8BB 3EGDB 5GAOp 2PVDB 2CP7A 2Y90A 1PHTA 1UHCA 1X43A 2BIVA 2K79A 2KMTA 2M9UA 2RI5A 5FROA 2YHTA 2KRMA 3NMZC 5GAOr 2OI3A 2LT4A 3LYIA 1RLPC 1N9SA 4ZNXA 2RN8A 3OMGA 3J81E 5I22A 1VQOT 2VYTA 4IIMA 2RMOA 2E64A 3RKWA 4F7UA 4DOWA 1QMCA 2M1HA 3EFSA 2H3EB 3QJ6A 1X6OA 3VJPA 2HZYA 2V8JA 4KH1B 2FPFA 3H9NA 2HL5C 1YHQQ 2O31A 4IUQA 2JM8A 5GAMh 2L8DA 2QTXA 5KCHA 1Q81R 4JDSA 2WSEE 2QI2A 2F2WA 4J6WA 1K0XA 2K4YA 2NWMA 1TUCA 4QQGA 4AFQC 1VQLT 1SSHA 2KDSA 1K0SA 2QGGA 4QW2A 3EGXB 4PJOB 3EFOB 2CP2A 3VKIA 4UC4A 3V8LA 1YCYA 4XTVA 1M3AA 2EBPA 1TUDA 4C8QD 3C95A 4M78A 3M9QA 1C6VX 3PMTA 2DM1A 3M5AA 5GAN3 4CRIA 3VYHB 2A7YA 2KT1A 3HFNA 4XU3A 1QLYA 1VQOQ 2QA4A 1UE9A 4J9EA 2FB7A 4IUPA 1T3LA 4A63B 2OTLQ 5J3BA 1VQ9T 3TQ7P 2DXBA 2QASA 4LUEA 1YBYA 4QT7A 1X2KA 1G2BA 1ZBJA 2QYZA 4QKUA 4FIBA 1I0CA 4PKCC 1H3ZA 1I81A 2RM4A 2H8HA 5I21A 1GCQC 4M75F 2DXTA 1VQ8A 2DEUA 2COWA 3VS7A 2K6DA 3DB4A 1Q86U 2VWFA 4B9XA 2MF2A 1KQSP 2DETA 4OB1B 2GFAA 4JRPA 2OAWA 2QA4T 4QQ6A 4NOYA 2BUDA 4OMQA 3WVDB 1IO6A 3IQLA 1M90U 2MIOA 5KYYB 2J6FA 3HRUA 4M75A 2LNHB 2JXBA 2HAXA 1MNEA 2LDMA 7AT1B 1LOJA 3M0RA 5GJWB 2DXCA 1VUBA 1AWOA 2PVGB 1PD0A 3EG0A 3QYHB 1OPKA 1WJSA 2O9SA 4XAXB 2P0KA 5KE3A 1K8AC 1K73U 3I55A 2E5QA 5LJ5h 1WHGA 4GLMA 4J6YA 2F69A 1A0NB 3EH2A 2YUNA 2CDTA 1NG2A 2FPEA 3GF5A 2YRDA 1V29B 2DEQA 3TSWA 3UT1A 2QA4Q 3CD6A 2KI7A 1RLQC 2J06A 2QXFA 4KGZB 4E7LA 2KNBB 3PFSA 1NJIR 1AZGB 1NBEB 1RUWA 2A36A 2D8HA 2EYZA 2EQKA 1UGRB 1UUEA 3NGPA 1QW1A 1WHLA 3RERA 3X24B 3JCMX 3EG9B 1KHIA 2CZ1B 4Z8AA 4M7DF 3I55T 5DLQE 2D8JA 3JCMQ 2AHJB 2ZPIB 5AT1B 2A37A 4WCIA 3PT9A 2LJ1A 2ZPHB 4Q5WA 4J7IA 2LQNA 1IREB 2D0NA 2WSFE 1JXOA 1OZ2A 3CD6T 4Y92A 4M7DE 3OYKA 1JQQA 2P84A 1PRLC 2DD4A 3GNFB 2XHCA 1TTHB 3EHQA 2LTOA 1MMGA 2A08A 2BE9B 4C92A 1M1KC 4DOVA 1Z9ZA 1Y96A 4J8OA 1H92A 1B34A 3BE3A 3HRSA 4LDWA 3I55Q 1Q95G 4J5YA 5GMKi 3V7CA 2ZZDA 1Y71A 3OYGA 3AT1B 2RNAA 1QCNA 4C5GA 2YLBA 5GAOl 3SDZA 2LJ3A 2DZCA 5KYNA 1PG5B 3HP9A 1MNDA 3CD6Q 2BKDN 3M0QA 3ER0A 5GAOn 4JLGA 1X01A 3JCMb 4ZGEB 4HVWA 4V2SA 3L2VA 1VIEA 3VRZA 2L3PA 4C5IA 2IIMA 3M0PA 1WXTA 2JT4A 1YFNA 4RCCA 3QKJA 3JCMJ 1AOJA 3RUXA 5CQYA 4C0GA 2OJ2A 4J9BA 3G4SA 2JUFA 1FMWA 4IUTA 2JMCA 4MMKA 1UTIA 3SB2A 1CKAA 3C4SA 2LJ0A 3L2QA 2FZKB 1NYGA 2D6FA 2KXDA 3MEUA 2EVRA 3QWXX 4J9DA 2O2OA 5A0LA 3CPWA 1WQ7A 1ACMB 1UJYA 4LDVA 1TSFA 3BW1A 2DVJA 2HBPA 1OV3A 4EIKA 1ABOA 3O8VA 2D1XA 3G71A 2CT4A 2O9VA 1KQ1A 3CXCS 3RMQA 2COYA 3JB9H 2KEAA 4C0ZA 2FO0A 3CMET 4M77G 2V8IA 1LNXA 3G4ST 2YRVA 3NHNA 4FL6A 4BDZA 2EKHA 4EPCA 1ZQ1A 1HK9A 3HSBA 2AKLA 3CCVT 2V1QA 2DJZA 4FYWB 2M0YA 5LJ3e 3RBBB 2Z0WA 2YRCA 2KE9A 2P0QA 4FCYA 1Q81U 3EFRA 4HA8A 2DL7A 3RMSA 2AKKA 3LGLA 3M55A 1VYTA 1VOMA 4JJBA 2BZXA 2RI3A 3I5SA 2HBWA 2FL7A 2NUTA 1YIJA 3SWNC 4M78C 2SRCA 2O4XA 3UATA 3G4SQ 3JB9G 1ZSZC 1XJWB 1W4SA 4E7IA 2QDYB 4ZGJB 3I9QA 4M77D 4F7UG 1ZUYA 2IG0A 2OX7A 2HNIA 4MMLA 3VV0A 3S3OA 1U5SA 1VQ7A 4FT2A 2YT6A 3P8DA 2VUBA 3A98A 1QVGA 1N5ZA 1KC8U 4RTYA 4ELZC 3E9FA 3CCLA 3V8JA 4HCKA 4F04B 3G71Q 1VYVA 3KXTA 4RCBA 4KBMB 4B6MA 3L42A 1JJ2A 1QVFP 3I5RA 4GBQA 2LCCA 1ABQA 1YIJT 5CIUA 2RD1A 2EQUA 2ZGWA 4HCBA 4M78G 2YUPA 3THKA 3EH1A 2FZCB 1EFNA 5KH6A 4Y91A 2ZPFB 2MK5A 3I56T 4LDYA 2O88A 1J3TA 3CQTA 3HPWA 5L8RE 4OP0A 3BDLA 1OU9A 2LC4A 1RABB 3JB9D 4RMOA 1RAEB 2LX7A 2CUDA 4KH0B 4CI0C 4TVRA 1GXIE 1TXQA 4QVDA 5KYUB 4AG2C 1GL5A 1YWOA 1PM3A 4JJDA 2EGCA 1JRIA 3G6EA 2QEXT 1I4K1 3OSSC 5KYXB 5FWBA 5IXBA 3HFOA 4RTWA 3JCMg 1YIJQ 3OS0A 4E7KA 3LW5E 4LUDA 1CSKA 1G3WA 4MDWA 4XQ3A 1D1CA 1NYFA 1IZ6A 4F14A 2A28A 1TUGB 5CCAA 2EFIA 3VUZA 4M78D 1M1GA 2XKOC 1VQ7Q 1CKBA 2B8AA 1NJIU 3JCMh 3E19A 3RR6A 1VQNT 4DBFA 3WXMB 2EIFA 1W70A 2LNVA 4RTVA 3CCLQ 1BI1A 2RQUA 4R55A 1UGVA 1LPLA 2ZPEB 5GAN5 5FLXE 2P0PA 2VGMA 1FX7A 1BBZA 3RDVA 3OYEA 1SG5A 2HSEB 3F70A 2FVUA 1Q82R 2RJDA 4OMOA 5CAIA 3KFVA 1NE8A 1JB0E 1NPPA 2DL8A 4WTOB 5GAN4 1ZLMA 2LQ8A 5IHKA 2L89A 5FWCA 1VQLA 4XU0A 4F7UB 1O75A 3TEEA 2QQRA 1M2VB 1SF9A 2X3XD 4HT8A 3CBOA 3H41A 2BTTA 2A0FB 1K9MC 5I11A 4FM4B 4C92C 1RACB 1ARKA 2XU8A 5GAMg 1TOVA 4OVAA 4M75D 2KT8A 2YSQA 3JCMW 1WZOA 4E6RA 1D0YA 2DJQA 4RG8A 3G6EQ 2COZA 2RF0A 1YJWT 2DLPA 3G1JA 1N8RC 1VQ9A 4IURA 4D8DA 3M56A 2RK1A 3J7AF 4C5EA 1M1FA 3CBMA 3SWNB 4R56A 4M78B 3OYLA 2ED1A 1ZSZB 3EGDA 2DK3A 4PJLA 2W0ZA 5CR2A 1PRMC 1ZHIA 2EJGA 1YP5A 1I1JA 1ZA2B 3J80E 2MWPA 4II1A 2CP3A 1TH7A 1BIBA 4Z88A 4ELYC 4L6V5 3QO3A 1QP3A 1GBQA 3VS4A 4C92G 4BE1A 1K9AA 1MV3A 2LZ6B 4PJOF 4IUUA 3EAEA 5GANg 3ME9A 1M2OA 5IN1A 2RJCA 1D0XA 1BIAA 4OB0B 3CPFA 2KSSA 1YJ9A 2H3JA 1W2BA 1Q7YR 2PUOB 5CKDA 3OW2P 2VVKA 2I2LA 4A4FA 4AFZC 3CPWS 3CC7T 4PJOE 3EGXA 5GANh 3EFOA 2DTIA 1WHJA 1VQ4T 2CGHA 1VQLQ 3PNWC 4XK8E 1MGQA 3GP8A 1OOTA 2QTVA 2ZPGB 1Y57A 2QDLA 2LP5A 4EMGA 4RUGA 2R57A 2DBMA 2DIQA 2QK0A 4N0AC 2K2MA 1D09B 4C92D 1KD1R 1YJ9T 2SEMA 5FW9A 1VQ9Q 1SHFA 5LJ5g 9ATCB 5CKEA 3MHXA 2BE7D 2EYQA 3QUIA 3L2ZA 3CCRA 2DPPB 4FSSA 3VU3C 3CC7Q 2RHIA 5LJ5f 3GLXA 1OPLA 2ESWA 1BCOA 1IB8A 4C8QB 2LMJA 4FYVB 3VS3A 1BB9A 5KE2A 1WI7A 3H0HA 1VQ5T 2M16A 1QVPA 1YNZA 2X3WD 2KRSA 3BFMA 3MP1A 2YUOA 2KAFA 2DRKA 5KYYA 5GAMd 3C94A 4GLKA 4HT9A 2JNGA 2KRNA 3UA7A 3CCET 2HD0A 4JRQA 3PIOA 4BI3A 1ZSGA 4P5NA 2XK0A 3HTRA 4JLIA 3UWNA 1YJ9Q 2VGNA 2JS0A 1WGSA 3CCRT 4RTXA 4OB3B 4C8QE 2E70A 4BD3A 1UG1A 1QVGS 5GMKe 4CC3A 3S3NA 1D1AA 1F1BB 1H8KA 2Y4XA 4M7AC 4A54A 1M4ZA 4EMKB 4E7JA 3INZA 1H641 1U1TA 1Q86C 1RI9A 2XDDA 3EGUA 1JJ2S 3FJ5A 3VS6A 5A2QE 4JRKA 2DYBA 1WHHA 4DBRA 3CCQT 1YITT 2GBQA 2E3IA 4C92B 1U1SA 3QJYA 1YCSB 1FMVA 4PFOA 1D3BB 2JS2A 2MYSA 1M90C 2RK2A 4E7SA 1Y96B 4M7DA 1PCXA 4J9IA 1KQSA 1MHNA 2EYXA 2JTMA 3PMIA 2QG9B 1M3BA 4YTLA 1U3OA 3NPFA 1SRLA 1NLPC 1NEGA 2WSCE 1LCKA 3SEMA 2J6KA 1N27A 3VS1A 5LJ5e 2BZYA 2X4YA 2HQHA 2JTFA 3EG9A 1OEBA 2F1LA 2FHDA 2IPOB 3QBYA 1BI0A 3TCJA 3CCRQ 3FDRA 4BY6C 2GNCA 2C0OA 2LCLA 1OX9A 1G8XA 2W10A 1ZX6A 1K73C 4M7AG 3OYCA 3HL8A 1TG0A 2F2VA 2PU9B 3M58A 4K11A 4BI4A 3M59A 1ZUKA 3VS0A 3OSVA 1QKWA 3CC4A 3CC2A 3P8HA 1TS9A 5D6YA 3TSZA 4JUVA 4AT1B 4J9FA 3HRTA 1BKBA 1VQ6T 2QQ9A 5I2MA 3R6OA 1IXDA 2HSPA 2EKOA 2F2XA 1ZBXA 1SRMA 2PTKA 1AVZC 3S3MA 1PWTA 4FYYB 3OB9A 5CVIA 2E6NA 5LJ5d 4GY5A 1AEYA 2DX1A 4JRIA 4M77C 1R8OB 1B7TA 3CMEA 2R5MA 3TREA 3REBB 4XTUA 3LX7A 2K7AA 1K8AR 2JOYA 5LJ3h 3OYAA 3CC4T 3CC2T 4OMNA 1SKUB 2DNUA 3MPUB 3CCVA 1Q82U 4M7AD 2K3YA 5CKBA 1UJ0A 1Y0MA 1KIKA 2XDBA 4JJCA 1UGQB 2VASA 3EG1A 1HD3A 2NUPB 2DA9A 4M4ZA 1OYXA 1EZZB 4RTUA 2G3RA 2RQVA 2O01E 4LD9K 4AFSC 2DMOA 3S6WA 3Q1JA 1JEGA 3SFMA 2L2PA 3GNGA 1GCQA 5IXFA 4ZN1A 1OI1A 2V8KA 3RKXA 1LJOA 4JS4A 2KROA 2DZ9A 2X4XA 4J83A 1RAIB 5J26A 3CC4Q 2EQMA 3CC2Q 3KUFA 3V7RA 3WVEB 1YWPA 1PD1A 4OMLA 2J7IA 2X35A 4E7HA 3U23A 1R0BG 3FEOA 3OYMA 3A8GB 3H6ZA 1M90R 5GMKj 4XTZA 2E5KA 4J6XA 1UGSB 3CCUA 4KUIA 4BDYA 1T0JA 3VS2A 4BUGA 3G7ZA 4J9GA 1M1KR 4KGVB 3CMEQ 2GQIA 1R77A 4FU6A 3URGA 1BYMA 3UF4A 1UFFA 1NM7A 2K57A 3PGGA 1K73R 4M7AB 3C0CA 4A53A 5IHNA 2EGAA 3I56A 2E3HA 1RI0A 1WJRA 3CCVQ 2K3BA 1Q7YU 5LJ5j 2OTJT 3O5ZA 1W2BS 4LXCA 2YXYA 5A0DA 2VC8A 2L5QA 3H0IA 4RG2A 1Y7XA 2AT1B 4PK4A 2X51A 4XTYA 2AZVA 4AFUC 4KGXB 1O9SA 3CCUT 1RADB 1GRIA 1M5Q1 4PFZA 3LWHA 4DBHA 4DEYA 1OZ3A 2QEXA 1GFCA 3QWYA 1KK7A 2MWOA 2JJ9A 5C0MA 4BY6B 3EHRA 1WIEA 5HKCA 2WACA 1C1AA 4ZGDB 4WF2A 2DE0X 2B86A 2GF7A 1JXMA 2RI2A 1XQHA 2CSQA 1KD1U 4C0FA 2VXFA 4M75C 1UDLA 1S1NA 3REAB 2ZAEA 1Q81C 2DTOA 3CXCP 2NLUA 3CCMT 2E6ZA 1VQNA 2EJFA 5A0GA 1K76A 1PNJA 4PL6A 4RTTA 4L5GA 2GQVA 2LQKA 3ZL7C 3PIPA 3OYFA 4CC4B 3CCUQ 3D7SB 4HCCA 2K5IA 4C0DC 2YWWA 3CCJA 3QPHA 8ATCB 3FIFA 4M77B 5CKFA 1K4US 3VS5A 1M8MA 1BCMA 1NPRA 4CC2A 3ASKA 1IGUA 5CKHA 3JCMf 4D6WA 1T3SA 2CT3A 3I56Q 1FMKA 2MPXC 1X69A 3L2UA 3E9GA 2XDPA 1BU1A 5KYWB 4PJMA 4M75G 2RHZA 5KYUA 4E7ZA 1KC8C 2P4RA 4HCZA 4CC7A 3UA6A 3CMAT 1WX6A 3E1SA 1T0HA 4XTXA 2NYSA 1I8FA 5KYXA 3X26B 1M3CA 3T9NA 2EYWA 4LD6A 2VV5A 1UB4A 2JTEA 4M77E 2HKQB 1YJWA 2QEXQ 3CCJT 4A4KA 2DFUA 3QXEB 1HJDA 2F5KA 1AD5A 2QQBA 2X4WA 3MEAA 1QVFA 1WLPB 3L2WA 2P4TA 3GOXA 1WPYA 1KQSS 4M7DC 2PZ1A 2RJFA 2KXCA 3LH5A 4Z02A 3RNJA 4AG1C 2GTJA 2G6FX 5DM7R 5DLOA 3OY9A 1WNLA 2C06A 2MI6A 2AIRB 3OA6A 3JB9F 1VQNQ 1G5VA 1N6AA 3EG3A 3LLRA 3H0FA 1G3YA 4F7UF 4IUVA 1SHGA 3UPUA 2JMAA 1VIFA 2ROTA 5GAMf 4QQDA 2DAQA 2L3QA 1JO8A 3A1PA 3JB9I 3JCMe 3CCJQ 1GFDA 5CO7A 1KG1A 1QP2A 2E10A 4ZTJA 4F7UE 2DL5A 2NUZA 2HQXA 3CC7A 4OB2B 1R0CB 4HVUA 2OTLT 1M2VA 4ANJA 4XTWA 1PSEA 1QCOA 1IGQA 4M7DG 1X6GA 2CSIA 5CQXA 1VQ4A 4KRTA 1YJNA 1NJIC 5IAYA 2M02A 2XG8D 2FEIA 4BACA 2K9GA 4M78F 2RHXA 2DVEA
chains in the Genus database with same CATH topology
3G71A 3S3NA 1AHJB 1FWZA 1Y07A 1G3TA 5C6SA 4LDUA 2Y4XA 1KQ1A 4M7AC 3RESA 4A54A 1M4ZA 3JRZA 3QIIA 3V8KA 3RMQA 3CXCS 3JB9H 4EMKB 4E7JA 3INZA 1M8VA 2DTHA 1K9MU 3CCLT 4C0ZA 1H641 1U1TA 1Q86C 3QSUA 2XDDA 2JVVA 3CMET 1JJ2S 3OYDA 5EG2A 4PLLA 4M77G 3OQ5A 2X4JA 4JRKA 2V8IA 4BB7A 2QQSA 5A2QE 1K8AU 2HQEA 3FRNA 3JCMc 3FJPA 1LNXA 3CCQT 3G4ST 1YITT 3OMCA 3CEYA 1PSFA 3FB9A 2YRVA 4M78E 5GANf 3SWNA 4C92B 1U1SA 4FL6A 4BDZA 3QJYA 1BI3A 1D3BB 1XOVA 4EPCA 1ZQ1A 3JCMd 1HK9A 1Q7YC 1M90C 2RK2A 4VUBA 4M77F 1Y96B 4X34A 1N8RU 3HSBA 4M7DA 2A3LA 3L1AA 3CCVT 1KQSA 1MHNA 2JTMA 3PMIA 3SD4A 4YTLA 2DJZA 5LJ3e 1YHQA 2RJEA 2CZ7B 4PJOA 4NS5A 2WSCE 3DB3A 2F5TX 2IVWA 5M9OA 3RIRA 3CCSA 1N27A 5LJ5e 2P0QA 2X4YA 1YJNT 2PVOB 2RO0A 2JTFA 4N4HA 3EFRA 1Q81U 4C8QC 5J39A 2FHDA 1VQPA 3QBYA 4HA8A 1BI0A 3TCJA 4MZMA 2KVQG 3FDRA 4ATOA 3OW2S 4M75B 4BY6C 3OS2A 1U8RA 1VQ5A 3RMSA 2R58A 5GAOq 2LCLA 3LGLA 5GMKl 4NL2A 4M77A 4XU1A 4M7DD 3M55A 1K73C 5GAMe 4M7AG 3OYCA 5FRMA 2K5FA 3HL8A 5FU7C 3X20B 4PJOD 2ZPBB 5GAOm 2EQJA 2PU9B 3HHTB 2K3XA 3VUBA 3M58A 3A8LB 5FRNA 4BI4A 3M59A 3DLLA 2RI3A 3VYGA 3OYJA 3OSVA 3CCEA 3FC3A 2FL7A 3BY7A 1YIJA 3JSCA 3CC4A 1VQOA 3SWNC 3CC2A 4M78C 4J7FA 3P8HA 5D6YA 2DD5A 5GAN6 3G6ET 4JUVA 2O4XA 1KD1C 3JB9G 2OTLA 3JCMV 3HRTA 4C0DB 4NL3A 1BKBA 1W4SA 4E7IA 2QQ9A 3OYBA 1VQ6T 5I2MA 2QDYB 3R6OA 3UDCA 4ZGJB 4M77D 4F7UG 5GMKh 1YHQT 5LJ3j 2DO3A 2EWNA 3QZ5B 2IG0A 2PQWA 4N4IA 3RKYA 3CCST 2EKOA 2HNIA 3JCMP 3M54A 1ZBXA 4MMLA 3VV0A 3S3OA 1VQ7A 1XTDA 1I5LA 4FT2A 1UGPB 2VUBA 3P8DA 4M75E 3S3MA 1XNIA 3OB9A 5CVIA 5HK3A 2E6NA 2EJ9A 5LJ5d 4GY5A 1VQPT 1QVGA 5FU6B 4C8QG 1KC8U 2PUKB 5I2SA 4EMKC 4ELZC 3MO8A 3E9FA 4JRIA 3CCLA 3V8JA 4M77C 1R8OB 1WQWA 3CXCA 3CMEA 2R5MA 1VQKA 3OYYA 3P8BB 3TREA 5GAOp 4RCBA 4KBMB 3KXTA 2PVDB 1M1KU 2Y90A 3LGFA 2BIVA 3L42A 1JJ2A 3CCQA 4C8QF 2KMTA 2M9UA 2RI5A 4XTUA 3LX7A 5FROA 1YITA 3OBYA 2RH2A 3QHSA 2YHTA 5GAOr 5GANe 2LT4A 3LYIA 1N9SA 2JOYA 2LCCA 5LJ3h 4DQ2A 1VQ8T 3OYAA 3OMGA 3CC4T 3J81E 1YIJT 5CIUA 1VQOT 2VYTA 2RD1A 3CC2T 2E64A 4BE0A 4A4EA 3RKWA 4F7UA 4DOWA 2EQUA 2M1HA 2ZGWA 3CCVA 4M78G 3EFSA 1Q82U 1X75C 4HCBA 2K3YA 5CKBA 4M7AD 3QJ6A 1X6OA 3VJPA 4LDXA 5KH6A 4Y91A 1N9RA 2ZPFB 3M4GA 1P92A 2XDBA 4KULA 2RHUA 3I56T 2V8JA 1UGQB 4LDYA 4E47A 3AHUA 1M9SA 4C8QA 3HPWA 2CZ0B 4MZTA 3DLMA 2RB6A 5L8RE 3BDUA 2CZ6B 3BDLA 4OP0A 4IUQA 1KHCA 2LC4A 5GAMh 2L8DA 2QTXA 5KCHA 1OYXA 3JB9D 4RMOA 4JDSA 2WSEE 2QI2A 2G3RA 4J6WA 2K4YA 4QQGA 3OW2A 4KUDK 2LRQA 2O01E 4CI0C 1VQLT 4LD9K 4TVRA 4M7DB 3HKSA 2KDSA 1GXIE 2LT1A 4QVDA 2CYZB 1VQKT 3S6WA 4QW2A 4O5VA 4PJOB 3Q1JA 1SSFA 2Y4YA 1RL2A 3SFMA 3VKIA 3GNGA 4UC4A 3NTIA 3NTKA 3V8LA 1YCYA 4XTVA 4C8QD 4ZN1A 1OI1A 3C95A 4Y28E 4M78A 1JRIA 3G6EA 2V8KA 3M9QA 2QEXT 3RKXA 1LJOA 1I4K1 4JS4A 4DA4A 3OSSC 3PMTA 3M5AA 5GAN3 5GANd 2DZ9A 4CRIA 2X4XA 4J83A 1VQ6A 3VYHB 2A7YA 3HFOA 5J26A 3JCMg 3HFNA 1B34B 4XU3A 3OS0A 5GAN2 4E7KA 1FXXA 2EQMA 3KUFA 2QA4A 3ZEHA 3LW5E 3V7RA 1G3WA 2FB7A 4MDWA 4XQ3A 3JB9J 3WVEB 4IUPA 4ZN3A 4EMHA 4C92F 1YI2A 1IZ6A 5J3BA 5GMKm 1VQ9T 3MCAB 2X35A 2DXBA 4QVZA 4E7HA 5CCAA 2QQAA 2EFIA 3FEOA 2ZCFB 3A8GB 3H6ZA 3VUZA 3QDRB 5GMKj 3OYMA 1YBYA 4M78D 4XTZA 1M1GA 4J6XA 2XKOC 4EMKA 4A4HA 4ME7A 1UGSB 5D6WA 2B8AA 1NJIU 3M57A 5GAN7 4IKFA 3JCMh 3E19A 3CCUA 4L59A 1VQNT 1DJ7B 4FIBA 4KT0E 4OF1A 3GIBA 4PKCC 1H3ZA 3WXMB 1I81A 2EIFA 4KUIA 2LNVA 2E41A 4BDYA 2RM4A 2GFUA 4C92E 1BI1A 3G7ZA 4BUGA 5I21A 4M75F 2DXTA 3N5BB 1VQ8A 4R55A 2KK4A 4FU6A 1D3BA 3A8OB 3URGA 1BYMA 3DB4A 1Q86U 2ZPEB 5GAN5 2K57A 4B9XA 2MF2A 4BI8B 5FLXE 4OB1B 3PGGA 2GFAA 3OS1A 1WJQA 2P0PA 2VGMA 4M7AB 3LWIA 4JRPA 1FX7A 4A53A 3OYEA 2LX9A 3A8MB 3F70A 2FVUA 2RJDA 2QA4T 3I56A 5CAIA 4QQ6A 4NOYA 1NE8A 1S72A 3JAME 1RI0A 2BUDA 1WJRA 3WVDB 2XIDA 1Q7YU 5LJ5j 1JB0E 1YI2T 2OTJT 1NPPA 1M90U 1W2BS 1HXDA 3H8ZA 4OGEA 5A0DA 5GAN4 3HRUA 5LJ3g 2LQ8A 4M75A 2VC8A 2L5QA 2HAXA 4RG2A 2L89A 1Y7XA 4MDXA 4XTYA 2M0OA 2LDMA 2E65A 1VQLA 1LOJA 4XU0A 4F7UB 2RA2A 1G3SA 1O9SA 1O75A 5LJ3f 2QQRA 3TEEA 3CCUT 5GAMj 4HT8A 5IT9E 3MEWA 2DXCA 1VUBA 3CBOA 3MEVA 1M5Q1 2PVGB 4FSXA 3QYHB 2KQWA 3LWHA 1K9MC 3A5ZB 1WJSA 4FM4B 3X28B 3OBWA 2XI9A 4C92C 2EAYA 5HK0A 4XAXB 2XU8A 2P0KA 1OZ3A 4B9WA 5KE3A 2QEXA 5GAMg 1K8AC 4OVAA 1K73U 4M75D 3I55A 3TU4K 4HKEA 2E5QA 2MWOA 3JCMW 1BI2A 5C0MA 5LJ5h 3META 3M4YA 4BY6B 3GPLA 5HKCA 2WACA 4BE2A 4J6YA 4RG8A 4XU2A 1YJWT 2F69A 4ZGDB 4WF2A 4X9DA 1N8RC 2GF7A 2RI2A 5FU7B 1VQ9A 1XQHA 1S72T 1QVFS 5LL6S 2YLCA 3GF5A 1KD1U 4IURA 3M56A 4C0FA 1V29B 1NZ9A 2DEQA 2DKGA 3UT1A 2RK1A 2VXFA 3LH0A 3J7AF 4M75C 4PNOA 3CD6A 4C5EA 1M1FA 3CBMA 4QVCA 3SWNB 4R56A 4M78B 3OYLA 2DTOA 3DKMA 1Q81C 2QXFA 4O6JA 3KBGA 4E7LA 2NLUA 3CCMT 2E6ZA 3FLGA 3PFSA 1VQNA 2EJFA 5A0GA 2DK3A 2K2VA 3OYHA 5CR2A 4PL6A 5D6XA 2OAUA 1ZHIA 2EJGA 4L5GA 2GQVA 2LQKA 3PIPA 3J80E 4OGCA 3OYFA 2MWPA 2EQKA 1UGRB 4II1A 1QW1A 2FYKA 4HCCA 1TH7A 3O8VA 1BIBA 5AYFA 3X24B 3JCMX 5GANj 4ELYC 1KHIA 2CZ1B 4L6V5 3RERA 2K5IA 1QP3A 3QO3A 4C0DC 4C92G 3OYIA 4BE1A 4M7DF 3I55T 5DLQE 4EDUA 3JCMQ 2AHJB 2ZPIB 4PJOF 3CCJA 4IUUA 4JS5A 3EAEA 2CS7A 3QPHA 5GANg 3FIFA 3ME9A 3QG1A 4M77B 5CKFA 5IN1A 4PLIA 4ZTFA 2RJCA 1KQ2A 1NPRA 3MP8A 3ASKA 2OTJA 3PT9A 2ZPHB 4Q5WA 1BIAA 4J7IA 4N0AA 4OB0B 5CKHA 1EIFA 2VXEA 3JCMf 4D6WA 3CPFA 2KSSA 5FU6C 1YJ9A 1IREB 2H3JA 1W2BA 2WSFE 3L2UA 2PUOB 2RHYA 5CKDA 1OZ2A 2E12A 3E9GA 3CD6T 2XDPA 4M7DE 2I2LA 3OYKA 1VQMA 4M75G 2O4XB 4A4FA 3X25B 2RHZA 3CPWS 3CC7T 4PJOE 3GNFB 2DD4A 5DY9A 5GANh 2DTIA 1KC8C 2DXUA 2XHCA 2LVMA 3OS5A 2D0QB 4HCZA 2LTOA 1VQ4T 4MZPA 2CGHA 2R5AA 3PNWC 3CMAT 4XK8E 4C92A 1MGQA 2L3RA 3E1SA 3GP8A 5KCOA 4XTXA 1M1KC 2E1HA 4DOVA 1I8FA 2ZPGB 1Y96A 3G71T 3X26B 3T9NA 4J8OA 4LD6A 1B34A 2XICA 2VV5A 1UB4A 4EMGA 4M77E 2MAMA 1YJWA 3CCJT 4A4KA 3HRSA 4LDWA 2GCXA 2R57A 4RKUE 3QXEB 1Q82C 3V7SA 2DIQA 4J5YA 5GMKi 3V7CA 2ZZDA 1Y71A 2F5KA 4N0AC 2QQBA 3OYGA 1UEBA 2X4WA 3MEAA 5GAN8 1QVFA 4C92D 4N4GA 4C5GA 3L2WA 2YLBA 1YJ9T 4M7AF 3NTHA 2P4TA 3GOXA 1WPYA 5GAOl 3ZBDA 1KQSS 3SDZA 3OYNA 5LJ5g 3CCMA 4M7DC 5CKEA 1VQMT 3MHXA 3L2RA 2RJFA 2DZCA 2EYQA 3HP9A 4Z02A 3QUIA 1JBMA 4PJOC 2BKDN 4X9CA 2JN0A 3L2ZA 5DM7R 3ER0A 5GAOn 2KY9A 3CCRA 2DIGA 2DPPB 5DLOA 4JLGA 3OY9A 1WNLA 1X01A 3JCMb 2C06A 3VU3C 2MI6A 2RHIA 5LJ5f 5LJ3d 3GLXA 4ZGEB 3OA6A 3JB9F 1G5VA 4V2SA 1N6AA 3L2VA 3PTAA 3LLRA 4C8QB 3CBPA 1G3YA 4OMFB 1VIEA 4F7UF 2XD0A 3ZFJA 4M7AE 4IUVA 4C5IA 4M7AA 3QZ9B 5KE2A 2MMPA 3NFCA 1VQ5T 2M16A 1QVPA 3A8HB 3M53A 2D9TA 2JZ2A 3BFMA 3MP1A 3UPUA 1VIFA 2CKKA 4RCCA 5GAMf 3QKJA 4QQDA 3JCMJ 3RUXA 2DAQA 5CQYA 4C0GA 2KAFA 5CK9A 3QYGB 3G4SA 5HY6A 3JB9I 5GAMd 3C94A 4GLKA 3JCMe 4C5HA 2JUFA 2JNGA 4HT9A 4IUTA 5CO7A 4MMKA 3CCET 1KG1A 2HD0A 3SB2A 4JRQA 3C4SA 3PIOA 1QP2A 2E10A 4ZTJA 3L2QA 4BI3A 4F7UE 4P5NA 2D6FA 2HQXA 2XK0A 4A4GA 3CC7A 4OB2B 2OTLT 3MP6A 4JLIA 3UWNA 3MEUA 4FT4A 5A0LA 4XTWA 1PSEA 2VGNA 3CPWA 1WQ7A 4M7DG 1WGSA 3C12A 5CQXA 1VQ4A 4LDVA 1YJNA 1NJIC 5IAYA 3CCRT 2XG8D 4OB3B 4PJOG 4BACA 3CMAA 4C8QE 3BW1A 2HBPA 4JJNK 2E70A 4BD3A 1VQ7T 4M78F 1QVGS 2K5LA 5GMKe 2RHXA 2DVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTU A;  3QHS A;  2YHT A;  5CAI A;  4NOY A;  5GAO r;  5GAN e;  4PJO E;  1KQ1 A;  1N9S A;  4DQ2 A;  5DY9 A;  3RES A;  5LJ3 h;  4A54 A;  5GAN h;  2DTI A;  3V8K A;  4M7A C;  5LJ5 j;  3JB9 H;  2DXU A;  4EMK B;  2RD1 A;  1HXD A;  3INZ A;  2DTH A;  2E64 A;  1M8V A;  1H64 1;  1U1T A;  3RKW A;  2CGH A;  4F7U A;  5LJ3 g;  2ZGW A;  4M75 A;  5GAN 4;  2VC8 A;  3EFS A;  4M78 G;  4M7A D;  4C92 A;  4M77 G;  4JRK A;  1MGQ A;  4XTY A;  3JCM c;  4XTX A;  3FJP A;  1LNX A;  1N9R A;  2E1H A;  2E65 A;  3M4G A;  4Y91 A;  1I8F A;  1LOJ A;  1Y96 A;  4XU0 A;  4F7U B;  3FB9 A;  2RA2 A;  4M78 E;  5GAN f;  5LJ3 f;  3SWN A;  1B34 A;  4C92 B;  1U1S A;  4EMG A;  4M77 E;  3AHU A;  5GAM j;  4HT8 A;  4C8Q A;  1D3B B;  2RB6 A;  1M5Q 1;  3BDU A;  1HK9 A;  4OP0 A;  3JCM d;  3HSB A;  4M77 F;  1Y96 B;  5GAM h;  2QTX A;  4M7D A;  3JB9 D;  3L1A A;  4C92 C;  2EAY A;  2DJZ A;  5LJ3 e;  3V7S A;  4J6W A;  4J5Y A;  5GMK i;  4PJO A;  3V7C A;  5GAM g;  5GMK e;  4N0A C;  4M75 D;  3RIR A;  5GAN 8;  3JCM W;  4M7D B;  5LJ5 e;  4C92 D;  5LJ5 h;  4QVD A;  2YLB A;  4M7A F;  3EFR A;  4C8Q C;  4PJO B;  1WPY A;  4J6Y A;  5GAO l;  4HA8 A;  5LJ5 g;  4XU2 A;  4M7D C;  4WF2 A;  4X9D A;  2DZC A;  1YCY A;  4M75 B;  3V8L A;  4XTV A;  4C8Q D;  4M7A G;  3QUI A;  1JBM A;  4PJO C;  2YLC A;  1JRI A;  2JN0 A;  4M78 A;  3L2Z A;  4X9C A;  5GAO n;  5GAO q;  5GMK l;  4NL2 A;  4M77 A;  4XU1 A;  1LJO A;  1I4K 1;  3RKX A;  4M7D D;  1WNL A;  1X01 A;  2DEQ A;  2DKG A;  3JCM b;  2VXF A;  3VU3 C;  5GAM e;  5LJ5 f;  2DZ9 A;  4M75 C;  5LJ3 d;  5GAN d;  4PNO A;  5GAN 3;  3JB9 F;  4PJO D;  3HFO A;  4QVC A;  4V2S A;  3JCM g;  5GAO m;  3HFN A;  1B34 B;  4M78 B;  4XU3 A;  3SWN B;  5GAN 2;  2DTO A;  4C8Q B;  3V7R A;  4F7U F;  2FB7 A;  4XQ3 A;  3JB9 J;  4M7A E;  2EJF A;  3BY7 A;  4M7A A;  4EMH A;  4C92 F;  3SWN C;  4M78 C;  5GMK m;  5GAN 6;  2EJG A;  3BFM A;  4JUV A;  3JB9 G;  4RCC A;  3JCM V;  5GAM f;  4NL3 A;  3JCM J;  3RUX A;  5GMK j;  4M78 D;  4XTZ A;  2FYK A;  4J6X A;  4EMK A;  1TH7 A;  4M77 D;  4F7U G;  1BIB A;  3RER A;  3JCM X;  5GMK h;  3JB9 I;  5LJ3 j;  5GAN j;  2EWN A;  5GAM d;  5GAN 7;  3JCM e;  3QO3 A;  4C92 G;  3JCM h;  3RKY A;  4HT9 A;  4M7D F;  4MMK A;  2HNI A;  3JCM P;  3SB2 A;  4MML A;  3JCM Q;  2E10 A;  1I5L A;  4PJO F;  3GIB A;  4F7U E;  1I81 A;  4M75 E;  5GAN g;  2E41 A;  3FIF A;  2RM4 A;  2EJ9 A;  4M77 B;  4C92 E;  5LJ5 d;  5I21 A;  4C8Q G;  4JLI A;  2DXT A;  4M75 F;  1KQ2 A;  4EMK C;  1D3B A;  4XTW A;  1BIA A;  1WQ7 A;  4M7D G;  4JRI A;  4N0A A;  3V8J A;  5GAN 5;  3JCM f;  2K57 A;  1WQW A;  2VXE A;  4M77 C;  4PJO G;  4C8Q E;  3BW1 A;  3PGG A;  4RCB A;  5GAO p;  3QSU A;  4M7A B;  2Y90 A;  4M78 F;  4A53 A;  4M7D E;  2I2L A;  4C8Q F;  2DVE A;  4M75 G; 
#chains in the Genus database with same CATH topology
 5C6S A;  1Y07 A;  4LDU A;  3JRZ A;  3QII A;  1WFW A;  2DTH A;  3QSU A;  1I07 A;  2JVV A;  3OQ5 A;  1K8A U;  2QQS A;  1D0Z A;  1WXU A;  3OMC A;  3CEY A;  1YJW Q;  3FB9 A;  4IIO A;  3I35 A;  4M78 E;  5GAN f;  3SWN A;  1KFZ A;  1ZUU A;  1XOV A;  4Z89 A;  3JCM d;  1ZSZ A;  4VUB A;  2A3L A;  2CUB A;  1TU0 B;  3SD4 A;  2RJE A;  4PJO A;  4NS5 A;  3DB3 A;  3CCS A;  3RIR A;  1YJN T;  2PVO B;  2RO0 A;  2ED0 A;  5J39 A;  4ESR A;  1VQP A;  2FG0 A;  2AZS A;  4PJN A;  4M75 B;  1VQ5 A;  4X1V A;  2R58 A;  5GAO q;  5L23 A;  4NL2 A;  4XU1 A;  1KC8 R;  4M7D D;  5GAM e;  1U06 A;  5FU7 C;  2DBK A;  2CP0 A;  4ORZ A;  1YN8 A;  3X20 B;  2ABL A;  3HHT B;  3A8L B;  3DLL A;  3VYG A;  2J6O A;  3CCE A;  3BY7 A;  2X9H A;  3JCM V;  4C0D B;  4NL3 A;  1E7O A;  3UDC A;  2DER A;  5GMK h;  2DO3 A;  3QZ5 B;  1E6G A;  2PQW A;  4N4I A;  2V1R A;  3CCS T;  3M54 A;  1PKS A;  1XTD A;  1I5L A;  1UGP B;  4M75 E;  1XNI A;  2DIL A;  5HK3 A;  1VQP T;  2EJ9 A;  1VQ4 Q;  1YJN Q;  2PUK B;  1WQW A;  1VQK A;  2QGF B;  3OYY A;  1M1K U;  1K9M R;  3LGF A;  2HCK A;  3CCQ A;  4C8Q F;  1YIT A;  3OBY A;  2RH2 A;  3QHS A;  5GAN e;  4DQ2 A;  1VQ8 T;  1NLO C;  1X2Q A;  4BE0 A;  3M0T A;  4A4E A;  1D1B A;  1X75 C;  4LDX A;  1N8R R;  1N9R A;  1MUZ A;  3M4G A;  2EW3 A;  1P92 A;  4KUL A;  2CP6 A;  2RHU A;  2M51 A;  4E47 A;  1IRX A;  3AHU A;  1M9S A;  4C8Q A;  2CZ0 B;  4MZT A;  3DLM A;  2RB6 A;  4LN2 A;  3BDU A;  2CZ6 B;  1KHC A;  3CCS Q;  2VB6 A;  2YDL A;  4F17 A;  4OMP A;  3OW2 A;  1E6H A;  4KUD K;  2LRQ A;  1VQP Q;  4M7D B;  3HKS A;  2LT1 A;  2CYZ B;  1VQK T;  4O5V A;  1VQ5 Q;  5IH2 A;  1SSF A;  2Y4Y A;  1RL2 A;  2DYI A;  2LQW A;  3NTI A;  3NTK A;  1EX4 A;  2HEQ A;  4Y28 E;  2FRW A;  1HYO A;  4DA4 A;  5GAN d;  1OU8 A;  1C0M A;  1X27 A;  1VQ6 A;  1VQ8 Q;  3CCE Q;  3CPW P;  1WA7 A;  1B34 B;  1OQK A;  5GAN 2;  1FXX A;  3ZEH A;  2C0T A;  2BZ8 A;  3JB9 J;  2CP5 A;  1QQJ A;  4ZN3 A;  4EMH A;  4C92 F;  1YI2 A;  1W6X A;  5GMK m;  4PJJ A;  3MCA B;  2KR3 A;  4QVZ A;  2MCN A;  4FW1 A;  2QQA A;  4JJN K;  2ZCF B;  3QDR B;  4EMK A;  4A4H A;  4ME7 A;  5D6W A;  4PFP A;  3M57 A;  5GAN 7;  4IKF A;  1X6B A;  5IHI A;  4L59 A;  1DJ7 B;  4KT0 E;  4OF1 A;  3GIB A;  1AWJ A;  2E41 A;  2GFU A;  4C92 E;  1RAF B;  3N5B B;  4LNP A;  1VQK Q;  2KK4 A;  1D3B A;  3A8O B;  1WHK A;  1AT1 B;  3CCQ Q;  2V26 A;  1YIT Q;  4BI8 B;  3OS1 A;  1WJQ A;  3LWI A;  2LX9 A;  3A8M B;  3SHW A;  1S72 A;  3JAM E;  3GBQ A;  2XID A;  1YI2 T;  2FZG B;  2L0A A;  1HXD A;  3H8Z A;  4OGE A;  2RPN A;  5LJ3 g;  2RQW A;  2ROL A;  4MDX A;  2FPD A;  2M0O A;  2E65 A;  3E2U A;  2RA2 A;  1G3S A;  5LJ3 f;  3PE0 A;  3M0S A;  5GAM j;  5IT9 E;  3MEW A;  3MEV A;  2EQI A;  4FSX A;  2KQW A;  2EGE A;  3A5Z B;  3X28 B;  5HK0 A;  3OBW A;  1QWE A;  2XI9 A;  2EAY A;  3TVT A;  4B9W A;  1MMD A;  1JU5 C;  2JW4 A;  3TU4 K;  4HKE A;  1BI2 A;  3MET A;  4J9C A;  3M4Y A;  3GPL A;  4BE2 A;  1LVK A;  4XU2 A;  2I0N A;  2EYY A;  4X9D A;  1QWF A;  2C0I A;  5FU7 B;  1S72 T;  1QVF S;  5LL6 S;  2YLC A;  1VQ6 Q;  4HXJ A;  1NZ9 A;  1QVG P;  2DKG A;  2CH4 W;  3LH0 A;  1WYX A;  4PNO A;  1PKT A;  3M0U A;  4QVC A;  8AT1 B;  1I5O B;  2L3S A;  1K1Z A;  1YI2 Q;  3DKM A;  4O6J A;  3KBG A;  1BK2 A;  3FLG A;  2YUQ A;  4FYX B;  2K2V A;  2PNI A;  3OYH A;  5D6X A;  5ECA A;  2OAU A;  1JJ2 P;  4OGC A;  1IHW A;  2HKN A;  2FYK A;  5AYF A;  4J9H A;  5GAN j;  2QAZ A;  2MOX A;  3OYI A;  1RAH B;  4EDU A;  3R6N A;  1Q86 R;  1G83 A;  4JS5 A;  1SPK A;  1SEM A;  2CS7 A;  2DL4 A;  3QG1 A;  4AMC A;  4PLI A;  4ZTF A;  1AWW A;  1KQ2 A;  3MP8 A;  2OTJ A;  1B07 A;  2ENM A;  2NUP A;  4N0A A;  1EIF A;  2VXE A;  5FU6 C;  4R0K A;  4HVV A;  2NUT B;  2RHY A;  1S72 Q;  2E12 A;  3MKD A;  4D8K A;  1VQM A;  2O4X B;  3JV3 A;  3X25 B;  2HL3 A;  5DY9 A;  3PVQ A;  2DXU A;  2LVM A;  3OS5 A;  4E2F B;  2D0Q B;  1AWX A;  4MZP A;  2R5A A;  1ZA1 B;  2L3R A;  5KCO A;  2E1H A;  1TWB A;  3G71 T;  2XIC A;  1Z9Q A;  3MJX A;  2MAM A;  2JM9 A;  2LCS A;  2XMF A;  1WDX A;  2GCX A;  4RKU E;  2CH4 A;  1Q82 C;  3V7S A;  1M30 A;  1UEB A;  5GAN 8;  4N4G A;  4M7A F;  3NTH A;  3ZBD A;  3OYN A;  3EG2 A;  2FRY A;  3CCM A;  2HDA A;  1VQM T;  3L2R A;  1VA7 A;  1FYN A;  1JBM A;  4PJO C;  4X9C A;  2JN0 A;  1RAG B;  3QDF A;  2KYB A;  2KY9 A;  2DIG A;  1RAA B;  4JPB W;  1H3H A;  2DRM A;  5LJ3 d;  1WXB A;  1GCP A;  2KYM A;  1NEB A;  3PTA A;  1AZE A;  2GTO A;  3CBP A;  4OMF B;  2XD0 A;  3ZFJ A;  4M7A E;  4M7A A;  3QZ9 B;  2MMP A;  3NFC A;  3A8H B;  2DF6 A;  3M53 A;  2D9T A;  2JZ2 A;  2CKK A;  1M27 C;  4LE9 A;  1MMN A;  5CK9 A;  3QYG B;  5HY6 A;  4C5H A;  2OTJ Q;  2E4H A;  4A4G A;  4F16 A;  3MP6 A;  1V76 A;  4FT4 A;  3VRY A;  1QKX A;  2ECZ A;  3C12 A;  1GBR A;  1VQM Q;  4PJO G;  1V1C A;  3CMA A;  6AT1 B;  1VQ7 T;  2K5L A;  3PVL A;  1AHJ B;  1FWZ A;  1G3T A;  3RES A;  3V8K A;  4DEX A;  1M8V A;  1K9M U;  1IHV A;  1WHM A;  3CCL T;  3OYD A;  5EG2 A;  4PLL A;  4BB7 A;  2X4J A;  2HQE A;  3FRN A;  3JCM c;  2VKN A;  3FJP A;  1PSF A;  2RQT A;  5GJV B;  1QCF A;  1BI3 A;  1Q7Y C;  4M77 F;  4X34 A;  1N8R U;  3L1A A;  1UHF A;  1YHQ A;  2CZ7 B;  2F5T X;  2IVW A;  5M9O A;  1VYU A;  4RTZ A;  3CCM Q;  4N4H A;  4C8Q C;  4JZ4 A;  1OUL A;  4MZM A;  2KVQ G;  4ATO A;  3OW2 S;  2KGT A;  2J05 A;  5HCK A;  3OS2 A;  1U8R A;  2KBT A;  5GMK l;  4M77 A;  1KSW A;  5FRM A;  2K5F A;  1UEC A;  5D7U A;  4PJO D;  4JZ3 A;  2ATC B;  2ZPB B;  4OMM A;  5GAO m;  2RQR A;  2EQJ A;  2K3X A;  3VUB A;  2AK5 A;  5FRN A;  3OYJ A;  1MMA A;  1PC0 A;  1W2B P;  1MV0 B;  1OX8 A;  3FC3 A;  3JSC A;  1HSQ A;  1VQO A;  4J7F A;  5KYW A;  2DD5 A;  2HMA A;  5GAN 6;  3G6E T;  4DBQ A;  1KD1 C;  1KJW A;  2DL3 A;  4FW2 A;  2OTL A;  3OYB A;  1YHQ T;  5LJ3 j;  2EWN A;  3ULR B;  2GGR A;  2CRE A;  3RKY A;  2EPD A;  3JCM P;  1W1F A;  5EC7 A;  5FU6 B;  4C8Q G;  5I2S A;  4EMK C;  3CMA Q;  1B3Q A;  3MO8 A;  3CXC A;  3P8B B;  3EGD B;  5GAO p;  2PVD B;  2CP7 A;  2Y90 A;  1PHT A;  1UHC A;  1X43 A;  2BIV A;  2K79 A;  2KMT A;  2M9U A;  2RI5 A;  5FRO A;  2YHT A;  2KRM A;  3NMZ C;  5GAO r;  2OI3 A;  2LT4 A;  3LYI A;  1RLP C;  1N9S A;  4ZNX A;  2RN8 A;  3OMG A;  3J81 E;  5I22 A;  1VQO T;  2VYT A;  4IIM A;  2RMO A;  2E64 A;  3RKW A;  4F7U A;  4DOW A;  1QMC A;  2M1H A;  3EFS A;  2H3E B;  3QJ6 A;  1X6O A;  3VJP A;  2HZY A;  2V8J A;  4KH1 B;  2FPF A;  3H9N A;  2HL5 C;  1YHQ Q;  2O31 A;  4IUQ A;  2JM8 A;  5GAM h;  2L8D A;  2QTX A;  5KCH A;  1Q81 R;  4JDS A;  2WSE E;  2QI2 A;  2F2W A;  4J6W A;  1K0X A;  2K4Y A;  2NWM A;  1TUC A;  4QQG A;  4AFQ C;  1VQL T;  1SSH A;  2KDS A;  1K0S A;  2QGG A;  4QW2 A;  3EGX B;  4PJO B;  3EFO B;  2CP2 A;  3VKI A;  4UC4 A;  3V8L A;  1YCY A;  4XTV A;  1M3A A;  2EBP A;  1TUD A;  4C8Q D;  3C95 A;  4M78 A;  3M9Q A;  1C6V X;  3PMT A;  2DM1 A;  3M5A A;  5GAN 3;  4CRI A;  3VYH B;  2A7Y A;  2KT1 A;  3HFN A;  4XU3 A;  1QLY A;  1VQO Q;  2QA4 A;  1UE9 A;  4J9E A;  2FB7 A;  4IUP A;  1T3L A;  4A63 B;  2OTL Q;  5J3B A;  1VQ9 T;  3TQ7 P;  2DXB A;  2QAS A;  4LUE A;  1YBY A;  4QT7 A;  1X2K A;  1G2B A;  1ZBJ A;  2QYZ A;  4QKU A;  4FIB A;  1I0C A;  4PKC C;  1H3Z A;  1I81 A;  2RM4 A;  2H8H A;  5I21 A;  1GCQ C;  4M75 F;  2DXT A;  1VQ8 A;  2DEU A;  2COW A;  3VS7 A;  2K6D A;  3DB4 A;  1Q86 U;  2VWF A;  4B9X A;  2MF2 A;  1KQS P;  2DET A;  4OB1 B;  2GFA A;  4JRP A;  2OAW A;  2QA4 T;  4QQ6 A;  4NOY A;  2BUD A;  4OMQ A;  3WVD B;  1IO6 A;  3IQL A;  1M90 U;  2MIO A;  5KYY B;  2J6F A;  3HRU A;  4M75 A;  2LNH B;  2JXB A;  2HAX A;  1MNE A;  2LDM A;  7AT1 B;  1LOJ A;  3M0R A;  5GJW B;  2DXC A;  1VUB A;  1AWO A;  2PVG B;  1PD0 A;  3EG0 A;  3QYH B;  1OPK A;  1WJS A;  2O9S A;  4XAX B;  2P0K A;  5KE3 A;  1K8A C;  1K73 U;  3I55 A;  2E5Q A;  5LJ5 h;  1WHG A;  4GLM A;  4J6Y A;  2F69 A;  1A0N B;  3EH2 A;  2YUN A;  2CDT A;  1NG2 A;  2FPE A;  3GF5 A;  2YRD A;  1V29 B;  2DEQ A;  3TSW A;  3UT1 A;  2QA4 Q;  3CD6 A;  2KI7 A;  1RLQ C;  2J06 A;  2QXF A;  4KGZ B;  4E7L A;  2KNB B;  3PFS A;  1NJI R;  1AZG B;  1NBE B;  1RUW A;  2A36 A;  2D8H A;  2EYZ A;  2EQK A;  1UGR B;  1UUE A;  3NGP A;  1QW1 A;  1WHL A;  3RER A;  3X24 B;  3JCM X;  3EG9 B;  1KHI A;  2CZ1 B;  4Z8A A;  4M7D F;  3I55 T;  5DLQ E;  2D8J A;  3JCM Q;  2AHJ B;  2ZPI B;  5AT1 B;  2A37 A;  4WCI A;  3PT9 A;  2LJ1 A;  2ZPH B;  4Q5W A;  4J7I A;  2LQN A;  1IRE B;  2D0N A;  2WSF E;  1JXO A;  1OZ2 A;  3CD6 T;  4Y92 A;  4M7D E;  3OYK A;  1JQQ A;  2P84 A;  1PRL C;  2DD4 A;  3GNF B;  2XHC A;  1TTH B;  3EHQ A;  2LTO A;  1MMG A;  2A08 A;  2BE9 B;  4C92 A;  1M1K C;  4DOV A;  1Z9Z A;  1Y96 A;  4J8O A;  1H92 A;  1B34 A;  3BE3 A;  3HRS A;  4LDW A;  3I55 Q;  1Q95 G;  4J5Y A;  5GMK i;  3V7C A;  2ZZD A;  1Y71 A;  3OYG A;  3AT1 B;  2RNA A;  1QCN A;  4C5G A;  2YLB A;  5GAO l;  3SDZ A;  2LJ3 A;  2DZC A;  5KYN A;  1PG5 B;  3HP9 A;  1MND A;  3CD6 Q;  2BKD N;  3M0Q A;  3ER0 A;  5GAO n;  4JLG A;  1X01 A;  3JCM b;  4ZGE B;  4HVW A;  4V2S A;  3L2V A;  1VIE A;  3VRZ A;  2L3P A;  4C5I A;  2IIM A;  3M0P A;  1WXT A;  2JT4 A;  1YFN A;  4RCC A;  3QKJ A;  3JCM J;  1AOJ A;  3RUX A;  5CQY A;  4C0G A;  2OJ2 A;  4J9B A;  3G4S A;  2JUF A;  1FMW A;  4IUT A;  2JMC A;  4MMK A;  1UTI A;  3SB2 A;  1CKA A;  3C4S A;  2LJ0 A;  3L2Q A;  2FZK B;  1NYG A;  2D6F A;  2KXD A;  3MEU A;  2EVR A;  3QWX X;  4J9D A;  2O2O A;  5A0L A;  3CPW A;  1WQ7 A;  1ACM B;  1UJY A;  4LDV A;  1TSF A;  3BW1 A;  2DVJ A;  2HBP A;  1OV3 A;  4EIK A;  1ABO A;  3O8V A;  2D1X A;  3G71 A;  2CT4 A;  2O9V A;  1KQ1 A;  3CXC S;  3RMQ A;  2COY A;  3JB9 H;  2KEA A;  4C0Z A;  2FO0 A;  3CME T;  4M77 G;  2V8I A;  1LNX A;  3G4S T;  2YRV A;  3NHN A;  4FL6 A;  4BDZ A;  2EKH A;  4EPC A;  1ZQ1 A;  1HK9 A;  3HSB A;  2AKL A;  3CCV T;  2V1Q A;  2DJZ A;  4FYW B;  2M0Y A;  5LJ3 e;  3RBB B;  2Z0W A;  2YRC A;  2KE9 A;  2P0Q A;  4FCY A;  1Q81 U;  3EFR A;  4HA8 A;  2DL7 A;  3RMS A;  2AKK A;  3LGL A;  3M55 A;  1VYT A;  1VOM A;  4JJB A;  2BZX A;  2RI3 A;  3I5S A;  2HBW A;  2FL7 A;  2NUT A;  1YIJ A;  3SWN C;  4M78 C;  2SRC A;  2O4X A;  3UAT A;  3G4S Q;  3JB9 G;  1ZSZ C;  1XJW B;  1W4S A;  4E7I A;  2QDY B;  4ZGJ B;  3I9Q A;  4M77 D;  4F7U G;  1ZUY A;  2IG0 A;  2OX7 A;  2HNI A;  4MML A;  3VV0 A;  3S3O A;  1U5S A;  1VQ7 A;  4FT2 A;  2YT6 A;  3P8D A;  2VUB A;  3A98 A;  1QVG A;  1N5Z A;  1KC8 U;  4RTY A;  4ELZ C;  3E9F A;  3CCL A;  3V8J A;  4HCK A;  4F04 B;  3G71 Q;  1VYV A;  3KXT A;  4RCB A;  4KBM B;  4B6M A;  3L42 A;  1JJ2 A;  1QVF P;  3I5R A;  4GBQ A;  2LCC A;  1ABQ A;  1YIJ T;  5CIU A;  2RD1 A;  2EQU A;  2ZGW A;  4HCB A;  4M78 G;  2YUP A;  3THK A;  3EH1 A;  2FZC B;  1EFN A;  5KH6 A;  4Y91 A;  2ZPF B;  2MK5 A;  3I56 T;  4LDY A;  2O88 A;  1J3T A;  3CQT A;  3HPW A;  5L8R E;  4OP0 A;  3BDL A;  1OU9 A;  2LC4 A;  1RAB B;  3JB9 D;  4RMO A;  1RAE B;  2LX7 A;  2CUD A;  4KH0 B;  4CI0 C;  4TVR A;  1GXI E;  1TXQ A;  4QVD A;  5KYU B;  4AG2 C;  1GL5 A;  1YWO A;  1PM3 A;  4JJD A;  2EGC A;  1JRI A;  3G6E A;  2QEX T;  1I4K 1;  3OSS C;  5KYX B;  5FWB A;  5IXB A;  3HFO A;  4RTW A;  3JCM g;  1YIJ Q;  3OS0 A;  4E7K A;  3LW5 E;  4LUD A;  1CSK A;  1G3W A;  4MDW A;  4XQ3 A;  1D1C A;  1NYF A;  1IZ6 A;  4F14 A;  2A28 A;  1TUG B;  5CCA A;  2EFI A;  3VUZ A;  4M78 D;  1M1G A;  2XKO C;  1VQ7 Q;  1CKB A;  2B8A A;  1NJI U;  3JCM h;  3E19 A;  3RR6 A;  1VQN T;  4DBF A;  3WXM B;  2EIF A;  1W70 A;  2LNV A;  4RTV A;  3CCL Q;  1BI1 A;  2RQU A;  4R55 A;  1UGV A;  1LPL A;  2ZPE B;  5GAN 5;  5FLX E;  2P0P A;  2VGM A;  1FX7 A;  1BBZ A;  3RDV A;  3OYE A;  1SG5 A;  2HSE B;  3F70 A;  2FVU A;  1Q82 R;  2RJD A;  4OMO A;  5CAI A;  3KFV A;  1NE8 A;  1JB0 E;  1NPP A;  2DL8 A;  4WTO B;  5GAN 4;  1ZLM A;  2LQ8 A;  5IHK A;  2L89 A;  5FWC A;  1VQL A;  4XU0 A;  4F7U B;  1O75 A;  3TEE A;  2QQR A;  1M2V B;  1SF9 A;  2X3X D;  4HT8 A;  3CBO A;  3H41 A;  2BTT A;  2A0F B;  1K9M C;  5I11 A;  4FM4 B;  4C92 C;  1RAC B;  1ARK A;  2XU8 A;  5GAM g;  1TOV A;  4OVA A;  4M75 D;  2KT8 A;  2YSQ A;  3JCM W;  1WZO A;  4E6R A;  1D0Y A;  2DJQ A;  4RG8 A;  3G6E Q;  2COZ A;  2RF0 A;  1YJW T;  2DLP A;  3G1J A;  1N8R C;  1VQ9 A;  4IUR A;  4D8D A;  3M56 A;  2RK1 A;  3J7A F;  4C5E A;  1M1F A;  3CBM A;  3SWN B;  4R56 A;  4M78 B;  3OYL A;  2ED1 A;  1ZSZ B;  3EGD A;  2DK3 A;  4PJL A;  2W0Z A;  5CR2 A;  1PRM C;  1ZHI A;  2EJG A;  1YP5 A;  1I1J A;  1ZA2 B;  3J80 E;  2MWP A;  4II1 A;  2CP3 A;  1TH7 A;  1BIB A;  4Z88 A;  4ELY C;  4L6V 5;  3QO3 A;  1QP3 A;  1GBQ A;  3VS4 A;  4C92 G;  4BE1 A;  1K9A A;  1MV3 A;  2LZ6 B;  4PJO F;  4IUU A;  3EAE A;  5GAN g;  3ME9 A;  1M2O A;  5IN1 A;  2RJC A;  1D0X A;  1BIA A;  4OB0 B;  3CPF A;  2KSS A;  1YJ9 A;  2H3J A;  1W2B A;  1Q7Y R;  2PUO B;  5CKD A;  3OW2 P;  2VVK A;  2I2L A;  4A4F A;  4AFZ C;  3CPW S;  3CC7 T;  4PJO E;  3EGX A;  5GAN h;  3EFO A;  2DTI A;  1WHJ A;  1VQ4 T;  2CGH A;  1VQL Q;  3PNW C;  4XK8 E;  1MGQ A;  3GP8 A;  1OOT A;  2QTV A;  2ZPG B;  1Y57 A;  2QDL A;  2LP5 A;  4EMG A;  4RUG A;  2R57 A;  2DBM A;  2DIQ A;  2QK0 A;  4N0A C;  2K2M A;  1D09 B;  4C92 D;  1KD1 R;  1YJ9 T;  2SEM A;  5FW9 A;  1VQ9 Q;  1SHF A;  5LJ5 g;  9ATC B;  5CKE A;  3MHX A;  2BE7 D;  2EYQ A;  3QUI A;  3L2Z A;  3CCR A;  2DPP B;  4FSS A;  3VU3 C;  3CC7 Q;  2RHI A;  5LJ5 f;  3GLX A;  1OPL A;  2ESW A;  1BCO A;  1IB8 A;  4C8Q B;  2LMJ A;  4FYV B;  3VS3 A;  1BB9 A;  5KE2 A;  1WI7 A;  3H0H A;  1VQ5 T;  2M16 A;  1QVP A;  1YNZ A;  2X3W D;  2KRS A;  3BFM A;  3MP1 A;  2YUO A;  2KAF A;  2DRK A;  5KYY A;  5GAM d;  3C94 A;  4GLK A;  4HT9 A;  2JNG A;  2KRN A;  3UA7 A;  3CCE T;  2HD0 A;  4JRQ A;  3PIO A;  4BI3 A;  1ZSG A;  4P5N A;  2XK0 A;  3HTR A;  4JLI A;  3UWN A;  1YJ9 Q;  2VGN A;  2JS0 A;  1WGS A;  3CCR T;  4RTX A;  4OB3 B;  4C8Q E;  2E70 A;  4BD3 A;  1UG1 A;  1QVG S;  5GMK e;  4CC3 A;  3S3N A;  1D1A A;  1F1B B;  1H8K A;  2Y4X A;  4M7A C;  4A54 A;  1M4Z A;  4EMK B;  4E7J A;  3INZ A;  1H64 1;  1U1T A;  1Q86 C;  1RI9 A;  2XDD A;  3EGU A;  1JJ2 S;  3FJ5 A;  3VS6 A;  5A2Q E;  4JRK A;  2DYB A;  1WHH A;  4DBR A;  3CCQ T;  1YIT T;  2GBQ A;  2E3I A;  4C92 B;  1U1S A;  3QJY A;  1YCS B;  1FMV A;  4PFO A;  1D3B B;  2JS2 A;  2MYS A;  1M90 C;  2RK2 A;  4E7S A;  1Y96 B;  4M7D A;  1PCX A;  4J9I A;  1KQS A;  1MHN A;  2EYX A;  2JTM A;  3PMI A;  2QG9 B;  1M3B A;  4YTL A;  1U3O A;  3NPF A;  1SRL A;  1NLP C;  1NEG A;  2WSC E;  1LCK A;  3SEM A;  2J6K A;  1N27 A;  3VS1 A;  5LJ5 e;  2BZY A;  2X4Y A;  2HQH A;  2JTF A;  3EG9 A;  1OEB A;  2F1L A;  2FHD A;  2IPO B;  3QBY A;  1BI0 A;  3TCJ A;  3CCR Q;  3FDR A;  4BY6 C;  2GNC A;  2C0O A;  2LCL A;  1OX9 A;  1G8X A;  2W10 A;  1ZX6 A;  1K73 C;  4M7A G;  3OYC A;  3HL8 A;  1TG0 A;  2F2V A;  2PU9 B;  3M58 A;  4K11 A;  4BI4 A;  3M59 A;  1ZUK A;  3VS0 A;  3OSV A;  1QKW A;  3CC4 A;  3CC2 A;  3P8H A;  1TS9 A;  5D6Y A;  3TSZ A;  4JUV A;  4AT1 B;  4J9F A;  3HRT A;  1BKB A;  1VQ6 T;  2QQ9 A;  5I2M A;  3R6O A;  1IXD A;  2HSP A;  2EKO A;  2F2X A;  1ZBX A;  1SRM A;  2PTK A;  1AVZ C;  3S3M A;  1PWT A;  4FYY B;  3OB9 A;  5CVI A;  2E6N A;  5LJ5 d;  4GY5 A;  1AEY A;  2DX1 A;  4JRI A;  4M77 C;  1R8O B;  1B7T A;  3CME A;  2R5M A;  3TRE A;  3REB B;  4XTU A;  3LX7 A;  2K7A A;  1K8A R;  2JOY A;  5LJ3 h;  3OYA A;  3CC4 T;  3CC2 T;  4OMN A;  1SKU B;  2DNU A;  3MPU B;  3CCV A;  1Q82 U;  4M7A D;  2K3Y A;  5CKB A;  1UJ0 A;  1Y0M A;  1KIK A;  2XDB A;  4JJC A;  1UGQ B;  2VAS A;  3EG1 A;  1HD3 A;  2NUP B;  2DA9 A;  4M4Z A;  1OYX A;  1EZZ B;  4RTU A;  2G3R A;  2RQV A;  2O01 E;  4LD9 K;  4AFS C;  2DMO A;  3S6W A;  3Q1J A;  1JEG A;  3SFM A;  2L2P A;  3GNG A;  1GCQ A;  5IXF A;  4ZN1 A;  1OI1 A;  2V8K A;  3RKX A;  1LJO A;  4JS4 A;  2KRO A;  2DZ9 A;  2X4X A;  4J83 A;  1RAI B;  5J26 A;  3CC4 Q;  2EQM A;  3CC2 Q;  3KUF A;  3V7R A;  3WVE B;  1YWP A;  1PD1 A;  4OML A;  2J7I A;  2X35 A;  4E7H A;  3U23 A;  1R0B G;  3FEO A;  3OYM A;  3A8G B;  3H6Z A;  1M90 R;  5GMK j;  4XTZ A;  2E5K A;  4J6X A;  1UGS B;  3CCU A;  4KUI A;  4BDY A;  1T0J A;  3VS2 A;  4BUG A;  3G7Z A;  4J9G A;  1M1K R;  4KGV B;  3CME Q;  2GQI A;  1R77 A;  4FU6 A;  3URG A;  1BYM A;  3UF4 A;  1UFF A;  1NM7 A;  2K57 A;  3PGG A;  1K73 R;  4M7A B;  3C0C A;  4A53 A;  5IHN A;  2EGA A;  3I56 A;  2E3H A;  1RI0 A;  1WJR A;  3CCV Q;  2K3B A;  1Q7Y U;  5LJ5 j;  2OTJ T;  3O5Z A;  1W2B S;  4LXC A;  2YXY A;  5A0D A;  2VC8 A;  2L5Q A;  3H0I A;  4RG2 A;  1Y7X A;  2AT1 B;  4PK4 A;  2X51 A;  4XTY A;  2AZV A;  4AFU C;  4KGX B;  1O9S A;  3CCU T;  1RAD B;  1GRI A;  1M5Q 1;  4PFZ A;  3LWH A;  4DBH A;  4DEY A;  1OZ3 A;  2QEX A;  1GFC A;  3QWY A;  1KK7 A;  2MWO A;  2JJ9 A;  5C0M A;  4BY6 B;  3EHR A;  1WIE A;  5HKC A;  2WAC A;  1C1A A;  4ZGD B;  4WF2 A;  2DE0 X;  2B86 A;  2GF7 A;  1JXM A;  2RI2 A;  1XQH A;  2CSQ A;  1KD1 U;  4C0F A;  2VXF A;  4M75 C;  1UDL A;  1S1N A;  3REA B;  2ZAE A;  1Q81 C;  2DTO A;  3CXC P;  2NLU A;  3CCM T;  2E6Z A;  1VQN A;  2EJF A;  5A0G A;  1K76 A;  1PNJ A;  4PL6 A;  4RTT A;  4L5G A;  2GQV A;  2LQK A;  3ZL7 C;  3PIP A;  3OYF A;  4CC4 B;  3CCU Q;  3D7S B;  4HCC A;  2K5I A;  4C0D C;  2YWW A;  3CCJ A;  3QPH A;  8ATC B;  3FIF A;  4M77 B;  5CKF A;  1K4U S;  3VS5 A;  1M8M A;  1BCM A;  1NPR A;  4CC2 A;  3ASK A;  1IGU A;  5CKH A;  3JCM f;  4D6W A;  1T3S A;  2CT3 A;  3I56 Q;  1FMK A;  2MPX C;  1X69 A;  3L2U A;  3E9G A;  2XDP A;  1BU1 A;  5KYW B;  4PJM A;  4M75 G;  2RHZ A;  5KYU A;  4E7Z A;  1KC8 C;  2P4R A;  4HCZ A;  4CC7 A;  3UA6 A;  3CMA T;  1WX6 A;  3E1S A;  1T0H A;  4XTX A;  2NYS A;  1I8F A;  5KYX A;  3X26 B;  1M3C A;  3T9N A;  2EYW A;  4LD6 A;  2VV5 A;  1UB4 A;  2JTE A;  4M77 E;  2HKQ B;  1YJW A;  2QEX Q;  3CCJ T;  4A4K A;  2DFU A;  3QXE B;  1HJD A;  2F5K A;  1AD5 A;  2QQB A;  2X4W A;  3MEA A;  1QVF A;  1WLP B;  3L2W A;  2P4T A;  3GOX A;  1WPY A;  1KQS S;  4M7D C;  2PZ1 A;  2RJF A;  2KXC A;  3LH5 A;  4Z02 A;  3RNJ A;  4AG1 C;  2GTJ A;  2G6F X;  5DM7 R;  5DLO A;  3OY9 A;  1WNL A;  2C06 A;  2MI6 A;  2AIR B;  3OA6 A;  3JB9 F;  1VQN Q;  1G5V A;  1N6A A;  3EG3 A;  3LLR A;  3H0F A;  1G3Y A;  4F7U F;  4IUV A;  1SHG A;  3UPU A;  2JMA A;  1VIF A;  2ROT A;  5GAM f;  4QQD A;  2DAQ A;  2L3Q A;  1JO8 A;  3A1P A;  3JB9 I;  3JCM e;  3CCJ Q;  1GFD A;  5CO7 A;  1KG1 A;  1QP2 A;  2E10 A;  4ZTJ A;  4F7U E;  2DL5 A;  2NUZ A;  2HQX A;  3CC7 A;  4OB2 B;  1R0C B;  4HVU A;  2OTL T;  1M2V A;  4ANJ A;  4XTW A;  1PSE A;  1QCO A;  1IGQ A;  4M7D G;  1X6G A;  2CSI A;  5CQX A;  1VQ4 A;  4KRT A;  1YJN A;  1NJI C;  5IAY A;  2M02 A;  2XG8 D;  2FEI A;  4BAC A;  2K9G A;  4M78 F;  2RHX A;  2DVE A; 
#chains in the Genus database with same CATH homology
 3G71 A;  3S3N A;  1AHJ B;  1FWZ A;  1Y07 A;  1G3T A;  5C6S A;  4LDU A;  2Y4X A;  1KQ1 A;  4M7A C;  3RES A;  4A54 A;  1M4Z A;  3JRZ A;  3QII A;  3V8K A;  3RMQ A;  3CXC S;  3JB9 H;  4EMK B;  4E7J A;  3INZ A;  1M8V A;  2DTH A;  1K9M U;  3CCL T;  4C0Z A;  1H64 1;  1U1T A;  1Q86 C;  3QSU A;  2XDD A;  2JVV A;  3CME T;  1JJ2 S;  3OYD A;  5EG2 A;  4PLL A;  4M77 G;  3OQ5 A;  2X4J A;  4JRK A;  2V8I A;  4BB7 A;  2QQS A;  5A2Q E;  1K8A U;  2HQE A;  3FRN A;  3JCM c;  3FJP A;  1LNX A;  3CCQ T;  3G4S T;  1YIT T;  3OMC A;  3CEY A;  1PSF A;  3FB9 A;  2YRV A;  4M78 E;  5GAN f;  3SWN A;  4C92 B;  1U1S A;  4FL6 A;  4BDZ A;  3QJY A;  1BI3 A;  1D3B B;  1XOV A;  4EPC A;  1ZQ1 A;  3JCM d;  1HK9 A;  1Q7Y C;  1M90 C;  2RK2 A;  4VUB A;  4M77 F;  1Y96 B;  4X34 A;  1N8R U;  3HSB A;  4M7D A;  2A3L A;  3L1A A;  3CCV T;  1KQS A;  1MHN A;  2JTM A;  3PMI A;  3SD4 A;  4YTL A;  2DJZ A;  5LJ3 e;  1YHQ A;  2RJE A;  2CZ7 B;  4PJO A;  4NS5 A;  2WSC E;  3DB3 A;  2F5T X;  2IVW A;  5M9O A;  3RIR A;  3CCS A;  1N27 A;  5LJ5 e;  2P0Q A;  2X4Y A;  1YJN T;  2PVO B;  2RO0 A;  2JTF A;  4N4H A;  3EFR A;  1Q81 U;  4C8Q C;  5J39 A;  2FHD A;  1VQP A;  3QBY A;  4HA8 A;  1BI0 A;  3TCJ A;  4MZM A;  2KVQ G;  3FDR A;  4ATO A;  3OW2 S;  4M75 B;  4BY6 C;  3OS2 A;  1U8R A;  1VQ5 A;  3RMS A;  2R58 A;  5GAO q;  2LCL A;  3LGL A;  5GMK l;  4NL2 A;  4M77 A;  4XU1 A;  4M7D D;  3M55 A;  1K73 C;  5GAM e;  4M7A G;  3OYC A;  5FRM A;  2K5F A;  3HL8 A;  5FU7 C;  3X20 B;  4PJO D;  2ZPB B;  5GAO m;  2EQJ A;  2PU9 B;  3HHT B;  2K3X A;  3VUB A;  3M58 A;  3A8L B;  5FRN A;  4BI4 A;  3M59 A;  3DLL A;  2RI3 A;  3VYG A;  3OYJ A;  3OSV A;  3CCE A;  3FC3 A;  2FL7 A;  3BY7 A;  1YIJ A;  3JSC A;  3CC4 A;  1VQO A;  3SWN C;  3CC2 A;  4M78 C;  4J7F A;  3P8H A;  5D6Y A;  2DD5 A;  5GAN 6;  3G6E T;  4JUV A;  2O4X A;  1KD1 C;  3JB9 G;  2OTL A;  3JCM V;  3HRT A;  4C0D B;  4NL3 A;  1BKB A;  1W4S A;  4E7I A;  2QQ9 A;  3OYB A;  1VQ6 T;  5I2M A;  2QDY B;  3R6O A;  3UDC A;  4ZGJ B;  4M77 D;  4F7U G;  5GMK h;  1YHQ T;  5LJ3 j;  2DO3 A;  2EWN A;  3QZ5 B;  2IG0 A;  2PQW A;  4N4I A;  3RKY A;  3CCS T;  2EKO A;  2HNI A;  3JCM P;  3M54 A;  1ZBX A;  4MML A;  3VV0 A;  3S3O A;  1VQ7 A;  1XTD A;  1I5L A;  4FT2 A;  1UGP B;  2VUB A;  3P8D A;  4M75 E;  3S3M A;  1XNI A;  3OB9 A;  5CVI A;  5HK3 A;  2E6N A;  2EJ9 A;  5LJ5 d;  4GY5 A;  1VQP T;  1QVG A;  5FU6 B;  4C8Q G;  1KC8 U;  2PUK B;  5I2S A;  4EMK C;  4ELZ C;  3MO8 A;  3E9F A;  4JRI A;  3CCL A;  3V8J A;  4M77 C;  1R8O B;  1WQW A;  3CXC A;  3CME A;  2R5M A;  1VQK A;  3OYY A;  3P8B B;  3TRE A;  5GAO p;  4RCB A;  4KBM B;  3KXT A;  2PVD B;  1M1K U;  2Y90 A;  3LGF A;  2BIV A;  3L42 A;  1JJ2 A;  3CCQ A;  4C8Q F;  2KMT A;  2M9U A;  2RI5 A;  4XTU A;  3LX7 A;  5FRO A;  1YIT A;  3OBY A;  2RH2 A;  3QHS A;  2YHT A;  5GAO r;  5GAN e;  2LT4 A;  3LYI A;  1N9S A;  2JOY A;  2LCC A;  5LJ3 h;  4DQ2 A;  1VQ8 T;  3OYA A;  3OMG A;  3CC4 T;  3J81 E;  1YIJ T;  5CIU A;  1VQO T;  2VYT A;  2RD1 A;  3CC2 T;  2E64 A;  4BE0 A;  4A4E A;  3RKW A;  4F7U A;  4DOW A;  2EQU A;  2M1H A;  2ZGW A;  3CCV A;  4M78 G;  3EFS A;  1Q82 U;  1X75 C;  4HCB A;  2K3Y A;  5CKB A;  4M7A D;  3QJ6 A;  1X6O A;  3VJP A;  4LDX A;  5KH6 A;  4Y91 A;  1N9R A;  2ZPF B;  3M4G A;  1P92 A;  2XDB A;  4KUL A;  2RHU A;  3I56 T;  2V8J A;  1UGQ B;  4LDY A;  4E47 A;  3AHU A;  1M9S A;  4C8Q A;  3HPW A;  2CZ0 B;  4MZT A;  3DLM A;  2RB6 A;  5L8R E;  3BDU A;  2CZ6 B;  3BDL A;  4OP0 A;  4IUQ A;  1KHC A;  2LC4 A;  5GAM h;  2L8D A;  2QTX A;  5KCH A;  1OYX A;  3JB9 D;  4RMO A;  4JDS A;  2WSE E;  2QI2 A;  2G3R A;  4J6W A;  2K4Y A;  4QQG A;  3OW2 A;  4KUD K;  2LRQ A;  2O01 E;  4CI0 C;  1VQL T;  4LD9 K;  4TVR A;  4M7D B;  3HKS A;  2KDS A;  1GXI E;  2LT1 A;  4QVD A;  2CYZ B;  1VQK T;  3S6W A;  4QW2 A;  4O5V A;  4PJO B;  3Q1J A;  1SSF A;  2Y4Y A;  1RL2 A;  3SFM A;  3VKI A;  3GNG A;  4UC4 A;  3NTI A;  3NTK A;  3V8L A;  1YCY A;  4XTV A;  4C8Q D;  4ZN1 A;  1OI1 A;  3C95 A;  4Y28 E;  4M78 A;  1JRI A;  3G6E A;  2V8K A;  3M9Q A;  2QEX T;  3RKX A;  1LJO A;  1I4K 1;  4JS4 A;  4DA4 A;  3OSS C;  3PMT A;  3M5A A;  5GAN 3;  5GAN d;  2DZ9 A;  4CRI A;  2X4X A;  4J83 A;  1VQ6 A;  3VYH B;  2A7Y A;  3HFO A;  5J26 A;  3JCM g;  3HFN A;  1B34 B;  4XU3 A;  3OS0 A;  5GAN 2;  4E7K A;  1FXX A;  2EQM A;  3KUF A;  2QA4 A;  3ZEH A;  3LW5 E;  3V7R A;  1G3W A;  2FB7 A;  4MDW A;  4XQ3 A;  3JB9 J;  3WVE B;  4IUP A;  4ZN3 A;  4EMH A;  4C92 F;  1YI2 A;  1IZ6 A;  5J3B A;  5GMK m;  1VQ9 T;  3MCA B;  2X35 A;  2DXB A;  4QVZ A;  4E7H A;  5CCA A;  2QQA A;  2EFI A;  3FEO A;  2ZCF B;  3A8G B;  3H6Z A;  3VUZ A;  3QDR B;  5GMK j;  3OYM A;  1YBY A;  4M78 D;  4XTZ A;  1M1G A;  4J6X A;  2XKO C;  4EMK A;  4A4H A;  4ME7 A;  1UGS B;  5D6W A;  2B8A A;  1NJI U;  3M57 A;  5GAN 7;  4IKF A;  3JCM h;  3E19 A;  3CCU A;  4L59 A;  1VQN T;  1DJ7 B;  4FIB A;  4KT0 E;  4OF1 A;  3GIB A;  4PKC C;  1H3Z A;  3WXM B;  1I81 A;  2EIF A;  4KUI A;  2LNV A;  2E41 A;  4BDY A;  2RM4 A;  2GFU A;  4C92 E;  1BI1 A;  3G7Z A;  4BUG A;  5I21 A;  4M75 F;  2DXT A;  3N5B B;  1VQ8 A;  4R55 A;  2KK4 A;  4FU6 A;  1D3B A;  3A8O B;  3URG A;  1BYM A;  3DB4 A;  1Q86 U;  2ZPE B;  5GAN 5;  2K57 A;  4B9X A;  2MF2 A;  4BI8 B;  5FLX E;  4OB1 B;  3PGG A;  2GFA A;  3OS1 A;  1WJQ A;  2P0P A;  2VGM A;  4M7A B;  3LWI A;  4JRP A;  1FX7 A;  4A53 A;  3OYE A;  2LX9 A;  3A8M B;  3F70 A;  2FVU A;  2RJD A;  2QA4 T;  3I56 A;  5CAI A;  4QQ6 A;  4NOY A;  1NE8 A;  1S72 A;  3JAM E;  1RI0 A;  2BUD A;  1WJR A;  3WVD B;  2XID A;  1Q7Y U;  5LJ5 j;  1JB0 E;  1YI2 T;  2OTJ T;  1NPP A;  1M90 U;  1W2B S;  1HXD A;  3H8Z A;  4OGE A;  5A0D A;  5GAN 4;  3HRU A;  5LJ3 g;  2LQ8 A;  4M75 A;  2VC8 A;  2L5Q A;  2HAX A;  4RG2 A;  2L89 A;  1Y7X A;  4MDX A;  4XTY A;  2M0O A;  2LDM A;  2E65 A;  1VQL A;  1LOJ A;  4XU0 A;  4F7U B;  2RA2 A;  1G3S A;  1O9S A;  1O75 A;  5LJ3 f;  2QQR A;  3TEE A;  3CCU T;  5GAM j;  4HT8 A;  5IT9 E;  3MEW A;  2DXC A;  1VUB A;  3CBO A;  3MEV A;  1M5Q 1;  2PVG B;  4FSX A;  3QYH B;  2KQW A;  3LWH A;  1K9M C;  3A5Z B;  1WJS A;  4FM4 B;  3X28 B;  3OBW A;  2XI9 A;  4C92 C;  2EAY A;  5HK0 A;  4XAX B;  2XU8 A;  2P0K A;  1OZ3 A;  4B9W A;  5KE3 A;  2QEX A;  5GAM g;  1K8A C;  4OVA A;  1K73 U;  4M75 D;  3I55 A;  3TU4 K;  4HKE A;  2E5Q A;  2MWO A;  3JCM W;  1BI2 A;  5C0M A;  5LJ5 h;  3MET A;  3M4Y A;  4BY6 B;  3GPL A;  5HKC A;  2WAC A;  4BE2 A;  4J6Y A;  4RG8 A;  4XU2 A;  1YJW T;  2F69 A;  4ZGD B;  4WF2 A;  4X9D A;  1N8R C;  2GF7 A;  2RI2 A;  5FU7 B;  1VQ9 A;  1XQH A;  1S72 T;  1QVF S;  5LL6 S;  2YLC A;  3GF5 A;  1KD1 U;  4IUR A;  3M56 A;  4C0F A;  1V29 B;  1NZ9 A;  2DEQ A;  2DKG A;  3UT1 A;  2RK1 A;  2VXF A;  3LH0 A;  3J7A F;  4M75 C;  4PNO A;  3CD6 A;  4C5E A;  1M1F A;  3CBM A;  4QVC A;  3SWN B;  4R56 A;  4M78 B;  3OYL A;  2DTO A;  3DKM A;  1Q81 C;  2QXF A;  4O6J A;  3KBG A;  4E7L A;  2NLU A;  3CCM T;  2E6Z A;  3FLG A;  3PFS A;  1VQN A;  2EJF A;  5A0G A;  2DK3 A;  2K2V A;  3OYH A;  5CR2 A;  4PL6 A;  5D6X A;  2OAU A;  1ZHI A;  2EJG A;  4L5G A;  2GQV A;  2LQK A;  3PIP A;  3J80 E;  4OGC A;  3OYF A;  2MWP A;  2EQK A;  1UGR B;  4II1 A;  1QW1 A;  2FYK A;  4HCC A;  1TH7 A;  3O8V A;  1BIB A;  5AYF A;  3X24 B;  3JCM X;  5GAN j;  4ELY C;  1KHI A;  2CZ1 B;  4L6V 5;  3RER A;  2K5I A;  1QP3 A;  3QO3 A;  4C0D C;  4C92 G;  3OYI A;  4BE1 A;  4M7D F;  3I55 T;  5DLQ E;  4EDU A;  3JCM Q;  2AHJ B;  2ZPI B;  4PJO F;  3CCJ A;  4IUU A;  4JS5 A;  3EAE A;  2CS7 A;  3QPH A;  5GAN g;  3FIF A;  3ME9 A;  3QG1 A;  4M77 B;  5CKF A;  5IN1 A;  4PLI A;  4ZTF A;  2RJC A;  1KQ2 A;  1NPR A;  3MP8 A;  3ASK A;  2OTJ A;  3PT9 A;  2ZPH B;  4Q5W A;  1BIA A;  4J7I A;  4N0A A;  4OB0 B;  5CKH A;  1EIF A;  2VXE A;  3JCM f;  4D6W A;  3CPF A;  2KSS A;  5FU6 C;  1YJ9 A;  1IRE B;  2H3J A;  1W2B A;  2WSF E;  3L2U A;  2PUO B;  2RHY A;  5CKD A;  1OZ2 A;  2E12 A;  3E9G A;  3CD6 T;  2XDP A;  4M7D E;  2I2L A;  3OYK A;  1VQM A;  4M75 G;  2O4X B;  4A4F A;  3X25 B;  2RHZ A;  3CPW S;  3CC7 T;  4PJO E;  3GNF B;  2DD4 A;  5DY9 A;  5GAN h;  2DTI A;  1KC8 C;  2DXU A;  2XHC A;  2LVM A;  3OS5 A;  2D0Q B;  4HCZ A;  2LTO A;  1VQ4 T;  4MZP A;  2CGH A;  2R5A A;  3PNW C;  3CMA T;  4XK8 E;  4C92 A;  1MGQ A;  2L3R A;  3E1S A;  3GP8 A;  5KCO A;  4XTX A;  1M1K C;  2E1H A;  4DOV A;  1I8F A;  2ZPG B;  1Y96 A;  3G71 T;  3X26 B;  3T9N A;  4J8O A;  4LD6 A;  1B34 A;  2XIC A;  2VV5 A;  1UB4 A;  4EMG A;  4M77 E;  2MAM A;  1YJW A;  3CCJ T;  4A4K A;  3HRS A;  4LDW A;  2GCX A;  2R57 A;  4RKU E;  3QXE B;  1Q82 C;  3V7S A;  2DIQ A;  4J5Y A;  5GMK i;  3V7C A;  2ZZD A;  1Y71 A;  2F5K A;  4N0A C;  2QQB A;  3OYG A;  1UEB A;  2X4W A;  3MEA A;  5GAN 8;  1QVF A;  4C92 D;  4N4G A;  4C5G A;  3L2W A;  2YLB A;  1YJ9 T;  4M7A F;  3NTH A;  2P4T A;  3GOX A;  1WPY A;  5GAO l;  3ZBD A;  1KQS S;  3SDZ A;  3OYN A;  5LJ5 g;  3CCM A;  4M7D C;  5CKE A;  1VQM T;  3MHX A;  3L2R A;  2RJF A;  2DZC A;  2EYQ A;  3HP9 A;  4Z02 A;  3QUI A;  1JBM A;  4PJO C;  2BKD N;  4X9C A;  2JN0 A;  3L2Z A;  5DM7 R;  3ER0 A;  5GAO n;  2KY9 A;  3CCR A;  2DIG A;  2DPP B;  5DLO A;  4JLG A;  3OY9 A;  1WNL A;  1X01 A;  3JCM b;  2C06 A;  3VU3 C;  2MI6 A;  2RHI A;  5LJ5 f;  5LJ3 d;  3GLX A;  4ZGE B;  3OA6 A;  3JB9 F;  1G5V A;  4V2S A;  1N6A A;  3L2V A;  3PTA A;  3LLR A;  4C8Q B;  3CBP A;  1G3Y A;  4OMF B;  1VIE A;  4F7U F;  2XD0 A;  3ZFJ A;  4M7A E;  4IUV A;  4C5I A;  4M7A A;  3QZ9 B;  5KE2 A;  2MMP A;  3NFC A;  1VQ5 T;  2M16 A;  1QVP A;  3A8H B;  3M53 A;  2D9T A;  2JZ2 A;  3BFM A;  3MP1 A;  3UPU A;  1VIF A;  2CKK A;  4RCC A;  5GAM f;  3QKJ A;  4QQD A;  3JCM J;  3RUX A;  2DAQ A;  5CQY A;  4C0G A;  2KAF A;  5CK9 A;  3QYG B;  3G4S A;  5HY6 A;  3JB9 I;  5GAM d;  3C94 A;  4GLK A;  3JCM e;  4C5H A;  2JUF A;  2JNG A;  4HT9 A;  4IUT A;  5CO7 A;  4MMK A;  3CCE T;  1KG1 A;  2HD0 A;  3SB2 A;  4JRQ A;  3C4S A;  3PIO A;  1QP2 A;  2E10 A;  4ZTJ A;  3L2Q A;  4BI3 A;  4F7U E;  4P5N A;  2D6F A;  2HQX A;  2XK0 A;  4A4G A;  3CC7 A;  4OB2 B;  2OTL T;  3MP6 A;  4JLI A;  3UWN A;  3MEU A;  4FT4 A;  5A0L A;  4XTW A;  1PSE A;  2VGN A;  3CPW A;  1WQ7 A;  4M7D G;  1WGS A;  3C12 A;  5CQX A;  1VQ4 A;  4LDV A;  1YJN A;  1NJI C;  5IAY A;  3CCR T;  2XG8 D;  4OB3 B;  4PJO G;  4BAC A;  3CMA A;  4C8Q E;  3BW1 A;  2HBP A;  4JJN K;  2E70 A;  4BD3 A;  1VQ7 T;  4M78 F;  1QVG S;  2K5L A;  5GMK e;  2RHX A;  2DVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...