5LJ3h

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3h00
1X01A 4M77E 3BDUA 4M7DF 3JCMb 4N0AC 3L2ZA 4OP0A 3RESA 4EMGA 4QVCA 4NL3A 5LJ5d 2E41A 2E65A 2Y90A 1JBMA 3AHUA 5GAN7 3SWNC 1Y96B 5GANf 4JRIA 4M78D 1I4K1 4M78B 4M7DA 4M75F 4EMKA 2HNIA 5GAOn 1B34B 1LNXA 3JCMh 4QVDA 4F7UB 3JCMJ 1BIBA 4XU2A 4C92C 3JB9D 3BY7A 5GAN4 3FJPA 3EFSA 2I2LA 5GAOl 3JCMX 1WQWA 2DZCA 4WF2A 2EJFA 4J6XA 3RUXA 4C92E 1JRIA 1BIAA 5GANd 2EJGA 3EFRA 3FB9A 1U1SA 5GAN6 5GAOp 2VXFA 3JCMP 1MGQA 1N9SA 3BW1A 4C8QC 4M7DD 1B34A 3V8KA 1KQ1A 2DKGA 4F7UA 3RKWA 4PJOF 1HXDA 2EWNA 5GMKm 4M7AF 2EJ9A 4M77F 4C8QE 2JN0A 1HK9A 1WNLA 3HFNA 4J6WA 4A54A 3QO3A 1N9RA 1H641 3M4GA 4M78G 2DTIA 2FB7A 4M75D 1WPYA 3FIFA 4M75B 5LJ3h 4F7UG 4M78E 1I8FA 3JCMf 2DTOA 4JRKA 3JB9G 4PJOA 1D3BB 2RM4A 4A53A 2RA2A 4XTZA 5CAIA 4EMKB 3JCMe 2RB6A 1M8VA 4XTVA 4HT8A 2DZ9A 3JB9J 2ZGWA 3JCMg 3PGGA 2DTHA 5GAMe 1WQ7A 4N0AA 3L1AA 2DVEA 4PNOA 1LJOA 5GAMh 4XTWA 3JB9I 4C92F 4XQ3A 5LJ5h 2VC8A 4EMKC 2DJZA 5GMKl 3JCMd 5GAMg 4M7DG 5GAMj 4M75A 3SWNA 3RIRA 4M7AD 4PJOD 4M7AB 5GAN3 1D3BA 2FYKA 4M77D 3VU3C 4M77B 2RD1A 4XU0A 2E10A 5GAOr 4M7DE 1YCYA 3V7RA 4RCBA 4M7AE 5GAN2 4C8QF 4M75G 4NL2A 1I5LA 3INZA 3V8LA 2YHTA 4M78C 2K57A 5LJ3e 4HA8A 4XU3A 3SWNB 3RKYA 4MMLA 4M7AA 4M77A 5LJ3g 4C8QA 4F7UE 5LJ3j 5GAOq 3JB9H 5GAMf 4C92D 1M5Q1 3JCMc 2DXTA 2EAYA 3V7CA 4C92B 5LJ5f 5GMKe 2DEQA 4PJOG 5LJ5e 5GAOm 3V7SA 5GMKh 4M77G 3JCMQ 4M7AG 4M7DC 2E1HA 3HFOA 4J6YA 1I81A 5LJ5g 1U1TA 4PJOE 3HSBA 4RCCA 2CGHA 5GMKj 5LJ5j 5GAN8 4HT9A 3RKXA 5DY9A 4C8QD 1LOJA 4C8QB 5GAMd 3JCMW 4XTYA 4C92A 4M75C 2YLCA 4EMHA 4MMKA 4JLIA 2VXEA 5I21A 4V2SA 5LJ3f 5GANe 4M75E 3SB2A 5GANh 4XTXA 5GAN5 2E64A 5GANg 4M78F 1TH7A 3QSUA 5GANj 4C92G 4DQ2A 3JCMV 3QUIA 4F7UF 3GIBA 3JB9F 4PJOB 4X9DA 2QTXA 4JUVA 4XU1A 5GMKi 1Y96A 4X9CA 5LJ3d 1KQ2A 3BFMA 4M7AC 4PJOC 4J5YA 4M77C 2YLBA 4M78A 3V8JA 3RERA 4XTUA 4M7DB 4NOYA 4Y91A 2DXUA 4C8QG 3QHSA
chains in the Genus database with same CATH superfamily
3OYFA 3CMAA 1Z9ZA 1K0SA 1G5VA 3RESA 4QVCA 2COWA 3VS0A 1NLPC 1CKAA 1WIEA 3PE0A 2CREA 1YJWA 2IG0A 4KT0E 2COYA 1BI3A 5GAOn 1B7TA 1X6OA 2QK0A 2DEUA 2XDBA 1VQLQ 2V1QA 2DXBA 3RKWA 3ZBDA 4BY6B 1M27C 3EHQA 3JV3A 4F7UG 1I8FA 1PC0A 2RB6A 2RHXA 4XTVA 1SF9A 4F17A 2JS2A 2KK4A 4KBMB 1WQ7A 1NZ9A 3WXMB 3MEUA 5GMKl 3VS6A 3CQTA 1E6HA 2XDDA 2FYKA 5KYWB 4J9HA 2NUTB 4PFOA 1Y07A 1WYXA 1KHCA 1VQ9A 1WXBA 1VQ7A 5A2QE 1YWOA 2DYIA 4OMOA 1W6XA 1WJRA 3HRSA 2KDSA 4HVUA 4QQDA 4C92B 1RAGB 4JPBW 1UGRB 2BZYA 4FW2A 2E1HA 4DEYA 4PJOE 3RNJA 3CMAQ 2X35A 1G3SA 1YCSB 1VQ6Q 1UEBA 4K11A 3SHWA 1YJ9T 4IUQA 3PVLA 3CBPA 3SB2A 3F70A 3QJ6A 3OYKA 4ELZC 2LQWA 3NMZC 2MPXC 4NS5A 4X9DA 2QA4A 1Y96A 1ZBXA 1X6BA 4FU6A 1PHTA 2OJ2A 1VQPT 1QW1A 1YJNA 5KCHA 1EX4A 2RJEA 1N27A 2CYZB 2E65A 3E19A 1OI1A 1X2KA 2XD0A 4JJCA 2DE0X 2HQEA 4M78D 2M0OA 2HNIA 4MZPA 1K9MU 2KXCA 3JB9D 3DKMA 3J80E 4BE1A 2O31A 2VGMA 1M90C 2BKDN 1G8XA 1E7OA 1KQSP 3CCSA 1D0ZA 2J6FA 1OZ3A 3UATA 2GNCA 1VQ7Q 2L5QA 1BI2A 1UUEA 4MZMA 4KRTA 3M9QA 5FROA 2X3XD 3OYDA 2YSQA 3TEEA 4RTXA 3CMET 1D1AA 1GFDA 2Y4YA 4JDSA 1NJIR 4A4FA 2EQKA 3CPWA 1PG5B 4DBHA 4MDXA 4M7DE 4M77B 2RD1A 1P92A 3EG1A 5FU6B 3EAEA 2W0ZA 3M5AA 3QWYA 1VQOT 2CP7A 2XKOC 2LX7A 1QVGP 4L6V5 1KFZA 2DD5A 2X9HA 1WA7A 4C5EA 2IIMA 5LJ3g 3GOXA 2P4RA 1PCXA 2QA4Q 2EYWA 1YP5A 2P4TA 1JO8A 1AEYA 2J6KA 1KQSA 1VOMA 1PSEA 1YJNQ 4FT2A 4KUDK 1QWEA 3A8MB 3ULRB 3LLRA 4OVAA 2EYZA 4JJDA 4IIOA 4AFQC 2VXEA 2KYMA 1M1GA 4JRPA 5LJ3f 2KYBA 2KBTA 1SSHA 3CCQA 1FX7A 2K5LA 3QUIA 1JU5C 1UHCA 4R55A 2QQAA 1MMNA 3BFMA 5FRMA 2GTJA 3UA6A 4M7AE 4RTUA 5I2MA 1VQLT 2E3IA 1UTIA 4JJNK 2ROLA 1Y96B 1I4K1 3GNFB 4EMKA 4L59A 5CO7A 2KAFA 1DJ7B 3EG0A 1PD1A 3EFOA 5GAOl 2M16A 1WHMA 2LCCA 1EFNA 1U1SA 2V1RA 3MJXA 2H8HA 3CCRA 4M7AF 1SG5A 4C5IA 1HK9A 2CT4A 2K3YA 3A1PA 2AKKA 2RN8A 1H641 2ATCB 5KYUA 3A8GB 2D0QB 3M0PA 2OX7A 3A8OB 4M4ZA 2K3BA 3REBB 4FM4B 2GGRA 4VUBA 1S72Q 3ZEHA 2QQSA 3VS3A 2WACA 4O5VA 1RL2A 2EIFA 2QQ9A 3JCMd 1Q82R 2JZ2A 1D3BA 1RUWA 1V76A 3S3OA 1Q82U 3CMAT 1X6GA 2M02A 1RAAB 5KH6A 3CCQQ 5HKCA 1YJWT 1OYXA 3VKIA 2O9VA 2MCNA 5FU7B 2DBKA 1AZEA 2HL5C 5LJ5e 4PFZA 1V1CA 3VS7A 3JCMQ 2HKNA 1EIFA 4OMFB 5DY9A 4C8QD 3JCMW 4J7IA 4D6WA 4M75C 3CCEA 1B07A 4JZ4A 2E64A 2EVRA 1VQ8Q 4DQ2A 1YBYA 1GXIE 3DB3A 4A4GA 1YWPA 3TCJA 2YT6A 4OMLA 4J5YA 4HCZA 2X4XA 3RERA 4LD9K 2LNVA 4CC3A 4J9IA 1I5LA 1CSKA 1KSWA 2L3SA 2V8KA 4N0AC 4EMGA 2B8AA 1BKBA 1JBMA 1D09B 2EGCA 2CZ6B 3SWNC 4GLMA 1JEGA 1VQ9T 3LX7A 1MV0B 1VQ7T 1QVFP 1KC8R 2K5IA 3OMCA 4KH1B 3EFSA 2EYYA 1I0CA 1KC8U 4F14A 3FB9A 2ESWA 5IHNA 3OS5A 2RO0A 1B34A 4KUIA 4OB1B 1C6VX 2XIDA 1SHGA 4LDXA 1WHJA 3KFVA 4AG2C 1B3QA 3FIFA 5CQXA 2KRMA 3HRTA 2DTOA 1BU1A 1XQHA 4LN2A 4E7SA 1M90R 2HQHA 1NPPA 5D6XA 1BI1A 2DBMA 4PNOA 1TOVA 2FRYA 5HY6A 5IH2A 4WCIA 1JB0E 2QA4T 5KYUB 3FC3A 4PJOD 2R58A 1WLPB 3CEYA 1UGSB 1FMKA 2P84A 5I22A 3OYBA 1YJNT 5GAN2 3CCEQ 1IZ6A 4B9WA 1RAIB 2JMCA 2DX1A 3M0UA 2J06A 5AYFA 3L2QA 5J3BA 1QVFA 3I9QA 1QWFA 2RJDA 2RQRA 2DXTA 3MP1A 4M7AG 1VQ4A 2EKOA 4HKEA 4ZGEB 1BB9A 3SDZA 2ZPIB 3PT9A 1YFNA 1BK2A 2KXDA 2VYTA 2CP5A 3CCST 2QDLA 4JLIA 5KE2A 2NUZA 3OS1A 5GAN5 5FW9A 3M0QA 2D6FA 4M78F 4B9XA 2DERA 2KRSA 4JS4A 2FZCB 5CVIA 3JB9F 2QEXA 5C0MA 4BE2A 3QYHB 4E7HA 3H9NA 1JJ2P 2YLBA 3OSVA 3AT1B 3I56A 2G6FX 4GLKA 4BE0A 2JNGA 4PK4A 2HZYA 1SEMA 2KEAA 2O01E 3UA7A 1MV3A 2RJCA 1Y71A 3TSWA 3LH0A 3BY7A 1K9MC 2L89A 3OW2S 1JRIA 2AZSA 5GAN6 1YHQA 1QKXA 2RHYA 4M7DD 1J3TA 3E2UA 2HBPA 1OU8A 2HKQB 3HFNA 1IHVA 2LJ0A 1HYOA 2A36A 3G7ZA 1D0XA 5A0LA 3A5ZB 2RA2A 2FG0A 3CCQT 2DNUA 2DZ9A 2PZ1A 4IUPA 3JCMg 2DD4A 1ZA2B 3FDRA 1JJ2A 1VQ4Q 3O5ZA 2ZPHB 1SPKA 3M54A 1HSQA 4QKUA 2EYXA 4RCBA 2XK0A 4NL2A 4Z88A 4CRIA 5KYWA 2F2VA 4F16A 2NUTA 2A37A 1WHKA 2L2PA 2QEXQ 1U8RA 1OX9A 2D8HA 4C92D 2EAYA 2DVJA 1GRIA 2X4YA 2BZXA 3OYAA 5LJ5j 5GAN8 4BDZA 2YWWA 3I56Q 1OEBA 1O9SA 4HVVA 4RG2A 3EH1A 2LQKA 4C92A 1YI2A 4PJJA 2PVOB 3C12A 1M30A 5GANh 2NYSA 1FMWA 1KHIA 2EKHA 4LUEA 2RMOA 1IREB 4FCYA 3CMEQ 3HHTB 3GIBA 1K73U 2FHDA 2SRCA 1VUBA 4X9CA 5LJ3d 1YHQQ 2X4JA 4ATOA 3M53A 2LQ8A 2KY9A 2SEMA 3CXCS 2X4WA 1VQOQ 3BDUA 2MK5A 3R6NA 4NL3A 2HQXA 4XAXB 4ESRA 4JRIA 1NLOC 1RAHB 3OYLA 1TTHB 3OYGA 2OTJA 2RHIA 3JCMX 3ME9A 3G4SA 4J6XA 4RTTA 2YUQA 4FYYB 1AVZC 1Q95G 4C8QE 1NYFA 3H8ZA 2JOYA 1W2BA 3M4GA 4M78G 1K0XA 3CCUA 3CCET 3CBMA 2QQRA 4ZN3A 5FWBA 3JB9G 1RAFB 2RM4A 3O8VA 4OF1A 3RR6A 1PKSA 1QP3A 3G1JA 4E2FB 3JB9J 3PGGA 5J26A 4N0AA 5GAMh 3ASKA 5LJ5h 2VC8A 2V26A 3SWNA 2GFAA 4M77D 4IURA 3CCJA 4PJLA 4C8QF 1Q82C 1ZUUA 5KCOA 3CCVA 4M77A 3C94A 3MPUB 1UDLA 5GAOq 3QWXX 4LNPA 2Y4XA 2XICA 4J9BA 2A28A 1OX8A 2BTTA 1RLQC 2P0KA 1G3WA 1U1TA 3HSBA 2CZ0B 1MNEA 2DL3A 1FWZA 3CC2A 3PFSA 3H0HA 3HKSA 5CCAA 3MEWA 1RABB 4X1VA 3X26B 1H3ZA 4CI0C 5GANg 1TH7A 1K76A 2QTVA 5CKBA 3KXTA 2QTXA 1NG2A 1G3TA 2DXUA 1FMVA 3P8BB 5GAN7 5GANf 1YJWQ 3LH5A 1IHWA 1M3AA 4Z02A 3JCMJ 4QVDA 5M9OA 1GL5A 2KVQG 1RACB 3FRNA 1BIBA 1OPLA 2KSSA 2EJFA 2DILA 3PMIA 1VQ5A 1KC8C 2ZAEA 1QMCA 1VQ4T 1BYMA 1X2QA 4KGXB 4RTVA 4PJMA 2CH4A 4PJOF 2EGAA 2JMAA 5GJVB 1ABOA 1Q86R 4AT1B 3QO3A 2R57A 1K9MR 4M75B 2HSEB 4AG1C 3KUFA 1Q86U 1NE8A 3IQLA 5CR2A 3QZ9B 1QLYA 4HT8A 2DTHA 2L8DA 2VKNA 2QEXT 4XQ3A 5GAMg 4PJNA 4MZTA 2AKLA 2KR3A 1AZGB 2VV5A 3I56T 3OYCA 4TVRA 3INZA 1VQ9Q 2LCLA 1T0HA 2YXYA 3SWNB 3RKYA 1NM7A 5GAMf 1TXQA 4N4HA 5I2SA 3GF5A 5LJ5f 3SD4A 1SSFA 3J7AF 5GMKe 2PNIA 4E47A 1YHQT 2ZPGB 3I55A 1MHNA 4C0FA 2FPEA 1QKWA 4LE9A 1WI7A 3CC7A 2LMJA 3UT1A 1R0CB 2DL4A 2QI2A 2X3WD 3E9GA 4E7ZA 5L8RE 1KQ2A 1OPKA 1VYTA 3EHRA 1WQWA 4C8QG 4PKCC 4M7DF 5KYYA 4IUVA 3TREA 2CH4W 2JTMA 4BDYA 3CD6A 3PIOA 2C06A 3BE3A 2LCSA 1LNXA 3L2RA 2RJFA 3FJPA 3CCMA 4B6MA 2O9SA 4C92E 1BIAA 5GAOp 1VIEA 3CCSQ 1WZOA 3OBWA 4J9FA 4A4EA 3D7SB 1QVGA 2R5MA 2FZGB 1UGVA 1UECA 5DLQE 5CAIA 1UJYA 2E5QA 3JRZA 3HP9A 2JS0A 2E12A 5L23A 2I0NA 4C92F 1Q7YR 1H3HA 4JJBA 1Q7YU 3I55Q 4A4KA 2A3LA 2HBWA 1M2OA 3PMTA 4HCKA 1Z9QA 2K4YA 4BD3A 1O75A 3PTAA 2R5AA 1BI0A 1D1BA 2DFUA 3NFCA 2LZ6B 2EYQA 3OB9A 2NLUA 1GBQA 5IAYA 1D1CA 1EZZB 3JCMc 2XHCA 1H8KA 2DO3A 3SEMA 1GBRA 2DEQA 4PJOG 3G4ST 1N8RR 2E6ZA 4FSSA 4J6YA 1VYVA 1QQJA 3QBYA 1YN8A 1N8RU 3QJYA 1QCNA 3X20B 4QW2A 1PRMC 3OW2P 1WHLA 5ECAA 2Z0WA 1OULA 5CKDA 2BE7D 2CSQA 1VQMA 5DLOA 2FZKB 4QQGA 1K73C 4M7AC 2GQVA 4ZN1A 2K5FA 8ATCB 2P0PA 4M77E 1NBEB 1YIJA 2DPPB 3A8LB 3RMQA 1RI0A 2C0IA 1ZLMA 2EGEA 5CKHA 3CPWS 3REAB 3L2VA 3MO8A 1M1FA 4F7UB 4FIBA 4ZGDB 2OI3A 4L5GA 5KYYB 3L2WA 2I2LA 3OQ5A 2DF6A 2CZ1B 2IPOB 3EFRA 2JM8A 2M9UA 2FRWA 1JQQA 1ZUYA 2M1HA 2MI6A 3CCRQ 2EWNA 4M77F 2HMAA 3CC2T 2RK1A 3OW2A 2RQTA 3RDVA 1ARKA 4DBRA 2D8JA 3NTHA 1TG0A 2LNHB 2B86A 3UF4A 1QP2A 1WJSA 1K1ZA 1M1KR 3OYEA 1MUZA 4M7DG 3OYJA 4ME7A 2CS7A 1G2BA 2NWMA 2QASA 5GAOr 1M1KU 5AT1B 3P8HA 4E7IA 1T0JA 1WHGA 2AHJB 2D9TA 2DMOA 1XJWB 5LJ3e 1K4US 1VQMQ 3CXCP 2M0YA 3NHNA 3S6WA 3CBOA 4JLGA 5C6SA 1BCMA 2DRMA 5GAOm 1VQ5T 1JXOA 1I81A 5GMKj 4HT9A 2KQWA 2LC4A 3R6OA 5KE3A 5CKEA 3S3MA 5I21A 1PD0A 3MEAA 1D0YA 5FRNA 4C92G 3JCMV 3M0RA 4DEXA 2VVKA 3KBGA 4Y91A 3RBBB 2K79A 3MHXA 1M2VB 3C0CA 2ROTA 3HRUA 2K9GA 2CDTA 3AHUA 3TU4K 5KYXB 3OS0A 2FO0A 1TWBA 2K3XA 2KI7A 1TSFA 3EGUA 1VYUA 3VYGA 2PVDB 2DZCA 5CQYA 2YRVA 4GY5A 1VQPA 5GANd 5A0GA 3VS4A 1M9SA 3LYIA 5IHKA 2RHZA 3OYIA 3GNGA 4C0DB 2O4XB 3I55T 2JN0A 1WNLA 4JRQA 2J05A 3EG9B 4IIMA 2E6NA 4J9GA 2RNAA 2RF0A 2DLPA 2CP0A 1Q86C 4LDUA 3QG1A 4Z8AA 1Q81C 3OBYA 1ZSGA 1MMGA 3VRYA 2DA9A 2F5KA 2HAXA 4FW1A 2DK3A 3TVTA 2DL5A 3FJ5A 3V7RA 4EIKA 5HK3A 3JAME 1UB4A 2JT4A 4HXJA 4M78C 1AHJB 2VASA 3VV0A 2PQWA 1MMDA 2JUFA 1OQKA 3EG3A 1M5Q1 4E7JA 4E7KA 4FYWB 3OS2A 2LJ1A 2LDMA 4M77G 4OMMA 3MP6A 6AT1B 2EW3A 5GAMd 1KIKA 1GCQC 4XTYA 2ABLA 4ORZA 1X75C 2KT1A 4EMHA 4EPCA 3G6EA 4RUGA 3OMGA 4OMQA 2FVUA 1X43A 2BUDA 2ZCFB 2JTEA 3LW5E 4RTWA 1NPRA 1HJDA 4LDVA 4C0GA 3L2ZA 3CCRT 1NEBA 2E41A 2FL7A 2A0FB 1ABQA 4N4IA 3UDCA 2KE9A 1AWXA 1QCFA 2JW4A 1K73R 3H0IA 2IVWA 2PTKA 4XU2A 3I5SA 1M3BA 4A63B 1T3LA 3EGXB 2EQJA 1ZA1B 3VS2A 2WSEE 3GLXA 5LL6S 4OB2B 1Y7XA 3PVQA 4CC4B 4M75D 2HSPA 3NTKA 2AZVA 2NUPB 2GQIA 1V29B 2XMFA 4ZGJB 4OB0B 1VQMT 2ED1A 1PWTA 1LJOA 2RQUA 4QVZA 4EMKC 2MMPA 4M75A 1MNDA 2OAUA 3CPFA 5HCKA 3NTIA 4MDWA 4ELYC 1Q7YC 1YCYA 1K9AA 1UG1A 1U3OA 5EC7A 2H3EB 2YHTA 4OGCA 4IUUA 3TQ7P 5LJ3j 1K8AU 3X25B 4O6JA 4DOWA 1UJ0A 2PUKB 4J9CA 1IXDA 2CGHA 1U06A 3PNWC 3RKXA 2QQBA 1LOJA 1VQ6A 1N8RC 3Q1JA 2PU9B 1SRMA 1YI2Q 1OZ2A 1FYNA 1WHHA 5D6YA 4XTXA 4KULA 1OU9A 4XU1A 3NPFA 1ZSZB 2RI3A 4M7DB 4NOYA 1E6GA 2F1LA 2LP5A 4C0DC 2A08A 3THKA 1WXTA 4AFUC 4PLIA 1N5ZA 2KMTA 1JJ2S 2JTFA 3MP8A 1VA7A 2OTJQ 2C0TA 3RUXA 3G4SQ 2ZPFB 2EJGA 3CCLA 1AWWA 2VXFA 1N9SA 1VQKA 4C8QC 2FPDA 1G3YA 2A7YA 1HXDA 1PSFA 4XK8E 3LGFA 3TSZA 2GBQA 1WJQA 1WX6A 2CP2A 1KJWA 3CCUQ 1WPYA 5LJ3h 2DIQA 2H3JA 4JRKA 3JCMe 2OTLA 1R8OB 2QDYB 3I5RA 1FXXA 2VUBA 2GFUA 3M0TA 4Y92A 4RKUE 2F69A 2DJZA 4BI4A 2ECZA 3M56A 2RQVA 3OA6A 4M7AB 2E10A 2HD0A 3CCJQ 3UPUA 1M1KC 2J7IA 3HTRA 4ZNXA 3QKJA 4C0ZA 3J81E 3CCVQ 1RAEB 3H0FA 3EGDA 4XU3A 4MMLA 3I35A 1Q81R 1UFFA 2QGGA 2RI5A 2EQIA 4JZ3A 2QGFB 1Q81U 3V7CA 1A0NB 3RMSA 2GCXA 3CPWP 2F2WA 3GBQA 3QZ5B 5LJ5g 4QQ6A 2CP3A 3CC2Q 4BI8B 1W1FA 3N5BB 1GCPA 1QVPA 2HEQA 4DA4A 1I5OB 2MYSA 3QPHA 5DM7R 2C0OA 3G71A 4OGEA 2K7AA 2YRCA 4AFZC 9ATCB 1W2BS 4FYXB 1WDXA 3CCLQ 4PJOC 1F1BB 4OMPA 3GP8A 2DYBA 4M78A 3V8JA 2KRNA 1SRLA 1VQKQ 3VS5A 3H6ZA 2VB6A 1RI9A 4LUDA 1G83A 2Y90A 1IB8A 3SFMA 3C4SA 5KYNA 4KGZB 2L0AA 2OTLQ 3OSSC 2DL8A 2EPDA 4UC4A 3FLGA 4BUGA 2QAZA 1GCQA 2KROA 1VQ5Q 3ZL7C 3L42A 1ZX6A 3JCMP 3M58A 1NJIU 3T9NA 4F7UA 5GMKm 2BE9B 2RI2A 3URGA 2EBPA 4A54A 7AT1B 3CC4A 3FEOA 2CT3A 3G6ET 2PVGB 3QDRB 1S72A 2QG9B 3HL8A 1KD1R 1VQNA 4J9DA 3RIRA 3JSCA 3C95A 1AT1B 2YUPA 4XU0A 1KD1U 1H92A 4ANJA 4GBQA 3X24B 2PUOB 2HDAA 3VUZA 2K57A 2DIGA 3G71Q 1YI2T 2V8IA 4HVWA 2WSCE 3QDFA 5IN1A 1SKUB 1MMAA 4DBQA 2LT1A 5IXBA 1ZSZC 4A4HA 4M7DC 2DJQA 1X69A 3DLMA 2AT1B 5HK0A 2L3PA 3EGDB 4J83A 4BY6C 2DRKA 1HD3A 1T3SA 2YUOA 2X51A 1IGUA 4FL6A 2DM1A 4QT7A 3OYYA 1X27A 5GANe 4DOVA 4M75E 1S1NA 3CC7Q 3QXEB 4J8OA 2D1XA 1VQ8A 3QSUA 2JM9A 2OTJT 4FSXA 5IXFA 4WTOB 1GFCA 3WVEB 3MKDA 4KH0B 1X01A 3U23A 4OP0A 2HL3A 4FYVB 3CD6Q 3PIPA 2RPNA 3M0SA 3CC4Q 3LGLA 4RTYA 4M78B 1YNZA 4M75F 3CCUT 4C92C 2MOXA 5J39A 1M2VA 4AFSC 4Z89A 3CCMQ 2F5TX 3VUBA 1VQNQ 5KYXA 2L3RA 2JXBA 1XNIA 3GPLA 4FT4A 2LTOA 4LXCA 3CCJT 2LT4A 1VQ6T 1AWOA 2FEIA 1TS9A 2DTIA 4RG8A 4D8DA 2GF7A 4KGVB 3CCVT 1XTDA 1M8MA 1UGPB 2O4XA 3VS1A 5GAMe 1QCOA 4OB3B 1YITA 4XTWA 2CUBA 3DB4A 3EG9A 1OOTA 3JB9I 4IKFA 3MCAB 1CKBA 3X28B 2LX9A 3V8LA 2F2XA 3WVDB 1KQSS 1Y0MA 4C8QA 4OMNA 3ZFJA 1JXMA 1K8AC 2M51A 4Y28E 4E7LA 2LJ3A 1VIFA 2VWFA 4RMOA 2CUDA 3CCLT 1XOVA 1PNJA 1VQKT 2XDPA 5D6WA 4LDWA 1IRXA 2G3RA 2CKKA 3EG2A 2LVMA 3VRZA 1NEGA 2OTLT 1C1AA 4P5NA 5GMKi 5IT9E 3S3NA 2QXFA 4M77C 1QVGS 4BB7A 4J9EA 2MF2A 5FU6C 4EMKB 3QHSA 2EQUA 2AK5A 3JCMb 1YIJQ 1RLPC 2MWPA 3EFOB 3M57A 2KNBB 3VYHB 4C5GA 1TUDA 1TUCA 2K6DA 4II1A 4PL6A 2BZ8A 1Y57A 3JCMh 4C5HA 2EFIA 3UWNA 1PRLC 2ED0A 5D7UA 1M90U 1YITQ 4WF2A 4RTZA 3ER0A 2JVVA 1N6AA 3V8KA 1KQ1A 2DKGA 3A98A 2K2MA 2CSIA 2EJ9A 2XG8D 2AIRB 3LWIA 1YJ9A 2W10A 3EGXA 5GAN4 4HCBA 4M78E 4PJOA 1LCKA 2CP6A 1D3BB 2MWOA 4A53A 2HCKA 3CXCA 1KG1A 3G71T 2ZGWA 2RQWA 1TUGB 2FPFA 4N4GA 2QYZA 5GAN3 3VU3C 3M55A 2NUPA 2E3HA 1WXUA 3HPWA 4CC7A 3LWHA 4M75G 1ZHIA 2KT8A 4E6RA 8AT1B 2V8JA 4HA8A 5CK9A 1TU0B 5CIUA 4F7UE 3JB9H 3CC7T 2XU8A 3MEVA 2L3QA 1SHFA 1ZBJA 4CC2A 5GMKh 3HFOA 1BBZA 2RK2A 3M59A 3OY9A 3E9FA 4C8QB 2D0NA 3OYNA 1U5SA 2WSFE 2J6OA 4V2SA 2ZPBB 2RH2A 3CD6T 3A8HB 1NYGA 1W4SA 3CC4T 5GANj 2MIOA 4F7UF 3CMEA 1BCOA 1UE9A 5FLXE 4JUVA 1S72T 4BI3A 3CCMT 4BACA 2JJ9A 2KGTA 1W70A 1M8VA 1VQNT 2LQNA 1UGQB 2O2OA 3META 3DLLA 1VQOA 5A0DA 2K2VA 1ZQ1A 1YJ9Q 1WFWA 2E4HA 5LJ5d 1IO6A 4ZTJA 1ZSZA 4M7DA 5FU7C 1B34B 2ZPEB 2E70A 1PKTA 1ZUKA 1VQPQ 3H41A 2CZ7B 4R56A 1IGQA 3BDLA 3NGPA 1MGQA 3BW1A 1AD5A 5GJWB 2YRDA 2COZA 2E5KA 1NJIC 2YDLA 4X34A 3VJPA 4J6WA 4YTLA 5EG2A 1I1JA 2OAWA 1R0BG 4IUTA 1N9RA 2FB7A 3OYMA 3JCMf 4XTZA 1AOJA 4ZTFA 1VQ8T 4JS5A 1KK7A 3L1AA 2DVEA 4F04B 2RHUA 4J7FA 5GAMj 4M7AD 4PJOB 1VQLA 1QVFS 1M3CA 2EQMA 2LRQA 2P0QA 2O88A 1KD1C 3L2UA 5IHIA 2DAQA 1W2BP 4Q5WA 3QIIA 5CKFA 1RADB 2DL7A 4LD6A 2ZZDA 3OYHA 4M7AA 3M4YA 2YUNA 3QYGB 1LVKA 5I11A 1WGSA 1OV3A 4HCCA 1I07A 3V7SA 1LPLA 1UHFA 2XI9A 3P8DA 4RCCA 4D8KA 2BIVA 3EH2A 4EDUA 4AMCA 2DETA 2ENMA 5FWCA 2YLCA 4MMKA 1YIJT 1M4ZA 3G6EQ 2DXCA 1K8AR 4PLLA 1R77A 4PFPA 2VGNA 1ACMB 2MAMA 1C0MA 2GTOA 3E1SA 4R0KA 4DBFA 1PM3A 1YITT 4XTUA 1AWJA 4LDYA
chains in the Genus database with same CATH topology
2P0PA 3H6ZA 4M77E 3OYFA 3CMAA 3I56A 4PJOD 4GLKA 1G5VA 3RESA 4QVCA 1YIJA 2DPPB 4BE0A 2JNGA 3A8LB 3RMQA 1RI0A 2Y90A 3SFMA 3C4SA 5CKHA 2O01E 3CPWS 3L2VA 1YJWA 2IG0A 4KT0E 3MO8A 1BI3A 5GAOn 2RJCA 1M1FA 3OSSC 1Y71A 4FIBA 4F7UB 3LH0A 4ZGDB 3BY7A 1K9MC 4L5GA 4UC4A 3L2WA 2I2LA 3FLGA 3OQ5A 4BUGA 2L89A 3OW2S 2CZ1B 1JRIA 1X6OA 3EFRA 5GAN6 2M9UA 3L42A 1YHQA 2XDBA 3JCMP 2RHYA 3M58A 4M7DD 1NJIU 3T9NA 2DXBA 2M1HA 3RKWA 2MI6A 3ZBDA 2EWNA 4F7UA 5GMKm 4M77F 2HBPA 3CC2T 2RK1A 2RI2A 4BY6B 3URGA 3HFNA 3OW2A 4A54A 3G7ZA 4F7UG 5A0LA 1I8FA 3CC4A 3A5ZB 3FEOA 2RA2A 3NTHA 3G6ET 2RB6A 2RHXA 2PVGB 3QDRB 4XTVA 3CCQT 1M8VA 2DZ9A 4IUPA 3JCMg 1S72A 2DD4A 3FDRA 2KK4A 4KBMB 1WQ7A 1NZ9A 1QP2A 1WJSA 3WXMB 1JJ2A 3MEUA 3HL8A 5GMKl 3OYEA 1VQNA 4M7DG 2ZPHB 3OYJA 4ME7A 3RIRA 2CS7A 2XDDA 3JSCA 2FYKA 3C95A 5GAOr 1M1KU 3M54A 4XU0A 1KD1U 3P8HA 1Y07A 4E7IA 4RCBA 3X24B 2PUOB 1KHCA 2AHJB 2D9TA 2XK0A 4NL2A 1VQ9A 3VUZA 2K57A 2DIGA 5LJ3e 1VQ7A 4CRIA 5A2QE 1YI2T 2V8IA 3S6WA 1WJRA 2WSCE 2KDSA 3HRSA 5IN1A 3CBOA 1U8RA 4C92D 4QQDA 4C92B 2EAYA 4JLGA 5C6SA 2LT1A 1UGRB 5GAOm 4A4HA 4M7DC 3DLMA 2E1HA 1VQ5T 1I81A 4PJOE 2X4YA 5HK0A 3OYAA 5GMKj 5LJ5j 2X35A 4J83A 4BY6C 2KQWA 5GAN8 4BDZA 4HT9A 1O9SA 4RG2A 1G3SA 1UEBA 2LC4A 2LQKA 3R6OA 4C92A 5KE3A 1YJ9T 5CKEA 3S3MA 4IUQA 4FL6A 1YI2A 5I21A 3OYYA 3CBPA 5GANe 2PVOB 3C12A 4M75E 3SB2A 4DOVA 3F70A 3MEAA 3QJ6A 3QXEB 5GANh 1KHIA 4J8OA 3OYKA 5FRNA 4ELZC 1VQ8A 3QSUA 4C92G 3JCMV 1IREB 3HHTB 3GIBA 4NS5A 4X9DA 1K73U 2FHDA 2OTJT 4FSXA 1VUBA 2QA4A 1Y96A 4X9CA 1ZBXA 5LJ3d 3WVEB 3KBGA 2X4JA 4FU6A 4ATOA 3M53A 2LQ8A 1VQPT 2KY9A 1QW1A 4Y91A 3CXCS 2X4WA 1YJNA 1X01A 5KCHA 3BDUA 3MHXA 2RJEA 4OP0A 4NL3A 1N27A 2CYZB 2HQXA 4XAXB 2E65A 3HRUA 3E19A 1OI1A 3PIPA 3AHUA 3TU4K 2XD0A 3LGLA 2HQEA 4JRIA 4M78D 4M78B 3OS0A 2M0OA 4M75F 2HNIA 4MZPA 2K3XA 3OYLA 3CCUT 1K9MU 3OYGA 4C92C 3JB9D 2OTJA 3DKMA 5J39A 3VYGA 3J80E 2PVDB 2RHIA 3JCMX 2DZCA 2F5TX 4BE1A 3ME9A 5CQYA 3G4SA 2YRVA 4GY5A 4J6XA 3VUBA 5GANd 2VGMA 1VQPA 1M90C 2BKDN 5A0GA 2L3RA 1M9SA 1XNIA 3LYIA 2RHZA 3GPLA 4FT4A 3OYIA 3GNGA 2LTOA 3CCSA 4C0DB 2O4XB 4C8QE 3I55T 1OZ3A 2JN0A 1WNLA 3CCJT 2LT4A 2JOYA 3H8ZA 4JRQA 1W2BA 1VQ6T 3M4GA 4M78G 2DTIA 3CCUA 2E6NA 4RG8A 3CCET 2L5QA 3CBMA 2QQRA 2GF7A 4ZN3A 1BI2A 3JB9G 2RM4A 3O8VA 4MZMA 3CCVT 4OF1A 1Q86C 4LDUA 1XTDA 1QP3A 3QG1A 1UGPB 2O4XA 3M9QA 5FROA 3JB9J 3PGGA 3OYDA 1Q81C 5GAMe 5J26A 4N0AA 4OB3B 3TEEA 5GAMh 3CMET 3OBYA 4XTWA 3DB4A 3JB9I 1YITA 3ASKA 5LJ5h 2VC8A 2Y4YA 4IKFA 2F5KA 4JDSA 3MCAB 2EQKA 4A4FA 3CPWA 2HAXA 3SWNA 2DK3A 2GFAA 4MDXA 4M7DE 4M77D 4M77B 2RD1A 4IURA 3X28B 3CCJA 2LX9A 1P92A 5FU6B 3EAEA 3M5AA 3V7RA 1VQOT 5HK3A 4C8QF 1Q82C 3JAME 1UB4A 4M78C 3V8LA 5KCOA 2XKOC 3CCVA 1AHJB 3WVDB 4L6V5 1KQSS 2DD5A 3VV0A 2PQWA 4C5EA 4M77A 3C94A 5LJ3g 3GOXA 4C8QA 5GAOq 2JUFA 2Y4XA 3ZFJA 1K8AC 1M5Q1 4E7JA 2XICA 4Y28E 3OYMA 4E7LA 4E7KA 2P4TA 1VIFA 3OS2A 4M77G 2LDMA 4RMOA 2P0KA 1KQSA 3MP6A 1U1TA 1G3WA 1PSEA 1XOVA 2CZ0B 4FT2A 3CCLT 3A8MB 3CC2A 1FWZA 4KUDK 3HSBA 3LLRA 3PFSA 1VQKT 5GAMd 4OVAA 3HKSA 5CCAA 2XDPA 4XTYA 5D6WA 3MEWA 1X75C 4EMHA 4LDWA 2VXEA 4JRPA 1M1GA 2G3RA 4EPCA 5LJ3f 3X26B 2CKKA 3G6EA 1H3ZA 4CI0C 3OMGA 3CCQA 1FX7A 2K5LA 5GANg 1TH7A 2LVMA 3QUIA 5CKBA 3KXTA 2FVUA 2OTLT 4R55A 2QTXA 4P5NA 5GMKi 5IT9E 3S3NA 2QQAA 3BFMA 2QXFA 2BUDA 2ZCFB 4M77C 1QVGS 4BB7A 1G3TA 5FRMA 2MF2A 2DXUA 3LW5E 3QHSA 5FU6C 4EMKB 4M7AE 2EQUA 5I2MA 1NPRA 1VQLT 4LDVA 3JCMb 4C0GA 3L2ZA 2MWPA 3CCRT 4JJNK 2E41A 3M57A 2FL7A 3P8BB 3UDCA 4N4IA 3VYHB 4C5GA 1Y96B 5GANf 5GAN7 4II1A 1I4K1 3GNFB 4PL6A 4Z02A 4EMKA 3JCMJ 4QVDA 5M9OA 3JCMh 2KVQG 3FRNA 1BIBA 2IVWA 4L59A 2KAFA 2KSSA 4XU2A 2EFIA 5CO7A 3UWNA 4C5HA 1DJ7B 5GAOl 1M90U 2M16A 4WF2A 2EJFA 3ER0A 3PMIA 2LCCA 1VQ5A 2EQJA 1U1SA 1KC8C 2JVVA 1VQ4T 1BYMA 1N6AA 3V8KA 1KQ1A 2DKGA 2WSEE 3CCRA 4PJOF 4M7AF 2EJ9A 2XG8D 3LWIA 1YJ9A 4C5IA 1HK9A 2K3YA 3GLXA 3QO3A 5LL6S 4OB2B 1H641 1Y7XA 2R57A 4M75D 3A8GB 4M75B 5GAN4 4HCBA 4M78E 4PJOA 3KUFA 1Q86U 2D0QB 3NTKA 1D3BB 1NE8A 2MWOA 3A8OB 4A53A 3CXCA 5CR2A 3QZ9B 1V29B 1KG1A 4FM4B 4ZGJB 4OB0B 3G71T 2ZGWA 4VUBA 4HT8A 2DTHA 1VQMT 3ZEHA 2QQSA 1LJOA 2L8DA 4QVZA 2WACA 2QEXT 4XQ3A 4O5VA 4EMKC 5GAMg 1RL2A 2EIFA 2MMPA 2QQ9A 3JCMd 4M75A 4N4GA 2OAUA 2JZ2A 3CPFA 5GAN3 1D3BA 3NTIA 3VU3C 4MDWA 3M55A 4ELYC 4MZTA 3HPWA 1Q7YC 1YCYA 3LWHA 3S3OA 1Q82U 3CMAT 2VV5A 3I56T 3OYCA 4TVRA 4M75G 1ZHIA 3INZA 2YHTA 2LCLA 5KH6A 4OGCA 2V8JA 4HA8A 5CK9A 5HKCA 3SWNB 3RKYA 4IUUA 1YJWT 1OYXA 3VKIA 5CIUA 4F7UE 5LJ3j 3JB9H 1K8AU 3CC7T 5FU7B 5GAMf 2XU8A 4N4HA 3X25B 3MEVA 3GF5A 4O6JA 5I2SA 5LJ5f 3SD4A 4DOWA 1SSFA 3J7AF 5GMKe 5LJ5e 2PUKB 5GMKh 3JCMQ 3HFOA 1EIFA 4OMFB 2RK2A 4E47A 1YHQT 2CGHA 2ZPGB 3M59A 3PNWC 3OY9A 1MHNA 3E9FA 4C0FA 3I55A 3RKXA 5DY9A 2QQBA 1LOJA 4C8QB 4C8QD 1VQ6A 1N8RC 3JCMW 3Q1JA 4J7IA 2PU9B 4D6WA 3OYNA 4M75C 2WSFE 3CCEA 4V2SA 2ZPBB 1OZ2A 2RH2A 3CD6T 3A8HB 1W4SA 5D6YA 3CC7A 4XTXA 3UT1A 2E64A 3CC4T 2QI2A 4DQ2A 1YBYA 3E9GA 3DB3A 4A4GA 5GANj 4F7UF 1GXIE 3CMEA 3TCJA 4KULA 5FLXE 4JUVA 4XU1A 1S72T 5L8RE 4BI3A 1KQ2A 3CCMT 4J5YA 4HCZA 4BACA 2X4XA 2RI3A 4LD9K 3RERA 4M7DB 2LNVA 4NOYA 1VQNT 1WQWA 4C8QG 4PKCC 1UGQB 4C0DC 3META 1VQOA 3DLLA 1I5LA 5A0DA 2K2VA 2V8KA 4M7DF 1ZQ1A 4N0AC 4IUVA 4EMGA 3TREA 2B8AA 1BKBA 5LJ5d 4PLIA 1JBMA 2KMTA 2JTMA 4BDYA 1JJ2S 3CD6A 2JTFA 3MP8A 2CZ6B 3SWNC 4ZTJA 1VQ9T 3PIOA 4M7DA 3LX7A 2C06A 5FU7C 1B34B 1LNXA 3L2RA 1VQ7T 2RJFA 2K5IA 3OMCA 3FJPA 3EFSA 3CCMA 2ZPEB 2E70A 4C92E 3RUXA 2ZPFB 1BIAA 1KC8U 2CZ7B 2EJGA 3FB9A 4R56A 3CCLA 5GAOp 3BDLA 2VXFA 1MGQA 1N9SA 1VIEA 3BW1A 3OS5A 2RO0A 4C8QC 1VQKA 1B34A 1G3YA 2A7YA 4KUIA 4OB1B 1HXDA 1PSFA 4XK8E 3LGFA 2XIDA 1NJIC 4LDXA 4X34A 3VJPA 1WJQA 4J6WA 4YTLA 3OBWA 5EG2A 4IUTA 1N9RA 2FB7A 4A4EA 1WPYA 3FIFA 5CQXA 3HRTA 5LJ3h 2DIQA 3JCMf 2H3JA 2DTOA 4JRKA 2R5MA 1QVGA 5DLQE 4XTZA 5CAIA 3JCMe 1XQHA 2OTLA 2E5QA 1NPPA 5D6XA 4ZTFA 1R8OB 2QDYB 3HP9A 3JRZA 1FXXA 2E12A 2VUBA 4JS5A 1BI1A 1VQ8T 4PNOA 3L1AA 2DVEA 5HY6A 2GFUA 2RHUA 4C92F 4J7FA 4RKUE 1JB0E 2DJZA 2F69A 4BI4A 5GAMj 2QA4T 3M56A 3FC3A 4M7AD 2R58A 4M7AB 3OA6A 4PJOB 1VQLA 1Q7YU 1QVFS 3CEYA 1UGSB 2E10A 2EQMA 2HD0A 2LRQA 2P0QA 2A3LA 4A4KA 3OYBA 3UPUA 1M1KC 1YJNT 1KD1C 3L2UA 3PMTA 5GAN2 2K4YA 2DAQA 1O75A 4BD3A 4Q5WA 3PTAA 3QKJA 1IZ6A 4B9WA 2R5AA 3QIIA 5CKFA 4C0ZA 1BI0A 3J81E 3NFCA 4LD6A 5AYFA 4XU3A 3L2QA 2ZZDA 5J3BA 4MMLA 2EYQA 3OYHA 1QVFA 3M4YA 3OB9A 2NLUA 4M7AA 2RI5A 5IAYA 3QYGB 2RJDA 1Q81U 3JCMc 2DXTA 2XHCA 2DO3A 3MP1A 3V7CA 3RMSA 1WGSA 4HCCA 2DEQA 4PJOG 3G4ST 1VQ4A 2E6ZA 2EKOA 2GCXA 3V7SA 4M7AG 4HKEA 2XI9A 4ZGEB 4J6YA 3QZ5B 5LJ5g 3P8DA 4QQ6A 4RCCA 3SDZA 2ZPIB 3PT9A 3QBYA 1N8RU 2BIVA 4BI8B 4EDUA 3N5BB 3QJYA 3X20B 4QW2A 2VYTA 3CCST 1QVPA 2YLCA 4DA4A 4MMKA 4JLIA 1YIJT 5KE2A 3QPHA 1M4ZA 5CKDA 2DXCA 5DM7R 3OS1A 5GAN5 2D6FA 3G71A 4M78F 4OGEA 4PLLA 4B9XA 1VQMA 5DLOA 2VGNA 4JS4A 2MAMA 5CVIA 3JB9F 2QEXA 5C0MA 1W2BS 3E1SA 4BE2A 3QYHB 4E7HA 4QQGA 1K73C 4M7AC 4PJOC 2GQVA 3GP8A 2YLBA 3OSVA 4M78A 3V8JA 1YITT 4XTUA 4ZN1A 2K5FA 4LDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X01 A;  4M77 E;  3BDU A;  4M7D F;  3JCM b;  4N0A C;  3L2Z A;  4OP0 A;  3RES A;  4EMG A;  4QVC A;  4NL3 A;  5LJ5 d;  2E41 A;  2E65 A;  2Y90 A;  1JBM A;  3AHU A;  5GAN 7;  3SWN C;  1Y96 B;  5GAN f;  4JRI A;  4M78 D;  1I4K 1;  4M78 B;  4M7D A;  4M75 F;  4EMK A;  2HNI A;  5GAO n;  1B34 B;  1LNX A;  3JCM h;  4QVD A;  4F7U B;  3JCM J;  1BIB A;  4XU2 A;  4C92 C;  3JB9 D;  3BY7 A;  5GAN 4;  3FJP A;  3EFS A;  2I2L A;  5GAO l;  3JCM X;  1WQW A;  2DZC A;  4WF2 A;  2EJF A;  4J6X A;  3RUX A;  4C92 E;  1JRI A;  1BIA A;  5GAN d;  2EJG A;  3EFR A;  3FB9 A;  1U1S A;  5GAN 6;  5GAO p;  2VXF A;  3JCM P;  1MGQ A;  1N9S A;  3BW1 A;  4C8Q C;  4M7D D;  1B34 A;  3V8K A;  1KQ1 A;  2DKG A;  4F7U A;  3RKW A;  4PJO F;  1HXD A;  2EWN A;  5GMK m;  4M7A F;  2EJ9 A;  4M77 F;  4C8Q E;  2JN0 A;  1HK9 A;  1WNL A;  3HFN A;  4J6W A;  4A54 A;  3QO3 A;  1N9R A;  1H64 1;  3M4G A;  4M78 G;  2DTI A;  2FB7 A;  4M75 D;  1WPY A;  3FIF A;  4M75 B;  5LJ3 h;  4F7U G;  4M78 E;  1I8F A;  3JCM f;  2DTO A;  4JRK A;  3JB9 G;  4PJO A;  1D3B B;  2RM4 A;  4A53 A;  2RA2 A;  4XTZ A;  5CAI A;  4EMK B;  3JCM e;  2RB6 A;  1M8V A;  4XTV A;  4HT8 A;  2DZ9 A;  3JB9 J;  2ZGW A;  3JCM g;  3PGG A;  2DTH A;  5GAM e;  1WQ7 A;  4N0A A;  3L1A A;  2DVE A;  4PNO A;  1LJO A;  5GAM h;  4XTW A;  3JB9 I;  4C92 F;  4XQ3 A;  5LJ5 h;  2VC8 A;  4EMK C;  2DJZ A;  5GMK l;  3JCM d;  5GAM g;  4M7D G;  5GAM j;  4M75 A;  3SWN A;  3RIR A;  4M7A D;  4PJO D;  4M7A B;  5GAN 3;  1D3B A;  2FYK A;  4M77 D;  3VU3 C;  4M77 B;  2RD1 A;  4XU0 A;  2E10 A;  5GAO r;  4M7D E;  1YCY A;  3V7R A;  4RCB A;  4M7A E;  5GAN 2;  4C8Q F;  4M75 G;  4NL2 A;  1I5L A;  3INZ A;  3V8L A;  2YHT A;  4M78 C;  2K57 A;  5LJ3 e;  4HA8 A;  4XU3 A;  3SWN B;  3RKY A;  4MML A;  4M7A A;  4M77 A;  5LJ3 g;  4C8Q A;  4F7U E;  5LJ3 j;  5GAO q;  3JB9 H;  5GAM f;  4C92 D;  1M5Q 1;  3JCM c;  2DXT A;  2EAY A;  3V7C A;  4C92 B;  5LJ5 f;  5GMK e;  2DEQ A;  4PJO G;  5LJ5 e;  5GAO m;  3V7S A;  5GMK h;  4M77 G;  3JCM Q;  4M7A G;  4M7D C;  2E1H A;  3HFO A;  4J6Y A;  1I81 A;  5LJ5 g;  1U1T A;  4PJO E;  3HSB A;  4RCC A;  2CGH A;  5GMK j;  5LJ5 j;  5GAN 8;  4HT9 A;  3RKX A;  5DY9 A;  4C8Q D;  1LOJ A;  4C8Q B;  5GAM d;  3JCM W;  4XTY A;  4C92 A;  4M75 C;  2YLC A;  4EMH A;  4MMK A;  4JLI A;  2VXE A;  5I21 A;  4V2S A;  5LJ3 f;  5GAN e;  4M75 E;  3SB2 A;  5GAN h;  4XTX A;  5GAN 5;  2E64 A;  5GAN g;  4M78 F;  1TH7 A;  3QSU A;  5GAN j;  4C92 G;  4DQ2 A;  3JCM V;  3QUI A;  4F7U F;  3GIB A;  3JB9 F;  4PJO B;  4X9D A;  2QTX A;  4JUV A;  4XU1 A;  5GMK i;  1Y96 A;  4X9C A;  5LJ3 d;  1KQ2 A;  3BFM A;  4M7A C;  4PJO C;  4J5Y A;  4M77 C;  2YLB A;  4M78 A;  3V8J A;  3RER A;  4XTU A;  4M7D B;  4NOY A;  4Y91 A;  2DXU A;  4C8Q G;  3QHS A; 
#chains in the Genus database with same CATH topology
 3OYF A;  3CMA A;  1Z9Z A;  1K0S A;  1G5V A;  3RES A;  4QVC A;  2COW A;  3VS0 A;  1NLP C;  1CKA A;  1WIE A;  3PE0 A;  2CRE A;  1YJW A;  2IG0 A;  4KT0 E;  2COY A;  1BI3 A;  5GAO n;  1B7T A;  1X6O A;  2QK0 A;  2DEU A;  2XDB A;  1VQL Q;  2V1Q A;  2DXB A;  3RKW A;  3ZBD A;  4BY6 B;  1M27 C;  3EHQ A;  3JV3 A;  4F7U G;  1I8F A;  1PC0 A;  2RB6 A;  2RHX A;  4XTV A;  1SF9 A;  4F17 A;  2JS2 A;  2KK4 A;  4KBM B;  1WQ7 A;  1NZ9 A;  3WXM B;  3MEU A;  5GMK l;  3VS6 A;  3CQT A;  1E6H A;  2XDD A;  2FYK A;  5KYW B;  4J9H A;  2NUT B;  4PFO A;  1Y07 A;  1WYX A;  1KHC A;  1VQ9 A;  1WXB A;  1VQ7 A;  5A2Q E;  1YWO A;  2DYI A;  4OMO A;  1W6X A;  1WJR A;  3HRS A;  2KDS A;  4HVU A;  4QQD A;  4C92 B;  1RAG B;  4JPB W;  1UGR B;  2BZY A;  4FW2 A;  2E1H A;  4DEY A;  4PJO E;  3RNJ A;  3CMA Q;  2X35 A;  1G3S A;  1YCS B;  1VQ6 Q;  1UEB A;  4K11 A;  3SHW A;  1YJ9 T;  4IUQ A;  3PVL A;  3CBP A;  3SB2 A;  3F70 A;  3QJ6 A;  3OYK A;  4ELZ C;  2LQW A;  3NMZ C;  2MPX C;  4NS5 A;  4X9D A;  2QA4 A;  1Y96 A;  1ZBX A;  1X6B A;  4FU6 A;  1PHT A;  2OJ2 A;  1VQP T;  1QW1 A;  1YJN A;  5KCH A;  1EX4 A;  2RJE A;  1N27 A;  2CYZ B;  2E65 A;  3E19 A;  1OI1 A;  1X2K A;  2XD0 A;  4JJC A;  2DE0 X;  2HQE A;  4M78 D;  2M0O A;  2HNI A;  4MZP A;  1K9M U;  2KXC A;  3JB9 D;  3DKM A;  3J80 E;  4BE1 A;  2O31 A;  2VGM A;  1M90 C;  2BKD N;  1G8X A;  1E7O A;  1KQS P;  3CCS A;  1D0Z A;  2J6F A;  1OZ3 A;  3UAT A;  2GNC A;  1VQ7 Q;  2L5Q A;  1BI2 A;  1UUE A;  4MZM A;  4KRT A;  3M9Q A;  5FRO A;  2X3X D;  3OYD A;  2YSQ A;  3TEE A;  4RTX A;  3CME T;  1D1A A;  1GFD A;  2Y4Y A;  4JDS A;  1NJI R;  4A4F A;  2EQK A;  3CPW A;  1PG5 B;  4DBH A;  4MDX A;  4M7D E;  4M77 B;  2RD1 A;  1P92 A;  3EG1 A;  5FU6 B;  3EAE A;  2W0Z A;  3M5A A;  3QWY A;  1VQO T;  2CP7 A;  2XKO C;  2LX7 A;  1QVG P;  4L6V 5;  1KFZ A;  2DD5 A;  2X9H A;  1WA7 A;  4C5E A;  2IIM A;  5LJ3 g;  3GOX A;  2P4R A;  1PCX A;  2QA4 Q;  2EYW A;  1YP5 A;  2P4T A;  1JO8 A;  1AEY A;  2J6K A;  1KQS A;  1VOM A;  1PSE A;  1YJN Q;  4FT2 A;  4KUD K;  1QWE A;  3A8M B;  3ULR B;  3LLR A;  4OVA A;  2EYZ A;  4JJD A;  4IIO A;  4AFQ C;  2VXE A;  2KYM A;  1M1G A;  4JRP A;  5LJ3 f;  2KYB A;  2KBT A;  1SSH A;  3CCQ A;  1FX7 A;  2K5L A;  3QUI A;  1JU5 C;  1UHC A;  4R55 A;  2QQA A;  1MMN A;  3BFM A;  5FRM A;  2GTJ A;  3UA6 A;  4M7A E;  4RTU A;  5I2M A;  1VQL T;  2E3I A;  1UTI A;  4JJN K;  2ROL A;  1Y96 B;  1I4K 1;  3GNF B;  4EMK A;  4L59 A;  5CO7 A;  2KAF A;  1DJ7 B;  3EG0 A;  1PD1 A;  3EFO A;  5GAO l;  2M16 A;  1WHM A;  2LCC A;  1EFN A;  1U1S A;  2V1R A;  3MJX A;  2H8H A;  3CCR A;  4M7A F;  1SG5 A;  4C5I A;  1HK9 A;  2CT4 A;  2K3Y A;  3A1P A;  2AKK A;  2RN8 A;  1H64 1;  2ATC B;  5KYU A;  3A8G B;  2D0Q B;  3M0P A;  2OX7 A;  3A8O B;  4M4Z A;  2K3B A;  3REB B;  4FM4 B;  2GGR A;  4VUB A;  1S72 Q;  3ZEH A;  2QQS A;  3VS3 A;  2WAC A;  4O5V A;  1RL2 A;  2EIF A;  2QQ9 A;  3JCM d;  1Q82 R;  2JZ2 A;  1D3B A;  1RUW A;  1V76 A;  3S3O A;  1Q82 U;  3CMA T;  1X6G A;  2M02 A;  1RAA B;  5KH6 A;  3CCQ Q;  5HKC A;  1YJW T;  1OYX A;  3VKI A;  2O9V A;  2MCN A;  5FU7 B;  2DBK A;  1AZE A;  2HL5 C;  5LJ5 e;  4PFZ A;  1V1C A;  3VS7 A;  3JCM Q;  2HKN A;  1EIF A;  4OMF B;  5DY9 A;  4C8Q D;  3JCM W;  4J7I A;  4D6W A;  4M75 C;  3CCE A;  1B07 A;  4JZ4 A;  2E64 A;  2EVR A;  1VQ8 Q;  4DQ2 A;  1YBY A;  1GXI E;  3DB3 A;  4A4G A;  1YWP A;  3TCJ A;  2YT6 A;  4OML A;  4J5Y A;  4HCZ A;  2X4X A;  3RER A;  4LD9 K;  2LNV A;  4CC3 A;  4J9I A;  1I5L A;  1CSK A;  1KSW A;  2L3S A;  2V8K A;  4N0A C;  4EMG A;  2B8A A;  1BKB A;  1JBM A;  1D09 B;  2EGC A;  2CZ6 B;  3SWN C;  4GLM A;  1JEG A;  1VQ9 T;  3LX7 A;  1MV0 B;  1VQ7 T;  1QVF P;  1KC8 R;  2K5I A;  3OMC A;  4KH1 B;  3EFS A;  2EYY A;  1I0C A;  1KC8 U;  4F14 A;  3FB9 A;  2ESW A;  5IHN A;  3OS5 A;  2RO0 A;  1B34 A;  4KUI A;  4OB1 B;  1C6V X;  2XID A;  1SHG A;  4LDX A;  1WHJ A;  3KFV A;  4AG2 C;  1B3Q A;  3FIF A;  5CQX A;  2KRM A;  3HRT A;  2DTO A;  1BU1 A;  1XQH A;  4LN2 A;  4E7S A;  1M90 R;  2HQH A;  1NPP A;  5D6X A;  1BI1 A;  2DBM A;  4PNO A;  1TOV A;  2FRY A;  5HY6 A;  5IH2 A;  4WCI A;  1JB0 E;  2QA4 T;  5KYU B;  3FC3 A;  4PJO D;  2R58 A;  1WLP B;  3CEY A;  1UGS B;  1FMK A;  2P84 A;  5I22 A;  3OYB A;  1YJN T;  5GAN 2;  3CCE Q;  1IZ6 A;  4B9W A;  1RAI B;  2JMC A;  2DX1 A;  3M0U A;  2J06 A;  5AYF A;  3L2Q A;  5J3B A;  1QVF A;  3I9Q A;  1QWF A;  2RJD A;  2RQR A;  2DXT A;  3MP1 A;  4M7A G;  1VQ4 A;  2EKO A;  4HKE A;  4ZGE B;  1BB9 A;  3SDZ A;  2ZPI B;  3PT9 A;  1YFN A;  1BK2 A;  2KXD A;  2VYT A;  2CP5 A;  3CCS T;  2QDL A;  4JLI A;  5KE2 A;  2NUZ A;  3OS1 A;  5GAN 5;  5FW9 A;  3M0Q A;  2D6F A;  4M78 F;  4B9X A;  2DER A;  2KRS A;  4JS4 A;  2FZC B;  5CVI A;  3JB9 F;  2QEX A;  5C0M A;  4BE2 A;  3QYH B;  4E7H A;  3H9N A;  1JJ2 P;  2YLB A;  3OSV A;  3AT1 B;  3I56 A;  2G6F X;  4GLK A;  4BE0 A;  2JNG A;  4PK4 A;  2HZY A;  1SEM A;  2KEA A;  2O01 E;  3UA7 A;  1MV3 A;  2RJC A;  1Y71 A;  3TSW A;  3LH0 A;  3BY7 A;  1K9M C;  2L89 A;  3OW2 S;  1JRI A;  2AZS A;  5GAN 6;  1YHQ A;  1QKX A;  2RHY A;  4M7D D;  1J3T A;  3E2U A;  2HBP A;  1OU8 A;  2HKQ B;  3HFN A;  1IHV A;  2LJ0 A;  1HYO A;  2A36 A;  3G7Z A;  1D0X A;  5A0L A;  3A5Z B;  2RA2 A;  2FG0 A;  3CCQ T;  2DNU A;  2DZ9 A;  2PZ1 A;  4IUP A;  3JCM g;  2DD4 A;  1ZA2 B;  3FDR A;  1JJ2 A;  1VQ4 Q;  3O5Z A;  2ZPH B;  1SPK A;  3M54 A;  1HSQ A;  4QKU A;  2EYX A;  4RCB A;  2XK0 A;  4NL2 A;  4Z88 A;  4CRI A;  5KYW A;  2F2V A;  4F16 A;  2NUT A;  2A37 A;  1WHK A;  2L2P A;  2QEX Q;  1U8R A;  1OX9 A;  2D8H A;  4C92 D;  2EAY A;  2DVJ A;  1GRI A;  2X4Y A;  2BZX A;  3OYA A;  5LJ5 j;  5GAN 8;  4BDZ A;  2YWW A;  3I56 Q;  1OEB A;  1O9S A;  4HVV A;  4RG2 A;  3EH1 A;  2LQK A;  4C92 A;  1YI2 A;  4PJJ A;  2PVO B;  3C12 A;  1M30 A;  5GAN h;  2NYS A;  1FMW A;  1KHI A;  2EKH A;  4LUE A;  2RMO A;  1IRE B;  4FCY A;  3CME Q;  3HHT B;  3GIB A;  1K73 U;  2FHD A;  2SRC A;  1VUB A;  4X9C A;  5LJ3 d;  1YHQ Q;  2X4J A;  4ATO A;  3M53 A;  2LQ8 A;  2KY9 A;  2SEM A;  3CXC S;  2X4W A;  1VQO Q;  3BDU A;  2MK5 A;  3R6N A;  4NL3 A;  2HQX A;  4XAX B;  4ESR A;  4JRI A;  1NLO C;  1RAH B;  3OYL A;  1TTH B;  3OYG A;  2OTJ A;  2RHI A;  3JCM X;  3ME9 A;  3G4S A;  4J6X A;  4RTT A;  2YUQ A;  4FYY B;  1AVZ C;  1Q95 G;  4C8Q E;  1NYF A;  3H8Z A;  2JOY A;  1W2B A;  3M4G A;  4M78 G;  1K0X A;  3CCU A;  3CCE T;  3CBM A;  2QQR A;  4ZN3 A;  5FWB A;  3JB9 G;  1RAF B;  2RM4 A;  3O8V A;  4OF1 A;  3RR6 A;  1PKS A;  1QP3 A;  3G1J A;  4E2F B;  3JB9 J;  3PGG A;  5J26 A;  4N0A A;  5GAM h;  3ASK A;  5LJ5 h;  2VC8 A;  2V26 A;  3SWN A;  2GFA A;  4M77 D;  4IUR A;  3CCJ A;  4PJL A;  4C8Q F;  1Q82 C;  1ZUU A;  5KCO A;  3CCV A;  4M77 A;  3C94 A;  3MPU B;  1UDL A;  5GAO q;  3QWX X;  4LNP A;  2Y4X A;  2XIC A;  4J9B A;  2A28 A;  1OX8 A;  2BTT A;  1RLQ C;  2P0K A;  1G3W A;  1U1T A;  3HSB A;  2CZ0 B;  1MNE A;  2DL3 A;  1FWZ A;  3CC2 A;  3PFS A;  3H0H A;  3HKS A;  5CCA A;  3MEW A;  1RAB B;  4X1V A;  3X26 B;  1H3Z A;  4CI0 C;  5GAN g;  1TH7 A;  1K76 A;  2QTV A;  5CKB A;  3KXT A;  2QTX A;  1NG2 A;  1G3T A;  2DXU A;  1FMV A;  3P8B B;  5GAN 7;  5GAN f;  1YJW Q;  3LH5 A;  1IHW A;  1M3A A;  4Z02 A;  3JCM J;  4QVD A;  5M9O A;  1GL5 A;  2KVQ G;  1RAC B;  3FRN A;  1BIB A;  1OPL A;  2KSS A;  2EJF A;  2DIL A;  3PMI A;  1VQ5 A;  1KC8 C;  2ZAE A;  1QMC A;  1VQ4 T;  1BYM A;  1X2Q A;  4KGX B;  4RTV A;  4PJM A;  2CH4 A;  4PJO F;  2EGA A;  2JMA A;  5GJV B;  1ABO A;  1Q86 R;  4AT1 B;  3QO3 A;  2R57 A;  1K9M R;  4M75 B;  2HSE B;  4AG1 C;  3KUF A;  1Q86 U;  1NE8 A;  3IQL A;  5CR2 A;  3QZ9 B;  1QLY A;  4HT8 A;  2DTH A;  2L8D A;  2VKN A;  2QEX T;  4XQ3 A;  5GAM g;  4PJN A;  4MZT A;  2AKL A;  2KR3 A;  1AZG B;  2VV5 A;  3I56 T;  3OYC A;  4TVR A;  3INZ A;  1VQ9 Q;  2LCL A;  1T0H A;  2YXY A;  3SWN B;  3RKY A;  1NM7 A;  5GAM f;  1TXQ A;  4N4H A;  5I2S A;  3GF5 A;  5LJ5 f;  3SD4 A;  1SSF A;  3J7A F;  5GMK e;  2PNI A;  4E47 A;  1YHQ T;  2ZPG B;  3I55 A;  1MHN A;  4C0F A;  2FPE A;  1QKW A;  4LE9 A;  1WI7 A;  3CC7 A;  2LMJ A;  3UT1 A;  1R0C B;  2DL4 A;  2QI2 A;  2X3W D;  3E9G A;  4E7Z A;  5L8R E;  1KQ2 A;  1OPK A;  1VYT A;  3EHR A;  1WQW A;  4C8Q G;  4PKC C;  4M7D F;  5KYY A;  4IUV A;  3TRE A;  2CH4 W;  2JTM A;  4BDY A;  3CD6 A;  3PIO A;  2C06 A;  3BE3 A;  2LCS A;  1LNX A;  3L2R A;  2RJF A;  3FJP A;  3CCM A;  4B6M A;  2O9S A;  4C92 E;  1BIA A;  5GAO p;  1VIE A;  3CCS Q;  1WZO A;  3OBW A;  4J9F A;  4A4E A;  3D7S B;  1QVG A;  2R5M A;  2FZG B;  1UGV A;  1UEC A;  5DLQ E;  5CAI A;  1UJY A;  2E5Q A;  3JRZ A;  3HP9 A;  2JS0 A;  2E12 A;  5L23 A;  2I0N A;  4C92 F;  1Q7Y R;  1H3H A;  4JJB A;  1Q7Y U;  3I55 Q;  4A4K A;  2A3L A;  2HBW A;  1M2O A;  3PMT A;  4HCK A;  1Z9Q A;  2K4Y A;  4BD3 A;  1O75 A;  3PTA A;  2R5A A;  1BI0 A;  1D1B A;  2DFU A;  3NFC A;  2LZ6 B;  2EYQ A;  3OB9 A;  2NLU A;  1GBQ A;  5IAY A;  1D1C A;  1EZZ B;  3JCM c;  2XHC A;  1H8K A;  2DO3 A;  3SEM A;  1GBR A;  2DEQ A;  4PJO G;  3G4S T;  1N8R R;  2E6Z A;  4FSS A;  4J6Y A;  1VYV A;  1QQJ A;  3QBY A;  1YN8 A;  1N8R U;  3QJY A;  1QCN A;  3X20 B;  4QW2 A;  1PRM C;  3OW2 P;  1WHL A;  5ECA A;  2Z0W A;  1OUL A;  5CKD A;  2BE7 D;  2CSQ A;  1VQM A;  5DLO A;  2FZK B;  4QQG A;  1K73 C;  4M7A C;  2GQV A;  4ZN1 A;  2K5F A;  8ATC B;  2P0P A;  4M77 E;  1NBE B;  1YIJ A;  2DPP B;  3A8L B;  3RMQ A;  1RI0 A;  2C0I A;  1ZLM A;  2EGE A;  5CKH A;  3CPW S;  3REA B;  3L2V A;  3MO8 A;  1M1F A;  4F7U B;  4FIB A;  4ZGD B;  2OI3 A;  4L5G A;  5KYY B;  3L2W A;  2I2L A;  3OQ5 A;  2DF6 A;  2CZ1 B;  2IPO B;  3EFR A;  2JM8 A;  2M9U A;  2FRW A;  1JQQ A;  1ZUY A;  2M1H A;  2MI6 A;  3CCR Q;  2EWN A;  4M77 F;  2HMA A;  3CC2 T;  2RK1 A;  3OW2 A;  2RQT A;  3RDV A;  1ARK A;  4DBR A;  2D8J A;  3NTH A;  1TG0 A;  2LNH B;  2B86 A;  3UF4 A;  1QP2 A;  1WJS A;  1K1Z A;  1M1K R;  3OYE A;  1MUZ A;  4M7D G;  3OYJ A;  4ME7 A;  2CS7 A;  1G2B A;  2NWM A;  2QAS A;  5GAO r;  1M1K U;  5AT1 B;  3P8H A;  4E7I A;  1T0J A;  1WHG A;  2AHJ B;  2D9T A;  2DMO A;  1XJW B;  5LJ3 e;  1K4U S;  1VQM Q;  3CXC P;  2M0Y A;  3NHN A;  3S6W A;  3CBO A;  4JLG A;  5C6S A;  1BCM A;  2DRM A;  5GAO m;  1VQ5 T;  1JXO A;  1I81 A;  5GMK j;  4HT9 A;  2KQW A;  2LC4 A;  3R6O A;  5KE3 A;  5CKE A;  3S3M A;  5I21 A;  1PD0 A;  3MEA A;  1D0Y A;  5FRN A;  4C92 G;  3JCM V;  3M0R A;  4DEX A;  2VVK A;  3KBG A;  4Y91 A;  3RBB B;  2K79 A;  3MHX A;  1M2V B;  3C0C A;  2ROT A;  3HRU A;  2K9G A;  2CDT A;  3AHU A;  3TU4 K;  5KYX B;  3OS0 A;  2FO0 A;  1TWB A;  2K3X A;  2KI7 A;  1TSF A;  3EGU A;  1VYU A;  3VYG A;  2PVD B;  2DZC A;  5CQY A;  2YRV A;  4GY5 A;  1VQP A;  5GAN d;  5A0G A;  3VS4 A;  1M9S A;  3LYI A;  5IHK A;  2RHZ A;  3OYI A;  3GNG A;  4C0D B;  2O4X B;  3I55 T;  2JN0 A;  1WNL A;  4JRQ A;  2J05 A;  3EG9 B;  4IIM A;  2E6N A;  4J9G A;  2RNA A;  2RF0 A;  2DLP A;  2CP0 A;  1Q86 C;  4LDU A;  3QG1 A;  4Z8A A;  1Q81 C;  3OBY A;  1ZSG A;  1MMG A;  3VRY A;  2DA9 A;  2F5K A;  2HAX A;  4FW1 A;  2DK3 A;  3TVT A;  2DL5 A;  3FJ5 A;  3V7R A;  4EIK A;  5HK3 A;  3JAM E;  1UB4 A;  2JT4 A;  4HXJ A;  4M78 C;  1AHJ B;  2VAS A;  3VV0 A;  2PQW A;  1MMD A;  2JUF A;  1OQK A;  3EG3 A;  1M5Q 1;  4E7J A;  4E7K A;  4FYW B;  3OS2 A;  2LJ1 A;  2LDM A;  4M77 G;  4OMM A;  3MP6 A;  6AT1 B;  2EW3 A;  5GAM d;  1KIK A;  1GCQ C;  4XTY A;  2ABL A;  4ORZ A;  1X75 C;  2KT1 A;  4EMH A;  4EPC A;  3G6E A;  4RUG A;  3OMG A;  4OMQ A;  2FVU A;  1X43 A;  2BUD A;  2ZCF B;  2JTE A;  3LW5 E;  4RTW A;  1NPR A;  1HJD A;  4LDV A;  4C0G A;  3L2Z A;  3CCR T;  1NEB A;  2E41 A;  2FL7 A;  2A0F B;  1ABQ A;  4N4I A;  3UDC A;  2KE9 A;  1AWX A;  1QCF A;  2JW4 A;  1K73 R;  3H0I A;  2IVW A;  2PTK A;  4XU2 A;  3I5S A;  1M3B A;  4A63 B;  1T3L A;  3EGX B;  2EQJ A;  1ZA1 B;  3VS2 A;  2WSE E;  3GLX A;  5LL6 S;  4OB2 B;  1Y7X A;  3PVQ A;  4CC4 B;  4M75 D;  2HSP A;  3NTK A;  2AZV A;  2NUP B;  2GQI A;  1V29 B;  2XMF A;  4ZGJ B;  4OB0 B;  1VQM T;  2ED1 A;  1PWT A;  1LJO A;  2RQU A;  4QVZ A;  4EMK C;  2MMP A;  4M75 A;  1MND A;  2OAU A;  3CPF A;  5HCK A;  3NTI A;  4MDW A;  4ELY C;  1Q7Y C;  1YCY A;  1K9A A;  1UG1 A;  1U3O A;  5EC7 A;  2H3E B;  2YHT A;  4OGC A;  4IUU A;  3TQ7 P;  5LJ3 j;  1K8A U;  3X25 B;  4O6J A;  4DOW A;  1UJ0 A;  2PUK B;  4J9C A;  1IXD A;  2CGH A;  1U06 A;  3PNW C;  3RKX A;  2QQB A;  1LOJ A;  1VQ6 A;  1N8R C;  3Q1J A;  2PU9 B;  1SRM A;  1YI2 Q;  1OZ2 A;  1FYN A;  1WHH A;  5D6Y A;  4XTX A;  4KUL A;  1OU9 A;  4XU1 A;  3NPF A;  1ZSZ B;  2RI3 A;  4M7D B;  4NOY A;  1E6G A;  2F1L A;  2LP5 A;  4C0D C;  2A08 A;  3THK A;  1WXT A;  4AFU C;  4PLI A;  1N5Z A;  2KMT A;  1JJ2 S;  2JTF A;  3MP8 A;  1VA7 A;  2OTJ Q;  2C0T A;  3RUX A;  3G4S Q;  2ZPF B;  2EJG A;  3CCL A;  1AWW A;  2VXF A;  1N9S A;  1VQK A;  4C8Q C;  2FPD A;  1G3Y A;  2A7Y A;  1HXD A;  1PSF A;  4XK8 E;  3LGF A;  3TSZ A;  2GBQ A;  1WJQ A;  1WX6 A;  2CP2 A;  1KJW A;  3CCU Q;  1WPY A;  5LJ3 h;  2DIQ A;  2H3J A;  4JRK A;  3JCM e;  2OTL A;  1R8O B;  2QDY B;  3I5R A;  1FXX A;  2VUB A;  2GFU A;  3M0T A;  4Y92 A;  4RKU E;  2F69 A;  2DJZ A;  4BI4 A;  2ECZ A;  3M56 A;  2RQV A;  3OA6 A;  4M7A B;  2E10 A;  2HD0 A;  3CCJ Q;  3UPU A;  1M1K C;  2J7I A;  3HTR A;  4ZNX A;  3QKJ A;  4C0Z A;  3J81 E;  3CCV Q;  1RAE B;  3H0F A;  3EGD A;  4XU3 A;  4MML A;  3I35 A;  1Q81 R;  1UFF A;  2QGG A;  2RI5 A;  2EQI A;  4JZ3 A;  2QGF B;  1Q81 U;  3V7C A;  1A0N B;  3RMS A;  2GCX A;  3CPW P;  2F2W A;  3GBQ A;  3QZ5 B;  5LJ5 g;  4QQ6 A;  2CP3 A;  3CC2 Q;  4BI8 B;  1W1F A;  3N5B B;  1GCP A;  1QVP A;  2HEQ A;  4DA4 A;  1I5O B;  2MYS A;  3QPH A;  5DM7 R;  2C0O A;  3G71 A;  4OGE A;  2K7A A;  2YRC A;  4AFZ C;  9ATC B;  1W2B S;  4FYX B;  1WDX A;  3CCL Q;  4PJO C;  1F1B B;  4OMP A;  3GP8 A;  2DYB A;  4M78 A;  3V8J A;  2KRN A;  1SRL A;  1VQK Q;  3VS5 A;  3H6Z A;  2VB6 A;  1RI9 A;  4LUD A;  1G83 A;  2Y90 A;  1IB8 A;  3SFM A;  3C4S A;  5KYN A;  4KGZ B;  2L0A A;  2OTL Q;  3OSS C;  2DL8 A;  2EPD A;  4UC4 A;  3FLG A;  4BUG A;  2QAZ A;  1GCQ A;  2KRO A;  1VQ5 Q;  3ZL7 C;  3L42 A;  1ZX6 A;  3JCM P;  3M58 A;  1NJI U;  3T9N A;  4F7U A;  5GMK m;  2BE9 B;  2RI2 A;  3URG A;  2EBP A;  4A54 A;  7AT1 B;  3CC4 A;  3FEO A;  2CT3 A;  3G6E T;  2PVG B;  3QDR B;  1S72 A;  2QG9 B;  3HL8 A;  1KD1 R;  1VQN A;  4J9D A;  3RIR A;  3JSC A;  3C95 A;  1AT1 B;  2YUP A;  4XU0 A;  1KD1 U;  1H92 A;  4ANJ A;  4GBQ A;  3X24 B;  2PUO B;  2HDA A;  3VUZ A;  2K57 A;  2DIG A;  3G71 Q;  1YI2 T;  2V8I A;  4HVW A;  2WSC E;  3QDF A;  5IN1 A;  1SKU B;  1MMA A;  4DBQ A;  2LT1 A;  5IXB A;  1ZSZ C;  4A4H A;  4M7D C;  2DJQ A;  1X69 A;  3DLM A;  2AT1 B;  5HK0 A;  2L3P A;  3EGD B;  4J83 A;  4BY6 C;  2DRK A;  1HD3 A;  1T3S A;  2YUO A;  2X51 A;  1IGU A;  4FL6 A;  2DM1 A;  4QT7 A;  3OYY A;  1X27 A;  5GAN e;  4DOV A;  4M75 E;  1S1N A;  3CC7 Q;  3QXE B;  4J8O A;  2D1X A;  1VQ8 A;  3QSU A;  2JM9 A;  2OTJ T;  4FSX A;  5IXF A;  4WTO B;  1GFC A;  3WVE B;  3MKD A;  4KH0 B;  1X01 A;  3U23 A;  4OP0 A;  2HL3 A;  4FYV B;  3CD6 Q;  3PIP A;  2RPN A;  3M0S A;  3CC4 Q;  3LGL A;  4RTY A;  4M78 B;  1YNZ A;  4M75 F;  3CCU T;  4C92 C;  2MOX A;  5J39 A;  1M2V A;  4AFS C;  4Z89 A;  3CCM Q;  2F5T X;  3VUB A;  1VQN Q;  5KYX A;  2L3R A;  2JXB A;  1XNI A;  3GPL A;  4FT4 A;  2LTO A;  4LXC A;  3CCJ T;  2LT4 A;  1VQ6 T;  1AWO A;  2FEI A;  1TS9 A;  2DTI A;  4RG8 A;  4D8D A;  2GF7 A;  4KGV B;  3CCV T;  1XTD A;  1M8M A;  1UGP B;  2O4X A;  3VS1 A;  5GAM e;  1QCO A;  4OB3 B;  1YIT A;  4XTW A;  2CUB A;  3DB4 A;  3EG9 A;  1OOT A;  3JB9 I;  4IKF A;  3MCA B;  1CKB A;  3X28 B;  2LX9 A;  3V8L A;  2F2X A;  3WVD B;  1KQS S;  1Y0M A;  4C8Q A;  4OMN A;  3ZFJ A;  1JXM A;  1K8A C;  2M51 A;  4Y28 E;  4E7L A;  2LJ3 A;  1VIF A;  2VWF A;  4RMO A;  2CUD A;  3CCL T;  1XOV A;  1PNJ A;  1VQK T;  2XDP A;  5D6W A;  4LDW A;  1IRX A;  2G3R A;  2CKK A;  3EG2 A;  2LVM A;  3VRZ A;  1NEG A;  2OTL T;  1C1A A;  4P5N A;  5GMK i;  5IT9 E;  3S3N A;  2QXF A;  4M77 C;  1QVG S;  4BB7 A;  4J9E A;  2MF2 A;  5FU6 C;  4EMK B;  3QHS A;  2EQU A;  2AK5 A;  3JCM b;  1YIJ Q;  1RLP C;  2MWP A;  3EFO B;  3M57 A;  2KNB B;  3VYH B;  4C5G A;  1TUD A;  1TUC A;  2K6D A;  4II1 A;  4PL6 A;  2BZ8 A;  1Y57 A;  3JCM h;  4C5H A;  2EFI A;  3UWN A;  1PRL C;  2ED0 A;  5D7U A;  1M90 U;  1YIT Q;  4WF2 A;  4RTZ A;  3ER0 A;  2JVV A;  1N6A A;  3V8K A;  1KQ1 A;  2DKG A;  3A98 A;  2K2M A;  2CSI A;  2EJ9 A;  2XG8 D;  2AIR B;  3LWI A;  1YJ9 A;  2W10 A;  3EGX A;  5GAN 4;  4HCB A;  4M78 E;  4PJO A;  1LCK A;  2CP6 A;  1D3B B;  2MWO A;  4A53 A;  2HCK A;  3CXC A;  1KG1 A;  3G71 T;  2ZGW A;  2RQW A;  1TUG B;  2FPF A;  4N4G A;  2QYZ A;  5GAN 3;  3VU3 C;  3M55 A;  2NUP A;  2E3H A;  1WXU A;  3HPW A;  4CC7 A;  3LWH A;  4M75 G;  1ZHI A;  2KT8 A;  4E6R A;  8AT1 B;  2V8J A;  4HA8 A;  5CK9 A;  1TU0 B;  5CIU A;  4F7U E;  3JB9 H;  3CC7 T;  2XU8 A;  3MEV A;  2L3Q A;  1SHF A;  1ZBJ A;  4CC2 A;  5GMK h;  3HFO A;  1BBZ A;  2RK2 A;  3M59 A;  3OY9 A;  3E9F A;  4C8Q B;  2D0N A;  3OYN A;  1U5S A;  2WSF E;  2J6O A;  4V2S A;  2ZPB B;  2RH2 A;  3CD6 T;  3A8H B;  1NYG A;  1W4S A;  3CC4 T;  5GAN j;  2MIO A;  4F7U F;  3CME A;  1BCO A;  1UE9 A;  5FLX E;  4JUV A;  1S72 T;  4BI3 A;  3CCM T;  4BAC A;  2JJ9 A;  2KGT A;  1W70 A;  1M8V A;  1VQN T;  2LQN A;  1UGQ B;  2O2O A;  3MET A;  3DLL A;  1VQO A;  5A0D A;  2K2V A;  1ZQ1 A;  1YJ9 Q;  1WFW A;  2E4H A;  5LJ5 d;  1IO6 A;  4ZTJ A;  1ZSZ A;  4M7D A;  5FU7 C;  1B34 B;  2ZPE B;  2E70 A;  1PKT A;  1ZUK A;  1VQP Q;  3H41 A;  2CZ7 B;  4R56 A;  1IGQ A;  3BDL A;  3NGP A;  1MGQ A;  3BW1 A;  1AD5 A;  5GJW B;  2YRD A;  2COZ A;  2E5K A;  1NJI C;  2YDL A;  4X34 A;  3VJP A;  4J6W A;  4YTL A;  5EG2 A;  1I1J A;  2OAW A;  1R0B G;  4IUT A;  1N9R A;  2FB7 A;  3OYM A;  3JCM f;  4XTZ A;  1AOJ A;  4ZTF A;  1VQ8 T;  4JS5 A;  1KK7 A;  3L1A A;  2DVE A;  4F04 B;  2RHU A;  4J7F A;  5GAM j;  4M7A D;  4PJO B;  1VQL A;  1QVF S;  1M3C A;  2EQM A;  2LRQ A;  2P0Q A;  2O88 A;  1KD1 C;  3L2U A;  5IHI A;  2DAQ A;  1W2B P;  4Q5W A;  3QII A;  5CKF A;  1RAD B;  2DL7 A;  4LD6 A;  2ZZD A;  3OYH A;  4M7A A;  3M4Y A;  2YUN A;  3QYG B;  1LVK A;  5I11 A;  1WGS A;  1OV3 A;  4HCC A;  1I07 A;  3V7S A;  1LPL A;  1UHF A;  2XI9 A;  3P8D A;  4RCC A;  4D8K A;  2BIV A;  3EH2 A;  4EDU A;  4AMC A;  2DET A;  2ENM A;  5FWC A;  2YLC A;  4MMK A;  1YIJ T;  1M4Z A;  3G6E Q;  2DXC A;  1K8A R;  4PLL A;  1R77 A;  4PFP A;  2VGN A;  1ACM B;  2MAM A;  1C0M A;  2GTO A;  3E1S A;  4R0K A;  4DBF A;  1PM3 A;  1YIT T;  4XTU A;  1AWJ A;  4LDY A; 
#chains in the Genus database with same CATH homology
 2P0P A;  3H6Z A;  4M77 E;  3OYF A;  3CMA A;  3I56 A;  4PJO D;  4GLK A;  1G5V A;  3RES A;  4QVC A;  1YIJ A;  2DPP B;  4BE0 A;  2JNG A;  3A8L B;  3RMQ A;  1RI0 A;  2Y90 A;  3SFM A;  3C4S A;  5CKH A;  2O01 E;  3CPW S;  3L2V A;  1YJW A;  2IG0 A;  4KT0 E;  3MO8 A;  1BI3 A;  5GAO n;  2RJC A;  1M1F A;  3OSS C;  1Y71 A;  4FIB A;  4F7U B;  3LH0 A;  4ZGD B;  3BY7 A;  1K9M C;  4L5G A;  4UC4 A;  3L2W A;  2I2L A;  3FLG A;  3OQ5 A;  4BUG A;  2L89 A;  3OW2 S;  2CZ1 B;  1JRI A;  1X6O A;  3EFR A;  5GAN 6;  2M9U A;  3L42 A;  1YHQ A;  2XDB A;  3JCM P;  2RHY A;  3M58 A;  4M7D D;  1NJI U;  3T9N A;  2DXB A;  2M1H A;  3RKW A;  2MI6 A;  3ZBD A;  2EWN A;  4F7U A;  5GMK m;  4M77 F;  2HBP A;  3CC2 T;  2RK1 A;  2RI2 A;  4BY6 B;  3URG A;  3HFN A;  3OW2 A;  4A54 A;  3G7Z A;  4F7U G;  5A0L A;  1I8F A;  3CC4 A;  3A5Z B;  3FEO A;  2RA2 A;  3NTH A;  3G6E T;  2RB6 A;  2RHX A;  2PVG B;  3QDR B;  4XTV A;  3CCQ T;  1M8V A;  2DZ9 A;  4IUP A;  3JCM g;  1S72 A;  2DD4 A;  3FDR A;  2KK4 A;  4KBM B;  1WQ7 A;  1NZ9 A;  1QP2 A;  1WJS A;  3WXM B;  1JJ2 A;  3MEU A;  3HL8 A;  5GMK l;  3OYE A;  1VQN A;  4M7D G;  2ZPH B;  3OYJ A;  4ME7 A;  3RIR A;  2CS7 A;  2XDD A;  3JSC A;  2FYK A;  3C95 A;  5GAO r;  1M1K U;  3M54 A;  4XU0 A;  1KD1 U;  3P8H A;  1Y07 A;  4E7I A;  4RCB A;  3X24 B;  2PUO B;  1KHC A;  2AHJ B;  2D9T A;  2XK0 A;  4NL2 A;  1VQ9 A;  3VUZ A;  2K57 A;  2DIG A;  5LJ3 e;  1VQ7 A;  4CRI A;  5A2Q E;  1YI2 T;  2V8I A;  3S6W A;  1WJR A;  2WSC E;  2KDS A;  3HRS A;  5IN1 A;  3CBO A;  1U8R A;  4C92 D;  4QQD A;  4C92 B;  2EAY A;  4JLG A;  5C6S A;  2LT1 A;  1UGR B;  5GAO m;  4A4H A;  4M7D C;  3DLM A;  2E1H A;  1VQ5 T;  1I81 A;  4PJO E;  2X4Y A;  5HK0 A;  3OYA A;  5GMK j;  5LJ5 j;  2X35 A;  4J83 A;  4BY6 C;  2KQW A;  5GAN 8;  4BDZ A;  4HT9 A;  1O9S A;  4RG2 A;  1G3S A;  1UEB A;  2LC4 A;  2LQK A;  3R6O A;  4C92 A;  5KE3 A;  1YJ9 T;  5CKE A;  3S3M A;  4IUQ A;  4FL6 A;  1YI2 A;  5I21 A;  3OYY A;  3CBP A;  5GAN e;  2PVO B;  3C12 A;  4M75 E;  3SB2 A;  4DOV A;  3F70 A;  3MEA A;  3QJ6 A;  3QXE B;  5GAN h;  1KHI A;  4J8O A;  3OYK A;  5FRN A;  4ELZ C;  1VQ8 A;  3QSU A;  4C92 G;  3JCM V;  1IRE B;  3HHT B;  3GIB A;  4NS5 A;  4X9D A;  1K73 U;  2FHD A;  2OTJ T;  4FSX A;  1VUB A;  2QA4 A;  1Y96 A;  4X9C A;  1ZBX A;  5LJ3 d;  3WVE B;  3KBG A;  2X4J A;  4FU6 A;  4ATO A;  3M53 A;  2LQ8 A;  1VQP T;  2KY9 A;  1QW1 A;  4Y91 A;  3CXC S;  2X4W A;  1YJN A;  1X01 A;  5KCH A;  3BDU A;  3MHX A;  2RJE A;  4OP0 A;  4NL3 A;  1N27 A;  2CYZ B;  2HQX A;  4XAX B;  2E65 A;  3HRU A;  3E19 A;  1OI1 A;  3PIP A;  3AHU A;  3TU4 K;  2XD0 A;  3LGL A;  2HQE A;  4JRI A;  4M78 D;  4M78 B;  3OS0 A;  2M0O A;  4M75 F;  2HNI A;  4MZP A;  2K3X A;  3OYL A;  3CCU T;  1K9M U;  3OYG A;  4C92 C;  3JB9 D;  2OTJ A;  3DKM A;  5J39 A;  3VYG A;  3J80 E;  2PVD B;  2RHI A;  3JCM X;  2DZC A;  2F5T X;  4BE1 A;  3ME9 A;  5CQY A;  3G4S A;  2YRV A;  4GY5 A;  4J6X A;  3VUB A;  5GAN d;  2VGM A;  1VQP A;  1M90 C;  2BKD N;  5A0G A;  2L3R A;  1M9S A;  1XNI A;  3LYI A;  2RHZ A;  3GPL A;  4FT4 A;  3OYI A;  3GNG A;  2LTO A;  3CCS A;  4C0D B;  2O4X B;  4C8Q E;  3I55 T;  1OZ3 A;  2JN0 A;  1WNL A;  3CCJ T;  2LT4 A;  2JOY A;  3H8Z A;  4JRQ A;  1W2B A;  1VQ6 T;  3M4G A;  4M78 G;  2DTI A;  3CCU A;  2E6N A;  4RG8 A;  3CCE T;  2L5Q A;  3CBM A;  2QQR A;  2GF7 A;  4ZN3 A;  1BI2 A;  3JB9 G;  2RM4 A;  3O8V A;  4MZM A;  3CCV T;  4OF1 A;  1Q86 C;  4LDU A;  1XTD A;  1QP3 A;  3QG1 A;  1UGP B;  2O4X A;  3M9Q A;  5FRO A;  3JB9 J;  3PGG A;  3OYD A;  1Q81 C;  5GAM e;  5J26 A;  4N0A A;  4OB3 B;  3TEE A;  5GAM h;  3CME T;  3OBY A;  4XTW A;  3DB4 A;  3JB9 I;  1YIT A;  3ASK A;  5LJ5 h;  2VC8 A;  2Y4Y A;  4IKF A;  2F5K A;  4JDS A;  3MCA B;  2EQK A;  4A4F A;  3CPW A;  2HAX A;  3SWN A;  2DK3 A;  2GFA A;  4MDX A;  4M7D E;  4M77 D;  4M77 B;  2RD1 A;  4IUR A;  3X28 B;  3CCJ A;  2LX9 A;  1P92 A;  5FU6 B;  3EAE A;  3M5A A;  3V7R A;  1VQO T;  5HK3 A;  4C8Q F;  1Q82 C;  3JAM E;  1UB4 A;  4M78 C;  3V8L A;  5KCO A;  2XKO C;  3CCV A;  1AHJ B;  3WVD B;  4L6V 5;  1KQS S;  2DD5 A;  3VV0 A;  2PQW A;  4C5E A;  4M77 A;  3C94 A;  5LJ3 g;  3GOX A;  4C8Q A;  5GAO q;  2JUF A;  2Y4X A;  3ZFJ A;  1K8A C;  1M5Q 1;  4E7J A;  2XIC A;  4Y28 E;  3OYM A;  4E7L A;  4E7K A;  2P4T A;  1VIF A;  3OS2 A;  4M77 G;  2LDM A;  4RMO A;  2P0K A;  1KQS A;  3MP6 A;  1U1T A;  1G3W A;  1PSE A;  1XOV A;  2CZ0 B;  4FT2 A;  3CCL T;  3A8M B;  3CC2 A;  1FWZ A;  4KUD K;  3HSB A;  3LLR A;  3PFS A;  1VQK T;  5GAM d;  4OVA A;  3HKS A;  5CCA A;  2XDP A;  4XTY A;  5D6W A;  3MEW A;  1X75 C;  4EMH A;  4LDW A;  2VXE A;  4JRP A;  1M1G A;  2G3R A;  4EPC A;  5LJ3 f;  3X26 B;  2CKK A;  3G6E A;  1H3Z A;  4CI0 C;  3OMG A;  3CCQ A;  1FX7 A;  2K5L A;  5GAN g;  1TH7 A;  2LVM A;  3QUI A;  5CKB A;  3KXT A;  2FVU A;  2OTL T;  4R55 A;  2QTX A;  4P5N A;  5GMK i;  5IT9 E;  3S3N A;  2QQA A;  3BFM A;  2QXF A;  2BUD A;  2ZCF B;  4M77 C;  1QVG S;  4BB7 A;  1G3T A;  5FRM A;  2MF2 A;  2DXU A;  3LW5 E;  3QHS A;  5FU6 C;  4EMK B;  4M7A E;  2EQU A;  5I2M A;  1NPR A;  1VQL T;  4LDV A;  3JCM b;  4C0G A;  3L2Z A;  2MWP A;  3CCR T;  4JJN K;  2E41 A;  3M57 A;  2FL7 A;  3P8B B;  3UDC A;  4N4I A;  3VYH B;  4C5G A;  1Y96 B;  5GAN f;  5GAN 7;  4II1 A;  1I4K 1;  3GNF B;  4PL6 A;  4Z02 A;  4EMK A;  3JCM J;  4QVD A;  5M9O A;  3JCM h;  2KVQ G;  3FRN A;  1BIB A;  2IVW A;  4L59 A;  2KAF A;  2KSS A;  4XU2 A;  2EFI A;  5CO7 A;  3UWN A;  4C5H A;  1DJ7 B;  5GAO l;  1M90 U;  2M16 A;  4WF2 A;  2EJF A;  3ER0 A;  3PMI A;  2LCC A;  1VQ5 A;  2EQJ A;  1U1S A;  1KC8 C;  2JVV A;  1VQ4 T;  1BYM A;  1N6A A;  3V8K A;  1KQ1 A;  2DKG A;  2WSE E;  3CCR A;  4PJO F;  4M7A F;  2EJ9 A;  2XG8 D;  3LWI A;  1YJ9 A;  4C5I A;  1HK9 A;  2K3Y A;  3GLX A;  3QO3 A;  5LL6 S;  4OB2 B;  1H64 1;  1Y7X A;  2R57 A;  4M75 D;  3A8G B;  4M75 B;  5GAN 4;  4HCB A;  4M78 E;  4PJO A;  3KUF A;  1Q86 U;  2D0Q B;  3NTK A;  1D3B B;  1NE8 A;  2MWO A;  3A8O B;  4A53 A;  3CXC A;  5CR2 A;  3QZ9 B;  1V29 B;  1KG1 A;  4FM4 B;  4ZGJ B;  4OB0 B;  3G71 T;  2ZGW A;  4VUB A;  4HT8 A;  2DTH A;  1VQM T;  3ZEH A;  2QQS A;  1LJO A;  2L8D A;  4QVZ A;  2WAC A;  2QEX T;  4XQ3 A;  4O5V A;  4EMK C;  5GAM g;  1RL2 A;  2EIF A;  2MMP A;  2QQ9 A;  3JCM d;  4M75 A;  4N4G A;  2OAU A;  2JZ2 A;  3CPF A;  5GAN 3;  1D3B A;  3NTI A;  3VU3 C;  4MDW A;  3M55 A;  4ELY C;  4MZT A;  3HPW A;  1Q7Y C;  1YCY A;  3LWH A;  3S3O A;  1Q82 U;  3CMA T;  2VV5 A;  3I56 T;  3OYC A;  4TVR A;  4M75 G;  1ZHI A;  3INZ A;  2YHT A;  2LCL A;  5KH6 A;  4OGC A;  2V8J A;  4HA8 A;  5CK9 A;  5HKC A;  3SWN B;  3RKY A;  4IUU A;  1YJW T;  1OYX A;  3VKI A;  5CIU A;  4F7U E;  5LJ3 j;  3JB9 H;  1K8A U;  3CC7 T;  5FU7 B;  5GAM f;  2XU8 A;  4N4H A;  3X25 B;  3MEV A;  3GF5 A;  4O6J A;  5I2S A;  5LJ5 f;  3SD4 A;  4DOW A;  1SSF A;  3J7A F;  5GMK e;  5LJ5 e;  2PUK B;  5GMK h;  3JCM Q;  3HFO A;  1EIF A;  4OMF B;  2RK2 A;  4E47 A;  1YHQ T;  2CGH A;  2ZPG B;  3M59 A;  3PNW C;  3OY9 A;  1MHN A;  3E9F A;  4C0F A;  3I55 A;  3RKX A;  5DY9 A;  2QQB A;  1LOJ A;  4C8Q B;  4C8Q D;  1VQ6 A;  1N8R C;  3JCM W;  3Q1J A;  4J7I A;  2PU9 B;  4D6W A;  3OYN A;  4M75 C;  2WSF E;  3CCE A;  4V2S A;  2ZPB B;  1OZ2 A;  2RH2 A;  3CD6 T;  3A8H B;  1W4S A;  5D6Y A;  3CC7 A;  4XTX A;  3UT1 A;  2E64 A;  3CC4 T;  2QI2 A;  4DQ2 A;  1YBY A;  3E9G A;  3DB3 A;  4A4G A;  5GAN j;  4F7U F;  1GXI E;  3CME A;  3TCJ A;  4KUL A;  5FLX E;  4JUV A;  4XU1 A;  1S72 T;  5L8R E;  4BI3 A;  1KQ2 A;  3CCM T;  4J5Y A;  4HCZ A;  4BAC A;  2X4X A;  2RI3 A;  4LD9 K;  3RER A;  4M7D B;  2LNV A;  4NOY A;  1VQN T;  1WQW A;  4C8Q G;  4PKC C;  1UGQ B;  4C0D C;  3MET A;  1VQO A;  3DLL A;  1I5L A;  5A0D A;  2K2V A;  2V8K A;  4M7D F;  1ZQ1 A;  4N0A C;  4IUV A;  4EMG A;  3TRE A;  2B8A A;  1BKB A;  5LJ5 d;  4PLI A;  1JBM A;  2KMT A;  2JTM A;  4BDY A;  1JJ2 S;  3CD6 A;  2JTF A;  3MP8 A;  2CZ6 B;  3SWN C;  4ZTJ A;  1VQ9 T;  3PIO A;  4M7D A;  3LX7 A;  2C06 A;  5FU7 C;  1B34 B;  1LNX A;  3L2R A;  1VQ7 T;  2RJF A;  2K5I A;  3OMC A;  3FJP A;  3EFS A;  3CCM A;  2ZPE B;  2E70 A;  4C92 E;  3RUX A;  2ZPF B;  1BIA A;  1KC8 U;  2CZ7 B;  2EJG A;  3FB9 A;  4R56 A;  3CCL A;  5GAO p;  3BDL A;  2VXF A;  1MGQ A;  1N9S A;  1VIE A;  3BW1 A;  3OS5 A;  2RO0 A;  4C8Q C;  1VQK A;  1B34 A;  1G3Y A;  2A7Y A;  4KUI A;  4OB1 B;  1HXD A;  1PSF A;  4XK8 E;  3LGF A;  2XID A;  1NJI C;  4LDX A;  4X34 A;  3VJP A;  1WJQ A;  4J6W A;  4YTL A;  3OBW A;  5EG2 A;  4IUT A;  1N9R A;  2FB7 A;  4A4E A;  1WPY A;  3FIF A;  5CQX A;  3HRT A;  5LJ3 h;  2DIQ A;  3JCM f;  2H3J A;  2DTO A;  4JRK A;  2R5M A;  1QVG A;  5DLQ E;  4XTZ A;  5CAI A;  3JCM e;  1XQH A;  2OTL A;  2E5Q A;  1NPP A;  5D6X A;  4ZTF A;  1R8O B;  2QDY B;  3HP9 A;  3JRZ A;  1FXX A;  2E12 A;  2VUB A;  4JS5 A;  1BI1 A;  1VQ8 T;  4PNO A;  3L1A A;  2DVE A;  5HY6 A;  2GFU A;  2RHU A;  4C92 F;  4J7F A;  4RKU E;  1JB0 E;  2DJZ A;  2F69 A;  4BI4 A;  5GAM j;  2QA4 T;  3M56 A;  3FC3 A;  4M7A D;  2R58 A;  4M7A B;  3OA6 A;  4PJO B;  1VQL A;  1Q7Y U;  1QVF S;  3CEY A;  1UGS B;  2E10 A;  2EQM A;  2HD0 A;  2LRQ A;  2P0Q A;  2A3L A;  4A4K A;  3OYB A;  3UPU A;  1M1K C;  1YJN T;  1KD1 C;  3L2U A;  3PMT A;  5GAN 2;  2K4Y A;  2DAQ A;  1O75 A;  4BD3 A;  4Q5W A;  3PTA A;  3QKJ A;  1IZ6 A;  4B9W A;  2R5A A;  3QII A;  5CKF A;  4C0Z A;  1BI0 A;  3J81 E;  3NFC A;  4LD6 A;  5AYF A;  4XU3 A;  3L2Q A;  2ZZD A;  5J3B A;  4MML A;  2EYQ A;  3OYH A;  1QVF A;  3M4Y A;  3OB9 A;  2NLU A;  4M7A A;  2RI5 A;  5IAY A;  3QYG B;  2RJD A;  1Q81 U;  3JCM c;  2DXT A;  2XHC A;  2DO3 A;  3MP1 A;  3V7C A;  3RMS A;  1WGS A;  4HCC A;  2DEQ A;  4PJO G;  3G4S T;  1VQ4 A;  2E6Z A;  2EKO A;  2GCX A;  3V7S A;  4M7A G;  4HKE A;  2XI9 A;  4ZGE B;  4J6Y A;  3QZ5 B;  5LJ5 g;  3P8D A;  4QQ6 A;  4RCC A;  3SDZ A;  2ZPI B;  3PT9 A;  3QBY A;  1N8R U;  2BIV A;  4BI8 B;  4EDU A;  3N5B B;  3QJY A;  3X20 B;  4QW2 A;  2VYT A;  3CCS T;  1QVP A;  2YLC A;  4DA4 A;  4MMK A;  4JLI A;  1YIJ T;  5KE2 A;  3QPH A;  1M4Z A;  5CKD A;  2DXC A;  5DM7 R;  3OS1 A;  5GAN 5;  2D6F A;  3G71 A;  4M78 F;  4OGE A;  4PLL A;  4B9X A;  1VQM A;  5DLO A;  2VGN A;  4JS4 A;  2MAM A;  5CVI A;  3JB9 F;  2QEX A;  5C0M A;  1W2B S;  3E1S A;  4BE2 A;  3QYH B;  4E7H A;  4QQG A;  1K73 C;  4M7A C;  4PJO C;  2GQV A;  3GP8 A;  2YLB A;  3OSV A;  4M78 A;  3V8J A;  1YIT T;  4XTU A;  4ZN1 A;  2K5F A;  4LDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...