4Z89A

Sh3-ii of drosophila rim-binding protein bound to a cacophony derived peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rim-binding protein
molecule keywords RIM-binding protein, isoform F
publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 15
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z89A00
1E6HA 2DL7A 5L23A 4J9BA 2ENMA 1T3SA 4AFUC 4RTXA 3H0HA 1QKWA 1OEBA 1SHGA 4KRTA 2OI3A 1JO8A 1WIEA 2RQUA 1M3CA 1X2KA 4ZNXA 1JXOA 2BZYA 2V1QA 1VA7A 1W70A 3PVQA 1PKSA 4HCKA 4IIOA 3H0IA 3EG3A 4J9CA 5IHKA 2L3QA 2X3WD 2A37A 1OPLA 3UF4A 3FJ5A 1W1FA 1KJWA 2BTTA 2L2PA 1PNJA 3I5SA 3VRZA 2KBTA 1H92A 2P4RA 1AWXA 2KRSA 2B86A 5ECAA 3QWXX 1AOJA 1UG1A 2M0YA 4OMQA 2EQIA 2JW4A 1ABQA 1QWFA 2DM1A 3EG2A 1JEGA 1K9AA 2ECZA 1GFDA 2DF6A 2DNUA 1YWPA 3CQTA 2JS0A 3I9QA 1PRMC 3NGPA 4LUEA 1T3LA 2K79A 3RBBB 2AK5A 2W0ZA 1X43A 5IHIA 2BZ8A 4EIKA 1ABOA 2YUQA 2EYXA 4ORZA 2MOXA 4OMPA 2BZXA 1I0CA 2C0IA 2YDLA 2YUOA 1WDXA 1AD5A 1I07A 2OJ2A 2LJ3A 4ESRA 2D0NA 5I22A 3UA6A 4F16A 1QLYA 3M0PA 1SEMA 2O9SA 3JV3A 3VS6A 4RTTA 2RMOA 2KT8A 1ZUYA 2W10A 1AVZC 1ARKA 4R0KA 1BB9A 2JS2A 5I11A 2PTKA 3M0TA 4Z8AA 2CT3A 2KYMA 1OPKA 4RUGA 1GBQA 1SSHA 2EBPA 2DJQA 2DYBA 2GTJA 2I0NA 4JZ4A 1YNZA 2C0TA 2DL4A 2KXDA 1XOVA 1SHFA 4JJDA 2VKNA 3IQLA 1PKTA 3EHRA 1WXUA 2C0OA 5GJVB 2KYBA 1U06A 1K0XA 4RTWA 1BU1A 1ZLMA 3REAB 4CC7A 2CH4A 4HVVA 5IH2A 3GBQA 1AWOA 1IO6A 3KFVA 4GBQA 4Z88A 1A0NB 1GFCA 1AWJA 4RTVA 2M51A 5FW9A 4AFZC 1YCSB 2RQWA 1WXBA 4JJCA 1X69A 1WFWA 1NG2A 1JU5C 5IXBA 2F2VA 1M3BA 2A28A 3VRYA 2GNCA 1TUDA 2JTEA 4J9HA 2J6OA 2ROLA 1SPKA 2DL3A 1G83A 5HCKA 1AZEA 1W6XA 2CREA 2KE9A 1UFFA 1ZUUA 2J7IA 3TSZA 1NLOC 1UE9A 1OV3A 1JXMA 3VS1A 4AFQC 1GL5A 1UUEA 2LJ0A 4J9GA 2DBKA 4HXJA 1LCKA 2GGRA 4HVWA 1K0SA 2CSIA 4D8KA 2KRMA 2MCNA 1E6GA 3TVTA 2K7AA 3VS7A 1ZX6A 2SRCA 1FYNA 2JM9A 2FPFA 3VS5A 5FWCA 2VWFA 2KEAA 5IXFA 2FPDA 1QCFA 3ULRB 2NUZA 1YN8A 1Z9QA 3EGUA 3EG0A 4RTYA 2L3PA 1EFNA 2PZ1A 2SEMA 2L0AA 2ROTA 1GRIA 4AG1C 2OAWA 3R6NA 2IIMA 2RN8A 2RQTA 2LMJA 2O9VA 2JMCA 4CC4B 1NLPC 1WLPB 3O5ZA 1GCQA 4AG2C 2EGCA 2RQVA 1RUWA 1MV3A 1AZGB 1RLQC 3RNJA 2KXCA 2YUNA 3VS2A 3M0UA 2FRWA 4J9IA 2YUPA 4D8DA 2RNAA 1PHTA 1UJ0A 1VYVA 2CSQA 3UATA 1T0HA 2KNBB 2EYWA 3U23A 1TG0A 4HVUA 2J06A 4QT7A 3C0CA 1PRLC 2L3SA 2YT6A 1CKBA 3I5RA 1SRLA 2K9GA 2RQRA 1YWOA 1CSKA 1H3HA 2FG0A 2AZSA 1X27A 2DX1A 2RF0A 2V1RA 1BBZA 1OOTA 1H8KA 2DA9A 2NWMA 1AWWA 3ZL7C 3M0SA 2DL5A 1M8MA 2K3BA 1GBRA 2KR3A 4F17A 1NYGA 2KGTA 2YSQA 2EGAA 1K1ZA 2JM8A 1M3AA 3EG1A 2DRKA 1I1JA 4LE9A 5IHNA 1X6GA 4GLMA 4J9EA 4FSSA 1HJDA 2E5KA 1VYUA 2J05A 2AKLA 4OMLA 4CC3A 2JXBA 3THKA 3A98A 2RPNA 2PNIA 4LUDA 1G2BA 3NPFA 4JJBA 4J9DA 1KFZA 3M0QA 1S1NA 1Y0MA 1GCQC 2LZ6B 2O31A 1X6BA 4RTZA 1GCPA 2XMFA 2LNHB 2O2OA 3NMZC 3M0RA 2K2MA 2D1XA 2DE0X 1V1CA 2EVRA 3TSWA 1Z9ZA 4DEXA 2D8JA 2HSPA 1PWTA 2FO0A 1K4US 1UJYA 2JMAA 3PE0A 2ED0A 4Y92A 1UTIA 2J6FA 3H0FA 1HSQA 4OMMA 1WI7A 2VVKA 1MV0B 1X2QA 2FPEA 1UECA 2HDAA 1WYXA 2F2WA 2CDTA 1QKXA 2CUDA 1WA7A 4J9FA 2F2XA 2DL8A 2LX7A 2EW3A 3SHWA 2A08A 1KIKA 4JZ3A 4CC2A 1CKAA 1K76A 3REBB 1UGVA 1AEYA 2KROA 2LJ1A 1FMKA 2GTOA 1WX6A 4A63B 1RI9A 2GBQA 1NYFA 4LN2A 2EPDA 4X1VA 2ESWA 1SRMA 3NHNA 1HD3A 2DLPA 3I35A 1ZBJA 2EYYA 2CUBA 1YP5A 2DMOA 4IIMA 2LQWA 1MUZA 2K6DA 2D8HA 1WXTA 4M4ZA 2FEIA 2EKHA 1UHFA 1U5SA 1M27C 1Y57A 2JT4A 1T0JA 1TUCA 1JQQA 2DILA 2KRNA 4K11A 1U3OA 2A36A 1ZSGA 3LH5A 2FRYA 2G6FX 5EC7A 4F14A 4RTUA 5FWBA 2DBMA 1KSWA 5GJWB 2CH4W 1NM7A 1VYTA 2HBWA 2LP5A 1M30A 4OMOA 1NEBA 2EGEA 2QDLA 2O88A 1J3TA 4LNPA 3VS4A 2GQIA 2J6KA 1ZUKA 1UDLA 2CT4A 1UHCA 2DVJA 2KT1A 1QWEA 1B07A 2LCSA 4E6RA 3VS0A 2ABLA 3H41A 2AZVA 2EYZA 4Z89A 4OMNA 2LQNA 2AKKA 4JPBW 1NEGA 4WCIA 2DRMA 1RLPC 3SEMA 2MIOA 2H8HA 1E7OA 3QWYA 1B3QA 2HCKA 3UA7A 3EHQA 1BK2A 4AFSC 1N5ZA 2HEQA 4DEYA 3PVLA 2X3XD 2ED1A 3VS3A
chains in the Genus database with same CATH superfamily
1VQ8Q 5A0LA 4BY6C 4J9BA 4ATOA 3P8BB 1R8OB 3H8ZA 4PJOA 2H3EB 5LJ5j 4KRTA 1JBMA 1WIEA 4RKUE 4ZNXA 3JCMd 3QUIA 3JCMQ 1TU0B 2HL5C 1XTDA 2LQ8A 2V1QA 4B6MA 4HCKA 2IG0A 2NLUA 1KQ2A 4QQ6A 3MEVA 5IHKA 4M77F 2RI3A 3FJ5A 1EZZB 3SFMA 2BTTA 5GAN7 3V8KA 1EX4A 1VQ6Q 3CPWP 3P8HA 5CIUA 3RKYA 2B86A 2QQRA 3QWXX 1QQJA 2R5AA 2YRVA 1ABQA 1QWFA 4QQGA 4M78C 1K8AC 2QAZA 4M77C 4GLKA 1YJNT 2KMTA 3GPLA 4EMHA 1VQ9A 2K57A 3V7SA 4ORZA 2ZPEB 1WQWA 3NTKA 2C0IA 3M9QA 4M7DF 3CD6Q 4JLIA 1UGPB 5FU6B 3UA6A 3EAEA 3M56A 5GAN6 2E6ZA 1VQOT 6AT1B 1KC8C 1BYMA 2RMOA 3QPHA 2KT8A 2G3RA 1KC8R 1N8RU 3JCMV 3JB9I 1VQ7Q 1AVZC 3QBYA 1BB9A 1TOVA 5GMKm 1Q7YU 4Z8AA 4M7DC 1OPKA 1BCMA 2LT4A 1SSHA 2LDMA 1OU8A 2GTJA 2VXFA 3QKJA 2RHIA 2RK1A 1XOVA 1Q95G 4JJDA 4PKCC 4L59A 3EHRA 2RJCA 1YI2T 1K0XA 4JRPA 2E41A 3CXCA 4RTWA 4C5EA 4HVVA 1BI2A 5IH2A 3GOXA 1SSFA 2CKKA 5D6YA 2ATCB 3G71A 4FYXB 2M02A 1GFCA 1YHQQ 1AWJA 1RAIB 2M51A 3FB9A 2QK0A 5A0DA 1WJSA 1X69A 1R0BG 5HK0A 3BY7A 5CKEA 5IXBA 1JJ2S 1FMVA 5D6WA 1YJWQ 1XJWB 5CR2A 5CQYA 2GNCA 4Z02A 2JTEA 4J9HA 3SWNB 1AZEA 1KQSA 2DETA 4X9DA 1M90C 1KG1A 1UFFA 3X20B 1M90R 2GF7A 1ZUUA 2QQBA 4HT9A 1NLOC 1VQNQ 1OV3A 2RHXA 4AFQC 4BB7A 4BE2A 4FYVB 2MMPA 2E3IA 2WACA 3UPUA 2OX7A 3CC7A 2VASA 4E7ZA 4M75B 2GGRA 3LYIA 1D1CA 2KRMA 4J7FA 3FC3A 5DLOA 2JM9A 2JNGA 2XK0A 3VS5A 2DZ9A 4C0GA 1G5VA 4BDYA 4YTLA 2NUZA 4BE1A 4RTYA 1S72A 3M57A 3VYHB 3X26B 2GCXA 5FU7C 2RN8A 2OTLT 2P0PA 1ZSZC 3CC4Q 2PUKB 3SWNC 1VQOA 5KYYA 3WVEB 5DY9A 2XKOC 1MV3A 4M78G 3VS2A 4M77G 5GAMd 2FRWA 5FRMA 2YUPA 2RNAA 4F7UG 1UJ0A 2DK3A 1BIAA 2CSQA 4Y28E 3AT1B 2LRQA 2JTMA 2MAMA 3CBOA 1TG0A 2M16A 3C0CA 2L3SA 1MNDA 3I5RA 3OW2S 1HK9A 1YWOA 3OYIA 2XIDA 1H3HA 1PC0A 4E47A 1RAEB 2AZSA 4HCCA 1M1GA 5GANh 1OOTA 2HQEA 2LX9A 4LDVA 3M0SA 1M8MA 5L8RE 4BDZA 3CCEQ 2KR3A 2YLBA 1NYGA 1TTHB 5I2SA 3JCMb 2YSQA 2LTOA 5KYWA 3TQ7P 1M3AA 4LE9A 1WHMA 4KGVB 1HJDA 2ZGWA 4LDXA 3CC2Q 2J05A 1Q86U 5CCAA 1W4SA 3THKA 1KD1U 2RA2A 3CCLT 1VQ5A 3I55A 3JCMe 4J6WA 1Q81C 4JJBA 4J9DA 3J80E 1GCQC 4OF1A 2EQJA 4RTZA 1GCPA 4C92C 2X51A 2YRDA 5AT1B 4N4HA 1MMNA 2DE0X 1V1CA 4AT1B 1NJIC 3TSWA 4NL3A 1NJIR 1K4US 3M5AA 3CMAT 1WZOA 4VUBA 1VQ6T 4Y92A 3H0FA 4PFZA 4R55A 1HSQA 1OX8A 3HHTB 2OTJT 3QJ6A 1X2QA 1UECA 2CDTA 4XU1A 5D7UA 3M55A 5GANj 2DL8A 4N0AC 2COZA 3LH0A 4QVDA 3SHWA 1KIKA 3AHUA 4JZ3A 3REBB 2OTLA 2LJ1A 1FMKA 1IB8A 4C8QF 4QVCA 5LJ5f 1NYFA 4LN2A 4KGZB 4Y91A 4X1VA 2ESWA 1Y96B 3NHNA 3QXEB 2YRCA 1K73U 1I5LA 2LQWA 2K6DA 4BD3A 2D8HA 4PJOF 3CCMQ 4A53A 1N9SA 2RB6A 2FEIA 2EKHA 4O6JA 1UHFA 2JJ9A 2NUTB 4KH0B 3PMTA 4M7DE 3OMCA 1VQKQ 1VQ4T 2R58A 1PSEA 2DILA 2A36A 3EGDB 3CCQQ 2FYKA 1ZSGA 3LH5A 2QASA 2QQAA 3VJPA 4F14A 3LX7A 2BIVA 5GJWB 4ZTFA 3CCRT 3C94A 4ZN3A 2O88A 2PVOB 4LNPA 3VS4A 1ZUKA 1B7TA 2KT1A 2DVJA 3JCMg 1RAHB 2KAFA 1Q82R 2EFIA 4XTXA 2D9TA 1M9SA 4MZMA 1VQ8A 2EYZA 3OS1A 4NOYA 2LQNA 3H6ZA 3GP8A 1NPPA 2DRMA 4E7SA 3LLRA 1WHLA 2H8HA 2VGMA 3UA7A 1BK2A 4AFSC 2E70A 3RUXA 3A8HB 1WHKA 2DEQA 3A8GB 2DXUA 1YCYA 1E6HA 2K4YA 5L23A 2ENMA 1T3SA 5DM7R 3G4ST 3ZEHA 1M1KC 2DEUA 1VQ6A 1M1KR 3H0HA 1YIJT 1OEBA 3HTRA 2OI3A 4CI0C 5LJ5g 2QA4Q 1X2KA 1D1AA 4TVRA 4M75A 4WTOB 1JXOA 1VA7A 3PVQA 1PKSA 2LQKA 1MHNA 3H0IA 3EG3A 2EJFA 4C5HA 2X3WD 1OPLA 3UF4A 4C92G 3MCAB 3VRZA 2HZYA 1IGQA 3CMEQ 1RI0A 2D0QB 1QP2A 2KRSA 3E9FA 3V8LA 2HMAA 3GLXA 3WXMB 2C06A 3CD6A 5CQXA 2EQMA 4OMQA 2M0OA 1MMGA 3EG2A 2ECZA 1GFDA 4KULA 5J26A 1GXIE 3CC4T 3I9QA 3V7CA 4PJNA 2W0ZA 3X24B 5IHIA 2BZ8A 4EIKA 1ABOA 2L3RA 1ZBXA 2EYXA 5GAMe 1UB4A 3LWIA 3EH1A 1VQ9T 2Y4YA 2YDLA 1OX9A 2M9UA 2JTFA 5I22A 4RG8A 3OYKA 2E5QA 4BY6B 1SEMA 2O9SA 3JV3A 4DBRA 1IHWA 1RAAB 3HL8A 1VQMQ 3CCRA 2QXFA 3FRNA 3A8OB 1C1AA 2EJGA 1JJ2P 1YHQA 2K5IA 4FIBA 1D3BB 1FWZA 1KHCA 2XU8A 4M7AD 3KBGA 1WXUA 3CEYA 1U06A 3OS0A 4ZTJA 4KGXB 2DERA 1FMWA 3REAB 1ZLMA 4CC7A 2CH4A 1YJWA 3GBQA 1AWOA 4JJNK 3SD4A 2HKNA 2RJEA 2O4XB 4Z88A 3MJXA 3QSUA 4OGEA 1A0NB 4M77B 3G71T 2RK2A 4C5GA 2ZPGB 1VQNA 2RQWA 4OVAA 3G4SA 3T9NA 1X6OA 2P0KA 1WFWA 1YIJA 2VB6A 3OB9A 2MWOA 3WVDB 5KE2A 1IHVA 4M7AE 1TUDA 1I81A 2ROLA 2DL3A 1G83A 5HCKA 2KI7A 3L2ZA 9ATCB 1SF9A 3TSZA 1UE9A 2ZPBB 1JXMA 1N27A 1O9SA 1UUEA 2A7YA 4J9GA 4L6V5 5GAN8 1PM3A 2NUPA 3OYMA 3OYAA 2DBKA 4HXJA 4C8QD 4C0ZA 2ZPIB 1LCKA 4M7DB 3CCSQ 3NTIA 3CCJQ 1K0SA 3EG9A 1KQ1A 3CC7T 4OGCA 3MPUB 1E6GA 3TVTA 2K7AA 3EFOA 4BI4A 1ZX6A 5GAOn 1FYNA 3G6EQ 4MZTA 4PJOD 3CC4A 1D0XA 5FWCA 4IUQA 2E12A 2QQSA 1QCFA 3L2WA 1VQPT 1TH7A 4DBFA 1Y96A 3GF5A 3CCMT 3OW2P 2EAYA 2L0AA 3RMQA 1B34B 1GRIA 2P0QA 2RI2A 1S72T 3R6NA 4C8QE 2LCCA 4UC4A 3URGA 2IIMA 4A54A 2QQ9A 2NUTA 1WLPB 3EGXB 2FL7A 8AT1B 4EDUA 4AG2C 1U8RA 1K8AU 2K5LA 1AZGB 1N8RR 4PJOE 3RNJA 4C5IA 2KXCA 1M1FA 3EGDA 5GANe 5KYUB 5GMKh 3M0UA 1MMAA 1W2BS 4D8DA 2BKDN 1Q7YR 4ANJA 2EKOA 1D1BA 3E2UA 5J3BA 5GAMh 4IUPA 3OYGA 2KNBB 5LJ3h 3CCEA 2BUDA 3X28B 4C0DB 3SB2A 1PRLC 2YT6A 1CKBA 2RQRA 7AT1B 4FYWB 4BUGA 1LNXA 3OYJA 1QVPA 2FG0A 4A4KA 1KC8U 1K9MU 3C95A 2RF0A 2V1RA 3CC2A 5A2QE 1KK7A 3BDLA 3JCMW 2DA9A 2NWMA 4LD9K 1AWWA 2DL5A 2K3BA 3RDVA 1YITQ 2RJFA 2XDBA 3F70A 1RAFB 2JM8A 3QYHB 2P4TA 2DVEA 1NBEB 5LL6S 3A8MB 5IHNA 5CK9A 1X6GA 2FB7A 4J9EA 1Y7XA 4FM4B 3CCUQ 1BI3A 1QVGS 2LNVA 2CZ6B 4OMLA 3QIIA 5FU7B 1LJOA 3D7SB 4LUDA 1ZSZB 5FLXE 1S1NA 1Y0MA 2LZ6B 2XHCA 1VQ5T 4MDWA 3I55T 1RAGB 3JRZA 2O2OA 3NMZC 3HRSA 4XK8E 2COYA 5FRNA 4C0DC 2JUFA 2EVRA 1UGQB 1Z9ZA 4NS5A 5CKBA 4DEXA 2FO0A 1OU9A 2MF2A 1RACB 5GAMj 1JB0E 2L8DA 2J6FA 5LJ3j 2M1HA 4OMMA 1MNEA 3LW5E 3S6WA 3KUFA 1VQPA 3RIRA 2F2WA 1WYXA 1QKXA 1TXQA 4J9FA 3VV0A 2HAXA 2F2XA 3BDUA 3CCMA 4LDUA 1C0MA 2COWA 4HT8A 3UDCA 2EW3A 5GANg 3RR6A 2HKQB 1K76A 4Q5WA 1AEYA 4A63B 1VQKA 1RI9A 2DZCA 2GBQA 4NL2A 1YJ9Q 3OBYA 2VYTA 2HD0A 3CCQA 3I35A 1VQLQ 2DMOA 1MUZA 2CP5A 3I56Q 4IUTA 1VQMT 3G7ZA 3TREA 4OP0A 1U5SA 4OB1B 5LJ3d 5I21A 1M27C 2DXBA 1Y57A 4JRIA 2JT4A 2KY9A 4C92B 3CCVQ 5C0MA 3CPWS 1M2VB 2FRYA 2CZ1B 5FWBA 1EIFA 3OYDA 2CH4W 3DB4A 1NM7A 4ZGDB 1AHJB 4LDYA 4XTYA 2LP5A 2HL3A 2EGEA 5FROA 4PJJA 2GQIA 2P84A 2CT4A 1UHCA 2GQVA 2E6NA 4M7DG 3DB3A 3QDFA 1D0ZA 2DIQA 4JDSA 4M78A 2AZVA 4M77A 2OAUA 2RHYA 1G3SA 3JB9F 4F7UA 2QEXQ 1Q86R 1VQ8T 2CP3A 3MKDA 2AKKA 1KD1R 1NEGA 4XU2A 1RLPC 2QA4A 4M7AF 2RM4A 2HEQA 5CKFA 4DOWA 3PVLA 4XTVA 2X3XD 3ER0A 1V29B 3VS3A 3JCMf 3S3OA 1WPYA 3A8LB 4QKUA 4AFUC 3DLMA 5C6SA 1QKWA 3CMEA 2E10A 4C8QB 3E19A 1ZA2B 1JO8A 4M7AC 2RQUA 2ZAEA 4M7DA 2JVVA 1I4K1 1Q81U 4HCZA 1W70A 4IIOA 1I5OB 3M4YA 2A37A 1KJWA 1HYOA 2A0FB 1H92A 2DD5A 2HNIA 1AWXA 3V8JA 1WGSA 1V76A 5ECAA 3CPFA 1AOJA 1UG1A 1IRXA 2KDSA 2LT1A 2M0YA 2JW4A 2DM1A 4J7IA 4V2SA 1K9AA 1B34A 3CD6T 4QVZA 2DF6A 4ZGEB 2DNUA 1K73R 3EFSA 3CQTA 2JS0A 8ATCB 3NGPA 2DTIA 4LUEA 2K79A 2AK5A 3EGXA 5CVIA 1VQMA 3OQ5A 3L42A 3J7AF 2MOXA 2CZ7B 3INZA 2HQHA 1VQ7T 4ELYC 2BZXA 1I0CA 4FSXA 4C8QC 3MP1A 2YUOA 4EMKC 1AT1B 2H3JA 1AD5A 2OJ2A 2X9HA 4ESRA 1YJNQ 4F16A 1I8FA 5IT9E 3M0PA 4DQ2A 2F1LA 2E3HA 4RTTA 1QP3A 2RI5A 4PJOC 2QGFB 1ZUYA 2W10A 4IUVA 3EH2A 2JOYA 1ARKA 2EQKA 3OY9A 2HQXA 5I11A 3M0TA 4OB3B 1VUBA 2KYMA 1R77A 3OBWA 4OB0B 1JJ2A 4RUGA 1X75C 2X4JA 2YLCA 2EBPA 2DYBA 1F1BB 2I0NA 3HRUA 1VQOQ 1Q82C 1YNZA 2C0TA 2DL4A 3UT1A 5D6XA 4MMLA 4ME7A 1SHFA 4JRQA 1YHQT 4N4GA 3IQLA 1C6VX 4A4FA 1NE8A 2KYBA 1BCOA 4J8OA 3L2UA 5CAIA 1IXDA 1BU1A 1YBYA 4C0FA 3CCUT 2E4HA 1IO6A 3HRTA 1YJWT 3KFVA 4GBQA 2YXYA 4RTVA 1YI2Q 2PVGB 2DJZA 1HXDA 4AFZC 1ZSZA 3SWNA 3GNFB 3META 2X4YA 3PIOA 1QW1A 3VKIA 1NG2A 1QCNA 1VQNT 1JU5C 2F2VA 3CCSA 4E2FB 3MEAA 3CCJA 1M3BA 2A28A 2PQWA 4MDXA 4IKFA 1SPKA 3GIBA 2QI2A 1X01A 1OZ3A 3OSVA 3L1AA 2FVUA 2QTXA 3CXCS 3VS1A 2DXTA 5HY6A 4J83A 2QGGA 3G1JA 1M1KU 1RABB 2CSIA 2RO0A 4DOVA 4D8KA 2MK5A 3C4SA 2MCNA 2DD4A 1N6AA 2IVWA 2SRCA 2LCLA 1W2BP 2KSSA 4M7AG 1U1TA 3PT9A 3CBMA 1YJ9T 2FPDA 1WHHA 3ULRB 5HK3A 4M75D 2YHTA 1VQLT 1YN8A 2IPOB 5GMKe 4RCCA 1VQ7A 1EFNA 3OW2A 2X35A 4KT0E 2SEMA 1KQSS 3HPWA 5LJ3e 1N9RA 4RMOA 2LMJA 2O9VA 5GAMf 5GAN3 3MEUA 5KCOA 3PMIA 1GCQA 4PFOA 4EPCA 2RQVA 4C92A 4J6XA 2MPXC 1RLQC 3HFNA 1M2VA 1O75A 4CRIA 4J9IA 4IURA 5LJ5h 3QYGB 2BE7D 4PLLA 1VYVA 4M75E 3BW1A 3UATA 3J81E 1T0HA 2EYWA 3U23A 4HVUA 4R56A 1LOJA 1YITA 2CS7A 3JB9D 3RMSA 1H3ZA 1PSFA 4QT7A 4FW1A 4XTUA 3CCET 4C8QG 1SRLA 1VIEA 5EG2A 4ZN1A 3CCUA 5GAOp 2DFUA 3OS2A 4N0AA 4HKEA 4PJOG 1H8KA 2QEXT 4XQ3A 4OMFB 3ZL7C 3CC2T 3MEWA 1GBRA 3JCMJ 2ZPFB 1K1ZA 3EG1A 2DRKA 3MP8A 4E7JA 5GMKi 2X4XA 2HSEB 4GLMA 3OYCA 4FSSA 4FU6A 4BI3A 2K2VA 5GAOl 4CC3A 4PK4A 2RH2A 5KYWB 2RPNA 2PNIA 3QDRB 1G2BA 1QCOA 3FLGA 3NPFA 1PD0A 3M0QA 2O31A 4FW2A 2R57A 1WHJA 2LNHB 2VGNA 3M0RA 4J5YA 2D1XA 2FZCB 2D8JA 2HSPA 3QZ5B 4PNOA 1UJYA 2JMAA 3CCLQ 2L5QA 3PE0A 2DXCA 2ED0A 2K3YA 5GAMg 5A0GA 3HSBA 5LJ3g 2VVKA 1YJ9A 2E64A 3X25B 2HDAA 2DTHA 4M78F 2CUDA 1VQLA 2EQUA 3A5ZB 2WSCE 3I56A 3CMAQ 4F7UF 2DKGA 2LX7A 1CKAA 1UGVA 3JB9J 3MO8A 4PLIA 2OTJQ 2KROA 2E65A 4KBMB 3CCVA 2Y90A 2EIFA 1FX7A 2BE9B 2EPDA 1VQKT 3M54A 1SRMA 1K8AR 2DLPA 1ZBJA 2EYYA 2CUBA 2EWNA 2AT1B 1N8RC 3CCQT 4FCYA 5LJ5d 4GY5A 1TS9A 2PUOB 1Q7YC 2B8AA 2JN0A 1OYXA 5GANf 3ME9A 2F69A 1IGUA 4JUVA 1JQQA 2KRNA 5J39A 3OYNA 1U3OA 5EC7A 2G6FX 1BI0A 1QVFS 1UGRB 4RTUA 1K9MC 1UEBA 1KSWA 2WSFE 2Z0WA 2KQWA 1K9MR 3LGLA 1XNIA 4FT4A 2HBWA 2QEXA 1M30A 1VQ4Q 1PG5B 3PIPA 3JAME 1WJRA 2QDLA 2JZ2A 5KCHA 2J6KA 1NZ9A 5GMKl 1UDLA 4IUUA 3ZFJA 5KE3A 2VV5A 3DKMA 4ELZC 5GAOq 3L2RA 2FZGB 2LCSA 3VS0A 4PJMA 5GAN4 5CO7A 3V7RA 3CCRQ 3JSCA 4Z89A 4E7IA 4WF2A 3MP6A 3CBPA 2CP0A 1QMCA 4JPBW 3SEMA 3C12A 3TCJA 2MIOA 1E7OA 4B9WA 1IREB 3QWYA 1B3QA 2DTOA 2GFUA 2VUBA 3EHQA 4A4EA 2QA4T 2DAQA 4DEYA 2ZZDA 2ED1A 5FU6C 2DL7A 3R6OA 5GMKj 3P8DA 3RKXA 4RTXA 2KVQG 1SHGA 4XTZA 4B9XA 1M3CA 2QDYB 3CMET 4OB2B 2V26A 1TWBA 1TUGB 2BZYA 1BKBA 1M90U 3JB9H 1Y07A 3OYHA 3G4SQ 4J9CA 2L3QA 1YIJQ 3OMGA 4MZPA 3FDRA 1W1FA 2L2PA 1PNJA 3I5SA 1Y71A 1YFNA 4BE0A 2KBTA 2P4RA 4F04B 2CYZB 1OQKA 1SKUB 2DYIA 3HP9A 2EQIA 1JEGA 2FZKB 3QHSA 1YJNA 5AYFA 1YWPA 4FYYB 1PRMC 4LDWA 1T3LA 3RBBB 3RKWA 1PCXA 1D0YA 1X43A 3NTHA 2YUQA 3L2VA 4DA4A 4OMPA 3SDZA 5KH6A 4M75F 4DBQA 1OULA 3M53A 2VC8A 1WDXA 1I07A 2LJ3A 2D0NA 3VUZA 1QLYA 3KXTA 2DIGA 3VS6A 5KYXB 1BI1A 2RD1A 4D6WA 4DBHA 2EYQA 1D3BA 1VQ9Q 4M7AB 4R0KA 3OA6A 2JS2A 2PTKA 4J6YA 2CT3A 4M75C 2ZCFB 3E1SA 1GBQA 4N4IA 2D6FA 2DJQA 4JZ4A 4KH1B 2KXDA 1YI2A 4QW2A 2L89A 2VKNA 1PKTA 2C0OA 2GFAA 2MYSA 2O4XA 5GJVB 3BE3A 4A4HA 2XDPA 4RG2A 1Q86C 4BACA 3CXCP 2XI9A 1KD1C 4RCBA 1SG5A 2AIRB 5GAN5 4L5GA 3HFOA 3PTAA 3RERA 2F5TX 3FJPA 5FW9A 4C92F 4KUIA 3TU4K 1YCSB 1KHIA 1WXBA 1VOMA 4JJCA 1WQ7A 3DLLA 5M9OA 1XQHA 1G3YA 4P5NA 3PNWC 4M78D 2F5KA 3VRYA 3S3NA 3CCST 4M77D 4EMKB 3G71Q 3CCJT 2J6OA 4FL6A 3HKSA 1Q81R 1W6XA 2CP2A 2CREA 2KE9A 4FT2A 1KQSP 2EJ9A 2FHDA 2J7IA 3G6ET 4PJOB 5DLQE 1GL5A 2LJ0A 3OYEA 2VXEA 5I2MA 1NJIU 4O5VA 3PGGA 4HVWA 1TSFA 4PJLA 1M2OA 1ZA1B 5IAYA 2XICA 4JRKA 1ZQ1A 3VS7A 5KYNA 5CKDA 1W2BA 2NUPB 2FPFA 2VWFA 5GAN2 4M78E 1D09B 2KEAA 5IXFA 1K73C 4M77E 2QYZA 3EG9B 1RL2A 2LC4A 4M7DD 4F7UE 3Q1JA 1Z9QA 3EGUA 3EFOB 3QZ9B 3EG0A 3CC7Q 4PL6A 3LGFA 2L3PA 5LJ5e 1QVFA 2PZ1A 1BIBA 2ROTA 2YWWA 4AG1C 2OAWA 3E9GA 4AMCA 5KYUA 1VIFA 2CP7A 4JLGA 2RQTA 4HA8A 3TEEA 2JMCA 4CC4B 1NLPC 3O5ZA 4E7KA 1VQPQ 1DJ7B 4LXCA 2EGCA 3QJYA 5GAOr 1RUWA 4QQDA 2V8KA 2YUNA 1WNLA 2XD0A 4II1A 1S72Q 1PHTA 3M59A 2KK4A 1M5Q1 4EMGA 4XU3A 1U1SA 1QVGA 1PD1A 2J06A 4JS5A 2QG9B 3JCMX 2I2LA 2HBPA 1RADB 3A1PA 2V8IA 2K9GA 3QG1A 1YITT 1JRIA 1MMDA 1CSKA 5GANd 1X27A 2DX1A 1BBZA 3O8VA 2CGHA 5HKCA 3M4GA 3GNGA 1LVKA 3OYYA 1OZ2A 4MMKA 4BI8B 4F17A 3BFMA 2KGTA 1OI1A 2EGAA 3S3MA 4M75G 1Q82U 2WSEE 2ZPHB 2RJDA 1I1JA 2E5KA 1VYUA 1G8XA 3CCLA 2AKLA 1LPLA 2JXBA 1G3WA 3A98A 3L2QA 3VU3C 1KFZA 2XG8D 3G6EA 1X6BA 2XMFA 1M4ZA 2CP6A 2K2MA 3MHXA 2MWPA 2V8JA 1P92A 4XTWA 3CMAA 2DO3A 1PWTA 1R0CB 3ZBDA 3JB9G 2OTJA 1UTIA 1VQ5Q 3I55Q 1WI7A 4JS4A 1MV0B 3JCMh 2R5MA 4PFPA 2FPEA 2X4WA 2PU9B 1WA7A 2NYSA 4E7LA 1NPRA 3CPWA 2A08A 1H641 3I56T 4CC2A 2K3XA 2LVMA 1QVFP 2A3LA 3FEOA 4X9CA 2GTOA 5IN1A 1WX6A 3JCMc 4XU0A 2QTVA 3OSSC 3VYGA 2PVDB 1HD3A 2CZ0B 3CCVT 1ZHIA 3FIFA 5LJ3f 2XDDA 3M58A 4XAXB 1YP5A 4IIMA 3UWNA 1M8VA 3OYLA 1WXTA 4M4ZA 3ASKA 5KYXA 3OS5A 1VQ4A 1UGSB 1G3TA 2OTLQ 3LWHA 3VUBA 3PFSA 5KYYB 4M7AA 3H9NA 4HCBA 1T0JA 2DPPB 1TUCA 1QVGP 4K11A 1IZ6A 2RHZA 1WJQA 2AHJB 2O01E 2DBMA 2Y4XA 3NFCA 4E7HA 3QO3A 1VYTA 3RESA 4OMOA 1NEBA 3EFRA 4X34A 4C92D 1WHGA 1J3TA 1FXXA 4A4GA 1QWEA 3OYFA 1B07A 4E6RA 4KUDK 3N5BB 2ABLA 3H41A 5GAOm 3OYBA 4OMNA 2E1HA 5CKHA 1MGQA 4WCIA 4LD6A 2HCKA 4M78B 4ZGJB 3JCMP 2K5FA 1ACMB 1N5ZA 4C8QA 2RHUA 2MI6A 4C92E 4F7UB 4EMKA
chains in the Genus database with same CATH topology
1E6HA 2DL7A 5L23A 4J9BA 2ENMA 1T3SA 4AFUC 4RTXA 3H0HA 1QKWA 1OEBA 1SHGA 4KRTA 2OI3A 1JO8A 1WIEA 2RQUA 1M3CA 1X2KA 4ZNXA 1JXOA 2BZYA 2V1QA 1VA7A 1W70A 3PVQA 1PKSA 4HCKA 4IIOA 3H0IA 3EG3A 4J9CA 5IHKA 2L3QA 2X3WD 2A37A 1OPLA 3UF4A 3FJ5A 1W1FA 1KJWA 2BTTA 2L2PA 1PNJA 3I5SA 3VRZA 2KBTA 1H92A 2P4RA 1AWXA 2KRSA 2B86A 5ECAA 3QWXX 1AOJA 1UG1A 2M0YA 4OMQA 2EQIA 2JW4A 1ABQA 1QWFA 2DM1A 3EG2A 1JEGA 1K9AA 2ECZA 1GFDA 2DF6A 2DNUA 1YWPA 3CQTA 2JS0A 3I9QA 1PRMC 3NGPA 4LUEA 1T3LA 2K79A 3RBBB 2AK5A 2W0ZA 1X43A 5IHIA 2BZ8A 4EIKA 1ABOA 2YUQA 2EYXA 4ORZA 2MOXA 4OMPA 2BZXA 1I0CA 2C0IA 2YDLA 2YUOA 1WDXA 1AD5A 1I07A 2OJ2A 2LJ3A 4ESRA 2D0NA 5I22A 3UA6A 4F16A 1QLYA 3M0PA 1SEMA 2O9SA 3JV3A 3VS6A 4RTTA 2RMOA 2KT8A 1ZUYA 2W10A 1AVZC 1ARKA 4R0KA 1BB9A 2JS2A 5I11A 2PTKA 3M0TA 4Z8AA 2CT3A 2KYMA 1OPKA 4RUGA 1GBQA 1SSHA 2EBPA 2DJQA 2DYBA 2GTJA 2I0NA 4JZ4A 1YNZA 2C0TA 2DL4A 2KXDA 1XOVA 1SHFA 4JJDA 2VKNA 3IQLA 1PKTA 3EHRA 1WXUA 2C0OA 5GJVB 2KYBA 1U06A 1K0XA 4RTWA 1BU1A 1ZLMA 3REAB 4CC7A 2CH4A 4HVVA 5IH2A 3GBQA 1AWOA 1IO6A 3KFVA 4GBQA 4Z88A 1A0NB 1GFCA 1AWJA 4RTVA 2M51A 5FW9A 4AFZC 1YCSB 2RQWA 1WXBA 4JJCA 1X69A 1WFWA 1NG2A 1JU5C 5IXBA 2F2VA 1M3BA 2A28A 3VRYA 2GNCA 1TUDA 2JTEA 4J9HA 2J6OA 2ROLA 1SPKA 2DL3A 1G83A 5HCKA 1AZEA 1W6XA 2CREA 2KE9A 1UFFA 1ZUUA 2J7IA 3TSZA 1NLOC 1UE9A 1OV3A 1JXMA 3VS1A 4AFQC 1GL5A 1UUEA 2LJ0A 4J9GA 2DBKA 4HXJA 1LCKA 2GGRA 4HVWA 1K0SA 2CSIA 4D8KA 2KRMA 2MCNA 1E6GA 3TVTA 2K7AA 3VS7A 1ZX6A 2SRCA 1FYNA 2JM9A 2FPFA 3VS5A 5FWCA 2VWFA 2KEAA 5IXFA 2FPDA 1QCFA 3ULRB 2NUZA 1YN8A 1Z9QA 3EGUA 3EG0A 4RTYA 2L3PA 1EFNA 2PZ1A 2SEMA 2L0AA 2ROTA 1GRIA 4AG1C 2OAWA 3R6NA 2IIMA 2RN8A 2RQTA 2LMJA 2O9VA 2JMCA 4CC4B 1NLPC 1WLPB 3O5ZA 1GCQA 4AG2C 2EGCA 2RQVA 1RUWA 1MV3A 1AZGB 1RLQC 3RNJA 2KXCA 2YUNA 3VS2A 3M0UA 2FRWA 4J9IA 2YUPA 4D8DA 2RNAA 1PHTA 1UJ0A 1VYVA 2CSQA 3UATA 1T0HA 2KNBB 2EYWA 3U23A 1TG0A 4HVUA 2J06A 4QT7A 3C0CA 1PRLC 2L3SA 2YT6A 1CKBA 3I5RA 1SRLA 2K9GA 2RQRA 1YWOA 1CSKA 1H3HA 2FG0A 2AZSA 1X27A 2DX1A 2RF0A 2V1RA 1BBZA 1OOTA 1H8KA 2DA9A 2NWMA 1AWWA 3ZL7C 3M0SA 2DL5A 1M8MA 2K3BA 1GBRA 2KR3A 4F17A 1NYGA 2KGTA 2YSQA 2EGAA 1K1ZA 2JM8A 1M3AA 3EG1A 2DRKA 1I1JA 4LE9A 5IHNA 1X6GA 4GLMA 4J9EA 4FSSA 1HJDA 2E5KA 1VYUA 2J05A 2AKLA 4OMLA 4CC3A 2JXBA 3THKA 3A98A 2RPNA 2PNIA 4LUDA 1G2BA 3NPFA 4JJBA 4J9DA 1KFZA 3M0QA 1S1NA 1Y0MA 1GCQC 2LZ6B 2O31A 1X6BA 4RTZA 1GCPA 2XMFA 2LNHB 2O2OA 3NMZC 3M0RA 2K2MA 2D1XA 2DE0X 1V1CA 2EVRA 3TSWA 1Z9ZA 4DEXA 2D8JA 2HSPA 1PWTA 2FO0A 1K4US 1UJYA 2JMAA 3PE0A 2ED0A 4Y92A 1UTIA 2J6FA 3H0FA 1HSQA 4OMMA 1WI7A 2VVKA 1MV0B 1X2QA 2FPEA 1UECA 2HDAA 1WYXA 2F2WA 2CDTA 1QKXA 2CUDA 1WA7A 4J9FA 2F2XA 2DL8A 2LX7A 2EW3A 3SHWA 2A08A 1KIKA 4JZ3A 4CC2A 1CKAA 1K76A 3REBB 1UGVA 1AEYA 2KROA 2LJ1A 1FMKA 2GTOA 1WX6A 4A63B 1RI9A 2GBQA 1NYFA 4LN2A 2EPDA 4X1VA 2ESWA 1SRMA 3NHNA 1HD3A 2DLPA 3I35A 1ZBJA 2EYYA 2CUBA 1YP5A 2DMOA 4IIMA 2LQWA 1MUZA 2K6DA 2D8HA 1WXTA 4M4ZA 2FEIA 2EKHA 1UHFA 1U5SA 1M27C 1Y57A 2JT4A 1T0JA 1TUCA 1JQQA 2DILA 2KRNA 4K11A 1U3OA 2A36A 1ZSGA 3LH5A 2FRYA 2G6FX 5EC7A 4F14A 4RTUA 5FWBA 2DBMA 1KSWA 5GJWB 2CH4W 1NM7A 1VYTA 2HBWA 2LP5A 1M30A 4OMOA 1NEBA 2EGEA 2QDLA 2O88A 1J3TA 4LNPA 3VS4A 2GQIA 2J6KA 1ZUKA 1UDLA 2CT4A 1UHCA 2DVJA 2KT1A 1QWEA 1B07A 2LCSA 4E6RA 3VS0A 2ABLA 3H41A 2AZVA 2EYZA 4Z89A 4OMNA 2LQNA 2AKKA 4JPBW 1NEGA 4WCIA 2DRMA 1RLPC 3SEMA 2MIOA 2H8HA 1E7OA 3QWYA 1B3QA 2HCKA 3UA7A 3EHQA 1BK2A 4AFSC 1N5ZA 2HEQA 4DEYA 3PVLA 2X3XD 2ED1A 3VS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6H A;  2DL7 A;  5L23 A;  4J9B A;  2ENM A;  1T3S A;  4AFU C;  4RTX A;  3H0H A;  1QKW A;  1OEB A;  1SHG A;  4KRT A;  2OI3 A;  1JO8 A;  1WIE A;  2RQU A;  1M3C A;  1X2K A;  4ZNX A;  1JXO A;  2BZY A;  2V1Q A;  1VA7 A;  1W70 A;  3PVQ A;  1PKS A;  4HCK A;  4IIO A;  3H0I A;  3EG3 A;  4J9C A;  5IHK A;  2L3Q A;  2X3W D;  2A37 A;  1OPL A;  3UF4 A;  3FJ5 A;  1W1F A;  1KJW A;  2BTT A;  2L2P A;  1PNJ A;  3I5S A;  3VRZ A;  2KBT A;  1H92 A;  2P4R A;  1AWX A;  2KRS A;  2B86 A;  5ECA A;  3QWX X;  1AOJ A;  1UG1 A;  2M0Y A;  4OMQ A;  2EQI A;  2JW4 A;  1ABQ A;  1QWF A;  2DM1 A;  3EG2 A;  1JEG A;  1K9A A;  2ECZ A;  1GFD A;  2DF6 A;  2DNU A;  1YWP A;  3CQT A;  2JS0 A;  3I9Q A;  1PRM C;  3NGP A;  4LUE A;  1T3L A;  2K79 A;  3RBB B;  2AK5 A;  2W0Z A;  1X43 A;  5IHI A;  2BZ8 A;  4EIK A;  1ABO A;  2YUQ A;  2EYX A;  4ORZ A;  2MOX A;  4OMP A;  2BZX A;  1I0C A;  2C0I A;  2YDL A;  2YUO A;  1WDX A;  1AD5 A;  1I07 A;  2OJ2 A;  2LJ3 A;  4ESR A;  2D0N A;  5I22 A;  3UA6 A;  4F16 A;  1QLY A;  3M0P A;  1SEM A;  2O9S A;  3JV3 A;  3VS6 A;  4RTT A;  2RMO A;  2KT8 A;  1ZUY A;  2W10 A;  1AVZ C;  1ARK A;  4R0K A;  1BB9 A;  2JS2 A;  5I11 A;  2PTK A;  3M0T A;  4Z8A A;  2CT3 A;  2KYM A;  1OPK A;  4RUG A;  1GBQ A;  1SSH A;  2EBP A;  2DJQ A;  2DYB A;  2GTJ A;  2I0N A;  4JZ4 A;  1YNZ A;  2C0T A;  2DL4 A;  2KXD A;  1XOV A;  1SHF A;  4JJD A;  2VKN A;  3IQL A;  1PKT A;  3EHR A;  1WXU A;  2C0O A;  5GJV B;  2KYB A;  1U06 A;  1K0X A;  4RTW A;  1BU1 A;  1ZLM A;  3REA B;  4CC7 A;  2CH4 A;  4HVV A;  5IH2 A;  3GBQ A;  1AWO A;  1IO6 A;  3KFV A;  4GBQ A;  4Z88 A;  1A0N B;  1GFC A;  1AWJ A;  4RTV A;  2M51 A;  5FW9 A;  4AFZ C;  1YCS B;  2RQW A;  1WXB A;  4JJC A;  1X69 A;  1WFW A;  1NG2 A;  1JU5 C;  5IXB A;  2F2V A;  1M3B A;  2A28 A;  3VRY A;  2GNC A;  1TUD A;  2JTE A;  4J9H A;  2J6O A;  2ROL A;  1SPK A;  2DL3 A;  1G83 A;  5HCK A;  1AZE A;  1W6X A;  2CRE A;  2KE9 A;  1UFF A;  1ZUU A;  2J7I A;  3TSZ A;  1NLO C;  1UE9 A;  1OV3 A;  1JXM A;  3VS1 A;  4AFQ C;  1GL5 A;  1UUE A;  2LJ0 A;  4J9G A;  2DBK A;  4HXJ A;  1LCK A;  2GGR A;  4HVW A;  1K0S A;  2CSI A;  4D8K A;  2KRM A;  2MCN A;  1E6G A;  3TVT A;  2K7A A;  3VS7 A;  1ZX6 A;  2SRC A;  1FYN A;  2JM9 A;  2FPF A;  3VS5 A;  5FWC A;  2VWF A;  2KEA A;  5IXF A;  2FPD A;  1QCF A;  3ULR B;  2NUZ A;  1YN8 A;  1Z9Q A;  3EGU A;  3EG0 A;  4RTY A;  2L3P A;  1EFN A;  2PZ1 A;  2SEM A;  2L0A A;  2ROT A;  1GRI A;  4AG1 C;  2OAW A;  3R6N A;  2IIM A;  2RN8 A;  2RQT A;  2LMJ A;  2O9V A;  2JMC A;  4CC4 B;  1NLP C;  1WLP B;  3O5Z A;  1GCQ A;  4AG2 C;  2EGC A;  2RQV A;  1RUW A;  1MV3 A;  1AZG B;  1RLQ C;  3RNJ A;  2KXC A;  2YUN A;  3VS2 A;  3M0U A;  2FRW A;  4J9I A;  2YUP A;  4D8D A;  2RNA A;  1PHT A;  1UJ0 A;  1VYV A;  2CSQ A;  3UAT A;  1T0H A;  2KNB B;  2EYW A;  3U23 A;  1TG0 A;  4HVU A;  2J06 A;  4QT7 A;  3C0C A;  1PRL C;  2L3S A;  2YT6 A;  1CKB A;  3I5R A;  1SRL A;  2K9G A;  2RQR A;  1YWO A;  1CSK A;  1H3H A;  2FG0 A;  2AZS A;  1X27 A;  2DX1 A;  2RF0 A;  2V1R A;  1BBZ A;  1OOT A;  1H8K A;  2DA9 A;  2NWM A;  1AWW A;  3ZL7 C;  3M0S A;  2DL5 A;  1M8M A;  2K3B A;  1GBR A;  2KR3 A;  4F17 A;  1NYG A;  2KGT A;  2YSQ A;  2EGA A;  1K1Z A;  2JM8 A;  1M3A A;  3EG1 A;  2DRK A;  1I1J A;  4LE9 A;  5IHN A;  1X6G A;  4GLM A;  4J9E A;  4FSS A;  1HJD A;  2E5K A;  1VYU A;  2J05 A;  2AKL A;  4OML A;  4CC3 A;  2JXB A;  3THK A;  3A98 A;  2RPN A;  2PNI A;  4LUD A;  1G2B A;  3NPF A;  4JJB A;  4J9D A;  1KFZ A;  3M0Q A;  1S1N A;  1Y0M A;  1GCQ C;  2LZ6 B;  2O31 A;  1X6B A;  4RTZ A;  1GCP A;  2XMF A;  2LNH B;  2O2O A;  3NMZ C;  3M0R A;  2K2M A;  2D1X A;  2DE0 X;  1V1C A;  2EVR A;  3TSW A;  1Z9Z A;  4DEX A;  2D8J A;  2HSP A;  1PWT A;  2FO0 A;  1K4U S;  1UJY A;  2JMA A;  3PE0 A;  2ED0 A;  4Y92 A;  1UTI A;  2J6F A;  3H0F A;  1HSQ A;  4OMM A;  1WI7 A;  2VVK A;  1MV0 B;  1X2Q A;  2FPE A;  1UEC A;  2HDA A;  1WYX A;  2F2W A;  2CDT A;  1QKX A;  2CUD A;  1WA7 A;  4J9F A;  2F2X A;  2DL8 A;  2LX7 A;  2EW3 A;  3SHW A;  2A08 A;  1KIK A;  4JZ3 A;  4CC2 A;  1CKA A;  1K76 A;  3REB B;  1UGV A;  1AEY A;  2KRO A;  2LJ1 A;  1FMK A;  2GTO A;  1WX6 A;  4A63 B;  1RI9 A;  2GBQ A;  1NYF A;  4LN2 A;  2EPD A;  4X1V A;  2ESW A;  1SRM A;  3NHN A;  1HD3 A;  2DLP A;  3I35 A;  1ZBJ A;  2EYY A;  2CUB A;  1YP5 A;  2DMO A;  4IIM A;  2LQW A;  1MUZ A;  2K6D A;  2D8H A;  1WXT A;  4M4Z A;  2FEI A;  2EKH A;  1UHF A;  1U5S A;  1M27 C;  1Y57 A;  2JT4 A;  1T0J A;  1TUC A;  1JQQ A;  2DIL A;  2KRN A;  4K11 A;  1U3O A;  2A36 A;  1ZSG A;  3LH5 A;  2FRY A;  2G6F X;  5EC7 A;  4F14 A;  4RTU A;  5FWB A;  2DBM A;  1KSW A;  5GJW B;  2CH4 W;  1NM7 A;  1VYT A;  2HBW A;  2LP5 A;  1M30 A;  4OMO A;  1NEB A;  2EGE A;  2QDL A;  2O88 A;  1J3T A;  4LNP A;  3VS4 A;  2GQI A;  2J6K A;  1ZUK A;  1UDL A;  2CT4 A;  1UHC A;  2DVJ A;  2KT1 A;  1QWE A;  1B07 A;  2LCS A;  4E6R A;  3VS0 A;  2ABL A;  3H41 A;  2AZV A;  2EYZ A;  4Z89 A;  4OMN A;  2LQN A;  2AKK A;  4JPB W;  1NEG A;  4WCI A;  2DRM A;  1RLP C;  3SEM A;  2MIO A;  2H8H A;  1E7O A;  3QWY A;  1B3Q A;  2HCK A;  3UA7 A;  3EHQ A;  1BK2 A;  4AFS C;  1N5Z A;  2HEQ A;  4DEY A;  3PVL A;  2X3X D;  2ED1 A;  3VS3 A; 
#chains in the Genus database with same CATH topology
 1VQ8 Q;  5A0L A;  4BY6 C;  4J9B A;  4ATO A;  3P8B B;  1R8O B;  3H8Z A;  4PJO A;  2H3E B;  5LJ5 j;  4KRT A;  1JBM A;  1WIE A;  4RKU E;  4ZNX A;  3JCM d;  3QUI A;  3JCM Q;  1TU0 B;  2HL5 C;  1XTD A;  2LQ8 A;  2V1Q A;  4B6M A;  4HCK A;  2IG0 A;  2NLU A;  1KQ2 A;  4QQ6 A;  3MEV A;  5IHK A;  4M77 F;  2RI3 A;  3FJ5 A;  1EZZ B;  3SFM A;  2BTT A;  5GAN 7;  3V8K A;  1EX4 A;  1VQ6 Q;  3CPW P;  3P8H A;  5CIU A;  3RKY A;  2B86 A;  2QQR A;  3QWX X;  1QQJ A;  2R5A A;  2YRV A;  1ABQ A;  1QWF A;  4QQG A;  4M78 C;  1K8A C;  2QAZ A;  4M77 C;  4GLK A;  1YJN T;  2KMT A;  3GPL A;  4EMH A;  1VQ9 A;  2K57 A;  3V7S A;  4ORZ A;  2ZPE B;  1WQW A;  3NTK A;  2C0I A;  3M9Q A;  4M7D F;  3CD6 Q;  4JLI A;  1UGP B;  5FU6 B;  3UA6 A;  3EAE A;  3M56 A;  5GAN 6;  2E6Z A;  1VQO T;  6AT1 B;  1KC8 C;  1BYM A;  2RMO A;  3QPH A;  2KT8 A;  2G3R A;  1KC8 R;  1N8R U;  3JCM V;  3JB9 I;  1VQ7 Q;  1AVZ C;  3QBY A;  1BB9 A;  1TOV A;  5GMK m;  1Q7Y U;  4Z8A A;  4M7D C;  1OPK A;  1BCM A;  2LT4 A;  1SSH A;  2LDM A;  1OU8 A;  2GTJ A;  2VXF A;  3QKJ A;  2RHI A;  2RK1 A;  1XOV A;  1Q95 G;  4JJD A;  4PKC C;  4L59 A;  3EHR A;  2RJC A;  1YI2 T;  1K0X A;  4JRP A;  2E41 A;  3CXC A;  4RTW A;  4C5E A;  4HVV A;  1BI2 A;  5IH2 A;  3GOX A;  1SSF A;  2CKK A;  5D6Y A;  2ATC B;  3G71 A;  4FYX B;  2M02 A;  1GFC A;  1YHQ Q;  1AWJ A;  1RAI B;  2M51 A;  3FB9 A;  2QK0 A;  5A0D A;  1WJS A;  1X69 A;  1R0B G;  5HK0 A;  3BY7 A;  5CKE A;  5IXB A;  1JJ2 S;  1FMV A;  5D6W A;  1YJW Q;  1XJW B;  5CR2 A;  5CQY A;  2GNC A;  4Z02 A;  2JTE A;  4J9H A;  3SWN B;  1AZE A;  1KQS A;  2DET A;  4X9D A;  1M90 C;  1KG1 A;  1UFF A;  3X20 B;  1M90 R;  2GF7 A;  1ZUU A;  2QQB A;  4HT9 A;  1NLO C;  1VQN Q;  1OV3 A;  2RHX A;  4AFQ C;  4BB7 A;  4BE2 A;  4FYV B;  2MMP A;  2E3I A;  2WAC A;  3UPU A;  2OX7 A;  3CC7 A;  2VAS A;  4E7Z A;  4M75 B;  2GGR A;  3LYI A;  1D1C A;  2KRM A;  4J7F A;  3FC3 A;  5DLO A;  2JM9 A;  2JNG A;  2XK0 A;  3VS5 A;  2DZ9 A;  4C0G A;  1G5V A;  4BDY A;  4YTL A;  2NUZ A;  4BE1 A;  4RTY A;  1S72 A;  3M57 A;  3VYH B;  3X26 B;  2GCX A;  5FU7 C;  2RN8 A;  2OTL T;  2P0P A;  1ZSZ C;  3CC4 Q;  2PUK B;  3SWN C;  1VQO A;  5KYY A;  3WVE B;  5DY9 A;  2XKO C;  1MV3 A;  4M78 G;  3VS2 A;  4M77 G;  5GAM d;  2FRW A;  5FRM A;  2YUP A;  2RNA A;  4F7U G;  1UJ0 A;  2DK3 A;  1BIA A;  2CSQ A;  4Y28 E;  3AT1 B;  2LRQ A;  2JTM A;  2MAM A;  3CBO A;  1TG0 A;  2M16 A;  3C0C A;  2L3S A;  1MND A;  3I5R A;  3OW2 S;  1HK9 A;  1YWO A;  3OYI A;  2XID A;  1H3H A;  1PC0 A;  4E47 A;  1RAE B;  2AZS A;  4HCC A;  1M1G A;  5GAN h;  1OOT A;  2HQE A;  2LX9 A;  4LDV A;  3M0S A;  1M8M A;  5L8R E;  4BDZ A;  3CCE Q;  2KR3 A;  2YLB A;  1NYG A;  1TTH B;  5I2S A;  3JCM b;  2YSQ A;  2LTO A;  5KYW A;  3TQ7 P;  1M3A A;  4LE9 A;  1WHM A;  4KGV B;  1HJD A;  2ZGW A;  4LDX A;  3CC2 Q;  2J05 A;  1Q86 U;  5CCA A;  1W4S A;  3THK A;  1KD1 U;  2RA2 A;  3CCL T;  1VQ5 A;  3I55 A;  3JCM e;  4J6W A;  1Q81 C;  4JJB A;  4J9D A;  3J80 E;  1GCQ C;  4OF1 A;  2EQJ A;  4RTZ A;  1GCP A;  4C92 C;  2X51 A;  2YRD A;  5AT1 B;  4N4H A;  1MMN A;  2DE0 X;  1V1C A;  4AT1 B;  1NJI C;  3TSW A;  4NL3 A;  1NJI R;  1K4U S;  3M5A A;  3CMA T;  1WZO A;  4VUB A;  1VQ6 T;  4Y92 A;  3H0F A;  4PFZ A;  4R55 A;  1HSQ A;  1OX8 A;  3HHT B;  2OTJ T;  3QJ6 A;  1X2Q A;  1UEC A;  2CDT A;  4XU1 A;  5D7U A;  3M55 A;  5GAN j;  2DL8 A;  4N0A C;  2COZ A;  3LH0 A;  4QVD A;  3SHW A;  1KIK A;  3AHU A;  4JZ3 A;  3REB B;  2OTL A;  2LJ1 A;  1FMK A;  1IB8 A;  4C8Q F;  4QVC A;  5LJ5 f;  1NYF A;  4LN2 A;  4KGZ B;  4Y91 A;  4X1V A;  2ESW A;  1Y96 B;  3NHN A;  3QXE B;  2YRC A;  1K73 U;  1I5L A;  2LQW A;  2K6D A;  4BD3 A;  2D8H A;  4PJO F;  3CCM Q;  4A53 A;  1N9S A;  2RB6 A;  2FEI A;  2EKH A;  4O6J A;  1UHF A;  2JJ9 A;  2NUT B;  4KH0 B;  3PMT A;  4M7D E;  3OMC A;  1VQK Q;  1VQ4 T;  2R58 A;  1PSE A;  2DIL A;  2A36 A;  3EGD B;  3CCQ Q;  2FYK A;  1ZSG A;  3LH5 A;  2QAS A;  2QQA A;  3VJP A;  4F14 A;  3LX7 A;  2BIV A;  5GJW B;  4ZTF A;  3CCR T;  3C94 A;  4ZN3 A;  2O88 A;  2PVO B;  4LNP A;  3VS4 A;  1ZUK A;  1B7T A;  2KT1 A;  2DVJ A;  3JCM g;  1RAH B;  2KAF A;  1Q82 R;  2EFI A;  4XTX A;  2D9T A;  1M9S A;  4MZM A;  1VQ8 A;  2EYZ A;  3OS1 A;  4NOY A;  2LQN A;  3H6Z A;  3GP8 A;  1NPP A;  2DRM A;  4E7S A;  3LLR A;  1WHL A;  2H8H A;  2VGM A;  3UA7 A;  1BK2 A;  4AFS C;  2E70 A;  3RUX A;  3A8H B;  1WHK A;  2DEQ A;  3A8G B;  2DXU A;  1YCY A;  1E6H A;  2K4Y A;  5L23 A;  2ENM A;  1T3S A;  5DM7 R;  3G4S T;  3ZEH A;  1M1K C;  2DEU A;  1VQ6 A;  1M1K R;  3H0H A;  1YIJ T;  1OEB A;  3HTR A;  2OI3 A;  4CI0 C;  5LJ5 g;  2QA4 Q;  1X2K A;  1D1A A;  4TVR A;  4M75 A;  4WTO B;  1JXO A;  1VA7 A;  3PVQ A;  1PKS A;  2LQK A;  1MHN A;  3H0I A;  3EG3 A;  2EJF A;  4C5H A;  2X3W D;  1OPL A;  3UF4 A;  4C92 G;  3MCA B;  3VRZ A;  2HZY A;  1IGQ A;  3CME Q;  1RI0 A;  2D0Q B;  1QP2 A;  2KRS A;  3E9F A;  3V8L A;  2HMA A;  3GLX A;  3WXM B;  2C06 A;  3CD6 A;  5CQX A;  2EQM A;  4OMQ A;  2M0O A;  1MMG A;  3EG2 A;  2ECZ A;  1GFD A;  4KUL A;  5J26 A;  1GXI E;  3CC4 T;  3I9Q A;  3V7C A;  4PJN A;  2W0Z A;  3X24 B;  5IHI A;  2BZ8 A;  4EIK A;  1ABO A;  2L3R A;  1ZBX A;  2EYX A;  5GAM e;  1UB4 A;  3LWI A;  3EH1 A;  1VQ9 T;  2Y4Y A;  2YDL A;  1OX9 A;  2M9U A;  2JTF A;  5I22 A;  4RG8 A;  3OYK A;  2E5Q A;  4BY6 B;  1SEM A;  2O9S A;  3JV3 A;  4DBR A;  1IHW A;  1RAA B;  3HL8 A;  1VQM Q;  3CCR A;  2QXF A;  3FRN A;  3A8O B;  1C1A A;  2EJG A;  1JJ2 P;  1YHQ A;  2K5I A;  4FIB A;  1D3B B;  1FWZ A;  1KHC A;  2XU8 A;  4M7A D;  3KBG A;  1WXU A;  3CEY A;  1U06 A;  3OS0 A;  4ZTJ A;  4KGX B;  2DER A;  1FMW A;  3REA B;  1ZLM A;  4CC7 A;  2CH4 A;  1YJW A;  3GBQ A;  1AWO A;  4JJN K;  3SD4 A;  2HKN A;  2RJE A;  2O4X B;  4Z88 A;  3MJX A;  3QSU A;  4OGE A;  1A0N B;  4M77 B;  3G71 T;  2RK2 A;  4C5G A;  2ZPG B;  1VQN A;  2RQW A;  4OVA A;  3G4S A;  3T9N A;  1X6O A;  2P0K A;  1WFW A;  1YIJ A;  2VB6 A;  3OB9 A;  2MWO A;  3WVD B;  5KE2 A;  1IHV A;  4M7A E;  1TUD A;  1I81 A;  2ROL A;  2DL3 A;  1G83 A;  5HCK A;  2KI7 A;  3L2Z A;  9ATC B;  1SF9 A;  3TSZ A;  1UE9 A;  2ZPB B;  1JXM A;  1N27 A;  1O9S A;  1UUE A;  2A7Y A;  4J9G A;  4L6V 5;  5GAN 8;  1PM3 A;  2NUP A;  3OYM A;  3OYA A;  2DBK A;  4HXJ A;  4C8Q D;  4C0Z A;  2ZPI B;  1LCK A;  4M7D B;  3CCS Q;  3NTI A;  3CCJ Q;  1K0S A;  3EG9 A;  1KQ1 A;  3CC7 T;  4OGC A;  3MPU B;  1E6G A;  3TVT A;  2K7A A;  3EFO A;  4BI4 A;  1ZX6 A;  5GAO n;  1FYN A;  3G6E Q;  4MZT A;  4PJO D;  3CC4 A;  1D0X A;  5FWC A;  4IUQ A;  2E12 A;  2QQS A;  1QCF A;  3L2W A;  1VQP T;  1TH7 A;  4DBF A;  1Y96 A;  3GF5 A;  3CCM T;  3OW2 P;  2EAY A;  2L0A A;  3RMQ A;  1B34 B;  1GRI A;  2P0Q A;  2RI2 A;  1S72 T;  3R6N A;  4C8Q E;  2LCC A;  4UC4 A;  3URG A;  2IIM A;  4A54 A;  2QQ9 A;  2NUT A;  1WLP B;  3EGX B;  2FL7 A;  8AT1 B;  4EDU A;  4AG2 C;  1U8R A;  1K8A U;  2K5L A;  1AZG B;  1N8R R;  4PJO E;  3RNJ A;  4C5I A;  2KXC A;  1M1F A;  3EGD A;  5GAN e;  5KYU B;  5GMK h;  3M0U A;  1MMA A;  1W2B S;  4D8D A;  2BKD N;  1Q7Y R;  4ANJ A;  2EKO A;  1D1B A;  3E2U A;  5J3B A;  5GAM h;  4IUP A;  3OYG A;  2KNB B;  5LJ3 h;  3CCE A;  2BUD A;  3X28 B;  4C0D B;  3SB2 A;  1PRL C;  2YT6 A;  1CKB A;  2RQR A;  7AT1 B;  4FYW B;  4BUG A;  1LNX A;  3OYJ A;  1QVP A;  2FG0 A;  4A4K A;  1KC8 U;  1K9M U;  3C95 A;  2RF0 A;  2V1R A;  3CC2 A;  5A2Q E;  1KK7 A;  3BDL A;  3JCM W;  2DA9 A;  2NWM A;  4LD9 K;  1AWW A;  2DL5 A;  2K3B A;  3RDV A;  1YIT Q;  2RJF A;  2XDB A;  3F70 A;  1RAF B;  2JM8 A;  3QYH B;  2P4T A;  2DVE A;  1NBE B;  5LL6 S;  3A8M B;  5IHN A;  5CK9 A;  1X6G A;  2FB7 A;  4J9E A;  1Y7X A;  4FM4 B;  3CCU Q;  1BI3 A;  1QVG S;  2LNV A;  2CZ6 B;  4OML A;  3QII A;  5FU7 B;  1LJO A;  3D7S B;  4LUD A;  1ZSZ B;  5FLX E;  1S1N A;  1Y0M A;  2LZ6 B;  2XHC A;  1VQ5 T;  4MDW A;  3I55 T;  1RAG B;  3JRZ A;  2O2O A;  3NMZ C;  3HRS A;  4XK8 E;  2COY A;  5FRN A;  4C0D C;  2JUF A;  2EVR A;  1UGQ B;  1Z9Z A;  4NS5 A;  5CKB A;  4DEX A;  2FO0 A;  1OU9 A;  2MF2 A;  1RAC B;  5GAM j;  1JB0 E;  2L8D A;  2J6F A;  5LJ3 j;  2M1H A;  4OMM A;  1MNE A;  3LW5 E;  3S6W A;  3KUF A;  1VQP A;  3RIR A;  2F2W A;  1WYX A;  1QKX A;  1TXQ A;  4J9F A;  3VV0 A;  2HAX A;  2F2X A;  3BDU A;  3CCM A;  4LDU A;  1C0M A;  2COW A;  4HT8 A;  3UDC A;  2EW3 A;  5GAN g;  3RR6 A;  2HKQ B;  1K76 A;  4Q5W A;  1AEY A;  4A63 B;  1VQK A;  1RI9 A;  2DZC A;  2GBQ A;  4NL2 A;  1YJ9 Q;  3OBY A;  2VYT A;  2HD0 A;  3CCQ A;  3I35 A;  1VQL Q;  2DMO A;  1MUZ A;  2CP5 A;  3I56 Q;  4IUT A;  1VQM T;  3G7Z A;  3TRE A;  4OP0 A;  1U5S A;  4OB1 B;  5LJ3 d;  5I21 A;  1M27 C;  2DXB A;  1Y57 A;  4JRI A;  2JT4 A;  2KY9 A;  4C92 B;  3CCV Q;  5C0M A;  3CPW S;  1M2V B;  2FRY A;  2CZ1 B;  5FWB A;  1EIF A;  3OYD A;  2CH4 W;  3DB4 A;  1NM7 A;  4ZGD B;  1AHJ B;  4LDY A;  4XTY A;  2LP5 A;  2HL3 A;  2EGE A;  5FRO A;  4PJJ A;  2GQI A;  2P84 A;  2CT4 A;  1UHC A;  2GQV A;  2E6N A;  4M7D G;  3DB3 A;  3QDF A;  1D0Z A;  2DIQ A;  4JDS A;  4M78 A;  2AZV A;  4M77 A;  2OAU A;  2RHY A;  1G3S A;  3JB9 F;  4F7U A;  2QEX Q;  1Q86 R;  1VQ8 T;  2CP3 A;  3MKD A;  2AKK A;  1KD1 R;  1NEG A;  4XU2 A;  1RLP C;  2QA4 A;  4M7A F;  2RM4 A;  2HEQ A;  5CKF A;  4DOW A;  3PVL A;  4XTV A;  2X3X D;  3ER0 A;  1V29 B;  3VS3 A;  3JCM f;  3S3O A;  1WPY A;  3A8L B;  4QKU A;  4AFU C;  3DLM A;  5C6S A;  1QKW A;  3CME A;  2E10 A;  4C8Q B;  3E19 A;  1ZA2 B;  1JO8 A;  4M7A C;  2RQU A;  2ZAE A;  4M7D A;  2JVV A;  1I4K 1;  1Q81 U;  4HCZ A;  1W70 A;  4IIO A;  1I5O B;  3M4Y A;  2A37 A;  1KJW A;  1HYO A;  2A0F B;  1H92 A;  2DD5 A;  2HNI A;  1AWX A;  3V8J A;  1WGS A;  1V76 A;  5ECA A;  3CPF A;  1AOJ A;  1UG1 A;  1IRX A;  2KDS A;  2LT1 A;  2M0Y A;  2JW4 A;  2DM1 A;  4J7I A;  4V2S A;  1K9A A;  1B34 A;  3CD6 T;  4QVZ A;  2DF6 A;  4ZGE B;  2DNU A;  1K73 R;  3EFS A;  3CQT A;  2JS0 A;  8ATC B;  3NGP A;  2DTI A;  4LUE A;  2K79 A;  2AK5 A;  3EGX A;  5CVI A;  1VQM A;  3OQ5 A;  3L42 A;  3J7A F;  2MOX A;  2CZ7 B;  3INZ A;  2HQH A;  1VQ7 T;  4ELY C;  2BZX A;  1I0C A;  4FSX A;  4C8Q C;  3MP1 A;  2YUO A;  4EMK C;  1AT1 B;  2H3J A;  1AD5 A;  2OJ2 A;  2X9H A;  4ESR A;  1YJN Q;  4F16 A;  1I8F A;  5IT9 E;  3M0P A;  4DQ2 A;  2F1L A;  2E3H A;  4RTT A;  1QP3 A;  2RI5 A;  4PJO C;  2QGF B;  1ZUY A;  2W10 A;  4IUV A;  3EH2 A;  2JOY A;  1ARK A;  2EQK A;  3OY9 A;  2HQX A;  5I11 A;  3M0T A;  4OB3 B;  1VUB A;  2KYM A;  1R77 A;  3OBW A;  4OB0 B;  1JJ2 A;  4RUG A;  1X75 C;  2X4J A;  2YLC A;  2EBP A;  2DYB A;  1F1B B;  2I0N A;  3HRU A;  1VQO Q;  1Q82 C;  1YNZ A;  2C0T A;  2DL4 A;  3UT1 A;  5D6X A;  4MML A;  4ME7 A;  1SHF A;  4JRQ A;  1YHQ T;  4N4G A;  3IQL A;  1C6V X;  4A4F A;  1NE8 A;  2KYB A;  1BCO A;  4J8O A;  3L2U A;  5CAI A;  1IXD A;  1BU1 A;  1YBY A;  4C0F A;  3CCU T;  2E4H A;  1IO6 A;  3HRT A;  1YJW T;  3KFV A;  4GBQ A;  2YXY A;  4RTV A;  1YI2 Q;  2PVG B;  2DJZ A;  1HXD A;  4AFZ C;  1ZSZ A;  3SWN A;  3GNF B;  3MET A;  2X4Y A;  3PIO A;  1QW1 A;  3VKI A;  1NG2 A;  1QCN A;  1VQN T;  1JU5 C;  2F2V A;  3CCS A;  4E2F B;  3MEA A;  3CCJ A;  1M3B A;  2A28 A;  2PQW A;  4MDX A;  4IKF A;  1SPK A;  3GIB A;  2QI2 A;  1X01 A;  1OZ3 A;  3OSV A;  3L1A A;  2FVU A;  2QTX A;  3CXC S;  3VS1 A;  2DXT A;  5HY6 A;  4J83 A;  2QGG A;  3G1J A;  1M1K U;  1RAB B;  2CSI A;  2RO0 A;  4DOV A;  4D8K A;  2MK5 A;  3C4S A;  2MCN A;  2DD4 A;  1N6A A;  2IVW A;  2SRC A;  2LCL A;  1W2B P;  2KSS A;  4M7A G;  1U1T A;  3PT9 A;  3CBM A;  1YJ9 T;  2FPD A;  1WHH A;  3ULR B;  5HK3 A;  4M75 D;  2YHT A;  1VQL T;  1YN8 A;  2IPO B;  5GMK e;  4RCC A;  1VQ7 A;  1EFN A;  3OW2 A;  2X35 A;  4KT0 E;  2SEM A;  1KQS S;  3HPW A;  5LJ3 e;  1N9R A;  4RMO A;  2LMJ A;  2O9V A;  5GAM f;  5GAN 3;  3MEU A;  5KCO A;  3PMI A;  1GCQ A;  4PFO A;  4EPC A;  2RQV A;  4C92 A;  4J6X A;  2MPX C;  1RLQ C;  3HFN A;  1M2V A;  1O75 A;  4CRI A;  4J9I A;  4IUR A;  5LJ5 h;  3QYG B;  2BE7 D;  4PLL A;  1VYV A;  4M75 E;  3BW1 A;  3UAT A;  3J81 E;  1T0H A;  2EYW A;  3U23 A;  4HVU A;  4R56 A;  1LOJ A;  1YIT A;  2CS7 A;  3JB9 D;  3RMS A;  1H3Z A;  1PSF A;  4QT7 A;  4FW1 A;  4XTU A;  3CCE T;  4C8Q G;  1SRL A;  1VIE A;  5EG2 A;  4ZN1 A;  3CCU A;  5GAO p;  2DFU A;  3OS2 A;  4N0A A;  4HKE A;  4PJO G;  1H8K A;  2QEX T;  4XQ3 A;  4OMF B;  3ZL7 C;  3CC2 T;  3MEW A;  1GBR A;  3JCM J;  2ZPF B;  1K1Z A;  3EG1 A;  2DRK A;  3MP8 A;  4E7J A;  5GMK i;  2X4X A;  2HSE B;  4GLM A;  3OYC A;  4FSS A;  4FU6 A;  4BI3 A;  2K2V A;  5GAO l;  4CC3 A;  4PK4 A;  2RH2 A;  5KYW B;  2RPN A;  2PNI A;  3QDR B;  1G2B A;  1QCO A;  3FLG A;  3NPF A;  1PD0 A;  3M0Q A;  2O31 A;  4FW2 A;  2R57 A;  1WHJ A;  2LNH B;  2VGN A;  3M0R A;  4J5Y A;  2D1X A;  2FZC B;  2D8J A;  2HSP A;  3QZ5 B;  4PNO A;  1UJY A;  2JMA A;  3CCL Q;  2L5Q A;  3PE0 A;  2DXC A;  2ED0 A;  2K3Y A;  5GAM g;  5A0G A;  3HSB A;  5LJ3 g;  2VVK A;  1YJ9 A;  2E64 A;  3X25 B;  2HDA A;  2DTH A;  4M78 F;  2CUD A;  1VQL A;  2EQU A;  3A5Z B;  2WSC E;  3I56 A;  3CMA Q;  4F7U F;  2DKG A;  2LX7 A;  1CKA A;  1UGV A;  3JB9 J;  3MO8 A;  4PLI A;  2OTJ Q;  2KRO A;  2E65 A;  4KBM B;  3CCV A;  2Y90 A;  2EIF A;  1FX7 A;  2BE9 B;  2EPD A;  1VQK T;  3M54 A;  1SRM A;  1K8A R;  2DLP A;  1ZBJ A;  2EYY A;  2CUB A;  2EWN A;  2AT1 B;  1N8R C;  3CCQ T;  4FCY A;  5LJ5 d;  4GY5 A;  1TS9 A;  2PUO B;  1Q7Y C;  2B8A A;  2JN0 A;  1OYX A;  5GAN f;  3ME9 A;  2F69 A;  1IGU A;  4JUV A;  1JQQ A;  2KRN A;  5J39 A;  3OYN A;  1U3O A;  5EC7 A;  2G6F X;  1BI0 A;  1QVF S;  1UGR B;  4RTU A;  1K9M C;  1UEB A;  1KSW A;  2WSF E;  2Z0W A;  2KQW A;  1K9M R;  3LGL A;  1XNI A;  4FT4 A;  2HBW A;  2QEX A;  1M30 A;  1VQ4 Q;  1PG5 B;  3PIP A;  3JAM E;  1WJR A;  2QDL A;  2JZ2 A;  5KCH A;  2J6K A;  1NZ9 A;  5GMK l;  1UDL A;  4IUU A;  3ZFJ A;  5KE3 A;  2VV5 A;  3DKM A;  4ELZ C;  5GAO q;  3L2R A;  2FZG B;  2LCS A;  3VS0 A;  4PJM A;  5GAN 4;  5CO7 A;  3V7R A;  3CCR Q;  3JSC A;  4Z89 A;  4E7I A;  4WF2 A;  3MP6 A;  3CBP A;  2CP0 A;  1QMC A;  4JPB W;  3SEM A;  3C12 A;  3TCJ A;  2MIO A;  1E7O A;  4B9W A;  1IRE B;  3QWY A;  1B3Q A;  2DTO A;  2GFU A;  2VUB A;  3EHQ A;  4A4E A;  2QA4 T;  2DAQ A;  4DEY A;  2ZZD A;  2ED1 A;  5FU6 C;  2DL7 A;  3R6O A;  5GMK j;  3P8D A;  3RKX A;  4RTX A;  2KVQ G;  1SHG A;  4XTZ A;  4B9X A;  1M3C A;  2QDY B;  3CME T;  4OB2 B;  2V26 A;  1TWB A;  1TUG B;  2BZY A;  1BKB A;  1M90 U;  3JB9 H;  1Y07 A;  3OYH A;  3G4S Q;  4J9C A;  2L3Q A;  1YIJ Q;  3OMG A;  4MZP A;  3FDR A;  1W1F A;  2L2P A;  1PNJ A;  3I5S A;  1Y71 A;  1YFN A;  4BE0 A;  2KBT A;  2P4R A;  4F04 B;  2CYZ B;  1OQK A;  1SKU B;  2DYI A;  3HP9 A;  2EQI A;  1JEG A;  2FZK B;  3QHS A;  1YJN A;  5AYF A;  1YWP A;  4FYY B;  1PRM C;  4LDW A;  1T3L A;  3RBB B;  3RKW A;  1PCX A;  1D0Y A;  1X43 A;  3NTH A;  2YUQ A;  3L2V A;  4DA4 A;  4OMP A;  3SDZ A;  5KH6 A;  4M75 F;  4DBQ A;  1OUL A;  3M53 A;  2VC8 A;  1WDX A;  1I07 A;  2LJ3 A;  2D0N A;  3VUZ A;  1QLY A;  3KXT A;  2DIG A;  3VS6 A;  5KYX B;  1BI1 A;  2RD1 A;  4D6W A;  4DBH A;  2EYQ A;  1D3B A;  1VQ9 Q;  4M7A B;  4R0K A;  3OA6 A;  2JS2 A;  2PTK A;  4J6Y A;  2CT3 A;  4M75 C;  2ZCF B;  3E1S A;  1GBQ A;  4N4I A;  2D6F A;  2DJQ A;  4JZ4 A;  4KH1 B;  2KXD A;  1YI2 A;  4QW2 A;  2L89 A;  2VKN A;  1PKT A;  2C0O A;  2GFA A;  2MYS A;  2O4X A;  5GJV B;  3BE3 A;  4A4H A;  2XDP A;  4RG2 A;  1Q86 C;  4BAC A;  3CXC P;  2XI9 A;  1KD1 C;  4RCB A;  1SG5 A;  2AIR B;  5GAN 5;  4L5G A;  3HFO A;  3PTA A;  3RER A;  2F5T X;  3FJP A;  5FW9 A;  4C92 F;  4KUI A;  3TU4 K;  1YCS B;  1KHI A;  1WXB A;  1VOM A;  4JJC A;  1WQ7 A;  3DLL A;  5M9O A;  1XQH A;  1G3Y A;  4P5N A;  3PNW C;  4M78 D;  2F5K A;  3VRY A;  3S3N A;  3CCS T;  4M77 D;  4EMK B;  3G71 Q;  3CCJ T;  2J6O A;  4FL6 A;  3HKS A;  1Q81 R;  1W6X A;  2CP2 A;  2CRE A;  2KE9 A;  4FT2 A;  1KQS P;  2EJ9 A;  2FHD A;  2J7I A;  3G6E T;  4PJO B;  5DLQ E;  1GL5 A;  2LJ0 A;  3OYE A;  2VXE A;  5I2M A;  1NJI U;  4O5V A;  3PGG A;  4HVW A;  1TSF A;  4PJL A;  1M2O A;  1ZA1 B;  5IAY A;  2XIC A;  4JRK A;  1ZQ1 A;  3VS7 A;  5KYN A;  5CKD A;  1W2B A;  2NUP B;  2FPF A;  2VWF A;  5GAN 2;  4M78 E;  1D09 B;  2KEA A;  5IXF A;  1K73 C;  4M77 E;  2QYZ A;  3EG9 B;  1RL2 A;  2LC4 A;  4M7D D;  4F7U E;  3Q1J A;  1Z9Q A;  3EGU A;  3EFO B;  3QZ9 B;  3EG0 A;  3CC7 Q;  4PL6 A;  3LGF A;  2L3P A;  5LJ5 e;  1QVF A;  2PZ1 A;  1BIB A;  2ROT A;  2YWW A;  4AG1 C;  2OAW A;  3E9G A;  4AMC A;  5KYU A;  1VIF A;  2CP7 A;  4JLG A;  2RQT A;  4HA8 A;  3TEE A;  2JMC A;  4CC4 B;  1NLP C;  3O5Z A;  4E7K A;  1VQP Q;  1DJ7 B;  4LXC A;  2EGC A;  3QJY A;  5GAO r;  1RUW A;  4QQD A;  2V8K A;  2YUN A;  1WNL A;  2XD0 A;  4II1 A;  1S72 Q;  1PHT A;  3M59 A;  2KK4 A;  1M5Q 1;  4EMG A;  4XU3 A;  1U1S A;  1QVG A;  1PD1 A;  2J06 A;  4JS5 A;  2QG9 B;  3JCM X;  2I2L A;  2HBP A;  1RAD B;  3A1P A;  2V8I A;  2K9G A;  3QG1 A;  1YIT T;  1JRI A;  1MMD A;  1CSK A;  5GAN d;  1X27 A;  2DX1 A;  1BBZ A;  3O8V A;  2CGH A;  5HKC A;  3M4G A;  3GNG A;  1LVK A;  3OYY A;  1OZ2 A;  4MMK A;  4BI8 B;  4F17 A;  3BFM A;  2KGT A;  1OI1 A;  2EGA A;  3S3M A;  4M75 G;  1Q82 U;  2WSE E;  2ZPH B;  2RJD A;  1I1J A;  2E5K A;  1VYU A;  1G8X A;  3CCL A;  2AKL A;  1LPL A;  2JXB A;  1G3W A;  3A98 A;  3L2Q A;  3VU3 C;  1KFZ A;  2XG8 D;  3G6E A;  1X6B A;  2XMF A;  1M4Z A;  2CP6 A;  2K2M A;  3MHX A;  2MWP A;  2V8J A;  1P92 A;  4XTW A;  3CMA A;  2DO3 A;  1PWT A;  1R0C B;  3ZBD A;  3JB9 G;  2OTJ A;  1UTI A;  1VQ5 Q;  3I55 Q;  1WI7 A;  4JS4 A;  1MV0 B;  3JCM h;  2R5M A;  4PFP A;  2FPE A;  2X4W A;  2PU9 B;  1WA7 A;  2NYS A;  4E7L A;  1NPR A;  3CPW A;  2A08 A;  1H64 1;  3I56 T;  4CC2 A;  2K3X A;  2LVM A;  1QVF P;  2A3L A;  3FEO A;  4X9C A;  2GTO A;  5IN1 A;  1WX6 A;  3JCM c;  4XU0 A;  2QTV A;  3OSS C;  3VYG A;  2PVD B;  1HD3 A;  2CZ0 B;  3CCV T;  1ZHI A;  3FIF A;  5LJ3 f;  2XDD A;  3M58 A;  4XAX B;  1YP5 A;  4IIM A;  3UWN A;  1M8V A;  3OYL A;  1WXT A;  4M4Z A;  3ASK A;  5KYX A;  3OS5 A;  1VQ4 A;  1UGS B;  1G3T A;  2OTL Q;  3LWH A;  3VUB A;  3PFS A;  5KYY B;  4M7A A;  3H9N A;  4HCB A;  1T0J A;  2DPP B;  1TUC A;  1QVG P;  4K11 A;  1IZ6 A;  2RHZ A;  1WJQ A;  2AHJ B;  2O01 E;  2DBM A;  2Y4X A;  3NFC A;  4E7H A;  3QO3 A;  1VYT A;  3RES A;  4OMO A;  1NEB A;  3EFR A;  4X34 A;  4C92 D;  1WHG A;  1J3T A;  1FXX A;  4A4G A;  1QWE A;  3OYF A;  1B07 A;  4E6R A;  4KUD K;  3N5B B;  2ABL A;  3H41 A;  5GAO m;  3OYB A;  4OMN A;  2E1H A;  5CKH A;  1MGQ A;  4WCI A;  4LD6 A;  2HCK A;  4M78 B;  4ZGJ B;  3JCM P;  2K5F A;  1ACM B;  1N5Z A;  4C8Q A;  2RHU A;  2MI6 A;  4C92 E;  4F7U B;  4EMK A; 
#chains in the Genus database with same CATH homology
 1E6H A;  2DL7 A;  5L23 A;  4J9B A;  2ENM A;  1T3S A;  4AFU C;  4RTX A;  3H0H A;  1QKW A;  1OEB A;  1SHG A;  4KRT A;  2OI3 A;  1JO8 A;  1WIE A;  2RQU A;  1M3C A;  1X2K A;  4ZNX A;  1JXO A;  2BZY A;  2V1Q A;  1VA7 A;  1W70 A;  3PVQ A;  1PKS A;  4HCK A;  4IIO A;  3H0I A;  3EG3 A;  4J9C A;  5IHK A;  2L3Q A;  2X3W D;  2A37 A;  1OPL A;  3UF4 A;  3FJ5 A;  1W1F A;  1KJW A;  2BTT A;  2L2P A;  1PNJ A;  3I5S A;  3VRZ A;  2KBT A;  1H92 A;  2P4R A;  1AWX A;  2KRS A;  2B86 A;  5ECA A;  3QWX X;  1AOJ A;  1UG1 A;  2M0Y A;  4OMQ A;  2EQI A;  2JW4 A;  1ABQ A;  1QWF A;  2DM1 A;  3EG2 A;  1JEG A;  1K9A A;  2ECZ A;  1GFD A;  2DF6 A;  2DNU A;  1YWP A;  3CQT A;  2JS0 A;  3I9Q A;  1PRM C;  3NGP A;  4LUE A;  1T3L A;  2K79 A;  3RBB B;  2AK5 A;  2W0Z A;  1X43 A;  5IHI A;  2BZ8 A;  4EIK A;  1ABO A;  2YUQ A;  2EYX A;  4ORZ A;  2MOX A;  4OMP A;  2BZX A;  1I0C A;  2C0I A;  2YDL A;  2YUO A;  1WDX A;  1AD5 A;  1I07 A;  2OJ2 A;  2LJ3 A;  4ESR A;  2D0N A;  5I22 A;  3UA6 A;  4F16 A;  1QLY A;  3M0P A;  1SEM A;  2O9S A;  3JV3 A;  3VS6 A;  4RTT A;  2RMO A;  2KT8 A;  1ZUY A;  2W10 A;  1AVZ C;  1ARK A;  4R0K A;  1BB9 A;  2JS2 A;  5I11 A;  2PTK A;  3M0T A;  4Z8A A;  2CT3 A;  2KYM A;  1OPK A;  4RUG A;  1GBQ A;  1SSH A;  2EBP A;  2DJQ A;  2DYB A;  2GTJ A;  2I0N A;  4JZ4 A;  1YNZ A;  2C0T A;  2DL4 A;  2KXD A;  1XOV A;  1SHF A;  4JJD A;  2VKN A;  3IQL A;  1PKT A;  3EHR A;  1WXU A;  2C0O A;  5GJV B;  2KYB A;  1U06 A;  1K0X A;  4RTW A;  1BU1 A;  1ZLM A;  3REA B;  4CC7 A;  2CH4 A;  4HVV A;  5IH2 A;  3GBQ A;  1AWO A;  1IO6 A;  3KFV A;  4GBQ A;  4Z88 A;  1A0N B;  1GFC A;  1AWJ A;  4RTV A;  2M51 A;  5FW9 A;  4AFZ C;  1YCS B;  2RQW A;  1WXB A;  4JJC A;  1X69 A;  1WFW A;  1NG2 A;  1JU5 C;  5IXB A;  2F2V A;  1M3B A;  2A28 A;  3VRY A;  2GNC A;  1TUD A;  2JTE A;  4J9H A;  2J6O A;  2ROL A;  1SPK A;  2DL3 A;  1G83 A;  5HCK A;  1AZE A;  1W6X A;  2CRE A;  2KE9 A;  1UFF A;  1ZUU A;  2J7I A;  3TSZ A;  1NLO C;  1UE9 A;  1OV3 A;  1JXM A;  3VS1 A;  4AFQ C;  1GL5 A;  1UUE A;  2LJ0 A;  4J9G A;  2DBK A;  4HXJ A;  1LCK A;  2GGR A;  4HVW A;  1K0S A;  2CSI A;  4D8K A;  2KRM A;  2MCN A;  1E6G A;  3TVT A;  2K7A A;  3VS7 A;  1ZX6 A;  2SRC A;  1FYN A;  2JM9 A;  2FPF A;  3VS5 A;  5FWC A;  2VWF A;  2KEA A;  5IXF A;  2FPD A;  1QCF A;  3ULR B;  2NUZ A;  1YN8 A;  1Z9Q A;  3EGU A;  3EG0 A;  4RTY A;  2L3P A;  1EFN A;  2PZ1 A;  2SEM A;  2L0A A;  2ROT A;  1GRI A;  4AG1 C;  2OAW A;  3R6N A;  2IIM A;  2RN8 A;  2RQT A;  2LMJ A;  2O9V A;  2JMC A;  4CC4 B;  1NLP C;  1WLP B;  3O5Z A;  1GCQ A;  4AG2 C;  2EGC A;  2RQV A;  1RUW A;  1MV3 A;  1AZG B;  1RLQ C;  3RNJ A;  2KXC A;  2YUN A;  3VS2 A;  3M0U A;  2FRW A;  4J9I A;  2YUP A;  4D8D A;  2RNA A;  1PHT A;  1UJ0 A;  1VYV A;  2CSQ A;  3UAT A;  1T0H A;  2KNB B;  2EYW A;  3U23 A;  1TG0 A;  4HVU A;  2J06 A;  4QT7 A;  3C0C A;  1PRL C;  2L3S A;  2YT6 A;  1CKB A;  3I5R A;  1SRL A;  2K9G A;  2RQR A;  1YWO A;  1CSK A;  1H3H A;  2FG0 A;  2AZS A;  1X27 A;  2DX1 A;  2RF0 A;  2V1R A;  1BBZ A;  1OOT A;  1H8K A;  2DA9 A;  2NWM A;  1AWW A;  3ZL7 C;  3M0S A;  2DL5 A;  1M8M A;  2K3B A;  1GBR A;  2KR3 A;  4F17 A;  1NYG A;  2KGT A;  2YSQ A;  2EGA A;  1K1Z A;  2JM8 A;  1M3A A;  3EG1 A;  2DRK A;  1I1J A;  4LE9 A;  5IHN A;  1X6G A;  4GLM A;  4J9E A;  4FSS A;  1HJD A;  2E5K A;  1VYU A;  2J05 A;  2AKL A;  4OML A;  4CC3 A;  2JXB A;  3THK A;  3A98 A;  2RPN A;  2PNI A;  4LUD A;  1G2B A;  3NPF A;  4JJB A;  4J9D A;  1KFZ A;  3M0Q A;  1S1N A;  1Y0M A;  1GCQ C;  2LZ6 B;  2O31 A;  1X6B A;  4RTZ A;  1GCP A;  2XMF A;  2LNH B;  2O2O A;  3NMZ C;  3M0R A;  2K2M A;  2D1X A;  2DE0 X;  1V1C A;  2EVR A;  3TSW A;  1Z9Z A;  4DEX A;  2D8J A;  2HSP A;  1PWT A;  2FO0 A;  1K4U S;  1UJY A;  2JMA A;  3PE0 A;  2ED0 A;  4Y92 A;  1UTI A;  2J6F A;  3H0F A;  1HSQ A;  4OMM A;  1WI7 A;  2VVK A;  1MV0 B;  1X2Q A;  2FPE A;  1UEC A;  2HDA A;  1WYX A;  2F2W A;  2CDT A;  1QKX A;  2CUD A;  1WA7 A;  4J9F A;  2F2X A;  2DL8 A;  2LX7 A;  2EW3 A;  3SHW A;  2A08 A;  1KIK A;  4JZ3 A;  4CC2 A;  1CKA A;  1K76 A;  3REB B;  1UGV A;  1AEY A;  2KRO A;  2LJ1 A;  1FMK A;  2GTO A;  1WX6 A;  4A63 B;  1RI9 A;  2GBQ A;  1NYF A;  4LN2 A;  2EPD A;  4X1V A;  2ESW A;  1SRM A;  3NHN A;  1HD3 A;  2DLP A;  3I35 A;  1ZBJ A;  2EYY A;  2CUB A;  1YP5 A;  2DMO A;  4IIM A;  2LQW A;  1MUZ A;  2K6D A;  2D8H A;  1WXT A;  4M4Z A;  2FEI A;  2EKH A;  1UHF A;  1U5S A;  1M27 C;  1Y57 A;  2JT4 A;  1T0J A;  1TUC A;  1JQQ A;  2DIL A;  2KRN A;  4K11 A;  1U3O A;  2A36 A;  1ZSG A;  3LH5 A;  2FRY A;  2G6F X;  5EC7 A;  4F14 A;  4RTU A;  5FWB A;  2DBM A;  1KSW A;  5GJW B;  2CH4 W;  1NM7 A;  1VYT A;  2HBW A;  2LP5 A;  1M30 A;  4OMO A;  1NEB A;  2EGE A;  2QDL A;  2O88 A;  1J3T A;  4LNP A;  3VS4 A;  2GQI A;  2J6K A;  1ZUK A;  1UDL A;  2CT4 A;  1UHC A;  2DVJ A;  2KT1 A;  1QWE A;  1B07 A;  2LCS A;  4E6R A;  3VS0 A;  2ABL A;  3H41 A;  2AZV A;  2EYZ A;  4Z89 A;  4OMN A;  2LQN A;  2AKK A;  4JPB W;  1NEG A;  4WCI A;  2DRM A;  1RLP C;  3SEM A;  2MIO A;  2H8H A;  1E7O A;  3QWY A;  1B3Q A;  2HCK A;  3UA7 A;  3EHQ A;  1BK2 A;  4AFS C;  1N5Z A;  2HEQ A;  4DEY A;  3PVL A;  2X3X D;  2ED1 A;  3VS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...