4Z89A

Sh3-ii of drosophila rim-binding protein bound to a cacophony derived peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rim-binding protein
molecule keywords RIM-binding protein, isoform F
total genus 15
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z89A00
4LE9A 3UA7A 5IH2A 1BK2A 1H8KA 1AOJA 3I5SA 4ESRA 2I0NA 2DM1A 4ZNXA 2KRMA 2EGEA 1JEGA 3KFVA 1SHFA 2J06A 4X1VA 1YP5A 2PNIA 4OMQA 1GCPA 2ED0A 2KRSA 4IIMA 1FYNA 1UFFA 3EGUA 1OV3A 1T0HA 2EYZA 1GBRA 1GRIA 3EG2A 4J9CA 1VYUA 5IHNA 2DNUA 2KGTA 2LJ0A 1BU1A 1ABOA 4RTYA 2RQVA 1AWOA 1X27A 4HVVA 3M0RA 2EW3A 2J05A 2KT8A 2JS0A 2RQRA 1FMKA 2W10A 2VKNA 1B07A 2RQUA 5I11A 2LP5A 3FJ5A 4J9BA 4CC2A 4F14A 1QCFA 4LUEA 1AZEA 1I0CA 1OEBA 2RQTA 1WLPB 1ZUUA 1GBQA 2F2WA 1PKSA 2RQWA 2DBMA 2DMOA 4Z8AA 3VS3A 1SRMA 2EQIA 4RTZA 1YNZA 1Z9ZA 1M3BA 2RNAA 3VRYA 1NEGA 2LNHB 1HJDA 2K3BA 1ZSGA 3NGPA 1ZUYA 1CKAA 2FRWA 1K9AA 2QDLA 2A08A 3NPFA 4RTTA 3ULRB 2JTEA 2D1XA 4JPBW 2FO0A 2DL3A 2YSQA 1ZUKA 1TUDA 1WDXA 5ECAA 1E6HA 2BZYA 2LQNA 2X3WD 2KEAA 4JZ3A 4F17A 1H92A 3O5ZA 1NLPC 1YWOA 4J9GA 1WYXA 2FPDA 1U5SA 1GCQC 1JXOA 4R0KA 2DLPA 5FWBA 1PRLC 5IHKA 3I5RA 4D8KA 1K0SA 2MOXA 2F2XA 1X43A 1JU5C 1X6BA 1CKBA 1SRLA 3H41A 2JS2A 2RPNA 1OPKA 3TVTA 2ED1A 2EGCA 2O9SA 5GJVB 2O2OA 2ROLA 1WXUA 1VYTA 2EPDA 2DRMA 4RTUA 5L23A 4M4ZA 4AG2C 1WXTA 2K7AA 1M27C 4OMLA 1PKTA 2RF0A 2M0YA 1E6GA 3PE0A 4RTXA 3SEMA 2JM9A 1NG2A 2YDLA 4AFSC 2LZ6B 1AEYA 5GJWB 2BTTA 2D8JA 4AG1C 4D8DA 1AWXA 2OI3A 4LN2A 4RTWA 1OOTA 1PRMC 3VRZA 2DL5A 3SHWA 2FPEA 1YN8A 2HDAA 2G6FX 3EG3A 1WI7A 2DBKA 2KBTA 2K9GA 2KYMA 1KFZA 1TUCA 1LCKA 1QKWA 1KSWA 2KXCA 1SSHA 1I07A 3CQTA 4J9EA 3QWYA 3U23A 1E7OA 2DE0X 2AZVA 1WFWA 5HCKA 1MV3A 1JXMA 1T3SA 2C0IA 1WX6A 2KROA 1GFCA 1TG0A 2XMFA 2AK5A 3VS0A 3REBB 5FW9A 4JJCA 3VS7A 2JT4A 1UHCA 5FWCA 4Z89A 1X2KA 2YUOA 1Y0MA 2ROTA 2JM8A 1NYFA 1B3QA 1JQQA 1VYVA 2LJ1A 3H0HA 2BZ8A 4RTVA 1AVZC 3VS2A 2B86A 2F2VA 2IIMA 2CSIA 3VS4A 1G2BA 1M30A 2L3SA 1Y57A 1W6XA 1S1NA 2L0AA 1J3TA 1CSKA 2CREA 2K79A 1AZGB 1T3LA 1NM7A 3TSZA 2FEIA 1X2QA 3EHQA 3EG1A 1IO6A 2KNBB 3VS5A 2AZSA 2GTOA 2O88A 3M0TA 1W1FA 2OJ2A 2E5KA 2GTJA 2NUZA 4J9DA 4A63B 3LH5A 4K11A 2DRKA 2BZXA 1K1ZA 2P4RA 2AKLA 2J6KA 1GCQA 1QWFA 4QT7A 4DEXA 1RUWA 2HCKA 4OMNA 2KRNA 3IQLA 4GBQA 4GLMA 1X69A 2DJQA 2H8HA 2LMJA 5I22A 1ABQA 2DX1A 1WIEA 2C0TA 1NLOC 1YCSB 1SEMA 2ABLA 3JV3A 4CC7A 1UDLA 4J9FA 2EBPA 4F16A 1BB9A 4AFUC 1H3HA 2LJ3A 1VA7A 1PWTA 2DL7A 1UGVA 1UHFA 4JZ4A 5IXFA 4LNPA 3REAB 4CC4B 2EVRA 2PZ1A 2DA9A 1YWPA 2KR3A 2L3PA 2NWMA 1HSQA 1G83A 1MV0B 1KJWA 2ECZA 3A98A 2KE9A 2K2MA 2YT6A 2A28A 2YUNA 2CT3A 2CUDA 4JJBA 2DVJA 3THKA 4HVWA 4Y92A 2L3QA 5IXBA 4IIOA 1NYGA 2J7IA 1MUZA 3EG0A 1ZBJA 1N5ZA 2KYBA 2O31A 2SEMA 1SPKA 2DL8A 4DEYA 4AFQC 2EYYA 2L2PA 3M0UA 1WXBA 2GGRA 1GFDA 1W70A 4JJDA 3PVLA 2FG0A 2JW4A 1U3OA 2SRCA 1M3CA 2CDTA 2FRYA 3M0SA 2ESWA 3M0PA 3QWXX 1KIKA 2OAWA 4RUGA 1K0XA 3PVQA 2DILA 1UJYA 1BBZA 2K6DA 2GBQA 1UTIA 2HEQA 2CH4W 3UA6A 1M8MA 2KXDA 2DYBA 1XOVA 4EIKA 4ORZA 1QWEA 1RLQC 1UG1A 3I35A 2J6OA 4HCKA 2V1RA 1UE9A 2VVKA 2KT1A 2CH4A 1AWWA 3EHRA 1QLYA 4OMPA 3TSWA 1I1JA 2CSQA 3H0IA 4WCIA 2JMAA 3RNJA 2ENMA 1GL5A 3H0FA 2O9VA 3NMZC 4J9HA 1K76A 2CT4A 2RN8A 5EC7A 2PTKA 1WA7A 2RMOA 3VS6A 3UF4A 1ARKA 1UUEA 3NHNA 4Z88A 3C0CA 2GNCA 2D8HA 4LUDA 1SHGA 2HSPA 3R6NA 2M51A 1AWJA 2DF6A 2FPFA 4FSSA 1UJ0A 2J6FA 4OMOA 4HXJA 2GQIA 2X3XD 2EYXA 3RBBB 2D0NA 2A36A 4HVUA 1JO8A 2LQWA 3M0QA 1RI9A 1K4US 1OPLA 1A0NB 1RLPC 3GBQA 2LX7A 2EGAA 2AKKA 3I9QA 4CC3A 4J9IA 1U06A 1PNJA 2LCSA 1ZX6A 1UECA 2W0ZA 2MCNA 1HD3A 4KRTA 1NEBA 2HBWA 2DL4A 4OMMA 1QKXA 1M3AA 2EKHA 4E6RA 2C0OA 2A37A 2YUPA 2MIOA 2JXBA 2VWFA 5IHIA 3VS1A 1Z9QA 2V1QA 1EFNA 1ZLMA 1X6GA 2CUBA 1AD5A 4AFZC 3UATA 2EYWA 1PHTA 2YUQA 2JMCA 3ZL7C 1V1CA 1T0JA
chains in the Genus database with same CATH superfamily
1WHMA 2E5QA 3WVEB 4ZNXA 5IN1A 1MNDA 3BFMA 3QJYA 4CI0C 2J06A 1D1BA 1D3BA 2WACA 2RJCA 5AYFA 1WNLA 2EQMA 3M4GA 2HBPA 4M77D 4PLIA 2L3RA 2DNUA 1YITT 3G71Q 3DB4A 4RTYA 2RQVA 1FX7A 2J05A 4BI4A 2CZ0B 1KG1A 4DBRA 3JCMP 2LT4A 3N5BB 1UGRB 2X35A 3CCRQ 5CKBA 5KYUB 1I0CA 3FC3A 2FZGB 3M9QA 1VQNQ 1GBQA 1QMCA 3H8ZA 2P0PA 1SRMA 4C8QG 1YNZA 4C5EA 5FU7B 3PIPA 2CYZB 3M59A 3OMCA 1VQ5Q 2LNHB 1HJDA 1Q82U 1ZSGA 2Y4XA 3NGPA 4C8QE 1CKAA 2JTFA 2K3XA 3JSCA 2ZAEA 4QQ6A 1YJ9Q 3A8MB 3CMAT 3HPWA 4FYWB 1LNXA 5GAMh 1JJ2A 3ZFJA 1K8AU 2DL3A 1ZUKA 1WDXA 1XTDA 4X34A 1N9RA 2OTJA 5HK3A 2VUBA 1M5Q1 5A0GA 2ZPHB 3CPWS 3OYGA 1NLPC 4J9GA 1WYXA 2FPDA 1GCQC 3G71T 1JXOA 3ASKA 2KAFA 4OF1A 2NUPA 1YIJA 2ZCFB 1K0SA 1R0CB 2MOXA 1X43A 1YJNA 1JU5C 1X6BA 5CQXA 4B9WA 4R55A 4Q5WA 2VV5A 1SRLA 3H41A 1IHVA 2RPNA 1IZ6A 3M58A 4AT1B 2QASA 2O9SA 3EFRA 3A5ZB 3INZA 1MMGA 3RR6A 1M27C 4OMLA 1Q86R 2V8JA 5GAN5 3ZBDA 4MMLA 5KCOA 1NG2A 3MP8A 2M02A 4LDUA 2LZ6B 1AEYA 2YRCA 4PJNA 2BTTA 2DZ9A 1N8RU 4LN2A 4LDWA 2GQVA 2DJZA 2DL5A 3SHWA 2FPEA 1QP3A 2G6FX 1WI7A 4J6YA 2KYMA 2K9GA 1YITA 1KFZA 1LCKA 2DAQA 2QGFB 4M77C 4PNOA 1KSWA 3CQTA 1QVGP 2XD0A 3U23A 2AZVA 1WFWA 1JXMA 1IHWA 5KYXA 4MDXA 1GFCA 2BIVA 2YXYA 4FSXA 4EMKC 2XMFA 3VS0A 4M7AF 3LX7A 1BIAA 4Z89A 3VS7A 2V26A 5FWCA 1M1KR 2RHIA 1LJOA 1O75A 3D7SB 1X6OA 4XU1A 2ZPBB 1B3QA 4J6WA 3H0HA 5AT1B 1KC8U 1I8FA 3VS2A 3CCQT 3VS4A 3QYHB 2EKOA 3G4ST 4PJMA 4BACA 5J3BA 1WQ7A 1Y57A 2L3SA 2M1HA 3OYYA 1I5LA 1BI0A 1S1NA 2L0AA 4MMKA 1J3TA 5LL6S 3TSZA 4M75D 2FEIA 3EHQA 2KNBB 2LT1A 2AZSA 2GTOA 4NL2A 3L2WA 3M0TA 2E5KA 2GTJA 4C0FA 3RERA 1VQPA 2GFUA 1K1ZA 2AKLA 2J6KA 1EX4A 8ATCB 1M8VA 4QT7A 5CAIA 3CCVQ 1KD1C 3OYDA 4GLMA 2DJQA 2WSFE 3MJXA 3HRTA 5I22A 2DD4A 3FJPA 1H641 1V29B 2QQ9A 4UC4A 1YCSB 2GCXA 4N0AC 2CP0A 4J9FA 4ZGEB 1BB9A 3BDLA 1UGQB 1U8RA 1PWTA 3KBGA 1SF9A 2E4HA 5GAN7 1UHFA 3H9NA 3QZ5B 5FU7C 4PJOE 5KH6A 2AHJB 3OS2A 1HSQA 1MV0B 4M7DC 1D0YA 1KJWA 4BY6C 2KE9A 2YT6A 1VQ6T 1G3SA 2A28A 2YUNA 1BI2A 2CT3A 1OX8A 3JCMf 3EGDB 2DO3A 2FB7A 1WPYA 2FZCB 2X4XA 3CBPA 3P8HA 5IXBA 1YJ9A 4IIOA 2PUOB 3FB9A 1ZSZA 3QO3A 1MUZA 3OQ5A 4IUUA 1ZBJA 1N5ZA 2EQUA 2O31A 2SEMA 4PFOA 4PJOB 4FCYA 1SPKA 3QDFA 4DEYA 1I5OB 5LJ3j 4QQGA 4M78C 3OYCA 5GANh 2VASA 4KH1B 1N27A 2AT1B 3OYKA 2GGRA 2PQWA 4M78F 4XK8E 3E9FA 1YCYA 2YRVA 2F5KA 3HSBA 2JW4A 5FRNA 1M3CA 1M9SA 4M77B 4NS5A 3QXEB 2ESWA 4FT2A 3M0PA 1QVGA 3G1JA 2DILA 2GBQA 5GAOl 2HEQA 1P92A 3JCMJ 2OTJQ 8AT1B 1NJIR 3MCAB 4HCKA 2V1RA 3L2UA 3QPHA 3TU4K 3SD4A 2COWA 2XICA 2ZGWA 3DKMA 3TEEA 5GAMg 4F7UG 1QLYA 3OS5A 3H0IA 3RNJA 3L42A 2XDDA 1WHGA 2CT4A 2QYZA 2QEXT 4PFPA 1VQPT 1UUEA 3GP8A 3CCLQ 3JCMX 1SHGA 4E47A 2E3IA 2M51A 1K8AR 5KYNA 4DOWA 4HXJA 4E7JA 2EYXA 3GPLA 2A36A 4C92C 4M7AC 1M90C 2LQWA 4P5NA 1RAEB 1A0NB 4PL6A 2LX7A 2CGHA 3L1AA 2OTJT 3CC7T 3T9NA 4CRIA 4DBQA 2EYQA 4KGXB 1UECA 4KRTA 5LJ5g 5GANj 2HBWA 2DL4A 3JB9H 4O5VA 3FDRA 1M3AA 3CCUT 3EFOB 1M4ZA 1W2BA 4E6RA 1VQ9Q 2YUPA 1VIEA 2JXBA 3JAME 3G4SQ 1ZA1B 1HXDA 3OYNA 2DETA 2Z0WA 2HL3A 1I4K1 3LW5E 1VQKQ 1YJ9T 1PD1A 4BY6B 2XKOC 1AD5A 4M7DB 3QG1A 3QIIA 1YHQA 4QVCA 1T0JA 3UA7A 1BK2A 5GAOr 5LJ3g 1VQLT 4E2FB 1H8KA 1AOJA 3I5SA 1K73U 2RK2A 4ESRA 4E7KA 1QQJA 2MYSA 5CCAA 2DPPB 5A2QE 3OW2P 2QXFA 3KFVA 1YI2Q 3G7ZA 3MEUA 1EIFA 1ZA2B 3MP1A 3QKJA 2LTOA 2ED0A 4LDYA 2KRSA 4OB0B 4IIMA 1UFFA 1VQMQ 3EGUA 2EYZA 1VQ9T 4RMOA 1GRIA 2VXEA 3CCSQ 1QCNA 2WSEE 1ABOA 1BU1A 4M7AB 1VQ7Q 3EG9A 1KHCA 1JJ2P 3M0RA 5KYWA 1QVFP 2KT8A 3JB9F 3C94A 4JLGA 2BE7D 2VKNA 2LP5A 3M54A 1FMVA 5D7UA 4J9BA 4F14A 2ZPGB 5HKCA 2OTLQ 2IVWA 2OAUA 4BI8B 1OEBA 2F2WA 2RQWA 2DBMA 1X01A 4N4IA 1K73C 2RB6A 2E10A 3GNGA 4YTLA 3I55A 3RKXA 1Q95G 1ZUYA 5LJ5d 2M16A 3LGFA 4DA4A 2QDLA 4Y91A 1YI2T 3ER0A 4RTTA 4N4HA 3OBWA 2RO0A 1NBEB 2D1XA 4HKEA 3SB2A 3EGDA 3CC2T 5ECAA 3CCQQ 3SWNA 1VOMA 1W2BP 2LQNA 2X3WD 3CC7A 1H3ZA 2EAYA 3JCMd 1AHJB 2DVEA 4GY5A 1U5SA 5GANf 4F04B 3UPUA 2KDSA 4R0KA 3BY7A 2XDPA 5LJ5j 2M9UA 3CCLA 3EH1A 1CKBA 5CK9A 1RAIB 1OPKA 2BUDA 5GAN2 4C8QC 1VQOQ 3HL8A 5GJVB 1YHQT 2P4TA 2XIDA 5L23A 4AG2C 1WXTA 5GMKj 1JBMA 1PKTA 2JTMA 4V2SA 4M78B 1G5VA 3G4SA 2M0YA 1E6GA 3SEMA 4J83A 1N9SA 4KUIA 2JNGA 4AFSC 3JB9I 2R5MA 2X4WA 1AWXA 1SKUB 1PRMC 1K73R 3JCMV 1Y7XA 1YN8A 2HDAA 2K4YA 1VQ9A 5GMKm 2EJ9A 2DBKA 3V8KA 3BDUA 3CC2Q 1TUCA 5FRMA 1QW1A 1KQSP 2H3EB 1G3YA 3QYGB 4OGCA 3CC7Q 1Q7YC 3QWYA 1E7OA 4FYVB 4C92A 1MV3A 1T3SA 4KULA 2C0IA 4OB1B 1WX6A 5HY6A 1VQ4T 4DBFA 5C0MA 2LX9A 3REBB 3I56T 3JB9D 5FW9A 2KK4A 3OBYA 3M5AA 2B8AA 1Y0MA 1VQOT 2ROTA 4M7DE 4C5GA 4LXCA 2LJ1A 2NUTB 1BI1A 2B86A 2IG0A 2F2VA 4M75F 3GIBA 5CKFA 2E3HA 2RI2A 5J39A 2EJFA 2XK0A 4WF2A 2EIFA 4EMHA 4XAXB 2CREA 2K79A 1T3LA 5GAOq 1Q82C 3E1SA 5FROA 3V7CA 3J81E 4C92F 1QVPA 5GANd 3KXTA 3CCMT 1M1GA 2HQHA 2P0QA 1WZOA 1Q82R 1W1FA 3DLLA 2BE9B 4C5HA 5GMKh 5FU6B 4A63B 1Q81R 1VQNA 1QWFA 2KQWA 3ME9A 3OSVA 3S3NA 2KRNA 3IQLA 3M4YA 1X69A 2HL5C 1ABQA 2DK3A 1RI0A 2ABLA 4M78G 4PJOF 4CC7A 2QEXQ 1M90U 4F16A 2YLBA 1IRXA 1H3HA 1VIFA 3EFSA 2DL7A 4RG2A 1UGVA 4M75B 4DBHA 4LNPA 3REAB 5FLXE 3P8BB 4QVDA 3VUZA 2VXFA 4HCCA 3JCMc 3PFSA 2KR3A 3RDVA 5M9OA 2ECZA 4JRIA 3EG9B 2KVQG 2MMPA 3JCMb 3PGGA 5KCHA 4ZGDB 4WTOB 2YHTA 4Y92A 4A54A 1MMAA 2L3QA 3CPWP 2EQKA 2HZYA 3CCJT 2J7IA 2LCCA 3EG0A 2BKDN 1TOVA 1IB8A 2E1HA 2L2PA 4M7DF 1FMWA 4M7AD 1GFDA 4PFZA 4BE0A 3SWNB 2SRCA 4GLKA 2FRYA 1YHQQ 5GAMd 1Q7YR 2JZ2A 4EPCA 4QVZA 1XJWB 2E41A 2OAWA 4RUGA 5I2SA 1YJWA 1S72A 2XDBA 1UJYA 1BBZA 1EZZB 1WJQA 1TS9A 3UA6A 3NTHA 2KXDA 1XOVA 4D6WA 4EIKA 4ORZA 4M7AE 1UG1A 1RLQC 2J6OA 1X75C 1WHJA 2FYKA 3X25B 2VVKA 4J8OA 2ATCB 2K5IA 1AWWA 1OU9A 4OMPA 1I1JA 2JVVA 4WCIA 2ENMA 1GL5A 3NMZC 2DFUA 4HA8A 4A4EA 2RN8A 1VQNT 4LD9K 1ARKA 2F69A 1G8XA 1I81A 4Z88A 2D8HA 3AT1B 4LUDA 4E7LA 3R6NA 1VQLA 3E19A 3CCST 2FPFA 4JS4A 2DXTA 1WJSA 1JRIA 2KSSA 1UJ0A 2G3RA 2J6FA 3EAEA 1OQKA 2QA4A 3G6ET 2E6NA 1JB0E 1D09B 1K4US 1BI3A 1OPLA 1RLPC 3GBQA 3QUIA 2EGAA 3OB9A 1D1CA 3LWIA 3V7RA 2DTOA 1FXXA 3L2QA 3OW2A 4J9IA 3PMTA 4VUBA 2LCSA 2MCNA 2W0ZA 4OMMA 5C6SA 1QKXA 4HT9A 2VYTA 4XTUA 5GMKi 2NUTA 3A8HB 3OA6A 5IHIA 3CCLT 3X26B 1YJNQ 3URGA 1D1AA 1UB4A 1SG5A 1ZLMA 3OYEA 3CCJA 4AFZC 4M77A 1PG5B 2V8KA 1PHTA 2OTLA 1PSEA 2YUQA 2JMCA 3ZL7C 3OYFA 2RHXA 4LE9A 4ANJA 4ZN1A 1IGQA 2MF2A 2I0NA 5IT9E 4C8QF 2DM1A 2CZ6B 2IPOB 4XTXA 3VV0A 2VGMA 2MAMA 4X1VA 2PNIA 5KE3A 4OMQA 1GCPA 2O4XA 5I2MA 1VQKA 2K5FA 1OV3A 1GBRA 3VJPA 2VC8A 1KQSS 3A8OB 2MPXC 3EG2A 5KYUA 1RAAB 2LJ0A 2QQRA 4ME7A 3FRNA 1AWOA 4HVVA 2PVOB 3G6EQ 2EW3A 3G71A 2DZCA 3C12A 4AMCA 2ZPIB 4MZPA 3CCRT 3CCEA 2RQRA 1FMKA 4II1A 1MMNA 2CS7A 2W10A 2RQUA 1KC8R 5I11A 3FJ5A 2JN0A 4BB7A 2HQXA 3JCMg 2K2VA 4CC2A 1QCFA 2K57A 5GAMf 1YJNT 1AZEA 1M1FA 2DIGA 3OY9A 1ZSZC 1ZHIA 1WLPB 1TUGB 3UT1A 4RTZA 3HRUA 1M3BA 2RNAA 1NEGA 2HD0A 1Y71A 1QCOA 2K3BA 2YWWA 1TTHB 2OX7A 2FRWA 4M7DA 3MO8A 1U1TA 1K9MR 2DERA 3NPFA 4IUTA 3HP9A 4R56A 4FIBA 2JTEA 5LJ3d 2EFIA 4JPBW 4L59A 2FO0A 3L2ZA 2YSQA 2LVMA 1E6HA 1K8AC 2BZYA 2KEAA 1H92A 3O5ZA 1ZQ1A 3J80E 4BE1A 1BYMA 1M90R 1IREB 4MDWA 2DLPA 1PRLC 1NPRA 3I5RA 3EH2A 2HNIA 4C0ZA 4ZN3A 2EWNA 3I56A 2Y4YA 1D0ZA 1IGUA 2ED1A 2O4XB 1BCOA 3V7SA 2QA4Q 4JRQA 2DRMA 2VGNA 4RTUA 4M4ZA 5DM7R 1GXIE 2NUPB 2K7AA 4M7DG 1NJIC 1C0MA 2RF0A 3MHXA 2X9HA 1B34B 4RTXA 3S6WA 1PCXA 3PE0A 1DJ7B 2JM9A 3BW1A 4M7AA 2QTXA 4J7FA 5GJWB 4EMKB 2FHDA 2QI2A 3OYBA 1LPLA 4D8DA 1VQKT 3VRZA 4PJJA 3EG3A 4ZTJA 5KE2A 1KQ2A 1M2VB 2NYSA 2H3JA 1QKWA 2KXCA 1SSHA 4C92E 1K9MC 4XQ3A 5KYWB 2DE0X 4LDXA 2QTVA 3O8VA 1LOJA 3NTIA 4KGZB 2KROA 3X24B 3OW2S 3OYHA 1MHNA 1NJIU 3LYIA 4E7ZA 1TG0A 5DLQE 2AK5A 2JUFA 4IURA 4M75E 2JT4A 1UHCA 1X2KA 2C06A 2YUOA 4OB3B 2JM8A 4HCBA 3QSUA 2FL7A 1JQQA 3L2RA 3I56Q 4OB2B 2BZ8A 3A8GB 2COZA 2M0OA 4EMGA 3DB3A 4JS5A 4ELZC 5LJ5h 3QBYA 2CP3A 3CXCS 5HK0A 1W6XA 1S72Q 3JCMW 2MWPA 1HK9A 1AZGB 1VQ6A 1NM7A 5CR2A 2HMAA 1X2QA 5DLOA 3EG1A 2D6FA 3VUBA 1OX9A 5GAOm 3CXCP 2OJ2A 3CCEQ 2NUZA 3LH5A 3CD6A 2DRKA 1VQ7A 2P0KA 2P4RA 3C95A 1K9MU 4DEXA 1ZBXA 1RUWA 2HQEA 2HCKA 3HFOA 2DEUA 4PJOD 2H8HA 1YIJQ 1W4SA 2DX1A 4A4FA 4BI3A 1WIEA 1UGPB 2C0TA 1NLOC 3A1PA 1SEMA 3G6EA 3LGLA 1M1KC 3JV3A 4RCCA 2DIQA 3CC4T 4EMKA 3R6OA 4C92B 1VA7A 2DXBA 4JZ4A 3LWHA 4A53A 1YJWQ 3VU3C 2PZ1A 2DA9A 1M2VA 1YWPA 4M78A 4J5YA 1VQ8A 5LJ3e 2L5QA 2L3PA 3META 4A4GA 1G83A 1RAFB 5I21A 4C92D 3NTKA 3FEOA 2E6ZA 2CUDA 4JJBA 2DVJA 3THKA 2ZPEB 5A0LA 3E9GA 3RMSA 1XNIA 4NOYA 2X51A 4O6JA 2L8DA 3FIFA 1NYGA 1N8RC 1KK7A 2RK1A 4XTYA 4MZMA 2DXUA 3RUXA 4AFQC 1N8RR 2EYYA 4M77F 5GANg 4B6MA 3DLMA 2XHCA 3CCSA 5KYYA 5GAMj 2CZ1B 3PVLA 1VQMT 1NPPA 2GF7A 4KBMB 3RMQA 2XU8A 1U3OA 2CDTA 3H6ZA 4FT4A 2QA4T 3OS1A 3Q1JA 4J6XA 5CVIA 3QWXX 4C8QA 1UEBA 1D3BB 3CC4Q 4X9DA 2L89A 3OYMA 2K6DA 1M2OA 2NLUA 4XU2A 3VKIA 2XI9A 3J7AF 5GMKl 1M8MA 1VQ5T 1ACMB 4RCBA 3AHUA 4PJLA 2EJGA 3HKSA 1M1KU 3I35A 3SDZA 2MK5A 3CXCA 2DXCA 3WVDB 2KI7A 1UE9A 4IUPA 5GAOp 2KT1A 3JCMh 3CCUA 3HFNA 3PNWC 3CCRA 4KT0E 1HYOA 2RI5A 3TSWA 4B9XA 2CSQA 3H0FA 2O9VA 3VYHB 1U1SA 1VUBA 4XTVA 5EC7A 2RA2A 3CCVT 2PTKA 3CD6T 1WA7A 1VQ7T 3UF4A 4C5IA 2OTLT 3C0CA 2MWOA 2GNCA 3PIOA 2HSPA 2QK0A 3QZ9B 2DF6A 1AT1B 1G3WA 5GAN8 1PSFA 2GQIA 2X3XD 2RJEA 1KQSA 4N0AA 4HVUA 3M0QA 1OZ2A 1RL2A 3M57A 1VQ4Q 4L5GA 2AKKA 1BIBA 3OS0A 2JOYA 4CC3A 2HAXA 2V8IA 5CKEA 1MGQA 4TVRA 2LQKA 2QG9B 3UWNA 4NL3A 1PD0A 3GOXA 2E65A 3CBMA 4DOVA 1NEBA 2D0QB 1WJRA 3RESA 3CD6Q 2EKHA 1Q86C 3CCET 2CP6A 1UGSB 2CP7A 2V1QA 3JCMQ 5IAYA 2QEXA 2A0FB 2GFAA 3OYLA 1Y07A 3GF5A 2JJ9A 4IUVA 3CCMQ 5IH2A 3CMET 1O9SA 1SSFA 3LLRA 1FWZA 3I55T 4Y28E 2QGGA 3BE3A 3HRSA 5DY9A 4M77G 4M75C 2KRMA 2EGEA 1JEGA 2EQJA 1B7TA 1SHFA 1VQ6Q 1YP5A 3M53A 2A7YA 1YITQ 1QVGS 1FYNA 3PTAA 2E12A 1T0HA 2F1LA 4ZGJB 3MEVA 4J9CA 1VYUA 5IHNA 2KGTA 2DD5A 3CMAQ 1VQPQ 2D9TA 3KUFA 3PMIA 4E7IA 1X27A 5GAN3 3L2VA 1WHHA 4FW2A 5LJ5f 2JS0A 4IUQA 1B07A 3X20B 2Y90A 3LH0A 2VB6A 4JJNK 4M7DD 4LUEA 1KD1U 4ELYC 2LQ8A 1OU8A 2QQAA 2RQTA 4EDUA 1W2BS 2LCLA 1ZUUA 1PKSA 2DMOA 3ZEHA 4LDVA 3GLXA 4Z8AA 3VS3A 2EQIA 1Z9ZA 4LD6A 3VRYA 1V76A 4HT8A 3CPWA 3C4SA 2DTHA 7AT1B 1OZ3A 1K9AA 4M78E 1KHIA 2A08A 3MEAA 5A0DA 2YRDA 3ULRB 2PVGB 1TSFA 2QDYB 3E2UA 1TUDA 3CMEQ 3TREA 2P84A 5KYYB 4FM4B 4JDSA 4XU0A 3UDCA 2ZPFB 3JRZA 2RJFA 3MP6A 1N6AA 4JZ3A 4F17A 2DEQA 2LC4A 3X28B 1YWOA 1YFNA 4BDYA 1R77A 1RADB 2R57A 4F7UB 5FWBA 5IHKA 4D8KA 2F2XA 1VQ4A 1BCMA 1JJ2S 4PJOC 1QP2A 2JS2A 1PC0A 4F7UE 3FLGA 1RABB 4XTZA 3TVTA 2EGCA 3CC4A 5GAOn 4C8QB 4E7HA 2O2OA 2ROLA 1WXUA 1VYTA 2EPDA 5J26A 5CIUA 3V8LA 5GAMe 1VQLQ 2HKNA 4C8QD 5GAN6 4L6V5 1WGSA 4PLLA 1WQWA 4JRKA 3QJ6A 2YDLA 1YI2A 1YBYA 2LDMA 3QDRB 4QW2A 2E70A 4A4KA 2D8JA 4AG1C 4J7IA 2OI3A 4RTWA 1OOTA 3CC2A 3OSSC 1VQ8Q 3CCMA 4PJOG 4FYXB 3TCJA 1OULA 4QKUA 5D6YA 2KBTA 1NZ9A 3S3OA 1Q7YU 2R58A 4FYYB 3SWNC 1I07A 4J9EA 3OYIA 1Y96B 3I55Q 1KC8C 5HCKA 2RH2A 1VQMA 4M78D 4Z02A 1D0XA 4JJCA 2PUKB 2KMTA 2ZZDA 1NYFA 2I2LA 1VYVA 5LJ3h 9ATCB 3V8JA 2CP5A 4RTVA 1AVZC 1F1BB 2IIMA 2CSIA 1BKBA 1G2BA 2CZ7B 1KD1R 2PVDB 3RIRA 1VQ8T 1M30A 1ZSZB 4XU3A 3CMAA 1CSKA 4PJOA 3GNFB 4M77E 4PKCC 1IO6A 2PU9B 2DTIA 3VS5A 3RKYA 2O88A 2HSEB 3HHTB 4J9DA 3OYAA 4K11A 2BZXA 1TWBA 3WXMB 1KQ1A 1GCQA 4BDZA 1RAHB 4JLIA 4OMNA 4M75A 4GBQA 3VYGA 2LMJA 5D6XA 1TU0B 5GMKe 1MMDA 3M56A 2CP2A 2R5AA 3CEYA 5CKHA 3MPUB 3MKDA 3EGXA 3JB9G 5CKDA 1VQOA 4C0DB 1UDLA 2EBPA 2RD1A 5D6WA 2RJDA 1QVFA 1RACB 4AFUC 2LJ3A 3M55A 1S72T 1WHKA 5LJ5e 6AT1B 5IXFA 4XTWA 1R0BG 1C1AA 4CC4B 2EVRA 1VQ5A 2KY9A 3JB9J 5LJ3f 2AIRB 2K5LA 3TQ7P 3MEWA 1B34A 2NWMA 3A98A 1Y96A 1TH7A 2K2MA 4JUVA 2E64A 4ATOA 3JCMe 2F5TX 4X9CA 4HVWA 1Q86U 2FVUA 2X4JA 4IKFA 4OVAA 3CCVA 4M75G 2KYBA 1G3TA 3EFOA 4A4HA 2COYA 2DL8A 3CMEA 5CQYA 2FZKB 3M0UA 1WXBA 1W70A 4JJDA 2LRQA 5CO7A 5GAN4 1OI1A 2FG0A 3OMGA 5L8RE 4N4GA 4E7SA 3M0SA 2CKKA 2RI3A 2MI6A 4C0DC 1KIKA 1K0XA 3PVQA 4OMFB 1NE8A 4M7AG 3CCJQ 2RHUA 1UTIA 1XQHA 2CH4W 2DYBA 4F7UA 3CCQA 4FL6A 4RKUE 2QQBA 3P8DA 2HKQB 1QWEA 4QQDA 4ZTFA 2CH4A 2RHYA 2A3LA 2QAZA 3EHRA 1OYXA 4OP0A 4FU6A 3A8LB 3F70A 1IXDA 2K3YA 2JMAA 3CBOA 4J9HA 1K76A 3EGXB 4JRPA 3RKWA 4RG8A 2RMOA 3VS6A 3HTRA 3NHNA 4BUGA 4DQ2A 1WHLA 4KH0B 4BD3A 4BE2A 1AWJA 1RAGB 4KUDK 4FSSA 4C0GA 4F7UF 4HCZA 4MZTA 3CCUQ 4OMOA 1MNEA 2DYIA 1Q81U 3RBBB 2D0NA 2DKGA 1JO8A 1LVKA 1RI9A 1C6VX 3PT9A 1YJWT 2RHZA 1QVFS 5KYXB 3I9QA 4KGVB 3NFCA 5EG2A 2O01E 1U06A 1PNJA 3S3MA 5GANe 1ZX6A 2XG8D 1HD3A 4PK4A 3OYJA 1R8OB 3SFMA 2C0OA 2A37A 2LNVA 2X4YA 1YIJT 1PM3A 5FU6C 2MIOA 2VWFA 3CPFA 3VS1A 2YLCA 1Z9QA 2QQSA 3QHSA 1EFNA 1X6GA 2CUBA 4OGEA 1Q81C 1TXQA 3UATA 2RM4A 2WSCE 4FW1A 2EYWA 4C92G 1V1CA
chains in the Genus database with same CATH topology
4LE9A 3UA7A 5IH2A 1BK2A 1H8KA 1AOJA 3I5SA 4ESRA 2I0NA 2DM1A 4ZNXA 2KRMA 2EGEA 1JEGA 3KFVA 1SHFA 2J06A 4X1VA 1YP5A 2PNIA 4OMQA 1GCPA 2ED0A 2KRSA 4IIMA 1FYNA 1UFFA 3EGUA 1OV3A 1T0HA 2EYZA 1GBRA 1GRIA 3EG2A 4J9CA 1VYUA 5IHNA 2DNUA 2KGTA 2LJ0A 1BU1A 1ABOA 4RTYA 2RQVA 1AWOA 1X27A 4HVVA 3M0RA 2EW3A 2J05A 2KT8A 2JS0A 2RQRA 1FMKA 2W10A 2VKNA 1B07A 2RQUA 5I11A 2LP5A 3FJ5A 4J9BA 4CC2A 4F14A 1QCFA 4LUEA 1AZEA 1I0CA 1OEBA 2RQTA 1WLPB 1ZUUA 1GBQA 2F2WA 1PKSA 2RQWA 2DBMA 2DMOA 4Z8AA 3VS3A 1SRMA 2EQIA 4RTZA 1YNZA 1Z9ZA 1M3BA 2RNAA 3VRYA 1NEGA 2LNHB 1HJDA 2K3BA 1ZSGA 3NGPA 1ZUYA 1CKAA 2FRWA 1K9AA 2QDLA 2A08A 3NPFA 4RTTA 3ULRB 2JTEA 2D1XA 4JPBW 2FO0A 2DL3A 2YSQA 1ZUKA 1TUDA 1WDXA 5ECAA 1E6HA 2BZYA 2LQNA 2X3WD 2KEAA 4JZ3A 4F17A 1H92A 3O5ZA 1NLPC 1YWOA 4J9GA 1WYXA 2FPDA 1U5SA 1GCQC 1JXOA 4R0KA 2DLPA 5FWBA 1PRLC 5IHKA 3I5RA 4D8KA 1K0SA 2MOXA 2F2XA 1X43A 1JU5C 1X6BA 1CKBA 1SRLA 3H41A 2JS2A 2RPNA 1OPKA 3TVTA 2ED1A 2EGCA 2O9SA 5GJVB 2O2OA 2ROLA 1WXUA 1VYTA 2EPDA 2DRMA 4RTUA 5L23A 4M4ZA 4AG2C 1WXTA 2K7AA 1M27C 4OMLA 1PKTA 2RF0A 2M0YA 1E6GA 3PE0A 4RTXA 3SEMA 2JM9A 1NG2A 2YDLA 4AFSC 2LZ6B 1AEYA 5GJWB 2BTTA 2D8JA 4AG1C 4D8DA 1AWXA 2OI3A 4LN2A 4RTWA 1OOTA 1PRMC 3VRZA 2DL5A 3SHWA 2FPEA 1YN8A 2HDAA 2G6FX 3EG3A 1WI7A 2DBKA 2KBTA 2K9GA 2KYMA 1KFZA 1TUCA 1LCKA 1QKWA 1KSWA 2KXCA 1SSHA 1I07A 3CQTA 4J9EA 3QWYA 3U23A 1E7OA 2DE0X 2AZVA 1WFWA 5HCKA 1MV3A 1JXMA 1T3SA 2C0IA 1WX6A 2KROA 1GFCA 1TG0A 2XMFA 2AK5A 3VS0A 3REBB 5FW9A 4JJCA 3VS7A 2JT4A 1UHCA 5FWCA 4Z89A 1X2KA 2YUOA 1Y0MA 2ROTA 2JM8A 1NYFA 1B3QA 1JQQA 1VYVA 2LJ1A 3H0HA 2BZ8A 4RTVA 1AVZC 3VS2A 2B86A 2F2VA 2IIMA 2CSIA 3VS4A 1G2BA 1M30A 2L3SA 1Y57A 1W6XA 1S1NA 2L0AA 1J3TA 1CSKA 2CREA 2K79A 1AZGB 1T3LA 1NM7A 3TSZA 2FEIA 1X2QA 3EHQA 3EG1A 1IO6A 2KNBB 3VS5A 2AZSA 2GTOA 2O88A 3M0TA 1W1FA 2OJ2A 2E5KA 2GTJA 2NUZA 4J9DA 4A63B 3LH5A 4K11A 2DRKA 2BZXA 1K1ZA 2P4RA 2AKLA 2J6KA 1GCQA 1QWFA 4QT7A 4DEXA 1RUWA 2HCKA 4OMNA 2KRNA 3IQLA 4GBQA 4GLMA 1X69A 2DJQA 2H8HA 2LMJA 5I22A 1ABQA 2DX1A 1WIEA 2C0TA 1NLOC 1YCSB 1SEMA 2ABLA 3JV3A 4CC7A 1UDLA 4J9FA 2EBPA 4F16A 1BB9A 4AFUC 1H3HA 2LJ3A 1VA7A 1PWTA 2DL7A 1UGVA 1UHFA 4JZ4A 5IXFA 4LNPA 3REAB 4CC4B 2EVRA 2PZ1A 2DA9A 1YWPA 2KR3A 2L3PA 2NWMA 1HSQA 1G83A 1MV0B 1KJWA 2ECZA 3A98A 2KE9A 2K2MA 2YT6A 2A28A 2YUNA 2CT3A 2CUDA 4JJBA 2DVJA 3THKA 4HVWA 4Y92A 2L3QA 5IXBA 4IIOA 1NYGA 2J7IA 1MUZA 3EG0A 1ZBJA 1N5ZA 2KYBA 2O31A 2SEMA 1SPKA 2DL8A 4DEYA 4AFQC 2EYYA 2L2PA 3M0UA 1WXBA 2GGRA 1GFDA 1W70A 4JJDA 3PVLA 2FG0A 2JW4A 1U3OA 2SRCA 1M3CA 2CDTA 2FRYA 3M0SA 2ESWA 3M0PA 3QWXX 1KIKA 2OAWA 4RUGA 1K0XA 3PVQA 2DILA 1UJYA 1BBZA 2K6DA 2GBQA 1UTIA 2HEQA 2CH4W 3UA6A 1M8MA 2KXDA 2DYBA 1XOVA 4EIKA 4ORZA 1QWEA 1RLQC 1UG1A 3I35A 2J6OA 4HCKA 2V1RA 1UE9A 2VVKA 2KT1A 2CH4A 1AWWA 3EHRA 1QLYA 4OMPA 3TSWA 1I1JA 2CSQA 3H0IA 4WCIA 2JMAA 3RNJA 2ENMA 1GL5A 3H0FA 2O9VA 3NMZC 4J9HA 1K76A 2CT4A 2RN8A 5EC7A 2PTKA 1WA7A 2RMOA 3VS6A 3UF4A 1ARKA 1UUEA 3NHNA 4Z88A 3C0CA 2GNCA 2D8HA 4LUDA 1SHGA 2HSPA 3R6NA 2M51A 1AWJA 2DF6A 2FPFA 4FSSA 1UJ0A 2J6FA 4OMOA 4HXJA 2GQIA 2X3XD 2EYXA 3RBBB 2D0NA 2A36A 4HVUA 1JO8A 2LQWA 3M0QA 1RI9A 1K4US 1OPLA 1A0NB 1RLPC 3GBQA 2LX7A 2EGAA 2AKKA 3I9QA 4CC3A 4J9IA 1U06A 1PNJA 2LCSA 1ZX6A 1UECA 2W0ZA 2MCNA 1HD3A 4KRTA 1NEBA 2HBWA 2DL4A 4OMMA 1QKXA 1M3AA 2EKHA 4E6RA 2C0OA 2A37A 2YUPA 2MIOA 2JXBA 2VWFA 5IHIA 3VS1A 1Z9QA 2V1QA 1EFNA 1ZLMA 1X6GA 2CUBA 1AD5A 4AFZC 3UATA 2EYWA 1PHTA 2YUQA 2JMCA 3ZL7C 1V1CA 1T0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LE9 A;  3UA7 A;  5IH2 A;  1BK2 A;  1H8K A;  1AOJ A;  3I5S A;  4ESR A;  2I0N A;  2DM1 A;  4ZNX A;  2KRM A;  2EGE A;  1JEG A;  3KFV A;  1SHF A;  2J06 A;  4X1V A;  1YP5 A;  2PNI A;  4OMQ A;  1GCP A;  2ED0 A;  2KRS A;  4IIM A;  1FYN A;  1UFF A;  3EGU A;  1OV3 A;  1T0H A;  2EYZ A;  1GBR A;  1GRI A;  3EG2 A;  4J9C A;  1VYU A;  5IHN A;  2DNU A;  2KGT A;  2LJ0 A;  1BU1 A;  1ABO A;  4RTY A;  2RQV A;  1AWO A;  1X27 A;  4HVV A;  3M0R A;  2EW3 A;  2J05 A;  2KT8 A;  2JS0 A;  2RQR A;  1FMK A;  2W10 A;  2VKN A;  1B07 A;  2RQU A;  5I11 A;  2LP5 A;  3FJ5 A;  4J9B A;  4CC2 A;  4F14 A;  1QCF A;  4LUE A;  1AZE A;  1I0C A;  1OEB A;  2RQT A;  1WLP B;  1ZUU A;  1GBQ A;  2F2W A;  1PKS A;  2RQW A;  2DBM A;  2DMO A;  4Z8A A;  3VS3 A;  1SRM A;  2EQI A;  4RTZ A;  1YNZ A;  1Z9Z A;  1M3B A;  2RNA A;  3VRY A;  1NEG A;  2LNH B;  1HJD A;  2K3B A;  1ZSG A;  3NGP A;  1ZUY A;  1CKA A;  2FRW A;  1K9A A;  2QDL A;  2A08 A;  3NPF A;  4RTT A;  3ULR B;  2JTE A;  2D1X A;  4JPB W;  2FO0 A;  2DL3 A;  2YSQ A;  1ZUK A;  1TUD A;  1WDX A;  5ECA A;  1E6H A;  2BZY A;  2LQN A;  2X3W D;  2KEA A;  4JZ3 A;  4F17 A;  1H92 A;  3O5Z A;  1NLP C;  1YWO A;  4J9G A;  1WYX A;  2FPD A;  1U5S A;  1GCQ C;  1JXO A;  4R0K A;  2DLP A;  5FWB A;  1PRL C;  5IHK A;  3I5R A;  4D8K A;  1K0S A;  2MOX A;  2F2X A;  1X43 A;  1JU5 C;  1X6B A;  1CKB A;  1SRL A;  3H41 A;  2JS2 A;  2RPN A;  1OPK A;  3TVT A;  2ED1 A;  2EGC A;  2O9S A;  5GJV B;  2O2O A;  2ROL A;  1WXU A;  1VYT A;  2EPD A;  2DRM A;  4RTU A;  5L23 A;  4M4Z A;  4AG2 C;  1WXT A;  2K7A A;  1M27 C;  4OML A;  1PKT A;  2RF0 A;  2M0Y A;  1E6G A;  3PE0 A;  4RTX A;  3SEM A;  2JM9 A;  1NG2 A;  2YDL A;  4AFS C;  2LZ6 B;  1AEY A;  5GJW B;  2BTT A;  2D8J A;  4AG1 C;  4D8D A;  1AWX A;  2OI3 A;  4LN2 A;  4RTW A;  1OOT A;  1PRM C;  3VRZ A;  2DL5 A;  3SHW A;  2FPE A;  1YN8 A;  2HDA A;  2G6F X;  3EG3 A;  1WI7 A;  2DBK A;  2KBT A;  2K9G A;  2KYM A;  1KFZ A;  1TUC A;  1LCK A;  1QKW A;  1KSW A;  2KXC A;  1SSH A;  1I07 A;  3CQT A;  4J9E A;  3QWY A;  3U23 A;  1E7O A;  2DE0 X;  2AZV A;  1WFW A;  5HCK A;  1MV3 A;  1JXM A;  1T3S A;  2C0I A;  1WX6 A;  2KRO A;  1GFC A;  1TG0 A;  2XMF A;  2AK5 A;  3VS0 A;  3REB B;  5FW9 A;  4JJC A;  3VS7 A;  2JT4 A;  1UHC A;  5FWC A;  4Z89 A;  1X2K A;  2YUO A;  1Y0M A;  2ROT A;  2JM8 A;  1NYF A;  1B3Q A;  1JQQ A;  1VYV A;  2LJ1 A;  3H0H A;  2BZ8 A;  4RTV A;  1AVZ C;  3VS2 A;  2B86 A;  2F2V A;  2IIM A;  2CSI A;  3VS4 A;  1G2B A;  1M30 A;  2L3S A;  1Y57 A;  1W6X A;  1S1N A;  2L0A A;  1J3T A;  1CSK A;  2CRE A;  2K79 A;  1AZG B;  1T3L A;  1NM7 A;  3TSZ A;  2FEI A;  1X2Q A;  3EHQ A;  3EG1 A;  1IO6 A;  2KNB B;  3VS5 A;  2AZS A;  2GTO A;  2O88 A;  3M0T A;  1W1F A;  2OJ2 A;  2E5K A;  2GTJ A;  2NUZ A;  4J9D A;  4A63 B;  3LH5 A;  4K11 A;  2DRK A;  2BZX A;  1K1Z A;  2P4R A;  2AKL A;  2J6K A;  1GCQ A;  1QWF A;  4QT7 A;  4DEX A;  1RUW A;  2HCK A;  4OMN A;  2KRN A;  3IQL A;  4GBQ A;  4GLM A;  1X69 A;  2DJQ A;  2H8H A;  2LMJ A;  5I22 A;  1ABQ A;  2DX1 A;  1WIE A;  2C0T A;  1NLO C;  1YCS B;  1SEM A;  2ABL A;  3JV3 A;  4CC7 A;  1UDL A;  4J9F A;  2EBP A;  4F16 A;  1BB9 A;  4AFU C;  1H3H A;  2LJ3 A;  1VA7 A;  1PWT A;  2DL7 A;  1UGV A;  1UHF A;  4JZ4 A;  5IXF A;  4LNP A;  3REA B;  4CC4 B;  2EVR A;  2PZ1 A;  2DA9 A;  1YWP A;  2KR3 A;  2L3P A;  2NWM A;  1HSQ A;  1G83 A;  1MV0 B;  1KJW A;  2ECZ A;  3A98 A;  2KE9 A;  2K2M A;  2YT6 A;  2A28 A;  2YUN A;  2CT3 A;  2CUD A;  4JJB A;  2DVJ A;  3THK A;  4HVW A;  4Y92 A;  2L3Q A;  5IXB A;  4IIO A;  1NYG A;  2J7I A;  1MUZ A;  3EG0 A;  1ZBJ A;  1N5Z A;  2KYB A;  2O31 A;  2SEM A;  1SPK A;  2DL8 A;  4DEY A;  4AFQ C;  2EYY A;  2L2P A;  3M0U A;  1WXB A;  2GGR A;  1GFD A;  1W70 A;  4JJD A;  3PVL A;  2FG0 A;  2JW4 A;  1U3O A;  2SRC A;  1M3C A;  2CDT A;  2FRY A;  3M0S A;  2ESW A;  3M0P A;  3QWX X;  1KIK A;  2OAW A;  4RUG A;  1K0X A;  3PVQ A;  2DIL A;  1UJY A;  1BBZ A;  2K6D A;  2GBQ A;  1UTI A;  2HEQ A;  2CH4 W;  3UA6 A;  1M8M A;  2KXD A;  2DYB A;  1XOV A;  4EIK A;  4ORZ A;  1QWE A;  1RLQ C;  1UG1 A;  3I35 A;  2J6O A;  4HCK A;  2V1R A;  1UE9 A;  2VVK A;  2KT1 A;  2CH4 A;  1AWW A;  3EHR A;  1QLY A;  4OMP A;  3TSW A;  1I1J A;  2CSQ A;  3H0I A;  4WCI A;  2JMA A;  3RNJ A;  2ENM A;  1GL5 A;  3H0F A;  2O9V A;  3NMZ C;  4J9H A;  1K76 A;  2CT4 A;  2RN8 A;  5EC7 A;  2PTK A;  1WA7 A;  2RMO A;  3VS6 A;  3UF4 A;  1ARK A;  1UUE A;  3NHN A;  4Z88 A;  3C0C A;  2GNC A;  2D8H A;  4LUD A;  1SHG A;  2HSP A;  3R6N A;  2M51 A;  1AWJ A;  2DF6 A;  2FPF A;  4FSS A;  1UJ0 A;  2J6F A;  4OMO A;  4HXJ A;  2GQI A;  2X3X D;  2EYX A;  3RBB B;  2D0N A;  2A36 A;  4HVU A;  1JO8 A;  2LQW A;  3M0Q A;  1RI9 A;  1K4U S;  1OPL A;  1A0N B;  1RLP C;  3GBQ A;  2LX7 A;  2EGA A;  2AKK A;  3I9Q A;  4CC3 A;  4J9I A;  1U06 A;  1PNJ A;  2LCS A;  1ZX6 A;  1UEC A;  2W0Z A;  2MCN A;  1HD3 A;  4KRT A;  1NEB A;  2HBW A;  2DL4 A;  4OMM A;  1QKX A;  1M3A A;  2EKH A;  4E6R A;  2C0O A;  2A37 A;  2YUP A;  2MIO A;  2JXB A;  2VWF A;  5IHI A;  3VS1 A;  1Z9Q A;  2V1Q A;  1EFN A;  1ZLM A;  1X6G A;  2CUB A;  1AD5 A;  4AFZ C;  3UAT A;  2EYW A;  1PHT A;  2YUQ A;  2JMC A;  3ZL7 C;  1V1C A;  1T0J A; 
#chains in the Genus database with same CATH topology
 1WHM A;  2E5Q A;  3WVE B;  4ZNX A;  5IN1 A;  1MND A;  3BFM A;  3QJY A;  4CI0 C;  2J06 A;  1D1B A;  1D3B A;  2WAC A;  2RJC A;  5AYF A;  1WNL A;  2EQM A;  3M4G A;  2HBP A;  4M77 D;  4PLI A;  2L3R A;  2DNU A;  1YIT T;  3G71 Q;  3DB4 A;  4RTY A;  2RQV A;  1FX7 A;  2J05 A;  4BI4 A;  2CZ0 B;  1KG1 A;  4DBR A;  3JCM P;  2LT4 A;  3N5B B;  1UGR B;  2X35 A;  3CCR Q;  5CKB A;  5KYU B;  1I0C A;  3FC3 A;  2FZG B;  3M9Q A;  1VQN Q;  1GBQ A;  1QMC A;  3H8Z A;  2P0P A;  1SRM A;  4C8Q G;  1YNZ A;  4C5E A;  5FU7 B;  3PIP A;  2CYZ B;  3M59 A;  3OMC A;  1VQ5 Q;  2LNH B;  1HJD A;  1Q82 U;  1ZSG A;  2Y4X A;  3NGP A;  4C8Q E;  1CKA A;  2JTF A;  2K3X A;  3JSC A;  2ZAE A;  4QQ6 A;  1YJ9 Q;  3A8M B;  3CMA T;  3HPW A;  4FYW B;  1LNX A;  5GAM h;  1JJ2 A;  3ZFJ A;  1K8A U;  2DL3 A;  1ZUK A;  1WDX A;  1XTD A;  4X34 A;  1N9R A;  2OTJ A;  5HK3 A;  2VUB A;  1M5Q 1;  5A0G A;  2ZPH B;  3CPW S;  3OYG A;  1NLP C;  4J9G A;  1WYX A;  2FPD A;  1GCQ C;  3G71 T;  1JXO A;  3ASK A;  2KAF A;  4OF1 A;  2NUP A;  1YIJ A;  2ZCF B;  1K0S A;  1R0C B;  2MOX A;  1X43 A;  1YJN A;  1JU5 C;  1X6B A;  5CQX A;  4B9W A;  4R55 A;  4Q5W A;  2VV5 A;  1SRL A;  3H41 A;  1IHV A;  2RPN A;  1IZ6 A;  3M58 A;  4AT1 B;  2QAS A;  2O9S A;  3EFR A;  3A5Z B;  3INZ A;  1MMG A;  3RR6 A;  1M27 C;  4OML A;  1Q86 R;  2V8J A;  5GAN 5;  3ZBD A;  4MML A;  5KCO A;  1NG2 A;  3MP8 A;  2M02 A;  4LDU A;  2LZ6 B;  1AEY A;  2YRC A;  4PJN A;  2BTT A;  2DZ9 A;  1N8R U;  4LN2 A;  4LDW A;  2GQV A;  2DJZ A;  2DL5 A;  3SHW A;  2FPE A;  1QP3 A;  2G6F X;  1WI7 A;  4J6Y A;  2KYM A;  2K9G A;  1YIT A;  1KFZ A;  1LCK A;  2DAQ A;  2QGF B;  4M77 C;  4PNO A;  1KSW A;  3CQT A;  1QVG P;  2XD0 A;  3U23 A;  2AZV A;  1WFW A;  1JXM A;  1IHW A;  5KYX A;  4MDX A;  1GFC A;  2BIV A;  2YXY A;  4FSX A;  4EMK C;  2XMF A;  3VS0 A;  4M7A F;  3LX7 A;  1BIA A;  4Z89 A;  3VS7 A;  2V26 A;  5FWC A;  1M1K R;  2RHI A;  1LJO A;  1O75 A;  3D7S B;  1X6O A;  4XU1 A;  2ZPB B;  1B3Q A;  4J6W A;  3H0H A;  5AT1 B;  1KC8 U;  1I8F A;  3VS2 A;  3CCQ T;  3VS4 A;  3QYH B;  2EKO A;  3G4S T;  4PJM A;  4BAC A;  5J3B A;  1WQ7 A;  1Y57 A;  2L3S A;  2M1H A;  3OYY A;  1I5L A;  1BI0 A;  1S1N A;  2L0A A;  4MMK A;  1J3T A;  5LL6 S;  3TSZ A;  4M75 D;  2FEI A;  3EHQ A;  2KNB B;  2LT1 A;  2AZS A;  2GTO A;  4NL2 A;  3L2W A;  3M0T A;  2E5K A;  2GTJ A;  4C0F A;  3RER A;  1VQP A;  2GFU A;  1K1Z A;  2AKL A;  2J6K A;  1EX4 A;  8ATC B;  1M8V A;  4QT7 A;  5CAI A;  3CCV Q;  1KD1 C;  3OYD A;  4GLM A;  2DJQ A;  2WSF E;  3MJX A;  3HRT A;  5I22 A;  2DD4 A;  3FJP A;  1H64 1;  1V29 B;  2QQ9 A;  4UC4 A;  1YCS B;  2GCX A;  4N0A C;  2CP0 A;  4J9F A;  4ZGE B;  1BB9 A;  3BDL A;  1UGQ B;  1U8R A;  1PWT A;  3KBG A;  1SF9 A;  2E4H A;  5GAN 7;  1UHF A;  3H9N A;  3QZ5 B;  5FU7 C;  4PJO E;  5KH6 A;  2AHJ B;  3OS2 A;  1HSQ A;  1MV0 B;  4M7D C;  1D0Y A;  1KJW A;  4BY6 C;  2KE9 A;  2YT6 A;  1VQ6 T;  1G3S A;  2A28 A;  2YUN A;  1BI2 A;  2CT3 A;  1OX8 A;  3JCM f;  3EGD B;  2DO3 A;  2FB7 A;  1WPY A;  2FZC B;  2X4X A;  3CBP A;  3P8H A;  5IXB A;  1YJ9 A;  4IIO A;  2PUO B;  3FB9 A;  1ZSZ A;  3QO3 A;  1MUZ A;  3OQ5 A;  4IUU A;  1ZBJ A;  1N5Z A;  2EQU A;  2O31 A;  2SEM A;  4PFO A;  4PJO B;  4FCY A;  1SPK A;  3QDF A;  4DEY A;  1I5O B;  5LJ3 j;  4QQG A;  4M78 C;  3OYC A;  5GAN h;  2VAS A;  4KH1 B;  1N27 A;  2AT1 B;  3OYK A;  2GGR A;  2PQW A;  4M78 F;  4XK8 E;  3E9F A;  1YCY A;  2YRV A;  2F5K A;  3HSB A;  2JW4 A;  5FRN A;  1M3C A;  1M9S A;  4M77 B;  4NS5 A;  3QXE B;  2ESW A;  4FT2 A;  3M0P A;  1QVG A;  3G1J A;  2DIL A;  2GBQ A;  5GAO l;  2HEQ A;  1P92 A;  3JCM J;  2OTJ Q;  8AT1 B;  1NJI R;  3MCA B;  4HCK A;  2V1R A;  3L2U A;  3QPH A;  3TU4 K;  3SD4 A;  2COW A;  2XIC A;  2ZGW A;  3DKM A;  3TEE A;  5GAM g;  4F7U G;  1QLY A;  3OS5 A;  3H0I A;  3RNJ A;  3L42 A;  2XDD A;  1WHG A;  2CT4 A;  2QYZ A;  2QEX T;  4PFP A;  1VQP T;  1UUE A;  3GP8 A;  3CCL Q;  3JCM X;  1SHG A;  4E47 A;  2E3I A;  2M51 A;  1K8A R;  5KYN A;  4DOW A;  4HXJ A;  4E7J A;  2EYX A;  3GPL A;  2A36 A;  4C92 C;  4M7A C;  1M90 C;  2LQW A;  4P5N A;  1RAE B;  1A0N B;  4PL6 A;  2LX7 A;  2CGH A;  3L1A A;  2OTJ T;  3CC7 T;  3T9N A;  4CRI A;  4DBQ A;  2EYQ A;  4KGX B;  1UEC A;  4KRT A;  5LJ5 g;  5GAN j;  2HBW A;  2DL4 A;  3JB9 H;  4O5V A;  3FDR A;  1M3A A;  3CCU T;  3EFO B;  1M4Z A;  1W2B A;  4E6R A;  1VQ9 Q;  2YUP A;  1VIE A;  2JXB A;  3JAM E;  3G4S Q;  1ZA1 B;  1HXD A;  3OYN A;  2DET A;  2Z0W A;  2HL3 A;  1I4K 1;  3LW5 E;  1VQK Q;  1YJ9 T;  1PD1 A;  4BY6 B;  2XKO C;  1AD5 A;  4M7D B;  3QG1 A;  3QII A;  1YHQ A;  4QVC A;  1T0J A;  3UA7 A;  1BK2 A;  5GAO r;  5LJ3 g;  1VQL T;  4E2F B;  1H8K A;  1AOJ A;  3I5S A;  1K73 U;  2RK2 A;  4ESR A;  4E7K A;  1QQJ A;  2MYS A;  5CCA A;  2DPP B;  5A2Q E;  3OW2 P;  2QXF A;  3KFV A;  1YI2 Q;  3G7Z A;  3MEU A;  1EIF A;  1ZA2 B;  3MP1 A;  3QKJ A;  2LTO A;  2ED0 A;  4LDY A;  2KRS A;  4OB0 B;  4IIM A;  1UFF A;  1VQM Q;  3EGU A;  2EYZ A;  1VQ9 T;  4RMO A;  1GRI A;  2VXE A;  3CCS Q;  1QCN A;  2WSE E;  1ABO A;  1BU1 A;  4M7A B;  1VQ7 Q;  3EG9 A;  1KHC A;  1JJ2 P;  3M0R A;  5KYW A;  1QVF P;  2KT8 A;  3JB9 F;  3C94 A;  4JLG A;  2BE7 D;  2VKN A;  2LP5 A;  3M54 A;  1FMV A;  5D7U A;  4J9B A;  4F14 A;  2ZPG B;  5HKC A;  2OTL Q;  2IVW A;  2OAU A;  4BI8 B;  1OEB A;  2F2W A;  2RQW A;  2DBM A;  1X01 A;  4N4I A;  1K73 C;  2RB6 A;  2E10 A;  3GNG A;  4YTL A;  3I55 A;  3RKX A;  1Q95 G;  1ZUY A;  5LJ5 d;  2M16 A;  3LGF A;  4DA4 A;  2QDL A;  4Y91 A;  1YI2 T;  3ER0 A;  4RTT A;  4N4H A;  3OBW A;  2RO0 A;  1NBE B;  2D1X A;  4HKE A;  3SB2 A;  3EGD A;  3CC2 T;  5ECA A;  3CCQ Q;  3SWN A;  1VOM A;  1W2B P;  2LQN A;  2X3W D;  3CC7 A;  1H3Z A;  2EAY A;  3JCM d;  1AHJ B;  2DVE A;  4GY5 A;  1U5S A;  5GAN f;  4F04 B;  3UPU A;  2KDS A;  4R0K A;  3BY7 A;  2XDP A;  5LJ5 j;  2M9U A;  3CCL A;  3EH1 A;  1CKB A;  5CK9 A;  1RAI B;  1OPK A;  2BUD A;  5GAN 2;  4C8Q C;  1VQO Q;  3HL8 A;  5GJV B;  1YHQ T;  2P4T A;  2XID A;  5L23 A;  4AG2 C;  1WXT A;  5GMK j;  1JBM A;  1PKT A;  2JTM A;  4V2S A;  4M78 B;  1G5V A;  3G4S A;  2M0Y A;  1E6G A;  3SEM A;  4J83 A;  1N9S A;  4KUI A;  2JNG A;  4AFS C;  3JB9 I;  2R5M A;  2X4W A;  1AWX A;  1SKU B;  1PRM C;  1K73 R;  3JCM V;  1Y7X A;  1YN8 A;  2HDA A;  2K4Y A;  1VQ9 A;  5GMK m;  2EJ9 A;  2DBK A;  3V8K A;  3BDU A;  3CC2 Q;  1TUC A;  5FRM A;  1QW1 A;  1KQS P;  2H3E B;  1G3Y A;  3QYG B;  4OGC A;  3CC7 Q;  1Q7Y C;  3QWY A;  1E7O A;  4FYV B;  4C92 A;  1MV3 A;  1T3S A;  4KUL A;  2C0I A;  4OB1 B;  1WX6 A;  5HY6 A;  1VQ4 T;  4DBF A;  5C0M A;  2LX9 A;  3REB B;  3I56 T;  3JB9 D;  5FW9 A;  2KK4 A;  3OBY A;  3M5A A;  2B8A A;  1Y0M A;  1VQO T;  2ROT A;  4M7D E;  4C5G A;  4LXC A;  2LJ1 A;  2NUT B;  1BI1 A;  2B86 A;  2IG0 A;  2F2V A;  4M75 F;  3GIB A;  5CKF A;  2E3H A;  2RI2 A;  5J39 A;  2EJF A;  2XK0 A;  4WF2 A;  2EIF A;  4EMH A;  4XAX B;  2CRE A;  2K79 A;  1T3L A;  5GAO q;  1Q82 C;  3E1S A;  5FRO A;  3V7C A;  3J81 E;  4C92 F;  1QVP A;  5GAN d;  3KXT A;  3CCM T;  1M1G A;  2HQH A;  2P0Q A;  1WZO A;  1Q82 R;  1W1F A;  3DLL A;  2BE9 B;  4C5H A;  5GMK h;  5FU6 B;  4A63 B;  1Q81 R;  1VQN A;  1QWF A;  2KQW A;  3ME9 A;  3OSV A;  3S3N A;  2KRN A;  3IQL A;  3M4Y A;  1X69 A;  2HL5 C;  1ABQ A;  2DK3 A;  1RI0 A;  2ABL A;  4M78 G;  4PJO F;  4CC7 A;  2QEX Q;  1M90 U;  4F16 A;  2YLB A;  1IRX A;  1H3H A;  1VIF A;  3EFS A;  2DL7 A;  4RG2 A;  1UGV A;  4M75 B;  4DBH A;  4LNP A;  3REA B;  5FLX E;  3P8B B;  4QVD A;  3VUZ A;  2VXF A;  4HCC A;  3JCM c;  3PFS A;  2KR3 A;  3RDV A;  5M9O A;  2ECZ A;  4JRI A;  3EG9 B;  2KVQ G;  2MMP A;  3JCM b;  3PGG A;  5KCH A;  4ZGD B;  4WTO B;  2YHT A;  4Y92 A;  4A54 A;  1MMA A;  2L3Q A;  3CPW P;  2EQK A;  2HZY A;  3CCJ T;  2J7I A;  2LCC A;  3EG0 A;  2BKD N;  1TOV A;  1IB8 A;  2E1H A;  2L2P A;  4M7D F;  1FMW A;  4M7A D;  1GFD A;  4PFZ A;  4BE0 A;  3SWN B;  2SRC A;  4GLK A;  2FRY A;  1YHQ Q;  5GAM d;  1Q7Y R;  2JZ2 A;  4EPC A;  4QVZ A;  1XJW B;  2E41 A;  2OAW A;  4RUG A;  5I2S A;  1YJW A;  1S72 A;  2XDB A;  1UJY A;  1BBZ A;  1EZZ B;  1WJQ A;  1TS9 A;  3UA6 A;  3NTH A;  2KXD A;  1XOV A;  4D6W A;  4EIK A;  4ORZ A;  4M7A E;  1UG1 A;  1RLQ C;  2J6O A;  1X75 C;  1WHJ A;  2FYK A;  3X25 B;  2VVK A;  4J8O A;  2ATC B;  2K5I A;  1AWW A;  1OU9 A;  4OMP A;  1I1J A;  2JVV A;  4WCI A;  2ENM A;  1GL5 A;  3NMZ C;  2DFU A;  4HA8 A;  4A4E A;  2RN8 A;  1VQN T;  4LD9 K;  1ARK A;  2F69 A;  1G8X A;  1I81 A;  4Z88 A;  2D8H A;  3AT1 B;  4LUD A;  4E7L A;  3R6N A;  1VQL A;  3E19 A;  3CCS T;  2FPF A;  4JS4 A;  2DXT A;  1WJS A;  1JRI A;  2KSS A;  1UJ0 A;  2G3R A;  2J6F A;  3EAE A;  1OQK A;  2QA4 A;  3G6E T;  2E6N A;  1JB0 E;  1D09 B;  1K4U S;  1BI3 A;  1OPL A;  1RLP C;  3GBQ A;  3QUI A;  2EGA A;  3OB9 A;  1D1C A;  3LWI A;  3V7R A;  2DTO A;  1FXX A;  3L2Q A;  3OW2 A;  4J9I A;  3PMT A;  4VUB A;  2LCS A;  2MCN A;  2W0Z A;  4OMM A;  5C6S A;  1QKX A;  4HT9 A;  2VYT A;  4XTU A;  5GMK i;  2NUT A;  3A8H B;  3OA6 A;  5IHI A;  3CCL T;  3X26 B;  1YJN Q;  3URG A;  1D1A A;  1UB4 A;  1SG5 A;  1ZLM A;  3OYE A;  3CCJ A;  4AFZ C;  4M77 A;  1PG5 B;  2V8K A;  1PHT A;  2OTL A;  1PSE A;  2YUQ A;  2JMC A;  3ZL7 C;  3OYF A;  2RHX A;  4LE9 A;  4ANJ A;  4ZN1 A;  1IGQ A;  2MF2 A;  2I0N A;  5IT9 E;  4C8Q F;  2DM1 A;  2CZ6 B;  2IPO B;  4XTX A;  3VV0 A;  2VGM A;  2MAM A;  4X1V A;  2PNI A;  5KE3 A;  4OMQ A;  1GCP A;  2O4X A;  5I2M A;  1VQK A;  2K5F A;  1OV3 A;  1GBR A;  3VJP A;  2VC8 A;  1KQS S;  3A8O B;  2MPX C;  3EG2 A;  5KYU A;  1RAA B;  2LJ0 A;  2QQR A;  4ME7 A;  3FRN A;  1AWO A;  4HVV A;  2PVO B;  3G6E Q;  2EW3 A;  3G71 A;  2DZC A;  3C12 A;  4AMC A;  2ZPI B;  4MZP A;  3CCR T;  3CCE A;  2RQR A;  1FMK A;  4II1 A;  1MMN A;  2CS7 A;  2W10 A;  2RQU A;  1KC8 R;  5I11 A;  3FJ5 A;  2JN0 A;  4BB7 A;  2HQX A;  3JCM g;  2K2V A;  4CC2 A;  1QCF A;  2K57 A;  5GAM f;  1YJN T;  1AZE A;  1M1F A;  2DIG A;  3OY9 A;  1ZSZ C;  1ZHI A;  1WLP B;  1TUG B;  3UT1 A;  4RTZ A;  3HRU A;  1M3B A;  2RNA A;  1NEG A;  2HD0 A;  1Y71 A;  1QCO A;  2K3B A;  2YWW A;  1TTH B;  2OX7 A;  2FRW A;  4M7D A;  3MO8 A;  1U1T A;  1K9M R;  2DER A;  3NPF A;  4IUT A;  3HP9 A;  4R56 A;  4FIB A;  2JTE A;  5LJ3 d;  2EFI A;  4JPB W;  4L59 A;  2FO0 A;  3L2Z A;  2YSQ A;  2LVM A;  1E6H A;  1K8A C;  2BZY A;  2KEA A;  1H92 A;  3O5Z A;  1ZQ1 A;  3J80 E;  4BE1 A;  1BYM A;  1M90 R;  1IRE B;  4MDW A;  2DLP A;  1PRL C;  1NPR A;  3I5R A;  3EH2 A;  2HNI A;  4C0Z A;  4ZN3 A;  2EWN A;  3I56 A;  2Y4Y A;  1D0Z A;  1IGU A;  2ED1 A;  2O4X B;  1BCO A;  3V7S A;  2QA4 Q;  4JRQ A;  2DRM A;  2VGN A;  4RTU A;  4M4Z A;  5DM7 R;  1GXI E;  2NUP B;  2K7A A;  4M7D G;  1NJI C;  1C0M A;  2RF0 A;  3MHX A;  2X9H A;  1B34 B;  4RTX A;  3S6W A;  1PCX A;  3PE0 A;  1DJ7 B;  2JM9 A;  3BW1 A;  4M7A A;  2QTX A;  4J7F A;  5GJW B;  4EMK B;  2FHD A;  2QI2 A;  3OYB A;  1LPL A;  4D8D A;  1VQK T;  3VRZ A;  4PJJ A;  3EG3 A;  4ZTJ A;  5KE2 A;  1KQ2 A;  1M2V B;  2NYS A;  2H3J A;  1QKW A;  2KXC A;  1SSH A;  4C92 E;  1K9M C;  4XQ3 A;  5KYW B;  2DE0 X;  4LDX A;  2QTV A;  3O8V A;  1LOJ A;  3NTI A;  4KGZ B;  2KRO A;  3X24 B;  3OW2 S;  3OYH A;  1MHN A;  1NJI U;  3LYI A;  4E7Z A;  1TG0 A;  5DLQ E;  2AK5 A;  2JUF A;  4IUR A;  4M75 E;  2JT4 A;  1UHC A;  1X2K A;  2C06 A;  2YUO A;  4OB3 B;  2JM8 A;  4HCB A;  3QSU A;  2FL7 A;  1JQQ A;  3L2R A;  3I56 Q;  4OB2 B;  2BZ8 A;  3A8G B;  2COZ A;  2M0O A;  4EMG A;  3DB3 A;  4JS5 A;  4ELZ C;  5LJ5 h;  3QBY A;  2CP3 A;  3CXC S;  5HK0 A;  1W6X A;  1S72 Q;  3JCM W;  2MWP A;  1HK9 A;  1AZG B;  1VQ6 A;  1NM7 A;  5CR2 A;  2HMA A;  1X2Q A;  5DLO A;  3EG1 A;  2D6F A;  3VUB A;  1OX9 A;  5GAO m;  3CXC P;  2OJ2 A;  3CCE Q;  2NUZ A;  3LH5 A;  3CD6 A;  2DRK A;  1VQ7 A;  2P0K A;  2P4R A;  3C95 A;  1K9M U;  4DEX A;  1ZBX A;  1RUW A;  2HQE A;  2HCK A;  3HFO A;  2DEU A;  4PJO D;  2H8H A;  1YIJ Q;  1W4S A;  2DX1 A;  4A4F A;  4BI3 A;  1WIE A;  1UGP B;  2C0T A;  1NLO C;  3A1P A;  1SEM A;  3G6E A;  3LGL A;  1M1K C;  3JV3 A;  4RCC A;  2DIQ A;  3CC4 T;  4EMK A;  3R6O A;  4C92 B;  1VA7 A;  2DXB A;  4JZ4 A;  3LWH A;  4A53 A;  1YJW Q;  3VU3 C;  2PZ1 A;  2DA9 A;  1M2V A;  1YWP A;  4M78 A;  4J5Y A;  1VQ8 A;  5LJ3 e;  2L5Q A;  2L3P A;  3MET A;  4A4G A;  1G83 A;  1RAF B;  5I21 A;  4C92 D;  3NTK A;  3FEO A;  2E6Z A;  2CUD A;  4JJB A;  2DVJ A;  3THK A;  2ZPE B;  5A0L A;  3E9G A;  3RMS A;  1XNI A;  4NOY A;  2X51 A;  4O6J A;  2L8D A;  3FIF A;  1NYG A;  1N8R C;  1KK7 A;  2RK1 A;  4XTY A;  4MZM A;  2DXU A;  3RUX A;  4AFQ C;  1N8R R;  2EYY A;  4M77 F;  5GAN g;  4B6M A;  3DLM A;  2XHC A;  3CCS A;  5KYY A;  5GAM j;  2CZ1 B;  3PVL A;  1VQM T;  1NPP A;  2GF7 A;  4KBM B;  3RMQ A;  2XU8 A;  1U3O A;  2CDT A;  3H6Z A;  4FT4 A;  2QA4 T;  3OS1 A;  3Q1J A;  4J6X A;  5CVI A;  3QWX X;  4C8Q A;  1UEB A;  1D3B B;  3CC4 Q;  4X9D A;  2L89 A;  3OYM A;  2K6D A;  1M2O A;  2NLU A;  4XU2 A;  3VKI A;  2XI9 A;  3J7A F;  5GMK l;  1M8M A;  1VQ5 T;  1ACM B;  4RCB A;  3AHU A;  4PJL A;  2EJG A;  3HKS A;  1M1K U;  3I35 A;  3SDZ A;  2MK5 A;  3CXC A;  2DXC A;  3WVD B;  2KI7 A;  1UE9 A;  4IUP A;  5GAO p;  2KT1 A;  3JCM h;  3CCU A;  3HFN A;  3PNW C;  3CCR A;  4KT0 E;  1HYO A;  2RI5 A;  3TSW A;  4B9X A;  2CSQ A;  3H0F A;  2O9V A;  3VYH B;  1U1S A;  1VUB A;  4XTV A;  5EC7 A;  2RA2 A;  3CCV T;  2PTK A;  3CD6 T;  1WA7 A;  1VQ7 T;  3UF4 A;  4C5I A;  2OTL T;  3C0C A;  2MWO A;  2GNC A;  3PIO A;  2HSP A;  2QK0 A;  3QZ9 B;  2DF6 A;  1AT1 B;  1G3W A;  5GAN 8;  1PSF A;  2GQI A;  2X3X D;  2RJE A;  1KQS A;  4N0A A;  4HVU A;  3M0Q A;  1OZ2 A;  1RL2 A;  3M57 A;  1VQ4 Q;  4L5G A;  2AKK A;  1BIB A;  3OS0 A;  2JOY A;  4CC3 A;  2HAX A;  2V8I A;  5CKE A;  1MGQ A;  4TVR A;  2LQK A;  2QG9 B;  3UWN A;  4NL3 A;  1PD0 A;  3GOX A;  2E65 A;  3CBM A;  4DOV A;  1NEB A;  2D0Q B;  1WJR A;  3RES A;  3CD6 Q;  2EKH A;  1Q86 C;  3CCE T;  2CP6 A;  1UGS B;  2CP7 A;  2V1Q A;  3JCM Q;  5IAY A;  2QEX A;  2A0F B;  2GFA A;  3OYL A;  1Y07 A;  3GF5 A;  2JJ9 A;  4IUV A;  3CCM Q;  5IH2 A;  3CME T;  1O9S A;  1SSF A;  3LLR A;  1FWZ A;  3I55 T;  4Y28 E;  2QGG A;  3BE3 A;  3HRS A;  5DY9 A;  4M77 G;  4M75 C;  2KRM A;  2EGE A;  1JEG A;  2EQJ A;  1B7T A;  1SHF A;  1VQ6 Q;  1YP5 A;  3M53 A;  2A7Y A;  1YIT Q;  1QVG S;  1FYN A;  3PTA A;  2E12 A;  1T0H A;  2F1L A;  4ZGJ B;  3MEV A;  4J9C A;  1VYU A;  5IHN A;  2KGT A;  2DD5 A;  3CMA Q;  1VQP Q;  2D9T A;  3KUF A;  3PMI A;  4E7I A;  1X27 A;  5GAN 3;  3L2V A;  1WHH A;  4FW2 A;  5LJ5 f;  2JS0 A;  4IUQ A;  1B07 A;  3X20 B;  2Y90 A;  3LH0 A;  2VB6 A;  4JJN K;  4M7D D;  4LUE A;  1KD1 U;  4ELY C;  2LQ8 A;  1OU8 A;  2QQA A;  2RQT A;  4EDU A;  1W2B S;  2LCL A;  1ZUU A;  1PKS A;  2DMO A;  3ZEH A;  4LDV A;  3GLX A;  4Z8A A;  3VS3 A;  2EQI A;  1Z9Z A;  4LD6 A;  3VRY A;  1V76 A;  4HT8 A;  3CPW A;  3C4S A;  2DTH A;  7AT1 B;  1OZ3 A;  1K9A A;  4M78 E;  1KHI A;  2A08 A;  3MEA A;  5A0D A;  2YRD A;  3ULR B;  2PVG B;  1TSF A;  2QDY B;  3E2U A;  1TUD A;  3CME Q;  3TRE A;  2P84 A;  5KYY B;  4FM4 B;  4JDS A;  4XU0 A;  3UDC A;  2ZPF B;  3JRZ A;  2RJF A;  3MP6 A;  1N6A A;  4JZ3 A;  4F17 A;  2DEQ A;  2LC4 A;  3X28 B;  1YWO A;  1YFN A;  4BDY A;  1R77 A;  1RAD B;  2R57 A;  4F7U B;  5FWB A;  5IHK A;  4D8K A;  2F2X A;  1VQ4 A;  1BCM A;  1JJ2 S;  4PJO C;  1QP2 A;  2JS2 A;  1PC0 A;  4F7U E;  3FLG A;  1RAB B;  4XTZ A;  3TVT A;  2EGC A;  3CC4 A;  5GAO n;  4C8Q B;  4E7H A;  2O2O A;  2ROL A;  1WXU A;  1VYT A;  2EPD A;  5J26 A;  5CIU A;  3V8L A;  5GAM e;  1VQL Q;  2HKN A;  4C8Q D;  5GAN 6;  4L6V 5;  1WGS A;  4PLL A;  1WQW A;  4JRK A;  3QJ6 A;  2YDL A;  1YI2 A;  1YBY A;  2LDM A;  3QDR B;  4QW2 A;  2E70 A;  4A4K A;  2D8J A;  4AG1 C;  4J7I A;  2OI3 A;  4RTW A;  1OOT A;  3CC2 A;  3OSS C;  1VQ8 Q;  3CCM A;  4PJO G;  4FYX B;  3TCJ A;  1OUL A;  4QKU A;  5D6Y A;  2KBT A;  1NZ9 A;  3S3O A;  1Q7Y U;  2R58 A;  4FYY B;  3SWN C;  1I07 A;  4J9E A;  3OYI A;  1Y96 B;  3I55 Q;  1KC8 C;  5HCK A;  2RH2 A;  1VQM A;  4M78 D;  4Z02 A;  1D0X A;  4JJC A;  2PUK B;  2KMT A;  2ZZD A;  1NYF A;  2I2L A;  1VYV A;  5LJ3 h;  9ATC B;  3V8J A;  2CP5 A;  4RTV A;  1AVZ C;  1F1B B;  2IIM A;  2CSI A;  1BKB A;  1G2B A;  2CZ7 B;  1KD1 R;  2PVD B;  3RIR A;  1VQ8 T;  1M30 A;  1ZSZ B;  4XU3 A;  3CMA A;  1CSK A;  4PJO A;  3GNF B;  4M77 E;  4PKC C;  1IO6 A;  2PU9 B;  2DTI A;  3VS5 A;  3RKY A;  2O88 A;  2HSE B;  3HHT B;  4J9D A;  3OYA A;  4K11 A;  2BZX A;  1TWB A;  3WXM B;  1KQ1 A;  1GCQ A;  4BDZ A;  1RAH B;  4JLI A;  4OMN A;  4M75 A;  4GBQ A;  3VYG A;  2LMJ A;  5D6X A;  1TU0 B;  5GMK e;  1MMD A;  3M56 A;  2CP2 A;  2R5A A;  3CEY A;  5CKH A;  3MPU B;  3MKD A;  3EGX A;  3JB9 G;  5CKD A;  1VQO A;  4C0D B;  1UDL A;  2EBP A;  2RD1 A;  5D6W A;  2RJD A;  1QVF A;  1RAC B;  4AFU C;  2LJ3 A;  3M55 A;  1S72 T;  1WHK A;  5LJ5 e;  6AT1 B;  5IXF A;  4XTW A;  1R0B G;  1C1A A;  4CC4 B;  2EVR A;  1VQ5 A;  2KY9 A;  3JB9 J;  5LJ3 f;  2AIR B;  2K5L A;  3TQ7 P;  3MEW A;  1B34 A;  2NWM A;  3A98 A;  1Y96 A;  1TH7 A;  2K2M A;  4JUV A;  2E64 A;  4ATO A;  3JCM e;  2F5T X;  4X9C A;  4HVW A;  1Q86 U;  2FVU A;  2X4J A;  4IKF A;  4OVA A;  3CCV A;  4M75 G;  2KYB A;  1G3T A;  3EFO A;  4A4H A;  2COY A;  2DL8 A;  3CME A;  5CQY A;  2FZK B;  3M0U A;  1WXB A;  1W70 A;  4JJD A;  2LRQ A;  5CO7 A;  5GAN 4;  1OI1 A;  2FG0 A;  3OMG A;  5L8R E;  4N4G A;  4E7S A;  3M0S A;  2CKK A;  2RI3 A;  2MI6 A;  4C0D C;  1KIK A;  1K0X A;  3PVQ A;  4OMF B;  1NE8 A;  4M7A G;  3CCJ Q;  2RHU A;  1UTI A;  1XQH A;  2CH4 W;  2DYB A;  4F7U A;  3CCQ A;  4FL6 A;  4RKU E;  2QQB A;  3P8D A;  2HKQ B;  1QWE A;  4QQD A;  4ZTF A;  2CH4 A;  2RHY A;  2A3L A;  2QAZ A;  3EHR A;  1OYX A;  4OP0 A;  4FU6 A;  3A8L B;  3F70 A;  1IXD A;  2K3Y A;  2JMA A;  3CBO A;  4J9H A;  1K76 A;  3EGX B;  4JRP A;  3RKW A;  4RG8 A;  2RMO A;  3VS6 A;  3HTR A;  3NHN A;  4BUG A;  4DQ2 A;  1WHL A;  4KH0 B;  4BD3 A;  4BE2 A;  1AWJ A;  1RAG B;  4KUD K;  4FSS A;  4C0G A;  4F7U F;  4HCZ A;  4MZT A;  3CCU Q;  4OMO A;  1MNE A;  2DYI A;  1Q81 U;  3RBB B;  2D0N A;  2DKG A;  1JO8 A;  1LVK A;  1RI9 A;  1C6V X;  3PT9 A;  1YJW T;  2RHZ A;  1QVF S;  5KYX B;  3I9Q A;  4KGV B;  3NFC A;  5EG2 A;  2O01 E;  1U06 A;  1PNJ A;  3S3M A;  5GAN e;  1ZX6 A;  2XG8 D;  1HD3 A;  4PK4 A;  3OYJ A;  1R8O B;  3SFM A;  2C0O A;  2A37 A;  2LNV A;  2X4Y A;  1YIJ T;  1PM3 A;  5FU6 C;  2MIO A;  2VWF A;  3CPF A;  3VS1 A;  2YLC A;  1Z9Q A;  2QQS A;  3QHS A;  1EFN A;  1X6G A;  2CUB A;  4OGE A;  1Q81 C;  1TXQ A;  3UAT A;  2RM4 A;  2WSC E;  4FW1 A;  2EYW A;  4C92 G;  1V1C A; 
#chains in the Genus database with same CATH homology
 4LE9 A;  3UA7 A;  5IH2 A;  1BK2 A;  1H8K A;  1AOJ A;  3I5S A;  4ESR A;  2I0N A;  2DM1 A;  4ZNX A;  2KRM A;  2EGE A;  1JEG A;  3KFV A;  1SHF A;  2J06 A;  4X1V A;  1YP5 A;  2PNI A;  4OMQ A;  1GCP A;  2ED0 A;  2KRS A;  4IIM A;  1FYN A;  1UFF A;  3EGU A;  1OV3 A;  1T0H A;  2EYZ A;  1GBR A;  1GRI A;  3EG2 A;  4J9C A;  1VYU A;  5IHN A;  2DNU A;  2KGT A;  2LJ0 A;  1BU1 A;  1ABO A;  4RTY A;  2RQV A;  1AWO A;  1X27 A;  4HVV A;  3M0R A;  2EW3 A;  2J05 A;  2KT8 A;  2JS0 A;  2RQR A;  1FMK A;  2W10 A;  2VKN A;  1B07 A;  2RQU A;  5I11 A;  2LP5 A;  3FJ5 A;  4J9B A;  4CC2 A;  4F14 A;  1QCF A;  4LUE A;  1AZE A;  1I0C A;  1OEB A;  2RQT A;  1WLP B;  1ZUU A;  1GBQ A;  2F2W A;  1PKS A;  2RQW A;  2DBM A;  2DMO A;  4Z8A A;  3VS3 A;  1SRM A;  2EQI A;  4RTZ A;  1YNZ A;  1Z9Z A;  1M3B A;  2RNA A;  3VRY A;  1NEG A;  2LNH B;  1HJD A;  2K3B A;  1ZSG A;  3NGP A;  1ZUY A;  1CKA A;  2FRW A;  1K9A A;  2QDL A;  2A08 A;  3NPF A;  4RTT A;  3ULR B;  2JTE A;  2D1X A;  4JPB W;  2FO0 A;  2DL3 A;  2YSQ A;  1ZUK A;  1TUD A;  1WDX A;  5ECA A;  1E6H A;  2BZY A;  2LQN A;  2X3W D;  2KEA A;  4JZ3 A;  4F17 A;  1H92 A;  3O5Z A;  1NLP C;  1YWO A;  4J9G A;  1WYX A;  2FPD A;  1U5S A;  1GCQ C;  1JXO A;  4R0K A;  2DLP A;  5FWB A;  1PRL C;  5IHK A;  3I5R A;  4D8K A;  1K0S A;  2MOX A;  2F2X A;  1X43 A;  1JU5 C;  1X6B A;  1CKB A;  1SRL A;  3H41 A;  2JS2 A;  2RPN A;  1OPK A;  3TVT A;  2ED1 A;  2EGC A;  2O9S A;  5GJV B;  2O2O A;  2ROL A;  1WXU A;  1VYT A;  2EPD A;  2DRM A;  4RTU A;  5L23 A;  4M4Z A;  4AG2 C;  1WXT A;  2K7A A;  1M27 C;  4OML A;  1PKT A;  2RF0 A;  2M0Y A;  1E6G A;  3PE0 A;  4RTX A;  3SEM A;  2JM9 A;  1NG2 A;  2YDL A;  4AFS C;  2LZ6 B;  1AEY A;  5GJW B;  2BTT A;  2D8J A;  4AG1 C;  4D8D A;  1AWX A;  2OI3 A;  4LN2 A;  4RTW A;  1OOT A;  1PRM C;  3VRZ A;  2DL5 A;  3SHW A;  2FPE A;  1YN8 A;  2HDA A;  2G6F X;  3EG3 A;  1WI7 A;  2DBK A;  2KBT A;  2K9G A;  2KYM A;  1KFZ A;  1TUC A;  1LCK A;  1QKW A;  1KSW A;  2KXC A;  1SSH A;  1I07 A;  3CQT A;  4J9E A;  3QWY A;  3U23 A;  1E7O A;  2DE0 X;  2AZV A;  1WFW A;  5HCK A;  1MV3 A;  1JXM A;  1T3S A;  2C0I A;  1WX6 A;  2KRO A;  1GFC A;  1TG0 A;  2XMF A;  2AK5 A;  3VS0 A;  3REB B;  5FW9 A;  4JJC A;  3VS7 A;  2JT4 A;  1UHC A;  5FWC A;  4Z89 A;  1X2K A;  2YUO A;  1Y0M A;  2ROT A;  2JM8 A;  1NYF A;  1B3Q A;  1JQQ A;  1VYV A;  2LJ1 A;  3H0H A;  2BZ8 A;  4RTV A;  1AVZ C;  3VS2 A;  2B86 A;  2F2V A;  2IIM A;  2CSI A;  3VS4 A;  1G2B A;  1M30 A;  2L3S A;  1Y57 A;  1W6X A;  1S1N A;  2L0A A;  1J3T A;  1CSK A;  2CRE A;  2K79 A;  1AZG B;  1T3L A;  1NM7 A;  3TSZ A;  2FEI A;  1X2Q A;  3EHQ A;  3EG1 A;  1IO6 A;  2KNB B;  3VS5 A;  2AZS A;  2GTO A;  2O88 A;  3M0T A;  1W1F A;  2OJ2 A;  2E5K A;  2GTJ A;  2NUZ A;  4J9D A;  4A63 B;  3LH5 A;  4K11 A;  2DRK A;  2BZX A;  1K1Z A;  2P4R A;  2AKL A;  2J6K A;  1GCQ A;  1QWF A;  4QT7 A;  4DEX A;  1RUW A;  2HCK A;  4OMN A;  2KRN A;  3IQL A;  4GBQ A;  4GLM A;  1X69 A;  2DJQ A;  2H8H A;  2LMJ A;  5I22 A;  1ABQ A;  2DX1 A;  1WIE A;  2C0T A;  1NLO C;  1YCS B;  1SEM A;  2ABL A;  3JV3 A;  4CC7 A;  1UDL A;  4J9F A;  2EBP A;  4F16 A;  1BB9 A;  4AFU C;  1H3H A;  2LJ3 A;  1VA7 A;  1PWT A;  2DL7 A;  1UGV A;  1UHF A;  4JZ4 A;  5IXF A;  4LNP A;  3REA B;  4CC4 B;  2EVR A;  2PZ1 A;  2DA9 A;  1YWP A;  2KR3 A;  2L3P A;  2NWM A;  1HSQ A;  1G83 A;  1MV0 B;  1KJW A;  2ECZ A;  3A98 A;  2KE9 A;  2K2M A;  2YT6 A;  2A28 A;  2YUN A;  2CT3 A;  2CUD A;  4JJB A;  2DVJ A;  3THK A;  4HVW A;  4Y92 A;  2L3Q A;  5IXB A;  4IIO A;  1NYG A;  2J7I A;  1MUZ A;  3EG0 A;  1ZBJ A;  1N5Z A;  2KYB A;  2O31 A;  2SEM A;  1SPK A;  2DL8 A;  4DEY A;  4AFQ C;  2EYY A;  2L2P A;  3M0U A;  1WXB A;  2GGR A;  1GFD A;  1W70 A;  4JJD A;  3PVL A;  2FG0 A;  2JW4 A;  1U3O A;  2SRC A;  1M3C A;  2CDT A;  2FRY A;  3M0S A;  2ESW A;  3M0P A;  3QWX X;  1KIK A;  2OAW A;  4RUG A;  1K0X A;  3PVQ A;  2DIL A;  1UJY A;  1BBZ A;  2K6D A;  2GBQ A;  1UTI A;  2HEQ A;  2CH4 W;  3UA6 A;  1M8M A;  2KXD A;  2DYB A;  1XOV A;  4EIK A;  4ORZ A;  1QWE A;  1RLQ C;  1UG1 A;  3I35 A;  2J6O A;  4HCK A;  2V1R A;  1UE9 A;  2VVK A;  2KT1 A;  2CH4 A;  1AWW A;  3EHR A;  1QLY A;  4OMP A;  3TSW A;  1I1J A;  2CSQ A;  3H0I A;  4WCI A;  2JMA A;  3RNJ A;  2ENM A;  1GL5 A;  3H0F A;  2O9V A;  3NMZ C;  4J9H A;  1K76 A;  2CT4 A;  2RN8 A;  5EC7 A;  2PTK A;  1WA7 A;  2RMO A;  3VS6 A;  3UF4 A;  1ARK A;  1UUE A;  3NHN A;  4Z88 A;  3C0C A;  2GNC A;  2D8H A;  4LUD A;  1SHG A;  2HSP A;  3R6N A;  2M51 A;  1AWJ A;  2DF6 A;  2FPF A;  4FSS A;  1UJ0 A;  2J6F A;  4OMO A;  4HXJ A;  2GQI A;  2X3X D;  2EYX A;  3RBB B;  2D0N A;  2A36 A;  4HVU A;  1JO8 A;  2LQW A;  3M0Q A;  1RI9 A;  1K4U S;  1OPL A;  1A0N B;  1RLP C;  3GBQ A;  2LX7 A;  2EGA A;  2AKK A;  3I9Q A;  4CC3 A;  4J9I A;  1U06 A;  1PNJ A;  2LCS A;  1ZX6 A;  1UEC A;  2W0Z A;  2MCN A;  1HD3 A;  4KRT A;  1NEB A;  2HBW A;  2DL4 A;  4OMM A;  1QKX A;  1M3A A;  2EKH A;  4E6R A;  2C0O A;  2A37 A;  2YUP A;  2MIO A;  2JXB A;  2VWF A;  5IHI A;  3VS1 A;  1Z9Q A;  2V1Q A;  1EFN A;  1ZLM A;  1X6G A;  2CUB A;  1AD5 A;  4AFZ C;  3UAT A;  2EYW A;  1PHT A;  2YUQ A;  2JMC A;  3ZL7 C;  1V1C A;  1T0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...