4Z89A

Sh3-ii of drosophila rim-binding protein bound to a cacophony derived peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIM-binding protein, isoform F
publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rim-binding protein
total genus 15
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z89A00
2YUPA 2KNBB 3REAB 4F14A 1YN8A 2ED0A 3I5SA 1PKSA 1X2QA 2JS0A 2E5KA 2KR3A 4J9FA 2G6FX 1HD3A 2LP5A 2O9SA 2MCNA 2J05A 2RQWA 1WXTA 1YP5A 1CKBA 2YUNA 1YNZA 1M27C 2KGTA 5IH2A 1OV3A 2KT8A 3UA7A 2JM9A 4CC3A 1RI9A 2KROA 2O9VA 1JU5C 2EGAA 1VA7A 2D8HA 1UUEA 1QLYA 2GTJA 2ABLA 1NEBA 3M0SA 3IQLA 2SRCA 2A36A 1G83A 5HCKA 2LJ0A 2VWFA 3EG1A 2KT1A 4HVUA 2M51A 3SHWA 3TVTA 1H3HA 1PNJA 1YWPA 2DLPA 1M30A 1T0HA 2F2WA 1OOTA 2DVJA 4HVWA 1GCPA 1H92A 2GQIA 4ESRA 4EIKA 2PNIA 3R6NA 1PKTA 3O5ZA 1AWXA 4J9EA 3EHRA 4LUDA 4Z88A 1UGVA 2LQWA 2JXBA 1NYFA 3VS2A 1PRMC 3PE0A 3RBBB 3M0TA 3VS0A 5FWBA 2K7AA 1E7OA 1Z9ZA 2J6KA 1K9AA 1ABOA 1M8MA 1NG2A 2X3XD 1YWOA 1U3OA 2EW3A 2AK5A 2J6OA 5IXFA 1JXOA 4J9BA 2DA9A 4OMPA 2CREA 2J06A 4A63B 1QKWA 2V1RA 3NGPA 2DL8A 2D8JA 4HCKA 2HEQA 4AFQC 2C0TA 1ZSGA 4JJDA 2KEAA 1WIEA 3THKA 4RTTA 2EYXA 4ORZA 2DYBA 3H0HA 1KSWA 4OMNA 2C0IA 2EYZA 2EQIA 3TSZA 1ZUUA 2LNHB 4GBQA 3VS6A 3NPFA 1MV0B 1V1CA 1W1FA 1Y0MA 1PRLC 2A08A 2YSQA 4RTXA 1ZLMA 2F2VA 1UTIA 2YUQA 1U5SA 4AFUC 2EVRA 4CC7A 2KRSA 1K76A 1ZX6A 1SHGA 2DJQA 4Y92A 4LN2A 4RTUA 2ESWA 5I11A 4RTYA 2RF0A 2BZYA 2DM1A 1AWOA 2L2PA 3VS4A 2NWMA 2DRKA 3A98A 4M4ZA 1XOVA 4J9HA 1JXMA 1Z9QA 3PVQA 1UJYA 2W10A 2EKHA 2LJ1A 3VS1A 1K4US 3I35A 4RTWA 2KXCA 2DE0X 1G2BA 2A28A 3M0QA 2CDTA 3I9QA 1OPLA 4OMMA 4IIOA 2HDAA 2OI3A 2MOXA 2VKNA 2DMOA 1WI7A 2OAWA 2K3BA 1NM7A 2MIOA 2CUBA 1AVZC 4AG2C 2AKLA 2LX7A 5ECAA 1SSHA 2B86A 1WYXA 2KXDA 3QWYA 2KRNA 1AEYA 1K1ZA 1X6BA 2GGRA 1M3CA 1UECA 2ENMA 1EFNA 1SRLA 1WA7A 1UJ0A 1GL5A 2V1QA 3REBB 3EHQA 1UDLA 1UE9A 2BZXA 4JJCA 1M3AA 2BTTA 3H41A 2A37A 1W6XA 2RN8A 2PZ1A 1N5ZA 1VYUA 2IIMA 2LQNA 3H0IA 3RNJA 1AZEA 2DRMA 2DL5A 1KIKA 4LUEA 2JMAA 1B3QA 2HCKA 2GBQA 2AKKA 1OPKA 1VYTA 2FG0A 2RQUA 2DX1A 2P4RA 4D8DA 2LMJA 2FPFA 2EGEA 2FPDA 4Z8AA 1ZUKA 3I5RA 2JTEA 1T3LA 1AOJA 1ZUYA 2RNAA 4WCIA 2J6FA 2CUDA 4LE9A 2ECZA 3CQTA 2FEIA 2H8HA 2M0YA 1SEMA 2DL4A 2RQVA 4JZ4A 1UHCA 1GFCA 1SHFA 1UFFA 5EC7A 1X2KA 2O88A 4CC2A 1BK2A 2CT4A 2CSQA 4OMLA 1KFZA 1X43A 2RQRA 2OJ2A 1OEBA 1FYNA 2GTOA 4F17A 1E6GA 1WX6A 2KBTA 1JO8A 2X3WD 2DNUA 3VRZA 3FJ5A 4J9DA 1W70A 1A0NB 2SEMA 2DF6A 5IHIA 2KYBA 1HJDA 5IXBA 4OMOA 1GCQC 4JPBW 3TSWA 1QWFA 4E6RA 2JW4A 2D0NA 1X69A 5GJWB 1WLPB 2O2OA 2CH4W 2FPEA 5I22A 2DILA 2HBWA 1PWTA 2PTKA 1ZBJA 1GBQA 2D1XA 4FSSA 5FW9A 1TUDA 1U06A 2K6DA 2KE9A 3GBQA 3PVLA 1YCSB 4RTZA 1WFWA 3C0CA 4RUGA 1AD5A 2YUOA 2ROTA 2VVKA 4GLMA 2YT6A 1RLPC 2K79A 1PHTA 1GBRA 1BBZA 2DL7A 3NMZC 2JM8A 3VS5A 4K11A 1GFDA 5IHKA 2DBKA 1JQQA 2EGCA 2NUZA 2RQTA 2DL3A 1UG1A 4X1VA 4HXJA 3UF4A 1IO6A 1Y57A 2KYMA 3NHNA 1M3BA 2I0NA 3QWXX 4D8KA 1E6HA 1RLQC 2L3SA 1AWJA 5GJVB 1AZGB 1MUZA 2GNCA 2XMFA 4HVVA 3ULRB 3SEMA 2L0AA 1X27A 1SPKA 4Z89A 3EG0A 3VRYA 1J3TA 1KJWA 2CSIA 2EPDA 1T0JA 2J7IA 1QWEA 4JZ3A 4DEXA 2L3QA 1NLOC 2JT4A 3VS3A 1LCKA 4OMQA 1K0XA 2K2MA 3U23A 2HSPA 4KRTA 2O31A 1GCQA 2W0ZA 3ZL7C 2CT3A 2EYWA 1FMKA 3EG2A 1GRIA 1CSKA 1UHFA 1QKXA 1HSQA 3M0RA 1B07A 1WXUA 1BB9A 4R0KA 4DEYA 1ARKA 2LJ3A 1WDXA 2JS2A 3KFVA 2CH4A 4IIMA 2DBMA 1RUWA 1NLPC 1I0CA 2ED1A 1ABQA 1AWWA 2LCSA 1K0SA 2AZSA 4J9IA 2ROLA 1I1JA 2FO0A 4AFSC 1SRMA 1NYGA 4JJBA 2AZVA 2QDLA 4AG1C 1S1NA 5FWCA 4AFZC 3EGUA 2L3PA 2BZ8A 2LZ6B 1NEGA 5L23A 3UA6A 1VYVA 3UATA 1BU1A 1MV3A 2RPNA 1I07A 2RMOA 3EG3A 3VS7A 1CKAA 2K9GA 4F16A 4ZNXA 2C0OA 1TUCA 1T3SA 1WXBA 3M0PA 3H0FA 3JV3A 3LH5A 2EBPA 1QCFA 1TG0A 2FRYA 4QT7A 2YDLA 1H8KA 2EYYA 2F2XA 4J9CA 2KRMA 2JMCA 4CC4B 4RTVA 5IHNA 1X6GA 3M0UA 1JEGA 4LNPA 2FRWA 4J9GA
chains in the Genus database with same CATH superfamily
1WJRA 1OI1A 2VGNA 1YN8A 2COYA 3I5SA 1PKSA 2E6ZA 2CP7A 3CBMA 4KULA 1VQPQ 3G6EQ 3OYMA 1K8AC 1YJNA 4IUVA 1WXTA 3BE3A 4ATOA 5IH2A 3OS2A 2KT8A 5GAMe 3E9GA 3L2RA 1VQLT 4BE0A 4CC3A 3I56Q 1RI9A 4F7UA 5GAN5 1I4K1 4ME7A 2VYTA 1ZSZC 2DTHA 1Y96B 3MEAA 2D8HA 1UUEA 4PJMA 2F1LA 1QLYA 2XICA 5KYXA 1NEBA 3JCMh 3IQLA 3E9FA 3C4SA 3RESA 3X26B 4J7IA 1TTHB 2VXEA 5LJ5e 4M75D 3SHWA 5KH6A 1JB0E 2HD0A 4PJOD 4M78F 3QYHB 4XTZA 1IHWA 1YWPA 3TU4K 4OB0B 1T0HA 2F2WA 3RR6A 5FU6C 2IG0A 2R5MA 1PSFA 3M5AA 4M7AE 1S72T 4EIKA 4J5YA 4JJNK 3VJPA 3X28B 3A8LB 3R6NA 1AWXA 2DETA 4Z88A 3NTHA 1UGVA 2JXBA 3GLXA 4EMKA 3CCLQ 1VQ4Q 3G71Q 3RBBB 3M0TA 3VS0A 3VUBA 3D7SB 5AT1B 5FWBA 2K7AA 3OYGA 3CC2T 1LPLA 2X3XD 1M8MA 1M5Q1 1NG2A 1UEBA 5FRMA 2EW3A 2DA9A 5FLXE 1WQWA 1VQNT 2CREA 4BI8B 1ZQ1A 3RERA 2D8JA 4HCKA 5KYYB 4PLIA 1ZSZB 5GMKh 4MMKA 2HQEA 4ORZA 1YJNQ 4M7DG 3I55A 4P5NA 2GQVA 4E7IA 1NJIR 2C0IA 4O6JA 2CZ6B 3TSZA 2MI6A 5A0GA 1VQ9A 1ACMB 2LNHB 1NJIC 5GMKl 2QQAA 5LJ3e 1V1CA 1PRLC 2YRDA 2CZ7B 1KD1R 4QQ6A 3EG9B 2RHIA 5FU6B 3JB9F 2Y4XA 4M7AD 3CD6T 4BB7A 4FT4A 1O75A 1TOVA 1MMGA 1Q82R 4PJJA 2VUBA 3AHUA 2H3JA 3A98A 4M4ZA 1XOVA 2HZYA 4J9HA 2JJ9A 2EKHA 3VS1A 2OTJA 4RTWA 3MHXA 2AT1B 1G2BA 1C0MA 2DD4A 1W2BA 1H641 3CMAQ 1MMDA 1M1KU 2K5FA 4C92F 2LX9A 3TCJA 4KH1B 3KXTA 2QGFB 1D3BB 2OAWA 1WI7A 5GANh 3HRSA 5D6XA 4JRIA 1QVGS 3V7RA 1B7TA 4AG2C 2AKLA 4ZN1A 2B86A 1OX8A 2KRNA 1G3YA 2GGRA 3CC4Q 1AT1B 5IAYA 2JNGA 3T9NA 2GF7A 2NUPB 1MNEA 3V8JA 3CXCP 2BTTA 3QUIA 4A53A 1Q95G 4Z02A 1AZEA 5I21A 1B3QA 2COZA 3I55Q 3CMEA 2RQUA 2P4RA 1VQ9Q 4C8QA 3JRZA 2EGEA 2ZCFB 1BKBA 2DTOA 4E7LA 1K73R 4JUVA 4C0DC 3QJ6A 4DBQA 2ECZA 3CCJA 3EGDB 2FEIA 2H8HA 4AMCA 4BDYA 4PK4A 1YBYA 1UFFA 1M2VB 1SHFA 2DTIA 4KUIA 2DFUA 3OYIA 1O9SA 4F17A 4OF1A 1E6GA 1Q86R 2KBTA 2DAQA 3MP8A 3VRZA 2FZKB 3HSBA 2OTJQ 4GLKA 4M77B 2KYBA 1NPRA 5IXBA 2RHZA 3TSWA 4WTOB 2VV5A 1QWFA 3KBGA 4E6RA 2JW4A 2DYIA 4KGXB 5GJWB 3CCRA 5GAMg 1QVFA 2O2OA 3WVEB 2OTLA 2MK5A 2MF2A 2DILA 2HBWA 2HSEB 4M75A 4D6WA 3C94A 1QP2A 4BY6B 3CCMT 2VC8A 2D1XA 2CP6A 1RAGB 1U06A 3VU3C 3GBQA 1QVPA 2GFUA 3C0CA 3S3MA 5LJ5g 1TU0B 2YT6A 3CXCA 2DERA 1RAEB 4BI4A 2K79A 3UT1A 1R8OB 2HKQB 1BBZA 3DLMA 2JM8A 3PIPA 1KC8U 2E10A 1JQQA 2HNIA 4X1VA 4HXJA 1YHQA 3CC7T 3UF4A 4C0FA 3M57A 3NHNA 4CI0C 3J80E 1AWJA 1AZGB 1Q81C 2RM4A 4N0AC 1QW1A 3DKMA 2MYSA 4HVVA 1U8RA 3CEYA 2EIFA 5LJ3d 4Z89A 3CCJQ 5DLOA 1VQMA 2RB6A 3M54A 4DEXA 4PJOF 1Y96A 2EJ9A 4RG2A 3OS0A 4WF2A 4FYVB 3GF5A 5GAN3 3U23A 3OYNA 3CPWS 3G4ST 2O31A 1YI2A 2HMAA 4XTVA 1WHGA 1WNLA 2HBPA 2EKOA 5J39A 4EDUA 2I2LA 4FW2A 3EG2A 1QKXA 3M0RA 5FU7C 1ARKA 3A8OB 2QTXA 1BI0A 2KDSA 1RACB 1RADB 2JS2A 3CCRQ 2CH4A 1RABB 2OTLQ 1VQOA 5LJ3g 1Q7YC 1BI2A 2E6NA 2K3YA 2AZSA 3BFMA 2HAXA 3G7ZA 3M4GA 2AZVA 3OA6A 4AG1C 4AFZC 2QK0A 1JRIA 3OYLA 5L23A 4C5HA 1K9MU 3OS1A 2EYQA 2KSSA 1OU9A 2ZPBB 4B9XA 4E7SA 3F70A 1TS9A 3VUZA 5KCOA 1KHCA 2VASA 3M9QA 2M16A 3H0FA 5GAN7 3NFCA 2EBPA 2FRYA 4KUDK 4QT7A 3OYFA 1ZHIA 5KYYA 1H8KA 1N9RA 3JSCA 4NL2A 2K57A 3OYBA 4E47A 2JMCA 1YHQQ 5IHNA 1JEGA 4LNPA 4J9GA 4QQDA 3V7CA 2KNBB 1X2QA 2BKDN 2E5KA 2KR3A 2L3RA 2LCCA 2JN0A 5CKHA 3MP6A 4JS5A 2G6FX 3ME9A 5FU7B 4JDSA 2J05A 1VQMQ 1P92A 2YUNA 3PGGA 2QQ9A 3EG9A 1M27C 2DK3A 1XTDA 3UA7A 5GAOm 3ZBDA 2JM9A 2RHYA 2LT1A 4L59A 2CYZB 3PMTA 1YI2Q 2RI2A 2EAYA 2KROA 5GAN4 1BYMA 1X6OA 1VQLA 4RG8A 4M78G 5GAOn 1R77A 1VA7A 2QDYB 3M0SA 1TXQA 3S3NA 2C06A 2A36A 5HCKA 3OYAA 1VQOQ 3CCVT 3EG1A 2KT1A 4BE1A 1G3WA 4JLGA 3GNFB 4M7DB 1D3BA 3TVTA 4PJOC 4GY5A 1H3HA 1PNJA 1B34B 4LDXA 2DVJA 4HVWA 3QO3A 1H92A 2GQIA 4OMFB 2V8KA 2X4XA 4F7UG 2PVDB 4OB2B 5GAOp 2NUPA 3JCMf 3EHRA 1S72A 2R58A 3NTKA 1JJ2P 1BI1A 3NTIA 3CCQA 3BDUA 2RJDA 4MZPA 3SDZA 1E7OA 4A4FA 1Z9ZA 1ABOA 2DPPB 5D7UA 1M9SA 3OSSC 4ZGJB 2AK5A 1VQ8T 2DJZA 2L5QA 1JXOA 2FB7A 1BI3A 4OMPA 4XAXB 3CC2A 1N8RU 1M1KR 1VOMA 1PG5B 3RKYA 2A0FB 2V1RA 2DL8A 3QHSA 2C0TA 5I2MA 3HFNA 3THKA 2EYXA 3OYJA 2ZGWA 2DYBA 4M75E 1KSWA 2IVWA 4IUPA 2EYZA 4LD9K 4NOYA 2EJGA 4HCZA 4O5VA 2YRVA 4BDZA 2LT4A 1M2VA 5GAMh 1W2BS 1PCXA 3GP8A 4JRPA 1MV0B 1W1FA 2A08A 3JCMX 2G3RA 1ZLMA 2F2VA 4AFUC 4CC7A 1M90U 1VQLQ 1ZX6A 1FXXA 1SHGA 4RCCA 1IGQA 4M77A 4RTYA 2XK0A 2E3HA 4IKFA 2QEXA 5LJ5h 4C92G 3CD6A 2NWMA 2A7YA 2RA2A 2QQSA 1Y7XA 3CCSA 4PFPA 4JS4A 2YXYA 2QXFA 1N9SA 2RI3A 2V8JA 4XTWA 1VQKA 3L2VA 4IIOA 3RIRA 2HDAA 3QSUA 2QQRA 2XG8D 1NZ9A 2DMOA 2JTMA 8AT1B 2CKKA 5CR2A 3PT9A 1S72Q 1AVZC 5ECAA 1JJ2A 1SSHA 1WYXA 1D0XA 3QWYA 3CCQQ 2F5KA 1M3CA 3M58A 3RMQA 1VQPT 1UECA 1VQ6A 4LXCA 3J7AF 1UJ0A 4XU3A 1GL5A 1W2BP 1UDLA 1UE9A 3CC2Q 4DBRA 5FROA 2A37A 2L8DA 2PZ1A 3OY9A 3FB9A 1N5ZA 2IIMA 5J3BA 5HY6A 3RNJA 3CCUA 2DRMA 3CCET 5GANf 2CS7A 1Y07A 4FW1A 2HCKA 1RAHB 4KBMB 1OYXA 2GBQA 1OPKA 3MCAB 1D0ZA 7AT1B 4R55A 2LMJA 3EGXB 1QQJA 2FPDA 2E65A 3OB9A 2EQUA 4F7UF 5LJ3h 4XTUA 1T3LA 2DO3A 5DLQE 2J6FA 2RD1A 1QVFS 1EZZB 4XU2A 3JB9H 2DL4A 2X4WA 3OQ5A 2DXCA 5EC7A 1KC8R 4OMLA 3VKIA 5KYUA 2QEXQ 3FIFA 5GMKj 1V76A 2GCXA 1WX6A 2X3WD 2DNUA 1WHJA 4A4HA 2XI9A 3FJ5A 3PTAA 4PKCC 1TWBA 1A0NB 2F69A 2QYZA 4J6XA 3CCLT 1VQ4T 1PD1A 4JPBW 3CBOA 3OYDA 2JOYA 3SD4A 3CXCS 3G71T 3CCSQ 2JUFA 3RUXA 4DQ2A 1VQKQ 4IUUA 1KD1C 3MEWA 4X34A 2YHTA 1PWTA 2PTKA 4ANJA 1ZBJA 2QI2A 3TREA 4FYXB 4N0AA 2CZ0B 2K6DA 1YCSB 1Q82C 1WFWA 2OAUA 1BCMA 4FIBA 1AD5A 2QA4A 1VQ6Q 1YJNT 5C0MA 2VVKA 3ER0A 3H6ZA 3RKWA 2CP5A 4XK8E 1QVFP 1VQ7A 3V8KA 3CCUQ 2DL7A 3NMZC 3VS5A 2RK2A 2RH2A 2QAZA 1U1SA 3LW5E 5GANj 3H9NA 2EGCA 2HQXA 4KH0B 1OQKA 1PC0A 1UG1A 5KYWA 1Y57A 2KYMA 1M3BA 2I0NA 1K9MR 4PJOG 1YJ9A 4D8KA 1AHJB 3CC7A 4C5EA 3OSVA 4M78C 3DB4A 4FU6A 3C12A 5DY9A 5GAN2 4XU1A 1D1CA 2L0AA 1SPKA 3VRYA 3OYEA 2DEQA 2FZCB 1QWEA 2HL5C 1NLOC 3CMAT 3VS3A 5KYNA 1K0XA 2K2MA 3DLLA 3QKJA 2HSPA 1GCQA 3MEVA 1WJQA 2W0ZA 3ZL7C 2YRCA 5CO7A 3MKDA 4M7DA 1WXUA 1BB9A 3MO8A 4DEYA 1K8AU 1G8XA 3OBWA 2O4XB 1WDXA 4RKUE 3CC4T 3KFVA 1FMWA 3LWHA 4KGZB 1K73C 1I0CA 2QGGA 4A54A 4DBHA 2E70A 2ROLA 1I1JA 1NYGA 2ZPFB 2QDLA 5FWCA 2PVGB 4FT2A 3BY7A 2CGHA 2E1HA 2L3PA 2LZ6B 3JCMQ 2BE9B 1NEGA 1F1BB 4BACA 3UA6A 4FCYA 3X24B 3UATA 2QA4Q 3I55T 1Q86C 1UGRB 3RDVA 3EG3A 3VS7A 2F5TX 4HKEA 1CKAA 4M78B 4ZNXA 2EWNA 2C0OA 3GNGA 4M77E 1TUGB 1VQ7Q 1D1AA 4M7AG 2FHDA 1N27A 3OYKA 1D0YA 2P0KA 3S6WA 4C8QF 3M0UA 3PIOA 1YJ9Q 1UGQB 1WHHA 3X20B 4F14A 3L2ZA 2JS0A 3BW1A 2BUDA 2LP5A 1WHMA 4FYYB 4F7UB 2RQWA 1YP5A 1CKBA 2V26A 4C92C 4C0DB 1G3TA 1PM3A 1YNZA 1YITT 2H3EB 5EG2A 1OV3A 1NE8A 2KK4A 3CMEQ 1N8RR 3JB9I 3LH0A 5J26A 2LC4A 1WGSA 1C6VX 2EGAA 1MHNA 2R57A 2MWPA 2WSFE 2SRCA 1XJWB 3CPFA 4M75F 1NJIU 3HHTB 2DXBA 4M77D 5GMKm 4E7KA 3ASKA 3JCMW 1IB8A 5HK3A 2FVUA 3CCVA 4E2FB 1M30A 3RMSA 3OW2P 2MWOA 1GCPA 1M90R 2KI7A 5CKFA 4ESRA 1NBEB 3GIBA 3ZFJA 3O5ZA 4LUDA 1R0CB 3M4YA 1YIJA 2DIGA 3VS2A 1PRMC 3PE0A 1ZA1B 5LL6S 3KUFA 2J6KA 4C92B 1K9AA 4KGVB 3CCJT 2QG9B 2VXFA 1U3OA 3OYCA 3EAEA 5IXFA 2PUOB 4ELYC 3M53A 5GAN8 1KQ1A 4A63B 8ATCB 3MPUB 1YJWA 2YLBA 4AFQC 2RHXA 3EGXA 4B9WA 4JJDA 4RTTA 1SSFA 5CVIA 5KE2A 1ZUUA 2KMTA 4MMLA 3QPHA 2AIRB 4GBQA 1ZSZA 1IGUA 3CCRT 3C95A 2NUTB 9ATCB 1Y0MA 3P8DA 4C8QC 2YSQA 1IZ6A 2EQMA 2LQ8A 2KRSA 4Y92A 4M7AF 2E41A 3MP1A 4LN2A 3QG1A 1RL2A 3JB9D 2QASA 1VQ5A 2ESWA 5GANd 1JJ2S 2FL7A 1BIBA 2YLCA 2RF0A 2BZYA 2P0QA 1AWOA 3UDCA 4ZTFA 3M59A 3J81E 1Z9QA 3PVQA 2BIVA 2K5IA 1UJYA 2LVMA 2W10A 2LJ1A 5HKCA 2K5LA 1K4US 4XTYA 2KXCA 5GAMf 4PJNA 4YTLA 3OW2A 1HK9A 2A28A 3M0QA 1M2OA 2PU9B 1KHIA 1OPLA 2BE7D 3L2UA 1SKUB 3G1JA 2WSCE 1TSFA 4HCBA 3LLRA 2VKNA 1YHQT 2K3BA 4AT1B 2CUBA 1KQ2A 2LX7A 4J6YA 1LNXA 1YIJQ 2DD5A 3E19A 4OVAA 3SFMA 1AEYA 5LJ5f 1K1ZA 3LGLA 2M1HA 2X9HA 4M75C 4FYWB 4DOVA 2Y4YA 3VYGA 3OS5A 1I8FA 4FSXA 2V1QA 3REBB 3EHQA 2BZXA 4M7DE 3H41A 2K4YA 1YJWQ 1PSEA 3H8ZA 4C8QB 1VYUA 2LQNA 1YI2T 1KIKA 1VIEA 3QXEB 3QDRB 2JMAA 4XTXA 5A0LA 4VUBA 3VV0A 2AKKA 1VYTA 2FG0A 2MPXC 3CCEA 4LDWA 4LD6A 2DX1A 3PMIA 2M0OA 1ZBXA 2FPFA 4ZTJA 1ZUKA 1VQOT 1AOJA 1ZUYA 2RNAA 4WCIA 2CUDA 2CP2A 2A3LA 3INZA 1I81A 4TVRA 4OGCA 4JZ4A 5CAIA 1UHCA 4MZTA 1VQ5Q 5IT9E 1FX7A 2M02A 1M1KC 1VQNA 1U1TA 1XNIA 2P84A 2O88A 1X75C 2XU8A 1BK2A 2Y90A 4CC2A 1FWZA 3BDLA 1KFZA 1FMVA 2E5QA 2RQRA 1OEBA 3AT1B 3EGDA 2ZPIB 2GTOA 4Q5WA 4A4EA 1Q81U 1V29B 2PQWA 1G5VA 3EFRA 2DF6A 5IHIA 1HJDA 5LJ3f 4PJOB 5GAMj 2D0QB 4M7DD 2CH4W 5I22A 4M7AC 1SG5A 4PFZA 1UB4A 3OMCA 3TQ7P 1QCNA 3MJXA 4M78A 5FW9A 1ZA2B 1TUDA 4E7JA 3PVLA 4PJLA 4EMGA 5LJ5j 4RTZA 4N4IA 4N4HA 4QQGA 4RUGA 1GXIE 2YUOA 4A4KA 3LX7A 2ROTA 1K8AR 1XQHA 1Q7YU 4LDYA 1LJOA 1VIFA 2DZCA 3META 4MDWA 1PHTA 1N6AA 2EQKA 1WPYA 4K11A 2DBKA 2XD0A 2NUZA 2RQTA 2DL3A 4MDXA 3QZ5B 3CCEQ 1G3SA 1IO6A 4IUQA 4RMOA 2XDDA 3JCMP 2XHCA 2LTOA 3QWXX 1KQSA 4LDUA 1E6HA 4BUGA 3G6ET 4R56A 5CKEA 2LRQA 5GJVB 3QBYA 1MUZA 2GNCA 2KAFA 2PUKB 1C1AA 4PL6A 4J7FA 2E64A 4IUTA 4B6MA 4OB1B 1J3TA 4EPCA 4M77F 2J7IA 2DKGA 4JZ3A 1VQNQ 3M55A 3I56T 2JT4A 1BIAA 2RJFA 5CCAA 2DXTA 4OMQA 4M7AB 4DOWA 3OYHA 5AYFA 1M1FA 2P0PA 3CMAA 2L89A 2CT3A 2EYWA 1CSKA 5DM7R 1HSQA 1B07A 2DXUA 3CCQT 2LJ3A 3JCMe 2X35A 5LJ3j 1IXDA 1RUWA 1NLPC 2ED1A 1AWWA 6AT1B 3EH2A 3Q1JA 1K0SA 3CC4A 2D6FA 3JB9J 1S1NA 3PNWC 3CD6Q 3EGUA 1KC8C 3HRUA 3SB2A 1BU1A 5IN1A 3QZ9B 2RPNA 4C92A 2KVQG 4C8QG 2RMOA 1I5OB 3L1AA 2K2VA 4F16A 1T3SA 1WXBA 3QYGB 4CRIA 2CP3A 1RI0A 3LH5A 1QCFA 3QJYA 2MAMA 5M9OA 5CK9A 2F2XA 4J9CA 4OB3B 2Z0WA 4RTVA 1HYOA 2YUPA 3SWNC 4C0ZA 3CCMA 2EFIA 3REAB 5A0DA 4UC4A 2ED0A 2IPOB 2QEXT 2DIQA 3EFSA 2JZ2A 2RK1A 3HL8A 3A8MB 4J9FA 1WHLA 2NUTA 5GMKe 1HD3A 2MCNA 2O9SA 1HXDA 3JCMJ 4DBFA 2DVEA 5CKBA 3CCST 4QW2A 5GMKi 2KGTA 1VQKT 4DA4A 1UGSB 2JVVA 4M75G 2O9VA 4Y91A 1YITA 1PD0A 1JU5C 3EFOB 4FL6A 2B8AA 4HA8A 1K9MC 3WXMB 2GTJA 2ABLA 4E7ZA 1G83A 1MMNA 2LJ0A 2NYSA 4KT0E 4RCBA 2VWFA 2D9TA 4HVUA 1VQ6T 1UGPB 5GAOr 4M77C 2M51A 2HL3A 1EIFA 3GOXA 4C0GA 1MGQA 4X9CA 2DLPA 5CKDA 3A8GB 3QDFA 1OOTA 3CCUT 2X51A 3FJPA 3L42A 4FM4B 2MMPA 2CP0A 1LVKA 3V8LA 4BY6C 2FZGB 4BE2A 3SWNB 3G4SA 2XIDA 5GANe 2ZPEB 4QVCA 2PNIA 1PKTA 1B34A 4J9EA 2LQWA 1NYFA 3JCMV 2HKNA 5D6WA 1YWOA 3QIIA 1SF9A 3MEUA 2J6OA 3TEEA 4XU0A 4J9BA 5GAMd 5GAOl 3CCMQ 2J06A 1QKWA 3NGPA 1M1GA 3WVDB 2HEQA 5C6SA 1ZSGA 2KEAA 1WIEA 1VQ9T 1QVGP 4ZGEB 3H0HA 4OMNA 3OBYA 4JRQA 2QTVA 2EQIA 2PVOB 1OULA 2ATCB 5LJ5d 4M78E 3VS6A 4EMKC 1D1BA 3NPFA 1VUBA 3GPLA 3RKXA 2XDBA 3M56A 2ZPGB 3OW2S 2KY9A 4EMHA 4RTXA 5KE3A 1UTIA 2YUQA 1YITQ 1U5SA 4M7DF 2EVRA 1OX9A 1K76A 2RHUA 2DJQA 3URGA 3CC7Q 3L2QA 4RTUA 3UPUA 1JBMA 5I11A 2M9UA 3JCMd 4PJOA 4MZMA 2DM1A 4ELZC 2OTJT 2L2PA 2QA4T 3VS4A 2DRKA 2K3XA 1JXMA 4JRKA 1IREB 1MMAA 5KYXB 3I35A 4F7UE 2LDMA 2DE0X 4NS5A 1VQ7T 2AHJB 1H3ZA 5CQXA 3DB3A 1RAFB 2CDTA 3I9QA 4OMMA 3G4SQ 2OI3A 1N8RC 2MOXA 4F04B 4HT9A 1NPPA 4J83A 1NM7A 2MIOA 3LWIA 1YJ9T 2YWWA 2KXDA 5L8RE 3O8VA 3JCMg 1X6BA 1Q81R 2VGMA 4QVZA 3HTRA 3A5ZB 2ENMA 4M78D 1EFNA 1SRLA 1WA7A 2COWA 4E7HA 1YFNA 4HCCA 4QKUA 4EMKB 4JJCA 1KD1U 1M3AA 1W6XA 2RN8A 5FRNA 3H0IA 1VQ5T 3X25B 1M90C 2KQWA 2DL5A 3CMET 2JTFA 2E12A 1QVGA 4LUEA 5A2QE 1Q82U 1BCOA 4II1A 1EX4A 4D8DA 2P4TA 4HT8A 4Z8AA 2DEUA 3I5RA 1I5LA 2JTEA 4X9DA 2EQJA 1Q7YR 5KYUB 4M7AA 1R0BG 1IRXA 2WSEE 4LE9A 4C92E 3CQTA 1M4ZA 2M0YA 1SEMA 4J6WA 2RQVA 3S3OA 1VQ8A 1OZ3A 1GFCA 3FRNA 3CBPA 1RAAB 1X2KA 2NLUA 2CT4A 2CSQA 2RI5A 1QCOA 1X43A 3P8BB 1TH7A 2OJ2A 4ZN3A 1FYNA 1DJ7B 1JO8A 2DZ9A 4XQ3A 4J9DA 2HQHA 1W70A 2SEMA 2O01E 2OTLT 4OMOA 1GCQC 2D0NA 2X4YA 1X69A 3L2WA 1W4SA 1WLPB 4M7DC 2LNVA 4L6V5 2FPEA 5CQYA 1OU8A 3P8HA 1GBQA 4FSSA 2WACA 2KE9A 2V8IA 3CPWP 1KQSS 4OGEA 3CCVQ 3FEOA 1QMCA 4GLMA 4L5GA 5HK0A 4N4GA 1K73U 2R5AA 3A1PA 1RLPC 1MNDA 2LQKA 2RO0A 5KYWB 1GBRA 4C92D 3E1SA 4JLIA 4PFOA 1IHVA 3HFOA 1GFDA 2LCLA 4PNOA 1KG1A 5IHKA 1WHKA 5GAOq 2GFAA 1KK7A 5GANg 4M77G 4V2SA 1Q86U 4Y28E 1RLQC 2L3SA 1VQMT 2XMFA 3ULRB 1LOJA 3V7SA 3SEMA 1WJSA 1X27A 5CIUA 4BI3A 1VQPA 3G6EA 3EG0A 2E3IA 1KJWA 2CSIA 1VQ8Q 2EPDA 1T0JA 2QQBA 2ZZDA 3EFOA 3HPWA 2L3QA 2ZPHB 1WZOA 3FDRA 4C5IA 4ZGDB 1Y71A 1LCKA 2OX7A 4LDVA 1M8VA 4C8QE 3HP9A 2FYKA 4PLLA 4KRTA 3I56A 3EH1A 4OP0A 3LGFA 4IURA 1KQSP 1FMKA 3VYHB 1GRIA 1UHFA 3N5BB 4R0KA 3PFSA 1YIJT 2RJCA 1OZ2A 4BD3A 5D6YA 3E2UA 4IIMA 5GAN6 2DBMA 2VB6A 4A4GA 1ABQA 2LCSA 1D09B 1X01A 2RJEA 1YCYA 4J9IA 3SWNA 3JCMb 3JAME 4NL3A 3HKSA 2FO0A 3OMGA 4AFSC 1SRMA 4JJBA 3LYIA 2O4XA 1YJWT 3R6OA 4J8OA 2XKOC 2BZ8A 3CPWA 1RAIB 3A8HB 2XDPA 3JCMc 4QVDA 1VYVA 3FC3A 1WQ7A 5KCHA 1QP3A 4M75B 1MV3A 2X4JA 3HRTA 1I07A 3OYYA 2K9GA 3UWNA 1TUCA 3FLGA 3M0PA 5I2SA 3CCLA 3ZEHA 2ZAEA 1VQ4A 3JV3A 3G71A 1TG0A 3JB9G 4PJOE 2YDLA 4C5GA 2CZ1B 2EYYA 2EJFA 2E4HA 2KRMA 4CC4B 1X6GA 4C8QD 2FRWA
chains in the Genus database with same CATH topology
2YUPA 2KNBB 3REAB 4F14A 1YN8A 2ED0A 3I5SA 1PKSA 1X2QA 2JS0A 2E5KA 2KR3A 4J9FA 2G6FX 1HD3A 2LP5A 2O9SA 2MCNA 2J05A 2RQWA 1WXTA 1YP5A 1CKBA 2YUNA 1YNZA 1M27C 2KGTA 5IH2A 1OV3A 2KT8A 3UA7A 2JM9A 4CC3A 1RI9A 2KROA 2O9VA 1JU5C 2EGAA 1VA7A 2D8HA 1UUEA 1QLYA 2GTJA 2ABLA 1NEBA 3M0SA 3IQLA 2SRCA 2A36A 1G83A 5HCKA 2LJ0A 2VWFA 3EG1A 2KT1A 4HVUA 2M51A 3SHWA 3TVTA 1H3HA 1PNJA 1YWPA 2DLPA 1M30A 1T0HA 2F2WA 1OOTA 2DVJA 4HVWA 1GCPA 1H92A 2GQIA 4ESRA 4EIKA 2PNIA 3R6NA 1PKTA 3O5ZA 1AWXA 4J9EA 3EHRA 4LUDA 4Z88A 1UGVA 2LQWA 2JXBA 1NYFA 3VS2A 1PRMC 3PE0A 3RBBB 3M0TA 3VS0A 5FWBA 2K7AA 1E7OA 1Z9ZA 2J6KA 1K9AA 1ABOA 1M8MA 1NG2A 2X3XD 1YWOA 1U3OA 2EW3A 2AK5A 2J6OA 5IXFA 1JXOA 4J9BA 2DA9A 4OMPA 2CREA 2J06A 4A63B 1QKWA 2V1RA 3NGPA 2DL8A 2D8JA 4HCKA 2HEQA 4AFQC 2C0TA 1ZSGA 4JJDA 2KEAA 1WIEA 3THKA 4RTTA 2EYXA 4ORZA 2DYBA 3H0HA 1KSWA 4OMNA 2C0IA 2EYZA 2EQIA 3TSZA 1ZUUA 2LNHB 4GBQA 3VS6A 3NPFA 1MV0B 1V1CA 1W1FA 1Y0MA 1PRLC 2A08A 2YSQA 4RTXA 1ZLMA 2F2VA 1UTIA 2YUQA 1U5SA 4AFUC 2EVRA 4CC7A 2KRSA 1K76A 1ZX6A 1SHGA 2DJQA 4Y92A 4LN2A 4RTUA 2ESWA 5I11A 4RTYA 2RF0A 2BZYA 2DM1A 1AWOA 2L2PA 3VS4A 2NWMA 2DRKA 3A98A 4M4ZA 1XOVA 4J9HA 1JXMA 1Z9QA 3PVQA 1UJYA 2W10A 2EKHA 2LJ1A 3VS1A 1K4US 3I35A 4RTWA 2KXCA 2DE0X 1G2BA 2A28A 3M0QA 2CDTA 3I9QA 1OPLA 4OMMA 4IIOA 2HDAA 2OI3A 2MOXA 2VKNA 2DMOA 1WI7A 2OAWA 2K3BA 1NM7A 2MIOA 2CUBA 1AVZC 4AG2C 2AKLA 2LX7A 5ECAA 1SSHA 2B86A 1WYXA 2KXDA 3QWYA 2KRNA 1AEYA 1K1ZA 1X6BA 2GGRA 1M3CA 1UECA 2ENMA 1EFNA 1SRLA 1WA7A 1UJ0A 1GL5A 2V1QA 3REBB 3EHQA 1UDLA 1UE9A 2BZXA 4JJCA 1M3AA 2BTTA 3H41A 2A37A 1W6XA 2RN8A 2PZ1A 1N5ZA 1VYUA 2IIMA 2LQNA 3H0IA 3RNJA 1AZEA 2DRMA 2DL5A 1KIKA 4LUEA 2JMAA 1B3QA 2HCKA 2GBQA 2AKKA 1OPKA 1VYTA 2FG0A 2RQUA 2DX1A 2P4RA 4D8DA 2LMJA 2FPFA 2EGEA 2FPDA 4Z8AA 1ZUKA 3I5RA 2JTEA 1T3LA 1AOJA 1ZUYA 2RNAA 4WCIA 2J6FA 2CUDA 4LE9A 2ECZA 3CQTA 2FEIA 2H8HA 2M0YA 1SEMA 2DL4A 2RQVA 4JZ4A 1UHCA 1GFCA 1SHFA 1UFFA 5EC7A 1X2KA 2O88A 4CC2A 1BK2A 2CT4A 2CSQA 4OMLA 1KFZA 1X43A 2RQRA 2OJ2A 1OEBA 1FYNA 2GTOA 4F17A 1E6GA 1WX6A 2KBTA 1JO8A 2X3WD 2DNUA 3VRZA 3FJ5A 4J9DA 1W70A 1A0NB 2SEMA 2DF6A 5IHIA 2KYBA 1HJDA 5IXBA 4OMOA 1GCQC 4JPBW 3TSWA 1QWFA 4E6RA 2JW4A 2D0NA 1X69A 5GJWB 1WLPB 2O2OA 2CH4W 2FPEA 5I22A 2DILA 2HBWA 1PWTA 2PTKA 1ZBJA 1GBQA 2D1XA 4FSSA 5FW9A 1TUDA 1U06A 2K6DA 2KE9A 3GBQA 3PVLA 1YCSB 4RTZA 1WFWA 3C0CA 4RUGA 1AD5A 2YUOA 2ROTA 2VVKA 4GLMA 2YT6A 1RLPC 2K79A 1PHTA 1GBRA 1BBZA 2DL7A 3NMZC 2JM8A 3VS5A 4K11A 1GFDA 5IHKA 2DBKA 1JQQA 2EGCA 2NUZA 2RQTA 2DL3A 1UG1A 4X1VA 4HXJA 3UF4A 1IO6A 1Y57A 2KYMA 3NHNA 1M3BA 2I0NA 3QWXX 4D8KA 1E6HA 1RLQC 2L3SA 1AWJA 5GJVB 1AZGB 1MUZA 2GNCA 2XMFA 4HVVA 3ULRB 3SEMA 2L0AA 1X27A 1SPKA 4Z89A 3EG0A 3VRYA 1J3TA 1KJWA 2CSIA 2EPDA 1T0JA 2J7IA 1QWEA 4JZ3A 4DEXA 2L3QA 1NLOC 2JT4A 3VS3A 1LCKA 4OMQA 1K0XA 2K2MA 3U23A 2HSPA 4KRTA 2O31A 1GCQA 2W0ZA 3ZL7C 2CT3A 2EYWA 1FMKA 3EG2A 1GRIA 1CSKA 1UHFA 1QKXA 1HSQA 3M0RA 1B07A 1WXUA 1BB9A 4R0KA 4DEYA 1ARKA 2LJ3A 1WDXA 2JS2A 3KFVA 2CH4A 4IIMA 2DBMA 1RUWA 1NLPC 1I0CA 2ED1A 1ABQA 1AWWA 2LCSA 1K0SA 2AZSA 4J9IA 2ROLA 1I1JA 2FO0A 4AFSC 1SRMA 1NYGA 4JJBA 2AZVA 2QDLA 4AG1C 1S1NA 5FWCA 4AFZC 3EGUA 2L3PA 2BZ8A 2LZ6B 1NEGA 5L23A 3UA6A 1VYVA 3UATA 1BU1A 1MV3A 2RPNA 1I07A 2RMOA 3EG3A 3VS7A 1CKAA 2K9GA 4F16A 4ZNXA 2C0OA 1TUCA 1T3SA 1WXBA 3M0PA 3H0FA 3JV3A 3LH5A 2EBPA 1QCFA 1TG0A 2FRYA 4QT7A 2YDLA 1H8KA 2EYYA 2F2XA 4J9CA 2KRMA 2JMCA 4CC4B 4RTVA 5IHNA 1X6GA 3M0UA 1JEGA 4LNPA 2FRWA 4J9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUP A;  2KNB B;  3REA B;  4F14 A;  1YN8 A;  2ED0 A;  3I5S A;  1PKS A;  1X2Q A;  2JS0 A;  2E5K A;  2KR3 A;  4J9F A;  2G6F X;  1HD3 A;  2LP5 A;  2O9S A;  2MCN A;  2J05 A;  2RQW A;  1WXT A;  1YP5 A;  1CKB A;  2YUN A;  1YNZ A;  1M27 C;  2KGT A;  5IH2 A;  1OV3 A;  2KT8 A;  3UA7 A;  2JM9 A;  4CC3 A;  1RI9 A;  2KRO A;  2O9V A;  1JU5 C;  2EGA A;  1VA7 A;  2D8H A;  1UUE A;  1QLY A;  2GTJ A;  2ABL A;  1NEB A;  3M0S A;  3IQL A;  2SRC A;  2A36 A;  1G83 A;  5HCK A;  2LJ0 A;  2VWF A;  3EG1 A;  2KT1 A;  4HVU A;  2M51 A;  3SHW A;  3TVT A;  1H3H A;  1PNJ A;  1YWP A;  2DLP A;  1M30 A;  1T0H A;  2F2W A;  1OOT A;  2DVJ A;  4HVW A;  1GCP A;  1H92 A;  2GQI A;  4ESR A;  4EIK A;  2PNI A;  3R6N A;  1PKT A;  3O5Z A;  1AWX A;  4J9E A;  3EHR A;  4LUD A;  4Z88 A;  1UGV A;  2LQW A;  2JXB A;  1NYF A;  3VS2 A;  1PRM C;  3PE0 A;  3RBB B;  3M0T A;  3VS0 A;  5FWB A;  2K7A A;  1E7O A;  1Z9Z A;  2J6K A;  1K9A A;  1ABO A;  1M8M A;  1NG2 A;  2X3X D;  1YWO A;  1U3O A;  2EW3 A;  2AK5 A;  2J6O A;  5IXF A;  1JXO A;  4J9B A;  2DA9 A;  4OMP A;  2CRE A;  2J06 A;  4A63 B;  1QKW A;  2V1R A;  3NGP A;  2DL8 A;  2D8J A;  4HCK A;  2HEQ A;  4AFQ C;  2C0T A;  1ZSG A;  4JJD A;  2KEA A;  1WIE A;  3THK A;  4RTT A;  2EYX A;  4ORZ A;  2DYB A;  3H0H A;  1KSW A;  4OMN A;  2C0I A;  2EYZ A;  2EQI A;  3TSZ A;  1ZUU A;  2LNH B;  4GBQ A;  3VS6 A;  3NPF A;  1MV0 B;  1V1C A;  1W1F A;  1Y0M A;  1PRL C;  2A08 A;  2YSQ A;  4RTX A;  1ZLM A;  2F2V A;  1UTI A;  2YUQ A;  1U5S A;  4AFU C;  2EVR A;  4CC7 A;  2KRS A;  1K76 A;  1ZX6 A;  1SHG A;  2DJQ A;  4Y92 A;  4LN2 A;  4RTU A;  2ESW A;  5I11 A;  4RTY A;  2RF0 A;  2BZY A;  2DM1 A;  1AWO A;  2L2P A;  3VS4 A;  2NWM A;  2DRK A;  3A98 A;  4M4Z A;  1XOV A;  4J9H A;  1JXM A;  1Z9Q A;  3PVQ A;  1UJY A;  2W10 A;  2EKH A;  2LJ1 A;  3VS1 A;  1K4U S;  3I35 A;  4RTW A;  2KXC A;  2DE0 X;  1G2B A;  2A28 A;  3M0Q A;  2CDT A;  3I9Q A;  1OPL A;  4OMM A;  4IIO A;  2HDA A;  2OI3 A;  2MOX A;  2VKN A;  2DMO A;  1WI7 A;  2OAW A;  2K3B A;  1NM7 A;  2MIO A;  2CUB A;  1AVZ C;  4AG2 C;  2AKL A;  2LX7 A;  5ECA A;  1SSH A;  2B86 A;  1WYX A;  2KXD A;  3QWY A;  2KRN A;  1AEY A;  1K1Z A;  1X6B A;  2GGR A;  1M3C A;  1UEC A;  2ENM A;  1EFN A;  1SRL A;  1WA7 A;  1UJ0 A;  1GL5 A;  2V1Q A;  3REB B;  3EHQ A;  1UDL A;  1UE9 A;  2BZX A;  4JJC A;  1M3A A;  2BTT A;  3H41 A;  2A37 A;  1W6X A;  2RN8 A;  2PZ1 A;  1N5Z A;  1VYU A;  2IIM A;  2LQN A;  3H0I A;  3RNJ A;  1AZE A;  2DRM A;  2DL5 A;  1KIK A;  4LUE A;  2JMA A;  1B3Q A;  2HCK A;  2GBQ A;  2AKK A;  1OPK A;  1VYT A;  2FG0 A;  2RQU A;  2DX1 A;  2P4R A;  4D8D A;  2LMJ A;  2FPF A;  2EGE A;  2FPD A;  4Z8A A;  1ZUK A;  3I5R A;  2JTE A;  1T3L A;  1AOJ A;  1ZUY A;  2RNA A;  4WCI A;  2J6F A;  2CUD A;  4LE9 A;  2ECZ A;  3CQT A;  2FEI A;  2H8H A;  2M0Y A;  1SEM A;  2DL4 A;  2RQV A;  4JZ4 A;  1UHC A;  1GFC A;  1SHF A;  1UFF A;  5EC7 A;  1X2K A;  2O88 A;  4CC2 A;  1BK2 A;  2CT4 A;  2CSQ A;  4OML A;  1KFZ A;  1X43 A;  2RQR A;  2OJ2 A;  1OEB A;  1FYN A;  2GTO A;  4F17 A;  1E6G A;  1WX6 A;  2KBT A;  1JO8 A;  2X3W D;  2DNU A;  3VRZ A;  3FJ5 A;  4J9D A;  1W70 A;  1A0N B;  2SEM A;  2DF6 A;  5IHI A;  2KYB A;  1HJD A;  5IXB A;  4OMO A;  1GCQ C;  4JPB W;  3TSW A;  1QWF A;  4E6R A;  2JW4 A;  2D0N A;  1X69 A;  5GJW B;  1WLP B;  2O2O A;  2CH4 W;  2FPE A;  5I22 A;  2DIL A;  2HBW A;  1PWT A;  2PTK A;  1ZBJ A;  1GBQ A;  2D1X A;  4FSS A;  5FW9 A;  1TUD A;  1U06 A;  2K6D A;  2KE9 A;  3GBQ A;  3PVL A;  1YCS B;  4RTZ A;  1WFW A;  3C0C A;  4RUG A;  1AD5 A;  2YUO A;  2ROT A;  2VVK A;  4GLM A;  2YT6 A;  1RLP C;  2K79 A;  1PHT A;  1GBR A;  1BBZ A;  2DL7 A;  3NMZ C;  2JM8 A;  3VS5 A;  4K11 A;  1GFD A;  5IHK A;  2DBK A;  1JQQ A;  2EGC A;  2NUZ A;  2RQT A;  2DL3 A;  1UG1 A;  4X1V A;  4HXJ A;  3UF4 A;  1IO6 A;  1Y57 A;  2KYM A;  3NHN A;  1M3B A;  2I0N A;  3QWX X;  4D8K A;  1E6H A;  1RLQ C;  2L3S A;  1AWJ A;  5GJV B;  1AZG B;  1MUZ A;  2GNC A;  2XMF A;  4HVV A;  3ULR B;  3SEM A;  2L0A A;  1X27 A;  1SPK A;  4Z89 A;  3EG0 A;  3VRY A;  1J3T A;  1KJW A;  2CSI A;  2EPD A;  1T0J A;  2J7I A;  1QWE A;  4JZ3 A;  4DEX A;  2L3Q A;  1NLO C;  2JT4 A;  3VS3 A;  1LCK A;  4OMQ A;  1K0X A;  2K2M A;  3U23 A;  2HSP A;  4KRT A;  2O31 A;  1GCQ A;  2W0Z A;  3ZL7 C;  2CT3 A;  2EYW A;  1FMK A;  3EG2 A;  1GRI A;  1CSK A;  1UHF A;  1QKX A;  1HSQ A;  3M0R A;  1B07 A;  1WXU A;  1BB9 A;  4R0K A;  4DEY A;  1ARK A;  2LJ3 A;  1WDX A;  2JS2 A;  3KFV A;  2CH4 A;  4IIM A;  2DBM A;  1RUW A;  1NLP C;  1I0C A;  2ED1 A;  1ABQ A;  1AWW A;  2LCS A;  1K0S A;  2AZS A;  4J9I A;  2ROL A;  1I1J A;  2FO0 A;  4AFS C;  1SRM A;  1NYG A;  4JJB A;  2AZV A;  2QDL A;  4AG1 C;  1S1N A;  5FWC A;  4AFZ C;  3EGU A;  2L3P A;  2BZ8 A;  2LZ6 B;  1NEG A;  5L23 A;  3UA6 A;  1VYV A;  3UAT A;  1BU1 A;  1MV3 A;  2RPN A;  1I07 A;  2RMO A;  3EG3 A;  3VS7 A;  1CKA A;  2K9G A;  4F16 A;  4ZNX A;  2C0O A;  1TUC A;  1T3S A;  1WXB A;  3M0P A;  3H0F A;  3JV3 A;  3LH5 A;  2EBP A;  1QCF A;  1TG0 A;  2FRY A;  4QT7 A;  2YDL A;  1H8K A;  2EYY A;  2F2X A;  4J9C A;  2KRM A;  2JMC A;  4CC4 B;  4RTV A;  5IHN A;  1X6G A;  3M0U A;  1JEG A;  4LNP A;  2FRW A;  4J9G A; 
#chains in the Genus database with same CATH topology
 1WJR A;  1OI1 A;  2VGN A;  1YN8 A;  2COY A;  3I5S A;  1PKS A;  2E6Z A;  2CP7 A;  3CBM A;  4KUL A;  1VQP Q;  3G6E Q;  3OYM A;  1K8A C;  1YJN A;  4IUV A;  1WXT A;  3BE3 A;  4ATO A;  5IH2 A;  3OS2 A;  2KT8 A;  5GAM e;  3E9G A;  3L2R A;  1VQL T;  4BE0 A;  4CC3 A;  3I56 Q;  1RI9 A;  4F7U A;  5GAN 5;  1I4K 1;  4ME7 A;  2VYT A;  1ZSZ C;  2DTH A;  1Y96 B;  3MEA A;  2D8H A;  1UUE A;  4PJM A;  2F1L A;  1QLY A;  2XIC A;  5KYX A;  1NEB A;  3JCM h;  3IQL A;  3E9F A;  3C4S A;  3RES A;  3X26 B;  4J7I A;  1TTH B;  2VXE A;  5LJ5 e;  4M75 D;  3SHW A;  5KH6 A;  1JB0 E;  2HD0 A;  4PJO D;  4M78 F;  3QYH B;  4XTZ A;  1IHW A;  1YWP A;  3TU4 K;  4OB0 B;  1T0H A;  2F2W A;  3RR6 A;  5FU6 C;  2IG0 A;  2R5M A;  1PSF A;  3M5A A;  4M7A E;  1S72 T;  4EIK A;  4J5Y A;  4JJN K;  3VJP A;  3X28 B;  3A8L B;  3R6N A;  1AWX A;  2DET A;  4Z88 A;  3NTH A;  1UGV A;  2JXB A;  3GLX A;  4EMK A;  3CCL Q;  1VQ4 Q;  3G71 Q;  3RBB B;  3M0T A;  3VS0 A;  3VUB A;  3D7S B;  5AT1 B;  5FWB A;  2K7A A;  3OYG A;  3CC2 T;  1LPL A;  2X3X D;  1M8M A;  1M5Q 1;  1NG2 A;  1UEB A;  5FRM A;  2EW3 A;  2DA9 A;  5FLX E;  1WQW A;  1VQN T;  2CRE A;  4BI8 B;  1ZQ1 A;  3RER A;  2D8J A;  4HCK A;  5KYY B;  4PLI A;  1ZSZ B;  5GMK h;  4MMK A;  2HQE A;  4ORZ A;  1YJN Q;  4M7D G;  3I55 A;  4P5N A;  2GQV A;  4E7I A;  1NJI R;  2C0I A;  4O6J A;  2CZ6 B;  3TSZ A;  2MI6 A;  5A0G A;  1VQ9 A;  1ACM B;  2LNH B;  1NJI C;  5GMK l;  2QQA A;  5LJ3 e;  1V1C A;  1PRL C;  2YRD A;  2CZ7 B;  1KD1 R;  4QQ6 A;  3EG9 B;  2RHI A;  5FU6 B;  3JB9 F;  2Y4X A;  4M7A D;  3CD6 T;  4BB7 A;  4FT4 A;  1O75 A;  1TOV A;  1MMG A;  1Q82 R;  4PJJ A;  2VUB A;  3AHU A;  2H3J A;  3A98 A;  4M4Z A;  1XOV A;  2HZY A;  4J9H A;  2JJ9 A;  2EKH A;  3VS1 A;  2OTJ A;  4RTW A;  3MHX A;  2AT1 B;  1G2B A;  1C0M A;  2DD4 A;  1W2B A;  1H64 1;  3CMA Q;  1MMD A;  1M1K U;  2K5F A;  4C92 F;  2LX9 A;  3TCJ A;  4KH1 B;  3KXT A;  2QGF B;  1D3B B;  2OAW A;  1WI7 A;  5GAN h;  3HRS A;  5D6X A;  4JRI A;  1QVG S;  3V7R A;  1B7T A;  4AG2 C;  2AKL A;  4ZN1 A;  2B86 A;  1OX8 A;  2KRN A;  1G3Y A;  2GGR A;  3CC4 Q;  1AT1 B;  5IAY A;  2JNG A;  3T9N A;  2GF7 A;  2NUP B;  1MNE A;  3V8J A;  3CXC P;  2BTT A;  3QUI A;  4A53 A;  1Q95 G;  4Z02 A;  1AZE A;  5I21 A;  1B3Q A;  2COZ A;  3I55 Q;  3CME A;  2RQU A;  2P4R A;  1VQ9 Q;  4C8Q A;  3JRZ A;  2EGE A;  2ZCF B;  1BKB A;  2DTO A;  4E7L A;  1K73 R;  4JUV A;  4C0D C;  3QJ6 A;  4DBQ A;  2ECZ A;  3CCJ A;  3EGD B;  2FEI A;  2H8H A;  4AMC A;  4BDY A;  4PK4 A;  1YBY A;  1UFF A;  1M2V B;  1SHF A;  2DTI A;  4KUI A;  2DFU A;  3OYI A;  1O9S A;  4F17 A;  4OF1 A;  1E6G A;  1Q86 R;  2KBT A;  2DAQ A;  3MP8 A;  3VRZ A;  2FZK B;  3HSB A;  2OTJ Q;  4GLK A;  4M77 B;  2KYB A;  1NPR A;  5IXB A;  2RHZ A;  3TSW A;  4WTO B;  2VV5 A;  1QWF A;  3KBG A;  4E6R A;  2JW4 A;  2DYI A;  4KGX B;  5GJW B;  3CCR A;  5GAM g;  1QVF A;  2O2O A;  3WVE B;  2OTL A;  2MK5 A;  2MF2 A;  2DIL A;  2HBW A;  2HSE B;  4M75 A;  4D6W A;  3C94 A;  1QP2 A;  4BY6 B;  3CCM T;  2VC8 A;  2D1X A;  2CP6 A;  1RAG B;  1U06 A;  3VU3 C;  3GBQ A;  1QVP A;  2GFU A;  3C0C A;  3S3M A;  5LJ5 g;  1TU0 B;  2YT6 A;  3CXC A;  2DER A;  1RAE B;  4BI4 A;  2K79 A;  3UT1 A;  1R8O B;  2HKQ B;  1BBZ A;  3DLM A;  2JM8 A;  3PIP A;  1KC8 U;  2E10 A;  1JQQ A;  2HNI A;  4X1V A;  4HXJ A;  1YHQ A;  3CC7 T;  3UF4 A;  4C0F A;  3M57 A;  3NHN A;  4CI0 C;  3J80 E;  1AWJ A;  1AZG B;  1Q81 C;  2RM4 A;  4N0A C;  1QW1 A;  3DKM A;  2MYS A;  4HVV A;  1U8R A;  3CEY A;  2EIF A;  5LJ3 d;  4Z89 A;  3CCJ Q;  5DLO A;  1VQM A;  2RB6 A;  3M54 A;  4DEX A;  4PJO F;  1Y96 A;  2EJ9 A;  4RG2 A;  3OS0 A;  4WF2 A;  4FYV B;  3GF5 A;  5GAN 3;  3U23 A;  3OYN A;  3CPW S;  3G4S T;  2O31 A;  1YI2 A;  2HMA A;  4XTV A;  1WHG A;  1WNL A;  2HBP A;  2EKO A;  5J39 A;  4EDU A;  2I2L A;  4FW2 A;  3EG2 A;  1QKX A;  3M0R A;  5FU7 C;  1ARK A;  3A8O B;  2QTX A;  1BI0 A;  2KDS A;  1RAC B;  1RAD B;  2JS2 A;  3CCR Q;  2CH4 A;  1RAB B;  2OTL Q;  1VQO A;  5LJ3 g;  1Q7Y C;  1BI2 A;  2E6N A;  2K3Y A;  2AZS A;  3BFM A;  2HAX A;  3G7Z A;  3M4G A;  2AZV A;  3OA6 A;  4AG1 C;  4AFZ C;  2QK0 A;  1JRI A;  3OYL A;  5L23 A;  4C5H A;  1K9M U;  3OS1 A;  2EYQ A;  2KSS A;  1OU9 A;  2ZPB B;  4B9X A;  4E7S A;  3F70 A;  1TS9 A;  3VUZ A;  5KCO A;  1KHC A;  2VAS A;  3M9Q A;  2M16 A;  3H0F A;  5GAN 7;  3NFC A;  2EBP A;  2FRY A;  4KUD K;  4QT7 A;  3OYF A;  1ZHI A;  5KYY A;  1H8K A;  1N9R A;  3JSC A;  4NL2 A;  2K57 A;  3OYB A;  4E47 A;  2JMC A;  1YHQ Q;  5IHN A;  1JEG A;  4LNP A;  4J9G A;  4QQD A;  3V7C A;  2KNB B;  1X2Q A;  2BKD N;  2E5K A;  2KR3 A;  2L3R A;  2LCC A;  2JN0 A;  5CKH A;  3MP6 A;  4JS5 A;  2G6F X;  3ME9 A;  5FU7 B;  4JDS A;  2J05 A;  1VQM Q;  1P92 A;  2YUN A;  3PGG A;  2QQ9 A;  3EG9 A;  1M27 C;  2DK3 A;  1XTD A;  3UA7 A;  5GAO m;  3ZBD A;  2JM9 A;  2RHY A;  2LT1 A;  4L59 A;  2CYZ B;  3PMT A;  1YI2 Q;  2RI2 A;  2EAY A;  2KRO A;  5GAN 4;  1BYM A;  1X6O A;  1VQL A;  4RG8 A;  4M78 G;  5GAO n;  1R77 A;  1VA7 A;  2QDY B;  3M0S A;  1TXQ A;  3S3N A;  2C06 A;  2A36 A;  5HCK A;  3OYA A;  1VQO Q;  3CCV T;  3EG1 A;  2KT1 A;  4BE1 A;  1G3W A;  4JLG A;  3GNF B;  4M7D B;  1D3B A;  3TVT A;  4PJO C;  4GY5 A;  1H3H A;  1PNJ A;  1B34 B;  4LDX A;  2DVJ A;  4HVW A;  3QO3 A;  1H92 A;  2GQI A;  4OMF B;  2V8K A;  2X4X A;  4F7U G;  2PVD B;  4OB2 B;  5GAO p;  2NUP A;  3JCM f;  3EHR A;  1S72 A;  2R58 A;  3NTK A;  1JJ2 P;  1BI1 A;  3NTI A;  3CCQ A;  3BDU A;  2RJD A;  4MZP A;  3SDZ A;  1E7O A;  4A4F A;  1Z9Z A;  1ABO A;  2DPP B;  5D7U A;  1M9S A;  3OSS C;  4ZGJ B;  2AK5 A;  1VQ8 T;  2DJZ A;  2L5Q A;  1JXO A;  2FB7 A;  1BI3 A;  4OMP A;  4XAX B;  3CC2 A;  1N8R U;  1M1K R;  1VOM A;  1PG5 B;  3RKY A;  2A0F B;  2V1R A;  2DL8 A;  3QHS A;  2C0T A;  5I2M A;  3HFN A;  3THK A;  2EYX A;  3OYJ A;  2ZGW A;  2DYB A;  4M75 E;  1KSW A;  2IVW A;  4IUP A;  2EYZ A;  4LD9 K;  4NOY A;  2EJG A;  4HCZ A;  4O5V A;  2YRV A;  4BDZ A;  2LT4 A;  1M2V A;  5GAM h;  1W2B S;  1PCX A;  3GP8 A;  4JRP A;  1MV0 B;  1W1F A;  2A08 A;  3JCM X;  2G3R A;  1ZLM A;  2F2V A;  4AFU C;  4CC7 A;  1M90 U;  1VQL Q;  1ZX6 A;  1FXX A;  1SHG A;  4RCC A;  1IGQ A;  4M77 A;  4RTY A;  2XK0 A;  2E3H A;  4IKF A;  2QEX A;  5LJ5 h;  4C92 G;  3CD6 A;  2NWM A;  2A7Y A;  2RA2 A;  2QQS A;  1Y7X A;  3CCS A;  4PFP A;  4JS4 A;  2YXY A;  2QXF A;  1N9S A;  2RI3 A;  2V8J A;  4XTW A;  1VQK A;  3L2V A;  4IIO A;  3RIR A;  2HDA A;  3QSU A;  2QQR A;  2XG8 D;  1NZ9 A;  2DMO A;  2JTM A;  8AT1 B;  2CKK A;  5CR2 A;  3PT9 A;  1S72 Q;  1AVZ C;  5ECA A;  1JJ2 A;  1SSH A;  1WYX A;  1D0X A;  3QWY A;  3CCQ Q;  2F5K A;  1M3C A;  3M58 A;  3RMQ A;  1VQP T;  1UEC A;  1VQ6 A;  4LXC A;  3J7A F;  1UJ0 A;  4XU3 A;  1GL5 A;  1W2B P;  1UDL A;  1UE9 A;  3CC2 Q;  4DBR A;  5FRO A;  2A37 A;  2L8D A;  2PZ1 A;  3OY9 A;  3FB9 A;  1N5Z A;  2IIM A;  5J3B A;  5HY6 A;  3RNJ A;  3CCU A;  2DRM A;  3CCE T;  5GAN f;  2CS7 A;  1Y07 A;  4FW1 A;  2HCK A;  1RAH B;  4KBM B;  1OYX A;  2GBQ A;  1OPK A;  3MCA B;  1D0Z A;  7AT1 B;  4R55 A;  2LMJ A;  3EGX B;  1QQJ A;  2FPD A;  2E65 A;  3OB9 A;  2EQU A;  4F7U F;  5LJ3 h;  4XTU A;  1T3L A;  2DO3 A;  5DLQ E;  2J6F A;  2RD1 A;  1QVF S;  1EZZ B;  4XU2 A;  3JB9 H;  2DL4 A;  2X4W A;  3OQ5 A;  2DXC A;  5EC7 A;  1KC8 R;  4OML A;  3VKI A;  5KYU A;  2QEX Q;  3FIF A;  5GMK j;  1V76 A;  2GCX A;  1WX6 A;  2X3W D;  2DNU A;  1WHJ A;  4A4H A;  2XI9 A;  3FJ5 A;  3PTA A;  4PKC C;  1TWB A;  1A0N B;  2F69 A;  2QYZ A;  4J6X A;  3CCL T;  1VQ4 T;  1PD1 A;  4JPB W;  3CBO A;  3OYD A;  2JOY A;  3SD4 A;  3CXC S;  3G71 T;  3CCS Q;  2JUF A;  3RUX A;  4DQ2 A;  1VQK Q;  4IUU A;  1KD1 C;  3MEW A;  4X34 A;  2YHT A;  1PWT A;  2PTK A;  4ANJ A;  1ZBJ A;  2QI2 A;  3TRE A;  4FYX B;  4N0A A;  2CZ0 B;  2K6D A;  1YCS B;  1Q82 C;  1WFW A;  2OAU A;  1BCM A;  4FIB A;  1AD5 A;  2QA4 A;  1VQ6 Q;  1YJN T;  5C0M A;  2VVK A;  3ER0 A;  3H6Z A;  3RKW A;  2CP5 A;  4XK8 E;  1QVF P;  1VQ7 A;  3V8K A;  3CCU Q;  2DL7 A;  3NMZ C;  3VS5 A;  2RK2 A;  2RH2 A;  2QAZ A;  1U1S A;  3LW5 E;  5GAN j;  3H9N A;  2EGC A;  2HQX A;  4KH0 B;  1OQK A;  1PC0 A;  1UG1 A;  5KYW A;  1Y57 A;  2KYM A;  1M3B A;  2I0N A;  1K9M R;  4PJO G;  1YJ9 A;  4D8K A;  1AHJ B;  3CC7 A;  4C5E A;  3OSV A;  4M78 C;  3DB4 A;  4FU6 A;  3C12 A;  5DY9 A;  5GAN 2;  4XU1 A;  1D1C A;  2L0A A;  1SPK A;  3VRY A;  3OYE A;  2DEQ A;  2FZC B;  1QWE A;  2HL5 C;  1NLO C;  3CMA T;  3VS3 A;  5KYN A;  1K0X A;  2K2M A;  3DLL A;  3QKJ A;  2HSP A;  1GCQ A;  3MEV A;  1WJQ A;  2W0Z A;  3ZL7 C;  2YRC A;  5CO7 A;  3MKD A;  4M7D A;  1WXU A;  1BB9 A;  3MO8 A;  4DEY A;  1K8A U;  1G8X A;  3OBW A;  2O4X B;  1WDX A;  4RKU E;  3CC4 T;  3KFV A;  1FMW A;  3LWH A;  4KGZ B;  1K73 C;  1I0C A;  2QGG A;  4A54 A;  4DBH A;  2E70 A;  2ROL A;  1I1J A;  1NYG A;  2ZPF B;  2QDL A;  5FWC A;  2PVG B;  4FT2 A;  3BY7 A;  2CGH A;  2E1H A;  2L3P A;  2LZ6 B;  3JCM Q;  2BE9 B;  1NEG A;  1F1B B;  4BAC A;  3UA6 A;  4FCY A;  3X24 B;  3UAT A;  2QA4 Q;  3I55 T;  1Q86 C;  1UGR B;  3RDV A;  3EG3 A;  3VS7 A;  2F5T X;  4HKE A;  1CKA A;  4M78 B;  4ZNX A;  2EWN A;  2C0O A;  3GNG A;  4M77 E;  1TUG B;  1VQ7 Q;  1D1A A;  4M7A G;  2FHD A;  1N27 A;  3OYK A;  1D0Y A;  2P0K A;  3S6W A;  4C8Q F;  3M0U A;  3PIO A;  1YJ9 Q;  1UGQ B;  1WHH A;  3X20 B;  4F14 A;  3L2Z A;  2JS0 A;  3BW1 A;  2BUD A;  2LP5 A;  1WHM A;  4FYY B;  4F7U B;  2RQW A;  1YP5 A;  1CKB A;  2V26 A;  4C92 C;  4C0D B;  1G3T A;  1PM3 A;  1YNZ A;  1YIT T;  2H3E B;  5EG2 A;  1OV3 A;  1NE8 A;  2KK4 A;  3CME Q;  1N8R R;  3JB9 I;  3LH0 A;  5J26 A;  2LC4 A;  1WGS A;  1C6V X;  2EGA A;  1MHN A;  2R57 A;  2MWP A;  2WSF E;  2SRC A;  1XJW B;  3CPF A;  4M75 F;  1NJI U;  3HHT B;  2DXB A;  4M77 D;  5GMK m;  4E7K A;  3ASK A;  3JCM W;  1IB8 A;  5HK3 A;  2FVU A;  3CCV A;  4E2F B;  1M30 A;  3RMS A;  3OW2 P;  2MWO A;  1GCP A;  1M90 R;  2KI7 A;  5CKF A;  4ESR A;  1NBE B;  3GIB A;  3ZFJ A;  3O5Z A;  4LUD A;  1R0C B;  3M4Y A;  1YIJ A;  2DIG A;  3VS2 A;  1PRM C;  3PE0 A;  1ZA1 B;  5LL6 S;  3KUF A;  2J6K A;  4C92 B;  1K9A A;  4KGV B;  3CCJ T;  2QG9 B;  2VXF A;  1U3O A;  3OYC A;  3EAE A;  5IXF A;  2PUO B;  4ELY C;  3M53 A;  5GAN 8;  1KQ1 A;  4A63 B;  8ATC B;  3MPU B;  1YJW A;  2YLB A;  4AFQ C;  2RHX A;  3EGX A;  4B9W A;  4JJD A;  4RTT A;  1SSF A;  5CVI A;  5KE2 A;  1ZUU A;  2KMT A;  4MML A;  3QPH A;  2AIR B;  4GBQ A;  1ZSZ A;  1IGU A;  3CCR T;  3C95 A;  2NUT B;  9ATC B;  1Y0M A;  3P8D A;  4C8Q C;  2YSQ A;  1IZ6 A;  2EQM A;  2LQ8 A;  2KRS A;  4Y92 A;  4M7A F;  2E41 A;  3MP1 A;  4LN2 A;  3QG1 A;  1RL2 A;  3JB9 D;  2QAS A;  1VQ5 A;  2ESW A;  5GAN d;  1JJ2 S;  2FL7 A;  1BIB A;  2YLC A;  2RF0 A;  2BZY A;  2P0Q A;  1AWO A;  3UDC A;  4ZTF A;  3M59 A;  3J81 E;  1Z9Q A;  3PVQ A;  2BIV A;  2K5I A;  1UJY A;  2LVM A;  2W10 A;  2LJ1 A;  5HKC A;  2K5L A;  1K4U S;  4XTY A;  2KXC A;  5GAM f;  4PJN A;  4YTL A;  3OW2 A;  1HK9 A;  2A28 A;  3M0Q A;  1M2O A;  2PU9 B;  1KHI A;  1OPL A;  2BE7 D;  3L2U A;  1SKU B;  3G1J A;  2WSC E;  1TSF A;  4HCB A;  3LLR A;  2VKN A;  1YHQ T;  2K3B A;  4AT1 B;  2CUB A;  1KQ2 A;  2LX7 A;  4J6Y A;  1LNX A;  1YIJ Q;  2DD5 A;  3E19 A;  4OVA A;  3SFM A;  1AEY A;  5LJ5 f;  1K1Z A;  3LGL A;  2M1H A;  2X9H A;  4M75 C;  4FYW B;  4DOV A;  2Y4Y A;  3VYG A;  3OS5 A;  1I8F A;  4FSX A;  2V1Q A;  3REB B;  3EHQ A;  2BZX A;  4M7D E;  3H41 A;  2K4Y A;  1YJW Q;  1PSE A;  3H8Z A;  4C8Q B;  1VYU A;  2LQN A;  1YI2 T;  1KIK A;  1VIE A;  3QXE B;  3QDR B;  2JMA A;  4XTX A;  5A0L A;  4VUB A;  3VV0 A;  2AKK A;  1VYT A;  2FG0 A;  2MPX C;  3CCE A;  4LDW A;  4LD6 A;  2DX1 A;  3PMI A;  2M0O A;  1ZBX A;  2FPF A;  4ZTJ A;  1ZUK A;  1VQO T;  1AOJ A;  1ZUY A;  2RNA A;  4WCI A;  2CUD A;  2CP2 A;  2A3L A;  3INZ A;  1I81 A;  4TVR A;  4OGC A;  4JZ4 A;  5CAI A;  1UHC A;  4MZT A;  1VQ5 Q;  5IT9 E;  1FX7 A;  2M02 A;  1M1K C;  1VQN A;  1U1T A;  1XNI A;  2P84 A;  2O88 A;  1X75 C;  2XU8 A;  1BK2 A;  2Y90 A;  4CC2 A;  1FWZ A;  3BDL A;  1KFZ A;  1FMV A;  2E5Q A;  2RQR A;  1OEB A;  3AT1 B;  3EGD A;  2ZPI B;  2GTO A;  4Q5W A;  4A4E A;  1Q81 U;  1V29 B;  2PQW A;  1G5V A;  3EFR A;  2DF6 A;  5IHI A;  1HJD A;  5LJ3 f;  4PJO B;  5GAM j;  2D0Q B;  4M7D D;  2CH4 W;  5I22 A;  4M7A C;  1SG5 A;  4PFZ A;  1UB4 A;  3OMC A;  3TQ7 P;  1QCN A;  3MJX A;  4M78 A;  5FW9 A;  1ZA2 B;  1TUD A;  4E7J A;  3PVL A;  4PJL A;  4EMG A;  5LJ5 j;  4RTZ A;  4N4I A;  4N4H A;  4QQG A;  4RUG A;  1GXI E;  2YUO A;  4A4K A;  3LX7 A;  2ROT A;  1K8A R;  1XQH A;  1Q7Y U;  4LDY A;  1LJO A;  1VIF A;  2DZC A;  3MET A;  4MDW A;  1PHT A;  1N6A A;  2EQK A;  1WPY A;  4K11 A;  2DBK A;  2XD0 A;  2NUZ A;  2RQT A;  2DL3 A;  4MDX A;  3QZ5 B;  3CCE Q;  1G3S A;  1IO6 A;  4IUQ A;  4RMO A;  2XDD A;  3JCM P;  2XHC A;  2LTO A;  3QWX X;  1KQS A;  4LDU A;  1E6H A;  4BUG A;  3G6E T;  4R56 A;  5CKE A;  2LRQ A;  5GJV B;  3QBY A;  1MUZ A;  2GNC A;  2KAF A;  2PUK B;  1C1A A;  4PL6 A;  4J7F A;  2E64 A;  4IUT A;  4B6M A;  4OB1 B;  1J3T A;  4EPC A;  4M77 F;  2J7I A;  2DKG A;  4JZ3 A;  1VQN Q;  3M55 A;  3I56 T;  2JT4 A;  1BIA A;  2RJF A;  5CCA A;  2DXT A;  4OMQ A;  4M7A B;  4DOW A;  3OYH A;  5AYF A;  1M1F A;  2P0P A;  3CMA A;  2L89 A;  2CT3 A;  2EYW A;  1CSK A;  5DM7 R;  1HSQ A;  1B07 A;  2DXU A;  3CCQ T;  2LJ3 A;  3JCM e;  2X35 A;  5LJ3 j;  1IXD A;  1RUW A;  1NLP C;  2ED1 A;  1AWW A;  6AT1 B;  3EH2 A;  3Q1J A;  1K0S A;  3CC4 A;  2D6F A;  3JB9 J;  1S1N A;  3PNW C;  3CD6 Q;  3EGU A;  1KC8 C;  3HRU A;  3SB2 A;  1BU1 A;  5IN1 A;  3QZ9 B;  2RPN A;  4C92 A;  2KVQ G;  4C8Q G;  2RMO A;  1I5O B;  3L1A A;  2K2V A;  4F16 A;  1T3S A;  1WXB A;  3QYG B;  4CRI A;  2CP3 A;  1RI0 A;  3LH5 A;  1QCF A;  3QJY A;  2MAM A;  5M9O A;  5CK9 A;  2F2X A;  4J9C A;  4OB3 B;  2Z0W A;  4RTV A;  1HYO A;  2YUP A;  3SWN C;  4C0Z A;  3CCM A;  2EFI A;  3REA B;  5A0D A;  4UC4 A;  2ED0 A;  2IPO B;  2QEX T;  2DIQ A;  3EFS A;  2JZ2 A;  2RK1 A;  3HL8 A;  3A8M B;  4J9F A;  1WHL A;  2NUT A;  5GMK e;  1HD3 A;  2MCN A;  2O9S A;  1HXD A;  3JCM J;  4DBF A;  2DVE A;  5CKB A;  3CCS T;  4QW2 A;  5GMK i;  2KGT A;  1VQK T;  4DA4 A;  1UGS B;  2JVV A;  4M75 G;  2O9V A;  4Y91 A;  1YIT A;  1PD0 A;  1JU5 C;  3EFO B;  4FL6 A;  2B8A A;  4HA8 A;  1K9M C;  3WXM B;  2GTJ A;  2ABL A;  4E7Z A;  1G83 A;  1MMN A;  2LJ0 A;  2NYS A;  4KT0 E;  4RCB A;  2VWF A;  2D9T A;  4HVU A;  1VQ6 T;  1UGP B;  5GAO r;  4M77 C;  2M51 A;  2HL3 A;  1EIF A;  3GOX A;  4C0G A;  1MGQ A;  4X9C A;  2DLP A;  5CKD A;  3A8G B;  3QDF A;  1OOT A;  3CCU T;  2X51 A;  3FJP A;  3L42 A;  4FM4 B;  2MMP A;  2CP0 A;  1LVK A;  3V8L A;  4BY6 C;  2FZG B;  4BE2 A;  3SWN B;  3G4S A;  2XID A;  5GAN e;  2ZPE B;  4QVC A;  2PNI A;  1PKT A;  1B34 A;  4J9E A;  2LQW A;  1NYF A;  3JCM V;  2HKN A;  5D6W A;  1YWO A;  3QII A;  1SF9 A;  3MEU A;  2J6O A;  3TEE A;  4XU0 A;  4J9B A;  5GAM d;  5GAO l;  3CCM Q;  2J06 A;  1QKW A;  3NGP A;  1M1G A;  3WVD B;  2HEQ A;  5C6S A;  1ZSG A;  2KEA A;  1WIE A;  1VQ9 T;  1QVG P;  4ZGE B;  3H0H A;  4OMN A;  3OBY A;  4JRQ A;  2QTV A;  2EQI A;  2PVO B;  1OUL A;  2ATC B;  5LJ5 d;  4M78 E;  3VS6 A;  4EMK C;  1D1B A;  3NPF A;  1VUB A;  3GPL A;  3RKX A;  2XDB A;  3M56 A;  2ZPG B;  3OW2 S;  2KY9 A;  4EMH A;  4RTX A;  5KE3 A;  1UTI A;  2YUQ A;  1YIT Q;  1U5S A;  4M7D F;  2EVR A;  1OX9 A;  1K76 A;  2RHU A;  2DJQ A;  3URG A;  3CC7 Q;  3L2Q A;  4RTU A;  3UPU A;  1JBM A;  5I11 A;  2M9U A;  3JCM d;  4PJO A;  4MZM A;  2DM1 A;  4ELZ C;  2OTJ T;  2L2P A;  2QA4 T;  3VS4 A;  2DRK A;  2K3X A;  1JXM A;  4JRK A;  1IRE B;  1MMA A;  5KYX B;  3I35 A;  4F7U E;  2LDM A;  2DE0 X;  4NS5 A;  1VQ7 T;  2AHJ B;  1H3Z A;  5CQX A;  3DB3 A;  1RAF B;  2CDT A;  3I9Q A;  4OMM A;  3G4S Q;  2OI3 A;  1N8R C;  2MOX A;  4F04 B;  4HT9 A;  1NPP A;  4J83 A;  1NM7 A;  2MIO A;  3LWI A;  1YJ9 T;  2YWW A;  2KXD A;  5L8R E;  3O8V A;  3JCM g;  1X6B A;  1Q81 R;  2VGM A;  4QVZ A;  3HTR A;  3A5Z B;  2ENM A;  4M78 D;  1EFN A;  1SRL A;  1WA7 A;  2COW A;  4E7H A;  1YFN A;  4HCC A;  4QKU A;  4EMK B;  4JJC A;  1KD1 U;  1M3A A;  1W6X A;  2RN8 A;  5FRN A;  3H0I A;  1VQ5 T;  3X25 B;  1M90 C;  2KQW A;  2DL5 A;  3CME T;  2JTF A;  2E12 A;  1QVG A;  4LUE A;  5A2Q E;  1Q82 U;  1BCO A;  4II1 A;  1EX4 A;  4D8D A;  2P4T A;  4HT8 A;  4Z8A A;  2DEU A;  3I5R A;  1I5L A;  2JTE A;  4X9D A;  2EQJ A;  1Q7Y R;  5KYU B;  4M7A A;  1R0B G;  1IRX A;  2WSE E;  4LE9 A;  4C92 E;  3CQT A;  1M4Z A;  2M0Y A;  1SEM A;  4J6W A;  2RQV A;  3S3O A;  1VQ8 A;  1OZ3 A;  1GFC A;  3FRN A;  3CBP A;  1RAA B;  1X2K A;  2NLU A;  2CT4 A;  2CSQ A;  2RI5 A;  1QCO A;  1X43 A;  3P8B B;  1TH7 A;  2OJ2 A;  4ZN3 A;  1FYN A;  1DJ7 B;  1JO8 A;  2DZ9 A;  4XQ3 A;  4J9D A;  2HQH A;  1W70 A;  2SEM A;  2O01 E;  2OTL T;  4OMO A;  1GCQ C;  2D0N A;  2X4Y A;  1X69 A;  3L2W A;  1W4S A;  1WLP B;  4M7D C;  2LNV A;  4L6V 5;  2FPE A;  5CQY A;  1OU8 A;  3P8H A;  1GBQ A;  4FSS A;  2WAC A;  2KE9 A;  2V8I A;  3CPW P;  1KQS S;  4OGE A;  3CCV Q;  3FEO A;  1QMC A;  4GLM A;  4L5G A;  5HK0 A;  4N4G A;  1K73 U;  2R5A A;  3A1P A;  1RLP C;  1MND A;  2LQK A;  2RO0 A;  5KYW B;  1GBR A;  4C92 D;  3E1S A;  4JLI A;  4PFO A;  1IHV A;  3HFO A;  1GFD A;  2LCL A;  4PNO A;  1KG1 A;  5IHK A;  1WHK A;  5GAO q;  2GFA A;  1KK7 A;  5GAN g;  4M77 G;  4V2S A;  1Q86 U;  4Y28 E;  1RLQ C;  2L3S A;  1VQM T;  2XMF A;  3ULR B;  1LOJ A;  3V7S A;  3SEM A;  1WJS A;  1X27 A;  5CIU A;  4BI3 A;  1VQP A;  3G6E A;  3EG0 A;  2E3I A;  1KJW A;  2CSI A;  1VQ8 Q;  2EPD A;  1T0J A;  2QQB A;  2ZZD A;  3EFO A;  3HPW A;  2L3Q A;  2ZPH B;  1WZO A;  3FDR A;  4C5I A;  4ZGD B;  1Y71 A;  1LCK A;  2OX7 A;  4LDV A;  1M8V A;  4C8Q E;  3HP9 A;  2FYK A;  4PLL A;  4KRT A;  3I56 A;  3EH1 A;  4OP0 A;  3LGF A;  4IUR A;  1KQS P;  1FMK A;  3VYH B;  1GRI A;  1UHF A;  3N5B B;  4R0K A;  3PFS A;  1YIJ T;  2RJC A;  1OZ2 A;  4BD3 A;  5D6Y A;  3E2U A;  4IIM A;  5GAN 6;  2DBM A;  2VB6 A;  4A4G A;  1ABQ A;  2LCS A;  1D09 B;  1X01 A;  2RJE A;  1YCY A;  4J9I A;  3SWN A;  3JCM b;  3JAM E;  4NL3 A;  3HKS A;  2FO0 A;  3OMG A;  4AFS C;  1SRM A;  4JJB A;  3LYI A;  2O4X A;  1YJW T;  3R6O A;  4J8O A;  2XKO C;  2BZ8 A;  3CPW A;  1RAI B;  3A8H B;  2XDP A;  3JCM c;  4QVD A;  1VYV A;  3FC3 A;  1WQ7 A;  5KCH A;  1QP3 A;  4M75 B;  1MV3 A;  2X4J A;  3HRT A;  1I07 A;  3OYY A;  2K9G A;  3UWN A;  1TUC A;  3FLG A;  3M0P A;  5I2S A;  3CCL A;  3ZEH A;  2ZAE A;  1VQ4 A;  3JV3 A;  3G71 A;  1TG0 A;  3JB9 G;  4PJO E;  2YDL A;  4C5G A;  2CZ1 B;  2EYY A;  2EJF A;  2E4H A;  2KRM A;  4CC4 B;  1X6G A;  4C8Q D;  2FRW A; 
#chains in the Genus database with same CATH homology
 2YUP A;  2KNB B;  3REA B;  4F14 A;  1YN8 A;  2ED0 A;  3I5S A;  1PKS A;  1X2Q A;  2JS0 A;  2E5K A;  2KR3 A;  4J9F A;  2G6F X;  1HD3 A;  2LP5 A;  2O9S A;  2MCN A;  2J05 A;  2RQW A;  1WXT A;  1YP5 A;  1CKB A;  2YUN A;  1YNZ A;  1M27 C;  2KGT A;  5IH2 A;  1OV3 A;  2KT8 A;  3UA7 A;  2JM9 A;  4CC3 A;  1RI9 A;  2KRO A;  2O9V A;  1JU5 C;  2EGA A;  1VA7 A;  2D8H A;  1UUE A;  1QLY A;  2GTJ A;  2ABL A;  1NEB A;  3M0S A;  3IQL A;  2SRC A;  2A36 A;  1G83 A;  5HCK A;  2LJ0 A;  2VWF A;  3EG1 A;  2KT1 A;  4HVU A;  2M51 A;  3SHW A;  3TVT A;  1H3H A;  1PNJ A;  1YWP A;  2DLP A;  1M30 A;  1T0H A;  2F2W A;  1OOT A;  2DVJ A;  4HVW A;  1GCP A;  1H92 A;  2GQI A;  4ESR A;  4EIK A;  2PNI A;  3R6N A;  1PKT A;  3O5Z A;  1AWX A;  4J9E A;  3EHR A;  4LUD A;  4Z88 A;  1UGV A;  2LQW A;  2JXB A;  1NYF A;  3VS2 A;  1PRM C;  3PE0 A;  3RBB B;  3M0T A;  3VS0 A;  5FWB A;  2K7A A;  1E7O A;  1Z9Z A;  2J6K A;  1K9A A;  1ABO A;  1M8M A;  1NG2 A;  2X3X D;  1YWO A;  1U3O A;  2EW3 A;  2AK5 A;  2J6O A;  5IXF A;  1JXO A;  4J9B A;  2DA9 A;  4OMP A;  2CRE A;  2J06 A;  4A63 B;  1QKW A;  2V1R A;  3NGP A;  2DL8 A;  2D8J A;  4HCK A;  2HEQ A;  4AFQ C;  2C0T A;  1ZSG A;  4JJD A;  2KEA A;  1WIE A;  3THK A;  4RTT A;  2EYX A;  4ORZ A;  2DYB A;  3H0H A;  1KSW A;  4OMN A;  2C0I A;  2EYZ A;  2EQI A;  3TSZ A;  1ZUU A;  2LNH B;  4GBQ A;  3VS6 A;  3NPF A;  1MV0 B;  1V1C A;  1W1F A;  1Y0M A;  1PRL C;  2A08 A;  2YSQ A;  4RTX A;  1ZLM A;  2F2V A;  1UTI A;  2YUQ A;  1U5S A;  4AFU C;  2EVR A;  4CC7 A;  2KRS A;  1K76 A;  1ZX6 A;  1SHG A;  2DJQ A;  4Y92 A;  4LN2 A;  4RTU A;  2ESW A;  5I11 A;  4RTY A;  2RF0 A;  2BZY A;  2DM1 A;  1AWO A;  2L2P A;  3VS4 A;  2NWM A;  2DRK A;  3A98 A;  4M4Z A;  1XOV A;  4J9H A;  1JXM A;  1Z9Q A;  3PVQ A;  1UJY A;  2W10 A;  2EKH A;  2LJ1 A;  3VS1 A;  1K4U S;  3I35 A;  4RTW A;  2KXC A;  2DE0 X;  1G2B A;  2A28 A;  3M0Q A;  2CDT A;  3I9Q A;  1OPL A;  4OMM A;  4IIO A;  2HDA A;  2OI3 A;  2MOX A;  2VKN A;  2DMO A;  1WI7 A;  2OAW A;  2K3B A;  1NM7 A;  2MIO A;  2CUB A;  1AVZ C;  4AG2 C;  2AKL A;  2LX7 A;  5ECA A;  1SSH A;  2B86 A;  1WYX A;  2KXD A;  3QWY A;  2KRN A;  1AEY A;  1K1Z A;  1X6B A;  2GGR A;  1M3C A;  1UEC A;  2ENM A;  1EFN A;  1SRL A;  1WA7 A;  1UJ0 A;  1GL5 A;  2V1Q A;  3REB B;  3EHQ A;  1UDL A;  1UE9 A;  2BZX A;  4JJC A;  1M3A A;  2BTT A;  3H41 A;  2A37 A;  1W6X A;  2RN8 A;  2PZ1 A;  1N5Z A;  1VYU A;  2IIM A;  2LQN A;  3H0I A;  3RNJ A;  1AZE A;  2DRM A;  2DL5 A;  1KIK A;  4LUE A;  2JMA A;  1B3Q A;  2HCK A;  2GBQ A;  2AKK A;  1OPK A;  1VYT A;  2FG0 A;  2RQU A;  2DX1 A;  2P4R A;  4D8D A;  2LMJ A;  2FPF A;  2EGE A;  2FPD A;  4Z8A A;  1ZUK A;  3I5R A;  2JTE A;  1T3L A;  1AOJ A;  1ZUY A;  2RNA A;  4WCI A;  2J6F A;  2CUD A;  4LE9 A;  2ECZ A;  3CQT A;  2FEI A;  2H8H A;  2M0Y A;  1SEM A;  2DL4 A;  2RQV A;  4JZ4 A;  1UHC A;  1GFC A;  1SHF A;  1UFF A;  5EC7 A;  1X2K A;  2O88 A;  4CC2 A;  1BK2 A;  2CT4 A;  2CSQ A;  4OML A;  1KFZ A;  1X43 A;  2RQR A;  2OJ2 A;  1OEB A;  1FYN A;  2GTO A;  4F17 A;  1E6G A;  1WX6 A;  2KBT A;  1JO8 A;  2X3W D;  2DNU A;  3VRZ A;  3FJ5 A;  4J9D A;  1W70 A;  1A0N B;  2SEM A;  2DF6 A;  5IHI A;  2KYB A;  1HJD A;  5IXB A;  4OMO A;  1GCQ C;  4JPB W;  3TSW A;  1QWF A;  4E6R A;  2JW4 A;  2D0N A;  1X69 A;  5GJW B;  1WLP B;  2O2O A;  2CH4 W;  2FPE A;  5I22 A;  2DIL A;  2HBW A;  1PWT A;  2PTK A;  1ZBJ A;  1GBQ A;  2D1X A;  4FSS A;  5FW9 A;  1TUD A;  1U06 A;  2K6D A;  2KE9 A;  3GBQ A;  3PVL A;  1YCS B;  4RTZ A;  1WFW A;  3C0C A;  4RUG A;  1AD5 A;  2YUO A;  2ROT A;  2VVK A;  4GLM A;  2YT6 A;  1RLP C;  2K79 A;  1PHT A;  1GBR A;  1BBZ A;  2DL7 A;  3NMZ C;  2JM8 A;  3VS5 A;  4K11 A;  1GFD A;  5IHK A;  2DBK A;  1JQQ A;  2EGC A;  2NUZ A;  2RQT A;  2DL3 A;  1UG1 A;  4X1V A;  4HXJ A;  3UF4 A;  1IO6 A;  1Y57 A;  2KYM A;  3NHN A;  1M3B A;  2I0N A;  3QWX X;  4D8K A;  1E6H A;  1RLQ C;  2L3S A;  1AWJ A;  5GJV B;  1AZG B;  1MUZ A;  2GNC A;  2XMF A;  4HVV A;  3ULR B;  3SEM A;  2L0A A;  1X27 A;  1SPK A;  4Z89 A;  3EG0 A;  3VRY A;  1J3T A;  1KJW A;  2CSI A;  2EPD A;  1T0J A;  2J7I A;  1QWE A;  4JZ3 A;  4DEX A;  2L3Q A;  1NLO C;  2JT4 A;  3VS3 A;  1LCK A;  4OMQ A;  1K0X A;  2K2M A;  3U23 A;  2HSP A;  4KRT A;  2O31 A;  1GCQ A;  2W0Z A;  3ZL7 C;  2CT3 A;  2EYW A;  1FMK A;  3EG2 A;  1GRI A;  1CSK A;  1UHF A;  1QKX A;  1HSQ A;  3M0R A;  1B07 A;  1WXU A;  1BB9 A;  4R0K A;  4DEY A;  1ARK A;  2LJ3 A;  1WDX A;  2JS2 A;  3KFV A;  2CH4 A;  4IIM A;  2DBM A;  1RUW A;  1NLP C;  1I0C A;  2ED1 A;  1ABQ A;  1AWW A;  2LCS A;  1K0S A;  2AZS A;  4J9I A;  2ROL A;  1I1J A;  2FO0 A;  4AFS C;  1SRM A;  1NYG A;  4JJB A;  2AZV A;  2QDL A;  4AG1 C;  1S1N A;  5FWC A;  4AFZ C;  3EGU A;  2L3P A;  2BZ8 A;  2LZ6 B;  1NEG A;  5L23 A;  3UA6 A;  1VYV A;  3UAT A;  1BU1 A;  1MV3 A;  2RPN A;  1I07 A;  2RMO A;  3EG3 A;  3VS7 A;  1CKA A;  2K9G A;  4F16 A;  4ZNX A;  2C0O A;  1TUC A;  1T3S A;  1WXB A;  3M0P A;  3H0F A;  3JV3 A;  3LH5 A;  2EBP A;  1QCF A;  1TG0 A;  2FRY A;  4QT7 A;  2YDL A;  1H8K A;  2EYY A;  2F2X A;  4J9C A;  2KRM A;  2JMC A;  4CC4 B;  4RTV A;  5IHN A;  1X6G A;  3M0U A;  1JEG A;  4LNP A;  2FRW A;  4J9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...