1QWEA

C-src sh3 domain complexed with ligand app12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qweA00
1AWOA 1UDLA 4JZ3A 1ZUUA 1T0HA 3H41A 2DA9A 1ARKA 2ROLA 1WX6A 2ESWA 4X1VA 1AEYA 1YNZA 3QWXX 1CKAA 1VYVA 5IHNA 1OEBA 2JS0A 2K2MA 1UHCA 1UJYA 2DL3A 2LMJA 1CSKA 1SHGA 2K9GA 2ROTA 3RBBB 1X2QA 2KEAA 2RQUA 3LH5A 1K1ZA 2L2PA 1NLOC 2OAWA 2ENMA 4AFUC 3M0UA 1GCPA 1RUWA 1M30A 1SSHA 1JXOA 1K4US 2EVRA 2EGEA 4AFSC 1PRLC 2KRSA 2OI3A 4J9HA 4HXJA 2F2VA 4D8KA 1AWXA 2PNIA 4RTZA 2F2XA 3M0SA 3EG2A 2EBPA 1K0SA 2L0AA 1E6HA 2HEQA 4J9EA 1AD5A 4OMPA 1GL5A 1SEMA 2JMCA 1BBZA 2CUDA 2RQRA 4ZNXA 1SRMA 1FMKA 1QCFA 3O5ZA 4R0KA 1W70A 1Y57A 1G83A 2KGTA 4JJBA 1X69A 3TSWA 2O31A 1M3BA 2CUBA 2HDAA 2EKHA 3CQTA 5FW9A 3EGUA 4FSSA 5FWBA 4Y92A 4OMNA 2DVJA 2PZ1A 4LUDA 3M0TA 1PRMC 2J6FA 2JTEA 2CT4A 1WXUA 4D8DA 4OMMA 4J9IA 1H3HA 3I9QA 3VRZA 2CSIA 4LUEA 2KT1A 1AOJA 3VS7A 2F2WA 2RF0A 3EHQA 4JJCA 2DYBA 2FO0A 1I0CA 1SPKA 1NLPC 2A08A 2I0NA 3VS3A 2DBMA 2A36A 3U23A 1X6BA 2LQNA 1EFNA 2KE9A 3UA6A 1VA7A 1JQQA 2DNUA 2VWFA 4HVWA 1V1CA 2EYXA 4ESRA 3QWYA 2JMAA 3UF4A 1PHTA 1WA7A 2BZ8A 1BU1A 2MOXA 1W6XA 2KR3A 2ABLA 3C0CA 3VS2A 1ZSGA 2XMFA 2SRCA 3TSZA 3VS5A 4F17A 1Z9QA 4J9DA 3EG1A 3I35A 2FPDA 2C0OA 3ULRB 3NGPA 1OOTA 4JPBW 2DLPA 1X27A 2LJ3A 2K79A 5IXBA 1UG1A 2DMOA 2W10A 2J6KA 2RMOA 1UTIA 2C0IA 1KJWA 1HJDA 1JU5C 1B3QA 5I22A 3R6NA 1WDXA 1AVZC 2EYYA 4CC4B 4EIKA 1ABOA 1KSWA 3FJ5A 3H0FA 2DL5A 1ZX6A 2LP5A 1WI7A 3THKA 4JZ4A 1OPLA 3VS1A 2FEIA 2FG0A 1U5SA 3EHRA 4AG2C 3NPFA 2KBTA 5GJVB 2BTTA 1LCKA 5GJWB 1SHFA 2DJQA 1GBQA 5FWCA 2RQWA 4E6RA 4ORZA 1W1FA 1XOVA 2V1QA 2D0NA 2L3PA 1E6GA 2J06A 3NHNA 1M3CA 1U3OA 2GBQA 2MIOA 1WIEA 4J9BA 3EG3A 1QKXA 3TVTA 2K3BA 1ZLMA 2J7IA 2YT6A 5ECAA 2CREA 1UHFA 2CSQA 5IH2A 4RTYA 2HSPA 2YUOA 2SEMA 3M0RA 2X3WD 1BB9A 5EC7A 4K11A 2DRKA 2GGRA 1A0NB 2FPFA 2B86A 1N5ZA 1CKBA 1JXMA 2FRYA 2A37A 3IQLA 5IHIA 4RTWA 2OJ2A 1RLQC 2KXCA 1Z9ZA 3SEMA 2EPDA 4HVUA 2JM9A 1HD3A 1M27C 1YN8A 5IXFA 4QT7A 1ABQA 3ZL7C 1AZGB 2W0ZA 1AWWA 2GTOA 1FYNA 1QWFA 1T3LA 1YP5A 1M3AA 2FRWA 5I11A 2DL7A 3M0QA 4GLMA 4J9CA 2AZSA 4GBQA 2YSQA 2GTJA 2VVKA 2KYBA 4CC7A 1NEGA 1NM7A 4J9FA 1AWJA 2JT4A 2NWMA 3VRYA 3KFVA 2A28A 2LNHB 4RTVA 4LE9A 2JW4A 3GBQA 4OMOA 1M8MA 1HSQA 1KIKA 1TUCA 1X43A 1NYGA 2H8HA 2K6DA 2O9VA 1PKSA 2ED1A 2CH4W 4Z89A 1QLYA 1SRLA 2QDLA 1OV3A 4LN2A 2RN8A 3REAB 2IIMA 1WLPB 3UATA 3VS0A 4OMQA 4RTTA 2YUNA 1GCQA 1QWEA 2RPNA 1NYFA 2L3SA 3VS6A 3NMZC 4LNPA 1BK2A 4J9GA 1TG0A 1UFFA 3RNJA 1UJ0A 1JEGA 2K7AA 2KNBB 2P4RA 1UUEA 2EYZA 2DL4A 3I5RA 1UECA 2AZVA 1JO8A 3A98A 4IIMA 1UGVA 1RLPC 2CH4A 3PVLA 1IO6A 2JM8A 5L23A 2FPEA 1GCQC 1MV3A 2DF6A 2DM1A 4AFZC 4CC3A 3EG0A 1MV0B 2J05A 2KT8A 4KRTA 2EGCA 1PKTA 4HVVA 2LJ0A 1I07A 2ED0A 2AK5A 1ZUKA 1AZEA 1TUDA 2LJ1A 4Z8AA 5IHKA 1VYTA 1ZBJA 3PE0A 1Y0MA 1VYUA 1WXBA 2D1XA 1YWPA 2PTKA 2RQTA 2DX1A 1GBRA 4DEXA 1I1JA 2YDLA 1OPKA 2KRMA 2EQIA 1MUZA 2M51A 4HCKA 5HCKA 2DRMA 4AFQC 1NG2A 3H0IA 1NEBA 2CDTA 2DE0X 2JS2A 4CC2A 2HCKA 2BZYA 2G6FX 2YUPA 2YUQA 1K76A 1ZUYA 1J3TA 2DILA 2D8HA 2O88A 4AG1C 1WYXA 2HBWA 1QKWA 1PWTA 2ECZA 2O9SA 3I5SA 3JV3A 4DEYA 4JJDA 4F14A 3UA7A 2EGAA 1T0JA 2AKKA 2V1RA 2LQWA 4Z88A 2DBKA 2GNCA 2AKLA 1H92A 2BZXA 1S1NA 1G2BA 1H8KA 4RTXA 1KFZA 2L3QA 1RI9A 1K0XA 2JXBA 2D8JA 2CT3A 1GFCA 4WCIA 1GRIA 1U06A 4RUGA 2O2OA 3VS4A 2DL8A 3M0PA 3H0HA 2M0YA 2GQIA 2RQVA 1E7OA 2EYWA 4IIOA 2KXDA 4OMLA 2X3XD 2MCNA 2KYMA 1B07A 1WFWA 1YCSB 1K9AA 2NUZA 4A63B 1X2KA 2KROA 2LX7A 3SHWA 1T3SA 2VKNA 2KRNA 1UE9A 2LZ6B 2J6OA 2C0TA 1WXTA 2EW3A 1YWOA 2RNAA 3PVQA 1PNJA 4RTUA 2E5KA 4M4ZA 4F16A 1X6GA 1GFDA 2LCSA 3REBB
chains in the Genus database with same CATH superfamily
3OYEA 1AWOA 2KDSA 2DA9A 3SFMA 1R0BG 2MMPA 3EFOA 3TCJA 5GAMh 1ARKA 1WX6A 1D3BB 2L89A 4M78C 4M77C 1YNZA 3QWXX 3M58A 5GAOp 3G1JA 2K9GA 3FC3A 1RACB 2RQUA 2HQXA 3KBGA 2CYZB 2DXBA 1NLOC 1EIFA 4ZTJA 1GCPA 2YRVA 1M30A 2DFUA 3LW5E 3I56T 4N4GA 3OSSC 2GFAA 1PRLC 1QP2A 1TH7A 5KE3A 4JUVA 3M53A 4HCCA 1Q82R 3M0SA 1K0SA 4DQ2A 5HK3A 1AD5A 3OB9A 4DOWA 4LDXA 3CCJA 5LJ5f 1PD1A 1YI2T 1YJWA 4IURA 2VYTA 1HK9A 1X69A 4E7HA 2YRCA 2KY9A 1VQLQ 2DAQA 1UGRB 3J7AF 2CUBA 2HDAA 2LQKA 1HXDA 4XU0A 2ZPIB 4FSSA 2Y4XA 3LWHA 4Y92A 2PZ1A 2FVUA 3M0TA 3UWNA 2CT4A 3EGXB 3OA6A 3L1AA 3MPUB 1YJNT 1WHKA 3VS7A 5HK0A 2RF0A 4C0DC 4FYWB 2QGGA 3G4SA 3RERA 1NLPC 2I0NA 2PQWA 4HT8A 2A36A 2NUPB 3UA6A 4LDUA 3CCJT 3TQ7P 1JQQA 3JB9J 1ZA1B 1LJOA 3EGXA 5GANg 3SDZA 4C8QC 2MOXA 2RHUA 3C0CA 3HRUA 3VS2A 1H641 4IKFA 2XMFA 3UDCA 3CPFA 2SRCA 4F17A 1Z9QA 3EG1A 4LD9K 3I35A 2E1HA 2CP7A 4J6WA 4JPBW 2LJ3A 2NUPA 2QDYB 2W10A 2J6KA 2RMOA 3I56Q 1HJDA 1SKUB 2XHCA 5I22A 3R6NA 1I81A 5KYWB 1ABOA 1KSWA 1KHCA 1N6AA 3FJ5A 1KHIA 1XTDA 3H9NA 4C0FA 3V7SA 1ZX6A 5CKHA 1WI7A 2FG0A 2JN0A 5A0DA 4FCYA 2PUOB 1G3SA 5GJWB 1SHFA 3I55A 4L6V5 2IG0A 2OX7A 1XOVA 2V1QA 3OYYA 1ZA2B 1JJ2A 5KYWA 4BE2A 4XTZA 4DBQA 4ZGJB 2LC4A 2J06A 2E64A 1M3CA 1U3OA 2MIOA 1XQHA 4M7DC 1ZBXA 4J9BA 4M7AE 4LD6A 2DTHA 3TVTA 4MZTA 4RTYA 4V2SA 2HNIA 3WVEB 4PJLA 3MEUA 2GGRA 4KUDK 1N5ZA 3C4SA 4L5GA 3V8KA 5KYNA 2FRYA 4FL6A 3Q1JA 5KH6A 3OMCA 3VYGA 1G3WA 1RLQC 1N8RU 2KXCA 1Z9ZA 4C5EA 2MWPA 4CI0C 3CPWS 4M77B 1D0XA 1WPYA 4HVUA 2JM9A 1YJWQ 1YN8A 2JNGA 2DD5A 4EMKB 3CCQA 2CS7A 3I55T 1ABQA 1YCYA 2Y4YA 4MDWA 1X6OA 2XDBA 3L2QA 1FYNA 3S3OA 4PK4A 2DL7A 2DXCA 2ZPFB 4GLMA 2YSQA 2EAYA 2XIDA 3X26B 1AWJA 2NWMA 1RAFB 3KFVA 2LNHB 4C92D 4RTVA 4PLIA 2JW4A 1C1AA 4EMKA 4M75B 4AT1B 4J8OA 2H8HA 2K6DA 1Q7YC 2ED1A 3ZBDA 3NTIA 2MYSA 3P8DA 3G4SQ 2K2VA 4BDZA 3REAB 3OYLA 3RUXA 1QVPA 2EQKA 3NTKA 3JB9F 4M7AF 3CMAA 3A8OB 3M4GA 1PC0A 2L8DA 2E70A 4EMHA 3CC2A 4RG8A 4M75A 5GAN4 2OTJT 3CCMQ 2F69A 4OB0B 3OMGA 3MP6A 1WHLA 4J9GA 4XTVA 1TG0A 4XK8E 4JRKA 9ATCB 3DKMA 1UJ0A 2CZ7B 1JEGA 1D0ZA 1VQ5Q 1UUEA 1QMCA 2DL4A 3CMEA 1RL2A 2QG9B 4M75E 2CH4A 3EG0A 2KT8A 3LX7A 4ATOA 4KRTA 2EGCA 1PKTA 2QQBA 2O01E 3ER0A 4MZMA 1KD1U 1ZUKA 1AZEA 1YITA 4MMKA 5J3BA 2D1XA 5GAOn 4C8QB 2P84A 4JS4A 1GBRA 2EJGA 2KRMA 1WGSA 4O6JA 3CMAT 1I4K1 4HCKA 5HCKA 3I55Q 4AFQC 4E7JA 3A8HB 5LJ3h 3CC2T 1NEBA 4HT9A 4J6XA 4IUQA 2DZ9A 1MMNA 1K76A 1RAAB 2O88A 3META 1QVFA 3OYFA 3M4YA 2MPXC 5LJ3e 2ECZA 3JCMf 2RK1A 5LJ5g 4JJDA 4KUIA 2OAUA 3CMET 1GXIE 1VQOA 3O8VA 4KH0B 2RB6A 2LQWA 2COZA 3CCVA 1K8AC 2LNVA 4A4KA 1OQKA 2GNCA 1QW1A 3JCMJ 3EG9B 5FRNA 4ZN1A 3CXCS 3VJPA 3PIPA 4C5GA 1U8RA 3CCSA 1O75A 3M57A 2C06A 1YITT 4M75G 1S72Q 4DOVA 4RUGA 2O2OA 4EPCA 3VS4A 2DL8A 3CXCP 3H0HA 1VIEA 4Z02A 1I8FA 3CCQQ 4QW2A 1WQ7A 3PIOA 3RESA 1RAEB 2K5IA 3V7RA 2P0QA 4XQ3A 2NUZA 2X4JA 3EG9A 1M1GA 2VKNA 1V76A 3AT1B 2J6OA 4FYYB 3MJXA 4PFZA 2EW3A 4PJOF 2RNAA 2JTFA 1M90U 3CEYA 3E2UA 2P0KA 1VQ8Q 1VQOT 1UDLA 1H3ZA 3CCVT 1N8RR 3PT9A 2ROLA 5GANh 4BE1A 4X1VA 4M77D 1AEYA 5IHNA 1OEBA 2K2MA 1ACMB 1NBEB 1UJYA 4R56A 2LMJA 3CD6A 2DTOA 1BCOA 1SHGA 3CCST 4OMFB 1AT1B 2EQJA 1X2QA 2KEAA 3LH5A 3CMAQ 2RJFA 1K1ZA 5CKDA 2OAWA 5GMKi 4ANJA 4QQ6A 5GANe 5LJ3j 2KI7A 3CC2Q 1SSHA 3DB4A 3OS1A 5KCOA 1VQLA 4AFSC 1BIBA 1LVKA 1OX8A 2KRSA 2FZGB 2HQEA 3LWIA 4RTZA 3UPUA 2F2XA 3EG2A 5D7UA 2L0AA 1YIJA 4J9EA 4OMPA 5GAN2 3SD4A 1W2BS 2HD0A 3CMEQ 2JMCA 1BIAA 4KT0E 5DLQE 4JDSA 2A7YA 3O5ZA 4R0KA 5HKCA 2V8IA 1W70A 1Y57A 4QVCA 1M2OA 4FYVB 8ATCB 3OYMA 3QPHA 2AIRB 1VQPQ 3CD6T 2HL5C 3EGUA 2HKQB 5FWBA 3QO3A 1MMDA 3JCMX 2NLUA 4D8DA 4J9IA 1H3HA 2H3JA 2CP2A 2CSIA 1VQLT 5GAMf 3E1SA 1K73U 3WXMB 4IUUA 3EHQA 2CZ0B 1BKBA 3JCMb 5EG2A 2FO0A 1I0CA 4PJJA 4WF2A 4ELYC 3CC7Q 3BFMA 1YIJT 2PVDB 2A08A 1JRIA 3A1PA 1ZSZA 2E3HA 4PNOA 2KE9A 1VQOQ 1KD1R 2RI3A 2DNUA 2VWFA 1KD1C 3CCVQ 3ME9A 3UF4A 1WA7A 4A4GA 4C8QD 3QG1A 5GANj 1QVGS 2GF7A 2LRQA 1W6XA 1ZSGA 3S3MA 3P8BB 3CCSQ 2GCXA 3DLMA 3L2VA 2FPDA 1VQ7A 1G8XA 2RHIA 3G7ZA 3JAME 2DLPA 3INZA 3JCMV 2PU9B 2K79A 1I5OB 1P92A 3LLRA 1UTIA 2BE7D 2C0IA 4LDVA 2PUKB 1NJIU 1JU5C 2CP0A 2CKKA 1UEBA 4EMKC 1AVZC 2EYYA 2XG8D 5J39A 3RIRA 5D6YA 4BUGA 1X75C 3X28B 5LJ3g 1IHWA 4JZ4A 1OPLA 4FSXA 4AG2C 3NPFA 3RKXA 3JCMP 2KQWA 2DJQA 1GBQA 2EQUA 4ORZA 4ZGDB 4NL2A 1Q82C 3C12A 2D0NA 4M75C 2L3PA 3V8LA 3TREA 2XD0A 3BDUA 3CD6Q 4J7FA 4M7DD 1D09B 2RM4A 4X9CA 4TVRA 1VQ7T 1QKXA 3QBYA 1YBYA 3OS2A 4L59A 5ECAA 4OF1A 2CREA 2VGNA 4JRPA 2R58A 3M0RA 1OZ2A 2VC8A 2X3WD 2YLCA 4RMOA 2FPFA 1QQJA 2RHYA 3HPWA 1M90R 2F5KA 1CKBA 3BE3A 1YIJQ 1JXMA 1M90C 3IQLA 1UB4A 5IHIA 2DERA 4LDYA 3CCEQ 5L8RE 2LTOA 2X4WA 4KGVB 3OYHA 1NPRA 2MK5A 1HD3A 1XNIA 2BKDN 1PSFA 3E9FA 4J83A 4OGCA 1AZGB 1WHJA 2QYZA 3OBYA 1YP5A 2DKGA 3RMQA 3M0QA 1Y07A 3ASKA 1NE8A 4GBQA 1Q95G 2VVKA 5C0MA 3QDRB 1LNXA 1NM7A 4BE0A 2RK2A 3VUZA 3JCMg 1YJWT 2YXYA 4II1A 3CCMA 3QYGB 4OMOA 5LJ5h 3PFSA 1KIKA 1TSFA 4KBMB 4FT2A 2O9VA 1QLYA 3CBMA 1VQ5A 2RN8A 4M7AB 2E41A 1B7TA 4RKUE 5LJ5e 4R55A 2R57A 3QKJA 2RD1A 5A2QE 2K57A 2YUNA 1GCQA 1QWEA 4E7ZA 2A3LA 1SSFA 3G4ST 4OVAA 1NYFA 4O5VA 1WJRA 3NMZC 2AHJB 1W4SA 3GLXA 4NOYA 3V8JA 3RNJA 1VQ7Q 5IN1A 4M7AA 8AT1B 2RJDA 2GFUA 2P4RA 2EYZA 3I5RA 1UECA 1K73R 3A98A 3QDFA 1BI2A 1RLPC 3M59A 3A8LB 2JM8A 3PVLA 4LXCA 5CQXA 4CC3A 3CCMT 2LX9A 4Y28E 2RHZA 4HVVA 2LJ0A 4NL3A 1I07A 2ED0A 1FMWA 2AK5A 2LJ1A 3L2ZA 1Y0MA 4FU6A 1VQ5T 2JUFA 5GAOq 2DX1A 4DEXA 1I1JA 4C92F 2EQIA 3RKWA 2M51A 5KCHA 2XDPA 2DRMA 2ATCB 4IUTA 3A5ZB 3JB9H 4JRQA 1NG2A 3H0IA 2FZCB 2CDTA 1RADB 2JS2A 2KK4A 1MHNA 4JLGA 2YUPA 4HCBA 1S72A 1JBMA 3QJ6A 1NJIR 2XDDA 3M56A 1TS9A 3H8ZA 1WYXA 4PKCC 2DEUA 4BI8B 2DETA 2O9SA 2RA2A 3CPWP 3MHXA 5CK9A 1VOMA 5LJ5j 3H6ZA 1SG5A 1M5Q1 4JRIA 2NUTA 3GIBA 2EYQA 2GQVA 2DEQA 1KFZA 2I2LA 1PG5B 1K0XA 3OS0A 2JXBA 2D8JA 5AT1B 2G3RA 4PJMA 4WCIA 1VQ8A 2H3EB 5CO7A 3EGDB 2RH2A 3M9QA 2RQVA 2HL3A 1BYMA 1Y71A 1E7OA 5KYYB 3D7SB 2KXDA 2HQHA 2CZ6B 1AHJB 3JB9G 4M7AG 4MDXA 2EFIA 2QASA 5FLXE 1X2KA 3SHWA 2DYIA 1KQ2A 2DXUA 3DLLA 3GNGA 1OU9A 1UE9A 1M1KU 1S72T 1K9MU 3CCUA 4WTOB 2DTIA 2DO3A 3CCQT 3EGDA 3EH1A 4RTUA 1C0MA 1FXXA 1M9SA 2P4TA 1N9SA 4Y91A 1KC8R 1KK7A 1ZSZC 2QI2A 5KYYA 1GFDA 2LCSA 2QA4Q 4JZ3A 4M78E 1T0HA 3H41A 4X9DA 4E7LA 3SB2A 2ESWA 1UGSB 1CKAA 1VYVA 4PJOA 2DL3A 4MMLA 1CSKA 4BDYA 4N4HA 4EDUA 4B9WA 5GAN5 1VQ8T 2QTXA 2ENMA 4AFUC 5LJ3d 1RUWA 1JXOA 2EGEA 4PJOE 3ZFJA 1OZ3A 4D8KA 4XTXA 2PNIA 5I21A 2WACA 2COWA 1VQPA 1WZOA 3TU4K 2DK3A 2BE9B 4DBFA 3EAEA 5DY9A 1SEMA 3CCUT 2K5FA 1BBZA 2RQRA 2E10A 4ZNXA 5FU6B 1FMKA 2WSFE 1QCFA 3FJPA 3J80E 2KGTA 4JJBA 2ZPHB 3X25B 2QAZA 1JJ2S 4M7AD 3CCRQ 4EMGA 1BI0A 3TSWA 3CBOA 2QQAA 3CC7A 4J7IA 1M3BA 3HTRA 3OYGA 1R8OB 2EKHA 5FW9A 1SF9A 3FDRA 3OY9A 5IT9E 4N4IA 4LUDA 3ZEHA 2DXTA 4DA4A 1G3TA 1PRMC 2J6FA 3PGGA 2JTEA 5FROA 2E12A 4OMMA 2JVVA 3I9QA 3GOXA 4M77F 3T9NA 4M78F 1KQSS 2F2WA 4J5YA 1VQ9A 1ZQ1A 4OB3B 1VQPT 4FIBA 1SPKA 5DLOA 4F7UF 3VS3A 3R6OA 3PTAA 4FW1A 1KQSP 3U23A 1X6BA 3OS5A 2LQNA 1PD0A 1EZZB 3FRNA 3GNFB 4HVWA 4PJOG 1WJSA 2EYXA 1V29B 4ESRA 3QWYA 4BI4A 2CP5A 5KYUA 1MMAA 5GANd 3JCMd 2BZ8A 1BU1A 2ABLA 3E19A 3CC7T 3P8HA 3MKDA 1PM3A 3TSZA 4JJNK 3C94A 3ULRB 5CVIA 3QZ5B 1Q86U 1F1BB 1UG1A 3JCMh 2QQ9A 1N8RC 1WDXA 1VQKQ 1YFNA 3H0FA 2DL5A 2LP5A 4UC4A 5CKEA 1VQ9T 3CCUQ 4A4FA 3THKA 1Y96A 2M02A 4C5IA 3JCMe 2E65A 2KBTA 2BTTA 3OW2S 3HFNA 1WHMA 1LCKA 5GAN6 5FWCA 2RQWA 1W1FA 3OW2P 4M75D 1E6GA 2RJCA 3NHNA 2BUDA 3CCEA 4HA8A 1WJQA 1B34A 2FB7A 4GY5A 2YHTA 2M9UA 1PCXA 4M7AC 1W2BP 3RR6A 1ZLMA 2J7IA 2WSCE 2L3RA 2YT6A 2EJ9A 4PL6A 2IPOB 2CSQA 1M1KR 1N27A 1K9MR 4C8QF 1BB9A 3OQ5A 4K11A 1WHHA 2DRKA 3RKYA 1A0NB 1K9MC 1G3YA 2B86A 3L2RA 2MAMA 1YJ9A 1ZSZB 2XK0A 4B6MA 2BIVA 2E3IA 1TTHB 5KE2A 4RTWA 5GMKl 3SEMA 1OYXA 1IXDA 1M27C 3FEOA 3WVDB 5KYXB 4JLIA 4QT7A 3JCMW 1Q81U 3LGLA 2W0ZA 1TOVA 5FU7B 3L2UA 2ZPBB 2GTOA 1T3LA 1QWFA 1RAHB 2FRWA 1M3AA 5I11A 1QVFS 2V8JA 3CCET 2AZSA 2CP3A 4A53A 4CC7A 4PJNA 4J9FA 4QVDA 2JT4A 1FX7A 2A28A 1QVFP 2RO0A 5KYXA 5C6SA 1TUCA 1BI3A 5CR2A 2ZPGB 1X43A 2KAFA 1IZ6A 3MEAA 1QVGP 1VQ4A 1VQ9Q 1WQWA 5GMKm 4FT4A 1YJ9T 4M7DF 5I2SA 4JS5A 4ZTFA 1D1AA 2DJZA 3LH0A 2JZ2A 3VS0A 3QYHB 1RABB 4DBRA 2FL7A 3LGFA 4E7KA 3OYKA 4PFOA 3TEEA 1OU8A 3M54A 3QIIA 4HKEA 1LPLA 2RPNA 4A54A 5CKFA 2A0FB 2RI5A 2L3SA 5D6XA 5M9OA 4ZN3A 3OBWA 4ZGEB 1UFFA 3OSVA 3OYJA 4BB7A 4BD3A 5I2MA 2DIGA 1QP3A 2AZVA 1JO8A 3JCMQ 4IIMA 1RAGB 1YHQA 3MP1A 3QZ9B 5L23A 2FPEA 4AFZC 4XU1A 1DJ7B 4C0ZA 5GAMe 5A0GA 4RCCA 2B8AA 2R5MA 2E6NA 1VQ4T 1TUDA 1YJNA 1IB8A 5IHKA 2RHXA 3HRTA 2DIQA 1BI1A 4C92B 1D3BA 4C5HA 3QXEB 2LQ8A 1VYUA 1WXBA 2RQTA 3MEWA 2QXFA 4PJOC 3PNWC 2HMAA 1Q7YU 1TXQA 1MUZA 4B9XA 3CPWA 3LYIA 1KC8U 7AT1B 1Q86R 1VQMA 1UGPB 2ZPEB 2X9HA 2DVEA 2HCKA 1Q86C 5GAOr 2CZ1B 3CC4A 1VIFA 2HAXA 2YUQA 2JOYA 1TWBA 1J3TA 2DILA 2D8HA 4C92A 3BDLA 2LVMA 1U1TA 2HBWA 1JB0E 1QKWA 2EWNA 3I5SA 3N5BB 3UA7A 1OULA 5A0LA 2F1LA 5D6WA 2EGAA 2L5QA 4GLKA 5LJ5d 1YHQT 1T0JA 2AKKA 2V1RA 4KGZB 3DB3A 4Z88A 3VV0A 2RJEA 1QCNA 2BZXA 1S1NA 2CP6A 4C92E 1YJ9Q 2L3QA 1RI9A 2XKOC 3BW1A 4ELZC 5DM7R 3OYBA 3JRZA 1EX4A 1FMVA 4A4HA 1M8VA 3NFCA 2QA4A 1M1FA 2EYWA 4IIOA 5FU6C 2X3XD 2IVWA 1M2VB 2M0OA 2XICA 4PFPA 1B07A 2EKOA 1NZ9A 3SWNB 3F70A 2QEXA 2OTLA 1VQMT 2KROA 2LX7A 5GAMj 4IUVA 3CC4T 4BACA 3MEVA 2HBPA 2LZ6B 3OYCA 2VGMA 3PVQA 1PNJA 2O4XB 3FLGA 4KGXB 3A8GB 2E5KA 4M4ZA 1X6GA 4X34A 3REBB 1D0YA 2EJFA 1M2VA 1ZUUA 3SWNA 3E9GA 1VQ4Q 4E7SA 2NYSA 3M5AA 2JS0A 1UHCA 2JTMA 2X51A 3VYHB 1Q81R 2KMTA 1K8AU 2ROTA 3RBBB 2P0PA 1K73C 1BCMA 2L2PA 1Q81C 2O4XA 2QA4T 4OP0A 3M0UA 3CCRA 5FRMA 1YI2Q 1K4US 2K4YA 2EVRA 1IGQA 4C92G 3CCLA 4OGEA 2OI3A 4J9HA 3VUBA 4HXJA 2F2VA 3GF5A 4QQDA 2QEXT 2Y90A 2OTLT 1AWXA 4F04B 2K3YA 2E4HA 1MGQA 2LT1A 4BY6B 2EBPA 1VUBA 1E6HA 2HEQA 1GL5A 3OYIA 3EFSA 2CUDA 3BY7A 1SRMA 2NUTB 1YHQQ 2M16A 1G83A 3S3NA 4E47A 3GP8A 4AMCA 5GAOl 1YJNQ 1VQ6A 2O31A 5CKBA 3L2WA 1NJIC 3CXCA 4XU2A 2VXFA 2V8KA 3EH2A 5GMKh 3CQTA 1KQSA 4OMNA 2DVJA 3HSBA 1G5VA 3URGA 3CCJQ 2YLBA 1WXUA 3CCRT 2CGHA 4M78B 4N0AA 1U1SA 2PVOB 3VRZA 1M4ZA 3CCLT 1VQMQ 4LUEA 1C6VX 2HKNA 2KT1A 1AOJA 3CC4Q 3G71A 5GMKe 2OTJA 4F7UB 4JJCA 4LDWA 2DYBA 4FM4B 3A8MB 2DBMA 3RDVA 1EFNA 1VA7A 2M1HA 1VQKA 5GAMg 5GAOm 1V1CA 4QVZA 4M77A 2JMAA 4M78A 1PHTA 5CQYA 3GPLA 4PJOB 3PMIA 4KH1B 4PLLA 2KR3A 1Q7YR 4F7UA 1KG1A 1VQ6T 3VS5A 4J9DA 2C0OA 3NGPA 1OOTA 1X27A 2FZKB 4E2FB 2LT4A 1KC8C 4M77E 3L42A 2MWOA 5LJ3f 5IXBA 3G6EA 2DMOA 3QUIA 1IRXA 1KJWA 1B3QA 1OI1A 3M55A 2QEXQ 4F7UE 2OTLQ 1RI0A 2EQMA 4CC4B 4EIKA 3RMSA 2RI2A 3OW2A 5GAN8 2DD4A 1QCOA 2WSEE 3G71T 5GAN3 5J26A 5FU7C 2QQRA 2X4XA 3VS1A 2FEIA 4Q5WA 1U5SA 3EHRA 2MF2A 2XI9A 5GJVB 1W2BA 5LL6S 1VQKT 3HP9A 4C0DB 4E6RA 1I5LA 3X24B 2QK0A 5CIUA 1X01A 1FWZA 2GBQA 4XAXB 4CRIA 1VQNA 5GMKj 1WIEA 3EG3A 2VUBA 1RAIB 4J6YA 2K3BA 3JB9D 4KULA 4A4EA 3G6ET 4IUPA 1UHFA 2K5LA 5IH2A 2HSPA 3CCLQ 2YUOA 2SEMA 3V7CA 2VASA 5EC7A 1WNLA 2YRDA 1JJ2P 4QKUA 1IREB 2QQSA 4DBHA 2QTVA 1IGUA 2V26A 2A37A 4M77G 3KXTA 4M78G 2OJ2A 4OB1B 1TU0B 2EPDA 5KYUB 2ZZDA 3MO8A 4F7UG 4C8QA 6AT1B 5IXFA 3AHUA 5GANf 1HYOA 3ZL7C 2E6ZA 3HRSA 1K8AR 1AWWA 1O9SA 4XTUA 1VQ6Q 1ZHIA 1QVGA 3FB9A 4J9CA 1VQNT 2HZYA 2GTJA 2KYBA 2D9TA 1NEGA 5HY6A 4C8QE 3VRYA 4D6WA 4C92C 2R5AA 1Q82U 2JJ9A 3X20B 4LE9A 1IHVA 1D1CA 3HFOA 2D0QB 4XU3A 3GBQA 1M8MA 3UT1A 1HSQA 2VB6A 2YWWA 3VU3C 1MNEA 5GAN7 1NYGA 2HSEB 3MP8A 3MCAB 3G71Q 1PKSA 1Y7XA 2OTJQ 1Y96B 4M75F 2CH4W 4M7DB 4BI3A 4Z89A 1SRLA 3HL8A 2QDLA 5CCAA 3JCMc 1OV3A 4LN2A 2KVQG 2VV5A 2IIMA 3PMTA 2X35A 2DZCA 3FIFA 1WLPB 3UATA 4ME7A 3QJYA 4OMQA 4RTTA 1MNDA 3EFRA 4HCZA 1B34B 3VS6A 3OYNA 4M7DA 4LNPA 2D6FA 1BK2A 4M78D 1UGQB 2K7AA 2KNBB 2FHDA 2E5QA 3G6EQ 3KUFA 1UGVA 1IO6A 1GCQC 1MV3A 2DF6A 2DM1A 2LDMA 1MV0B 2J05A 4QQGA 2EIFA 4M7DE 4NS5A 1NPPA 3SWNC 1PSEA 4C8QG 2PVGB 4Z8AA 3HKSA 1VYTA 1ZBJA 3PE0A 3S6WA 2PTKA 1YWPA 2XU8A 3QHSA 4PJOD 4P5NA 2YDLA 4RCBA 2F5TX 1OPKA 4C0GA 1M1KC 2LCLA 4XTYA 4YTLA 3JB9I 2ZAEA 4FYXB 2Z0WA 2ZGWA 2QGFB 5AYFA 4MZPA 2DE0X 2ZCFB 3VKIA 4CC2A 2BZYA 2G6FX 3J81E 3OYDA 1VQNQ 4FW2A 1ZUYA 4AG1C 3NTHA 1XJWB 2COYA 2VXEA 5CAIA 1YITQ 1PWTA 1WHGA 2K3XA 3JV3A 4DEYA 1MMGA 4F14A 2X4YA 1R77A 2LCCA 2DBKA 4XTWA 2AKLA 1H92A 1G2BA 4VUBA 1TUGB 5IAYA 1H8KA 4RTXA 2CT3A 1GFCA 1R0CB 4BY6C 1GRIA 1U06A 2FYKA 3M0PA 4E7IA 2M0YA 2GQIA 4M7DG 3QSUA 1OX9A 1KQ1A 3HHTB 4OMLA 2KSSA 2MCNA 3I56A 2KYMA 3JSCA 1WFWA 1YCSB 3EFOB 1K9AA 2AT1B 1D1BA 4RG2A 4N0AC 4A63B 4OB2B 5GAMd 1T3SA 1N9RA 2KRNA 2C0TA 3CBPA 1WXTA 3OYAA 1YWOA 3C95A 1LOJA 1YI2A 4F16A 2DPPB 2MI6A
chains in the Genus database with same CATH topology
1AWOA 1UDLA 4JZ3A 1ZUUA 1T0HA 3H41A 2DA9A 1ARKA 2ROLA 1WX6A 2ESWA 4X1VA 1AEYA 1YNZA 3QWXX 1CKAA 1VYVA 5IHNA 1OEBA 2JS0A 2K2MA 1UHCA 1UJYA 2DL3A 2LMJA 1CSKA 1SHGA 2K9GA 2ROTA 3RBBB 1X2QA 2KEAA 2RQUA 3LH5A 1K1ZA 2L2PA 1NLOC 2OAWA 2ENMA 4AFUC 3M0UA 1GCPA 1RUWA 1M30A 1SSHA 1JXOA 1K4US 2EVRA 2EGEA 4AFSC 1PRLC 2KRSA 2OI3A 4J9HA 4HXJA 2F2VA 4D8KA 1AWXA 2PNIA 4RTZA 2F2XA 3M0SA 3EG2A 2EBPA 1K0SA 2L0AA 1E6HA 2HEQA 4J9EA 1AD5A 4OMPA 1GL5A 1SEMA 2JMCA 1BBZA 2CUDA 2RQRA 4ZNXA 1SRMA 1FMKA 1QCFA 3O5ZA 4R0KA 1W70A 1Y57A 1G83A 2KGTA 4JJBA 1X69A 3TSWA 2O31A 1M3BA 2CUBA 2HDAA 2EKHA 3CQTA 5FW9A 3EGUA 4FSSA 5FWBA 4Y92A 4OMNA 2DVJA 2PZ1A 4LUDA 3M0TA 1PRMC 2J6FA 2JTEA 2CT4A 1WXUA 4D8DA 4OMMA 4J9IA 1H3HA 3I9QA 3VRZA 2CSIA 4LUEA 2KT1A 1AOJA 3VS7A 2F2WA 2RF0A 3EHQA 4JJCA 2DYBA 2FO0A 1I0CA 1SPKA 1NLPC 2A08A 2I0NA 3VS3A 2DBMA 2A36A 3U23A 1X6BA 2LQNA 1EFNA 2KE9A 3UA6A 1VA7A 1JQQA 2DNUA 2VWFA 4HVWA 1V1CA 2EYXA 4ESRA 3QWYA 2JMAA 3UF4A 1PHTA 1WA7A 2BZ8A 1BU1A 2MOXA 1W6XA 2KR3A 2ABLA 3C0CA 3VS2A 1ZSGA 2XMFA 2SRCA 3TSZA 3VS5A 4F17A 1Z9QA 4J9DA 3EG1A 3I35A 2FPDA 2C0OA 3ULRB 3NGPA 1OOTA 4JPBW 2DLPA 1X27A 2LJ3A 2K79A 5IXBA 1UG1A 2DMOA 2W10A 2J6KA 2RMOA 1UTIA 2C0IA 1KJWA 1HJDA 1JU5C 1B3QA 5I22A 3R6NA 1WDXA 1AVZC 2EYYA 4CC4B 4EIKA 1ABOA 1KSWA 3FJ5A 3H0FA 2DL5A 1ZX6A 2LP5A 1WI7A 3THKA 4JZ4A 1OPLA 3VS1A 2FEIA 2FG0A 1U5SA 3EHRA 4AG2C 3NPFA 2KBTA 5GJVB 2BTTA 1LCKA 5GJWB 1SHFA 2DJQA 1GBQA 5FWCA 2RQWA 4E6RA 4ORZA 1W1FA 1XOVA 2V1QA 2D0NA 2L3PA 1E6GA 2J06A 3NHNA 1M3CA 1U3OA 2GBQA 2MIOA 1WIEA 4J9BA 3EG3A 1QKXA 3TVTA 2K3BA 1ZLMA 2J7IA 2YT6A 5ECAA 2CREA 1UHFA 2CSQA 5IH2A 4RTYA 2HSPA 2YUOA 2SEMA 3M0RA 2X3WD 1BB9A 5EC7A 4K11A 2DRKA 2GGRA 1A0NB 2FPFA 2B86A 1N5ZA 1CKBA 1JXMA 2FRYA 2A37A 3IQLA 5IHIA 4RTWA 2OJ2A 1RLQC 2KXCA 1Z9ZA 3SEMA 2EPDA 4HVUA 2JM9A 1HD3A 1M27C 1YN8A 5IXFA 4QT7A 1ABQA 3ZL7C 1AZGB 2W0ZA 1AWWA 2GTOA 1FYNA 1QWFA 1T3LA 1YP5A 1M3AA 2FRWA 5I11A 2DL7A 3M0QA 4GLMA 4J9CA 2AZSA 4GBQA 2YSQA 2GTJA 2VVKA 2KYBA 4CC7A 1NEGA 1NM7A 4J9FA 1AWJA 2JT4A 2NWMA 3VRYA 3KFVA 2A28A 2LNHB 4RTVA 4LE9A 2JW4A 3GBQA 4OMOA 1M8MA 1HSQA 1KIKA 1TUCA 1X43A 1NYGA 2H8HA 2K6DA 2O9VA 1PKSA 2ED1A 2CH4W 4Z89A 1QLYA 1SRLA 2QDLA 1OV3A 4LN2A 2RN8A 3REAB 2IIMA 1WLPB 3UATA 3VS0A 4OMQA 4RTTA 2YUNA 1GCQA 1QWEA 2RPNA 1NYFA 2L3SA 3VS6A 3NMZC 4LNPA 1BK2A 4J9GA 1TG0A 1UFFA 3RNJA 1UJ0A 1JEGA 2K7AA 2KNBB 2P4RA 1UUEA 2EYZA 2DL4A 3I5RA 1UECA 2AZVA 1JO8A 3A98A 4IIMA 1UGVA 1RLPC 2CH4A 3PVLA 1IO6A 2JM8A 5L23A 2FPEA 1GCQC 1MV3A 2DF6A 2DM1A 4AFZC 4CC3A 3EG0A 1MV0B 2J05A 2KT8A 4KRTA 2EGCA 1PKTA 4HVVA 2LJ0A 1I07A 2ED0A 2AK5A 1ZUKA 1AZEA 1TUDA 2LJ1A 4Z8AA 5IHKA 1VYTA 1ZBJA 3PE0A 1Y0MA 1VYUA 1WXBA 2D1XA 1YWPA 2PTKA 2RQTA 2DX1A 1GBRA 4DEXA 1I1JA 2YDLA 1OPKA 2KRMA 2EQIA 1MUZA 2M51A 4HCKA 5HCKA 2DRMA 4AFQC 1NG2A 3H0IA 1NEBA 2CDTA 2DE0X 2JS2A 4CC2A 2HCKA 2BZYA 2G6FX 2YUPA 2YUQA 1K76A 1ZUYA 1J3TA 2DILA 2D8HA 2O88A 4AG1C 1WYXA 2HBWA 1QKWA 1PWTA 2ECZA 2O9SA 3I5SA 3JV3A 4DEYA 4JJDA 4F14A 3UA7A 2EGAA 1T0JA 2AKKA 2V1RA 2LQWA 4Z88A 2DBKA 2GNCA 2AKLA 1H92A 2BZXA 1S1NA 1G2BA 1H8KA 4RTXA 1KFZA 2L3QA 1RI9A 1K0XA 2JXBA 2D8JA 2CT3A 1GFCA 4WCIA 1GRIA 1U06A 4RUGA 2O2OA 3VS4A 2DL8A 3M0PA 3H0HA 2M0YA 2GQIA 2RQVA 1E7OA 2EYWA 4IIOA 2KXDA 4OMLA 2X3XD 2MCNA 2KYMA 1B07A 1WFWA 1YCSB 1K9AA 2NUZA 4A63B 1X2KA 2KROA 2LX7A 3SHWA 1T3SA 2VKNA 2KRNA 1UE9A 2LZ6B 2J6OA 2C0TA 1WXTA 2EW3A 1YWOA 2RNAA 3PVQA 1PNJA 4RTUA 2E5KA 4M4ZA 4F16A 1X6GA 1GFDA 2LCSA 3REBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWO A;  1UDL A;  4JZ3 A;  1ZUU A;  1T0H A;  3H41 A;  2DA9 A;  1ARK A;  2ROL A;  1WX6 A;  2ESW A;  4X1V A;  1AEY A;  1YNZ A;  3QWX X;  1CKA A;  1VYV A;  5IHN A;  1OEB A;  2JS0 A;  2K2M A;  1UHC A;  1UJY A;  2DL3 A;  2LMJ A;  1CSK A;  1SHG A;  2K9G A;  2ROT A;  3RBB B;  1X2Q A;  2KEA A;  2RQU A;  3LH5 A;  1K1Z A;  2L2P A;  1NLO C;  2OAW A;  2ENM A;  4AFU C;  3M0U A;  1GCP A;  1RUW A;  1M30 A;  1SSH A;  1JXO A;  1K4U S;  2EVR A;  2EGE A;  4AFS C;  1PRL C;  2KRS A;  2OI3 A;  4J9H A;  4HXJ A;  2F2V A;  4D8K A;  1AWX A;  2PNI A;  4RTZ A;  2F2X A;  3M0S A;  3EG2 A;  2EBP A;  1K0S A;  2L0A A;  1E6H A;  2HEQ A;  4J9E A;  1AD5 A;  4OMP A;  1GL5 A;  1SEM A;  2JMC A;  1BBZ A;  2CUD A;  2RQR A;  4ZNX A;  1SRM A;  1FMK A;  1QCF A;  3O5Z A;  4R0K A;  1W70 A;  1Y57 A;  1G83 A;  2KGT A;  4JJB A;  1X69 A;  3TSW A;  2O31 A;  1M3B A;  2CUB A;  2HDA A;  2EKH A;  3CQT A;  5FW9 A;  3EGU A;  4FSS A;  5FWB A;  4Y92 A;  4OMN A;  2DVJ A;  2PZ1 A;  4LUD A;  3M0T A;  1PRM C;  2J6F A;  2JTE A;  2CT4 A;  1WXU A;  4D8D A;  4OMM A;  4J9I A;  1H3H A;  3I9Q A;  3VRZ A;  2CSI A;  4LUE A;  2KT1 A;  1AOJ A;  3VS7 A;  2F2W A;  2RF0 A;  3EHQ A;  4JJC A;  2DYB A;  2FO0 A;  1I0C A;  1SPK A;  1NLP C;  2A08 A;  2I0N A;  3VS3 A;  2DBM A;  2A36 A;  3U23 A;  1X6B A;  2LQN A;  1EFN A;  2KE9 A;  3UA6 A;  1VA7 A;  1JQQ A;  2DNU A;  2VWF A;  4HVW A;  1V1C A;  2EYX A;  4ESR A;  3QWY A;  2JMA A;  3UF4 A;  1PHT A;  1WA7 A;  2BZ8 A;  1BU1 A;  2MOX A;  1W6X A;  2KR3 A;  2ABL A;  3C0C A;  3VS2 A;  1ZSG A;  2XMF A;  2SRC A;  3TSZ A;  3VS5 A;  4F17 A;  1Z9Q A;  4J9D A;  3EG1 A;  3I35 A;  2FPD A;  2C0O A;  3ULR B;  3NGP A;  1OOT A;  4JPB W;  2DLP A;  1X27 A;  2LJ3 A;  2K79 A;  5IXB A;  1UG1 A;  2DMO A;  2W10 A;  2J6K A;  2RMO A;  1UTI A;  2C0I A;  1KJW A;  1HJD A;  1JU5 C;  1B3Q A;  5I22 A;  3R6N A;  1WDX A;  1AVZ C;  2EYY A;  4CC4 B;  4EIK A;  1ABO A;  1KSW A;  3FJ5 A;  3H0F A;  2DL5 A;  1ZX6 A;  2LP5 A;  1WI7 A;  3THK A;  4JZ4 A;  1OPL A;  3VS1 A;  2FEI A;  2FG0 A;  1U5S A;  3EHR A;  4AG2 C;  3NPF A;  2KBT A;  5GJV B;  2BTT A;  1LCK A;  5GJW B;  1SHF A;  2DJQ A;  1GBQ A;  5FWC A;  2RQW A;  4E6R A;  4ORZ A;  1W1F A;  1XOV A;  2V1Q A;  2D0N A;  2L3P A;  1E6G A;  2J06 A;  3NHN A;  1M3C A;  1U3O A;  2GBQ A;  2MIO A;  1WIE A;  4J9B A;  3EG3 A;  1QKX A;  3TVT A;  2K3B A;  1ZLM A;  2J7I A;  2YT6 A;  5ECA A;  2CRE A;  1UHF A;  2CSQ A;  5IH2 A;  4RTY A;  2HSP A;  2YUO A;  2SEM A;  3M0R A;  2X3W D;  1BB9 A;  5EC7 A;  4K11 A;  2DRK A;  2GGR A;  1A0N B;  2FPF A;  2B86 A;  1N5Z A;  1CKB A;  1JXM A;  2FRY A;  2A37 A;  3IQL A;  5IHI A;  4RTW A;  2OJ2 A;  1RLQ C;  2KXC A;  1Z9Z A;  3SEM A;  2EPD A;  4HVU A;  2JM9 A;  1HD3 A;  1M27 C;  1YN8 A;  5IXF A;  4QT7 A;  1ABQ A;  3ZL7 C;  1AZG B;  2W0Z A;  1AWW A;  2GTO A;  1FYN A;  1QWF A;  1T3L A;  1YP5 A;  1M3A A;  2FRW A;  5I11 A;  2DL7 A;  3M0Q A;  4GLM A;  4J9C A;  2AZS A;  4GBQ A;  2YSQ A;  2GTJ A;  2VVK A;  2KYB A;  4CC7 A;  1NEG A;  1NM7 A;  4J9F A;  1AWJ A;  2JT4 A;  2NWM A;  3VRY A;  3KFV A;  2A28 A;  2LNH B;  4RTV A;  4LE9 A;  2JW4 A;  3GBQ A;  4OMO A;  1M8M A;  1HSQ A;  1KIK A;  1TUC A;  1X43 A;  1NYG A;  2H8H A;  2K6D A;  2O9V A;  1PKS A;  2ED1 A;  2CH4 W;  4Z89 A;  1QLY A;  1SRL A;  2QDL A;  1OV3 A;  4LN2 A;  2RN8 A;  3REA B;  2IIM A;  1WLP B;  3UAT A;  3VS0 A;  4OMQ A;  4RTT A;  2YUN A;  1GCQ A;  1QWE A;  2RPN A;  1NYF A;  2L3S A;  3VS6 A;  3NMZ C;  4LNP A;  1BK2 A;  4J9G A;  1TG0 A;  1UFF A;  3RNJ A;  1UJ0 A;  1JEG A;  2K7A A;  2KNB B;  2P4R A;  1UUE A;  2EYZ A;  2DL4 A;  3I5R A;  1UEC A;  2AZV A;  1JO8 A;  3A98 A;  4IIM A;  1UGV A;  1RLP C;  2CH4 A;  3PVL A;  1IO6 A;  2JM8 A;  5L23 A;  2FPE A;  1GCQ C;  1MV3 A;  2DF6 A;  2DM1 A;  4AFZ C;  4CC3 A;  3EG0 A;  1MV0 B;  2J05 A;  2KT8 A;  4KRT A;  2EGC A;  1PKT A;  4HVV A;  2LJ0 A;  1I07 A;  2ED0 A;  2AK5 A;  1ZUK A;  1AZE A;  1TUD A;  2LJ1 A;  4Z8A A;  5IHK A;  1VYT A;  1ZBJ A;  3PE0 A;  1Y0M A;  1VYU A;  1WXB A;  2D1X A;  1YWP A;  2PTK A;  2RQT A;  2DX1 A;  1GBR A;  4DEX A;  1I1J A;  2YDL A;  1OPK A;  2KRM A;  2EQI A;  1MUZ A;  2M51 A;  4HCK A;  5HCK A;  2DRM A;  4AFQ C;  1NG2 A;  3H0I A;  1NEB A;  2CDT A;  2DE0 X;  2JS2 A;  4CC2 A;  2HCK A;  2BZY A;  2G6F X;  2YUP A;  2YUQ A;  1K76 A;  1ZUY A;  1J3T A;  2DIL A;  2D8H A;  2O88 A;  4AG1 C;  1WYX A;  2HBW A;  1QKW A;  1PWT A;  2ECZ A;  2O9S A;  3I5S A;  3JV3 A;  4DEY A;  4JJD A;  4F14 A;  3UA7 A;  2EGA A;  1T0J A;  2AKK A;  2V1R A;  2LQW A;  4Z88 A;  2DBK A;  2GNC A;  2AKL A;  1H92 A;  2BZX A;  1S1N A;  1G2B A;  1H8K A;  4RTX A;  1KFZ A;  2L3Q A;  1RI9 A;  1K0X A;  2JXB A;  2D8J A;  2CT3 A;  1GFC A;  4WCI A;  1GRI A;  1U06 A;  4RUG A;  2O2O A;  3VS4 A;  2DL8 A;  3M0P A;  3H0H A;  2M0Y A;  2GQI A;  2RQV A;  1E7O A;  2EYW A;  4IIO A;  2KXD A;  4OML A;  2X3X D;  2MCN A;  2KYM A;  1B07 A;  1WFW A;  1YCS B;  1K9A A;  2NUZ A;  4A63 B;  1X2K A;  2KRO A;  2LX7 A;  3SHW A;  1T3S A;  2VKN A;  2KRN A;  1UE9 A;  2LZ6 B;  2J6O A;  2C0T A;  1WXT A;  2EW3 A;  1YWO A;  2RNA A;  3PVQ A;  1PNJ A;  4RTU A;  2E5K A;  4M4Z A;  4F16 A;  1X6G A;  1GFD A;  2LCS A;  3REB B; 
#chains in the Genus database with same CATH topology
 3OYE A;  1AWO A;  2KDS A;  2DA9 A;  3SFM A;  1R0B G;  2MMP A;  3EFO A;  3TCJ A;  5GAM h;  1ARK A;  1WX6 A;  1D3B B;  2L89 A;  4M78 C;  4M77 C;  1YNZ A;  3QWX X;  3M58 A;  5GAO p;  3G1J A;  2K9G A;  3FC3 A;  1RAC B;  2RQU A;  2HQX A;  3KBG A;  2CYZ B;  2DXB A;  1NLO C;  1EIF A;  4ZTJ A;  1GCP A;  2YRV A;  1M30 A;  2DFU A;  3LW5 E;  3I56 T;  4N4G A;  3OSS C;  2GFA A;  1PRL C;  1QP2 A;  1TH7 A;  5KE3 A;  4JUV A;  3M53 A;  4HCC A;  1Q82 R;  3M0S A;  1K0S A;  4DQ2 A;  5HK3 A;  1AD5 A;  3OB9 A;  4DOW A;  4LDX A;  3CCJ A;  5LJ5 f;  1PD1 A;  1YI2 T;  1YJW A;  4IUR A;  2VYT A;  1HK9 A;  1X69 A;  4E7H A;  2YRC A;  2KY9 A;  1VQL Q;  2DAQ A;  1UGR B;  3J7A F;  2CUB A;  2HDA A;  2LQK A;  1HXD A;  4XU0 A;  2ZPI B;  4FSS A;  2Y4X A;  3LWH A;  4Y92 A;  2PZ1 A;  2FVU A;  3M0T A;  3UWN A;  2CT4 A;  3EGX B;  3OA6 A;  3L1A A;  3MPU B;  1YJN T;  1WHK A;  3VS7 A;  5HK0 A;  2RF0 A;  4C0D C;  4FYW B;  2QGG A;  3G4S A;  3RER A;  1NLP C;  2I0N A;  2PQW A;  4HT8 A;  2A36 A;  2NUP B;  3UA6 A;  4LDU A;  3CCJ T;  3TQ7 P;  1JQQ A;  3JB9 J;  1ZA1 B;  1LJO A;  3EGX A;  5GAN g;  3SDZ A;  4C8Q C;  2MOX A;  2RHU A;  3C0C A;  3HRU A;  3VS2 A;  1H64 1;  4IKF A;  2XMF A;  3UDC A;  3CPF A;  2SRC A;  4F17 A;  1Z9Q A;  3EG1 A;  4LD9 K;  3I35 A;  2E1H A;  2CP7 A;  4J6W A;  4JPB W;  2LJ3 A;  2NUP A;  2QDY B;  2W10 A;  2J6K A;  2RMO A;  3I56 Q;  1HJD A;  1SKU B;  2XHC A;  5I22 A;  3R6N A;  1I81 A;  5KYW B;  1ABO A;  1KSW A;  1KHC A;  1N6A A;  3FJ5 A;  1KHI A;  1XTD A;  3H9N A;  4C0F A;  3V7S A;  1ZX6 A;  5CKH A;  1WI7 A;  2FG0 A;  2JN0 A;  5A0D A;  4FCY A;  2PUO B;  1G3S A;  5GJW B;  1SHF A;  3I55 A;  4L6V 5;  2IG0 A;  2OX7 A;  1XOV A;  2V1Q A;  3OYY A;  1ZA2 B;  1JJ2 A;  5KYW A;  4BE2 A;  4XTZ A;  4DBQ A;  4ZGJ B;  2LC4 A;  2J06 A;  2E64 A;  1M3C A;  1U3O A;  2MIO A;  1XQH A;  4M7D C;  1ZBX A;  4J9B A;  4M7A E;  4LD6 A;  2DTH A;  3TVT A;  4MZT A;  4RTY A;  4V2S A;  2HNI A;  3WVE B;  4PJL A;  3MEU A;  2GGR A;  4KUD K;  1N5Z A;  3C4S A;  4L5G A;  3V8K A;  5KYN A;  2FRY A;  4FL6 A;  3Q1J A;  5KH6 A;  3OMC A;  3VYG A;  1G3W A;  1RLQ C;  1N8R U;  2KXC A;  1Z9Z A;  4C5E A;  2MWP A;  4CI0 C;  3CPW S;  4M77 B;  1D0X A;  1WPY A;  4HVU A;  2JM9 A;  1YJW Q;  1YN8 A;  2JNG A;  2DD5 A;  4EMK B;  3CCQ A;  2CS7 A;  3I55 T;  1ABQ A;  1YCY A;  2Y4Y A;  4MDW A;  1X6O A;  2XDB A;  3L2Q A;  1FYN A;  3S3O A;  4PK4 A;  2DL7 A;  2DXC A;  2ZPF B;  4GLM A;  2YSQ A;  2EAY A;  2XID A;  3X26 B;  1AWJ A;  2NWM A;  1RAF B;  3KFV A;  2LNH B;  4C92 D;  4RTV A;  4PLI A;  2JW4 A;  1C1A A;  4EMK A;  4M75 B;  4AT1 B;  4J8O A;  2H8H A;  2K6D A;  1Q7Y C;  2ED1 A;  3ZBD A;  3NTI A;  2MYS A;  3P8D A;  3G4S Q;  2K2V A;  4BDZ A;  3REA B;  3OYL A;  3RUX A;  1QVP A;  2EQK A;  3NTK A;  3JB9 F;  4M7A F;  3CMA A;  3A8O B;  3M4G A;  1PC0 A;  2L8D A;  2E70 A;  4EMH A;  3CC2 A;  4RG8 A;  4M75 A;  5GAN 4;  2OTJ T;  3CCM Q;  2F69 A;  4OB0 B;  3OMG A;  3MP6 A;  1WHL A;  4J9G A;  4XTV A;  1TG0 A;  4XK8 E;  4JRK A;  9ATC B;  3DKM A;  1UJ0 A;  2CZ7 B;  1JEG A;  1D0Z A;  1VQ5 Q;  1UUE A;  1QMC A;  2DL4 A;  3CME A;  1RL2 A;  2QG9 B;  4M75 E;  2CH4 A;  3EG0 A;  2KT8 A;  3LX7 A;  4ATO A;  4KRT A;  2EGC A;  1PKT A;  2QQB A;  2O01 E;  3ER0 A;  4MZM A;  1KD1 U;  1ZUK A;  1AZE A;  1YIT A;  4MMK A;  5J3B A;  2D1X A;  5GAO n;  4C8Q B;  2P84 A;  4JS4 A;  1GBR A;  2EJG A;  2KRM A;  1WGS A;  4O6J A;  3CMA T;  1I4K 1;  4HCK A;  5HCK A;  3I55 Q;  4AFQ C;  4E7J A;  3A8H B;  5LJ3 h;  3CC2 T;  1NEB A;  4HT9 A;  4J6X A;  4IUQ A;  2DZ9 A;  1MMN A;  1K76 A;  1RAA B;  2O88 A;  3MET A;  1QVF A;  3OYF A;  3M4Y A;  2MPX C;  5LJ3 e;  2ECZ A;  3JCM f;  2RK1 A;  5LJ5 g;  4JJD A;  4KUI A;  2OAU A;  3CME T;  1GXI E;  1VQO A;  3O8V A;  4KH0 B;  2RB6 A;  2LQW A;  2COZ A;  3CCV A;  1K8A C;  2LNV A;  4A4K A;  1OQK A;  2GNC A;  1QW1 A;  3JCM J;  3EG9 B;  5FRN A;  4ZN1 A;  3CXC S;  3VJP A;  3PIP A;  4C5G A;  1U8R A;  3CCS A;  1O75 A;  3M57 A;  2C06 A;  1YIT T;  4M75 G;  1S72 Q;  4DOV A;  4RUG A;  2O2O A;  4EPC A;  3VS4 A;  2DL8 A;  3CXC P;  3H0H A;  1VIE A;  4Z02 A;  1I8F A;  3CCQ Q;  4QW2 A;  1WQ7 A;  3PIO A;  3RES A;  1RAE B;  2K5I A;  3V7R A;  2P0Q A;  4XQ3 A;  2NUZ A;  2X4J A;  3EG9 A;  1M1G A;  2VKN A;  1V76 A;  3AT1 B;  2J6O A;  4FYY B;  3MJX A;  4PFZ A;  2EW3 A;  4PJO F;  2RNA A;  2JTF A;  1M90 U;  3CEY A;  3E2U A;  2P0K A;  1VQ8 Q;  1VQO T;  1UDL A;  1H3Z A;  3CCV T;  1N8R R;  3PT9 A;  2ROL A;  5GAN h;  4BE1 A;  4X1V A;  4M77 D;  1AEY A;  5IHN A;  1OEB A;  2K2M A;  1ACM B;  1NBE B;  1UJY A;  4R56 A;  2LMJ A;  3CD6 A;  2DTO A;  1BCO A;  1SHG A;  3CCS T;  4OMF B;  1AT1 B;  2EQJ A;  1X2Q A;  2KEA A;  3LH5 A;  3CMA Q;  2RJF A;  1K1Z A;  5CKD A;  2OAW A;  5GMK i;  4ANJ A;  4QQ6 A;  5GAN e;  5LJ3 j;  2KI7 A;  3CC2 Q;  1SSH A;  3DB4 A;  3OS1 A;  5KCO A;  1VQL A;  4AFS C;  1BIB A;  1LVK A;  1OX8 A;  2KRS A;  2FZG B;  2HQE A;  3LWI A;  4RTZ A;  3UPU A;  2F2X A;  3EG2 A;  5D7U A;  2L0A A;  1YIJ A;  4J9E A;  4OMP A;  5GAN 2;  3SD4 A;  1W2B S;  2HD0 A;  3CME Q;  2JMC A;  1BIA A;  4KT0 E;  5DLQ E;  4JDS A;  2A7Y A;  3O5Z A;  4R0K A;  5HKC A;  2V8I A;  1W70 A;  1Y57 A;  4QVC A;  1M2O A;  4FYV B;  8ATC B;  3OYM A;  3QPH A;  2AIR B;  1VQP Q;  3CD6 T;  2HL5 C;  3EGU A;  2HKQ B;  5FWB A;  3QO3 A;  1MMD A;  3JCM X;  2NLU A;  4D8D A;  4J9I A;  1H3H A;  2H3J A;  2CP2 A;  2CSI A;  1VQL T;  5GAM f;  3E1S A;  1K73 U;  3WXM B;  4IUU A;  3EHQ A;  2CZ0 B;  1BKB A;  3JCM b;  5EG2 A;  2FO0 A;  1I0C A;  4PJJ A;  4WF2 A;  4ELY C;  3CC7 Q;  3BFM A;  1YIJ T;  2PVD B;  2A08 A;  1JRI A;  3A1P A;  1ZSZ A;  2E3H A;  4PNO A;  2KE9 A;  1VQO Q;  1KD1 R;  2RI3 A;  2DNU A;  2VWF A;  1KD1 C;  3CCV Q;  3ME9 A;  3UF4 A;  1WA7 A;  4A4G A;  4C8Q D;  3QG1 A;  5GAN j;  1QVG S;  2GF7 A;  2LRQ A;  1W6X A;  1ZSG A;  3S3M A;  3P8B B;  3CCS Q;  2GCX A;  3DLM A;  3L2V A;  2FPD A;  1VQ7 A;  1G8X A;  2RHI A;  3G7Z A;  3JAM E;  2DLP A;  3INZ A;  3JCM V;  2PU9 B;  2K79 A;  1I5O B;  1P92 A;  3LLR A;  1UTI A;  2BE7 D;  2C0I A;  4LDV A;  2PUK B;  1NJI U;  1JU5 C;  2CP0 A;  2CKK A;  1UEB A;  4EMK C;  1AVZ C;  2EYY A;  2XG8 D;  5J39 A;  3RIR A;  5D6Y A;  4BUG A;  1X75 C;  3X28 B;  5LJ3 g;  1IHW A;  4JZ4 A;  1OPL A;  4FSX A;  4AG2 C;  3NPF A;  3RKX A;  3JCM P;  2KQW A;  2DJQ A;  1GBQ A;  2EQU A;  4ORZ A;  4ZGD B;  4NL2 A;  1Q82 C;  3C12 A;  2D0N A;  4M75 C;  2L3P A;  3V8L A;  3TRE A;  2XD0 A;  3BDU A;  3CD6 Q;  4J7F A;  4M7D D;  1D09 B;  2RM4 A;  4X9C A;  4TVR A;  1VQ7 T;  1QKX A;  3QBY A;  1YBY A;  3OS2 A;  4L59 A;  5ECA A;  4OF1 A;  2CRE A;  2VGN A;  4JRP A;  2R58 A;  3M0R A;  1OZ2 A;  2VC8 A;  2X3W D;  2YLC A;  4RMO A;  2FPF A;  1QQJ A;  2RHY A;  3HPW A;  1M90 R;  2F5K A;  1CKB A;  3BE3 A;  1YIJ Q;  1JXM A;  1M90 C;  3IQL A;  1UB4 A;  5IHI A;  2DER A;  4LDY A;  3CCE Q;  5L8R E;  2LTO A;  2X4W A;  4KGV B;  3OYH A;  1NPR A;  2MK5 A;  1HD3 A;  1XNI A;  2BKD N;  1PSF A;  3E9F A;  4J83 A;  4OGC A;  1AZG B;  1WHJ A;  2QYZ A;  3OBY A;  1YP5 A;  2DKG A;  3RMQ A;  3M0Q A;  1Y07 A;  3ASK A;  1NE8 A;  4GBQ A;  1Q95 G;  2VVK A;  5C0M A;  3QDR B;  1LNX A;  1NM7 A;  4BE0 A;  2RK2 A;  3VUZ A;  3JCM g;  1YJW T;  2YXY A;  4II1 A;  3CCM A;  3QYG B;  4OMO A;  5LJ5 h;  3PFS A;  1KIK A;  1TSF A;  4KBM B;  4FT2 A;  2O9V A;  1QLY A;  3CBM A;  1VQ5 A;  2RN8 A;  4M7A B;  2E41 A;  1B7T A;  4RKU E;  5LJ5 e;  4R55 A;  2R57 A;  3QKJ A;  2RD1 A;  5A2Q E;  2K57 A;  2YUN A;  1GCQ A;  1QWE A;  4E7Z A;  2A3L A;  1SSF A;  3G4S T;  4OVA A;  1NYF A;  4O5V A;  1WJR A;  3NMZ C;  2AHJ B;  1W4S A;  3GLX A;  4NOY A;  3V8J A;  3RNJ A;  1VQ7 Q;  5IN1 A;  4M7A A;  8AT1 B;  2RJD A;  2GFU A;  2P4R A;  2EYZ A;  3I5R A;  1UEC A;  1K73 R;  3A98 A;  3QDF A;  1BI2 A;  1RLP C;  3M59 A;  3A8L B;  2JM8 A;  3PVL A;  4LXC A;  5CQX A;  4CC3 A;  3CCM T;  2LX9 A;  4Y28 E;  2RHZ A;  4HVV A;  2LJ0 A;  4NL3 A;  1I07 A;  2ED0 A;  1FMW A;  2AK5 A;  2LJ1 A;  3L2Z A;  1Y0M A;  4FU6 A;  1VQ5 T;  2JUF A;  5GAO q;  2DX1 A;  4DEX A;  1I1J A;  4C92 F;  2EQI A;  3RKW A;  2M51 A;  5KCH A;  2XDP A;  2DRM A;  2ATC B;  4IUT A;  3A5Z B;  3JB9 H;  4JRQ A;  1NG2 A;  3H0I A;  2FZC B;  2CDT A;  1RAD B;  2JS2 A;  2KK4 A;  1MHN A;  4JLG A;  2YUP A;  4HCB A;  1S72 A;  1JBM A;  3QJ6 A;  1NJI R;  2XDD A;  3M56 A;  1TS9 A;  3H8Z A;  1WYX A;  4PKC C;  2DEU A;  4BI8 B;  2DET A;  2O9S A;  2RA2 A;  3CPW P;  3MHX A;  5CK9 A;  1VOM A;  5LJ5 j;  3H6Z A;  1SG5 A;  1M5Q 1;  4JRI A;  2NUT A;  3GIB A;  2EYQ A;  2GQV A;  2DEQ A;  1KFZ A;  2I2L A;  1PG5 B;  1K0X A;  3OS0 A;  2JXB A;  2D8J A;  5AT1 B;  2G3R A;  4PJM A;  4WCI A;  1VQ8 A;  2H3E B;  5CO7 A;  3EGD B;  2RH2 A;  3M9Q A;  2RQV A;  2HL3 A;  1BYM A;  1Y71 A;  1E7O A;  5KYY B;  3D7S B;  2KXD A;  2HQH A;  2CZ6 B;  1AHJ B;  3JB9 G;  4M7A G;  4MDX A;  2EFI A;  2QAS A;  5FLX E;  1X2K A;  3SHW A;  2DYI A;  1KQ2 A;  2DXU A;  3DLL A;  3GNG A;  1OU9 A;  1UE9 A;  1M1K U;  1S72 T;  1K9M U;  3CCU A;  4WTO B;  2DTI A;  2DO3 A;  3CCQ T;  3EGD A;  3EH1 A;  4RTU A;  1C0M A;  1FXX A;  1M9S A;  2P4T A;  1N9S A;  4Y91 A;  1KC8 R;  1KK7 A;  1ZSZ C;  2QI2 A;  5KYY A;  1GFD A;  2LCS A;  2QA4 Q;  4JZ3 A;  4M78 E;  1T0H A;  3H41 A;  4X9D A;  4E7L A;  3SB2 A;  2ESW A;  1UGS B;  1CKA A;  1VYV A;  4PJO A;  2DL3 A;  4MML A;  1CSK A;  4BDY A;  4N4H A;  4EDU A;  4B9W A;  5GAN 5;  1VQ8 T;  2QTX A;  2ENM A;  4AFU C;  5LJ3 d;  1RUW A;  1JXO A;  2EGE A;  4PJO E;  3ZFJ A;  1OZ3 A;  4D8K A;  4XTX A;  2PNI A;  5I21 A;  2WAC A;  2COW A;  1VQP A;  1WZO A;  3TU4 K;  2DK3 A;  2BE9 B;  4DBF A;  3EAE A;  5DY9 A;  1SEM A;  3CCU T;  2K5F A;  1BBZ A;  2RQR A;  2E10 A;  4ZNX A;  5FU6 B;  1FMK A;  2WSF E;  1QCF A;  3FJP A;  3J80 E;  2KGT A;  4JJB A;  2ZPH B;  3X25 B;  2QAZ A;  1JJ2 S;  4M7A D;  3CCR Q;  4EMG A;  1BI0 A;  3TSW A;  3CBO A;  2QQA A;  3CC7 A;  4J7I A;  1M3B A;  3HTR A;  3OYG A;  1R8O B;  2EKH A;  5FW9 A;  1SF9 A;  3FDR A;  3OY9 A;  5IT9 E;  4N4I A;  4LUD A;  3ZEH A;  2DXT A;  4DA4 A;  1G3T A;  1PRM C;  2J6F A;  3PGG A;  2JTE A;  5FRO A;  2E12 A;  4OMM A;  2JVV A;  3I9Q A;  3GOX A;  4M77 F;  3T9N A;  4M78 F;  1KQS S;  2F2W A;  4J5Y A;  1VQ9 A;  1ZQ1 A;  4OB3 B;  1VQP T;  4FIB A;  1SPK A;  5DLO A;  4F7U F;  3VS3 A;  3R6O A;  3PTA A;  4FW1 A;  1KQS P;  3U23 A;  1X6B A;  3OS5 A;  2LQN A;  1PD0 A;  1EZZ B;  3FRN A;  3GNF B;  4HVW A;  4PJO G;  1WJS A;  2EYX A;  1V29 B;  4ESR A;  3QWY A;  4BI4 A;  2CP5 A;  5KYU A;  1MMA A;  5GAN d;  3JCM d;  2BZ8 A;  1BU1 A;  2ABL A;  3E19 A;  3CC7 T;  3P8H A;  3MKD A;  1PM3 A;  3TSZ A;  4JJN K;  3C94 A;  3ULR B;  5CVI A;  3QZ5 B;  1Q86 U;  1F1B B;  1UG1 A;  3JCM h;  2QQ9 A;  1N8R C;  1WDX A;  1VQK Q;  1YFN A;  3H0F A;  2DL5 A;  2LP5 A;  4UC4 A;  5CKE A;  1VQ9 T;  3CCU Q;  4A4F A;  3THK A;  1Y96 A;  2M02 A;  4C5I A;  3JCM e;  2E65 A;  2KBT A;  2BTT A;  3OW2 S;  3HFN A;  1WHM A;  1LCK A;  5GAN 6;  5FWC A;  2RQW A;  1W1F A;  3OW2 P;  4M75 D;  1E6G A;  2RJC A;  3NHN A;  2BUD A;  3CCE A;  4HA8 A;  1WJQ A;  1B34 A;  2FB7 A;  4GY5 A;  2YHT A;  2M9U A;  1PCX A;  4M7A C;  1W2B P;  3RR6 A;  1ZLM A;  2J7I A;  2WSC E;  2L3R A;  2YT6 A;  2EJ9 A;  4PL6 A;  2IPO B;  2CSQ A;  1M1K R;  1N27 A;  1K9M R;  4C8Q F;  1BB9 A;  3OQ5 A;  4K11 A;  1WHH A;  2DRK A;  3RKY A;  1A0N B;  1K9M C;  1G3Y A;  2B86 A;  3L2R A;  2MAM A;  1YJ9 A;  1ZSZ B;  2XK0 A;  4B6M A;  2BIV A;  2E3I A;  1TTH B;  5KE2 A;  4RTW A;  5GMK l;  3SEM A;  1OYX A;  1IXD A;  1M27 C;  3FEO A;  3WVD B;  5KYX B;  4JLI A;  4QT7 A;  3JCM W;  1Q81 U;  3LGL A;  2W0Z A;  1TOV A;  5FU7 B;  3L2U A;  2ZPB B;  2GTO A;  1T3L A;  1QWF A;  1RAH B;  2FRW A;  1M3A A;  5I11 A;  1QVF S;  2V8J A;  3CCE T;  2AZS A;  2CP3 A;  4A53 A;  4CC7 A;  4PJN A;  4J9F A;  4QVD A;  2JT4 A;  1FX7 A;  2A28 A;  1QVF P;  2RO0 A;  5KYX A;  5C6S A;  1TUC A;  1BI3 A;  5CR2 A;  2ZPG B;  1X43 A;  2KAF A;  1IZ6 A;  3MEA A;  1QVG P;  1VQ4 A;  1VQ9 Q;  1WQW A;  5GMK m;  4FT4 A;  1YJ9 T;  4M7D F;  5I2S A;  4JS5 A;  4ZTF A;  1D1A A;  2DJZ A;  3LH0 A;  2JZ2 A;  3VS0 A;  3QYH B;  1RAB B;  4DBR A;  2FL7 A;  3LGF A;  4E7K A;  3OYK A;  4PFO A;  3TEE A;  1OU8 A;  3M54 A;  3QII A;  4HKE A;  1LPL A;  2RPN A;  4A54 A;  5CKF A;  2A0F B;  2RI5 A;  2L3S A;  5D6X A;  5M9O A;  4ZN3 A;  3OBW A;  4ZGE B;  1UFF A;  3OSV A;  3OYJ A;  4BB7 A;  4BD3 A;  5I2M A;  2DIG A;  1QP3 A;  2AZV A;  1JO8 A;  3JCM Q;  4IIM A;  1RAG B;  1YHQ A;  3MP1 A;  3QZ9 B;  5L23 A;  2FPE A;  4AFZ C;  4XU1 A;  1DJ7 B;  4C0Z A;  5GAM e;  5A0G A;  4RCC A;  2B8A A;  2R5M A;  2E6N A;  1VQ4 T;  1TUD A;  1YJN A;  1IB8 A;  5IHK A;  2RHX A;  3HRT A;  2DIQ A;  1BI1 A;  4C92 B;  1D3B A;  4C5H A;  3QXE B;  2LQ8 A;  1VYU A;  1WXB A;  2RQT A;  3MEW A;  2QXF A;  4PJO C;  3PNW C;  2HMA A;  1Q7Y U;  1TXQ A;  1MUZ A;  4B9X A;  3CPW A;  3LYI A;  1KC8 U;  7AT1 B;  1Q86 R;  1VQM A;  1UGP B;  2ZPE B;  2X9H A;  2DVE A;  2HCK A;  1Q86 C;  5GAO r;  2CZ1 B;  3CC4 A;  1VIF A;  2HAX A;  2YUQ A;  2JOY A;  1TWB A;  1J3T A;  2DIL A;  2D8H A;  4C92 A;  3BDL A;  2LVM A;  1U1T A;  2HBW A;  1JB0 E;  1QKW A;  2EWN A;  3I5S A;  3N5B B;  3UA7 A;  1OUL A;  5A0L A;  2F1L A;  5D6W A;  2EGA A;  2L5Q A;  4GLK A;  5LJ5 d;  1YHQ T;  1T0J A;  2AKK A;  2V1R A;  4KGZ B;  3DB3 A;  4Z88 A;  3VV0 A;  2RJE A;  1QCN A;  2BZX A;  1S1N A;  2CP6 A;  4C92 E;  1YJ9 Q;  2L3Q A;  1RI9 A;  2XKO C;  3BW1 A;  4ELZ C;  5DM7 R;  3OYB A;  3JRZ A;  1EX4 A;  1FMV A;  4A4H A;  1M8V A;  3NFC A;  2QA4 A;  1M1F A;  2EYW A;  4IIO A;  5FU6 C;  2X3X D;  2IVW A;  1M2V B;  2M0O A;  2XIC A;  4PFP A;  1B07 A;  2EKO A;  1NZ9 A;  3SWN B;  3F70 A;  2QEX A;  2OTL A;  1VQM T;  2KRO A;  2LX7 A;  5GAM j;  4IUV A;  3CC4 T;  4BAC A;  3MEV A;  2HBP A;  2LZ6 B;  3OYC A;  2VGM A;  3PVQ A;  1PNJ A;  2O4X B;  3FLG A;  4KGX B;  3A8G B;  2E5K A;  4M4Z A;  1X6G A;  4X34 A;  3REB B;  1D0Y A;  2EJF A;  1M2V A;  1ZUU A;  3SWN A;  3E9G A;  1VQ4 Q;  4E7S A;  2NYS A;  3M5A A;  2JS0 A;  1UHC A;  2JTM A;  2X51 A;  3VYH B;  1Q81 R;  2KMT A;  1K8A U;  2ROT A;  3RBB B;  2P0P A;  1K73 C;  1BCM A;  2L2P A;  1Q81 C;  2O4X A;  2QA4 T;  4OP0 A;  3M0U A;  3CCR A;  5FRM A;  1YI2 Q;  1K4U S;  2K4Y A;  2EVR A;  1IGQ A;  4C92 G;  3CCL A;  4OGE A;  2OI3 A;  4J9H A;  3VUB A;  4HXJ A;  2F2V A;  3GF5 A;  4QQD A;  2QEX T;  2Y90 A;  2OTL T;  1AWX A;  4F04 B;  2K3Y A;  2E4H A;  1MGQ A;  2LT1 A;  4BY6 B;  2EBP A;  1VUB A;  1E6H A;  2HEQ A;  1GL5 A;  3OYI A;  3EFS A;  2CUD A;  3BY7 A;  1SRM A;  2NUT B;  1YHQ Q;  2M16 A;  1G83 A;  3S3N A;  4E47 A;  3GP8 A;  4AMC A;  5GAO l;  1YJN Q;  1VQ6 A;  2O31 A;  5CKB A;  3L2W A;  1NJI C;  3CXC A;  4XU2 A;  2VXF A;  2V8K A;  3EH2 A;  5GMK h;  3CQT A;  1KQS A;  4OMN A;  2DVJ A;  3HSB A;  1G5V A;  3URG A;  3CCJ Q;  2YLB A;  1WXU A;  3CCR T;  2CGH A;  4M78 B;  4N0A A;  1U1S A;  2PVO B;  3VRZ A;  1M4Z A;  3CCL T;  1VQM Q;  4LUE A;  1C6V X;  2HKN A;  2KT1 A;  1AOJ A;  3CC4 Q;  3G71 A;  5GMK e;  2OTJ A;  4F7U B;  4JJC A;  4LDW A;  2DYB A;  4FM4 B;  3A8M B;  2DBM A;  3RDV A;  1EFN A;  1VA7 A;  2M1H A;  1VQK A;  5GAM g;  5GAO m;  1V1C A;  4QVZ A;  4M77 A;  2JMA A;  4M78 A;  1PHT A;  5CQY A;  3GPL A;  4PJO B;  3PMI A;  4KH1 B;  4PLL A;  2KR3 A;  1Q7Y R;  4F7U A;  1KG1 A;  1VQ6 T;  3VS5 A;  4J9D A;  2C0O A;  3NGP A;  1OOT A;  1X27 A;  2FZK B;  4E2F B;  2LT4 A;  1KC8 C;  4M77 E;  3L42 A;  2MWO A;  5LJ3 f;  5IXB A;  3G6E A;  2DMO A;  3QUI A;  1IRX A;  1KJW A;  1B3Q A;  1OI1 A;  3M55 A;  2QEX Q;  4F7U E;  2OTL Q;  1RI0 A;  2EQM A;  4CC4 B;  4EIK A;  3RMS A;  2RI2 A;  3OW2 A;  5GAN 8;  2DD4 A;  1QCO A;  2WSE E;  3G71 T;  5GAN 3;  5J26 A;  5FU7 C;  2QQR A;  2X4X A;  3VS1 A;  2FEI A;  4Q5W A;  1U5S A;  3EHR A;  2MF2 A;  2XI9 A;  5GJV B;  1W2B A;  5LL6 S;  1VQK T;  3HP9 A;  4C0D B;  4E6R A;  1I5L A;  3X24 B;  2QK0 A;  5CIU A;  1X01 A;  1FWZ A;  2GBQ A;  4XAX B;  4CRI A;  1VQN A;  5GMK j;  1WIE A;  3EG3 A;  2VUB A;  1RAI B;  4J6Y A;  2K3B A;  3JB9 D;  4KUL A;  4A4E A;  3G6E T;  4IUP A;  1UHF A;  2K5L A;  5IH2 A;  2HSP A;  3CCL Q;  2YUO A;  2SEM A;  3V7C A;  2VAS A;  5EC7 A;  1WNL A;  2YRD A;  1JJ2 P;  4QKU A;  1IRE B;  2QQS A;  4DBH A;  2QTV A;  1IGU A;  2V26 A;  2A37 A;  4M77 G;  3KXT A;  4M78 G;  2OJ2 A;  4OB1 B;  1TU0 B;  2EPD A;  5KYU B;  2ZZD A;  3MO8 A;  4F7U G;  4C8Q A;  6AT1 B;  5IXF A;  3AHU A;  5GAN f;  1HYO A;  3ZL7 C;  2E6Z A;  3HRS A;  1K8A R;  1AWW A;  1O9S A;  4XTU A;  1VQ6 Q;  1ZHI A;  1QVG A;  3FB9 A;  4J9C A;  1VQN T;  2HZY A;  2GTJ A;  2KYB A;  2D9T A;  1NEG A;  5HY6 A;  4C8Q E;  3VRY A;  4D6W A;  4C92 C;  2R5A A;  1Q82 U;  2JJ9 A;  3X20 B;  4LE9 A;  1IHV A;  1D1C A;  3HFO A;  2D0Q B;  4XU3 A;  3GBQ A;  1M8M A;  3UT1 A;  1HSQ A;  2VB6 A;  2YWW A;  3VU3 C;  1MNE A;  5GAN 7;  1NYG A;  2HSE B;  3MP8 A;  3MCA B;  3G71 Q;  1PKS A;  1Y7X A;  2OTJ Q;  1Y96 B;  4M75 F;  2CH4 W;  4M7D B;  4BI3 A;  4Z89 A;  1SRL A;  3HL8 A;  2QDL A;  5CCA A;  3JCM c;  1OV3 A;  4LN2 A;  2KVQ G;  2VV5 A;  2IIM A;  3PMT A;  2X35 A;  2DZC A;  3FIF A;  1WLP B;  3UAT A;  4ME7 A;  3QJY A;  4OMQ A;  4RTT A;  1MND A;  3EFR A;  4HCZ A;  1B34 B;  3VS6 A;  3OYN A;  4M7D A;  4LNP A;  2D6F A;  1BK2 A;  4M78 D;  1UGQ B;  2K7A A;  2KNB B;  2FHD A;  2E5Q A;  3G6E Q;  3KUF A;  1UGV A;  1IO6 A;  1GCQ C;  1MV3 A;  2DF6 A;  2DM1 A;  2LDM A;  1MV0 B;  2J05 A;  4QQG A;  2EIF A;  4M7D E;  4NS5 A;  1NPP A;  3SWN C;  1PSE A;  4C8Q G;  2PVG B;  4Z8A A;  3HKS A;  1VYT A;  1ZBJ A;  3PE0 A;  3S6W A;  2PTK A;  1YWP A;  2XU8 A;  3QHS A;  4PJO D;  4P5N A;  2YDL A;  4RCB A;  2F5T X;  1OPK A;  4C0G A;  1M1K C;  2LCL A;  4XTY A;  4YTL A;  3JB9 I;  2ZAE A;  4FYX B;  2Z0W A;  2ZGW A;  2QGF B;  5AYF A;  4MZP A;  2DE0 X;  2ZCF B;  3VKI A;  4CC2 A;  2BZY A;  2G6F X;  3J81 E;  3OYD A;  1VQN Q;  4FW2 A;  1ZUY A;  4AG1 C;  3NTH A;  1XJW B;  2COY A;  2VXE A;  5CAI A;  1YIT Q;  1PWT A;  1WHG A;  2K3X A;  3JV3 A;  4DEY A;  1MMG A;  4F14 A;  2X4Y A;  1R77 A;  2LCC A;  2DBK A;  4XTW A;  2AKL A;  1H92 A;  1G2B A;  4VUB A;  1TUG B;  5IAY A;  1H8K A;  4RTX A;  2CT3 A;  1GFC A;  1R0C B;  4BY6 C;  1GRI A;  1U06 A;  2FYK A;  3M0P A;  4E7I A;  2M0Y A;  2GQI A;  4M7D G;  3QSU A;  1OX9 A;  1KQ1 A;  3HHT B;  4OML A;  2KSS A;  2MCN A;  3I56 A;  2KYM A;  3JSC A;  1WFW A;  1YCS B;  3EFO B;  1K9A A;  2AT1 B;  1D1B A;  4RG2 A;  4N0A C;  4A63 B;  4OB2 B;  5GAM d;  1T3S A;  1N9R A;  2KRN A;  2C0T A;  3CBP A;  1WXT A;  3OYA A;  1YWO A;  3C95 A;  1LOJ A;  1YI2 A;  4F16 A;  2DPP B;  2MI6 A; 
#chains in the Genus database with same CATH homology
 1AWO A;  1UDL A;  4JZ3 A;  1ZUU A;  1T0H A;  3H41 A;  2DA9 A;  1ARK A;  2ROL A;  1WX6 A;  2ESW A;  4X1V A;  1AEY A;  1YNZ A;  3QWX X;  1CKA A;  1VYV A;  5IHN A;  1OEB A;  2JS0 A;  2K2M A;  1UHC A;  1UJY A;  2DL3 A;  2LMJ A;  1CSK A;  1SHG A;  2K9G A;  2ROT A;  3RBB B;  1X2Q A;  2KEA A;  2RQU A;  3LH5 A;  1K1Z A;  2L2P A;  1NLO C;  2OAW A;  2ENM A;  4AFU C;  3M0U A;  1GCP A;  1RUW A;  1M30 A;  1SSH A;  1JXO A;  1K4U S;  2EVR A;  2EGE A;  4AFS C;  1PRL C;  2KRS A;  2OI3 A;  4J9H A;  4HXJ A;  2F2V A;  4D8K A;  1AWX A;  2PNI A;  4RTZ A;  2F2X A;  3M0S A;  3EG2 A;  2EBP A;  1K0S A;  2L0A A;  1E6H A;  2HEQ A;  4J9E A;  1AD5 A;  4OMP A;  1GL5 A;  1SEM A;  2JMC A;  1BBZ A;  2CUD A;  2RQR A;  4ZNX A;  1SRM A;  1FMK A;  1QCF A;  3O5Z A;  4R0K A;  1W70 A;  1Y57 A;  1G83 A;  2KGT A;  4JJB A;  1X69 A;  3TSW A;  2O31 A;  1M3B A;  2CUB A;  2HDA A;  2EKH A;  3CQT A;  5FW9 A;  3EGU A;  4FSS A;  5FWB A;  4Y92 A;  4OMN A;  2DVJ A;  2PZ1 A;  4LUD A;  3M0T A;  1PRM C;  2J6F A;  2JTE A;  2CT4 A;  1WXU A;  4D8D A;  4OMM A;  4J9I A;  1H3H A;  3I9Q A;  3VRZ A;  2CSI A;  4LUE A;  2KT1 A;  1AOJ A;  3VS7 A;  2F2W A;  2RF0 A;  3EHQ A;  4JJC A;  2DYB A;  2FO0 A;  1I0C A;  1SPK A;  1NLP C;  2A08 A;  2I0N A;  3VS3 A;  2DBM A;  2A36 A;  3U23 A;  1X6B A;  2LQN A;  1EFN A;  2KE9 A;  3UA6 A;  1VA7 A;  1JQQ A;  2DNU A;  2VWF A;  4HVW A;  1V1C A;  2EYX A;  4ESR A;  3QWY A;  2JMA A;  3UF4 A;  1PHT A;  1WA7 A;  2BZ8 A;  1BU1 A;  2MOX A;  1W6X A;  2KR3 A;  2ABL A;  3C0C A;  3VS2 A;  1ZSG A;  2XMF A;  2SRC A;  3TSZ A;  3VS5 A;  4F17 A;  1Z9Q A;  4J9D A;  3EG1 A;  3I35 A;  2FPD A;  2C0O A;  3ULR B;  3NGP A;  1OOT A;  4JPB W;  2DLP A;  1X27 A;  2LJ3 A;  2K79 A;  5IXB A;  1UG1 A;  2DMO A;  2W10 A;  2J6K A;  2RMO A;  1UTI A;  2C0I A;  1KJW A;  1HJD A;  1JU5 C;  1B3Q A;  5I22 A;  3R6N A;  1WDX A;  1AVZ C;  2EYY A;  4CC4 B;  4EIK A;  1ABO A;  1KSW A;  3FJ5 A;  3H0F A;  2DL5 A;  1ZX6 A;  2LP5 A;  1WI7 A;  3THK A;  4JZ4 A;  1OPL A;  3VS1 A;  2FEI A;  2FG0 A;  1U5S A;  3EHR A;  4AG2 C;  3NPF A;  2KBT A;  5GJV B;  2BTT A;  1LCK A;  5GJW B;  1SHF A;  2DJQ A;  1GBQ A;  5FWC A;  2RQW A;  4E6R A;  4ORZ A;  1W1F A;  1XOV A;  2V1Q A;  2D0N A;  2L3P A;  1E6G A;  2J06 A;  3NHN A;  1M3C A;  1U3O A;  2GBQ A;  2MIO A;  1WIE A;  4J9B A;  3EG3 A;  1QKX A;  3TVT A;  2K3B A;  1ZLM A;  2J7I A;  2YT6 A;  5ECA A;  2CRE A;  1UHF A;  2CSQ A;  5IH2 A;  4RTY A;  2HSP A;  2YUO A;  2SEM A;  3M0R A;  2X3W D;  1BB9 A;  5EC7 A;  4K11 A;  2DRK A;  2GGR A;  1A0N B;  2FPF A;  2B86 A;  1N5Z A;  1CKB A;  1JXM A;  2FRY A;  2A37 A;  3IQL A;  5IHI A;  4RTW A;  2OJ2 A;  1RLQ C;  2KXC A;  1Z9Z A;  3SEM A;  2EPD A;  4HVU A;  2JM9 A;  1HD3 A;  1M27 C;  1YN8 A;  5IXF A;  4QT7 A;  1ABQ A;  3ZL7 C;  1AZG B;  2W0Z A;  1AWW A;  2GTO A;  1FYN A;  1QWF A;  1T3L A;  1YP5 A;  1M3A A;  2FRW A;  5I11 A;  2DL7 A;  3M0Q A;  4GLM A;  4J9C A;  2AZS A;  4GBQ A;  2YSQ A;  2GTJ A;  2VVK A;  2KYB A;  4CC7 A;  1NEG A;  1NM7 A;  4J9F A;  1AWJ A;  2JT4 A;  2NWM A;  3VRY A;  3KFV A;  2A28 A;  2LNH B;  4RTV A;  4LE9 A;  2JW4 A;  3GBQ A;  4OMO A;  1M8M A;  1HSQ A;  1KIK A;  1TUC A;  1X43 A;  1NYG A;  2H8H A;  2K6D A;  2O9V A;  1PKS A;  2ED1 A;  2CH4 W;  4Z89 A;  1QLY A;  1SRL A;  2QDL A;  1OV3 A;  4LN2 A;  2RN8 A;  3REA B;  2IIM A;  1WLP B;  3UAT A;  3VS0 A;  4OMQ A;  4RTT A;  2YUN A;  1GCQ A;  1QWE A;  2RPN A;  1NYF A;  2L3S A;  3VS6 A;  3NMZ C;  4LNP A;  1BK2 A;  4J9G A;  1TG0 A;  1UFF A;  3RNJ A;  1UJ0 A;  1JEG A;  2K7A A;  2KNB B;  2P4R A;  1UUE A;  2EYZ A;  2DL4 A;  3I5R A;  1UEC A;  2AZV A;  1JO8 A;  3A98 A;  4IIM A;  1UGV A;  1RLP C;  2CH4 A;  3PVL A;  1IO6 A;  2JM8 A;  5L23 A;  2FPE A;  1GCQ C;  1MV3 A;  2DF6 A;  2DM1 A;  4AFZ C;  4CC3 A;  3EG0 A;  1MV0 B;  2J05 A;  2KT8 A;  4KRT A;  2EGC A;  1PKT A;  4HVV A;  2LJ0 A;  1I07 A;  2ED0 A;  2AK5 A;  1ZUK A;  1AZE A;  1TUD A;  2LJ1 A;  4Z8A A;  5IHK A;  1VYT A;  1ZBJ A;  3PE0 A;  1Y0M A;  1VYU A;  1WXB A;  2D1X A;  1YWP A;  2PTK A;  2RQT A;  2DX1 A;  1GBR A;  4DEX A;  1I1J A;  2YDL A;  1OPK A;  2KRM A;  2EQI A;  1MUZ A;  2M51 A;  4HCK A;  5HCK A;  2DRM A;  4AFQ C;  1NG2 A;  3H0I A;  1NEB A;  2CDT A;  2DE0 X;  2JS2 A;  4CC2 A;  2HCK A;  2BZY A;  2G6F X;  2YUP A;  2YUQ A;  1K76 A;  1ZUY A;  1J3T A;  2DIL A;  2D8H A;  2O88 A;  4AG1 C;  1WYX A;  2HBW A;  1QKW A;  1PWT A;  2ECZ A;  2O9S A;  3I5S A;  3JV3 A;  4DEY A;  4JJD A;  4F14 A;  3UA7 A;  2EGA A;  1T0J A;  2AKK A;  2V1R A;  2LQW A;  4Z88 A;  2DBK A;  2GNC A;  2AKL A;  1H92 A;  2BZX A;  1S1N A;  1G2B A;  1H8K A;  4RTX A;  1KFZ A;  2L3Q A;  1RI9 A;  1K0X A;  2JXB A;  2D8J A;  2CT3 A;  1GFC A;  4WCI A;  1GRI A;  1U06 A;  4RUG A;  2O2O A;  3VS4 A;  2DL8 A;  3M0P A;  3H0H A;  2M0Y A;  2GQI A;  2RQV A;  1E7O A;  2EYW A;  4IIO A;  2KXD A;  4OML A;  2X3X D;  2MCN A;  2KYM A;  1B07 A;  1WFW A;  1YCS B;  1K9A A;  2NUZ A;  4A63 B;  1X2K A;  2KRO A;  2LX7 A;  3SHW A;  1T3S A;  2VKN A;  2KRN A;  1UE9 A;  2LZ6 B;  2J6O A;  2C0T A;  1WXT A;  2EW3 A;  1YWO A;  2RNA A;  3PVQ A;  1PNJ A;  4RTU A;  2E5K A;  4M4Z A;  4F16 A;  1X6G A;  1GFD A;  2LCS A;  3REB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...