1QWEA

C-src sh3 domain complexed with ligand app12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qweA00
1QWEA 1ABQA 4X1VA 4OMQA 1GL5A 1QKWA 1MV0B 4CC3A 4AFQC 1SRMA 2SEMA 1JO8A 5I22A 4AFSC 3RBBB 2F2XA 1X69A 5ECAA 4E6RA 2EGAA 2L3SA 1RLPC 3I5RA 4OMPA 4RTVA 2A37A 2AZVA 1NG2A 4JPBW 3THKA 2ABLA 1SHGA 1YWPA 2FEIA 5GJWB 3A98A 1UUEA 4LN2A 4J9IA 2LMJA 1UTIA 2KT8A 2KXDA 2C0OA 1QKXA 1UDLA 2CDTA 4Z89A 1B07A 1PKTA 1AZEA 3M0TA 1QCFA 1SEMA 5FWCA 1E6HA 1K76A 2D1XA 2PNIA 1AWJA 1Y0MA 2W10A 1YP5A 1UECA 3RNJA 2LJ3A 2ED0A 2C0TA 2FRYA 2HSPA 1CKBA 2JM8A 4F14A 1U3OA 4JZ3A 1T0HA 1I0CA 3H0IA 1KSWA 1WYXA 2K6DA 1ZUUA 2K7AA 3TSWA 1NLPC 1AWXA 2KYBA 4K11A 2DL7A 2D0NA 1SHFA 2YUQA 2YUPA 1X2QA 1BB9A 1GBQA 2ENMA 2FPDA 1A0NB 1FMKA 4J9HA 5HCKA 2RQUA 4ESRA 2L0AA 3VS5A 1RLQC 2DBKA 1WDXA 3VS1A 4J9FA 2DYBA 3EG2A 2L2PA 2IIMA 1UJYA 2DLPA 1PRLC 2VKNA 2EGEA 2DRKA 2RQVA 1W6XA 2MOXA 1KJWA 3UA6A 2CH4A 3EG0A 3M0QA 5IXFA 2LZ6B 1AWWA 3IQLA 2XMFA 1B3QA 1E7OA 4J9DA 1XOVA 1OV3A 2BZXA 1OPLA 1PKSA 4DEYA 1JXMA 3VRYA 3ZL7C 2LNHB 3NHNA 4HVWA 1WI7A 1W70A 3VS2A 1U5SA 4LE9A 2GBQA 5IH2A 2FO0A 1J3TA 2A28A 2KXCA 3FJ5A 4GLMA 2KBTA 3I35A 2BZYA 4R0KA 1MUZA 2O88A 3PVQA 1H3HA 2QDLA 4HCKA 2ECZA 1YWOA 2LP5A 4OMOA 1OOTA 1RI9A 4ORZA 2DE0X 2OI3A 5I11A 3CQTA 1VYVA 2NWMA 2DX1A 3EG3A 2M0YA 2RN8A 1Z9ZA 3O5ZA 1SRLA 4AG1C 2J6OA 4CC4B 1PNJA 1VA7A 1Z9QA 2KYMA 3NGPA 2VWFA 4KRTA 3VS0A 3M0UA 4Y92A 4LUEA 2ROLA 4LNPA 2RQTA 4Z8AA 2FG0A 1T3LA 2BZ8A 3VRZA 2D8JA 4F16A 4RTWA 5FW9A 3UA7A 2GTOA 2JW4A 2V1QA 1M3CA 3EHRA 4HVVA 3VS3A 4JZ4A 5GJVB 3H0HA 3VS6A 2X3XD 2KRMA 2F2VA 2DJQA 2GTJA 2LJ0A 3TVTA 4J9EA 1PHTA 1UJ0A 2J6FA 4GBQA 2DMOA 2CH4W 1V1CA 1ABOA 2DF6A 1GFDA 2HDAA 2K2MA 2DL8A 1VYTA 4J9CA 2YDLA 1JU5C 3REBB 1KFZA 2BTTA 3ULRB 5L23A 2EYYA 1AD5A 3QWYA 1I1JA 3PVLA 2VVKA 2L3QA 2JT4A 4RTUA 2EVRA 1BU1A 1VYUA 2EQIA 3M0SA 1GBRA 1AWOA 3SHWA 1N5ZA 2PZ1A 3M0PA 2A08A 1NEGA 2RF0A 4DEXA 2KT1A 1WXBA 2E5KA 1Y57A 1ZBJA 1NYGA 2J06A 1GRIA 2KR3A 1YN8A 3EG1A 2ED1A 2H8HA 1ZSGA 3C0CA 1BBZA 2KRSA 2B86A 2O9VA 4AFUC 1RUWA 4OMMA 4AG2C 1GCPA 3M0RA 3JV3A 3UATA 2DL3A 2RMOA 1QWFA 3H0FA 1G2BA 3H41A 2V1RA 4OMNA 1ZUYA 2GQIA 2DA9A 2L3PA 3NMZC 1CSKA 2A36A 3U23A 2EYWA 5IHKA 2LJ1A 1NYFA 1TG0A 3EHQA 2G6FX 4HVUA 1HD3A 1WA7A 2DBMA 2DRMA 1M3BA 1M30A 1ZX6A 2SRCA 5IHIA 4RUGA 2LQNA 1UGVA 2MCNA 2CUDA 2EKHA 4RTTA 1AVZC 2GGRA 4CC7A 2O2OA 5IXBA 1UHCA 4RTYA 2K3BA 2KNBB 1UFFA 5IHNA 4JJCA 1AZGB 1W1FA 1SSHA 2FRWA 2I0NA 2M51A 2K79A 2RQWA 1UG1A 2CT3A 2OAWA 1M8MA 2X3WD 2HBWA 3VS7A 1AOJA 2KRNA 1JQQA 1UE9A 2JM9A 1GCQA 4J9GA 4D8DA 2OJ2A 4EIKA 3LH5A 4AFZC 2NUZA 3SEMA 1ZLMA 4RTZA 3VS4A 2P4RA 3REAB 1OPKA 2JS0A 1ZUKA 4FSSA 2DM1A 1JEGA 2AKLA 2JS2A 1X6BA 2AZSA 4D8KA 4QT7A 2YUNA 2J7IA 5EC7A 4WCIA 4IIOA 1H92A 1E6GA 2DILA 4LUDA 1PWTA 2EPDA 1SPKA 1QLYA 1TUDA 2CREA 1K0XA 4RTXA 5FWBA 1WFWA 1NLOC 2EW3A 2DNUA 2HEQA 1AEYA 2GNCA 3EGUA 3KFVA 3QWXX 2YSQA 1GCQC 1KIKA 1YNZA 2EGCA 2KEAA 1LCKA 1X43A 1EFNA 3NPFA 3R6NA 2CUBA 4JJDA 2DL4A 1BK2A 2CSQA 2RQRA 1WLPB 1T3SA 2DVJA 3TSZA 1TUCA 2EYZA 2K9GA 4F17A 2EBPA 3I9QA 1ARKA 2LX7A 2C0IA 3I5SA 2D8HA 2DL5A 2JTEA 1X6GA 3PE0A 2JXBA 2KGTA 1NEBA 2EYXA 1K4US 1OEBA 2AK5A 1S1NA 2KROA 1H8KA 1WXTA 1M27C 2J05A 1HSQA 3GBQA 1U06A 4HXJA 1T0JA 2JMCA 2FPEA 1MV3A 2YT6A 4CC2A 2AKKA 4OMLA 1I07A 2CT4A 2LCSA 2PTKA 1FYNA 4A63B 1NM7A 2RPNA 2O31A 1GFCA 2ROTA 1WIEA 1JXOA 1X27A 2CSIA 2F2WA 1K9AA 2MIOA 4IIMA 1G83A 1CKAA 1K0SA 3UF4A 2ESWA 1YCSB 4Z88A 1X2KA 1HJDA 1UHFA 1M3AA 2J6KA 2FPFA 4M4ZA 1WX6A 2O9SA 4JJBA 1PRMC 1WXUA 1K1ZA 2HCKA 4J9BA 2KE9A 2JMAA 2LQWA 2RNAA 1IO6A 2W0ZA 4ZNXA 2YUOA
chains in the Genus database with same CATH superfamily
3JCMb 4ZGJB 4PNOA 2E41A 3A1PA 1GL5A 3RR6A 4CC3A 1SRMA 4PJLA 1JO8A 2AT1B 3FB9A 3WVDB 4PJOA 3RESA 1IREB 5GANf 3WVEB 3E19A 2NLUA 4E6RA 2L3SA 3H6ZA 3RERA 2JNGA 5GAMe 5GAMd 2ZAEA 4PLLA 4BI8B 4R55A 3A98A 1UUEA 2YHTA 4J9IA 1RI0A 2CDTA 3M9QA 4Z02A 1B07A 3J81E 1NJIU 1YCYA 1D1BA 3LLRA 5FWCA 1H3ZA 1AWJA 1Y0MA 2QQRA 1YP5A 5IT9E 1UECA 1DJ7B 4FYYB 4PJOB 1WJQA 2DYIA 3A8MB 4E7HA 2HSEB 3RKYA 4ZTFA 1RAIB 1Y7XA 2HSPA 3LWHA 2IVWA 4JZ3A 5GAMj 2QEXA 2XK0A 1ZSZC 3QPHA 4K11A 1SHFA 5GAN5 3G4SQ 1QCOA 1M9SA 3ZFJA 2VGMA 3QJYA 5KE2A 2QA4Q 1FMKA 3CPWA 1Q81U 1KK7A 1KC8U 3M5AA 5GANe 4RG2A 4M75F 1N27A 2HAXA 4X9CA 2RQVA 3CBPA 1K73R 1Q7YR 3UA6A 2E6NA 4LDWA 4JRQA 1PSFA 2E64A 1AWWA 4LDUA 8ATCB 1B3QA 1HYOA 3QZ5B 1E7OA 2JUFA 1XOVA 1OV3A 2E10A 1SG5A 3HL8A 4DEYA 3ZL7C 1VOMA 3CCST 4HVWA 2ZPIB 2HNIA 3MEUA 3MO8A 1M1FA 5GANj 3G71Q 1VIEA 3OYDA 3N5BB 2A28A 2KXCA 3OYAA 3WXMB 4M78E 2CP7A 4R0KA 2ECZA 1VIFA 1YWOA 2LP5A 4FW2A 2HZYA 1VYVA 4N4HA 3S6WA 3EG3A 1Q7YC 5KYUA 4JRPA 1UGSB 3O5ZA 1BCMA 1YITT 4AG1C 2J6OA 1SKUB 1VA7A 3NGPA 3V8KA 3OY9A 3S3MA 4KRTA 4ZN3A 3M0UA 4LUEA 1VQ6T 1D0YA 2FG0A 4M78G 1WQWA 2DZCA 2D8JA 1QW1A 4RTWA 1TU0B 1WGSA 2RI3A 3G7ZA 2P84A 5IN1A 1M3CA 5HY6A 2DKGA 3MCAB 5KCHA 3VS6A 2IG0A 3EFRA 2BUDA 4OB3B 5DY9A 1WHMA 3L2VA 1BIAA 4PJMA 3MP8A 4HT9A 1GFDA 1VYTA 2OTLA 1JU5C 2ATCB 5L23A 3CMEQ 2EYYA 1YJ9A 2HMAA 3CCUA 3QYGB 1HK9A 5FRNA 3EFOB 4DBHA 5DLOA 1YJWA 5J26A 4OGEA 2O01E 2M9UA 3HRUA 3SHWA 3P8DA 5LJ3h 3M0PA 1NEGA 4JRKA 4KGZB 4OB0B 2RA2A 6AT1B 3GNFB 1YJ9T 5CKFA 3JCMW 2NYSA 2RHYA 5D6WA 4M7DC 3H9NA 4LD9K 2V8IA 5D6YA 1LVKA 4R56A 1WHJA 2LDMA 4BD3A 2K5IA 2M02A 4M77E 4AFUC 1TXQA 5KYWA 3OW2S 5CKEA 1XJWB 2EIFA 4J6YA 1O75A 2HD0A 4F7UE 2DTHA 3FJPA 4C8QC 1WHHA 5LJ3d 4M7AG 3NMZC 4LDVA 2CP3A 1CSKA 1C6VX 3OW2P 2EYWA 3CCEA 3HFOA 3EHQA 4M77G 3JB9H 4DOVA 4A4GA 1TUGB 1VQMQ 5KYYA 1QQJA 2DRMA 5IHIA 2RM4A 1G3WA 2MCNA 7AT1B 2EKHA 3VYGA 2DERA 4RTTA 2JN0A 2XDBA 5GMKi 4VUBA 1I81A 1KQSA 1LJOA 1UHCA 1VQNA 2K3BA 5IHNA 2JZ2A 3CCET 1W1FA 2M0OA 4M78F 4BDYA 2I0NA 2B8AA 4OMFB 2OAWA 1YI2T 3VS7A 5FLXE 2CYZB 3GNGA 3HKSA 3G4SA 1C0MA 2E4HA 3MPUB 1M8VA 1OX8A 5CQYA 3VS4A 5A2QE 2OTJA 4FSSA 2DM1A 3CCMQ 1VQNT 2AZSA 2DETA 4KUDK 2YUNA 4C0ZA 3OBYA 4O5VA 1E6GA 3ZBDA 3S3OA 1PWTA 1SPKA 1TUDA 2EW3A 3QG1A 1BCOA 1BI3A 3V7CA 2FZCB 2VXEA 1FMVA 2XU8A 3OYBA 3ER0A 2L8DA 2KVQG 2OTJT 1NE8A 2DIGA 2DL4A 2WSFE 4DOWA 4XQ3A 3CMAQ 1YJNQ 2HQXA 2K57A 2ZZDA 4MZTA 2DVJA 3X20B 4M75A 2EYZA 4MZMA 1NBEB 2EBPA 3JB9I 3ASKA 3EGXA 3G71A 2VV5A 1VQ4Q 3EG9B 2P0QA 1X6GA 2L89A 2BIVA 3OYIA 2K2VA 2QAZA 4E2FB 5LJ3g 2JOYA 3CCJT 2XHCA 2ZPFB 4PFOA 1JJ2A 4M7DB 3P8HA 3CCVQ 3CPFA 4IUUA 5CK9A 1YIJA 4MDXA 4CC2A 1I07A 2CT4A 1B7TA 3OS1A 2KI7A 4M7AF 1N8RR 2RPNA 1WIEA 2K5FA 3CC7Q 2CSIA 1LNXA 2DK3A 1K9AA 3CXCA 4RMOA 4M77F 4ZN1A 4C8QB 3OB9A 3CCLT 1CKAA 4BI4A 3UF4A 3OBWA 3HHTB 3A5ZB 4O6JA 1UHFA 1M3AA 1YIJT 1TOVA 3OMCA 2JTMA 3I55A 2F1LA 1WX6A 2RHZA 4OVAA 3SWNA 4F7UF 2CZ1B 1K1ZA 2HCKA 5KCOA 3LGLA 1SF9A 3CC4Q 1YHQA 2YRDA 2YUOA 4V2SA 3CMEA 2Y90A 1R0BG 5FRMA 4Y28E 1Y71A 5GAOm 4A4EA 5GAN7 1OU8A 1MHNA 5I22A 3I55T 2YXYA 4AFSC 3MEVA 1RL2A 1RLPC 3I5RA 4IUPA 4FYWB 1RAGB 1YHQT 4FSXA 1B34B 4JPBW 3THKA 4J6XA 2ABLA 4C92C 4PLIA 5GJWB 2OAUA 4QW2A 2LMJA 2YLBA 4C0FA 1UTIA 4YTLA 4J7IA 4IUQA 2R5AA 1UDLA 4BE1A 1AZEA 1QCFA 4XU0A 3HRTA 5GAOq 4LXCA 2PNIA 3JCMe 3JCMd 4DA4A 3RNJA 1I5LA 1VQPA 1WHGA 2ED0A 3OA6A 2C0TA 1IZ6A 1VQ9A 4N4IA 1FWZA 5GMKl 1CKBA 2MPXC 1U3OA 2RO0A 3DB4A 1T0HA 1KSWA 2R5MA 1WYXA 2VASA 1IHWA 2Y4XA 1ZA2B 1NLPC 2KYBA 1MNEA 2D0NA 2X35A 1X2QA 2LVMA 1M1GA 1BB9A 2RK1A 1GBQA 1D0ZA 1A0NB 2HKNA 1VQMA 1VQPT 1RACB 2L0AA 4ESRA 5IAYA 3SDZA 2DBKA 2VUBA 1VQ9T 2QXFA 3CCQQ 4J9FA 2DYBA 1VQ7T 2IIMA 1UJYA 1LPLA 3TREA 3QBYA 5GAN2 2EGEA 2GFAA 1S72Q 1W6XA 2MOXA 5HKCA 2QTVA 2NUTB 3JB9F 1BI1A 2CH4A 3TQ7P 1ZQ1A 1WNLA 2FB7A 1OI1A 3BDLA 2QG9B 2PUKB 1OPLA 5GAMh 3O8VA 3EGDA 1W70A 1U5SA 3CCMA 5FU7C 3T9NA 2YRCA 4GLMA 2KBTA 3I35A 2BZYA 4M78A 3PVQA 3R6OA 4HCKA 4OMOA 3CCRQ 4ORZA 2DE0X 1VQLA 2CZ6B 4XAXB 2QQBA 2DXBA 1VQ5A 2M0YA 1Z9ZA 4C0GA 5GAN8 2ZPEB 2MF2A 1G8XA 1D09B 2QASA 2V26A 2F69A 5CQXA 3BE3A 1IGUA 1FXXA 4F16A 1VQ4A 3QZ9B 1VQLT 3HTRA 2GTOA 2JW4A 1VQ5T 2K3XA 4C92B 5CAIA 3OYHA 5GANh 2EFIA 3H0HA 5KE3A 4A4FA 2P0PA 2JJ9A 3X28B 4E7IA 1UJ0A 2DMOA 2E3HA 2CH4W 5KH6A 2X9HA 3J80E 3X26B 4OP0A 2DF6A 2HDAA 3AHUA 2DL8A 4J9CA 1OX9A 2YDLA 2FVUA 3REBB 2BTTA 1I1JA 2VVKA 4OB1B 3JB9D 4A4KA 2L3QA 2RD1A 3CC7A 3CPWP 4ZGDB 3OYYA 4XK8E 5EG2A 1BU1A 1KD1U 2EQIA 1GBRA 2F5KA 4XU2A 1AWOA 4BUGA 3C4SA 3OYKA 5GANd 4ZGEB 2EWNA 3G1JA 2KT1A 1WXBA 4HCZA 1QP2A 2QEXT 3EG1A 2XDDA 4M7AA 2H8HA 3JCMX 2XIDA 3CC7T 3NFCA 1H641 2EQKA 1OZ2A 1BBZA 2KRSA 4BY6C 1MMDA 2B86A 2O9VA 1V76A 3GF5A 4KULA 4M77A 3OMGA 3RKXA 3JV3A 1QWFA 2XICA 1G2BA 2DFUA 4DBQA 2V1RA 3JCMV 4F7UA 4QQDA 1ZUYA 2HBPA 1TWBA 3PTAA 1V29B 2A36A 3U23A 1JB0E 5IHKA 5GAMg 2VB6A 5FU7B 4HVUA 3JCMP 3JRZA 2DBMA 1QVGS 2FZGB 1M3BA 1ZX6A 2SRCA 3J7AF 2KAFA 2LNVA 1MNDA 1UGVA 2CUDA 1AVZC 4CC7A 2O2OA 1TSFA 5I2SA 1IRXA 3V7RA 2KNBB 2AHJB 4ME7A 3TU4K 3MJXA 1PD1A 1QVGP 2FRWA 2RQWA 3VUBA 4PJOE 5KYNA 1VUBA 2HBWA 2X3WD 1X75C 2QDYB 2KRNA 4JDSA 3X25B 2JM9A 1GCQA 2OJ2A 2NUZA 5LJ5f 4PFZA 2COWA 3GIBA 2DPPB 3QXEB 4A53A 5CVIA 2VC8A 1JEGA 2AKLA 4HKEA 5KYUB 4QVZA 4E47A 2E6ZA 5A0DA 4OB2B 5EC7A 1WQ7A 2DILA 1QLYA 1WFWA 1NLOC 2LX9A 1S72A 2DNUA 3GOXA 4KUIA 3M53A 5GANg 4M7DD 4ATOA 5GAN4 1G5VA 3EGUA 3KFVA 3QWXX 2YSQA 5CCAA 1YNZA 4NL2A 4C5EA 1X43A 2FHDA 3NPFA 5GMKe 4B6MA 2CUBA 4JJDA 1I4K1 3PFSA 4CRIA 2CSQA 4ELZC 3G6EA 1WLPB 3I56Q 3C94A 3OSSC 1WJSA 5GAN6 2D6FA 2KK4A 3QIIA 3I9QA 3RMSA 2ZPHB 2GFUA 4C8QD 2OTLT 3VU3C 2D8HA 3TEEA 4RCCA 2LT4A 2JXBA 3CCUT 1K4US 2AK5A 3DLMA 1S1NA 1VQOQ 4A4HA 2KROA 1VQ8Q 2P4TA 1WXTA 1M27C 3CCRA 1YJWT 1RADB 4XTVA 1WPYA 4L6V5 1HSQA 4MMKA 3CD6Q 3G6ET 5LJ5e 3M4GA 4BY6B 4M75C 2YT6A 1MV3A 5GMKj 2L5QA 4OMLA 3HFNA 3AT1B 3KBGA 4BACA 2PTKA 4A63B 1KQSS 2O31A 4PJJA 3HP9A 1X27A 2RJFA 2F2WA 2KQWA 4FM4B 2WACA 4FYXB 1I8FA 3EH2A 1VQKQ 2ESWA 4Z88A 2VGNA 4B9XA 4FU6A 3P8BB 1KQSP 1W4SA 5I2MA 1PC0A 4JJBA 4KBMB 4KGVB 2L3RA 2E70A 5KYWB 4F7UG 5LJ5j 4MZPA 2E65A 4XU3A 2G3RA 2JMAA 4WF2A 2LQWA 2RNAA 1IO6A 1K8AR 3CC2Q 2QI2A 3OW2A 2AIRB 1MV0B 4AFQC 2SEMA 2VXFA 3MEAA 1OULA 2CS7A 1BYMA 3RBBB 3M4YA 3CBMA 2R57A 2F2XA 4LDYA 5ECAA 3SWNC 1QVFS 1IXDA 2QA4A 3VJPA 4OMPA 5KYYB 2A37A 1M90U 2AZVA 3VYHB 1SHGA 2FEIA 3URGA 3PNWC 2F5TX 3SD4A 4FW1A 4PJOF 4EMKC 4LDXA 1QKXA 1QVFP 4Z89A 1PKTA 4C0DC 4FT4A 1K8AC 3G4ST 1QP3A 1NPPA 1K76A 2D1XA 2QA4T 1HXDA 2EQMA 3Q1JA 3QO3A 2PU9B 3GP8A 1ACMB 1PM3A 1I0CA 4X9DA 3TSWA 1RABB 2DXUA 2YWWA 2DL7A 3UWNA 2MYSA 3E1SA 3KXTA 2YUQA 2YUPA 2ENMA 2FPDA 4J6WA 4EDUA 3FLGA 3QYHB 5HCKA 4D6WA 1RLQC 3PIOA 2QK0A 5DM7R 5AT1B 2L2PA 2EJGA 1Y96A 2QQ9A 2DLPA 2XD0A 2E3IA 4LD6A 2VKNA 2DRKA 3JAME 3G71T 2RJEA 9ATCB 1KJWA 4M75B 1Q95G 3JB9G 3RDVA 2VYTA 3CEYA 3OYJA 4HCCA 3EGXB 1WHLA 1WJRA 2X4JA 2O4XA 4J9DA 1R77A 2CP5A 3OS0A 3LW5E 1X01A 3VRYA 3NHNA 2A0FB 5GAOl 2D0QB 2EQJA 3VS2A 5IH2A 3PT9A 2FO0A 3SFMA 1BIBA 4C92D 2XKOC 3FJ5A 2O88A 3CBOA 1H3HA 2QDLA 4BB7A 1RI9A 4PJOD 3JCMh 3CQTA 2NWMA 2KDSA 4EMKA 1W2BS 4ELYC 1SRLA 3CCSQ 4CC4B 3BW1A 1PNJA 2X4WA 1Z9QA 3UPUA 4RCBA 4IUTA 1ZA1B 3VS0A 4TVRA 1TTHB 4Y92A 3OYEA 3I56A 3E2UA 2ROLA 4LNPA 3X24B 1M5Q1 1K8AU 3LYIA 4M78C 3QSUA 1T3LA 2BZ8A 3HRSA 3SWNB 1JBMA 2CKKA 3CMET 4PFPA 4IURA 1W2BP 5FW9A 1NPRA 3UA7A 4JLGA 4XTXA 2V1QA 3EHRA 4HVVA 1VQOA 3VS3A 3GPLA 5GJVB 1I5OB 2X3XD 2XG8D 1YITQ 2HL3A 2DJQA 2GTJA 2LJ0A 4GLKA 1GXIE 1KD1R 2NUPA 1K9MR 4XU1A 3CD6A 2J6FA 5FU6C 4EMKB 4EMHA 1U1TA 5KYXA 1V1CA 1ABOA 3UDCA 4C0DB 1QMCA 2K2MA 4WTOB 3QJ6A 1VQ6Q 2QQSA 1MMGA 2ZGWA 1AD5A 2KSSA 3JCMc 3PVLA 2DZ9A 3VUZA 4M7DE 4E7LA 3QUIA 2JT4A 3JCMQ 2EVRA 1TS9A 3C95A 4OGCA 1PG5B 2JVVA 1VYUA 4DBRA 2CP0A 1VQKA 3S3NA 2PZ1A 2A08A 2MI6A 2P0KA 2RF0A 4DEXA 3A8HB 3PGGA 1FMWA 3RKWA 3JB9J 2DTIA 1KD1C 1Y57A 1ZBJA 1NYGA 3OQ5A 1YN8A 4C8QE 1K9MC 4OF1A 2GCXA 2LCLA 1ZSGA 3EFSA 4ANJA 1WHKA 3PMIA 3C0CA 3CC2A 4E7KA 3FEOA 5CO7A 1RUWA 4OMMA 3E9GA 3RMQA 2LQ8A 1GCPA 3M0RA 1VQMT 5L8RE 1M2VA 5GAMf 1D3BA 4N4GA 5DLQE 5GAOp 3M54A 1C1AA 3H8ZA 2DVEA 4OMNA 3META 4QKUA 2DA9A 1YJ9Q 4C8QG 4M7AC 4BE2A 2L3PA 2FZKB 4QVCA 3F70A 4NL3A 1TH7A 2X51A 1EX4A 3OYLA 2CZ0B 4M77C 2G6FX 2A3LA 1KQ1A 1WA7A 3FIFA 3OYNA 2H3EB 1PSEA 1QCNA 3CCMT 2YRVA 4N0AA 3CMAA 1YJNA 1UFFA 4JJCA 3EGDB 1AZGB 4JJNK 3JCMg 1SSHA 1KHIA 2K79A 3QKJA 2CT3A 5D6XA 1XQHA 1EIFA 2HKQB 1AOJA 2E12A 2QGFB 1JQQA 1UE9A 4J9GA 4M78B 2WSCE 4FIBA 3LH5A 4AFZC 4EIKA 4IKFA 1IB8A 2K4YA 3OYMA 4HCBA 2JS0A 3CPWS 3A8GB 3CMAT 1YJNT 1X6BA 4D8KA 1KHCA 3BFMA 3CCVA 4C5HA 3M57A 3CCEQ 2EPDA 2CREA 5CR2A 1VQ4T 5CIUA 5M9OA 3L2QA 5FU6B 1OZ3A 1AEYA 1YI2Q 1GCQC 3V8LA 5GAOn 2YLCA 4MMLA 2KY9A 1LCKA 1OU9A 2BE7D 3R6NA 1FX7A 2BE9B 1K9MU 3GLXA 1VQNQ 1BK2A 4NS5A 3NTIA 3CCVT 4P5NA 1T3SA 2PUOB 3TSZA 4L59A 1TUCA 2K9GA 1X6OA 5FROA 2LX7A 2C0IA 1ARKA 3I5SA 2DL5A 4B9WA 5J39A 4CI0C 1NEBA 2EYXA 3CC4A 4PK4A 1OEBA 4M7DF 4EMGA 1H8KA 2C06A 2OTJQ 5CKDA 2DAQA 4HXJA 1PD0A 5I21A 3CCSA 2QYZA 4BE0A 3RUXA 4C8QF 4ZTJA 1NM7A 3CC4T 3V8JA 4J7FA 2MK5A 2ROTA 4JRIA 4J8OA 3A8LB 4JLIA 1N9RA 4KGXB 1ZHIA 4QVDA 3DLLA 2MIOA 2RI5A 4M7AB 1G83A 2LRQA 3CCJQ 4KH0B 1X2KA 1HJDA 1YITA 2J6KA 2FPFA 2HQEA 3L2WA 4M77B 2O9SA 3V7SA 1PRMC 1WXUA 1D1CA 1WZOA 2KE9A 4FT2A 1M90R 1VQ6A 2W0ZA 4C92E 1O9SA 1QWEA 4FCYA 4F7UB 1ABQA 4X1VA 4OMQA 1QKWA 1ZBXA 1IHVA 3CCLQ 5GMKh 2DO3A 2KMTA 1UGPB 1K73C 3LWIA 2ZPBB 1YIJQ 3OS5A 1P92A 1X69A 3FRNA 2EGAA 1PCXA 4RTVA 1XNIA 2MWOA 3LH0A 1NG2A 3CCQA 4AT1B 1YWPA 4C92G 4F04B 3EFOA 2RK2A 3TCJA 4LN2A 2DEQA 3BY7A 4PL6A 2KT8A 1QVGA 2KXDA 1ZSZA 2C0OA 1UB4A 4PJOG 1M90C 4RKUE 3M0TA 3SB2A 2DXCA 1SEMA 5LJ5h 2DIQA 3I55Q 1E6HA 2LC4A 3PMTA 2E1HA 2QTXA 2I2LA 2W10A 2MMPA 1R0CB 4AMCA 2LJ3A 5LJ3f 3CCQT 4M75D 1YHQQ 1U8RA 1M4ZA 2FRYA 2JM8A 4F14A 3H0IA 2M16A 2K6DA 1ZUUA 1S72T 2K7AA 2K3YA 5HK3A 1AWXA 1Y07A 1ZSZB 1G3TA 4J9HA 1G3SA 2RQUA 3VS5A 2DD4A 1WDXA 3VS1A 2WSEE 3QHSA 5LJ5d 3EG2A 4M7AE 5C0MA 1PRLC 1QVPA 3M59A 2JTFA 2LT1A 2DEUA 4X34A 2MAMA 3VKIA 2PVDB 3EG0A 2LCCA 2MWPA 2RHUA 3OYGA 3M0QA 2X4YA 5IXFA 4E7ZA 1MGQA 2LZ6B 3CCRT 3IQLA 2XMFA 3L2ZA 1M1KR 1Q86R 3E9FA 2EYQA 1VQPQ 2BZXA 2FYKA 1PKSA 1JXMA 1VQ9Q 1D1AA 2LNHB 2PQWA 2LQKA 1R8OB 1WI7A 1VQ7Q 5LJ3e 4LE9A 2GBQA 2CP2A 4NOYA 4Q5WA 2GF7A 4L5GA 1K73U 1Q7YU 1J3TA 4KT0E 2BKDN 1MUZA 3RIRA 3BDUA 1OOTA 1YI2A 2OI3A 3LX7A 5I11A 2DX1A 2RN8A 1SSFA 2Z0WA 4FL6A 4Y91A 1F1BB 2ZCFB 2KYMA 4QQ6A 2VWFA 1RAAB 1KQ2A 1M1KC 1Q86C 1BKBA 1Q82R 2RH2A 1YBYA 2RQTA 2H3JA 4Z8AA 5LJ3j 4C92F 1RAHB 4HA8A 3VRZA 2HL5C 2K5LA 2DJZA 4JZ4A 2KRMA 2F2VA 3TVTA 4J9EA 1MMNA 4J5YA 1PHTA 3D7SB 4GBQA 4GY5A 3EG9A 1RAEB 2X4XA 1JJ2S 5GAN3 3INZA 1KFZA 3ULRB 3QWYA 4QQGA 1VQLQ 4DBFA 5LJ5g 1Q82C 1VQ5Q 4XTUA 4M7DA 3DKMA 5J3BA 4RTUA 3MP6A 1QVFA 3A8OB 1LOJA 4XTWA 1JJ2P 3M0SA 3CXCS 5C6SA 3CCJA 4XTZA 3VV0A 1N5ZA 5A0GA 3HSBA 3NTHA 3ZEHA 2OX7A 3L42A 4A54A 2E5KA 4E7JA 2J06A 2KR3A 1GRIA 2ED1A 4C8QA 3CXCP 4DQ2A 1MMAA 2EJ9A 1RAFB 2GQVA 4PKCC 3CCLA 4J83A 4RG8A 4AG2C 1YFNA 3UATA 2DL3A 2ZPGB 2RMOA 3H0FA 3MKDA 3L2RA 1D0XA 2RHXA 3H41A 2M1HA 4XTYA 2GQIA 1IGQA 2QEXQ 4JS4A 4IUVA 1N9SA 1BI0A 4M78D 4HT8A 5CKHA 1U1SA 3MP1A 1Y96B 2LJ1A 1NYFA 1TG0A 3OYCA 3KUFA 1M2OA 3JCMf 1M1KU 1HD3A 2CP6A 1Q86U 4UC4A 3M55A 1M30A 1B34A 4RUGA 2LQNA 3FC3A 3M58A 2GGRA 2O4XB 1AHJB 2LTOA 5IXBA 1XTDA 4RTYA 3EAEA 1AT1B 4E7SA 4BDZA 2EAYA 4EPCA 3JCMJ 4II1A 2V8JA 2M51A 1UG1A 1N8RC 1M8MA 2V8KA 2DXTA 3DB3A 3MHXA 2Y4YA 2RJDA 3EH1A 2EQUA 5A0LA 1NJIR 2RI2A 4D8DA 5D7UA 2HQHA 1VQ8A 3SEMA 4FYVB 1ZLMA 4KH1B 4RTZA 2P4RA 3REAB 1OPKA 5GAOr 1ZUKA 4N0AC 2RB6A 1NZ9A 2JS2A 3JSCA 1Q82U 3I56T 3HPWA 4QT7A 3LGFA 2J7IA 2PVOB 4WCIA 4IIOA 1H92A 2QGGA 4LUDA 8AT1B 1K0XA 3L2UA 4C5IA 4RTXA 5FWBA 2XI9A 5HK0A 4PJOC 1BI2A 2HEQA 4MDWA 2IPOB 1W2BA 2GNCA 1VQOT 2EJFA 1KIKA 2EGCA 3ME9A 4JUVA 1VQ8T 2KEAA 3NTKA 2EKOA 1EFNA 5LL6S 1Q81R 5AYFA 1KC8R 3CD6T 2RQRA 3OS2A 2R58A 1NJIC 4M75E 5CKBA 2NUTA 4PJNA 2FL7A 4F17A 1VQ7A 2QQAA 2D9TA 3OSVA 2NUPB 4M7AD 2CGHA 2JTEA 4JS5A 3PE0A 5KYXB 4C5GA 1N6AA 2KGTA 3QDFA 1G3YA 3QDRB 4M7DG 2XDPA 4M77D 2J05A 2DD5A 3M56A 1UGQB 3C12A 1OQKA 1VQKT 2COZA 5GMKm 3GBQA 1U06A 1T0JA 2RHIA 2JMCA 4M75G 2FPEA 1OYXA 2AKKA 2OTLQ 1KG1A 2CZ7B 1Q81C 2RJCA 2LCSA 1FYNA 1KC8C 3FDRA 1GFCA 3OYFA 3CCUQ 3CC2T 1UGRB 1JXOA 3UT1A 3L1AA 4IIMA 3PIPA 1YJWQ 1K0SA 1YCSB 3G6EQ 1UEBA 2PVGB 4M4ZA 1EZZB 3MEWA 4BI3A 1N8RU 4J9BA 2COYA 1M2VB 2A7YA 1D3BB 2DTOA 2E5QA 4ZNXA 1JRIA 4C92A
chains in the Genus database with same CATH topology
1QWEA 1ABQA 4X1VA 4OMQA 1GL5A 1QKWA 1MV0B 4CC3A 4AFQC 1SRMA 2SEMA 1JO8A 5I22A 4AFSC 3RBBB 2F2XA 1X69A 5ECAA 4E6RA 2EGAA 2L3SA 1RLPC 3I5RA 4OMPA 4RTVA 2A37A 2AZVA 1NG2A 4JPBW 3THKA 2ABLA 1SHGA 1YWPA 2FEIA 5GJWB 3A98A 1UUEA 4LN2A 4J9IA 2LMJA 1UTIA 2KT8A 2KXDA 2C0OA 1QKXA 1UDLA 2CDTA 4Z89A 1B07A 1PKTA 1AZEA 3M0TA 1QCFA 1SEMA 5FWCA 1E6HA 1K76A 2D1XA 2PNIA 1AWJA 1Y0MA 2W10A 1YP5A 1UECA 3RNJA 2LJ3A 2ED0A 2C0TA 2FRYA 2HSPA 1CKBA 2JM8A 4F14A 1U3OA 4JZ3A 1T0HA 1I0CA 3H0IA 1KSWA 1WYXA 2K6DA 1ZUUA 2K7AA 3TSWA 1NLPC 1AWXA 2KYBA 4K11A 2DL7A 2D0NA 1SHFA 2YUQA 2YUPA 1X2QA 1BB9A 1GBQA 2ENMA 2FPDA 1A0NB 1FMKA 4J9HA 5HCKA 2RQUA 4ESRA 2L0AA 3VS5A 1RLQC 2DBKA 1WDXA 3VS1A 4J9FA 2DYBA 3EG2A 2L2PA 2IIMA 1UJYA 2DLPA 1PRLC 2VKNA 2EGEA 2DRKA 2RQVA 1W6XA 2MOXA 1KJWA 3UA6A 2CH4A 3EG0A 3M0QA 5IXFA 2LZ6B 1AWWA 3IQLA 2XMFA 1B3QA 1E7OA 4J9DA 1XOVA 1OV3A 2BZXA 1OPLA 1PKSA 4DEYA 1JXMA 3VRYA 3ZL7C 2LNHB 3NHNA 4HVWA 1WI7A 1W70A 3VS2A 1U5SA 4LE9A 2GBQA 5IH2A 2FO0A 1J3TA 2A28A 2KXCA 3FJ5A 4GLMA 2KBTA 3I35A 2BZYA 4R0KA 1MUZA 2O88A 3PVQA 1H3HA 2QDLA 4HCKA 2ECZA 1YWOA 2LP5A 4OMOA 1OOTA 1RI9A 4ORZA 2DE0X 2OI3A 5I11A 3CQTA 1VYVA 2NWMA 2DX1A 3EG3A 2M0YA 2RN8A 1Z9ZA 3O5ZA 1SRLA 4AG1C 2J6OA 4CC4B 1PNJA 1VA7A 1Z9QA 2KYMA 3NGPA 2VWFA 4KRTA 3VS0A 3M0UA 4Y92A 4LUEA 2ROLA 4LNPA 2RQTA 4Z8AA 2FG0A 1T3LA 2BZ8A 3VRZA 2D8JA 4F16A 4RTWA 5FW9A 3UA7A 2GTOA 2JW4A 2V1QA 1M3CA 3EHRA 4HVVA 3VS3A 4JZ4A 5GJVB 3H0HA 3VS6A 2X3XD 2KRMA 2F2VA 2DJQA 2GTJA 2LJ0A 3TVTA 4J9EA 1PHTA 1UJ0A 2J6FA 4GBQA 2DMOA 2CH4W 1V1CA 1ABOA 2DF6A 1GFDA 2HDAA 2K2MA 2DL8A 1VYTA 4J9CA 2YDLA 1JU5C 3REBB 1KFZA 2BTTA 3ULRB 5L23A 2EYYA 1AD5A 3QWYA 1I1JA 3PVLA 2VVKA 2L3QA 2JT4A 4RTUA 2EVRA 1BU1A 1VYUA 2EQIA 3M0SA 1GBRA 1AWOA 3SHWA 1N5ZA 2PZ1A 3M0PA 2A08A 1NEGA 2RF0A 4DEXA 2KT1A 1WXBA 2E5KA 1Y57A 1ZBJA 1NYGA 2J06A 1GRIA 2KR3A 1YN8A 3EG1A 2ED1A 2H8HA 1ZSGA 3C0CA 1BBZA 2KRSA 2B86A 2O9VA 4AFUC 1RUWA 4OMMA 4AG2C 1GCPA 3M0RA 3JV3A 3UATA 2DL3A 2RMOA 1QWFA 3H0FA 1G2BA 3H41A 2V1RA 4OMNA 1ZUYA 2GQIA 2DA9A 2L3PA 3NMZC 1CSKA 2A36A 3U23A 2EYWA 5IHKA 2LJ1A 1NYFA 1TG0A 3EHQA 2G6FX 4HVUA 1HD3A 1WA7A 2DBMA 2DRMA 1M3BA 1M30A 1ZX6A 2SRCA 5IHIA 4RUGA 2LQNA 1UGVA 2MCNA 2CUDA 2EKHA 4RTTA 1AVZC 2GGRA 4CC7A 2O2OA 5IXBA 1UHCA 4RTYA 2K3BA 2KNBB 1UFFA 5IHNA 4JJCA 1AZGB 1W1FA 1SSHA 2FRWA 2I0NA 2M51A 2K79A 2RQWA 1UG1A 2CT3A 2OAWA 1M8MA 2X3WD 2HBWA 3VS7A 1AOJA 2KRNA 1JQQA 1UE9A 2JM9A 1GCQA 4J9GA 4D8DA 2OJ2A 4EIKA 3LH5A 4AFZC 2NUZA 3SEMA 1ZLMA 4RTZA 3VS4A 2P4RA 3REAB 1OPKA 2JS0A 1ZUKA 4FSSA 2DM1A 1JEGA 2AKLA 2JS2A 1X6BA 2AZSA 4D8KA 4QT7A 2YUNA 2J7IA 5EC7A 4WCIA 4IIOA 1H92A 1E6GA 2DILA 4LUDA 1PWTA 2EPDA 1SPKA 1QLYA 1TUDA 2CREA 1K0XA 4RTXA 5FWBA 1WFWA 1NLOC 2EW3A 2DNUA 2HEQA 1AEYA 2GNCA 3EGUA 3KFVA 3QWXX 2YSQA 1GCQC 1KIKA 1YNZA 2EGCA 2KEAA 1LCKA 1X43A 1EFNA 3NPFA 3R6NA 2CUBA 4JJDA 2DL4A 1BK2A 2CSQA 2RQRA 1WLPB 1T3SA 2DVJA 3TSZA 1TUCA 2EYZA 2K9GA 4F17A 2EBPA 3I9QA 1ARKA 2LX7A 2C0IA 3I5SA 2D8HA 2DL5A 2JTEA 1X6GA 3PE0A 2JXBA 2KGTA 1NEBA 2EYXA 1K4US 1OEBA 2AK5A 1S1NA 2KROA 1H8KA 1WXTA 1M27C 2J05A 1HSQA 3GBQA 1U06A 4HXJA 1T0JA 2JMCA 2FPEA 1MV3A 2YT6A 4CC2A 2AKKA 4OMLA 1I07A 2CT4A 2LCSA 2PTKA 1FYNA 4A63B 1NM7A 2RPNA 2O31A 1GFCA 2ROTA 1WIEA 1JXOA 1X27A 2CSIA 2F2WA 1K9AA 2MIOA 4IIMA 1G83A 1CKAA 1K0SA 3UF4A 2ESWA 1YCSB 4Z88A 1X2KA 1HJDA 1UHFA 1M3AA 2J6KA 2FPFA 4M4ZA 1WX6A 2O9SA 4JJBA 1PRMC 1WXUA 1K1ZA 2HCKA 4J9BA 2KE9A 2JMAA 2LQWA 2RNAA 1IO6A 2W0ZA 4ZNXA 2YUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWE A;  1ABQ A;  4X1V A;  4OMQ A;  1GL5 A;  1QKW A;  1MV0 B;  4CC3 A;  4AFQ C;  1SRM A;  2SEM A;  1JO8 A;  5I22 A;  4AFS C;  3RBB B;  2F2X A;  1X69 A;  5ECA A;  4E6R A;  2EGA A;  2L3S A;  1RLP C;  3I5R A;  4OMP A;  4RTV A;  2A37 A;  2AZV A;  1NG2 A;  4JPB W;  3THK A;  2ABL A;  1SHG A;  1YWP A;  2FEI A;  5GJW B;  3A98 A;  1UUE A;  4LN2 A;  4J9I A;  2LMJ A;  1UTI A;  2KT8 A;  2KXD A;  2C0O A;  1QKX A;  1UDL A;  2CDT A;  4Z89 A;  1B07 A;  1PKT A;  1AZE A;  3M0T A;  1QCF A;  1SEM A;  5FWC A;  1E6H A;  1K76 A;  2D1X A;  2PNI A;  1AWJ A;  1Y0M A;  2W10 A;  1YP5 A;  1UEC A;  3RNJ A;  2LJ3 A;  2ED0 A;  2C0T A;  2FRY A;  2HSP A;  1CKB A;  2JM8 A;  4F14 A;  1U3O A;  4JZ3 A;  1T0H A;  1I0C A;  3H0I A;  1KSW A;  1WYX A;  2K6D A;  1ZUU A;  2K7A A;  3TSW A;  1NLP C;  1AWX A;  2KYB A;  4K11 A;  2DL7 A;  2D0N A;  1SHF A;  2YUQ A;  2YUP A;  1X2Q A;  1BB9 A;  1GBQ A;  2ENM A;  2FPD A;  1A0N B;  1FMK A;  4J9H A;  5HCK A;  2RQU A;  4ESR A;  2L0A A;  3VS5 A;  1RLQ C;  2DBK A;  1WDX A;  3VS1 A;  4J9F A;  2DYB A;  3EG2 A;  2L2P A;  2IIM A;  1UJY A;  2DLP A;  1PRL C;  2VKN A;  2EGE A;  2DRK A;  2RQV A;  1W6X A;  2MOX A;  1KJW A;  3UA6 A;  2CH4 A;  3EG0 A;  3M0Q A;  5IXF A;  2LZ6 B;  1AWW A;  3IQL A;  2XMF A;  1B3Q A;  1E7O A;  4J9D A;  1XOV A;  1OV3 A;  2BZX A;  1OPL A;  1PKS A;  4DEY A;  1JXM A;  3VRY A;  3ZL7 C;  2LNH B;  3NHN A;  4HVW A;  1WI7 A;  1W70 A;  3VS2 A;  1U5S A;  4LE9 A;  2GBQ A;  5IH2 A;  2FO0 A;  1J3T A;  2A28 A;  2KXC A;  3FJ5 A;  4GLM A;  2KBT A;  3I35 A;  2BZY A;  4R0K A;  1MUZ A;  2O88 A;  3PVQ A;  1H3H A;  2QDL A;  4HCK A;  2ECZ A;  1YWO A;  2LP5 A;  4OMO A;  1OOT A;  1RI9 A;  4ORZ A;  2DE0 X;  2OI3 A;  5I11 A;  3CQT A;  1VYV A;  2NWM A;  2DX1 A;  3EG3 A;  2M0Y A;  2RN8 A;  1Z9Z A;  3O5Z A;  1SRL A;  4AG1 C;  2J6O A;  4CC4 B;  1PNJ A;  1VA7 A;  1Z9Q A;  2KYM A;  3NGP A;  2VWF A;  4KRT A;  3VS0 A;  3M0U A;  4Y92 A;  4LUE A;  2ROL A;  4LNP A;  2RQT A;  4Z8A A;  2FG0 A;  1T3L A;  2BZ8 A;  3VRZ A;  2D8J A;  4F16 A;  4RTW A;  5FW9 A;  3UA7 A;  2GTO A;  2JW4 A;  2V1Q A;  1M3C A;  3EHR A;  4HVV A;  3VS3 A;  4JZ4 A;  5GJV B;  3H0H A;  3VS6 A;  2X3X D;  2KRM A;  2F2V A;  2DJQ A;  2GTJ A;  2LJ0 A;  3TVT A;  4J9E A;  1PHT A;  1UJ0 A;  2J6F A;  4GBQ A;  2DMO A;  2CH4 W;  1V1C A;  1ABO A;  2DF6 A;  1GFD A;  2HDA A;  2K2M A;  2DL8 A;  1VYT A;  4J9C A;  2YDL A;  1JU5 C;  3REB B;  1KFZ A;  2BTT A;  3ULR B;  5L23 A;  2EYY A;  1AD5 A;  3QWY A;  1I1J A;  3PVL A;  2VVK A;  2L3Q A;  2JT4 A;  4RTU A;  2EVR A;  1BU1 A;  1VYU A;  2EQI A;  3M0S A;  1GBR A;  1AWO A;  3SHW A;  1N5Z A;  2PZ1 A;  3M0P A;  2A08 A;  1NEG A;  2RF0 A;  4DEX A;  2KT1 A;  1WXB A;  2E5K A;  1Y57 A;  1ZBJ A;  1NYG A;  2J06 A;  1GRI A;  2KR3 A;  1YN8 A;  3EG1 A;  2ED1 A;  2H8H A;  1ZSG A;  3C0C A;  1BBZ A;  2KRS A;  2B86 A;  2O9V A;  4AFU C;  1RUW A;  4OMM A;  4AG2 C;  1GCP A;  3M0R A;  3JV3 A;  3UAT A;  2DL3 A;  2RMO A;  1QWF A;  3H0F A;  1G2B A;  3H41 A;  2V1R A;  4OMN A;  1ZUY A;  2GQI A;  2DA9 A;  2L3P A;  3NMZ C;  1CSK A;  2A36 A;  3U23 A;  2EYW A;  5IHK A;  2LJ1 A;  1NYF A;  1TG0 A;  3EHQ A;  2G6F X;  4HVU A;  1HD3 A;  1WA7 A;  2DBM A;  2DRM A;  1M3B A;  1M30 A;  1ZX6 A;  2SRC A;  5IHI A;  4RUG A;  2LQN A;  1UGV A;  2MCN A;  2CUD A;  2EKH A;  4RTT A;  1AVZ C;  2GGR A;  4CC7 A;  2O2O A;  5IXB A;  1UHC A;  4RTY A;  2K3B A;  2KNB B;  1UFF A;  5IHN A;  4JJC A;  1AZG B;  1W1F A;  1SSH A;  2FRW A;  2I0N A;  2M51 A;  2K79 A;  2RQW A;  1UG1 A;  2CT3 A;  2OAW A;  1M8M A;  2X3W D;  2HBW A;  3VS7 A;  1AOJ A;  2KRN A;  1JQQ A;  1UE9 A;  2JM9 A;  1GCQ A;  4J9G A;  4D8D A;  2OJ2 A;  4EIK A;  3LH5 A;  4AFZ C;  2NUZ A;  3SEM A;  1ZLM A;  4RTZ A;  3VS4 A;  2P4R A;  3REA B;  1OPK A;  2JS0 A;  1ZUK A;  4FSS A;  2DM1 A;  1JEG A;  2AKL A;  2JS2 A;  1X6B A;  2AZS A;  4D8K A;  4QT7 A;  2YUN A;  2J7I A;  5EC7 A;  4WCI A;  4IIO A;  1H92 A;  1E6G A;  2DIL A;  4LUD A;  1PWT A;  2EPD A;  1SPK A;  1QLY A;  1TUD A;  2CRE A;  1K0X A;  4RTX A;  5FWB A;  1WFW A;  1NLO C;  2EW3 A;  2DNU A;  2HEQ A;  1AEY A;  2GNC A;  3EGU A;  3KFV A;  3QWX X;  2YSQ A;  1GCQ C;  1KIK A;  1YNZ A;  2EGC A;  2KEA A;  1LCK A;  1X43 A;  1EFN A;  3NPF A;  3R6N A;  2CUB A;  4JJD A;  2DL4 A;  1BK2 A;  2CSQ A;  2RQR A;  1WLP B;  1T3S A;  2DVJ A;  3TSZ A;  1TUC A;  2EYZ A;  2K9G A;  4F17 A;  2EBP A;  3I9Q A;  1ARK A;  2LX7 A;  2C0I A;  3I5S A;  2D8H A;  2DL5 A;  2JTE A;  1X6G A;  3PE0 A;  2JXB A;  2KGT A;  1NEB A;  2EYX A;  1K4U S;  1OEB A;  2AK5 A;  1S1N A;  2KRO A;  1H8K A;  1WXT A;  1M27 C;  2J05 A;  1HSQ A;  3GBQ A;  1U06 A;  4HXJ A;  1T0J A;  2JMC A;  2FPE A;  1MV3 A;  2YT6 A;  4CC2 A;  2AKK A;  4OML A;  1I07 A;  2CT4 A;  2LCS A;  2PTK A;  1FYN A;  4A63 B;  1NM7 A;  2RPN A;  2O31 A;  1GFC A;  2ROT A;  1WIE A;  1JXO A;  1X27 A;  2CSI A;  2F2W A;  1K9A A;  2MIO A;  4IIM A;  1G83 A;  1CKA A;  1K0S A;  3UF4 A;  2ESW A;  1YCS B;  4Z88 A;  1X2K A;  1HJD A;  1UHF A;  1M3A A;  2J6K A;  2FPF A;  4M4Z A;  1WX6 A;  2O9S A;  4JJB A;  1PRM C;  1WXU A;  1K1Z A;  2HCK A;  4J9B A;  2KE9 A;  2JMA A;  2LQW A;  2RNA A;  1IO6 A;  2W0Z A;  4ZNX A;  2YUO A; 
#chains in the Genus database with same CATH topology
 3JCM b;  4ZGJ B;  4PNO A;  2E41 A;  3A1P A;  1GL5 A;  3RR6 A;  4CC3 A;  1SRM A;  4PJL A;  1JO8 A;  2AT1 B;  3FB9 A;  3WVD B;  4PJO A;  3RES A;  1IRE B;  5GAN f;  3WVE B;  3E19 A;  2NLU A;  4E6R A;  2L3S A;  3H6Z A;  3RER A;  2JNG A;  5GAM e;  5GAM d;  2ZAE A;  4PLL A;  4BI8 B;  4R55 A;  3A98 A;  1UUE A;  2YHT A;  4J9I A;  1RI0 A;  2CDT A;  3M9Q A;  4Z02 A;  1B07 A;  3J81 E;  1NJI U;  1YCY A;  1D1B A;  3LLR A;  5FWC A;  1H3Z A;  1AWJ A;  1Y0M A;  2QQR A;  1YP5 A;  5IT9 E;  1UEC A;  1DJ7 B;  4FYY B;  4PJO B;  1WJQ A;  2DYI A;  3A8M B;  4E7H A;  2HSE B;  3RKY A;  4ZTF A;  1RAI B;  1Y7X A;  2HSP A;  3LWH A;  2IVW A;  4JZ3 A;  5GAM j;  2QEX A;  2XK0 A;  1ZSZ C;  3QPH A;  4K11 A;  1SHF A;  5GAN 5;  3G4S Q;  1QCO A;  1M9S A;  3ZFJ A;  2VGM A;  3QJY A;  5KE2 A;  2QA4 Q;  1FMK A;  3CPW A;  1Q81 U;  1KK7 A;  1KC8 U;  3M5A A;  5GAN e;  4RG2 A;  4M75 F;  1N27 A;  2HAX A;  4X9C A;  2RQV A;  3CBP A;  1K73 R;  1Q7Y R;  3UA6 A;  2E6N A;  4LDW A;  4JRQ A;  1PSF A;  2E64 A;  1AWW A;  4LDU A;  8ATC B;  1B3Q A;  1HYO A;  3QZ5 B;  1E7O A;  2JUF A;  1XOV A;  1OV3 A;  2E10 A;  1SG5 A;  3HL8 A;  4DEY A;  3ZL7 C;  1VOM A;  3CCS T;  4HVW A;  2ZPI B;  2HNI A;  3MEU A;  3MO8 A;  1M1F A;  5GAN j;  3G71 Q;  1VIE A;  3OYD A;  3N5B B;  2A28 A;  2KXC A;  3OYA A;  3WXM B;  4M78 E;  2CP7 A;  4R0K A;  2ECZ A;  1VIF A;  1YWO A;  2LP5 A;  4FW2 A;  2HZY A;  1VYV A;  4N4H A;  3S6W A;  3EG3 A;  1Q7Y C;  5KYU A;  4JRP A;  1UGS B;  3O5Z A;  1BCM A;  1YIT T;  4AG1 C;  2J6O A;  1SKU B;  1VA7 A;  3NGP A;  3V8K A;  3OY9 A;  3S3M A;  4KRT A;  4ZN3 A;  3M0U A;  4LUE A;  1VQ6 T;  1D0Y A;  2FG0 A;  4M78 G;  1WQW A;  2DZC A;  2D8J A;  1QW1 A;  4RTW A;  1TU0 B;  1WGS A;  2RI3 A;  3G7Z A;  2P84 A;  5IN1 A;  1M3C A;  5HY6 A;  2DKG A;  3MCA B;  5KCH A;  3VS6 A;  2IG0 A;  3EFR A;  2BUD A;  4OB3 B;  5DY9 A;  1WHM A;  3L2V A;  1BIA A;  4PJM A;  3MP8 A;  4HT9 A;  1GFD A;  1VYT A;  2OTL A;  1JU5 C;  2ATC B;  5L23 A;  3CME Q;  2EYY A;  1YJ9 A;  2HMA A;  3CCU A;  3QYG B;  1HK9 A;  5FRN A;  3EFO B;  4DBH A;  5DLO A;  1YJW A;  5J26 A;  4OGE A;  2O01 E;  2M9U A;  3HRU A;  3SHW A;  3P8D A;  5LJ3 h;  3M0P A;  1NEG A;  4JRK A;  4KGZ B;  4OB0 B;  2RA2 A;  6AT1 B;  3GNF B;  1YJ9 T;  5CKF A;  3JCM W;  2NYS A;  2RHY A;  5D6W A;  4M7D C;  3H9N A;  4LD9 K;  2V8I A;  5D6Y A;  1LVK A;  4R56 A;  1WHJ A;  2LDM A;  4BD3 A;  2K5I A;  2M02 A;  4M77 E;  4AFU C;  1TXQ A;  5KYW A;  3OW2 S;  5CKE A;  1XJW B;  2EIF A;  4J6Y A;  1O75 A;  2HD0 A;  4F7U E;  2DTH A;  3FJP A;  4C8Q C;  1WHH A;  5LJ3 d;  4M7A G;  3NMZ C;  4LDV A;  2CP3 A;  1CSK A;  1C6V X;  3OW2 P;  2EYW A;  3CCE A;  3HFO A;  3EHQ A;  4M77 G;  3JB9 H;  4DOV A;  4A4G A;  1TUG B;  1VQM Q;  5KYY A;  1QQJ A;  2DRM A;  5IHI A;  2RM4 A;  1G3W A;  2MCN A;  7AT1 B;  2EKH A;  3VYG A;  2DER A;  4RTT A;  2JN0 A;  2XDB A;  5GMK i;  4VUB A;  1I81 A;  1KQS A;  1LJO A;  1UHC A;  1VQN A;  2K3B A;  5IHN A;  2JZ2 A;  3CCE T;  1W1F A;  2M0O A;  4M78 F;  4BDY A;  2I0N A;  2B8A A;  4OMF B;  2OAW A;  1YI2 T;  3VS7 A;  5FLX E;  2CYZ B;  3GNG A;  3HKS A;  3G4S A;  1C0M A;  2E4H A;  3MPU B;  1M8V A;  1OX8 A;  5CQY A;  3VS4 A;  5A2Q E;  2OTJ A;  4FSS A;  2DM1 A;  3CCM Q;  1VQN T;  2AZS A;  2DET A;  4KUD K;  2YUN A;  4C0Z A;  3OBY A;  4O5V A;  1E6G A;  3ZBD A;  3S3O A;  1PWT A;  1SPK A;  1TUD A;  2EW3 A;  3QG1 A;  1BCO A;  1BI3 A;  3V7C A;  2FZC B;  2VXE A;  1FMV A;  2XU8 A;  3OYB A;  3ER0 A;  2L8D A;  2KVQ G;  2OTJ T;  1NE8 A;  2DIG A;  2DL4 A;  2WSF E;  4DOW A;  4XQ3 A;  3CMA Q;  1YJN Q;  2HQX A;  2K57 A;  2ZZD A;  4MZT A;  2DVJ A;  3X20 B;  4M75 A;  2EYZ A;  4MZM A;  1NBE B;  2EBP A;  3JB9 I;  3ASK A;  3EGX A;  3G71 A;  2VV5 A;  1VQ4 Q;  3EG9 B;  2P0Q A;  1X6G A;  2L89 A;  2BIV A;  3OYI A;  2K2V A;  2QAZ A;  4E2F B;  5LJ3 g;  2JOY A;  3CCJ T;  2XHC A;  2ZPF B;  4PFO A;  1JJ2 A;  4M7D B;  3P8H A;  3CCV Q;  3CPF A;  4IUU A;  5CK9 A;  1YIJ A;  4MDX A;  4CC2 A;  1I07 A;  2CT4 A;  1B7T A;  3OS1 A;  2KI7 A;  4M7A F;  1N8R R;  2RPN A;  1WIE A;  2K5F A;  3CC7 Q;  2CSI A;  1LNX A;  2DK3 A;  1K9A A;  3CXC A;  4RMO A;  4M77 F;  4ZN1 A;  4C8Q B;  3OB9 A;  3CCL T;  1CKA A;  4BI4 A;  3UF4 A;  3OBW A;  3HHT B;  3A5Z B;  4O6J A;  1UHF A;  1M3A A;  1YIJ T;  1TOV A;  3OMC A;  2JTM A;  3I55 A;  2F1L A;  1WX6 A;  2RHZ A;  4OVA A;  3SWN A;  4F7U F;  2CZ1 B;  1K1Z A;  2HCK A;  5KCO A;  3LGL A;  1SF9 A;  3CC4 Q;  1YHQ A;  2YRD A;  2YUO A;  4V2S A;  3CME A;  2Y90 A;  1R0B G;  5FRM A;  4Y28 E;  1Y71 A;  5GAO m;  4A4E A;  5GAN 7;  1OU8 A;  1MHN A;  5I22 A;  3I55 T;  2YXY A;  4AFS C;  3MEV A;  1RL2 A;  1RLP C;  3I5R A;  4IUP A;  4FYW B;  1RAG B;  1YHQ T;  4FSX A;  1B34 B;  4JPB W;  3THK A;  4J6X A;  2ABL A;  4C92 C;  4PLI A;  5GJW B;  2OAU A;  4QW2 A;  2LMJ A;  2YLB A;  4C0F A;  1UTI A;  4YTL A;  4J7I A;  4IUQ A;  2R5A A;  1UDL A;  4BE1 A;  1AZE A;  1QCF A;  4XU0 A;  3HRT A;  5GAO q;  4LXC A;  2PNI A;  3JCM e;  3JCM d;  4DA4 A;  3RNJ A;  1I5L A;  1VQP A;  1WHG A;  2ED0 A;  3OA6 A;  2C0T A;  1IZ6 A;  1VQ9 A;  4N4I A;  1FWZ A;  5GMK l;  1CKB A;  2MPX C;  1U3O A;  2RO0 A;  3DB4 A;  1T0H A;  1KSW A;  2R5M A;  1WYX A;  2VAS A;  1IHW A;  2Y4X A;  1ZA2 B;  1NLP C;  2KYB A;  1MNE A;  2D0N A;  2X35 A;  1X2Q A;  2LVM A;  1M1G A;  1BB9 A;  2RK1 A;  1GBQ A;  1D0Z A;  1A0N B;  2HKN A;  1VQM A;  1VQP T;  1RAC B;  2L0A A;  4ESR A;  5IAY A;  3SDZ A;  2DBK A;  2VUB A;  1VQ9 T;  2QXF A;  3CCQ Q;  4J9F A;  2DYB A;  1VQ7 T;  2IIM A;  1UJY A;  1LPL A;  3TRE A;  3QBY A;  5GAN 2;  2EGE A;  2GFA A;  1S72 Q;  1W6X A;  2MOX A;  5HKC A;  2QTV A;  2NUT B;  3JB9 F;  1BI1 A;  2CH4 A;  3TQ7 P;  1ZQ1 A;  1WNL A;  2FB7 A;  1OI1 A;  3BDL A;  2QG9 B;  2PUK B;  1OPL A;  5GAM h;  3O8V A;  3EGD A;  1W70 A;  1U5S A;  3CCM A;  5FU7 C;  3T9N A;  2YRC A;  4GLM A;  2KBT A;  3I35 A;  2BZY A;  4M78 A;  3PVQ A;  3R6O A;  4HCK A;  4OMO A;  3CCR Q;  4ORZ A;  2DE0 X;  1VQL A;  2CZ6 B;  4XAX B;  2QQB A;  2DXB A;  1VQ5 A;  2M0Y A;  1Z9Z A;  4C0G A;  5GAN 8;  2ZPE B;  2MF2 A;  1G8X A;  1D09 B;  2QAS A;  2V26 A;  2F69 A;  5CQX A;  3BE3 A;  1IGU A;  1FXX A;  4F16 A;  1VQ4 A;  3QZ9 B;  1VQL T;  3HTR A;  2GTO A;  2JW4 A;  1VQ5 T;  2K3X A;  4C92 B;  5CAI A;  3OYH A;  5GAN h;  2EFI A;  3H0H A;  5KE3 A;  4A4F A;  2P0P A;  2JJ9 A;  3X28 B;  4E7I A;  1UJ0 A;  2DMO A;  2E3H A;  2CH4 W;  5KH6 A;  2X9H A;  3J80 E;  3X26 B;  4OP0 A;  2DF6 A;  2HDA A;  3AHU A;  2DL8 A;  4J9C A;  1OX9 A;  2YDL A;  2FVU A;  3REB B;  2BTT A;  1I1J A;  2VVK A;  4OB1 B;  3JB9 D;  4A4K A;  2L3Q A;  2RD1 A;  3CC7 A;  3CPW P;  4ZGD B;  3OYY A;  4XK8 E;  5EG2 A;  1BU1 A;  1KD1 U;  2EQI A;  1GBR A;  2F5K A;  4XU2 A;  1AWO A;  4BUG A;  3C4S A;  3OYK A;  5GAN d;  4ZGE B;  2EWN A;  3G1J A;  2KT1 A;  1WXB A;  4HCZ A;  1QP2 A;  2QEX T;  3EG1 A;  2XDD A;  4M7A A;  2H8H A;  3JCM X;  2XID A;  3CC7 T;  3NFC A;  1H64 1;  2EQK A;  1OZ2 A;  1BBZ A;  2KRS A;  4BY6 C;  1MMD A;  2B86 A;  2O9V A;  1V76 A;  3GF5 A;  4KUL A;  4M77 A;  3OMG A;  3RKX A;  3JV3 A;  1QWF A;  2XIC A;  1G2B A;  2DFU A;  4DBQ A;  2V1R A;  3JCM V;  4F7U A;  4QQD A;  1ZUY A;  2HBP A;  1TWB A;  3PTA A;  1V29 B;  2A36 A;  3U23 A;  1JB0 E;  5IHK A;  5GAM g;  2VB6 A;  5FU7 B;  4HVU A;  3JCM P;  3JRZ A;  2DBM A;  1QVG S;  2FZG B;  1M3B A;  1ZX6 A;  2SRC A;  3J7A F;  2KAF A;  2LNV A;  1MND A;  1UGV A;  2CUD A;  1AVZ C;  4CC7 A;  2O2O A;  1TSF A;  5I2S A;  1IRX A;  3V7R A;  2KNB B;  2AHJ B;  4ME7 A;  3TU4 K;  3MJX A;  1PD1 A;  1QVG P;  2FRW A;  2RQW A;  3VUB A;  4PJO E;  5KYN A;  1VUB A;  2HBW A;  2X3W D;  1X75 C;  2QDY B;  2KRN A;  4JDS A;  3X25 B;  2JM9 A;  1GCQ A;  2OJ2 A;  2NUZ A;  5LJ5 f;  4PFZ A;  2COW A;  3GIB A;  2DPP B;  3QXE B;  4A53 A;  5CVI A;  2VC8 A;  1JEG A;  2AKL A;  4HKE A;  5KYU B;  4QVZ A;  4E47 A;  2E6Z A;  5A0D A;  4OB2 B;  5EC7 A;  1WQ7 A;  2DIL A;  1QLY A;  1WFW A;  1NLO C;  2LX9 A;  1S72 A;  2DNU A;  3GOX A;  4KUI A;  3M53 A;  5GAN g;  4M7D D;  4ATO A;  5GAN 4;  1G5V A;  3EGU A;  3KFV A;  3QWX X;  2YSQ A;  5CCA A;  1YNZ A;  4NL2 A;  4C5E A;  1X43 A;  2FHD A;  3NPF A;  5GMK e;  4B6M A;  2CUB A;  4JJD A;  1I4K 1;  3PFS A;  4CRI A;  2CSQ A;  4ELZ C;  3G6E A;  1WLP B;  3I56 Q;  3C94 A;  3OSS C;  1WJS A;  5GAN 6;  2D6F A;  2KK4 A;  3QII A;  3I9Q A;  3RMS A;  2ZPH B;  2GFU A;  4C8Q D;  2OTL T;  3VU3 C;  2D8H A;  3TEE A;  4RCC A;  2LT4 A;  2JXB A;  3CCU T;  1K4U S;  2AK5 A;  3DLM A;  1S1N A;  1VQO Q;  4A4H A;  2KRO A;  1VQ8 Q;  2P4T A;  1WXT A;  1M27 C;  3CCR A;  1YJW T;  1RAD B;  4XTV A;  1WPY A;  4L6V 5;  1HSQ A;  4MMK A;  3CD6 Q;  3G6E T;  5LJ5 e;  3M4G A;  4BY6 B;  4M75 C;  2YT6 A;  1MV3 A;  5GMK j;  2L5Q A;  4OML A;  3HFN A;  3AT1 B;  3KBG A;  4BAC A;  2PTK A;  4A63 B;  1KQS S;  2O31 A;  4PJJ A;  3HP9 A;  1X27 A;  2RJF A;  2F2W A;  2KQW A;  4FM4 B;  2WAC A;  4FYX B;  1I8F A;  3EH2 A;  1VQK Q;  2ESW A;  4Z88 A;  2VGN A;  4B9X A;  4FU6 A;  3P8B B;  1KQS P;  1W4S A;  5I2M A;  1PC0 A;  4JJB A;  4KBM B;  4KGV B;  2L3R A;  2E70 A;  5KYW B;  4F7U G;  5LJ5 j;  4MZP A;  2E65 A;  4XU3 A;  2G3R A;  2JMA A;  4WF2 A;  2LQW A;  2RNA A;  1IO6 A;  1K8A R;  3CC2 Q;  2QI2 A;  3OW2 A;  2AIR B;  1MV0 B;  4AFQ C;  2SEM A;  2VXF A;  3MEA A;  1OUL A;  2CS7 A;  1BYM A;  3RBB B;  3M4Y A;  3CBM A;  2R57 A;  2F2X A;  4LDY A;  5ECA A;  3SWN C;  1QVF S;  1IXD A;  2QA4 A;  3VJP A;  4OMP A;  5KYY B;  2A37 A;  1M90 U;  2AZV A;  3VYH B;  1SHG A;  2FEI A;  3URG A;  3PNW C;  2F5T X;  3SD4 A;  4FW1 A;  4PJO F;  4EMK C;  4LDX A;  1QKX A;  1QVF P;  4Z89 A;  1PKT A;  4C0D C;  4FT4 A;  1K8A C;  3G4S T;  1QP3 A;  1NPP A;  1K76 A;  2D1X A;  2QA4 T;  1HXD A;  2EQM A;  3Q1J A;  3QO3 A;  2PU9 B;  3GP8 A;  1ACM B;  1PM3 A;  1I0C A;  4X9D A;  3TSW A;  1RAB B;  2DXU A;  2YWW A;  2DL7 A;  3UWN A;  2MYS A;  3E1S A;  3KXT A;  2YUQ A;  2YUP A;  2ENM A;  2FPD A;  4J6W A;  4EDU A;  3FLG A;  3QYH B;  5HCK A;  4D6W A;  1RLQ C;  3PIO A;  2QK0 A;  5DM7 R;  5AT1 B;  2L2P A;  2EJG A;  1Y96 A;  2QQ9 A;  2DLP A;  2XD0 A;  2E3I A;  4LD6 A;  2VKN A;  2DRK A;  3JAM E;  3G71 T;  2RJE A;  9ATC B;  1KJW A;  4M75 B;  1Q95 G;  3JB9 G;  3RDV A;  2VYT A;  3CEY A;  3OYJ A;  4HCC A;  3EGX B;  1WHL A;  1WJR A;  2X4J A;  2O4X A;  4J9D A;  1R77 A;  2CP5 A;  3OS0 A;  3LW5 E;  1X01 A;  3VRY A;  3NHN A;  2A0F B;  5GAO l;  2D0Q B;  2EQJ A;  3VS2 A;  5IH2 A;  3PT9 A;  2FO0 A;  3SFM A;  1BIB A;  4C92 D;  2XKO C;  3FJ5 A;  2O88 A;  3CBO A;  1H3H A;  2QDL A;  4BB7 A;  1RI9 A;  4PJO D;  3JCM h;  3CQT A;  2NWM A;  2KDS A;  4EMK A;  1W2B S;  4ELY C;  1SRL A;  3CCS Q;  4CC4 B;  3BW1 A;  1PNJ A;  2X4W A;  1Z9Q A;  3UPU A;  4RCB A;  4IUT A;  1ZA1 B;  3VS0 A;  4TVR A;  1TTH B;  4Y92 A;  3OYE A;  3I56 A;  3E2U A;  2ROL A;  4LNP A;  3X24 B;  1M5Q 1;  1K8A U;  3LYI A;  4M78 C;  3QSU A;  1T3L A;  2BZ8 A;  3HRS A;  3SWN B;  1JBM A;  2CKK A;  3CME T;  4PFP A;  4IUR A;  1W2B P;  5FW9 A;  1NPR A;  3UA7 A;  4JLG A;  4XTX A;  2V1Q A;  3EHR A;  4HVV A;  1VQO A;  3VS3 A;  3GPL A;  5GJV B;  1I5O B;  2X3X D;  2XG8 D;  1YIT Q;  2HL3 A;  2DJQ A;  2GTJ A;  2LJ0 A;  4GLK A;  1GXI E;  1KD1 R;  2NUP A;  1K9M R;  4XU1 A;  3CD6 A;  2J6F A;  5FU6 C;  4EMK B;  4EMH A;  1U1T A;  5KYX A;  1V1C A;  1ABO A;  3UDC A;  4C0D B;  1QMC A;  2K2M A;  4WTO B;  3QJ6 A;  1VQ6 Q;  2QQS A;  1MMG A;  2ZGW A;  1AD5 A;  2KSS A;  3JCM c;  3PVL A;  2DZ9 A;  3VUZ A;  4M7D E;  4E7L A;  3QUI A;  2JT4 A;  3JCM Q;  2EVR A;  1TS9 A;  3C95 A;  4OGC A;  1PG5 B;  2JVV A;  1VYU A;  4DBR A;  2CP0 A;  1VQK A;  3S3N A;  2PZ1 A;  2A08 A;  2MI6 A;  2P0K A;  2RF0 A;  4DEX A;  3A8H B;  3PGG A;  1FMW A;  3RKW A;  3JB9 J;  2DTI A;  1KD1 C;  1Y57 A;  1ZBJ A;  1NYG A;  3OQ5 A;  1YN8 A;  4C8Q E;  1K9M C;  4OF1 A;  2GCX A;  2LCL A;  1ZSG A;  3EFS A;  4ANJ A;  1WHK A;  3PMI A;  3C0C A;  3CC2 A;  4E7K A;  3FEO A;  5CO7 A;  1RUW A;  4OMM A;  3E9G A;  3RMQ A;  2LQ8 A;  1GCP A;  3M0R A;  1VQM T;  5L8R E;  1M2V A;  5GAM f;  1D3B A;  4N4G A;  5DLQ E;  5GAO p;  3M54 A;  1C1A A;  3H8Z A;  2DVE A;  4OMN A;  3MET A;  4QKU A;  2DA9 A;  1YJ9 Q;  4C8Q G;  4M7A C;  4BE2 A;  2L3P A;  2FZK B;  4QVC A;  3F70 A;  4NL3 A;  1TH7 A;  2X51 A;  1EX4 A;  3OYL A;  2CZ0 B;  4M77 C;  2G6F X;  2A3L A;  1KQ1 A;  1WA7 A;  3FIF A;  3OYN A;  2H3E B;  1PSE A;  1QCN A;  3CCM T;  2YRV A;  4N0A A;  3CMA A;  1YJN A;  1UFF A;  4JJC A;  3EGD B;  1AZG B;  4JJN K;  3JCM g;  1SSH A;  1KHI A;  2K79 A;  3QKJ A;  2CT3 A;  5D6X A;  1XQH A;  1EIF A;  2HKQ B;  1AOJ A;  2E12 A;  2QGF B;  1JQQ A;  1UE9 A;  4J9G A;  4M78 B;  2WSC E;  4FIB A;  3LH5 A;  4AFZ C;  4EIK A;  4IKF A;  1IB8 A;  2K4Y A;  3OYM A;  4HCB A;  2JS0 A;  3CPW S;  3A8G B;  3CMA T;  1YJN T;  1X6B A;  4D8K A;  1KHC A;  3BFM A;  3CCV A;  4C5H A;  3M57 A;  3CCE Q;  2EPD A;  2CRE A;  5CR2 A;  1VQ4 T;  5CIU A;  5M9O A;  3L2Q A;  5FU6 B;  1OZ3 A;  1AEY A;  1YI2 Q;  1GCQ C;  3V8L A;  5GAO n;  2YLC A;  4MML A;  2KY9 A;  1LCK A;  1OU9 A;  2BE7 D;  3R6N A;  1FX7 A;  2BE9 B;  1K9M U;  3GLX A;  1VQN Q;  1BK2 A;  4NS5 A;  3NTI A;  3CCV T;  4P5N A;  1T3S A;  2PUO B;  3TSZ A;  4L59 A;  1TUC A;  2K9G A;  1X6O A;  5FRO A;  2LX7 A;  2C0I A;  1ARK A;  3I5S A;  2DL5 A;  4B9W A;  5J39 A;  4CI0 C;  1NEB A;  2EYX A;  3CC4 A;  4PK4 A;  1OEB A;  4M7D F;  4EMG A;  1H8K A;  2C06 A;  2OTJ Q;  5CKD A;  2DAQ A;  4HXJ A;  1PD0 A;  5I21 A;  3CCS A;  2QYZ A;  4BE0 A;  3RUX A;  4C8Q F;  4ZTJ A;  1NM7 A;  3CC4 T;  3V8J A;  4J7F A;  2MK5 A;  2ROT A;  4JRI A;  4J8O A;  3A8L B;  4JLI A;  1N9R A;  4KGX B;  1ZHI A;  4QVD A;  3DLL A;  2MIO A;  2RI5 A;  4M7A B;  1G83 A;  2LRQ A;  3CCJ Q;  4KH0 B;  1X2K A;  1HJD A;  1YIT A;  2J6K A;  2FPF A;  2HQE A;  3L2W A;  4M77 B;  2O9S A;  3V7S A;  1PRM C;  1WXU A;  1D1C A;  1WZO A;  2KE9 A;  4FT2 A;  1M90 R;  1VQ6 A;  2W0Z A;  4C92 E;  1O9S A;  1QWE A;  4FCY A;  4F7U B;  1ABQ A;  4X1V A;  4OMQ A;  1QKW A;  1ZBX A;  1IHV A;  3CCL Q;  5GMK h;  2DO3 A;  2KMT A;  1UGP B;  1K73 C;  3LWI A;  2ZPB B;  1YIJ Q;  3OS5 A;  1P92 A;  1X69 A;  3FRN A;  2EGA A;  1PCX A;  4RTV A;  1XNI A;  2MWO A;  3LH0 A;  1NG2 A;  3CCQ A;  4AT1 B;  1YWP A;  4C92 G;  4F04 B;  3EFO A;  2RK2 A;  3TCJ A;  4LN2 A;  2DEQ A;  3BY7 A;  4PL6 A;  2KT8 A;  1QVG A;  2KXD A;  1ZSZ A;  2C0O A;  1UB4 A;  4PJO G;  1M90 C;  4RKU E;  3M0T A;  3SB2 A;  2DXC A;  1SEM A;  5LJ5 h;  2DIQ A;  3I55 Q;  1E6H A;  2LC4 A;  3PMT A;  2E1H A;  2QTX A;  2I2L A;  2W10 A;  2MMP A;  1R0C B;  4AMC A;  2LJ3 A;  5LJ3 f;  3CCQ T;  4M75 D;  1YHQ Q;  1U8R A;  1M4Z A;  2FRY A;  2JM8 A;  4F14 A;  3H0I A;  2M16 A;  2K6D A;  1ZUU A;  1S72 T;  2K7A A;  2K3Y A;  5HK3 A;  1AWX A;  1Y07 A;  1ZSZ B;  1G3T A;  4J9H A;  1G3S A;  2RQU A;  3VS5 A;  2DD4 A;  1WDX A;  3VS1 A;  2WSE E;  3QHS A;  5LJ5 d;  3EG2 A;  4M7A E;  5C0M A;  1PRL C;  1QVP A;  3M59 A;  2JTF A;  2LT1 A;  2DEU A;  4X34 A;  2MAM A;  3VKI A;  2PVD B;  3EG0 A;  2LCC A;  2MWP A;  2RHU A;  3OYG A;  3M0Q A;  2X4Y A;  5IXF A;  4E7Z A;  1MGQ A;  2LZ6 B;  3CCR T;  3IQL A;  2XMF A;  3L2Z A;  1M1K R;  1Q86 R;  3E9F A;  2EYQ A;  1VQP Q;  2BZX A;  2FYK A;  1PKS A;  1JXM A;  1VQ9 Q;  1D1A A;  2LNH B;  2PQW A;  2LQK A;  1R8O B;  1WI7 A;  1VQ7 Q;  5LJ3 e;  4LE9 A;  2GBQ A;  2CP2 A;  4NOY A;  4Q5W A;  2GF7 A;  4L5G A;  1K73 U;  1Q7Y U;  1J3T A;  4KT0 E;  2BKD N;  1MUZ A;  3RIR A;  3BDU A;  1OOT A;  1YI2 A;  2OI3 A;  3LX7 A;  5I11 A;  2DX1 A;  2RN8 A;  1SSF A;  2Z0W A;  4FL6 A;  4Y91 A;  1F1B B;  2ZCF B;  2KYM A;  4QQ6 A;  2VWF A;  1RAA B;  1KQ2 A;  1M1K C;  1Q86 C;  1BKB A;  1Q82 R;  2RH2 A;  1YBY A;  2RQT A;  2H3J A;  4Z8A A;  5LJ3 j;  4C92 F;  1RAH B;  4HA8 A;  3VRZ A;  2HL5 C;  2K5L A;  2DJZ A;  4JZ4 A;  2KRM A;  2F2V A;  3TVT A;  4J9E A;  1MMN A;  4J5Y A;  1PHT A;  3D7S B;  4GBQ A;  4GY5 A;  3EG9 A;  1RAE B;  2X4X A;  1JJ2 S;  5GAN 3;  3INZ A;  1KFZ A;  3ULR B;  3QWY A;  4QQG A;  1VQL Q;  4DBF A;  5LJ5 g;  1Q82 C;  1VQ5 Q;  4XTU A;  4M7D A;  3DKM A;  5J3B A;  4RTU A;  3MP6 A;  1QVF A;  3A8O B;  1LOJ A;  4XTW A;  1JJ2 P;  3M0S A;  3CXC S;  5C6S A;  3CCJ A;  4XTZ A;  3VV0 A;  1N5Z A;  5A0G A;  3HSB A;  3NTH A;  3ZEH A;  2OX7 A;  3L42 A;  4A54 A;  2E5K A;  4E7J A;  2J06 A;  2KR3 A;  1GRI A;  2ED1 A;  4C8Q A;  3CXC P;  4DQ2 A;  1MMA A;  2EJ9 A;  1RAF B;  2GQV A;  4PKC C;  3CCL A;  4J83 A;  4RG8 A;  4AG2 C;  1YFN A;  3UAT A;  2DL3 A;  2ZPG B;  2RMO A;  3H0F A;  3MKD A;  3L2R A;  1D0X A;  2RHX A;  3H41 A;  2M1H A;  4XTY A;  2GQI A;  1IGQ A;  2QEX Q;  4JS4 A;  4IUV A;  1N9S A;  1BI0 A;  4M78 D;  4HT8 A;  5CKH A;  1U1S A;  3MP1 A;  1Y96 B;  2LJ1 A;  1NYF A;  1TG0 A;  3OYC A;  3KUF A;  1M2O A;  3JCM f;  1M1K U;  1HD3 A;  2CP6 A;  1Q86 U;  4UC4 A;  3M55 A;  1M30 A;  1B34 A;  4RUG A;  2LQN A;  3FC3 A;  3M58 A;  2GGR A;  2O4X B;  1AHJ B;  2LTO A;  5IXB A;  1XTD A;  4RTY A;  3EAE A;  1AT1 B;  4E7S A;  4BDZ A;  2EAY A;  4EPC A;  3JCM J;  4II1 A;  2V8J A;  2M51 A;  1UG1 A;  1N8R C;  1M8M A;  2V8K A;  2DXT A;  3DB3 A;  3MHX A;  2Y4Y A;  2RJD A;  3EH1 A;  2EQU A;  5A0L A;  1NJI R;  2RI2 A;  4D8D A;  5D7U A;  2HQH A;  1VQ8 A;  3SEM A;  4FYV B;  1ZLM A;  4KH1 B;  4RTZ A;  2P4R A;  3REA B;  1OPK A;  5GAO r;  1ZUK A;  4N0A C;  2RB6 A;  1NZ9 A;  2JS2 A;  3JSC A;  1Q82 U;  3I56 T;  3HPW A;  4QT7 A;  3LGF A;  2J7I A;  2PVO B;  4WCI A;  4IIO A;  1H92 A;  2QGG A;  4LUD A;  8AT1 B;  1K0X A;  3L2U A;  4C5I A;  4RTX A;  5FWB A;  2XI9 A;  5HK0 A;  4PJO C;  1BI2 A;  2HEQ A;  4MDW A;  2IPO B;  1W2B A;  2GNC A;  1VQO T;  2EJF A;  1KIK A;  2EGC A;  3ME9 A;  4JUV A;  1VQ8 T;  2KEA A;  3NTK A;  2EKO A;  1EFN A;  5LL6 S;  1Q81 R;  5AYF A;  1KC8 R;  3CD6 T;  2RQR A;  3OS2 A;  2R58 A;  1NJI C;  4M75 E;  5CKB A;  2NUT A;  4PJN A;  2FL7 A;  4F17 A;  1VQ7 A;  2QQA A;  2D9T A;  3OSV A;  2NUP B;  4M7A D;  2CGH A;  2JTE A;  4JS5 A;  3PE0 A;  5KYX B;  4C5G A;  1N6A A;  2KGT A;  3QDF A;  1G3Y A;  3QDR B;  4M7D G;  2XDP A;  4M77 D;  2J05 A;  2DD5 A;  3M56 A;  1UGQ B;  3C12 A;  1OQK A;  1VQK T;  2COZ A;  5GMK m;  3GBQ A;  1U06 A;  1T0J A;  2RHI A;  2JMC A;  4M75 G;  2FPE A;  1OYX A;  2AKK A;  2OTL Q;  1KG1 A;  2CZ7 B;  1Q81 C;  2RJC A;  2LCS A;  1FYN A;  1KC8 C;  3FDR A;  1GFC A;  3OYF A;  3CCU Q;  3CC2 T;  1UGR B;  1JXO A;  3UT1 A;  3L1A A;  4IIM A;  3PIP A;  1YJW Q;  1K0S A;  1YCS B;  3G6E Q;  1UEB A;  2PVG B;  4M4Z A;  1EZZ B;  3MEW A;  4BI3 A;  1N8R U;  4J9B A;  2COY A;  1M2V B;  2A7Y A;  1D3B B;  2DTO A;  2E5Q A;  4ZNX A;  1JRI A;  4C92 A; 
#chains in the Genus database with same CATH homology
 1QWE A;  1ABQ A;  4X1V A;  4OMQ A;  1GL5 A;  1QKW A;  1MV0 B;  4CC3 A;  4AFQ C;  1SRM A;  2SEM A;  1JO8 A;  5I22 A;  4AFS C;  3RBB B;  2F2X A;  1X69 A;  5ECA A;  4E6R A;  2EGA A;  2L3S A;  1RLP C;  3I5R A;  4OMP A;  4RTV A;  2A37 A;  2AZV A;  1NG2 A;  4JPB W;  3THK A;  2ABL A;  1SHG A;  1YWP A;  2FEI A;  5GJW B;  3A98 A;  1UUE A;  4LN2 A;  4J9I A;  2LMJ A;  1UTI A;  2KT8 A;  2KXD A;  2C0O A;  1QKX A;  1UDL A;  2CDT A;  4Z89 A;  1B07 A;  1PKT A;  1AZE A;  3M0T A;  1QCF A;  1SEM A;  5FWC A;  1E6H A;  1K76 A;  2D1X A;  2PNI A;  1AWJ A;  1Y0M A;  2W10 A;  1YP5 A;  1UEC A;  3RNJ A;  2LJ3 A;  2ED0 A;  2C0T A;  2FRY A;  2HSP A;  1CKB A;  2JM8 A;  4F14 A;  1U3O A;  4JZ3 A;  1T0H A;  1I0C A;  3H0I A;  1KSW A;  1WYX A;  2K6D A;  1ZUU A;  2K7A A;  3TSW A;  1NLP C;  1AWX A;  2KYB A;  4K11 A;  2DL7 A;  2D0N A;  1SHF A;  2YUQ A;  2YUP A;  1X2Q A;  1BB9 A;  1GBQ A;  2ENM A;  2FPD A;  1A0N B;  1FMK A;  4J9H A;  5HCK A;  2RQU A;  4ESR A;  2L0A A;  3VS5 A;  1RLQ C;  2DBK A;  1WDX A;  3VS1 A;  4J9F A;  2DYB A;  3EG2 A;  2L2P A;  2IIM A;  1UJY A;  2DLP A;  1PRL C;  2VKN A;  2EGE A;  2DRK A;  2RQV A;  1W6X A;  2MOX A;  1KJW A;  3UA6 A;  2CH4 A;  3EG0 A;  3M0Q A;  5IXF A;  2LZ6 B;  1AWW A;  3IQL A;  2XMF A;  1B3Q A;  1E7O A;  4J9D A;  1XOV A;  1OV3 A;  2BZX A;  1OPL A;  1PKS A;  4DEY A;  1JXM A;  3VRY A;  3ZL7 C;  2LNH B;  3NHN A;  4HVW A;  1WI7 A;  1W70 A;  3VS2 A;  1U5S A;  4LE9 A;  2GBQ A;  5IH2 A;  2FO0 A;  1J3T A;  2A28 A;  2KXC A;  3FJ5 A;  4GLM A;  2KBT A;  3I35 A;  2BZY A;  4R0K A;  1MUZ A;  2O88 A;  3PVQ A;  1H3H A;  2QDL A;  4HCK A;  2ECZ A;  1YWO A;  2LP5 A;  4OMO A;  1OOT A;  1RI9 A;  4ORZ A;  2DE0 X;  2OI3 A;  5I11 A;  3CQT A;  1VYV A;  2NWM A;  2DX1 A;  3EG3 A;  2M0Y A;  2RN8 A;  1Z9Z A;  3O5Z A;  1SRL A;  4AG1 C;  2J6O A;  4CC4 B;  1PNJ A;  1VA7 A;  1Z9Q A;  2KYM A;  3NGP A;  2VWF A;  4KRT A;  3VS0 A;  3M0U A;  4Y92 A;  4LUE A;  2ROL A;  4LNP A;  2RQT A;  4Z8A A;  2FG0 A;  1T3L A;  2BZ8 A;  3VRZ A;  2D8J A;  4F16 A;  4RTW A;  5FW9 A;  3UA7 A;  2GTO A;  2JW4 A;  2V1Q A;  1M3C A;  3EHR A;  4HVV A;  3VS3 A;  4JZ4 A;  5GJV B;  3H0H A;  3VS6 A;  2X3X D;  2KRM A;  2F2V A;  2DJQ A;  2GTJ A;  2LJ0 A;  3TVT A;  4J9E A;  1PHT A;  1UJ0 A;  2J6F A;  4GBQ A;  2DMO A;  2CH4 W;  1V1C A;  1ABO A;  2DF6 A;  1GFD A;  2HDA A;  2K2M A;  2DL8 A;  1VYT A;  4J9C A;  2YDL A;  1JU5 C;  3REB B;  1KFZ A;  2BTT A;  3ULR B;  5L23 A;  2EYY A;  1AD5 A;  3QWY A;  1I1J A;  3PVL A;  2VVK A;  2L3Q A;  2JT4 A;  4RTU A;  2EVR A;  1BU1 A;  1VYU A;  2EQI A;  3M0S A;  1GBR A;  1AWO A;  3SHW A;  1N5Z A;  2PZ1 A;  3M0P A;  2A08 A;  1NEG A;  2RF0 A;  4DEX A;  2KT1 A;  1WXB A;  2E5K A;  1Y57 A;  1ZBJ A;  1NYG A;  2J06 A;  1GRI A;  2KR3 A;  1YN8 A;  3EG1 A;  2ED1 A;  2H8H A;  1ZSG A;  3C0C A;  1BBZ A;  2KRS A;  2B86 A;  2O9V A;  4AFU C;  1RUW A;  4OMM A;  4AG2 C;  1GCP A;  3M0R A;  3JV3 A;  3UAT A;  2DL3 A;  2RMO A;  1QWF A;  3H0F A;  1G2B A;  3H41 A;  2V1R A;  4OMN A;  1ZUY A;  2GQI A;  2DA9 A;  2L3P A;  3NMZ C;  1CSK A;  2A36 A;  3U23 A;  2EYW A;  5IHK A;  2LJ1 A;  1NYF A;  1TG0 A;  3EHQ A;  2G6F X;  4HVU A;  1HD3 A;  1WA7 A;  2DBM A;  2DRM A;  1M3B A;  1M30 A;  1ZX6 A;  2SRC A;  5IHI A;  4RUG A;  2LQN A;  1UGV A;  2MCN A;  2CUD A;  2EKH A;  4RTT A;  1AVZ C;  2GGR A;  4CC7 A;  2O2O A;  5IXB A;  1UHC A;  4RTY A;  2K3B A;  2KNB B;  1UFF A;  5IHN A;  4JJC A;  1AZG B;  1W1F A;  1SSH A;  2FRW A;  2I0N A;  2M51 A;  2K79 A;  2RQW A;  1UG1 A;  2CT3 A;  2OAW A;  1M8M A;  2X3W D;  2HBW A;  3VS7 A;  1AOJ A;  2KRN A;  1JQQ A;  1UE9 A;  2JM9 A;  1GCQ A;  4J9G A;  4D8D A;  2OJ2 A;  4EIK A;  3LH5 A;  4AFZ C;  2NUZ A;  3SEM A;  1ZLM A;  4RTZ A;  3VS4 A;  2P4R A;  3REA B;  1OPK A;  2JS0 A;  1ZUK A;  4FSS A;  2DM1 A;  1JEG A;  2AKL A;  2JS2 A;  1X6B A;  2AZS A;  4D8K A;  4QT7 A;  2YUN A;  2J7I A;  5EC7 A;  4WCI A;  4IIO A;  1H92 A;  1E6G A;  2DIL A;  4LUD A;  1PWT A;  2EPD A;  1SPK A;  1QLY A;  1TUD A;  2CRE A;  1K0X A;  4RTX A;  5FWB A;  1WFW A;  1NLO C;  2EW3 A;  2DNU A;  2HEQ A;  1AEY A;  2GNC A;  3EGU A;  3KFV A;  3QWX X;  2YSQ A;  1GCQ C;  1KIK A;  1YNZ A;  2EGC A;  2KEA A;  1LCK A;  1X43 A;  1EFN A;  3NPF A;  3R6N A;  2CUB A;  4JJD A;  2DL4 A;  1BK2 A;  2CSQ A;  2RQR A;  1WLP B;  1T3S A;  2DVJ A;  3TSZ A;  1TUC A;  2EYZ A;  2K9G A;  4F17 A;  2EBP A;  3I9Q A;  1ARK A;  2LX7 A;  2C0I A;  3I5S A;  2D8H A;  2DL5 A;  2JTE A;  1X6G A;  3PE0 A;  2JXB A;  2KGT A;  1NEB A;  2EYX A;  1K4U S;  1OEB A;  2AK5 A;  1S1N A;  2KRO A;  1H8K A;  1WXT A;  1M27 C;  2J05 A;  1HSQ A;  3GBQ A;  1U06 A;  4HXJ A;  1T0J A;  2JMC A;  2FPE A;  1MV3 A;  2YT6 A;  4CC2 A;  2AKK A;  4OML A;  1I07 A;  2CT4 A;  2LCS A;  2PTK A;  1FYN A;  4A63 B;  1NM7 A;  2RPN A;  2O31 A;  1GFC A;  2ROT A;  1WIE A;  1JXO A;  1X27 A;  2CSI A;  2F2W A;  1K9A A;  2MIO A;  4IIM A;  1G83 A;  1CKA A;  1K0S A;  3UF4 A;  2ESW A;  1YCS B;  4Z88 A;  1X2K A;  1HJD A;  1UHF A;  1M3A A;  2J6K A;  2FPF A;  4M4Z A;  1WX6 A;  2O9S A;  4JJB A;  1PRM C;  1WXU A;  1K1Z A;  2HCK A;  4J9B A;  2KE9 A;  2JMA A;  2LQW A;  2RNA A;  1IO6 A;  2W0Z A;  4ZNX A;  2YUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...