1QWEA

C-src sh3 domain complexed with ligand app12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (signal transduction/peptide)
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
source organism Avian sarcoma virus
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qweA00
3RBBB 1JXMA 1UHCA 1NM7A 2FG0A 4AFQC 1X43A 2JXBA 2PNIA 2YSQA 2ED0A 1SHGA 3I9QA 3UATA 2DF6A 2ECZA 1I07A 5L23A 2EGEA 1M3BA 2K79A 5HCKA 3M0TA 1SHFA 2BZYA 3CQTA 4X1VA 2FPFA 2KXDA 4OMLA 2NWMA 4Z8AA 2LQNA 1JU5C 2O9SA 4DEYA 4J9DA 1NYFA 2YUQA 2MIOA 2HSPA 2DNUA 2ABLA 4J9BA 2KNBB 5EC7A 1OOTA 2EYXA 4HVUA 3VS7A 1PRMC 3EG3A 2J6KA 1VA7A 1T0JA 3C0CA 4R0KA 2K2MA 1MV0B 3EG0A 5IXBA 1OPLA 2D8HA 2LMJA 1ZUUA 2EGCA 1HD3A 2EYWA 1WXTA 2FO0A 1LCKA 2QDLA 4Z88A 1W6XA 4J9IA 2GTOA 4ZNXA 1GBRA 2J05A 3KFVA 3H0FA 2DL3A 2DL7A 2L2PA 3EG1A 1TG0A 1SRMA 1BU1A 2JW4A 2ROTA 1UJ0A 4HCKA 3NGPA 2O9VA 4LN2A 1GFCA 4AFZC 1YN8A 2EVRA 1KSWA 1M8MA 2YT6A 4CC3A 1GCPA 3H41A 3QWXX 2RQTA 2C0OA 2GQIA 1U06A 3UF4A 1K76A 3TSWA 1PKSA 1CKBA 1V1CA 2DMOA 4RTTA 2NUZA 5IHIA 4J9HA 3O5ZA 2BTTA 1TUDA 4JPBW 2G6FX 1T0HA 1WXBA 2AZSA 2IIMA 4Z89A 1ABOA 1VYVA 5IH2A 3M0PA 1JO8A 2JT4A 2X3WD 4IIMA 1AZGB 4OMOA 2J6OA 2M0YA 2J7IA 4AG2C 4OMQA 1PKTA 3JV3A 1AZEA 1AEYA 1QCFA 1UE9A 2EYYA 2W10A 3VS6A 4RTXA 1NLOC 2SEMA 5GJWB 2XMFA 3NHNA 4EIKA 1YWOA 2RN8A 2YDLA 1AVZC 1CSKA 3UA6A 4J9FA 2L0AA 2F2XA 4LNPA 2M51A 1W1FA 3M0SA 3A98A 1EFNA 1GL5A 5FWCA 1YWPA 1QWFA 5FWBA 3H0IA 4E6RA 4RTWA 4D8DA 2LJ1A 1SEMA 4RTYA 2J6FA 2KYBA 4AFUC 5ECAA 2RQRA 3QWYA 1K4US 4RTUA 3H0HA 2A28A 3I35A 1KJWA 3M0RA 2DL5A 1SSHA 1AWXA 1UTIA 5I22A 2D0NA 2DL8A 3VS4A 2L3QA 2KXCA 1AOJA 2K9GA 2KYMA 1B07A 1KFZA 2LNHB 4J9CA 4LUEA 3REAB 1PHTA 1T3SA 1YP5A 2D1XA 2DA9A 1X2QA 2EYZA 1UG1A 1GCQA 1K0SA 4RUGA 1M3AA 1JQQA 1UGVA 2EW3A 3UA7A 4JJBA 1OV3A 1HJDA 2O88A 3REBB 1AWJA 4DEXA 2KT1A 1S1NA 4HVVA 1A0NB 5IXFA 2JS2A 4AG1C 1M3CA 1ZUKA 4JZ4A 1WFWA 1W70A 2C0IA 5FW9A 1K9AA 2CSIA 2KEAA 1RI9A 2KBTA 2YUNA 2YUOA 1WIEA 1U3OA 5GJVB 1Y57A 1WDXA 2FPDA 1RLQC 2DLPA 1G83A 2W0ZA 2ENMA 4Y92A 2CUBA 1RLPC 2KT8A 2YUPA 1AD5A 2RMOA 4F16A 2JS0A 4ORZA 4RTVA 1E6GA 2AKKA 1X27A 2A36A 2JTEA 2DBMA 3PVLA 4IIOA 1X6BA 4J9GA 1NLPC 1QKXA 2B86A 1X2KA 2OJ2A 2X3XD 1WXUA 2DRMA 1BBZA 2LJ3A 2JMAA 2AK5A 2PTKA 2HBWA 2DBKA 2MOXA 1UUEA 2OI3A 1ZBJA 2EKHA 2JM9A 1E6HA 4AFSC 3NPFA 2EBPA 1QLYA 2F2WA 2GBQA 3SHWA 3R6NA 1FYNA 1U5SA 1NEGA 2BZ8A 4F17A 1GFDA 1IO6A 3LH5A 2FEIA 2K7AA 3ZL7C 4OMPA 4HVWA 2ROLA 1K1ZA 4KRTA 2RNAA 2CT4A 3VRZA 1VYUA 1UDLA 2V1QA 1UJYA 4CC2A 1HSQA 3TSZA 1WA7A 1JEGA 2DE0X 3SEMA 2O2OA 4D8KA 2LQWA 1NYGA 2EPDA 4CC4B 3EG2A 2AKLA 1T3LA 3FJ5A 1PRLC 2RF0A 1ZUYA 3VS0A 5I11A 2RQWA 1ZX6A 2O31A 1G2BA 1BK2A 3ULRB 2L3PA 2LZ6B 2LJ0A 1H92A 2HCKA 3EHQA 3VS2A 1Z9QA 1MV3A 2VKNA 4M4ZA 3EGUA 3I5RA 2LCSA 1BB9A 2DX1A 2VVKA 2K6DA 1WYXA 2KRNA 4WCIA 2KE9A 2DYBA 2J06A 2RQVA 2CDTA 3VS3A 3TVTA 4LE9A 1J3TA 1WX6A 4QT7A 4CC7A 1M27C 2GGRA 4ESRA 1FMKA 1AWWA 2K3BA 2D8JA 2RQUA 1N5ZA 2ED1A 2GTJA 2RPNA 1KIKA 1PWTA 1UECA 2A08A 2KROA 2KGTA 1E7OA 3U23A 1UFFA 2VWFA 3M0QA 4GLMA 2MCNA 1X69A 2CUDA 2I0NA 2SRCA 1Y0MA 4FSSA 2KRSA 1AWOA 3PE0A 2CH4A 3THKA 2CREA 2PZ1A 4RTZA 3M0UA 1QWEA 1ABQA 1RUWA 4GBQA 2HEQA 2ESWA 4OMMA 1OPKA 2GNCA 1ARKA 2A37A 1VYTA 2FRYA 1GCQC 2DRKA 1ZLMA 1K0XA 1XOVA 2L3SA 1B3QA 4JJCA 2BZXA 2DM1A 2EGAA 2JMCA 1SRLA 2FRWA 2DILA 2V1RA 4JZ3A 2C0TA 3RNJA 4JJDA 4OMNA 2F2VA 4K11A 1YNZA 1QKWA 2KRMA 1WI7A 3NMZC 2KR3A 1JXOA 2H8HA 2JM8A 3PVQA 3VS1A 1NEBA 2FPEA 5IHKA 2CSQA 5IHNA 1TUCA 2CT3A 3VRYA 1YCSB 1MUZA 1GRIA 1GBQA 2OAWA 2CH4W 3VS5A 4HXJA 4J9EA 1UHFA 1SPKA 2DJQA 1I0CA 2LP5A 1PNJA 1WLPB 1H8KA 2AZVA 1NG2A 2DVJA 1M30A 1Z9ZA 2EQIA 3I5SA 4F14A 1X6GA 4LUDA 1OEBA 4A63B 1I1JA 2HDAA 1ZSGA 2E5KA 1H3HA 2LX7A 3GBQA 3IQLA 2DL4A 1CKAA 3EHRA 2P4RA
chains in the Genus database with same CATH superfamily
4M77E 4AFQC 3GIBA 5D6WA 2LVMA 3FEOA 1VQLA 2EGEA 1ZBXA 4C5HA 3S3MA 4PJJA 1VUBA 4FCYA 2K79A 3M0TA 3OS5A 4IUQA 1VQ7Q 5GANd 2VGMA 2Z0WA 4QVZA 4M77B 4Z8AA 1QCOA 3CMAA 4DEYA 2YUQA 2MIOA 1YCYA 4M75F 3MP1A 5GAMg 2EFIA 5A0DA 2KNBB 5EC7A 3J80E 1WHJA 3KXTA 4HVUA 4XAXB 1PRMC 4OB0B 1VA7A 4R0KA 3G6EQ 2BIVA 3OYDA 3VV0A 2GFUA 4R55A 4OMFB 2XICA 4R56A 3KFVA 2MAMA 1OX8A 4PFOA 1YIJA 2EQUA 2DL7A 3EG1A 1MNEA 3GNFB 1S72T 1BU1A 1M2VA 3OYYA 5GAN2 3G7ZA 4GLKA 3O8VA 4BDYA 3JRZA 4FYYB 1OULA 4M77C 5CAIA 9ATCB 1YN8A 1D09B 4BE2A 1KHIA 2YT6A 3CCET 2LRQA 2RK1A 1YHQQ 2EJGA 1B34B 2C0OA 2KAFA 3FIFA 3GNGA 2OTLT 1K76A 1PKSA 3OS0A 1VQ4T 1YJ9Q 4RTTA 4C92G 1NJIU 4XU1A 4PLLA 2NUZA 4FL6A 5GANh 3A1PA 3O5ZA 3EGDA 3CPWA 3RESA 5LJ5e 3CC7Q 1PSFA 1PC0A 3ZFJA 4Z89A 4M7DF 3DB3A 3H6ZA 1NPPA 1AT1B 3OYKA 5LJ3d 4OMOA 3CCJQ 2J6OA 2J7IA 4DQ2A 3HP9A 3VYGA 4OMQA 1PKTA 2WSFE 2XDPA 3M4YA 2PQWA 2YLBA 2E10A 2CZ0B 4LDVA 3JSCA 3X24B 2XMFA 3HRSA 5KYNA 2X4YA 4HCZA 3S6WA 2YRVA 1D1BA 2HL3A 4J6YA 3BFMA 4C8QE 4GY5A 3QHSA 3M0SA 3NTHA 1IHWA 5FWCA 3EG9B 3VYHB 2IVWA 2MI6A 1QWFA 5FWBA 3CXCP 4M7AD 4E6RA 4PJOD 4D8DA 2J6FA 4RTUA 2I2LA 1KJWA 2FZCB 1UTIA 2D0NA 3VS4A 3QZ5B 3GF5A 2KXCA 3OSVA 4C8QB 2K9GA 5GMKj 4J9CA 1Q81R 3JB9D 3QDFA 4M77A 4PJOG 2D1XA 2X4JA 2DZCA 4C0FA 1Q82U 3PIOA 4RUGA 4RG8A 1JQQA 4J83A 3GLXA 4M77D 3MP6A 3REBB 2QDYB 4DEXA 4HVVA 4N0AC 5LJ3h 2JS2A 1Q7YC 1S72A 4KBMB 5FW9A 3A8LB 2YUNA 1VIEA 5LL6S 1GXIE 1U3OA 3JB9J 4DOWA 1Y57A 2QASA 2CUBA 2VXEA 4RG2A 3X25B 3OB9A 5GMKm 1AD5A 4C8QC 4XTVA 3CCVA 2JS0A 3LGFA 2HQHA 1G3SA 2DKGA 4ORZA 4RTVA 2AKKA 2OTLA 3M55A 3FLGA 5KYYB 5FROA 1VQ4A 4J9GA 4JUVA 1SG5A 1Y96B 1UGQB 2FZGB 2X3XD 1WXUA 4FYWB 3CCLQ 2HSEB 3M54A 3JCMc 3PIPA 2HQEA 3A8GB 1BIAA 1B34A 2AIRB 1Y07A 4E7HA 2JOYA 4PFPA 2OI3A 1KHCA 1ZBJA 2EKHA 4JLGA 4JJNK 4BE0A 1D1CA 3OYJA 3L2WA 1VQOQ 1QVFS 1QLYA 2F2WA 3SFMA 1K73R 1M90R 5FRMA 2Y90A 4XK8E 4FT4A 4ZTJA 3JCMe 1FYNA 4M7AF 4F17A 1TSFA 3A5ZB 4A53A 3JCMX 4OMPA 4PJLA 2ROLA 3LGLA 3CCST 2RNAA 1N8RC 1VQ8T 1UDLA 1B7TA 1IGUA 2HQXA 4B9WA 4ZN1A 4M78E 3L2RA 2LQWA 2VXFA 4LDUA 1YITT 1IHVA 1VQMQ 3JB9F 2AKLA 1T3LA 2HD0A 1PRLC 4ZTFA 2RQWA 2O31A 2EWNA 4M77F 2Y4XA 2L3PA 2LZ6B 3ULRB 2LJ0A 2HAXA 2HCKA 3CXCA 2EYQA 2ZCFB 4N0AA 4E7LA 5FU7B 4M78B 6AT1B 2XHCA 3EG9A 5HKCA 1H3ZA 1RAAB 3LW5E 1ACMB 1WYXA 2KRNA 2QQBA 5D6YA 2QXFA 2DYBA 4BD3A 2CDTA 1WX6A 4PLIA 4QT7A 1YI2Q 2GF7A 3JCMP 4C8QA 2ZPEB 4ELZC 5LJ5j 3G4SQ 3CCRQ 4EPCA 4C8QD 2ED1A 2M16A 3M56A 4J7IA 4IURA 2KROA 5CKEA 2EQMA 1M5Q1 2DXTA 1I4K1 2VWFA 5DLOA 4GLMA 5EG2A 1QCNA 2CZ6B 2MWOA 3CCQA 1ZSZB 3N5BB 5FU7C 3I55T 2RJCA 2KRSA 1AWOA 4M78C 2CH4A 2VASA 1MMNA 3THKA 2CREA 2PZ1A 4RTZA 1D0ZA 2JVVA 3OQ5A 1VQLQ 4JRPA 4NOYA 1RUWA 3EFSA 2HEQA 5GAOm 1I5LA 3MEUA 2WSCE 2O01E 1ZLMA 1K0XA 5LJ3g 2L3SA 1B3QA 3QZ9B 1TWBA 3EFOB 2BZXA 3CMAQ 1MGQA 4M7DE 4X9DA 2JMCA 2FRWA 2DILA 2V1RA 2P0QA 2NLUA 3RNJA 4OMNA 1Y96A 4MDXA 4LDXA 1WI7A 2KR3A 2K3YA 5IHKA 3QG1A 1M4ZA 5CIUA 3V8KA 3WVDB 4XTZA 1GBQA 1YIJQ 2CH4W 4VUBA 1QVFP 2M0OA 1BI3A 1I81A 2DJQA 2G3RA 2M02A 3CCSA 1I0CA 4DBQA 1H8KA 2AZVA 4ZGJB 3BDUA 1WZOA 4F14A 1KC8R 1X6GA 4LD6A 3FC3A 1YITA 3CCUT 2COWA 4Y28E 2FG0A 2EKOA 5DLQE 3PFSA 2PNIA 2LNVA 3I9QA 1C6VX 2DF6A 1I07A 3CBMA 5HK0A 2CP5A 3S3OA 5KCHA 3CC4T 4C8QF 2COYA 3CQTA 4X1VA 1N8RR 1D0YA 1MMDA 2OX7A 2O9SA 1NYFA 2JZ2A 2QA4A 2CS7A 2HSPA 1U1SA 3UWNA 4J9BA 1OOTA 2EYXA 4M78A 3EG3A 1C0MA 2LX9A 3VUBA 3C0CA 1VQOA 2YXYA 1WHLA 4QQDA 1TOVA 4KH0B 4BE1A 4M78D 1XTDA 2JTFA 2EYWA 4RCBA 1WXTA 3JCMb 1W2BS 1W6XA 4J9IA 3FB9A 1VQ6T 4ZNXA 3MEAA 3LWHA 1GBRA 1N27A 3CD6A 1I8FA 2YRCA 2VC8A 2E12A 5L8RE 3DB4A 2XKOC 2JW4A 2ROTA 3NGPA 2O9VA 4LN2A 1K73U 4AFZC 1M90U 4C5GA 1YJNT 1VQMA 1RAHB 1M8MA 2GCXA 1ZSZA 5GMKl 3OYGA 1PCXA 4M75G 3F70A 1PD1A 2GQIA 2JNGA 3UF4A 2JTMA 4O5VA 4FU6A 3CBOA 1N9SA 2KY9A 3OYLA 4JPBW 7AT1B 4L6V5 4C0GA 1BI0A 4C5IA 4B6MA 3UPUA 1VYVA 2RJDA 2H3EB 2JT4A 2X3WD 2EJ9A 4XTYA 5LJ5f 1IGQA 4XTWA 3OYHA 2X35A 1PSEA 2ZPHB 3OYIA 1S72Q 3HRUA 4FYVB 1AZEA 2QEXA 3HFOA 1QCFA 1RL2A 4ATOA 3EFRA 1IXDA 2E3HA 1FMVA 1NLOC 1QQJA 1TU0B 2K5IA 5GJWB 2DAQA 2RN8A 3CCEQ 2CP2A 1KK7A 3CCVQ 1AVZC 4XU2A 4J9FA 3GP8A 2OTLQ 2E6NA 4M78F 1VQ4Q 3RERA 2M51A 1QVGS 3H0IA 5CKHA 1VQNT 4EDUA 4M7DG 3NFCA 1SEMA 4RTYA 4AFUC 3CBPA 4JDSA 3H0HA 2A28A 5A0GA 3M0RA 2DL5A 1SSHA 5GAOq 5GAOr 2DL8A 1JBMA 2PUOB 4XTUA 1LPLA 1FWZA 1UGPB 1M8VA 1B07A 1KFZA 4X34A 2LNHB 3M4GA 1RACB 1PHTA 3QJ6A 4MMLA 1X2QA 2QQRA 3WVEB 1M1KR 2EYZA 1M3AA 2EW3A 3UA7A 4JJBA 1OV3A 2P0PA 1HJDA 1VQ6A 1AWJA 4OGEA 3I56T 2KT1A 1S1NA 5IXFA 1MHNA 1WQ7A 5GAMe 2V26A 4PJMA 2ZPBB 1OX9A 1W2BP 2KEAA 1G3WA 1U1TA 4EMGA 1RLQC 4Z02A 4QW2A 3VJPA 4DBFA 3AHUA 2RB6A 1YJNA 1RLPC 4D6WA 2KT8A 2CGHA 2RO0A 2RMOA 1K8AR 2V8KA 3QBYA 5GAOl 1K9MU 1X01A 1YFNA 2A36A 4IIOA 4XU3A 3QIIA 3T9NA 2OJ2A 1KC8U 4BI3A 1BBZA 1R8OB 1OZ3A 5CVIA 3V7SA 2LJ3A 1YJWT 2AK5A 1RAEB 4XQ3A 1KD1C 2PTKA 3QSUA 4QQ6A 8AT1B 3TQ7P 1MMGA 4HT8A 2AHJB 2BKDN 4F7UE 2RI5A 1RAFB 2XDDA 2KI7A 1VQ7T 2JJ9A 3SB2A 3SD4A 3NPFA 2EBPA 5AT1B 2E6ZA 2GBQA 3QXEB 3J7AF 1FXXA 1U5SA 2BZ8A 4P5NA 4LDYA 4C5EA 3ZL7C 3SWNC 3JCMf 3CCQQ 4F7UB 3E2UA 3MCAB 4KRTA 5KYXB 3G6ET 1IRXA 2LC4A 2MWPA 2V1QA 2WSEE 1UJYA 1HSQA 3RKYA 1ZQ1A 3MEWA 2DE0X 1UGSB 1WJSA 4D8KA 1M1GA 1VQKT 2K2VA 1ZHIA 2GQVA 2ZZDA 3FJ5A 3VS0A 1G2BA 1VQNA 2DPPB 2E3IA 5CQXA 1ZA1B 3EHQA 5IN1A 4AT1B 1Z9QA 1VQ5T 2VKNA 4L59A 2MK5A 1QVGP 3EGUA 2LCSA 3DKMA 5J39A 2R58A 1TUGB 3OMCA 4JRIA 1MMAA 2QG9B 4M7AG 4E47A 3CC2T 1Q86U 2XG8D 3NTKA 2J06A 2K57A 5DM7R 3OBYA 1N9RA 3TEEA 1J3TA 1VQ9T 2EAYA 3ASKA 4CC7A 1M27C 3S3NA 3I56A 3CCSQ 3PT9A 2K3BA 2RQUA 1G8XA 1N5ZA 2RPNA 3CC7T 2A08A 3JB9G 4RMOA 3RKXA 1JJ2S 3M0QA 3FJPA 1YITQ 2MCNA 1W2BA 2SRCA 4M77G 4ANJA 5I2SA 3CCEA 4OGCA 4RKUE 3M0UA 2M9UA 2DTHA 2WACA 2EIFA 3H8ZA 4OMMA 3LLRA 4DOVA 2GNCA 2A37A 1VYTA 2XDBA 3G71T 1GCQC 2DRKA 3QYHB 1KQSS 4BUGA 1YJWA 2QA4Q 2K3XA 4PNOA 5HY6A 2ZPIB 2C0TA 4JJDA 4K11A 4C0DB 1KG1A 1QKWA 3PMTA 2DERA 3JCMg 1K9MC 2H8HA 1NJIC 2FPEA 1OYXA 2CSQA 5IHNA 3CD6Q 2B8AA 1TTHB 1YCSB 1MUZA 4E2FB 3HRTA 1UHFA 2YWWA 5AYFA 1NG2A 4LD9K 1Z9ZA 1RADB 3CPFA 1O75A 4KH1B 1OEBA 2RK2A 3X20B 4A63B 1I1JA 1ZSGA 2E5KA 2LX7A 5GAMj 1VQKA 2XD0A 4F7UA 2DL4A 5KYXA 3EHRA 3RBBB 5KH6A 1UHCA 1NM7A 2QQSA 1MNDA 3ME9A 4WF2A 5C0MA 4C0DC 1EZZB 2ED0A 1SHGA 4LDWA 2DEUA 2ECZA 3MPUB 4KULA 2O4XB 5GANe 1VQ5A 2HNIA 2LDMA 3OSSC 2BZYA 2RHYA 2NUPB 2QAZA 2FPFA 1QVGA 2KXDA 2FZKB 3VU3C 3PTAA 4J9DA 3CC2A 2CP7A 1RABB 2DNUA 1VIFA 2KQWA 2RH2A 5GMKh 4EMHA 3RUXA 4BDZA 2J6KA 1K8AU 1T0JA 1MV0B 3DLMA 2F69A 2D8HA 2LMJA 4B9XA 2DTIA 4IUUA 4A4KA 3OS1A 2QEXQ 4QQGA 4Z88A 2GTOA 2DTOA 3CMET 3H0FA 2L2PA 1TG0A 4HCBA 1Q82C 3P8DA 2XI9A 1VQPT 5CR2A 3LYIA 2PVOB 4C8QG 5HK3A 4KUIA 1UJ0A 5GMKi 1JJ2P 3V8LA 4V2SA 1GFCA 2EVRA 4E7IA 3HKSA 1NBEB 4CC3A 1GCPA 1Q7YR 1D1AA 3G71A 3QWXX 3HSBA 2BE7D 2DO3A 3QO3A 2DEQA 4MZMA 2YLCA 3QYGB 2DETA 5KYYA 1BCMA 1PM3A 5GAN8 3CPWS 5IHIA 5GAN3 4M7DD 3ZBDA 2M1HA 2BTTA 1FX7A 1TUDA 1KQSP 2G6FX 3D7SB 4XTXA 1WXBA 2AZSA 1WGSA 3OY9A 4EMKB 1ABOA 4BI8B 4DBHA 4XU0A 1V29B 5IH2A 3M0PA 5LJ3e 1JO8A 1VQ6Q 4FSXA 2X9HA 4F7UF 1OU9A 3OBWA 2M0YA 2L89A 4AG2C 1VQ8A 4FT2A 2EJFA 3JV3A 1AEYA 1Q81U 1RAGB 1BYMA 3VS6A 1JRIA 1YJNQ 3KBGA 2SEMA 3OYAA 1BI2A 1C1AA 3CCRT 4J6XA 1WQWA 2YDLA 1UGRB 4HKEA 2LTOA 1XNIA 2L0AA 4LNPA 4NL3A 4PK4A 1I5OB 1W1FA 3A98A 4WTOB 1GL5A 3C4SA 1YWPA 4EMKC 1X6OA 2CKKA 3CCMT 3HFNA 2LJ1A 3FRNA 4A4GA 2KYBA 5ECAA 2RQRA 3MHXA 3QWYA 2QI2A 1K4US 3I35A 1LNXA 2ATCB 1BKBA 5I22A 2L3QA 2O4XA 4BB7A 1AOJA 3HPWA 4C92E 2KYMA 2NUPA 2QGGA 4F04B 5FU6B 4UC4A 4LUEA 3REAB 1T3SA 5KCOA 3OYNA 2DA9A 3X26B 1UG1A 3RR6A 1K0SA 2R5AA 1UGVA 2BE9B 2O88A 3CMEA 1A0NB 1PD0A 1M2OA 1M3CA 2K5FA 4C92B 1ZUKA 2XIDA 3LWIA 4JZ4A 3I55A 1WFWA 1W70A 2C0IA 2DXCA 2RHIA 1LVKA 4M78G 1KQ2A 1M1FA 2CSIA 4HT9A 5GAMf 1VQPA 1KQ1A 1WIEA 1WDXA 2FPDA 1TS9A 2P0KA 2NYSA 4Q5WA 3JCMJ 2A7YA 2QYZA 5KYUB 3TU4K 1F1BB 5KYWB 2YUPA 2V8IA 1VQNQ 5D7UA 4F16A 2VV5A 1G3TA 2E41A 2FVUA 5FU6C 1E6GA 4OB3B 1X27A 1QP2A 3PVLA 2DZ9A 1NLPC 2OTJT 3JCMW 1X2KA 2DFUA 1Q82R 2JMAA 3EFOA 2A3LA 5CCAA 5GANj 2HBWA 2DBKA 4C92C 2MOXA 4OF1A 4QKUA 1KQSA 2IG0A 3JB9I 3TREA 4FYXB 3CPWP 2CYZB 2ZPGB 1E6HA 3I56Q 3RIRA 4JLIA 2K5LA 1QW1A 3E9FA 3R6NA 1QVFA 3EGXB 3LX7A 4EMKA 5CKDA 4TVRA 3QKJA 1NEGA 3L1AA 2HBPA 1GFDA 2EQJA 2FEIA 2K7AA 3JCMd 5J26A 4HVWA 3BDLA 1WPYA 1K1ZA 2HKNA 2DVEA 2CT4A 3CCUA 3VRZA 3OYMA 2L5QA 1QMCA 4KGVB 3OYFA 1WA7A 2DD5A 1JEGA 3SEMA 2LCLA 1Y71A 2O2OA 4M7AB 1NYGA 4PJOB 4PFZA 4MZPA 3CC4A 2RF0A 4DBRA 3CXCS 1ZX6A 3CCMA 1Q81C 2DYIA 1YJWQ 1BK2A 2RJEA 2JN0A 4C0ZA 1Y7XA 3V7CA 1MV3A 4J6WA 4M4ZA 4E7ZA 2DX1A 2VVKA 2R57A 2RJFA 3ER0A 2K6DA 4IUPA 3WXMB 4WCIA 2E70A 3DLLA 1R0CB 2RQVA 4FIBA 1WHKA 4A4HA 4MMKA 2HL5C 1OZ2A 5FRNA 2KMTA 4NL2A 3J81E 1Q7YU 1YBYA 3RMSA 2GGRA 3EH2A 4M7AC 2KK4A 1NPRA 1N6AA 4PJOC 2VUBA 4CI0C 5I2MA 4A4EA 1G5VA 2D8JA 5LJ3j 2GTJA 1EIFA 1PWTA 2KGTA 3BE3A 1UFFA 1VQKQ 1VOMA 3JCMh 2I0NA 2XK0A 1Y0MA 4FSSA 1WJRA 4C92A 3SWNB 2E64A 4C92D 3MJXA 2ZGWA 1QWEA 2R5MA 2ESWA 4IUVA 1VQ5Q 2KDSA 2F5KA 2DIQA 5LJ5g 1ARKA 1PG5B 2FRYA 5KYUA 2OTJA 1XOVA 2E5QA 5KYWA 4OB2B 2MMPA 4JJCA 3CCVT 1K73C 1M90C 3CC2Q 1SRLA 4ME7A 3META 4ZN3A 1XQHA 2F2VA 1VQ9Q 1YNZA 4YTLA 4JS5A 1FMWA 1JXOA 2H3JA 3PVQA 3VS1A 1NEBA 3OMGA 5DY9A 2F5TX 2VYTA 3MKDA 3GOXA 1N8RU 3EH1A 3VUZA 4IKFA 1D0XA 4BY6B 5GAN5 1GRIA 2OAWA 3VS5A 3C12A 4J9EA 1QP3A 2KVQG 1OQKA 3MEVA 1PNJA 1WLPB 3I5SA 2DVJA 1M30A 1DJ7B 3EGXA 4E7JA 2Y4YA 4LUDA 1LJOA 4ELYC 2RA2A 3GBQA 2MPXC 2DXUA 3PE0A 3IQLA 3HTRA 1CKAA 1JXMA 3G71Q 1BIBA 2DJZA 2PVDB 2A0FB 1X43A 2JXBA 2P84A 2YSQA 2ZAEA 3UATA 5L23A 4M7AA 2D0QB 4PJOA 1M3BA 2EQKA 2L3RA 5HCKA 3ZEHA 1SHFA 1Q95G 2L8DA 4NS5A 3M57A 2BUDA 4E7SA 5GANf 3E19A 4FW1A 4BY6C 1YHQT 4OMLA 2NWMA 2LQNA 1JU5C 2LQKA 1YJ9T 2ABLA 2E1HA 3VS7A 5CQYA 4QVCA 3PMIA 2K2MA 3EG0A 5IXBA 1OPLA 4C92F 1ZUUA 4L5GA 2EGCA 1VQ8Q 1HD3A 2FHDA 3HL8A 2FO0A 1LCKA 2QDLA 2F1LA 1D3BB 2J05A 1WHMA 3UT1A 2QQ9A 4KGZB 2DL3A 2COZA 3CCJT 2RHXA 1SRMA 1NE8A 4A54A 2IPOB 2ZPFB 4PKCC 4HCKA 2QTXA 5J3BA 1UEBA 2RI3A 3MO8A 3CCQT 1KSWA 3LH0A 1M9SA 5CKFA 1RAIB 1WHHA 2NUTB 3C94A 3H41A 2RQTA 1U06A 3SWNA 3L42A 1W4SA 3TSWA 1CKBA 1V1CA 2DMOA 1G3YA 4FM4B 4A4FA 4BI4A 2LT1A 1NZ9A 4E7KA 3JCMQ 3E1SA 2V8JA 3L2QA 1VQ7A 3OYBA 3QJYA 4JRKA 5I21A 1T0HA 2RI2A 2IIMA 1WJQA 1KC8C 5A2QE 4PL6A 3CMEQ 2C06A 4IIMA 1AZGB 5FLXE 8ATCB 5LJ3f 3L2ZA 3KUFA 3I55Q 3G6EA 3OW2S 2X4WA 1KD1R 5A0LA 2DK3A 3AT1B 1VQPQ 4PJOF 5CKBA 1UE9A 3FDRA 2EYYA 2W10A 1M1KU 1WNLA 4RTXA 3NHNA 4EIKA 1YWOA 3QPHA 2MF2A 5GANg 3PNWC 3L2UA 1CSKA 3UA6A 2VB6A 5CO7A 2F2XA 5IAYA 2JUFA 1EFNA 5KE3A 2YRDA 4RTWA 2X51A 2XU8A 3P8BB 3OYCA 4M75E 3RMQA 1YHQA 4QVDA 5GAN4 4F7UG 1AWXA 1YJ9A 2LT4A 1VQ9A 3CCLT 2CP0A 3A8OB 5KE2A 4AMCA 2QA4T 1YP5A 1BI1A 2AT1B 2PVGB 3CC7A 3RDVA 4M75B 1GCQA 1QVPA 1VQOT 2RM4A 3G1JA 3V7RA 1Q86C 2DIGA 3CCUQ 4AG1C 3CCJA 2QGFB 1OU8A 1K9AA 5GAMd 1RI9A 4II1A 2KBTA 3H9NA 4BACA 2YUOA 1D3BA 5GJVB 3CD6T 3NTIA 4CRIA 2DLPA 4OP0A 1G83A 3CC4Q 2W0ZA 2ENMA 1EX4A 4MZTA 4Y92A 1JB0E 1H641 3CCMQ 1BCOA 3M9QA 4J7FA 4ZGEB 2JTEA 1VQMT 3L2VA 2DBMA 1X6BA 1QKXA 2B86A 4M75C 2NUTA 2DRMA 3JB9H 2KSSA 2D9TA 2HKQB 2HZYA 3QUIA 1UUEA 4J8OA 5LJ5d 2JM9A 2CP6A 4KGXB 4AFSC 3BW1A 4JRQA 1HYOA 4OB1B 3SHWA 4J5YA 4DA4A 1ZSZC 4M7DB 1U8RA 2OAUA 1YI2T 1ZA2B 4KT0E 3M5AA 1IO6A 3LH5A 3R6OA 5D6XA 1XJWB 3G4ST 1WHGA 1K9MR 3OW2P 4O6JA 3MP8A 1NJIR 1VYUA 2MYSA 4CC2A 3TSZA 2QEXT 3A8MB 5GAMh 5GAN7 1R77A 2FB7A 1IREB 2EPDA 2E4HA 4Y91A 4N4IA 3EG2A 4CC4B 2FYKA 3Q1JA 5M9OA 4FW2A 2OTJQ 1ZUYA 3M58A 2YHTA 5I11A 3UDCA 2RD1A 3P8HA 3M59A 1H92A 1UB4A 1VQLT 1M1KC 3VS2A 3E9GA 5C6SA 1OI1A 2K4YA 3I5RA 1SSFA 3JCMV 2GFAA 4KUDK 4M7DC 1BB9A 2DD4A 3CCLA 3CMAT 2KE9A 1TH7A 4MDWA 3VS3A 3A8HB 2QK0A 3OS2A 3TVTA 4LE9A 5LJ5h 4ZGDB 4IUTA 4X9CA 5GAN6 2QQAA 5IT9E 1SF9A 4HA8A 4ESRA 1FMKA 2VGNA 1M2VB 3TCJA 1AWWA 1AHJB 1KIKA 3C95A 1UECA 4OVAA 1K8AC 4M75A 1E7OA 3SDZA 3U23A 3OA6A 4LXCA 1YIJT 4HCCA 1X69A 2CUDA 2CP3A 4M75D 1SKUB 1JJ2A 4JS4A 2CZ7B 3GPLA 1IB8A 2D6FA 3BY7A 3V8JA 3M53A 3VKIA 1HXDA 2PUKB 1O9SA 1ABQA 3X28B 4GBQA 4RCCA 2CZ1B 2LQ8A 2FL7A 1Q86R 1KD1U 1OPKA 2RHUA 3EGDB 5GMKe 2DM1A 2E65A 2EGAA 2RHZA 1X75C 4N4GA 2PU9B 4JZ3A 3EAEA 3CEYA 3PGGA 2HMAA 5GAOp 1RI0A 1R0BG 2KRMA 3NMZC 2X4XA 2DXBA 2JM8A 5CK9A 4M7AE 1LOJA 3JAME 4PJOE 2P4TA 1TUCA 2CT3A 3URGA 4PJNA 3VRYA 1IZ6A 4N4HA 1YI2A 2QTVA 4HXJA 3RKWA 1SPKA 3G4SA 1TXQA 2LP5A 3CCRA 3OYEA 2EQIA 1P92A 2LCCA 4M7DA 3OW2A 5GAOn 2HDAA 1H3HA 3INZA 1HK9A 3HHTB 1V76A 4J9HA 3QDRB 2P4RA
chains in the Genus database with same CATH topology
3RBBB 1JXMA 1UHCA 1NM7A 2FG0A 4AFQC 1X43A 2JXBA 2PNIA 2YSQA 2ED0A 1SHGA 3I9QA 3UATA 2DF6A 2ECZA 1I07A 5L23A 2EGEA 1M3BA 2K79A 5HCKA 3M0TA 1SHFA 2BZYA 3CQTA 4X1VA 2FPFA 2KXDA 4OMLA 2NWMA 4Z8AA 2LQNA 1JU5C 2O9SA 4DEYA 4J9DA 1NYFA 2YUQA 2MIOA 2HSPA 2DNUA 2ABLA 4J9BA 2KNBB 5EC7A 1OOTA 2EYXA 4HVUA 3VS7A 1PRMC 3EG3A 2J6KA 1VA7A 1T0JA 3C0CA 4R0KA 2K2MA 1MV0B 3EG0A 5IXBA 1OPLA 2D8HA 2LMJA 1ZUUA 2EGCA 1HD3A 2EYWA 1WXTA 2FO0A 1LCKA 2QDLA 4Z88A 1W6XA 4J9IA 2GTOA 4ZNXA 1GBRA 2J05A 3KFVA 3H0FA 2DL3A 2DL7A 2L2PA 3EG1A 1TG0A 1SRMA 1BU1A 2JW4A 2ROTA 1UJ0A 4HCKA 3NGPA 2O9VA 4LN2A 1GFCA 4AFZC 1YN8A 2EVRA 1KSWA 1M8MA 2YT6A 4CC3A 1GCPA 3H41A 3QWXX 2RQTA 2C0OA 2GQIA 1U06A 3UF4A 1K76A 3TSWA 1PKSA 1CKBA 1V1CA 2DMOA 4RTTA 2NUZA 5IHIA 4J9HA 3O5ZA 2BTTA 1TUDA 4JPBW 2G6FX 1T0HA 1WXBA 2AZSA 2IIMA 4Z89A 1ABOA 1VYVA 5IH2A 3M0PA 1JO8A 2JT4A 2X3WD 4IIMA 1AZGB 4OMOA 2J6OA 2M0YA 2J7IA 4AG2C 4OMQA 1PKTA 3JV3A 1AZEA 1AEYA 1QCFA 1UE9A 2EYYA 2W10A 3VS6A 4RTXA 1NLOC 2SEMA 5GJWB 2XMFA 3NHNA 4EIKA 1YWOA 2RN8A 2YDLA 1AVZC 1CSKA 3UA6A 4J9FA 2L0AA 2F2XA 4LNPA 2M51A 1W1FA 3M0SA 3A98A 1EFNA 1GL5A 5FWCA 1YWPA 1QWFA 5FWBA 3H0IA 4E6RA 4RTWA 4D8DA 2LJ1A 1SEMA 4RTYA 2J6FA 2KYBA 4AFUC 5ECAA 2RQRA 3QWYA 1K4US 4RTUA 3H0HA 2A28A 3I35A 1KJWA 3M0RA 2DL5A 1SSHA 1AWXA 1UTIA 5I22A 2D0NA 2DL8A 3VS4A 2L3QA 2KXCA 1AOJA 2K9GA 2KYMA 1B07A 1KFZA 2LNHB 4J9CA 4LUEA 3REAB 1PHTA 1T3SA 1YP5A 2D1XA 2DA9A 1X2QA 2EYZA 1UG1A 1GCQA 1K0SA 4RUGA 1M3AA 1JQQA 1UGVA 2EW3A 3UA7A 4JJBA 1OV3A 1HJDA 2O88A 3REBB 1AWJA 4DEXA 2KT1A 1S1NA 4HVVA 1A0NB 5IXFA 2JS2A 4AG1C 1M3CA 1ZUKA 4JZ4A 1WFWA 1W70A 2C0IA 5FW9A 1K9AA 2CSIA 2KEAA 1RI9A 2KBTA 2YUNA 2YUOA 1WIEA 1U3OA 5GJVB 1Y57A 1WDXA 2FPDA 1RLQC 2DLPA 1G83A 2W0ZA 2ENMA 4Y92A 2CUBA 1RLPC 2KT8A 2YUPA 1AD5A 2RMOA 4F16A 2JS0A 4ORZA 4RTVA 1E6GA 2AKKA 1X27A 2A36A 2JTEA 2DBMA 3PVLA 4IIOA 1X6BA 4J9GA 1NLPC 1QKXA 2B86A 1X2KA 2OJ2A 2X3XD 1WXUA 2DRMA 1BBZA 2LJ3A 2JMAA 2AK5A 2PTKA 2HBWA 2DBKA 2MOXA 1UUEA 2OI3A 1ZBJA 2EKHA 2JM9A 1E6HA 4AFSC 3NPFA 2EBPA 1QLYA 2F2WA 2GBQA 3SHWA 3R6NA 1FYNA 1U5SA 1NEGA 2BZ8A 4F17A 1GFDA 1IO6A 3LH5A 2FEIA 2K7AA 3ZL7C 4OMPA 4HVWA 2ROLA 1K1ZA 4KRTA 2RNAA 2CT4A 3VRZA 1VYUA 1UDLA 2V1QA 1UJYA 4CC2A 1HSQA 3TSZA 1WA7A 1JEGA 2DE0X 3SEMA 2O2OA 4D8KA 2LQWA 1NYGA 2EPDA 4CC4B 3EG2A 2AKLA 1T3LA 3FJ5A 1PRLC 2RF0A 1ZUYA 3VS0A 5I11A 2RQWA 1ZX6A 2O31A 1G2BA 1BK2A 3ULRB 2L3PA 2LZ6B 2LJ0A 1H92A 2HCKA 3EHQA 3VS2A 1Z9QA 1MV3A 2VKNA 4M4ZA 3EGUA 3I5RA 2LCSA 1BB9A 2DX1A 2VVKA 2K6DA 1WYXA 2KRNA 4WCIA 2KE9A 2DYBA 2J06A 2RQVA 2CDTA 3VS3A 3TVTA 4LE9A 1J3TA 1WX6A 4QT7A 4CC7A 1M27C 2GGRA 4ESRA 1FMKA 1AWWA 2K3BA 2D8JA 2RQUA 1N5ZA 2ED1A 2GTJA 2RPNA 1KIKA 1PWTA 1UECA 2A08A 2KROA 2KGTA 1E7OA 3U23A 1UFFA 2VWFA 3M0QA 4GLMA 2MCNA 1X69A 2CUDA 2I0NA 2SRCA 1Y0MA 4FSSA 2KRSA 1AWOA 3PE0A 2CH4A 3THKA 2CREA 2PZ1A 4RTZA 3M0UA 1QWEA 1ABQA 1RUWA 4GBQA 2HEQA 2ESWA 4OMMA 1OPKA 2GNCA 1ARKA 2A37A 1VYTA 2FRYA 1GCQC 2DRKA 1ZLMA 1K0XA 1XOVA 2L3SA 1B3QA 4JJCA 2BZXA 2DM1A 2EGAA 2JMCA 1SRLA 2FRWA 2DILA 2V1RA 4JZ3A 2C0TA 3RNJA 4JJDA 4OMNA 2F2VA 4K11A 1YNZA 1QKWA 2KRMA 1WI7A 3NMZC 2KR3A 1JXOA 2H8HA 2JM8A 3PVQA 3VS1A 1NEBA 2FPEA 5IHKA 2CSQA 5IHNA 1TUCA 2CT3A 3VRYA 1YCSB 1MUZA 1GRIA 1GBQA 2OAWA 2CH4W 3VS5A 4HXJA 4J9EA 1UHFA 1SPKA 2DJQA 1I0CA 2LP5A 1PNJA 1WLPB 1H8KA 2AZVA 1NG2A 2DVJA 1M30A 1Z9ZA 2EQIA 3I5SA 4F14A 1X6GA 4LUDA 1OEBA 4A63B 1I1JA 2HDAA 1ZSGA 2E5KA 1H3HA 2LX7A 3GBQA 3IQLA 2DL4A 1CKAA 3EHRA 2P4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBB B;  1JXM A;  1UHC A;  1NM7 A;  2FG0 A;  4AFQ C;  1X43 A;  2JXB A;  2PNI A;  2YSQ A;  2ED0 A;  1SHG A;  3I9Q A;  3UAT A;  2DF6 A;  2ECZ A;  1I07 A;  5L23 A;  2EGE A;  1M3B A;  2K79 A;  5HCK A;  3M0T A;  1SHF A;  2BZY A;  3CQT A;  4X1V A;  2FPF A;  2KXD A;  4OML A;  2NWM A;  4Z8A A;  2LQN A;  1JU5 C;  2O9S A;  4DEY A;  4J9D A;  1NYF A;  2YUQ A;  2MIO A;  2HSP A;  2DNU A;  2ABL A;  4J9B A;  2KNB B;  5EC7 A;  1OOT A;  2EYX A;  4HVU A;  3VS7 A;  1PRM C;  3EG3 A;  2J6K A;  1VA7 A;  1T0J A;  3C0C A;  4R0K A;  2K2M A;  1MV0 B;  3EG0 A;  5IXB A;  1OPL A;  2D8H A;  2LMJ A;  1ZUU A;  2EGC A;  1HD3 A;  2EYW A;  1WXT A;  2FO0 A;  1LCK A;  2QDL A;  4Z88 A;  1W6X A;  4J9I A;  2GTO A;  4ZNX A;  1GBR A;  2J05 A;  3KFV A;  3H0F A;  2DL3 A;  2DL7 A;  2L2P A;  3EG1 A;  1TG0 A;  1SRM A;  1BU1 A;  2JW4 A;  2ROT A;  1UJ0 A;  4HCK A;  3NGP A;  2O9V A;  4LN2 A;  1GFC A;  4AFZ C;  1YN8 A;  2EVR A;  1KSW A;  1M8M A;  2YT6 A;  4CC3 A;  1GCP A;  3H41 A;  3QWX X;  2RQT A;  2C0O A;  2GQI A;  1U06 A;  3UF4 A;  1K76 A;  3TSW A;  1PKS A;  1CKB A;  1V1C A;  2DMO A;  4RTT A;  2NUZ A;  5IHI A;  4J9H A;  3O5Z A;  2BTT A;  1TUD A;  4JPB W;  2G6F X;  1T0H A;  1WXB A;  2AZS A;  2IIM A;  4Z89 A;  1ABO A;  1VYV A;  5IH2 A;  3M0P A;  1JO8 A;  2JT4 A;  2X3W D;  4IIM A;  1AZG B;  4OMO A;  2J6O A;  2M0Y A;  2J7I A;  4AG2 C;  4OMQ A;  1PKT A;  3JV3 A;  1AZE A;  1AEY A;  1QCF A;  1UE9 A;  2EYY A;  2W10 A;  3VS6 A;  4RTX A;  1NLO C;  2SEM A;  5GJW B;  2XMF A;  3NHN A;  4EIK A;  1YWO A;  2RN8 A;  2YDL A;  1AVZ C;  1CSK A;  3UA6 A;  4J9F A;  2L0A A;  2F2X A;  4LNP A;  2M51 A;  1W1F A;  3M0S A;  3A98 A;  1EFN A;  1GL5 A;  5FWC A;  1YWP A;  1QWF A;  5FWB A;  3H0I A;  4E6R A;  4RTW A;  4D8D A;  2LJ1 A;  1SEM A;  4RTY A;  2J6F A;  2KYB A;  4AFU C;  5ECA A;  2RQR A;  3QWY A;  1K4U S;  4RTU A;  3H0H A;  2A28 A;  3I35 A;  1KJW A;  3M0R A;  2DL5 A;  1SSH A;  1AWX A;  1UTI A;  5I22 A;  2D0N A;  2DL8 A;  3VS4 A;  2L3Q A;  2KXC A;  1AOJ A;  2K9G A;  2KYM A;  1B07 A;  1KFZ A;  2LNH B;  4J9C A;  4LUE A;  3REA B;  1PHT A;  1T3S A;  1YP5 A;  2D1X A;  2DA9 A;  1X2Q A;  2EYZ A;  1UG1 A;  1GCQ A;  1K0S A;  4RUG A;  1M3A A;  1JQQ A;  1UGV A;  2EW3 A;  3UA7 A;  4JJB A;  1OV3 A;  1HJD A;  2O88 A;  3REB B;  1AWJ A;  4DEX A;  2KT1 A;  1S1N A;  4HVV A;  1A0N B;  5IXF A;  2JS2 A;  4AG1 C;  1M3C A;  1ZUK A;  4JZ4 A;  1WFW A;  1W70 A;  2C0I A;  5FW9 A;  1K9A A;  2CSI A;  2KEA A;  1RI9 A;  2KBT A;  2YUN A;  2YUO A;  1WIE A;  1U3O A;  5GJV B;  1Y57 A;  1WDX A;  2FPD A;  1RLQ C;  2DLP A;  1G83 A;  2W0Z A;  2ENM A;  4Y92 A;  2CUB A;  1RLP C;  2KT8 A;  2YUP A;  1AD5 A;  2RMO A;  4F16 A;  2JS0 A;  4ORZ A;  4RTV A;  1E6G A;  2AKK A;  1X27 A;  2A36 A;  2JTE A;  2DBM A;  3PVL A;  4IIO A;  1X6B A;  4J9G A;  1NLP C;  1QKX A;  2B86 A;  1X2K A;  2OJ2 A;  2X3X D;  1WXU A;  2DRM A;  1BBZ A;  2LJ3 A;  2JMA A;  2AK5 A;  2PTK A;  2HBW A;  2DBK A;  2MOX A;  1UUE A;  2OI3 A;  1ZBJ A;  2EKH A;  2JM9 A;  1E6H A;  4AFS C;  3NPF A;  2EBP A;  1QLY A;  2F2W A;  2GBQ A;  3SHW A;  3R6N A;  1FYN A;  1U5S A;  1NEG A;  2BZ8 A;  4F17 A;  1GFD A;  1IO6 A;  3LH5 A;  2FEI A;  2K7A A;  3ZL7 C;  4OMP A;  4HVW A;  2ROL A;  1K1Z A;  4KRT A;  2RNA A;  2CT4 A;  3VRZ A;  1VYU A;  1UDL A;  2V1Q A;  1UJY A;  4CC2 A;  1HSQ A;  3TSZ A;  1WA7 A;  1JEG A;  2DE0 X;  3SEM A;  2O2O A;  4D8K A;  2LQW A;  1NYG A;  2EPD A;  4CC4 B;  3EG2 A;  2AKL A;  1T3L A;  3FJ5 A;  1PRL C;  2RF0 A;  1ZUY A;  3VS0 A;  5I11 A;  2RQW A;  1ZX6 A;  2O31 A;  1G2B A;  1BK2 A;  3ULR B;  2L3P A;  2LZ6 B;  2LJ0 A;  1H92 A;  2HCK A;  3EHQ A;  3VS2 A;  1Z9Q A;  1MV3 A;  2VKN A;  4M4Z A;  3EGU A;  3I5R A;  2LCS A;  1BB9 A;  2DX1 A;  2VVK A;  2K6D A;  1WYX A;  2KRN A;  4WCI A;  2KE9 A;  2DYB A;  2J06 A;  2RQV A;  2CDT A;  3VS3 A;  3TVT A;  4LE9 A;  1J3T A;  1WX6 A;  4QT7 A;  4CC7 A;  1M27 C;  2GGR A;  4ESR A;  1FMK A;  1AWW A;  2K3B A;  2D8J A;  2RQU A;  1N5Z A;  2ED1 A;  2GTJ A;  2RPN A;  1KIK A;  1PWT A;  1UEC A;  2A08 A;  2KRO A;  2KGT A;  1E7O A;  3U23 A;  1UFF A;  2VWF A;  3M0Q A;  4GLM A;  2MCN A;  1X69 A;  2CUD A;  2I0N A;  2SRC A;  1Y0M A;  4FSS A;  2KRS A;  1AWO A;  3PE0 A;  2CH4 A;  3THK A;  2CRE A;  2PZ1 A;  4RTZ A;  3M0U A;  1QWE A;  1ABQ A;  1RUW A;  4GBQ A;  2HEQ A;  2ESW A;  4OMM A;  1OPK A;  2GNC A;  1ARK A;  2A37 A;  1VYT A;  2FRY A;  1GCQ C;  2DRK A;  1ZLM A;  1K0X A;  1XOV A;  2L3S A;  1B3Q A;  4JJC A;  2BZX A;  2DM1 A;  2EGA A;  2JMC A;  1SRL A;  2FRW A;  2DIL A;  2V1R A;  4JZ3 A;  2C0T A;  3RNJ A;  4JJD A;  4OMN A;  2F2V A;  4K11 A;  1YNZ A;  1QKW A;  2KRM A;  1WI7 A;  3NMZ C;  2KR3 A;  1JXO A;  2H8H A;  2JM8 A;  3PVQ A;  3VS1 A;  1NEB A;  2FPE A;  5IHK A;  2CSQ A;  5IHN A;  1TUC A;  2CT3 A;  3VRY A;  1YCS B;  1MUZ A;  1GRI A;  1GBQ A;  2OAW A;  2CH4 W;  3VS5 A;  4HXJ A;  4J9E A;  1UHF A;  1SPK A;  2DJQ A;  1I0C A;  2LP5 A;  1PNJ A;  1WLP B;  1H8K A;  2AZV A;  1NG2 A;  2DVJ A;  1M30 A;  1Z9Z A;  2EQI A;  3I5S A;  4F14 A;  1X6G A;  4LUD A;  1OEB A;  4A63 B;  1I1J A;  2HDA A;  1ZSG A;  2E5K A;  1H3H A;  2LX7 A;  3GBQ A;  3IQL A;  2DL4 A;  1CKA A;  3EHR A;  2P4R A; 
#chains in the Genus database with same CATH topology
 4M77 E;  4AFQ C;  3GIB A;  5D6W A;  2LVM A;  3FEO A;  1VQL A;  2EGE A;  1ZBX A;  4C5H A;  3S3M A;  4PJJ A;  1VUB A;  4FCY A;  2K79 A;  3M0T A;  3OS5 A;  4IUQ A;  1VQ7 Q;  5GAN d;  2VGM A;  2Z0W A;  4QVZ A;  4M77 B;  4Z8A A;  1QCO A;  3CMA A;  4DEY A;  2YUQ A;  2MIO A;  1YCY A;  4M75 F;  3MP1 A;  5GAM g;  2EFI A;  5A0D A;  2KNB B;  5EC7 A;  3J80 E;  1WHJ A;  3KXT A;  4HVU A;  4XAX B;  1PRM C;  4OB0 B;  1VA7 A;  4R0K A;  3G6E Q;  2BIV A;  3OYD A;  3VV0 A;  2GFU A;  4R55 A;  4OMF B;  2XIC A;  4R56 A;  3KFV A;  2MAM A;  1OX8 A;  4PFO A;  1YIJ A;  2EQU A;  2DL7 A;  3EG1 A;  1MNE A;  3GNF B;  1S72 T;  1BU1 A;  1M2V A;  3OYY A;  5GAN 2;  3G7Z A;  4GLK A;  3O8V A;  4BDY A;  3JRZ A;  4FYY B;  1OUL A;  4M77 C;  5CAI A;  9ATC B;  1YN8 A;  1D09 B;  4BE2 A;  1KHI A;  2YT6 A;  3CCE T;  2LRQ A;  2RK1 A;  1YHQ Q;  2EJG A;  1B34 B;  2C0O A;  2KAF A;  3FIF A;  3GNG A;  2OTL T;  1K76 A;  1PKS A;  3OS0 A;  1VQ4 T;  1YJ9 Q;  4RTT A;  4C92 G;  1NJI U;  4XU1 A;  4PLL A;  2NUZ A;  4FL6 A;  5GAN h;  3A1P A;  3O5Z A;  3EGD A;  3CPW A;  3RES A;  5LJ5 e;  3CC7 Q;  1PSF A;  1PC0 A;  3ZFJ A;  4Z89 A;  4M7D F;  3DB3 A;  3H6Z A;  1NPP A;  1AT1 B;  3OYK A;  5LJ3 d;  4OMO A;  3CCJ Q;  2J6O A;  2J7I A;  4DQ2 A;  3HP9 A;  3VYG A;  4OMQ A;  1PKT A;  2WSF E;  2XDP A;  3M4Y A;  2PQW A;  2YLB A;  2E10 A;  2CZ0 B;  4LDV A;  3JSC A;  3X24 B;  2XMF A;  3HRS A;  5KYN A;  2X4Y A;  4HCZ A;  3S6W A;  2YRV A;  1D1B A;  2HL3 A;  4J6Y A;  3BFM A;  4C8Q E;  4GY5 A;  3QHS A;  3M0S A;  3NTH A;  1IHW A;  5FWC A;  3EG9 B;  3VYH B;  2IVW A;  2MI6 A;  1QWF A;  5FWB A;  3CXC P;  4M7A D;  4E6R A;  4PJO D;  4D8D A;  2J6F A;  4RTU A;  2I2L A;  1KJW A;  2FZC B;  1UTI A;  2D0N A;  3VS4 A;  3QZ5 B;  3GF5 A;  2KXC A;  3OSV A;  4C8Q B;  2K9G A;  5GMK j;  4J9C A;  1Q81 R;  3JB9 D;  3QDF A;  4M77 A;  4PJO G;  2D1X A;  2X4J A;  2DZC A;  4C0F A;  1Q82 U;  3PIO A;  4RUG A;  4RG8 A;  1JQQ A;  4J83 A;  3GLX A;  4M77 D;  3MP6 A;  3REB B;  2QDY B;  4DEX A;  4HVV A;  4N0A C;  5LJ3 h;  2JS2 A;  1Q7Y C;  1S72 A;  4KBM B;  5FW9 A;  3A8L B;  2YUN A;  1VIE A;  5LL6 S;  1GXI E;  1U3O A;  3JB9 J;  4DOW A;  1Y57 A;  2QAS A;  2CUB A;  2VXE A;  4RG2 A;  3X25 B;  3OB9 A;  5GMK m;  1AD5 A;  4C8Q C;  4XTV A;  3CCV A;  2JS0 A;  3LGF A;  2HQH A;  1G3S A;  2DKG A;  4ORZ A;  4RTV A;  2AKK A;  2OTL A;  3M55 A;  3FLG A;  5KYY B;  5FRO A;  1VQ4 A;  4J9G A;  4JUV A;  1SG5 A;  1Y96 B;  1UGQ B;  2FZG B;  2X3X D;  1WXU A;  4FYW B;  3CCL Q;  2HSE B;  3M54 A;  3JCM c;  3PIP A;  2HQE A;  3A8G B;  1BIA A;  1B34 A;  2AIR B;  1Y07 A;  4E7H A;  2JOY A;  4PFP A;  2OI3 A;  1KHC A;  1ZBJ A;  2EKH A;  4JLG A;  4JJN K;  4BE0 A;  1D1C A;  3OYJ A;  3L2W A;  1VQO Q;  1QVF S;  1QLY A;  2F2W A;  3SFM A;  1K73 R;  1M90 R;  5FRM A;  2Y90 A;  4XK8 E;  4FT4 A;  4ZTJ A;  3JCM e;  1FYN A;  4M7A F;  4F17 A;  1TSF A;  3A5Z B;  4A53 A;  3JCM X;  4OMP A;  4PJL A;  2ROL A;  3LGL A;  3CCS T;  2RNA A;  1N8R C;  1VQ8 T;  1UDL A;  1B7T A;  1IGU A;  2HQX A;  4B9W A;  4ZN1 A;  4M78 E;  3L2R A;  2LQW A;  2VXF A;  4LDU A;  1YIT T;  1IHV A;  1VQM Q;  3JB9 F;  2AKL A;  1T3L A;  2HD0 A;  1PRL C;  4ZTF A;  2RQW A;  2O31 A;  2EWN A;  4M77 F;  2Y4X A;  2L3P A;  2LZ6 B;  3ULR B;  2LJ0 A;  2HAX A;  2HCK A;  3CXC A;  2EYQ A;  2ZCF B;  4N0A A;  4E7L A;  5FU7 B;  4M78 B;  6AT1 B;  2XHC A;  3EG9 A;  5HKC A;  1H3Z A;  1RAA B;  3LW5 E;  1ACM B;  1WYX A;  2KRN A;  2QQB A;  5D6Y A;  2QXF A;  2DYB A;  4BD3 A;  2CDT A;  1WX6 A;  4PLI A;  4QT7 A;  1YI2 Q;  2GF7 A;  3JCM P;  4C8Q A;  2ZPE B;  4ELZ C;  5LJ5 j;  3G4S Q;  3CCR Q;  4EPC A;  4C8Q D;  2ED1 A;  2M16 A;  3M56 A;  4J7I A;  4IUR A;  2KRO A;  5CKE A;  2EQM A;  1M5Q 1;  2DXT A;  1I4K 1;  2VWF A;  5DLO A;  4GLM A;  5EG2 A;  1QCN A;  2CZ6 B;  2MWO A;  3CCQ A;  1ZSZ B;  3N5B B;  5FU7 C;  3I55 T;  2RJC A;  2KRS A;  1AWO A;  4M78 C;  2CH4 A;  2VAS A;  1MMN A;  3THK A;  2CRE A;  2PZ1 A;  4RTZ A;  1D0Z A;  2JVV A;  3OQ5 A;  1VQL Q;  4JRP A;  4NOY A;  1RUW A;  3EFS A;  2HEQ A;  5GAO m;  1I5L A;  3MEU A;  2WSC E;  2O01 E;  1ZLM A;  1K0X A;  5LJ3 g;  2L3S A;  1B3Q A;  3QZ9 B;  1TWB A;  3EFO B;  2BZX A;  3CMA Q;  1MGQ A;  4M7D E;  4X9D A;  2JMC A;  2FRW A;  2DIL A;  2V1R A;  2P0Q A;  2NLU A;  3RNJ A;  4OMN A;  1Y96 A;  4MDX A;  4LDX A;  1WI7 A;  2KR3 A;  2K3Y A;  5IHK A;  3QG1 A;  1M4Z A;  5CIU A;  3V8K A;  3WVD B;  4XTZ A;  1GBQ A;  1YIJ Q;  2CH4 W;  4VUB A;  1QVF P;  2M0O A;  1BI3 A;  1I81 A;  2DJQ A;  2G3R A;  2M02 A;  3CCS A;  1I0C A;  4DBQ A;  1H8K A;  2AZV A;  4ZGJ B;  3BDU A;  1WZO A;  4F14 A;  1KC8 R;  1X6G A;  4LD6 A;  3FC3 A;  1YIT A;  3CCU T;  2COW A;  4Y28 E;  2FG0 A;  2EKO A;  5DLQ E;  3PFS A;  2PNI A;  2LNV A;  3I9Q A;  1C6V X;  2DF6 A;  1I07 A;  3CBM A;  5HK0 A;  2CP5 A;  3S3O A;  5KCH A;  3CC4 T;  4C8Q F;  2COY A;  3CQT A;  4X1V A;  1N8R R;  1D0Y A;  1MMD A;  2OX7 A;  2O9S A;  1NYF A;  2JZ2 A;  2QA4 A;  2CS7 A;  2HSP A;  1U1S A;  3UWN A;  4J9B A;  1OOT A;  2EYX A;  4M78 A;  3EG3 A;  1C0M A;  2LX9 A;  3VUB A;  3C0C A;  1VQO A;  2YXY A;  1WHL A;  4QQD A;  1TOV A;  4KH0 B;  4BE1 A;  4M78 D;  1XTD A;  2JTF A;  2EYW A;  4RCB A;  1WXT A;  3JCM b;  1W2B S;  1W6X A;  4J9I A;  3FB9 A;  1VQ6 T;  4ZNX A;  3MEA A;  3LWH A;  1GBR A;  1N27 A;  3CD6 A;  1I8F A;  2YRC A;  2VC8 A;  2E12 A;  5L8R E;  3DB4 A;  2XKO C;  2JW4 A;  2ROT A;  3NGP A;  2O9V A;  4LN2 A;  1K73 U;  4AFZ C;  1M90 U;  4C5G A;  1YJN T;  1VQM A;  1RAH B;  1M8M A;  2GCX A;  1ZSZ A;  5GMK l;  3OYG A;  1PCX A;  4M75 G;  3F70 A;  1PD1 A;  2GQI A;  2JNG A;  3UF4 A;  2JTM A;  4O5V A;  4FU6 A;  3CBO A;  1N9S A;  2KY9 A;  3OYL A;  4JPB W;  7AT1 B;  4L6V 5;  4C0G A;  1BI0 A;  4C5I A;  4B6M A;  3UPU A;  1VYV A;  2RJD A;  2H3E B;  2JT4 A;  2X3W D;  2EJ9 A;  4XTY A;  5LJ5 f;  1IGQ A;  4XTW A;  3OYH A;  2X35 A;  1PSE A;  2ZPH B;  3OYI A;  1S72 Q;  3HRU A;  4FYV B;  1AZE A;  2QEX A;  3HFO A;  1QCF A;  1RL2 A;  4ATO A;  3EFR A;  1IXD A;  2E3H A;  1FMV A;  1NLO C;  1QQJ A;  1TU0 B;  2K5I A;  5GJW B;  2DAQ A;  2RN8 A;  3CCE Q;  2CP2 A;  1KK7 A;  3CCV Q;  1AVZ C;  4XU2 A;  4J9F A;  3GP8 A;  2OTL Q;  2E6N A;  4M78 F;  1VQ4 Q;  3RER A;  2M51 A;  1QVG S;  3H0I A;  5CKH A;  1VQN T;  4EDU A;  4M7D G;  3NFC A;  1SEM A;  4RTY A;  4AFU C;  3CBP A;  4JDS A;  3H0H A;  2A28 A;  5A0G A;  3M0R A;  2DL5 A;  1SSH A;  5GAO q;  5GAO r;  2DL8 A;  1JBM A;  2PUO B;  4XTU A;  1LPL A;  1FWZ A;  1UGP B;  1M8V A;  1B07 A;  1KFZ A;  4X34 A;  2LNH B;  3M4G A;  1RAC B;  1PHT A;  3QJ6 A;  4MML A;  1X2Q A;  2QQR A;  3WVE B;  1M1K R;  2EYZ A;  1M3A A;  2EW3 A;  3UA7 A;  4JJB A;  1OV3 A;  2P0P A;  1HJD A;  1VQ6 A;  1AWJ A;  4OGE A;  3I56 T;  2KT1 A;  1S1N A;  5IXF A;  1MHN A;  1WQ7 A;  5GAM e;  2V26 A;  4PJM A;  2ZPB B;  1OX9 A;  1W2B P;  2KEA A;  1G3W A;  1U1T A;  4EMG A;  1RLQ C;  4Z02 A;  4QW2 A;  3VJP A;  4DBF A;  3AHU A;  2RB6 A;  1YJN A;  1RLP C;  4D6W A;  2KT8 A;  2CGH A;  2RO0 A;  2RMO A;  1K8A R;  2V8K A;  3QBY A;  5GAO l;  1K9M U;  1X01 A;  1YFN A;  2A36 A;  4IIO A;  4XU3 A;  3QII A;  3T9N A;  2OJ2 A;  1KC8 U;  4BI3 A;  1BBZ A;  1R8O B;  1OZ3 A;  5CVI A;  3V7S A;  2LJ3 A;  1YJW T;  2AK5 A;  1RAE B;  4XQ3 A;  1KD1 C;  2PTK A;  3QSU A;  4QQ6 A;  8AT1 B;  3TQ7 P;  1MMG A;  4HT8 A;  2AHJ B;  2BKD N;  4F7U E;  2RI5 A;  1RAF B;  2XDD A;  2KI7 A;  1VQ7 T;  2JJ9 A;  3SB2 A;  3SD4 A;  3NPF A;  2EBP A;  5AT1 B;  2E6Z A;  2GBQ A;  3QXE B;  3J7A F;  1FXX A;  1U5S A;  2BZ8 A;  4P5N A;  4LDY A;  4C5E A;  3ZL7 C;  3SWN C;  3JCM f;  3CCQ Q;  4F7U B;  3E2U A;  3MCA B;  4KRT A;  5KYX B;  3G6E T;  1IRX A;  2LC4 A;  2MWP A;  2V1Q A;  2WSE E;  1UJY A;  1HSQ A;  3RKY A;  1ZQ1 A;  3MEW A;  2DE0 X;  1UGS B;  1WJS A;  4D8K A;  1M1G A;  1VQK T;  2K2V A;  1ZHI A;  2GQV A;  2ZZD A;  3FJ5 A;  3VS0 A;  1G2B A;  1VQN A;  2DPP B;  2E3I A;  5CQX A;  1ZA1 B;  3EHQ A;  5IN1 A;  4AT1 B;  1Z9Q A;  1VQ5 T;  2VKN A;  4L59 A;  2MK5 A;  1QVG P;  3EGU A;  2LCS A;  3DKM A;  5J39 A;  2R58 A;  1TUG B;  3OMC A;  4JRI A;  1MMA A;  2QG9 B;  4M7A G;  4E47 A;  3CC2 T;  1Q86 U;  2XG8 D;  3NTK A;  2J06 A;  2K57 A;  5DM7 R;  3OBY A;  1N9R A;  3TEE A;  1J3T A;  1VQ9 T;  2EAY A;  3ASK A;  4CC7 A;  1M27 C;  3S3N A;  3I56 A;  3CCS Q;  3PT9 A;  2K3B A;  2RQU A;  1G8X A;  1N5Z A;  2RPN A;  3CC7 T;  2A08 A;  3JB9 G;  4RMO A;  3RKX A;  1JJ2 S;  3M0Q A;  3FJP A;  1YIT Q;  2MCN A;  1W2B A;  2SRC A;  4M77 G;  4ANJ A;  5I2S A;  3CCE A;  4OGC A;  4RKU E;  3M0U A;  2M9U A;  2DTH A;  2WAC A;  2EIF A;  3H8Z A;  4OMM A;  3LLR A;  4DOV A;  2GNC A;  2A37 A;  1VYT A;  2XDB A;  3G71 T;  1GCQ C;  2DRK A;  3QYH B;  1KQS S;  4BUG A;  1YJW A;  2QA4 Q;  2K3X A;  4PNO A;  5HY6 A;  2ZPI B;  2C0T A;  4JJD A;  4K11 A;  4C0D B;  1KG1 A;  1QKW A;  3PMT A;  2DER A;  3JCM g;  1K9M C;  2H8H A;  1NJI C;  2FPE A;  1OYX A;  2CSQ A;  5IHN A;  3CD6 Q;  2B8A A;  1TTH B;  1YCS B;  1MUZ A;  4E2F B;  3HRT A;  1UHF A;  2YWW A;  5AYF A;  1NG2 A;  4LD9 K;  1Z9Z A;  1RAD B;  3CPF A;  1O75 A;  4KH1 B;  1OEB A;  2RK2 A;  3X20 B;  4A63 B;  1I1J A;  1ZSG A;  2E5K A;  2LX7 A;  5GAM j;  1VQK A;  2XD0 A;  4F7U A;  2DL4 A;  5KYX A;  3EHR A;  3RBB B;  5KH6 A;  1UHC A;  1NM7 A;  2QQS A;  1MND A;  3ME9 A;  4WF2 A;  5C0M A;  4C0D C;  1EZZ B;  2ED0 A;  1SHG A;  4LDW A;  2DEU A;  2ECZ A;  3MPU B;  4KUL A;  2O4X B;  5GAN e;  1VQ5 A;  2HNI A;  2LDM A;  3OSS C;  2BZY A;  2RHY A;  2NUP B;  2QAZ A;  2FPF A;  1QVG A;  2KXD A;  2FZK B;  3VU3 C;  3PTA A;  4J9D A;  3CC2 A;  2CP7 A;  1RAB B;  2DNU A;  1VIF A;  2KQW A;  2RH2 A;  5GMK h;  4EMH A;  3RUX A;  4BDZ A;  2J6K A;  1K8A U;  1T0J A;  1MV0 B;  3DLM A;  2F69 A;  2D8H A;  2LMJ A;  4B9X A;  2DTI A;  4IUU A;  4A4K A;  3OS1 A;  2QEX Q;  4QQG A;  4Z88 A;  2GTO A;  2DTO A;  3CME T;  3H0F A;  2L2P A;  1TG0 A;  4HCB A;  1Q82 C;  3P8D A;  2XI9 A;  1VQP T;  5CR2 A;  3LYI A;  2PVO B;  4C8Q G;  5HK3 A;  4KUI A;  1UJ0 A;  5GMK i;  1JJ2 P;  3V8L A;  4V2S A;  1GFC A;  2EVR A;  4E7I A;  3HKS A;  1NBE B;  4CC3 A;  1GCP A;  1Q7Y R;  1D1A A;  3G71 A;  3QWX X;  3HSB A;  2BE7 D;  2DO3 A;  3QO3 A;  2DEQ A;  4MZM A;  2YLC A;  3QYG B;  2DET A;  5KYY A;  1BCM A;  1PM3 A;  5GAN 8;  3CPW S;  5IHI A;  5GAN 3;  4M7D D;  3ZBD A;  2M1H A;  2BTT A;  1FX7 A;  1TUD A;  1KQS P;  2G6F X;  3D7S B;  4XTX A;  1WXB A;  2AZS A;  1WGS A;  3OY9 A;  4EMK B;  1ABO A;  4BI8 B;  4DBH A;  4XU0 A;  1V29 B;  5IH2 A;  3M0P A;  5LJ3 e;  1JO8 A;  1VQ6 Q;  4FSX A;  2X9H A;  4F7U F;  1OU9 A;  3OBW A;  2M0Y A;  2L89 A;  4AG2 C;  1VQ8 A;  4FT2 A;  2EJF A;  3JV3 A;  1AEY A;  1Q81 U;  1RAG B;  1BYM A;  3VS6 A;  1JRI A;  1YJN Q;  3KBG A;  2SEM A;  3OYA A;  1BI2 A;  1C1A A;  3CCR T;  4J6X A;  1WQW A;  2YDL A;  1UGR B;  4HKE A;  2LTO A;  1XNI A;  2L0A A;  4LNP A;  4NL3 A;  4PK4 A;  1I5O B;  1W1F A;  3A98 A;  4WTO B;  1GL5 A;  3C4S A;  1YWP A;  4EMK C;  1X6O A;  2CKK A;  3CCM T;  3HFN A;  2LJ1 A;  3FRN A;  4A4G A;  2KYB A;  5ECA A;  2RQR A;  3MHX A;  3QWY A;  2QI2 A;  1K4U S;  3I35 A;  1LNX A;  2ATC B;  1BKB A;  5I22 A;  2L3Q A;  2O4X A;  4BB7 A;  1AOJ A;  3HPW A;  4C92 E;  2KYM A;  2NUP A;  2QGG A;  4F04 B;  5FU6 B;  4UC4 A;  4LUE A;  3REA B;  1T3S A;  5KCO A;  3OYN A;  2DA9 A;  3X26 B;  1UG1 A;  3RR6 A;  1K0S A;  2R5A A;  1UGV A;  2BE9 B;  2O88 A;  3CME A;  1A0N B;  1PD0 A;  1M2O A;  1M3C A;  2K5F A;  4C92 B;  1ZUK A;  2XID A;  3LWI A;  4JZ4 A;  3I55 A;  1WFW A;  1W70 A;  2C0I A;  2DXC A;  2RHI A;  1LVK A;  4M78 G;  1KQ2 A;  1M1F A;  2CSI A;  4HT9 A;  5GAM f;  1VQP A;  1KQ1 A;  1WIE A;  1WDX A;  2FPD A;  1TS9 A;  2P0K A;  2NYS A;  4Q5W A;  3JCM J;  2A7Y A;  2QYZ A;  5KYU B;  3TU4 K;  1F1B B;  5KYW B;  2YUP A;  2V8I A;  1VQN Q;  5D7U A;  4F16 A;  2VV5 A;  1G3T A;  2E41 A;  2FVU A;  5FU6 C;  1E6G A;  4OB3 B;  1X27 A;  1QP2 A;  3PVL A;  2DZ9 A;  1NLP C;  2OTJ T;  3JCM W;  1X2K A;  2DFU A;  1Q82 R;  2JMA A;  3EFO A;  2A3L A;  5CCA A;  5GAN j;  2HBW A;  2DBK A;  4C92 C;  2MOX A;  4OF1 A;  4QKU A;  1KQS A;  2IG0 A;  3JB9 I;  3TRE A;  4FYX B;  3CPW P;  2CYZ B;  2ZPG B;  1E6H A;  3I56 Q;  3RIR A;  4JLI A;  2K5L A;  1QW1 A;  3E9F A;  3R6N A;  1QVF A;  3EGX B;  3LX7 A;  4EMK A;  5CKD A;  4TVR A;  3QKJ A;  1NEG A;  3L1A A;  2HBP A;  1GFD A;  2EQJ A;  2FEI A;  2K7A A;  3JCM d;  5J26 A;  4HVW A;  3BDL A;  1WPY A;  1K1Z A;  2HKN A;  2DVE A;  2CT4 A;  3CCU A;  3VRZ A;  3OYM A;  2L5Q A;  1QMC A;  4KGV B;  3OYF A;  1WA7 A;  2DD5 A;  1JEG A;  3SEM A;  2LCL A;  1Y71 A;  2O2O A;  4M7A B;  1NYG A;  4PJO B;  4PFZ A;  4MZP A;  3CC4 A;  2RF0 A;  4DBR A;  3CXC S;  1ZX6 A;  3CCM A;  1Q81 C;  2DYI A;  1YJW Q;  1BK2 A;  2RJE A;  2JN0 A;  4C0Z A;  1Y7X A;  3V7C A;  1MV3 A;  4J6W A;  4M4Z A;  4E7Z A;  2DX1 A;  2VVK A;  2R57 A;  2RJF A;  3ER0 A;  2K6D A;  4IUP A;  3WXM B;  4WCI A;  2E70 A;  3DLL A;  1R0C B;  2RQV A;  4FIB A;  1WHK A;  4A4H A;  4MMK A;  2HL5 C;  1OZ2 A;  5FRN A;  2KMT A;  4NL2 A;  3J81 E;  1Q7Y U;  1YBY A;  3RMS A;  2GGR A;  3EH2 A;  4M7A C;  2KK4 A;  1NPR A;  1N6A A;  4PJO C;  2VUB A;  4CI0 C;  5I2M A;  4A4E A;  1G5V A;  2D8J A;  5LJ3 j;  2GTJ A;  1EIF A;  1PWT A;  2KGT A;  3BE3 A;  1UFF A;  1VQK Q;  1VOM A;  3JCM h;  2I0N A;  2XK0 A;  1Y0M A;  4FSS A;  1WJR A;  4C92 A;  3SWN B;  2E64 A;  4C92 D;  3MJX A;  2ZGW A;  1QWE A;  2R5M A;  2ESW A;  4IUV A;  1VQ5 Q;  2KDS A;  2F5K A;  2DIQ A;  5LJ5 g;  1ARK A;  1PG5 B;  2FRY A;  5KYU A;  2OTJ A;  1XOV A;  2E5Q A;  5KYW A;  4OB2 B;  2MMP A;  4JJC A;  3CCV T;  1K73 C;  1M90 C;  3CC2 Q;  1SRL A;  4ME7 A;  3MET A;  4ZN3 A;  1XQH A;  2F2V A;  1VQ9 Q;  1YNZ A;  4YTL A;  4JS5 A;  1FMW A;  1JXO A;  2H3J A;  3PVQ A;  3VS1 A;  1NEB A;  3OMG A;  5DY9 A;  2F5T X;  2VYT A;  3MKD A;  3GOX A;  1N8R U;  3EH1 A;  3VUZ A;  4IKF A;  1D0X A;  4BY6 B;  5GAN 5;  1GRI A;  2OAW A;  3VS5 A;  3C12 A;  4J9E A;  1QP3 A;  2KVQ G;  1OQK A;  3MEV A;  1PNJ A;  1WLP B;  3I5S A;  2DVJ A;  1M30 A;  1DJ7 B;  3EGX A;  4E7J A;  2Y4Y A;  4LUD A;  1LJO A;  4ELY C;  2RA2 A;  3GBQ A;  2MPX C;  2DXU A;  3PE0 A;  3IQL A;  3HTR A;  1CKA A;  1JXM A;  3G71 Q;  1BIB A;  2DJZ A;  2PVD B;  2A0F B;  1X43 A;  2JXB A;  2P84 A;  2YSQ A;  2ZAE A;  3UAT A;  5L23 A;  4M7A A;  2D0Q B;  4PJO A;  1M3B A;  2EQK A;  2L3R A;  5HCK A;  3ZEH A;  1SHF A;  1Q95 G;  2L8D A;  4NS5 A;  3M57 A;  2BUD A;  4E7S A;  5GAN f;  3E19 A;  4FW1 A;  4BY6 C;  1YHQ T;  4OML A;  2NWM A;  2LQN A;  1JU5 C;  2LQK A;  1YJ9 T;  2ABL A;  2E1H A;  3VS7 A;  5CQY A;  4QVC A;  3PMI A;  2K2M A;  3EG0 A;  5IXB A;  1OPL A;  4C92 F;  1ZUU A;  4L5G A;  2EGC A;  1VQ8 Q;  1HD3 A;  2FHD A;  3HL8 A;  2FO0 A;  1LCK A;  2QDL A;  2F1L A;  1D3B B;  2J05 A;  1WHM A;  3UT1 A;  2QQ9 A;  4KGZ B;  2DL3 A;  2COZ A;  3CCJ T;  2RHX A;  1SRM A;  1NE8 A;  4A54 A;  2IPO B;  2ZPF B;  4PKC C;  4HCK A;  2QTX A;  5J3B A;  1UEB A;  2RI3 A;  3MO8 A;  3CCQ T;  1KSW A;  3LH0 A;  1M9S A;  5CKF A;  1RAI B;  1WHH A;  2NUT B;  3C94 A;  3H41 A;  2RQT A;  1U06 A;  3SWN A;  3L42 A;  1W4S A;  3TSW A;  1CKB A;  1V1C A;  2DMO A;  1G3Y A;  4FM4 B;  4A4F A;  4BI4 A;  2LT1 A;  1NZ9 A;  4E7K A;  3JCM Q;  3E1S A;  2V8J A;  3L2Q A;  1VQ7 A;  3OYB A;  3QJY A;  4JRK A;  5I21 A;  1T0H A;  2RI2 A;  2IIM A;  1WJQ A;  1KC8 C;  5A2Q E;  4PL6 A;  3CME Q;  2C06 A;  4IIM A;  1AZG B;  5FLX E;  8ATC B;  5LJ3 f;  3L2Z A;  3KUF A;  3I55 Q;  3G6E A;  3OW2 S;  2X4W A;  1KD1 R;  5A0L A;  2DK3 A;  3AT1 B;  1VQP Q;  4PJO F;  5CKB A;  1UE9 A;  3FDR A;  2EYY A;  2W10 A;  1M1K U;  1WNL A;  4RTX A;  3NHN A;  4EIK A;  1YWO A;  3QPH A;  2MF2 A;  5GAN g;  3PNW C;  3L2U A;  1CSK A;  3UA6 A;  2VB6 A;  5CO7 A;  2F2X A;  5IAY A;  2JUF A;  1EFN A;  5KE3 A;  2YRD A;  4RTW A;  2X51 A;  2XU8 A;  3P8B B;  3OYC A;  4M75 E;  3RMQ A;  1YHQ A;  4QVD A;  5GAN 4;  4F7U G;  1AWX A;  1YJ9 A;  2LT4 A;  1VQ9 A;  3CCL T;  2CP0 A;  3A8O B;  5KE2 A;  4AMC A;  2QA4 T;  1YP5 A;  1BI1 A;  2AT1 B;  2PVG B;  3CC7 A;  3RDV A;  4M75 B;  1GCQ A;  1QVP A;  1VQO T;  2RM4 A;  3G1J A;  3V7R A;  1Q86 C;  2DIG A;  3CCU Q;  4AG1 C;  3CCJ A;  2QGF B;  1OU8 A;  1K9A A;  5GAM d;  1RI9 A;  4II1 A;  2KBT A;  3H9N A;  4BAC A;  2YUO A;  1D3B A;  5GJV B;  3CD6 T;  3NTI A;  4CRI A;  2DLP A;  4OP0 A;  1G83 A;  3CC4 Q;  2W0Z A;  2ENM A;  1EX4 A;  4MZT A;  4Y92 A;  1JB0 E;  1H64 1;  3CCM Q;  1BCO A;  3M9Q A;  4J7F A;  4ZGE B;  2JTE A;  1VQM T;  3L2V A;  2DBM A;  1X6B A;  1QKX A;  2B86 A;  4M75 C;  2NUT A;  2DRM A;  3JB9 H;  2KSS A;  2D9T A;  2HKQ B;  2HZY A;  3QUI A;  1UUE A;  4J8O A;  5LJ5 d;  2JM9 A;  2CP6 A;  4KGX B;  4AFS C;  3BW1 A;  4JRQ A;  1HYO A;  4OB1 B;  3SHW A;  4J5Y A;  4DA4 A;  1ZSZ C;  4M7D B;  1U8R A;  2OAU A;  1YI2 T;  1ZA2 B;  4KT0 E;  3M5A A;  1IO6 A;  3LH5 A;  3R6O A;  5D6X A;  1XJW B;  3G4S T;  1WHG A;  1K9M R;  3OW2 P;  4O6J A;  3MP8 A;  1NJI R;  1VYU A;  2MYS A;  4CC2 A;  3TSZ A;  2QEX T;  3A8M B;  5GAM h;  5GAN 7;  1R77 A;  2FB7 A;  1IRE B;  2EPD A;  2E4H A;  4Y91 A;  4N4I A;  3EG2 A;  4CC4 B;  2FYK A;  3Q1J A;  5M9O A;  4FW2 A;  2OTJ Q;  1ZUY A;  3M58 A;  2YHT A;  5I11 A;  3UDC A;  2RD1 A;  3P8H A;  3M59 A;  1H92 A;  1UB4 A;  1VQL T;  1M1K C;  3VS2 A;  3E9G A;  5C6S A;  1OI1 A;  2K4Y A;  3I5R A;  1SSF A;  3JCM V;  2GFA A;  4KUD K;  4M7D C;  1BB9 A;  2DD4 A;  3CCL A;  3CMA T;  2KE9 A;  1TH7 A;  4MDW A;  3VS3 A;  3A8H B;  2QK0 A;  3OS2 A;  3TVT A;  4LE9 A;  5LJ5 h;  4ZGD B;  4IUT A;  4X9C A;  5GAN 6;  2QQA A;  5IT9 E;  1SF9 A;  4HA8 A;  4ESR A;  1FMK A;  2VGN A;  1M2V B;  3TCJ A;  1AWW A;  1AHJ B;  1KIK A;  3C95 A;  1UEC A;  4OVA A;  1K8A C;  4M75 A;  1E7O A;  3SDZ A;  3U23 A;  3OA6 A;  4LXC A;  1YIJ T;  4HCC A;  1X69 A;  2CUD A;  2CP3 A;  4M75 D;  1SKU B;  1JJ2 A;  4JS4 A;  2CZ7 B;  3GPL A;  1IB8 A;  2D6F A;  3BY7 A;  3V8J A;  3M53 A;  3VKI A;  1HXD A;  2PUK B;  1O9S A;  1ABQ A;  3X28 B;  4GBQ A;  4RCC A;  2CZ1 B;  2LQ8 A;  2FL7 A;  1Q86 R;  1KD1 U;  1OPK A;  2RHU A;  3EGD B;  5GMK e;  2DM1 A;  2E65 A;  2EGA A;  2RHZ A;  1X75 C;  4N4G A;  2PU9 B;  4JZ3 A;  3EAE A;  3CEY A;  3PGG A;  2HMA A;  5GAO p;  1RI0 A;  1R0B G;  2KRM A;  3NMZ C;  2X4X A;  2DXB A;  2JM8 A;  5CK9 A;  4M7A E;  1LOJ A;  3JAM E;  4PJO E;  2P4T A;  1TUC A;  2CT3 A;  3URG A;  4PJN A;  3VRY A;  1IZ6 A;  4N4H A;  1YI2 A;  2QTV A;  4HXJ A;  3RKW A;  1SPK A;  3G4S A;  1TXQ A;  2LP5 A;  3CCR A;  3OYE A;  2EQI A;  1P92 A;  2LCC A;  4M7D A;  3OW2 A;  5GAO n;  2HDA A;  1H3H A;  3INZ A;  1HK9 A;  3HHT B;  1V76 A;  4J9H A;  3QDR B;  2P4R A; 
#chains in the Genus database with same CATH homology
 3RBB B;  1JXM A;  1UHC A;  1NM7 A;  2FG0 A;  4AFQ C;  1X43 A;  2JXB A;  2PNI A;  2YSQ A;  2ED0 A;  1SHG A;  3I9Q A;  3UAT A;  2DF6 A;  2ECZ A;  1I07 A;  5L23 A;  2EGE A;  1M3B A;  2K79 A;  5HCK A;  3M0T A;  1SHF A;  2BZY A;  3CQT A;  4X1V A;  2FPF A;  2KXD A;  4OML A;  2NWM A;  4Z8A A;  2LQN A;  1JU5 C;  2O9S A;  4DEY A;  4J9D A;  1NYF A;  2YUQ A;  2MIO A;  2HSP A;  2DNU A;  2ABL A;  4J9B A;  2KNB B;  5EC7 A;  1OOT A;  2EYX A;  4HVU A;  3VS7 A;  1PRM C;  3EG3 A;  2J6K A;  1VA7 A;  1T0J A;  3C0C A;  4R0K A;  2K2M A;  1MV0 B;  3EG0 A;  5IXB A;  1OPL A;  2D8H A;  2LMJ A;  1ZUU A;  2EGC A;  1HD3 A;  2EYW A;  1WXT A;  2FO0 A;  1LCK A;  2QDL A;  4Z88 A;  1W6X A;  4J9I A;  2GTO A;  4ZNX A;  1GBR A;  2J05 A;  3KFV A;  3H0F A;  2DL3 A;  2DL7 A;  2L2P A;  3EG1 A;  1TG0 A;  1SRM A;  1BU1 A;  2JW4 A;  2ROT A;  1UJ0 A;  4HCK A;  3NGP A;  2O9V A;  4LN2 A;  1GFC A;  4AFZ C;  1YN8 A;  2EVR A;  1KSW A;  1M8M A;  2YT6 A;  4CC3 A;  1GCP A;  3H41 A;  3QWX X;  2RQT A;  2C0O A;  2GQI A;  1U06 A;  3UF4 A;  1K76 A;  3TSW A;  1PKS A;  1CKB A;  1V1C A;  2DMO A;  4RTT A;  2NUZ A;  5IHI A;  4J9H A;  3O5Z A;  2BTT A;  1TUD A;  4JPB W;  2G6F X;  1T0H A;  1WXB A;  2AZS A;  2IIM A;  4Z89 A;  1ABO A;  1VYV A;  5IH2 A;  3M0P A;  1JO8 A;  2JT4 A;  2X3W D;  4IIM A;  1AZG B;  4OMO A;  2J6O A;  2M0Y A;  2J7I A;  4AG2 C;  4OMQ A;  1PKT A;  3JV3 A;  1AZE A;  1AEY A;  1QCF A;  1UE9 A;  2EYY A;  2W10 A;  3VS6 A;  4RTX A;  1NLO C;  2SEM A;  5GJW B;  2XMF A;  3NHN A;  4EIK A;  1YWO A;  2RN8 A;  2YDL A;  1AVZ C;  1CSK A;  3UA6 A;  4J9F A;  2L0A A;  2F2X A;  4LNP A;  2M51 A;  1W1F A;  3M0S A;  3A98 A;  1EFN A;  1GL5 A;  5FWC A;  1YWP A;  1QWF A;  5FWB A;  3H0I A;  4E6R A;  4RTW A;  4D8D A;  2LJ1 A;  1SEM A;  4RTY A;  2J6F A;  2KYB A;  4AFU C;  5ECA A;  2RQR A;  3QWY A;  1K4U S;  4RTU A;  3H0H A;  2A28 A;  3I35 A;  1KJW A;  3M0R A;  2DL5 A;  1SSH A;  1AWX A;  1UTI A;  5I22 A;  2D0N A;  2DL8 A;  3VS4 A;  2L3Q A;  2KXC A;  1AOJ A;  2K9G A;  2KYM A;  1B07 A;  1KFZ A;  2LNH B;  4J9C A;  4LUE A;  3REA B;  1PHT A;  1T3S A;  1YP5 A;  2D1X A;  2DA9 A;  1X2Q A;  2EYZ A;  1UG1 A;  1GCQ A;  1K0S A;  4RUG A;  1M3A A;  1JQQ A;  1UGV A;  2EW3 A;  3UA7 A;  4JJB A;  1OV3 A;  1HJD A;  2O88 A;  3REB B;  1AWJ A;  4DEX A;  2KT1 A;  1S1N A;  4HVV A;  1A0N B;  5IXF A;  2JS2 A;  4AG1 C;  1M3C A;  1ZUK A;  4JZ4 A;  1WFW A;  1W70 A;  2C0I A;  5FW9 A;  1K9A A;  2CSI A;  2KEA A;  1RI9 A;  2KBT A;  2YUN A;  2YUO A;  1WIE A;  1U3O A;  5GJV B;  1Y57 A;  1WDX A;  2FPD A;  1RLQ C;  2DLP A;  1G83 A;  2W0Z A;  2ENM A;  4Y92 A;  2CUB A;  1RLP C;  2KT8 A;  2YUP A;  1AD5 A;  2RMO A;  4F16 A;  2JS0 A;  4ORZ A;  4RTV A;  1E6G A;  2AKK A;  1X27 A;  2A36 A;  2JTE A;  2DBM A;  3PVL A;  4IIO A;  1X6B A;  4J9G A;  1NLP C;  1QKX A;  2B86 A;  1X2K A;  2OJ2 A;  2X3X D;  1WXU A;  2DRM A;  1BBZ A;  2LJ3 A;  2JMA A;  2AK5 A;  2PTK A;  2HBW A;  2DBK A;  2MOX A;  1UUE A;  2OI3 A;  1ZBJ A;  2EKH A;  2JM9 A;  1E6H A;  4AFS C;  3NPF A;  2EBP A;  1QLY A;  2F2W A;  2GBQ A;  3SHW A;  3R6N A;  1FYN A;  1U5S A;  1NEG A;  2BZ8 A;  4F17 A;  1GFD A;  1IO6 A;  3LH5 A;  2FEI A;  2K7A A;  3ZL7 C;  4OMP A;  4HVW A;  2ROL A;  1K1Z A;  4KRT A;  2RNA A;  2CT4 A;  3VRZ A;  1VYU A;  1UDL A;  2V1Q A;  1UJY A;  4CC2 A;  1HSQ A;  3TSZ A;  1WA7 A;  1JEG A;  2DE0 X;  3SEM A;  2O2O A;  4D8K A;  2LQW A;  1NYG A;  2EPD A;  4CC4 B;  3EG2 A;  2AKL A;  1T3L A;  3FJ5 A;  1PRL C;  2RF0 A;  1ZUY A;  3VS0 A;  5I11 A;  2RQW A;  1ZX6 A;  2O31 A;  1G2B A;  1BK2 A;  3ULR B;  2L3P A;  2LZ6 B;  2LJ0 A;  1H92 A;  2HCK A;  3EHQ A;  3VS2 A;  1Z9Q A;  1MV3 A;  2VKN A;  4M4Z A;  3EGU A;  3I5R A;  2LCS A;  1BB9 A;  2DX1 A;  2VVK A;  2K6D A;  1WYX A;  2KRN A;  4WCI A;  2KE9 A;  2DYB A;  2J06 A;  2RQV A;  2CDT A;  3VS3 A;  3TVT A;  4LE9 A;  1J3T A;  1WX6 A;  4QT7 A;  4CC7 A;  1M27 C;  2GGR A;  4ESR A;  1FMK A;  1AWW A;  2K3B A;  2D8J A;  2RQU A;  1N5Z A;  2ED1 A;  2GTJ A;  2RPN A;  1KIK A;  1PWT A;  1UEC A;  2A08 A;  2KRO A;  2KGT A;  1E7O A;  3U23 A;  1UFF A;  2VWF A;  3M0Q A;  4GLM A;  2MCN A;  1X69 A;  2CUD A;  2I0N A;  2SRC A;  1Y0M A;  4FSS A;  2KRS A;  1AWO A;  3PE0 A;  2CH4 A;  3THK A;  2CRE A;  2PZ1 A;  4RTZ A;  3M0U A;  1QWE A;  1ABQ A;  1RUW A;  4GBQ A;  2HEQ A;  2ESW A;  4OMM A;  1OPK A;  2GNC A;  1ARK A;  2A37 A;  1VYT A;  2FRY A;  1GCQ C;  2DRK A;  1ZLM A;  1K0X A;  1XOV A;  2L3S A;  1B3Q A;  4JJC A;  2BZX A;  2DM1 A;  2EGA A;  2JMC A;  1SRL A;  2FRW A;  2DIL A;  2V1R A;  4JZ3 A;  2C0T A;  3RNJ A;  4JJD A;  4OMN A;  2F2V A;  4K11 A;  1YNZ A;  1QKW A;  2KRM A;  1WI7 A;  3NMZ C;  2KR3 A;  1JXO A;  2H8H A;  2JM8 A;  3PVQ A;  3VS1 A;  1NEB A;  2FPE A;  5IHK A;  2CSQ A;  5IHN A;  1TUC A;  2CT3 A;  3VRY A;  1YCS B;  1MUZ A;  1GRI A;  1GBQ A;  2OAW A;  2CH4 W;  3VS5 A;  4HXJ A;  4J9E A;  1UHF A;  1SPK A;  2DJQ A;  1I0C A;  2LP5 A;  1PNJ A;  1WLP B;  1H8K A;  2AZV A;  1NG2 A;  2DVJ A;  1M30 A;  1Z9Z A;  2EQI A;  3I5S A;  4F14 A;  1X6G A;  4LUD A;  1OEB A;  4A63 B;  1I1J A;  2HDA A;  1ZSG A;  2E5K A;  1H3H A;  2LX7 A;  3GBQ A;  3IQL A;  2DL4 A;  1CKA A;  3EHR A;  2P4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...