1OOTA

Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein at 1.39 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
SPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
publication title Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution
rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ootA00
1PRLC 1GFCA 3RBBB 1ABQA 1ZBJA 4AFQC 2ENMA 1PNJA 1SRMA 4OMMA 4D8KA 1UECA 4J9HA 4JPBW 5IHIA 4RTYA 2DBKA 2YUOA 2RMOA 5L23A 2F2WA 2YUQA 1E7OA 4OMLA 3H0HA 1J3TA 2M51A 1KJWA 4ZNXA 4AFSC 2J05A 1G83A 4RTVA 3TVTA 4RTXA 2FPFA 4AFZC 2AKKA 2V1RA 4HVVA 1SEMA 1K0XA 3QWXX 1VYVA 2ROTA 5EC7A 2GTOA 2QDLA 3I35A 2D0NA 1ZSGA 2DNUA 1OOTA 2KBTA 1BB9A 3CQTA 1K76A 2HSPA 4Y92A 1WDXA 3PVQA 1RLPC 2RQWA 2B86A 5IXBA 2OAWA 3EGUA 2KE9A 3I9QA 1GCPA 1M3CA 1ZLMA 1WXTA 2PZ1A 2DLPA 2LQNA 2CH4W 1U3OA 3EG3A 2W10A 4CC7A 1BBZA 2CREA 2RN8A 1CSKA 2J6KA 3QWYA 1Z9ZA 1M8MA 4KRTA 2K7AA 3NGPA 2GQIA 1T0JA 1UE9A 4HVWA 4JZ4A 1KFZA 5IHNA 4Z88A 5I11A 3M0QA 1AVZC 3UA6A 1B07A 2O9VA 4OMNA 2EGEA 2NWMA 1CKBA 2DX1A 2K2MA 2LNHB 1JQQA 1N5ZA 1A0NB 3SHWA 1GL5A 2CSQA 2O2OA 3SEMA 2JT4A 3REAB 1SPKA 1RLQC 1YN8A 2ROLA 2EYXA 4RTZA 2JMAA 3UA7A 3M0RA 2C0OA 3EG1A 4R0KA 4A63B 2JM8A 5GJVB 2EGAA 3LH5A 4J9IA 2DJQA 1TG0A 2JM9A 1QWFA 2VVKA 2MCNA 1SSHA 1G2BA 1X2QA 1AWOA 1Z9QA 2YUPA 2YUNA 1OPKA 1QWEA 2CH4A 4OMOA 5ECAA 2EQIA 2PNIA 4CC4B 1T3LA 2KGTA 3M0UA 1UFFA 1AOJA 1BK2A 2LQWA 2LZ6B 2EBPA 2VKNA 4J9DA 2LCSA 1B3QA 2ED1A 2LJ0A 1K1ZA 1HSQA 1JEGA 1XOVA 4CC3A 1WYXA 4DEXA 1BU1A 1WFWA 3EG2A 4OMPA 2JS0A 2F2XA 4JJDA 1Y57A 2DRKA 1QKXA 1H92A 4IIOA 1SHFA 1ARKA 2EYYA 2IIMA 1JU5C 2A37A 2DF6A 2DRMA 3VS7A 3GBQA 4LN2A 2K3BA 1E6GA 1LCKA 3VS2A 1SHGA 1GCQC 2LP5A 2VWFA 1NLPC 2AK5A 1PRMC 5HCKA 2AZSA 2O88A 4RTTA 2K79A 2DMOA 1W70A 2SEMA 1H3HA 3M0PA 2D8JA 1TUDA 2V1QA 4F17A 3EHRA 3IQLA 1NG2A 2CT3A 1PHTA 2KYBA 2DL5A 4J9GA 1MV0B 2D8HA 2ABLA 2CT4A 3TSWA 2ECZA 2FPDA 2NUZA 2L3SA 1UHCA 2HBWA 2KROA 4AFUC 1UUEA 2HCKA 1S1NA 3H0FA 4LNPA 3FJ5A 2K9GA 1GBQA 2CSIA 2HDAA 4Z8AA 2G6FX 4LE9A 1W1FA 2LJ3A 5FWCA 1ABOA 4Z89A 2OJ2A 1AEYA 1ZUYA 4F16A 1JXOA 1YP5A 4M4ZA 3R6NA 1WLPB 4OMQA 2LJ1A 2BZ8A 1CKAA 1WA7A 5FWBA 1NYGA 2KR3A 2RNAA 1UDLA 1W6XA 4AG1C 1YCSB 2YSQA 1AZGB 1M27C 1M30A 3VS0A 2PTKA 4J9EA 2W0ZA 1VA7A 1JO8A 3H41A 1RUWA 2JXBA 2A28A 4JJCA 1E6HA 1QLYA 2FO0A 4RTWA 2C0IA 2RQUA 2JS2A 1I07A 1YNZA 1HD3A 2EPDA 1WXBA 1K0SA 3M0SA 4J9FA 4RUGA 2JW4A 1AZEA 2YDLA 3UATA 2A36A 1KSWA 1FYNA 4HXJA 3VS6A 2MIOA 1UGVA 4JZ3A 1ZUKA 4RTUA 2SRCA 1M3BA 1GBRA 2L2PA 3VRZA 2P4RA 1T3SA 3C0CA 3REBB 2C0TA 2L0AA 4GLMA 2RF0A 2EYZA 1NYFA 3M0TA 2EW3A 2KEAA 2KNBB 1TUCA 1X2KA 2M0YA 4FSSA 1YWOA 2JMCA 1X43A 2DL7A 2K6DA 2OI3A 1K9AA 2J06A 4LUEA 2A08A 3VRYA 2O31A 1WXUA 1X27A 3I5SA 2KRSA 2BZYA 2BTTA 3ULRB 3THKA 2YT6A 3RNJA 2FRYA 2KRNA 1WX6A 1NEBA 4D8DA 3VS4A 1VYUA 1WI7A 4X1VA 3VS1A 4ORZA 1KIKA 4WCIA 3PE0A 2ED0A 4F14A 2KYMA 3I5RA 4GBQA 1QKWA 1MV3A 1HJDA 2FG0A 2XMFA 1EFNA 2DILA 2FEIA 1UJ0A 2KXCA 2CUDA 1JXMA 1AD5A 1H8KA 4J9CA 2FPEA 2LMJA 1PKSA 2I0NA 1PKTA 1UJYA 3KFVA 3NPFA 2J6OA 2GBQA 2X3WD 1I0CA 2J7IA 3JV3A 1GCQA 2E5KA 2F2VA 3NMZC 4LUDA 2X3XD 4JJBA 2GNCA 3VS5A 3EHQA 2DM1A 3ZL7C 4CC2A 1AWWA 2KXDA 2RPNA 3O5ZA 2L3QA 2DL3A 1NLOC 1QCFA 2CUBA 5IXFA 1U5SA 3PVLA 1K4US 1UTIA 4ESRA 3A98A 1X6GA 2EVRA 1MUZA 2O9SA 5IHKA 1T0HA 1GFDA 2RQRA 2DYBA 3NHNA 2H8HA 1UHFA 1PWTA 1I1JA 1X69A 3UF4A 5I22A 2MOXA 1YWPA 2J6FA 2GTJA 1VYTA 4DEYA 2KT8A 4IIMA 2RQTA 2AZVA 2KT1A 4J9BA 2CDTA 1GRIA 1NEGA 1M3AA 2JTEA 1ZUUA 2KRMA 1Y0MA 1FMKA 1RI9A 1V1CA 2DBMA 4EIKA 1OPLA 2BZXA 2DE0X 1ZX6A 2GGRA 1OEBA 2EGCA 1NM7A 2L3PA 2RQVA 2DVJA 2DA9A 1WIEA 2LX7A 2D1XA 2EYWA 2FRWA 3H0IA 1AWXA 2DL4A 4QT7A 3EG0A 2EKHA 4K11A 1AWJA 5IH2A 3U23A 1SRLA 1IO6A 3VS3A 3TSZA 1OV3A 4AG2C 4HCKA 1X6BA 5FW9A 1U06A 2AKLA 2DL8A 2HEQA 4HVUA 5GJWB 1UG1A 2ESWA 4E6RA
chains in the Genus database with same CATH superfamily
2MPXC 3RBBB 1ABQA 4KGVB 1OU8A 1PNJA 2PUOB 5HY6A 4D8KA 1M1GA 5C0MA 1YHQQ 2XDBA 1TSFA 5IHIA 1K8AR 3CCET 4RTYA 4A53A 3A8LB 5L23A 3LYIA 4DBFA 2MI6A 1J3TA 2M51A 4PJOA 1KQSS 4AFSC 2ZZDA 2D9TA 1G83A 4M78E 1YI2Q 2LDMA 2NYSA 1YBYA 1K0XA 5GAOl 4C5GA 1VYVA 2ROTA 4N4GA 2GTOA 5EC7A 2D0NA 1DJ7B 1ZSGA 2DNUA 4OB1B 3GOXA 1K76A 3LGFA 5KCOA 3PVQA 5D6WA 3QO3A 2B86A 4P5NA 3CCMQ 1AHJB 1VUBA 5IXBA 4M7AF 3CCVT 2DZCA 3I9QA 2RK1A 2E6ZA 4EMKB 3I56Q 1M3CA 2E64A 2DIQA 2X35A 3HRUA 1WXTA 2OTLQ 3JSCA 4DBRA 1BIBA 1NJIU 3CCEA 1U3OA 4PFPA 2RN8A 3G4ST 3QDRB 2KY9A 3MP6A 2KVQG 4E47A 1M8MA 4KRTA 1ZBXA 2QASA 4C92D 4JZ4A 3V8KA 1H641 1HK9A 5IHNA 3QXEB 4Z88A 3CC2Q 4QVZA 3GNGA 5IAYA 2LVMA 3UA6A 2EGEA 2NWMA 3UPUA 2PQWA 2HL5C 1JQQA 3HTRA 3F70A 1A0NB 1GL5A 3SEMA 2DXUA 2ZPGB 1SPKA 2DAQA 1NJIC 1YN8A 2ROLA 4NOYA 2MMPA 3M0RA 3UA7A 2C0OA 2Y90A 3EG1A 4A63B 5GJVB 3MJXA 2HKNA 4MZMA 1TG0A 1IRXA 2JM9A 3JCMP 1VQ6T 4KGXB 3OYHA 2V26A 1AWOA 2RO0A 4E2FB 4C8QD 3M0UA 2NUTA 3M4GA 1M1KR 3TU4K 2DFUA 3J7AF 3OMCA 2EBPA 4J9DA 1KC8U 4VUBA 3CCEQ 2ED1A 5CR2A 4ZGJB 1HSQA 4CC3A 3RUXA 1WYXA 1Q81R 1N27A 1Q7YR 3P8DA 2VGMA 3TQ7P 1VQOA 3S6WA 2X4JA 1BI3A 2HZYA 1R0CB 4UC4A 4FL6A 3GBQA 2QK0A 3CPWA 4XAXB 2DJZA 4NL2A 3FEOA 2VWFA 2AK5A 1PRMC 3DKMA 3LW5E 1BYMA 2AZSA 1KC8C 4M75F 4XTWA 4RTTA 2K79A 2EQJA 5D6YA 5I21A 2ZPFB 4XU3A 1V29B 4LD9K 1TUDA 1NG2A 2JTFA 4PJMA 4J6WA 2CZ0B 4OB3B 3CPWS 1W2BP 4EMGA 1MNDA 1MV0B 2D8HA 4N0AA 2CT4A 3TSWA 4M7AC 1OU9A 2NUZA 4PJOB 3G4SQ 3PMTA 3CCQT 3AT1B 4FYYB 4ELYC 2HBWA 2XIDA 5KYWA 3H0FA 1U1TA 2DVEA 2COWA 4C0FA 2DTIA 1M2VA 2ZGWA 2C06A 5GAOm 4F7UE 4M78G 2JOYA 1EIFA 2G6FX 3OYFA 1SG5A 2LJ3A 2DEUA 1U1SA 1UEBA 3JCMW 1ZUYA 2E4HA 4QW2A 1YP5A 6AT1B 5LJ5h 3PIPA 3R6NA 3S3MA 3FLGA 2EIFA 4KBMB 2E5QA 2LT1A 1XQHA 3M54A 1YJ9T 1YCSB 2DXCA 1BCOA 4BE2A 1VQOQ 3VS0A 4KULA 1VQ6Q 4J9EA 1ACMB 1VA7A 1NBEB 3CCQA 1M1FA 1RUWA 3OYJA 1E6HA 4RTWA 1MMGA 3FIFA 1I07A 1YNZA 1HD3A 1WXBA 1VQ7T 2O01E 4J9FA 2YXYA 4BE1A 1AZEA 1X75C 2COYA 3JB9D 1Q82U 1KD1U 2E1HA 3VRZA 2HSEB 2P4RA 5FROA 3REBB 4IUPA 1NYFA 3M0TA 2EW3A 2KEAA 2KNBB 1SF9A 1G5VA 4C92F 2R57A 2LT4A 2RJFA 1IHVA 2A08A 4A4KA 3I5SA 1QMCA 4J83A 5FU7B 3THKA 3QHSA 2KRNA 2NUTB 4KUIA 1NEBA 1VYUA 2CKKA 2DD4A 1TXQA 3VS1A 4DBHA 1KD1C 2L8DA 4A4GA 4WCIA 1VQ7A 2V8IA 3NTIA 2K2VA 4F14A 4GBQA 1IHWA 1QKWA 3INZA 2RD1A 2FG0A 2XMFA 1EFNA 2FEIA 4M75C 4HCBA 2E41A 1WJQA 4PJOE 1MMNA 4PJJA 2ZPIB 3NPFA 1OULA 1K9MR 3CCQQ 3CCUT 2J7IA 4DBQA 2V8KA 2E5KA 1K8AU 4O6JA 4LD6A 4CC2A 2RPNA 1G3YA 2L3QA 2M16A 2QI2A 4C8QF 1EZZB 1UGSB 5GAMj 2X4WA 2Y4YA 1UTIA 4E7ZA 3A98A 1X6GA 1MUZA 5IHKA 1GFDA 3KBGA 5GMKi 4FW1A 2IG0A 2H8HA 1W2BA 1OI1A 5I22A 2MOXA 2J6FA 1YJ9Q 4DEYA 3QJYA 1K8AC 3DLLA 3JCMJ 2KT8A 4IIMA 2RQTA 5L8RE 2EFIA 2DPPB 3L2VA 1QVGP 1LVKA 3PIOA 1N8RR 2JTEA 1ZUUA 1Y0MA 2E70A 5HKCA 3CCUA 5KYWB 1V1CA 1OQKA 2DBMA 1PCXA 1ZX6A 1FMVA 3MP1A 5LJ5f 1W2BS 3HFOA 4CI0C 1NM7A 1ZHIA 1M2VB 2HL3A 5CAIA 2D1XA 1VQ7Q 3VYHB 1D3BA 2DL4A 4GY5A 1VIFA 3NFCA 2E12A 4K11A 2EKOA 3L2ZA 3SB2A 3LX7A 4BUGA 1VIEA 2DL8A 2HEQA 4HVUA 3AHUA 1BI1A 2ESWA 1FMWA 2KDSA 2E3IA 2HQHA 7AT1B 2MWPA 5GMKm 2PUKB 3JCMd 1JJ2P 3OA6A 1YHQT 4JPBW 2LX9A 3VUZA 3HP9A 2YUOA 5LJ3j 4OMLA 3H0HA 3HRSA 1KJWA 1WQWA 4C92C 2J05A 1D1BA 4RTVA 2FPFA 1H3ZA 3GLXA 2DEQA 2H3EB 4J8OA 1MMAA 3QWXX 1RAIB 2QDLA 3I35A 1M1KU 4FYWB 2KBTA 4Y28E 2RI2A 3WVDB 3RDVA 2RQWA 1D1CA 3EGXA 2VYTA 3DB4A 3CCUQ 4ZGDB 1TU0B 3VU3C 3OS1A 8ATCB 2R5AA 4A4FA 3PNWC 2LQNA 4M77E 3EG3A 3OB9A 4CC7A 4Z02A 5GAMd 4BDYA 4XK8E 1Z9ZA 1M1KC 3JB9F 4M7AA 2GQIA 2R5MA 4C8QC 1KFZA 3X25B 1AVZC 3QPHA 1Q81C 3HSBA 2HQEA 2FVUA 2LNHB 1Q7YC 2A7YA 2CSQA 3TCJA 3REAB 4OB0B 1RLQC 2E65A 4RKUE 4R0KA 4PJOG 3PTAA 1KQ2A 3JCMX 3RIRA 4J9IA 4HCCA 5FRNA 4F04B 4LXCA 2MCNA 1SSHA 1Z9QA 2YUPA 1PC0A 1VQ9T 3FC3A 1T3LA 5J39A 1BKBA 1QVGA 3OBYA 4R55A 1NPRA 1Q86R 2LQWA 2LZ6B 4OGCA 5KE3A 1VQ5A 1G8XA 4XQ3A 3OMGA 2LCSA 4M7DE 2COZA 2L89A 1K1ZA 1P92A 2QGGA 4IKFA 1HYOA 2FYKA 1QCOA 5LJ3d 4DEXA 1XNIA 3E9FA 1WFWA 1QVGS 4OMPA 2HKQB 3QG1A 4CRIA 1D3BB 2QTVA 4JJDA 1Y57A 3SDZA 4N4IA 1QKXA 3OYAA 1H92A 3RKXA 5KCHA 1M2OA 5C6SA 2A37A 3QJ6A 2NUPA 4XU1A 3VS2A 1QW1A 1R8OB 1SHGA 4B9XA 4F7UF 1VQ9A 4E7SA 3ZFJA 5KYXA 1JJ2A 5GANj 1WNLA 2SEMA 1PD1A 2D8JA 4QKUA 4L6V5 2XKOC 4NL3A 3IQLA 2HMAA 2CT3A 2GFUA 2JJ9A 2KYBA 3CC4T 4J9GA 1K73R 3OQ5A 1UHCA 3G1JA 3X28B 3GNFB 2KI7A 5IT9E 1JJ2S 4M75A 2KROA 1YJWA 1S1NA 4LNPA 2XICA 2LQKA 2X51A 2F69A 2HDAA 2E6NA 4TVRA 1W1FA 5GAOn 5FWCA 1YIJT 2DTOA 3EGXB 1I5OB 3DLMA 4M4ZA 5CKBA 1WLPB 4OMQA 4EMHA 4C5IA 1G3TA 5FWBA 1NYGA 2KR3A 2RNAA 3ZEHA 1BI0A 3ER0A 2VASA 1D0ZA 4AG1C 1KK7A 1RAGB 1WHGA 3CC4A 1VQOT 4HT9A 1WJRA 2RHIA 2QA4T 1NPPA 3JCMV 4JJNK 4M7AB 1JO8A 1KHIA 5IN1A 4M77G 4DOWA 3A8HB 4JJCA 2FO0A 2FB7A 2QYZA 1VQ9Q 2RQUA 3PT9A 4BE0A 5GMKj 3S3NA 1K0SA 2DD5A 4MZPA 2QAZA 2YDLA 5M9OA 2BUDA 1K9MC 1YIJA 3UATA 1KSWA 2PU9B 4HXJA 1TOVA 4JZ3A 3JB9I 5LJ5e 1YJNT 3C0CA 1N8RU 8AT1B 1WPYA 1I8FA 4J5YA 5GAOp 2C0TA 4JS4A 2RHUA 2V8JA 1YJWQ 2O4XA 2EYZA 4MZTA 9ATCB 2CYZB 1TUCA 2OAUA 1M90R 2QA4A 2JMCA 2XDDA 4N4HA 2A3LA 1X43A 2K6DA 1MHNA 4LUEA 3H6ZA 3O8VA 3VRYA 1X27A 4PJNA 2BTTA 1OYXA 2YT6A 1KQ1A 3VS4A 3C12A 3M55A 4M78D 2QEXT 3V8JA 2GF7A 4MDXA 5GANd 3PE0A 2ED0A 4MMLA 4J6XA 3CXCP 5KYYA 1N8RC 3OYNA 4C92A 2ZPBB 4BI4A 2M9UA 3OSSC 2L3RA 1UJ0A 2KXCA 2CUDA 1JXMA 3CC4Q 1H8KA 4J9CA 2DIGA 2FPEA 4OMFB 1PKSA 2I0NA 1PKTA 3VYGA 5CQXA 2J6OA 2GBQA 1I0CA 1YJNA 1VQ8A 2K5FA 1GCQA 3QYHB 1R77A 4QQ6A 4M7DG 3L1AA 3JCMh 4LUDA 2X3XD 3ASKA 2GNCA 1JBMA 3EHQA 3RMQA 1AWWA 3MPUB 4JRQA 5A0LA 1M8VA 2NUPB 4EPCA 2MYSA 5FLXE 3CCRA 3KUFA 1RAAB 5IXFA 4OB2B 3HRTA 1K4US 1Q95G 1YIJQ 5KYXB 2DXBA 1VQPT 2I2LA 3ME9A 1C6VX 2EJGA 1QP3A 1KHCA 2QEXA 1O75A 4J7IA 3HKSA 1UHFA 5GAOq 1I1JA 3BE3A 2XHCA 2QDYB 4B9WA 2FZKB 4IUVA 4C8QA 4J7FA 2KT1A 4LDWA 2CDTA 1GRIA 1O9SA 4M75B 2QA4Q 1B7TA 2FZGB 4M7AE 2XDPA 1D0XA 2GGRA 4D6WA 1OEBA 2K3XA 2YRDA 4B6MA 1WIEA 1QVFP 5LJ5g 3MEAA 5GAMh 2HAXA 3MKDA 2JZ2A 2VXEA 2EKHA 1VQPA 1WJSA 3EG9A 4AT1B 3VUBA 3TSZA 1OV3A 4HCKA 1X6BA 1YJNQ 1VQ8Q 5CVIA 5GJWB 1IGQA 1UG1A 2H3JA 4E6RA 3VKIA 1TUGB 4XU0A 3OYKA 4ELZC 1KG1A 1LJOA 1IZ6A 2EYQA 4ZTJA 2ENMA 1SRMA 2KSSA 1VQLT 4J9HA 1X01A 3CCRQ 5LL6S 1TTHB 4A54A 4M77F 2F2WA 2YUQA 2MAMA 2DTHA 4JRIA 2RHZA 2QEXQ 4RTXA 2BKDN 2CZ1B 2AKKA 3MO8A 2V1RA 4FYXB 1EX4A 1SEMA 4BDZA 3SD4A 2LRQA 2QQBA 4DQ2A 1UGPB 4A4HA 4LDVA 1OOTA 3CQTA 2HSPA 4Y92A 1S72T 1Q86U 1WDXA 4FIBA 2E10A 5FU6C 1I5LA 4NS5A 2O4XB 2KE9A 1GCPA 1ZLMA 2K4YA 1VQLA 2CH4W 5LJ3h 2CREA 1N9RA 4IUTA 4RG2A 5A0DA 2ZAEA 1LPLA 1CSKA 1VQPQ 3E9GA 2J6KA 4ZGEB 1TWBA 5KYYB 2IPOB 1VQ4T 1Q86C 1RI0A 4C92B 2AT1B 3JCMf 3JCMQ 5KH6A 5I11A 3S3OA 3RERA 3M0QA 4OMNA 2CP5A 1S72A 2K2MA 1N5ZA 2QQSA 3PMIA 4KT0E 4M75E 3SHWA 2LC4A 1C1AA 3CPFA 3A8GB 1WQ7A 2EYXA 5KYUA 4RTZA 2JMAA 4FYVB 4O5VA 4QVDA 3UDCA 5GAN4 2JM8A 1RADB 2EGAA 2QG9B 2F5TX 4II1A 2DJQA 5KYNA 4M78F 1QWFA 2VVKA 1LOJA 5GAN6 4FCYA 4DA4A 2P84A 4XTVA 1X2QA 4IURA 3I55T 2YUNA 3C95A 1OPKA 1QWEA 2CH4A 2EQIA 3EGDA 1VQ4A 3EH1A 4CC4B 3A8OB 1UFFA 1PSFA 4C8QB 2RJEA 4KGZB 2X9HA 1K73C 1AOJA 3WXMB 1BK2A 4E7LA 5GAMf 3C4SA 3VJPA 2VKNA 3M57A 1VQLQ 1B3QA 5GAN2 1JEGA 1QVFA 2P4TA 4M7AG 2DRKA 1BCMA 2QTXA 2HNIA 1FWZA 4IIOA 1RABB 3SWNC 1HXDA 3OYBA 1ARKA 2YLBA 3JAME 2EYYA 3EG9B 1JU5C 2DF6A 2DRMA 1D0YA 3VS7A 4RCCA 4LN2A 3I55A 2K3BA 1QP2A 1QVFS 1WGSA 4KH1B 4BY6B 1GCQC 5FRMA 4WF2A 1S72Q 1NLPC 3QIIA 4BB7A 2O88A 2K3YA 2DMOA 1WHLA 3M0PA 5CO7A 3FRNA 3JB9J 2V1QA 4F17A 2OX7A 4C0ZA 1Q81U 3GIBA 3G6ET 2LCCA 4E7JA 3RESA 2DERA 1PHTA 2RH2A 1Q7YU 2RI3A 2G3RA 1RAFB 2DL5A 4JLGA 1RL2A 4PJOD 2ABLA 4F7UA 2FPDA 1M9SA 1M90U 4RCBA 4AFUC 1WHHA 5CQYA 2EQKA 3M5AA 1VQ4Q 3FJ5A 2K9GA 1LNXA 1PM3A 5DY9A 4Y91A 1NE8A 3H8ZA 4LE9A 2ATCB 5DLQE 1IB8A 1BIAA 1ABOA 4Z89A 1VQ5T 5LJ3f 1JXOA 1I81A 3CMET 5GANh 2LJ1A 2BZ8A 1CKAA 2VGNA 1WA7A 2RHYA 2ZPHB 2RK2A 1M90C 2CP6A 3V7CA 1UDLA 1W6XA 3DB3A 3G6EA 1U8RA 1Q82R 2YRVA 3RKYA 1WHMA 1VQMT 1RAEB 4JDSA 1YFNA 1AZGB 1M27C 1M30A 5CKHA 4XTZA 2RJCA 1VQKT 1MMDA 5GAN8 2BE9B 3CMAA 2AIRB 4BY6C 2Z0WA 1MGQA 2JXBA 3QZ9B 3I55Q 5A0GA 1MNEA 1IXDA 1QLYA 2WSFE 4PKCC 2C0IA 3FJPA 4M78C 4C8QE 3MCAB 3EFOA 4XTUA 1Y7XA 3BY7A 4ANJA 2JW4A 3V7SA 1N6AA 1PG5B 2FL7A 3CMEA 5KYUB 2SRCA 1GBRA 2L2PA 1T3SA 4M75G 4QQDA 3TREA 4GLMA 2ZCFB 1IREB 3ZBDA 1VQMA 1YJWT 2KMTA 2RF0A 2E3HA 2VC8A 4LDUA 1VQKA 4FSSA 3QDFA 3QSUA 1YWOA 2WACA 3X24B 2J06A 3EGDB 2KRSA 2MWOA 3EFRA 2BIVA 3RNJA 1WX6A 4IUUA 4LDYA 2BE7D 5GMKh 4X1VA 4PFOA 2Y4XA 1BI2A 5CKEA 2KYMA 3I5RA 4IUQA 3JCMc 2JTMA 3G6EQ 3OW2P 4RG8A 3OYIA 2KAFA 2LMJA 1UJYA 3KFVA 4KH0B 1ZA1B 2X3WD 3CMAQ 3CCSA 3CBMA 2QXFA 2F2VA 4C0DC 2DETA 2VV5A 3GPLA 4C5EA 2P0QA 4M77D 2DL3A 2EQMA 1QCFA 3L2UA 1U5SA 4ESRA 1AT1B 2LCLA 1FX7A 2EVRA 2O9SA 1VQ5Q 4OGEA 1W4SA 3CMEQ 2DYBA 2FHDA 2PVOB 2EQUA 1M5Q1 3NHNA 3OYGA 3HFNA 1PWTA 2X4XA 4FT2A 4HT8A 1YWPA 3TEEA 4BACA 1K9MU 3QKJA 2DXTA 1VQMQ 4F7UB 3URGA 2M0OA 4FT4A 2AZVA 3CCJT 1VQKQ 2EWNA 3RKWA 2KRMA 4BD3A 3OS2A 1FMKA 3HPWA 3JRZA 2BZXA 3P8BB 2DE0X 3CCVA 2YLCA 4FSXA 5GANf 1N9SA 3JCMe 4X9CA 2L3PA 4KUDK 2RQVA 1I4K1 2LX7A 4X9DA 4ME7A 2FRWA 1XJWB 4FW2A 4Q5WA 3H0IA 1AWXA 4C92G 3V7RA 3G4SA 4JS5A 1AWJA 3OYYA 2CP0A 1JRIA 1X6OA 2GQVA 4C0GA 1SRLA 5CKFA 3EAEA 3VS3A 2B8AA 3NTKA 2NLUA 4PJOF 1VQ8T 2AKLA 3CCSQ 4EMKC 4BI8B 1PRLC 1GFCA 1YITT 4A4EA 3CCJA 2D6FA 1ZBJA 5KE2A 4AFQC 4OMMA 4M7DD 1UECA 3CCRT 2EJFA 3LWHA 2DBKA 2RMOA 1E7OA 4ZN3A 3L2RA 4ZNXA 3EFOB 4JRKA 2XK0A 3TVTA 4AFZC 4HVVA 3T9NA 1VQ6A 5GAMe 4C8QG 1VQNT 3SWNA 1Y71A 1BB9A 2KQWA 1XTDA 3M56A 4M77A 2YRCA 2QGFB 1WHJA 2OTJT 4L5GA 2OAWA 3EGUA 3CCVQ 3OYCA 3L2QA 4JRPA 1YITA 3CC7T 2PZ1A 3OYDA 3QZ5B 3A5ZB 2DLPA 3M9QA 1B34A 4DOVA 2W10A 3M59A 1BBZA 2JUFA 1PSEA 3RMSA 4JLIA 1ZSZA 3GF5A 3HL8A 3QWYA 1IGUA 1NZ9A 2K7AA 3NGPA 2CZ6B 1T0JA 3OSVA 2CP3A 1UE9A 4HVWA 4JUVA 3OW2A 4LDXA 1PD0A 2RJDA 2K5IA 1JB0E 2ZPEB 3BDUA 3E2UA 1G3SA 4XTXA 1VQNA 3E19A 4HKEA 1B07A 2O9VA 3JCMg 1CKBA 3CCJQ 2DX1A 2OTJA 2O2OA 2JT4A 3OW2S 2K5LA 5FU6B 2L5QA 4EDUA 2QQ9A 3LH5A 5GMKl 3CC7A 4PLLA 5DM7R 3MEWA 5LJ3e 3QUIA 3FB9A 1G2BA 4OP0A 2DK3A 5CK9A 1ZA2B 5ECAA 4OMOA 4E7HA 4M7DA 2PNIA 3E1SA 2KGTA 3M4YA 2M02A 3PFSA 5DLOA 5EG2A 5J3BA 3CBOA 4MDWA 3QBYA 4M78A 5HK3A 1YITQ 1SSFA 2CP2A 4PNOA 2JN0A 5A2QE 2CS7A 2VXFA 5GAN3 4PJOC 2VUBA 1SKUB 3J81E 2LJ0A 3BW1A 3P8HA 1XOVA 3R6OA 5GAMg 3CEYA 4ZN1A 5CIUA 1BU1A 1YJ9A 1QVPA 2HQXA 3EG2A 2GCXA 2JS0A 2CP7A 2F2XA 3CCLT 1NJIR 5CKDA 1SHFA 2IIMA 3EH2A 1VQNQ 3OY9A 1E6GA 1LCKA 2LP5A 1Y07A 1Q82C 2YHTA 1Y96A 5HCKA 2OTJQ 3MP8A 3JB9G 5LJ5j 3UWNA 3RR6A 3EFSA 4QVCA 1OZ3A 1W70A 1H3HA 5GAOr 2XD0A 2DZ9A 2M1HA 2RM4A 3EHRA 2R58A 3CC7Q 5HK0A 3D7SB 2LQ8A 2LNVA 2ECZA 1UGQB 2LTOA 3NTHA 2L3SA 3OYEA 4E7KA 3A8MB 3CXCA 2QQAA 2CZ7B 1UUEA 2RI5A 2HCKA 3CCLA 1FXXA 3X26B 1GBQA 3X20B 4RMOA 1C0MA 2CSIA 2HD0A 3SWNB 4X34A 4QQGA 4Z8AA 4M77B 1WHKA 5J26A 2DYIA 2OJ2A 1AEYA 4F16A 3CXCS 3KXTA 4FM4B 1K73U 4M7DF 5LJ3g 3LH0A 4AMCA 1B34B 3BDLA 1KC8R 3G71T 2YSQA 1ZSZB 4OVAA 3M53A 2PTKA 1KQSP 2W0ZA 4M7AD 4GLKA 5FU7C 3JCMb 3H41A 1QQJA 2RA2A 2A28A 2WSCE 2JS2A 1R0BG 2EPDA 3M0SA 3BFMA 4RUGA 2CGHA 3L42A 4MMKA 2A36A 1FYNA 3VS6A 2RB6A 2DO3A 2MIOA 1UGVA 3M58A 3META 4XU2A 1ZUKA 3CD6T 4RTUA 4F7UG 5AYFA 5GANe 4L59A 1M3BA 3N5BB 4PLIA 1D1AA 2L0AA 1TH7A 3G71A 3CCLQ 2F1LA 2YWWA 3OS0A 5I2SA 1X2KA 2M0YA 4M77C 4EMKA 5AT1B 2F5KA 2DL7A 2XU8A 2OI3A 1K9AA 2O31A 1WXUA 4M7DB 2BZYA 4OF1A 2HBPA 3ULRB 2FRYA 4YTLA 4D8DA 4E7IA 1WI7A 4ORZA 5LJ5d 1YI2T 1KIKA 4M78B 3GP8A 2KK4A 4XTYA 4HA8A 1OZ2A 5CCAA 4N0AC 1MV3A 1M4ZA 1HJDA 2PVGB 3UT1A 4PJLA 2DILA 1ZSZC 2MF2A 2PVDB 5D6XA 3CD6A 1AD5A 2DKGA 3J80E 2WSEE 1G3WA 5D7UA 3JB9H 3A1PA 3CMAT 1TS9A 3CCMT 1ZQ1A 3OS5A 3JV3A 1YCYA 3VV0A 3NMZC 4HCZA 3I56T 3HHTB 4C92E 1V76A 4JJBA 3VS5A 2X4YA 3ZL7C 2DM1A 2OTLT 1WZOA 2KXDA 3MEUA 3O5ZA 1YHQA 1NLOC 3G7ZA 2CUBA 5GAN5 4R56A 3LLRA 3PVLA 5I2MA 1Y96B 2EJ9A 2K57A 1GXIE 1T0HA 3FDRA 2RQRA 1D09B 3LGLA 5GMKe 1YI2A 2D0QB 2QQRA 2VB6A 4FU6A 2EAYA 3CBPA 3PGGA 1RAHB 1X69A 3UF4A 4WTOB 1OX8A 2IVWA 2GTJA 2JVVA 1VYTA 3CC2T 3L2WA 1RACB 3MEVA 3Q1JA 1KD1R 3G71Q 3OYMA 4J9BA 4M75D 2GFAA 1NEGA 2FZCB 4PK4A 3C94A 4M7DC 1M3AA 3CCMA 1RI9A 3H9NA 4J6YA 4EIKA 1OPLA 1OX9A 2P0KA 2EGCA 2MK5A 3I56A 4C0DB 4C5HA 2DVJA 2OTLA 2DA9A 3V8LA 2JNGA 4ATOA 2EYWA 5GANg 2XG8D 3SFMA 4QT7A 3EG0A 3LWIA 4PFZA 1QCNA 3OYLA 1VOMA 5IH2A 3U23A 2RHXA 3CD6Q 2P0PA 4PL6A 1IO6A 2AHJB 3OBWA 4ZTFA 2XI9A 3MHXA 4BI3A 4AG2C 3WVEB 5GAN7 5FW9A 1UB4A 2A0FB 4V2SA 1U06A 3CPWP 3QYGB 3CCST 1F1BB 1UGRB 1RLPC 1KQSA 3CC2A
chains in the Genus database with same CATH topology
1PRLC 1GFCA 3RBBB 1ABQA 1ZBJA 4AFQC 2ENMA 1PNJA 1SRMA 4OMMA 4D8KA 1UECA 4J9HA 4JPBW 5IHIA 4RTYA 2DBKA 2YUOA 2RMOA 5L23A 2F2WA 2YUQA 1E7OA 4OMLA 3H0HA 1J3TA 2M51A 1KJWA 4ZNXA 4AFSC 2J05A 1G83A 4RTVA 3TVTA 4RTXA 2FPFA 4AFZC 2AKKA 2V1RA 4HVVA 1SEMA 1K0XA 3QWXX 1VYVA 2ROTA 5EC7A 2GTOA 2QDLA 3I35A 2D0NA 1ZSGA 2DNUA 1OOTA 2KBTA 1BB9A 3CQTA 1K76A 2HSPA 4Y92A 1WDXA 3PVQA 1RLPC 2RQWA 2B86A 5IXBA 2OAWA 3EGUA 2KE9A 3I9QA 1GCPA 1M3CA 1ZLMA 1WXTA 2PZ1A 2DLPA 2LQNA 2CH4W 1U3OA 3EG3A 2W10A 4CC7A 1BBZA 2CREA 2RN8A 1CSKA 2J6KA 3QWYA 1Z9ZA 1M8MA 4KRTA 2K7AA 3NGPA 2GQIA 1T0JA 1UE9A 4HVWA 4JZ4A 1KFZA 5IHNA 4Z88A 5I11A 3M0QA 1AVZC 3UA6A 1B07A 2O9VA 4OMNA 2EGEA 2NWMA 1CKBA 2DX1A 2K2MA 2LNHB 1JQQA 1N5ZA 1A0NB 3SHWA 1GL5A 2CSQA 2O2OA 3SEMA 2JT4A 3REAB 1SPKA 1RLQC 1YN8A 2ROLA 2EYXA 4RTZA 2JMAA 3UA7A 3M0RA 2C0OA 3EG1A 4R0KA 4A63B 2JM8A 5GJVB 2EGAA 3LH5A 4J9IA 2DJQA 1TG0A 2JM9A 1QWFA 2VVKA 2MCNA 1SSHA 1G2BA 1X2QA 1AWOA 1Z9QA 2YUPA 2YUNA 1OPKA 1QWEA 2CH4A 4OMOA 5ECAA 2EQIA 2PNIA 4CC4B 1T3LA 2KGTA 3M0UA 1UFFA 1AOJA 1BK2A 2LQWA 2LZ6B 2EBPA 2VKNA 4J9DA 2LCSA 1B3QA 2ED1A 2LJ0A 1K1ZA 1HSQA 1JEGA 1XOVA 4CC3A 1WYXA 4DEXA 1BU1A 1WFWA 3EG2A 4OMPA 2JS0A 2F2XA 4JJDA 1Y57A 2DRKA 1QKXA 1H92A 4IIOA 1SHFA 1ARKA 2EYYA 2IIMA 1JU5C 2A37A 2DF6A 2DRMA 3VS7A 3GBQA 4LN2A 2K3BA 1E6GA 1LCKA 3VS2A 1SHGA 1GCQC 2LP5A 2VWFA 1NLPC 2AK5A 1PRMC 5HCKA 2AZSA 2O88A 4RTTA 2K79A 2DMOA 1W70A 2SEMA 1H3HA 3M0PA 2D8JA 1TUDA 2V1QA 4F17A 3EHRA 3IQLA 1NG2A 2CT3A 1PHTA 2KYBA 2DL5A 4J9GA 1MV0B 2D8HA 2ABLA 2CT4A 3TSWA 2ECZA 2FPDA 2NUZA 2L3SA 1UHCA 2HBWA 2KROA 4AFUC 1UUEA 2HCKA 1S1NA 3H0FA 4LNPA 3FJ5A 2K9GA 1GBQA 2CSIA 2HDAA 4Z8AA 2G6FX 4LE9A 1W1FA 2LJ3A 5FWCA 1ABOA 4Z89A 2OJ2A 1AEYA 1ZUYA 4F16A 1JXOA 1YP5A 4M4ZA 3R6NA 1WLPB 4OMQA 2LJ1A 2BZ8A 1CKAA 1WA7A 5FWBA 1NYGA 2KR3A 2RNAA 1UDLA 1W6XA 4AG1C 1YCSB 2YSQA 1AZGB 1M27C 1M30A 3VS0A 2PTKA 4J9EA 2W0ZA 1VA7A 1JO8A 3H41A 1RUWA 2JXBA 2A28A 4JJCA 1E6HA 1QLYA 2FO0A 4RTWA 2C0IA 2RQUA 2JS2A 1I07A 1YNZA 1HD3A 2EPDA 1WXBA 1K0SA 3M0SA 4J9FA 4RUGA 2JW4A 1AZEA 2YDLA 3UATA 2A36A 1KSWA 1FYNA 4HXJA 3VS6A 2MIOA 1UGVA 4JZ3A 1ZUKA 4RTUA 2SRCA 1M3BA 1GBRA 2L2PA 3VRZA 2P4RA 1T3SA 3C0CA 3REBB 2C0TA 2L0AA 4GLMA 2RF0A 2EYZA 1NYFA 3M0TA 2EW3A 2KEAA 2KNBB 1TUCA 1X2KA 2M0YA 4FSSA 1YWOA 2JMCA 1X43A 2DL7A 2K6DA 2OI3A 1K9AA 2J06A 4LUEA 2A08A 3VRYA 2O31A 1WXUA 1X27A 3I5SA 2KRSA 2BZYA 2BTTA 3ULRB 3THKA 2YT6A 3RNJA 2FRYA 2KRNA 1WX6A 1NEBA 4D8DA 3VS4A 1VYUA 1WI7A 4X1VA 3VS1A 4ORZA 1KIKA 4WCIA 3PE0A 2ED0A 4F14A 2KYMA 3I5RA 4GBQA 1QKWA 1MV3A 1HJDA 2FG0A 2XMFA 1EFNA 2DILA 2FEIA 1UJ0A 2KXCA 2CUDA 1JXMA 1AD5A 1H8KA 4J9CA 2FPEA 2LMJA 1PKSA 2I0NA 1PKTA 1UJYA 3KFVA 3NPFA 2J6OA 2GBQA 2X3WD 1I0CA 2J7IA 3JV3A 1GCQA 2E5KA 2F2VA 3NMZC 4LUDA 2X3XD 4JJBA 2GNCA 3VS5A 3EHQA 2DM1A 3ZL7C 4CC2A 1AWWA 2KXDA 2RPNA 3O5ZA 2L3QA 2DL3A 1NLOC 1QCFA 2CUBA 5IXFA 1U5SA 3PVLA 1K4US 1UTIA 4ESRA 3A98A 1X6GA 2EVRA 1MUZA 2O9SA 5IHKA 1T0HA 1GFDA 2RQRA 2DYBA 3NHNA 2H8HA 1UHFA 1PWTA 1I1JA 1X69A 3UF4A 5I22A 2MOXA 1YWPA 2J6FA 2GTJA 1VYTA 4DEYA 2KT8A 4IIMA 2RQTA 2AZVA 2KT1A 4J9BA 2CDTA 1GRIA 1NEGA 1M3AA 2JTEA 1ZUUA 2KRMA 1Y0MA 1FMKA 1RI9A 1V1CA 2DBMA 4EIKA 1OPLA 2BZXA 2DE0X 1ZX6A 2GGRA 1OEBA 2EGCA 1NM7A 2L3PA 2RQVA 2DVJA 2DA9A 1WIEA 2LX7A 2D1XA 2EYWA 2FRWA 3H0IA 1AWXA 2DL4A 4QT7A 3EG0A 2EKHA 4K11A 1AWJA 5IH2A 3U23A 1SRLA 1IO6A 3VS3A 3TSZA 1OV3A 4AG2C 4HCKA 1X6BA 5FW9A 1U06A 2AKLA 2DL8A 2HEQA 4HVUA 5GJWB 1UG1A 2ESWA 4E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRL C;  1GFC A;  3RBB B;  1ABQ A;  1ZBJ A;  4AFQ C;  2ENM A;  1PNJ A;  1SRM A;  4OMM A;  4D8K A;  1UEC A;  4J9H A;  4JPB W;  5IHI A;  4RTY A;  2DBK A;  2YUO A;  2RMO A;  5L23 A;  2F2W A;  2YUQ A;  1E7O A;  4OML A;  3H0H A;  1J3T A;  2M51 A;  1KJW A;  4ZNX A;  4AFS C;  2J05 A;  1G83 A;  4RTV A;  3TVT A;  4RTX A;  2FPF A;  4AFZ C;  2AKK A;  2V1R A;  4HVV A;  1SEM A;  1K0X A;  3QWX X;  1VYV A;  2ROT A;  5EC7 A;  2GTO A;  2QDL A;  3I35 A;  2D0N A;  1ZSG A;  2DNU A;  1OOT A;  2KBT A;  1BB9 A;  3CQT A;  1K76 A;  2HSP A;  4Y92 A;  1WDX A;  3PVQ A;  1RLP C;  2RQW A;  2B86 A;  5IXB A;  2OAW A;  3EGU A;  2KE9 A;  3I9Q A;  1GCP A;  1M3C A;  1ZLM A;  1WXT A;  2PZ1 A;  2DLP A;  2LQN A;  2CH4 W;  1U3O A;  3EG3 A;  2W10 A;  4CC7 A;  1BBZ A;  2CRE A;  2RN8 A;  1CSK A;  2J6K A;  3QWY A;  1Z9Z A;  1M8M A;  4KRT A;  2K7A A;  3NGP A;  2GQI A;  1T0J A;  1UE9 A;  4HVW A;  4JZ4 A;  1KFZ A;  5IHN A;  4Z88 A;  5I11 A;  3M0Q A;  1AVZ C;  3UA6 A;  1B07 A;  2O9V A;  4OMN A;  2EGE A;  2NWM A;  1CKB A;  2DX1 A;  2K2M A;  2LNH B;  1JQQ A;  1N5Z A;  1A0N B;  3SHW A;  1GL5 A;  2CSQ A;  2O2O A;  3SEM A;  2JT4 A;  3REA B;  1SPK A;  1RLQ C;  1YN8 A;  2ROL A;  2EYX A;  4RTZ A;  2JMA A;  3UA7 A;  3M0R A;  2C0O A;  3EG1 A;  4R0K A;  4A63 B;  2JM8 A;  5GJV B;  2EGA A;  3LH5 A;  4J9I A;  2DJQ A;  1TG0 A;  2JM9 A;  1QWF A;  2VVK A;  2MCN A;  1SSH A;  1G2B A;  1X2Q A;  1AWO A;  1Z9Q A;  2YUP A;  2YUN A;  1OPK A;  1QWE A;  2CH4 A;  4OMO A;  5ECA A;  2EQI A;  2PNI A;  4CC4 B;  1T3L A;  2KGT A;  3M0U A;  1UFF A;  1AOJ A;  1BK2 A;  2LQW A;  2LZ6 B;  2EBP A;  2VKN A;  4J9D A;  2LCS A;  1B3Q A;  2ED1 A;  2LJ0 A;  1K1Z A;  1HSQ A;  1JEG A;  1XOV A;  4CC3 A;  1WYX A;  4DEX A;  1BU1 A;  1WFW A;  3EG2 A;  4OMP A;  2JS0 A;  2F2X A;  4JJD A;  1Y57 A;  2DRK A;  1QKX A;  1H92 A;  4IIO A;  1SHF A;  1ARK A;  2EYY A;  2IIM A;  1JU5 C;  2A37 A;  2DF6 A;  2DRM A;  3VS7 A;  3GBQ A;  4LN2 A;  2K3B A;  1E6G A;  1LCK A;  3VS2 A;  1SHG A;  1GCQ C;  2LP5 A;  2VWF A;  1NLP C;  2AK5 A;  1PRM C;  5HCK A;  2AZS A;  2O88 A;  4RTT A;  2K79 A;  2DMO A;  1W70 A;  2SEM A;  1H3H A;  3M0P A;  2D8J A;  1TUD A;  2V1Q A;  4F17 A;  3EHR A;  3IQL A;  1NG2 A;  2CT3 A;  1PHT A;  2KYB A;  2DL5 A;  4J9G A;  1MV0 B;  2D8H A;  2ABL A;  2CT4 A;  3TSW A;  2ECZ A;  2FPD A;  2NUZ A;  2L3S A;  1UHC A;  2HBW A;  2KRO A;  4AFU C;  1UUE A;  2HCK A;  1S1N A;  3H0F A;  4LNP A;  3FJ5 A;  2K9G A;  1GBQ A;  2CSI A;  2HDA A;  4Z8A A;  2G6F X;  4LE9 A;  1W1F A;  2LJ3 A;  5FWC A;  1ABO A;  4Z89 A;  2OJ2 A;  1AEY A;  1ZUY A;  4F16 A;  1JXO A;  1YP5 A;  4M4Z A;  3R6N A;  1WLP B;  4OMQ A;  2LJ1 A;  2BZ8 A;  1CKA A;  1WA7 A;  5FWB A;  1NYG A;  2KR3 A;  2RNA A;  1UDL A;  1W6X A;  4AG1 C;  1YCS B;  2YSQ A;  1AZG B;  1M27 C;  1M30 A;  3VS0 A;  2PTK A;  4J9E A;  2W0Z A;  1VA7 A;  1JO8 A;  3H41 A;  1RUW A;  2JXB A;  2A28 A;  4JJC A;  1E6H A;  1QLY A;  2FO0 A;  4RTW A;  2C0I A;  2RQU A;  2JS2 A;  1I07 A;  1YNZ A;  1HD3 A;  2EPD A;  1WXB A;  1K0S A;  3M0S A;  4J9F A;  4RUG A;  2JW4 A;  1AZE A;  2YDL A;  3UAT A;  2A36 A;  1KSW A;  1FYN A;  4HXJ A;  3VS6 A;  2MIO A;  1UGV A;  4JZ3 A;  1ZUK A;  4RTU A;  2SRC A;  1M3B A;  1GBR A;  2L2P A;  3VRZ A;  2P4R A;  1T3S A;  3C0C A;  3REB B;  2C0T A;  2L0A A;  4GLM A;  2RF0 A;  2EYZ A;  1NYF A;  3M0T A;  2EW3 A;  2KEA A;  2KNB B;  1TUC A;  1X2K A;  2M0Y A;  4FSS A;  1YWO A;  2JMC A;  1X43 A;  2DL7 A;  2K6D A;  2OI3 A;  1K9A A;  2J06 A;  4LUE A;  2A08 A;  3VRY A;  2O31 A;  1WXU A;  1X27 A;  3I5S A;  2KRS A;  2BZY A;  2BTT A;  3ULR B;  3THK A;  2YT6 A;  3RNJ A;  2FRY A;  2KRN A;  1WX6 A;  1NEB A;  4D8D A;  3VS4 A;  1VYU A;  1WI7 A;  4X1V A;  3VS1 A;  4ORZ A;  1KIK A;  4WCI A;  3PE0 A;  2ED0 A;  4F14 A;  2KYM A;  3I5R A;  4GBQ A;  1QKW A;  1MV3 A;  1HJD A;  2FG0 A;  2XMF A;  1EFN A;  2DIL A;  2FEI A;  1UJ0 A;  2KXC A;  2CUD A;  1JXM A;  1AD5 A;  1H8K A;  4J9C A;  2FPE A;  2LMJ A;  1PKS A;  2I0N A;  1PKT A;  1UJY A;  3KFV A;  3NPF A;  2J6O A;  2GBQ A;  2X3W D;  1I0C A;  2J7I A;  3JV3 A;  1GCQ A;  2E5K A;  2F2V A;  3NMZ C;  4LUD A;  2X3X D;  4JJB A;  2GNC A;  3VS5 A;  3EHQ A;  2DM1 A;  3ZL7 C;  4CC2 A;  1AWW A;  2KXD A;  2RPN A;  3O5Z A;  2L3Q A;  2DL3 A;  1NLO C;  1QCF A;  2CUB A;  5IXF A;  1U5S A;  3PVL A;  1K4U S;  1UTI A;  4ESR A;  3A98 A;  1X6G A;  2EVR A;  1MUZ A;  2O9S A;  5IHK A;  1T0H A;  1GFD A;  2RQR A;  2DYB A;  3NHN A;  2H8H A;  1UHF A;  1PWT A;  1I1J A;  1X69 A;  3UF4 A;  5I22 A;  2MOX A;  1YWP A;  2J6F A;  2GTJ A;  1VYT A;  4DEY A;  2KT8 A;  4IIM A;  2RQT A;  2AZV A;  2KT1 A;  4J9B A;  2CDT A;  1GRI A;  1NEG A;  1M3A A;  2JTE A;  1ZUU A;  2KRM A;  1Y0M A;  1FMK A;  1RI9 A;  1V1C A;  2DBM A;  4EIK A;  1OPL A;  2BZX A;  2DE0 X;  1ZX6 A;  2GGR A;  1OEB A;  2EGC A;  1NM7 A;  2L3P A;  2RQV A;  2DVJ A;  2DA9 A;  1WIE A;  2LX7 A;  2D1X A;  2EYW A;  2FRW A;  3H0I A;  1AWX A;  2DL4 A;  4QT7 A;  3EG0 A;  2EKH A;  4K11 A;  1AWJ A;  5IH2 A;  3U23 A;  1SRL A;  1IO6 A;  3VS3 A;  3TSZ A;  1OV3 A;  4AG2 C;  4HCK A;  1X6B A;  5FW9 A;  1U06 A;  2AKL A;  2DL8 A;  2HEQ A;  4HVU A;  5GJW B;  1UG1 A;  2ESW A;  4E6R A; 
#chains in the Genus database with same CATH topology
 2MPX C;  3RBB B;  1ABQ A;  4KGV B;  1OU8 A;  1PNJ A;  2PUO B;  5HY6 A;  4D8K A;  1M1G A;  5C0M A;  1YHQ Q;  2XDB A;  1TSF A;  5IHI A;  1K8A R;  3CCE T;  4RTY A;  4A53 A;  3A8L B;  5L23 A;  3LYI A;  4DBF A;  2MI6 A;  1J3T A;  2M51 A;  4PJO A;  1KQS S;  4AFS C;  2ZZD A;  2D9T A;  1G83 A;  4M78 E;  1YI2 Q;  2LDM A;  2NYS A;  1YBY A;  1K0X A;  5GAO l;  4C5G A;  1VYV A;  2ROT A;  4N4G A;  2GTO A;  5EC7 A;  2D0N A;  1DJ7 B;  1ZSG A;  2DNU A;  4OB1 B;  3GOX A;  1K76 A;  3LGF A;  5KCO A;  3PVQ A;  5D6W A;  3QO3 A;  2B86 A;  4P5N A;  3CCM Q;  1AHJ B;  1VUB A;  5IXB A;  4M7A F;  3CCV T;  2DZC A;  3I9Q A;  2RK1 A;  2E6Z A;  4EMK B;  3I56 Q;  1M3C A;  2E64 A;  2DIQ A;  2X35 A;  3HRU A;  1WXT A;  2OTL Q;  3JSC A;  4DBR A;  1BIB A;  1NJI U;  3CCE A;  1U3O A;  4PFP A;  2RN8 A;  3G4S T;  3QDR B;  2KY9 A;  3MP6 A;  2KVQ G;  4E47 A;  1M8M A;  4KRT A;  1ZBX A;  2QAS A;  4C92 D;  4JZ4 A;  3V8K A;  1H64 1;  1HK9 A;  5IHN A;  3QXE B;  4Z88 A;  3CC2 Q;  4QVZ A;  3GNG A;  5IAY A;  2LVM A;  3UA6 A;  2EGE A;  2NWM A;  3UPU A;  2PQW A;  2HL5 C;  1JQQ A;  3HTR A;  3F70 A;  1A0N B;  1GL5 A;  3SEM A;  2DXU A;  2ZPG B;  1SPK A;  2DAQ A;  1NJI C;  1YN8 A;  2ROL A;  4NOY A;  2MMP A;  3M0R A;  3UA7 A;  2C0O A;  2Y90 A;  3EG1 A;  4A63 B;  5GJV B;  3MJX A;  2HKN A;  4MZM A;  1TG0 A;  1IRX A;  2JM9 A;  3JCM P;  1VQ6 T;  4KGX B;  3OYH A;  2V26 A;  1AWO A;  2RO0 A;  4E2F B;  4C8Q D;  3M0U A;  2NUT A;  3M4G A;  1M1K R;  3TU4 K;  2DFU A;  3J7A F;  3OMC A;  2EBP A;  4J9D A;  1KC8 U;  4VUB A;  3CCE Q;  2ED1 A;  5CR2 A;  4ZGJ B;  1HSQ A;  4CC3 A;  3RUX A;  1WYX A;  1Q81 R;  1N27 A;  1Q7Y R;  3P8D A;  2VGM A;  3TQ7 P;  1VQO A;  3S6W A;  2X4J A;  1BI3 A;  2HZY A;  1R0C B;  4UC4 A;  4FL6 A;  3GBQ A;  2QK0 A;  3CPW A;  4XAX B;  2DJZ A;  4NL2 A;  3FEO A;  2VWF A;  2AK5 A;  1PRM C;  3DKM A;  3LW5 E;  1BYM A;  2AZS A;  1KC8 C;  4M75 F;  4XTW A;  4RTT A;  2K79 A;  2EQJ A;  5D6Y A;  5I21 A;  2ZPF B;  4XU3 A;  1V29 B;  4LD9 K;  1TUD A;  1NG2 A;  2JTF A;  4PJM A;  4J6W A;  2CZ0 B;  4OB3 B;  3CPW S;  1W2B P;  4EMG A;  1MND A;  1MV0 B;  2D8H A;  4N0A A;  2CT4 A;  3TSW A;  4M7A C;  1OU9 A;  2NUZ A;  4PJO B;  3G4S Q;  3PMT A;  3CCQ T;  3AT1 B;  4FYY B;  4ELY C;  2HBW A;  2XID A;  5KYW A;  3H0F A;  1U1T A;  2DVE A;  2COW A;  4C0F A;  2DTI A;  1M2V A;  2ZGW A;  2C06 A;  5GAO m;  4F7U E;  4M78 G;  2JOY A;  1EIF A;  2G6F X;  3OYF A;  1SG5 A;  2LJ3 A;  2DEU A;  1U1S A;  1UEB A;  3JCM W;  1ZUY A;  2E4H A;  4QW2 A;  1YP5 A;  6AT1 B;  5LJ5 h;  3PIP A;  3R6N A;  3S3M A;  3FLG A;  2EIF A;  4KBM B;  2E5Q A;  2LT1 A;  1XQH A;  3M54 A;  1YJ9 T;  1YCS B;  2DXC A;  1BCO A;  4BE2 A;  1VQO Q;  3VS0 A;  4KUL A;  1VQ6 Q;  4J9E A;  1ACM B;  1VA7 A;  1NBE B;  3CCQ A;  1M1F A;  1RUW A;  3OYJ A;  1E6H A;  4RTW A;  1MMG A;  3FIF A;  1I07 A;  1YNZ A;  1HD3 A;  1WXB A;  1VQ7 T;  2O01 E;  4J9F A;  2YXY A;  4BE1 A;  1AZE A;  1X75 C;  2COY A;  3JB9 D;  1Q82 U;  1KD1 U;  2E1H A;  3VRZ A;  2HSE B;  2P4R A;  5FRO A;  3REB B;  4IUP A;  1NYF A;  3M0T A;  2EW3 A;  2KEA A;  2KNB B;  1SF9 A;  1G5V A;  4C92 F;  2R57 A;  2LT4 A;  2RJF A;  1IHV A;  2A08 A;  4A4K A;  3I5S A;  1QMC A;  4J83 A;  5FU7 B;  3THK A;  3QHS A;  2KRN A;  2NUT B;  4KUI A;  1NEB A;  1VYU A;  2CKK A;  2DD4 A;  1TXQ A;  3VS1 A;  4DBH A;  1KD1 C;  2L8D A;  4A4G A;  4WCI A;  1VQ7 A;  2V8I A;  3NTI A;  2K2V A;  4F14 A;  4GBQ A;  1IHW A;  1QKW A;  3INZ A;  2RD1 A;  2FG0 A;  2XMF A;  1EFN A;  2FEI A;  4M75 C;  4HCB A;  2E41 A;  1WJQ A;  4PJO E;  1MMN A;  4PJJ A;  2ZPI B;  3NPF A;  1OUL A;  1K9M R;  3CCQ Q;  3CCU T;  2J7I A;  4DBQ A;  2V8K A;  2E5K A;  1K8A U;  4O6J A;  4LD6 A;  4CC2 A;  2RPN A;  1G3Y A;  2L3Q A;  2M16 A;  2QI2 A;  4C8Q F;  1EZZ B;  1UGS B;  5GAM j;  2X4W A;  2Y4Y A;  1UTI A;  4E7Z A;  3A98 A;  1X6G A;  1MUZ A;  5IHK A;  1GFD A;  3KBG A;  5GMK i;  4FW1 A;  2IG0 A;  2H8H A;  1W2B A;  1OI1 A;  5I22 A;  2MOX A;  2J6F A;  1YJ9 Q;  4DEY A;  3QJY A;  1K8A C;  3DLL A;  3JCM J;  2KT8 A;  4IIM A;  2RQT A;  5L8R E;  2EFI A;  2DPP B;  3L2V A;  1QVG P;  1LVK A;  3PIO A;  1N8R R;  2JTE A;  1ZUU A;  1Y0M A;  2E70 A;  5HKC A;  3CCU A;  5KYW B;  1V1C A;  1OQK A;  2DBM A;  1PCX A;  1ZX6 A;  1FMV A;  3MP1 A;  5LJ5 f;  1W2B S;  3HFO A;  4CI0 C;  1NM7 A;  1ZHI A;  1M2V B;  2HL3 A;  5CAI A;  2D1X A;  1VQ7 Q;  3VYH B;  1D3B A;  2DL4 A;  4GY5 A;  1VIF A;  3NFC A;  2E12 A;  4K11 A;  2EKO A;  3L2Z A;  3SB2 A;  3LX7 A;  4BUG A;  1VIE A;  2DL8 A;  2HEQ A;  4HVU A;  3AHU A;  1BI1 A;  2ESW A;  1FMW A;  2KDS A;  2E3I A;  2HQH A;  7AT1 B;  2MWP A;  5GMK m;  2PUK B;  3JCM d;  1JJ2 P;  3OA6 A;  1YHQ T;  4JPB W;  2LX9 A;  3VUZ A;  3HP9 A;  2YUO A;  5LJ3 j;  4OML A;  3H0H A;  3HRS A;  1KJW A;  1WQW A;  4C92 C;  2J05 A;  1D1B A;  4RTV A;  2FPF A;  1H3Z A;  3GLX A;  2DEQ A;  2H3E B;  4J8O A;  1MMA A;  3QWX X;  1RAI B;  2QDL A;  3I35 A;  1M1K U;  4FYW B;  2KBT A;  4Y28 E;  2RI2 A;  3WVD B;  3RDV A;  2RQW A;  1D1C A;  3EGX A;  2VYT A;  3DB4 A;  3CCU Q;  4ZGD B;  1TU0 B;  3VU3 C;  3OS1 A;  8ATC B;  2R5A A;  4A4F A;  3PNW C;  2LQN A;  4M77 E;  3EG3 A;  3OB9 A;  4CC7 A;  4Z02 A;  5GAM d;  4BDY A;  4XK8 E;  1Z9Z A;  1M1K C;  3JB9 F;  4M7A A;  2GQI A;  2R5M A;  4C8Q C;  1KFZ A;  3X25 B;  1AVZ C;  3QPH A;  1Q81 C;  3HSB A;  2HQE A;  2FVU A;  2LNH B;  1Q7Y C;  2A7Y A;  2CSQ A;  3TCJ A;  3REA B;  4OB0 B;  1RLQ C;  2E65 A;  4RKU E;  4R0K A;  4PJO G;  3PTA A;  1KQ2 A;  3JCM X;  3RIR A;  4J9I A;  4HCC A;  5FRN A;  4F04 B;  4LXC A;  2MCN A;  1SSH A;  1Z9Q A;  2YUP A;  1PC0 A;  1VQ9 T;  3FC3 A;  1T3L A;  5J39 A;  1BKB A;  1QVG A;  3OBY A;  4R55 A;  1NPR A;  1Q86 R;  2LQW A;  2LZ6 B;  4OGC A;  5KE3 A;  1VQ5 A;  1G8X A;  4XQ3 A;  3OMG A;  2LCS A;  4M7D E;  2COZ A;  2L89 A;  1K1Z A;  1P92 A;  2QGG A;  4IKF A;  1HYO A;  2FYK A;  1QCO A;  5LJ3 d;  4DEX A;  1XNI A;  3E9F A;  1WFW A;  1QVG S;  4OMP A;  2HKQ B;  3QG1 A;  4CRI A;  1D3B B;  2QTV A;  4JJD A;  1Y57 A;  3SDZ A;  4N4I A;  1QKX A;  3OYA A;  1H92 A;  3RKX A;  5KCH A;  1M2O A;  5C6S A;  2A37 A;  3QJ6 A;  2NUP A;  4XU1 A;  3VS2 A;  1QW1 A;  1R8O B;  1SHG A;  4B9X A;  4F7U F;  1VQ9 A;  4E7S A;  3ZFJ A;  5KYX A;  1JJ2 A;  5GAN j;  1WNL A;  2SEM A;  1PD1 A;  2D8J A;  4QKU A;  4L6V 5;  2XKO C;  4NL3 A;  3IQL A;  2HMA A;  2CT3 A;  2GFU A;  2JJ9 A;  2KYB A;  3CC4 T;  4J9G A;  1K73 R;  3OQ5 A;  1UHC A;  3G1J A;  3X28 B;  3GNF B;  2KI7 A;  5IT9 E;  1JJ2 S;  4M75 A;  2KRO A;  1YJW A;  1S1N A;  4LNP A;  2XIC A;  2LQK A;  2X51 A;  2F69 A;  2HDA A;  2E6N A;  4TVR A;  1W1F A;  5GAO n;  5FWC A;  1YIJ T;  2DTO A;  3EGX B;  1I5O B;  3DLM A;  4M4Z A;  5CKB A;  1WLP B;  4OMQ A;  4EMH A;  4C5I A;  1G3T A;  5FWB A;  1NYG A;  2KR3 A;  2RNA A;  3ZEH A;  1BI0 A;  3ER0 A;  2VAS A;  1D0Z A;  4AG1 C;  1KK7 A;  1RAG B;  1WHG A;  3CC4 A;  1VQO T;  4HT9 A;  1WJR A;  2RHI A;  2QA4 T;  1NPP A;  3JCM V;  4JJN K;  4M7A B;  1JO8 A;  1KHI A;  5IN1 A;  4M77 G;  4DOW A;  3A8H B;  4JJC A;  2FO0 A;  2FB7 A;  2QYZ A;  1VQ9 Q;  2RQU A;  3PT9 A;  4BE0 A;  5GMK j;  3S3N A;  1K0S A;  2DD5 A;  4MZP A;  2QAZ A;  2YDL A;  5M9O A;  2BUD A;  1K9M C;  1YIJ A;  3UAT A;  1KSW A;  2PU9 B;  4HXJ A;  1TOV A;  4JZ3 A;  3JB9 I;  5LJ5 e;  1YJN T;  3C0C A;  1N8R U;  8AT1 B;  1WPY A;  1I8F A;  4J5Y A;  5GAO p;  2C0T A;  4JS4 A;  2RHU A;  2V8J A;  1YJW Q;  2O4X A;  2EYZ A;  4MZT A;  9ATC B;  2CYZ B;  1TUC A;  2OAU A;  1M90 R;  2QA4 A;  2JMC A;  2XDD A;  4N4H A;  2A3L A;  1X43 A;  2K6D A;  1MHN A;  4LUE A;  3H6Z A;  3O8V A;  3VRY A;  1X27 A;  4PJN A;  2BTT A;  1OYX A;  2YT6 A;  1KQ1 A;  3VS4 A;  3C12 A;  3M55 A;  4M78 D;  2QEX T;  3V8J A;  2GF7 A;  4MDX A;  5GAN d;  3PE0 A;  2ED0 A;  4MML A;  4J6X A;  3CXC P;  5KYY A;  1N8R C;  3OYN A;  4C92 A;  2ZPB B;  4BI4 A;  2M9U A;  3OSS C;  2L3R A;  1UJ0 A;  2KXC A;  2CUD A;  1JXM A;  3CC4 Q;  1H8K A;  4J9C A;  2DIG A;  2FPE A;  4OMF B;  1PKS A;  2I0N A;  1PKT A;  3VYG A;  5CQX A;  2J6O A;  2GBQ A;  1I0C A;  1YJN A;  1VQ8 A;  2K5F A;  1GCQ A;  3QYH B;  1R77 A;  4QQ6 A;  4M7D G;  3L1A A;  3JCM h;  4LUD A;  2X3X D;  3ASK A;  2GNC A;  1JBM A;  3EHQ A;  3RMQ A;  1AWW A;  3MPU B;  4JRQ A;  5A0L A;  1M8V A;  2NUP B;  4EPC A;  2MYS A;  5FLX E;  3CCR A;  3KUF A;  1RAA B;  5IXF A;  4OB2 B;  3HRT A;  1K4U S;  1Q95 G;  1YIJ Q;  5KYX B;  2DXB A;  1VQP T;  2I2L A;  3ME9 A;  1C6V X;  2EJG A;  1QP3 A;  1KHC A;  2QEX A;  1O75 A;  4J7I A;  3HKS A;  1UHF A;  5GAO q;  1I1J A;  3BE3 A;  2XHC A;  2QDY B;  4B9W A;  2FZK B;  4IUV A;  4C8Q A;  4J7F A;  2KT1 A;  4LDW A;  2CDT A;  1GRI A;  1O9S A;  4M75 B;  2QA4 Q;  1B7T A;  2FZG B;  4M7A E;  2XDP A;  1D0X A;  2GGR A;  4D6W A;  1OEB A;  2K3X A;  2YRD A;  4B6M A;  1WIE A;  1QVF P;  5LJ5 g;  3MEA A;  5GAM h;  2HAX A;  3MKD A;  2JZ2 A;  2VXE A;  2EKH A;  1VQP A;  1WJS A;  3EG9 A;  4AT1 B;  3VUB A;  3TSZ A;  1OV3 A;  4HCK A;  1X6B A;  1YJN Q;  1VQ8 Q;  5CVI A;  5GJW B;  1IGQ A;  1UG1 A;  2H3J A;  4E6R A;  3VKI A;  1TUG B;  4XU0 A;  3OYK A;  4ELZ C;  1KG1 A;  1LJO A;  1IZ6 A;  2EYQ A;  4ZTJ A;  2ENM A;  1SRM A;  2KSS A;  1VQL T;  4J9H A;  1X01 A;  3CCR Q;  5LL6 S;  1TTH B;  4A54 A;  4M77 F;  2F2W A;  2YUQ A;  2MAM A;  2DTH A;  4JRI A;  2RHZ A;  2QEX Q;  4RTX A;  2BKD N;  2CZ1 B;  2AKK A;  3MO8 A;  2V1R A;  4FYX B;  1EX4 A;  1SEM A;  4BDZ A;  3SD4 A;  2LRQ A;  2QQB A;  4DQ2 A;  1UGP B;  4A4H A;  4LDV A;  1OOT A;  3CQT A;  2HSP A;  4Y92 A;  1S72 T;  1Q86 U;  1WDX A;  4FIB A;  2E10 A;  5FU6 C;  1I5L A;  4NS5 A;  2O4X B;  2KE9 A;  1GCP A;  1ZLM A;  2K4Y A;  1VQL A;  2CH4 W;  5LJ3 h;  2CRE A;  1N9R A;  4IUT A;  4RG2 A;  5A0D A;  2ZAE A;  1LPL A;  1CSK A;  1VQP Q;  3E9G A;  2J6K A;  4ZGE B;  1TWB A;  5KYY B;  2IPO B;  1VQ4 T;  1Q86 C;  1RI0 A;  4C92 B;  2AT1 B;  3JCM f;  3JCM Q;  5KH6 A;  5I11 A;  3S3O A;  3RER A;  3M0Q A;  4OMN A;  2CP5 A;  1S72 A;  2K2M A;  1N5Z A;  2QQS A;  3PMI A;  4KT0 E;  4M75 E;  3SHW A;  2LC4 A;  1C1A A;  3CPF A;  3A8G B;  1WQ7 A;  2EYX A;  5KYU A;  4RTZ A;  2JMA A;  4FYV B;  4O5V A;  4QVD A;  3UDC A;  5GAN 4;  2JM8 A;  1RAD B;  2EGA A;  2QG9 B;  2F5T X;  4II1 A;  2DJQ A;  5KYN A;  4M78 F;  1QWF A;  2VVK A;  1LOJ A;  5GAN 6;  4FCY A;  4DA4 A;  2P84 A;  4XTV A;  1X2Q A;  4IUR A;  3I55 T;  2YUN A;  3C95 A;  1OPK A;  1QWE A;  2CH4 A;  2EQI A;  3EGD A;  1VQ4 A;  3EH1 A;  4CC4 B;  3A8O B;  1UFF A;  1PSF A;  4C8Q B;  2RJE A;  4KGZ B;  2X9H A;  1K73 C;  1AOJ A;  3WXM B;  1BK2 A;  4E7L A;  5GAM f;  3C4S A;  3VJP A;  2VKN A;  3M57 A;  1VQL Q;  1B3Q A;  5GAN 2;  1JEG A;  1QVF A;  2P4T A;  4M7A G;  2DRK A;  1BCM A;  2QTX A;  2HNI A;  1FWZ A;  4IIO A;  1RAB B;  3SWN C;  1HXD A;  3OYB A;  1ARK A;  2YLB A;  3JAM E;  2EYY A;  3EG9 B;  1JU5 C;  2DF6 A;  2DRM A;  1D0Y A;  3VS7 A;  4RCC A;  4LN2 A;  3I55 A;  2K3B A;  1QP2 A;  1QVF S;  1WGS A;  4KH1 B;  4BY6 B;  1GCQ C;  5FRM A;  4WF2 A;  1S72 Q;  1NLP C;  3QII A;  4BB7 A;  2O88 A;  2K3Y A;  2DMO A;  1WHL A;  3M0P A;  5CO7 A;  3FRN A;  3JB9 J;  2V1Q A;  4F17 A;  2OX7 A;  4C0Z A;  1Q81 U;  3GIB A;  3G6E T;  2LCC A;  4E7J A;  3RES A;  2DER A;  1PHT A;  2RH2 A;  1Q7Y U;  2RI3 A;  2G3R A;  1RAF B;  2DL5 A;  4JLG A;  1RL2 A;  4PJO D;  2ABL A;  4F7U A;  2FPD A;  1M9S A;  1M90 U;  4RCB A;  4AFU C;  1WHH A;  5CQY A;  2EQK A;  3M5A A;  1VQ4 Q;  3FJ5 A;  2K9G A;  1LNX A;  1PM3 A;  5DY9 A;  4Y91 A;  1NE8 A;  3H8Z A;  4LE9 A;  2ATC B;  5DLQ E;  1IB8 A;  1BIA A;  1ABO A;  4Z89 A;  1VQ5 T;  5LJ3 f;  1JXO A;  1I81 A;  3CME T;  5GAN h;  2LJ1 A;  2BZ8 A;  1CKA A;  2VGN A;  1WA7 A;  2RHY A;  2ZPH B;  2RK2 A;  1M90 C;  2CP6 A;  3V7C A;  1UDL A;  1W6X A;  3DB3 A;  3G6E A;  1U8R A;  1Q82 R;  2YRV A;  3RKY A;  1WHM A;  1VQM T;  1RAE B;  4JDS A;  1YFN A;  1AZG B;  1M27 C;  1M30 A;  5CKH A;  4XTZ A;  2RJC A;  1VQK T;  1MMD A;  5GAN 8;  2BE9 B;  3CMA A;  2AIR B;  4BY6 C;  2Z0W A;  1MGQ A;  2JXB A;  3QZ9 B;  3I55 Q;  5A0G A;  1MNE A;  1IXD A;  1QLY A;  2WSF E;  4PKC C;  2C0I A;  3FJP A;  4M78 C;  4C8Q E;  3MCA B;  3EFO A;  4XTU A;  1Y7X A;  3BY7 A;  4ANJ A;  2JW4 A;  3V7S A;  1N6A A;  1PG5 B;  2FL7 A;  3CME A;  5KYU B;  2SRC A;  1GBR A;  2L2P A;  1T3S A;  4M75 G;  4QQD A;  3TRE A;  4GLM A;  2ZCF B;  1IRE B;  3ZBD A;  1VQM A;  1YJW T;  2KMT A;  2RF0 A;  2E3H A;  2VC8 A;  4LDU A;  1VQK A;  4FSS A;  3QDF A;  3QSU A;  1YWO A;  2WAC A;  3X24 B;  2J06 A;  3EGD B;  2KRS A;  2MWO A;  3EFR A;  2BIV A;  3RNJ A;  1WX6 A;  4IUU A;  4LDY A;  2BE7 D;  5GMK h;  4X1V A;  4PFO A;  2Y4X A;  1BI2 A;  5CKE A;  2KYM A;  3I5R A;  4IUQ A;  3JCM c;  2JTM A;  3G6E Q;  3OW2 P;  4RG8 A;  3OYI A;  2KAF A;  2LMJ A;  1UJY A;  3KFV A;  4KH0 B;  1ZA1 B;  2X3W D;  3CMA Q;  3CCS A;  3CBM A;  2QXF A;  2F2V A;  4C0D C;  2DET A;  2VV5 A;  3GPL A;  4C5E A;  2P0Q A;  4M77 D;  2DL3 A;  2EQM A;  1QCF A;  3L2U A;  1U5S A;  4ESR A;  1AT1 B;  2LCL A;  1FX7 A;  2EVR A;  2O9S A;  1VQ5 Q;  4OGE A;  1W4S A;  3CME Q;  2DYB A;  2FHD A;  2PVO B;  2EQU A;  1M5Q 1;  3NHN A;  3OYG A;  3HFN A;  1PWT A;  2X4X A;  4FT2 A;  4HT8 A;  1YWP A;  3TEE A;  4BAC A;  1K9M U;  3QKJ A;  2DXT A;  1VQM Q;  4F7U B;  3URG A;  2M0O A;  4FT4 A;  2AZV A;  3CCJ T;  1VQK Q;  2EWN A;  3RKW A;  2KRM A;  4BD3 A;  3OS2 A;  1FMK A;  3HPW A;  3JRZ A;  2BZX A;  3P8B B;  2DE0 X;  3CCV A;  2YLC A;  4FSX A;  5GAN f;  1N9S A;  3JCM e;  4X9C A;  2L3P A;  4KUD K;  2RQV A;  1I4K 1;  2LX7 A;  4X9D A;  4ME7 A;  2FRW A;  1XJW B;  4FW2 A;  4Q5W A;  3H0I A;  1AWX A;  4C92 G;  3V7R A;  3G4S A;  4JS5 A;  1AWJ A;  3OYY A;  2CP0 A;  1JRI A;  1X6O A;  2GQV A;  4C0G A;  1SRL A;  5CKF A;  3EAE A;  3VS3 A;  2B8A A;  3NTK A;  2NLU A;  4PJO F;  1VQ8 T;  2AKL A;  3CCS Q;  4EMK C;  4BI8 B;  1PRL C;  1GFC A;  1YIT T;  4A4E A;  3CCJ A;  2D6F A;  1ZBJ A;  5KE2 A;  4AFQ C;  4OMM A;  4M7D D;  1UEC A;  3CCR T;  2EJF A;  3LWH A;  2DBK A;  2RMO A;  1E7O A;  4ZN3 A;  3L2R A;  4ZNX A;  3EFO B;  4JRK A;  2XK0 A;  3TVT A;  4AFZ C;  4HVV A;  3T9N A;  1VQ6 A;  5GAM e;  4C8Q G;  1VQN T;  3SWN A;  1Y71 A;  1BB9 A;  2KQW A;  1XTD A;  3M56 A;  4M77 A;  2YRC A;  2QGF B;  1WHJ A;  2OTJ T;  4L5G A;  2OAW A;  3EGU A;  3CCV Q;  3OYC A;  3L2Q A;  4JRP A;  1YIT A;  3CC7 T;  2PZ1 A;  3OYD A;  3QZ5 B;  3A5Z B;  2DLP A;  3M9Q A;  1B34 A;  4DOV A;  2W10 A;  3M59 A;  1BBZ A;  2JUF A;  1PSE A;  3RMS A;  4JLI A;  1ZSZ A;  3GF5 A;  3HL8 A;  3QWY A;  1IGU A;  1NZ9 A;  2K7A A;  3NGP A;  2CZ6 B;  1T0J A;  3OSV A;  2CP3 A;  1UE9 A;  4HVW A;  4JUV A;  3OW2 A;  4LDX A;  1PD0 A;  2RJD A;  2K5I A;  1JB0 E;  2ZPE B;  3BDU A;  3E2U A;  1G3S A;  4XTX A;  1VQN A;  3E19 A;  4HKE A;  1B07 A;  2O9V A;  3JCM g;  1CKB A;  3CCJ Q;  2DX1 A;  2OTJ A;  2O2O A;  2JT4 A;  3OW2 S;  2K5L A;  5FU6 B;  2L5Q A;  4EDU A;  2QQ9 A;  3LH5 A;  5GMK l;  3CC7 A;  4PLL A;  5DM7 R;  3MEW A;  5LJ3 e;  3QUI A;  3FB9 A;  1G2B A;  4OP0 A;  2DK3 A;  5CK9 A;  1ZA2 B;  5ECA A;  4OMO A;  4E7H A;  4M7D A;  2PNI A;  3E1S A;  2KGT A;  3M4Y A;  2M02 A;  3PFS A;  5DLO A;  5EG2 A;  5J3B A;  3CBO A;  4MDW A;  3QBY A;  4M78 A;  5HK3 A;  1YIT Q;  1SSF A;  2CP2 A;  4PNO A;  2JN0 A;  5A2Q E;  2CS7 A;  2VXF A;  5GAN 3;  4PJO C;  2VUB A;  1SKU B;  3J81 E;  2LJ0 A;  3BW1 A;  3P8H A;  1XOV A;  3R6O A;  5GAM g;  3CEY A;  4ZN1 A;  5CIU A;  1BU1 A;  1YJ9 A;  1QVP A;  2HQX A;  3EG2 A;  2GCX A;  2JS0 A;  2CP7 A;  2F2X A;  3CCL T;  1NJI R;  5CKD A;  1SHF A;  2IIM A;  3EH2 A;  1VQN Q;  3OY9 A;  1E6G A;  1LCK A;  2LP5 A;  1Y07 A;  1Q82 C;  2YHT A;  1Y96 A;  5HCK A;  2OTJ Q;  3MP8 A;  3JB9 G;  5LJ5 j;  3UWN A;  3RR6 A;  3EFS A;  4QVC A;  1OZ3 A;  1W70 A;  1H3H A;  5GAO r;  2XD0 A;  2DZ9 A;  2M1H A;  2RM4 A;  3EHR A;  2R58 A;  3CC7 Q;  5HK0 A;  3D7S B;  2LQ8 A;  2LNV A;  2ECZ A;  1UGQ B;  2LTO A;  3NTH A;  2L3S A;  3OYE A;  4E7K A;  3A8M B;  3CXC A;  2QQA A;  2CZ7 B;  1UUE A;  2RI5 A;  2HCK A;  3CCL A;  1FXX A;  3X26 B;  1GBQ A;  3X20 B;  4RMO A;  1C0M A;  2CSI A;  2HD0 A;  3SWN B;  4X34 A;  4QQG A;  4Z8A A;  4M77 B;  1WHK A;  5J26 A;  2DYI A;  2OJ2 A;  1AEY A;  4F16 A;  3CXC S;  3KXT A;  4FM4 B;  1K73 U;  4M7D F;  5LJ3 g;  3LH0 A;  4AMC A;  1B34 B;  3BDL A;  1KC8 R;  3G71 T;  2YSQ A;  1ZSZ B;  4OVA A;  3M53 A;  2PTK A;  1KQS P;  2W0Z A;  4M7A D;  4GLK A;  5FU7 C;  3JCM b;  3H41 A;  1QQJ A;  2RA2 A;  2A28 A;  2WSC E;  2JS2 A;  1R0B G;  2EPD A;  3M0S A;  3BFM A;  4RUG A;  2CGH A;  3L42 A;  4MMK A;  2A36 A;  1FYN A;  3VS6 A;  2RB6 A;  2DO3 A;  2MIO A;  1UGV A;  3M58 A;  3MET A;  4XU2 A;  1ZUK A;  3CD6 T;  4RTU A;  4F7U G;  5AYF A;  5GAN e;  4L59 A;  1M3B A;  3N5B B;  4PLI A;  1D1A A;  2L0A A;  1TH7 A;  3G71 A;  3CCL Q;  2F1L A;  2YWW A;  3OS0 A;  5I2S A;  1X2K A;  2M0Y A;  4M77 C;  4EMK A;  5AT1 B;  2F5K A;  2DL7 A;  2XU8 A;  2OI3 A;  1K9A A;  2O31 A;  1WXU A;  4M7D B;  2BZY A;  4OF1 A;  2HBP A;  3ULR B;  2FRY A;  4YTL A;  4D8D A;  4E7I A;  1WI7 A;  4ORZ A;  5LJ5 d;  1YI2 T;  1KIK A;  4M78 B;  3GP8 A;  2KK4 A;  4XTY A;  4HA8 A;  1OZ2 A;  5CCA A;  4N0A C;  1MV3 A;  1M4Z A;  1HJD A;  2PVG B;  3UT1 A;  4PJL A;  2DIL A;  1ZSZ C;  2MF2 A;  2PVD B;  5D6X A;  3CD6 A;  1AD5 A;  2DKG A;  3J80 E;  2WSE E;  1G3W A;  5D7U A;  3JB9 H;  3A1P A;  3CMA T;  1TS9 A;  3CCM T;  1ZQ1 A;  3OS5 A;  3JV3 A;  1YCY A;  3VV0 A;  3NMZ C;  4HCZ A;  3I56 T;  3HHT B;  4C92 E;  1V76 A;  4JJB A;  3VS5 A;  2X4Y A;  3ZL7 C;  2DM1 A;  2OTL T;  1WZO A;  2KXD A;  3MEU A;  3O5Z A;  1YHQ A;  1NLO C;  3G7Z A;  2CUB A;  5GAN 5;  4R56 A;  3LLR A;  3PVL A;  5I2M A;  1Y96 B;  2EJ9 A;  2K57 A;  1GXI E;  1T0H A;  3FDR A;  2RQR A;  1D09 B;  3LGL A;  5GMK e;  1YI2 A;  2D0Q B;  2QQR A;  2VB6 A;  4FU6 A;  2EAY A;  3CBP A;  3PGG A;  1RAH B;  1X69 A;  3UF4 A;  4WTO B;  1OX8 A;  2IVW A;  2GTJ A;  2JVV A;  1VYT A;  3CC2 T;  3L2W A;  1RAC B;  3MEV A;  3Q1J A;  1KD1 R;  3G71 Q;  3OYM A;  4J9B A;  4M75 D;  2GFA A;  1NEG A;  2FZC B;  4PK4 A;  3C94 A;  4M7D C;  1M3A A;  3CCM A;  1RI9 A;  3H9N A;  4J6Y A;  4EIK A;  1OPL A;  1OX9 A;  2P0K A;  2EGC A;  2MK5 A;  3I56 A;  4C0D B;  4C5H A;  2DVJ A;  2OTL A;  2DA9 A;  3V8L A;  2JNG A;  4ATO A;  2EYW A;  5GAN g;  2XG8 D;  3SFM A;  4QT7 A;  3EG0 A;  3LWI A;  4PFZ A;  1QCN A;  3OYL A;  1VOM A;  5IH2 A;  3U23 A;  2RHX A;  3CD6 Q;  2P0P A;  4PL6 A;  1IO6 A;  2AHJ B;  3OBW A;  4ZTF A;  2XI9 A;  3MHX A;  4BI3 A;  4AG2 C;  3WVE B;  5GAN 7;  5FW9 A;  1UB4 A;  2A0F B;  4V2S A;  1U06 A;  3CPW P;  3QYG B;  3CCS T;  1F1B B;  1UGR B;  1RLP C;  1KQS A;  3CC2 A; 
#chains in the Genus database with same CATH homology
 1PRL C;  1GFC A;  3RBB B;  1ABQ A;  1ZBJ A;  4AFQ C;  2ENM A;  1PNJ A;  1SRM A;  4OMM A;  4D8K A;  1UEC A;  4J9H A;  4JPB W;  5IHI A;  4RTY A;  2DBK A;  2YUO A;  2RMO A;  5L23 A;  2F2W A;  2YUQ A;  1E7O A;  4OML A;  3H0H A;  1J3T A;  2M51 A;  1KJW A;  4ZNX A;  4AFS C;  2J05 A;  1G83 A;  4RTV A;  3TVT A;  4RTX A;  2FPF A;  4AFZ C;  2AKK A;  2V1R A;  4HVV A;  1SEM A;  1K0X A;  3QWX X;  1VYV A;  2ROT A;  5EC7 A;  2GTO A;  2QDL A;  3I35 A;  2D0N A;  1ZSG A;  2DNU A;  1OOT A;  2KBT A;  1BB9 A;  3CQT A;  1K76 A;  2HSP A;  4Y92 A;  1WDX A;  3PVQ A;  1RLP C;  2RQW A;  2B86 A;  5IXB A;  2OAW A;  3EGU A;  2KE9 A;  3I9Q A;  1GCP A;  1M3C A;  1ZLM A;  1WXT A;  2PZ1 A;  2DLP A;  2LQN A;  2CH4 W;  1U3O A;  3EG3 A;  2W10 A;  4CC7 A;  1BBZ A;  2CRE A;  2RN8 A;  1CSK A;  2J6K A;  3QWY A;  1Z9Z A;  1M8M A;  4KRT A;  2K7A A;  3NGP A;  2GQI A;  1T0J A;  1UE9 A;  4HVW A;  4JZ4 A;  1KFZ A;  5IHN A;  4Z88 A;  5I11 A;  3M0Q A;  1AVZ C;  3UA6 A;  1B07 A;  2O9V A;  4OMN A;  2EGE A;  2NWM A;  1CKB A;  2DX1 A;  2K2M A;  2LNH B;  1JQQ A;  1N5Z A;  1A0N B;  3SHW A;  1GL5 A;  2CSQ A;  2O2O A;  3SEM A;  2JT4 A;  3REA B;  1SPK A;  1RLQ C;  1YN8 A;  2ROL A;  2EYX A;  4RTZ A;  2JMA A;  3UA7 A;  3M0R A;  2C0O A;  3EG1 A;  4R0K A;  4A63 B;  2JM8 A;  5GJV B;  2EGA A;  3LH5 A;  4J9I A;  2DJQ A;  1TG0 A;  2JM9 A;  1QWF A;  2VVK A;  2MCN A;  1SSH A;  1G2B A;  1X2Q A;  1AWO A;  1Z9Q A;  2YUP A;  2YUN A;  1OPK A;  1QWE A;  2CH4 A;  4OMO A;  5ECA A;  2EQI A;  2PNI A;  4CC4 B;  1T3L A;  2KGT A;  3M0U A;  1UFF A;  1AOJ A;  1BK2 A;  2LQW A;  2LZ6 B;  2EBP A;  2VKN A;  4J9D A;  2LCS A;  1B3Q A;  2ED1 A;  2LJ0 A;  1K1Z A;  1HSQ A;  1JEG A;  1XOV A;  4CC3 A;  1WYX A;  4DEX A;  1BU1 A;  1WFW A;  3EG2 A;  4OMP A;  2JS0 A;  2F2X A;  4JJD A;  1Y57 A;  2DRK A;  1QKX A;  1H92 A;  4IIO A;  1SHF A;  1ARK A;  2EYY A;  2IIM A;  1JU5 C;  2A37 A;  2DF6 A;  2DRM A;  3VS7 A;  3GBQ A;  4LN2 A;  2K3B A;  1E6G A;  1LCK A;  3VS2 A;  1SHG A;  1GCQ C;  2LP5 A;  2VWF A;  1NLP C;  2AK5 A;  1PRM C;  5HCK A;  2AZS A;  2O88 A;  4RTT A;  2K79 A;  2DMO A;  1W70 A;  2SEM A;  1H3H A;  3M0P A;  2D8J A;  1TUD A;  2V1Q A;  4F17 A;  3EHR A;  3IQL A;  1NG2 A;  2CT3 A;  1PHT A;  2KYB A;  2DL5 A;  4J9G A;  1MV0 B;  2D8H A;  2ABL A;  2CT4 A;  3TSW A;  2ECZ A;  2FPD A;  2NUZ A;  2L3S A;  1UHC A;  2HBW A;  2KRO A;  4AFU C;  1UUE A;  2HCK A;  1S1N A;  3H0F A;  4LNP A;  3FJ5 A;  2K9G A;  1GBQ A;  2CSI A;  2HDA A;  4Z8A A;  2G6F X;  4LE9 A;  1W1F A;  2LJ3 A;  5FWC A;  1ABO A;  4Z89 A;  2OJ2 A;  1AEY A;  1ZUY A;  4F16 A;  1JXO A;  1YP5 A;  4M4Z A;  3R6N A;  1WLP B;  4OMQ A;  2LJ1 A;  2BZ8 A;  1CKA A;  1WA7 A;  5FWB A;  1NYG A;  2KR3 A;  2RNA A;  1UDL A;  1W6X A;  4AG1 C;  1YCS B;  2YSQ A;  1AZG B;  1M27 C;  1M30 A;  3VS0 A;  2PTK A;  4J9E A;  2W0Z A;  1VA7 A;  1JO8 A;  3H41 A;  1RUW A;  2JXB A;  2A28 A;  4JJC A;  1E6H A;  1QLY A;  2FO0 A;  4RTW A;  2C0I A;  2RQU A;  2JS2 A;  1I07 A;  1YNZ A;  1HD3 A;  2EPD A;  1WXB A;  1K0S A;  3M0S A;  4J9F A;  4RUG A;  2JW4 A;  1AZE A;  2YDL A;  3UAT A;  2A36 A;  1KSW A;  1FYN A;  4HXJ A;  3VS6 A;  2MIO A;  1UGV A;  4JZ3 A;  1ZUK A;  4RTU A;  2SRC A;  1M3B A;  1GBR A;  2L2P A;  3VRZ A;  2P4R A;  1T3S A;  3C0C A;  3REB B;  2C0T A;  2L0A A;  4GLM A;  2RF0 A;  2EYZ A;  1NYF A;  3M0T A;  2EW3 A;  2KEA A;  2KNB B;  1TUC A;  1X2K A;  2M0Y A;  4FSS A;  1YWO A;  2JMC A;  1X43 A;  2DL7 A;  2K6D A;  2OI3 A;  1K9A A;  2J06 A;  4LUE A;  2A08 A;  3VRY A;  2O31 A;  1WXU A;  1X27 A;  3I5S A;  2KRS A;  2BZY A;  2BTT A;  3ULR B;  3THK A;  2YT6 A;  3RNJ A;  2FRY A;  2KRN A;  1WX6 A;  1NEB A;  4D8D A;  3VS4 A;  1VYU A;  1WI7 A;  4X1V A;  3VS1 A;  4ORZ A;  1KIK A;  4WCI A;  3PE0 A;  2ED0 A;  4F14 A;  2KYM A;  3I5R A;  4GBQ A;  1QKW A;  1MV3 A;  1HJD A;  2FG0 A;  2XMF A;  1EFN A;  2DIL A;  2FEI A;  1UJ0 A;  2KXC A;  2CUD A;  1JXM A;  1AD5 A;  1H8K A;  4J9C A;  2FPE A;  2LMJ A;  1PKS A;  2I0N A;  1PKT A;  1UJY A;  3KFV A;  3NPF A;  2J6O A;  2GBQ A;  2X3W D;  1I0C A;  2J7I A;  3JV3 A;  1GCQ A;  2E5K A;  2F2V A;  3NMZ C;  4LUD A;  2X3X D;  4JJB A;  2GNC A;  3VS5 A;  3EHQ A;  2DM1 A;  3ZL7 C;  4CC2 A;  1AWW A;  2KXD A;  2RPN A;  3O5Z A;  2L3Q A;  2DL3 A;  1NLO C;  1QCF A;  2CUB A;  5IXF A;  1U5S A;  3PVL A;  1K4U S;  1UTI A;  4ESR A;  3A98 A;  1X6G A;  2EVR A;  1MUZ A;  2O9S A;  5IHK A;  1T0H A;  1GFD A;  2RQR A;  2DYB A;  3NHN A;  2H8H A;  1UHF A;  1PWT A;  1I1J A;  1X69 A;  3UF4 A;  5I22 A;  2MOX A;  1YWP A;  2J6F A;  2GTJ A;  1VYT A;  4DEY A;  2KT8 A;  4IIM A;  2RQT A;  2AZV A;  2KT1 A;  4J9B A;  2CDT A;  1GRI A;  1NEG A;  1M3A A;  2JTE A;  1ZUU A;  2KRM A;  1Y0M A;  1FMK A;  1RI9 A;  1V1C A;  2DBM A;  4EIK A;  1OPL A;  2BZX A;  2DE0 X;  1ZX6 A;  2GGR A;  1OEB A;  2EGC A;  1NM7 A;  2L3P A;  2RQV A;  2DVJ A;  2DA9 A;  1WIE A;  2LX7 A;  2D1X A;  2EYW A;  2FRW A;  3H0I A;  1AWX A;  2DL4 A;  4QT7 A;  3EG0 A;  2EKH A;  4K11 A;  1AWJ A;  5IH2 A;  3U23 A;  1SRL A;  1IO6 A;  3VS3 A;  3TSZ A;  1OV3 A;  4AG2 C;  4HCK A;  1X6B A;  5FW9 A;  1U06 A;  2AKL A;  2DL8 A;  2HEQ A;  4HVU A;  5GJW B;  1UG1 A;  2ESW A;  4E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...