1OOTA

Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein at 1.39 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'SPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
molecule tags Structural genomics
source organism Saccharomyces cerevisiae
publication title Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution
rcsb
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ootA00
2HEQA 4DEXA 1JEGA 2RNAA 5L23A 2O9VA 4HVVA 2FPEA 2MCNA 3VS3A 1BB9A 2C0OA 2DL3A 3NMZC 2I0NA 4J9CA 5FWCA 4OMLA 5IHIA 4LE9A 1UJ0A 3U23A 3UF4A 5FWBA 1G2BA 1NLOC 1IO6A 2RQRA 2V1QA 4Z8AA 2HSPA 3SEMA 1Z9QA 1GCQC 2FRYA 2C0IA 2PTKA 1UHCA 3H0HA 4F14A 3I35A 2AKLA 2SEMA 4IIMA 4F16A 2EPDA 1CKAA 4Z89A 1ABOA 1T3SA 3M0SA 1E6HA 1HJDA 5IHNA 3EGUA 4AFSC 1JO8A 2DM1A 1T3LA 1N5ZA 2BTTA 2A08A 3M0UA 3ULRB 2J06A 2E5KA 3VS4A 4OMOA 2K9GA 2VKNA 1YP5A 3TSWA 2DBMA 2M0YA 3UA7A 3EHQA 1HSQA 1X27A 2LQNA 2K2MA 2DX1A 3PE0A 4HVUA 1WLPB 2K7AA 2ROTA 2FPDA 3REAB 4JPBW 1OV3A 3RNJA 2RQTA 4EIKA 2HBWA 1AZEA 4HXJA 2LJ1A 3PVQA 1M27C 5HCKA 4AFQC 2OJ2A 1E6GA 3REBB 3EG0A 2BZ8A 1PRMC 3QWXX 3QWYA 4HCKA 1PHTA 1GBRA 1UDLA 1JU5C 4OMMA 2CUDA 2O2OA 1EFNA 1CKBA 2DL7A 2EYYA 1AWJA 2EGEA 4J9FA 3EG1A 1WYXA 2NWMA 1T0JA 4R0KA 1QCFA 3ZL7C 3A98A 2KRNA 1U5SA 3VS2A 3VS1A 1GRIA 2L0AA 1ZLMA 2DL5A 2QDLA 1AVZC 4RTYA 2RQUA 2JTEA 2KNBB 4CC4B 2DJQA 3NPFA 3H0IA 1HD3A 1QWEA 1CSKA 4E6RA 1SEMA 1K0XA 1JXOA 3M0PA 1GL5A 2JS2A 1T0HA 1LCKA 2OI3A 2VWFA 1SRLA 1AZGB 1VA7A 4FSSA 1UTIA 3TSZA 4AFZC 2O9SA 4QT7A 1ZUUA 2F2VA 1K0SA 1RLPC 3I5SA 3TVTA 4GLMA 1I07A 4F17A 2L3SA 1WXBA 1PRLC 2AZVA 3PVLA 3H0FA 2W10A 1BU1A 4X1VA 5IH2A 2DF6A 1XOVA 5ECAA 1RI9A 1BK2A 3UATA 2B86A 4J9GA 1Z9ZA 4LUDA 2KROA 1SRMA 1WXUA 1X69A 2JMCA 3VS7A 1M30A 1SHFA 3EG3A 1ZUKA 1K76A 2A36A 1UECA 2DLPA 2RF0A 1AWOA 4JZ4A 4M4ZA 2GTOA 2JM9A 2VVKA 2KGTA 1H92A 3M0QA 1KJWA 2X3WD 2EYXA 1X6BA 1JXMA 2CT3A 4AFUC 4GBQA 1RLQC 1NYFA 2ROLA 1FYNA 2DBKA 1OPKA 2K3BA 4RTXA 4DEYA 2LZ6B 2KRSA 1MUZA 3RBBB 2FEIA 2YUPA 4CC3A 4ZNXA 3VRYA 4OMPA 1KSWA 1H3HA 2JM8A 5IHKA 2RQWA 1TUCA 4A63B 1RUWA 2L3QA 2V1RA 1X2KA 2CH4W 4J9IA 2EQIA 4RTWA 1SHGA 2SRCA 2ED0A 1OOTA 4JJCA 1OPLA 2OAWA 5I22A 4JZ3A 1NEGA 1K9AA 4ORZA 1UGVA 3VS0A 1ZBJA 2O31A 2ECZA 2LMJA 1WFWA 3C0CA 2BZXA 3IQLA 4OMNA 2DILA 2EYZA 2KXCA 2KR3A 1A0NB 2GGRA 1YWOA 1U06A 2KRMA 1UE9A 2LX7A 1X6GA 2XMFA 3GBQA 3M0RA 2L2PA 1GBQA 3FJ5A 2DL4A 1U3OA 1QKWA 1H8KA 4OMQA 4KRTA 1SPKA 2JMAA 4HVWA 2D0NA 2KYBA 1YN8A 4RTTA 2O88A 1B3QA 2H8HA 1KIKA 4AG2C 4Y92A 2CH4A 1K1ZA 5IXBA 2CREA 1ZSGA 3NGPA 1AWXA 1S1NA 3SHWA 1W1FA 3VS5A 2FG0A 2EVRA 1UHFA 3LH5A 2NUZA 2CUBA 1K4US 4AG1C 1M8MA 2D1XA 1GCPA 2FO0A 2RN8A 5GJVB 4JJBA 2YDLA 2W0ZA 1BBZA 1NG2A 1X43A 1GFCA 4WCIA 2DE0X 1MV0B 2GBQA 1SSHA 2EGAA 1W6XA 3H41A 4RUGA 1I0CA 4J9DA 1KFZA 4D8DA 2MIOA 2PNIA 4LUEA 1ZUYA 3VRZA 1OEBA 1TUDA 2EGCA 3O5ZA 5GJWB 2JW4A 2ESWA 2AKKA 1UUEA 3EG2A 1AD5A 1GCQA 3I9QA 4RTVA 1WA7A 5I11A 4JJDA 1NYGA 1WX6A 2G6FX 5FW9A 1PNJA 1QLYA 1Y0MA 1UG1A 3M0TA 1G83A 2J7IA 2PZ1A 4IIOA 1B07A 2ENMA 2P4RA 1YNZA 2DNUA 1WIEA 2KYMA 1J3TA 2MOXA 2LCSA 2IIMA 1YWPA 2RQVA 1WI7A 2KEAA 3NHNA 2DMOA 3R6NA 2J6KA 4CC7A 1V1CA 2KXDA 1I1JA 1M3AA 2D8HA 4D8KA 2KT8A 1QKXA 2C0TA 2BZYA 2YUNA 2ABLA 2KBTA 4LN2A 1JQQA 1M3CA 4Z88A 1W70A 2LP5A 1PKTA 2DL8A 1UJYA 2DYBA 2YT6A 1ARKA 1VYVA 2X3XD 2RMOA 4RTUA 1VYTA 2F2WA 1UFFA 2JT4A 1NLPC 3EHRA 2CDTA 1M3BA 2AK5A 1Y57A 3THKA 4J9EA 2K6DA 3CQTA 1PWTA 1WXTA 1MV3A 1QWFA 1WDXA 1X2QA 2A37A 2EBPA 2DA9A 2EKHA 2F2XA 4RTZA 5EC7A 2J05A 2D8JA 1FMKA 2DRKA 1AEYA 2DVJA 3VS6A 2YUQA 2KT1A 1AOJA 2RPNA 3I5RA 2ED1A 2FRWA 2FPFA 1GFDA 1NM7A 4CC2A 2DRMA 1AWWA 2KE9A 2YUOA 2LJ3A 1PKSA 2CSQA 2GNCA 2K79A 2J6FA 4K11A 2EYWA 2L3PA 2M51A 2JXBA 2JS0A 2J6OA 2GQIA 2YSQA 2HCKA 2CSIA 4LNPA 1NEBA 2LJ0A 5IXFA 4ESRA 1E7OA 1ZX6A 3UA6A 4J9HA 1YCSB 2A28A 2HDAA 1VYUA 1TG0A 3KFVA 2CT4A 2LNHB 2LQWA 2EW3A 4J9BA 3JV3A 1ABQA 2GTJA 2AZSA
chains in the Genus database with same CATH superfamily
4LD6A 3EGDA 4B6MA 5LJ3j 3DKMA 4XTUA 3MEVA 1I8FA 1VOMA 2MCNA 3VS3A 1M90U 3PGGA 1QVPA 4A53A 3PNWC 1VQMQ 1OI1A 5FWCA 2RHZA 2PQWA 3U23A 3PMIA 4JDSA 5FWBA 2E6ZA 3P8DA 4L59A 2HQXA 4D6WA 1VQ6Q 1YJ9A 5KYYB 2FRYA 1YJNA 3OYJA 3S3NA 1TSFA 3P8BB 7AT1B 2EQJA 4ELZC 2RJEA 3JB9J 1VQ9A 2PTKA 5GAOq 4F14A 4BE0A 2JNGA 1I81A 3OYFA 4F16A 2EPDA 3OYEA 3L2RA 1M2VA 5CKFA 2XIDA 1RAAB 1VQ6T 1MNEA 1ABOA 3QO3A 5GAMe 3M0SA 1E6HA 3RUXA 2QDYB 3EGUA 5KH6A 2GFUA 3X20B 2A08A 3M0UA 2RA2A 2XDDA 1UGRB 3HP9A 3CBMA 4C92C 3VU3C 4A4KA 1B34A 1ZSZC 5LJ5h 2IPOB 5M9OA 2OX7A 1BKBA 2QAZA 1X27A 2K2MA 3GNGA 1YFNA 5I21A 3JCMe 2FPDA 4EDUA 1VQ8T 3HKSA 3VV0A 2HBWA 1AZEA 3CC7Q 2D0QB 3E1SA 4OB0B 2K5LA 1VQLT 1VQ8A 1PHTA 3CC4T 5GMKe 1UDLA 1G3TA 3G6EQ 2CUDA 4C92G 1EFNA 2B8AA 3TCJA 3X25B 1YITQ 1K9MC 4KH1B 2QQRA 4M75D 2COWA 1VQLQ 2JTMA 3M5AA 3VS1A 2QA4T 2L0AA 4M7DE 2QDLA 2DL5A 3EH1A 4II1A 2RQUA 4C5HA 5J39A 3H0IA 1QWEA 4J8OA 4A4EA 1SEMA 2Y90A 1PSEA 1D0YA 3GP8A 2BE7D 3GLXA 1SRLA 4M77C 3L2WA 1M4ZA 2EYQA 1UGSB 4FSSA 3TSZA 4AFZC 2CZ1B 2MWOA 1VQ9T 4E7SA 3TVTA 3QPHA 2DYIA 1I07A 2EJ9A 2OTJT 2L3SA 1WXBA 1PRLC 2AZVA 3PVLA 1YHQQ 2WSFE 5IAYA 2LNVA 1BIBA 2RK1A 2W10A 2XD0A 1BU1A 3MCAB 3ASKA 1GXIE 4C0GA 1R0CB 1RI9A 1BK2A 2L5QA 1KQ1A 5EG2A 2BE9B 4NOYA 3CC2Q 1WXUA 2QQBA 2YRCA 4OB2B 5GAN7 5DLOA 5HK3A 1SHFA 5KYXA 3EH2A 2VXEA 4JZ4A 4M4ZA 1NPRA 3JB9D 3A8MB 5GAOr 2EYXA 2CT3A 3G71Q 1FYNA 1TWBA 2DBKA 4RTXA 4DEYA 3OQ5A 4OGEA 5DM7R 3M4YA 3LW5E 5CIUA 5KE3A 2CP6A 3MEWA 3L2UA 4OMPA 4C8QA 2RQWA 3S3OA 3QYGB 4IUTA 2L3QA 3HSBA 4RTWA 4PJOE 1HXDA 4QQDA 4JJCA 4OB3B 3CMEQ 1TOVA 3OYDA 4XAXB 1IZ6A 4JZ3A 4F7UB 3HL8A 1RABB 2E4HA 1K9AA 3C95A 4VUBA 1VQ6A 2O31A 1OX8A 1YI2A 4M78D 1KD1U 4A4HA 2KR3A 3CCQT 1A0NB 3MKDA 3OYYA 2CZ7B 1HYOA 2LX7A 2L2PA 1N9SA 1QW1A 1BI0A 2ZCFB 1QQJA 4KRTA 4QVDA 2JMAA 2D0NA 4PJOB 3CCQQ 2EQKA 1EX4A 1XNIA 4KUIA 1W2BS 2H8HA 1WHJA 1MMAA 1G3WA 1K1ZA 1PC0A 5IXBA 1ZSGA 4XTXA 2DD4A 2FZKB 4M7DD 4GLKA 2QEXQ 5GAOl 1PSFA 4NL3A 4J6XA 1YIJA 2RN8A 2ATCB 1X43A 4PLIA 2NYSA 4EMGA 1M5Q1 2RI2A 4C0DB 2NUTA 3EG9A 4RUGA 1I0CA 1KFZA 4D8DA 3INZA 3VRZA 2OAUA 3JCMW 2JW4A 1KC8R 2AKKA 2LT4A 3EG2A 1AD5A 1WX6A 4E7ZA 2KVQG 3JCMb 1N8RC 4FU6A 1FX7A 3M0TA 1G83A 3PMTA 1LNXA 2IG0A 2ENMA 3M53A 2PVOB 3M56A 2MOXA 2DZ9A 4O6JA 1M8VA 5IN1A 2RQVA 4M78E 3QYHB 1V1CA 4R55A 3CCRT 1M3AA 4D8KA 1S72T 4AT1B 2GQVA 2XU8A 2JTFA 1LOJA 1PG5B 1YHQT 3TEEA 5C6SA 3Q1JA 3LLRA 4DBQA 2DL8A 3NFCA 1UJYA 2QXFA 2RJDA 3PFSA 1VQ4A 3CCJT 3V7SA 1R77A 2QG9B 1ARKA 2DXBA 1UFFA 1RAGB 2R57A 4DOWA 2P84A 2CDTA 2I2LA 2K6DA 3CQTA 2A37A 9ATCB 1AT1B 1OU8A 1FMKA 2RHIA 3KBGA 2DVJA 2V8JA 5FU6C 2YUQA 3RERA 3I5RA 3I56Q 2ED1A 2FRWA 2FPFA 4FM4B 3CEYA 1GFDA 5I2SA 1NM7A 4PJJA 2P0KA 4BI3A 3OYBA 1VQ4Q 4N4IA 2J6FA 2COZA 2JXBA 2L89A 3A1PA 4AMCA 3G4SA 2J6OA 2E10A 3JB9G 4LDYA 2GQIA 3OYMA 2XDBA 3G6ET 3BW1A 2HCKA 4LNPA 4OMFB 3HTRA 1W2BP 5IXFA 3X28B 3UA6A 4J9HA 2A28A 3CD6Q 5GMKm 2LNHB 4E7LA 1RACB 1VQLA 1IB8A 2DXCA 1ABQA 2GTJA 2X4YA 1N8RU 4XU1A 3JCMQ 2AZSA 2L8DA 1PM3A 1K73C 4J7FA 2DVEA 5A2QE 2O9VA 3QHSA 1RAHB 3OS0A 4P5NA 2LDMA 4MMKA 4QQGA 2YRVA 2HKNA 2RK2A 2O4XA 5IHIA 5KYWA 2BKDN 2QQSA 3UF4A 5CR2A 2VGNA 3R6OA 2LRQA 2RQRA 2V1QA 3CMAA 2HSPA 2R58A 3EFOA 3I55A 3LX7A 3URGA 3FC3A 1X75C 2XDPA 4BI4A 2RJCA 3H0HA 3I35A 2SEMA 3A8LB 4BACA 3OBYA 1CKAA 3D7SB 4ME7A 4Z89A 4C5EA 4KULA 2K3XA 1HJDA 1JO8A 3J7AF 4HCBA 5GAOm 2YWWA 1IGUA 3FRNA 3CPWS 3NTHA 2KAFA 1MNDA 4OMOA 5GAOp 2MI6A 2VKNA 1ZA2B 4XTWA 4E47A 3TSWA 6AT1B 5GAN4 2QI2A 4DBHA 5CAIA 2M0YA 4KT0E 3MP8A 3UA7A 4A54A 3GNFB 1JJ2A 4RCCA 4M7AD 3REAB 3CC7T 4JPBW 4C8QG 3N5BB 4Q5WA 2EFIA 4LDXA 2HAXA 1BI3A 4PJLA 4QVZA 1M27C 5HCKA 2OJ2A 1E6GA 3CC4Q 1UEBA 2BZ8A 4HCKA 1YJWA 2CP0A 3V8KA 1M90R 5GANf 2JJ9A 4OMMA 4M75G 4DQ2A 2JOYA 5D7UA 1NJIC 2P4TA 2DL7A 1VQ5A 4FYXB 2A7YA 4J9FA 1WYXA 4OP0A 2EKOA 4ZTFA 3M57A 3ZL7C 3A98A 2KRNA 1U5SA 3I55Q 3E19A 3VS2A 2E64A 1U8RA 1GRIA 1AVZC 1M2VB 4WF2A 2DJQA 1F1BB 1D3BA 1UGQB 2DEUA 5CQXA 4M77E 3BY7A 1VIEA 4DBFA 1T0HA 4N4GA 2VWFA 1ZSZB 1VA7A 4OGCA 4MDXA 4M7AE 2O9SA 4QT7A 1ZUUA 2F2VA 4CI0C 3TU4K 1QCNA 4FYVB 2HL5C 4F17A 5D6WA 3L2ZA 4XTVA 3CXCP 1WHLA 4BI8B 1NZ9A 3J81E 1YJ9T 1M9SA 4X1VA 5IH2A 1XOVA 3SDZA 4PJOA 4J9GA 3HHTB 1Z9ZA 1LPLA 4LUDA 1YJWT 2KROA 1SRMA 2HBPA 1X69A 1WJQA 2JMCA 1M30A 1ZUKA 2E3HA 2FZCB 1H641 4E2FB 1AWOA 2MMPA 4PJOF 2KGTA 2DKGA 2QGGA 1KJWA 1D1BA 1R8OB 2QA4A 1X6BA 1NYFA 2ROLA 1OZ3A 4HA8A 1WHGA 2FEIA 2YUPA 1KSWA 3OBWA 2NLUA 2JM8A 4PFZA 1FMVA 2DERA 1YITT 2A3LA 4M75F 1RUWA 3GOXA 3EG9B 4J9IA 1FWZA 1PCXA 3TQ7P 4BY6B 1OOTA 5I22A 3SFMA 1VQOA 1NEGA 4N0AC 2K57A 3ZFJA 2CP7A 3VS0A 2NUPB 1VIFA 1TTHB 2ECZA 2LMJA 1WFWA 2A0FB 2EWNA 3C0CA 4OF1A 3S6WA 1NJIR 3IQLA 4HCCA 4ATOA 4OMNA 2DILA 2DK3A 2EYZA 2KXCA 3CXCS 3OS1A 1QCOA 1P92A 1KK7A 3QJ6A 4ZN3A 1UE9A 1KG1A 1X6GA 3RESA 2R5AA 5GAN3 1GBQA 1DJ7B 3FJ5A 1SKUB 2WACA 3OS5A 1Q82C 1M2OA 5FROA 2VGMA 2BUDA 1ZBXA 2KYBA 1YN8A 1NBEB 2O88A 1D3BB 1W2BA 4JS5A 2ZPFB 3I56T 2ZGWA 1TUGB 2EAYA 1ZSZA 4IKFA 2CREA 3NGPA 3CBPA 2FG0A 2NUZA 1K4US 1YI2Q 2D1XA 4OB1B 2XI9A 5GJVB 1NPPA 3P8HA 2YDLA 2W0ZA 1BBZA 3JB9H 1GFCA 3VUBA 1WNLA 2GBQA 1Y7XA 3C12A 4F7UG 2F1LA 3KXTA 5KYYA 4C92E 4J9DA 4PNOA 4LUEA 1ZUYA 1B7TA 3RKXA 3O5ZA 3CCQA 2ESWA 5GANe 3ZEHA 5L8RE 1JJ2P 4RTVA 1WA7A 2XK0A 5I11A 4JJDA 1NYGA 2G6FX 1QLYA 1Y0MA 2MYSA 4M7DG 4EMKC 5GMKh 2D9TA 3JCMV 3M54A 3QZ5B 3GPLA 3CCVQ 3SD4A 5KYNA 2P4RA 2DNUA 3V7CA 3RMSA 2KYMA 1J3TA 4BDYA 1SSFA 3CPWA 2GCXA 5LJ3d 4BDZA 1YWPA 3JCMd 2DTHA 3LYIA 4M77B 2DTOA 2MAMA 3NHNA 3V8LA 4QW2A 2DMOA 2H3EB 2RD1A 3R6NA 3CC2A 2J6KA 4M7DB 1Y96B 3FIFA 2D8HA 1WPYA 1QKXA 2C0TA 3CD6A 2M02A 2BZYA 4E7KA 2YUNA 2NUTB 1QVGA 4JLIA 2KBTA 2OTLA 1V76A 2DXUA 1JQQA 1M3CA 4J6WA 1YIJT 4XTZA 4Z88A 4FCYA 2PVGB 2EQMA 1PKTA 5GMKj 5GANh 2DYBA 4M77F 5CKBA 1OU9A 1D1AA 3CMAT 2LTOA 2QQ9A 3A8OB 1PWTA 4EMKA 1QWFA 1X2QA 3RKYA 1N8RR 2F2XA 2VASA 2J05A 2RH2A 3EGXA 2DRKA 3G7ZA 3CCUA 4J7IA 1RAEB 5A0LA 1XQHA 3VS6A 2ZPBB 5KYXB 4PJOG 2YUOA 1PKSA 1IGQA 3EFRA 2GNCA 3JCMf 2PUKB 4C8QC 2M51A 3M9QA 3CCJQ 3CPWP 4DBRA 4IURA 4A4FA 1VQKT 3OY9A 2YSQA 3ME9A 1M1KU 2E70A 1NEBA 4YTLA 5CK9A 1E7OA 1KD1R 5LJ5f 2HDAA 2M0OA 1VYUA 3KFVA 1K8AC 4J5YA 3L2QA 4ZTJA 3SWNB 3JSCA 1RI0A 3JV3A 2YLBA 3ER0A 2FZGB 4F7UA 2RNAA 5L23A 4HVVA 3G4SQ 2FPEA 1C6VX 2HSEB 4TVRA 2DL3A 4M7AB 4OMLA 1Y71A 1KHIA 2K5IA 4LE9A 2FYKA 1UJ0A 1G2BA 3BDLA 3V7RA 1NLOC 3OMCA 1IO6A 3F70A 4Z8AA 3QDRB 5GAN2 1Z9QA 1JB0E 4E7IA 1LVKA 1W4SA 2KQWA 4PJNA 1I5OB 3LGLA 1YJNQ 3MHXA 1XJWB 1YHQA 1UGPB 1UHCA 4OVAA 3VYGA 4M7AF 2QTXA 2HZYA 1WJRA 2AT1B 3A8GB 2YRDA 3H9NA 4C8QF 3SWNC 1NJIU 1T3SA 2D6FA 2WSCE 4ZN1A 1IXDA 5IHNA 2GFAA 4AFSC 3CC2T 3UT1A 2DM1A 2LT1A 1N5ZA 4M7AA 5KYUB 3ULRB 1I5LA 4HT8A 2K5FA 2K9GA 2XICA 2X35A 2G3RA 1YP5A 5CO7A 4PJOD 5GAN8 2VYTA 1HK9A 4LXCA 4R56A 1VQ5T 3EHQA 1HSQA 2L3RA 2LQNA 2Y4YA 2HD0A 3DLMA 2ROTA 2DIQA 2AIRB 3CC7A 1ZQ1A 4BE2A 3EFOB 1VQOQ 4FT2A 3RNJA 2RI3A 2RQTA 4HXJA 1G8XA 2KK4A 2LJ1A 3PVQA 2KI7A 3BFMA 3HRUA 3EG0A 5KYWB 1Q7YC 2HQHA 4PLLA 1M90C 1GBRA 4C0ZA 3AHUA 1JRIA 3M55A 2CKKA 4QKUA 3CCUT 1JJ2S 1Q95G 1Q81R 3PIPA 3SWNA 2EGEA 4LDWA 1KQ2A 5A0GA 3EG1A 5AYFA 1T0JA 2LX9A 1Y07A 2K2VA 3X26B 1ZLMA 4RTYA 5LJ3g 1Q82R 3L42A 4ANJA 1WQ7A 4CC4B 1OZ2A 1JXOA 2EJFA 3M0PA 1K73R 1QVFA 2JS2A 2LQKA 3OYGA 2F5KA 4IUUA 3CCMT 1Q86U 1UTIA 1K0SA 1RLPC 1WZOA 3DB3A 3I5SA 4GLMA 2RO0A 1YJ9Q 1OULA 3H0FA 4BUGA 5KE2A 3WXMB 3O8VA 2DF6A 5GAN6 3CCMQ 2DZCA 2B86A 2P0QA 5GANg 4Z02A 2COYA 4UC4A 3OS2A 2CZ0B 1BIAA 4QVCA 1K76A 2FL7A 2MPXC 2JZ2A 2A36A 2RF0A 4PK4A 5KYUA 2GTOA 2VVKA 3VKIA 1YCYA 3M0QA 4C8QD 5CKDA 5FRMA 4AFUC 1JXMA 4GBQA 1RLQC 4X34A 1OPKA 2K3BA 4MZTA 2KRSA 1VQNA 1VQNT 3KUFA 4IUPA 5GMKl 4JRIA 3A8HB 1H3HA 3G4ST 1TUCA 4JLGA 1VQKA 4A63B 3LH0A 2CYZB 3OYCA 2V1RA 2JVVA 2CH4W 4FYYB 2EQIA 5CKEA 4ZGEB 2SRCA 3TREA 1YBYA 2ED0A 2LC4A 5GAMh 3G6EA 1G3SA 5CQYA 4PJOC 1K9MR 4NL2A 5A0DA 2QYZA 4C5GA 4XU2A 2YLCA 1YJNT 3VUZA 3CCET 2DJZA 2OTJA 2DL4A 3OW2P 4J6YA 2LVMA 1H8KA 4MZPA 2RHUA 2VUBA 1SPKA 4HVWA 2CS7A 4M7DA 1EZZB 1M1KC 2WSEE 5KCHA 2RHXA 5DLQE 1QVFP 1KIKA 1LJOA 2RI5A 4N4HA 5FU6B 1S1NA 3SHWA 3FLGA 1YI2T 4M7DF 2H3JA 3VS5A 3I56A 2EVRA 3EAEA 4BY6C 2CUBA 4AG1C 2KDSA 1M8MA 1GCPA 4C8QE 4IUQA 3CMET 2FO0A 1EIFA 4JJBA 3META 3OYNA 1H3ZA 1O9SA 1VQKQ 4WCIA 2DE0X 1KQSA 2CZ6B 2EGAA 2EJGA 3JB9I 2LQ8A 4M75E 3H41A 2ZPIB 4BD3A 2EGCA 4M75B 2R5MA 4A4GA 3C94A 1UUEA 2XHCA 1GCQA 4V2SA 1Q82U 2NUPA 2M16A 5FW9A 2QTVA 1VUBA 1UG1A 4KH0B 2J7IA 2K4YA 2PZ1A 3JCMh 4C5IA 5GAOn 4IIOA 4Y91A 2MK5A 3M59A 3QIIA 1C0MA 2AHJB 3CPFA 3L1AA 3QZ9B 3OW2A 2IIMA 3H6ZA 3NTKA 2RB6A 1Q81C 1WI7A 2KEAA 1QVGP 4KGZB 4C92F 3CMEA 1U1TA 2KXDA 1I1JA 4FSXA 2KT8A 4IUVA 3OYHA 3OB9A 4C92A 1VQ7T 2FVUA 3MP6A 1W70A 2LP5A 2FHDA 2YT6A 5HKCA 3CCST 3FEOA 2E3IA 2RMOA 4RTUA 1VYTA 1G5VA 2F2WA 4JS4A 1N9RA 3UDCA 4JRQA 1M3BA 2PUOB 3THKA 1WXTA 1WDXA 2EKHA 2EBPA 1X6OA 2DA9A 3JCMJ 3MP1A 4RTZA 5EC7A 2LCCA 2D8JA 3WVDB 3ZBDA 2E12A 1OQKA 3OYLA 3EGDB 2OTLQ 1N27A 4KGVB 1Q7YR 1D09B 1UB4A 1R0BG 2KT1A 1AOJA 4HT9A 3JCMg 2DRMA 2LJ3A 2CSQA 4XQ3A 2K79A 4LDUA 1QVGS 2EYWA 3OSSC 3CCVT 2E41A 1V29B 2VB6A 1X01A 3E2UA 1WHMA 4M77A 4C0FA 3OYAA 4BB7A 3CCLA 3CCLT 5GMKi 5CVIA 5D6XA 3CCUQ 2LJ0A 4L5GA 1ZX6A 4QQ6A 1TG0A 4M77D 1B34B 2F69A 2LQWA 4J83A 4XU0A 4J9BA 4XU3A 2X4JA 1VQPT 3RKWA 1WHHA 2HEQA 4DEXA 1JEGA 2KY9A 2O4XB 3QKJA 2RJFA 2YXYA 3L2VA 1D1CA 4LDVA 1QMCA 4ZGJB 2XG8D 5HK0A 1BB9A 2C0OA 3NMZC 3CCRQ 2I0NA 4J9CA 1I4K1 3QJYA 4XTYA 2CGHA 3FJPA 1U1SA 1KQSP 3V8JA 2HKQB 4FT4A 4ELYC 3QXEB 4MZMA 3T9NA 3SEMA 1C1AA 4GY5A 1GCQC 3CCEA 3QBYA 3RIRA 4C92B 3OA6A 4X9DA 3JRZA 1RAFB 4PJMA 4F7UE 2C0IA 1NE8A 1Q7YU 1IREB 2RHYA 3HRSA 3JAME 2AKLA 4CRIA 3CCMA 4IIMA 3CD6T 1KD1C 3CBOA 1TH7A 5LL6S 4RG8A 3E9GA 3PT9A 1K8AR 2FB7A 5J26A 1T3LA 3I55T 2DETA 1BYMA 2BTTA 5LJ5e 4B9WA 2J06A 2E5KA 3VS4A 5KCOA 2PU9B 2QQAA 1VQNQ 4E7JA 1YITA 1PD0A 2CP5A 2DBMA 4JJNK 3JCMc 2ZZDA 2QA4Q 2C06A 2CP3A 2ZPGB 2DX1A 3PE0A 4FIBA 4KBMB 4X9CA 3SB2A 4HVUA 1WLPB 2K7AA 2VXFA 1Q86C 4O5VA 1OV3A 4EIKA 4BE1A 2MWPA 4AFQC 1M1FA 3REBB 1PRMC 3QWXX 3QWYA 3M58A 1TS9A 1JU5C 1KQSS 5GANd 1JBMA 4M78C 1YJWQ 2Z0WA 4EPCA 2O2OA 2QGFB 3CCEQ 2CP2A 1CKBA 3DLLA 2EYYA 1AWJA 4FW2A 2NWMA 4R0KA 1QCFA 2ZAEA 8ATCB 1M1GA 2DPPB 4PL6A 1M1KR 5I2MA 4JRKA 5GAMj 1K73U 5GANj 1AHJB 3S3MA 2JTEA 2KNBB 1VQMA 3NPFA 3HFNA 3CCJA 4M7DC 1HD3A 2EQUA 1CSKA 4E6RA 3PTAA 5GAN5 1K0XA 2P0PA 1GL5A 4M7AC 3LWHA 5LJ3h 1LCKA 2OI3A 1VQMT 2OTLT 1AZGB 1ACMB 2HQEA 1FMWA 4C8QB 2QASA 8AT1B 4M78G 4RCBA 2DXTA 1K8AU 1TXQA 1Q81U 1PD1A 2DTIA 2V26A 1SF9A 2XKOC 5C0MA 4B9XA 1Y96A 1TU0B 2V8IA 3JCMP 3EGXB 2X4WA 1BCOA 3FDRA 4FL6A 5ECAA 3UATA 3GF5A 3MEAA 4PFPA 1KC8U 3VS7A 1WQWA 1VQOT 3BE3A 1KHCA 3EG3A 3G1JA 1FXXA 1UECA 2DLPA 2VC8A 2DD5A 2JM9A 1H92A 5LJ3f 2X3WD 3BDUA 5LJ5d 1D0XA 3QSUA 3QUIA 2LZ6B 3G71T 3GIBA 3CXCA 1MUZA 3RBBB 1D0ZA 4CC3A 4ZNXA 2GF7A 4M75C 3VRYA 3OYKA 4RG2A 5IHKA 2IVWA 1MGQA 1WHKA 1X2KA 3CCVA 5FLXE 3CC4A 3QDFA 3RDVA 1SHGA 4XK8E 3H8ZA 1OPLA 2OAWA 3RR6A 1VQ8Q 4ORZA 1UGVA 1ZBJA 1ZHIA 2M9UA 2QEXT 4KUDK 2HMAA 2BZXA 2GGRA 1YWOA 1U06A 2KRMA 2XMFA 3GBQA 3M0RA 1YIJQ 3MPUB 1U3OA 2JN0A 1QKWA 2Y4XA 1SG5A 4OMQA 4DOVA 4RTTA 1O75A 2E5QA 2V8KA 1B3QA 5J3BA 5LJ3e 4MDWA 4Y92A 2CH4A 4AG2C 3JCMX 3MJXA 1AWXA 3MO8A 1W1FA 3CCSA 4C92D 1UHFA 3LH5A 4F04B 1QP2A 5HY6A 5AT1B 1S72A 4KGXB 4RKUE 1MMNA 4WTOB 3QG1A 1RAIB 1VQ9Q 1NG2A 3AT1B 3CCLQ 1MV0B 3FB9A 4F7UF 1SSHA 3VYHB 1W6XA 4ZGDB 1RADB 4M78F 2MIOA 2X4XA 2PNIA 1G3YA 1OEBA 1TUDA 3OSVA 5GJWB 2RM4A 4MMLA 1BI2A 3CMAQ 2KSSA 3I9QA 1WGSA 2HNIA 1VQPQ 3HPWA 1PNJA 2K3YA 1WJSA 4M78A 1MMGA 3LWIA 2LCLA 3VJPA 2ZPHB 3E9FA 2DEQA 4L6V5 1B07A 1YNZA 1WIEA 4Y28E 1ZA1B 4EMHA 1MMDA 2QK0A 4PKCC 3OW2S 1Q86R 2LCSA 2X9HA 2EIFA 2MF2A 4CC7A 3JB9F 3LGFA 1BI1A 4HKEA 4NS5A 2O01E 3UWNA 4HCZA 3OMGA 2JUFA 1OX9A 5LJ5j 1S72Q 3NTIA 2X51A 2ABLA 4FW1A 5FU7C 2E1HA 2HL3A 5D6YA 3HFOA 4LN2A 1IHVA 1VQ4T 2PVDB 4JUVA 5FU7B 4M75A 3CCSQ 1BCMA 2ZPEB 3WVEB 1IHWA 1VQ7A 2E6NA 1VYVA 2X3XD 4LD9K 2DFUA 5GAMd 2DO3A 3PIOA 5GAMf 2JT4A 5LJ5g 1RL2A 1NLPC 3X24B 3EHRA 1QVFS 3CCRA 2AK5A 1Y57A 4J9EA 2DAQA 1MV3A 1OYXA 5CCAA 4FYWB 3EFSA 4DA4A 1IRXA 3HRTA 3M4GA 5GAMg 2BIVA 3J80E 1AEYA 3RMQA 5IT9E 1N6AA 4M77G 2QEXA 4EMKB 2RPNA 2OTJQ 1VQPA 4CC2A 1AWWA 2KE9A 4M7AG 1VQ7Q 5CKHA 2M1HA 3DB4A 1VQ5Q 2F5TX 4K11A 2L3PA 4C0DC 3MEUA 3C4SA 3OYIA 2JS0A 5DY9A 4RMOA 2KMTA 3A5ZB 2CSIA 1KC8C 2YHTA 1QP3A 1XTDA 1MHNA 4N0AA 4ESRA 5FRNA 1YCSB 3UPUA 2CT4A 4E7HA 1K9MU 2EW3A 4M78B 2E65A 2DIGA 4JRPA 3G71A 4PFOA 2VV5A
chains in the Genus database with same CATH topology
2HEQA 4DEXA 1JEGA 2RNAA 5L23A 2O9VA 4HVVA 2FPEA 2MCNA 3VS3A 1BB9A 2C0OA 2DL3A 3NMZC 2I0NA 4J9CA 5FWCA 4OMLA 5IHIA 4LE9A 1UJ0A 3U23A 3UF4A 5FWBA 1G2BA 1NLOC 1IO6A 2RQRA 2V1QA 4Z8AA 2HSPA 3SEMA 1Z9QA 1GCQC 2FRYA 2C0IA 2PTKA 1UHCA 3H0HA 4F14A 3I35A 2AKLA 2SEMA 4IIMA 4F16A 2EPDA 1CKAA 4Z89A 1ABOA 1T3SA 3M0SA 1E6HA 1HJDA 5IHNA 3EGUA 4AFSC 1JO8A 2DM1A 1T3LA 1N5ZA 2BTTA 2A08A 3M0UA 3ULRB 2J06A 2E5KA 3VS4A 4OMOA 2K9GA 2VKNA 1YP5A 3TSWA 2DBMA 2M0YA 3UA7A 3EHQA 1HSQA 1X27A 2LQNA 2K2MA 2DX1A 3PE0A 4HVUA 1WLPB 2K7AA 2ROTA 2FPDA 3REAB 4JPBW 1OV3A 3RNJA 2RQTA 4EIKA 2HBWA 1AZEA 4HXJA 2LJ1A 3PVQA 1M27C 5HCKA 4AFQC 2OJ2A 1E6GA 3REBB 3EG0A 2BZ8A 1PRMC 3QWXX 3QWYA 4HCKA 1PHTA 1GBRA 1UDLA 1JU5C 4OMMA 2CUDA 2O2OA 1EFNA 1CKBA 2DL7A 2EYYA 1AWJA 2EGEA 4J9FA 3EG1A 1WYXA 2NWMA 1T0JA 4R0KA 1QCFA 3ZL7C 3A98A 2KRNA 1U5SA 3VS2A 3VS1A 1GRIA 2L0AA 1ZLMA 2DL5A 2QDLA 1AVZC 4RTYA 2RQUA 2JTEA 2KNBB 4CC4B 2DJQA 3NPFA 3H0IA 1HD3A 1QWEA 1CSKA 4E6RA 1SEMA 1K0XA 1JXOA 3M0PA 1GL5A 2JS2A 1T0HA 1LCKA 2OI3A 2VWFA 1SRLA 1AZGB 1VA7A 4FSSA 1UTIA 3TSZA 4AFZC 2O9SA 4QT7A 1ZUUA 2F2VA 1K0SA 1RLPC 3I5SA 3TVTA 4GLMA 1I07A 4F17A 2L3SA 1WXBA 1PRLC 2AZVA 3PVLA 3H0FA 2W10A 1BU1A 4X1VA 5IH2A 2DF6A 1XOVA 5ECAA 1RI9A 1BK2A 3UATA 2B86A 4J9GA 1Z9ZA 4LUDA 2KROA 1SRMA 1WXUA 1X69A 2JMCA 3VS7A 1M30A 1SHFA 3EG3A 1ZUKA 1K76A 2A36A 1UECA 2DLPA 2RF0A 1AWOA 4JZ4A 4M4ZA 2GTOA 2JM9A 2VVKA 2KGTA 1H92A 3M0QA 1KJWA 2X3WD 2EYXA 1X6BA 1JXMA 2CT3A 4AFUC 4GBQA 1RLQC 1NYFA 2ROLA 1FYNA 2DBKA 1OPKA 2K3BA 4RTXA 4DEYA 2LZ6B 2KRSA 1MUZA 3RBBB 2FEIA 2YUPA 4CC3A 4ZNXA 3VRYA 4OMPA 1KSWA 1H3HA 2JM8A 5IHKA 2RQWA 1TUCA 4A63B 1RUWA 2L3QA 2V1RA 1X2KA 2CH4W 4J9IA 2EQIA 4RTWA 1SHGA 2SRCA 2ED0A 1OOTA 4JJCA 1OPLA 2OAWA 5I22A 4JZ3A 1NEGA 1K9AA 4ORZA 1UGVA 3VS0A 1ZBJA 2O31A 2ECZA 2LMJA 1WFWA 3C0CA 2BZXA 3IQLA 4OMNA 2DILA 2EYZA 2KXCA 2KR3A 1A0NB 2GGRA 1YWOA 1U06A 2KRMA 1UE9A 2LX7A 1X6GA 2XMFA 3GBQA 3M0RA 2L2PA 1GBQA 3FJ5A 2DL4A 1U3OA 1QKWA 1H8KA 4OMQA 4KRTA 1SPKA 2JMAA 4HVWA 2D0NA 2KYBA 1YN8A 4RTTA 2O88A 1B3QA 2H8HA 1KIKA 4AG2C 4Y92A 2CH4A 1K1ZA 5IXBA 2CREA 1ZSGA 3NGPA 1AWXA 1S1NA 3SHWA 1W1FA 3VS5A 2FG0A 2EVRA 1UHFA 3LH5A 2NUZA 2CUBA 1K4US 4AG1C 1M8MA 2D1XA 1GCPA 2FO0A 2RN8A 5GJVB 4JJBA 2YDLA 2W0ZA 1BBZA 1NG2A 1X43A 1GFCA 4WCIA 2DE0X 1MV0B 2GBQA 1SSHA 2EGAA 1W6XA 3H41A 4RUGA 1I0CA 4J9DA 1KFZA 4D8DA 2MIOA 2PNIA 4LUEA 1ZUYA 3VRZA 1OEBA 1TUDA 2EGCA 3O5ZA 5GJWB 2JW4A 2ESWA 2AKKA 1UUEA 3EG2A 1AD5A 1GCQA 3I9QA 4RTVA 1WA7A 5I11A 4JJDA 1NYGA 1WX6A 2G6FX 5FW9A 1PNJA 1QLYA 1Y0MA 1UG1A 3M0TA 1G83A 2J7IA 2PZ1A 4IIOA 1B07A 2ENMA 2P4RA 1YNZA 2DNUA 1WIEA 2KYMA 1J3TA 2MOXA 2LCSA 2IIMA 1YWPA 2RQVA 1WI7A 2KEAA 3NHNA 2DMOA 3R6NA 2J6KA 4CC7A 1V1CA 2KXDA 1I1JA 1M3AA 2D8HA 4D8KA 2KT8A 1QKXA 2C0TA 2BZYA 2YUNA 2ABLA 2KBTA 4LN2A 1JQQA 1M3CA 4Z88A 1W70A 2LP5A 1PKTA 2DL8A 1UJYA 2DYBA 2YT6A 1ARKA 1VYVA 2X3XD 2RMOA 4RTUA 1VYTA 2F2WA 1UFFA 2JT4A 1NLPC 3EHRA 2CDTA 1M3BA 2AK5A 1Y57A 3THKA 4J9EA 2K6DA 3CQTA 1PWTA 1WXTA 1MV3A 1QWFA 1WDXA 1X2QA 2A37A 2EBPA 2DA9A 2EKHA 2F2XA 4RTZA 5EC7A 2J05A 2D8JA 1FMKA 2DRKA 1AEYA 2DVJA 3VS6A 2YUQA 2KT1A 1AOJA 2RPNA 3I5RA 2ED1A 2FRWA 2FPFA 1GFDA 1NM7A 4CC2A 2DRMA 1AWWA 2KE9A 2YUOA 2LJ3A 1PKSA 2CSQA 2GNCA 2K79A 2J6FA 4K11A 2EYWA 2L3PA 2M51A 2JXBA 2JS0A 2J6OA 2GQIA 2YSQA 2HCKA 2CSIA 4LNPA 1NEBA 2LJ0A 5IXFA 4ESRA 1E7OA 1ZX6A 3UA6A 4J9HA 1YCSB 2A28A 2HDAA 1VYUA 1TG0A 3KFVA 2CT4A 2LNHB 2LQWA 2EW3A 4J9BA 3JV3A 1ABQA 2GTJA 2AZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEQ A;  4DEX A;  1JEG A;  2RNA A;  5L23 A;  2O9V A;  4HVV A;  2FPE A;  2MCN A;  3VS3 A;  1BB9 A;  2C0O A;  2DL3 A;  3NMZ C;  2I0N A;  4J9C A;  5FWC A;  4OML A;  5IHI A;  4LE9 A;  1UJ0 A;  3U23 A;  3UF4 A;  5FWB A;  1G2B A;  1NLO C;  1IO6 A;  2RQR A;  2V1Q A;  4Z8A A;  2HSP A;  3SEM A;  1Z9Q A;  1GCQ C;  2FRY A;  2C0I A;  2PTK A;  1UHC A;  3H0H A;  4F14 A;  3I35 A;  2AKL A;  2SEM A;  4IIM A;  4F16 A;  2EPD A;  1CKA A;  4Z89 A;  1ABO A;  1T3S A;  3M0S A;  1E6H A;  1HJD A;  5IHN A;  3EGU A;  4AFS C;  1JO8 A;  2DM1 A;  1T3L A;  1N5Z A;  2BTT A;  2A08 A;  3M0U A;  3ULR B;  2J06 A;  2E5K A;  3VS4 A;  4OMO A;  2K9G A;  2VKN A;  1YP5 A;  3TSW A;  2DBM A;  2M0Y A;  3UA7 A;  3EHQ A;  1HSQ A;  1X27 A;  2LQN A;  2K2M A;  2DX1 A;  3PE0 A;  4HVU A;  1WLP B;  2K7A A;  2ROT A;  2FPD A;  3REA B;  4JPB W;  1OV3 A;  3RNJ A;  2RQT A;  4EIK A;  2HBW A;  1AZE A;  4HXJ A;  2LJ1 A;  3PVQ A;  1M27 C;  5HCK A;  4AFQ C;  2OJ2 A;  1E6G A;  3REB B;  3EG0 A;  2BZ8 A;  1PRM C;  3QWX X;  3QWY A;  4HCK A;  1PHT A;  1GBR A;  1UDL A;  1JU5 C;  4OMM A;  2CUD A;  2O2O A;  1EFN A;  1CKB A;  2DL7 A;  2EYY A;  1AWJ A;  2EGE A;  4J9F A;  3EG1 A;  1WYX A;  2NWM A;  1T0J A;  4R0K A;  1QCF A;  3ZL7 C;  3A98 A;  2KRN A;  1U5S A;  3VS2 A;  3VS1 A;  1GRI A;  2L0A A;  1ZLM A;  2DL5 A;  2QDL A;  1AVZ C;  4RTY A;  2RQU A;  2JTE A;  2KNB B;  4CC4 B;  2DJQ A;  3NPF A;  3H0I A;  1HD3 A;  1QWE A;  1CSK A;  4E6R A;  1SEM A;  1K0X A;  1JXO A;  3M0P A;  1GL5 A;  2JS2 A;  1T0H A;  1LCK A;  2OI3 A;  2VWF A;  1SRL A;  1AZG B;  1VA7 A;  4FSS A;  1UTI A;  3TSZ A;  4AFZ C;  2O9S A;  4QT7 A;  1ZUU A;  2F2V A;  1K0S A;  1RLP C;  3I5S A;  3TVT A;  4GLM A;  1I07 A;  4F17 A;  2L3S A;  1WXB A;  1PRL C;  2AZV A;  3PVL A;  3H0F A;  2W10 A;  1BU1 A;  4X1V A;  5IH2 A;  2DF6 A;  1XOV A;  5ECA A;  1RI9 A;  1BK2 A;  3UAT A;  2B86 A;  4J9G A;  1Z9Z A;  4LUD A;  2KRO A;  1SRM A;  1WXU A;  1X69 A;  2JMC A;  3VS7 A;  1M30 A;  1SHF A;  3EG3 A;  1ZUK A;  1K76 A;  2A36 A;  1UEC A;  2DLP A;  2RF0 A;  1AWO A;  4JZ4 A;  4M4Z A;  2GTO A;  2JM9 A;  2VVK A;  2KGT A;  1H92 A;  3M0Q A;  1KJW A;  2X3W D;  2EYX A;  1X6B A;  1JXM A;  2CT3 A;  4AFU C;  4GBQ A;  1RLQ C;  1NYF A;  2ROL A;  1FYN A;  2DBK A;  1OPK A;  2K3B A;  4RTX A;  4DEY A;  2LZ6 B;  2KRS A;  1MUZ A;  3RBB B;  2FEI A;  2YUP A;  4CC3 A;  4ZNX A;  3VRY A;  4OMP A;  1KSW A;  1H3H A;  2JM8 A;  5IHK A;  2RQW A;  1TUC A;  4A63 B;  1RUW A;  2L3Q A;  2V1R A;  1X2K A;  2CH4 W;  4J9I A;  2EQI A;  4RTW A;  1SHG A;  2SRC A;  2ED0 A;  1OOT A;  4JJC A;  1OPL A;  2OAW A;  5I22 A;  4JZ3 A;  1NEG A;  1K9A A;  4ORZ A;  1UGV A;  3VS0 A;  1ZBJ A;  2O31 A;  2ECZ A;  2LMJ A;  1WFW A;  3C0C A;  2BZX A;  3IQL A;  4OMN A;  2DIL A;  2EYZ A;  2KXC A;  2KR3 A;  1A0N B;  2GGR A;  1YWO A;  1U06 A;  2KRM A;  1UE9 A;  2LX7 A;  1X6G A;  2XMF A;  3GBQ A;  3M0R A;  2L2P A;  1GBQ A;  3FJ5 A;  2DL4 A;  1U3O A;  1QKW A;  1H8K A;  4OMQ A;  4KRT A;  1SPK A;  2JMA A;  4HVW A;  2D0N A;  2KYB A;  1YN8 A;  4RTT A;  2O88 A;  1B3Q A;  2H8H A;  1KIK A;  4AG2 C;  4Y92 A;  2CH4 A;  1K1Z A;  5IXB A;  2CRE A;  1ZSG A;  3NGP A;  1AWX A;  1S1N A;  3SHW A;  1W1F A;  3VS5 A;  2FG0 A;  2EVR A;  1UHF A;  3LH5 A;  2NUZ A;  2CUB A;  1K4U S;  4AG1 C;  1M8M A;  2D1X A;  1GCP A;  2FO0 A;  2RN8 A;  5GJV B;  4JJB A;  2YDL A;  2W0Z A;  1BBZ A;  1NG2 A;  1X43 A;  1GFC A;  4WCI A;  2DE0 X;  1MV0 B;  2GBQ A;  1SSH A;  2EGA A;  1W6X A;  3H41 A;  4RUG A;  1I0C A;  4J9D A;  1KFZ A;  4D8D A;  2MIO A;  2PNI A;  4LUE A;  1ZUY A;  3VRZ A;  1OEB A;  1TUD A;  2EGC A;  3O5Z A;  5GJW B;  2JW4 A;  2ESW A;  2AKK A;  1UUE A;  3EG2 A;  1AD5 A;  1GCQ A;  3I9Q A;  4RTV A;  1WA7 A;  5I11 A;  4JJD A;  1NYG A;  1WX6 A;  2G6F X;  5FW9 A;  1PNJ A;  1QLY A;  1Y0M A;  1UG1 A;  3M0T A;  1G83 A;  2J7I A;  2PZ1 A;  4IIO A;  1B07 A;  2ENM A;  2P4R A;  1YNZ A;  2DNU A;  1WIE A;  2KYM A;  1J3T A;  2MOX A;  2LCS A;  2IIM A;  1YWP A;  2RQV A;  1WI7 A;  2KEA A;  3NHN A;  2DMO A;  3R6N A;  2J6K A;  4CC7 A;  1V1C A;  2KXD A;  1I1J A;  1M3A A;  2D8H A;  4D8K A;  2KT8 A;  1QKX A;  2C0T A;  2BZY A;  2YUN A;  2ABL A;  2KBT A;  4LN2 A;  1JQQ A;  1M3C A;  4Z88 A;  1W70 A;  2LP5 A;  1PKT A;  2DL8 A;  1UJY A;  2DYB A;  2YT6 A;  1ARK A;  1VYV A;  2X3X D;  2RMO A;  4RTU A;  1VYT A;  2F2W A;  1UFF A;  2JT4 A;  1NLP C;  3EHR A;  2CDT A;  1M3B A;  2AK5 A;  1Y57 A;  3THK A;  4J9E A;  2K6D A;  3CQT A;  1PWT A;  1WXT A;  1MV3 A;  1QWF A;  1WDX A;  1X2Q A;  2A37 A;  2EBP A;  2DA9 A;  2EKH A;  2F2X A;  4RTZ A;  5EC7 A;  2J05 A;  2D8J A;  1FMK A;  2DRK A;  1AEY A;  2DVJ A;  3VS6 A;  2YUQ A;  2KT1 A;  1AOJ A;  2RPN A;  3I5R A;  2ED1 A;  2FRW A;  2FPF A;  1GFD A;  1NM7 A;  4CC2 A;  2DRM A;  1AWW A;  2KE9 A;  2YUO A;  2LJ3 A;  1PKS A;  2CSQ A;  2GNC A;  2K79 A;  2J6F A;  4K11 A;  2EYW A;  2L3P A;  2M51 A;  2JXB A;  2JS0 A;  2J6O A;  2GQI A;  2YSQ A;  2HCK A;  2CSI A;  4LNP A;  1NEB A;  2LJ0 A;  5IXF A;  4ESR A;  1E7O A;  1ZX6 A;  3UA6 A;  4J9H A;  1YCS B;  2A28 A;  2HDA A;  1VYU A;  1TG0 A;  3KFV A;  2CT4 A;  2LNH B;  2LQW A;  2EW3 A;  4J9B A;  3JV3 A;  1ABQ A;  2GTJ A;  2AZS A; 
#chains in the Genus database with same CATH topology
 4LD6 A;  3EGD A;  4B6M A;  5LJ3 j;  3DKM A;  4XTU A;  3MEV A;  1I8F A;  1VOM A;  2MCN A;  3VS3 A;  1M90 U;  3PGG A;  1QVP A;  4A53 A;  3PNW C;  1VQM Q;  1OI1 A;  5FWC A;  2RHZ A;  2PQW A;  3U23 A;  3PMI A;  4JDS A;  5FWB A;  2E6Z A;  3P8D A;  4L59 A;  2HQX A;  4D6W A;  1VQ6 Q;  1YJ9 A;  5KYY B;  2FRY A;  1YJN A;  3OYJ A;  3S3N A;  1TSF A;  3P8B B;  7AT1 B;  2EQJ A;  4ELZ C;  2RJE A;  3JB9 J;  1VQ9 A;  2PTK A;  5GAO q;  4F14 A;  4BE0 A;  2JNG A;  1I81 A;  3OYF A;  4F16 A;  2EPD A;  3OYE A;  3L2R A;  1M2V A;  5CKF A;  2XID A;  1RAA B;  1VQ6 T;  1MNE A;  1ABO A;  3QO3 A;  5GAM e;  3M0S A;  1E6H A;  3RUX A;  2QDY B;  3EGU A;  5KH6 A;  2GFU A;  3X20 B;  2A08 A;  3M0U A;  2RA2 A;  2XDD A;  1UGR B;  3HP9 A;  3CBM A;  4C92 C;  3VU3 C;  4A4K A;  1B34 A;  1ZSZ C;  5LJ5 h;  2IPO B;  5M9O A;  2OX7 A;  1BKB A;  2QAZ A;  1X27 A;  2K2M A;  3GNG A;  1YFN A;  5I21 A;  3JCM e;  2FPD A;  4EDU A;  1VQ8 T;  3HKS A;  3VV0 A;  2HBW A;  1AZE A;  3CC7 Q;  2D0Q B;  3E1S A;  4OB0 B;  2K5L A;  1VQL T;  1VQ8 A;  1PHT A;  3CC4 T;  5GMK e;  1UDL A;  1G3T A;  3G6E Q;  2CUD A;  4C92 G;  1EFN A;  2B8A A;  3TCJ A;  3X25 B;  1YIT Q;  1K9M C;  4KH1 B;  2QQR A;  4M75 D;  2COW A;  1VQL Q;  2JTM A;  3M5A A;  3VS1 A;  2QA4 T;  2L0A A;  4M7D E;  2QDL A;  2DL5 A;  3EH1 A;  4II1 A;  2RQU A;  4C5H A;  5J39 A;  3H0I A;  1QWE A;  4J8O A;  4A4E A;  1SEM A;  2Y90 A;  1PSE A;  1D0Y A;  3GP8 A;  2BE7 D;  3GLX A;  1SRL A;  4M77 C;  3L2W A;  1M4Z A;  2EYQ A;  1UGS B;  4FSS A;  3TSZ A;  4AFZ C;  2CZ1 B;  2MWO A;  1VQ9 T;  4E7S A;  3TVT A;  3QPH A;  2DYI A;  1I07 A;  2EJ9 A;  2OTJ T;  2L3S A;  1WXB A;  1PRL C;  2AZV A;  3PVL A;  1YHQ Q;  2WSF E;  5IAY A;  2LNV A;  1BIB A;  2RK1 A;  2W10 A;  2XD0 A;  1BU1 A;  3MCA B;  3ASK A;  1GXI E;  4C0G A;  1R0C B;  1RI9 A;  1BK2 A;  2L5Q A;  1KQ1 A;  5EG2 A;  2BE9 B;  4NOY A;  3CC2 Q;  1WXU A;  2QQB A;  2YRC A;  4OB2 B;  5GAN 7;  5DLO A;  5HK3 A;  1SHF A;  5KYX A;  3EH2 A;  2VXE A;  4JZ4 A;  4M4Z A;  1NPR A;  3JB9 D;  3A8M B;  5GAO r;  2EYX A;  2CT3 A;  3G71 Q;  1FYN A;  1TWB A;  2DBK A;  4RTX A;  4DEY A;  3OQ5 A;  4OGE A;  5DM7 R;  3M4Y A;  3LW5 E;  5CIU A;  5KE3 A;  2CP6 A;  3MEW A;  3L2U A;  4OMP A;  4C8Q A;  2RQW A;  3S3O A;  3QYG B;  4IUT A;  2L3Q A;  3HSB A;  4RTW A;  4PJO E;  1HXD A;  4QQD A;  4JJC A;  4OB3 B;  3CME Q;  1TOV A;  3OYD A;  4XAX B;  1IZ6 A;  4JZ3 A;  4F7U B;  3HL8 A;  1RAB B;  2E4H A;  1K9A A;  3C95 A;  4VUB A;  1VQ6 A;  2O31 A;  1OX8 A;  1YI2 A;  4M78 D;  1KD1 U;  4A4H A;  2KR3 A;  3CCQ T;  1A0N B;  3MKD A;  3OYY A;  2CZ7 B;  1HYO A;  2LX7 A;  2L2P A;  1N9S A;  1QW1 A;  1BI0 A;  2ZCF B;  1QQJ A;  4KRT A;  4QVD A;  2JMA A;  2D0N A;  4PJO B;  3CCQ Q;  2EQK A;  1EX4 A;  1XNI A;  4KUI A;  1W2B S;  2H8H A;  1WHJ A;  1MMA A;  1G3W A;  1K1Z A;  1PC0 A;  5IXB A;  1ZSG A;  4XTX A;  2DD4 A;  2FZK B;  4M7D D;  4GLK A;  2QEX Q;  5GAO l;  1PSF A;  4NL3 A;  4J6X A;  1YIJ A;  2RN8 A;  2ATC B;  1X43 A;  4PLI A;  2NYS A;  4EMG A;  1M5Q 1;  2RI2 A;  4C0D B;  2NUT A;  3EG9 A;  4RUG A;  1I0C A;  1KFZ A;  4D8D A;  3INZ A;  3VRZ A;  2OAU A;  3JCM W;  2JW4 A;  1KC8 R;  2AKK A;  2LT4 A;  3EG2 A;  1AD5 A;  1WX6 A;  4E7Z A;  2KVQ G;  3JCM b;  1N8R C;  4FU6 A;  1FX7 A;  3M0T A;  1G83 A;  3PMT A;  1LNX A;  2IG0 A;  2ENM A;  3M53 A;  2PVO B;  3M56 A;  2MOX A;  2DZ9 A;  4O6J A;  1M8V A;  5IN1 A;  2RQV A;  4M78 E;  3QYH B;  1V1C A;  4R55 A;  3CCR T;  1M3A A;  4D8K A;  1S72 T;  4AT1 B;  2GQV A;  2XU8 A;  2JTF A;  1LOJ A;  1PG5 B;  1YHQ T;  3TEE A;  5C6S A;  3Q1J A;  3LLR A;  4DBQ A;  2DL8 A;  3NFC A;  1UJY A;  2QXF A;  2RJD A;  3PFS A;  1VQ4 A;  3CCJ T;  3V7S A;  1R77 A;  2QG9 B;  1ARK A;  2DXB A;  1UFF A;  1RAG B;  2R57 A;  4DOW A;  2P84 A;  2CDT A;  2I2L A;  2K6D A;  3CQT A;  2A37 A;  9ATC B;  1AT1 B;  1OU8 A;  1FMK A;  2RHI A;  3KBG A;  2DVJ A;  2V8J A;  5FU6 C;  2YUQ A;  3RER A;  3I5R A;  3I56 Q;  2ED1 A;  2FRW A;  2FPF A;  4FM4 B;  3CEY A;  1GFD A;  5I2S A;  1NM7 A;  4PJJ A;  2P0K A;  4BI3 A;  3OYB A;  1VQ4 Q;  4N4I A;  2J6F A;  2COZ A;  2JXB A;  2L89 A;  3A1P A;  4AMC A;  3G4S A;  2J6O A;  2E10 A;  3JB9 G;  4LDY A;  2GQI A;  3OYM A;  2XDB A;  3G6E T;  3BW1 A;  2HCK A;  4LNP A;  4OMF B;  3HTR A;  1W2B P;  5IXF A;  3X28 B;  3UA6 A;  4J9H A;  2A28 A;  3CD6 Q;  5GMK m;  2LNH B;  4E7L A;  1RAC B;  1VQL A;  1IB8 A;  2DXC A;  1ABQ A;  2GTJ A;  2X4Y A;  1N8R U;  4XU1 A;  3JCM Q;  2AZS A;  2L8D A;  1PM3 A;  1K73 C;  4J7F A;  2DVE A;  5A2Q E;  2O9V A;  3QHS A;  1RAH B;  3OS0 A;  4P5N A;  2LDM A;  4MMK A;  4QQG A;  2YRV A;  2HKN A;  2RK2 A;  2O4X A;  5IHI A;  5KYW A;  2BKD N;  2QQS A;  3UF4 A;  5CR2 A;  2VGN A;  3R6O A;  2LRQ A;  2RQR A;  2V1Q A;  3CMA A;  2HSP A;  2R58 A;  3EFO A;  3I55 A;  3LX7 A;  3URG A;  3FC3 A;  1X75 C;  2XDP A;  4BI4 A;  2RJC A;  3H0H A;  3I35 A;  2SEM A;  3A8L B;  4BAC A;  3OBY A;  1CKA A;  3D7S B;  4ME7 A;  4Z89 A;  4C5E A;  4KUL A;  2K3X A;  1HJD A;  1JO8 A;  3J7A F;  4HCB A;  5GAO m;  2YWW A;  1IGU A;  3FRN A;  3CPW S;  3NTH A;  2KAF A;  1MND A;  4OMO A;  5GAO p;  2MI6 A;  2VKN A;  1ZA2 B;  4XTW A;  4E47 A;  3TSW A;  6AT1 B;  5GAN 4;  2QI2 A;  4DBH A;  5CAI A;  2M0Y A;  4KT0 E;  3MP8 A;  3UA7 A;  4A54 A;  3GNF B;  1JJ2 A;  4RCC A;  4M7A D;  3REA B;  3CC7 T;  4JPB W;  4C8Q G;  3N5B B;  4Q5W A;  2EFI A;  4LDX A;  2HAX A;  1BI3 A;  4PJL A;  4QVZ A;  1M27 C;  5HCK A;  2OJ2 A;  1E6G A;  3CC4 Q;  1UEB A;  2BZ8 A;  4HCK A;  1YJW A;  2CP0 A;  3V8K A;  1M90 R;  5GAN f;  2JJ9 A;  4OMM A;  4M75 G;  4DQ2 A;  2JOY A;  5D7U A;  1NJI C;  2P4T A;  2DL7 A;  1VQ5 A;  4FYX B;  2A7Y A;  4J9F A;  1WYX A;  4OP0 A;  2EKO A;  4ZTF A;  3M57 A;  3ZL7 C;  3A98 A;  2KRN A;  1U5S A;  3I55 Q;  3E19 A;  3VS2 A;  2E64 A;  1U8R A;  1GRI A;  1AVZ C;  1M2V B;  4WF2 A;  2DJQ A;  1F1B B;  1D3B A;  1UGQ B;  2DEU A;  5CQX A;  4M77 E;  3BY7 A;  1VIE A;  4DBF A;  1T0H A;  4N4G A;  2VWF A;  1ZSZ B;  1VA7 A;  4OGC A;  4MDX A;  4M7A E;  2O9S A;  4QT7 A;  1ZUU A;  2F2V A;  4CI0 C;  3TU4 K;  1QCN A;  4FYV B;  2HL5 C;  4F17 A;  5D6W A;  3L2Z A;  4XTV A;  3CXC P;  1WHL A;  4BI8 B;  1NZ9 A;  3J81 E;  1YJ9 T;  1M9S A;  4X1V A;  5IH2 A;  1XOV A;  3SDZ A;  4PJO A;  4J9G A;  3HHT B;  1Z9Z A;  1LPL A;  4LUD A;  1YJW T;  2KRO A;  1SRM A;  2HBP A;  1X69 A;  1WJQ A;  2JMC A;  1M30 A;  1ZUK A;  2E3H A;  2FZC B;  1H64 1;  4E2F B;  1AWO A;  2MMP A;  4PJO F;  2KGT A;  2DKG A;  2QGG A;  1KJW A;  1D1B A;  1R8O B;  2QA4 A;  1X6B A;  1NYF A;  2ROL A;  1OZ3 A;  4HA8 A;  1WHG A;  2FEI A;  2YUP A;  1KSW A;  3OBW A;  2NLU A;  2JM8 A;  4PFZ A;  1FMV A;  2DER A;  1YIT T;  2A3L A;  4M75 F;  1RUW A;  3GOX A;  3EG9 B;  4J9I A;  1FWZ A;  1PCX A;  3TQ7 P;  4BY6 B;  1OOT A;  5I22 A;  3SFM A;  1VQO A;  1NEG A;  4N0A C;  2K57 A;  3ZFJ A;  2CP7 A;  3VS0 A;  2NUP B;  1VIF A;  1TTH B;  2ECZ A;  2LMJ A;  1WFW A;  2A0F B;  2EWN A;  3C0C A;  4OF1 A;  3S6W A;  1NJI R;  3IQL A;  4HCC A;  4ATO A;  4OMN A;  2DIL A;  2DK3 A;  2EYZ A;  2KXC A;  3CXC S;  3OS1 A;  1QCO A;  1P92 A;  1KK7 A;  3QJ6 A;  4ZN3 A;  1UE9 A;  1KG1 A;  1X6G A;  3RES A;  2R5A A;  5GAN 3;  1GBQ A;  1DJ7 B;  3FJ5 A;  1SKU B;  2WAC A;  3OS5 A;  1Q82 C;  1M2O A;  5FRO A;  2VGM A;  2BUD A;  1ZBX A;  2KYB A;  1YN8 A;  1NBE B;  2O88 A;  1D3B B;  1W2B A;  4JS5 A;  2ZPF B;  3I56 T;  2ZGW A;  1TUG B;  2EAY A;  1ZSZ A;  4IKF A;  2CRE A;  3NGP A;  3CBP A;  2FG0 A;  2NUZ A;  1K4U S;  1YI2 Q;  2D1X A;  4OB1 B;  2XI9 A;  5GJV B;  1NPP A;  3P8H A;  2YDL A;  2W0Z A;  1BBZ A;  3JB9 H;  1GFC A;  3VUB A;  1WNL A;  2GBQ A;  1Y7X A;  3C12 A;  4F7U G;  2F1L A;  3KXT A;  5KYY A;  4C92 E;  4J9D A;  4PNO A;  4LUE A;  1ZUY A;  1B7T A;  3RKX A;  3O5Z A;  3CCQ A;  2ESW A;  5GAN e;  3ZEH A;  5L8R E;  1JJ2 P;  4RTV A;  1WA7 A;  2XK0 A;  5I11 A;  4JJD A;  1NYG A;  2G6F X;  1QLY A;  1Y0M A;  2MYS A;  4M7D G;  4EMK C;  5GMK h;  2D9T A;  3JCM V;  3M54 A;  3QZ5 B;  3GPL A;  3CCV Q;  3SD4 A;  5KYN A;  2P4R A;  2DNU A;  3V7C A;  3RMS A;  2KYM A;  1J3T A;  4BDY A;  1SSF A;  3CPW A;  2GCX A;  5LJ3 d;  4BDZ A;  1YWP A;  3JCM d;  2DTH A;  3LYI A;  4M77 B;  2DTO A;  2MAM A;  3NHN A;  3V8L A;  4QW2 A;  2DMO A;  2H3E B;  2RD1 A;  3R6N A;  3CC2 A;  2J6K A;  4M7D B;  1Y96 B;  3FIF A;  2D8H A;  1WPY A;  1QKX A;  2C0T A;  3CD6 A;  2M02 A;  2BZY A;  4E7K A;  2YUN A;  2NUT B;  1QVG A;  4JLI A;  2KBT A;  2OTL A;  1V76 A;  2DXU A;  1JQQ A;  1M3C A;  4J6W A;  1YIJ T;  4XTZ A;  4Z88 A;  4FCY A;  2PVG B;  2EQM A;  1PKT A;  5GMK j;  5GAN h;  2DYB A;  4M77 F;  5CKB A;  1OU9 A;  1D1A A;  3CMA T;  2LTO A;  2QQ9 A;  3A8O B;  1PWT A;  4EMK A;  1QWF A;  1X2Q A;  3RKY A;  1N8R R;  2F2X A;  2VAS A;  2J05 A;  2RH2 A;  3EGX A;  2DRK A;  3G7Z A;  3CCU A;  4J7I A;  1RAE B;  5A0L A;  1XQH A;  3VS6 A;  2ZPB B;  5KYX B;  4PJO G;  2YUO A;  1PKS A;  1IGQ A;  3EFR A;  2GNC A;  3JCM f;  2PUK B;  4C8Q C;  2M51 A;  3M9Q A;  3CCJ Q;  3CPW P;  4DBR A;  4IUR A;  4A4F A;  1VQK T;  3OY9 A;  2YSQ A;  3ME9 A;  1M1K U;  2E70 A;  1NEB A;  4YTL A;  5CK9 A;  1E7O A;  1KD1 R;  5LJ5 f;  2HDA A;  2M0O A;  1VYU A;  3KFV A;  1K8A C;  4J5Y A;  3L2Q A;  4ZTJ A;  3SWN B;  3JSC A;  1RI0 A;  3JV3 A;  2YLB A;  3ER0 A;  2FZG B;  4F7U A;  2RNA A;  5L23 A;  4HVV A;  3G4S Q;  2FPE A;  1C6V X;  2HSE B;  4TVR A;  2DL3 A;  4M7A B;  4OML A;  1Y71 A;  1KHI A;  2K5I A;  4LE9 A;  2FYK A;  1UJ0 A;  1G2B A;  3BDL A;  3V7R A;  1NLO C;  3OMC A;  1IO6 A;  3F70 A;  4Z8A A;  3QDR B;  5GAN 2;  1Z9Q A;  1JB0 E;  4E7I A;  1LVK A;  1W4S A;  2KQW A;  4PJN A;  1I5O B;  3LGL A;  1YJN Q;  3MHX A;  1XJW B;  1YHQ A;  1UGP B;  1UHC A;  4OVA A;  3VYG A;  4M7A F;  2QTX A;  2HZY A;  1WJR A;  2AT1 B;  3A8G B;  2YRD A;  3H9N A;  4C8Q F;  3SWN C;  1NJI U;  1T3S A;  2D6F A;  2WSC E;  4ZN1 A;  1IXD A;  5IHN A;  2GFA A;  4AFS C;  3CC2 T;  3UT1 A;  2DM1 A;  2LT1 A;  1N5Z A;  4M7A A;  5KYU B;  3ULR B;  1I5L A;  4HT8 A;  2K5F A;  2K9G A;  2XIC A;  2X35 A;  2G3R A;  1YP5 A;  5CO7 A;  4PJO D;  5GAN 8;  2VYT A;  1HK9 A;  4LXC A;  4R56 A;  1VQ5 T;  3EHQ A;  1HSQ A;  2L3R A;  2LQN A;  2Y4Y A;  2HD0 A;  3DLM A;  2ROT A;  2DIQ A;  2AIR B;  3CC7 A;  1ZQ1 A;  4BE2 A;  3EFO B;  1VQO Q;  4FT2 A;  3RNJ A;  2RI3 A;  2RQT A;  4HXJ A;  1G8X A;  2KK4 A;  2LJ1 A;  3PVQ A;  2KI7 A;  3BFM A;  3HRU A;  3EG0 A;  5KYW B;  1Q7Y C;  2HQH A;  4PLL A;  1M90 C;  1GBR A;  4C0Z A;  3AHU A;  1JRI A;  3M55 A;  2CKK A;  4QKU A;  3CCU T;  1JJ2 S;  1Q95 G;  1Q81 R;  3PIP A;  3SWN A;  2EGE A;  4LDW A;  1KQ2 A;  5A0G A;  3EG1 A;  5AYF A;  1T0J A;  2LX9 A;  1Y07 A;  2K2V A;  3X26 B;  1ZLM A;  4RTY A;  5LJ3 g;  1Q82 R;  3L42 A;  4ANJ A;  1WQ7 A;  4CC4 B;  1OZ2 A;  1JXO A;  2EJF A;  3M0P A;  1K73 R;  1QVF A;  2JS2 A;  2LQK A;  3OYG A;  2F5K A;  4IUU A;  3CCM T;  1Q86 U;  1UTI A;  1K0S A;  1RLP C;  1WZO A;  3DB3 A;  3I5S A;  4GLM A;  2RO0 A;  1YJ9 Q;  1OUL A;  3H0F A;  4BUG A;  5KE2 A;  3WXM B;  3O8V A;  2DF6 A;  5GAN 6;  3CCM Q;  2DZC A;  2B86 A;  2P0Q A;  5GAN g;  4Z02 A;  2COY A;  4UC4 A;  3OS2 A;  2CZ0 B;  1BIA A;  4QVC A;  1K76 A;  2FL7 A;  2MPX C;  2JZ2 A;  2A36 A;  2RF0 A;  4PK4 A;  5KYU A;  2GTO A;  2VVK A;  3VKI A;  1YCY A;  3M0Q A;  4C8Q D;  5CKD A;  5FRM A;  4AFU C;  1JXM A;  4GBQ A;  1RLQ C;  4X34 A;  1OPK A;  2K3B A;  4MZT A;  2KRS A;  1VQN A;  1VQN T;  3KUF A;  4IUP A;  5GMK l;  4JRI A;  3A8H B;  1H3H A;  3G4S T;  1TUC A;  4JLG A;  1VQK A;  4A63 B;  3LH0 A;  2CYZ B;  3OYC A;  2V1R A;  2JVV A;  2CH4 W;  4FYY B;  2EQI A;  5CKE A;  4ZGE B;  2SRC A;  3TRE A;  1YBY A;  2ED0 A;  2LC4 A;  5GAM h;  3G6E A;  1G3S A;  5CQY A;  4PJO C;  1K9M R;  4NL2 A;  5A0D A;  2QYZ A;  4C5G A;  4XU2 A;  2YLC A;  1YJN T;  3VUZ A;  3CCE T;  2DJZ A;  2OTJ A;  2DL4 A;  3OW2 P;  4J6Y A;  2LVM A;  1H8K A;  4MZP A;  2RHU A;  2VUB A;  1SPK A;  4HVW A;  2CS7 A;  4M7D A;  1EZZ B;  1M1K C;  2WSE E;  5KCH A;  2RHX A;  5DLQ E;  1QVF P;  1KIK A;  1LJO A;  2RI5 A;  4N4H A;  5FU6 B;  1S1N A;  3SHW A;  3FLG A;  1YI2 T;  4M7D F;  2H3J A;  3VS5 A;  3I56 A;  2EVR A;  3EAE A;  4BY6 C;  2CUB A;  4AG1 C;  2KDS A;  1M8M A;  1GCP A;  4C8Q E;  4IUQ A;  3CME T;  2FO0 A;  1EIF A;  4JJB A;  3MET A;  3OYN A;  1H3Z A;  1O9S A;  1VQK Q;  4WCI A;  2DE0 X;  1KQS A;  2CZ6 B;  2EGA A;  2EJG A;  3JB9 I;  2LQ8 A;  4M75 E;  3H41 A;  2ZPI B;  4BD3 A;  2EGC A;  4M75 B;  2R5M A;  4A4G A;  3C94 A;  1UUE A;  2XHC A;  1GCQ A;  4V2S A;  1Q82 U;  2NUP A;  2M16 A;  5FW9 A;  2QTV A;  1VUB A;  1UG1 A;  4KH0 B;  2J7I A;  2K4Y A;  2PZ1 A;  3JCM h;  4C5I A;  5GAO n;  4IIO A;  4Y91 A;  2MK5 A;  3M59 A;  3QII A;  1C0M A;  2AHJ B;  3CPF A;  3L1A A;  3QZ9 B;  3OW2 A;  2IIM A;  3H6Z A;  3NTK A;  2RB6 A;  1Q81 C;  1WI7 A;  2KEA A;  1QVG P;  4KGZ B;  4C92 F;  3CME A;  1U1T A;  2KXD A;  1I1J A;  4FSX A;  2KT8 A;  4IUV A;  3OYH A;  3OB9 A;  4C92 A;  1VQ7 T;  2FVU A;  3MP6 A;  1W70 A;  2LP5 A;  2FHD A;  2YT6 A;  5HKC A;  3CCS T;  3FEO A;  2E3I A;  2RMO A;  4RTU A;  1VYT A;  1G5V A;  2F2W A;  4JS4 A;  1N9R A;  3UDC A;  4JRQ A;  1M3B A;  2PUO B;  3THK A;  1WXT A;  1WDX A;  2EKH A;  2EBP A;  1X6O A;  2DA9 A;  3JCM J;  3MP1 A;  4RTZ A;  5EC7 A;  2LCC A;  2D8J A;  3WVD B;  3ZBD A;  2E12 A;  1OQK A;  3OYL A;  3EGD B;  2OTL Q;  1N27 A;  4KGV B;  1Q7Y R;  1D09 B;  1UB4 A;  1R0B G;  2KT1 A;  1AOJ A;  4HT9 A;  3JCM g;  2DRM A;  2LJ3 A;  2CSQ A;  4XQ3 A;  2K79 A;  4LDU A;  1QVG S;  2EYW A;  3OSS C;  3CCV T;  2E41 A;  1V29 B;  2VB6 A;  1X01 A;  3E2U A;  1WHM A;  4M77 A;  4C0F A;  3OYA A;  4BB7 A;  3CCL A;  3CCL T;  5GMK i;  5CVI A;  5D6X A;  3CCU Q;  2LJ0 A;  4L5G A;  1ZX6 A;  4QQ6 A;  1TG0 A;  4M77 D;  1B34 B;  2F69 A;  2LQW A;  4J83 A;  4XU0 A;  4J9B A;  4XU3 A;  2X4J A;  1VQP T;  3RKW A;  1WHH A;  2HEQ A;  4DEX A;  1JEG A;  2KY9 A;  2O4X B;  3QKJ A;  2RJF A;  2YXY A;  3L2V A;  1D1C A;  4LDV A;  1QMC A;  4ZGJ B;  2XG8 D;  5HK0 A;  1BB9 A;  2C0O A;  3NMZ C;  3CCR Q;  2I0N A;  4J9C A;  1I4K 1;  3QJY A;  4XTY A;  2CGH A;  3FJP A;  1U1S A;  1KQS P;  3V8J A;  2HKQ B;  4FT4 A;  4ELY C;  3QXE B;  4MZM A;  3T9N A;  3SEM A;  1C1A A;  4GY5 A;  1GCQ C;  3CCE A;  3QBY A;  3RIR A;  4C92 B;  3OA6 A;  4X9D A;  3JRZ A;  1RAF B;  4PJM A;  4F7U E;  2C0I A;  1NE8 A;  1Q7Y U;  1IRE B;  2RHY A;  3HRS A;  3JAM E;  2AKL A;  4CRI A;  3CCM A;  4IIM A;  3CD6 T;  1KD1 C;  3CBO A;  1TH7 A;  5LL6 S;  4RG8 A;  3E9G A;  3PT9 A;  1K8A R;  2FB7 A;  5J26 A;  1T3L A;  3I55 T;  2DET A;  1BYM A;  2BTT A;  5LJ5 e;  4B9W A;  2J06 A;  2E5K A;  3VS4 A;  5KCO A;  2PU9 B;  2QQA A;  1VQN Q;  4E7J A;  1YIT A;  1PD0 A;  2CP5 A;  2DBM A;  4JJN K;  3JCM c;  2ZZD A;  2QA4 Q;  2C06 A;  2CP3 A;  2ZPG B;  2DX1 A;  3PE0 A;  4FIB A;  4KBM B;  4X9C A;  3SB2 A;  4HVU A;  1WLP B;  2K7A A;  2VXF A;  1Q86 C;  4O5V A;  1OV3 A;  4EIK A;  4BE1 A;  2MWP A;  4AFQ C;  1M1F A;  3REB B;  1PRM C;  3QWX X;  3QWY A;  3M58 A;  1TS9 A;  1JU5 C;  1KQS S;  5GAN d;  1JBM A;  4M78 C;  1YJW Q;  2Z0W A;  4EPC A;  2O2O A;  2QGF B;  3CCE Q;  2CP2 A;  1CKB A;  3DLL A;  2EYY A;  1AWJ A;  4FW2 A;  2NWM A;  4R0K A;  1QCF A;  2ZAE A;  8ATC B;  1M1G A;  2DPP B;  4PL6 A;  1M1K R;  5I2M A;  4JRK A;  5GAM j;  1K73 U;  5GAN j;  1AHJ B;  3S3M A;  2JTE A;  2KNB B;  1VQM A;  3NPF A;  3HFN A;  3CCJ A;  4M7D C;  1HD3 A;  2EQU A;  1CSK A;  4E6R A;  3PTA A;  5GAN 5;  1K0X A;  2P0P A;  1GL5 A;  4M7A C;  3LWH A;  5LJ3 h;  1LCK A;  2OI3 A;  1VQM T;  2OTL T;  1AZG B;  1ACM B;  2HQE A;  1FMW A;  4C8Q B;  2QAS A;  8AT1 B;  4M78 G;  4RCB A;  2DXT A;  1K8A U;  1TXQ A;  1Q81 U;  1PD1 A;  2DTI A;  2V26 A;  1SF9 A;  2XKO C;  5C0M A;  4B9X A;  1Y96 A;  1TU0 B;  2V8I A;  3JCM P;  3EGX B;  2X4W A;  1BCO A;  3FDR A;  4FL6 A;  5ECA A;  3UAT A;  3GF5 A;  3MEA A;  4PFP A;  1KC8 U;  3VS7 A;  1WQW A;  1VQO T;  3BE3 A;  1KHC A;  3EG3 A;  3G1J A;  1FXX A;  1UEC A;  2DLP A;  2VC8 A;  2DD5 A;  2JM9 A;  1H92 A;  5LJ3 f;  2X3W D;  3BDU A;  5LJ5 d;  1D0X A;  3QSU A;  3QUI A;  2LZ6 B;  3G71 T;  3GIB A;  3CXC A;  1MUZ A;  3RBB B;  1D0Z A;  4CC3 A;  4ZNX A;  2GF7 A;  4M75 C;  3VRY A;  3OYK A;  4RG2 A;  5IHK A;  2IVW A;  1MGQ A;  1WHK A;  1X2K A;  3CCV A;  5FLX E;  3CC4 A;  3QDF A;  3RDV A;  1SHG A;  4XK8 E;  3H8Z A;  1OPL A;  2OAW A;  3RR6 A;  1VQ8 Q;  4ORZ A;  1UGV A;  1ZBJ A;  1ZHI A;  2M9U A;  2QEX T;  4KUD K;  2HMA A;  2BZX A;  2GGR A;  1YWO A;  1U06 A;  2KRM A;  2XMF A;  3GBQ A;  3M0R A;  1YIJ Q;  3MPU B;  1U3O A;  2JN0 A;  1QKW A;  2Y4X A;  1SG5 A;  4OMQ A;  4DOV A;  4RTT A;  1O75 A;  2E5Q A;  2V8K A;  1B3Q A;  5J3B A;  5LJ3 e;  4MDW A;  4Y92 A;  2CH4 A;  4AG2 C;  3JCM X;  3MJX A;  1AWX A;  3MO8 A;  1W1F A;  3CCS A;  4C92 D;  1UHF A;  3LH5 A;  4F04 B;  1QP2 A;  5HY6 A;  5AT1 B;  1S72 A;  4KGX B;  4RKU E;  1MMN A;  4WTO B;  3QG1 A;  1RAI B;  1VQ9 Q;  1NG2 A;  3AT1 B;  3CCL Q;  1MV0 B;  3FB9 A;  4F7U F;  1SSH A;  3VYH B;  1W6X A;  4ZGD B;  1RAD B;  4M78 F;  2MIO A;  2X4X A;  2PNI A;  1G3Y A;  1OEB A;  1TUD A;  3OSV A;  5GJW B;  2RM4 A;  4MML A;  1BI2 A;  3CMA Q;  2KSS A;  3I9Q A;  1WGS A;  2HNI A;  1VQP Q;  3HPW A;  1PNJ A;  2K3Y A;  1WJS A;  4M78 A;  1MMG A;  3LWI A;  2LCL A;  3VJP A;  2ZPH B;  3E9F A;  2DEQ A;  4L6V 5;  1B07 A;  1YNZ A;  1WIE A;  4Y28 E;  1ZA1 B;  4EMH A;  1MMD A;  2QK0 A;  4PKC C;  3OW2 S;  1Q86 R;  2LCS A;  2X9H A;  2EIF A;  2MF2 A;  4CC7 A;  3JB9 F;  3LGF A;  1BI1 A;  4HKE A;  4NS5 A;  2O01 E;  3UWN A;  4HCZ A;  3OMG A;  2JUF A;  1OX9 A;  5LJ5 j;  1S72 Q;  3NTI A;  2X51 A;  2ABL A;  4FW1 A;  5FU7 C;  2E1H A;  2HL3 A;  5D6Y A;  3HFO A;  4LN2 A;  1IHV A;  1VQ4 T;  2PVD B;  4JUV A;  5FU7 B;  4M75 A;  3CCS Q;  1BCM A;  2ZPE B;  3WVE B;  1IHW A;  1VQ7 A;  2E6N A;  1VYV A;  2X3X D;  4LD9 K;  2DFU A;  5GAM d;  2DO3 A;  3PIO A;  5GAM f;  2JT4 A;  5LJ5 g;  1RL2 A;  1NLP C;  3X24 B;  3EHR A;  1QVF S;  3CCR A;  2AK5 A;  1Y57 A;  4J9E A;  2DAQ A;  1MV3 A;  1OYX A;  5CCA A;  4FYW B;  3EFS A;  4DA4 A;  1IRX A;  3HRT A;  3M4G A;  5GAM g;  2BIV A;  3J80 E;  1AEY A;  3RMQ A;  5IT9 E;  1N6A A;  4M77 G;  2QEX A;  4EMK B;  2RPN A;  2OTJ Q;  1VQP A;  4CC2 A;  1AWW A;  2KE9 A;  4M7A G;  1VQ7 Q;  5CKH A;  2M1H A;  3DB4 A;  1VQ5 Q;  2F5T X;  4K11 A;  2L3P A;  4C0D C;  3MEU A;  3C4S A;  3OYI A;  2JS0 A;  5DY9 A;  4RMO A;  2KMT A;  3A5Z B;  2CSI A;  1KC8 C;  2YHT A;  1QP3 A;  1XTD A;  1MHN A;  4N0A A;  4ESR A;  5FRN A;  1YCS B;  3UPU A;  2CT4 A;  4E7H A;  1K9M U;  2EW3 A;  4M78 B;  2E65 A;  2DIG A;  4JRP A;  3G71 A;  4PFO A;  2VV5 A; 
#chains in the Genus database with same CATH homology
 2HEQ A;  4DEX A;  1JEG A;  2RNA A;  5L23 A;  2O9V A;  4HVV A;  2FPE A;  2MCN A;  3VS3 A;  1BB9 A;  2C0O A;  2DL3 A;  3NMZ C;  2I0N A;  4J9C A;  5FWC A;  4OML A;  5IHI A;  4LE9 A;  1UJ0 A;  3U23 A;  3UF4 A;  5FWB A;  1G2B A;  1NLO C;  1IO6 A;  2RQR A;  2V1Q A;  4Z8A A;  2HSP A;  3SEM A;  1Z9Q A;  1GCQ C;  2FRY A;  2C0I A;  2PTK A;  1UHC A;  3H0H A;  4F14 A;  3I35 A;  2AKL A;  2SEM A;  4IIM A;  4F16 A;  2EPD A;  1CKA A;  4Z89 A;  1ABO A;  1T3S A;  3M0S A;  1E6H A;  1HJD A;  5IHN A;  3EGU A;  4AFS C;  1JO8 A;  2DM1 A;  1T3L A;  1N5Z A;  2BTT A;  2A08 A;  3M0U A;  3ULR B;  2J06 A;  2E5K A;  3VS4 A;  4OMO A;  2K9G A;  2VKN A;  1YP5 A;  3TSW A;  2DBM A;  2M0Y A;  3UA7 A;  3EHQ A;  1HSQ A;  1X27 A;  2LQN A;  2K2M A;  2DX1 A;  3PE0 A;  4HVU A;  1WLP B;  2K7A A;  2ROT A;  2FPD A;  3REA B;  4JPB W;  1OV3 A;  3RNJ A;  2RQT A;  4EIK A;  2HBW A;  1AZE A;  4HXJ A;  2LJ1 A;  3PVQ A;  1M27 C;  5HCK A;  4AFQ C;  2OJ2 A;  1E6G A;  3REB B;  3EG0 A;  2BZ8 A;  1PRM C;  3QWX X;  3QWY A;  4HCK A;  1PHT A;  1GBR A;  1UDL A;  1JU5 C;  4OMM A;  2CUD A;  2O2O A;  1EFN A;  1CKB A;  2DL7 A;  2EYY A;  1AWJ A;  2EGE A;  4J9F A;  3EG1 A;  1WYX A;  2NWM A;  1T0J A;  4R0K A;  1QCF A;  3ZL7 C;  3A98 A;  2KRN A;  1U5S A;  3VS2 A;  3VS1 A;  1GRI A;  2L0A A;  1ZLM A;  2DL5 A;  2QDL A;  1AVZ C;  4RTY A;  2RQU A;  2JTE A;  2KNB B;  4CC4 B;  2DJQ A;  3NPF A;  3H0I A;  1HD3 A;  1QWE A;  1CSK A;  4E6R A;  1SEM A;  1K0X A;  1JXO A;  3M0P A;  1GL5 A;  2JS2 A;  1T0H A;  1LCK A;  2OI3 A;  2VWF A;  1SRL A;  1AZG B;  1VA7 A;  4FSS A;  1UTI A;  3TSZ A;  4AFZ C;  2O9S A;  4QT7 A;  1ZUU A;  2F2V A;  1K0S A;  1RLP C;  3I5S A;  3TVT A;  4GLM A;  1I07 A;  4F17 A;  2L3S A;  1WXB A;  1PRL C;  2AZV A;  3PVL A;  3H0F A;  2W10 A;  1BU1 A;  4X1V A;  5IH2 A;  2DF6 A;  1XOV A;  5ECA A;  1RI9 A;  1BK2 A;  3UAT A;  2B86 A;  4J9G A;  1Z9Z A;  4LUD A;  2KRO A;  1SRM A;  1WXU A;  1X69 A;  2JMC A;  3VS7 A;  1M30 A;  1SHF A;  3EG3 A;  1ZUK A;  1K76 A;  2A36 A;  1UEC A;  2DLP A;  2RF0 A;  1AWO A;  4JZ4 A;  4M4Z A;  2GTO A;  2JM9 A;  2VVK A;  2KGT A;  1H92 A;  3M0Q A;  1KJW A;  2X3W D;  2EYX A;  1X6B A;  1JXM A;  2CT3 A;  4AFU C;  4GBQ A;  1RLQ C;  1NYF A;  2ROL A;  1FYN A;  2DBK A;  1OPK A;  2K3B A;  4RTX A;  4DEY A;  2LZ6 B;  2KRS A;  1MUZ A;  3RBB B;  2FEI A;  2YUP A;  4CC3 A;  4ZNX A;  3VRY A;  4OMP A;  1KSW A;  1H3H A;  2JM8 A;  5IHK A;  2RQW A;  1TUC A;  4A63 B;  1RUW A;  2L3Q A;  2V1R A;  1X2K A;  2CH4 W;  4J9I A;  2EQI A;  4RTW A;  1SHG A;  2SRC A;  2ED0 A;  1OOT A;  4JJC A;  1OPL A;  2OAW A;  5I22 A;  4JZ3 A;  1NEG A;  1K9A A;  4ORZ A;  1UGV A;  3VS0 A;  1ZBJ A;  2O31 A;  2ECZ A;  2LMJ A;  1WFW A;  3C0C A;  2BZX A;  3IQL A;  4OMN A;  2DIL A;  2EYZ A;  2KXC A;  2KR3 A;  1A0N B;  2GGR A;  1YWO A;  1U06 A;  2KRM A;  1UE9 A;  2LX7 A;  1X6G A;  2XMF A;  3GBQ A;  3M0R A;  2L2P A;  1GBQ A;  3FJ5 A;  2DL4 A;  1U3O A;  1QKW A;  1H8K A;  4OMQ A;  4KRT A;  1SPK A;  2JMA A;  4HVW A;  2D0N A;  2KYB A;  1YN8 A;  4RTT A;  2O88 A;  1B3Q A;  2H8H A;  1KIK A;  4AG2 C;  4Y92 A;  2CH4 A;  1K1Z A;  5IXB A;  2CRE A;  1ZSG A;  3NGP A;  1AWX A;  1S1N A;  3SHW A;  1W1F A;  3VS5 A;  2FG0 A;  2EVR A;  1UHF A;  3LH5 A;  2NUZ A;  2CUB A;  1K4U S;  4AG1 C;  1M8M A;  2D1X A;  1GCP A;  2FO0 A;  2RN8 A;  5GJV B;  4JJB A;  2YDL A;  2W0Z A;  1BBZ A;  1NG2 A;  1X43 A;  1GFC A;  4WCI A;  2DE0 X;  1MV0 B;  2GBQ A;  1SSH A;  2EGA A;  1W6X A;  3H41 A;  4RUG A;  1I0C A;  4J9D A;  1KFZ A;  4D8D A;  2MIO A;  2PNI A;  4LUE A;  1ZUY A;  3VRZ A;  1OEB A;  1TUD A;  2EGC A;  3O5Z A;  5GJW B;  2JW4 A;  2ESW A;  2AKK A;  1UUE A;  3EG2 A;  1AD5 A;  1GCQ A;  3I9Q A;  4RTV A;  1WA7 A;  5I11 A;  4JJD A;  1NYG A;  1WX6 A;  2G6F X;  5FW9 A;  1PNJ A;  1QLY A;  1Y0M A;  1UG1 A;  3M0T A;  1G83 A;  2J7I A;  2PZ1 A;  4IIO A;  1B07 A;  2ENM A;  2P4R A;  1YNZ A;  2DNU A;  1WIE A;  2KYM A;  1J3T A;  2MOX A;  2LCS A;  2IIM A;  1YWP A;  2RQV A;  1WI7 A;  2KEA A;  3NHN A;  2DMO A;  3R6N A;  2J6K A;  4CC7 A;  1V1C A;  2KXD A;  1I1J A;  1M3A A;  2D8H A;  4D8K A;  2KT8 A;  1QKX A;  2C0T A;  2BZY A;  2YUN A;  2ABL A;  2KBT A;  4LN2 A;  1JQQ A;  1M3C A;  4Z88 A;  1W70 A;  2LP5 A;  1PKT A;  2DL8 A;  1UJY A;  2DYB A;  2YT6 A;  1ARK A;  1VYV A;  2X3X D;  2RMO A;  4RTU A;  1VYT A;  2F2W A;  1UFF A;  2JT4 A;  1NLP C;  3EHR A;  2CDT A;  1M3B A;  2AK5 A;  1Y57 A;  3THK A;  4J9E A;  2K6D A;  3CQT A;  1PWT A;  1WXT A;  1MV3 A;  1QWF A;  1WDX A;  1X2Q A;  2A37 A;  2EBP A;  2DA9 A;  2EKH A;  2F2X A;  4RTZ A;  5EC7 A;  2J05 A;  2D8J A;  1FMK A;  2DRK A;  1AEY A;  2DVJ A;  3VS6 A;  2YUQ A;  2KT1 A;  1AOJ A;  2RPN A;  3I5R A;  2ED1 A;  2FRW A;  2FPF A;  1GFD A;  1NM7 A;  4CC2 A;  2DRM A;  1AWW A;  2KE9 A;  2YUO A;  2LJ3 A;  1PKS A;  2CSQ A;  2GNC A;  2K79 A;  2J6F A;  4K11 A;  2EYW A;  2L3P A;  2M51 A;  2JXB A;  2JS0 A;  2J6O A;  2GQI A;  2YSQ A;  2HCK A;  2CSI A;  4LNP A;  1NEB A;  2LJ0 A;  5IXF A;  4ESR A;  1E7O A;  1ZX6 A;  3UA6 A;  4J9H A;  1YCS B;  2A28 A;  2HDA A;  1VYU A;  1TG0 A;  3KFV A;  2CT4 A;  2LNH B;  2LQW A;  2EW3 A;  4J9B A;  3JV3 A;  1ABQ A;  2GTJ A;  2AZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...