1OOTA

Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein at 1.39 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
SPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
publication title Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ootA00
1AZEA 3U23A 4RTYA 1YWPA 1FMKA 3A98A 2EQIA 2DVJA 1YP5A 2KT1A 1ZUUA 2CH4W 1ABQA 2W0ZA 1X2QA 4ESRA 2GGRA 3THKA 1KSWA 1WFWA 1RI9A 3R6NA 4OMPA 3TVTA 4D8DA 2PTKA 4E6RA 2FRWA 1MUZA 2AZVA 2YT6A 1ZUYA 4FSSA 1GBQA 1GCQC 2CT3A 2JW4A 1CKAA 1GCPA 2A28A 1CSKA 1PRLC 1H3HA 1RUWA 2DBMA 3RNJA 3M0SA 4Z89A 1MV0B 5I22A 1WYXA 1K1ZA 1NG2A 2LQWA 3QWYA 1HSQA 2ROTA 1SRLA 1EFNA 1UJ0A 2KRSA 5L23A 2KXDA 3I5RA 4ZNXA 3VS5A 2L3QA 2KYBA 1OPKA 2GTOA 4CC7A 2L3PA 2EVRA 2DX1A 5GJVB 4CC3A 1S1NA 1T0JA 2M0YA 1GBRA 2O31A 3O5ZA 1AEYA 2HBWA 2JS2A 1T0HA 3M0TA 2RPNA 2NWMA 2A37A 2NUZA 2DYBA 1SPKA 2X3WD 2EPDA 3H0HA 2F2WA 2J7IA 2FRYA 1U5SA 2D8HA 2VVKA 4QT7A 2HSPA 1KFZA 1G83A 1UGVA 3GBQA 2LJ1A 1AWJA 2I0NA 5FWBA 2RN8A 5HCKA 4RTZA 2KXCA 1TUCA 2DNUA 4RTTA 2KNBB 3UA6A 4AG1C 1WLPB 2V1QA 2DLPA 2DJQA 2J06A 1OPLA 1OOTA 1QWEA 2KROA 2K79A 4LE9A 1OV3A 2K6DA 4EIKA 3VRYA 2ED1A 2ENMA 4Z8AA 4AFZC 1PKSA 1AWOA 1I0CA 2O88A 1AD5A 3NHNA 2CT4A 3H41A 2BTTA 2D8JA 4JZ3A 1VYUA 2K2MA 4DEYA 2MOXA 2LJ0A 2LP5A 2L0AA 2OI3A 5IHKA 3ULRB 2BZXA 4HVUA 1U06A 3EHQA 4X1VA 1K76A 2KE9A 5I11A 2P4RA 3NMZC 4CC2A 1UECA 2KR3A 1B3QA 1NLOC 2KYMA 4HVWA 2O9SA 1X27A 3PVLA 2G6FX 1YN8A 1K9AA 1WXTA 2GQIA 3I35A 4JJCA 4RTXA 3VS4A 2BZYA 2ABLA 2JMAA 1WA7A 1GCQA 4J9DA 2CDTA 4D8KA 1E7OA 1UHCA 1JXOA 1NEBA 3NGPA 2F2XA 1E6HA 1PHTA 3ZL7C 1W70A 4M4ZA 1UHFA 1V1CA 3UATA 1ZUKA 2KRNA 2DF6A 1FYNA 3I5SA 1JO8A 2ESWA 1VA7A 1WX6A 2K9GA 4F14A 2IIMA 2JMCA 4A63B 2LNHB 1QWFA 2RQRA 1TUDA 4WCIA 1H8KA 2PZ1A 1J3TA 1X6BA 2RQVA 1Z9QA 2FG0A 1JEGA 1G2BA 1A0NB 3QWXX 3EG2A 2SRCA 3EGUA 2DL3A 1X69A 2LX7A 3KFVA 1NM7A 3LH5A 1YNZA 2W10A 1Y57A 3EG1A 1ARKA 2MCNA 4J9HA 1CKBA 1QCFA 1AWWA 4R0KA 2DMOA 2JS0A 1KJWA 2DE0X 3H0IA 1SHFA 3VS1A 1Z9ZA 2PNIA 4Z88A 2D1XA 2VKNA 3UF4A 2EYWA 1GL5A 2C0OA 1NYFA 2GTJA 1HJDA 1K0XA 5IXFA 2H8HA 2L2PA 3PVQA 1YWOA 3VS0A 4OMQA 1WIEA 2L3SA 2RQTA 1JU5C 2M51A 3M0UA 2J05A 2YUOA 2MIOA 1UJYA 4KRTA 1ZX6A 1GFCA 5IHIA 1H92A 2D0NA 1ZSGA 3JV3A 2AKLA 3REAB 4HVVA 3SEMA 2C0TA 2EGCA 3VS6A 2FPEA 1M30A 2FPFA 4J9CA 1M3AA 4LN2A 1UDLA 4K11A 4LUDA 2AK5A 3NPFA 2EKHA 2EYYA 1AOJA 1JXMA 4RTVA 1ZBJA 3M0QA 2KGTA 3PE0A 1VYVA 1GFDA 1WXUA 4HCKA 2RF0A 2EW3A 4AFSC 3UA7A 1AVZC 2EGAA 2E5KA 2FO0A 2C0IA 2OAWA 3C0CA 2DL4A 2RMOA 1ZLMA 2DRKA 2YUPA 1E6GA 1SRMA 2YUQA 2HEQA 1X2KA 2JXBA 1T3LA 2YDLA 2J6FA 2ED0A 1UFFA 2AZSA 1NLPC 1N5ZA 2VWFA 4HXJA 5ECAA 2DA9A 1TG0A 1M27C 1PKTA 2KRMA 2YSQA 1LCKA 2OJ2A 4DEXA 2LCSA 1IO6A 2DBKA 2B86A 1I1JA 2EBPA 2JT4A 3EG3A 4LUEA 3EG0A 2J6KA 2JM9A 3I9QA 4JJBA 1K0SA 2QDLA 2HDAA 2JM8A 2JTEA 4IIOA 2LQNA 4AFQC 3VS2A 3VS3A 2A36A 1BU1A 5FW9A 2CH4A 4RTUA 4J9IA 2ROLA 2RQWA 4OMLA 1UTIA 2XMFA 2GBQA 2KBTA 2YUNA 1GRIA 2CUBA 4JZ4A 1M3CA 2O9VA 5IXBA 4J9GA 2EGEA 4RTWA 2K7AA 5GJWB 4CC4B 1K4US 2K3BA 3TSZA 1PNJA 1RLQC 1HD3A 1BK2A 4JPBW 3IQLA 2CUDA 2FEIA 1QKXA 3FJ5A 1PRMC 1UUEA 1NEGA 1U3OA 4GLMA 4AFUC 4J9BA 4F17A 2J6OA 1T3SA 2LJ3A 2EYXA 2SEMA 1Y0MA 1SEMA 1WDXA 1QLYA 1YCSB 2KT8A 1M3BA 1UE9A 4RUGA 1SHGA 2CSQA 2V1RA 4IIMA 1PWTA 2FPDA 5FWCA 1AZGB 1I07A 3M0PA 1B07A 1BBZA 5EC7A 3H0FA 1MV3A 1JQQA 3RBBB 4GBQA 3M0RA 2DRMA 2DM1A 1XOVA 2DILA 2DL7A 4LNPA 4OMNA 5IHNA 2CREA 2GNCA 2RQUA 1W6XA 2DL8A 1X6GA 1W1FA 1KIKA 4JJDA 3TSWA 2X3XD 1WXBA 4ORZA 4Y92A 3VS7A 1M8MA 2LZ6B 1ABOA 2ECZA 2RNAA 1VYTA 2LMJA 1OEBA 2DL5A 1AWXA 4F16A 1BB9A 1X43A 4J9EA 2AKKA 4OMMA 1WI7A 2O2OA 5IH2A 2HCKA 1UG1A 3VRZA 4J9FA 4OMOA 4AG2C 3EHRA 2KEAA 1RLPC 1QKWA 1SSHA 2F2VA 3REBB 2BZ8A 2EYZA 1NYGA 3SHWA 3CQTA 2A08A 2CSIA
chains in the Genus database with same CATH superfamily
4E7KA 3QJ6A 3ME9A 1VQ8Q 3R6OA 3A98A 1RAFB 2E41A 5KYYA 2MMPA 1ZUUA 3G71Q 1U1SA 1X2QA 4ESRA 3V8KA 3THKA 2XK0A 3DLLA 4LDUA 4OMPA 3TVTA 1C0MA 3EGDB 1G8XA 2FRWA 5A2QE 2HBPA 4OB1B 1FX7A 2YT6A 4MZMA 2OTJQ 3M57A 3QZ9B 2CT3A 2JW4A 1NE8A 1GCPA 2RO0A 1CSKA 3FJPA 3E9FA 3RNJA 4C92G 4Z89A 5GAMe 4XTZA 4M7AE 4PJOD 2CZ1B 4BB7A 1SRLA 1SSFA 1QMCA 3JRZA 1FWZA 5L23A 2KSSA 3CCVT 2G3RA 3OSSC 1KHIA 1ZSZC 2E3IA 3MP8A 3VS5A 2DJZA 2AHJB 2RHIA 2GTOA 4CC7A 1QVPA 3OQ5A 4KGXB 4MDWA 2M0YA 3OA6A 3MP6A 2E70A 1LPLA 2GQVA 3O5ZA 5CIUA 3H8ZA 3RKXA 1VQKT 2RPNA 2NWMA 2VXEA 4JS4A 2DYBA 2X3WD 4PJOF 2EPDA 2F2WA 1LVKA 1U5SA 8ATCB 3WVDB 2VGNA 1G3YA 3HFNA 1KFZA 4HCBA 5GAN5 1BI1A 2I0NA 3RERA 1WHHA 4XU1A 4E7IA 3QDRB 2DNUA 3VJPA 1WJQA 3MEVA 2DJQA 1TWBA 4BACA 1SG5A 1WQWA 1OPLA 2KROA 2RHUA 1QVFP 4FYXB 4M78B 4EIKA 1KD1R 1KQSP 5A0LA 3L2UA 3BE3A 4XU3A 1IHVA 3H41A 2BTTA 4PJNA 1IGQA 4JZ3A 4ANJA 4DBHA 5KH6A 2FHDA 2F1LA 2LP5A 5CKDA 2L0AA 2OI3A 3OYCA 2NUPB 2RJDA 4HVUA 1U06A 3EHQA 4DBRA 1K76A 1YHQT 4N4GA 3QBYA 2F5TX 2P4RA 3PTAA 3NMZC 1VQ6T 4M7DE 1M8VA 2HQEA 1JJ2P 1NLOC 4KH1B 4FT2A 2YRCA 2QQBA 2O9SA 2ZZDA 1R8OB 3CXCP 1K9AA 4QW2A 1YJNT 2XI9A 2K57A 1OU9A 3G4SA 4QQ6A 3OS1A 2O4XA 3FRNA 2CDTA 4JRQA 4Y91A 1ZQ1A 1E6HA 3ZL7C 1W70A 2D6FA 4M4ZA 3EFRA 4PFZA 3OYLA 1KG1A 3EH1A 5FROA 1O9SA 2KRNA 4IUQA 4E7ZA 2ESWA 3A8LB 2RJFA 1VA7A 2K9GA 2FZKB 2JMCA 4A63B 1S72A 5DLQE 2RQRA 2DERA 2PZ1A 1J3TA 1X6BA 2RQVA 2QQAA 1RAGB 4LDYA 1M1KR 3QWXX 3OYDA 1X69A 3L2RA 3KFVA 3MO8A 1NM7A 2NLUA 3G4SQ 1ARKA 2MCNA 3AHUA 1RADB 4HT9A 1QCFA 1HXDA 3QKJA 4R55A 1MNEA 2DTHA 1KJWA 4PFOA 2Y4XA 1Z9ZA 2PNIA 1MMAA 1NJIC 1KC8R 3CCMT 1KD1C 2GFUA 5GAMd 3OYBA 1FMVA 1VQ7A 1S72Q 1H641 2RK1A 1YJ9T 1VQLT 3VS0A 2CP0A 2Y90A 2HQHA 2LT1A 3JAME 3CC2A 2P0PA 4AT1B 3VYGA 5GANf 1JU5C 3UT1A 2YUOA 1M90R 1UJYA 1JRIA 2XDPA 1Q82R 4BDYA 3HPWA 1GFCA 5IHIA 1H92A 5GAMg 2NUPA 1GXIE 3FLGA 3RDVA 3VUZA 3JCMc 2AKLA 1MMGA 4HA8A 3VS6A 3GLXA 4C0ZA 1UB4A 1EZZB 4M7AB 3X28B 1M3AA 4K11A 1VQ7Q 3NPFA 2VGMA 3G71T 2PUOB 5KYWA 1AOJA 4A4GA 4AMCA 1BI2A 2KGTA 4XTUA 3QUIA 2LT4A 2ZGWA 4TVRA 3JB9D 3CC2Q 4AFSC 1NPRA 2H3JA 3H6ZA 4YTLA 1RAEB 2C0IA 1WZOA 2HZYA 2A0FB 1K73U 2YUPA 2EQKA 4X34A 3KXTA 2PVGB 3VU3C 1M1KC 1D1CA 1T3LA 4OVAA 3VYHB 3OBYA 5LJ3e 1Q86U 1NLPC 2XIDA 1N5ZA 4PKCC 2QGFB 2DEUA 1M27C 3JB9F 3CCJT 2LCSA 1IO6A 3JCMJ 2EBPA 2XDDA 1K9MR 4OP0A 4JJBA 1NZ9A 3OBWA 2JTEA 4F7UF 3M4YA 1P92A 2CH4A 4OMLA 4BE1A 2YUNA 2CUBA 3PMTA 2QTXA 1M3CA 3JCMQ 1M90C 2JZ2A 2F5KA 4J9GA 1Q82C 3QDFA 4OGEA 2K3BA 2KMTA 3QSUA 3DB4A 1HD3A 3CCVA 4M7DB 4IUUA 1I81A 3I56T 1QKXA 4KT0E 2XDBA 5DM7R 3HFOA 1SF9A 1U3OA 3MKDA 4ZTJA 2K5FA 4BI3A 1Y0MA 1QLYA 2OTLT 1UE9A 4RUGA 2CSQA 4DOWA 2E6ZA 4M7AG 2RH2A 5GANh 1ZBXA 1I07A 5IT9E 1B07A 5KYXB 9ATCB 1TH7A 3RBBB 3CCVQ 3BY7A 1IREB 1K8AC 1FXXA 4IUTA 2GNCA 1N27A 1UGQB 3TSWA 2X3XD 1TXQA 2EQJA 4A4FA 4Y92A 1XJWB 3V8JA 3LX7A 2RNAA 1K9MC 3CD6T 1OEBA 1TSFA 2E6NA 4OB3B 4P5NA 3JB9I 2GFAA 4J9EA 2AKKA 4OMMA 4C5HA 5IH2A 2LCCA 3LGLA 4L59A 3JCMW 4XK8E 4PFPA 1RLPC 1QKWA 1YJWA 4J6XA 3GIBA 4EMGA 5LJ5h 3JB9H 1U8RA 3OYEA 4ZGDB 1YITQ 1VQ6A 1PSFA 5GMKj 3EFSA 1FMKA 3MEWA 3G4ST 2EQIA 2DVJA 3OYMA 1YP5A 2DK3A 2RHZA 5LJ5e 5I2MA 1YI2A 2MK5A 2F69A 1YJNA 2CH4W 2CP3A 4FYWB 1G5VA 4Z02A 2K3YA 3WXMB 1XNIA 2MYSA 3M9QA 5CCAA 1R0BG 2OX7A 5LJ3d 4FSXA 2MPXC 1WFWA 1V29B 4GLKA 1YJWQ 4C92D 1MGQA 4M7DG 4GY5A 4PJOE 1VQ6Q 4EMKC 3HRUA 1VQ5T 5KCHA 1ZHIA 4C92C 1RUWA 2DBMA 4BY6C 2X35A 3CBPA 1Y96B 5KYUA 5I22A 2KVQG 3C12A 1K1ZA 1YI2Q 1ACMB 4M77C 3FEOA 4Y28E 3JCMb 3L2QA 5KYXA 2KXDA 3I5RA 5GMKm 1VUBA 4C5GA 2L3QA 2KYBA 1OPKA 3A8MB 4M77B 4A4KA 1Q7YU 4KUDK 1BKBA 2QDYB 1IB8A 2O31A 2HMAA 1RI0A 2JS2A 2K5LA 1T0HA 4XTYA 1YJ9A 1UEBA 3EFOB 1VIFA 2IG0A 1B7TA 4QT7A 4FW1A 2QAZA 4FT4A 4X9DA 4FM4B 2PVDB 1PC0A 1RACB 1BCMA 3SWNC 4FYVB 2MWPA 5HCKA 2E1HA 4RTZA 2RD1A 2KXCA 4RCCA 3UA6A 4BE0A 2VB6A 3OYFA 4J6YA 1Q81U 3TEEA 2EJFA 3M5AA 3G71A 1OV3A 5EG2A 1YJ9Q 4Z8AA 1PKSA 3FIFA 1AWOA 2YRVA 1R0CB 2QYZA 1AD5A 3NHNA 3OYNA 1C1AA 4E7SA 2ZAEA 1U1TA 5I21A 2X4YA 5IHKA 2E4HA 5J26A 1QVFA 1WPYA 1BIBA 2BKDN 4BDZA 1KQSA 2KE9A 2DTOA 1UECA 5J3BA 2KYMA 3TU4K 2G6FX 2Y4YA 4LD9K 1Y96A 3ASKA 3I35A 3VS4A 2HL3A 2ABLA 1MMNA 3CCJA 3J80E 4WF2A 4EMKA 4DBFA 1JXOA 5LL6S 4C92A 4IURA 3J7AF 2GCXA 4C0DB 3UATA 3CXCA 2DF6A 3MHXA 4M77A 3I5SA 1JO8A 3EGXA 4F14A 3C4SA 4M75B 1QWFA 4WCIA 5CAIA 4M77G 2FG0A 4LDXA 4QKUA 1IHWA 3OYAA 4JRIA 4C8QC 3L2VA 2LX7A 2JNGA 4IKFA 2HSEB 2RI2A 1YNZA 3CCJQ 1W2BA 3EG1A 4R0KA 3I56A 2ZPEB 4HT8A 3VS1A 4C8QB 4Z88A 1I5OB 2D1XA 3GNGA 3CCRT 2GTJA 3G6ET 1HJDA 5KYNA 2L2PA 5HKCA 2OTLA 2IPOB 2RHYA 1W4SA 5D6WA 2LRQA 1O75A 3SWNA 1M5Q1 3E19A 4LXCA 1M9SA 1W2BS 3A8OB 4Q5WA 1PD1A 4M78C 5FRMA 1N8RR 1ZX6A 3UDCA 2QEXT 3I56Q 3URGA 2K2VA 1PCXA 1YITT 3TQ7P 3JV3A 4HVVA 2EGCA 2L5QA 2QI2A 2FPEA 3CBMA 1M30A 5FU7B 4OF1A 2OTLQ 2EKHA 3M58A 3QYHB 2WSCE 5A0DA 3CD6A 1FMWA 3OYJA 3PE0A 2CZ0B 2EKOA 3P8HA 2QQSA 4HCKA 4KH0B 1VOMA 2EW3A 1RAIB 4JDSA 5IAYA 3G7ZA 1AVZC 1YJWT 4F7UE 2A3LA 2VV5A 3EGDA 1LOJA 2OAWA 2CS7A 2RMOA 2DRKA 3L42A 1M1FA 2XD0A 2YUQA 3S3OA 2ZPHB 4A4HA 2YDLA 2BE9B 2DIQA 1YIJT 1WHGA 1YI2T 4M75A 2VWFA 5CKEA 3CD6Q 2RI5A 3A1PA 2KRMA 4M75G 3FDRA 3BW1A 3SD4A 1F1BB 4DEXA 3JCMf 2JT4A 1I1JA 2NYSA 2C06A 3EG0A 5GAOl 2J6KA 2HDAA 2HNIA 1TS9A 4ZGEB 3VS3A 4C8QA 4EMHA 5FW9A 1QQJA 1NJIU 2XMFA 1KD1U 2LQKA 2GBQA 4C8QG 2E10A 1VQ5A 2VXFA 4JS5A 1BI3A 4PJJA 1TTHB 5IXBA 1N8RC 3PNWC 1OZ2A 2K7AA 1M1GA 1V76A 3QO3A 2ZPIB 1RLQC 3JCMX 5HK3A 1UUEA 1BI0A 4N0AC 1T3SA 2RHXA 2SEMA 1WDXA 4M7AD 5GAMj 1RAHB 4M78A 2CP6A 1VQ5Q 2DEQA 2RM4A 2V1RA 1XQHA 2EAYA 2MI6A 1JB0E 2FPDA 4M7AC 4M78G 1N9RA 2BIVA 3H9NA 3DLMA 3M0PA 3X26B 1BBZA 5EC7A 1Q86R 1EX4A 5L8RE 1JQQA 1LNXA 3CPWA 2DFUA 1BIAA 3I55T 1QVGA 1B34B 2XHCA 2DM1A 2DILA 2DL7A 4LNPA 4OMNA 5IHNA 2CREA 4WTOB 2E65A 2RQUA 2DL8A 3UWNA 1M1KU 1G3WA 2XU8A 1M8MA 2LZ6B 1ABOA 3OW2A 1VYTA 5HY6A 2DL5A 5GMKh 5CVIA 3GF5A 3CCLT 1X43A 1WI7A 3CMEA 3CPWS 1QVGS 1UG1A 3VRZA 4OB2B 3TCJA 4J9FA 4OMOA 1KHCA 2V8KA 2KEAA 1SSHA 2F2VA 3CCST 3V7RA 1NYGA 2B8AA 3SHWA 3BDUA 2M9UA 3SFMA 3NTIA 2CSIA 3NTHA 2MWOA 5J39A 1AZEA 3OW2S 4RTYA 3M55A 3L2WA 2KT1A 3LLRA 1HYOA 1KC8C 1UGRB 2CZ6B 3JCMh 3X20B 3RMSA 1Q82U 3CMEQ 1ABQA 2W0ZA 3TREA 5GAN3 2BUDA 4M7DD 2GGRA 2LVMA 1VQNA 1KSWA 1RI9A 3R6NA 3OY9A 2FZCB 1MUZA 2AZVA 4EDUA 4BI4A 4M7DC 1Q95G 1ZUYA 2LC4A 4FSSA 1GBQA 1N6AA 2QK0A 1Q86C 4C0FA 2ATCB 3M0SA 2DTIA 1UGPB 2LQWA 1WHMA 2ROTA 4N0AA 1EFNA 3OB9A 4J7IA 1UJ0A 5C6SA 4ZNXA 5FU6C 1QP2A 1VQNQ 4FW2A 1OX8A 2EVRA 1K8AU 2D9TA 2JN0A 5GJVB 4CC3A 1S1NA 4M7AA 1T0JA 2PU9B 2E12A 1GBRA 2DXUA 2KQWA 1D0XA 3OYYA 3CCRA 3G6EA 1AEYA 1N9SA 1VQ9T 3M0TA 3PGGA 4XTXA 5FU6B 1SPKA 4KBMB 3H0HA 4J6WA 2QA4Q 2DXBA 1K9MU 2VVKA 2HSPA 1G83A 1IXDA 4ZTFA 5GANe 1AWJA 2IVWA 2KAFA 5KCOA 1D1AA 2QEXA 3DB3A 2RN8A 3CEYA 4ME7A 1YITA 1TUCA 4RTTA 5GAN7 2KNBB 4EPCA 6AT1B 2OAUA 4AG1C 1RL2A 1WLPB 2V1QA 2QGGA 3CCRQ 1RAAB 3G6EQ 1G3TA 1M2VB 1QWEA 1OOTA 4B6MA 5AYFA 3KUFA 3VRYA 2ED1A 4AFZC 2JTFA 3CC7A 4PNOA 2CT4A 2EQMA 1D3BB 1VYUA 2K2MA 1M2OA 4DEYA 4V2SA 2MOXA 3ULRB 4N4IA 2BZXA 2QEXQ 4X1VA 2HKQB 3LWIA 3ZFJA 3P8BB 4A53A 4NL3A 4FCYA 4HVWA 3M59A 4CRIA 1YIJA 3MP1A 1G3SA 5CKHA 1X27A 3PVLA 4OMFB 1Q7YR 3HKSA 1LJOA 5FRNA 3CC7Q 1WXTA 2CP7A 2PUKB 2BZYA 4A54A 2JMAA 4M7DA 3LWHA 1D09B 2DXCA 4J9DA 4D8KA 1UHCA 1NEBA 3PIOA 4J5YA 4VUBA 5LJ3j 1PHTA 3X25B 5GMKi 4XU2A 1UHFA 2L89A 4M77D 1V1CA 1ZUKA 1FYNA 4B9WA 5D7UA 2DZ9A 4LDVA 2LNHB 1KQ1A 4B9XA 1YIJQ 3AT1B 1H8KA 5CKFA 1Z9QA 5LJ3g 1A0NB 3EG2A 5GAN6 1KQ2A 1R77A 2SRCA 3EGUA 5GAMf 2D0QB 3LH5A 3X24B 2DYIA 7AT1B 2W10A 1Y57A 4C92F 2VASA 4J9HA 1CKBA 1VQMA 2JS0A 4M77F 2DE0X 3H0IA 4PLIA 2EQUA 3ZBDA 5M9OA 3UF4A 3Q1JA 2KDSA 4HCCA 2QQRA 2EIFA 4BUGA 1YWOA 3CCQA 1Y7XA 2HKNA 2DIGA 3CCUT 3M0UA 5GAN2 4JRPA 1VQMQ 3P8DA 3I55A 2D0NA 2PQWA 1ZSGA 2DVEA 3SEMA 3L2ZA 3HRTA 4J9CA 3VV0A 2VC8A 2ZPGB 2KI7A 5GANd 1JXMA 3CMET 4RTVA 1ZBJA 3CC4T 1YBYA 3M0QA 3QPHA 3CCQQ 3CCLA 5GAOr 3SB2A 3UA7A 2E5KA 4RCBA 3I55Q 2DL4A 2LCLA 3CCSA 2P0KA 1E6GA 1SRMA 2HEQA 3HRSA 2MF2A 3GNFB 1UFFA 2AZSA 5KE3A 4M75D 4C0DC 4HXJA 1TG0A 1ZA1B 2R57A 2JOYA 2YSQA 1QCOA 4M75C 3C94A 1LCKA 4NL2A 1VQOA 2COYA 1QVFS 1JJ2A 3CCLQ 2OJ2A 2YHTA 1VQNT 2DBKA 1KQSS 2B86A 4LUEA 1SKUB 1I4K1 1EIFA 4BD3A 2JM9A 3I9QA 1PD0A 3M53A 1MNDA 3OYIA 1NPPA 2QDLA 2DZCA 5LJ5d 2JM8A 4IIOA 3CCSQ 4C8QD 3VS2A 2GF7A 4ELYC 2A36A 3NTKA 2XG8D 2DO3A 4M75F 4RTUA 5LJ5j 3GOXA 1WHJA 4J9IA 2QA4T 1UTIA 5CKBA 3EFOA 5IN1A 5GAMh 3RKYA 3QJYA 1JJ2S 2LDMA 2YLCA 2EGEA 1VQOQ 5GJWB 4CC4B 3OS2A 2X4XA 5LJ5g 1K4US 3CXCS 3TSZA 3SDZA 5A0GA 1BK2A 4JPBW 2O4XB 3IQLA 4C5IA 4C8QF 2CUDA 2FEIA 4NS5A 3FJ5A 3HTRA 2AT1B 1PRMC 2RJCA 3CMAT 2QTVA 4AFUC 3L1AA 2J6OA 4F17A 1VQ4T 4PJOC 2EYXA 3WVEB 1SEMA 3BDLA 4M78D 1M3BA 1VQ9A 3C95A 1SHGA 4OB0B 3V7CA 3OSVA 2DKGA 4JJNK 4IIMA 4ZN1A 1ZSZB 5FWCA 2EYQA 1AZGB 4PJOB 5FU7C 1MHNA 5HK0A 1I5LA 3M0RA 4ELZC 2COWA 5GAOn 2FVUA 3JCMV 1IGUA 1XOVA 4M78F 4HCZA 4XAXB 1VQPT 4JJDA 1XTDA 4R56A 2CYZB 1OI1A 2RI3A 1VQ9Q 3CC7T 3VS7A 4E7LA 3CCET 2ECZA 4RG2A 1AWXA 3ER0A 1NJIR 5D6XA 3PMIA 2KY9A 1YFNA 4LD6A 3V8LA 4JRKA 1WQ7A 4AG2C 1JBMA 3OS5A 2RJEA 2EYZA 4J7FA 2A08A 3M4GA 5LJ3f 4DA4A 3QZ5B 3U23A 1YWPA 1C6VX 1ZA2B 5CO7A 2DXTA 5KYWB 4QVDA 2X9HA 1IRXA 1N8RU 3LW5E 3EAEA 4QVZA 2P84A 2E64A 3QXEB 2BE7D 2X51A 1NBEB 1QW1A 4D8DA 2PTKA 4E6RA 4XTVA 2ZPBB 3LYIA 2K4YA 1GCQC 2FYKA 4HKEA 1CKAA 1W2BP 2A28A 2X4WA 2JTMA 1PRLC 1H3HA 2CZ7B 1OYXA 1MV0B 4XU0A 4QQGA 1WYXA 1NG2A 3FB9A 3QWYA 1DJ7B 1I8FA 1HSQA 1ZSZA 2CGHA 3QYGB 1VQMT 3M54A 2ZPFB 4BI8B 4PJOA 4MMKA 1WJSA 2KRSA 3VKIA 2A7YA 4PJOG 5GMKl 4LDWA 2L3PA 3EH2A 2DAQA 1WHKA 2DX1A 4DOVA 1WJRA 3A5ZB 8AT1B 2DD5A 1K73R 2HBWA 2LX9A 2JVVA 4PJMA 4ATOA 2A37A 2NUZA 3O8VA 4N4HA 3CCQT 1QP3A 2J7IA 2FRYA 2RB6A 1BYMA 2D8HA 2EFIA 1H3ZA 2L3RA 1UGVA 3E2UA 3GBQA 3CCUA 2O01E 2LJ1A 3V7SA 5GAOp 4M7AF 5FWBA 2FL7A 2COZA 4FYYB 2QG9B 4L6V5 3RIRA 3MEUA 3INZA 2DLPA 5DLOA 5C0MA 2P4TA 2J06A 3A8GB 1VQ8T 2K79A 4LE9A 4A4EA 2K6DA 2XICA 1X75C 3CC4A 2ENMA 1IZ6A 1RABB 2FB7A 2M0OA 1I0CA 4QVCA 3MCAB 4XTWA 2O88A 2RK2A 2D8JA 1PG5B 5GMKe 3CCUQ 1KC8U 2LJ0A 2YXYA 4JUVA 2DD4A 4C5EA 3S3MA 2R5MA 4DBQA 3BFMA 5LJ3h 4BE2A 1X6OA 2M1HA 5I11A 2OTJT 1AHJB 4CC2A 2KR3A 1B3QA 3ZEHA 5GAN8 1VQOT 4PJLA 1M90U 1K8AR 4CI0C 5LJ5f 4C92E 5KE2A 3CC4Q 1OU8A 4ZN3A 1YN8A 4JJCA 2GQIA 4RTXA 3OMCA 4M77E 4J83A 5CQXA 1WA7A 3FC3A 1GCQA 4E47A 3JCMe 3QG1A 1E7OA 2E5QA 3EG9B 1K73C 4D6WA 3NGPA 4DQ2A 2F2XA 1TOVA 5I2SA 2KK4A 1WX6A 2WSEE 4F7UB 2IIMA 3VUBA 2QA4A 3G1JA 1TUDA 4F04B 3J81E 1JEGA 1G2BA 2HL5C 4M7DF 4KULA 3DKMA 2DL3A 4MDXA 4II1A 1MMDA 2DETA 1B34A 1AWWA 2DMOA 4FL6A 3CPFA 1SHFA 2HQXA 2I2LA 2NUTB 3GP8A 2PVOB 2LNVA 2VKNA 1Y07A 3CMAA 1AT1B 2QXFA 4RMOA 1VQ4A 2EYWA 2EJ9A 3PFSA 1GL5A 1NYFA 2C0OA 3T9NA 1K0XA 5IXFA 2H8HA 3PVQA 3NFCA 3OYGA 3CPWP 3HP9A 4OMQA 1QVGP 1WIEA 2L3SA 2RQTA 1VQKA 1KK7A 5KYUB 4MZTA 2ZCFB 2K5IA 2M51A 2J05A 2K3XA 2MIOA 4KRTA 1OULA 3LGFA 2V8JA 2EJGA 3JSCA 2LQ8A 4QQDA 3E9GA 3OYKA 3OW2P 3CMAQ 3REAB 2C0TA 1VQ4Q 1WHLA 2QQ9A 2FPFA 2P0QA 1VQPA 3LH0A 4LN2A 4XQ3A 1UDLA 4LUDA 2AK5A 2V26A 4KUIA 3OYHA 4C0GA 2EYYA 3CCEA 5GAN4 1YCYA 1WGSA 2V8IA 1VQKQ 1VYVA 4E7JA 1GFDA 1WXUA 4ZGJB 2RF0A 1Y71A 2L8DA 1OX9A 2X4JA 3MPUB 2EGAA 2FO0A 3JCMP 4M75E 3META 3EG9A 3C0CA 3JB9G 2DPPB 3QHSA 2JJ9A 3JB9J 3HHTB 1ZLMA 3QIIA 4MMLA 1D0YA 1X2KA 2JXBA 2VYTA 3RKWA 1VQPQ 2J6FA 1BCOA 2ED0A 1YHQA 4F7UA 2R5AA 3RUXA 3GPLA 5ECAA 2DA9A 4PLLA 4OGCA 3CCEQ 2FZGB 4X9CA 1PKTA 4F7UG 2CKKA 4C8QE 2WACA 2QASA 4PK4A 5GAOm 3EG3A 5AT1B 1X01A 1K0SA 3RMQA 3HSBA 2LQNA 4AFQC 4FIBA 2NUTA 2EWNA 1BU1A 4PL6A 3E1SA 3RR6A 1PM3A 2ROLA 2RQWA 1YHQQ 1S72T 2KBTA 1GRIA 1OQKA 2Z0WA 3D7SB 3KBGA 4JZ4A 3JCMd 2O9VA 5KYYB 1VIEA 1Q81R 4RTWA 5GAOq 3MJXA 5CK9A 3PT9A 1PSEA 4JLGA 2LTOA 1PNJA 1YJNQ 4M78E 2E3HA 3F70A 2R58A 1QCNA 4EMKB 5D6YA 2CP2A 4RG8A 1NEGA 3S6WA 4GLMA 4C92B 4J9BA 3PIPA 1WNLA 4BY6B 2LJ3A 1M2VA 3JCMg 1D0ZA 1YCSB 1VQ7T 2KT8A 3EGXB 3S3NA 2RA2A 4E2FB 3M56A 2H3EB 3CCMA 4NOYA 1OZ3A 2JUFA 4MZPA 1PWTA 2YRDA 1D3BA 1TUGB 2AIRB 4UC4A 4J8OA 3CC2T 2CP5A 3H0FA 1VQLA 1MV3A 5CQYA 2WSFE 4L5GA 4GBQA 4FU6A 3HL8A 1HK9A 5DY9A 2DRMA 3MEAA 1Q7YC 2M02A 1M4ZA 2M16A 1W6XA 1X6GA 2YWWA 1W1FA 1KIKA 1TU0B 3CBOA 5CR2A 4O5VA 4IUPA 1WXBA 1D1BA 3N5BB 4JLIA 4ORZA 1VQ8A 3CCMQ 1UGSB 5GANj 2HD0A 4RKUE 3OS0A 4E7HA 4O6JA 2LMJA 4KGZB 4IUVA 3SWNB 4F16A 1BB9A 1VQLQ 2O2OA 2HCKA 2VUBA 5GANg 2XKOC 2YLBA 3UPUA 3EHRA 3OMGA 3A8HB 3REBB 2BZ8A 4KGVB 2HAXA 2MAMA 3CQTA 2OTJA 5FLXE 3RESA 1Q81C
chains in the Genus database with same CATH topology
1AZEA 3U23A 4RTYA 1YWPA 1FMKA 3A98A 2EQIA 2DVJA 1YP5A 2KT1A 1ZUUA 2CH4W 1ABQA 2W0ZA 1X2QA 4ESRA 2GGRA 3THKA 1KSWA 1WFWA 1RI9A 3R6NA 4OMPA 3TVTA 4D8DA 2PTKA 4E6RA 2FRWA 1MUZA 2AZVA 2YT6A 1ZUYA 4FSSA 1GBQA 1GCQC 2CT3A 2JW4A 1CKAA 1GCPA 2A28A 1CSKA 1PRLC 1H3HA 1RUWA 2DBMA 3RNJA 3M0SA 4Z89A 1MV0B 5I22A 1WYXA 1K1ZA 1NG2A 2LQWA 3QWYA 1HSQA 2ROTA 1SRLA 1EFNA 1UJ0A 2KRSA 5L23A 2KXDA 3I5RA 4ZNXA 3VS5A 2L3QA 2KYBA 1OPKA 2GTOA 4CC7A 2L3PA 2EVRA 2DX1A 5GJVB 4CC3A 1S1NA 1T0JA 2M0YA 1GBRA 2O31A 3O5ZA 1AEYA 2HBWA 2JS2A 1T0HA 3M0TA 2RPNA 2NWMA 2A37A 2NUZA 2DYBA 1SPKA 2X3WD 2EPDA 3H0HA 2F2WA 2J7IA 2FRYA 1U5SA 2D8HA 2VVKA 4QT7A 2HSPA 1KFZA 1G83A 1UGVA 3GBQA 2LJ1A 1AWJA 2I0NA 5FWBA 2RN8A 5HCKA 4RTZA 2KXCA 1TUCA 2DNUA 4RTTA 2KNBB 3UA6A 4AG1C 1WLPB 2V1QA 2DLPA 2DJQA 2J06A 1OPLA 1OOTA 1QWEA 2KROA 2K79A 4LE9A 1OV3A 2K6DA 4EIKA 3VRYA 2ED1A 2ENMA 4Z8AA 4AFZC 1PKSA 1AWOA 1I0CA 2O88A 1AD5A 3NHNA 2CT4A 3H41A 2BTTA 2D8JA 4JZ3A 1VYUA 2K2MA 4DEYA 2MOXA 2LJ0A 2LP5A 2L0AA 2OI3A 5IHKA 3ULRB 2BZXA 4HVUA 1U06A 3EHQA 4X1VA 1K76A 2KE9A 5I11A 2P4RA 3NMZC 4CC2A 1UECA 2KR3A 1B3QA 1NLOC 2KYMA 4HVWA 2O9SA 1X27A 3PVLA 2G6FX 1YN8A 1K9AA 1WXTA 2GQIA 3I35A 4JJCA 4RTXA 3VS4A 2BZYA 2ABLA 2JMAA 1WA7A 1GCQA 4J9DA 2CDTA 4D8KA 1E7OA 1UHCA 1JXOA 1NEBA 3NGPA 2F2XA 1E6HA 1PHTA 3ZL7C 1W70A 4M4ZA 1UHFA 1V1CA 3UATA 1ZUKA 2KRNA 2DF6A 1FYNA 3I5SA 1JO8A 2ESWA 1VA7A 1WX6A 2K9GA 4F14A 2IIMA 2JMCA 4A63B 2LNHB 1QWFA 2RQRA 1TUDA 4WCIA 1H8KA 2PZ1A 1J3TA 1X6BA 2RQVA 1Z9QA 2FG0A 1JEGA 1G2BA 1A0NB 3QWXX 3EG2A 2SRCA 3EGUA 2DL3A 1X69A 2LX7A 3KFVA 1NM7A 3LH5A 1YNZA 2W10A 1Y57A 3EG1A 1ARKA 2MCNA 4J9HA 1CKBA 1QCFA 1AWWA 4R0KA 2DMOA 2JS0A 1KJWA 2DE0X 3H0IA 1SHFA 3VS1A 1Z9ZA 2PNIA 4Z88A 2D1XA 2VKNA 3UF4A 2EYWA 1GL5A 2C0OA 1NYFA 2GTJA 1HJDA 1K0XA 5IXFA 2H8HA 2L2PA 3PVQA 1YWOA 3VS0A 4OMQA 1WIEA 2L3SA 2RQTA 1JU5C 2M51A 3M0UA 2J05A 2YUOA 2MIOA 1UJYA 4KRTA 1ZX6A 1GFCA 5IHIA 1H92A 2D0NA 1ZSGA 3JV3A 2AKLA 3REAB 4HVVA 3SEMA 2C0TA 2EGCA 3VS6A 2FPEA 1M30A 2FPFA 4J9CA 1M3AA 4LN2A 1UDLA 4K11A 4LUDA 2AK5A 3NPFA 2EKHA 2EYYA 1AOJA 1JXMA 4RTVA 1ZBJA 3M0QA 2KGTA 3PE0A 1VYVA 1GFDA 1WXUA 4HCKA 2RF0A 2EW3A 4AFSC 3UA7A 1AVZC 2EGAA 2E5KA 2FO0A 2C0IA 2OAWA 3C0CA 2DL4A 2RMOA 1ZLMA 2DRKA 2YUPA 1E6GA 1SRMA 2YUQA 2HEQA 1X2KA 2JXBA 1T3LA 2YDLA 2J6FA 2ED0A 1UFFA 2AZSA 1NLPC 1N5ZA 2VWFA 4HXJA 5ECAA 2DA9A 1TG0A 1M27C 1PKTA 2KRMA 2YSQA 1LCKA 2OJ2A 4DEXA 2LCSA 1IO6A 2DBKA 2B86A 1I1JA 2EBPA 2JT4A 3EG3A 4LUEA 3EG0A 2J6KA 2JM9A 3I9QA 4JJBA 1K0SA 2QDLA 2HDAA 2JM8A 2JTEA 4IIOA 2LQNA 4AFQC 3VS2A 3VS3A 2A36A 1BU1A 5FW9A 2CH4A 4RTUA 4J9IA 2ROLA 2RQWA 4OMLA 1UTIA 2XMFA 2GBQA 2KBTA 2YUNA 1GRIA 2CUBA 4JZ4A 1M3CA 2O9VA 5IXBA 4J9GA 2EGEA 4RTWA 2K7AA 5GJWB 4CC4B 1K4US 2K3BA 3TSZA 1PNJA 1RLQC 1HD3A 1BK2A 4JPBW 3IQLA 2CUDA 2FEIA 1QKXA 3FJ5A 1PRMC 1UUEA 1NEGA 1U3OA 4GLMA 4AFUC 4J9BA 4F17A 2J6OA 1T3SA 2LJ3A 2EYXA 2SEMA 1Y0MA 1SEMA 1WDXA 1QLYA 1YCSB 2KT8A 1M3BA 1UE9A 4RUGA 1SHGA 2CSQA 2V1RA 4IIMA 1PWTA 2FPDA 5FWCA 1AZGB 1I07A 3M0PA 1B07A 1BBZA 5EC7A 3H0FA 1MV3A 1JQQA 3RBBB 4GBQA 3M0RA 2DRMA 2DM1A 1XOVA 2DILA 2DL7A 4LNPA 4OMNA 5IHNA 2CREA 2GNCA 2RQUA 1W6XA 2DL8A 1X6GA 1W1FA 1KIKA 4JJDA 3TSWA 2X3XD 1WXBA 4ORZA 4Y92A 3VS7A 1M8MA 2LZ6B 1ABOA 2ECZA 2RNAA 1VYTA 2LMJA 1OEBA 2DL5A 1AWXA 4F16A 1BB9A 1X43A 4J9EA 2AKKA 4OMMA 1WI7A 2O2OA 5IH2A 2HCKA 1UG1A 3VRZA 4J9FA 4OMOA 4AG2C 3EHRA 2KEAA 1RLPC 1QKWA 1SSHA 2F2VA 3REBB 2BZ8A 2EYZA 1NYGA 3SHWA 3CQTA 2A08A 2CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZE A;  3U23 A;  4RTY A;  1YWP A;  1FMK A;  3A98 A;  2EQI A;  2DVJ A;  1YP5 A;  2KT1 A;  1ZUU A;  2CH4 W;  1ABQ A;  2W0Z A;  1X2Q A;  4ESR A;  2GGR A;  3THK A;  1KSW A;  1WFW A;  1RI9 A;  3R6N A;  4OMP A;  3TVT A;  4D8D A;  2PTK A;  4E6R A;  2FRW A;  1MUZ A;  2AZV A;  2YT6 A;  1ZUY A;  4FSS A;  1GBQ A;  1GCQ C;  2CT3 A;  2JW4 A;  1CKA A;  1GCP A;  2A28 A;  1CSK A;  1PRL C;  1H3H A;  1RUW A;  2DBM A;  3RNJ A;  3M0S A;  4Z89 A;  1MV0 B;  5I22 A;  1WYX A;  1K1Z A;  1NG2 A;  2LQW A;  3QWY A;  1HSQ A;  2ROT A;  1SRL A;  1EFN A;  1UJ0 A;  2KRS A;  5L23 A;  2KXD A;  3I5R A;  4ZNX A;  3VS5 A;  2L3Q A;  2KYB A;  1OPK A;  2GTO A;  4CC7 A;  2L3P A;  2EVR A;  2DX1 A;  5GJV B;  4CC3 A;  1S1N A;  1T0J A;  2M0Y A;  1GBR A;  2O31 A;  3O5Z A;  1AEY A;  2HBW A;  2JS2 A;  1T0H A;  3M0T A;  2RPN A;  2NWM A;  2A37 A;  2NUZ A;  2DYB A;  1SPK A;  2X3W D;  2EPD A;  3H0H A;  2F2W A;  2J7I A;  2FRY A;  1U5S A;  2D8H A;  2VVK A;  4QT7 A;  2HSP A;  1KFZ A;  1G83 A;  1UGV A;  3GBQ A;  2LJ1 A;  1AWJ A;  2I0N A;  5FWB A;  2RN8 A;  5HCK A;  4RTZ A;  2KXC A;  1TUC A;  2DNU A;  4RTT A;  2KNB B;  3UA6 A;  4AG1 C;  1WLP B;  2V1Q A;  2DLP A;  2DJQ A;  2J06 A;  1OPL A;  1OOT A;  1QWE A;  2KRO A;  2K79 A;  4LE9 A;  1OV3 A;  2K6D A;  4EIK A;  3VRY A;  2ED1 A;  2ENM A;  4Z8A A;  4AFZ C;  1PKS A;  1AWO A;  1I0C A;  2O88 A;  1AD5 A;  3NHN A;  2CT4 A;  3H41 A;  2BTT A;  2D8J A;  4JZ3 A;  1VYU A;  2K2M A;  4DEY A;  2MOX A;  2LJ0 A;  2LP5 A;  2L0A A;  2OI3 A;  5IHK A;  3ULR B;  2BZX A;  4HVU A;  1U06 A;  3EHQ A;  4X1V A;  1K76 A;  2KE9 A;  5I11 A;  2P4R A;  3NMZ C;  4CC2 A;  1UEC A;  2KR3 A;  1B3Q A;  1NLO C;  2KYM A;  4HVW A;  2O9S A;  1X27 A;  3PVL A;  2G6F X;  1YN8 A;  1K9A A;  1WXT A;  2GQI A;  3I35 A;  4JJC A;  4RTX A;  3VS4 A;  2BZY A;  2ABL A;  2JMA A;  1WA7 A;  1GCQ A;  4J9D A;  2CDT A;  4D8K A;  1E7O A;  1UHC A;  1JXO A;  1NEB A;  3NGP A;  2F2X A;  1E6H A;  1PHT A;  3ZL7 C;  1W70 A;  4M4Z A;  1UHF A;  1V1C A;  3UAT A;  1ZUK A;  2KRN A;  2DF6 A;  1FYN A;  3I5S A;  1JO8 A;  2ESW A;  1VA7 A;  1WX6 A;  2K9G A;  4F14 A;  2IIM A;  2JMC A;  4A63 B;  2LNH B;  1QWF A;  2RQR A;  1TUD A;  4WCI A;  1H8K A;  2PZ1 A;  1J3T A;  1X6B A;  2RQV A;  1Z9Q A;  2FG0 A;  1JEG A;  1G2B A;  1A0N B;  3QWX X;  3EG2 A;  2SRC A;  3EGU A;  2DL3 A;  1X69 A;  2LX7 A;  3KFV A;  1NM7 A;  3LH5 A;  1YNZ A;  2W10 A;  1Y57 A;  3EG1 A;  1ARK A;  2MCN A;  4J9H A;  1CKB A;  1QCF A;  1AWW A;  4R0K A;  2DMO A;  2JS0 A;  1KJW A;  2DE0 X;  3H0I A;  1SHF A;  3VS1 A;  1Z9Z A;  2PNI A;  4Z88 A;  2D1X A;  2VKN A;  3UF4 A;  2EYW A;  1GL5 A;  2C0O A;  1NYF A;  2GTJ A;  1HJD A;  1K0X A;  5IXF A;  2H8H A;  2L2P A;  3PVQ A;  1YWO A;  3VS0 A;  4OMQ A;  1WIE A;  2L3S A;  2RQT A;  1JU5 C;  2M51 A;  3M0U A;  2J05 A;  2YUO A;  2MIO A;  1UJY A;  4KRT A;  1ZX6 A;  1GFC A;  5IHI A;  1H92 A;  2D0N A;  1ZSG A;  3JV3 A;  2AKL A;  3REA B;  4HVV A;  3SEM A;  2C0T A;  2EGC A;  3VS6 A;  2FPE A;  1M30 A;  2FPF A;  4J9C A;  1M3A A;  4LN2 A;  1UDL A;  4K11 A;  4LUD A;  2AK5 A;  3NPF A;  2EKH A;  2EYY A;  1AOJ A;  1JXM A;  4RTV A;  1ZBJ A;  3M0Q A;  2KGT A;  3PE0 A;  1VYV A;  1GFD A;  1WXU A;  4HCK A;  2RF0 A;  2EW3 A;  4AFS C;  3UA7 A;  1AVZ C;  2EGA A;  2E5K A;  2FO0 A;  2C0I A;  2OAW A;  3C0C A;  2DL4 A;  2RMO A;  1ZLM A;  2DRK A;  2YUP A;  1E6G A;  1SRM A;  2YUQ A;  2HEQ A;  1X2K A;  2JXB A;  1T3L A;  2YDL A;  2J6F A;  2ED0 A;  1UFF A;  2AZS A;  1NLP C;  1N5Z A;  2VWF A;  4HXJ A;  5ECA A;  2DA9 A;  1TG0 A;  1M27 C;  1PKT A;  2KRM A;  2YSQ A;  1LCK A;  2OJ2 A;  4DEX A;  2LCS A;  1IO6 A;  2DBK A;  2B86 A;  1I1J A;  2EBP A;  2JT4 A;  3EG3 A;  4LUE A;  3EG0 A;  2J6K A;  2JM9 A;  3I9Q A;  4JJB A;  1K0S A;  2QDL A;  2HDA A;  2JM8 A;  2JTE A;  4IIO A;  2LQN A;  4AFQ C;  3VS2 A;  3VS3 A;  2A36 A;  1BU1 A;  5FW9 A;  2CH4 A;  4RTU A;  4J9I A;  2ROL A;  2RQW A;  4OML A;  1UTI A;  2XMF A;  2GBQ A;  2KBT A;  2YUN A;  1GRI A;  2CUB A;  4JZ4 A;  1M3C A;  2O9V A;  5IXB A;  4J9G A;  2EGE A;  4RTW A;  2K7A A;  5GJW B;  4CC4 B;  1K4U S;  2K3B A;  3TSZ A;  1PNJ A;  1RLQ C;  1HD3 A;  1BK2 A;  4JPB W;  3IQL A;  2CUD A;  2FEI A;  1QKX A;  3FJ5 A;  1PRM C;  1UUE A;  1NEG A;  1U3O A;  4GLM A;  4AFU C;  4J9B A;  4F17 A;  2J6O A;  1T3S A;  2LJ3 A;  2EYX A;  2SEM A;  1Y0M A;  1SEM A;  1WDX A;  1QLY A;  1YCS B;  2KT8 A;  1M3B A;  1UE9 A;  4RUG A;  1SHG A;  2CSQ A;  2V1R A;  4IIM A;  1PWT A;  2FPD A;  5FWC A;  1AZG B;  1I07 A;  3M0P A;  1B07 A;  1BBZ A;  5EC7 A;  3H0F A;  1MV3 A;  1JQQ A;  3RBB B;  4GBQ A;  3M0R A;  2DRM A;  2DM1 A;  1XOV A;  2DIL A;  2DL7 A;  4LNP A;  4OMN A;  5IHN A;  2CRE A;  2GNC A;  2RQU A;  1W6X A;  2DL8 A;  1X6G A;  1W1F A;  1KIK A;  4JJD A;  3TSW A;  2X3X D;  1WXB A;  4ORZ A;  4Y92 A;  3VS7 A;  1M8M A;  2LZ6 B;  1ABO A;  2ECZ A;  2RNA A;  1VYT A;  2LMJ A;  1OEB A;  2DL5 A;  1AWX A;  4F16 A;  1BB9 A;  1X43 A;  4J9E A;  2AKK A;  4OMM A;  1WI7 A;  2O2O A;  5IH2 A;  2HCK A;  1UG1 A;  3VRZ A;  4J9F A;  4OMO A;  4AG2 C;  3EHR A;  2KEA A;  1RLP C;  1QKW A;  1SSH A;  2F2V A;  3REB B;  2BZ8 A;  2EYZ A;  1NYG A;  3SHW A;  3CQT A;  2A08 A;  2CSI A; 
#chains in the Genus database with same CATH topology
 4E7K A;  3QJ6 A;  3ME9 A;  1VQ8 Q;  3R6O A;  3A98 A;  1RAF B;  2E41 A;  5KYY A;  2MMP A;  1ZUU A;  3G71 Q;  1U1S A;  1X2Q A;  4ESR A;  3V8K A;  3THK A;  2XK0 A;  3DLL A;  4LDU A;  4OMP A;  3TVT A;  1C0M A;  3EGD B;  1G8X A;  2FRW A;  5A2Q E;  2HBP A;  4OB1 B;  1FX7 A;  2YT6 A;  4MZM A;  2OTJ Q;  3M57 A;  3QZ9 B;  2CT3 A;  2JW4 A;  1NE8 A;  1GCP A;  2RO0 A;  1CSK A;  3FJP A;  3E9F A;  3RNJ A;  4C92 G;  4Z89 A;  5GAM e;  4XTZ A;  4M7A E;  4PJO D;  2CZ1 B;  4BB7 A;  1SRL A;  1SSF A;  1QMC A;  3JRZ A;  1FWZ A;  5L23 A;  2KSS A;  3CCV T;  2G3R A;  3OSS C;  1KHI A;  1ZSZ C;  2E3I A;  3MP8 A;  3VS5 A;  2DJZ A;  2AHJ B;  2RHI A;  2GTO A;  4CC7 A;  1QVP A;  3OQ5 A;  4KGX B;  4MDW A;  2M0Y A;  3OA6 A;  3MP6 A;  2E70 A;  1LPL A;  2GQV A;  3O5Z A;  5CIU A;  3H8Z A;  3RKX A;  1VQK T;  2RPN A;  2NWM A;  2VXE A;  4JS4 A;  2DYB A;  2X3W D;  4PJO F;  2EPD A;  2F2W A;  1LVK A;  1U5S A;  8ATC B;  3WVD B;  2VGN A;  1G3Y A;  3HFN A;  1KFZ A;  4HCB A;  5GAN 5;  1BI1 A;  2I0N A;  3RER A;  1WHH A;  4XU1 A;  4E7I A;  3QDR B;  2DNU A;  3VJP A;  1WJQ A;  3MEV A;  2DJQ A;  1TWB A;  4BAC A;  1SG5 A;  1WQW A;  1OPL A;  2KRO A;  2RHU A;  1QVF P;  4FYX B;  4M78 B;  4EIK A;  1KD1 R;  1KQS P;  5A0L A;  3L2U A;  3BE3 A;  4XU3 A;  1IHV A;  3H41 A;  2BTT A;  4PJN A;  1IGQ A;  4JZ3 A;  4ANJ A;  4DBH A;  5KH6 A;  2FHD A;  2F1L A;  2LP5 A;  5CKD A;  2L0A A;  2OI3 A;  3OYC A;  2NUP B;  2RJD A;  4HVU A;  1U06 A;  3EHQ A;  4DBR A;  1K76 A;  1YHQ T;  4N4G A;  3QBY A;  2F5T X;  2P4R A;  3PTA A;  3NMZ C;  1VQ6 T;  4M7D E;  1M8V A;  2HQE A;  1JJ2 P;  1NLO C;  4KH1 B;  4FT2 A;  2YRC A;  2QQB A;  2O9S A;  2ZZD A;  1R8O B;  3CXC P;  1K9A A;  4QW2 A;  1YJN T;  2XI9 A;  2K57 A;  1OU9 A;  3G4S A;  4QQ6 A;  3OS1 A;  2O4X A;  3FRN A;  2CDT A;  4JRQ A;  4Y91 A;  1ZQ1 A;  1E6H A;  3ZL7 C;  1W70 A;  2D6F A;  4M4Z A;  3EFR A;  4PFZ A;  3OYL A;  1KG1 A;  3EH1 A;  5FRO A;  1O9S A;  2KRN A;  4IUQ A;  4E7Z A;  2ESW A;  3A8L B;  2RJF A;  1VA7 A;  2K9G A;  2FZK B;  2JMC A;  4A63 B;  1S72 A;  5DLQ E;  2RQR A;  2DER A;  2PZ1 A;  1J3T A;  1X6B A;  2RQV A;  2QQA A;  1RAG B;  4LDY A;  1M1K R;  3QWX X;  3OYD A;  1X69 A;  3L2R A;  3KFV A;  3MO8 A;  1NM7 A;  2NLU A;  3G4S Q;  1ARK A;  2MCN A;  3AHU A;  1RAD B;  4HT9 A;  1QCF A;  1HXD A;  3QKJ A;  4R55 A;  1MNE A;  2DTH A;  1KJW A;  4PFO A;  2Y4X A;  1Z9Z A;  2PNI A;  1MMA A;  1NJI C;  1KC8 R;  3CCM T;  1KD1 C;  2GFU A;  5GAM d;  3OYB A;  1FMV A;  1VQ7 A;  1S72 Q;  1H64 1;  2RK1 A;  1YJ9 T;  1VQL T;  3VS0 A;  2CP0 A;  2Y90 A;  2HQH A;  2LT1 A;  3JAM E;  3CC2 A;  2P0P A;  4AT1 B;  3VYG A;  5GAN f;  1JU5 C;  3UT1 A;  2YUO A;  1M90 R;  1UJY A;  1JRI A;  2XDP A;  1Q82 R;  4BDY A;  3HPW A;  1GFC A;  5IHI A;  1H92 A;  5GAM g;  2NUP A;  1GXI E;  3FLG A;  3RDV A;  3VUZ A;  3JCM c;  2AKL A;  1MMG A;  4HA8 A;  3VS6 A;  3GLX A;  4C0Z A;  1UB4 A;  1EZZ B;  4M7A B;  3X28 B;  1M3A A;  4K11 A;  1VQ7 Q;  3NPF A;  2VGM A;  3G71 T;  2PUO B;  5KYW A;  1AOJ A;  4A4G A;  4AMC A;  1BI2 A;  2KGT A;  4XTU A;  3QUI A;  2LT4 A;  2ZGW A;  4TVR A;  3JB9 D;  3CC2 Q;  4AFS C;  1NPR A;  2H3J A;  3H6Z A;  4YTL A;  1RAE B;  2C0I A;  1WZO A;  2HZY A;  2A0F B;  1K73 U;  2YUP A;  2EQK A;  4X34 A;  3KXT A;  2PVG B;  3VU3 C;  1M1K C;  1D1C A;  1T3L A;  4OVA A;  3VYH B;  3OBY A;  5LJ3 e;  1Q86 U;  1NLP C;  2XID A;  1N5Z A;  4PKC C;  2QGF B;  2DEU A;  1M27 C;  3JB9 F;  3CCJ T;  2LCS A;  1IO6 A;  3JCM J;  2EBP A;  2XDD A;  1K9M R;  4OP0 A;  4JJB A;  1NZ9 A;  3OBW A;  2JTE A;  4F7U F;  3M4Y A;  1P92 A;  2CH4 A;  4OML A;  4BE1 A;  2YUN A;  2CUB A;  3PMT A;  2QTX A;  1M3C A;  3JCM Q;  1M90 C;  2JZ2 A;  2F5K A;  4J9G A;  1Q82 C;  3QDF A;  4OGE A;  2K3B A;  2KMT A;  3QSU A;  3DB4 A;  1HD3 A;  3CCV A;  4M7D B;  4IUU A;  1I81 A;  3I56 T;  1QKX A;  4KT0 E;  2XDB A;  5DM7 R;  3HFO A;  1SF9 A;  1U3O A;  3MKD A;  4ZTJ A;  2K5F A;  4BI3 A;  1Y0M A;  1QLY A;  2OTL T;  1UE9 A;  4RUG A;  2CSQ A;  4DOW A;  2E6Z A;  4M7A G;  2RH2 A;  5GAN h;  1ZBX A;  1I07 A;  5IT9 E;  1B07 A;  5KYX B;  9ATC B;  1TH7 A;  3RBB B;  3CCV Q;  3BY7 A;  1IRE B;  1K8A C;  1FXX A;  4IUT A;  2GNC A;  1N27 A;  1UGQ B;  3TSW A;  2X3X D;  1TXQ A;  2EQJ A;  4A4F A;  4Y92 A;  1XJW B;  3V8J A;  3LX7 A;  2RNA A;  1K9M C;  3CD6 T;  1OEB A;  1TSF A;  2E6N A;  4OB3 B;  4P5N A;  3JB9 I;  2GFA A;  4J9E A;  2AKK A;  4OMM A;  4C5H A;  5IH2 A;  2LCC A;  3LGL A;  4L59 A;  3JCM W;  4XK8 E;  4PFP A;  1RLP C;  1QKW A;  1YJW A;  4J6X A;  3GIB A;  4EMG A;  5LJ5 h;  3JB9 H;  1U8R A;  3OYE A;  4ZGD B;  1YIT Q;  1VQ6 A;  1PSF A;  5GMK j;  3EFS A;  1FMK A;  3MEW A;  3G4S T;  2EQI A;  2DVJ A;  3OYM A;  1YP5 A;  2DK3 A;  2RHZ A;  5LJ5 e;  5I2M A;  1YI2 A;  2MK5 A;  2F69 A;  1YJN A;  2CH4 W;  2CP3 A;  4FYW B;  1G5V A;  4Z02 A;  2K3Y A;  3WXM B;  1XNI A;  2MYS A;  3M9Q A;  5CCA A;  1R0B G;  2OX7 A;  5LJ3 d;  4FSX A;  2MPX C;  1WFW A;  1V29 B;  4GLK A;  1YJW Q;  4C92 D;  1MGQ A;  4M7D G;  4GY5 A;  4PJO E;  1VQ6 Q;  4EMK C;  3HRU A;  1VQ5 T;  5KCH A;  1ZHI A;  4C92 C;  1RUW A;  2DBM A;  4BY6 C;  2X35 A;  3CBP A;  1Y96 B;  5KYU A;  5I22 A;  2KVQ G;  3C12 A;  1K1Z A;  1YI2 Q;  1ACM B;  4M77 C;  3FEO A;  4Y28 E;  3JCM b;  3L2Q A;  5KYX A;  2KXD A;  3I5R A;  5GMK m;  1VUB A;  4C5G A;  2L3Q A;  2KYB A;  1OPK A;  3A8M B;  4M77 B;  4A4K A;  1Q7Y U;  4KUD K;  1BKB A;  2QDY B;  1IB8 A;  2O31 A;  2HMA A;  1RI0 A;  2JS2 A;  2K5L A;  1T0H A;  4XTY A;  1YJ9 A;  1UEB A;  3EFO B;  1VIF A;  2IG0 A;  1B7T A;  4QT7 A;  4FW1 A;  2QAZ A;  4FT4 A;  4X9D A;  4FM4 B;  2PVD B;  1PC0 A;  1RAC B;  1BCM A;  3SWN C;  4FYV B;  2MWP A;  5HCK A;  2E1H A;  4RTZ A;  2RD1 A;  2KXC A;  4RCC A;  3UA6 A;  4BE0 A;  2VB6 A;  3OYF A;  4J6Y A;  1Q81 U;  3TEE A;  2EJF A;  3M5A A;  3G71 A;  1OV3 A;  5EG2 A;  1YJ9 Q;  4Z8A A;  1PKS A;  3FIF A;  1AWO A;  2YRV A;  1R0C B;  2QYZ A;  1AD5 A;  3NHN A;  3OYN A;  1C1A A;  4E7S A;  2ZAE A;  1U1T A;  5I21 A;  2X4Y A;  5IHK A;  2E4H A;  5J26 A;  1QVF A;  1WPY A;  1BIB A;  2BKD N;  4BDZ A;  1KQS A;  2KE9 A;  2DTO A;  1UEC A;  5J3B A;  2KYM A;  3TU4 K;  2G6F X;  2Y4Y A;  4LD9 K;  1Y96 A;  3ASK A;  3I35 A;  3VS4 A;  2HL3 A;  2ABL A;  1MMN A;  3CCJ A;  3J80 E;  4WF2 A;  4EMK A;  4DBF A;  1JXO A;  5LL6 S;  4C92 A;  4IUR A;  3J7A F;  2GCX A;  4C0D B;  3UAT A;  3CXC A;  2DF6 A;  3MHX A;  4M77 A;  3I5S A;  1JO8 A;  3EGX A;  4F14 A;  3C4S A;  4M75 B;  1QWF A;  4WCI A;  5CAI A;  4M77 G;  2FG0 A;  4LDX A;  4QKU A;  1IHW A;  3OYA A;  4JRI A;  4C8Q C;  3L2V A;  2LX7 A;  2JNG A;  4IKF A;  2HSE B;  2RI2 A;  1YNZ A;  3CCJ Q;  1W2B A;  3EG1 A;  4R0K A;  3I56 A;  2ZPE B;  4HT8 A;  3VS1 A;  4C8Q B;  4Z88 A;  1I5O B;  2D1X A;  3GNG A;  3CCR T;  2GTJ A;  3G6E T;  1HJD A;  5KYN A;  2L2P A;  5HKC A;  2OTL A;  2IPO B;  2RHY A;  1W4S A;  5D6W A;  2LRQ A;  1O75 A;  3SWN A;  1M5Q 1;  3E19 A;  4LXC A;  1M9S A;  1W2B S;  3A8O B;  4Q5W A;  1PD1 A;  4M78 C;  5FRM A;  1N8R R;  1ZX6 A;  3UDC A;  2QEX T;  3I56 Q;  3URG A;  2K2V A;  1PCX A;  1YIT T;  3TQ7 P;  3JV3 A;  4HVV A;  2EGC A;  2L5Q A;  2QI2 A;  2FPE A;  3CBM A;  1M30 A;  5FU7 B;  4OF1 A;  2OTL Q;  2EKH A;  3M58 A;  3QYH B;  2WSC E;  5A0D A;  3CD6 A;  1FMW A;  3OYJ A;  3PE0 A;  2CZ0 B;  2EKO A;  3P8H A;  2QQS A;  4HCK A;  4KH0 B;  1VOM A;  2EW3 A;  1RAI B;  4JDS A;  5IAY A;  3G7Z A;  1AVZ C;  1YJW T;  4F7U E;  2A3L A;  2VV5 A;  3EGD A;  1LOJ A;  2OAW A;  2CS7 A;  2RMO A;  2DRK A;  3L42 A;  1M1F A;  2XD0 A;  2YUQ A;  3S3O A;  2ZPH B;  4A4H A;  2YDL A;  2BE9 B;  2DIQ A;  1YIJ T;  1WHG A;  1YI2 T;  4M75 A;  2VWF A;  5CKE A;  3CD6 Q;  2RI5 A;  3A1P A;  2KRM A;  4M75 G;  3FDR A;  3BW1 A;  3SD4 A;  1F1B B;  4DEX A;  3JCM f;  2JT4 A;  1I1J A;  2NYS A;  2C06 A;  3EG0 A;  5GAO l;  2J6K A;  2HDA A;  2HNI A;  1TS9 A;  4ZGE B;  3VS3 A;  4C8Q A;  4EMH A;  5FW9 A;  1QQJ A;  1NJI U;  2XMF A;  1KD1 U;  2LQK A;  2GBQ A;  4C8Q G;  2E10 A;  1VQ5 A;  2VXF A;  4JS5 A;  1BI3 A;  4PJJ A;  1TTH B;  5IXB A;  1N8R C;  3PNW C;  1OZ2 A;  2K7A A;  1M1G A;  1V76 A;  3QO3 A;  2ZPI B;  1RLQ C;  3JCM X;  5HK3 A;  1UUE A;  1BI0 A;  4N0A C;  1T3S A;  2RHX A;  2SEM A;  1WDX A;  4M7A D;  5GAM j;  1RAH B;  4M78 A;  2CP6 A;  1VQ5 Q;  2DEQ A;  2RM4 A;  2V1R A;  1XQH A;  2EAY A;  2MI6 A;  1JB0 E;  2FPD A;  4M7A C;  4M78 G;  1N9R A;  2BIV A;  3H9N A;  3DLM A;  3M0P A;  3X26 B;  1BBZ A;  5EC7 A;  1Q86 R;  1EX4 A;  5L8R E;  1JQQ A;  1LNX A;  3CPW A;  2DFU A;  1BIA A;  3I55 T;  1QVG A;  1B34 B;  2XHC A;  2DM1 A;  2DIL A;  2DL7 A;  4LNP A;  4OMN A;  5IHN A;  2CRE A;  4WTO B;  2E65 A;  2RQU A;  2DL8 A;  3UWN A;  1M1K U;  1G3W A;  2XU8 A;  1M8M A;  2LZ6 B;  1ABO A;  3OW2 A;  1VYT A;  5HY6 A;  2DL5 A;  5GMK h;  5CVI A;  3GF5 A;  3CCL T;  1X43 A;  1WI7 A;  3CME A;  3CPW S;  1QVG S;  1UG1 A;  3VRZ A;  4OB2 B;  3TCJ A;  4J9F A;  4OMO A;  1KHC A;  2V8K A;  2KEA A;  1SSH A;  2F2V A;  3CCS T;  3V7R A;  1NYG A;  2B8A A;  3SHW A;  3BDU A;  2M9U A;  3SFM A;  3NTI A;  2CSI A;  3NTH A;  2MWO A;  5J39 A;  1AZE A;  3OW2 S;  4RTY A;  3M55 A;  3L2W A;  2KT1 A;  3LLR A;  1HYO A;  1KC8 C;  1UGR B;  2CZ6 B;  3JCM h;  3X20 B;  3RMS A;  1Q82 U;  3CME Q;  1ABQ A;  2W0Z A;  3TRE A;  5GAN 3;  2BUD A;  4M7D D;  2GGR A;  2LVM A;  1VQN A;  1KSW A;  1RI9 A;  3R6N A;  3OY9 A;  2FZC B;  1MUZ A;  2AZV A;  4EDU A;  4BI4 A;  4M7D C;  1Q95 G;  1ZUY A;  2LC4 A;  4FSS A;  1GBQ A;  1N6A A;  2QK0 A;  1Q86 C;  4C0F A;  2ATC B;  3M0S A;  2DTI A;  1UGP B;  2LQW A;  1WHM A;  2ROT A;  4N0A A;  1EFN A;  3OB9 A;  4J7I A;  1UJ0 A;  5C6S A;  4ZNX A;  5FU6 C;  1QP2 A;  1VQN Q;  4FW2 A;  1OX8 A;  2EVR A;  1K8A U;  2D9T A;  2JN0 A;  5GJV B;  4CC3 A;  1S1N A;  4M7A A;  1T0J A;  2PU9 B;  2E12 A;  1GBR A;  2DXU A;  2KQW A;  1D0X A;  3OYY A;  3CCR A;  3G6E A;  1AEY A;  1N9S A;  1VQ9 T;  3M0T A;  3PGG A;  4XTX A;  5FU6 B;  1SPK A;  4KBM B;  3H0H A;  4J6W A;  2QA4 Q;  2DXB A;  1K9M U;  2VVK A;  2HSP A;  1G83 A;  1IXD A;  4ZTF A;  5GAN e;  1AWJ A;  2IVW A;  2KAF A;  5KCO A;  1D1A A;  2QEX A;  3DB3 A;  2RN8 A;  3CEY A;  4ME7 A;  1YIT A;  1TUC A;  4RTT A;  5GAN 7;  2KNB B;  4EPC A;  6AT1 B;  2OAU A;  4AG1 C;  1RL2 A;  1WLP B;  2V1Q A;  2QGG A;  3CCR Q;  1RAA B;  3G6E Q;  1G3T A;  1M2V B;  1QWE A;  1OOT A;  4B6M A;  5AYF A;  3KUF A;  3VRY A;  2ED1 A;  4AFZ C;  2JTF A;  3CC7 A;  4PNO A;  2CT4 A;  2EQM A;  1D3B B;  1VYU A;  2K2M A;  1M2O A;  4DEY A;  4V2S A;  2MOX A;  3ULR B;  4N4I A;  2BZX A;  2QEX Q;  4X1V A;  2HKQ B;  3LWI A;  3ZFJ A;  3P8B B;  4A53 A;  4NL3 A;  4FCY A;  4HVW A;  3M59 A;  4CRI A;  1YIJ A;  3MP1 A;  1G3S A;  5CKH A;  1X27 A;  3PVL A;  4OMF B;  1Q7Y R;  3HKS A;  1LJO A;  5FRN A;  3CC7 Q;  1WXT A;  2CP7 A;  2PUK B;  2BZY A;  4A54 A;  2JMA A;  4M7D A;  3LWH A;  1D09 B;  2DXC A;  4J9D A;  4D8K A;  1UHC A;  1NEB A;  3PIO A;  4J5Y A;  4VUB A;  5LJ3 j;  1PHT A;  3X25 B;  5GMK i;  4XU2 A;  1UHF A;  2L89 A;  4M77 D;  1V1C A;  1ZUK A;  1FYN A;  4B9W A;  5D7U A;  2DZ9 A;  4LDV A;  2LNH B;  1KQ1 A;  4B9X A;  1YIJ Q;  3AT1 B;  1H8K A;  5CKF A;  1Z9Q A;  5LJ3 g;  1A0N B;  3EG2 A;  5GAN 6;  1KQ2 A;  1R77 A;  2SRC A;  3EGU A;  5GAM f;  2D0Q B;  3LH5 A;  3X24 B;  2DYI A;  7AT1 B;  2W10 A;  1Y57 A;  4C92 F;  2VAS A;  4J9H A;  1CKB A;  1VQM A;  2JS0 A;  4M77 F;  2DE0 X;  3H0I A;  4PLI A;  2EQU A;  3ZBD A;  5M9O A;  3UF4 A;  3Q1J A;  2KDS A;  4HCC A;  2QQR A;  2EIF A;  4BUG A;  1YWO A;  3CCQ A;  1Y7X A;  2HKN A;  2DIG A;  3CCU T;  3M0U A;  5GAN 2;  4JRP A;  1VQM Q;  3P8D A;  3I55 A;  2D0N A;  2PQW A;  1ZSG A;  2DVE A;  3SEM A;  3L2Z A;  3HRT A;  4J9C A;  3VV0 A;  2VC8 A;  2ZPG B;  2KI7 A;  5GAN d;  1JXM A;  3CME T;  4RTV A;  1ZBJ A;  3CC4 T;  1YBY A;  3M0Q A;  3QPH A;  3CCQ Q;  3CCL A;  5GAO r;  3SB2 A;  3UA7 A;  2E5K A;  4RCB A;  3I55 Q;  2DL4 A;  2LCL A;  3CCS A;  2P0K A;  1E6G A;  1SRM A;  2HEQ A;  3HRS A;  2MF2 A;  3GNF B;  1UFF A;  2AZS A;  5KE3 A;  4M75 D;  4C0D C;  4HXJ A;  1TG0 A;  1ZA1 B;  2R57 A;  2JOY A;  2YSQ A;  1QCO A;  4M75 C;  3C94 A;  1LCK A;  4NL2 A;  1VQO A;  2COY A;  1QVF S;  1JJ2 A;  3CCL Q;  2OJ2 A;  2YHT A;  1VQN T;  2DBK A;  1KQS S;  2B86 A;  4LUE A;  1SKU B;  1I4K 1;  1EIF A;  4BD3 A;  2JM9 A;  3I9Q A;  1PD0 A;  3M53 A;  1MND A;  3OYI A;  1NPP A;  2QDL A;  2DZC A;  5LJ5 d;  2JM8 A;  4IIO A;  3CCS Q;  4C8Q D;  3VS2 A;  2GF7 A;  4ELY C;  2A36 A;  3NTK A;  2XG8 D;  2DO3 A;  4M75 F;  4RTU A;  5LJ5 j;  3GOX A;  1WHJ A;  4J9I A;  2QA4 T;  1UTI A;  5CKB A;  3EFO A;  5IN1 A;  5GAM h;  3RKY A;  3QJY A;  1JJ2 S;  2LDM A;  2YLC A;  2EGE A;  1VQO Q;  5GJW B;  4CC4 B;  3OS2 A;  2X4X A;  5LJ5 g;  1K4U S;  3CXC S;  3TSZ A;  3SDZ A;  5A0G A;  1BK2 A;  4JPB W;  2O4X B;  3IQL A;  4C5I A;  4C8Q F;  2CUD A;  2FEI A;  4NS5 A;  3FJ5 A;  3HTR A;  2AT1 B;  1PRM C;  2RJC A;  3CMA T;  2QTV A;  4AFU C;  3L1A A;  2J6O A;  4F17 A;  1VQ4 T;  4PJO C;  2EYX A;  3WVE B;  1SEM A;  3BDL A;  4M78 D;  1M3B A;  1VQ9 A;  3C95 A;  1SHG A;  4OB0 B;  3V7C A;  3OSV A;  2DKG A;  4JJN K;  4IIM A;  4ZN1 A;  1ZSZ B;  5FWC A;  2EYQ A;  1AZG B;  4PJO B;  5FU7 C;  1MHN A;  5HK0 A;  1I5L A;  3M0R A;  4ELZ C;  2COW A;  5GAO n;  2FVU A;  3JCM V;  1IGU A;  1XOV A;  4M78 F;  4HCZ A;  4XAX B;  1VQP T;  4JJD A;  1XTD A;  4R56 A;  2CYZ B;  1OI1 A;  2RI3 A;  1VQ9 Q;  3CC7 T;  3VS7 A;  4E7L A;  3CCE T;  2ECZ A;  4RG2 A;  1AWX A;  3ER0 A;  1NJI R;  5D6X A;  3PMI A;  2KY9 A;  1YFN A;  4LD6 A;  3V8L A;  4JRK A;  1WQ7 A;  4AG2 C;  1JBM A;  3OS5 A;  2RJE A;  2EYZ A;  4J7F A;  2A08 A;  3M4G A;  5LJ3 f;  4DA4 A;  3QZ5 B;  3U23 A;  1YWP A;  1C6V X;  1ZA2 B;  5CO7 A;  2DXT A;  5KYW B;  4QVD A;  2X9H A;  1IRX A;  1N8R U;  3LW5 E;  3EAE A;  4QVZ A;  2P84 A;  2E64 A;  3QXE B;  2BE7 D;  2X51 A;  1NBE B;  1QW1 A;  4D8D A;  2PTK A;  4E6R A;  4XTV A;  2ZPB B;  3LYI A;  2K4Y A;  1GCQ C;  2FYK A;  4HKE A;  1CKA A;  1W2B P;  2A28 A;  2X4W A;  2JTM A;  1PRL C;  1H3H A;  2CZ7 B;  1OYX A;  1MV0 B;  4XU0 A;  4QQG A;  1WYX A;  1NG2 A;  3FB9 A;  3QWY A;  1DJ7 B;  1I8F A;  1HSQ A;  1ZSZ A;  2CGH A;  3QYG B;  1VQM T;  3M54 A;  2ZPF B;  4BI8 B;  4PJO A;  4MMK A;  1WJS A;  2KRS A;  3VKI A;  2A7Y A;  4PJO G;  5GMK l;  4LDW A;  2L3P A;  3EH2 A;  2DAQ A;  1WHK A;  2DX1 A;  4DOV A;  1WJR A;  3A5Z B;  8AT1 B;  2DD5 A;  1K73 R;  2HBW A;  2LX9 A;  2JVV A;  4PJM A;  4ATO A;  2A37 A;  2NUZ A;  3O8V A;  4N4H A;  3CCQ T;  1QP3 A;  2J7I A;  2FRY A;  2RB6 A;  1BYM A;  2D8H A;  2EFI A;  1H3Z A;  2L3R A;  1UGV A;  3E2U A;  3GBQ A;  3CCU A;  2O01 E;  2LJ1 A;  3V7S A;  5GAO p;  4M7A F;  5FWB A;  2FL7 A;  2COZ A;  4FYY B;  2QG9 B;  4L6V 5;  3RIR A;  3MEU A;  3INZ A;  2DLP A;  5DLO A;  5C0M A;  2P4T A;  2J06 A;  3A8G B;  1VQ8 T;  2K79 A;  4LE9 A;  4A4E A;  2K6D A;  2XIC A;  1X75 C;  3CC4 A;  2ENM A;  1IZ6 A;  1RAB B;  2FB7 A;  2M0O A;  1I0C A;  4QVC A;  3MCA B;  4XTW A;  2O88 A;  2RK2 A;  2D8J A;  1PG5 B;  5GMK e;  3CCU Q;  1KC8 U;  2LJ0 A;  2YXY A;  4JUV A;  2DD4 A;  4C5E A;  3S3M A;  2R5M A;  4DBQ A;  3BFM A;  5LJ3 h;  4BE2 A;  1X6O A;  2M1H A;  5I11 A;  2OTJ T;  1AHJ B;  4CC2 A;  2KR3 A;  1B3Q A;  3ZEH A;  5GAN 8;  1VQO T;  4PJL A;  1M90 U;  1K8A R;  4CI0 C;  5LJ5 f;  4C92 E;  5KE2 A;  3CC4 Q;  1OU8 A;  4ZN3 A;  1YN8 A;  4JJC A;  2GQI A;  4RTX A;  3OMC A;  4M77 E;  4J83 A;  5CQX A;  1WA7 A;  3FC3 A;  1GCQ A;  4E47 A;  3JCM e;  3QG1 A;  1E7O A;  2E5Q A;  3EG9 B;  1K73 C;  4D6W A;  3NGP A;  4DQ2 A;  2F2X A;  1TOV A;  5I2S A;  2KK4 A;  1WX6 A;  2WSE E;  4F7U B;  2IIM A;  3VUB A;  2QA4 A;  3G1J A;  1TUD A;  4F04 B;  3J81 E;  1JEG A;  1G2B A;  2HL5 C;  4M7D F;  4KUL A;  3DKM A;  2DL3 A;  4MDX A;  4II1 A;  1MMD A;  2DET A;  1B34 A;  1AWW A;  2DMO A;  4FL6 A;  3CPF A;  1SHF A;  2HQX A;  2I2L A;  2NUT B;  3GP8 A;  2PVO B;  2LNV A;  2VKN A;  1Y07 A;  3CMA A;  1AT1 B;  2QXF A;  4RMO A;  1VQ4 A;  2EYW A;  2EJ9 A;  3PFS A;  1GL5 A;  1NYF A;  2C0O A;  3T9N A;  1K0X A;  5IXF A;  2H8H A;  3PVQ A;  3NFC A;  3OYG A;  3CPW P;  3HP9 A;  4OMQ A;  1QVG P;  1WIE A;  2L3S A;  2RQT A;  1VQK A;  1KK7 A;  5KYU B;  4MZT A;  2ZCF B;  2K5I A;  2M51 A;  2J05 A;  2K3X A;  2MIO A;  4KRT A;  1OUL A;  3LGF A;  2V8J A;  2EJG A;  3JSC A;  2LQ8 A;  4QQD A;  3E9G A;  3OYK A;  3OW2 P;  3CMA Q;  3REA B;  2C0T A;  1VQ4 Q;  1WHL A;  2QQ9 A;  2FPF A;  2P0Q A;  1VQP A;  3LH0 A;  4LN2 A;  4XQ3 A;  1UDL A;  4LUD A;  2AK5 A;  2V26 A;  4KUI A;  3OYH A;  4C0G A;  2EYY A;  3CCE A;  5GAN 4;  1YCY A;  1WGS A;  2V8I A;  1VQK Q;  1VYV A;  4E7J A;  1GFD A;  1WXU A;  4ZGJ B;  2RF0 A;  1Y71 A;  2L8D A;  1OX9 A;  2X4J A;  3MPU B;  2EGA A;  2FO0 A;  3JCM P;  4M75 E;  3MET A;  3EG9 A;  3C0C A;  3JB9 G;  2DPP B;  3QHS A;  2JJ9 A;  3JB9 J;  3HHT B;  1ZLM A;  3QII A;  4MML A;  1D0Y A;  1X2K A;  2JXB A;  2VYT A;  3RKW A;  1VQP Q;  2J6F A;  1BCO A;  2ED0 A;  1YHQ A;  4F7U A;  2R5A A;  3RUX A;  3GPL A;  5ECA A;  2DA9 A;  4PLL A;  4OGC A;  3CCE Q;  2FZG B;  4X9C A;  1PKT A;  4F7U G;  2CKK A;  4C8Q E;  2WAC A;  2QAS A;  4PK4 A;  5GAO m;  3EG3 A;  5AT1 B;  1X01 A;  1K0S A;  3RMQ A;  3HSB A;  2LQN A;  4AFQ C;  4FIB A;  2NUT A;  2EWN A;  1BU1 A;  4PL6 A;  3E1S A;  3RR6 A;  1PM3 A;  2ROL A;  2RQW A;  1YHQ Q;  1S72 T;  2KBT A;  1GRI A;  1OQK A;  2Z0W A;  3D7S B;  3KBG A;  4JZ4 A;  3JCM d;  2O9V A;  5KYY B;  1VIE A;  1Q81 R;  4RTW A;  5GAO q;  3MJX A;  5CK9 A;  3PT9 A;  1PSE A;  4JLG A;  2LTO A;  1PNJ A;  1YJN Q;  4M78 E;  2E3H A;  3F70 A;  2R58 A;  1QCN A;  4EMK B;  5D6Y A;  2CP2 A;  4RG8 A;  1NEG A;  3S6W A;  4GLM A;  4C92 B;  4J9B A;  3PIP A;  1WNL A;  4BY6 B;  2LJ3 A;  1M2V A;  3JCM g;  1D0Z A;  1YCS B;  1VQ7 T;  2KT8 A;  3EGX B;  3S3N A;  2RA2 A;  4E2F B;  3M56 A;  2H3E B;  3CCM A;  4NOY A;  1OZ3 A;  2JUF A;  4MZP A;  1PWT A;  2YRD A;  1D3B A;  1TUG B;  2AIR B;  4UC4 A;  4J8O A;  3CC2 T;  2CP5 A;  3H0F A;  1VQL A;  1MV3 A;  5CQY A;  2WSF E;  4L5G A;  4GBQ A;  4FU6 A;  3HL8 A;  1HK9 A;  5DY9 A;  2DRM A;  3MEA A;  1Q7Y C;  2M02 A;  1M4Z A;  2M16 A;  1W6X A;  1X6G A;  2YWW A;  1W1F A;  1KIK A;  1TU0 B;  3CBO A;  5CR2 A;  4O5V A;  4IUP A;  1WXB A;  1D1B A;  3N5B B;  4JLI A;  4ORZ A;  1VQ8 A;  3CCM Q;  1UGS B;  5GAN j;  2HD0 A;  4RKU E;  3OS0 A;  4E7H A;  4O6J A;  2LMJ A;  4KGZ B;  4IUV A;  3SWN B;  4F16 A;  1BB9 A;  1VQL Q;  2O2O A;  2HCK A;  2VUB A;  5GAN g;  2XKO C;  2YLB A;  3UPU A;  3EHR A;  3OMG A;  3A8H B;  3REB B;  2BZ8 A;  4KGV B;  2HAX A;  2MAM A;  3CQT A;  2OTJ A;  5FLX E;  3RES A;  1Q81 C; 
#chains in the Genus database with same CATH homology
 1AZE A;  3U23 A;  4RTY A;  1YWP A;  1FMK A;  3A98 A;  2EQI A;  2DVJ A;  1YP5 A;  2KT1 A;  1ZUU A;  2CH4 W;  1ABQ A;  2W0Z A;  1X2Q A;  4ESR A;  2GGR A;  3THK A;  1KSW A;  1WFW A;  1RI9 A;  3R6N A;  4OMP A;  3TVT A;  4D8D A;  2PTK A;  4E6R A;  2FRW A;  1MUZ A;  2AZV A;  2YT6 A;  1ZUY A;  4FSS A;  1GBQ A;  1GCQ C;  2CT3 A;  2JW4 A;  1CKA A;  1GCP A;  2A28 A;  1CSK A;  1PRL C;  1H3H A;  1RUW A;  2DBM A;  3RNJ A;  3M0S A;  4Z89 A;  1MV0 B;  5I22 A;  1WYX A;  1K1Z A;  1NG2 A;  2LQW A;  3QWY A;  1HSQ A;  2ROT A;  1SRL A;  1EFN A;  1UJ0 A;  2KRS A;  5L23 A;  2KXD A;  3I5R A;  4ZNX A;  3VS5 A;  2L3Q A;  2KYB A;  1OPK A;  2GTO A;  4CC7 A;  2L3P A;  2EVR A;  2DX1 A;  5GJV B;  4CC3 A;  1S1N A;  1T0J A;  2M0Y A;  1GBR A;  2O31 A;  3O5Z A;  1AEY A;  2HBW A;  2JS2 A;  1T0H A;  3M0T A;  2RPN A;  2NWM A;  2A37 A;  2NUZ A;  2DYB A;  1SPK A;  2X3W D;  2EPD A;  3H0H A;  2F2W A;  2J7I A;  2FRY A;  1U5S A;  2D8H A;  2VVK A;  4QT7 A;  2HSP A;  1KFZ A;  1G83 A;  1UGV A;  3GBQ A;  2LJ1 A;  1AWJ A;  2I0N A;  5FWB A;  2RN8 A;  5HCK A;  4RTZ A;  2KXC A;  1TUC A;  2DNU A;  4RTT A;  2KNB B;  3UA6 A;  4AG1 C;  1WLP B;  2V1Q A;  2DLP A;  2DJQ A;  2J06 A;  1OPL A;  1OOT A;  1QWE A;  2KRO A;  2K79 A;  4LE9 A;  1OV3 A;  2K6D A;  4EIK A;  3VRY A;  2ED1 A;  2ENM A;  4Z8A A;  4AFZ C;  1PKS A;  1AWO A;  1I0C A;  2O88 A;  1AD5 A;  3NHN A;  2CT4 A;  3H41 A;  2BTT A;  2D8J A;  4JZ3 A;  1VYU A;  2K2M A;  4DEY A;  2MOX A;  2LJ0 A;  2LP5 A;  2L0A A;  2OI3 A;  5IHK A;  3ULR B;  2BZX A;  4HVU A;  1U06 A;  3EHQ A;  4X1V A;  1K76 A;  2KE9 A;  5I11 A;  2P4R A;  3NMZ C;  4CC2 A;  1UEC A;  2KR3 A;  1B3Q A;  1NLO C;  2KYM A;  4HVW A;  2O9S A;  1X27 A;  3PVL A;  2G6F X;  1YN8 A;  1K9A A;  1WXT A;  2GQI A;  3I35 A;  4JJC A;  4RTX A;  3VS4 A;  2BZY A;  2ABL A;  2JMA A;  1WA7 A;  1GCQ A;  4J9D A;  2CDT A;  4D8K A;  1E7O A;  1UHC A;  1JXO A;  1NEB A;  3NGP A;  2F2X A;  1E6H A;  1PHT A;  3ZL7 C;  1W70 A;  4M4Z A;  1UHF A;  1V1C A;  3UAT A;  1ZUK A;  2KRN A;  2DF6 A;  1FYN A;  3I5S A;  1JO8 A;  2ESW A;  1VA7 A;  1WX6 A;  2K9G A;  4F14 A;  2IIM A;  2JMC A;  4A63 B;  2LNH B;  1QWF A;  2RQR A;  1TUD A;  4WCI A;  1H8K A;  2PZ1 A;  1J3T A;  1X6B A;  2RQV A;  1Z9Q A;  2FG0 A;  1JEG A;  1G2B A;  1A0N B;  3QWX X;  3EG2 A;  2SRC A;  3EGU A;  2DL3 A;  1X69 A;  2LX7 A;  3KFV A;  1NM7 A;  3LH5 A;  1YNZ A;  2W10 A;  1Y57 A;  3EG1 A;  1ARK A;  2MCN A;  4J9H A;  1CKB A;  1QCF A;  1AWW A;  4R0K A;  2DMO A;  2JS0 A;  1KJW A;  2DE0 X;  3H0I A;  1SHF A;  3VS1 A;  1Z9Z A;  2PNI A;  4Z88 A;  2D1X A;  2VKN A;  3UF4 A;  2EYW A;  1GL5 A;  2C0O A;  1NYF A;  2GTJ A;  1HJD A;  1K0X A;  5IXF A;  2H8H A;  2L2P A;  3PVQ A;  1YWO A;  3VS0 A;  4OMQ A;  1WIE A;  2L3S A;  2RQT A;  1JU5 C;  2M51 A;  3M0U A;  2J05 A;  2YUO A;  2MIO A;  1UJY A;  4KRT A;  1ZX6 A;  1GFC A;  5IHI A;  1H92 A;  2D0N A;  1ZSG A;  3JV3 A;  2AKL A;  3REA B;  4HVV A;  3SEM A;  2C0T A;  2EGC A;  3VS6 A;  2FPE A;  1M30 A;  2FPF A;  4J9C A;  1M3A A;  4LN2 A;  1UDL A;  4K11 A;  4LUD A;  2AK5 A;  3NPF A;  2EKH A;  2EYY A;  1AOJ A;  1JXM A;  4RTV A;  1ZBJ A;  3M0Q A;  2KGT A;  3PE0 A;  1VYV A;  1GFD A;  1WXU A;  4HCK A;  2RF0 A;  2EW3 A;  4AFS C;  3UA7 A;  1AVZ C;  2EGA A;  2E5K A;  2FO0 A;  2C0I A;  2OAW A;  3C0C A;  2DL4 A;  2RMO A;  1ZLM A;  2DRK A;  2YUP A;  1E6G A;  1SRM A;  2YUQ A;  2HEQ A;  1X2K A;  2JXB A;  1T3L A;  2YDL A;  2J6F A;  2ED0 A;  1UFF A;  2AZS A;  1NLP C;  1N5Z A;  2VWF A;  4HXJ A;  5ECA A;  2DA9 A;  1TG0 A;  1M27 C;  1PKT A;  2KRM A;  2YSQ A;  1LCK A;  2OJ2 A;  4DEX A;  2LCS A;  1IO6 A;  2DBK A;  2B86 A;  1I1J A;  2EBP A;  2JT4 A;  3EG3 A;  4LUE A;  3EG0 A;  2J6K A;  2JM9 A;  3I9Q A;  4JJB A;  1K0S A;  2QDL A;  2HDA A;  2JM8 A;  2JTE A;  4IIO A;  2LQN A;  4AFQ C;  3VS2 A;  3VS3 A;  2A36 A;  1BU1 A;  5FW9 A;  2CH4 A;  4RTU A;  4J9I A;  2ROL A;  2RQW A;  4OML A;  1UTI A;  2XMF A;  2GBQ A;  2KBT A;  2YUN A;  1GRI A;  2CUB A;  4JZ4 A;  1M3C A;  2O9V A;  5IXB A;  4J9G A;  2EGE A;  4RTW A;  2K7A A;  5GJW B;  4CC4 B;  1K4U S;  2K3B A;  3TSZ A;  1PNJ A;  1RLQ C;  1HD3 A;  1BK2 A;  4JPB W;  3IQL A;  2CUD A;  2FEI A;  1QKX A;  3FJ5 A;  1PRM C;  1UUE A;  1NEG A;  1U3O A;  4GLM A;  4AFU C;  4J9B A;  4F17 A;  2J6O A;  1T3S A;  2LJ3 A;  2EYX A;  2SEM A;  1Y0M A;  1SEM A;  1WDX A;  1QLY A;  1YCS B;  2KT8 A;  1M3B A;  1UE9 A;  4RUG A;  1SHG A;  2CSQ A;  2V1R A;  4IIM A;  1PWT A;  2FPD A;  5FWC A;  1AZG B;  1I07 A;  3M0P A;  1B07 A;  1BBZ A;  5EC7 A;  3H0F A;  1MV3 A;  1JQQ A;  3RBB B;  4GBQ A;  3M0R A;  2DRM A;  2DM1 A;  1XOV A;  2DIL A;  2DL7 A;  4LNP A;  4OMN A;  5IHN A;  2CRE A;  2GNC A;  2RQU A;  1W6X A;  2DL8 A;  1X6G A;  1W1F A;  1KIK A;  4JJD A;  3TSW A;  2X3X D;  1WXB A;  4ORZ A;  4Y92 A;  3VS7 A;  1M8M A;  2LZ6 B;  1ABO A;  2ECZ A;  2RNA A;  1VYT A;  2LMJ A;  1OEB A;  2DL5 A;  1AWX A;  4F16 A;  1BB9 A;  1X43 A;  4J9E A;  2AKK A;  4OMM A;  1WI7 A;  2O2O A;  5IH2 A;  2HCK A;  1UG1 A;  3VRZ A;  4J9F A;  4OMO A;  4AG2 C;  3EHR A;  2KEA A;  1RLP C;  1QKW A;  1SSH A;  2F2V A;  3REB B;  2BZ8 A;  2EYZ A;  1NYG A;  3SHW A;  3CQT A;  2A08 A;  2CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...