1IHWA

Solution structure of the dna binding domain of hiv-1 integrase, nmr, 40 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the DNA binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ihwA00
5D7UA 4FW2A 1C0MA 1C6VX 1IHVA 4FW1A 1C1AA 1IHWA 1EX4A 1QMCA
chains in the Genus database with same CATH superfamily
3QPHA 3JCMf 3LH0A 3OYDA 2OTLA 1VQ5T 4RMOA 2RPNA 1NEBA 2V1RA 3KUFA 3UATA 3QWXX 1JXOA 2GCXA 1VYVA 3H0IA 2BUDA 2JJ9A 5HK3A 2DXCA 3RKXA 5IHNA 1IHVA 4DA4A 3PTAA 3VV0A 4HKEA 4HVUA 3MHXA 2E5QA 3G1JA 1W6XA 1TSFA 4J7IA 5GANg 1XOVA 4HCKA 1K76A 2M51A 3MPUB 2X3XD 3OS2A 1RAHB 1KHIA 4XTZA 5CQXA 3VS7A 4F17A 3JCMb 2XMFA 4M77F 4A53A 1G3SA 3OMCA 3TVTA 1QVGS 2O9SA 3CPWP 3VS3A 2GFUA 2EPDA 3EH1A 1RI0A 4RTWA 4QKUA 1Q81R 1NM7A 3QG1A 2QI2A 1N9RA 5C0MA 5D6WA 1PC0A 3CMEQ 4RCBA 1ZUUA 5GANe 3RKYA 1TXQA 3JRZA 2QA4Q 1IREB 1W70A 4PKCC 4WCIA 2COYA 1KQ2A 3GBQA 3V7SA 3GPLA 4M7AC 1VQPT 1AWWA 1V1CA 2LCSA 4KGVB 1PSEA 2A36A 5CO7A 4JS4A 3KXTA 1N8RU 1I4K1 1KD1C 4KGXB 4UC4A 3X26B 2DTIA 1IGUA 1KIKA 1AT1B 1M27C 1WZOA 4FYYB 3OYMA 4RTUA 1QVPA 3CCJQ 4EDUA 2PU9B 3FJPA 1G5VA 2MI6A 4XTVA 1JEGA 2DXBA 1M1KU 1VQLA 3ZEHA 2PUOB 2F5KA 2HEQA 2HAXA 2XD0A 3CC2A 1M90C 4N4GA 5KYYB 2K5IA 2QDYB 2YRCA 4C92C 4J5YA 3LH5A 4BUGA 2E64A 2DIGA 1GCQC 4OGEA 1Q95G 2EQUA 5LJ3g 3CCQQ 1YI2Q 1KQSS 5KYYA 3KBGA 5CIUA 2PVDB 1VQ8A 3G4SA 2QTXA 2JNGA 4E7JA 2J6KA 2DRKA 1KC8U 1I1JA 4J9CA 1NZ9A 2DL5A 3KFVA 5EG2A 3GP8A 4J6XA 1RAFB 3SB2A 1M30A 2BE9B 4J6YA 1OX9A 1WGSA 1YWOA 2GQIA 3EHRA 1AWXA 1PRLC 2QTVA 3OYJA 4QQGA 1RAGB 5LJ3e 5GAMh 5EC7A 1LCKA 2JMCA 4L5GA 1AZGB 1YJNQ 2YLCA 3GOXA 3EFSA 1K8AC 2DXTA 4XTXA 1JJ2A 1CKBA 2FPFA 1YITQ 3LW5E 4C5HA 4QQ6A 1AEYA 2I2LA 4OB0B 1VQNA 4IUTA 4PLIA 3UA6A 1ZBJA 5GAOm 2RJCA 2LX7A 5FU6B 3EFRA 1GFDA 4M7DD 3RESA 4PJJA 1GXIE 1U1TA 4C8QF 4NL2A 4GBQA 3ASKA 2QG9B 1KD1U 4AMCA 4J9FA 3G71A 1M1KR 2BKDN 4HCBA 2FZCB 2ZAEA 1ZSZC 1YJ9A 1BU1A 5A0LA 3F70A 3SHWA 2LCCA 2IG0A 2OTLQ 3OQ5A 3CCUT 1YJNT 5HCKA 2MOXA 2HSEB 2FB7A 2EQIA 1VA7A 1ZA2B 3J7AF 4BD3A 2PTKA 1YITT 7AT1B 1WHLA 4DBQA 3LGLA 2FEIA 2NYSA 4Z88A 4GLMA 1KC8R 3VUZA 1JO8A 1OX8A 3ER0A 1I8FA 2A08A 4Y91A 1C0MA 2HQXA 4XU2A 3CXCS 1KQSA 4C8QG 3SWNB 4C8QB 2COWA 1GCPA 3TEEA 2CREA 2MK5A 2EYWA 4BDYA 4N0AC 2F69A 1ZA1B 2DVEA 2C0IA 3SWNA 2H8HA 4C8QA 3CCRA 4X1VA 4J8OA 3OYLA 2RM4A 4RUGA 5J39A 2ZPGB 5CKFA 3ZFJA 3VUBA 1E7OA 4QQDA 3O8VA 5GMKj 1W4SA 2E4HA 1OI1A 3OS5A 1B3QA 1R0BG 1V29B 4JRIA 2ZPFB 3V8KA 4A4HA 3C94A 2ED1A 3E1SA 2EYQA 2JW4A 4HVWA 1IZ6A 4A4EA 1Q82U 4D8DA 4EMGA 3GLXA 4PJOF 4RTZA 4XU0A 4KRTA 1I07A 4ELZC 2E1HA 4M7AD 1X2QA 3S6WA 3A5ZB 1VQ5A 3L2UA 4RG8A 5KH6A 3FLGA 2A7YA 1VQLQ 3RNJA 4MMLA 4A4GA 4AG1C 3A1PA 2KSSA 1SF9A 4C8QE 3HSBA 3I55A 2CP3A 3G7ZA 4JLGA 2VXEA 3CPWS 2DNUA 1MUZA 3M0RA 2X3WD 4R56A 2LNVA 2OAWA 1QWEA 4XTWA 2ABLA 4MZTA 5AT1B 1VQ8Q 2DF6A 2XICA 3G4SQ 1VOMA 3H41A 4DEXA 3QKJA 1N5ZA 4PJOG 2DEQA 3L2VA 2J7IA 2EBPA 2LT4A 2MAMA 5I21A 3NMZC 3RMQA 3CCST 2BZ8A 1WXUA 2QAZA 1BIAA 4E6RA 1VQLT 1I5LA 4M78G 2ZGWA 5GAN3 3E2UA 4M78B 4D8KA 1UDLA 3CXCA 4PJOA 5IXFA 3QBYA 2FRWA 2C06A 3CC7A 1AWJA 1CSKA 1MNDA 2FZKB 1BI1A 4X34A 2J05A 3UT1A 4QVDA 1YHQT 4J9EA 4MDXA 4M78A 2OTJA 1K73U 2LJ0A 2O2OA 1VQPA 4IKFA 2YUPA 1Q82R 1W2BA 2KVQG 3JCMg 3G4ST 2EJGA 2D8HA 3JSCA 1VQNQ 3VS1A 2JM9A 4EPCA 2CZ7B 3GNGA 3CBOA 2L89A 3HP9A 4B6MA 2JUFA 2R58A 1QCOA 3M4GA 2FO0A 3G71Q 2EGEA 4QT7A 5GAN7 5IHIA 1YJ9Q 1NEGA 3A8OB 2QK0A 1B7TA 2E10A 3DB4A 2HBPA 1U06A 4ZN3A 2FVUA 2CT4A 3JCMe 2LVMA 3OYIA 1WJQA 1WQWA 3NTIA 4PJOE 2KT8A 3M5AA 3OYAA 4LDUA 3M55A 2Z0WA 3OSSC 4DBRA 3OBYA 4QVZA 4JZ3A 1PCXA 4JJNK 2DL7A 4B9XA 4JJBA 5IXBA 1WPYA 4C5EA 2PVOB 3J81E 1T0HA 3CPWA 3OYHA 3G71T 1VQOA 4BACA 3R6OA 4KUIA 4ME7A 2MYSA 1YJ9T 1Q86C 2HL5C 2DO3A 1RADB 2PNIA 3M54A 1HJDA 3BY7A 2EFIA 1QP3A 1YP5A 3SDZA 5GAMd 2LC4A 1WXTA 2QQ9A 3OYYA 2FPDA 3GF5A 1K73R 3H0HA 3CCRQ 1IHWA 2XU8A 1K0XA 1PD0A 4C5IA 3R6NA 1HD3A 1PWTA 2DZCA 2L3SA 2KROA 3FB9A 4PK4A 4IUQA 1GRIA 3S3OA 1O9SA 1GBQA 4CC7A 2YRVA 4RTYA 3CCVT 3JV3A 2FRYA 1KJWA 4LUEA 1RLQC 2DBMA 3I5RA 5FRNA 4E7IA 2MWOA 4JUVA 4JJCA 3UWNA 3EFOB 5GAOq 1HSQA 4NS5A 1M1GA 1AZEA 5GJVB 4JPBW 2ENMA 1AVZC 3FEOA 4XK8E 3VJPA 1Y96B 1VQ5Q 3M57A 2ZPIB 3CCUA 3JCMP 1JB0E 5A0DA 2FL7A 1N6AA 2LQWA 3QSUA 3OMGA 2ROTA 2KGTA 2CUDA 2JTEA 3A8HB 2AIRB 1QCNA 2YUQA 1Y96A 4V2SA 1IO6A 5GAOl 4OMNA 2X4XA 1NLOC 4EMKB 1I0CA 2MPXC 3I55Q 1P92A 1UGVA 1GL5A 5GAN5 5KYWA 3C95A 2VASA 1D0XA 4LD9K 2RHZA 1B07A 4O6JA 1TOVA 4EMKA 5FWCA 4PJMA 5HY6A 1X75C 1VQ7T 4HVVA 3A98A 4LD6A 4XTUA 1R8OB 2G6FX 2M16A 1OEBA 2YXYA 1WHJA 3CC4A 1ACMB 5I22A 1PRMC 1D0ZA 1X6OA 2HZYA 1UGQB 2K57A 1SEMA 3H0FA 4J9GA 5GMKi 4KT0E 2NUZA 1WYXA 4X9CA 5KYXB 4MDWA 3CC7Q 1XNIA 2KMTA 3I55T 4M77C 3TU4K 1X2KA 3I56A 3JAME 2RI5A 2OTJQ 5GMKm 1QW1A 2ROLA 4PJNA 1VQPQ 1NYFA 1LNXA 4LDXA 1H8KA 1WQ7A 1C1AA 2AZVA 2HQHA 4BE2A 2DILA 1KSWA 2GTJA 2EVRA 1ZLMA 3M0SA 2GF7A 1KG1A 4ORZA 4E7SA 4FCYA 2HQEA 2KNBB 3MEVA 1M2OA 2H3JA 3LWIA 2HCKA 2HDAA 3CC7T 4PLLA 1S72T 2CP0A 4M7DG 1M3CA 4M7DB 1UB4A 4BY6B 2CSQA 2NUTB 2OTJT 1D3BB 2ED0A 2QQBA 3EHQA 1VIEA 1KQ1A 4M7DA 1QLYA 1NJIU 3MP6A 4DBFA 2EKOA 3M56A 2CS7A 1D3BA 2DXUA 1NLPC 5GAMj 1T3SA 4HCZA 5GAMf 2RHIA 2RD1A 1Y7XA 3CCSA 1VQOQ 2QQRA 1ARKA 2RHYA 2E3IA 3A8LB 2NWMA 1Q7YC 2BZXA 1SKUB 3QXEB 1UFFA 4AFSC 4DOWA 1B34B 2E41A 3HTRA 4LDWA 2LNHB 2X4YA 3EG0A 1RI9A 1G3YA 3HFOA 1YHQA 2CSIA 1OU8A 3EG9B 1M8VA 3NGPA 1B34A 3V8LA 4BE1A 1W1FA 2C0OA 2F2WA 2D1XA 3C12A 5ECAA 1M1FA 4FIBA 1HXDA 3PMIA 3EG9A 5GMKe 4F16A 2FG0A 3JCMX 3AT1B 4M7DE 1YNZA 2R5MA 5KCHA 1VQOT 4A4FA 3JB9I 2KYMA 2QGGA 1VUBA 3SD4A 3MKDA 2RK2A 3HPWA 5IAYA 3QHSA 2RHXA 2LJ1A 3OB9A 3CCET 3CCUQ 1WDXA 2DE0X 4C8QC 1JXMA 5GAOp 2KAFA 1PNJA 1QVGA 3V7CA 1M2VB 3C4SA 2O9VA 1QKXA 2WACA 1R0CB 1PHTA 1NJIR 2E6ZA 4R55A 4M7AG 2JTFA 2DFUA 4RKUE 4M7AB 1N8RR 2JMAA 3HKSA 3I35A 1M2VA 5DY9A 4WTOB 3L42A 2A0FB 2ZZDA 2VXFA 1K9AA 3VKIA 4J9BA 1HYOA 4M7AA 5LJ5d 1BCMA 2DD4A 1WFWA 1PD1A 5CCAA 4BI4A 1D1AA 2V8KA 1AD5A 1OPKA 3CD6T 2OAUA 3HRUA 2SEMA 3UDCA 4AFQC 4RTTA 2L5QA 1OZ3A 2RO0A 3OYKA 1Z9ZA 1VQ4T 1H92A 2CP5A 1X69A 3CC4Q 1OU9A 3V8JA 2X4WA 1OQKA 4KUDK 2QQSA 4LDVA 4M75D 1JU5C 4FT4A 2X4JA 3PIPA 2RI3A 2ZPBB 1M90U 2HMAA 4LNPA 1F1BB 4J9HA 2KDSA 3OYCA 2JOYA 3AHUA 3MEUA 2VYTA 1BB9A 3CCVA 3QZ5B 5CKBA 3CCMT 3I56Q 1YBYA 2CZ6B 4R0KA 1UJYA 5HK0A 3OS1A 2DKGA 1ZBXA 4M77D 3M0TA 1WA7A 1J3TA 3FC3A 2X9HA 2YDLA 3CC4T 5IH2A 5L23A 3S3MA 4M7AE 3L2WA 2JM8A 3LX7A 4ATOA 1UUEA 3S3NA 3DLMA 1UECA 4GY5A 4A54A 2EGAA 1BI2A 4RTXA 1ZUKA 2DYIA 4NOYA 3TCJA 4PJOC 4PNOA 3CBMA 3E19A 5KYUB 1BI0A 1TWBA 2J06A 3M58A 3I56T 2K2MA 1RL2A 1K8AU 5FU7B 1RUWA 1M9SA 1OULA 2VUBA 5KYUA 2P84A 3EG1A 2HNIA 2Y90A 5GANh 1KD1R 5FROA 2DVJA 1WLPB 3PE0A 3META 4ZGJB 1VQ7A 5IT9E 4JRQA 3QDRB 4DBHA 2VVKA 1IGQA 2AK5A 2DBKA 3CCLT 2RMOA 2EQKA 5I2SA 1KHCA 2FPEA 2KRSA 2FZGB 3CBPA 1TS9A 2XK0A 4FU6A 1ZSZB 3PGGA 1UE9A 4M78F 4C0ZA 4A63B 1TTHB 5FLXE 3CCSQ 3PNWC 2W0ZA 2DX1A 1YJWA 1UEBA 1ZSZA 1ZUYA 3H8ZA 1ZSGA 3J80E 1SSHA 1YWPA 1BIBA 5I2MA 1YHQQ 1K4US 3X28B 3ZL7C 1NYGA 4E7KA 5CK9A 3ZBDA 1RLPC 3P8HA 2RA2A 4JLIA 1FMKA 2EQJA 3LWHA 1WI7A 4C92D 3RBBB 2P0QA 3L1AA 1K9MC 1UTIA 4CC4B 2EIFA 2EW3A 2DTHA 3OBWA 3DLLA 1TUCA 1JJ2P 1O75A 1M8MA 3V7RA 2FYKA 4O5VA 3M4YA 2CH4A 1A0NB 3T9NA 1UHCA 1QP2A 4M4ZA 1UJ0A 1S72A 4IURA 1FMWA 4N0AA 1K8AR 2LQNA 3RDVA 5GMKl 1VIFA 4IIMA 1PSFA 1BI3A 2F1LA 1LVKA 2KXCA 2GTOA 5LJ5f 2LQ8A 2VB6A 5LJ3h 5M9OA 1QVFP 4GLKA 3UA7A 5J3BA 5KCOA 5GAN8 4XAXB 1SRLA 3M9QA 2K5LA 1BYMA 2F5TX 2KR3A 3OYNA 3NPFA 2A28A 4FT2A 2G3RA 3QYGB 2AT1B 2CP2A 2CDTA 1H3ZA 4ZN1A 3NTKA 2AZSA 2D8JA 3WVEB 1OYXA 4JRKA 4K11A 1YCYA 3FIFA 3L2ZA 2L0AA 2XIDA 5A2QE 2IVWA 2JN0A 2LX9A 4Z02A 2X51A 4FYXB 3LLRA 2K6DA 3CMAA 3PMTA 2KK4A 2KRMA 2AHJB 2AKKA 1Q81C 4M78E 3CCVQ 2HD0A 5HKCA 2VGNA 2RQWA 1WHMA 3VRZA 4JS5A 4XU3A 5LJ5h 3TSWA 1VQKT 2D6FA 2GBQA 2YRDA 1Z9QA 2L2PA 2QXFA 2E5KA 1MNEA 4ZTJA 1K9MU 2CYZB 2OI3A 4FL6A 4Y28E 3G6EA 4FSSA 3H9NA 3JB9D 3FDRA 2KT1A 4LDYA 1X27A 3QYHB 3CCEA 4CI0C 4WF2A 2V1QA 2QQAA 4NL3A 1MMNA 1QMCA 3URGA 3HRSA 3L2RA 1QQJA 4HT9A 2HBWA 2CZ1B 5GAMg 5A0GA 1PKTA 4OVAA 3MP1A 1ABOA 1OV3A 3PVLA 2RN8A 1VQ6A 1MMAA 3REAB 5KE3A 2KY9A 2R5AA 3OYFA 4BB7A 2HSPA 3CD6A 1VQ7Q 3TREA 2B86A 2XKOC 2DLPA 4OB3B 4IIOA 1VQ4A 3M59A 4IUVA 3EFOA 4JZ4A 2K3BA 2LZ6B 4VUBA 3VS5A 5L8RE 3HL8A 2D0NA 2YLBA 4OMQA 2Y4XA 3QO3A 5GAMe 1RAEB 4ZGEB 4CC2A 3N5BB 1YJWQ 1BKBA 1VQMA 2K5FA 2LTOA 3U23A 9ATCB 1SHFA 2LJ3A 3CCMA 1CKAA 3BW1A 4C0DB 2K4YA 4HA8A 4OMOA 3BE3A 1G2BA 1Q81U 4HXJA 3CXCP 2OJ2A 2LDMA 4ANJA 3RR6A 5CKDA 5CKHA 1TUGB 2RI2A 4RTVA 2YT6A 3OYGA 2E12A 2JS2A 1N8RC 1D1CA 1I81A 1D0YA 1Q86U 1NE8A 3JCMQ 1ZX6A 3EG2A 2RHUA 2QEXA 1W2BP 4M7DF 2DD5A 1YJWT 3FRNA 1XQHA 5DLOA 1M1KC 1R77A 2RF0A 2YWWA 1S72Q 1G83A 4IUUA 1X43A 5GJWB 2I0NA 4J9IA 5KYXA 3VS4A 1EIFA 4FYWB 5CAIA 4J7FA 3WXMB 4KBMB 3MCAB 5GANd 4OB1B 1FX7A 1M3AA 5D6YA 4M75F 1NPRA 3O5ZA 1EZZB 1D1BA 4LN2A 1MMDA 2M0YA 4HCCA 2QASA 1Y07A 3PIOA 1SPKA 2CP6A 3QJ6A 2XDDA 3CCLA 1YIJT 2KRNA 5GAOn 2JZ2A 3RKWA 3NTHA 3HRTA 5GAOr 3A8GB 3P8BB 1BK2A 5FWBA 1KC8C 3OYEA 1U3OA 2JTMA 4LUDA 4XU1A 4F7UF 4ZNXA 4YTLA 1LJOA 4PJLA 2JT4A 3RERA 1E6GA 3JCMJ 3JCMV 3JB9J 1KK7A 1JJ2S 5AYFA 3EH2A 5DLQE 3CMAQ 2NUTA 3JCMh 3INZA 2P4TA 3CQTA 2HKNA 3OW2P 3MEWA 4M75G 2EGCA 1OZ2A 1UGPB 2DAQA 4KH0B 4M75B 4BE0A 1KFZA 2LT1A 4DEYA 1Q86R 4J6WA 2CP7A 2L3RA 5FU6C 1SG5A 4M75A 2VC8A 1QVFS 2O4XB 3PFSA 3LGFA 1FXXA 3G6EQ 1MV0B 4CRIA 2PVGB 4E47A 2YSQA 4OF1A 2EYXA 4F7UG 4F7UB 2VGMA 2ATCB 3CCEQ 2P4RA 2O4XA 5J26A 5DM7R 4M7AF 4N4HA 1V76A 4M77G 4M77B 1GFCA 1SRMA 3CMAT 2EYYA 5LJ3d 2E3HA 4F7UA 3CMET 2E6NA 4ZGDB 2E65A 2QA4T 3M0UA 4M77A 8AT1B 2DMOA 2V26A 2RJEA 4OMFB 3EGXB 1Y57A 2HL3A 1VQ6Q 5KYNA 4E7HA 2RJDA 1K0SA 1SSFA 4J9DA 1Y0MA 1LPLA 3CD6Q 1QKWA 4F04B 3EGXA 1JQQA 3G6ET 2ZCFB 1WXBA 4CC3A 1N27A 1VQ4Q 3I9QA 3CCJT 4B9WA 5FW9A 4C92F 3DB3A 3SWNC 4DOVA 4M75E 1S1NA 2XG8D 2DZ9A 5I11A 1UGRB 3GNFB 2IPOB 1RAAB 4J83A 2EJ9A 3VS6A 3QIIA 1VQMQ 3RMSA 2GFAA 2H3EB 2MIOA 1IB8A 4MZMA 4OMPA 3CCMQ 1FMVA 4EMHA 2VKNA 5KE2A 1VQ6T 3CCQT 4C0GA 4F7UE 1YI2T 1JBMA 1VQKA 3VRYA 4E7ZA 2CT3A 5FU7C 2CKKA 4M77E 1DJ7B 3CEYA 1Q82C 2E70A 1UHFA 1PKSA 5LJ5g 2EYZA 1M3BA 1Q7YU 2QEXQ 1ZQ1A 2L8DA 2EQMA 5GANj 1NBEB 2NUPB 1VQ9A 4C92G 5GANf 4C92B 1VQMT 1X01A 3UPUA 3HHTB 2WSFE 2RQUA 1QVFA 4FYVB 3X25B 2DJZA 2MMPA 2J6OA 2NUPA 2VV5A 3OY9A 2BE7D 1FYNA 2KBTA 4C92A 5GAN2 1GCQA 2K2VA 4AFZC 2BTTA 4KH1B 4C5GA 3P8DA 3M53A 5LJ5e 2PQWA 1MGQA 4MMKA 2IIMA 3X24B 1G3TA 4X9DA 2JS0A 2VWFA 1N9SA 3LYIA 2KXDA 3CCLQ 1X6GA 2DJQA 2KE9A 1OOTA 4KGZB 1G8XA 5LL6S 2QEXT 2ZPEB 3TQ7P 2RQTA 3NFCA 2EAYA 3OS0A 1MHNA 2OTLT 4Z8AA 1VYUA 2K3YA 2DRMA 1PM3A 4M78C 3RUXA 2V8JA 2DERA 5GAN6 3JB9F 3OA6A 1AHJB 1TH7A 1W2BS 4OP0A 1K73C 3MEAA 4PFPA 2QYZA 4AT1B 4C92E 3L2QA 5FRMA 1LOJA 2L3PA 3QJYA 1WNLA 4LE9A 2DM1A 1Q7YR 2EKHA 1TG0A 3UF4A 2KI7A 1ABQA 6AT1B 1M90R 2HKQB 4Y92A 1YCSB 5LJ3j 1BCOA 5LJ3f 2SRCA 2AKLA 2LCLA 2LRQA 5D6XA 2XHCA 1IRXA 2YUNA 4JDSA 1RABB 1D09B 5IN1A 3GIBA 1C6VX 3BDUA 2BIVA 2K9GA 3A8MB 2DL3A 1U5SA 2F2XA 3JB9G 3QDFA 3CC2Q 3JCMc 2WSEE 2KEAA 2NLUA 3ME9A 1QVGP 1YIJA 2P0PA 4HT8A 3SEMA 3QUIA 3THKA 2CUBA 2DEUA 2GNCA 2RH2A 2B8AA 5GAN4 3VYGA 2M1HA 4EIKA 5GMKh 2K79A 3OYBA 4BI3A 2LQKA 1WX6A 2LP5A 3RIRA 3OW2S 3D7SB 5D7UA 2A3LA 4PJOB 2DL8A 2D9TA 1ZHIA 2DTOA 1RAIB 5LJ5j 3M0QA 4D6WA 5CVIA 3X20B 4L59A 4XQ3A 3EGUA 3CC2T 2O31A 1T0JA 2K3XA 4C8QD 3JCMd 3OSVA 4DQ2A 3EG3A 2BZYA 1M5Q1 4C0FA 3VYHB 1X6BA 2KQWA 3JCMW 3VU3C 3M0PA 2D0QB 4QW2A 1VQKQ 2XI9A 2RB6A 1K1ZA 1VQ8T 2JVVA 2RQVA 2CH4W 1NPPA 3NHNA 3WVDB 2GGRA 1U1SA 4KULA 1AWOA 1PG5B 3EAEA 3VS0A 1Y71A 1EX4A 4TVRA 1H641 4QVCA 2PZ1A 1KQSP 3JB9H 1VQ9Q 4RCCA 1WHGA 1M4ZA 1GBRA 1JRIA 2A37A 2DA9A 2DL4A 4AFUC 4OB2B 3CMEA 2DYBA 2RQRA 1T3LA 3TSZA 2QA4A 3REBB 5CKEA 2K7AA 3ULRB 4BDZA 1WHKA 2CZ0B 3PT9A 2M9UA 2X35A 1QWFA 2LMJA 1XJWB 2M02A 3EGDB 3DKMA 1NG2A 2ESWA 4EMKC 5IHKA 1OPLA 1WHHA 3H6ZA 2FHDA 1VQNT 3FJ5A 2ZPHB 4C0DC 4FM4B 3C0CA 4F14A 3EGDA 2DETA 1YFNA 1I5OB 2MCNA 3Q1JA 4LXCA 4JRPA 2WSCE 3CCJA 2Y4YA 2XDPA 1WJSA 3QZ9B 4OMLA 4JJDA 1VQ9T 2DPPB 1YN8A 2EJFA 4A4KA 2MF2A 1QCFA 2F2VA 2GQVA 2EWNA 3E9FA 3HFNA 2DK3A 4BI8B 5CR2A 3OW2A 1UG1A 1H3HA 1WIEA 2XDBA 2KYBA 4IUPA 4RG2A 4N4IA 3E9GA 2COZA 4PJOD 2R57A 2RK1A 3MO8A 3CCQA 1HK9A 1YI2A 1G3WA 3MP8A 4AG2C 1EFNA 4Z89A 2QGFB 3I5SA 3SFMA 4E2FB 4ZTFA 1TU0B 4M78D 2O88A 1FWZA 1MMGA 1VYTA 2QDLA 3CPFA 4E7LA 2OX7A 2PUKB 1TUDA 4OGCA 1XTDA 4L6V5 4ELYC 2JXBA 2ECZA 5CQYA 4FW2A 2M0OA 3VS2A 3MJXA 4MZPA 2V8IA 4FSXA 2J6FA 3PVQA 2W10A 3QWYA 3CCRT 1YJNA 4P5NA 3IQLA 1IXDA 1BBZA 2YUOA 1E6HA 1SHGA 4M7DC 2YHTA 5KYWB 4FW1A 1K9MR 4BY6C 2MWPA 1MV3A 1YITA 4PFOA 5C6SA 3BDLA 4OMMA 4ESRA 1U8RA 1NJIC 2C0TA 1YIJQ 2DIQA 4Q5WA 4PFZA 1AOJA 2O01E 2CGHA 1RACB 2RNAA 3BFMA 4II1A 4M75C 2RJFA 4PL6A 4XTYA 8ATCB 1UGSB 2P0KA 2L3QA 1WJRA
chains in the Genus database with same CATH topology
5D7UA 4FW2A 1C0MA 1C6VX 1IHVA 4FW1A 1C1AA 1IHWA 1EX4A 1QMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7U A;  4FW2 A;  1C0M A;  1C6V X;  1IHV A;  4FW1 A;  1C1A A;  1IHW A;  1EX4 A;  1QMC A; 
#chains in the Genus database with same CATH topology
 3QPH A;  3JCM f;  3LH0 A;  3OYD A;  2OTL A;  1VQ5 T;  4RMO A;  2RPN A;  1NEB A;  2V1R A;  3KUF A;  3UAT A;  3QWX X;  1JXO A;  2GCX A;  1VYV A;  3H0I A;  2BUD A;  2JJ9 A;  5HK3 A;  2DXC A;  3RKX A;  5IHN A;  1IHV A;  4DA4 A;  3PTA A;  3VV0 A;  4HKE A;  4HVU A;  3MHX A;  2E5Q A;  3G1J A;  1W6X A;  1TSF A;  4J7I A;  5GAN g;  1XOV A;  4HCK A;  1K76 A;  2M51 A;  3MPU B;  2X3X D;  3OS2 A;  1RAH B;  1KHI A;  4XTZ A;  5CQX A;  3VS7 A;  4F17 A;  3JCM b;  2XMF A;  4M77 F;  4A53 A;  1G3S A;  3OMC A;  3TVT A;  1QVG S;  2O9S A;  3CPW P;  3VS3 A;  2GFU A;  2EPD A;  3EH1 A;  1RI0 A;  4RTW A;  4QKU A;  1Q81 R;  1NM7 A;  3QG1 A;  2QI2 A;  1N9R A;  5C0M A;  5D6W A;  1PC0 A;  3CME Q;  4RCB A;  1ZUU A;  5GAN e;  3RKY A;  1TXQ A;  3JRZ A;  2QA4 Q;  1IRE B;  1W70 A;  4PKC C;  4WCI A;  2COY A;  1KQ2 A;  3GBQ A;  3V7S A;  3GPL A;  4M7A C;  1VQP T;  1AWW A;  1V1C A;  2LCS A;  4KGV B;  1PSE A;  2A36 A;  5CO7 A;  4JS4 A;  3KXT A;  1N8R U;  1I4K 1;  1KD1 C;  4KGX B;  4UC4 A;  3X26 B;  2DTI A;  1IGU A;  1KIK A;  1AT1 B;  1M27 C;  1WZO A;  4FYY B;  3OYM A;  4RTU A;  1QVP A;  3CCJ Q;  4EDU A;  2PU9 B;  3FJP A;  1G5V A;  2MI6 A;  4XTV A;  1JEG A;  2DXB A;  1M1K U;  1VQL A;  3ZEH A;  2PUO B;  2F5K A;  2HEQ A;  2HAX A;  2XD0 A;  3CC2 A;  1M90 C;  4N4G A;  5KYY B;  2K5I A;  2QDY B;  2YRC A;  4C92 C;  4J5Y A;  3LH5 A;  4BUG A;  2E64 A;  2DIG A;  1GCQ C;  4OGE A;  1Q95 G;  2EQU A;  5LJ3 g;  3CCQ Q;  1YI2 Q;  1KQS S;  5KYY A;  3KBG A;  5CIU A;  2PVD B;  1VQ8 A;  3G4S A;  2QTX A;  2JNG A;  4E7J A;  2J6K A;  2DRK A;  1KC8 U;  1I1J A;  4J9C A;  1NZ9 A;  2DL5 A;  3KFV A;  5EG2 A;  3GP8 A;  4J6X A;  1RAF B;  3SB2 A;  1M30 A;  2BE9 B;  4J6Y A;  1OX9 A;  1WGS A;  1YWO A;  2GQI A;  3EHR A;  1AWX A;  1PRL C;  2QTV A;  3OYJ A;  4QQG A;  1RAG B;  5LJ3 e;  5GAM h;  5EC7 A;  1LCK A;  2JMC A;  4L5G A;  1AZG B;  1YJN Q;  2YLC A;  3GOX A;  3EFS A;  1K8A C;  2DXT A;  4XTX A;  1JJ2 A;  1CKB A;  2FPF A;  1YIT Q;  3LW5 E;  4C5H A;  4QQ6 A;  1AEY A;  2I2L A;  4OB0 B;  1VQN A;  4IUT A;  4PLI A;  3UA6 A;  1ZBJ A;  5GAO m;  2RJC A;  2LX7 A;  5FU6 B;  3EFR A;  1GFD A;  4M7D D;  3RES A;  4PJJ A;  1GXI E;  1U1T A;  4C8Q F;  4NL2 A;  4GBQ A;  3ASK A;  2QG9 B;  1KD1 U;  4AMC A;  4J9F A;  3G71 A;  1M1K R;  2BKD N;  4HCB A;  2FZC B;  2ZAE A;  1ZSZ C;  1YJ9 A;  1BU1 A;  5A0L A;  3F70 A;  3SHW A;  2LCC A;  2IG0 A;  2OTL Q;  3OQ5 A;  3CCU T;  1YJN T;  5HCK A;  2MOX A;  2HSE B;  2FB7 A;  2EQI A;  1VA7 A;  1ZA2 B;  3J7A F;  4BD3 A;  2PTK A;  1YIT T;  7AT1 B;  1WHL A;  4DBQ A;  3LGL A;  2FEI A;  2NYS A;  4Z88 A;  4GLM A;  1KC8 R;  3VUZ A;  1JO8 A;  1OX8 A;  3ER0 A;  1I8F A;  2A08 A;  4Y91 A;  1C0M A;  2HQX A;  4XU2 A;  3CXC S;  1KQS A;  4C8Q G;  3SWN B;  4C8Q B;  2COW A;  1GCP A;  3TEE A;  2CRE A;  2MK5 A;  2EYW A;  4BDY A;  4N0A C;  2F69 A;  1ZA1 B;  2DVE A;  2C0I A;  3SWN A;  2H8H A;  4C8Q A;  3CCR A;  4X1V A;  4J8O A;  3OYL A;  2RM4 A;  4RUG A;  5J39 A;  2ZPG B;  5CKF A;  3ZFJ A;  3VUB A;  1E7O A;  4QQD A;  3O8V A;  5GMK j;  1W4S A;  2E4H A;  1OI1 A;  3OS5 A;  1B3Q A;  1R0B G;  1V29 B;  4JRI A;  2ZPF B;  3V8K A;  4A4H A;  3C94 A;  2ED1 A;  3E1S A;  2EYQ A;  2JW4 A;  4HVW A;  1IZ6 A;  4A4E A;  1Q82 U;  4D8D A;  4EMG A;  3GLX A;  4PJO F;  4RTZ A;  4XU0 A;  4KRT A;  1I07 A;  4ELZ C;  2E1H A;  4M7A D;  1X2Q A;  3S6W A;  3A5Z B;  1VQ5 A;  3L2U A;  4RG8 A;  5KH6 A;  3FLG A;  2A7Y A;  1VQL Q;  3RNJ A;  4MML A;  4A4G A;  4AG1 C;  3A1P A;  2KSS A;  1SF9 A;  4C8Q E;  3HSB A;  3I55 A;  2CP3 A;  3G7Z A;  4JLG A;  2VXE A;  3CPW S;  2DNU A;  1MUZ A;  3M0R A;  2X3W D;  4R56 A;  2LNV A;  2OAW A;  1QWE A;  4XTW A;  2ABL A;  4MZT A;  5AT1 B;  1VQ8 Q;  2DF6 A;  2XIC A;  3G4S Q;  1VOM A;  3H41 A;  4DEX A;  3QKJ A;  1N5Z A;  4PJO G;  2DEQ A;  3L2V A;  2J7I A;  2EBP A;  2LT4 A;  2MAM A;  5I21 A;  3NMZ C;  3RMQ A;  3CCS T;  2BZ8 A;  1WXU A;  2QAZ A;  1BIA A;  4E6R A;  1VQL T;  1I5L A;  4M78 G;  2ZGW A;  5GAN 3;  3E2U A;  4M78 B;  4D8K A;  1UDL A;  3CXC A;  4PJO A;  5IXF A;  3QBY A;  2FRW A;  2C06 A;  3CC7 A;  1AWJ A;  1CSK A;  1MND A;  2FZK B;  1BI1 A;  4X34 A;  2J05 A;  3UT1 A;  4QVD A;  1YHQ T;  4J9E A;  4MDX A;  4M78 A;  2OTJ A;  1K73 U;  2LJ0 A;  2O2O A;  1VQP A;  4IKF A;  2YUP A;  1Q82 R;  1W2B A;  2KVQ G;  3JCM g;  3G4S T;  2EJG A;  2D8H A;  3JSC A;  1VQN Q;  3VS1 A;  2JM9 A;  4EPC A;  2CZ7 B;  3GNG A;  3CBO A;  2L89 A;  3HP9 A;  4B6M A;  2JUF A;  2R58 A;  1QCO A;  3M4G A;  2FO0 A;  3G71 Q;  2EGE A;  4QT7 A;  5GAN 7;  5IHI A;  1YJ9 Q;  1NEG A;  3A8O B;  2QK0 A;  1B7T A;  2E10 A;  3DB4 A;  2HBP A;  1U06 A;  4ZN3 A;  2FVU A;  2CT4 A;  3JCM e;  2LVM A;  3OYI A;  1WJQ A;  1WQW A;  3NTI A;  4PJO E;  2KT8 A;  3M5A A;  3OYA A;  4LDU A;  3M55 A;  2Z0W A;  3OSS C;  4DBR A;  3OBY A;  4QVZ A;  4JZ3 A;  1PCX A;  4JJN K;  2DL7 A;  4B9X A;  4JJB A;  5IXB A;  1WPY A;  4C5E A;  2PVO B;  3J81 E;  1T0H A;  3CPW A;  3OYH A;  3G71 T;  1VQO A;  4BAC A;  3R6O A;  4KUI A;  4ME7 A;  2MYS A;  1YJ9 T;  1Q86 C;  2HL5 C;  2DO3 A;  1RAD B;  2PNI A;  3M54 A;  1HJD A;  3BY7 A;  2EFI A;  1QP3 A;  1YP5 A;  3SDZ A;  5GAM d;  2LC4 A;  1WXT A;  2QQ9 A;  3OYY A;  2FPD A;  3GF5 A;  1K73 R;  3H0H A;  3CCR Q;  1IHW A;  2XU8 A;  1K0X A;  1PD0 A;  4C5I A;  3R6N A;  1HD3 A;  1PWT A;  2DZC A;  2L3S A;  2KRO A;  3FB9 A;  4PK4 A;  4IUQ A;  1GRI A;  3S3O A;  1O9S A;  1GBQ A;  4CC7 A;  2YRV A;  4RTY A;  3CCV T;  3JV3 A;  2FRY A;  1KJW A;  4LUE A;  1RLQ C;  2DBM A;  3I5R A;  5FRN A;  4E7I A;  2MWO A;  4JUV A;  4JJC A;  3UWN A;  3EFO B;  5GAO q;  1HSQ A;  4NS5 A;  1M1G A;  1AZE A;  5GJV B;  4JPB W;  2ENM A;  1AVZ C;  3FEO A;  4XK8 E;  3VJP A;  1Y96 B;  1VQ5 Q;  3M57 A;  2ZPI B;  3CCU A;  3JCM P;  1JB0 E;  5A0D A;  2FL7 A;  1N6A A;  2LQW A;  3QSU A;  3OMG A;  2ROT A;  2KGT A;  2CUD A;  2JTE A;  3A8H B;  2AIR B;  1QCN A;  2YUQ A;  1Y96 A;  4V2S A;  1IO6 A;  5GAO l;  4OMN A;  2X4X A;  1NLO C;  4EMK B;  1I0C A;  2MPX C;  3I55 Q;  1P92 A;  1UGV A;  1GL5 A;  5GAN 5;  5KYW A;  3C95 A;  2VAS A;  1D0X A;  4LD9 K;  2RHZ A;  1B07 A;  4O6J A;  1TOV A;  4EMK A;  5FWC A;  4PJM A;  5HY6 A;  1X75 C;  1VQ7 T;  4HVV A;  3A98 A;  4LD6 A;  4XTU A;  1R8O B;  2G6F X;  2M16 A;  1OEB A;  2YXY A;  1WHJ A;  3CC4 A;  1ACM B;  5I22 A;  1PRM C;  1D0Z A;  1X6O A;  2HZY A;  1UGQ B;  2K57 A;  1SEM A;  3H0F A;  4J9G A;  5GMK i;  4KT0 E;  2NUZ A;  1WYX A;  4X9C A;  5KYX B;  4MDW A;  3CC7 Q;  1XNI A;  2KMT A;  3I55 T;  4M77 C;  3TU4 K;  1X2K A;  3I56 A;  3JAM E;  2RI5 A;  2OTJ Q;  5GMK m;  1QW1 A;  2ROL A;  4PJN A;  1VQP Q;  1NYF A;  1LNX A;  4LDX A;  1H8K A;  1WQ7 A;  1C1A A;  2AZV A;  2HQH A;  4BE2 A;  2DIL A;  1KSW A;  2GTJ A;  2EVR A;  1ZLM A;  3M0S A;  2GF7 A;  1KG1 A;  4ORZ A;  4E7S A;  4FCY A;  2HQE A;  2KNB B;  3MEV A;  1M2O A;  2H3J A;  3LWI A;  2HCK A;  2HDA A;  3CC7 T;  4PLL A;  1S72 T;  2CP0 A;  4M7D G;  1M3C A;  4M7D B;  1UB4 A;  4BY6 B;  2CSQ A;  2NUT B;  2OTJ T;  1D3B B;  2ED0 A;  2QQB A;  3EHQ A;  1VIE A;  1KQ1 A;  4M7D A;  1QLY A;  1NJI U;  3MP6 A;  4DBF A;  2EKO A;  3M56 A;  2CS7 A;  1D3B A;  2DXU A;  1NLP C;  5GAM j;  1T3S A;  4HCZ A;  5GAM f;  2RHI A;  2RD1 A;  1Y7X A;  3CCS A;  1VQO Q;  2QQR A;  1ARK A;  2RHY A;  2E3I A;  3A8L B;  2NWM A;  1Q7Y C;  2BZX A;  1SKU B;  3QXE B;  1UFF A;  4AFS C;  4DOW A;  1B34 B;  2E41 A;  3HTR A;  4LDW A;  2LNH B;  2X4Y A;  3EG0 A;  1RI9 A;  1G3Y A;  3HFO A;  1YHQ A;  2CSI A;  1OU8 A;  3EG9 B;  1M8V A;  3NGP A;  1B34 A;  3V8L A;  4BE1 A;  1W1F A;  2C0O A;  2F2W A;  2D1X A;  3C12 A;  5ECA A;  1M1F A;  4FIB A;  1HXD A;  3PMI A;  3EG9 A;  5GMK e;  4F16 A;  2FG0 A;  3JCM X;  3AT1 B;  4M7D E;  1YNZ A;  2R5M A;  5KCH A;  1VQO T;  4A4F A;  3JB9 I;  2KYM A;  2QGG A;  1VUB A;  3SD4 A;  3MKD A;  2RK2 A;  3HPW A;  5IAY A;  3QHS A;  2RHX A;  2LJ1 A;  3OB9 A;  3CCE T;  3CCU Q;  1WDX A;  2DE0 X;  4C8Q C;  1JXM A;  5GAO p;  2KAF A;  1PNJ A;  1QVG A;  3V7C A;  1M2V B;  3C4S A;  2O9V A;  1QKX A;  2WAC A;  1R0C B;  1PHT A;  1NJI R;  2E6Z A;  4R55 A;  4M7A G;  2JTF A;  2DFU A;  4RKU E;  4M7A B;  1N8R R;  2JMA A;  3HKS A;  3I35 A;  1M2V A;  5DY9 A;  4WTO B;  3L42 A;  2A0F B;  2ZZD A;  2VXF A;  1K9A A;  3VKI A;  4J9B A;  1HYO A;  4M7A A;  5LJ5 d;  1BCM A;  2DD4 A;  1WFW A;  1PD1 A;  5CCA A;  4BI4 A;  1D1A A;  2V8K A;  1AD5 A;  1OPK A;  3CD6 T;  2OAU A;  3HRU A;  2SEM A;  3UDC A;  4AFQ C;  4RTT A;  2L5Q A;  1OZ3 A;  2RO0 A;  3OYK A;  1Z9Z A;  1VQ4 T;  1H92 A;  2CP5 A;  1X69 A;  3CC4 Q;  1OU9 A;  3V8J A;  2X4W A;  1OQK A;  4KUD K;  2QQS A;  4LDV A;  4M75 D;  1JU5 C;  4FT4 A;  2X4J A;  3PIP A;  2RI3 A;  2ZPB B;  1M90 U;  2HMA A;  4LNP A;  1F1B B;  4J9H A;  2KDS A;  3OYC A;  2JOY A;  3AHU A;  3MEU A;  2VYT A;  1BB9 A;  3CCV A;  3QZ5 B;  5CKB A;  3CCM T;  3I56 Q;  1YBY A;  2CZ6 B;  4R0K A;  1UJY A;  5HK0 A;  3OS1 A;  2DKG A;  1ZBX A;  4M77 D;  3M0T A;  1WA7 A;  1J3T A;  3FC3 A;  2X9H A;  2YDL A;  3CC4 T;  5IH2 A;  5L23 A;  3S3M A;  4M7A E;  3L2W A;  2JM8 A;  3LX7 A;  4ATO A;  1UUE A;  3S3N A;  3DLM A;  1UEC A;  4GY5 A;  4A54 A;  2EGA A;  1BI2 A;  4RTX A;  1ZUK A;  2DYI A;  4NOY A;  3TCJ A;  4PJO C;  4PNO A;  3CBM A;  3E19 A;  5KYU B;  1BI0 A;  1TWB A;  2J06 A;  3M58 A;  3I56 T;  2K2M A;  1RL2 A;  1K8A U;  5FU7 B;  1RUW A;  1M9S A;  1OUL A;  2VUB A;  5KYU A;  2P84 A;  3EG1 A;  2HNI A;  2Y90 A;  5GAN h;  1KD1 R;  5FRO A;  2DVJ A;  1WLP B;  3PE0 A;  3MET A;  4ZGJ B;  1VQ7 A;  5IT9 E;  4JRQ A;  3QDR B;  4DBH A;  2VVK A;  1IGQ A;  2AK5 A;  2DBK A;  3CCL T;  2RMO A;  2EQK A;  5I2S A;  1KHC A;  2FPE A;  2KRS A;  2FZG B;  3CBP A;  1TS9 A;  2XK0 A;  4FU6 A;  1ZSZ B;  3PGG A;  1UE9 A;  4M78 F;  4C0Z A;  4A63 B;  1TTH B;  5FLX E;  3CCS Q;  3PNW C;  2W0Z A;  2DX1 A;  1YJW A;  1UEB A;  1ZSZ A;  1ZUY A;  3H8Z A;  1ZSG A;  3J80 E;  1SSH A;  1YWP A;  1BIB A;  5I2M A;  1YHQ Q;  1K4U S;  3X28 B;  3ZL7 C;  1NYG A;  4E7K A;  5CK9 A;  3ZBD A;  1RLP C;  3P8H A;  2RA2 A;  4JLI A;  1FMK A;  2EQJ A;  3LWH A;  1WI7 A;  4C92 D;  3RBB B;  2P0Q A;  3L1A A;  1K9M C;  1UTI A;  4CC4 B;  2EIF A;  2EW3 A;  2DTH A;  3OBW A;  3DLL A;  1TUC A;  1JJ2 P;  1O75 A;  1M8M A;  3V7R A;  2FYK A;  4O5V A;  3M4Y A;  2CH4 A;  1A0N B;  3T9N A;  1UHC A;  1QP2 A;  4M4Z A;  1UJ0 A;  1S72 A;  4IUR A;  1FMW A;  4N0A A;  1K8A R;  2LQN A;  3RDV A;  5GMK l;  1VIF A;  4IIM A;  1PSF A;  1BI3 A;  2F1L A;  1LVK A;  2KXC A;  2GTO A;  5LJ5 f;  2LQ8 A;  2VB6 A;  5LJ3 h;  5M9O A;  1QVF P;  4GLK A;  3UA7 A;  5J3B A;  5KCO A;  5GAN 8;  4XAX B;  1SRL A;  3M9Q A;  2K5L A;  1BYM A;  2F5T X;  2KR3 A;  3OYN A;  3NPF A;  2A28 A;  4FT2 A;  2G3R A;  3QYG B;  2AT1 B;  2CP2 A;  2CDT A;  1H3Z A;  4ZN1 A;  3NTK A;  2AZS A;  2D8J A;  3WVE B;  1OYX A;  4JRK A;  4K11 A;  1YCY A;  3FIF A;  3L2Z A;  2L0A A;  2XID A;  5A2Q E;  2IVW A;  2JN0 A;  2LX9 A;  4Z02 A;  2X51 A;  4FYX B;  3LLR A;  2K6D A;  3CMA A;  3PMT A;  2KK4 A;  2KRM A;  2AHJ B;  2AKK A;  1Q81 C;  4M78 E;  3CCV Q;  2HD0 A;  5HKC A;  2VGN A;  2RQW A;  1WHM A;  3VRZ A;  4JS5 A;  4XU3 A;  5LJ5 h;  3TSW A;  1VQK T;  2D6F A;  2GBQ A;  2YRD A;  1Z9Q A;  2L2P A;  2QXF A;  2E5K A;  1MNE A;  4ZTJ A;  1K9M U;  2CYZ B;  2OI3 A;  4FL6 A;  4Y28 E;  3G6E A;  4FSS A;  3H9N A;  3JB9 D;  3FDR A;  2KT1 A;  4LDY A;  1X27 A;  3QYH B;  3CCE A;  4CI0 C;  4WF2 A;  2V1Q A;  2QQA A;  4NL3 A;  1MMN A;  1QMC A;  3URG A;  3HRS A;  3L2R A;  1QQJ A;  4HT9 A;  2HBW A;  2CZ1 B;  5GAM g;  5A0G A;  1PKT A;  4OVA A;  3MP1 A;  1ABO A;  1OV3 A;  3PVL A;  2RN8 A;  1VQ6 A;  1MMA A;  3REA B;  5KE3 A;  2KY9 A;  2R5A A;  3OYF A;  4BB7 A;  2HSP A;  3CD6 A;  1VQ7 Q;  3TRE A;  2B86 A;  2XKO C;  2DLP A;  4OB3 B;  4IIO A;  1VQ4 A;  3M59 A;  4IUV A;  3EFO A;  4JZ4 A;  2K3B A;  2LZ6 B;  4VUB A;  3VS5 A;  5L8R E;  3HL8 A;  2D0N A;  2YLB A;  4OMQ A;  2Y4X A;  3QO3 A;  5GAM e;  1RAE B;  4ZGE B;  4CC2 A;  3N5B B;  1YJW Q;  1BKB A;  1VQM A;  2K5F A;  2LTO A;  3U23 A;  9ATC B;  1SHF A;  2LJ3 A;  3CCM A;  1CKA A;  3BW1 A;  4C0D B;  2K4Y A;  4HA8 A;  4OMO A;  3BE3 A;  1G2B A;  1Q81 U;  4HXJ A;  3CXC P;  2OJ2 A;  2LDM A;  4ANJ A;  3RR6 A;  5CKD A;  5CKH A;  1TUG B;  2RI2 A;  4RTV A;  2YT6 A;  3OYG A;  2E12 A;  2JS2 A;  1N8R C;  1D1C A;  1I81 A;  1D0Y A;  1Q86 U;  1NE8 A;  3JCM Q;  1ZX6 A;  3EG2 A;  2RHU A;  2QEX A;  1W2B P;  4M7D F;  2DD5 A;  1YJW T;  3FRN A;  1XQH A;  5DLO A;  1M1K C;  1R77 A;  2RF0 A;  2YWW A;  1S72 Q;  1G83 A;  4IUU A;  1X43 A;  5GJW B;  2I0N A;  4J9I A;  5KYX A;  3VS4 A;  1EIF A;  4FYW B;  5CAI A;  4J7F A;  3WXM B;  4KBM B;  3MCA B;  5GAN d;  4OB1 B;  1FX7 A;  1M3A A;  5D6Y A;  4M75 F;  1NPR A;  3O5Z A;  1EZZ B;  1D1B A;  4LN2 A;  1MMD A;  2M0Y A;  4HCC A;  2QAS A;  1Y07 A;  3PIO A;  1SPK A;  2CP6 A;  3QJ6 A;  2XDD A;  3CCL A;  1YIJ T;  2KRN A;  5GAO n;  2JZ2 A;  3RKW A;  3NTH A;  3HRT A;  5GAO r;  3A8G B;  3P8B B;  1BK2 A;  5FWB A;  1KC8 C;  3OYE A;  1U3O A;  2JTM A;  4LUD A;  4XU1 A;  4F7U F;  4ZNX A;  4YTL A;  1LJO A;  4PJL A;  2JT4 A;  3RER A;  1E6G A;  3JCM J;  3JCM V;  3JB9 J;  1KK7 A;  1JJ2 S;  5AYF A;  3EH2 A;  5DLQ E;  3CMA Q;  2NUT A;  3JCM h;  3INZ A;  2P4T A;  3CQT A;  2HKN A;  3OW2 P;  3MEW A;  4M75 G;  2EGC A;  1OZ2 A;  1UGP B;  2DAQ A;  4KH0 B;  4M75 B;  4BE0 A;  1KFZ A;  2LT1 A;  4DEY A;  1Q86 R;  4J6W A;  2CP7 A;  2L3R A;  5FU6 C;  1SG5 A;  4M75 A;  2VC8 A;  1QVF S;  2O4X B;  3PFS A;  3LGF A;  1FXX A;  3G6E Q;  1MV0 B;  4CRI A;  2PVG B;  4E47 A;  2YSQ A;  4OF1 A;  2EYX A;  4F7U G;  4F7U B;  2VGM A;  2ATC B;  3CCE Q;  2P4R A;  2O4X A;  5J26 A;  5DM7 R;  4M7A F;  4N4H A;  1V76 A;  4M77 G;  4M77 B;  1GFC A;  1SRM A;  3CMA T;  2EYY A;  5LJ3 d;  2E3H A;  4F7U A;  3CME T;  2E6N A;  4ZGD B;  2E65 A;  2QA4 T;  3M0U A;  4M77 A;  8AT1 B;  2DMO A;  2V26 A;  2RJE A;  4OMF B;  3EGX B;  1Y57 A;  2HL3 A;  1VQ6 Q;  5KYN A;  4E7H A;  2RJD A;  1K0S A;  1SSF A;  4J9D A;  1Y0M A;  1LPL A;  3CD6 Q;  1QKW A;  4F04 B;  3EGX A;  1JQQ A;  3G6E T;  2ZCF B;  1WXB A;  4CC3 A;  1N27 A;  1VQ4 Q;  3I9Q A;  3CCJ T;  4B9W A;  5FW9 A;  4C92 F;  3DB3 A;  3SWN C;  4DOV A;  4M75 E;  1S1N A;  2XG8 D;  2DZ9 A;  5I11 A;  1UGR B;  3GNF B;  2IPO B;  1RAA B;  4J83 A;  2EJ9 A;  3VS6 A;  3QII A;  1VQM Q;  3RMS A;  2GFA A;  2H3E B;  2MIO A;  1IB8 A;  4MZM A;  4OMP A;  3CCM Q;  1FMV A;  4EMH A;  2VKN A;  5KE2 A;  1VQ6 T;  3CCQ T;  4C0G A;  4F7U E;  1YI2 T;  1JBM A;  1VQK A;  3VRY A;  4E7Z A;  2CT3 A;  5FU7 C;  2CKK A;  4M77 E;  1DJ7 B;  3CEY A;  1Q82 C;  2E70 A;  1UHF A;  1PKS A;  5LJ5 g;  2EYZ A;  1M3B A;  1Q7Y U;  2QEX Q;  1ZQ1 A;  2L8D A;  2EQM A;  5GAN j;  1NBE B;  2NUP B;  1VQ9 A;  4C92 G;  5GAN f;  4C92 B;  1VQM T;  1X01 A;  3UPU A;  3HHT B;  2WSF E;  2RQU A;  1QVF A;  4FYV B;  3X25 B;  2DJZ A;  2MMP A;  2J6O A;  2NUP A;  2VV5 A;  3OY9 A;  2BE7 D;  1FYN A;  2KBT A;  4C92 A;  5GAN 2;  1GCQ A;  2K2V A;  4AFZ C;  2BTT A;  4KH1 B;  4C5G A;  3P8D A;  3M53 A;  5LJ5 e;  2PQW A;  1MGQ A;  4MMK A;  2IIM A;  3X24 B;  1G3T A;  4X9D A;  2JS0 A;  2VWF A;  1N9S A;  3LYI A;  2KXD A;  3CCL Q;  1X6G A;  2DJQ A;  2KE9 A;  1OOT A;  4KGZ B;  1G8X A;  5LL6 S;  2QEX T;  2ZPE B;  3TQ7 P;  2RQT A;  3NFC A;  2EAY A;  3OS0 A;  1MHN A;  2OTL T;  4Z8A A;  1VYU A;  2K3Y A;  2DRM A;  1PM3 A;  4M78 C;  3RUX A;  2V8J A;  2DER A;  5GAN 6;  3JB9 F;  3OA6 A;  1AHJ B;  1TH7 A;  1W2B S;  4OP0 A;  1K73 C;  3MEA A;  4PFP A;  2QYZ A;  4AT1 B;  4C92 E;  3L2Q A;  5FRM A;  1LOJ A;  2L3P A;  3QJY A;  1WNL A;  4LE9 A;  2DM1 A;  1Q7Y R;  2EKH A;  1TG0 A;  3UF4 A;  2KI7 A;  1ABQ A;  6AT1 B;  1M90 R;  2HKQ B;  4Y92 A;  1YCS B;  5LJ3 j;  1BCO A;  5LJ3 f;  2SRC A;  2AKL A;  2LCL A;  2LRQ A;  5D6X A;  2XHC A;  1IRX A;  2YUN A;  4JDS A;  1RAB B;  1D09 B;  5IN1 A;  3GIB A;  1C6V X;  3BDU A;  2BIV A;  2K9G A;  3A8M B;  2DL3 A;  1U5S A;  2F2X A;  3JB9 G;  3QDF A;  3CC2 Q;  3JCM c;  2WSE E;  2KEA A;  2NLU A;  3ME9 A;  1QVG P;  1YIJ A;  2P0P A;  4HT8 A;  3SEM A;  3QUI A;  3THK A;  2CUB A;  2DEU A;  2GNC A;  2RH2 A;  2B8A A;  5GAN 4;  3VYG A;  2M1H A;  4EIK A;  5GMK h;  2K79 A;  3OYB A;  4BI3 A;  2LQK A;  1WX6 A;  2LP5 A;  3RIR A;  3OW2 S;  3D7S B;  5D7U A;  2A3L A;  4PJO B;  2DL8 A;  2D9T A;  1ZHI A;  2DTO A;  1RAI B;  5LJ5 j;  3M0Q A;  4D6W A;  5CVI A;  3X20 B;  4L59 A;  4XQ3 A;  3EGU A;  3CC2 T;  2O31 A;  1T0J A;  2K3X A;  4C8Q D;  3JCM d;  3OSV A;  4DQ2 A;  3EG3 A;  2BZY A;  1M5Q 1;  4C0F A;  3VYH B;  1X6B A;  2KQW A;  3JCM W;  3VU3 C;  3M0P A;  2D0Q B;  4QW2 A;  1VQK Q;  2XI9 A;  2RB6 A;  1K1Z A;  1VQ8 T;  2JVV A;  2RQV A;  2CH4 W;  1NPP A;  3NHN A;  3WVD B;  2GGR A;  1U1S A;  4KUL A;  1AWO A;  1PG5 B;  3EAE A;  3VS0 A;  1Y71 A;  1EX4 A;  4TVR A;  1H64 1;  4QVC A;  2PZ1 A;  1KQS P;  3JB9 H;  1VQ9 Q;  4RCC A;  1WHG A;  1M4Z A;  1GBR A;  1JRI A;  2A37 A;  2DA9 A;  2DL4 A;  4AFU C;  4OB2 B;  3CME A;  2DYB A;  2RQR A;  1T3L A;  3TSZ A;  2QA4 A;  3REB B;  5CKE A;  2K7A A;  3ULR B;  4BDZ A;  1WHK A;  2CZ0 B;  3PT9 A;  2M9U A;  2X35 A;  1QWF A;  2LMJ A;  1XJW B;  2M02 A;  3EGD B;  3DKM A;  1NG2 A;  2ESW A;  4EMK C;  5IHK A;  1OPL A;  1WHH A;  3H6Z A;  2FHD A;  1VQN T;  3FJ5 A;  2ZPH B;  4C0D C;  4FM4 B;  3C0C A;  4F14 A;  3EGD A;  2DET A;  1YFN A;  1I5O B;  2MCN A;  3Q1J A;  4LXC A;  4JRP A;  2WSC E;  3CCJ A;  2Y4Y A;  2XDP A;  1WJS A;  3QZ9 B;  4OML A;  4JJD A;  1VQ9 T;  2DPP B;  1YN8 A;  2EJF A;  4A4K A;  2MF2 A;  1QCF A;  2F2V A;  2GQV A;  2EWN A;  3E9F A;  3HFN A;  2DK3 A;  4BI8 B;  5CR2 A;  3OW2 A;  1UG1 A;  1H3H A;  1WIE A;  2XDB A;  2KYB A;  4IUP A;  4RG2 A;  4N4I A;  3E9G A;  2COZ A;  4PJO D;  2R57 A;  2RK1 A;  3MO8 A;  3CCQ A;  1HK9 A;  1YI2 A;  1G3W A;  3MP8 A;  4AG2 C;  1EFN A;  4Z89 A;  2QGF B;  3I5S A;  3SFM A;  4E2F B;  4ZTF A;  1TU0 B;  4M78 D;  2O88 A;  1FWZ A;  1MMG A;  1VYT A;  2QDL A;  3CPF A;  4E7L A;  2OX7 A;  2PUK B;  1TUD A;  4OGC A;  1XTD A;  4L6V 5;  4ELY C;  2JXB A;  2ECZ A;  5CQY A;  4FW2 A;  2M0O A;  3VS2 A;  3MJX A;  4MZP A;  2V8I A;  4FSX A;  2J6F A;  3PVQ A;  2W10 A;  3QWY A;  3CCR T;  1YJN A;  4P5N A;  3IQL A;  1IXD A;  1BBZ A;  2YUO A;  1E6H A;  1SHG A;  4M7D C;  2YHT A;  5KYW B;  4FW1 A;  1K9M R;  4BY6 C;  2MWP A;  1MV3 A;  1YIT A;  4PFO A;  5C6S A;  3BDL A;  4OMM A;  4ESR A;  1U8R A;  1NJI C;  2C0T A;  1YIJ Q;  2DIQ A;  4Q5W A;  4PFZ A;  1AOJ A;  2O01 E;  2CGH A;  1RAC B;  2RNA A;  3BFM A;  4II1 A;  4M75 C;  2RJF A;  4PL6 A;  4XTY A;  8ATC B;  1UGS B;  2P0K A;  2L3Q A;  1WJR A; 
#chains in the Genus database with same CATH homology
 5D7U A;  4FW2 A;  1C0M A;  1C6V X;  1IHV A;  4FW1 A;  1C1A A;  1IHW A;  1EX4 A;  1QMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...