1IHWA

Solution structure of the dna binding domain of hiv-1 integrase, nmr, 40 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the DNA binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
molecule keywords HIV-1 INTEGRASE
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ihwA00
1IHWA 1IHVA 1C1AA 1C6VX 1EX4A 4FW1A 4FW2A 1C0MA 1QMCA 5D7UA
chains in the Genus database with same CATH superfamily
3HTRA 1NZ9A 4QQGA 4L59A 3OYFA 4ZGDB 2COZA 4ORZA 4A63B 3G71T 2QEXT 3OYGA 3J81E 2DL7A 2R58A 3HRUA 2K5FA 5J26A 2Y4XA 4OB1B 2MF2A 1TOVA 2FVUA 2L8DA 4FM4B 1D3BA 2L3PA 1T0HA 2QQAA 2MCNA 4NS5A 1YN8A 2H8HA 1CKAA 1PC0A 5D6WA 4DBFA 4FCYA 3C95A 1M90C 1IZ6A 2LX7A 3LWHA 3QIIA 2QDLA 1VQLA 5AT1B 2FB7A 2GTOA 3MP8A 1AT1B 2VXFA 2DILA 1A0NB 2OAUA 3LGLA 4AFUC 5LJ5f 1QVGA 3OYHA 1M2VB 4FYYB 1SPKA 1UGRB 2PQWA 3OY9A 4XTUA 1FX7A 1KQ1A 1M1FA 4FL6A 5IHNA 1I1JA 1AOJA 1FMKA 3ASKA 4JJBA 3CCUA 1MUZA 2BE7D 1KD1U 1B7TA 4HVVA 1WZOA 1JO8A 4PL6A 3H0IA 4FW1A 1Z9QA 2L0AA 3VS2A 2G3RA 4KUDK 5LJ3h 5ECAA 3EGDB 2X3WD 3JB9F 1QCNA 2DETA 1XNIA 1SSHA 1BI1A 1Q7YC 1KC8C 5EG2A 2VASA 3CCST 2JJ9A 3PIPA 3CPWS 3BE3A 5FRNA 1Q86C 2QA4A 1G3TA 6AT1B 1HSQA 2JTFA 4J9EA 4M77D 2Y90A 4XAXB 3G4ST 1PSFA 2EJ9A 3CBOA 5I21A 1PWTA 2JUFA 4HCBA 1X6GA 4ELYC 2YHTA 1ZSZC 5KYXA 3I9QA 1DJ7B 2CREA 2L3RA 3MEVA 3JCMg 4CC2A 2VC8A 2NUTA 4JRQA 2ECZA 3MKDA 4A54A 1N8RU 4C92F 3ZEHA 3BY7A 1KQ2A 5D6YA 5DLQE 3PVLA 4GBQA 4D8DA 4M77G 3INZA 4PFOA 2KRMA 2A08A 5GANg 1WDXA 1TUDA 4PFZA 3P8HA 1R0BG 1D1CA 1OU9A 3PT9A 1RADB 2NUPB 4AG1C 5I11A 4BD3A 2E65A 5A0DA 3H0HA 4OVAA 5LJ3e 1BYMA 2KE9A 2RHXA 4QKUA 1UGSB 2IIMA 1F1BB 1YHQT 2M02A 5I2MA 4QT7A 1VQ8Q 2LT4A 3A8MB 1BI2A 3REBB 2ENMA 1W2BS 4OMNA 4EPCA 2D6FA 3A8LB 3PGGA 3T9NA 2V8IA 4MDWA 1T0JA 4QQDA 3CC4Q 2J6FA 2EJGA 2CKKA 4JS4A 1WQ7A 5GMKm 4RTUA 4OGEA 4M4ZA 1MMDA 4BE1A 4WCIA 3SB2A 3X24B 1QVFA 2ZPFB 2HCKA 3JB9J 2SRCA 1PD1A 3MCAB 3X28B 3UWNA 1UE9A 1X2KA 2LQWA 1WXBA 2HQEA 2V26A 4GLKA 3LYIA 1QW1A 3CPFA 4E7HA 2LNVA 1NYFA 2MWOA 3L2ZA 2JMCA 4M77E 5GAN7 3D7SB 4OF1A 2QAZA 2EQJA 1ZA2B 2EGAA 4Y92A 2RJFA 4J7IA 4FYXB 4CRIA 4QVCA 3CCQA 2ZPHB 2ZAEA 1UGPB 2EYXA 3TU4K 2K5IA 4FYWB 3E2UA 1TS9A 1R0CB 4FW2A 3VYHB 3V7CA 3CD6T 1AHJB 2V1QA 1JBMA 4HVUA 4C8QA 3OS1A 1LPLA 4J6WA 4F04B 1CSKA 1WHGA 1PKSA 5CQYA 2QA4Q 2MPXC 4HA8A 3EG2A 4LE9A 3QWYA 1LNXA 2J05A 1QVGS 2D8HA 1YITA 4DQ2A 5CKEA 1VQMA 1JJ2S 2ED1A 3MJXA 1GFCA 3GP8A 2ROLA 1RAFB 2OTLT 2DVEA 1LVKA 3OMCA 1GL5A 3VU3C 4LUEA 3QDRB 3M55A 2BKDN 4KH1B 5CCAA 3LX7A 2JN0A 2EVRA 4RKUE 2CZ1B 1T3LA 1SKUB 4RCBA 2Z0WA 1ACMB 2XMFA 2XK0A 2ESWA 4PLIA 3M56A 4UC4A 4AFZC 1D09B 2E5QA 3I55T 1XQHA 1ZQ1A 1MMAA 4KH0B 3VKIA 1EFNA 1G2BA 3CQTA 1TSFA 3RUXA 4XTYA 5CKHA 1VQLQ 3MEUA 3RKWA 1FMVA 1GFDA 1WNLA 3JCMQ 1BBZA 5IXFA 4M77F 3QJYA 4HKEA 1T3SA 1KQSP 2E41A 4J5YA 2H3JA 2VKNA 1PM3A 5CVIA 1IB8A 2MK5A 1RAAB 1BCMA 2KNBB 3CCVA 3JB9I 2K6DA 3DLLA 1GXIE 4LN2A 2YRDA 3CCUQ 1R77A 4C92D 1M1GA 5GMKi 1FXXA 1TWBA 3RIRA 3SFMA 3QXEB 5GANd 4HCKA 1NPRA 3C94A 1D0YA 3GNFB 2VVKA 3MO8A 3QJ6A 1YHQQ 4NOYA 2ZPEB 5DY9A 1VQ8T 2ATCB 2DXBA 1VQ4A 1OZ3A 3L2QA 2YDLA 3SWNB 4M7DB 2E3IA 1YJ9Q 4M78E 2ROTA 1JB0E 3OYDA 5GAOq 1VQPQ 2FEIA 2VWFA 2DE0X 2FZCB 2I2LA 4PJLA 2AZVA 3OYNA 4J6XA 3JRZA 2AT1B 1GCQC 1NG2A 2ZZDA 5KYWA 3KFVA 1RI9A 3V8LA 2X4WA 2O9SA 4D6WA 4D8KA 3OS5A 2DERA 2PVOB 3EG9A 3CCRA 4TVRA 1IHWA 1G3WA 1P92A 5FWCA 3VS4A 3BFMA 2GBQA 4OMFB 3CMAQ 5I2SA 1Y07A 4A4FA 2XD0A 4HCZA 1UHCA 3PVQA 1UJ0A 4C8QF 2EQUA 4EMKC 2K4YA 1K1ZA 1YITQ 1MHNA 4KGVB 1NBEB 1K4US 3OW2S 5GANf 1UJYA 3L2UA 4E2FB 1G5VA 2HSEB 4PJOA 1WXUA 2ZCFB 1RAEB 3H8ZA 1UHFA 1SSFA 1XOVA 1QP3A 1YJNA 4MMLA 2JMAA 2CS7A 2CP6A 2ZGWA 2DVJA 2YLCA 1YJ9A 4E7LA 4RTYA 2JXBA 2G6FX 4EMHA 3BW1A 3SHWA 3JB9H 1KJWA 1NE8A 1B34B 3CCJA 2YLBA 1YI2A 1V76A 4DBQA 3DB4A 1K0XA 2AIRB 4RG8A 1YJWQ 3CC2A 3RDVA 2FZKB 4CC3A 2L89A 2RQRA 3VYGA 1B34A 4CI0C 1UGQB 1O9SA 3GOXA 2XICA 2XG8D 2GFUA 1PHTA 1WJRA 2H3EB 2V1RA 4M78F 4MZTA 1M5Q1 5EC7A 3CC2T 4BI3A 3PMTA 4C92C 2HNIA 1N5ZA 1KD1R 3I5SA 1W2BA 5IHKA 1JU5C 5FRMA 3GF5A 5CKFA 4J7FA 1ZSGA 2DAQA 1YP5A 2KSSA 1SHGA 2DXCA 1QVFS 4KBMB 1VQOQ 2DTIA 1GRIA 3CCMQ 3M0RA 2RJCA 3JV3A 1LOJA 1VYTA 5KE3A 1BI3A 2PU9B 1VQ5T 3QYGB 4DEXA 4XU3A 1MV3A 1VYUA 2RPNA 2X35A 4J9IA 1PSEA 4IUTA 3VRYA 1D1AA 3OYIA 3EHQA 3OBWA 3QHSA 4AMCA 4C5GA 1V1CA 4WTOB 3OMGA 5CR2A 3CC7T 2CDTA 3VRZA 4Z88A 3CCJQ 1WJSA 1QKXA 3CBMA 1W70A 2HKNA 2RO0A 3N5BB 2KAFA 3GLXA 1OZ2A 2RQVA 1BCOA 5L23A 2VXEA 1I07A 4PNOA 2LMJA 2HZYA 2F2WA 2LQNA 2A37A 1J3TA 1U1TA 2DRMA 2QK0A 5HK0A 4LXCA 2LCLA 3CPWA 4YTLA 5GAOn 1M4ZA 3JCMX 2P4RA 3S3MA 1NLOC 3SDZA 2C0OA 1WGSA 4J9DA 4E7ZA 5GANe 1VQPT 1VQ4T 3OYLA 2CSIA 1IXDA 4MZPA 4GY5A 3HSBA 2OJ2A 3HP9A 3C0CA 1NJIR 4LDVA 1M8VA 3CPWP 1UG1A 2QA4T 2RF0A 3JCMV 1HD3A 3P8BB 2R5MA 2EYYA 2EBPA 5C0MA 1X6OA 4F7UF 4XTXA 2PNIA 4M7AC 4E7JA 2GNCA 4DEYA 2C06A 1HJDA 2NUTB 3LW5E 4NL3A 2RM4A 2K5LA 3V8KA 2ZPBB 1U3OA 4FSSA 4PJOC 3MEWA 4A4KA 2EYWA 4F16A 1WHLA 2MMPA 1G83A 5LJ5h 2K2VA 3META 2E12A 5KYYA 2COWA 2EYZA 2DL8A 1K8AU 1JQQA 2QGGA 2EFIA 2M0OA 1RI0A 3I56A 4N0AA 4BDYA 4M7AE 3M5AA 2RK2A 3HRTA 2DM1A 3EAEA 5FLXE 3RERA 2VB6A 3I56Q 1IREB 1JJ2P 2F2VA 2P4TA 1N8RC 1VQNQ 1VQLT 2AHJB 1XJWB 1M3AA 3PIOA 1KHIA 1BU1A 2QEXQ 3UATA 3EFOA 5CKDA 1ZUYA 1QQJA 4IURA 4JRPA 4KGZB 3A5ZB 1RL2A 1I4K1 1JXMA 4IUUA 2X4YA 4M78D 1U06A 1X43A 3HRSA 4QW2A 1ZSZB 1K9MC 1VQ9A 4JZ3A 3QBYA 3UA7A 3EG3A 4XU2A 4C92B 5GAMg 5L8RE 4WF2A 2HDAA 1TXQA 3JCMb 4BB7A 4F17A 1VQ5A 2DKGA 2CP5A 5J3BA 1VQ7Q 4A4EA 1VQ4Q 5LJ3d 3TEEA 4M75F 3A1PA 2F5TX 4M78G 2F2XA 1YIJQ 2RH2A 4BI8B 2K57A 4E6RA 4RMOA 2KBTA 4PK4A 2DXTA 4OMPA 3ZBDA 1K73U 4XQ3A 1BIAA 5GMKh 1KC8U 4OMMA 2YRVA 4J83A 4J9GA 3NFCA 3G71Q 3CCVT 5GAOp 3PE0A 1ZLMA 2DF6A 1QWFA 1NLPC 4ANJA 2PVGB 4F7UA 5GAOm 3REAB 2WSFE 1VOMA 2W10A 3SWNA 1K8AR 4M7DA 1W4SA 2DA9A 4B6MA 1S1NA 3E19A 2LX9A 3I5RA 2FRYA 1KIKA 2Y4YA 1KHCA 4EMGA 5KYWB 4PJOD 2K3XA 2RNAA 2AKKA 3HL8A 1M27C 2E70A 1JEGA 3G4SQ 1FWZA 3S3OA 2DEUA 1GBRA 3EG9B 3EGDA 1I0CA 4M75D 1WJQA 1KFZA 1FMWA 4M7DF 1TG0A 2PVDB 3LWIA 4IUVA 1MMGA 3RMQA 1VQ9Q 4JJCA 2YSQA 5IT9E 1VQ7A 3EFRA 4VUBA 1MNDA 3OYMA 4C0ZA 1X6BA 3QZ5B 2GCXA 3EGUA 2QQRA 4OB0B 3VS6A 2KT1A 2X51A 1WHKA 1TTHB 4PFPA 3NTKA 2KEAA 2KT8A 4PLLA 1Q81R 4M7AF 4DBHA 4JRKA 1ZBXA 2WSCE 3EH2A 2ZPGB 3QKJA 4C8QE 3G6ET 3VS3A 2DL5A 1N9SA 5GAN5 1S72Q 3VS0A 2D8JA 2LRQA 3V7RA 4C8QG 3RMSA 1VQMT 3J7AF 2CYZB 1OI1A 2RHIA 3PMIA 1NM7A 4M77B 2FL7A 3EHRA 4IIOA 1YJWA 3CC2Q 2HD0A 3URGA 2KROA 1HXDA 2OTLA 1Q7YU 4J6YA 1ABOA 2GGRA 5GMKj 3CCRQ 2YUPA 2M16A 1K9MU 3A8GB 4JDSA 3PTAA 3I55A 3CC4T 1AWXA 5C6SA 2DRKA 2LQKA 3M0QA 1QCFA 3G7ZA 1YJNT 1VQOT 1X01A 3HFOA 2M0YA 3CD6A 3CMEA 5KCHA 2MOXA 3WVEB 1M1KU 3P8DA 5D6XA 3G4SA 3KBGA 2NLUA 2DLPA 4N4GA 4KULA 1OEBA 4KGXB 1LCKA 2E5KA 2I0NA 1IGUA 1KG1A 2FHDA 4C0DB 2P0QA 3CBPA 3PNWC 2A36A 1MMNA 5CAIA 2FPEA 2O31A 3CCLA 4J8OA 2QXFA 1K0SA 4Y91A 5I22A 5DM7R 2DYBA 4B9WA 3CCJT 1RAIB 1JXOA 2CZ6B 2FPFA 2XKOC 1RACB 3PFSA 2L2PA 2KK4A 2HBPA 1KQSA 2NYSA 1YJ9T 1IGQA 4Z89A 1H3HA 1D3BB 2LDMA 1E6HA 1RLPC 2DD5A 3CCEA 1NJIU 5LJ5j 4MDXA 3FJPA 3H9NA 2E1HA 5GAMj 3VV0A 3X25B 4M75C 5LL6S 2CZ0B 1PRLC 3EGXA 4DA4A 1YIJT 2CP0A 1BKBA 2X3XD 1PG5B 5A0GA 4OMLA 3KXTA 2BZYA 4QVZA 2XIDA 2DL4A 3CCVQ 1AZEA 2D0NA 2QGFB 1OYXA 1ZBJA 3M57A 1N6AA 2CT4A 2YWWA 1AWWA 2E6ZA 3NTHA 3SWNC 4M7DC 2DBMA 3V8JA 4PKCC 1H8KA 1ZUUA 1WPYA 3CCMA 7AT1B 2PZ1A 2JT4A 2GTJA 4ZN3A 5GAMe 3OYJA 4BI4A 4FSXA 5KE2A 2DYIA 1N9RA 2E4HA 2X9HA 1YI2Q 2SEMA 4C5HA 2BIVA 4QVDA 1Q81C 1KK7A 3CCRT 3CC4A 4XTWA 2DFUA 4OMQA 2CH4A 1X75C 2V8KA 4X9DA 3OYYA 1M8MA 3E1SA 3GPLA 4AFSC 4IUPA 2KR3A 5GAMf 2JM8A 4C5EA 5IN1A 3BDLA 5LJ3j 4EMKB 1YJWT 2J06A 3NGPA 4RTXA 1RAHB 2JTMA 2KDSA 3WVDB 2DMOA 4ZTJA 3OSVA 3G6EQ 1QCOA 1YCSB 2NUZA 4LDYA 5FU7B 3FRNA 1AD5A 1C6VX 2GFAA 2L5QA 3G6EA 4ZGJB 3RESA 2DJZA 4LDXA 2VYTA 3L2WA 2HL5C 3CCUT 3UF4A 4BE0A 2QTXA 5FWBA 8AT1B 3J80E 1U5SA 1Q81U 2E3HA 3HHTB 5J39A 3IQLA 3CMET 3SEMA 3ME9A 5LJ5g 1M3CA 4XTVA 4XK8E 4M77C 2DIQA 3LH0A 2O01E 2J7IA 4KT0E 1K9AA 2EWNA 1M1KC 1VIEA 2MI6A 4KRTA 1TH7A 2IVWA 2HAXA 3C12A 1UUEA 2QG9B 2D0QB 4L6V5 2EYQA 1OX8A 4HVWA 2JW4A 3LLRA 1VQ5Q 4OP0A 2EIFA 5CIUA 2YUNA 4IUQA 1M90U 4E7SA 5GAN3 3JAME 2DNUA 5CKBA 1K76A 2DL3A 5LJ3f 4GLMA 4RG2A 3I35A 4P5NA 3M4YA 3M0UA 2XI9A 3ZFJA 5GAOl 1YHQA 1SF9A 3DKMA 1HK9A 2AZSA 3JCMh 5IHIA 3JCMP 2C0TA 1YITT 3OS2A 1H3ZA 2V8JA 3RKXA 4M7DD 2XDDA 4C0GA 2EAYA 3G1JA 4Z02A 2O2OA 2DXUA 1Y96A 1EX4A 3WXMB 2OAWA 1WQWA 1D1BA 1QMCA 3C4SA 2M1HA 3JB9D 4K11A 1OX9A 1YWOA 3H6ZA 1G8XA 1M2VA 4QQ6A 2NWMA 4F14A 2KQWA 2QQ9A 4IIMA 1ZHIA 2FG0A 2ZPIB 2OX7A 2RI3A 1WLPB 4M75A 2CUBA 4N0AC 3CCSA 3SD4A 4JRIA 2LZ6B 2XDPA 1VQ9T 1YWPA 3RR6A 3A8OB 4JLIA 2DIGA 2FRWA 1UECA 1C1AA 1TUCA 5CQXA 3EG1A 4PJOG 4E7IA 4OMOA 1OPKA 2LCCA 2J6KA 1VA7A 4BY6B 2RI5A 2QYZA 5GAN8 1PD0A 3OQ5A 1KQSS 2W0ZA 1E7OA 1IO6A 1D0ZA 4O6JA 2X4XA 3V7SA 2LJ0A 2O4XA 3OSSC 4PJNA 3X20B 1K9MR 2QQBA 4J9BA 1YI2T 1ABQA 5GMKl 4HT8A 1R8OB 1QVFP 3U23A 2CH4W 1XTDA 1Y71A 4KUIA 4R0KA 3FEOA 2LC4A 2HSPA 2LNHB 2DBKA 1I81A 5KYXB 4M7AG 2OTJQ 1M90R 2DJQA 3VS5A 4PJMA 4M7DE 4HXJA 1X2QA 2D1XA 3NPFA 1BB9A 2MWPA 4C8QC 2P0PA 4FYVB 3OS0A 2HMAA 5GANh 1QVGP 2LCSA 3CCEQ 1QVPA 1X27A 1VIFA 5GAN4 1ZA1B 1VUBA 3GIBA 2RJEA 2DK3A 2A3LA 3QZ9B 2CSQA 4M7AA 2GQVA 2XDBA 3TREA 4FIBA 4MZMA 1VQKQ 2AKLA 1Q7YR 2K3YA 4J9FA 3NTIA 1QWEA 4JJDA 3M9QA 1WX6A 4HCCA 1H641 2RK1A 4R56A 4BUGA 4M75G 3F70A 5IXBA 2CT3A 2EKHA 3MPUB 4JLGA 1MNEA 1U1SA 4Y28E 1NYGA 2KRNA 4JJNK 4F7UB 1VQ7T 4A4HA 2B86A 4RUGA 2BUDA 3R6NA 2L3QA 2BZ8A 1YIJA 5GAMh 4AT1B 3JCMJ 1WIEA 3TSZA 3VUBA 3VS1A 5A0LA 1N27A 3JCMc 5GAOr 3EFSA 2BZXA 5M9OA 1EIFA 2HKQB 4BE2A 1W2BP 9ATCB 4N4IA 2OTJA 4FT4A 4L5GA 3OYBA 1M30A 2O88A 1AVZC 3R6OA 2EQMA 4J9HA 3ZL7C 2P84A 1Z9ZA 3UA6A 2OTLQ 4RTWA 1Y96B 2K7AA 1I5OB 2EW3A 4JZ4A 1W6XA 4LDUA 1N8RR 2B8AA 3OW2P 1O75A 1UFFA 1UB4A 1WI7A 2KI7A 4PJOB 1OULA 1PNJA 2A28A 1VQKA 2R5AA 3M53A 1EZZB 1QP2A 2DX1A 1M2OA 2KY9A 2MYSA 3QG1A 4J9CA 5GJVB 2WACA 1VQ6T 2LT1A 5GANj 1BK2A 1JRIA 5FW9A 1IHVA 5GAN2 3A8HB 5GJWB 2VUBA 5LJ5e 1WHHA 1VQOA 1SEMA 4ME7A 3M0SA 1YCYA 3L2VA 3HKSA 4BACA 2FO0A 4C8QD 1GCQA 3NHNA 1MGQA 2HQXA 4FU6A 4LD6A 4CC7A 2QASA 2QI2A 1AWOA 3CCQT 4ESRA 2KXCA 1I8FA 2X4JA 1Y57A 3OYAA 1WFWA 1D0XA 1VQNT 3CCLT 1X69A 1OQKA 2QTVA 1G3SA 3AT1B 2LP5A 1TU0B 3M59A 4A4GA 2DZCA 3Q1JA 3FLGA 2DTHA 2OI3A 2QDYB 1K8AC 3MEAA 3TSWA 1Q86R 1NJIC 2RQUA 4DOWA 1RUWA 4M78A 2WSEE 3OYCA 2YUQA 3HPWA 4JS5A 4AG2C 4CC4B 2GF7A 2RN8A 2OTJT 5CK9A 4R55A 4EIKA 1SG5A 3I55Q 3CMEQ 1OU8A 1VQNA 4AFQC 2FYKA 1K73R 2DZ9A 3UPUA 3OA6A 4EDUA 1WHMA 1ZSZA 3TQ7P 2K9GA 3S6WA 5FU6C 2VV5A 3BDUA 2YRCA 2C0IA 4Z8AA 1JJ2A 4LNPA 4RTTA 1U8RA 2E6NA 1UTIA 3UT1A 4B9XA 1VQKT 2FPDA 2KXDA 1Q82R 1E6GA 3THKA 1ZUKA 1HYOA 1Y0MA 5KYUB 2JNGA 4M78B 2KYMA 3QSUA 2YXYA 1WA7A 2KVQG 2XHCA 2EQIA 3KUFA 1GBQA 2JS2A 4Q5WA 2HEQA 2KYBA 4X1VA 2VGNA 3TCJA 2E64A 5KCOA 4C92A 4RTZA 1B07A 1AEYA 1WHJA 4E7KA 3JSCA 4RCCA 1VQ6Q 2M51A 4O5VA 1RLQC 2E10A 2RD1A 1FYNA 2D9TA 1UGVA 3VUZA 3DB3A 1ARKA 3OBYA 4II1A 3OB9A 1QLYA 5HK3A 1Q82C 2CP7A 1KSWA 5LJ3g 4C0DC 2LVMA 4M7DG 3L2RA 4JPBW 1Y7XA 3HFNA 5KYNA 1G3YA 1Q86U 3M0TA 2EQKA 3JB9G 3CMAT 3QPHA 2FZGB 4FT2A 2PUOB 3X26B 4LD9K 2F1LA 2O4XB 4C8QB 4NL2A 1VQ8A 2JM9A 5IAYA 2PTKA 3H41A 1S72T 5KH6A 4ELZC 3JCMe 1KC8R 2JS0A 3GNGA 2A7YA 2P0KA 3JCMW 1OOTA 4OB3B 1NPPA 3O8VA 1VQMQ 4PJOE 4M75B 2DTOA 3ER0A 4DBRA 2DEQA 1NEGA 3QYHB 3M54A 4OB2B 4M77A 1M1KR 2KGTA 4F7UG 2AK5A 2GQIA 1Q82U 3VJPA 2IPOB 5DLOA 1MV0B 3TVTA 5HCKA 1LJOA 3RKYA 2M9UA 2A0FB 2JZ2A 3M4GA 4HT9A 1VQPA 3M58A 2CP3A 2K79A 3CCET 5GAMd 3FIFA 4JUVA 1GCPA 2LTOA 3CCQQ 5LJ5d 1WYXA 3EFOB 4ZGEB 2RMOA 3LH5A 1PRMC 4M7AD 1RAGB 4PJJA 2XU8A 1YFNA 3NMZC 2RHYA 4C5IA 2EGCA 2MAMA 1ZX6A 2VGMA 2ABLA 2RHZA 3E9FA 3FJ5A 4LUDA 3OYKA 2KMTA 3RNJA 4XU1A 1W1FA 5GMKe 5KYYB 2EKOA 2RB6A 1K73C 3M0PA 1SHFA 2NUPA 2K2MA 2HBWA 4BDZA 4LDWA 2LJ1A 1PKTA 2JTEA 3A98A 4C92E 2EJFA 1M3BA 3QUIA 2J6OA 3LGFA 3OW2A 3O5ZA 2QQSA 5FU7C 5KYUA 2CZ7B 3MHXA 1VQ6A 1YJNQ 1YBYA 1UEBA 3RBBB 3CXCP 5FU6B 1CKBA 4ZNXA 2JOYA 3FB9A 1BIBA 3MP1A 1OV3A 4PJOF 3QDFA 1BI0A 1S72A 2LQ8A 2MIOA 1AWJA 1VYVA 2EGEA 3EGXB 2QEXA 3CC7Q 3G71A 2YT6A 1H92A 4M78C 4ZN1A 1WXTA 4XTZA 1M9SA 2O9VA 4X9CA 3CC7A 4XU0A 2CP2A 2RQTA 1SRMA 1KD1C 4ZTFA 3VS7A 3GBQA 3CEYA 3L1AA 4MMKA 2DO3A 3CD6Q 2CGHA 5A2QE 3CCSQ 3MP6A 1SRLA 2RI2A 5AYFA 3L42A 4V2SA 4A53A 2L3SA 3EH1A 5HKCA 3CXCS 2COYA 3I56T 5FROA 5GAN6 1V29B 2RJDA 2HQHA 3ULRB 2RA2A 4F7UE 2RHUA 4C92G 4M75E 3QWXX 1QKWA 1Q95G 8ATCB 4EMKA 4OGCA 2DPPB 3S3NA 3CCLQ 5CO7A 1UDLA 2YUOA 2F5KA 5D7UA 1IRXA 2EPDA 2DD4A 1NEBA 3QO3A 5HY6A 1AZGB 1RABB 3UDCA 4M7AB 3FC3A 2BTTA 3JCMf 2HL3A 3DLMA 4X34A 1C0MA 2BE9B 3AHUA 3CXCA 2ED0A 4RTVA 3FDRA 1I5LA 1OPLA 3CMAA 4E47A 4IKFA 3H0FA 3JCMd 4C0FA 3OYEA 1PCXA 3EG0A 3E9GA 2RQWA 4N4HA 4BY6C 2PUKB 2KRSA 2IG0A 1TUGB 2F69A 4DOVA 5IH2A 3CCMT 1YNZA 4ATOA 2R57A 1B3QA 2JVVA 2K3BA 2CUDA 2LJ3A
chains in the Genus database with same CATH topology
1IHWA 1IHVA 1C1AA 1C6VX 1EX4A 4FW1A 4FW2A 1C0MA 1QMCA 5D7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHW A;  1IHV A;  1C1A A;  1C6V X;  1EX4 A;  4FW1 A;  4FW2 A;  1C0M A;  1QMC A;  5D7U A; 
#chains in the Genus database with same CATH topology
 3HTR A;  1NZ9 A;  4QQG A;  4L59 A;  3OYF A;  4ZGD B;  2COZ A;  4ORZ A;  4A63 B;  3G71 T;  2QEX T;  3OYG A;  3J81 E;  2DL7 A;  2R58 A;  3HRU A;  2K5F A;  5J26 A;  2Y4X A;  4OB1 B;  2MF2 A;  1TOV A;  2FVU A;  2L8D A;  4FM4 B;  1D3B A;  2L3P A;  1T0H A;  2QQA A;  2MCN A;  4NS5 A;  1YN8 A;  2H8H A;  1CKA A;  1PC0 A;  5D6W A;  4DBF A;  4FCY A;  3C95 A;  1M90 C;  1IZ6 A;  2LX7 A;  3LWH A;  3QII A;  2QDL A;  1VQL A;  5AT1 B;  2FB7 A;  2GTO A;  3MP8 A;  1AT1 B;  2VXF A;  2DIL A;  1A0N B;  2OAU A;  3LGL A;  4AFU C;  5LJ5 f;  1QVG A;  3OYH A;  1M2V B;  4FYY B;  1SPK A;  1UGR B;  2PQW A;  3OY9 A;  4XTU A;  1FX7 A;  1KQ1 A;  1M1F A;  4FL6 A;  5IHN A;  1I1J A;  1AOJ A;  1FMK A;  3ASK A;  4JJB A;  3CCU A;  1MUZ A;  2BE7 D;  1KD1 U;  1B7T A;  4HVV A;  1WZO A;  1JO8 A;  4PL6 A;  3H0I A;  4FW1 A;  1Z9Q A;  2L0A A;  3VS2 A;  2G3R A;  4KUD K;  5LJ3 h;  5ECA A;  3EGD B;  2X3W D;  3JB9 F;  1QCN A;  2DET A;  1XNI A;  1SSH A;  1BI1 A;  1Q7Y C;  1KC8 C;  5EG2 A;  2VAS A;  3CCS T;  2JJ9 A;  3PIP A;  3CPW S;  3BE3 A;  5FRN A;  1Q86 C;  2QA4 A;  1G3T A;  6AT1 B;  1HSQ A;  2JTF A;  4J9E A;  4M77 D;  2Y90 A;  4XAX B;  3G4S T;  1PSF A;  2EJ9 A;  3CBO A;  5I21 A;  1PWT A;  2JUF A;  4HCB A;  1X6G A;  4ELY C;  2YHT A;  1ZSZ C;  5KYX A;  3I9Q A;  1DJ7 B;  2CRE A;  2L3R A;  3MEV A;  3JCM g;  4CC2 A;  2VC8 A;  2NUT A;  4JRQ A;  2ECZ A;  3MKD A;  4A54 A;  1N8R U;  4C92 F;  3ZEH A;  3BY7 A;  1KQ2 A;  5D6Y A;  5DLQ E;  3PVL A;  4GBQ A;  4D8D A;  4M77 G;  3INZ A;  4PFO A;  2KRM A;  2A08 A;  5GAN g;  1WDX A;  1TUD A;  4PFZ A;  3P8H A;  1R0B G;  1D1C A;  1OU9 A;  3PT9 A;  1RAD B;  2NUP B;  4AG1 C;  5I11 A;  4BD3 A;  2E65 A;  5A0D A;  3H0H A;  4OVA A;  5LJ3 e;  1BYM A;  2KE9 A;  2RHX A;  4QKU A;  1UGS B;  2IIM A;  1F1B B;  1YHQ T;  2M02 A;  5I2M A;  4QT7 A;  1VQ8 Q;  2LT4 A;  3A8M B;  1BI2 A;  3REB B;  2ENM A;  1W2B S;  4OMN A;  4EPC A;  2D6F A;  3A8L B;  3PGG A;  3T9N A;  2V8I A;  4MDW A;  1T0J A;  4QQD A;  3CC4 Q;  2J6F A;  2EJG A;  2CKK A;  4JS4 A;  1WQ7 A;  5GMK m;  4RTU A;  4OGE A;  4M4Z A;  1MMD A;  4BE1 A;  4WCI A;  3SB2 A;  3X24 B;  1QVF A;  2ZPF B;  2HCK A;  3JB9 J;  2SRC A;  1PD1 A;  3MCA B;  3X28 B;  3UWN A;  1UE9 A;  1X2K A;  2LQW A;  1WXB A;  2HQE A;  2V26 A;  4GLK A;  3LYI A;  1QW1 A;  3CPF A;  4E7H A;  2LNV A;  1NYF A;  2MWO A;  3L2Z A;  2JMC A;  4M77 E;  5GAN 7;  3D7S B;  4OF1 A;  2QAZ A;  2EQJ A;  1ZA2 B;  2EGA A;  4Y92 A;  2RJF A;  4J7I A;  4FYX B;  4CRI A;  4QVC A;  3CCQ A;  2ZPH B;  2ZAE A;  1UGP B;  2EYX A;  3TU4 K;  2K5I A;  4FYW B;  3E2U A;  1TS9 A;  1R0C B;  4FW2 A;  3VYH B;  3V7C A;  3CD6 T;  1AHJ B;  2V1Q A;  1JBM A;  4HVU A;  4C8Q A;  3OS1 A;  1LPL A;  4J6W A;  4F04 B;  1CSK A;  1WHG A;  1PKS A;  5CQY A;  2QA4 Q;  2MPX C;  4HA8 A;  3EG2 A;  4LE9 A;  3QWY A;  1LNX A;  2J05 A;  1QVG S;  2D8H A;  1YIT A;  4DQ2 A;  5CKE A;  1VQM A;  1JJ2 S;  2ED1 A;  3MJX A;  1GFC A;  3GP8 A;  2ROL A;  1RAF B;  2OTL T;  2DVE A;  1LVK A;  3OMC A;  1GL5 A;  3VU3 C;  4LUE A;  3QDR B;  3M55 A;  2BKD N;  4KH1 B;  5CCA A;  3LX7 A;  2JN0 A;  2EVR A;  4RKU E;  2CZ1 B;  1T3L A;  1SKU B;  4RCB A;  2Z0W A;  1ACM B;  2XMF A;  2XK0 A;  2ESW A;  4PLI A;  3M56 A;  4UC4 A;  4AFZ C;  1D09 B;  2E5Q A;  3I55 T;  1XQH A;  1ZQ1 A;  1MMA A;  4KH0 B;  3VKI A;  1EFN A;  1G2B A;  3CQT A;  1TSF A;  3RUX A;  4XTY A;  5CKH A;  1VQL Q;  3MEU A;  3RKW A;  1FMV A;  1GFD A;  1WNL A;  3JCM Q;  1BBZ A;  5IXF A;  4M77 F;  3QJY A;  4HKE A;  1T3S A;  1KQS P;  2E41 A;  4J5Y A;  2H3J A;  2VKN A;  1PM3 A;  5CVI A;  1IB8 A;  2MK5 A;  1RAA B;  1BCM A;  2KNB B;  3CCV A;  3JB9 I;  2K6D A;  3DLL A;  1GXI E;  4LN2 A;  2YRD A;  3CCU Q;  1R77 A;  4C92 D;  1M1G A;  5GMK i;  1FXX A;  1TWB A;  3RIR A;  3SFM A;  3QXE B;  5GAN d;  4HCK A;  1NPR A;  3C94 A;  1D0Y A;  3GNF B;  2VVK A;  3MO8 A;  3QJ6 A;  1YHQ Q;  4NOY A;  2ZPE B;  5DY9 A;  1VQ8 T;  2ATC B;  2DXB A;  1VQ4 A;  1OZ3 A;  3L2Q A;  2YDL A;  3SWN B;  4M7D B;  2E3I A;  1YJ9 Q;  4M78 E;  2ROT A;  1JB0 E;  3OYD A;  5GAO q;  1VQP Q;  2FEI A;  2VWF A;  2DE0 X;  2FZC B;  2I2L A;  4PJL A;  2AZV A;  3OYN A;  4J6X A;  3JRZ A;  2AT1 B;  1GCQ C;  1NG2 A;  2ZZD A;  5KYW A;  3KFV A;  1RI9 A;  3V8L A;  2X4W A;  2O9S A;  4D6W A;  4D8K A;  3OS5 A;  2DER A;  2PVO B;  3EG9 A;  3CCR A;  4TVR A;  1IHW A;  1G3W A;  1P92 A;  5FWC A;  3VS4 A;  3BFM A;  2GBQ A;  4OMF B;  3CMA Q;  5I2S A;  1Y07 A;  4A4F A;  2XD0 A;  4HCZ A;  1UHC A;  3PVQ A;  1UJ0 A;  4C8Q F;  2EQU A;  4EMK C;  2K4Y A;  1K1Z A;  1YIT Q;  1MHN A;  4KGV B;  1NBE B;  1K4U S;  3OW2 S;  5GAN f;  1UJY A;  3L2U A;  4E2F B;  1G5V A;  2HSE B;  4PJO A;  1WXU A;  2ZCF B;  1RAE B;  3H8Z A;  1UHF A;  1SSF A;  1XOV A;  1QP3 A;  1YJN A;  4MML A;  2JMA A;  2CS7 A;  2CP6 A;  2ZGW A;  2DVJ A;  2YLC A;  1YJ9 A;  4E7L A;  4RTY A;  2JXB A;  2G6F X;  4EMH A;  3BW1 A;  3SHW A;  3JB9 H;  1KJW A;  1NE8 A;  1B34 B;  3CCJ A;  2YLB A;  1YI2 A;  1V76 A;  4DBQ A;  3DB4 A;  1K0X A;  2AIR B;  4RG8 A;  1YJW Q;  3CC2 A;  3RDV A;  2FZK B;  4CC3 A;  2L89 A;  2RQR A;  3VYG A;  1B34 A;  4CI0 C;  1UGQ B;  1O9S A;  3GOX A;  2XIC A;  2XG8 D;  2GFU A;  1PHT A;  1WJR A;  2H3E B;  2V1R A;  4M78 F;  4MZT A;  1M5Q 1;  5EC7 A;  3CC2 T;  4BI3 A;  3PMT A;  4C92 C;  2HNI A;  1N5Z A;  1KD1 R;  3I5S A;  1W2B A;  5IHK A;  1JU5 C;  5FRM A;  3GF5 A;  5CKF A;  4J7F A;  1ZSG A;  2DAQ A;  1YP5 A;  2KSS A;  1SHG A;  2DXC A;  1QVF S;  4KBM B;  1VQO Q;  2DTI A;  1GRI A;  3CCM Q;  3M0R A;  2RJC A;  3JV3 A;  1LOJ A;  1VYT A;  5KE3 A;  1BI3 A;  2PU9 B;  1VQ5 T;  3QYG B;  4DEX A;  4XU3 A;  1MV3 A;  1VYU A;  2RPN A;  2X35 A;  4J9I A;  1PSE A;  4IUT A;  3VRY A;  1D1A A;  3OYI A;  3EHQ A;  3OBW A;  3QHS A;  4AMC A;  4C5G A;  1V1C A;  4WTO B;  3OMG A;  5CR2 A;  3CC7 T;  2CDT A;  3VRZ A;  4Z88 A;  3CCJ Q;  1WJS A;  1QKX A;  3CBM A;  1W70 A;  2HKN A;  2RO0 A;  3N5B B;  2KAF A;  3GLX A;  1OZ2 A;  2RQV A;  1BCO A;  5L23 A;  2VXE A;  1I07 A;  4PNO A;  2LMJ A;  2HZY A;  2F2W A;  2LQN A;  2A37 A;  1J3T A;  1U1T A;  2DRM A;  2QK0 A;  5HK0 A;  4LXC A;  2LCL A;  3CPW A;  4YTL A;  5GAO n;  1M4Z A;  3JCM X;  2P4R A;  3S3M A;  1NLO C;  3SDZ A;  2C0O A;  1WGS A;  4J9D A;  4E7Z A;  5GAN e;  1VQP T;  1VQ4 T;  3OYL A;  2CSI A;  1IXD A;  4MZP A;  4GY5 A;  3HSB A;  2OJ2 A;  3HP9 A;  3C0C A;  1NJI R;  4LDV A;  1M8V A;  3CPW P;  1UG1 A;  2QA4 T;  2RF0 A;  3JCM V;  1HD3 A;  3P8B B;  2R5M A;  2EYY A;  2EBP A;  5C0M A;  1X6O A;  4F7U F;  4XTX A;  2PNI A;  4M7A C;  4E7J A;  2GNC A;  4DEY A;  2C06 A;  1HJD A;  2NUT B;  3LW5 E;  4NL3 A;  2RM4 A;  2K5L A;  3V8K A;  2ZPB B;  1U3O A;  4FSS A;  4PJO C;  3MEW A;  4A4K A;  2EYW A;  4F16 A;  1WHL A;  2MMP A;  1G83 A;  5LJ5 h;  2K2V A;  3MET A;  2E12 A;  5KYY A;  2COW A;  2EYZ A;  2DL8 A;  1K8A U;  1JQQ A;  2QGG A;  2EFI A;  2M0O A;  1RI0 A;  3I56 A;  4N0A A;  4BDY A;  4M7A E;  3M5A A;  2RK2 A;  3HRT A;  2DM1 A;  3EAE A;  5FLX E;  3RER A;  2VB6 A;  3I56 Q;  1IRE B;  1JJ2 P;  2F2V A;  2P4T A;  1N8R C;  1VQN Q;  1VQL T;  2AHJ B;  1XJW B;  1M3A A;  3PIO A;  1KHI A;  1BU1 A;  2QEX Q;  3UAT A;  3EFO A;  5CKD A;  1ZUY A;  1QQJ A;  4IUR A;  4JRP A;  4KGZ B;  3A5Z B;  1RL2 A;  1I4K 1;  1JXM A;  4IUU A;  2X4Y A;  4M78 D;  1U06 A;  1X43 A;  3HRS A;  4QW2 A;  1ZSZ B;  1K9M C;  1VQ9 A;  4JZ3 A;  3QBY A;  3UA7 A;  3EG3 A;  4XU2 A;  4C92 B;  5GAM g;  5L8R E;  4WF2 A;  2HDA A;  1TXQ A;  3JCM b;  4BB7 A;  4F17 A;  1VQ5 A;  2DKG A;  2CP5 A;  5J3B A;  1VQ7 Q;  4A4E A;  1VQ4 Q;  5LJ3 d;  3TEE A;  4M75 F;  3A1P A;  2F5T X;  4M78 G;  2F2X A;  1YIJ Q;  2RH2 A;  4BI8 B;  2K57 A;  4E6R A;  4RMO A;  2KBT A;  4PK4 A;  2DXT A;  4OMP A;  3ZBD A;  1K73 U;  4XQ3 A;  1BIA A;  5GMK h;  1KC8 U;  4OMM A;  2YRV A;  4J83 A;  4J9G A;  3NFC A;  3G71 Q;  3CCV T;  5GAO p;  3PE0 A;  1ZLM A;  2DF6 A;  1QWF A;  1NLP C;  4ANJ A;  2PVG B;  4F7U A;  5GAO m;  3REA B;  2WSF E;  1VOM A;  2W10 A;  3SWN A;  1K8A R;  4M7D A;  1W4S A;  2DA9 A;  4B6M A;  1S1N A;  3E19 A;  2LX9 A;  3I5R A;  2FRY A;  1KIK A;  2Y4Y A;  1KHC A;  4EMG A;  5KYW B;  4PJO D;  2K3X A;  2RNA A;  2AKK A;  3HL8 A;  1M27 C;  2E70 A;  1JEG A;  3G4S Q;  1FWZ A;  3S3O A;  2DEU A;  1GBR A;  3EG9 B;  3EGD A;  1I0C A;  4M75 D;  1WJQ A;  1KFZ A;  1FMW A;  4M7D F;  1TG0 A;  2PVD B;  3LWI A;  4IUV A;  1MMG A;  3RMQ A;  1VQ9 Q;  4JJC A;  2YSQ A;  5IT9 E;  1VQ7 A;  3EFR A;  4VUB A;  1MND A;  3OYM A;  4C0Z A;  1X6B A;  3QZ5 B;  2GCX A;  3EGU A;  2QQR A;  4OB0 B;  3VS6 A;  2KT1 A;  2X51 A;  1WHK A;  1TTH B;  4PFP A;  3NTK A;  2KEA A;  2KT8 A;  4PLL A;  1Q81 R;  4M7A F;  4DBH A;  4JRK A;  1ZBX A;  2WSC E;  3EH2 A;  2ZPG B;  3QKJ A;  4C8Q E;  3G6E T;  3VS3 A;  2DL5 A;  1N9S A;  5GAN 5;  1S72 Q;  3VS0 A;  2D8J A;  2LRQ A;  3V7R A;  4C8Q G;  3RMS A;  1VQM T;  3J7A F;  2CYZ B;  1OI1 A;  2RHI A;  3PMI A;  1NM7 A;  4M77 B;  2FL7 A;  3EHR A;  4IIO A;  1YJW A;  3CC2 Q;  2HD0 A;  3URG A;  2KRO A;  1HXD A;  2OTL A;  1Q7Y U;  4J6Y A;  1ABO A;  2GGR A;  5GMK j;  3CCR Q;  2YUP A;  2M16 A;  1K9M U;  3A8G B;  4JDS A;  3PTA A;  3I55 A;  3CC4 T;  1AWX A;  5C6S A;  2DRK A;  2LQK A;  3M0Q A;  1QCF A;  3G7Z A;  1YJN T;  1VQO T;  1X01 A;  3HFO A;  2M0Y A;  3CD6 A;  3CME A;  5KCH A;  2MOX A;  3WVE B;  1M1K U;  3P8D A;  5D6X A;  3G4S A;  3KBG A;  2NLU A;  2DLP A;  4N4G A;  4KUL A;  1OEB A;  4KGX B;  1LCK A;  2E5K A;  2I0N A;  1IGU A;  1KG1 A;  2FHD A;  4C0D B;  2P0Q A;  3CBP A;  3PNW C;  2A36 A;  1MMN A;  5CAI A;  2FPE A;  2O31 A;  3CCL A;  4J8O A;  2QXF A;  1K0S A;  4Y91 A;  5I22 A;  5DM7 R;  2DYB A;  4B9W A;  3CCJ T;  1RAI B;  1JXO A;  2CZ6 B;  2FPF A;  2XKO C;  1RAC B;  3PFS A;  2L2P A;  2KK4 A;  2HBP A;  1KQS A;  2NYS A;  1YJ9 T;  1IGQ A;  4Z89 A;  1H3H A;  1D3B B;  2LDM A;  1E6H A;  1RLP C;  2DD5 A;  3CCE A;  1NJI U;  5LJ5 j;  4MDX A;  3FJP A;  3H9N A;  2E1H A;  5GAM j;  3VV0 A;  3X25 B;  4M75 C;  5LL6 S;  2CZ0 B;  1PRL C;  3EGX A;  4DA4 A;  1YIJ T;  2CP0 A;  1BKB A;  2X3X D;  1PG5 B;  5A0G A;  4OML A;  3KXT A;  2BZY A;  4QVZ A;  2XID A;  2DL4 A;  3CCV Q;  1AZE A;  2D0N A;  2QGF B;  1OYX A;  1ZBJ A;  3M57 A;  1N6A A;  2CT4 A;  2YWW A;  1AWW A;  2E6Z A;  3NTH A;  3SWN C;  4M7D C;  2DBM A;  3V8J A;  4PKC C;  1H8K A;  1ZUU A;  1WPY A;  3CCM A;  7AT1 B;  2PZ1 A;  2JT4 A;  2GTJ A;  4ZN3 A;  5GAM e;  3OYJ A;  4BI4 A;  4FSX A;  5KE2 A;  2DYI A;  1N9R A;  2E4H A;  2X9H A;  1YI2 Q;  2SEM A;  4C5H A;  2BIV A;  4QVD A;  1Q81 C;  1KK7 A;  3CCR T;  3CC4 A;  4XTW A;  2DFU A;  4OMQ A;  2CH4 A;  1X75 C;  2V8K A;  4X9D A;  3OYY A;  1M8M A;  3E1S A;  3GPL A;  4AFS C;  4IUP A;  2KR3 A;  5GAM f;  2JM8 A;  4C5E A;  5IN1 A;  3BDL A;  5LJ3 j;  4EMK B;  1YJW T;  2J06 A;  3NGP A;  4RTX A;  1RAH B;  2JTM A;  2KDS A;  3WVD B;  2DMO A;  4ZTJ A;  3OSV A;  3G6E Q;  1QCO A;  1YCS B;  2NUZ A;  4LDY A;  5FU7 B;  3FRN A;  1AD5 A;  1C6V X;  2GFA A;  2L5Q A;  3G6E A;  4ZGJ B;  3RES A;  2DJZ A;  4LDX A;  2VYT A;  3L2W A;  2HL5 C;  3CCU T;  3UF4 A;  4BE0 A;  2QTX A;  5FWB A;  8AT1 B;  3J80 E;  1U5S A;  1Q81 U;  2E3H A;  3HHT B;  5J39 A;  3IQL A;  3CME T;  3SEM A;  3ME9 A;  5LJ5 g;  1M3C A;  4XTV A;  4XK8 E;  4M77 C;  2DIQ A;  3LH0 A;  2O01 E;  2J7I A;  4KT0 E;  1K9A A;  2EWN A;  1M1K C;  1VIE A;  2MI6 A;  4KRT A;  1TH7 A;  2IVW A;  2HAX A;  3C12 A;  1UUE A;  2QG9 B;  2D0Q B;  4L6V 5;  2EYQ A;  1OX8 A;  4HVW A;  2JW4 A;  3LLR A;  1VQ5 Q;  4OP0 A;  2EIF A;  5CIU A;  2YUN A;  4IUQ A;  1M90 U;  4E7S A;  5GAN 3;  3JAM E;  2DNU A;  5CKB A;  1K76 A;  2DL3 A;  5LJ3 f;  4GLM A;  4RG2 A;  3I35 A;  4P5N A;  3M4Y A;  3M0U A;  2XI9 A;  3ZFJ A;  5GAO l;  1YHQ A;  1SF9 A;  3DKM A;  1HK9 A;  2AZS A;  3JCM h;  5IHI A;  3JCM P;  2C0T A;  1YIT T;  3OS2 A;  1H3Z A;  2V8J A;  3RKX A;  4M7D D;  2XDD A;  4C0G A;  2EAY A;  3G1J A;  4Z02 A;  2O2O A;  2DXU A;  1Y96 A;  1EX4 A;  3WXM B;  2OAW A;  1WQW A;  1D1B A;  1QMC A;  3C4S A;  2M1H A;  3JB9 D;  4K11 A;  1OX9 A;  1YWO A;  3H6Z A;  1G8X A;  1M2V A;  4QQ6 A;  2NWM A;  4F14 A;  2KQW A;  2QQ9 A;  4IIM A;  1ZHI A;  2FG0 A;  2ZPI B;  2OX7 A;  2RI3 A;  1WLP B;  4M75 A;  2CUB A;  4N0A C;  3CCS A;  3SD4 A;  4JRI A;  2LZ6 B;  2XDP A;  1VQ9 T;  1YWP A;  3RR6 A;  3A8O B;  4JLI A;  2DIG A;  2FRW A;  1UEC A;  1C1A A;  1TUC A;  5CQX A;  3EG1 A;  4PJO G;  4E7I A;  4OMO A;  1OPK A;  2LCC A;  2J6K A;  1VA7 A;  4BY6 B;  2RI5 A;  2QYZ A;  5GAN 8;  1PD0 A;  3OQ5 A;  1KQS S;  2W0Z A;  1E7O A;  1IO6 A;  1D0Z A;  4O6J A;  2X4X A;  3V7S A;  2LJ0 A;  2O4X A;  3OSS C;  4PJN A;  3X20 B;  1K9M R;  2QQB A;  4J9B A;  1YI2 T;  1ABQ A;  5GMK l;  4HT8 A;  1R8O B;  1QVF P;  3U23 A;  2CH4 W;  1XTD A;  1Y71 A;  4KUI A;  4R0K A;  3FEO A;  2LC4 A;  2HSP A;  2LNH B;  2DBK A;  1I81 A;  5KYX B;  4M7A G;  2OTJ Q;  1M90 R;  2DJQ A;  3VS5 A;  4PJM A;  4M7D E;  4HXJ A;  1X2Q A;  2D1X A;  3NPF A;  1BB9 A;  2MWP A;  4C8Q C;  2P0P A;  4FYV B;  3OS0 A;  2HMA A;  5GAN h;  1QVG P;  2LCS A;  3CCE Q;  1QVP A;  1X27 A;  1VIF A;  5GAN 4;  1ZA1 B;  1VUB A;  3GIB A;  2RJE A;  2DK3 A;  2A3L A;  3QZ9 B;  2CSQ A;  4M7A A;  2GQV A;  2XDB A;  3TRE A;  4FIB A;  4MZM A;  1VQK Q;  2AKL A;  1Q7Y R;  2K3Y A;  4J9F A;  3NTI A;  1QWE A;  4JJD A;  3M9Q A;  1WX6 A;  4HCC A;  1H64 1;  2RK1 A;  4R56 A;  4BUG A;  4M75 G;  3F70 A;  5IXB A;  2CT3 A;  2EKH A;  3MPU B;  4JLG A;  1MNE A;  1U1S A;  4Y28 E;  1NYG A;  2KRN A;  4JJN K;  4F7U B;  1VQ7 T;  4A4H A;  2B86 A;  4RUG A;  2BUD A;  3R6N A;  2L3Q A;  2BZ8 A;  1YIJ A;  5GAM h;  4AT1 B;  3JCM J;  1WIE A;  3TSZ A;  3VUB A;  3VS1 A;  5A0L A;  1N27 A;  3JCM c;  5GAO r;  3EFS A;  2BZX A;  5M9O A;  1EIF A;  2HKQ B;  4BE2 A;  1W2B P;  9ATC B;  4N4I A;  2OTJ A;  4FT4 A;  4L5G A;  3OYB A;  1M30 A;  2O88 A;  1AVZ C;  3R6O A;  2EQM A;  4J9H A;  3ZL7 C;  2P84 A;  1Z9Z A;  3UA6 A;  2OTL Q;  4RTW A;  1Y96 B;  2K7A A;  1I5O B;  2EW3 A;  4JZ4 A;  1W6X A;  4LDU A;  1N8R R;  2B8A A;  3OW2 P;  1O75 A;  1UFF A;  1UB4 A;  1WI7 A;  2KI7 A;  4PJO B;  1OUL A;  1PNJ A;  2A28 A;  1VQK A;  2R5A A;  3M53 A;  1EZZ B;  1QP2 A;  2DX1 A;  1M2O A;  2KY9 A;  2MYS A;  3QG1 A;  4J9C A;  5GJV B;  2WAC A;  1VQ6 T;  2LT1 A;  5GAN j;  1BK2 A;  1JRI A;  5FW9 A;  1IHV A;  5GAN 2;  3A8H B;  5GJW B;  2VUB A;  5LJ5 e;  1WHH A;  1VQO A;  1SEM A;  4ME7 A;  3M0S A;  1YCY A;  3L2V A;  3HKS A;  4BAC A;  2FO0 A;  4C8Q D;  1GCQ A;  3NHN A;  1MGQ A;  2HQX A;  4FU6 A;  4LD6 A;  4CC7 A;  2QAS A;  2QI2 A;  1AWO A;  3CCQ T;  4ESR A;  2KXC A;  1I8F A;  2X4J A;  1Y57 A;  3OYA A;  1WFW A;  1D0X A;  1VQN T;  3CCL T;  1X69 A;  1OQK A;  2QTV A;  1G3S A;  3AT1 B;  2LP5 A;  1TU0 B;  3M59 A;  4A4G A;  2DZC A;  3Q1J A;  3FLG A;  2DTH A;  2OI3 A;  2QDY B;  1K8A C;  3MEA A;  3TSW A;  1Q86 R;  1NJI C;  2RQU A;  4DOW A;  1RUW A;  4M78 A;  2WSE E;  3OYC A;  2YUQ A;  3HPW A;  4JS5 A;  4AG2 C;  4CC4 B;  2GF7 A;  2RN8 A;  2OTJ T;  5CK9 A;  4R55 A;  4EIK A;  1SG5 A;  3I55 Q;  3CME Q;  1OU8 A;  1VQN A;  4AFQ C;  2FYK A;  1K73 R;  2DZ9 A;  3UPU A;  3OA6 A;  4EDU A;  1WHM A;  1ZSZ A;  3TQ7 P;  2K9G A;  3S6W A;  5FU6 C;  2VV5 A;  3BDU A;  2YRC A;  2C0I A;  4Z8A A;  1JJ2 A;  4LNP A;  4RTT A;  1U8R A;  2E6N A;  1UTI A;  3UT1 A;  4B9X A;  1VQK T;  2FPD A;  2KXD A;  1Q82 R;  1E6G A;  3THK A;  1ZUK A;  1HYO A;  1Y0M A;  5KYU B;  2JNG A;  4M78 B;  2KYM A;  3QSU A;  2YXY A;  1WA7 A;  2KVQ G;  2XHC A;  2EQI A;  3KUF A;  1GBQ A;  2JS2 A;  4Q5W A;  2HEQ A;  2KYB A;  4X1V A;  2VGN A;  3TCJ A;  2E64 A;  5KCO A;  4C92 A;  4RTZ A;  1B07 A;  1AEY A;  1WHJ A;  4E7K A;  3JSC A;  4RCC A;  1VQ6 Q;  2M51 A;  4O5V A;  1RLQ C;  2E10 A;  2RD1 A;  1FYN A;  2D9T A;  1UGV A;  3VUZ A;  3DB3 A;  1ARK A;  3OBY A;  4II1 A;  3OB9 A;  1QLY A;  5HK3 A;  1Q82 C;  2CP7 A;  1KSW A;  5LJ3 g;  4C0D C;  2LVM A;  4M7D G;  3L2R A;  4JPB W;  1Y7X A;  3HFN A;  5KYN A;  1G3Y A;  1Q86 U;  3M0T A;  2EQK A;  3JB9 G;  3CMA T;  3QPH A;  2FZG B;  4FT2 A;  2PUO B;  3X26 B;  4LD9 K;  2F1L A;  2O4X B;  4C8Q B;  4NL2 A;  1VQ8 A;  2JM9 A;  5IAY A;  2PTK A;  3H41 A;  1S72 T;  5KH6 A;  4ELZ C;  3JCM e;  1KC8 R;  2JS0 A;  3GNG A;  2A7Y A;  2P0K A;  3JCM W;  1OOT A;  4OB3 B;  1NPP A;  3O8V A;  1VQM Q;  4PJO E;  4M75 B;  2DTO A;  3ER0 A;  4DBR A;  2DEQ A;  1NEG A;  3QYH B;  3M54 A;  4OB2 B;  4M77 A;  1M1K R;  2KGT A;  4F7U G;  2AK5 A;  2GQI A;  1Q82 U;  3VJP A;  2IPO B;  5DLO A;  1MV0 B;  3TVT A;  5HCK A;  1LJO A;  3RKY A;  2M9U A;  2A0F B;  2JZ2 A;  3M4G A;  4HT9 A;  1VQP A;  3M58 A;  2CP3 A;  2K79 A;  3CCE T;  5GAM d;  3FIF A;  4JUV A;  1GCP A;  2LTO A;  3CCQ Q;  5LJ5 d;  1WYX A;  3EFO B;  4ZGE B;  2RMO A;  3LH5 A;  1PRM C;  4M7A D;  1RAG B;  4PJJ A;  2XU8 A;  1YFN A;  3NMZ C;  2RHY A;  4C5I A;  2EGC A;  2MAM A;  1ZX6 A;  2VGM A;  2ABL A;  2RHZ A;  3E9F A;  3FJ5 A;  4LUD A;  3OYK A;  2KMT A;  3RNJ A;  4XU1 A;  1W1F A;  5GMK e;  5KYY B;  2EKO A;  2RB6 A;  1K73 C;  3M0P A;  1SHF A;  2NUP A;  2K2M A;  2HBW A;  4BDZ A;  4LDW A;  2LJ1 A;  1PKT A;  2JTE A;  3A98 A;  4C92 E;  2EJF A;  1M3B A;  3QUI A;  2J6O A;  3LGF A;  3OW2 A;  3O5Z A;  2QQS A;  5FU7 C;  5KYU A;  2CZ7 B;  3MHX A;  1VQ6 A;  1YJN Q;  1YBY A;  1UEB A;  3RBB B;  3CXC P;  5FU6 B;  1CKB A;  4ZNX A;  2JOY A;  3FB9 A;  1BIB A;  3MP1 A;  1OV3 A;  4PJO F;  3QDF A;  1BI0 A;  1S72 A;  2LQ8 A;  2MIO A;  1AWJ A;  1VYV A;  2EGE A;  3EGX B;  2QEX A;  3CC7 Q;  3G71 A;  2YT6 A;  1H92 A;  4M78 C;  4ZN1 A;  1WXT A;  4XTZ A;  1M9S A;  2O9V A;  4X9C A;  3CC7 A;  4XU0 A;  2CP2 A;  2RQT A;  1SRM A;  1KD1 C;  4ZTF A;  3VS7 A;  3GBQ A;  3CEY A;  3L1A A;  4MMK A;  2DO3 A;  3CD6 Q;  2CGH A;  5A2Q E;  3CCS Q;  3MP6 A;  1SRL A;  2RI2 A;  5AYF A;  3L42 A;  4V2S A;  4A53 A;  2L3S A;  3EH1 A;  5HKC A;  3CXC S;  2COY A;  3I56 T;  5FRO A;  5GAN 6;  1V29 B;  2RJD A;  2HQH A;  3ULR B;  2RA2 A;  4F7U E;  2RHU A;  4C92 G;  4M75 E;  3QWX X;  1QKW A;  1Q95 G;  8ATC B;  4EMK A;  4OGC A;  2DPP B;  3S3N A;  3CCL Q;  5CO7 A;  1UDL A;  2YUO A;  2F5K A;  5D7U A;  1IRX A;  2EPD A;  2DD4 A;  1NEB A;  3QO3 A;  5HY6 A;  1AZG B;  1RAB B;  3UDC A;  4M7A B;  3FC3 A;  2BTT A;  3JCM f;  2HL3 A;  3DLM A;  4X34 A;  1C0M A;  2BE9 B;  3AHU A;  3CXC A;  2ED0 A;  4RTV A;  3FDR A;  1I5L A;  1OPL A;  3CMA A;  4E47 A;  4IKF A;  3H0F A;  3JCM d;  4C0F A;  3OYE A;  1PCX A;  3EG0 A;  3E9G A;  2RQW A;  4N4H A;  4BY6 C;  2PUK B;  2KRS A;  2IG0 A;  1TUG B;  2F69 A;  4DOV A;  5IH2 A;  3CCM T;  1YNZ A;  4ATO A;  2R57 A;  1B3Q A;  2JVV A;  2K3B A;  2CUD A;  2LJ3 A; 
#chains in the Genus database with same CATH homology
 1IHW A;  1IHV A;  1C1A A;  1C6V X;  1EX4 A;  4FW1 A;  4FW2 A;  1C0M A;  1QMC A;  5D7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...