1IHWA

Solution structure of the dna binding domain of hiv-1 integrase, nmr, 40 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the DNA binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna binding protein
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ihwA00
1C6VX 1QMCA 4FW2A 4FW1A 1IHVA 1IHWA 1C1AA 1C0MA 5D7UA 1EX4A
chains in the Genus database with same CATH superfamily
1MMNA 3H0IA 4JZ3A 3CCMT 3G1JA 1UGPB 2DVEA 1U5SA 2E4HA 2DJQA 2JJ9A 4Y92A 1GBQA 7AT1B 1OV3A 2MF2A 4BE2A 2LMJA 2VV5A 3BY7A 4C5EA 1D0ZA 1IB8A 5A2QE 3RKXA 3CPWS 1AVZC 1ZSZC 3UA6A 3FLGA 1IO6A 5IAYA 4B9WA 3EH1A 1Y7XA 1IREB 3QYGB 3VKIA 4QVDA 3ZFJA 3PTAA 3MEWA 3V8LA 3L2WA 1M2VA 1NYGA 5LJ3g 2DZCA 4FYWB 5GANj 3GBQA 2E65A 2ESWA 1BI0A 2RA2A 1D1BA 2LX7A 1M3BA 2DRMA 4J9IA 3CCMQ 2HKQB 1B07A 4ELYC 4CC2A 2VGNA 3J7AF 1WQWA 2EW3A 1MV0B 4AMCA 4CC7A 3UT1A 4DBQA 3L2RA 5J3BA 1YIJT 2HQHA 1UUEA 5LJ5f 3A1PA 1RUWA 3PT9A 2SRCA 1VQKT 4FW1A 1Q86R 1BYMA 1M4ZA 2JZ2A 1PM3A 2C0IA 4PFOA 2ED1A 5KYYA 3CCMA 4PFZA 1Q82C 1FWZA 2KT1A 5A0DA 3FEOA 1CSKA 2DXCA 2MMPA 4JRKA 5AT1B 4OMMA 2HAXA 1ZHIA 3LH5A 1N6AA 5GAN2 2EYQA 2DXUA 2JMCA 5EC7A 2CH4W 4A4HA 3UF4A 1TOVA 1QCOA 5GMKi 1K1ZA 1YIJQ 1X27A 2W0ZA 2EQJA 5GMKe 1UGVA 5ECAA 1VQ7T 1VQKQ 2D6FA 3HRSA 2GQIA 1N9RA 2PVDB 2HD0A 1NG2A 2PUKB 5KYNA 3OYAA 1UEBA 3HTRA 1S1NA 1KQ2A 1U3OA 2XMFA 4XTYA 3H0HA 1GCQA 3CCST 3DKMA 1YIJA 3OB9A 1NJIC 2RHYA 3H6ZA 4PLIA 5CKEA 3ZEHA 1M3CA 2JS2A 4CI0C 4C8QB 3MPUB 4CC4B 5LJ3h 1VQMT 4PLLA 4OGEA 3JCMf 4AFZC 1NZ9A 2M1HA 1VQ7Q 2XD0A 5HK3A 4QQ6A 2XDDA 4EMGA 2MCNA 4XTZA 3E2UA 3PVLA 4J83A 3SDZA 1AZEA 1SKUB 1VQ8T 4M78E 1M1KR 3URGA 4HXJA 2YUQA 4DBHA 3CPWP 4N0AA 2FG0A 3CCSQ 1TWBA 4J6WA 4BDYA 1VQ7A 2RD1A 3TQ7P 3PIOA 1R0CB 3J80E 3C12A 4X9DA 4B9XA 2AK5A 1VA7A 2X4JA 5CKDA 1UGSB 5GJWB 3I5RA 1VQMQ 1K0XA 2FRYA 4ELZC 3FIFA 2DL3A 2EYYA 4PL6A 1T0HA 1K9MR 3G6EA 2DEUA 2C06A 1OOTA 2BUDA 4FCYA 4PK4A 4RG2A 1Z9QA 3CCSA 2CKKA 1VQ8Q 1RAGB 1AWXA 4IURA 1M90C 2OTJQ 2JN0A 5KCHA 1QLYA 4IIOA 3UDCA 1VQMA 1XJWB 3LX7A 4MZTA 1YJ9A 2K5LA 1X2KA 2KRNA 1RACB 4RTZA 2K79A 3VS7A 2M9UA 4M7AB 5EG2A 1RAAB 5KYUB 4A63B 1H641 2P0PA 1WHMA 1PD1A 1VQ8A 2EBPA 2GBQA 4RTYA 3AT1B 2DPPB 4JRPA 1XNIA 3CBOA 2OTJA 4BI8B 3OYNA 3OYCA 2FPEA 2JNGA 3F70A 1IGUA 2OI3A 2X35A 2CUDA 2WSEE 2RK2A 2V1RA 2LJ0A 4D8KA 1VYUA 2DIGA 2DILA 2DXBA 2O9SA 3VV0A 1VQNT 5I21A 3OYIA 3NHNA 3QBYA 3RERA 2YSQA 2K5IA 1QKXA 2YLBA 3NGPA 1I1JA 1OI1A 4LNPA 4C92E 2QA4Q 3OYDA 3EG1A 4X9CA 1I81A 5D6YA 4ZN3A 2L3PA 1QVFS 1VQLQ 2WSFE 3RBBB 1TUCA 1MV3A 2CZ6B 4AG2C 2A0FB 4HA8A 1UHCA 2CP0A 4AFSC 3META 1UE9A 2KQWA 1VQNQ 5IHIA 2HMAA 1BKBA 2VB6A 4OMLA 3EFOB 1LOJA 2QA4A 3SEMA 4LN2A 1M1KU 4WF2A 3OYLA 1VQLA 2K9GA 1PRLC 2AHJB 2VGMA 3EG9B 5IT9E 1MHNA 2EPDA 2ZPEB 3VYHB 4M7DB 4MDXA 1PSFA 4M78D 2RM4A 3RNJA 1K8AR 1JJ2A 1V76A 3REAB 2QQAA 1AWOA 4XU2A 4XTWA 2EGEA 4BY6C 3X25B 5GAMe 2K2VA 3JCMc 2E6NA 5GANe 1K9MU 2JTFA 5IXFA 4N4IA 5HCKA 2CP6A 3LW5E 2HBPA 1G3TA 1RI0A 1Q81U 4J7IA 4M77A 3BW1A 4DBFA 1UGRB 2AKKA 2LDMA 1RLQC 2M02A 4M77C 1D3BB 2XI9A 5GAN5 4M7AA 4M75A 4HCZA 5KYUA 4M7AC 4M75C 3L2UA 4OMQA 2DMOA 3BDUA 1TU0B 2EJGA 4M77F 3J81E 2L3RA 4M7AF 1O75A 4M75F 1IHWA 3LGFA 3EGDB 4PJOD 1PD0A 1WXUA 2FRWA 4J9FA 3FJPA 2DK3A 3M54A 1G8XA 5LJ5g 5GAN3 1ARKA 2DE0X 3JRZA 1MUZA 2CZ7B 3RMQA 2F5KA 3BDLA 3M0PA 3HL8A 4ORZA 2KY9A 4WCIA 4VUBA 2DRKA 2KXDA 2JTMA 4FW2A 2E64A 1X6GA 3OBYA 1ZUUA 2Y4YA 2E70A 4JLIA 3ZL7C 2P0KA 3S6WA 2FPFA 2HNIA 1FX7A 3OMCA 1ZA1B 4C8QD 1K9AA 4DA4A 1WGSA 4M77G 3CCEA 1YJNT 5GAMd 3I9QA 2JS0A 5A0GA 4M7AG 5GANd 4M75G 2O4XA 2KYBA 4C5GA 3CMET 2IIMA 3G7ZA 1H92A 3HSBA 3CXCA 2LP5A 4C92D 2K3XA 3QG1A 1M30A 5GAOr 1OQKA 1WXBA 1HXDA 2COZA 1B3QA 1QVPA 2LZ6B 2X51A 1XTDA 1ZSZB 2ABLA 3EG9A 3REBB 3HFOA 3FB9A 5FWCA 4M7DA 2L0AA 3E9FA 4QKUA 4B6MA 4ZNXA 1YJNQ 4Y91A 3UATA 5KYWB 2D1XA 1I4K1 1VOMA 3INZA 3EG3A 1TS9A 2L89A 1K8AU 4M7DF 3RR6A 2CP2A 3CMEQ 4JZ4A 4C0DC 2O01E 3THKA 1IHVA 5GMKl 3G4SQ 1NYFA 3DB4A 3NTHA 1RL2A 4ZN1A 1D3BA 5IN1A 1UGQB 2E10A 1Z9ZA 2BE9B 2DLPA 4WTOB 5LJ5h 3DLMA 2D0QB 2JM9A 2LJ1A 1YJNA 2DL8A 4RTWA 3JCMV 4KH0B 1YWPA 4BACA 3HRTA 1B34A 2MOXA 2VWFA 2BIVA 2B86A 3HPWA 1U06A 3TCJA 5IHNA 3EGDA 5M9OA 5J39A 3I56T 1RAEB 3G4SA 4HVVA 2VUBA 3TSZA 4IKFA 2FZCB 1AT1B 2RI3A 3QKJA 2JMAA 3P8DA 4J9EA 3ZBDA 2FL7A 2LX9A 1B7TA 3V8JA 2QEXT 4JJDA 3I55Q 4M7DG 2X4WA 1PC0A 4OF1A 5IXBA 1VQ5T 5GAOm 1W4SA 1KK7A 4FYXB 1WPYA 2FEIA 1WNLA 1WXTA 4E7HA 2D0NA 3JB9F 2DFUA 1GFDA 1M1KC 1YI2Q 1ZBXA 4FYYB 2HQEA 3KBGA 5CK9A 3QYHB 4RUGA 1N5ZA 2CGHA 2RQVA 2E3HA 2E5QA 3A5ZB 3VJPA 3FRNA 3I55A 2E6ZA 4J9HA 2PUOB 2KT8A 2GQVA 4J9DA 3MEUA 1YJWT 3QHSA 2QEXQ 4N4GA 3VS4A 2LQWA 2K57A 3OYKA 2MAMA 2WSCE 1VQ5Q 3JCMh 3ULRB 3OYFA 1YCYA 4JS4A 1K9MC 3MKDA 3BE3A 1YI2A 2HQXA 4OB1B 1UDLA 4E6RA 1ZSZA 1N9SA 1PCXA 2XIDA 4NS5A 1Q81C 2QDLA 3X26B 4PJMA 1BBZA 2NWMA 2H8HA 1YITT 1VUBA 3M58A 3KFVA 3MEVA 3D7SB 5I2MA 4OVAA 5GAMj 2DL4A 1KFZA 5KYWA 2KBTA 3RDVA 1QWFA 2QEXA 3CC2T 3DB3A 3JB9G 1AEYA 3UA7A 3JCMW 1NEGA 2EAYA 1JU5C 3QWYA 4JJNK 4QVCA 4DEYA 1TUDA 1YJWQ 2FVUA 3OY9A 2FPDA 1V1CA 1MNDA 1ABOA 3QIIA 3S3MA 2HBWA 3OS1A 4KUDK 2J7IA 2QI2A 3RIRA 4J9CA 2DBMA 2CYZB 2RHXA 4RKUE 1LJOA 1YITQ 2JUFA 1XQHA 1KQSP 3M55A 1DJ7B 1EFNA 2LC4A 2Y90A 2YUPA 1YJWA 3CC2Q 2VXFA 2EYZA 2LT4A 3CCLT 2ZGWA 1RI9A 1SEMA 1UTIA 1SG5A 4PJJA 1YNZA 2GF7A 5IHKA 2RHIA 1YITA 2BE7D 2A36A 3OS5A 1SRLA 3UWNA 1R0BG 4L6V5 1JQQA 1BB9A 4LD9K 2DA9A 2ENMA 3WXMB 1JJ2S 2NYSA 1X2QA 1NE8A 2FHDA 4F16A 2RQUA 2DBKA 4E7KA 5FW9A 5LJ3j 1JB0E 2R5MA 1QVGA 4Z8AA 1VQOT 4EMKB 2RHZA 4OB0B 4LUEA 2YDLA 2CUBA 1VQKA 3O5ZA 3E19A 3VS3A 4A4FA 2BKDN 2AKLA 2YUOA 3EHRA 2XDPA 1K8AC 1PNJA 1GCPA 3GNFB 2H3JA 5AYFA 1M8VA 4BE1A 2YXYA 3EHQA 3GIBA 2ATCB 3PMIA 3CC4T 3HFNA 4OMFB 3A8OB 3OW2A 2L5QA 2AZSA 2KK4A 1QCFA 2CS7A 2PNIA 3OMGA 3EGXA 2D8JA 4FT2A 4BI4A 2YLCA 2ZPFB 2JXBA 3A8HB 2EWNA 5FU7C 2FYKA 1HJDA 1IGQA 3RKYA 3GP8A 4XU3A 4N4HA 1VYTA 4CRIA 4JS5A 3PMTA 1QP3A 1PSEA 3WVDB 4XTVA 6AT1B 1CKBA 3PGGA 1KD1R 8AT1B 4XTXA 4BY6B 3CCQT 5GAN8 3OYYA 4M78A 1WJRA 4QVZA 3EG0A 2QASA 4M78C 2G6FX 4P5NA 3MO8A 4IIMA 3JCMP 5GAMf 2M16A 3JCMb 1Q86U 4EIKA 2F2WA 4J7FA 5GANf 4PJOE 3C95A 4M78F 3OQ5A 2RK1A 4RMOA 2ZZDA 4M77B 2MI6A 3P8BB 3PIPA 3CXCS 4M75B 5GAOn 2KXCA 1YHQT 1OX9A 4RTVA 4OB3B 3X24B 3M0UA 2M0OA 2VVKA 2VYTA 1YBYA 3CCQQ 3M59A 1ZLMA 1E6HA 4GLMA 1K4US 1I07A 4BB7A 2D9TA 2P4RA 1GFCA 2FZGB 1GRIA 3NFCA 3X20B 1WYXA 4YTLA 4Y28E 1LNXA 1KG1A 1LCKA 2K2MA 2MK5A 4C8QE 2L3QA 3OSSC 1QKWA 4EMKA 2F1LA 3WVEB 1BI3A 3V8KA 4EMKC 1JJ2P 4RTUA 2DF6A 1YHQQ 4XQ3A 2CSQA 5KYXB 3CCQA 4M78G 1VQ6T 4F7UB 4OMOA 4MMLA 3V7RA 1TUGB 5GAN7 1MNEA 3VS1A 2PVOB 3A8LB 3M57A 3MCAB 4II1A 2PU9B 2ZPIB 5FROA 2JM8A 4HVWA 4BD3A 4E7JA 2QG9B 3M53A 2O4XB 1YHQA 1VQ9T 2CP7A 2OJ2A 4LD6A 9ATCB 1PKSA 2K4YA 2GFUA 3TVTA 2V1QA 4KT0E 1YN8A 1N8RR 2VASA 2KYMA 4F04B 2GNCA 1KHIA 4C92C 2J06A 2XKOC 1BK2A 1JXOA 3U23A 4QW2A 2ZCFB 3SD4A 2EIFA 1NPPA 1OU8A 3AHUA 1UECA 2GCXA 2VC8A 1VQNA 3BFMA 1E7OA 4GY5A 3UPUA 4EPCA 4BE0A 2E12A 3ME9A 2LT1A 4A4KA 4JUVA 3L1AA 3QXEB 4ZGDB 1WFWA 4C0DB 3KXTA 3H8ZA 2DX1A 2G3RA 4MZPA 1SHGA 3IQLA 1RADB 5D7UA 1SPKA 2F2XA 2CH4A 2J05A 3MP1A 3NMZC 5CKBA 2A28A 4FT4A 4ZGJB 1TSFA 4OP0A 2YT6A 3VS6A 1OPKA 1ZUKA 3CCRT 1X75C 1B34B 1WHGA 5KE3A 4O5VA 3E9GA 3CXCP 1VQ4T 2YRVA 4JRQA 4R0KA 3CMAT 1H3HA 3VS2A 2DNUA 4OGCA 1NBEB 1W2BA 3TU4K 1PG5B 4E7SA 4OMNA 2HL5C 2RNAA 2NUTB 2CREA 4NOYA 2KROA 5CQXA 3Q1JA 5KYXA 3QWXX 4F7UA 5FRMA 2DVJA 1D1CA 4R56A 3TSWA 5GMKh 5KCOA 2JT4A 1IZ6A 1M2OA 2L3SA 3GNGA 1CKAA 2NLUA 2Z0WA 2W10A 2YRCA 3SWNA 4F7UF 1UFFA 5L23A 3SWNC 1WHKA 5CO7A 2KMTA 1AOJA 5LJ3e 2LTOA 1QVFP 1D09B 4XU0A 4XAXB 3NTIA 1R77A 4LDYA 3MEAA 2AIRB 2IG0A 5CKHA 4X34A 1ZQ1A 1UJ0A 3CCUT 3R6OA 4AFUC 5C0MA 1UB4A 3NTKA 3VRYA 1KSWA 1Q86C 2E5KA 2X3XD 1N8RU 2P0QA 1YCSB 2I0NA 3QO3A 3CBMA 3CD6T 3QZ5B 4JDSA 4JJBA 2V8KA 3MHXA 3JCMg 1O9SA 2DM1A 4C5IA 5LJ5j 3I35A 2KI7A 4JPBW 4C0FA 2VXEA 4F7UG 1BCMA 2VKNA 5FU6C 3VUZA 1QVGS 3LWIA 1S72T 1EIFA 2QXFA 4FSXA 3CCUQ 4E7IA 1M3AA 4J9GA 3RUXA 4OMPA 1VYVA 1M8MA 1RLPC 2DD4A 2QAZA 3M0QA 1F1BB 1Q7YR 3M4GA 4IUPA 3OYBA 5HY6A 3CD6Q 1NEBA 3CC7T 2A37A 5DY9A 4M7AD 2K6DA 3CMEA 3C0CA 2DAQA 2XU8A 1OULA 3HKSA 3OYJA 3L42A 1PHTA 5GMKm 3CCUA 5LJ3d 3OW2S 2QYZA 4C5HA 1M9SA 5GAOl 2BZ8A 1H3ZA 2RN8A 2NUTA 1EZZB 4PJLA 2BZYA 2PZ1A 4AT1B 1T3SA 3CD6A 5GANg 1EX4A 1RAFB 5HK0A 3QSUA 4J6XA 3EH2A 2R57A 2IPOB 2OAUA 3LYIA 3CC7Q 2HSEB 1QCNA 2F5TX 2RF0A 4KULA 2GTJA 3M4YA 3I56Q 3EG2A 1I8FA 2V26A 1ZSGA 1X6OA 2RQWA 2OAWA 1ZBJA 1W1FA 1D0YA 1OZ3A 1M1GA 2RMOA 2JOYA 2COYA 4KGVB 4ESRA 4Z89A 3OSVA 2DXTA 2BTTA 3I56A 2KNBB 3A8MB 3ER0A 3OYGA 3LH0A 3L2QA 4XTUA 3RMSA 1OPLA 1I5OB 2B8AA 3L2ZA 3CCVT 1MMDA 1GBRA 1AD5A 2RHUA 4NL2A 4A53A 4IUTA 4DQ2A 2QTVA 1I0CA 3M0RA 2DJZA 2KDSA 1Q95G 3EGXB 1VQ5A 1G3YA 1LVKA 4OB2B 4RTTA 5CR2A 2EJ9A 4M7DD 2HZYA 3C4SA 2DERA 4FL6A 2A08A 5FU7B 2OX7A 1BU1A 3VU3C 1SF9A 3QJ6A 3QPHA 4ANJA 2LRQA 2EQIA 4FSSA 1VIEA 3OYEA 2RI5A 1NPRA 4R55A 3PNWC 4L5GA 1QVGP 1WIEA 4J8OA 2LCLA 3QDFA 3CCVQ 3C94A 4M78B 4KRTA 5GAMh 1VQPT 4XU1A 3JV3A 1Q7YU 1FYNA 1K73R 5GANh 4JRIA 2XHCA 1WA7A 1FXXA 4HCKA 3JB9H 3JSCA 4RTXA 1M27C 3P8HA 4XK8E 1UHFA 4HCCA 2AZVA 2A3LA 2EQMA 2RJCA 2YWWA 3M0SA 5CCAA 3CCVA 3OW2P 2COWA 1BI2A 1UJYA 5CVIA 2RQRA 3CPFA 2X4YA 5KH6A 3N5BB 4MZMA 2M51A 3CC2A 2D8HA 4A4EA 4AFQC 4DEXA 3PE0A 3JB9D 1VQPQ 4PJOB 4LDUA 4CC3A 2HCKA 1HSQA 4KUIA 3OS2A 4J5YA 1OEBA 2L2PA 1SSFA 5A0LA 3A98A 2J6KA 3V7CA 3CCLQ 1N8RC 3OBWA 1ZA2B 1C1AA 4KBMB 3JAME 4NL3A 1OU9A 1KC8R 1OX8A 2CDTA 2MYSA 1WJQA 3M56A 2P4TA 5FWBA 2JTEA 4PKCC 2GTOA 1I5LA 2JVVA 3QUIA 1VQPA 3G6ET 3MP8A 2CSIA 1BCOA 2X4XA 1GCQC 5DLQE 5IH2A 4HVUA 1QW1A 5L8RE 3CCLA 2RO0A 1KQSA 1WHJA 2WACA 4LDVA 3OYHA 1HD3A 2X3WD 1G3WA 4FM4B 1YJ9T 3GF5A 2DD5A 1VQOQ 2MIOA 1YWOA 2EKOA 1M1FA 4LE9A 1W2BS 2YUNA 2EYWA 2QQBA 4C92B 1ABQA 3RESA 3FJ5A 2K3YA 1NLOC 1BI1A 1WHLA 4GLKA 2HKNA 3G6EQ 2K7AA 2P84A 2SEMA 1T3LA 3I5SA 2OTLT 2OTJT 1KIKA 1TH7A 1RAHB 1IXDA 4N0AC 1VIFA 3NPFA 3GLXA 1C6VX 3R6NA 2PQWA 1VQOA 1YP5A 3CC4Q 1BIBA 3PFSA 1IRXA 2QQRA 2KEAA 2K3BA 4Q5WA 2EQKA 1YJ9Q 3HRUA 5LJ5e 3VYGA 4HCBA 1JBMA 1W70A 2DYBA 4KGXB 2QDYB 1QP2A 3VS5A 3TREA 1K73U 2ZAEA 3HP9A 2XK0A 2KVQG 4EDUA 5GAOq 2QTXA 4RG8A 1R8OB 1D0XA 1Q81R 2LJ3A 1OYXA 4IUVA 1RABB 5HKCA 3CC4A 4FIBA 4FU6A 2OTLQ 2HSPA 3GOXA 4E47A 1PRMC 2O31A 5C6SA 2DTOA 3S3OA 1K0SA 1KJWA 3JCMJ 4PJOA 1SRMA 5GAOp 3DLLA 2KGTA 4PJOC 1G5VA 2C0OA 3CPWA 1D1AA 2QA4T 2AT1B 3EGUA 2LNVA 2RB6A 1U1TA 2O9VA 4PJOF 3JCMQ 4DOVA 2R5AA 2OTLA 1VQLT 2IVWA 2E41A 4F17A 3QZ9B 1LPLA 4QQGA 4Z88A 3EAEA 2QQSA 4MDWA 3VS0A 3LLRA 3JCMX 1JXMA 4QT7A 1YFNA 2EKHA 1KC8U 3MP6A 3PVQA 4GBQA 1Q82R 4A54A 4KGZB 3SWNB 2CP3A 2ECZA 1Y0MA 1A0NB 3S3NA 1WLPB 4C8QA 2HDAA 3JCMe 4C8QC 2HEQA 5LJ5d 1WZOA 2ED0A 2A7YA 3M5AA 3GPLA 5LJ3f 5GJVB 2EGAA 2KE9A 2QGFB 2FO0A 2J6OA 4ME7A 4TVRA 3CBPA 4C8QF 2RH2A 2RQTA 4C92A 2DL5A 1Q7YC 1VQ6Q 3V7SA 2DZ9A 1OZ2A 1TTHB 3CQTA 1JO8A 4F14A 5I22A 3EFRA 4PJOG 1BIAA 2RJDA 4D6WA 1W2BP 4C92F 2RI2A 2QK0A 4O6JA 4PJNA 1HYOA 2RJEA 4QQDA 3VRZA 2DIQA 3L2VA 1GXIE 1JRIA 2J6FA 1KHCA 4M77E 1KD1U 1NJIR 4E7ZA 3KUFA 1VQ9Q 1WJSA 1MMAA 4M7AE 2M0YA 4M75E 1VQ6A 5FU6B 4FYVB 4KH1B 3LGLA 1Y96B 2NUZA 2DTHA 3ASKA 4LDXA 1Y07A 2GGRA 4PNOA 3SFMA 3RKWA 3T9NA 1K76A 2ROLA 5D6XA 5LL6S 2EGCA 2LQKA 4C8QG 1ZX6A 2JW4A 1AZGB 1SSHA 2LCSA 3CCJT 3CCET 3QJYA 1VQ9A 1PKTA 4A4GA 4E2FB 4C0ZA 5GAN4 2RPNA 2HL3A 1AWJA 2DO3A 1Y71A 3A8GB 4C92G 3JCMd 5D6WA 5GAN6 3H0FA 5GMKj 2V8JA 4F7UE 1ZUYA 1NLPC 4X1VA 2LQ8A 1G83A 2MWOA 1NM7A 1QWEA 2XICA 2YHTA 2LNHB 2EYXA 1X6BA 4LXCA 3CCRQ 3QDRB 4JJCA 4HT9A 2CP5A 2MWPA 2RJFA 4AG1C 4D8DA 3CCJQ 1VQ4Q 3CCEQ 1WI7A 2L8DA 3OYMA 1M90R 2V8IA 3CMAQ 1WHHA 4ZTJA 1U1SA 5DLOA 3VUBA 1Q82U 3M9QA 2LQNA 2KSSA 5CQYA 1T0JA 1H8KA 1FMKA 5I11A 3OA6A 2E1HA 2PVGB 2NUPB 3SB2A 3CCRA 4E7LA 3LWHA 3CCJA 1VQ4A 4M7DE 1Y57A 1ACMB 2KR3A 1G2BA 1RAIB 3X28B 3CMAA 4PFPA 2DETA 1K73C 2F69A 1WX6A 3EFOA 3G4ST 2KRSA 4RCBA 4IUUA 4JLGA 2QGGA 3G71T 1N27A 1AWWA 1QQJA 4DBRA 3TEEA 5J26A 4C0GA 5DM7R 4DOWA 2E3IA 3H9NA 3FDRA 2X9HA 2FB7A 1E6GA 1MMGA 2I2LA 1Y96A 3O8VA 1NJIU 1GL5A 3CEYA 2DL7A 4HT8A 4M7DC 1X69A 4MMKA 2CZ1B 4L59A 4V2SA 5CAIA 1W6XA 4J9BA 1J3TA 1M2VB 5FRNA 2R58A 1FMVA 4M4ZA 2XDBA 2YRDA 4LUDA 4M77D 1X01A 2EVRA 2EJFA 2Y4XA 3JB9J 4M75D 3HHTB 2KAFA 3G71Q 4UC4A 2DEQA 2EQUA 3I55T 1KQSS 1G3SA 2QQ9A 2LVMA 2BZXA 3H41A 1WQ7A 3JB9I 1QVFA 1C0MA 1KC8C 2MPXC 5CIUA 2ZPGB 8ATCB 5CKFA 1S72Q 3FC3A 2KRMA 2FZKB 5GAMg 1YI2T 3M0TA 5KYYB 3E1SA 2ROTA 1MGQA 2H3EB 2PTKA 3SHWA 5FLXE 3G71A 2XG8D 1HK9A 2DYIA 1WDXA 1M5Q1 3EFSA 1UG1A 1FMWA 5I2SA 2F2VA 4ZTFA 1X43A 4RCCA 1JEGA 1TG0A 1S72A 4ATOA 2DTIA 1XOVA 1SHFA 4ZGEB 1PWTA 1QMCA 2ZPHB 1M90U 2ZPBB 4K11A 4BI3A 1TXQA 2EFIA 1AHJB 2GFAA 3MJXA 1V29B 2NUPA 3OS0A 2C0TA 1U8RA 2O2OA 4BDZA 3CC7A 4Z02A 4HKEA 2CT4A 4IUQA 1KD1C 1KQ1A 2CT3A 5KE2A 2K5FA 4J6YA 2LCCA 1P92A 2CZ0B 2DKGA 4EMHA 4LDWA 2O88A 4BUGA
chains in the Genus database with same CATH topology
1C6VX 1QMCA 4FW2A 4FW1A 1IHVA 1IHWA 1C1AA 1C0MA 5D7UA 1EX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6V X;  1QMC A;  4FW2 A;  4FW1 A;  1IHV A;  1IHW A;  1C1A A;  1C0M A;  5D7U A;  1EX4 A; 
#chains in the Genus database with same CATH topology
 1MMN A;  3H0I A;  4JZ3 A;  3CCM T;  3G1J A;  1UGP B;  2DVE A;  1U5S A;  2E4H A;  2DJQ A;  2JJ9 A;  4Y92 A;  1GBQ A;  7AT1 B;  1OV3 A;  2MF2 A;  4BE2 A;  2LMJ A;  2VV5 A;  3BY7 A;  4C5E A;  1D0Z A;  1IB8 A;  5A2Q E;  3RKX A;  3CPW S;  1AVZ C;  1ZSZ C;  3UA6 A;  3FLG A;  1IO6 A;  5IAY A;  4B9W A;  3EH1 A;  1Y7X A;  1IRE B;  3QYG B;  3VKI A;  4QVD A;  3ZFJ A;  3PTA A;  3MEW A;  3V8L A;  3L2W A;  1M2V A;  1NYG A;  5LJ3 g;  2DZC A;  4FYW B;  5GAN j;  3GBQ A;  2E65 A;  2ESW A;  1BI0 A;  2RA2 A;  1D1B A;  2LX7 A;  1M3B A;  2DRM A;  4J9I A;  3CCM Q;  2HKQ B;  1B07 A;  4ELY C;  4CC2 A;  2VGN A;  3J7A F;  1WQW A;  2EW3 A;  1MV0 B;  4AMC A;  4CC7 A;  3UT1 A;  4DBQ A;  3L2R A;  5J3B A;  1YIJ T;  2HQH A;  1UUE A;  5LJ5 f;  3A1P A;  1RUW A;  3PT9 A;  2SRC A;  1VQK T;  4FW1 A;  1Q86 R;  1BYM A;  1M4Z A;  2JZ2 A;  1PM3 A;  2C0I A;  4PFO A;  2ED1 A;  5KYY A;  3CCM A;  4PFZ A;  1Q82 C;  1FWZ A;  2KT1 A;  5A0D A;  3FEO A;  1CSK A;  2DXC A;  2MMP A;  4JRK A;  5AT1 B;  4OMM A;  2HAX A;  1ZHI A;  3LH5 A;  1N6A A;  5GAN 2;  2EYQ A;  2DXU A;  2JMC A;  5EC7 A;  2CH4 W;  4A4H A;  3UF4 A;  1TOV A;  1QCO A;  5GMK i;  1K1Z A;  1YIJ Q;  1X27 A;  2W0Z A;  2EQJ A;  5GMK e;  1UGV A;  5ECA A;  1VQ7 T;  1VQK Q;  2D6F A;  3HRS A;  2GQI A;  1N9R A;  2PVD B;  2HD0 A;  1NG2 A;  2PUK B;  5KYN A;  3OYA A;  1UEB A;  3HTR A;  1S1N A;  1KQ2 A;  1U3O A;  2XMF A;  4XTY A;  3H0H A;  1GCQ A;  3CCS T;  3DKM A;  1YIJ A;  3OB9 A;  1NJI C;  2RHY A;  3H6Z A;  4PLI A;  5CKE A;  3ZEH A;  1M3C A;  2JS2 A;  4CI0 C;  4C8Q B;  3MPU B;  4CC4 B;  5LJ3 h;  1VQM T;  4PLL A;  4OGE A;  3JCM f;  4AFZ C;  1NZ9 A;  2M1H A;  1VQ7 Q;  2XD0 A;  5HK3 A;  4QQ6 A;  2XDD A;  4EMG A;  2MCN A;  4XTZ A;  3E2U A;  3PVL A;  4J83 A;  3SDZ A;  1AZE A;  1SKU B;  1VQ8 T;  4M78 E;  1M1K R;  3URG A;  4HXJ A;  2YUQ A;  4DBH A;  3CPW P;  4N0A A;  2FG0 A;  3CCS Q;  1TWB A;  4J6W A;  4BDY A;  1VQ7 A;  2RD1 A;  3TQ7 P;  3PIO A;  1R0C B;  3J80 E;  3C12 A;  4X9D A;  4B9X A;  2AK5 A;  1VA7 A;  2X4J A;  5CKD A;  1UGS B;  5GJW B;  3I5R A;  1VQM Q;  1K0X A;  2FRY A;  4ELZ C;  3FIF A;  2DL3 A;  2EYY A;  4PL6 A;  1T0H A;  1K9M R;  3G6E A;  2DEU A;  2C06 A;  1OOT A;  2BUD A;  4FCY A;  4PK4 A;  4RG2 A;  1Z9Q A;  3CCS A;  2CKK A;  1VQ8 Q;  1RAG B;  1AWX A;  4IUR A;  1M90 C;  2OTJ Q;  2JN0 A;  5KCH A;  1QLY A;  4IIO A;  3UDC A;  1VQM A;  1XJW B;  3LX7 A;  4MZT A;  1YJ9 A;  2K5L A;  1X2K A;  2KRN A;  1RAC B;  4RTZ A;  2K79 A;  3VS7 A;  2M9U A;  4M7A B;  5EG2 A;  1RAA B;  5KYU B;  4A63 B;  1H64 1;  2P0P A;  1WHM A;  1PD1 A;  1VQ8 A;  2EBP A;  2GBQ A;  4RTY A;  3AT1 B;  2DPP B;  4JRP A;  1XNI A;  3CBO A;  2OTJ A;  4BI8 B;  3OYN A;  3OYC A;  2FPE A;  2JNG A;  3F70 A;  1IGU A;  2OI3 A;  2X35 A;  2CUD A;  2WSE E;  2RK2 A;  2V1R A;  2LJ0 A;  4D8K A;  1VYU A;  2DIG A;  2DIL A;  2DXB A;  2O9S A;  3VV0 A;  1VQN T;  5I21 A;  3OYI A;  3NHN A;  3QBY A;  3RER A;  2YSQ A;  2K5I A;  1QKX A;  2YLB A;  3NGP A;  1I1J A;  1OI1 A;  4LNP A;  4C92 E;  2QA4 Q;  3OYD A;  3EG1 A;  4X9C A;  1I81 A;  5D6Y A;  4ZN3 A;  2L3P A;  1QVF S;  1VQL Q;  2WSF E;  3RBB B;  1TUC A;  1MV3 A;  2CZ6 B;  4AG2 C;  2A0F B;  4HA8 A;  1UHC A;  2CP0 A;  4AFS C;  3MET A;  1UE9 A;  2KQW A;  1VQN Q;  5IHI A;  2HMA A;  1BKB A;  2VB6 A;  4OML A;  3EFO B;  1LOJ A;  2QA4 A;  3SEM A;  4LN2 A;  1M1K U;  4WF2 A;  3OYL A;  1VQL A;  2K9G A;  1PRL C;  2AHJ B;  2VGM A;  3EG9 B;  5IT9 E;  1MHN A;  2EPD A;  2ZPE B;  3VYH B;  4M7D B;  4MDX A;  1PSF A;  4M78 D;  2RM4 A;  3RNJ A;  1K8A R;  1JJ2 A;  1V76 A;  3REA B;  2QQA A;  1AWO A;  4XU2 A;  4XTW A;  2EGE A;  4BY6 C;  3X25 B;  5GAM e;  2K2V A;  3JCM c;  2E6N A;  5GAN e;  1K9M U;  2JTF A;  5IXF A;  4N4I A;  5HCK A;  2CP6 A;  3LW5 E;  2HBP A;  1G3T A;  1RI0 A;  1Q81 U;  4J7I A;  4M77 A;  3BW1 A;  4DBF A;  1UGR B;  2AKK A;  2LDM A;  1RLQ C;  2M02 A;  4M77 C;  1D3B B;  2XI9 A;  5GAN 5;  4M7A A;  4M75 A;  4HCZ A;  5KYU A;  4M7A C;  4M75 C;  3L2U A;  4OMQ A;  2DMO A;  3BDU A;  1TU0 B;  2EJG A;  4M77 F;  3J81 E;  2L3R A;  4M7A F;  1O75 A;  4M75 F;  1IHW A;  3LGF A;  3EGD B;  4PJO D;  1PD0 A;  1WXU A;  2FRW A;  4J9F A;  3FJP A;  2DK3 A;  3M54 A;  1G8X A;  5LJ5 g;  5GAN 3;  1ARK A;  2DE0 X;  3JRZ A;  1MUZ A;  2CZ7 B;  3RMQ A;  2F5K A;  3BDL A;  3M0P A;  3HL8 A;  4ORZ A;  2KY9 A;  4WCI A;  4VUB A;  2DRK A;  2KXD A;  2JTM A;  4FW2 A;  2E64 A;  1X6G A;  3OBY A;  1ZUU A;  2Y4Y A;  2E70 A;  4JLI A;  3ZL7 C;  2P0K A;  3S6W A;  2FPF A;  2HNI A;  1FX7 A;  3OMC A;  1ZA1 B;  4C8Q D;  1K9A A;  4DA4 A;  1WGS A;  4M77 G;  3CCE A;  1YJN T;  5GAM d;  3I9Q A;  2JS0 A;  5A0G A;  4M7A G;  5GAN d;  4M75 G;  2O4X A;  2KYB A;  4C5G A;  3CME T;  2IIM A;  3G7Z A;  1H92 A;  3HSB A;  3CXC A;  2LP5 A;  4C92 D;  2K3X A;  3QG1 A;  1M30 A;  5GAO r;  1OQK A;  1WXB A;  1HXD A;  2COZ A;  1B3Q A;  1QVP A;  2LZ6 B;  2X51 A;  1XTD A;  1ZSZ B;  2ABL A;  3EG9 A;  3REB B;  3HFO A;  3FB9 A;  5FWC A;  4M7D A;  2L0A A;  3E9F A;  4QKU A;  4B6M A;  4ZNX A;  1YJN Q;  4Y91 A;  3UAT A;  5KYW B;  2D1X A;  1I4K 1;  1VOM A;  3INZ A;  3EG3 A;  1TS9 A;  2L89 A;  1K8A U;  4M7D F;  3RR6 A;  2CP2 A;  3CME Q;  4JZ4 A;  4C0D C;  2O01 E;  3THK A;  1IHV A;  5GMK l;  3G4S Q;  1NYF A;  3DB4 A;  3NTH A;  1RL2 A;  4ZN1 A;  1D3B A;  5IN1 A;  1UGQ B;  2E10 A;  1Z9Z A;  2BE9 B;  2DLP A;  4WTO B;  5LJ5 h;  3DLM A;  2D0Q B;  2JM9 A;  2LJ1 A;  1YJN A;  2DL8 A;  4RTW A;  3JCM V;  4KH0 B;  1YWP A;  4BAC A;  3HRT A;  1B34 A;  2MOX A;  2VWF A;  2BIV A;  2B86 A;  3HPW A;  1U06 A;  3TCJ A;  5IHN A;  3EGD A;  5M9O A;  5J39 A;  3I56 T;  1RAE B;  3G4S A;  4HVV A;  2VUB A;  3TSZ A;  4IKF A;  2FZC B;  1AT1 B;  2RI3 A;  3QKJ A;  2JMA A;  3P8D A;  4J9E A;  3ZBD A;  2FL7 A;  2LX9 A;  1B7T A;  3V8J A;  2QEX T;  4JJD A;  3I55 Q;  4M7D G;  2X4W A;  1PC0 A;  4OF1 A;  5IXB A;  1VQ5 T;  5GAO m;  1W4S A;  1KK7 A;  4FYX B;  1WPY A;  2FEI A;  1WNL A;  1WXT A;  4E7H A;  2D0N A;  3JB9 F;  2DFU A;  1GFD A;  1M1K C;  1YI2 Q;  1ZBX A;  4FYY B;  2HQE A;  3KBG A;  5CK9 A;  3QYH B;  4RUG A;  1N5Z A;  2CGH A;  2RQV A;  2E3H A;  2E5Q A;  3A5Z B;  3VJP A;  3FRN A;  3I55 A;  2E6Z A;  4J9H A;  2PUO B;  2KT8 A;  2GQV A;  4J9D A;  3MEU A;  1YJW T;  3QHS A;  2QEX Q;  4N4G A;  3VS4 A;  2LQW A;  2K57 A;  3OYK A;  2MAM A;  2WSC E;  1VQ5 Q;  3JCM h;  3ULR B;  3OYF A;  1YCY A;  4JS4 A;  1K9M C;  3MKD A;  3BE3 A;  1YI2 A;  2HQX A;  4OB1 B;  1UDL A;  4E6R A;  1ZSZ A;  1N9S A;  1PCX A;  2XID A;  4NS5 A;  1Q81 C;  2QDL A;  3X26 B;  4PJM A;  1BBZ A;  2NWM A;  2H8H A;  1YIT T;  1VUB A;  3M58 A;  3KFV A;  3MEV A;  3D7S B;  5I2M A;  4OVA A;  5GAM j;  2DL4 A;  1KFZ A;  5KYW A;  2KBT A;  3RDV A;  1QWF A;  2QEX A;  3CC2 T;  3DB3 A;  3JB9 G;  1AEY A;  3UA7 A;  3JCM W;  1NEG A;  2EAY A;  1JU5 C;  3QWY A;  4JJN K;  4QVC A;  4DEY A;  1TUD A;  1YJW Q;  2FVU A;  3OY9 A;  2FPD A;  1V1C A;  1MND A;  1ABO A;  3QII A;  3S3M A;  2HBW A;  3OS1 A;  4KUD K;  2J7I A;  2QI2 A;  3RIR A;  4J9C A;  2DBM A;  2CYZ B;  2RHX A;  4RKU E;  1LJO A;  1YIT Q;  2JUF A;  1XQH A;  1KQS P;  3M55 A;  1DJ7 B;  1EFN A;  2LC4 A;  2Y90 A;  2YUP A;  1YJW A;  3CC2 Q;  2VXF A;  2EYZ A;  2LT4 A;  3CCL T;  2ZGW A;  1RI9 A;  1SEM A;  1UTI A;  1SG5 A;  4PJJ A;  1YNZ A;  2GF7 A;  5IHK A;  2RHI A;  1YIT A;  2BE7 D;  2A36 A;  3OS5 A;  1SRL A;  3UWN A;  1R0B G;  4L6V 5;  1JQQ A;  1BB9 A;  4LD9 K;  2DA9 A;  2ENM A;  3WXM B;  1JJ2 S;  2NYS A;  1X2Q A;  1NE8 A;  2FHD A;  4F16 A;  2RQU A;  2DBK A;  4E7K A;  5FW9 A;  5LJ3 j;  1JB0 E;  2R5M A;  1QVG A;  4Z8A A;  1VQO T;  4EMK B;  2RHZ A;  4OB0 B;  4LUE A;  2YDL A;  2CUB A;  1VQK A;  3O5Z A;  3E19 A;  3VS3 A;  4A4F A;  2BKD N;  2AKL A;  2YUO A;  3EHR A;  2XDP A;  1K8A C;  1PNJ A;  1GCP A;  3GNF B;  2H3J A;  5AYF A;  1M8V A;  4BE1 A;  2YXY A;  3EHQ A;  3GIB A;  2ATC B;  3PMI A;  3CC4 T;  3HFN A;  4OMF B;  3A8O B;  3OW2 A;  2L5Q A;  2AZS A;  2KK4 A;  1QCF A;  2CS7 A;  2PNI A;  3OMG A;  3EGX A;  2D8J A;  4FT2 A;  4BI4 A;  2YLC A;  2ZPF B;  2JXB A;  3A8H B;  2EWN A;  5FU7 C;  2FYK A;  1HJD A;  1IGQ A;  3RKY A;  3GP8 A;  4XU3 A;  4N4H A;  1VYT A;  4CRI A;  4JS5 A;  3PMT A;  1QP3 A;  1PSE A;  3WVD B;  4XTV A;  6AT1 B;  1CKB A;  3PGG A;  1KD1 R;  8AT1 B;  4XTX A;  4BY6 B;  3CCQ T;  5GAN 8;  3OYY A;  4M78 A;  1WJR A;  4QVZ A;  3EG0 A;  2QAS A;  4M78 C;  2G6F X;  4P5N A;  3MO8 A;  4IIM A;  3JCM P;  5GAM f;  2M16 A;  3JCM b;  1Q86 U;  4EIK A;  2F2W A;  4J7F A;  5GAN f;  4PJO E;  3C95 A;  4M78 F;  3OQ5 A;  2RK1 A;  4RMO A;  2ZZD A;  4M77 B;  2MI6 A;  3P8B B;  3PIP A;  3CXC S;  4M75 B;  5GAO n;  2KXC A;  1YHQ T;  1OX9 A;  4RTV A;  4OB3 B;  3X24 B;  3M0U A;  2M0O A;  2VVK A;  2VYT A;  1YBY A;  3CCQ Q;  3M59 A;  1ZLM A;  1E6H A;  4GLM A;  1K4U S;  1I07 A;  4BB7 A;  2D9T A;  2P4R A;  1GFC A;  2FZG B;  1GRI A;  3NFC A;  3X20 B;  1WYX A;  4YTL A;  4Y28 E;  1LNX A;  1KG1 A;  1LCK A;  2K2M A;  2MK5 A;  4C8Q E;  2L3Q A;  3OSS C;  1QKW A;  4EMK A;  2F1L A;  3WVE B;  1BI3 A;  3V8K A;  4EMK C;  1JJ2 P;  4RTU A;  2DF6 A;  1YHQ Q;  4XQ3 A;  2CSQ A;  5KYX B;  3CCQ A;  4M78 G;  1VQ6 T;  4F7U B;  4OMO A;  4MML A;  3V7R A;  1TUG B;  5GAN 7;  1MNE A;  3VS1 A;  2PVO B;  3A8L B;  3M57 A;  3MCA B;  4II1 A;  2PU9 B;  2ZPI B;  5FRO A;  2JM8 A;  4HVW A;  4BD3 A;  4E7J A;  2QG9 B;  3M53 A;  2O4X B;  1YHQ A;  1VQ9 T;  2CP7 A;  2OJ2 A;  4LD6 A;  9ATC B;  1PKS A;  2K4Y A;  2GFU A;  3TVT A;  2V1Q A;  4KT0 E;  1YN8 A;  1N8R R;  2VAS A;  2KYM A;  4F04 B;  2GNC A;  1KHI A;  4C92 C;  2J06 A;  2XKO C;  1BK2 A;  1JXO A;  3U23 A;  4QW2 A;  2ZCF B;  3SD4 A;  2EIF A;  1NPP A;  1OU8 A;  3AHU A;  1UEC A;  2GCX A;  2VC8 A;  1VQN A;  3BFM A;  1E7O A;  4GY5 A;  3UPU A;  4EPC A;  4BE0 A;  2E12 A;  3ME9 A;  2LT1 A;  4A4K A;  4JUV A;  3L1A A;  3QXE B;  4ZGD B;  1WFW A;  4C0D B;  3KXT A;  3H8Z A;  2DX1 A;  2G3R A;  4MZP A;  1SHG A;  3IQL A;  1RAD B;  5D7U A;  1SPK A;  2F2X A;  2CH4 A;  2J05 A;  3MP1 A;  3NMZ C;  5CKB A;  2A28 A;  4FT4 A;  4ZGJ B;  1TSF A;  4OP0 A;  2YT6 A;  3VS6 A;  1OPK A;  1ZUK A;  3CCR T;  1X75 C;  1B34 B;  1WHG A;  5KE3 A;  4O5V A;  3E9G A;  3CXC P;  1VQ4 T;  2YRV A;  4JRQ A;  4R0K A;  3CMA T;  1H3H A;  3VS2 A;  2DNU A;  4OGC A;  1NBE B;  1W2B A;  3TU4 K;  1PG5 B;  4E7S A;  4OMN A;  2HL5 C;  2RNA A;  2NUT B;  2CRE A;  4NOY A;  2KRO A;  5CQX A;  3Q1J A;  5KYX A;  3QWX X;  4F7U A;  5FRM A;  2DVJ A;  1D1C A;  4R56 A;  3TSW A;  5GMK h;  5KCO A;  2JT4 A;  1IZ6 A;  1M2O A;  2L3S A;  3GNG A;  1CKA A;  2NLU A;  2Z0W A;  2W10 A;  2YRC A;  3SWN A;  4F7U F;  1UFF A;  5L23 A;  3SWN C;  1WHK A;  5CO7 A;  2KMT A;  1AOJ A;  5LJ3 e;  2LTO A;  1QVF P;  1D09 B;  4XU0 A;  4XAX B;  3NTI A;  1R77 A;  4LDY A;  3MEA A;  2AIR B;  2IG0 A;  5CKH A;  4X34 A;  1ZQ1 A;  1UJ0 A;  3CCU T;  3R6O A;  4AFU C;  5C0M A;  1UB4 A;  3NTK A;  3VRY A;  1KSW A;  1Q86 C;  2E5K A;  2X3X D;  1N8R U;  2P0Q A;  1YCS B;  2I0N A;  3QO3 A;  3CBM A;  3CD6 T;  3QZ5 B;  4JDS A;  4JJB A;  2V8K A;  3MHX A;  3JCM g;  1O9S A;  2DM1 A;  4C5I A;  5LJ5 j;  3I35 A;  2KI7 A;  4JPB W;  4C0F A;  2VXE A;  4F7U G;  1BCM A;  2VKN A;  5FU6 C;  3VUZ A;  1QVG S;  3LWI A;  1S72 T;  1EIF A;  2QXF A;  4FSX A;  3CCU Q;  4E7I A;  1M3A A;  4J9G A;  3RUX A;  4OMP A;  1VYV A;  1M8M A;  1RLP C;  2DD4 A;  2QAZ A;  3M0Q A;  1F1B B;  1Q7Y R;  3M4G A;  4IUP A;  3OYB A;  5HY6 A;  3CD6 Q;  1NEB A;  3CC7 T;  2A37 A;  5DY9 A;  4M7A D;  2K6D A;  3CME A;  3C0C A;  2DAQ A;  2XU8 A;  1OUL A;  3HKS A;  3OYJ A;  3L42 A;  1PHT A;  5GMK m;  3CCU A;  5LJ3 d;  3OW2 S;  2QYZ A;  4C5H A;  1M9S A;  5GAO l;  2BZ8 A;  1H3Z A;  2RN8 A;  2NUT A;  1EZZ B;  4PJL A;  2BZY A;  2PZ1 A;  4AT1 B;  1T3S A;  3CD6 A;  5GAN g;  1EX4 A;  1RAF B;  5HK0 A;  3QSU A;  4J6X A;  3EH2 A;  2R57 A;  2IPO B;  2OAU A;  3LYI A;  3CC7 Q;  2HSE B;  1QCN A;  2F5T X;  2RF0 A;  4KUL A;  2GTJ A;  3M4Y A;  3I56 Q;  3EG2 A;  1I8F A;  2V26 A;  1ZSG A;  1X6O A;  2RQW A;  2OAW A;  1ZBJ A;  1W1F A;  1D0Y A;  1OZ3 A;  1M1G A;  2RMO A;  2JOY A;  2COY A;  4KGV B;  4ESR A;  4Z89 A;  3OSV A;  2DXT A;  2BTT A;  3I56 A;  2KNB B;  3A8M B;  3ER0 A;  3OYG A;  3LH0 A;  3L2Q A;  4XTU A;  3RMS A;  1OPL A;  1I5O B;  2B8A A;  3L2Z A;  3CCV T;  1MMD A;  1GBR A;  1AD5 A;  2RHU A;  4NL2 A;  4A53 A;  4IUT A;  4DQ2 A;  2QTV A;  1I0C A;  3M0R A;  2DJZ A;  2KDS A;  1Q95 G;  3EGX B;  1VQ5 A;  1G3Y A;  1LVK A;  4OB2 B;  4RTT A;  5CR2 A;  2EJ9 A;  4M7D D;  2HZY A;  3C4S A;  2DER A;  4FL6 A;  2A08 A;  5FU7 B;  2OX7 A;  1BU1 A;  3VU3 C;  1SF9 A;  3QJ6 A;  3QPH A;  4ANJ A;  2LRQ A;  2EQI A;  4FSS A;  1VIE A;  3OYE A;  2RI5 A;  1NPR A;  4R55 A;  3PNW C;  4L5G A;  1QVG P;  1WIE A;  4J8O A;  2LCL A;  3QDF A;  3CCV Q;  3C94 A;  4M78 B;  4KRT A;  5GAM h;  1VQP T;  4XU1 A;  3JV3 A;  1Q7Y U;  1FYN A;  1K73 R;  5GAN h;  4JRI A;  2XHC A;  1WA7 A;  1FXX A;  4HCK A;  3JB9 H;  3JSC A;  4RTX A;  1M27 C;  3P8H A;  4XK8 E;  1UHF A;  4HCC A;  2AZV A;  2A3L A;  2EQM A;  2RJC A;  2YWW A;  3M0S A;  5CCA A;  3CCV A;  3OW2 P;  2COW A;  1BI2 A;  1UJY A;  5CVI A;  2RQR A;  3CPF A;  2X4Y A;  5KH6 A;  3N5B B;  4MZM A;  2M51 A;  3CC2 A;  2D8H A;  4A4E A;  4AFQ C;  4DEX A;  3PE0 A;  3JB9 D;  1VQP Q;  4PJO B;  4LDU A;  4CC3 A;  2HCK A;  1HSQ A;  4KUI A;  3OS2 A;  4J5Y A;  1OEB A;  2L2P A;  1SSF A;  5A0L A;  3A98 A;  2J6K A;  3V7C A;  3CCL Q;  1N8R C;  3OBW A;  1ZA2 B;  1C1A A;  4KBM B;  3JAM E;  4NL3 A;  1OU9 A;  1KC8 R;  1OX8 A;  2CDT A;  2MYS A;  1WJQ A;  3M56 A;  2P4T A;  5FWB A;  2JTE A;  4PKC C;  2GTO A;  1I5L A;  2JVV A;  3QUI A;  1VQP A;  3G6E T;  3MP8 A;  2CSI A;  1BCO A;  2X4X A;  1GCQ C;  5DLQ E;  5IH2 A;  4HVU A;  1QW1 A;  5L8R E;  3CCL A;  2RO0 A;  1KQS A;  1WHJ A;  2WAC A;  4LDV A;  3OYH A;  1HD3 A;  2X3W D;  1G3W A;  4FM4 B;  1YJ9 T;  3GF5 A;  2DD5 A;  1VQO Q;  2MIO A;  1YWO A;  2EKO A;  1M1F A;  4LE9 A;  1W2B S;  2YUN A;  2EYW A;  2QQB A;  4C92 B;  1ABQ A;  3RES A;  3FJ5 A;  2K3Y A;  1NLO C;  1BI1 A;  1WHL A;  4GLK A;  2HKN A;  3G6E Q;  2K7A A;  2P84 A;  2SEM A;  1T3L A;  3I5S A;  2OTL T;  2OTJ T;  1KIK A;  1TH7 A;  1RAH B;  1IXD A;  4N0A C;  1VIF A;  3NPF A;  3GLX A;  1C6V X;  3R6N A;  2PQW A;  1VQO A;  1YP5 A;  3CC4 Q;  1BIB A;  3PFS A;  1IRX A;  2QQR A;  2KEA A;  2K3B A;  4Q5W A;  2EQK A;  1YJ9 Q;  3HRU A;  5LJ5 e;  3VYG A;  4HCB A;  1JBM A;  1W70 A;  2DYB A;  4KGX B;  2QDY B;  1QP2 A;  3VS5 A;  3TRE A;  1K73 U;  2ZAE A;  3HP9 A;  2XK0 A;  2KVQ G;  4EDU A;  5GAO q;  2QTX A;  4RG8 A;  1R8O B;  1D0X A;  1Q81 R;  2LJ3 A;  1OYX A;  4IUV A;  1RAB B;  5HKC A;  3CC4 A;  4FIB A;  4FU6 A;  2OTL Q;  2HSP A;  3GOX A;  4E47 A;  1PRM C;  2O31 A;  5C6S A;  2DTO A;  3S3O A;  1K0S A;  1KJW A;  3JCM J;  4PJO A;  1SRM A;  5GAO p;  3DLL A;  2KGT A;  4PJO C;  1G5V A;  2C0O A;  3CPW A;  1D1A A;  2QA4 T;  2AT1 B;  3EGU A;  2LNV A;  2RB6 A;  1U1T A;  2O9V A;  4PJO F;  3JCM Q;  4DOV A;  2R5A A;  2OTL A;  1VQL T;  2IVW A;  2E41 A;  4F17 A;  3QZ9 B;  1LPL A;  4QQG A;  4Z88 A;  3EAE A;  2QQS A;  4MDW A;  3VS0 A;  3LLR A;  3JCM X;  1JXM A;  4QT7 A;  1YFN A;  2EKH A;  1KC8 U;  3MP6 A;  3PVQ A;  4GBQ A;  1Q82 R;  4A54 A;  4KGZ B;  3SWN B;  2CP3 A;  2ECZ A;  1Y0M A;  1A0N B;  3S3N A;  1WLP B;  4C8Q A;  2HDA A;  3JCM e;  4C8Q C;  2HEQ A;  5LJ5 d;  1WZO A;  2ED0 A;  2A7Y A;  3M5A A;  3GPL A;  5LJ3 f;  5GJV B;  2EGA A;  2KE9 A;  2QGF B;  2FO0 A;  2J6O A;  4ME7 A;  4TVR A;  3CBP A;  4C8Q F;  2RH2 A;  2RQT A;  4C92 A;  2DL5 A;  1Q7Y C;  1VQ6 Q;  3V7S A;  2DZ9 A;  1OZ2 A;  1TTH B;  3CQT A;  1JO8 A;  4F14 A;  5I22 A;  3EFR A;  4PJO G;  1BIA A;  2RJD A;  4D6W A;  1W2B P;  4C92 F;  2RI2 A;  2QK0 A;  4O6J A;  4PJN A;  1HYO A;  2RJE A;  4QQD A;  3VRZ A;  2DIQ A;  3L2V A;  1GXI E;  1JRI A;  2J6F A;  1KHC A;  4M77 E;  1KD1 U;  1NJI R;  4E7Z A;  3KUF A;  1VQ9 Q;  1WJS A;  1MMA A;  4M7A E;  2M0Y A;  4M75 E;  1VQ6 A;  5FU6 B;  4FYV B;  4KH1 B;  3LGL A;  1Y96 B;  2NUZ A;  2DTH A;  3ASK A;  4LDX A;  1Y07 A;  2GGR A;  4PNO A;  3SFM A;  3RKW A;  3T9N A;  1K76 A;  2ROL A;  5D6X A;  5LL6 S;  2EGC A;  2LQK A;  4C8Q G;  1ZX6 A;  2JW4 A;  1AZG B;  1SSH A;  2LCS A;  3CCJ T;  3CCE T;  3QJY A;  1VQ9 A;  1PKT A;  4A4G A;  4E2F B;  4C0Z A;  5GAN 4;  2RPN A;  2HL3 A;  1AWJ A;  2DO3 A;  1Y71 A;  3A8G B;  4C92 G;  3JCM d;  5D6W A;  5GAN 6;  3H0F A;  5GMK j;  2V8J A;  4F7U E;  1ZUY A;  1NLP C;  4X1V A;  2LQ8 A;  1G83 A;  2MWO A;  1NM7 A;  1QWE A;  2XIC A;  2YHT A;  2LNH B;  2EYX A;  1X6B A;  4LXC A;  3CCR Q;  3QDR B;  4JJC A;  4HT9 A;  2CP5 A;  2MWP A;  2RJF A;  4AG1 C;  4D8D A;  3CCJ Q;  1VQ4 Q;  3CCE Q;  1WI7 A;  2L8D A;  3OYM A;  1M90 R;  2V8I A;  3CMA Q;  1WHH A;  4ZTJ A;  1U1S A;  5DLO A;  3VUB A;  1Q82 U;  3M9Q A;  2LQN A;  2KSS A;  5CQY A;  1T0J A;  1H8K A;  1FMK A;  5I11 A;  3OA6 A;  2E1H A;  2PVG B;  2NUP B;  3SB2 A;  3CCR A;  4E7L A;  3LWH A;  3CCJ A;  1VQ4 A;  4M7D E;  1Y57 A;  1ACM B;  2KR3 A;  1G2B A;  1RAI B;  3X28 B;  3CMA A;  4PFP A;  2DET A;  1K73 C;  2F69 A;  1WX6 A;  3EFO A;  3G4S T;  2KRS A;  4RCB A;  4IUU A;  4JLG A;  2QGG A;  3G71 T;  1N27 A;  1AWW A;  1QQJ A;  4DBR A;  3TEE A;  5J26 A;  4C0G A;  5DM7 R;  4DOW A;  2E3I A;  3H9N A;  3FDR A;  2X9H A;  2FB7 A;  1E6G A;  1MMG A;  2I2L A;  1Y96 A;  3O8V A;  1NJI U;  1GL5 A;  3CEY A;  2DL7 A;  4HT8 A;  4M7D C;  1X69 A;  4MMK A;  2CZ1 B;  4L59 A;  4V2S A;  5CAI A;  1W6X A;  4J9B A;  1J3T A;  1M2V B;  5FRN A;  2R58 A;  1FMV A;  4M4Z A;  2XDB A;  2YRD A;  4LUD A;  4M77 D;  1X01 A;  2EVR A;  2EJF A;  2Y4X A;  3JB9 J;  4M75 D;  3HHT B;  2KAF A;  3G71 Q;  4UC4 A;  2DEQ A;  2EQU A;  3I55 T;  1KQS S;  1G3S A;  2QQ9 A;  2LVM A;  2BZX A;  3H41 A;  1WQ7 A;  3JB9 I;  1QVF A;  1C0M A;  1KC8 C;  2MPX C;  5CIU A;  2ZPG B;  8ATC B;  5CKF A;  1S72 Q;  3FC3 A;  2KRM A;  2FZK B;  5GAM g;  1YI2 T;  3M0T A;  5KYY B;  3E1S A;  2ROT A;  1MGQ A;  2H3E B;  2PTK A;  3SHW A;  5FLX E;  3G71 A;  2XG8 D;  1HK9 A;  2DYI A;  1WDX A;  1M5Q 1;  3EFS A;  1UG1 A;  1FMW A;  5I2S A;  2F2V A;  4ZTF A;  1X43 A;  4RCC A;  1JEG A;  1TG0 A;  1S72 A;  4ATO A;  2DTI A;  1XOV A;  1SHF A;  4ZGE B;  1PWT A;  1QMC A;  2ZPH B;  1M90 U;  2ZPB B;  4K11 A;  4BI3 A;  1TXQ A;  2EFI A;  1AHJ B;  2GFA A;  3MJX A;  1V29 B;  2NUP A;  3OS0 A;  2C0T A;  1U8R A;  2O2O A;  4BDZ A;  3CC7 A;  4Z02 A;  4HKE A;  2CT4 A;  4IUQ A;  1KD1 C;  1KQ1 A;  2CT3 A;  5KE2 A;  2K5F A;  4J6Y A;  2LCC A;  1P92 A;  2CZ0 B;  2DKG A;  4EMH A;  4LDW A;  2O88 A;  4BUG A; 
#chains in the Genus database with same CATH homology
 1C6V X;  1QMC A;  4FW2 A;  4FW1 A;  1IHV A;  1IHW A;  1C1A A;  1C0M A;  5D7U A;  1EX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...