1IHWA

Solution structure of the dna binding domain of hiv-1 integrase, nmr, 40 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
52
structure length
52
Chain Sequence
MIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the DNA binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 5
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ihwA00
1C6VX 4FW1A 5D7UA 1IHVA 1C1AA 1C0MA 1IHWA 1QMCA 1EX4A 4FW2A
chains in the Genus database with same CATH superfamily
4JS5A 1GBQA 2RQWA 4N4HA 4ZTJA 1NBEB 4XTZA 4PNOA 1YWPA 4P5NA 1ZA1B 2JJ9A 4RG8A 3RMSA 4N0AA 2LX7A 4OB0B 1MNEA 2QQAA 1K76A 2AZVA 2D1XA 2E5QA 2RHYA 4M7AF 4ELYC 3LH0A 2HQEA 4IUTA 4IKFA 1U06A 4J8OA 2BE9B 4AFQC 4J6XA 4C92E 4XU0A 1FMKA 2X35A 4AT1B 5FROA 4E2FB 1FYNA 2YT6A 2CZ1B 1UB4A 2YHTA 5GJWB 3WVDB 3MP8A 3CCRQ 3TSZA 2VGMA 4KBMB 4RG2A 2CSIA 1TSFA 1Q86U 2FZGB 2YUQA 3OS1A 2CP2A 2EQUA 4KH1B 1G83A 4J9IA 4OMQA 2LX9A 4A4HA 3LGLA 5EC7A 1Q86R 4XTYA 2OAUA 2KDSA 4YTLA 4JJCA 4IUQA 1G3TA 3H0FA 3KXTA 4EMKB 1RAFB 1VQOA 1T0JA 5CVIA 4ZTFA 1JRIA 3DKMA 3EAEA 4PFZA 2MWPA 3QWYA 4DBFA 1VQPQ 2DZ9A 2M02A 3NMZC 5KCHA 1VOMA 1SRLA 2JTFA 4IIOA 2X4XA 2AKKA 1R0BG 4J7FA 2A37A 5KE2A 1WGSA 2KRMA 3X28B 5FWCA 1ZLMA 2CT3A 3PFSA 3RNJA 2DRMA 1B7TA 1X69A 1UECA 1D0ZA 3EG1A 1M2OA 1JB0E 4C92F 3M9QA 3CCJQ 5GMKe 2EPDA 2RH2A 2DYBA 2DFUA 5J39A 3QZ9B 1X27A 3JAME 4AG1C 3A98A 2JMAA 1U5SA 2EQIA 3NPFA 1AWWA 1LPLA 2JN0A 3REAB 3GBQA 1OZ3A 2M1HA 3HPWA 5A2QE 3D7SB 1W1FA 3EGUA 5GAN5 2GGRA 2KXCA 2EVRA 4X9DA 1ZQ1A 1Z9ZA 4E7SA 2XDDA 3GP8A 2GTJA 1YCSB 2LJ0A 2F2XA 1QWFA 5GAMf 2RMOA 4CC7A 3OYNA 2QAZA 3CCRA 2YWWA 1VQ5T 4M78D 4PJOB 4XTXA 3CCEQ 1K0XA 2ZPHB 4R56A 3V7CA 4OMPA 1OV3A 3QSUA 5GAMh 1AWXA 1PWTA 1WFWA 3RIRA 5FU6B 2P0PA 4BY6B 2PUKB 1WQWA 2WSEE 1EIFA 3L2WA 2RK1A 2ZCFB 2WACA 4RKUE 4NL2A 1VQNA 5GAN2 4BI4A 5FRMA 1ZBXA 5IH2A 4RCBA 1BCOA 1H92A 1IB8A 2MWOA 1IHWA 1S1NA 4OMFB 5KYWA 3AHUA 1WI7A 1TUGB 2QDYB 2VC8A 2M16A 1NYFA 2EYXA 4JLGA 1ZSZC 4F17A 3PT9A 3CBPA 1WJSA 2X4YA 1VQMQ 2CKKA 1BI3A 2ZPGB 1ACMB 1VQPA 1ABOA 3VJPA 4RUGA 2FEIA 1RI9A 2ZPFB 3G1JA 4FSSA 1VYVA 1MHNA 5KYXA 2M0OA 1UEBA 2P0QA 3TVTA 3QBYA 2CP7A 3META 3SEMA 1MMGA 3QDFA 3A8HB 3TU4K 3M0TA 4KULA 1VQOT 3VRZA 3H0IA 1UTIA 4M4ZA 3OYLA 1B07A 3CCJA 5HCKA 3CCQT 1WHMA 3OSVA 4C92B 1W2BP 3I55Q 2L5QA 4RMOA 3H0HA 5GAMg 2ED0A 1Y71A 1BBZA 1C0MA 5GAMd 2QA4T 3FEOA 1YFNA 2AKLA 5A0GA 1TUDA 2HBPA 3A8LB 3CBMA 2K3BA 3OYCA 3LWHA 3CMEQ 1BIBA 2DRKA 2NUPB 5AYFA 4PJMA 4Z88A 5HKCA 1WA7A 2RB6A 3FDRA 5KYUA 3I56Q 1UGPB 3P8HA 1M1FA 1ZX6A 2R5MA 3CCEA 1VYTA 2O2OA 3VS3A 3HL8A 3QIIA 2RPNA 4HT9A 4M7DD 5LJ3h 5GJVB 1K73U 1I81A 3QJYA 3PTAA 3UA6A 2RQRA 1I0CA 1RLQC 4C0FA 1X2QA 1RLPC 5DLOA 5IXFA 2EYWA 2CUDA 1FMWA 3CCRT 3EGXB 1K73R 1QQJA 2HNIA 1GFCA 2LCLA 1UHFA 1N27A 3JB9I 4BACA 4HCKA 1VQKQ 1JEGA 2XIDA 4WF2A 3TCJA 1UGVA 4JRQA 3C12A 4XU1A 4GBQA 1VQ9T 1Y96A 3GOXA 2BZ8A 2RM4A 1VQMA 2HQHA 4QVZA 3WVEB 4LUEA 4ZGDB 4M77B 4PK4A 1VQNT 2OI3A 4JJDA 4ATOA 2L3SA 4QVCA 1G8XA 3JCMV 9ATCB 2D9TA 4XK8E 2YDLA 3MEWA 3MHXA 2D8JA 4RTUA 2O88A 3JB9F 2KSSA 1ZSZA 3G7ZA 5HK0A 1D1BA 2CDTA 2IPOB 3UT1A 2KRSA 2DYIA 1K8AU 1M3CA 1GFDA 3UDCA 1Q82U 5GAOm 2QDLA 3NGPA 3I55A 2KR3A 4PFOA 2VWFA 1BI1A 2OAWA 3H41A 2MK5A 5LJ3g 1K8AR 2F69A 3EG9A 2EJFA 5LJ3d 4J83A 3X20B 1D1CA 1Q82R 2C0IA 3MKDA 4KGXB 4FYYB 2IG0A 3CCJT 2ATCB 4JJNK 3CMEA 2FYKA 4J7IA 3MO8A 2GQIA 2LCSA 1FXXA 4M75D 2E12A 5CKBA 4OGCA 3PIPA 4M78C 1Y7XA 3I56A 2AT1B 4JRKA 3E9GA 3RBBB 2ZPBB 4RTWA 4E7HA 2R5AA 1CKBA 1HXDA 2JUFA 1YHQQ 1B34B 3JCMX 3OS0A 5CQYA 1AZEA 2NYSA 2OJ2A 3X25B 3VS2A 1P92A 4J9EA 3VS0A 4M7DE 5A0LA 1RABB 3E19A 2EJ9A 1KHCA 1UGSB 4M78G 5DM7R 3CCLQ 4PL6A 1MUZA 1OU8A 3JCMf 3A5ZB 1YI2T 1VQKA 2L0AA 1VQ4Q 1G3SA 2XI9A 5KH6A 1RAEB 4J6YA 2VV5A 5FU7B 3H9NA 2FVUA 1WIEA 3PE0A 4BDYA 2EKOA 2VB6A 5KYNA 2D0QB 2DJZA 1SKUB 2KT1A 2DTIA 4BDZA 1Q82C 1HJDA 3H8ZA 1T3SA 4C8QD 1ZA2B 2EW3A 1NJIU 4OMOA 1M1GA 1VQ5Q 1N6AA 1D3BA 2FO0A 4JRIA 5I2SA 3T9NA 3E2UA 5GANj 2KQWA 3RKYA 4C0DC 4E7IA 3M58A 3SDZA 3M4GA 2KGTA 1NJIR 4XTVA 5LL6S 2KEAA 1YCYA 4C0GA 3EFRA 2ZAEA 1A0NB 1RAHB 1KC8U 2IIMA 2DL4A 1MMNA 2HKNA 2V8JA 4LUDA 4D8DA 4HVWA 1H3ZA 2NUTA 2L3RA 2RN8A 4F7UG 3OS5A 2KK4A 1E6HA 2YUNA 4J9HA 2DL7A 4Y28E 4R0KA 3HP9A 2X3WD 3A8OB 2HCKA 4JUVA 4AFZC 4AFSC 3C0CA 5GAMe 4HCBA 3BDUA 2CP0A 3R6NA 4LDVA 2MOXA 4M7DF 5KYYA 1VQ6T 1KC8R 1N8RU 4D6WA 1I07A 3DB3A 2O4XB 1R77A 4GLMA 2YLBA 1NG2A 1MV3A 1VYUA 4LE9A 2KBTA 1KHIA 2VVKA 1OOTA 2MIOA 3EGDB 4M7DC 1YHQA 2DAQA 4JPBW 1N8RR 2EFIA 2M51A 3UA7A 3V8KA 1SSFA 2YLCA 1UE9A 2K5IA 5IHNA 4M78A 1HK9A 2DILA 1BIAA 3CMAQ 3I56T 3CCVT 3DB4A 4DBRA 1TS9A 3CCLA 1WHKA 2E5KA 3CCQQ 3DLMA 2X4WA 1VQ4A 1OU9A 2RJDA 3X24B 3MEUA 3RMQA 4M7DG 2V8IA 4A4KA 3I5SA 2HD0A 2HQXA 2QK0A 4C5GA 2QA4Q 3EHRA 3MP6A 1VQ7T 4LD6A 4FT4A 3CPFA 4BI3A 5HY6A 1WHGA 3VS6A 4FYVB 2LRQA 3FLGA 1VQKT 1ZUUA 1M4ZA 4MDXA 2L8DA 2K2MA 3QO3A 1TUCA 3RKWA 1VQ5A 5LJ5h 1IXDA 2QTXA 2MF2A 2ABLA 2V26A 4MZTA 4C8QE 2RHZA 3L2ZA 2YXYA 5AT1B 3QUIA 4DOVA 2P0KA 4JJBA 1E7OA 2GFAA 1NPPA 3SWNB 4FW2A 3BDLA 1K4US 2EKHA 1W4SA 2L2PA 3L2UA 4HT8A 3P8DA 3VS7A 5IHIA 1D0XA 3MCAB 5LJ3e 4M75C 4EMGA 2O9SA 3JSCA 4F04B 2DXUA 1VQ9Q 1LVKA 1Q81U 1AEYA 2LQNA 5A0DA 3M0QA 4MZPA 3ER0A 4HVVA 1VQNQ 2DD4A 5FWBA 4J9CA 2RJFA 2PVOB 2CREA 1HYOA 1UGRB 3M53A 1I5LA 4EMHA 1IZ6A 3PMIA 1X6OA 4KGZB 1KJWA 1EX4A 1Q81R 4XU2A 3VS1A 3OYGA 4M75G 4LN2A 2XK0A 2RQUA 1K0SA 3CMAA 1UJYA 5IT9E 2DL5A 4M7DA 1OPKA 2DTOA 2DIGA 4MDWA 1TU0B 2RQVA 5GMKj 3CCQA 2W10A 2M9UA 5LJ5g 1HD3A 2L3PA 1YHQT 4O6JA 5LJ5d 4C8QF 1WQ7A 3QPHA 2QA4A 2A08A 2V8KA 5ECAA 4E6RA 4GLKA 4KRTA 2KE9A 4AG2C 1KQ2A 4HXJA 1WHLA 3FIFA 2HDAA 3GLXA 3CCLT 4C8QC 2BKDN 1QW1A 4FCYA 4JLIA 1SHGA 2KYMA 3OBYA 2JNGA 2JW4A 2VXFA 4RTZA 1OPLA 1VQ4T 4A4FA 1M8MA 4IURA 1M2VA 2DBMA 2COYA 1KIKA 2DF6A 2K57A 3EFOA 2DNUA 1G3YA 3Q1JA 1M30A 5FLXE 1Q86C 2DL8A 4XTUA 4M7AB 1MNDA 2XU8A 3S3OA 3QDRB 3CCMT 2DERA 5IHKA 2HEQA 4C8QG 3FRNA 4PKCC 1UG1A 4E7JA 5KCOA 5J3BA 2LDMA 1KD1U 2PTKA 1EFNA 2EQKA 1PG5B 1YI2Q 2NLUA 1CSKA 5KYWB 1BCMA 3PVQA 4HA8A 2CS7A 1WXBA 1RAIB 3LGFA 1VQ9A 5L23A 3MP1A 4OF1A 1RAAB 2HZYA 1KD1R 1QP3A 1NPRA 5HK3A 1D0YA 3L1AA 2XHCA 2J06A 2LMJA 2ECZA 2BE7D 1JJ2P 2EIFA 1W2BS 4JDSA 2HMAA 3EHQA 5CKFA 4M75A 3OMCA 5KYXB 2P84A 2RJEA 1M1KU 3JB9H 2A0FB 4OVAA 4BB7A 3NHNA 2R57A 2CP5A 1SHFA 3CC4T 3JCMe 1TG0A 4RCCA 1PKSA 1KQSP 3GNGA 4Y92A 1PKTA 4AMCA 1M1KR 1Z9QA 3G6EA 2DVJA 2JM9A 2LNVA 1M5Q1 1U1SA 1PM3A 3OYEA 4IUUA 1GRIA 2RJCA 4ESRA 1WPYA 2RI5A 2PVGB 2XDPA 2GCXA 4J6WA 2C0OA 3CMAT 3EG0A 2PUOB 1VQ6Q 3O8VA 3GPLA 2E3HA 2ZZDA 1ARKA 4OB1B 4C8QA 3PNWC 2QGGA 1D09B 3HRTA 4OB2B 4JRPA 1M3AA 3QKJA 1FMVA 1WNLA 2K3XA 4LDXA 1BU1A 3LX7A 5CR2A 5LJ3f 2VASA 1J3TA 4NS5A 5GANg 3CCVQ 4PJLA 4L6V5 3HRUA 4HCCA 2AHJB 2DJQA 3NFCA 5GMKi 1YI2A 3JB9J 4J9GA 3JCMb 2JMCA 4NOYA 2JS2A 4M78E 2EQMA 2FL7A 2EGAA 2Y4YA 2K3YA 2RO0A 5I2MA 1JXMA 3VYGA 1VQ7Q 3WXMB 3NTIA 3OYFA 4L59A 1QMCA 3FC3A 1AD5A 1NLPC 1UHCA 2F5KA 3VRYA 3EG2A 4FW1A 3HRSA 1I8FA 1X01A 1ZSZB 1WJQA 1V1CA 2KY9A 2KMTA 2CZ7B 4DEXA 1NZ9A 2QQSA 4IIMA 1QCOA 2HKQB 3VYHB 3G4ST 1IO6A 2A28A 1H641 1T0HA 1YJNT 1Y07A 1GCPA 4MMKA 2BZXA 3EG9B 5D6YA 3INZA 5LJ5e 5FU7C 2HL3A 3BE3A 2DEUA 2B8AA 3EH2A 1RI0A 4HKEA 2LC4A 3PMTA 4EDUA 3OSSC 3JCMJ 3MEVA 4DQ2A 3EGXA 3G6ET 2LVMA 1X6GA 3VV0A 1C1AA 1VQ6A 3ZFJA 2AZSA 3A1PA 4F7UE 2RI3A 1NM7A 5CO7A 2F1LA 3JRZA 3C94A 3LW5E 2EYQA 2KAFA 5D6WA 4K11A 2LT1A 5D6XA 4M78F 1SRMA 5GMKh 3LYIA 1WHHA 3A8GB 4J5YA 1QWEA 3NTKA 1JJ2A 2EJGA 3THKA 4N4GA 4XTWA 1K73C 2ROLA 3CBOA 5GAOr 3E1SA 3L2RA 2DXTA 1QKXA 2SRCA 3CCVA 3VS4A 5CCAA 3JCMW 2DBKA 1MMAA 1X75C 4CC2A 2DM1A 2CYZB 2JT4A 4OMNA 2DKGA 1M90U 3J7AF 4QQGA 1AT1B 3V7SA 1I5OB 3M5AA 3QHSA 2I0NA 3EFSA 1WLPB 3VU3C 2RQTA 4PJOD 3TREA 3OY9A 2CH4A 2GQVA 3S3MA 3OS2A 2HL5C 1M90R 1VQ7A 2MI6A 3OQ5A 1TOVA 2DIQA 4C0ZA 2EGEA 2DD5A 3VUZA 1VIFA 3M0SA 2E3IA 2LQ8A 1X43A 1W2BA 3QYGB 3OYAA 2KI7A 1BI0A 1H3HA 1YJWQ 2CGHA 3CEYA 8AT1B 2EAYA 1M3BA 2FRYA 2LCCA 1K8AC 4F7UF 2X4JA 2A36A 1KG1A 2GFUA 1S72T 1LOJA 3VKIA 4MMLA 3CCMQ 3GF5A 3P8BB 3KBGA 2QQBA 3M54A 2K7AA 1TXQA 4NL3A 1XNIA 3I9QA 3QXEB 1KFZA 2FB7A 5GAMj 5GAN8 1R8OB 1MMDA 4IUVA 5KYYB 1YITT 2K5LA 1ZUKA 2XICA 3VS5A 4PJJA 1Q7YU 2LQWA 3M0RA 2PNIA 4LNPA 1BKBA 4C92D 1BI2A 1QVGP 4HCZA 1M90C 3OYIA 1Q7YR 2NWMA 2YRCA 2ESWA 3CXCP 2QI2A 3G71Q 2CZ6B 2QG9B 4M78B 2K9GA 4FL6A 3CC4Q 2ED1A 1BYMA 1PSFA 1U3OA 3M57A 4FYWB 3X26B 1VQLT 1AZGB 2YUPA 3CCST 4M75E 5DY9A 3QWXX 2LJ1A 3CD6Q 2HSEB 5IAYA 1WHJA 1AOJA 1NE8A 2HSPA 1X6BA 3MEAA 4RTTA 1YJ9T 3PGGA 2LJ3A 4MZMA 3JCMc 3ZBDA 3HHTB 4OGEA 2F5TX 3TQ7P 4O5VA 1AHJB 4CC4B 1H8KA 2FZCB 2MAMA 2X51A 1YIJQ 4EMKC 1ZUYA 1NJIC 1YJWA 2ZPIB 3SD4A 2VKNA 2E4HA 1G5VA 5LJ5f 4Z02A 2F2WA 1WXUA 3CCMA 3OW2P 3HFNA 2B86A 2FRWA 1AWJA 1IHVA 4M77D 2E1HA 1KSWA 2K6DA 4FIBA 1Q7YC 1YNZA 2BTTA 2M0YA 3OYMA 1KC8C 1C6VX 1VQ8Q 4C0DB 5LJ3j 4B6MA 1GCQC 1TTHB 2KROA 2NUZA 5GAN4 1X2KA 1RAGB 3OBWA 3HFOA 3CPWP 1NEBA 1QCNA 1M9SA 4F7UA 2QEXQ 1N8RC 2YRVA 4M75F 3KFVA 4FSXA 3CQTA 2DEQA 2CSQA 2YRDA 4L5GA 1WDXA 2Y90A 1QVFP 4KUDK 2K5FA 4F16A 2OTLT 3OYYA 3G71A 4Z8AA 1SEMA 3OYBA 2LT4A 4M7AC 2KNBB 2HBWA 3R6OA 4DEYA 5CKHA 3CC4A 2J6OA 2K2VA 4B9XA 4PJOF 4M7DB 4ZNXA 5GAOn 3CC2T 4OB3B 1Y0MA 3OYHA 3I5RA 1VUBA 3G4SQ 1PD0A 1PSEA 1V76A 2DPPB 2DZCA 2RD1A 3CD6A 1YJNQ 2J6FA 1OI1A 4PJOC 3QZ5B 2VYTA 3HSBA 2LP5A 2QYZA 1IGQA 3L2QA 2PZ1A 5FU6C 1NYGA 1OX8A 3SWNA 4BY6C 3L42A 4M7AG 2QASA 2J05A 2VGNA 1HSQA 1PD1A 3RESA 3G6EQ 1W6XA 2PVDB 2CT4A 2WSCE 3C95A 4BD3A 1XTDA 1M2VB 1R0CB 4PLLA 2FPDA 4PJOG 1YIJA 2CUBA 4J9FA 3EFOB 3SFMA 1E6GA 2L3QA 1M8VA 4RTYA 1OEBA 1ZHIA 4PLIA 4UC4A 4ANJA 3LH5A 3C4SA 3V8LA 4II1A 1RUWA 3RR6A 1IREB 2KXDA 1QVGA 1JO8A 3UATA 2VUBA 2XMFA 2AIRB 2QQRA 1QVPA 3CXCA 4EMKA 3QYHB 2W0ZA 1JJ2S 3F70A 1VQ8A 1QCFA 3CC7Q 1RL2A 1YJWT 3ASKA 4M77E 4A4GA 2DLPA 2RHIA 2D6FA 4A53A 2X9HA 1JU5C 2P4RA 3MJXA 3KUFA 4FT2A 1EZZB 3M55A 4BUGA 2J7IA 1YBYA 3JB9D 1SPKA 2CZ0B 4LDWA 4QW2A 2ENMA 3OYJA 2QEXA 1KQSS 4C92C 3OB9A 5GAOq 1T3LA 1VA7A 5CK9A 2DXBA 1Q81C 2DMOA 1UUEA 4A63B 1RACB 3HTRA 2EQJA 3CCUQ 4M75B 4AFUC 1GCQA 2LQKA 3H6ZA 5IXBA 2VXEA 3LLRA 4EPCA 4R55A 2JS0A 1JQQA 4RTXA 2O9VA 6AT1B 5GAOl 1XJWB 2A3LA 1QP2A 1W70A 2JM8A 2XG8D 5GANf 3HKSA 4D8KA 1OZ2A 3G4SA 4C92G 1CKAA 5GMKm 1S72Q 2PQWA 4VUBA 1YJNA 1Y57A 2JTMA 2OTJQ 2LNHB 4M7AA 1TWBA 5GANh 5FRNA 3G71T 3FB9A 3UWNA 2SEMA 3ZEHA 3OW2A 3FJ5A 2JTEA 1OQKA 1M27C 2JOYA 4B9WA 4PJOA 1YITQ 3REBB 3CD6T 1YP5A 4E47A 2PU9B 4FU6A 2I2LA 2P4TA 2BZYA 2QQ9A 1NLOC 4M77F 2DO3A 1WX6A 4JZ3A 3CPWA 2E70A 3BFMA 1SF9A 1U8RA 4E7LA 1XOVA 4E7KA 4C8QB 1ZBJA 4OP0A 1PHTA 2IVWA 1N9RA 3VUBA 4M77C 1QVFA 1GL5A 2KRNA 1OULA 1BK2A 3M4YA 4LXCA 2CH4W 4XQ3A 2CP6A 4KUIA 5KYUB 4ORZA 3BW1A 1VQLQ 1YN8A 3J80E 1YIJT 3CC7A 1G3WA 4HVUA 3CCSQ 1KQ1A 2Z0WA 7AT1B 1KD1C 2EYZA 2XD0A 2O01E 4RTVA 3IQLA 5IN1A 2YUOA 1Q95G 1I1JA 3J81E 3E9FA 4ME7A 4M77G 3OMGA 4N4IA 3RDVA 1YJ9Q 5GAOp 2LTOA 3U23A 1KK7A 2MYSA 3LWIA 2QGFB 3CCUA 5GANd 1VQ8T 2DE0X 1AVZC 1UDLA 2QXFA 5CAIA 3N5BB 2MMPA 3UF4A 1M1KC 1MGQA 5FW9A 4BE0A 4C92A 3OYDA 1Y96B 4F14A 3NTHA 1DJ7B 2QEXT 2E65A 4QQ6A 4LDYA 3ZL7C 2XKOC 1S72A 4BI8B 3PIOA 3QJ6A 1ABQA 2OTJA 4ZN3A 2GF7A 2X3XD 4XU3A 2FPEA 5J26A 2NUPA 1XQHA 4KH0B 5LJ5j 3O5ZA 2ROTA 2EGCA 1UJ0A 1FWZA 2GNCA 5CIUA 4IUPA 2V1QA 2KYBA 2QTVA 1NEGA 1YITA 4WCIA 2C0TA 3BY7A 3M0UA 2HAXA 2R58A 4DOWA 3M59A 5KE3A 1OX9A 4Q5WA 2MPXC 4ZGEB 5EG2A 4C5HA 2BUDA 3ULRB 4EIKA 1AWOA 2JXBA 2F2VA 2OTLQ 4FYXB 1K9MU 2RA2A 8ATCB 3V7RA 3EH1A 4ZGJB 2RHUA 4GY5A 1N9SA 3L2VA 1VQLA 1LNXA 5DLQE 1GBRA 4X1VA 3CC2Q 2FPFA 2Y4XA 1PRLC 3CCSA 2LZ6B 2G3RA 1K9MR 4V2SA 4OMLA 4CI0C 3I35A 4M77A 1VQPT 2DA9A 4JZ4A 4FM4B 2E41A 2RK2A 1UFFA 4QT7A 3JCMP 1YJ9A 4OMMA 4M7AD 1O75A 2OX7A 4WTOB 4TVRA 3CC7T 2COZA 2GBQA 1KQSA 2FG0A 2H3JA 1K1ZA 2RI2A 2EWNA 1PRMC 4LDUA 3RERA 1ZSGA 1JXOA 5CQXA 5I21A 1F1BB 3JB9G 2FZKB 3PVLA 2KVQG 2DVEA 4X34A 1PNJA 5C0MA 2RHXA 3CCUT 3JV3A 4Y91A 1TH7A 3GNFB 1O9SA 5CKDA 1WZOA 1QVGS 2E64A 3M56A 3SHWA 2DX1A 1D3BB 2GTOA 4QVDA 2H3EB 3CXCS 3UPUA 2ZGWA 4KGVB 3CCET 2CP3A 2H8HA 3FJPA 1K9MC 3OA6A 2C06A 1IRXA 1K9AA 1B34A 3A8MB 3EG3A 3S3NA 4DBQA 1D1AA 2OTJT 1YWOA 4N0AC 4BE2A 2E6ZA 4C5IA 3AT1B 2A7YA 1I4K1 5GAN3 3QG1A 2NUTB 3JCMh 5I11A 1GXIE 4QKUA 2XDBA 2OTLA 2EYYA 1B3QA 2E6NA 4DBHA 3JCMQ 4CC3A 2E10A 1SSHA 1FX7A 3GIBA 2DETA 5CKEA 1JBMA 1UGQB 2ZPEB 5D7UA 3CC2A 2DK3A 2J6KA 2DXCA 1V29B 1LCKA 1VQMT 3URGA 4PFPA 5I22A 1SG5A 2BIVA 3RUXA 1BB9A 4ZN1A 5M9OA 2K4YA 3RKXA 2RF0A 2O31A 3TEEA 4A54A 2AK5A 1RADB 2WSFE 3ME9A 4JS4A 2KT8A 3SWNC 1VIEA 3DLLA 1G2BA 1WYXA 3OW2S 3TSWA 2JVVA 5C6SA 4LD9K 4M7AE 4X9CA 4XAXB 5GANe 4A4EA 3MPUB 4DA4A 5L8RE 1U1TA 4C5EA 3I55T 3M0PA 1QLYA 2V1RA 1QKWA 3SB2A 2FHDA 2D0NA 4PJNA 1WXTA 2DL3A 1LJOA 4PJOE 3CPWS 2RNAA 2L89A 3JCMg 4Z89A 2G6FX 5GAN6 3OYKA 4E7ZA 5GAN7 3JCMd 1PC0A 2EBPA 1N5ZA 3CMET 1QVFS 4BE1A 1VQOQ 4ELZC 1IGUA 4QQDA 2O4XA 2YSQA 4KT0E 1MV0B 2DTHA 1WJRA 2MCNA 3EGDA 2COWA 5GMKl 4F7UB 2D8HA 4J9DA 1OYXA 4CRIA 2JZ2A 3V8JA 4J9BA 3S6WA 1PCXA 2K79A
chains in the Genus database with same CATH topology
1C6VX 4FW1A 5D7UA 1IHVA 1C1AA 1C0MA 1IHWA 1QMCA 1EX4A 4FW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6V X;  4FW1 A;  5D7U A;  1IHV A;  1C1A A;  1C0M A;  1IHW A;  1QMC A;  1EX4 A;  4FW2 A; 
#chains in the Genus database with same CATH topology
 4JS5 A;  1GBQ A;  2RQW A;  4N4H A;  4ZTJ A;  1NBE B;  4XTZ A;  4PNO A;  1YWP A;  4P5N A;  1ZA1 B;  2JJ9 A;  4RG8 A;  3RMS A;  4N0A A;  2LX7 A;  4OB0 B;  1MNE A;  2QQA A;  1K76 A;  2AZV A;  2D1X A;  2E5Q A;  2RHY A;  4M7A F;  4ELY C;  3LH0 A;  2HQE A;  4IUT A;  4IKF A;  1U06 A;  4J8O A;  2BE9 B;  4AFQ C;  4J6X A;  4C92 E;  4XU0 A;  1FMK A;  2X35 A;  4AT1 B;  5FRO A;  4E2F B;  1FYN A;  2YT6 A;  2CZ1 B;  1UB4 A;  2YHT A;  5GJW B;  3WVD B;  3MP8 A;  3CCR Q;  3TSZ A;  2VGM A;  4KBM B;  4RG2 A;  2CSI A;  1TSF A;  1Q86 U;  2FZG B;  2YUQ A;  3OS1 A;  2CP2 A;  2EQU A;  4KH1 B;  1G83 A;  4J9I A;  4OMQ A;  2LX9 A;  4A4H A;  3LGL A;  5EC7 A;  1Q86 R;  4XTY A;  2OAU A;  2KDS A;  4YTL A;  4JJC A;  4IUQ A;  1G3T A;  3H0F A;  3KXT A;  4EMK B;  1RAF B;  1VQO A;  1T0J A;  5CVI A;  4ZTF A;  1JRI A;  3DKM A;  3EAE A;  4PFZ A;  2MWP A;  3QWY A;  4DBF A;  1VQP Q;  2DZ9 A;  2M02 A;  3NMZ C;  5KCH A;  1VOM A;  1SRL A;  2JTF A;  4IIO A;  2X4X A;  2AKK A;  1R0B G;  4J7F A;  2A37 A;  5KE2 A;  1WGS A;  2KRM A;  3X28 B;  5FWC A;  1ZLM A;  2CT3 A;  3PFS A;  3RNJ A;  2DRM A;  1B7T A;  1X69 A;  1UEC A;  1D0Z A;  3EG1 A;  1M2O A;  1JB0 E;  4C92 F;  3M9Q A;  3CCJ Q;  5GMK e;  2EPD A;  2RH2 A;  2DYB A;  2DFU A;  5J39 A;  3QZ9 B;  1X27 A;  3JAM E;  4AG1 C;  3A98 A;  2JMA A;  1U5S A;  2EQI A;  3NPF A;  1AWW A;  1LPL A;  2JN0 A;  3REA B;  3GBQ A;  1OZ3 A;  2M1H A;  3HPW A;  5A2Q E;  3D7S B;  1W1F A;  3EGU A;  5GAN 5;  2GGR A;  2KXC A;  2EVR A;  4X9D A;  1ZQ1 A;  1Z9Z A;  4E7S A;  2XDD A;  3GP8 A;  2GTJ A;  1YCS B;  2LJ0 A;  2F2X A;  1QWF A;  5GAM f;  2RMO A;  4CC7 A;  3OYN A;  2QAZ A;  3CCR A;  2YWW A;  1VQ5 T;  4M78 D;  4PJO B;  4XTX A;  3CCE Q;  1K0X A;  2ZPH B;  4R56 A;  3V7C A;  4OMP A;  1OV3 A;  3QSU A;  5GAM h;  1AWX A;  1PWT A;  1WFW A;  3RIR A;  5FU6 B;  2P0P A;  4BY6 B;  2PUK B;  1WQW A;  2WSE E;  1EIF A;  3L2W A;  2RK1 A;  2ZCF B;  2WAC A;  4RKU E;  4NL2 A;  1VQN A;  5GAN 2;  4BI4 A;  5FRM A;  1ZBX A;  5IH2 A;  4RCB A;  1BCO A;  1H92 A;  1IB8 A;  2MWO A;  1IHW A;  1S1N A;  4OMF B;  5KYW A;  3AHU A;  1WI7 A;  1TUG B;  2QDY B;  2VC8 A;  2M16 A;  1NYF A;  2EYX A;  4JLG A;  1ZSZ C;  4F17 A;  3PT9 A;  3CBP A;  1WJS A;  2X4Y A;  1VQM Q;  2CKK A;  1BI3 A;  2ZPG B;  1ACM B;  1VQP A;  1ABO A;  3VJP A;  4RUG A;  2FEI A;  1RI9 A;  2ZPF B;  3G1J A;  4FSS A;  1VYV A;  1MHN A;  5KYX A;  2M0O A;  1UEB A;  2P0Q A;  3TVT A;  3QBY A;  2CP7 A;  3MET A;  3SEM A;  1MMG A;  3QDF A;  3A8H B;  3TU4 K;  3M0T A;  4KUL A;  1VQO T;  3VRZ A;  3H0I A;  1UTI A;  4M4Z A;  3OYL A;  1B07 A;  3CCJ A;  5HCK A;  3CCQ T;  1WHM A;  3OSV A;  4C92 B;  1W2B P;  3I55 Q;  2L5Q A;  4RMO A;  3H0H A;  5GAM g;  2ED0 A;  1Y71 A;  1BBZ A;  1C0M A;  5GAM d;  2QA4 T;  3FEO A;  1YFN A;  2AKL A;  5A0G A;  1TUD A;  2HBP A;  3A8L B;  3CBM A;  2K3B A;  3OYC A;  3LWH A;  3CME Q;  1BIB A;  2DRK A;  2NUP B;  5AYF A;  4PJM A;  4Z88 A;  5HKC A;  1WA7 A;  2RB6 A;  3FDR A;  5KYU A;  3I56 Q;  1UGP B;  3P8H A;  1M1F A;  1ZX6 A;  2R5M A;  3CCE A;  1VYT A;  2O2O A;  3VS3 A;  3HL8 A;  3QII A;  2RPN A;  4HT9 A;  4M7D D;  5LJ3 h;  5GJV B;  1K73 U;  1I81 A;  3QJY A;  3PTA A;  3UA6 A;  2RQR A;  1I0C A;  1RLQ C;  4C0F A;  1X2Q A;  1RLP C;  5DLO A;  5IXF A;  2EYW A;  2CUD A;  1FMW A;  3CCR T;  3EGX B;  1K73 R;  1QQJ A;  2HNI A;  1GFC A;  2LCL A;  1UHF A;  1N27 A;  3JB9 I;  4BAC A;  4HCK A;  1VQK Q;  1JEG A;  2XID A;  4WF2 A;  3TCJ A;  1UGV A;  4JRQ A;  3C12 A;  4XU1 A;  4GBQ A;  1VQ9 T;  1Y96 A;  3GOX A;  2BZ8 A;  2RM4 A;  1VQM A;  2HQH A;  4QVZ A;  3WVE B;  4LUE A;  4ZGD B;  4M77 B;  4PK4 A;  1VQN T;  2OI3 A;  4JJD A;  4ATO A;  2L3S A;  4QVC A;  1G8X A;  3JCM V;  9ATC B;  2D9T A;  4XK8 E;  2YDL A;  3MEW A;  3MHX A;  2D8J A;  4RTU A;  2O88 A;  3JB9 F;  2KSS A;  1ZSZ A;  3G7Z A;  5HK0 A;  1D1B A;  2CDT A;  2IPO B;  3UT1 A;  2KRS A;  2DYI A;  1K8A U;  1M3C A;  1GFD A;  3UDC A;  1Q82 U;  5GAO m;  2QDL A;  3NGP A;  3I55 A;  2KR3 A;  4PFO A;  2VWF A;  1BI1 A;  2OAW A;  3H41 A;  2MK5 A;  5LJ3 g;  1K8A R;  2F69 A;  3EG9 A;  2EJF A;  5LJ3 d;  4J83 A;  3X20 B;  1D1C A;  1Q82 R;  2C0I A;  3MKD A;  4KGX B;  4FYY B;  2IG0 A;  3CCJ T;  2ATC B;  4JJN K;  3CME A;  2FYK A;  4J7I A;  3MO8 A;  2GQI A;  2LCS A;  1FXX A;  4M75 D;  2E12 A;  5CKB A;  4OGC A;  3PIP A;  4M78 C;  1Y7X A;  3I56 A;  2AT1 B;  4JRK A;  3E9G A;  3RBB B;  2ZPB B;  4RTW A;  4E7H A;  2R5A A;  1CKB A;  1HXD A;  2JUF A;  1YHQ Q;  1B34 B;  3JCM X;  3OS0 A;  5CQY A;  1AZE A;  2NYS A;  2OJ2 A;  3X25 B;  3VS2 A;  1P92 A;  4J9E A;  3VS0 A;  4M7D E;  5A0L A;  1RAB B;  3E19 A;  2EJ9 A;  1KHC A;  1UGS B;  4M78 G;  5DM7 R;  3CCL Q;  4PL6 A;  1MUZ A;  1OU8 A;  3JCM f;  3A5Z B;  1YI2 T;  1VQK A;  2L0A A;  1VQ4 Q;  1G3S A;  2XI9 A;  5KH6 A;  1RAE B;  4J6Y A;  2VV5 A;  5FU7 B;  3H9N A;  2FVU A;  1WIE A;  3PE0 A;  4BDY A;  2EKO A;  2VB6 A;  5KYN A;  2D0Q B;  2DJZ A;  1SKU B;  2KT1 A;  2DTI A;  4BDZ A;  1Q82 C;  1HJD A;  3H8Z A;  1T3S A;  4C8Q D;  1ZA2 B;  2EW3 A;  1NJI U;  4OMO A;  1M1G A;  1VQ5 Q;  1N6A A;  1D3B A;  2FO0 A;  4JRI A;  5I2S A;  3T9N A;  3E2U A;  5GAN j;  2KQW A;  3RKY A;  4C0D C;  4E7I A;  3M58 A;  3SDZ A;  3M4G A;  2KGT A;  1NJI R;  4XTV A;  5LL6 S;  2KEA A;  1YCY A;  4C0G A;  3EFR A;  2ZAE A;  1A0N B;  1RAH B;  1KC8 U;  2IIM A;  2DL4 A;  1MMN A;  2HKN A;  2V8J A;  4LUD A;  4D8D A;  4HVW A;  1H3Z A;  2NUT A;  2L3R A;  2RN8 A;  4F7U G;  3OS5 A;  2KK4 A;  1E6H A;  2YUN A;  4J9H A;  2DL7 A;  4Y28 E;  4R0K A;  3HP9 A;  2X3W D;  3A8O B;  2HCK A;  4JUV A;  4AFZ C;  4AFS C;  3C0C A;  5GAM e;  4HCB A;  3BDU A;  2CP0 A;  3R6N A;  4LDV A;  2MOX A;  4M7D F;  5KYY A;  1VQ6 T;  1KC8 R;  1N8R U;  4D6W A;  1I07 A;  3DB3 A;  2O4X B;  1R77 A;  4GLM A;  2YLB A;  1NG2 A;  1MV3 A;  1VYU A;  4LE9 A;  2KBT A;  1KHI A;  2VVK A;  1OOT A;  2MIO A;  3EGD B;  4M7D C;  1YHQ A;  2DAQ A;  4JPB W;  1N8R R;  2EFI A;  2M51 A;  3UA7 A;  3V8K A;  1SSF A;  2YLC A;  1UE9 A;  2K5I A;  5IHN A;  4M78 A;  1HK9 A;  2DIL A;  1BIA A;  3CMA Q;  3I56 T;  3CCV T;  3DB4 A;  4DBR A;  1TS9 A;  3CCL A;  1WHK A;  2E5K A;  3CCQ Q;  3DLM A;  2X4W A;  1VQ4 A;  1OU9 A;  2RJD A;  3X24 B;  3MEU A;  3RMQ A;  4M7D G;  2V8I A;  4A4K A;  3I5S A;  2HD0 A;  2HQX A;  2QK0 A;  4C5G A;  2QA4 Q;  3EHR A;  3MP6 A;  1VQ7 T;  4LD6 A;  4FT4 A;  3CPF A;  4BI3 A;  5HY6 A;  1WHG A;  3VS6 A;  4FYV B;  2LRQ A;  3FLG A;  1VQK T;  1ZUU A;  1M4Z A;  4MDX A;  2L8D A;  2K2M A;  3QO3 A;  1TUC A;  3RKW A;  1VQ5 A;  5LJ5 h;  1IXD A;  2QTX A;  2MF2 A;  2ABL A;  2V26 A;  4MZT A;  4C8Q E;  2RHZ A;  3L2Z A;  2YXY A;  5AT1 B;  3QUI A;  4DOV A;  2P0K A;  4JJB A;  1E7O A;  2GFA A;  1NPP A;  3SWN B;  4FW2 A;  3BDL A;  1K4U S;  2EKH A;  1W4S A;  2L2P A;  3L2U A;  4HT8 A;  3P8D A;  3VS7 A;  5IHI A;  1D0X A;  3MCA B;  5LJ3 e;  4M75 C;  4EMG A;  2O9S A;  3JSC A;  4F04 B;  2DXU A;  1VQ9 Q;  1LVK A;  1Q81 U;  1AEY A;  2LQN A;  5A0D A;  3M0Q A;  4MZP A;  3ER0 A;  4HVV A;  1VQN Q;  2DD4 A;  5FWB A;  4J9C A;  2RJF A;  2PVO B;  2CRE A;  1HYO A;  1UGR B;  3M53 A;  1I5L A;  4EMH A;  1IZ6 A;  3PMI A;  1X6O A;  4KGZ B;  1KJW A;  1EX4 A;  1Q81 R;  4XU2 A;  3VS1 A;  3OYG A;  4M75 G;  4LN2 A;  2XK0 A;  2RQU A;  1K0S A;  3CMA A;  1UJY A;  5IT9 E;  2DL5 A;  4M7D A;  1OPK A;  2DTO A;  2DIG A;  4MDW A;  1TU0 B;  2RQV A;  5GMK j;  3CCQ A;  2W10 A;  2M9U A;  5LJ5 g;  1HD3 A;  2L3P A;  1YHQ T;  4O6J A;  5LJ5 d;  4C8Q F;  1WQ7 A;  3QPH A;  2QA4 A;  2A08 A;  2V8K A;  5ECA A;  4E6R A;  4GLK A;  4KRT A;  2KE9 A;  4AG2 C;  1KQ2 A;  4HXJ A;  1WHL A;  3FIF A;  2HDA A;  3GLX A;  3CCL T;  4C8Q C;  2BKD N;  1QW1 A;  4FCY A;  4JLI A;  1SHG A;  2KYM A;  3OBY A;  2JNG A;  2JW4 A;  2VXF A;  4RTZ A;  1OPL A;  1VQ4 T;  4A4F A;  1M8M A;  4IUR A;  1M2V A;  2DBM A;  2COY A;  1KIK A;  2DF6 A;  2K57 A;  3EFO A;  2DNU A;  1G3Y A;  3Q1J A;  1M30 A;  5FLX E;  1Q86 C;  2DL8 A;  4XTU A;  4M7A B;  1MND A;  2XU8 A;  3S3O A;  3QDR B;  3CCM T;  2DER A;  5IHK A;  2HEQ A;  4C8Q G;  3FRN A;  4PKC C;  1UG1 A;  4E7J A;  5KCO A;  5J3B A;  2LDM A;  1KD1 U;  2PTK A;  1EFN A;  2EQK A;  1PG5 B;  1YI2 Q;  2NLU A;  1CSK A;  5KYW B;  1BCM A;  3PVQ A;  4HA8 A;  2CS7 A;  1WXB A;  1RAI B;  3LGF A;  1VQ9 A;  5L23 A;  3MP1 A;  4OF1 A;  1RAA B;  2HZY A;  1KD1 R;  1QP3 A;  1NPR A;  5HK3 A;  1D0Y A;  3L1A A;  2XHC A;  2J06 A;  2LMJ A;  2ECZ A;  2BE7 D;  1JJ2 P;  2EIF A;  1W2B S;  4JDS A;  2HMA A;  3EHQ A;  5CKF A;  4M75 A;  3OMC A;  5KYX B;  2P84 A;  2RJE A;  1M1K U;  3JB9 H;  2A0F B;  4OVA A;  4BB7 A;  3NHN A;  2R57 A;  2CP5 A;  1SHF A;  3CC4 T;  3JCM e;  1TG0 A;  4RCC A;  1PKS A;  1KQS P;  3GNG A;  4Y92 A;  1PKT A;  4AMC A;  1M1K R;  1Z9Q A;  3G6E A;  2DVJ A;  2JM9 A;  2LNV A;  1M5Q 1;  1U1S A;  1PM3 A;  3OYE A;  4IUU A;  1GRI A;  2RJC A;  4ESR A;  1WPY A;  2RI5 A;  2PVG B;  2XDP A;  2GCX A;  4J6W A;  2C0O A;  3CMA T;  3EG0 A;  2PUO B;  1VQ6 Q;  3O8V A;  3GPL A;  2E3H A;  2ZZD A;  1ARK A;  4OB1 B;  4C8Q A;  3PNW C;  2QGG A;  1D09 B;  3HRT A;  4OB2 B;  4JRP A;  1M3A A;  3QKJ A;  1FMV A;  1WNL A;  2K3X A;  4LDX A;  1BU1 A;  3LX7 A;  5CR2 A;  5LJ3 f;  2VAS A;  1J3T A;  4NS5 A;  5GAN g;  3CCV Q;  4PJL A;  4L6V 5;  3HRU A;  4HCC A;  2AHJ B;  2DJQ A;  3NFC A;  5GMK i;  1YI2 A;  3JB9 J;  4J9G A;  3JCM b;  2JMC A;  4NOY A;  2JS2 A;  4M78 E;  2EQM A;  2FL7 A;  2EGA A;  2Y4Y A;  2K3Y A;  2RO0 A;  5I2M A;  1JXM A;  3VYG A;  1VQ7 Q;  3WXM B;  3NTI A;  3OYF A;  4L59 A;  1QMC A;  3FC3 A;  1AD5 A;  1NLP C;  1UHC A;  2F5K A;  3VRY A;  3EG2 A;  4FW1 A;  3HRS A;  1I8F A;  1X01 A;  1ZSZ B;  1WJQ A;  1V1C A;  2KY9 A;  2KMT A;  2CZ7 B;  4DEX A;  1NZ9 A;  2QQS A;  4IIM A;  1QCO A;  2HKQ B;  3VYH B;  3G4S T;  1IO6 A;  2A28 A;  1H64 1;  1T0H A;  1YJN T;  1Y07 A;  1GCP A;  4MMK A;  2BZX A;  3EG9 B;  5D6Y A;  3INZ A;  5LJ5 e;  5FU7 C;  2HL3 A;  3BE3 A;  2DEU A;  2B8A A;  3EH2 A;  1RI0 A;  4HKE A;  2LC4 A;  3PMT A;  4EDU A;  3OSS C;  3JCM J;  3MEV A;  4DQ2 A;  3EGX A;  3G6E T;  2LVM A;  1X6G A;  3VV0 A;  1C1A A;  1VQ6 A;  3ZFJ A;  2AZS A;  3A1P A;  4F7U E;  2RI3 A;  1NM7 A;  5CO7 A;  2F1L A;  3JRZ A;  3C94 A;  3LW5 E;  2EYQ A;  2KAF A;  5D6W A;  4K11 A;  2LT1 A;  5D6X A;  4M78 F;  1SRM A;  5GMK h;  3LYI A;  1WHH A;  3A8G B;  4J5Y A;  1QWE A;  3NTK A;  1JJ2 A;  2EJG A;  3THK A;  4N4G A;  4XTW A;  1K73 C;  2ROL A;  3CBO A;  5GAO r;  3E1S A;  3L2R A;  2DXT A;  1QKX A;  2SRC A;  3CCV A;  3VS4 A;  5CCA A;  3JCM W;  2DBK A;  1MMA A;  1X75 C;  4CC2 A;  2DM1 A;  2CYZ B;  2JT4 A;  4OMN A;  2DKG A;  1M90 U;  3J7A F;  4QQG A;  1AT1 B;  3V7S A;  1I5O B;  3M5A A;  3QHS A;  2I0N A;  3EFS A;  1WLP B;  3VU3 C;  2RQT A;  4PJO D;  3TRE A;  3OY9 A;  2CH4 A;  2GQV A;  3S3M A;  3OS2 A;  2HL5 C;  1M90 R;  1VQ7 A;  2MI6 A;  3OQ5 A;  1TOV A;  2DIQ A;  4C0Z A;  2EGE A;  2DD5 A;  3VUZ A;  1VIF A;  3M0S A;  2E3I A;  2LQ8 A;  1X43 A;  1W2B A;  3QYG B;  3OYA A;  2KI7 A;  1BI0 A;  1H3H A;  1YJW Q;  2CGH A;  3CEY A;  8AT1 B;  2EAY A;  1M3B A;  2FRY A;  2LCC A;  1K8A C;  4F7U F;  2X4J A;  2A36 A;  1KG1 A;  2GFU A;  1S72 T;  1LOJ A;  3VKI A;  4MML A;  3CCM Q;  3GF5 A;  3P8B B;  3KBG A;  2QQB A;  3M54 A;  2K7A A;  1TXQ A;  4NL3 A;  1XNI A;  3I9Q A;  3QXE B;  1KFZ A;  2FB7 A;  5GAM j;  5GAN 8;  1R8O B;  1MMD A;  4IUV A;  5KYY B;  1YIT T;  2K5L A;  1ZUK A;  2XIC A;  3VS5 A;  4PJJ A;  1Q7Y U;  2LQW A;  3M0R A;  2PNI A;  4LNP A;  1BKB A;  4C92 D;  1BI2 A;  1QVG P;  4HCZ A;  1M90 C;  3OYI A;  1Q7Y R;  2NWM A;  2YRC A;  2ESW A;  3CXC P;  2QI2 A;  3G71 Q;  2CZ6 B;  2QG9 B;  4M78 B;  2K9G A;  4FL6 A;  3CC4 Q;  2ED1 A;  1BYM A;  1PSF A;  1U3O A;  3M57 A;  4FYW B;  3X26 B;  1VQL T;  1AZG B;  2YUP A;  3CCS T;  4M75 E;  5DY9 A;  3QWX X;  2LJ1 A;  3CD6 Q;  2HSE B;  5IAY A;  1WHJ A;  1AOJ A;  1NE8 A;  2HSP A;  1X6B A;  3MEA A;  4RTT A;  1YJ9 T;  3PGG A;  2LJ3 A;  4MZM A;  3JCM c;  3ZBD A;  3HHT B;  4OGE A;  2F5T X;  3TQ7 P;  4O5V A;  1AHJ B;  4CC4 B;  1H8K A;  2FZC B;  2MAM A;  2X51 A;  1YIJ Q;  4EMK C;  1ZUY A;  1NJI C;  1YJW A;  2ZPI B;  3SD4 A;  2VKN A;  2E4H A;  1G5V A;  5LJ5 f;  4Z02 A;  2F2W A;  1WXU A;  3CCM A;  3OW2 P;  3HFN A;  2B86 A;  2FRW A;  1AWJ A;  1IHV A;  4M77 D;  2E1H A;  1KSW A;  2K6D A;  4FIB A;  1Q7Y C;  1YNZ A;  2BTT A;  2M0Y A;  3OYM A;  1KC8 C;  1C6V X;  1VQ8 Q;  4C0D B;  5LJ3 j;  4B6M A;  1GCQ C;  1TTH B;  2KRO A;  2NUZ A;  5GAN 4;  1X2K A;  1RAG B;  3OBW A;  3HFO A;  3CPW P;  1NEB A;  1QCN A;  1M9S A;  4F7U A;  2QEX Q;  1N8R C;  2YRV A;  4M75 F;  3KFV A;  4FSX A;  3CQT A;  2DEQ A;  2CSQ A;  2YRD A;  4L5G A;  1WDX A;  2Y90 A;  1QVF P;  4KUD K;  2K5F A;  4F16 A;  2OTL T;  3OYY A;  3G71 A;  4Z8A A;  1SEM A;  3OYB A;  2LT4 A;  4M7A C;  2KNB B;  2HBW A;  3R6O A;  4DEY A;  5CKH A;  3CC4 A;  2J6O A;  2K2V A;  4B9X A;  4PJO F;  4M7D B;  4ZNX A;  5GAO n;  3CC2 T;  4OB3 B;  1Y0M A;  3OYH A;  3I5R A;  1VUB A;  3G4S Q;  1PD0 A;  1PSE A;  1V76 A;  2DPP B;  2DZC A;  2RD1 A;  3CD6 A;  1YJN Q;  2J6F A;  1OI1 A;  4PJO C;  3QZ5 B;  2VYT A;  3HSB A;  2LP5 A;  2QYZ A;  1IGQ A;  3L2Q A;  2PZ1 A;  5FU6 C;  1NYG A;  1OX8 A;  3SWN A;  4BY6 C;  3L42 A;  4M7A G;  2QAS A;  2J05 A;  2VGN A;  1HSQ A;  1PD1 A;  3RES A;  3G6E Q;  1W6X A;  2PVD B;  2CT4 A;  2WSC E;  3C95 A;  4BD3 A;  1XTD A;  1M2V B;  1R0C B;  4PLL A;  2FPD A;  4PJO G;  1YIJ A;  2CUB A;  4J9F A;  3EFO B;  3SFM A;  1E6G A;  2L3Q A;  1M8V A;  4RTY A;  1OEB A;  1ZHI A;  4PLI A;  4UC4 A;  4ANJ A;  3LH5 A;  3C4S A;  3V8L A;  4II1 A;  1RUW A;  3RR6 A;  1IRE B;  2KXD A;  1QVG A;  1JO8 A;  3UAT A;  2VUB A;  2XMF A;  2AIR B;  2QQR A;  1QVP A;  3CXC A;  4EMK A;  3QYH B;  2W0Z A;  1JJ2 S;  3F70 A;  1VQ8 A;  1QCF A;  3CC7 Q;  1RL2 A;  1YJW T;  3ASK A;  4M77 E;  4A4G A;  2DLP A;  2RHI A;  2D6F A;  4A53 A;  2X9H A;  1JU5 C;  2P4R A;  3MJX A;  3KUF A;  4FT2 A;  1EZZ B;  3M55 A;  4BUG A;  2J7I A;  1YBY A;  3JB9 D;  1SPK A;  2CZ0 B;  4LDW A;  4QW2 A;  2ENM A;  3OYJ A;  2QEX A;  1KQS S;  4C92 C;  3OB9 A;  5GAO q;  1T3L A;  1VA7 A;  5CK9 A;  2DXB A;  1Q81 C;  2DMO A;  1UUE A;  4A63 B;  1RAC B;  3HTR A;  2EQJ A;  3CCU Q;  4M75 B;  4AFU C;  1GCQ A;  2LQK A;  3H6Z A;  5IXB A;  2VXE A;  3LLR A;  4EPC A;  4R55 A;  2JS0 A;  1JQQ A;  4RTX A;  2O9V A;  6AT1 B;  5GAO l;  1XJW B;  2A3L A;  1QP2 A;  1W70 A;  2JM8 A;  2XG8 D;  5GAN f;  3HKS A;  4D8K A;  1OZ2 A;  3G4S A;  4C92 G;  1CKA A;  5GMK m;  1S72 Q;  2PQW A;  4VUB A;  1YJN A;  1Y57 A;  2JTM A;  2OTJ Q;  2LNH B;  4M7A A;  1TWB A;  5GAN h;  5FRN A;  3G71 T;  3FB9 A;  3UWN A;  2SEM A;  3ZEH A;  3OW2 A;  3FJ5 A;  2JTE A;  1OQK A;  1M27 C;  2JOY A;  4B9W A;  4PJO A;  1YIT Q;  3REB B;  3CD6 T;  1YP5 A;  4E47 A;  2PU9 B;  4FU6 A;  2I2L A;  2P4T A;  2BZY A;  2QQ9 A;  1NLO C;  4M77 F;  2DO3 A;  1WX6 A;  4JZ3 A;  3CPW A;  2E70 A;  3BFM A;  1SF9 A;  1U8R A;  4E7L A;  1XOV A;  4E7K A;  4C8Q B;  1ZBJ A;  4OP0 A;  1PHT A;  2IVW A;  1N9R A;  3VUB A;  4M77 C;  1QVF A;  1GL5 A;  2KRN A;  1OUL A;  1BK2 A;  3M4Y A;  4LXC A;  2CH4 W;  4XQ3 A;  2CP6 A;  4KUI A;  5KYU B;  4ORZ A;  3BW1 A;  1VQL Q;  1YN8 A;  3J80 E;  1YIJ T;  3CC7 A;  1G3W A;  4HVU A;  3CCS Q;  1KQ1 A;  2Z0W A;  7AT1 B;  1KD1 C;  2EYZ A;  2XD0 A;  2O01 E;  4RTV A;  3IQL A;  5IN1 A;  2YUO A;  1Q95 G;  1I1J A;  3J81 E;  3E9F A;  4ME7 A;  4M77 G;  3OMG A;  4N4I A;  3RDV A;  1YJ9 Q;  5GAO p;  2LTO A;  3U23 A;  1KK7 A;  2MYS A;  3LWI A;  2QGF B;  3CCU A;  5GAN d;  1VQ8 T;  2DE0 X;  1AVZ C;  1UDL A;  2QXF A;  5CAI A;  3N5B B;  2MMP A;  3UF4 A;  1M1K C;  1MGQ A;  5FW9 A;  4BE0 A;  4C92 A;  3OYD A;  1Y96 B;  4F14 A;  3NTH A;  1DJ7 B;  2QEX T;  2E65 A;  4QQ6 A;  4LDY A;  3ZL7 C;  2XKO C;  1S72 A;  4BI8 B;  3PIO A;  3QJ6 A;  1ABQ A;  2OTJ A;  4ZN3 A;  2GF7 A;  2X3X D;  4XU3 A;  2FPE A;  5J26 A;  2NUP A;  1XQH A;  4KH0 B;  5LJ5 j;  3O5Z A;  2ROT A;  2EGC A;  1UJ0 A;  1FWZ A;  2GNC A;  5CIU A;  4IUP A;  2V1Q A;  2KYB A;  2QTV A;  1NEG A;  1YIT A;  4WCI A;  2C0T A;  3BY7 A;  3M0U A;  2HAX A;  2R58 A;  4DOW A;  3M59 A;  5KE3 A;  1OX9 A;  4Q5W A;  2MPX C;  4ZGE B;  5EG2 A;  4C5H A;  2BUD A;  3ULR B;  4EIK A;  1AWO A;  2JXB A;  2F2V A;  2OTL Q;  4FYX B;  1K9M U;  2RA2 A;  8ATC B;  3V7R A;  3EH1 A;  4ZGJ B;  2RHU A;  4GY5 A;  1N9S A;  3L2V A;  1VQL A;  1LNX A;  5DLQ E;  1GBR A;  4X1V A;  3CC2 Q;  2FPF A;  2Y4X A;  1PRL C;  3CCS A;  2LZ6 B;  2G3R A;  1K9M R;  4V2S A;  4OML A;  4CI0 C;  3I35 A;  4M77 A;  1VQP T;  2DA9 A;  4JZ4 A;  4FM4 B;  2E41 A;  2RK2 A;  1UFF A;  4QT7 A;  3JCM P;  1YJ9 A;  4OMM A;  4M7A D;  1O75 A;  2OX7 A;  4WTO B;  4TVR A;  3CC7 T;  2COZ A;  2GBQ A;  1KQS A;  2FG0 A;  2H3J A;  1K1Z A;  2RI2 A;  2EWN A;  1PRM C;  4LDU A;  3RER A;  1ZSG A;  1JXO A;  5CQX A;  5I21 A;  1F1B B;  3JB9 G;  2FZK B;  3PVL A;  2KVQ G;  2DVE A;  4X34 A;  1PNJ A;  5C0M A;  2RHX A;  3CCU T;  3JV3 A;  4Y91 A;  1TH7 A;  3GNF B;  1O9S A;  5CKD A;  1WZO A;  1QVG S;  2E64 A;  3M56 A;  3SHW A;  2DX1 A;  1D3B B;  2GTO A;  4QVD A;  2H3E B;  3CXC S;  3UPU A;  2ZGW A;  4KGV B;  3CCE T;  2CP3 A;  2H8H A;  3FJP A;  1K9M C;  3OA6 A;  2C06 A;  1IRX A;  1K9A A;  1B34 A;  3A8M B;  3EG3 A;  3S3N A;  4DBQ A;  1D1A A;  2OTJ T;  1YWO A;  4N0A C;  4BE2 A;  2E6Z A;  4C5I A;  3AT1 B;  2A7Y A;  1I4K 1;  5GAN 3;  3QG1 A;  2NUT B;  3JCM h;  5I11 A;  1GXI E;  4QKU A;  2XDB A;  2OTL A;  2EYY A;  1B3Q A;  2E6N A;  4DBH A;  3JCM Q;  4CC3 A;  2E10 A;  1SSH A;  1FX7 A;  3GIB A;  2DET A;  5CKE A;  1JBM A;  1UGQ B;  2ZPE B;  5D7U A;  3CC2 A;  2DK3 A;  2J6K A;  2DXC A;  1V29 B;  1LCK A;  1VQM T;  3URG A;  4PFP A;  5I22 A;  1SG5 A;  2BIV A;  3RUX A;  1BB9 A;  4ZN1 A;  5M9O A;  2K4Y A;  3RKX A;  2RF0 A;  2O31 A;  3TEE A;  4A54 A;  2AK5 A;  1RAD B;  2WSF E;  3ME9 A;  4JS4 A;  2KT8 A;  3SWN C;  1VIE A;  3DLL A;  1G2B A;  1WYX A;  3OW2 S;  3TSW A;  2JVV A;  5C6S A;  4LD9 K;  4M7A E;  4X9C A;  4XAX B;  5GAN e;  4A4E A;  3MPU B;  4DA4 A;  5L8R E;  1U1T A;  4C5E A;  3I55 T;  3M0P A;  1QLY A;  2V1R A;  1QKW A;  3SB2 A;  2FHD A;  2D0N A;  4PJN A;  1WXT A;  2DL3 A;  1LJO A;  4PJO E;  3CPW S;  2RNA A;  2L89 A;  3JCM g;  4Z89 A;  2G6F X;  5GAN 6;  3OYK A;  4E7Z A;  5GAN 7;  3JCM d;  1PC0 A;  2EBP A;  1N5Z A;  3CME T;  1QVF S;  4BE1 A;  1VQO Q;  4ELZ C;  1IGU A;  4QQD A;  2O4X A;  2YSQ A;  4KT0 E;  1MV0 B;  2DTH A;  1WJR A;  2MCN A;  3EGD A;  2COW A;  5GMK l;  4F7U B;  2D8H A;  4J9D A;  1OYX A;  4CRI A;  2JZ2 A;  3V8J A;  4J9B A;  3S6W A;  1PCX A;  2K79 A; 
#chains in the Genus database with same CATH homology
 1C6V X;  4FW1 A;  5D7U A;  1IHV A;  1C1A A;  1C0M A;  1IHW A;  1QMC A;  1EX4 A;  4FW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...