1VQ7Q

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq7Q00
3G71Q 3CCJQ 1QVGP 3CPWP 1NJIR 3I56Q 1YJ9Q 3CCQQ 1VQ7Q 3CCVQ 1VQ8Q 1YJNQ 1Q82R 1VQ4Q 1Q86R 2OTLQ 3CCMQ 3CCEQ 1K73R 3I55Q 3CCRQ 1VQPQ 1W2BP 3CC2Q 3OW2P 1VQOQ 1KD1R 1M1KR 3G6EQ 1YI2Q 1Q7YR 1VQLQ 1Q81R 1JJ2P 1KQSP 1QVFP 2OTJQ 2QEXQ 1VQ6Q 1YHQQ 1S72Q 1VQ9Q 3CCSQ 3CMAQ 1YITQ 3G4SQ 1VQNQ 3CD6Q 3CXCP 1K8AR 1VQ5Q 3CCLQ 1YIJQ 1KC8R 1VQKQ 3CCUQ 3CC4Q 1YJWQ 3CC7Q 3CMEQ 1VQMQ 1K9MR 1N8RR 1M90R 2QA4Q
chains in the Genus database with same CATH superfamily
4O5VA 1QVGP 1IRXA 4CRIA 1I5OB 2EW3A 5KH6A 1U1SA 3I55A 1WXTA 1OEBA 2DXUA 4M77E 4BY6C 4F17A 5CKFA 5GAN7 5GANg 4RTWA 3C0CA 2ZAEA 4MZTA 4C8QE 4IKFA 3VJPA 1YHQQ 1RUWA 4AFUC 2MF2A 3CMEQ 2CREA 3TREA 1YITA 1RAHB 1NBEB 2YXYA 3G71Q 1XNIA 2V8IA 1TUDA 4KUDK 2E1HA 2MK5A 4M75G 2ZCFB 2DAQA 2A3LA 2KYBA 3GOXA 3CCLA 1PRLC 4HVUA 1U5SA 3L2WA 4KT0E 2DM1A 4AFSC 3PVQA 1TUGB 4F7UG 2DL3A 1QVFS 2KBTA 3JB9D 1ZSZC 2JM8A 1ARKA 2QYZA 1RAEB 1MMGA 2EBPA 3EAEA 1B07A 4C5HA 2DERA 2E6NA 5IN1A 1NPPA 2D9TA 1OU8A 1WHGA 2MOXA 4WF2A 1WLPB 2A08A 3BDUA 1S72Q 4MZPA 2JM9A 1VQNQ 4ATOA 4OB2B 1S72A 3F70A 3VRZA 1RI9A 1HXDA 4BI4A 3QDRB 2F69A 1EIFA 2VGMA 2YRDA 4CC4B 2EGEA 4M7AF 4QKUA 4PJOF 4M7AB 4QVDA 1VQMT 3R6OA 1MMNA 2HAXA 1VQ8A 2CP2A 2IPOB 1G3SA 1M1GA 3S6WA 2R5MA 4M75F 4EMKB 3JCMQ 3EFOB 4QW2A 4M77G 3NFCA 2AHJB 1WQWA 4HCZA 4BY6B 2FRYA 2FPEA 1W70A 3JCMJ 1QVPA 4DOVA 3CQTA 2IG0A 4C0DC 5LJ5h 2KI7A 3CCST 3FIFA 4E7SA 2CP7A 1JEGA 3M0PA 3NTKA 1YIJQ 4OF1A 4ZGEB 2E41A 2RO0A 3ZFJA 2E4HA 3AHUA 3LLRA 1X69A 4HT8A 2VWFA 4AG1C 4K11A 2G3RA 1PRMC 4C92D 3RERA 5KYWB 4M75E 4KULA 4PJJA 1M9SA 3QSUA 3C94A 2ZPBB 1HJDA 2DYBA 5KCHA 2RK2A 2HDAA 5GAOp 3OS5A 2H8HA 3FRNA 4MDXA 2Y90A 4GY5A 1QWEA 2HMAA 2D1XA 4FSXA 1VIEA 4F16A 5FLXE 5KYXB 4RKUE 3CC4T 1BKBA 2DEUA 5HY6A 1YI2A 4XTWA 3OBYA 3QUIA 2SEMA 2KXCA 4PJLA 3QWXX 1AWXA 2F2WA 2M16A 1NE8A 2O88A 2CDTA 2JTFA 2FZGB 3MP8A 3BW1A 2X4XA 3VS6A 3OYFA 1ZBJA 3ER0A 4M78E 1AZEA 3CD6T 3A8LB 4ZTJA 5J39A 1UG1A 2JMCA 1UGVA 2KMTA 4J9GA 3G4SQ 2XDDA 2ZZDA 2FL7A 2J06A 1ZQ1A 1K1ZA 2GFAA 2O01E 1YJ9Q 1UUEA 4XTVA 1VQ8Q 4AFQC 4IURA 4KRTA 3G71A 2J6OA 5I2MA 3E19A 3GLXA 4FW2A 3QKJA 4C8QB 3A5ZB 3NGPA 4ZGDB 5GAOr 1HSQA 1R8OB 3TSZA 2K5IA 3M55A 4XTYA 2H3EB 5CO7A 1QQJA 1H3ZA 5GMKe 1X75C 2W0ZA 2J6FA 1X6GA 1GBQA 2P0QA 2H3JA 1D0YA 4J9HA 1PC0A 3NMZC 2COZA 1ZUYA 4J9DA 1G3TA 2HKNA 1PSFA 3UATA 1NEGA 2K7AA 4HCBA 2LCLA 2AZVA 2DJZA 2A36A 1WHMA 5IXFA 1YI2Q 2K2VA 4OMPA 1HK9A 1X2QA 3CBOA 2JTEA 3GNGA 1VQ6A 4RTXA 2RI5A 1JQQA 1V29B 4M7DB 2HBWA 4BB7A 2DXCA 3LGFA 3CCUT 5D7UA 1Y96B 2KNBB 2RB6A 3CC7A 3H41A 3OMCA 4A4FA 3C12A 3CPWA 2RQRA 4PFOA 3EHRA 3GF5A 2ZPHB 3SDZA 4JZ3A 3ZBDA 2EGAA 3CMET 3CMEA 2L3SA 1G3WA 3RIRA 2DL5A 1B34A 2MCNA 5CKDA 3M58A 4NOYA 1M90C 3OYAA 3MHXA 2L3QA 3INZA 1G8XA 4KGVB 3OB9A 4PJOD 4QQ6A 2KR3A 4M77C 1YIJA 1E6HA 1MMDA 4J9CA 1QW1A 1AEYA 2A0FB 4WCIA 1K0XA 1C1AA 3FB9A 1WZOA 1VQ6T 1ZSZB 5L8RE 1QVFA 3O8VA 3CMAQ 3ME9A 1KJWA 1Y71A 5IAYA 1TSFA 4E7KA 4P5NA 3CMAA 2LJ1A 3JCMd 2R57A 1VA7A 1KHCA 1C6VX 1U8RA 3OYEA 2EYWA 4PJOG 1BCOA 3JB9F 2COYA 2JW4A 2VXFA 2E70A 6AT1B 1MV3A 4M75A 3RKWA 1K8AU 3VUZA 1M8VA 2MYSA 4QVZA 4JJDA 3THKA 3EFOA 2EKOA 2LJ3A 1IHWA 1GRIA 2A37A 2QGFB 2D6FA 3CCJT 2RJEA 1BBZA 4JRIA 1MGQA 4M7DG 2F2VA 3EH2A 2LMJA 5FWBA 3JCMW 2EJ9A 1NM7A 3OW2P 1YIJT 3OS1A 3TQ7P 4DBQA 3CCUQ 1UTIA 2D0NA 2DXBA 2KRMA 2RHZA 2RHXA 3ULRB 3A8MB 5GANf 4KBMB 4J6WA 2DBMA 2P4RA 3RKXA 2EQKA 2ZPIB 1Y0MA 4ZGJB 4JPBW 4O6JA 4CC2A 2FPFA 1KSWA 2WSFE 3LW5E 1VQOQ 3QJ6A 4D6WA 1CKAA 3A98A 2HSPA 2OTJQ 4ZTFA 5GAMj 2IVWA 1VQMA 3M4YA 1M27C 4ELYC 3WVDB 2P0PA 2O9VA 1K9MR 3EGDA 5A2QE 3QDFA 2HQHA 4RG2A 1BB9A 2O9SA 1QCFA 1OOTA 1Y57A 1OZ2A 3MPUB 1RLQC 1WHJA 4C5IA 3CCEQ 5KYWA 2M02A 1GCQA 3CCVA 1R0CB 2O4XA 2QQSA 2XIDA 3G4SA 1JJ2P 3FEOA 4PJOE 1IGQA 1D1AA 1FMWA 3CXCA 2QG9B 3OYIA 2RPNA 4M77F 3EG1A 1OPKA 2LNHB 3JCMe 2YUOA 4PJNA 3QJYA 4MDWA 2E10A 3V8JA 3OS0A 2OTLA 2QEXQ 3JCMh 4A4HA 1VQ5Q 3C95A 3QYHB 4X9DA 3EG3A 3MJXA 5GMKj 2CP3A 4N4GA 2I2LA 3OMGA 3VU3C 3R6NA 2WSCE 1K8AC 3NTHA 4C5EA 4C8QC 1B3QA 5I2SA 3OYLA 4JJNK 3P8DA 4M7AC 3J80E 1SF9A 2LCCA 1YHQT 1YWPA 1FMKA 2DL7A 1BIBA 1WIEA 2CT3A 3A8GB 2FO0A 1VQ4T 1YJWQ 4Z02A 3CCVT 4BACA 4F7UF 2D8JA 2P4TA 1CSKA 4FYWB 4C8QD 4M4ZA 1VQ4Q 2EWNA 5GAOm 2DK3A 1K73R 1EZZB 2K3YA 5AT1B 5KE2A 1QP2A 2B8AA 1V1CA 4BE2A 4M7DD 4QVCA 1TU0B 3OYYA 4B6MA 1TG0A 5L23A 1YWOA 3CCMT 2I0NA 2K6DA 2NYSA 3WVEB 1YJ9T 1VQPT 3HFOA 4E2FB 2OTLT 4E7ZA 1N8RC 3PMIA 2O4XB 4HXJA 3D7SB 4A53A 5AYFA 3OYCA 1WJQA 5CCAA 2EYYA 1WQ7A 4PFZA 2AK5A 1D09B 1MUZA 1YITT 4VUBA 3BY7A 3KXTA 1YHQA 2DVEA 5CVIA 2X3WD 1VQ4A 5CR2A 1WHHA 2HZYA 2QA4T 1N6AA 1SKUB 3HP9A 2EFIA 2E12A 1UDLA 1GFDA 1S1NA 5IT9E 3EFSA 1ABOA 1BIAA 4CC3A 5KYNA 4N4HA 1N8RU 1AOJA 2X4JA 2GQVA 4LXCA 3CXCP 3A8OB 1RAFB 4LUEA 1H8KA 3MKDA 7AT1B 2COWA 4X1VA 4J8OA 1GBRA 3EG9A 2E3HA 2KAFA 1AVZC 3HRUA 1B34B 2ATCB 1D0XA 4LDUA 2E5KA 4M75B 3RUXA 4ORZA 2RJCA 1M1KC 4M7AE 2CUDA 2KY9A 2VB6A 5FU7C 2D8HA 3PMTA 4RCCA 2PUKB 4Q5WA 3HL8A 5I22A 3FDRA 2M9UA 3E9GA 2F5KA 4FT2A 1VQ8T 3V8LA 2KEAA 2M0OA 4Z88A 4DBRA 1YN8A 1LPLA 5D6WA 3OSSC 2KRSA 1TS9A 2L89A 1WDXA 2NUTA 2V1QA 5GAN5 2RHUA 5D6YA 2QQAA 3CCJA 2QEXA 2BZYA 2YHTA 4RTYA 1Q7YU 1WA7A 1OZ3A 9ATCB 3OW2A 2QDYB 1VIFA 1Q82R 4OMOA 1SHGA 2KROA 2ESWA 3EG0A 1I4K1 1TUCA 1KD1U 2ZGWA 3H6ZA 2KE9A 2QI2A 4R0KA 3M56A 4PJMA 2OJ2A 1OQKA 4J83A 4F14A 3SEMA 2CZ1B 1RACB 3FJ5A 5LJ3h 2HL5C 1I5LA 5GAMf 1UECA 3O5ZA 2F2XA 3L2VA 3CCVQ 1VOMA 1OULA 3NPFA 1NG2A 2CKKA 3G1JA 1I1JA 1GCPA 2E65A 4XTUA 3GBQA 4TVRA 2XK0A 2V8KA 2PVDB 3DLMA 1TTHB 4M77D 2B86A 2M51A 1AWWA 1LVKA 5LJ3j 4IUPA 4XU2A 5LJ3d 2QDLA 1PNJA 3M0TA 3VV0A 1GCQC 3EGUA 2RQUA 2C0OA 3VS3A 2JOYA 3TSWA 2NUZA 1OYXA 2DIGA 2HNIA 4N4IA 4QQGA 4M7DC 1G83A 1BU1A 1WXBA 4C8QG 4C92C 2F1LA 5FRNA 3L42A 2RHYA 3RKYA 5A0DA 3QXEB 4M77A 1ZA1B 1ABQA 1U3OA 4F04B 3OYDA 5FRMA 1FYNA 1AT1B 1IXDA 1ZSZA 4OGCA 1TWBA 1M5Q1 4JJBA 4L59A 1SPKA 1XJWB 1D0ZA 1VQKA 1IHVA 1NYGA 5HK0A 4WTOB 4OMFB 1KFZA 4II1A 3M59A 2DVJA 1Q95G 1ACMB 2VYTA 2LJ0A 3PT9A 4J9IA 2QK0A 3JSCA 5CIUA 2LRQA 4DQ2A 1DJ7B 1KIKA 4LD9K 3V8KA 4GLKA 2RH2A 4JDSA 2K2MA 2KRNA 2XI9A 5CQYA 1JJ2S 5KYYB 2CGHA 1D3BA 1QWFA 3CCLQ 2MI6A 4IIMA 3JB9I 1QP3A 4F7UA 5C6SA 2X35A 1OX8A 1YBYA 2EGCA 1XTDA 1TOVA 1G2BA 2F5TX 2DD4A 1Q86R 1JB0E 1PCXA 3PFSA 1I81A 2HL3A 2CSIA 1W2BP 2L8DA 1PHTA 2DKGA 3L2ZA 3RDVA 3J81E 2Y4XA 1SHFA 1JRIA 2CZ7B 3NHNA 1PWTA 1QVFP 2GGRA 4J6XA 2JNGA 1X01A 3VS2A 4J7IA 2FPDA 4DBFA 3JCMP 1K9MU 3S3OA 1SEMA 3PIPA 3SHWA 3UF4A 1JJ2A 3WXMB 4PFPA 1X6OA 1JXMA 3A1PA 2L3PA 4E7LA 2EQIA 1KK7A 1WJSA 2J7IA 5DLQE 4C0FA 1FX7A 3PIOA 1U1TA 4KGXB 5CKBA 4M7DF 1QKWA 1BCMA 2JZ2A 3M0RA 4XTXA 3ZEHA 1FWZA 5FW9A 2J6KA 2RHIA 2CP6A 5IHKA 2DMOA 4E7HA 2RM4A 1BI2A 3RNJA 1ZHIA 3HFNA 1VQNT 1WX6A 2FZKB 4LE9A 3JB9J 4FIBA 2L2PA 3JRZA 1VQLT 2VVKA 4DEYA 2ROTA 4BD3A 1VQ6Q 1BI1A 1RADB 3JB9G 4M77B 4FU6A 4PNOA 1N27A 3E9FA 3FC3A 1YJ9A 2ED1A 1QCNA 2EKHA 2LVMA 2HD0A 4Y91A 4B9WA 4GBQA 2XG8D 1N5ZA 1Q81U 1NLPC 4L5GA 1Q86U 3MO8A 3RR6A 1PKTA 2O31A 4EMGA 2CH4W 1PG5B 2RJDA 2LX7A 5CQXA 1LOJA 4EMKA 3BDLA 1XQHA 2FEIA 2KT8A 1YJNQ 3L1AA 2FVUA 2EYXA 1R0BG 3NTIA 1MNDA 2ABLA 2LQNA 3JCMb 3H9NA 1FXXA 4A4KA 2DILA 3RMQA 2K5FA 4MMLA 3HTRA 1JO8A 1M1FA 4FYVB 2LZ6B 2DL8A 2E3IA 1Q81C 2CS7A 3JAME 4LDXA 3CPWS 2EAYA 4HKEA 2YDLA 3H0FA 4PJOB 2PTKA 5IHNA 2DLPA 2L5QA 5GMKm 2QXFA 4FT4A 4ZNXA 1M1KR 1Q7YR 5IH2A 4GLMA 3TCJA 4LN2A 1UHCA 2WSEE 1K9MC 1WFWA 2LNVA 3REAB 2CT4A 3EFRA 3MCAB 1BK2A 1LCKA 3MEVA 4J5YA 2ROLA 4A4EA 5ECAA 4RUGA 1KQ1A 3QWYA 4AG2C 4Z8AA 4B9XA 1WHKA 3G6EA 4BDZA 1NEBA 5GJVB 3VRYA 1NLOC 2OAUA 1BYMA 2OAWA 1K4US 2JS2A 2GF7A 3VKIA 2X4WA 1RLPC 2GNCA 2NLUA 5GMKi 3QPHA 1V76A 4PK4A 4EPCA 1QVGS 3MEAA 3SWNC 1Q82C 2RQWA 1I8FA 2AKLA 1M3AA 4EDUA 2BUDA 3T9NA 3P8BB 2NUPA 2KSSA 3JCMc 1YCSB 1Q81R 5KYXA 1VQ9Q 2DEQA 4RMOA 4XQ3A 1UB4A 4M78B 3FJPA 1E7OA 1RAAB 1HD3A 1M30A 2BE7D 2ED0A 2EQUA 1HYOA 3P8HA 4RTTA 2BKDN 4RTVA 1A0NB 4PKCC 3OSVA 1T0HA 1SRMA 3G6ET 2EVRA 1EX4A 1Q82U 3U23A 5CKHA 3REBB 1KQ2A 3HHTB 5EG2A 3L2RA 2RNAA 5FU6C 2VXEA 3J7AF 2KGTA 3M53A 4KH0B 4OMLA 1C0MA 3CPWP 3QG1A 5A0LA 1MMAA 2BTTA 2HCKA 3E1SA 4HCCA 1RAGB 2ENMA 3EGXB 5A0GA 3QZ5B 2QEXT 2OTJT 5EC7A 3G7ZA 1NZ9A 1P92A 2QQBA 2RK1A 1W1FA 3OYGA 3HKSA 3QZ9B 1M3BA 1F1BB 2YSQA 1M90R 5GANd 2JN0A 1VYVA 3A8HB 2QASA 1I0CA 2K4YA 3QHSA 4OB1B 4JLGA 3GIBA 5GAN8 3CCMA 3QIIA 5GAN4 2DJQA 4JJCA 1M2VB 4M7AD 1T3SA 5C0MA 4J6YA 1Y96A 4CI0C 1QMCA 4HA8A 2W10A 3CC7T 5KYUB 3KUFA 1SSHA 3UT1A 1GFCA 1PKSA 4M7DA 3UA7A 1TH7A 2X9HA 3DB3A 4OMQA 2QGGA 4LDWA 1KHIA 2E64A 3HRTA 4LDYA 2E6ZA 3DLLA 3OYHA 1VQLA 1W2BS 2EIFA 4E47A 2DRKA 4HVVA 1KC8U 1KQSS 3CC2A 3CC2T 2DYIA 2CZ0B 4M78A 4BI8B 4C92B 1VQOT 2BZXA 4C92F 3V7RA 1K0SA 5GAMg 2OX7A 4FSSA 2FHDA 2FB7A 3L2UA 1M90U 1YP5A 2DL4A 2R58A 5LJ5e 2D0QB 1IREB 4XU0A 4M75D 1QVGA 4HT9A 1YJWT 3OYKA 4J9FA 1ZUKA 1N9RA 1UJYA 1IZ6A 4XU3A 4EMHA 4D8DA 2XD0A 3M0QA 2K79A 3I56A 4C92G 3I56T 2HKQB 3META 1W2BA 3QO3A 1K73U 1KC8C 3I9QA 4IUTA 5I21A 3JCMV 2QA4A 2VV5A 2YWWA 5DY9A 5GAN3 2JMAA 4E7IA 2QTXA 4MMKA 3OYBA 2VGNA 1WYXA 5LJ5f 4M75C 4ME7A 1AWJA 3CC4Q 3OYNA 1H641 3JCMg 4DA4A 4C8QA 4LDVA 2DX1A 5CAIA 2YUPA 1VQLQ 3X24B 1JBMA 1YJWA 2LQWA 2RQVA 1S72T 2X51A 2PVGB 2YRVA 2QA4Q 3KFVA 1WXUA 5LJ3e 1W6XA 2R5AA 2K57A 5LJ5j 3AT1B 3X20B 2E5QA 4F7UE 2KQWA 3SD4A 3HRSA 2DF6A 4JS5A 4R55A 1VQ5T 2RMOA 3EG2A 4ESRA 3CCSQ 3TEEA 5HKCA 1OPLA 1VQKQ 1UGSB 3S3NA 2IIMA 3VS7A 1K76A 3I55Q 3SWNA 2XDBA 2X3XD 1D1CA 4FW1A 4OB3B 4JZ4A 1XOVA 1NYFA 3RBBB 2V26A 2YT6A 3L2QA 1AZGB 1YFNA 3MP1A 3CCRQ 1BI0A 3PNWC 4E6RA 4QT7A 4OP0A 5GAMd 1WI7A 2FRWA 5DLOA 2LTOA 1D1BA 1WJRA 2DD5A 1ZBXA 1J3TA 2XDPA 1WGSA 4RTUA 4RG8A 2DRMA 3V7CA 2PVOB 2LP5A 2PU9B 3X28B 3KBGA 1K9AA 4Y28E 2OI3A 3H8ZA 2AZSA 2JVVA 2NUPB 4FYXB 1X2KA 2CP0A 1O75A 3MEWA 4ZN3A 2RA2A 5LJ5g 1K73C 5FWCA 2P0KA 4IIOA 1OX9A 2EYZA 4EMKC 5GAN6 4RTZA 2GBQA 4FM4B 4HCKA 3I35A 3CCRA 1VYUA 1OU9A 1PD1A 3EHQA 3VYGA 2HEQA 3RMSA 4ELZC 5GJWB 4NS5A 2DTHA 1CKBA 4ZN1A 3CD6Q 1K8AR 1W4SA 3SFMA 1VQ7T 1N8RR 3Q1JA 2KT1A 2P84A 4C5GA 3PTAA 4AT1B 3HPWA 4AMCA 1OV3A 2DA9A 5CK9A 1EFNA 1X43A 2ZPFB 4PLIA 2GTOA 4DOWA 3JCMX 2DBKA 3EH1A 5IXBA 4C92E 5GAN2 1M3CA 1NJIC 1AWOA 4F7UB 2FG0A 1YJNT 3CCUA 5GMKh 1MV0B 2MWOA 3OA6A 4AFZC 4IUUA 3VS4A 3MEUA 5LL6S 1QKXA 1BI3A 3OW2S 1X27A 3G6EQ 3EGDB 3M0SA 3UWNA 1Y7XA 4X9CA 3M57A 2RN8A 2HSEB 1QCOA 2DETA 4OGEA 5GAOl 3I5SA 8AT1B 4E7JA 1NJIR 2AT1B 2O2OA 3TU4K 2EPDA 5GANe 3LH5A 3ZL7C 3LWIA 3M4GA 4IUVA 2CH4A 2CSQA 4KUIA 1KQSA 1VQNA 1TXQA 3X26B 4M78F 1M8MA 4N0AC 2XMFA 3EG9B 4M78C 1JU5C 1Y07A 2CP5A 4CC7A 4C92A 4A63B 5LJ3f 3IQLA 1M2OA 1KD1C 2PQWA 5LJ5d 2M1HA 1D3BB 3LYIA 2RI2A 4BE0A 2QQRA 2BE9B 1ZLMA 1ZSGA 2EQJA 4OMMA 2DZCA 2KK4A 2RF0A 4IUQA 4XK8E 3H0IA 3OBWA 3OY9A 3X25B 2LC4A 1WHLA 2K3XA 3GNFB 3H0HA 2KYMA 3BE3A 1RAIB 5FU6B 1T0JA 4M78G 4A4GA 2DFUA 2KXDA 3N5BB 3SB2A 2JUFA 4DEXA 1UE9A 2YLCA 1T3LA 1UEBA 2JJ9A 3M5AA 1VQPQ 2GTJA 4JLIA 3EGXA 3OQ5A 3I5RA 3PE0A 1Z9ZA 2K5LA 2XU8A 3CCSA 3TVTA 1SSFA 1PM3A 4C8QF 3GP8A 2DIQA 4NL2A 3PGGA 4FYYB 1RL2A 1NJIU 2VASA 1Q7YC 5J3BA 1UHFA 4BUGA 2MIOA 5D6XA 1VUBA 2NWMA 2PUOB 1I07A 3M54A 3UDCA 4OVAA 4OB0B 3CCQT 3CCQA 2ECZA 2PZ1A 2DE0X 2DNUA 3I56Q 2XHCA 3E2UA 1SG5A 3HSBA 2LQ8A 5KYUA 4YTLA 1IO6A 5M9OA 2AKKA 2FYKA 1LNXA 1SRLA 1YCYA 3BFMA 3VS0A 2BZ8A 3LX7A 2JXBA 4XAXB 3CC4A 1MHNA 3RESA 3CCRT 1QLYA 1KC8R 4V2SA 3DB4A 2WACA 4FL6A 1WPYA 4ANJA 3CCJQ 2EQMA 3QYGB 2DXTA 2DTOA 3CCMQ 1AHJB 1G3YA 4BI3A 4PJOC 5KCOA 4M7DE 2M0YA 2KDSA 2KVQG 5FROA 2DO3A 4M78D 5HCKA 1B7TA 5HK3A 1KG1A 3SWNB 3CD6A 2QQ9A 2CYZB 1UGQB 2J05A 4XU1A 3CCEA 3CCET 2RI3A 3CBPA 1AD5A 3PVLA 2NUTB 2Z0WA 4RCBA 1U06A 5DM7R 1GL5A 2LT1A 4M7AA 2K3BA 3GPLA 4PJOA 3VS1A 1PD0A 3LGLA 3CXCS 4JRPA 2LCSA 4J9BA 3CPFA 3M0UA 3DKMA 5GAMh 3CC7Q 2QAZA 1VQ5A 3ASKA 3UPUA 2XKOC 5GAOn 2JS0A 2HBPA 2X4YA 5GANj 2GQIA 1JXOA 2A7YA 5KYYA 4JS4A 2C0IA 4EIKA 3G4ST 3OYMA 2LDMA 1M4ZA 3JCMf 2CZ6B 3VUBA 1E6GA 3URGA 2DZ9A 3C4SA 1YITQ 2C0TA 2MMPA 5GMKl 4Y92A 2RJFA 2V8JA 3V7SA 1OI1A 1M1KU 5KE3A 4C0GA 1YNZA 2LT4A 2AIRB 4JRKA 1VQ7Q 4BDYA 3M9QA 2MWPA 1Z9QA 4C0ZA 1VQOA 4J7FA 1UFFA 3CMAT 2DTIA 1VQKT 1UGRB 4A54A 2MPXC 4NL3A 1VQPA 1ZA2B 4OMNA 4L6V5 1VYTA 2HQXA 3S3MA 4HVWA 1VQMQ 3LWHA 1MNEA 4LNPA 2LX9A 2Y4YA 5IHIA 3OS2A 5GANh 4QQDA 2JTMA 3G71T 3CEYA 3JV3A 4LD6A 2EYQA 1UJ0A 2PNIA 1KD1R 1YI2T 3OYJA 2ZPGB 2MAMA 4JUVA 8ATCB 5GAMe 1VQ7A 3UA6A 2DPPB 2EJFA 3FLGA 4D8KA 2A28A 2GCXA 2VUBA 2EJGA 4R56A 4M7AG 3VYHB 5I11A 4UC4A 4N0AA 1VQ9A 1VQ9T 1N9SA 4C0DB 2RD1A 2RQTA 1KQSP 4JRQA 1GXIE 2HQEA 2QTVA 4MZMA 2V1RA 4LUDA 1LJOA 2L3RA 5J26A 1RABB 3LH0A 2CUBA 2ZPEB 1NPRA 4X34A 4Z89A 1YJNA 3I55T 2BIVA 1IB8A 2VC8A 2FZCB 4KGZB 4J9EA 2LQKA 2SRCA 3CC2Q 2YUNA 4BE1A 1RI0A 1UGPB 4PLLA 3CBMA 2YLBA 1O9SA 1PSEA 2VKNA 3QBYA 1X6BA 1R77A 1H92A 2C06A 1ZUUA 2OTJA 4KH1B 2YRCA 4PL6A 4DBHA 5FU7B 2YUQA 1M2VA 1Q86C 3CCQQ 2GFUA 1H3HA 2K9GA 2OTLQ 1ZX6A 5CKEA 3CCLT 2G6FX 2JT4A 4XTZA 3MP6A 2XICA 3VS5A 3JB9H 1FMVA 2L0AA 1G5VA 5GAOq 1WNLA 4FCYA 5LJ3g 1IGUA
chains in the Genus database with same CATH topology
3G71Q 3CCJQ 1QVGP 3CPWP 1NJIR 3I56Q 1YJ9Q 3CCQQ 1VQ7Q 3CCVQ 1VQ8Q 1YJNQ 1Q82R 1VQ4Q 1Q86R 2OTLQ 3CCMQ 3CCEQ 1K73R 3I55Q 3CCRQ 1VQPQ 1W2BP 3CC2Q 3OW2P 1VQOQ 1KD1R 1M1KR 3G6EQ 1YI2Q 1Q7YR 1VQLQ 1Q81R 1JJ2P 1KQSP 1QVFP 2OTJQ 2QEXQ 1VQ6Q 1YHQQ 1S72Q 1VQ9Q 3CCSQ 3CMAQ 1YITQ 3G4SQ 1VQNQ 3CD6Q 3CXCP 1K8AR 1VQ5Q 3CCLQ 1YIJQ 1KC8R 1VQKQ 3CCUQ 3CC4Q 1YJWQ 3CC7Q 3CMEQ 1VQMQ 1K9MR 1N8RR 1M90R 2QA4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Q;  3CCJ Q;  1QVG P;  3CPW P;  1NJI R;  3I56 Q;  1YJ9 Q;  3CCQ Q;  1VQ7 Q;  3CCV Q;  1VQ8 Q;  1YJN Q;  1Q82 R;  1VQ4 Q;  1Q86 R;  2OTL Q;  3CCM Q;  3CCE Q;  1K73 R;  3I55 Q;  3CCR Q;  1VQP Q;  1W2B P;  3CC2 Q;  3OW2 P;  1VQO Q;  1KD1 R;  1M1K R;  3G6E Q;  1YI2 Q;  1Q7Y R;  1VQL Q;  1Q81 R;  1JJ2 P;  1KQS P;  1QVF P;  2OTJ Q;  2QEX Q;  1VQ6 Q;  1YHQ Q;  1S72 Q;  1VQ9 Q;  3CCS Q;  3CMA Q;  1YIT Q;  3G4S Q;  1VQN Q;  3CD6 Q;  3CXC P;  1K8A R;  1VQ5 Q;  3CCL Q;  1YIJ Q;  1KC8 R;  1VQK Q;  3CCU Q;  3CC4 Q;  1YJW Q;  3CC7 Q;  3CME Q;  1VQM Q;  1K9M R;  1N8R R;  1M90 R;  2QA4 Q; 
#chains in the Genus database with same CATH topology
 4O5V A;  1QVG P;  1IRX A;  4CRI A;  1I5O B;  2EW3 A;  5KH6 A;  1U1S A;  3I55 A;  1WXT A;  1OEB A;  2DXU A;  4M77 E;  4BY6 C;  4F17 A;  5CKF A;  5GAN 7;  5GAN g;  4RTW A;  3C0C A;  2ZAE A;  4MZT A;  4C8Q E;  4IKF A;  3VJP A;  1YHQ Q;  1RUW A;  4AFU C;  2MF2 A;  3CME Q;  2CRE A;  3TRE A;  1YIT A;  1RAH B;  1NBE B;  2YXY A;  3G71 Q;  1XNI A;  2V8I A;  1TUD A;  4KUD K;  2E1H A;  2MK5 A;  4M75 G;  2ZCF B;  2DAQ A;  2A3L A;  2KYB A;  3GOX A;  3CCL A;  1PRL C;  4HVU A;  1U5S A;  3L2W A;  4KT0 E;  2DM1 A;  4AFS C;  3PVQ A;  1TUG B;  4F7U G;  2DL3 A;  1QVF S;  2KBT A;  3JB9 D;  1ZSZ C;  2JM8 A;  1ARK A;  2QYZ A;  1RAE B;  1MMG A;  2EBP A;  3EAE A;  1B07 A;  4C5H A;  2DER A;  2E6N A;  5IN1 A;  1NPP A;  2D9T A;  1OU8 A;  1WHG A;  2MOX A;  4WF2 A;  1WLP B;  2A08 A;  3BDU A;  1S72 Q;  4MZP A;  2JM9 A;  1VQN Q;  4ATO A;  4OB2 B;  1S72 A;  3F70 A;  3VRZ A;  1RI9 A;  1HXD A;  4BI4 A;  3QDR B;  2F69 A;  1EIF A;  2VGM A;  2YRD A;  4CC4 B;  2EGE A;  4M7A F;  4QKU A;  4PJO F;  4M7A B;  4QVD A;  1VQM T;  3R6O A;  1MMN A;  2HAX A;  1VQ8 A;  2CP2 A;  2IPO B;  1G3S A;  1M1G A;  3S6W A;  2R5M A;  4M75 F;  4EMK B;  3JCM Q;  3EFO B;  4QW2 A;  4M77 G;  3NFC A;  2AHJ B;  1WQW A;  4HCZ A;  4BY6 B;  2FRY A;  2FPE A;  1W70 A;  3JCM J;  1QVP A;  4DOV A;  3CQT A;  2IG0 A;  4C0D C;  5LJ5 h;  2KI7 A;  3CCS T;  3FIF A;  4E7S A;  2CP7 A;  1JEG A;  3M0P A;  3NTK A;  1YIJ Q;  4OF1 A;  4ZGE B;  2E41 A;  2RO0 A;  3ZFJ A;  2E4H A;  3AHU A;  3LLR A;  1X69 A;  4HT8 A;  2VWF A;  4AG1 C;  4K11 A;  2G3R A;  1PRM C;  4C92 D;  3RER A;  5KYW B;  4M75 E;  4KUL A;  4PJJ A;  1M9S A;  3QSU A;  3C94 A;  2ZPB B;  1HJD A;  2DYB A;  5KCH A;  2RK2 A;  2HDA A;  5GAO p;  3OS5 A;  2H8H A;  3FRN A;  4MDX A;  2Y90 A;  4GY5 A;  1QWE A;  2HMA A;  2D1X A;  4FSX A;  1VIE A;  4F16 A;  5FLX E;  5KYX B;  4RKU E;  3CC4 T;  1BKB A;  2DEU A;  5HY6 A;  1YI2 A;  4XTW A;  3OBY A;  3QUI A;  2SEM A;  2KXC A;  4PJL A;  3QWX X;  1AWX A;  2F2W A;  2M16 A;  1NE8 A;  2O88 A;  2CDT A;  2JTF A;  2FZG B;  3MP8 A;  3BW1 A;  2X4X A;  3VS6 A;  3OYF A;  1ZBJ A;  3ER0 A;  4M78 E;  1AZE A;  3CD6 T;  3A8L B;  4ZTJ A;  5J39 A;  1UG1 A;  2JMC A;  1UGV A;  2KMT A;  4J9G A;  3G4S Q;  2XDD A;  2ZZD A;  2FL7 A;  2J06 A;  1ZQ1 A;  1K1Z A;  2GFA A;  2O01 E;  1YJ9 Q;  1UUE A;  4XTV A;  1VQ8 Q;  4AFQ C;  4IUR A;  4KRT A;  3G71 A;  2J6O A;  5I2M A;  3E19 A;  3GLX A;  4FW2 A;  3QKJ A;  4C8Q B;  3A5Z B;  3NGP A;  4ZGD B;  5GAO r;  1HSQ A;  1R8O B;  3TSZ A;  2K5I A;  3M55 A;  4XTY A;  2H3E B;  5CO7 A;  1QQJ A;  1H3Z A;  5GMK e;  1X75 C;  2W0Z A;  2J6F A;  1X6G A;  1GBQ A;  2P0Q A;  2H3J A;  1D0Y A;  4J9H A;  1PC0 A;  3NMZ C;  2COZ A;  1ZUY A;  4J9D A;  1G3T A;  2HKN A;  1PSF A;  3UAT A;  1NEG A;  2K7A A;  4HCB A;  2LCL A;  2AZV A;  2DJZ A;  2A36 A;  1WHM A;  5IXF A;  1YI2 Q;  2K2V A;  4OMP A;  1HK9 A;  1X2Q A;  3CBO A;  2JTE A;  3GNG A;  1VQ6 A;  4RTX A;  2RI5 A;  1JQQ A;  1V29 B;  4M7D B;  2HBW A;  4BB7 A;  2DXC A;  3LGF A;  3CCU T;  5D7U A;  1Y96 B;  2KNB B;  2RB6 A;  3CC7 A;  3H41 A;  3OMC A;  4A4F A;  3C12 A;  3CPW A;  2RQR A;  4PFO A;  3EHR A;  3GF5 A;  2ZPH B;  3SDZ A;  4JZ3 A;  3ZBD A;  2EGA A;  3CME T;  3CME A;  2L3S A;  1G3W A;  3RIR A;  2DL5 A;  1B34 A;  2MCN A;  5CKD A;  3M58 A;  4NOY A;  1M90 C;  3OYA A;  3MHX A;  2L3Q A;  3INZ A;  1G8X A;  4KGV B;  3OB9 A;  4PJO D;  4QQ6 A;  2KR3 A;  4M77 C;  1YIJ A;  1E6H A;  1MMD A;  4J9C A;  1QW1 A;  1AEY A;  2A0F B;  4WCI A;  1K0X A;  1C1A A;  3FB9 A;  1WZO A;  1VQ6 T;  1ZSZ B;  5L8R E;  1QVF A;  3O8V A;  3CMA Q;  3ME9 A;  1KJW A;  1Y71 A;  5IAY A;  1TSF A;  4E7K A;  4P5N A;  3CMA A;  2LJ1 A;  3JCM d;  2R57 A;  1VA7 A;  1KHC A;  1C6V X;  1U8R A;  3OYE A;  2EYW A;  4PJO G;  1BCO A;  3JB9 F;  2COY A;  2JW4 A;  2VXF A;  2E70 A;  6AT1 B;  1MV3 A;  4M75 A;  3RKW A;  1K8A U;  3VUZ A;  1M8V A;  2MYS A;  4QVZ A;  4JJD A;  3THK A;  3EFO A;  2EKO A;  2LJ3 A;  1IHW A;  1GRI A;  2A37 A;  2QGF B;  2D6F A;  3CCJ T;  2RJE A;  1BBZ A;  4JRI A;  1MGQ A;  4M7D G;  2F2V A;  3EH2 A;  2LMJ A;  5FWB A;  3JCM W;  2EJ9 A;  1NM7 A;  3OW2 P;  1YIJ T;  3OS1 A;  3TQ7 P;  4DBQ A;  3CCU Q;  1UTI A;  2D0N A;  2DXB A;  2KRM A;  2RHZ A;  2RHX A;  3ULR B;  3A8M B;  5GAN f;  4KBM B;  4J6W A;  2DBM A;  2P4R A;  3RKX A;  2EQK A;  2ZPI B;  1Y0M A;  4ZGJ B;  4JPB W;  4O6J A;  4CC2 A;  2FPF A;  1KSW A;  2WSF E;  3LW5 E;  1VQO Q;  3QJ6 A;  4D6W A;  1CKA A;  3A98 A;  2HSP A;  2OTJ Q;  4ZTF A;  5GAM j;  2IVW A;  1VQM A;  3M4Y A;  1M27 C;  4ELY C;  3WVD B;  2P0P A;  2O9V A;  1K9M R;  3EGD A;  5A2Q E;  3QDF A;  2HQH A;  4RG2 A;  1BB9 A;  2O9S A;  1QCF A;  1OOT A;  1Y57 A;  1OZ2 A;  3MPU B;  1RLQ C;  1WHJ A;  4C5I A;  3CCE Q;  5KYW A;  2M02 A;  1GCQ A;  3CCV A;  1R0C B;  2O4X A;  2QQS A;  2XID A;  3G4S A;  1JJ2 P;  3FEO A;  4PJO E;  1IGQ A;  1D1A A;  1FMW A;  3CXC A;  2QG9 B;  3OYI A;  2RPN A;  4M77 F;  3EG1 A;  1OPK A;  2LNH B;  3JCM e;  2YUO A;  4PJN A;  3QJY A;  4MDW A;  2E10 A;  3V8J A;  3OS0 A;  2OTL A;  2QEX Q;  3JCM h;  4A4H A;  1VQ5 Q;  3C95 A;  3QYH B;  4X9D A;  3EG3 A;  3MJX A;  5GMK j;  2CP3 A;  4N4G A;  2I2L A;  3OMG A;  3VU3 C;  3R6N A;  2WSC E;  1K8A C;  3NTH A;  4C5E A;  4C8Q C;  1B3Q A;  5I2S A;  3OYL A;  4JJN K;  3P8D A;  4M7A C;  3J80 E;  1SF9 A;  2LCC A;  1YHQ T;  1YWP A;  1FMK A;  2DL7 A;  1BIB A;  1WIE A;  2CT3 A;  3A8G B;  2FO0 A;  1VQ4 T;  1YJW Q;  4Z02 A;  3CCV T;  4BAC A;  4F7U F;  2D8J A;  2P4T A;  1CSK A;  4FYW B;  4C8Q D;  4M4Z A;  1VQ4 Q;  2EWN A;  5GAO m;  2DK3 A;  1K73 R;  1EZZ B;  2K3Y A;  5AT1 B;  5KE2 A;  1QP2 A;  2B8A A;  1V1C A;  4BE2 A;  4M7D D;  4QVC A;  1TU0 B;  3OYY A;  4B6M A;  1TG0 A;  5L23 A;  1YWO A;  3CCM T;  2I0N A;  2K6D A;  2NYS A;  3WVE B;  1YJ9 T;  1VQP T;  3HFO A;  4E2F B;  2OTL T;  4E7Z A;  1N8R C;  3PMI A;  2O4X B;  4HXJ A;  3D7S B;  4A53 A;  5AYF A;  3OYC A;  1WJQ A;  5CCA A;  2EYY A;  1WQ7 A;  4PFZ A;  2AK5 A;  1D09 B;  1MUZ A;  1YIT T;  4VUB A;  3BY7 A;  3KXT A;  1YHQ A;  2DVE A;  5CVI A;  2X3W D;  1VQ4 A;  5CR2 A;  1WHH A;  2HZY A;  2QA4 T;  1N6A A;  1SKU B;  3HP9 A;  2EFI A;  2E12 A;  1UDL A;  1GFD A;  1S1N A;  5IT9 E;  3EFS A;  1ABO A;  1BIA A;  4CC3 A;  5KYN A;  4N4H A;  1N8R U;  1AOJ A;  2X4J A;  2GQV A;  4LXC A;  3CXC P;  3A8O B;  1RAF B;  4LUE A;  1H8K A;  3MKD A;  7AT1 B;  2COW A;  4X1V A;  4J8O A;  1GBR A;  3EG9 A;  2E3H A;  2KAF A;  1AVZ C;  3HRU A;  1B34 B;  2ATC B;  1D0X A;  4LDU A;  2E5K A;  4M75 B;  3RUX A;  4ORZ A;  2RJC A;  1M1K C;  4M7A E;  2CUD A;  2KY9 A;  2VB6 A;  5FU7 C;  2D8H A;  3PMT A;  4RCC A;  2PUK B;  4Q5W A;  3HL8 A;  5I22 A;  3FDR A;  2M9U A;  3E9G A;  2F5K A;  4FT2 A;  1VQ8 T;  3V8L A;  2KEA A;  2M0O A;  4Z88 A;  4DBR A;  1YN8 A;  1LPL A;  5D6W A;  3OSS C;  2KRS A;  1TS9 A;  2L89 A;  1WDX A;  2NUT A;  2V1Q A;  5GAN 5;  2RHU A;  5D6Y A;  2QQA A;  3CCJ A;  2QEX A;  2BZY A;  2YHT A;  4RTY A;  1Q7Y U;  1WA7 A;  1OZ3 A;  9ATC B;  3OW2 A;  2QDY B;  1VIF A;  1Q82 R;  4OMO A;  1SHG A;  2KRO A;  2ESW A;  3EG0 A;  1I4K 1;  1TUC A;  1KD1 U;  2ZGW A;  3H6Z A;  2KE9 A;  2QI2 A;  4R0K A;  3M56 A;  4PJM A;  2OJ2 A;  1OQK A;  4J83 A;  4F14 A;  3SEM A;  2CZ1 B;  1RAC B;  3FJ5 A;  5LJ3 h;  2HL5 C;  1I5L A;  5GAM f;  1UEC A;  3O5Z A;  2F2X A;  3L2V A;  3CCV Q;  1VOM A;  1OUL A;  3NPF A;  1NG2 A;  2CKK A;  3G1J A;  1I1J A;  1GCP A;  2E65 A;  4XTU A;  3GBQ A;  4TVR A;  2XK0 A;  2V8K A;  2PVD B;  3DLM A;  1TTH B;  4M77 D;  2B86 A;  2M51 A;  1AWW A;  1LVK A;  5LJ3 j;  4IUP A;  4XU2 A;  5LJ3 d;  2QDL A;  1PNJ A;  3M0T A;  3VV0 A;  1GCQ C;  3EGU A;  2RQU A;  2C0O A;  3VS3 A;  2JOY A;  3TSW A;  2NUZ A;  1OYX A;  2DIG A;  2HNI A;  4N4I A;  4QQG A;  4M7D C;  1G83 A;  1BU1 A;  1WXB A;  4C8Q G;  4C92 C;  2F1L A;  5FRN A;  3L42 A;  2RHY A;  3RKY A;  5A0D A;  3QXE B;  4M77 A;  1ZA1 B;  1ABQ A;  1U3O A;  4F04 B;  3OYD A;  5FRM A;  1FYN A;  1AT1 B;  1IXD A;  1ZSZ A;  4OGC A;  1TWB A;  1M5Q 1;  4JJB A;  4L59 A;  1SPK A;  1XJW B;  1D0Z A;  1VQK A;  1IHV A;  1NYG A;  5HK0 A;  4WTO B;  4OMF B;  1KFZ A;  4II1 A;  3M59 A;  2DVJ A;  1Q95 G;  1ACM B;  2VYT A;  2LJ0 A;  3PT9 A;  4J9I A;  2QK0 A;  3JSC A;  5CIU A;  2LRQ A;  4DQ2 A;  1DJ7 B;  1KIK A;  4LD9 K;  3V8K A;  4GLK A;  2RH2 A;  4JDS A;  2K2M A;  2KRN A;  2XI9 A;  5CQY A;  1JJ2 S;  5KYY B;  2CGH A;  1D3B A;  1QWF A;  3CCL Q;  2MI6 A;  4IIM A;  3JB9 I;  1QP3 A;  4F7U A;  5C6S A;  2X35 A;  1OX8 A;  1YBY A;  2EGC A;  1XTD A;  1TOV A;  1G2B A;  2F5T X;  2DD4 A;  1Q86 R;  1JB0 E;  1PCX A;  3PFS A;  1I81 A;  2HL3 A;  2CSI A;  1W2B P;  2L8D A;  1PHT A;  2DKG A;  3L2Z A;  3RDV A;  3J81 E;  2Y4X A;  1SHF A;  1JRI A;  2CZ7 B;  3NHN A;  1PWT A;  1QVF P;  2GGR A;  4J6X A;  2JNG A;  1X01 A;  3VS2 A;  4J7I A;  2FPD A;  4DBF A;  3JCM P;  1K9M U;  3S3O A;  1SEM A;  3PIP A;  3SHW A;  3UF4 A;  1JJ2 A;  3WXM B;  4PFP A;  1X6O A;  1JXM A;  3A1P A;  2L3P A;  4E7L A;  2EQI A;  1KK7 A;  1WJS A;  2J7I A;  5DLQ E;  4C0F A;  1FX7 A;  3PIO A;  1U1T A;  4KGX B;  5CKB A;  4M7D F;  1QKW A;  1BCM A;  2JZ2 A;  3M0R A;  4XTX A;  3ZEH A;  1FWZ A;  5FW9 A;  2J6K A;  2RHI A;  2CP6 A;  5IHK A;  2DMO A;  4E7H A;  2RM4 A;  1BI2 A;  3RNJ A;  1ZHI A;  3HFN A;  1VQN T;  1WX6 A;  2FZK B;  4LE9 A;  3JB9 J;  4FIB A;  2L2P A;  3JRZ A;  1VQL T;  2VVK A;  4DEY A;  2ROT A;  4BD3 A;  1VQ6 Q;  1BI1 A;  1RAD B;  3JB9 G;  4M77 B;  4FU6 A;  4PNO A;  1N27 A;  3E9F A;  3FC3 A;  1YJ9 A;  2ED1 A;  1QCN A;  2EKH A;  2LVM A;  2HD0 A;  4Y91 A;  4B9W A;  4GBQ A;  2XG8 D;  1N5Z A;  1Q81 U;  1NLP C;  4L5G A;  1Q86 U;  3MO8 A;  3RR6 A;  1PKT A;  2O31 A;  4EMG A;  2CH4 W;  1PG5 B;  2RJD A;  2LX7 A;  5CQX A;  1LOJ A;  4EMK A;  3BDL A;  1XQH A;  2FEI A;  2KT8 A;  1YJN Q;  3L1A A;  2FVU A;  2EYX A;  1R0B G;  3NTI A;  1MND A;  2ABL A;  2LQN A;  3JCM b;  3H9N A;  1FXX A;  4A4K A;  2DIL A;  3RMQ A;  2K5F A;  4MML A;  3HTR A;  1JO8 A;  1M1F A;  4FYV B;  2LZ6 B;  2DL8 A;  2E3I A;  1Q81 C;  2CS7 A;  3JAM E;  4LDX A;  3CPW S;  2EAY A;  4HKE A;  2YDL A;  3H0F A;  4PJO B;  2PTK A;  5IHN A;  2DLP A;  2L5Q A;  5GMK m;  2QXF A;  4FT4 A;  4ZNX A;  1M1K R;  1Q7Y R;  5IH2 A;  4GLM A;  3TCJ A;  4LN2 A;  1UHC A;  2WSE E;  1K9M C;  1WFW A;  2LNV A;  3REA B;  2CT4 A;  3EFR A;  3MCA B;  1BK2 A;  1LCK A;  3MEV A;  4J5Y A;  2ROL A;  4A4E A;  5ECA A;  4RUG A;  1KQ1 A;  3QWY A;  4AG2 C;  4Z8A A;  4B9X A;  1WHK A;  3G6E A;  4BDZ A;  1NEB A;  5GJV B;  3VRY A;  1NLO C;  2OAU A;  1BYM A;  2OAW A;  1K4U S;  2JS2 A;  2GF7 A;  3VKI A;  2X4W A;  1RLP C;  2GNC A;  2NLU A;  5GMK i;  3QPH A;  1V76 A;  4PK4 A;  4EPC A;  1QVG S;  3MEA A;  3SWN C;  1Q82 C;  2RQW A;  1I8F A;  2AKL A;  1M3A A;  4EDU A;  2BUD A;  3T9N A;  3P8B B;  2NUP A;  2KSS A;  3JCM c;  1YCS B;  1Q81 R;  5KYX A;  1VQ9 Q;  2DEQ A;  4RMO A;  4XQ3 A;  1UB4 A;  4M78 B;  3FJP A;  1E7O A;  1RAA B;  1HD3 A;  1M30 A;  2BE7 D;  2ED0 A;  2EQU A;  1HYO A;  3P8H A;  4RTT A;  2BKD N;  4RTV A;  1A0N B;  4PKC C;  3OSV A;  1T0H A;  1SRM A;  3G6E T;  2EVR A;  1EX4 A;  1Q82 U;  3U23 A;  5CKH A;  3REB B;  1KQ2 A;  3HHT B;  5EG2 A;  3L2R A;  2RNA A;  5FU6 C;  2VXE A;  3J7A F;  2KGT A;  3M53 A;  4KH0 B;  4OML A;  1C0M A;  3CPW P;  3QG1 A;  5A0L A;  1MMA A;  2BTT A;  2HCK A;  3E1S A;  4HCC A;  1RAG B;  2ENM A;  3EGX B;  5A0G A;  3QZ5 B;  2QEX T;  2OTJ T;  5EC7 A;  3G7Z A;  1NZ9 A;  1P92 A;  2QQB A;  2RK1 A;  1W1F A;  3OYG A;  3HKS A;  3QZ9 B;  1M3B A;  1F1B B;  2YSQ A;  1M90 R;  5GAN d;  2JN0 A;  1VYV A;  3A8H B;  2QAS A;  1I0C A;  2K4Y A;  3QHS A;  4OB1 B;  4JLG A;  3GIB A;  5GAN 8;  3CCM A;  3QII A;  5GAN 4;  2DJQ A;  4JJC A;  1M2V B;  4M7A D;  1T3S A;  5C0M A;  4J6Y A;  1Y96 A;  4CI0 C;  1QMC A;  4HA8 A;  2W10 A;  3CC7 T;  5KYU B;  3KUF A;  1SSH A;  3UT1 A;  1GFC A;  1PKS A;  4M7D A;  3UA7 A;  1TH7 A;  2X9H A;  3DB3 A;  4OMQ A;  2QGG A;  4LDW A;  1KHI A;  2E64 A;  3HRT A;  4LDY A;  2E6Z A;  3DLL A;  3OYH A;  1VQL A;  1W2B S;  2EIF A;  4E47 A;  2DRK A;  4HVV A;  1KC8 U;  1KQS S;  3CC2 A;  3CC2 T;  2DYI A;  2CZ0 B;  4M78 A;  4BI8 B;  4C92 B;  1VQO T;  2BZX A;  4C92 F;  3V7R A;  1K0S A;  5GAM g;  2OX7 A;  4FSS A;  2FHD A;  2FB7 A;  3L2U A;  1M90 U;  1YP5 A;  2DL4 A;  2R58 A;  5LJ5 e;  2D0Q B;  1IRE B;  4XU0 A;  4M75 D;  1QVG A;  4HT9 A;  1YJW T;  3OYK A;  4J9F A;  1ZUK A;  1N9R A;  1UJY A;  1IZ6 A;  4XU3 A;  4EMH A;  4D8D A;  2XD0 A;  3M0Q A;  2K79 A;  3I56 A;  4C92 G;  3I56 T;  2HKQ B;  3MET A;  1W2B A;  3QO3 A;  1K73 U;  1KC8 C;  3I9Q A;  4IUT A;  5I21 A;  3JCM V;  2QA4 A;  2VV5 A;  2YWW A;  5DY9 A;  5GAN 3;  2JMA A;  4E7I A;  2QTX A;  4MMK A;  3OYB A;  2VGN A;  1WYX A;  5LJ5 f;  4M75 C;  4ME7 A;  1AWJ A;  3CC4 Q;  3OYN A;  1H64 1;  3JCM g;  4DA4 A;  4C8Q A;  4LDV A;  2DX1 A;  5CAI A;  2YUP A;  1VQL Q;  3X24 B;  1JBM A;  1YJW A;  2LQW A;  2RQV A;  1S72 T;  2X51 A;  2PVG B;  2YRV A;  2QA4 Q;  3KFV A;  1WXU A;  5LJ3 e;  1W6X A;  2R5A A;  2K57 A;  5LJ5 j;  3AT1 B;  3X20 B;  2E5Q A;  4F7U E;  2KQW A;  3SD4 A;  3HRS A;  2DF6 A;  4JS5 A;  4R55 A;  1VQ5 T;  2RMO A;  3EG2 A;  4ESR A;  3CCS Q;  3TEE A;  5HKC A;  1OPL A;  1VQK Q;  1UGS B;  3S3N A;  2IIM A;  3VS7 A;  1K76 A;  3I55 Q;  3SWN A;  2XDB A;  2X3X D;  1D1C A;  4FW1 A;  4OB3 B;  4JZ4 A;  1XOV A;  1NYF A;  3RBB B;  2V26 A;  2YT6 A;  3L2Q A;  1AZG B;  1YFN A;  3MP1 A;  3CCR Q;  1BI0 A;  3PNW C;  4E6R A;  4QT7 A;  4OP0 A;  5GAM d;  1WI7 A;  2FRW A;  5DLO A;  2LTO A;  1D1B A;  1WJR A;  2DD5 A;  1ZBX A;  1J3T A;  2XDP A;  1WGS A;  4RTU A;  4RG8 A;  2DRM A;  3V7C A;  2PVO B;  2LP5 A;  2PU9 B;  3X28 B;  3KBG A;  1K9A A;  4Y28 E;  2OI3 A;  3H8Z A;  2AZS A;  2JVV A;  2NUP B;  4FYX B;  1X2K A;  2CP0 A;  1O75 A;  3MEW A;  4ZN3 A;  2RA2 A;  5LJ5 g;  1K73 C;  5FWC A;  2P0K A;  4IIO A;  1OX9 A;  2EYZ A;  4EMK C;  5GAN 6;  4RTZ A;  2GBQ A;  4FM4 B;  4HCK A;  3I35 A;  3CCR A;  1VYU A;  1OU9 A;  1PD1 A;  3EHQ A;  3VYG A;  2HEQ A;  3RMS A;  4ELZ C;  5GJW B;  4NS5 A;  2DTH A;  1CKB A;  4ZN1 A;  3CD6 Q;  1K8A R;  1W4S A;  3SFM A;  1VQ7 T;  1N8R R;  3Q1J A;  2KT1 A;  2P84 A;  4C5G A;  3PTA A;  4AT1 B;  3HPW A;  4AMC A;  1OV3 A;  2DA9 A;  5CK9 A;  1EFN A;  1X43 A;  2ZPF B;  4PLI A;  2GTO A;  4DOW A;  3JCM X;  2DBK A;  3EH1 A;  5IXB A;  4C92 E;  5GAN 2;  1M3C A;  1NJI C;  1AWO A;  4F7U B;  2FG0 A;  1YJN T;  3CCU A;  5GMK h;  1MV0 B;  2MWO A;  3OA6 A;  4AFZ C;  4IUU A;  3VS4 A;  3MEU A;  5LL6 S;  1QKX A;  1BI3 A;  3OW2 S;  1X27 A;  3G6E Q;  3EGD B;  3M0S A;  3UWN A;  1Y7X A;  4X9C A;  3M57 A;  2RN8 A;  2HSE B;  1QCO A;  2DET A;  4OGE A;  5GAO l;  3I5S A;  8AT1 B;  4E7J A;  1NJI R;  2AT1 B;  2O2O A;  3TU4 K;  2EPD A;  5GAN e;  3LH5 A;  3ZL7 C;  3LWI A;  3M4G A;  4IUV A;  2CH4 A;  2CSQ A;  4KUI A;  1KQS A;  1VQN A;  1TXQ A;  3X26 B;  4M78 F;  1M8M A;  4N0A C;  2XMF A;  3EG9 B;  4M78 C;  1JU5 C;  1Y07 A;  2CP5 A;  4CC7 A;  4C92 A;  4A63 B;  5LJ3 f;  3IQL A;  1M2O A;  1KD1 C;  2PQW A;  5LJ5 d;  2M1H A;  1D3B B;  3LYI A;  2RI2 A;  4BE0 A;  2QQR A;  2BE9 B;  1ZLM A;  1ZSG A;  2EQJ A;  4OMM A;  2DZC A;  2KK4 A;  2RF0 A;  4IUQ A;  4XK8 E;  3H0I A;  3OBW A;  3OY9 A;  3X25 B;  2LC4 A;  1WHL A;  2K3X A;  3GNF B;  3H0H A;  2KYM A;  3BE3 A;  1RAI B;  5FU6 B;  1T0J A;  4M78 G;  4A4G A;  2DFU A;  2KXD A;  3N5B B;  3SB2 A;  2JUF A;  4DEX A;  1UE9 A;  2YLC A;  1T3L A;  1UEB A;  2JJ9 A;  3M5A A;  1VQP Q;  2GTJ A;  4JLI A;  3EGX A;  3OQ5 A;  3I5R A;  3PE0 A;  1Z9Z A;  2K5L A;  2XU8 A;  3CCS A;  3TVT A;  1SSF A;  1PM3 A;  4C8Q F;  3GP8 A;  2DIQ A;  4NL2 A;  3PGG A;  4FYY B;  1RL2 A;  1NJI U;  2VAS A;  1Q7Y C;  5J3B A;  1UHF A;  4BUG A;  2MIO A;  5D6X A;  1VUB A;  2NWM A;  2PUO B;  1I07 A;  3M54 A;  3UDC A;  4OVA A;  4OB0 B;  3CCQ T;  3CCQ A;  2ECZ A;  2PZ1 A;  2DE0 X;  2DNU A;  3I56 Q;  2XHC A;  3E2U A;  1SG5 A;  3HSB A;  2LQ8 A;  5KYU A;  4YTL A;  1IO6 A;  5M9O A;  2AKK A;  2FYK A;  1LNX A;  1SRL A;  1YCY A;  3BFM A;  3VS0 A;  2BZ8 A;  3LX7 A;  2JXB A;  4XAX B;  3CC4 A;  1MHN A;  3RES A;  3CCR T;  1QLY A;  1KC8 R;  4V2S A;  3DB4 A;  2WAC A;  4FL6 A;  1WPY A;  4ANJ A;  3CCJ Q;  2EQM A;  3QYG B;  2DXT A;  2DTO A;  3CCM Q;  1AHJ B;  1G3Y A;  4BI3 A;  4PJO C;  5KCO A;  4M7D E;  2M0Y A;  2KDS A;  2KVQ G;  5FRO A;  2DO3 A;  4M78 D;  5HCK A;  1B7T A;  5HK3 A;  1KG1 A;  3SWN B;  3CD6 A;  2QQ9 A;  2CYZ B;  1UGQ B;  2J05 A;  4XU1 A;  3CCE A;  3CCE T;  2RI3 A;  3CBP A;  1AD5 A;  3PVL A;  2NUT B;  2Z0W A;  4RCB A;  1U06 A;  5DM7 R;  1GL5 A;  2LT1 A;  4M7A A;  2K3B A;  3GPL A;  4PJO A;  3VS1 A;  1PD0 A;  3LGL A;  3CXC S;  4JRP A;  2LCS A;  4J9B A;  3CPF A;  3M0U A;  3DKM A;  5GAM h;  3CC7 Q;  2QAZ A;  1VQ5 A;  3ASK A;  3UPU A;  2XKO C;  5GAO n;  2JS0 A;  2HBP A;  2X4Y A;  5GAN j;  2GQI A;  1JXO A;  2A7Y A;  5KYY A;  4JS4 A;  2C0I A;  4EIK A;  3G4S T;  3OYM A;  2LDM A;  1M4Z A;  3JCM f;  2CZ6 B;  3VUB A;  1E6G A;  3URG A;  2DZ9 A;  3C4S A;  1YIT Q;  2C0T A;  2MMP A;  5GMK l;  4Y92 A;  2RJF A;  2V8J A;  3V7S A;  1OI1 A;  1M1K U;  5KE3 A;  4C0G A;  1YNZ A;  2LT4 A;  2AIR B;  4JRK A;  1VQ7 Q;  4BDY A;  3M9Q A;  2MWP A;  1Z9Q A;  4C0Z A;  1VQO A;  4J7F A;  1UFF A;  3CMA T;  2DTI A;  1VQK T;  1UGR B;  4A54 A;  2MPX C;  4NL3 A;  1VQP A;  1ZA2 B;  4OMN A;  4L6V 5;  1VYT A;  2HQX A;  3S3M A;  4HVW A;  1VQM Q;  3LWH A;  1MNE A;  4LNP A;  2LX9 A;  2Y4Y A;  5IHI A;  3OS2 A;  5GAN h;  4QQD A;  2JTM A;  3G71 T;  3CEY A;  3JV3 A;  4LD6 A;  2EYQ A;  1UJ0 A;  2PNI A;  1KD1 R;  1YI2 T;  3OYJ A;  2ZPG B;  2MAM A;  4JUV A;  8ATC B;  5GAM e;  1VQ7 A;  3UA6 A;  2DPP B;  2EJF A;  3FLG A;  4D8K A;  2A28 A;  2GCX A;  2VUB A;  2EJG A;  4R56 A;  4M7A G;  3VYH B;  5I11 A;  4UC4 A;  4N0A A;  1VQ9 A;  1VQ9 T;  1N9S A;  4C0D B;  2RD1 A;  2RQT A;  1KQS P;  4JRQ A;  1GXI E;  2HQE A;  2QTV A;  4MZM A;  2V1R A;  4LUD A;  1LJO A;  2L3R A;  5J26 A;  1RAB B;  3LH0 A;  2CUB A;  2ZPE B;  1NPR A;  4X34 A;  4Z89 A;  1YJN A;  3I55 T;  2BIV A;  1IB8 A;  2VC8 A;  2FZC B;  4KGZ B;  4J9E A;  2LQK A;  2SRC A;  3CC2 Q;  2YUN A;  4BE1 A;  1RI0 A;  1UGP B;  4PLL A;  3CBM A;  2YLB A;  1O9S A;  1PSE A;  2VKN A;  3QBY A;  1X6B A;  1R77 A;  1H92 A;  2C06 A;  1ZUU A;  2OTJ A;  4KH1 B;  2YRC A;  4PL6 A;  4DBH A;  5FU7 B;  2YUQ A;  1M2V A;  1Q86 C;  3CCQ Q;  2GFU A;  1H3H A;  2K9G A;  2OTL Q;  1ZX6 A;  5CKE A;  3CCL T;  2G6F X;  2JT4 A;  4XTZ A;  3MP6 A;  2XIC A;  3VS5 A;  3JB9 H;  1FMV A;  2L0A A;  1G5V A;  5GAO q;  1WNL A;  4FCY A;  5LJ3 g;  1IGU A; 
#chains in the Genus database with same CATH homology
 3G71 Q;  3CCJ Q;  1QVG P;  3CPW P;  1NJI R;  3I56 Q;  1YJ9 Q;  3CCQ Q;  1VQ7 Q;  3CCV Q;  1VQ8 Q;  1YJN Q;  1Q82 R;  1VQ4 Q;  1Q86 R;  2OTL Q;  3CCM Q;  3CCE Q;  1K73 R;  3I55 Q;  3CCR Q;  1VQP Q;  1W2B P;  3CC2 Q;  3OW2 P;  1VQO Q;  1KD1 R;  1M1K R;  3G6E Q;  1YI2 Q;  1Q7Y R;  1VQL Q;  1Q81 R;  1JJ2 P;  1KQS P;  1QVF P;  2OTJ Q;  2QEX Q;  1VQ6 Q;  1YHQ Q;  1S72 Q;  1VQ9 Q;  3CCS Q;  3CMA Q;  1YIT Q;  3G4S Q;  1VQN Q;  3CD6 Q;  3CXC P;  1K8A R;  1VQ5 Q;  3CCL Q;  1YIJ Q;  1KC8 R;  1VQK Q;  3CCU Q;  3CC4 Q;  1YJW Q;  3CC7 Q;  3CME Q;  1VQM Q;  1K9M R;  1N8R R;  1M90 R;  2QA4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...