1VQ7Q

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq7Q00
3CCQQ 1KQSP 1K73R 3CCVQ 2QEXQ 3CMEQ 3OW2P 1Q82R 3G6EQ 3G4SQ 3CCSQ 1VQ4Q 1N8RR 1YJ9Q 3CXCP 1Q7YR 1VQ9Q 1M90R 1S72Q 1VQ8Q 3CMAQ 3CCJQ 1W2BP 1QVGP 1K9MR 1VQ6Q 3CCRQ 2OTJQ 1YI2Q 1VQKQ 3I56Q 1Q86R 1K8AR 1VQ7Q 2OTLQ 1YHQQ 1Q81R 1YIJQ 1VQPQ 3I55Q 1VQNQ 3CC7Q 1QVFP 3CCUQ 3CCMQ 1VQ5Q 2QA4Q 1KD1R 3CD6Q 1VQMQ 1YJWQ 3CC4Q 1KC8R 1M1KR 1VQOQ 1YJNQ 1NJIR 1VQLQ 3G71Q 1YITQ 3CC2Q 3CCEQ 1JJ2P 3CCLQ 3CPWP
chains in the Genus database with same CATH superfamily
2EJFA 4PJOD 1BKBA 1GCPA 3EGXA 4A63B 3VU3C 3LLRA 4O6JA 1UHFA 1Q86R 2X4WA 4LD6A 3TU4K 2L3SA 1X2QA 3M57A 3E19A 4KBMB 2BIVA 3C12A 3C4SA 2KRMA 2EJ9A 2RN8A 3CCLT 2DL3A 2LT1A 4AG1C 3KXTA 5J26A 1YITA 4DBRA 1JJ2S 2YHTA 4NL2A 3TCJA 4ZN1A 1NYFA 5KE2A 3JB9G 4J6XA 3S6WA 2HL5C 2BE9B 4BD3A 4M7AB 3M56A 1YFNA 2YT6A 1YCSB 1YN8A 1U8RA 4J6WA 1H8KA 1KHCA 3S3MA 2J6KA 3M58A 3CCEA 2XU8A 1VIEA 2KE9A 3X24B 1YHQT 1BCMA 4M78A 1OPLA 5LJ5h 2LTOA 4M7DE 1S72A 4QVZA 1K0SA 2GFUA 1YI2A 2QQAA 2GF7A 1DJ7B 2W10A 3S3NA 3SWNB 4R55A 5GAMj 1TH7A 3RR6A 5GJWB 2CZ0B 3CCUQ 2JTEA 4IUVA 2L89A 5KYXB 1ZSZA 5GJVB 2CP7A 2AKKA 1IXDA 2LMJA 1UGPB 4DBQA 1GCQC 1OQKA 3JCMb 2KXDA 3EFRA 2COYA 2DILA 1JQQA 3QHSA 2MI6A 2D9TA 3HRSA 2RHIA 1YWOA 3VUZA 2YSQA 3HPWA 3DKMA 4RTZA 2LT4A 2Z0WA 4F7UG 3TVTA 2RJFA 2PTKA 2DM1A 2R5AA 4M77C 2DYBA 3CPFA 4ZN3A 2KI7A 5D6YA 2JM9A 2F2VA 3VS7A 2P84A 2RF0A 2M0YA 4J9FA 4EMGA 4IUTA 3RUXA 4FSXA 2DO3A 4M77G 3MEAA 4C8QA 5CAIA 2QA4A 1HSQA 1NEBA 2WSCE 2CREA 2YRCA 3HL8A 2V26A 4X34A 3NTIA 4GBQA 4JRKA 4N0AC 1ABQA 3CCUT 1V76A 1RUWA 1M90C 2DRMA 2HQEA 4JJNK 3CC7A 1D0XA 4C0ZA 3H8ZA 1S1NA 1YJWQ 2O9SA 4II1A 1SRLA 4ZGDB 3QWXX 1UFFA 4MMKA 2COZA 5GAN5 4OF1A 3TSWA 3VRZA 5KYNA 1M90R 1G2BA 2O4XB 1M30A 3CD6T 2ZGWA 3G71T 2HL3A 2PQWA 8ATCB 1W6XA 3U23A 1HK9A 1VQLQ 7AT1B 1UGQB 1X6GA 5GANe 2RMOA 5KYWB 2OTJT 2O9VA 1VUBA 3SB2A 3CCQQ 2RHUA 3GNFB 1AT1B 3QJ6A 2ED1A 4JZ3A 2RJEA 2FPDA 3N5BB 3V8JA 4M7AA 1A0NB 4PJOC 3ULRB 1M9SA 2DMOA 2QAZA 4XTZA 1YJNA 3SHWA 3QZ5B 1M1KC 3L2WA 5FWCA 1V29B 4KULA 4PFPA 2XIDA 1WZOA 3MPUB 1UEBA 1AEYA 2JS0A 3SWNA 2LQ8A 4LNPA 2AZVA 2H3EB 3LH0A 4HVUA 3QYHB 1WI7A 5CQXA 1M1KR 3OYAA 2VGNA 2GCXA 3VS5A 5KYXA 2KQWA 1UE9A 4ZGJB 2XDBA 5FRMA 3OW2P 4ME7A 4XTVA 1N8RR 3E1SA 3FEOA 4J7IA 3RMQA 4BE1A 3OYMA 2JT4A 1PKTA 1WNLA 3REAB 1G83A 1RLQC 1VQMQ 3CCQT 1PKSA 3VUBA 2VXFA 1PSEA 1R77A 1X27A 1X6BA 1WQ7A 2K2MA 4IUQA 2FHDA 1ZQ1A 1UGRB 3PIOA 3EG3A 2YDLA 3JCMc 2VVKA 2DNUA 4KGVB 1NM7A 4HT8A 3BY7A 2XD0A 1BYMA 5DLOA 1OULA 5CKBA 3OS2A 4CC3A 4C92D 2LQWA 3CXCA 4E7IA 2QK0A 2IPOB 2DLPA 1KD1U 3JCMf 1G3TA 4RTUA 3MHXA 1M5Q1 1WA7A 2RD1A 4J8OA 1YJ9Q 1VQ8A 2EQMA 2A08A 2DF6A 5GANg 4C5IA 1SPKA 4WTOB 2X35A 3JRZA 3PFSA 3OYJA 3EG9B 4B6MA 3OW2A 4PJOB 2CUBA 2FZKB 2G6FX 1QW1A 3QKJA 3I5RA 3A1PA 2DTIA 3CCSA 1GFCA 1FX7A 1UGSB 5FU6C 1TG0A 2ROTA 2O4XA 1VQMT 1VQ7A 2QGGA 3PTAA 2RJDA 2EWNA 3M0SA 4A53A 4JZ4A 3VS1A 5GMKh 2OJ2A 3CCEQ 4M75G 2GTJA 5KYWA 1RAFB 2KVQG 1G3YA 2RH2A 5CCAA 2M1HA 2O01E 2P0QA 1UG1A 4HCCA 1N6AA 3LGLA 4M78G 1ABOA 1WJRA 2NUZA 1C1AA 5AT1B 2DZ9A 1PCXA 3I9QA 2O2OA 2JTMA 3RERA 2XG8D 9ATCB 2QTVA 2EGAA 5IXBA 4M7DD 1IRXA 1X43A 3C0CA 1YITT 4PNOA 2KROA 1BIBA 1K8AU 4OMPA 5J3BA 4C5HA 2JW4A 5GANd 1VQOQ 3FDRA 3TQ7P 1LCKA 5GAMg 5LJ3e 3LW5E 4BE2A 1AOJA 3OW2S 3FJPA 2KT8A 5KYUB 5HKCA 3OMGA 3M59A 4LDXA 4C8QC 1KQ2A 4J9HA 5M9OA 3CCET 1X01A 5HCKA 3VS4A 2LCLA 2QA4Q 1SEMA 2FPFA 3HSBA 2GQVA 1S72T 1KC8U 1YI2T 2D0NA 5CQYA 5A0GA 4C8QG 2RQVA 1M27C 2KK4A 1AVZC 2JVVA 3MO8A 4OGEA 3ZEHA 3OQ5A 2QEXQ 1QVPA 1RABB 1M3BA 4LUDA 5FU6B 1M4ZA 2A37A 5IN1A 2XK0A 3L2ZA 2A0FB 2DL4A 3ASKA 1SKUB 2DPPB 3PE0A 2QQ9A 1KFZA 4Y92A 3RMSA 4IKFA 4RTXA 1PM3A 1JBMA 1X6OA 2PUOB 4D6WA 4BACA 2H8HA 5J39A 3L2VA 3Q1JA 3M0QA 4KUIA 2EFIA 2FRWA 3BDUA 3EG9A 1RLPC 2DIQA 4FU6A 2CZ7B 4ELZC 3I55A 1YP5A 1FMWA 1QWEA 5GAMd 2ESWA 4M7AC 3GBQA 5GAOp 1Q82U 2QA4T 5EG2A 1G5VA 3LX7A 3OYYA 5KYYB 2VC8A 4OVAA 2M51A 4AFSC 1PRLC 1FMKA 3JB9F 2EYWA 4FYYB 1LPLA 1YJNQ 4EIKA 4M7AG 2FYKA 4CI0C 3CCLQ 2R5MA 1GFDA 2RHXA 3PMIA 4CC4B 3CC7T 3WXMB 1SG5A 3SWNC 1SHGA 2QQRA 4X9DA 1B3QA 2DXCA 2X4JA 1NPPA 3INZA 3QYGB 3MP6A 1K9MU 1WGSA 2FL7A 2MK5A 5LJ3g 1AWJA 2O88A 1C6VX 3DB4A 2ZPGB 1WDXA 2ZPBB 4RMOA 3GIBA 4A4HA 4ZTJA 2ED0A 5GAOl 5GANj 3G4SA 1Q7YR 1TXQA 1PD0A 2X51A 1CKAA 1YHQQ 1MMNA 5A0DA 1HD3A 5HK0A 3EFSA 2D0QB 3GP8A 3UA7A 3QUIA 1KQ1A 1G8XA 1KD1C 4AFUC 4AT1B 1ZUYA 1RAGB 2CP3A 3RIRA 2LVMA 1WQWA 3OBYA 3LYIA 2MWOA 5KYUA 3I35A 1XTDA 1T0JA 1UB4A 2WACA 5IHKA 1YIJA 3TREA 1B7TA 1YJNT 2E3HA 2I2LA 4DEYA 4F7UF 5GMKi 1KD1R 1Q81U 2PVOB 4MDWA 2RA2A 4OB2B 1QWFA 3P8HA 3OYIA 3OBWA 1AHJB 1IGQA 2ECZA 1VQ8Q 1QKXA 2WSEE 4M77F 4C92B 2EQKA 1EX4A 1BBZA 2K7AA 4K11A 2QDYB 4RCCA 1NLPC 4ELYC 1MGQA 2CP0A 1WHKA 2EJGA 3LWHA 1Y71A 4JJCA 5LJ3d 2G3RA 3CBMA 2CT4A 3PVLA 3P8BB 2JMAA 2D8HA 4XTXA 1H92A 3V8KA 2P0KA 3ER0A 1IREB 1Y57A 2J7IA 4PJJA 1VQ7Q 5CO7A 1TUDA 5IAYA 4HT9A 1RAAB 3QWYA 4RUGA 3META 4J5YA 2YRVA 1WX6A 2X3XD 2IVWA 3M0PA 2LCSA 3OYEA 2A28A 4JPBW 2D1XA 2HEQA 2PVDB 3EG1A 3JCMX 1NEGA 4RCBA 1K8AC 2FZGB 2DERA 5KYYA 3EFOB 4O5VA 2DETA 3CD6Q 1NG2A 1UECA 2WSFE 1JU5C 4C5EA 3G71Q 2H3JA 1QP3A 2V8KA 1VQ8T 2ZAEA 3E9FA 1OX8A 1BI2A 3C95A 3RNJA 3TEEA 5HK3A 2QDLA 4RKUE 5LJ5g 1UJYA 4HVVA 2DXUA 1QVGP 2OTJQ 2E6NA 1XNIA 1K8AR 1X69A 1VQPA 2HAXA 4DBFA 1X2KA 3H0IA 1I81A 2A7YA 4PJOF 3CCST 1KC8C 3VRYA 1P92A 3PVQA 1VOMA 1TU0B 3EG0A 5CR2A 4ZNXA 4M7DB 1VQ7T 1WHGA 4LDVA 3LGFA 2HZYA 2RQUA 2Y90A 2RQTA 4PLLA 4ESRA 1YBYA 1ZA2B 2LRQA 1WYXA 4F7UE 4JRIA 3OYBA 2MMPA 4LDUA 2J6FA 4KGZB 2E65A 3JCMP 4BE0A 1HJDA 3FIFA 4WF2A 1WFWA 3GF5A 4FW1A 1ACMB 6AT1B 4OMLA 1WXTA 4ATOA 4M77E 4JRPA 2O31A 2QASA 2E4HA 2YUOA 2NYSA 2RO0A 3REBB 3MP8A 2HDAA 3F70A 4BI8B 2BZXA 1RACB 4BY6B 3UATA 1QVGA 3LH5A 1GRIA 2CZ6B 3H9NA 3JAME 2DEQA 1K9AA 2DXBA 1KJWA 2DA9A 4J7FA 5LJ3j 1Q82C 1XQHA 1Y0MA 4C0FA 2M0OA 1CSKA 5LJ5d 4C92A 2YRDA 5KE3A 2GQIA 2HCKA 1K0XA 3OYDA 1BU1A 5A0LA 1W4SA 1IZ6A 3VS0A 2VB6A 5EC7A 2V8IA 2K6DA 4EPCA 1Q82R 3CXCP 4PJOG 2JUFA 3JCMe 2LCCA 1K9MC 2YLBA 4PK4A 1VQNA 2EYYA 2IIMA 3QO3A 4M4ZA 2CKKA 4NL3A 2MOXA 1NLOC 2L3QA 3NTKA 1JEGA 3RBBB 1NE8A 1I07A 2PU9B 4E6RA 1IB8A 3EGUA 5GAOn 3J7AF 4FIBA 3V7SA 4CC2A 3UA6A 3OSSC 1VQ4A 2VXEA 1QMCA 1K9MR 4X1VA 4LUEA 4M75F 2LJ1A 2PNIA 3EFOA 3NGPA 3X28B 2BZYA 2BE7D 4DOWA 3OYKA 4J9BA 2VV5A 5DLQE 2F2WA 2DKGA 3SEMA 4PJOE 3HKSA 1IGUA 2L0AA 4FM4B 1KIKA 3BE3A 2RB6A 4M78F 3EAEA 4XTYA 3H6ZA 1QVGS 5GMKe 2LX9A 3I56A 2LC4A 1BK2A 2QG9B 2ABLA 4D8KA 4HKEA 4FYWB 1C0MA 4QVCA 5GANf 3JB9J 1Q81C 3I55T 3EH1A 1OZ3A 1NPRA 5DM7R 1TS9A 1M1GA 3JCMh 3OYGA 3RESA 5C0MA 4M7DA 2C0IA 2HKQB 3SD4A 1AD5A 3CCRA 3M53A 5KH6A 1Q81R 3NMZC 4Z89A 1WHMA 2K79A 1UUEA 4A54A 1QVFP 3NTHA 3JCMW 1YWPA 1D1CA 2DBMA 2AK5A 4N4HA 3QBYA 4J9EA 2K5FA 1YITQ 2KEAA 2K3YA 3HTRA 2L3PA 5GAOr 2EQJA 2VGMA 2VKNA 4B9XA 3L42A 2NUPA 4OMFB 2K9GA 2KMTA 3M54A 2GBQA 3QIIA 4L6V5 4OMQA 1QCNA 3KUFA 4PJMA 4J9GA 3ZFJA 5A2QE 2K3XA 4OP0A 4C8QF 5LJ5j 2P4RA 3MEWA 4F04B 1QLYA 1QCFA 3L2UA 4XU0A 2QYZA 4XU3A 4P5NA 2PZ1A 3C94A 3FRNA 5L23A 1Y07A 5KCHA 1M3CA 4OB0B 1I5LA 1RAHB 2KBTA 2MCNA 1LOJA 1S72Q 1HYOA 1YI2Q 3S3OA 2CP2A 4VUBA 2ZPHB 2Y4XA 2RNAA 4ZGEB 1FYNA 3JB9H 4PJLA 1U3OA 4C5GA 3RKXA 3BW1A 4XU1A 1I4K1 3A8LB 3OA6A 2LJ3A 5FW9A 1XJWB 5GAMf 3CPWP 2KGTA 2YUNA 2VYTA 3UT1A 3A8MB 1YIJT 3CXCS 1QVFA 2LP5A 4F17A 1TUGB 1O75A 3UDCA 3AHUA 4FYVB 3MKDA 2YUQA 2FRYA 4FL6A 4F7UA 2K5IA 4JDSA 4MZPA 4M75E 1RAEB 1JRIA 4A4KA 4EMHA 4HXJA 5FU7C 5GAN6 4FCYA 1WHLA 3JB9D 5ECAA 2K5LA 1UJ0A 2FO0A 1BIAA 2HQXA 2DE0X 4OMMA 4Q5WA 5GAN4 1WPYA 4M78E 4C0GA 2SEMA 1WJQA 4M7AF 2E10A 4N4IA 5I2MA 3J80E 1H3HA 3CCMA 3OYHA 1JXMA 3UF4A 2EKHA 1SF9A 1Y96A 4IUUA 4OGCA 3VS3A 2RJCA 2P0PA 1E7OA 4OB3B 4R0KA 3DLLA 2EQUA 1VQKA 1G3SA 3ME9A 4A4FA 5CK9A 4E7LA 2DL8A 3CC7Q 4JLGA 5GAN2 2KRNA 4V2SA 3CPWA 1TWBA 2PVGB 3AT1B 1UTIA 1YJWA 4BI3A 5GAN3 1M2VB 3PIPA 2ZPIB 2P4TA 4AMCA 4HA8A 2X4XA 2YXYA 1JB0E 3DB3A 3CMEA 3CMAA 1MNEA 2E12A 1QVFS 4DA4A 1PWTA 4HCZA 4L59A 1MMGA 2KNBB 1OU8A 1ZX6A 2F5KA 3NFCA 4C8QE 4D8DA 1VQLA 3OMCA 1JXOA 2K2VA 2W0ZA 3M55A 2JZ2A 2ZCFB 1KQSP 1R8OB 1I8FA 3EG2A 5LL6S 1VQPT 1M2OA 4YTLA 4C92C 2QQSA 2I0NA 1K76A 4WCIA 2RQRA 1PRMC 4XQ3A 4M77D 2VASA 4LN2A 3RKWA 5LJ3f 1Z9ZA 3QXEB 1GBRA 3G7ZA 2JS2A 8AT1B 4C92G 3FB9A 2RI3A 5FWBA 2R58A 5CVIA 1NJIU 5FU7B 3NHNA 5I11A 1MHNA 4KUDK 4C0DC 3V7RA 3CQTA 3CCJA 1QKWA 4HVWA 1K1ZA 3URGA 5IXFA 3G1JA 2DD4A 1PC0A 2A3LA 3JCMQ 2FVUA 2RHZA 4A4EA 4RG8A 1ZLMA 2XDDA 1V1CA 4QQ6A 4B9WA 3OSVA 4JS4A 2DZCA 4J9CA 2EW3A 3CPWS 1GBQA 1FMVA 3CCVA 3E2UA 2C0TA 4JJBA 1UGVA 2ROLA 5I22A 5CKFA 1N8RU 2J6OA 5IHIA 2OTLA 3TSZA 4E47A 4EMKB 1T3SA 4M7AE 4XAXB 4PL6A 1KQSA 4BUGA 2DVJA 2DX1A 2NLUA 5HY6A 4E2FB 4DOVA 2RK2A 3VJPA 3M0RA 1AZEA 3WVEB 1SHFA 2DL7A 2NWMA 3X26B 1B34B 2NUTB 2IG0A 1Q95G 1N5ZA 2MYSA 2DJQA 1OEBA 1BCOA 2XICA 3H41A 2LQKA 2MWPA 2QTXA 2LNVA 1E6GA 2HSPA 3CC4A 2D8JA 2RPNA 2FEIA 4M7DC 1RADB 3HRTA 2LZ6B 1D3BB 3EHQA 1VQNT 3V7CA 1D1BA 1YJ9A 1PG5B 1K73U 4CRIA 3CCRQ 1G3WA 2EYXA 4M7DG 2MIOA 4JLIA 1VQ5A 3M0UA 1M2VA 1MMAA 1VQ4T 3T9NA 2B8AA 4BB7A 2BKDN 4J83A 3CCSQ 4Y28E 4ORZA 3OY9A 2LNHB 2RQWA 3OS1A 1WHHA 4C0DB 1LJOA 1OX9A 5GMKj 1OI1A 4FT2A 2XKOC 4M75A 1H3ZA 3L1AA 1TUCA 4BY6C 2RK1A 2F2XA 2EYZA 1HXDA 3M0TA 2OAWA 2YWWA 3GPLA 1KQSS 2HD0A 3I56T 4A4GA 4E7JA 2VUBA 5LJ5f 2CP6A 4J9DA 2D6FA 3MCAB 2E3IA 3R6NA 4Y91A 2QQBA 2CH4A 1BI0A 4MMLA 2K3BA 3VYGA 5GAOm 2EGEA 2J06A 4PLIA 2GTOA 2HBPA 3QJYA 3OS5A 1N27A 2DEUA 1WXUA 1D1AA 2JN0A 5L8RE 3CCRT 1UHCA 2EPDA 3G6EA 2M16A 2GNCA 4IIMA 3LWIA 1VQ6A 2RHYA 2JOYA 1B07A 2COWA 1ZBXA 3FLGA 4GLMA 5IT9E 1VQOA 3UPUA 4BDZA 1U1TA 4PKCC 2MAMA 3X25B 4X9CA 3THKA 4Z88A 4RTTA 2DTOA 1AWXA 4FYXB 1XOVA 1ARKA 4PJNA 3ZL7C 2CS7A 2CP5A 3OS0A 4MZMA 4EMKA 3CCMQ 3PNWC 1VIFA 3SDZA 1KC8R 2LQNA 4M75D 3H0HA 5I21A 4DBHA 2YLCA 1RI0A 2QEXA 2NUPB 4QQGA 4E7ZA 5FRNA 1NBEB 5GAN8 1W2BP 1B34A 2XHCA 4MZTA 4M78D 4AFQC 3VS2A 2E5QA 1R0CB 2NUTA 1VQKQ 3HFNA 4QW2A 3MJXA 3PGGA 1TOVA 2CH4W 1MMDA 1RL2A 4KRTA 4E7KA 5CIUA 2FG0A 3A8GB 4PFOA 1M1FA 2CT3A 2HMAA 2DD5A 2L2PA 4AG2C 3CC2A 2JNGA 2RI2A 4GY5A 1VA7A 2DRKA 4FSSA 5GMKl 1D3BA 2XMFA 3CMEQ 1OOTA 3CMAQ 2JM8A 2EIFA 3A8OB 4OMOA 3HFOA 1J3TA 4RTWA 2CDTA 1U1SA 3JB9I 1E6HA 3OYCA 4XTWA 5CKDA 4RTYA 5D6XA 1EIFA 2SRCA 1JO8A 3D7SB 2C06A 2B86A 1NJIC 3I55Q 1VYTA 1WXBA 4IIOA 4TVRA 2QXFA 1GXIE 1KK7A 3KFVA 4KH0B 3FC3A 1VQ9A 3CCMT 3JCMJ 5D6WA 1T0HA 4GLKA 2V8JA 1R0BG 1LVKA 5I2SA 3QZ9B 4F7UB 4EDUA 1QCOA 1AZGB 2DVEA 1NJIR 4KT0E 2E70A 2EKOA 4C8QD 1W2BA 5D7UA 3CCLA 1WIEA 2JJ9A 1VQKT 4LD9K 2ATCB 2DJZA 2LJ0A 3L2QA 3P8DA 4M77B 3CCJQ 2V1QA 1N8RC 5CKHA 1YJWT 4Z02A 2CUDA 1SSFA 1NYGA 2QI2A 1N9SA 4FT4A 1U06A 3UWNA 3CMET 2K4YA 1ZUKA 1Y96B 2EYQA 2HSEB 2X4YA 2M02A 3CMAT 2DAQA 2VWFA 3CCVQ 3G4SQ 5AYFA 1M8MA 3GNGA 3A8HB 4NOYA 1Q7YU 1YHQA 1MNDA 2F1LA 2OTLQ 1VQLT 5GANh 4DEXA 2X9HA 4JJDA 1AWWA 3MEUA 3HRUA 2K57A 2OX7A 2JMCA 3VV0A 2KRSA 1EZZB 2MPXC 1W70A 4ANJA 1D09B 3M9QA 2RM4A 1N9RA 1K73C 5GAMe 2E1HA 2DXTA 1KSWA 1FXXA 4XU2A 5GMKm 1TSFA 1YIJQ 2EAYA 3M4YA 3X20B 3HHTB 3O8VA 4LXCA 3V8LA 3M4GA 1PHTA 4CC7A 1Q86U 4M7AD 3CC4Q 2MF2A 2XDPA 4Z8AA 3OYFA 3CCJT 3PT9A 4IUPA 2ZZDA 3IQLA 1K73R 2F69A 1AWOA 1W2BS 2KDSA 4FW2A 4RG2A 1PD1A 2JXBA 3A5ZB 1M3AA 1X75C 3GOXA 3VS6A 1VQ5Q 3CCVT 3VKIA 1M8VA 3G4ST 1UDLA 3JCMg 1YNZA 1ZHIA 4E7HA 2KYMA 2OTLT 4LE9A 2GFAA 1ZBJA 4M75C 2DYIA 5FROA 1I1JA 1BI3A 3BDLA 2ENMA 3WVDB 2HQHA 2C0OA 3CCUA 3J81E 2EBPA 2KYBA 1EFNA 2KT1A 3NPFA 1Y7XA 1I5OB 4M78C 4DQ2A 5GAMh 1GL5A 2CSIA 2DL5A 3OYLA 1BI1A 3QDFA 1NZ9A 1PNJA 1GCQA 5KCOA 3QG1A 1T3LA 2CGHA 3R6OA 2FB7A 3CC4T 2RI5A 5IH2A 1ZSZC 4N4GA 2A36A 2AKLA 4J9IA 4JRQA 1WJSA 3CD6A 1ZA1B 2DBKA 3CBPA 3DLMA 3CEYA 3MEVA 5GAOq 3G71A 1YJ9T 1Z9QA 3EGDB 3O5ZA 1MUZA 2KSSA 3QPHA 2AZSA 3G6EQ 1H641 1RAIB 2HNIA 1F1BB 3EH2A 2OTJA 1VQ6Q 5C6SA 4M77A 3RKYA 1VQ5T 4C92F 3QSUA 1VQPQ 2Y4YA 5FLXE 2EGCA 2L8DA 1MV0B 1VYUA 3GLXA 2KAFA 1IHWA 3BFMA 4AFZC 4PFZA 4OB1B 3HP9A 1IHVA 3I5SA 3EGXB 1RI9A 2L3RA 4F16A 3JCMd 4BI4A 1YCYA 1TTHB 2AT1B 1WHJA 1ZUUA 4EMKC 2GGRA 1O9SA 4N0AA 2LDMA 2FZCB 3FJ5A 4NS5A 1FWZA 1D0YA 3CBOA 3JSCA 2KY9A 2CZ1B 2LX7A 2BTTA 3OB9A 1JJ2P 4OMNA 2ZPFB 1IO6A 2CYZB 2JTFA 5IHNA 4JS5A 2FPEA 3OYNA 4RTVA 3A98A 1ZSGA 4J6YA 1CKBA 4M75B 1M90U 4QT7A 2AHJB 4XTUA 2F5TX 2KXCA 4UC4A 2XI9A 3G6ET 3CC2Q 3VYHB 3ZBDA 1VQ6T 4M78B 3CCQA 4QKUA 2E64A 2HBWA 3MP1A 2E5KA 2X3WD 1QP2A 1WLPB 1SSHA 4QQDA 1PSFA 1SRMA 2M9UA 1VQOT 4HCBA 2PUKB 2L5QA 5LJ3h 1K4US 1ZSZB 2E6ZA 4PJOA 4ZTFA 1QQJA 5GAN7 5DY9A 3H0FA 3E9GA 1OU9A 4M7DF 3JCMV 1VQ9Q 1BB9A 4F14A 1OYXA 4L5GA 2E41A 4XK8E 1VQNQ 2BZ8A 1OV3A 1JJ2A 1MV3A 4HCKA 2V1RA 1VYVA 2QEXT 2HKNA 1OZ2A 2CSQA 1D0ZA 1U5SA 2EQIA 4MDXA 1KHIA 4IURA 5CKEA 1M1KU 3PMTA 4R56A 2YUPA 1VQ4Q 2QGFB 3SFMA 2EVRA 1Q7YC 2ZPEB 3QDRB 4C92E 2KR3A 3CC2T 3JV3A 4C8QB 3KBGA 2J05A 1VQMA 2DTHA 1I0CA 4E7SA 4BDYA 2DK3A 3EGDA 2DIGA 3RDVA 2R57A 2DFUA 1W1FA 1OPKA 4KH1B 1LNXA 3I56Q 2AIRB 1KG1A 2BUDA 2OI3A 5LJ5e 1Q86C 4LDWA 4QVDA 4KGXB 4LDYA 3EHRA 4JUVA 2OAUA 3L2RA 1VQ9T 3M5AA
chains in the Genus database with same CATH topology
3CCQQ 1KQSP 1K73R 3CCVQ 2QEXQ 3CMEQ 3OW2P 1Q82R 3G6EQ 3G4SQ 3CCSQ 1VQ4Q 1N8RR 1YJ9Q 3CXCP 1Q7YR 1VQ9Q 1M90R 1S72Q 1VQ8Q 3CMAQ 3CCJQ 1W2BP 1QVGP 1K9MR 1VQ6Q 3CCRQ 2OTJQ 1YI2Q 1VQKQ 3I56Q 1Q86R 1K8AR 1VQ7Q 2OTLQ 1YHQQ 1Q81R 1YIJQ 1VQPQ 3I55Q 1VQNQ 3CC7Q 1QVFP 3CCUQ 3CCMQ 1VQ5Q 2QA4Q 1KD1R 3CD6Q 1VQMQ 1YJWQ 3CC4Q 1KC8R 1M1KR 1VQOQ 1YJNQ 1NJIR 1VQLQ 3G71Q 1YITQ 3CC2Q 3CCEQ 1JJ2P 3CCLQ 3CPWP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ Q;  1KQS P;  1K73 R;  3CCV Q;  2QEX Q;  3CME Q;  3OW2 P;  1Q82 R;  3G6E Q;  3G4S Q;  3CCS Q;  1VQ4 Q;  1N8R R;  1YJ9 Q;  3CXC P;  1Q7Y R;  1VQ9 Q;  1M90 R;  1S72 Q;  1VQ8 Q;  3CMA Q;  3CCJ Q;  1W2B P;  1QVG P;  1K9M R;  1VQ6 Q;  3CCR Q;  2OTJ Q;  1YI2 Q;  1VQK Q;  3I56 Q;  1Q86 R;  1K8A R;  1VQ7 Q;  2OTL Q;  1YHQ Q;  1Q81 R;  1YIJ Q;  1VQP Q;  3I55 Q;  1VQN Q;  3CC7 Q;  1QVF P;  3CCU Q;  3CCM Q;  1VQ5 Q;  2QA4 Q;  1KD1 R;  3CD6 Q;  1VQM Q;  1YJW Q;  3CC4 Q;  1KC8 R;  1M1K R;  1VQO Q;  1YJN Q;  1NJI R;  1VQL Q;  3G71 Q;  1YIT Q;  3CC2 Q;  3CCE Q;  1JJ2 P;  3CCL Q;  3CPW P; 
#chains in the Genus database with same CATH topology
 2EJF A;  4PJO D;  1BKB A;  1GCP A;  3EGX A;  4A63 B;  3VU3 C;  3LLR A;  4O6J A;  1UHF A;  1Q86 R;  2X4W A;  4LD6 A;  3TU4 K;  2L3S A;  1X2Q A;  3M57 A;  3E19 A;  4KBM B;  2BIV A;  3C12 A;  3C4S A;  2KRM A;  2EJ9 A;  2RN8 A;  3CCL T;  2DL3 A;  2LT1 A;  4AG1 C;  3KXT A;  5J26 A;  1YIT A;  4DBR A;  1JJ2 S;  2YHT A;  4NL2 A;  3TCJ A;  4ZN1 A;  1NYF A;  5KE2 A;  3JB9 G;  4J6X A;  3S6W A;  2HL5 C;  2BE9 B;  4BD3 A;  4M7A B;  3M56 A;  1YFN A;  2YT6 A;  1YCS B;  1YN8 A;  1U8R A;  4J6W A;  1H8K A;  1KHC A;  3S3M A;  2J6K A;  3M58 A;  3CCE A;  2XU8 A;  1VIE A;  2KE9 A;  3X24 B;  1YHQ T;  1BCM A;  4M78 A;  1OPL A;  5LJ5 h;  2LTO A;  4M7D E;  1S72 A;  4QVZ A;  1K0S A;  2GFU A;  1YI2 A;  2QQA A;  2GF7 A;  1DJ7 B;  2W10 A;  3S3N A;  3SWN B;  4R55 A;  5GAM j;  1TH7 A;  3RR6 A;  5GJW B;  2CZ0 B;  3CCU Q;  2JTE A;  4IUV A;  2L89 A;  5KYX B;  1ZSZ A;  5GJV B;  2CP7 A;  2AKK A;  1IXD A;  2LMJ A;  1UGP B;  4DBQ A;  1GCQ C;  1OQK A;  3JCM b;  2KXD A;  3EFR A;  2COY A;  2DIL A;  1JQQ A;  3QHS A;  2MI6 A;  2D9T A;  3HRS A;  2RHI A;  1YWO A;  3VUZ A;  2YSQ A;  3HPW A;  3DKM A;  4RTZ A;  2LT4 A;  2Z0W A;  4F7U G;  3TVT A;  2RJF A;  2PTK A;  2DM1 A;  2R5A A;  4M77 C;  2DYB A;  3CPF A;  4ZN3 A;  2KI7 A;  5D6Y A;  2JM9 A;  2F2V A;  3VS7 A;  2P84 A;  2RF0 A;  2M0Y A;  4J9F A;  4EMG A;  4IUT A;  3RUX A;  4FSX A;  2DO3 A;  4M77 G;  3MEA A;  4C8Q A;  5CAI A;  2QA4 A;  1HSQ A;  1NEB A;  2WSC E;  2CRE A;  2YRC A;  3HL8 A;  2V26 A;  4X34 A;  3NTI A;  4GBQ A;  4JRK A;  4N0A C;  1ABQ A;  3CCU T;  1V76 A;  1RUW A;  1M90 C;  2DRM A;  2HQE A;  4JJN K;  3CC7 A;  1D0X A;  4C0Z A;  3H8Z A;  1S1N A;  1YJW Q;  2O9S A;  4II1 A;  1SRL A;  4ZGD B;  3QWX X;  1UFF A;  4MMK A;  2COZ A;  5GAN 5;  4OF1 A;  3TSW A;  3VRZ A;  5KYN A;  1M90 R;  1G2B A;  2O4X B;  1M30 A;  3CD6 T;  2ZGW A;  3G71 T;  2HL3 A;  2PQW A;  8ATC B;  1W6X A;  3U23 A;  1HK9 A;  1VQL Q;  7AT1 B;  1UGQ B;  1X6G A;  5GAN e;  2RMO A;  5KYW B;  2OTJ T;  2O9V A;  1VUB A;  3SB2 A;  3CCQ Q;  2RHU A;  3GNF B;  1AT1 B;  3QJ6 A;  2ED1 A;  4JZ3 A;  2RJE A;  2FPD A;  3N5B B;  3V8J A;  4M7A A;  1A0N B;  4PJO C;  3ULR B;  1M9S A;  2DMO A;  2QAZ A;  4XTZ A;  1YJN A;  3SHW A;  3QZ5 B;  1M1K C;  3L2W A;  5FWC A;  1V29 B;  4KUL A;  4PFP A;  2XID A;  1WZO A;  3MPU B;  1UEB A;  1AEY A;  2JS0 A;  3SWN A;  2LQ8 A;  4LNP A;  2AZV A;  2H3E B;  3LH0 A;  4HVU A;  3QYH B;  1WI7 A;  5CQX A;  1M1K R;  3OYA A;  2VGN A;  2GCX A;  3VS5 A;  5KYX A;  2KQW A;  1UE9 A;  4ZGJ B;  2XDB A;  5FRM A;  3OW2 P;  4ME7 A;  4XTV A;  1N8R R;  3E1S A;  3FEO A;  4J7I A;  3RMQ A;  4BE1 A;  3OYM A;  2JT4 A;  1PKT A;  1WNL A;  3REA B;  1G83 A;  1RLQ C;  1VQM Q;  3CCQ T;  1PKS A;  3VUB A;  2VXF A;  1PSE A;  1R77 A;  1X27 A;  1X6B A;  1WQ7 A;  2K2M A;  4IUQ A;  2FHD A;  1ZQ1 A;  1UGR B;  3PIO A;  3EG3 A;  2YDL A;  3JCM c;  2VVK A;  2DNU A;  4KGV B;  1NM7 A;  4HT8 A;  3BY7 A;  2XD0 A;  1BYM A;  5DLO A;  1OUL A;  5CKB A;  3OS2 A;  4CC3 A;  4C92 D;  2LQW A;  3CXC A;  4E7I A;  2QK0 A;  2IPO B;  2DLP A;  1KD1 U;  3JCM f;  1G3T A;  4RTU A;  3MHX A;  1M5Q 1;  1WA7 A;  2RD1 A;  4J8O A;  1YJ9 Q;  1VQ8 A;  2EQM A;  2A08 A;  2DF6 A;  5GAN g;  4C5I A;  1SPK A;  4WTO B;  2X35 A;  3JRZ A;  3PFS A;  3OYJ A;  3EG9 B;  4B6M A;  3OW2 A;  4PJO B;  2CUB A;  2FZK B;  2G6F X;  1QW1 A;  3QKJ A;  3I5R A;  3A1P A;  2DTI A;  3CCS A;  1GFC A;  1FX7 A;  1UGS B;  5FU6 C;  1TG0 A;  2ROT A;  2O4X A;  1VQM T;  1VQ7 A;  2QGG A;  3PTA A;  2RJD A;  2EWN A;  3M0S A;  4A53 A;  4JZ4 A;  3VS1 A;  5GMK h;  2OJ2 A;  3CCE Q;  4M75 G;  2GTJ A;  5KYW A;  1RAF B;  2KVQ G;  1G3Y A;  2RH2 A;  5CCA A;  2M1H A;  2O01 E;  2P0Q A;  1UG1 A;  4HCC A;  1N6A A;  3LGL A;  4M78 G;  1ABO A;  1WJR A;  2NUZ A;  1C1A A;  5AT1 B;  2DZ9 A;  1PCX A;  3I9Q A;  2O2O A;  2JTM A;  3RER A;  2XG8 D;  9ATC B;  2QTV A;  2EGA A;  5IXB A;  4M7D D;  1IRX A;  1X43 A;  3C0C A;  1YIT T;  4PNO A;  2KRO A;  1BIB A;  1K8A U;  4OMP A;  5J3B A;  4C5H A;  2JW4 A;  5GAN d;  1VQO Q;  3FDR A;  3TQ7 P;  1LCK A;  5GAM g;  5LJ3 e;  3LW5 E;  4BE2 A;  1AOJ A;  3OW2 S;  3FJP A;  2KT8 A;  5KYU B;  5HKC A;  3OMG A;  3M59 A;  4LDX A;  4C8Q C;  1KQ2 A;  4J9H A;  5M9O A;  3CCE T;  1X01 A;  5HCK A;  3VS4 A;  2LCL A;  2QA4 Q;  1SEM A;  2FPF A;  3HSB A;  2GQV A;  1S72 T;  1KC8 U;  1YI2 T;  2D0N A;  5CQY A;  5A0G A;  4C8Q G;  2RQV A;  1M27 C;  2KK4 A;  1AVZ C;  2JVV A;  3MO8 A;  4OGE A;  3ZEH A;  3OQ5 A;  2QEX Q;  1QVP A;  1RAB B;  1M3B A;  4LUD A;  5FU6 B;  1M4Z A;  2A37 A;  5IN1 A;  2XK0 A;  3L2Z A;  2A0F B;  2DL4 A;  3ASK A;  1SKU B;  2DPP B;  3PE0 A;  2QQ9 A;  1KFZ A;  4Y92 A;  3RMS A;  4IKF A;  4RTX A;  1PM3 A;  1JBM A;  1X6O A;  2PUO B;  4D6W A;  4BAC A;  2H8H A;  5J39 A;  3L2V A;  3Q1J A;  3M0Q A;  4KUI A;  2EFI A;  2FRW A;  3BDU A;  3EG9 A;  1RLP C;  2DIQ A;  4FU6 A;  2CZ7 B;  4ELZ C;  3I55 A;  1YP5 A;  1FMW A;  1QWE A;  5GAM d;  2ESW A;  4M7A C;  3GBQ A;  5GAO p;  1Q82 U;  2QA4 T;  5EG2 A;  1G5V A;  3LX7 A;  3OYY A;  5KYY B;  2VC8 A;  4OVA A;  2M51 A;  4AFS C;  1PRL C;  1FMK A;  3JB9 F;  2EYW A;  4FYY B;  1LPL A;  1YJN Q;  4EIK A;  4M7A G;  2FYK A;  4CI0 C;  3CCL Q;  2R5M A;  1GFD A;  2RHX A;  3PMI A;  4CC4 B;  3CC7 T;  3WXM B;  1SG5 A;  3SWN C;  1SHG A;  2QQR A;  4X9D A;  1B3Q A;  2DXC A;  2X4J A;  1NPP A;  3INZ A;  3QYG B;  3MP6 A;  1K9M U;  1WGS A;  2FL7 A;  2MK5 A;  5LJ3 g;  1AWJ A;  2O88 A;  1C6V X;  3DB4 A;  2ZPG B;  1WDX A;  2ZPB B;  4RMO A;  3GIB A;  4A4H A;  4ZTJ A;  2ED0 A;  5GAO l;  5GAN j;  3G4S A;  1Q7Y R;  1TXQ A;  1PD0 A;  2X51 A;  1CKA A;  1YHQ Q;  1MMN A;  5A0D A;  1HD3 A;  5HK0 A;  3EFS A;  2D0Q B;  3GP8 A;  3UA7 A;  3QUI A;  1KQ1 A;  1G8X A;  1KD1 C;  4AFU C;  4AT1 B;  1ZUY A;  1RAG B;  2CP3 A;  3RIR A;  2LVM A;  1WQW A;  3OBY A;  3LYI A;  2MWO A;  5KYU A;  3I35 A;  1XTD A;  1T0J A;  1UB4 A;  2WAC A;  5IHK A;  1YIJ A;  3TRE A;  1B7T A;  1YJN T;  2E3H A;  2I2L A;  4DEY A;  4F7U F;  5GMK i;  1KD1 R;  1Q81 U;  2PVO B;  4MDW A;  2RA2 A;  4OB2 B;  1QWF A;  3P8H A;  3OYI A;  3OBW A;  1AHJ B;  1IGQ A;  2ECZ A;  1VQ8 Q;  1QKX A;  2WSE E;  4M77 F;  4C92 B;  2EQK A;  1EX4 A;  1BBZ A;  2K7A A;  4K11 A;  2QDY B;  4RCC A;  1NLP C;  4ELY C;  1MGQ A;  2CP0 A;  1WHK A;  2EJG A;  3LWH A;  1Y71 A;  4JJC A;  5LJ3 d;  2G3R A;  3CBM A;  2CT4 A;  3PVL A;  3P8B B;  2JMA A;  2D8H A;  4XTX A;  1H92 A;  3V8K A;  2P0K A;  3ER0 A;  1IRE B;  1Y57 A;  2J7I A;  4PJJ A;  1VQ7 Q;  5CO7 A;  1TUD A;  5IAY A;  4HT9 A;  1RAA B;  3QWY A;  4RUG A;  3MET A;  4J5Y A;  2YRV A;  1WX6 A;  2X3X D;  2IVW A;  3M0P A;  2LCS A;  3OYE A;  2A28 A;  4JPB W;  2D1X A;  2HEQ A;  2PVD B;  3EG1 A;  3JCM X;  1NEG A;  4RCB A;  1K8A C;  2FZG B;  2DER A;  5KYY A;  3EFO B;  4O5V A;  2DET A;  3CD6 Q;  1NG2 A;  1UEC A;  2WSF E;  1JU5 C;  4C5E A;  3G71 Q;  2H3J A;  1QP3 A;  2V8K A;  1VQ8 T;  2ZAE A;  3E9F A;  1OX8 A;  1BI2 A;  3C95 A;  3RNJ A;  3TEE A;  5HK3 A;  2QDL A;  4RKU E;  5LJ5 g;  1UJY A;  4HVV A;  2DXU A;  1QVG P;  2OTJ Q;  2E6N A;  1XNI A;  1K8A R;  1X69 A;  1VQP A;  2HAX A;  4DBF A;  1X2K A;  3H0I A;  1I81 A;  2A7Y A;  4PJO F;  3CCS T;  1KC8 C;  3VRY A;  1P92 A;  3PVQ A;  1VOM A;  1TU0 B;  3EG0 A;  5CR2 A;  4ZNX A;  4M7D B;  1VQ7 T;  1WHG A;  4LDV A;  3LGF A;  2HZY A;  2RQU A;  2Y90 A;  2RQT A;  4PLL A;  4ESR A;  1YBY A;  1ZA2 B;  2LRQ A;  1WYX A;  4F7U E;  4JRI A;  3OYB A;  2MMP A;  4LDU A;  2J6F A;  4KGZ B;  2E65 A;  3JCM P;  4BE0 A;  1HJD A;  3FIF A;  4WF2 A;  1WFW A;  3GF5 A;  4FW1 A;  1ACM B;  6AT1 B;  4OML A;  1WXT A;  4ATO A;  4M77 E;  4JRP A;  2O31 A;  2QAS A;  2E4H A;  2YUO A;  2NYS A;  2RO0 A;  3REB B;  3MP8 A;  2HDA A;  3F70 A;  4BI8 B;  2BZX A;  1RAC B;  4BY6 B;  3UAT A;  1QVG A;  3LH5 A;  1GRI A;  2CZ6 B;  3H9N A;  3JAM E;  2DEQ A;  1K9A A;  2DXB A;  1KJW A;  2DA9 A;  4J7F A;  5LJ3 j;  1Q82 C;  1XQH A;  1Y0M A;  4C0F A;  2M0O A;  1CSK A;  5LJ5 d;  4C92 A;  2YRD A;  5KE3 A;  2GQI A;  2HCK A;  1K0X A;  3OYD A;  1BU1 A;  5A0L A;  1W4S A;  1IZ6 A;  3VS0 A;  2VB6 A;  5EC7 A;  2V8I A;  2K6D A;  4EPC A;  1Q82 R;  3CXC P;  4PJO G;  2JUF A;  3JCM e;  2LCC A;  1K9M C;  2YLB A;  4PK4 A;  1VQN A;  2EYY A;  2IIM A;  3QO3 A;  4M4Z A;  2CKK A;  4NL3 A;  2MOX A;  1NLO C;  2L3Q A;  3NTK A;  1JEG A;  3RBB B;  1NE8 A;  1I07 A;  2PU9 B;  4E6R A;  1IB8 A;  3EGU A;  5GAO n;  3J7A F;  4FIB A;  3V7S A;  4CC2 A;  3UA6 A;  3OSS C;  1VQ4 A;  2VXE A;  1QMC A;  1K9M R;  4X1V A;  4LUE A;  4M75 F;  2LJ1 A;  2PNI A;  3EFO A;  3NGP A;  3X28 B;  2BZY A;  2BE7 D;  4DOW A;  3OYK A;  4J9B A;  2VV5 A;  5DLQ E;  2F2W A;  2DKG A;  3SEM A;  4PJO E;  3HKS A;  1IGU A;  2L0A A;  4FM4 B;  1KIK A;  3BE3 A;  2RB6 A;  4M78 F;  3EAE A;  4XTY A;  3H6Z A;  1QVG S;  5GMK e;  2LX9 A;  3I56 A;  2LC4 A;  1BK2 A;  2QG9 B;  2ABL A;  4D8K A;  4HKE A;  4FYW B;  1C0M A;  4QVC A;  5GAN f;  3JB9 J;  1Q81 C;  3I55 T;  3EH1 A;  1OZ3 A;  1NPR A;  5DM7 R;  1TS9 A;  1M1G A;  3JCM h;  3OYG A;  3RES A;  5C0M A;  4M7D A;  2C0I A;  2HKQ B;  3SD4 A;  1AD5 A;  3CCR A;  3M53 A;  5KH6 A;  1Q81 R;  3NMZ C;  4Z89 A;  1WHM A;  2K79 A;  1UUE A;  4A54 A;  1QVF P;  3NTH A;  3JCM W;  1YWP A;  1D1C A;  2DBM A;  2AK5 A;  4N4H A;  3QBY A;  4J9E A;  2K5F A;  1YIT Q;  2KEA A;  2K3Y A;  3HTR A;  2L3P A;  5GAO r;  2EQJ A;  2VGM A;  2VKN A;  4B9X A;  3L42 A;  2NUP A;  4OMF B;  2K9G A;  2KMT A;  3M54 A;  2GBQ A;  3QII A;  4L6V 5;  4OMQ A;  1QCN A;  3KUF A;  4PJM A;  4J9G A;  3ZFJ A;  5A2Q E;  2K3X A;  4OP0 A;  4C8Q F;  5LJ5 j;  2P4R A;  3MEW A;  4F04 B;  1QLY A;  1QCF A;  3L2U A;  4XU0 A;  2QYZ A;  4XU3 A;  4P5N A;  2PZ1 A;  3C94 A;  3FRN A;  5L23 A;  1Y07 A;  5KCH A;  1M3C A;  4OB0 B;  1I5L A;  1RAH B;  2KBT A;  2MCN A;  1LOJ A;  1S72 Q;  1HYO A;  1YI2 Q;  3S3O A;  2CP2 A;  4VUB A;  2ZPH B;  2Y4X A;  2RNA A;  4ZGE B;  1FYN A;  3JB9 H;  4PJL A;  1U3O A;  4C5G A;  3RKX A;  3BW1 A;  4XU1 A;  1I4K 1;  3A8L B;  3OA6 A;  2LJ3 A;  5FW9 A;  1XJW B;  5GAM f;  3CPW P;  2KGT A;  2YUN A;  2VYT A;  3UT1 A;  3A8M B;  1YIJ T;  3CXC S;  1QVF A;  2LP5 A;  4F17 A;  1TUG B;  1O75 A;  3UDC A;  3AHU A;  4FYV B;  3MKD A;  2YUQ A;  2FRY A;  4FL6 A;  4F7U A;  2K5I A;  4JDS A;  4MZP A;  4M75 E;  1RAE B;  1JRI A;  4A4K A;  4EMH A;  4HXJ A;  5FU7 C;  5GAN 6;  4FCY A;  1WHL A;  3JB9 D;  5ECA A;  2K5L A;  1UJ0 A;  2FO0 A;  1BIA A;  2HQX A;  2DE0 X;  4OMM A;  4Q5W A;  5GAN 4;  1WPY A;  4M78 E;  4C0G A;  2SEM A;  1WJQ A;  4M7A F;  2E10 A;  4N4I A;  5I2M A;  3J80 E;  1H3H A;  3CCM A;  3OYH A;  1JXM A;  3UF4 A;  2EKH A;  1SF9 A;  1Y96 A;  4IUU A;  4OGC A;  3VS3 A;  2RJC A;  2P0P A;  1E7O A;  4OB3 B;  4R0K A;  3DLL A;  2EQU A;  1VQK A;  1G3S A;  3ME9 A;  4A4F A;  5CK9 A;  4E7L A;  2DL8 A;  3CC7 Q;  4JLG A;  5GAN 2;  2KRN A;  4V2S A;  3CPW A;  1TWB A;  2PVG B;  3AT1 B;  1UTI A;  1YJW A;  4BI3 A;  5GAN 3;  1M2V B;  3PIP A;  2ZPI B;  2P4T A;  4AMC A;  4HA8 A;  2X4X A;  2YXY A;  1JB0 E;  3DB3 A;  3CME A;  3CMA A;  1MNE A;  2E12 A;  1QVF S;  4DA4 A;  1PWT A;  4HCZ A;  4L59 A;  1MMG A;  2KNB B;  1OU8 A;  1ZX6 A;  2F5K A;  3NFC A;  4C8Q E;  4D8D A;  1VQL A;  3OMC A;  1JXO A;  2K2V A;  2W0Z A;  3M55 A;  2JZ2 A;  2ZCF B;  1KQS P;  1R8O B;  1I8F A;  3EG2 A;  5LL6 S;  1VQP T;  1M2O A;  4YTL A;  4C92 C;  2QQS A;  2I0N A;  1K76 A;  4WCI A;  2RQR A;  1PRM C;  4XQ3 A;  4M77 D;  2VAS A;  4LN2 A;  3RKW A;  5LJ3 f;  1Z9Z A;  3QXE B;  1GBR A;  3G7Z A;  2JS2 A;  8AT1 B;  4C92 G;  3FB9 A;  2RI3 A;  5FWB A;  2R58 A;  5CVI A;  1NJI U;  5FU7 B;  3NHN A;  5I11 A;  1MHN A;  4KUD K;  4C0D C;  3V7R A;  3CQT A;  3CCJ A;  1QKW A;  4HVW A;  1K1Z A;  3URG A;  5IXF A;  3G1J A;  2DD4 A;  1PC0 A;  2A3L A;  3JCM Q;  2FVU A;  2RHZ A;  4A4E A;  4RG8 A;  1ZLM A;  2XDD A;  1V1C A;  4QQ6 A;  4B9W A;  3OSV A;  4JS4 A;  2DZC A;  4J9C A;  2EW3 A;  3CPW S;  1GBQ A;  1FMV A;  3CCV A;  3E2U A;  2C0T A;  4JJB A;  1UGV A;  2ROL A;  5I22 A;  5CKF A;  1N8R U;  2J6O A;  5IHI A;  2OTL A;  3TSZ A;  4E47 A;  4EMK B;  1T3S A;  4M7A E;  4XAX B;  4PL6 A;  1KQS A;  4BUG A;  2DVJ A;  2DX1 A;  2NLU A;  5HY6 A;  4E2F B;  4DOV A;  2RK2 A;  3VJP A;  3M0R A;  1AZE A;  3WVE B;  1SHF A;  2DL7 A;  2NWM A;  3X26 B;  1B34 B;  2NUT B;  2IG0 A;  1Q95 G;  1N5Z A;  2MYS A;  2DJQ A;  1OEB A;  1BCO A;  2XIC A;  3H41 A;  2LQK A;  2MWP A;  2QTX A;  2LNV A;  1E6G A;  2HSP A;  3CC4 A;  2D8J A;  2RPN A;  2FEI A;  4M7D C;  1RAD B;  3HRT A;  2LZ6 B;  1D3B B;  3EHQ A;  1VQN T;  3V7C A;  1D1B A;  1YJ9 A;  1PG5 B;  1K73 U;  4CRI A;  3CCR Q;  1G3W A;  2EYX A;  4M7D G;  2MIO A;  4JLI A;  1VQ5 A;  3M0U A;  1M2V A;  1MMA A;  1VQ4 T;  3T9N A;  2B8A A;  4BB7 A;  2BKD N;  4J83 A;  3CCS Q;  4Y28 E;  4ORZ A;  3OY9 A;  2LNH B;  2RQW A;  3OS1 A;  1WHH A;  4C0D B;  1LJO A;  1OX9 A;  5GMK j;  1OI1 A;  4FT2 A;  2XKO C;  4M75 A;  1H3Z A;  3L1A A;  1TUC A;  4BY6 C;  2RK1 A;  2F2X A;  2EYZ A;  1HXD A;  3M0T A;  2OAW A;  2YWW A;  3GPL A;  1KQS S;  2HD0 A;  3I56 T;  4A4G A;  4E7J A;  2VUB A;  5LJ5 f;  2CP6 A;  4J9D A;  2D6F A;  3MCA B;  2E3I A;  3R6N A;  4Y91 A;  2QQB A;  2CH4 A;  1BI0 A;  4MML A;  2K3B A;  3VYG A;  5GAO m;  2EGE A;  2J06 A;  4PLI A;  2GTO A;  2HBP A;  3QJY A;  3OS5 A;  1N27 A;  2DEU A;  1WXU A;  1D1A A;  2JN0 A;  5L8R E;  3CCR T;  1UHC A;  2EPD A;  3G6E A;  2M16 A;  2GNC A;  4IIM A;  3LWI A;  1VQ6 A;  2RHY A;  2JOY A;  1B07 A;  2COW A;  1ZBX A;  3FLG A;  4GLM A;  5IT9 E;  1VQO A;  3UPU A;  4BDZ A;  1U1T A;  4PKC C;  2MAM A;  3X25 B;  4X9C A;  3THK A;  4Z88 A;  4RTT A;  2DTO A;  1AWX A;  4FYX B;  1XOV A;  1ARK A;  4PJN A;  3ZL7 C;  2CS7 A;  2CP5 A;  3OS0 A;  4MZM A;  4EMK A;  3CCM Q;  3PNW C;  1VIF A;  3SDZ A;  1KC8 R;  2LQN A;  4M75 D;  3H0H A;  5I21 A;  4DBH A;  2YLC A;  1RI0 A;  2QEX A;  2NUP B;  4QQG A;  4E7Z A;  5FRN A;  1NBE B;  5GAN 8;  1W2B P;  1B34 A;  2XHC A;  4MZT A;  4M78 D;  4AFQ C;  3VS2 A;  2E5Q A;  1R0C B;  2NUT A;  1VQK Q;  3HFN A;  4QW2 A;  3MJX A;  3PGG A;  1TOV A;  2CH4 W;  1MMD A;  1RL2 A;  4KRT A;  4E7K A;  5CIU A;  2FG0 A;  3A8G B;  4PFO A;  1M1F A;  2CT3 A;  2HMA A;  2DD5 A;  2L2P A;  4AG2 C;  3CC2 A;  2JNG A;  2RI2 A;  4GY5 A;  1VA7 A;  2DRK A;  4FSS A;  5GMK l;  1D3B A;  2XMF A;  3CME Q;  1OOT A;  3CMA Q;  2JM8 A;  2EIF A;  3A8O B;  4OMO A;  3HFO A;  1J3T A;  4RTW A;  2CDT A;  1U1S A;  3JB9 I;  1E6H A;  3OYC A;  4XTW A;  5CKD A;  4RTY A;  5D6X A;  1EIF A;  2SRC A;  1JO8 A;  3D7S B;  2C06 A;  2B86 A;  1NJI C;  3I55 Q;  1VYT A;  1WXB A;  4IIO A;  4TVR A;  2QXF A;  1GXI E;  1KK7 A;  3KFV A;  4KH0 B;  3FC3 A;  1VQ9 A;  3CCM T;  3JCM J;  5D6W A;  1T0H A;  4GLK A;  2V8J A;  1R0B G;  1LVK A;  5I2S A;  3QZ9 B;  4F7U B;  4EDU A;  1QCO A;  1AZG B;  2DVE A;  1NJI R;  4KT0 E;  2E70 A;  2EKO A;  4C8Q D;  1W2B A;  5D7U A;  3CCL A;  1WIE A;  2JJ9 A;  1VQK T;  4LD9 K;  2ATC B;  2DJZ A;  2LJ0 A;  3L2Q A;  3P8D A;  4M77 B;  3CCJ Q;  2V1Q A;  1N8R C;  5CKH A;  1YJW T;  4Z02 A;  2CUD A;  1SSF A;  1NYG A;  2QI2 A;  1N9S A;  4FT4 A;  1U06 A;  3UWN A;  3CME T;  2K4Y A;  1ZUK A;  1Y96 B;  2EYQ A;  2HSE B;  2X4Y A;  2M02 A;  3CMA T;  2DAQ A;  2VWF A;  3CCV Q;  3G4S Q;  5AYF A;  1M8M A;  3GNG A;  3A8H B;  4NOY A;  1Q7Y U;  1YHQ A;  1MND A;  2F1L A;  2OTL Q;  1VQL T;  5GAN h;  4DEX A;  2X9H A;  4JJD A;  1AWW A;  3MEU A;  3HRU A;  2K57 A;  2OX7 A;  2JMC A;  3VV0 A;  2KRS A;  1EZZ B;  2MPX C;  1W70 A;  4ANJ A;  1D09 B;  3M9Q A;  2RM4 A;  1N9R A;  1K73 C;  5GAM e;  2E1H A;  2DXT A;  1KSW A;  1FXX A;  4XU2 A;  5GMK m;  1TSF A;  1YIJ Q;  2EAY A;  3M4Y A;  3X20 B;  3HHT B;  3O8V A;  4LXC A;  3V8L A;  3M4G A;  1PHT A;  4CC7 A;  1Q86 U;  4M7A D;  3CC4 Q;  2MF2 A;  2XDP A;  4Z8A A;  3OYF A;  3CCJ T;  3PT9 A;  4IUP A;  2ZZD A;  3IQL A;  1K73 R;  2F69 A;  1AWO A;  1W2B S;  2KDS A;  4FW2 A;  4RG2 A;  1PD1 A;  2JXB A;  3A5Z B;  1M3A A;  1X75 C;  3GOX A;  3VS6 A;  1VQ5 Q;  3CCV T;  3VKI A;  1M8V A;  3G4S T;  1UDL A;  3JCM g;  1YNZ A;  1ZHI A;  4E7H A;  2KYM A;  2OTL T;  4LE9 A;  2GFA A;  1ZBJ A;  4M75 C;  2DYI A;  5FRO A;  1I1J A;  1BI3 A;  3BDL A;  2ENM A;  3WVD B;  2HQH A;  2C0O A;  3CCU A;  3J81 E;  2EBP A;  2KYB A;  1EFN A;  2KT1 A;  3NPF A;  1Y7X A;  1I5O B;  4M78 C;  4DQ2 A;  5GAM h;  1GL5 A;  2CSI A;  2DL5 A;  3OYL A;  1BI1 A;  3QDF A;  1NZ9 A;  1PNJ A;  1GCQ A;  5KCO A;  3QG1 A;  1T3L A;  2CGH A;  3R6O A;  2FB7 A;  3CC4 T;  2RI5 A;  5IH2 A;  1ZSZ C;  4N4G A;  2A36 A;  2AKL A;  4J9I A;  4JRQ A;  1WJS A;  3CD6 A;  1ZA1 B;  2DBK A;  3CBP A;  3DLM A;  3CEY A;  3MEV A;  5GAO q;  3G71 A;  1YJ9 T;  1Z9Q A;  3EGD B;  3O5Z A;  1MUZ A;  2KSS A;  3QPH A;  2AZS A;  3G6E Q;  1H64 1;  1RAI B;  2HNI A;  1F1B B;  3EH2 A;  2OTJ A;  1VQ6 Q;  5C6S A;  4M77 A;  3RKY A;  1VQ5 T;  4C92 F;  3QSU A;  1VQP Q;  2Y4Y A;  5FLX E;  2EGC A;  2L8D A;  1MV0 B;  1VYU A;  3GLX A;  2KAF A;  1IHW A;  3BFM A;  4AFZ C;  4PFZ A;  4OB1 B;  3HP9 A;  1IHV A;  3I5S A;  3EGX B;  1RI9 A;  2L3R A;  4F16 A;  3JCM d;  4BI4 A;  1YCY A;  1TTH B;  2AT1 B;  1WHJ A;  1ZUU A;  4EMK C;  2GGR A;  1O9S A;  4N0A A;  2LDM A;  2FZC B;  3FJ5 A;  4NS5 A;  1FWZ A;  1D0Y A;  3CBO A;  3JSC A;  2KY9 A;  2CZ1 B;  2LX7 A;  2BTT A;  3OB9 A;  1JJ2 P;  4OMN A;  2ZPF B;  1IO6 A;  2CYZ B;  2JTF A;  5IHN A;  4JS5 A;  2FPE A;  3OYN A;  4RTV A;  3A98 A;  1ZSG A;  4J6Y A;  1CKB A;  4M75 B;  1M90 U;  4QT7 A;  2AHJ B;  4XTU A;  2F5T X;  2KXC A;  4UC4 A;  2XI9 A;  3G6E T;  3CC2 Q;  3VYH B;  3ZBD A;  1VQ6 T;  4M78 B;  3CCQ A;  4QKU A;  2E64 A;  2HBW A;  3MP1 A;  2E5K A;  2X3W D;  1QP2 A;  1WLP B;  1SSH A;  4QQD A;  1PSF A;  1SRM A;  2M9U A;  1VQO T;  4HCB A;  2PUK B;  2L5Q A;  5LJ3 h;  1K4U S;  1ZSZ B;  2E6Z A;  4PJO A;  4ZTF A;  1QQJ A;  5GAN 7;  5DY9 A;  3H0F A;  3E9G A;  1OU9 A;  4M7D F;  3JCM V;  1VQ9 Q;  1BB9 A;  4F14 A;  1OYX A;  4L5G A;  2E41 A;  4XK8 E;  1VQN Q;  2BZ8 A;  1OV3 A;  1JJ2 A;  1MV3 A;  4HCK A;  2V1R A;  1VYV A;  2QEX T;  2HKN A;  1OZ2 A;  2CSQ A;  1D0Z A;  1U5S A;  2EQI A;  4MDX A;  1KHI A;  4IUR A;  5CKE A;  1M1K U;  3PMT A;  4R56 A;  2YUP A;  1VQ4 Q;  2QGF B;  3SFM A;  2EVR A;  1Q7Y C;  2ZPE B;  3QDR B;  4C92 E;  2KR3 A;  3CC2 T;  3JV3 A;  4C8Q B;  3KBG A;  2J05 A;  1VQM A;  2DTH A;  1I0C A;  4E7S A;  4BDY A;  2DK3 A;  3EGD A;  2DIG A;  3RDV A;  2R57 A;  2DFU A;  1W1F A;  1OPK A;  4KH1 B;  1LNX A;  3I56 Q;  2AIR B;  1KG1 A;  2BUD A;  2OI3 A;  5LJ5 e;  1Q86 C;  4LDW A;  4QVD A;  4KGX B;  4LDY A;  3EHR A;  4JUV A;  2OAU A;  3L2R A;  1VQ9 T;  3M5A A; 
#chains in the Genus database with same CATH homology
 3CCQ Q;  1KQS P;  1K73 R;  3CCV Q;  2QEX Q;  3CME Q;  3OW2 P;  1Q82 R;  3G6E Q;  3G4S Q;  3CCS Q;  1VQ4 Q;  1N8R R;  1YJ9 Q;  3CXC P;  1Q7Y R;  1VQ9 Q;  1M90 R;  1S72 Q;  1VQ8 Q;  3CMA Q;  3CCJ Q;  1W2B P;  1QVG P;  1K9M R;  1VQ6 Q;  3CCR Q;  2OTJ Q;  1YI2 Q;  1VQK Q;  3I56 Q;  1Q86 R;  1K8A R;  1VQ7 Q;  2OTL Q;  1YHQ Q;  1Q81 R;  1YIJ Q;  1VQP Q;  3I55 Q;  1VQN Q;  3CC7 Q;  1QVF P;  3CCU Q;  3CCM Q;  1VQ5 Q;  2QA4 Q;  1KD1 R;  3CD6 Q;  1VQM Q;  1YJW Q;  3CC4 Q;  1KC8 R;  1M1K R;  1VQO Q;  1YJN Q;  1NJI R;  1VQL Q;  3G71 Q;  1YIT Q;  3CC2 Q;  3CCE Q;  1JJ2 P;  3CCL Q;  3CPW P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...