1VQ7Q

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq7Q00
2OTJQ 1NJIR 3CCVQ 1YITQ 1K9MR 1JJ2P 3CCUQ 1N8RR 3CPWP 1K73R 3CCSQ 3CD6Q 1M90R 3OW2P 3CCEQ 3CMEQ 1VQ7Q 1Q86R 1VQ6Q 3I56Q 1VQ5Q 1M1KR 1KQSP 1VQNQ 3G71Q 1VQLQ 1YJWQ 1VQ8Q 3CCQQ 3CCRQ 1YIJQ 1VQMQ 1YHQQ 1W2BP 3G6EQ 3CXCP 3CCMQ 1YI2Q 1Q81R 1Q82R 1KD1R 1VQ4Q 1VQ9Q 3CMAQ 1YJNQ 1VQOQ 1S72Q 1QVGP 1KC8R 3CC4Q 1YJ9Q 1QVFP 2OTLQ 1VQPQ 1K8AR 3CCLQ 3CC7Q 2QA4Q 3I55Q 1Q7YR 3CCJQ 2QEXQ 1VQKQ 3CC2Q 3G4SQ
chains in the Genus database with same CATH superfamily
1RAFB 4J6WA 4M75D 1I4K1 3ER0A 3L2WA 1VQ9A 1OPKA 2XDDA 4ANJA 5LJ3g 3SD4A 1LNXA 3M0UA 2AT1B 3OS5A 2EYQA 1W6XA 4R0KA 2KRNA 2AKLA 3GP8A 2D8JA 1I81A 1ZHIA 4CC4B 4C8QD 4RMOA 1M8MA 4Q5WA 1MNDA 3GNFB 2DVEA 3JV3A 2AZSA 3JB9G 3NTKA 2FB7A 4O5VA 2NUTB 4L59A 3RMSA 4ZGDB 1K8AU 3U23A 1VYVA 3NFCA 4IKFA 4PJOE 1K9MR 4BDZA 4A4FA 3ZFJA 2PNIA 3WXMB 3BDLA 2LT1A 1N9SA 2DIQA 1ZUUA 1D0ZA 1YWOA 4J9GA 1Q82U 4BY6C 1UDLA 4AG1C 2F2XA 4XTZA 3H0FA 2HSEB 1KQ2A 1PSFA 4QVDA 2YLBA 1BI2A 3OW2P 1PD1A 2FG0A 3C94A 3JB9J 3EGXA 4OMQA 3E19A 2EQIA 4C92A 1G3TA 2EBPA 1PC0A 2DBKA 3GNGA 2C0IA 4A53A 3BDUA 2VWFA 1KC8R 1OULA 2ATCB 3OB9A 2Y4YA 2LDMA 4KT0E 1GFCA 1XOVA 3M54A 2QYZA 5DLQE 1N8RR 3LGLA 3PVLA 4IUPA 2VKNA 4BUGA 2QTXA 5FU7B 1VQLQ 5J26A 1VQ4Q 4AMCA 3OYKA 3CC4Q 3GF5A 3J80E 1JXMA 4PJLA 2GCXA 1I5OB 4B9WA 4A4HA 2F1LA 3M58A 3V8JA 2K3YA 5LJ3f 2OAUA 4M78C 3CCUQ 1K9MC 1GFDA 2YXYA 1JRIA 2RHZA 1NPPA 1H92A 4JJDA 1VQNQ 4GLKA 2GFUA 3EGDB 1UEBA 2K9GA 3A8OB 4M7AF 1VQLT 2B8AA 5L23A 1VQ4T 1PKSA 2GGRA 2JTEA 3CC4T 3CC7Q 1RLPC 3DB3A 3S3OA 4N4IA 4HXJA 1I5LA 4KGZB 3JB9H 3CCUT 1SHFA 5A0GA 3OA6A 4BDYA 1D3BB 1M90U 3H8ZA 3VS5A 1VYUA 2HDAA 1TH7A 3LH5A 4J83A 1VQNT 3CMAQ 1M30A 1YN8A 2XICA 1KC8C 4DOWA 3OYLA 4XQ3A 2YLCA 1WZOA 4NL2A 3CC7T 4ESRA 4OVAA 2NYSA 2V1RA 3JCMV 1G83A 1N6AA 1N8RC 2M0YA 4RTZA 1QVGA 1Y71A 1BI0A 1K4US 1I0CA 2KR3A 2QDLA 3CCQQ 4E7LA 2DXUA 3KUFA 2BUDA 2QAZA 1Y96A 2NUPB 5CO7A 3CMAT 3REBB 4XTXA 4LDUA 3UT1A 4BE2A 1Z9QA 5CK9A 2LNVA 1VQLA 1SEMA 2KROA 5CAIA 4J6XA 1OOTA 2K5IA 2DKGA 5KYNA 3CC4A 2Y4XA 1FMWA 4OMLA 4M75G 3CCQT 8ATCB 1M27C 3M4GA 4M7DB 3FEOA 3OYDA 4LE9A 3VUZA 5GAMj 1WFWA 3CCUA 3RR6A 2BKDN 1GRIA 3JRZA 1K73R 6AT1B 3V7SA 5HY6A 1VQNA 4MDXA 3KBGA 4HVVA 5KYYB 3VS7A 1RAGB 4J9HA 4QKUA 5LJ3j 1AVZC 3VS2A 3M5AA 4PJNA 1VIEA 1IZ6A 4C8QG 3CC7A 4JZ3A 1TUDA 3RKXA 1JQQA 2L8DA 8AT1B 2COYA 2RO0A 3JCMg 4M7DD 2L3PA 5L8RE 2O01E 4F7UG 1FXXA 5IXBA 4QQ6A 3P8DA 3CMAA 4BI8B 1WHJA 2CREA 1Q81U 2J6KA 4AFZC 1JXOA 1KHCA 5FWCA 2HSPA 3QWYA 5KYWB 4LDVA 4JJNK 2FL7A 4C92D 4LDXA 2ZPIB 3CPWS 3CCQA 3JB9F 1OI1A 1ZSZA 1VQOA 1M1FA 1ZA1B 3L2QA 4IUTA 3LLRA 2ESWA 2KXDA 3HHTB 2DERA 2PVGB 1X69A 1UGQB 5GAN7 4M7AC 2GTOA 2A36A 3HPWA 2XK0A 1RL2A 1MV0B 1TG0A 1QKWA 2WSEE 1QWEA 1K73C 4LN2A 2PQWA 2WSFE 2C06A 4RTYA 4J5YA 5GMKe 2CP5A 4PK4A 3J7AF 2ABLA 1W2BP 1VQMQ 4DEYA 2MOXA 1X6GA 3FJ5A 1UB4A 4V2SA 3JAME 2VVKA 3SB2A 3H0IA 2AIRB 3G4SQ 4Y28E 1G3SA 3E9GA 2ZGWA 2HQEA 3VRZA 3DLMA 3X25B 3EH1A 3RKWA 2NLUA 2O4XA 3META 1PKTA 1HSQA 1QLYA 1VQ8Q 3LH0A 2DZ9A 4PJOB 2SEMA 3CXCS 1VQMT 3SEMA 3AHUA 1WGSA 1AOJA 4EMKC 4D6WA 1VUBA 5IHNA 5CR2A 3BFMA 2EW3A 2SRCA 1PNJA 3G4ST 1VQ6Q 5FRNA 1G2BA 1U8RA 3G71Q 3JCMf 2A7YA 2RJDA 4C8QA 2QG9B 4ME7A 1BIAA 1VQ8T 2BTTA 1U06A 1QMCA 2JNGA 5GAMh 3VYHB 1IO6A 2ROLA 2D1XA 4A4EA 4R56A 2K57A 1Y07A 2J6OA 3R6NA 3EFSA 2K7AA 4FL6A 5LJ3h 2YUQA 2CT4A 2OTLQ 3HSBA 1VQ6T 4E7KA 1GCPA 2D0NA 4GBQA 5KE3A 1JBMA 2DXBA 3G71T 1QVGP 2ED1A 2FO0A 1E6HA 1M2VB 2VXFA 5C6SA 2JVVA 2RD1A 2DVJA 1ABQA 1BBZA 2DLPA 3QDRB 3VS0A 3C0CA 1AZEA 2FRWA 2EFIA 4N0AC 2F69A 5GAN5 2LVMA 3VS3A 3M59A 1Z9ZA 3OBYA 1VQMA 2NUTA 2JTFA 2OX7A 2KK4A 2OTLT 4J6YA 3P8HA 4IUQA 3G4SA 4ELZC 2E70A 3FJPA 1Q7YR 2HBWA 5DM7R 1KG1A 2E41A 5LJ3d 1H3ZA 2KE9A 4HA8A 3GOXA 2VUBA 3SWNB 3EFOB 2V8IA 2K5FA 2EJFA 1N5ZA 4M7AE 1UG1A 3OYHA 1IHWA 5AT1B 4RCCA 2X3WD 3RIRA 2E6ZA 3UWNA 2DYBA 1VA7A 5CKEA 2XI9A 4LD6A 3G71A 1XQHA 1RADB 2DK3A 2FZCB 3QBYA 3HRSA 2K4YA 2RHXA 2YWWA 3QO3A 2KSSA 2HL3A 4FYWB 1K1ZA 3CEYA 1HD3A 2NUZA 4XU3A 5I22A 4PLIA 4A63B 1CSKA 1PD0A 2ECZA 1QCOA 2MK5A 2R5MA 3KXTA 3PIPA 2P84A 4BB7A 2KYBA 3JCMb 4OF1A 2RQWA 4C92G 1M5Q1 5GANg 1AWJA 2CP6A 1IREB 2KVQG 3I5SA 1MHNA 3M4YA 1Q7YC 4M78F 4F7UF 1MUZA 4BY6B 3EGDA 4F17A 2DF6A 4JPBW 4C0GA 4J8OA 2EYZA 3S3NA 1M1KR 3V7RA 4FSSA 3MJXA 3VS6A 3L2ZA 2ZZDA 1HYOA 1TWBA 4C0ZA 2HBPA 4C0DC 1PWTA 3THKA 4OMPA 2JS2A 2CP0A 1NE8A 2YHTA 4HVUA 1D3BA 1OQKA 2P4RA 5HK3A 3CQTA 1NJIC 2DIGA 3ZBDA 1ZUKA 4FW1A 2IPOB 1BCOA 2YUNA 2QASA 3OW2S 3MP6A 4M77F 2VB6A 4ZGEB 1BKBA 4C0FA 2ZCFB 1QP3A 2FHDA 1SRLA 3M0QA 4QQDA 4ELYC 4FCYA 1BIBA 1KC8U 2O2OA 1BI3A 2CUDA 4EPCA 3CCSQ 4RTXA 2QXFA 1N8RU 2NUPA 4DOVA 5GAN4 4CRIA 4M78B 4JDSA 2AK5A 2FZKB 2CZ0B 1S72Q 1LVKA 3F70A 2ED0A 1T3SA 2CUBA 1AWOA 3QSUA 4XAXB 2JM9A 1KK7A 2C0TA 4XK8E 1EX4A 2K79A 4DEXA 4R55A 5IHKA 4PLLA 2O88A 3CCST 4M7DA 2K5LA 1HXDA 2LCSA 1M1KC 3NTIA 1UE9A 3S3MA 2DEUA 1YI2Q 3VRYA 1A0NB 2GF7A 2JUFA 1WJSA 1QW1A 2RN8A 3J81E 2R58A 1U1SA 3JCMQ 1S72T 4M77B 5DLOA 3UDCA 2CGHA 2RHIA 5KYYA 3EG2A 1BU1A 5GANf 4DBHA 2KEAA 2EGCA 1NEGA 4M4ZA 1VQ5Q 2JS0A 4M75C 3JCMJ 3EGUA 3OYMA 3EG3A 3VJPA 4KGXB 2O9VA 1YI2T 1RI0A 4Z89A 3JCMh 2DJQA 3VV0A 4J9BA 4B9XA 3I5RA 2CZ6B 5J3BA 3A8MB 2VYTA 5DY9A 1KFZA 2K3XA 3RMQA 2K6DA 2M51A 2M0OA 5GAMf 2P0QA 1VQ5T 4E7HA 4Y91A 3OQ5A 5KYWA 3NGPA 5GJWB 1TSFA 2KY9A 2DAQA 2JXBA 2AHJB 1LOJA 2HAXA 3PFSA 2FPEA 3CCSA 2VC8A 2RB6A 1D0YA 2PUOB 4IIOA 3JSCA 3M53A 2DM1A 2DEQA 2YRCA 3JCMd 1UGRB 5GMKj 3EHRA 4L6V5 1S72A 2JMAA 3FLGA 4FYYB 2KT8A 4XU2A 4FM4B 2LNHB 3A8LB 1OU9A 1VQKQ 2DL8A 1V76A 1YCSB 3OS2A 1D09B 1YI2A 1SSFA 2BE9B 2RA2A 1YIJQ 3CCMQ 4M77C 1UFFA 1NLOC 2XIDA 3CPWA 3O5ZA 1Y57A 4F16A 4PFZA 4DA4A 1UJ0A 2DRKA 2F5KA 3I35A 2EJ9A 5FRMA 1VQKT 1VQ5A 1K9AA 4ZN1A 2E12A 4PJOA 3INZA 2V8KA 2YUOA 2E5KA 4KBMB 5FW9A 3PVQA 2BZYA 3MEAA 3NTHA 3GIBA 5GANj 3E9FA 1M8VA 3CCLA 4RTVA 1VQOQ 4MZMA 1YIJT 2DL4A 2HCKA 3CCMT 2OI3A 1B34B 4JJCA 5GAOl 4RUGA 3MO8A 3MHXA 2JN0A 3GPLA 4M7AB 1M3CA 3CD6Q 3QYHB 4IIMA 3X26B 1VOMA 2R5AA 4BE0A 2J05A 4J7FA 4DBRA 3OS0A 2HQXA 1VQPA 2RJEA 2DPPB 3PGGA 4KH1B 1VQOT 4CC2A 1X27A 2MIOA 4AFUC 2ZPFB 4OGCA 4F04B 1UGPB 1G8XA 2D6FA 3OMGA 3CXCA 1FMKA 2DNUA 4GY5A 1FX7A 2EQUA 4M75E 3CD6T 2AKKA 3I56Q 3URGA 5FU6C 3UF4A 2XU8A 1M2VA 4RKUE 2P0KA 1HK9A 2RH2A 2A28A 1IGUA 1CKAA 1RAHB 1W2BS 5CVIA 4BE1A 5GAOr 3A1PA 1VQKA 3C4SA 3QWXX 2ZPEB 3LYIA 3MEVA 4ZNXA 1QP2A 3CC2Q 5GMKi 1GCQC 1WPYA 2HZYA 3A5ZB 4EMKB 4JRKA 3EG1A 1M90R 1OYXA 1M9SA 4WTOB 4ZTJA 1FWZA 1YIJA 5M9OA 3CCMA 1WHKA 1TXQA 2GNCA 3M9QA 1EIFA 2DL7A 4OB1B 3T9NA 3I56T 4E2FB 1KQSS 2DFUA 1D1BA 1ZQ1A 2FRYA 3M0TA 2DTHA 2LJ3A 1F1BB 2MAMA 4M78E 4F7UE 3SWNA 3EFOA 4MDWA 2EIFA 1XNIA 1WX6A 2CZ1B 3CC2T 2KGTA 3HKSA 2J7IA 2E5QA 2KI7A 2IIMA 5GMKh 1TU0B 2MCNA 2JMCA 1ABOA 2VV5A 2F2VA 4RG8A 2VGMA 1YWPA 1JJ2A 4RTTA 3OYIA 3FDRA 3BE3A 1GBQA 3CD6A 3OBWA 3VU3C 3TSWA 2BZ8A 4ATOA 2DETA 4M77E 4PL6A 2JTMA 2PVOB 4ZGJB 4OMFB 5AYFA 1PRMC 2W10A 1TS9A 2L89A 3EG0A 4KULA 4L5GA 2LCCA 2QQAA 2RI3A 3MP1A 2QTVA 2YT6A 3I56A 1AEYA 1NBEB 2B86A 1RI9A 3TSZA 5GJVB 5GANh 1RUWA 2KYMA 1UTIA 1YJ9Q 3X20B 2EYWA 3CC2A 3MEWA 4DBQA 2RHYA 2QK0A 2QI2A 3TEEA 1K0XA 3H0HA 3VKIA 3PIOA 4QT7A 1Q7YU 5IHIA 5GAN3 1M2OA 5IT9E 2L0AA 2CP3A 3A8HB 2JOYA 1EFNA 4C92C 4LDYA 3M55A 2G3RA 2DMOA 4JLGA 3EH2A 3CCJA 3BW1A 4PKCC 2ZPBB 2QDYB 1YJ9T 2M02A 4PJOD 3JCMP 1YFNA 5GANd 3OYEA 3QZ9B 3CPWP 1UJYA 1QVFA 1AWWA 4B6MA 3JB9D 2XD0A 3P8BB 4HCKA 3CCEQ 1TUGB 2ROTA 1NJIU 2FZGB 2LX7A 4QVCA 2KDSA 3PMIA 1OU8A 1SG5A 3FB9A 3FC3A 3PTAA 3L2RA 2A0FB 2F5TX 1NZ9A 2MMPA 4XU1A 3MP8A 5D6WA 1N9RA 3QYGB 5I2MA 4M78A 1YITQ 2E3IA 2ZPGB 5EC7A 1B7TA 4FW2A 4HVWA 2XG8D 1D1AA 3FRNA 3RESA 1EZZB 3CCET 1OX9A 5GAMd 1AT1B 1ZA2B 2FVUA 5KE2A 5I2SA 2X51A 4AFSC 2RNAA 1JO8A 3VYGA 2YDLA 5KYXB 7AT1B 3OW2A 2RI2A 1WYXA 4D8KA 1LCKA 2QEXQ 4KRTA 4C0DB 4OMMA 2RQUA 4GLMA 2CSQA 3RKYA 1YITT 1VQ7Q 3NMZC 5LJ3e 2A37A 3PE0A 3M0RA 3MEUA 1UGSB 2DXTA 3H41A 3R6OA 5D6XA 2RM4A 1YJ9A 2L5QA 1M1KU 3QHSA 2KRMA 2PZ1A 4VUBA 5CKHA 2RQVA 2AZVA 2CYZB 1ZBJA 2RHUA 5IAYA 2OTJQ 1JEGA 2V8JA 2JZ2A 5HKCA 2QEXT 1SRMA 1WLPB 3OSVA 4M75F 2Z0WA 1VQ7T 1R0CB 4M7DG 1B07A 3G6EQ 4ZTFA 2X4WA 3CPFA 2O31A 5GAN2 4N4HA 4EDUA 3EG9B 5KCHA 1RAAB 1WXBA 1VIFA 2JJ9A 1UHFA 1SHGA 3CCEA 3L2VA 2D8HA 4DBFA 5C0MA 4LDWA 2OTJT 1C6VX 4IUUA 5GAOm 1OX8A 1UGVA 3MPUB 1VYTA 2IVWA 2EJGA 2LMJA 4C8QF 3M0PA 4X9CA 1R77A 5CKDA 2HEQA 3G6ET 1IB8A 4PNOA 3OYFA 2CH4W 1YITA 1K76A 3QXEB 5CCAA 3OMCA 1V1CA 1JJ2P 2EPDA 1D0XA 2CP7A 1NEBA 2H3JA 1AWXA 1Q86R 1K9MU 2YRVA 2VXEA 5LJ5e 2QQSA 1H641 4X9DA 2MYSA 3RNJA 3OYJA 3ME9A 4JS5A 3E1SA 1IXDA 3ASKA 1X6BA 3NHNA 2QEXA 1TUCA 4M75B 1X75C 2MWOA 4C5EA 1C1AA 2JW4A 3RERA 5KYUB 1VQ7A 4HKEA 3CBOA 2HMAA 2X3XD 2RMOA 2YRDA 5FLXE 1ZUYA 4WF2A 2EQJA 3LWHA 4OMOA 3VS4A 1KD1R 1WHGA 4EMGA 4PFOA 1H8KA 3DKMA 3LGFA 3QZ5B 1LJOA 2OTJA 5GAOq 2VGNA 4C5HA 2EWNA 3VUBA 3L42A 4XTUA 3A98A 2ZAEA 4KUDK 1QVPA 2CSIA 3E2UA 1AD5A 1KIKA 5FROA 4MMKA 1AHJB 3G6EA 1QWFA 4A54A 1B34A 1ZSZC 4AT1B 4F7UB 2EYYA 9ATCB 1YHQQ 2COZA 1AZGB 4M7AA 3VS1A 1FMVA 2RQTA 1QCNA 1M4ZA 1X2QA 3QUIA 2PTKA 1ZX6A 1KSWA 4LD9K 1Q86C 1OV3A 2M16A 4PJOG 1QVFP 3HFOA 1NM7A 3EFRA 2ZPHB 1T0JA 2KMTA 1YHQT 2DD5A 4M78D 5GMKl 1WJQA 4D8DA 2PUKB 4WCIA 1E7OA 1WIEA 4C5GA 1GBRA 1MNEA 1BK2A 2GTJA 2RJCA 2VASA 1WHMA 2DO3A 2HD0A 2HL5C 2WACA 1KD1C 1OEBA 3ZEHA 1R8OB 4II1A 2KRSA 4J9DA 3X28B 4EMKA 1QKXA 3CCLQ 3GLXA 1TTHB 1SF9A 2A08A 4XTYA 2OJ2A 1W1FA 3CCVQ 4Y92A 2RI5A 3CMEQ 4M77D 1M3BA 3OYNA 5CKFA 1NYGA 3M57A 4J9IA 2NWMA 4C8QC 5A0LA 5LJ5g 2DZCA 4X34A 1VQPQ 2QQ9A 2QA4Q 1YNZA 2BIVA 5LL6S 4A4GA 3CCLT 2JT4A 1W2BA 3V7CA 4CI0C 4E7SA 4QVZA 3CCVT 2LZ6B 1YHQA 1OPLA 3CMET 2V1QA 3JCMe 4NOYA 3ZL7C 5FU6B 4MZPA 2PVDB 1K8AR 1VQPT 1D1CA 2QA4T 1KQSA 4TVRA 1LPLA 4N0AA 4RCBA 4ORZA 1WHHA 1T3LA 2EKHA 3RUXA 1K73U 1O9SA 2FPDA 2X35A 1Q82R 2E1HA 4PJJA 4N4GA 4E47A 5I21A 3JCMc 1ARKA 3UA6A 1FYNA 3L2UA 4JZ4A 1RABB 4X1VA 3WVDB 1XJWB 4M7DF 3EHQA 2IG0A 1U3OA 4PFPA 4LXCA 1X2KA 4PJMA 3MCAB 1M3AA 2E3HA 2I0NA 4C5IA 1PHTA 1RLQC 3CCVA 3JB9I 1RACB 3JCMX 3OS1A 3QPHA 5CKBA 2X4JA 5HCKA 3CMEA 4BACA 1Y7XA 2XKOC 4MMLA 4NS5A 4A4KA 3HRTA 1I1JA 2GQVA 1YCYA 4C92F 5J39A 2EVRA 3A8GB 4HCBA 3LW5E 2KT1A 4IUVA 4NL3A 1XTDA 4F14A 1OZ3A 1WXUA 2QA4A 2CS7A 2M9UA 2A3LA 2GFAA 4Z02A 3X24B 2EQKA 1WNLA 1K8AC 5KH6A 2MWPA 1PG5B 2DRMA 2L3QA 2MPXC 4OGEA 2E6NA 4XU0A 5FU7C 5LJ5f 2QGGA 2FYKA 1MMAA 1WA7A 2P0PA 1VQ4A 1NG2A 4OP0A 1JU5C 2EQMA 2L3SA 2LQKA 4M7AD 1Q82C 2CDTA 4HCZA 3SDZA 3IQLA 4KGVB 2L2PA 2C0OA 1IGQA 2DD4A 1W70A 3OYCA 2YSQA 3CBMA 3PT9A 4J7IA 2LQWA 1IRXA 2YUPA 3D7SB 2RK1A 3MKDA 3C12A 3UPUA 3JCMW 4C8QE 5KYXA 2KNBB 2FPFA 2LJ0A 4JJBA 3BY7A 2X4XA 1YJNQ 2XDPA 4E7ZA 4HT9A 1RAIB 3EGXB 3O8VA 2L3RA 2MI6A 4JUVA 4AFQC 4C92B 4O6JA 4EIKA 2XHCA 2LRQA 3CCJQ 5CQYA 5GAOn 2OAWA 3G1JA 5ECAA 3HL8A 3TU4K 2LTOA 2HKNA 2HNIA 1PSEA 4KUIA 4M78G 5IH2A 2ENMA 1WI7A 4CC7A 1U5SA 1NPRA 3LX7A 3CCRQ 2HQHA 5CIUA 2XDBA 3UATA 4FYXB 2Y90A 1YJNT 4CC3A 2EGAA 2K3BA 1MMDA 1X43A 4PJOF 2EGEA 3CCJT 2KAFA 2LJ1A 1M1GA 3H9NA 4HCCA 1WJRA 1MMGA 2GBQA 2K2VA 3OSSC 4OB3B 1YJWQ 3EG9A 1P92A 1OZ2A 2M1HA 5D6YA 3PMTA 3QKJA 4M77G 3CCRT 1GL5A 4FT4A 3PNWC 3OYGA 1QVGS 5HK0A 5GAN6 2RF0A 1B3QA 1DJ7B 1RAEB 2PU9B 1SSHA 3DLLA 1I07A 1G5VA 2MF2A 2I2LA 1U1TA 1KQ1A 1M90C 2BZXA 2LQ8A 2E10A 4J9EA 4M7DC 5LJ5j 2CP2A 2DTOA 2W0ZA 2DILA 1YJWT 3TQ7P 2K2MA 1QQJA 4JLIA 4BD3A 4JRPA 5GAOp 3S6WA 1BYMA 4UC4A 1KJWA 2DL3A 4HT8A 1ZLMA 1UECA 4JS4A 3CBPA 1UHCA 3SHWA 1W4SA 5GMKm 4FYVB 2QQRA 1KQSP 4QQGA 3EAEA 4M75A 1HJDA 1YJNA 2H8HA 2D9TA 1PCXA 2DXCA 1Q81R 4FU6A 4J9FA 5KYUA 2KQWA 5FWBA 2BE7D 3HTRA 3OYBA 3UA7A 1BCMA 2FEIA 3I55Q 3L1AA 4Z88A 3TREA 1Y96B 3QG1A 4E7JA 4XTWA 3V8KA 5CQXA 2LP5A 2LQNA 2CT3A 5GANe 3CCRA 2E64A 2H3EB 2COWA 4FSXA 4LNPA 1I8FA 3GBQA 2DBMA 1ACMB 5I11A 1MGQA 4AG2C 3QIIA 1K0SA 4LUDA 2J06A 4BI3A 3I55T 3HFNA 2HKQB 4F7UA 1PM3A 4KH0B 1YJWA 1YBYA 2CKKA 3N5BB 2V26A 4JRIA 1J3TA 3REAB 1NLPC 5EG2A 1KHIA 2QQBA 2F2WA 2LX9A 5GAMe 1MV3A 2RK2A 3H6ZA 3LWIA 1WQWA 4RTUA 3QJYA 1QCFA 4IURA 2O9SA 1T0HA 2KBTA 3OYYA 4FIBA 4XTVA 3M0SA 2CH4A 3HP9A 1JJ2S 1X01A 1E6GA 2X9HA 1R0BG 2DX1A 1Q86U 1PRLC 4M77A 3CXCP 2RPNA 1IHVA 3OY9A 1H3HA 2E4HA 1Q81C 1WQ7A 2EKOA 2KXCA 1Y0MA 4FT2A 2E65A 1ZBXA 2JM8A 2D0QB 2RQRA 4M7AG 4RG2A 2DTIA 3Q1JA 5A2QE 2EYXA 3AT1B 1VQ8A 4PJOC 1Q95G 5KCOA 5GAN8 5IXFA 3SFMA 2LT4A 4J9CA 1VQ9Q 1V29B 1WDXA 1KD1U 3I55A 2CZ7B 1ZSZB 3DB4A 1TOVA 2X4YA 4EMHA 2LCLA 1G3YA 3NPFA 1NJIR 1MMNA 1CKBA 1VQ6A 1S1NA 3G7ZA 3QDFA 4M7DE 1G3WA 1YP5A 4YTLA 5LJ5h 2RJFA 4K11A 1VQ9T 3FIFA 4Z8AA 1UUEA 1O75A 1WHLA 4RTWA 2P4TA 3C95A 4LUEA 3ULRB 2DA9A 2DE0X 2WSCE 3TVTA 3M56A 4OMNA 4MZTA 2OTLA 2EAYA 2LC4A 4C92E 1SPKA 1N27A 1ZSGA 4P5NA 3RBBB 2QGFB 2R57A 1QVFS 2O4XB 1BB9A 4ZN3A 3OYAA 1BI1A 3WVEB 5IN1A 3HRUA 4JRQA 2DL5A 4OB0B 2DYIA 1GCQA 5A0DA 5LJ5d 2XMFA 3KFVA 1C0MA 2G6FX 3TCJA 3V8LA 1WXTA 4E6RA 4E7IA 1SKUB 3I9QA 1JB0E 1GXIE 4DQ2A 2J6FA 1X6OA 4QW2A 2DJZA 3RDVA 4OB2B 3QJ6A 4BI4A 5D7UA 1NYFA 4C8QB 3SWNC 5GAMg 2GQIA
chains in the Genus database with same CATH topology
2OTJQ 1NJIR 3CCVQ 1YITQ 1K9MR 1JJ2P 3CCUQ 1N8RR 3CPWP 1K73R 3CCSQ 3CD6Q 1M90R 3OW2P 3CCEQ 3CMEQ 1VQ7Q 1Q86R 1VQ6Q 3I56Q 1VQ5Q 1M1KR 1KQSP 1VQNQ 3G71Q 1VQLQ 1YJWQ 1VQ8Q 3CCQQ 3CCRQ 1YIJQ 1VQMQ 1YHQQ 1W2BP 3G6EQ 3CXCP 3CCMQ 1YI2Q 1Q81R 1Q82R 1KD1R 1VQ4Q 1VQ9Q 3CMAQ 1YJNQ 1VQOQ 1S72Q 1QVGP 1KC8R 3CC4Q 1YJ9Q 1QVFP 2OTLQ 1VQPQ 1K8AR 3CCLQ 3CC7Q 2QA4Q 3I55Q 1Q7YR 3CCJQ 2QEXQ 1VQKQ 3CC2Q 3G4SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ Q;  1NJI R;  3CCV Q;  1YIT Q;  1K9M R;  1JJ2 P;  3CCU Q;  1N8R R;  3CPW P;  1K73 R;  3CCS Q;  3CD6 Q;  1M90 R;  3OW2 P;  3CCE Q;  3CME Q;  1VQ7 Q;  1Q86 R;  1VQ6 Q;  3I56 Q;  1VQ5 Q;  1M1K R;  1KQS P;  1VQN Q;  3G71 Q;  1VQL Q;  1YJW Q;  1VQ8 Q;  3CCQ Q;  3CCR Q;  1YIJ Q;  1VQM Q;  1YHQ Q;  1W2B P;  3G6E Q;  3CXC P;  3CCM Q;  1YI2 Q;  1Q81 R;  1Q82 R;  1KD1 R;  1VQ4 Q;  1VQ9 Q;  3CMA Q;  1YJN Q;  1VQO Q;  1S72 Q;  1QVG P;  1KC8 R;  3CC4 Q;  1YJ9 Q;  1QVF P;  2OTL Q;  1VQP Q;  1K8A R;  3CCL Q;  3CC7 Q;  2QA4 Q;  3I55 Q;  1Q7Y R;  3CCJ Q;  2QEX Q;  1VQK Q;  3CC2 Q;  3G4S Q; 
#chains in the Genus database with same CATH topology
 1RAF B;  4J6W A;  4M75 D;  1I4K 1;  3ER0 A;  3L2W A;  1VQ9 A;  1OPK A;  2XDD A;  4ANJ A;  5LJ3 g;  3SD4 A;  1LNX A;  3M0U A;  2AT1 B;  3OS5 A;  2EYQ A;  1W6X A;  4R0K A;  2KRN A;  2AKL A;  3GP8 A;  2D8J A;  1I81 A;  1ZHI A;  4CC4 B;  4C8Q D;  4RMO A;  1M8M A;  4Q5W A;  1MND A;  3GNF B;  2DVE A;  3JV3 A;  2AZS A;  3JB9 G;  3NTK A;  2FB7 A;  4O5V A;  2NUT B;  4L59 A;  3RMS A;  4ZGD B;  1K8A U;  3U23 A;  1VYV A;  3NFC A;  4IKF A;  4PJO E;  1K9M R;  4BDZ A;  4A4F A;  3ZFJ A;  2PNI A;  3WXM B;  3BDL A;  2LT1 A;  1N9S A;  2DIQ A;  1ZUU A;  1D0Z A;  1YWO A;  4J9G A;  1Q82 U;  4BY6 C;  1UDL A;  4AG1 C;  2F2X A;  4XTZ A;  3H0F A;  2HSE B;  1KQ2 A;  1PSF A;  4QVD A;  2YLB A;  1BI2 A;  3OW2 P;  1PD1 A;  2FG0 A;  3C94 A;  3JB9 J;  3EGX A;  4OMQ A;  3E19 A;  2EQI A;  4C92 A;  1G3T A;  2EBP A;  1PC0 A;  2DBK A;  3GNG A;  2C0I A;  4A53 A;  3BDU A;  2VWF A;  1KC8 R;  1OUL A;  2ATC B;  3OB9 A;  2Y4Y A;  2LDM A;  4KT0 E;  1GFC A;  1XOV A;  3M54 A;  2QYZ A;  5DLQ E;  1N8R R;  3LGL A;  3PVL A;  4IUP A;  2VKN A;  4BUG A;  2QTX A;  5FU7 B;  1VQL Q;  5J26 A;  1VQ4 Q;  4AMC A;  3OYK A;  3CC4 Q;  3GF5 A;  3J80 E;  1JXM A;  4PJL A;  2GCX A;  1I5O B;  4B9W A;  4A4H A;  2F1L A;  3M58 A;  3V8J A;  2K3Y A;  5LJ3 f;  2OAU A;  4M78 C;  3CCU Q;  1K9M C;  1GFD A;  2YXY A;  1JRI A;  2RHZ A;  1NPP A;  1H92 A;  4JJD A;  1VQN Q;  4GLK A;  2GFU A;  3EGD B;  1UEB A;  2K9G A;  3A8O B;  4M7A F;  1VQL T;  2B8A A;  5L23 A;  1VQ4 T;  1PKS A;  2GGR A;  2JTE A;  3CC4 T;  3CC7 Q;  1RLP C;  3DB3 A;  3S3O A;  4N4I A;  4HXJ A;  1I5L A;  4KGZ B;  3JB9 H;  3CCU T;  1SHF A;  5A0G A;  3OA6 A;  4BDY A;  1D3B B;  1M90 U;  3H8Z A;  3VS5 A;  1VYU A;  2HDA A;  1TH7 A;  3LH5 A;  4J83 A;  1VQN T;  3CMA Q;  1M30 A;  1YN8 A;  2XIC A;  1KC8 C;  4DOW A;  3OYL A;  4XQ3 A;  2YLC A;  1WZO A;  4NL2 A;  3CC7 T;  4ESR A;  4OVA A;  2NYS A;  2V1R A;  3JCM V;  1G83 A;  1N6A A;  1N8R C;  2M0Y A;  4RTZ A;  1QVG A;  1Y71 A;  1BI0 A;  1K4U S;  1I0C A;  2KR3 A;  2QDL A;  3CCQ Q;  4E7L A;  2DXU A;  3KUF A;  2BUD A;  2QAZ A;  1Y96 A;  2NUP B;  5CO7 A;  3CMA T;  3REB B;  4XTX A;  4LDU A;  3UT1 A;  4BE2 A;  1Z9Q A;  5CK9 A;  2LNV A;  1VQL A;  1SEM A;  2KRO A;  5CAI A;  4J6X A;  1OOT A;  2K5I A;  2DKG A;  5KYN A;  3CC4 A;  2Y4X A;  1FMW A;  4OML A;  4M75 G;  3CCQ T;  8ATC B;  1M27 C;  3M4G A;  4M7D B;  3FEO A;  3OYD A;  4LE9 A;  3VUZ A;  5GAM j;  1WFW A;  3CCU A;  3RR6 A;  2BKD N;  1GRI A;  3JRZ A;  1K73 R;  6AT1 B;  3V7S A;  5HY6 A;  1VQN A;  4MDX A;  3KBG A;  4HVV A;  5KYY B;  3VS7 A;  1RAG B;  4J9H A;  4QKU A;  5LJ3 j;  1AVZ C;  3VS2 A;  3M5A A;  4PJN A;  1VIE A;  1IZ6 A;  4C8Q G;  3CC7 A;  4JZ3 A;  1TUD A;  3RKX A;  1JQQ A;  2L8D A;  8AT1 B;  2COY A;  2RO0 A;  3JCM g;  4M7D D;  2L3P A;  5L8R E;  2O01 E;  4F7U G;  1FXX A;  5IXB A;  4QQ6 A;  3P8D A;  3CMA A;  4BI8 B;  1WHJ A;  2CRE A;  1Q81 U;  2J6K A;  4AFZ C;  1JXO A;  1KHC A;  5FWC A;  2HSP A;  3QWY A;  5KYW B;  4LDV A;  4JJN K;  2FL7 A;  4C92 D;  4LDX A;  2ZPI B;  3CPW S;  3CCQ A;  3JB9 F;  1OI1 A;  1ZSZ A;  1VQO A;  1M1F A;  1ZA1 B;  3L2Q A;  4IUT A;  3LLR A;  2ESW A;  2KXD A;  3HHT B;  2DER A;  2PVG B;  1X69 A;  1UGQ B;  5GAN 7;  4M7A C;  2GTO A;  2A36 A;  3HPW A;  2XK0 A;  1RL2 A;  1MV0 B;  1TG0 A;  1QKW A;  2WSE E;  1QWE A;  1K73 C;  4LN2 A;  2PQW A;  2WSF E;  2C06 A;  4RTY A;  4J5Y A;  5GMK e;  2CP5 A;  4PK4 A;  3J7A F;  2ABL A;  1W2B P;  1VQM Q;  4DEY A;  2MOX A;  1X6G A;  3FJ5 A;  1UB4 A;  4V2S A;  3JAM E;  2VVK A;  3SB2 A;  3H0I A;  2AIR B;  3G4S Q;  4Y28 E;  1G3S A;  3E9G A;  2ZGW A;  2HQE A;  3VRZ A;  3DLM A;  3X25 B;  3EH1 A;  3RKW A;  2NLU A;  2O4X A;  3MET A;  1PKT A;  1HSQ A;  1QLY A;  1VQ8 Q;  3LH0 A;  2DZ9 A;  4PJO B;  2SEM A;  3CXC S;  1VQM T;  3SEM A;  3AHU A;  1WGS A;  1AOJ A;  4EMK C;  4D6W A;  1VUB A;  5IHN A;  5CR2 A;  3BFM A;  2EW3 A;  2SRC A;  1PNJ A;  3G4S T;  1VQ6 Q;  5FRN A;  1G2B A;  1U8R A;  3G71 Q;  3JCM f;  2A7Y A;  2RJD A;  4C8Q A;  2QG9 B;  4ME7 A;  1BIA A;  1VQ8 T;  2BTT A;  1U06 A;  1QMC A;  2JNG A;  5GAM h;  3VYH B;  1IO6 A;  2ROL A;  2D1X A;  4A4E A;  4R56 A;  2K57 A;  1Y07 A;  2J6O A;  3R6N A;  3EFS A;  2K7A A;  4FL6 A;  5LJ3 h;  2YUQ A;  2CT4 A;  2OTL Q;  3HSB A;  1VQ6 T;  4E7K A;  1GCP A;  2D0N A;  4GBQ A;  5KE3 A;  1JBM A;  2DXB A;  3G71 T;  1QVG P;  2ED1 A;  2FO0 A;  1E6H A;  1M2V B;  2VXF A;  5C6S A;  2JVV A;  2RD1 A;  2DVJ A;  1ABQ A;  1BBZ A;  2DLP A;  3QDR B;  3VS0 A;  3C0C A;  1AZE A;  2FRW A;  2EFI A;  4N0A C;  2F69 A;  5GAN 5;  2LVM A;  3VS3 A;  3M59 A;  1Z9Z A;  3OBY A;  1VQM A;  2NUT A;  2JTF A;  2OX7 A;  2KK4 A;  2OTL T;  4J6Y A;  3P8H A;  4IUQ A;  3G4S A;  4ELZ C;  2E70 A;  3FJP A;  1Q7Y R;  2HBW A;  5DM7 R;  1KG1 A;  2E41 A;  5LJ3 d;  1H3Z A;  2KE9 A;  4HA8 A;  3GOX A;  2VUB A;  3SWN B;  3EFO B;  2V8I A;  2K5F A;  2EJF A;  1N5Z A;  4M7A E;  1UG1 A;  3OYH A;  1IHW A;  5AT1 B;  4RCC A;  2X3W D;  3RIR A;  2E6Z A;  3UWN A;  2DYB A;  1VA7 A;  5CKE A;  2XI9 A;  4LD6 A;  3G71 A;  1XQH A;  1RAD B;  2DK3 A;  2FZC B;  3QBY A;  3HRS A;  2K4Y A;  2RHX A;  2YWW A;  3QO3 A;  2KSS A;  2HL3 A;  4FYW B;  1K1Z A;  3CEY A;  1HD3 A;  2NUZ A;  4XU3 A;  5I22 A;  4PLI A;  4A63 B;  1CSK A;  1PD0 A;  2ECZ A;  1QCO A;  2MK5 A;  2R5M A;  3KXT A;  3PIP A;  2P84 A;  4BB7 A;  2KYB A;  3JCM b;  4OF1 A;  2RQW A;  4C92 G;  1M5Q 1;  5GAN g;  1AWJ A;  2CP6 A;  1IRE B;  2KVQ G;  3I5S A;  1MHN A;  3M4Y A;  1Q7Y C;  4M78 F;  4F7U F;  1MUZ A;  4BY6 B;  3EGD A;  4F17 A;  2DF6 A;  4JPB W;  4C0G A;  4J8O A;  2EYZ A;  3S3N A;  1M1K R;  3V7R A;  4FSS A;  3MJX A;  3VS6 A;  3L2Z A;  2ZZD A;  1HYO A;  1TWB A;  4C0Z A;  2HBP A;  4C0D C;  1PWT A;  3THK A;  4OMP A;  2JS2 A;  2CP0 A;  1NE8 A;  2YHT A;  4HVU A;  1D3B A;  1OQK A;  2P4R A;  5HK3 A;  3CQT A;  1NJI C;  2DIG A;  3ZBD A;  1ZUK A;  4FW1 A;  2IPO B;  1BCO A;  2YUN A;  2QAS A;  3OW2 S;  3MP6 A;  4M77 F;  2VB6 A;  4ZGE B;  1BKB A;  4C0F A;  2ZCF B;  1QP3 A;  2FHD A;  1SRL A;  3M0Q A;  4QQD A;  4ELY C;  4FCY A;  1BIB A;  1KC8 U;  2O2O A;  1BI3 A;  2CUD A;  4EPC A;  3CCS Q;  4RTX A;  2QXF A;  1N8R U;  2NUP A;  4DOV A;  5GAN 4;  4CRI A;  4M78 B;  4JDS A;  2AK5 A;  2FZK B;  2CZ0 B;  1S72 Q;  1LVK A;  3F70 A;  2ED0 A;  1T3S A;  2CUB A;  1AWO A;  3QSU A;  4XAX B;  2JM9 A;  1KK7 A;  2C0T A;  4XK8 E;  1EX4 A;  2K79 A;  4DEX A;  4R55 A;  5IHK A;  4PLL A;  2O88 A;  3CCS T;  4M7D A;  2K5L A;  1HXD A;  2LCS A;  1M1K C;  3NTI A;  1UE9 A;  3S3M A;  2DEU A;  1YI2 Q;  3VRY A;  1A0N B;  2GF7 A;  2JUF A;  1WJS A;  1QW1 A;  2RN8 A;  3J81 E;  2R58 A;  1U1S A;  3JCM Q;  1S72 T;  4M77 B;  5DLO A;  3UDC A;  2CGH A;  2RHI A;  5KYY A;  3EG2 A;  1BU1 A;  5GAN f;  4DBH A;  2KEA A;  2EGC A;  1NEG A;  4M4Z A;  1VQ5 Q;  2JS0 A;  4M75 C;  3JCM J;  3EGU A;  3OYM A;  3EG3 A;  3VJP A;  4KGX B;  2O9V A;  1YI2 T;  1RI0 A;  4Z89 A;  3JCM h;  2DJQ A;  3VV0 A;  4J9B A;  4B9X A;  3I5R A;  2CZ6 B;  5J3B A;  3A8M B;  2VYT A;  5DY9 A;  1KFZ A;  2K3X A;  3RMQ A;  2K6D A;  2M51 A;  2M0O A;  5GAM f;  2P0Q A;  1VQ5 T;  4E7H A;  4Y91 A;  3OQ5 A;  5KYW A;  3NGP A;  5GJW B;  1TSF A;  2KY9 A;  2DAQ A;  2JXB A;  2AHJ B;  1LOJ A;  2HAX A;  3PFS A;  2FPE A;  3CCS A;  2VC8 A;  2RB6 A;  1D0Y A;  2PUO B;  4IIO A;  3JSC A;  3M53 A;  2DM1 A;  2DEQ A;  2YRC A;  3JCM d;  1UGR B;  5GMK j;  3EHR A;  4L6V 5;  1S72 A;  2JMA A;  3FLG A;  4FYY B;  2KT8 A;  4XU2 A;  4FM4 B;  2LNH B;  3A8L B;  1OU9 A;  1VQK Q;  2DL8 A;  1V76 A;  1YCS B;  3OS2 A;  1D09 B;  1YI2 A;  1SSF A;  2BE9 B;  2RA2 A;  1YIJ Q;  3CCM Q;  4M77 C;  1UFF A;  1NLO C;  2XID A;  3CPW A;  3O5Z A;  1Y57 A;  4F16 A;  4PFZ A;  4DA4 A;  1UJ0 A;  2DRK A;  2F5K A;  3I35 A;  2EJ9 A;  5FRM A;  1VQK T;  1VQ5 A;  1K9A A;  4ZN1 A;  2E12 A;  4PJO A;  3INZ A;  2V8K A;  2YUO A;  2E5K A;  4KBM B;  5FW9 A;  3PVQ A;  2BZY A;  3MEA A;  3NTH A;  3GIB A;  5GAN j;  3E9F A;  1M8V A;  3CCL A;  4RTV A;  1VQO Q;  4MZM A;  1YIJ T;  2DL4 A;  2HCK A;  3CCM T;  2OI3 A;  1B34 B;  4JJC A;  5GAO l;  4RUG A;  3MO8 A;  3MHX A;  2JN0 A;  3GPL A;  4M7A B;  1M3C A;  3CD6 Q;  3QYH B;  4IIM A;  3X26 B;  1VOM A;  2R5A A;  4BE0 A;  2J05 A;  4J7F A;  4DBR A;  3OS0 A;  2HQX A;  1VQP A;  2RJE A;  2DPP B;  3PGG A;  4KH1 B;  1VQO T;  4CC2 A;  1X27 A;  2MIO A;  4AFU C;  2ZPF B;  4OGC A;  4F04 B;  1UGP B;  1G8X A;  2D6F A;  3OMG A;  3CXC A;  1FMK A;  2DNU A;  4GY5 A;  1FX7 A;  2EQU A;  4M75 E;  3CD6 T;  2AKK A;  3I56 Q;  3URG A;  5FU6 C;  3UF4 A;  2XU8 A;  1M2V A;  4RKU E;  2P0K A;  1HK9 A;  2RH2 A;  2A28 A;  1IGU A;  1CKA A;  1RAH B;  1W2B S;  5CVI A;  4BE1 A;  5GAO r;  3A1P A;  1VQK A;  3C4S A;  3QWX X;  2ZPE B;  3LYI A;  3MEV A;  4ZNX A;  1QP2 A;  3CC2 Q;  5GMK i;  1GCQ C;  1WPY A;  2HZY A;  3A5Z B;  4EMK B;  4JRK A;  3EG1 A;  1M90 R;  1OYX A;  1M9S A;  4WTO B;  4ZTJ A;  1FWZ A;  1YIJ A;  5M9O A;  3CCM A;  1WHK A;  1TXQ A;  2GNC A;  3M9Q A;  1EIF A;  2DL7 A;  4OB1 B;  3T9N A;  3I56 T;  4E2F B;  1KQS S;  2DFU A;  1D1B A;  1ZQ1 A;  2FRY A;  3M0T A;  2DTH A;  2LJ3 A;  1F1B B;  2MAM A;  4M78 E;  4F7U E;  3SWN A;  3EFO A;  4MDW A;  2EIF A;  1XNI A;  1WX6 A;  2CZ1 B;  3CC2 T;  2KGT A;  3HKS A;  2J7I A;  2E5Q A;  2KI7 A;  2IIM A;  5GMK h;  1TU0 B;  2MCN A;  2JMC A;  1ABO A;  2VV5 A;  2F2V A;  4RG8 A;  2VGM A;  1YWP A;  1JJ2 A;  4RTT A;  3OYI A;  3FDR A;  3BE3 A;  1GBQ A;  3CD6 A;  3OBW A;  3VU3 C;  3TSW A;  2BZ8 A;  4ATO A;  2DET A;  4M77 E;  4PL6 A;  2JTM A;  2PVO B;  4ZGJ B;  4OMF B;  5AYF A;  1PRM C;  2W10 A;  1TS9 A;  2L89 A;  3EG0 A;  4KUL A;  4L5G A;  2LCC A;  2QQA A;  2RI3 A;  3MP1 A;  2QTV A;  2YT6 A;  3I56 A;  1AEY A;  1NBE B;  2B86 A;  1RI9 A;  3TSZ A;  5GJV B;  5GAN h;  1RUW A;  2KYM A;  1UTI A;  1YJ9 Q;  3X20 B;  2EYW A;  3CC2 A;  3MEW A;  4DBQ A;  2RHY A;  2QK0 A;  2QI2 A;  3TEE A;  1K0X A;  3H0H A;  3VKI A;  3PIO A;  4QT7 A;  1Q7Y U;  5IHI A;  5GAN 3;  1M2O A;  5IT9 E;  2L0A A;  2CP3 A;  3A8H B;  2JOY A;  1EFN A;  4C92 C;  4LDY A;  3M55 A;  2G3R A;  2DMO A;  4JLG A;  3EH2 A;  3CCJ A;  3BW1 A;  4PKC C;  2ZPB B;  2QDY B;  1YJ9 T;  2M02 A;  4PJO D;  3JCM P;  1YFN A;  5GAN d;  3OYE A;  3QZ9 B;  3CPW P;  1UJY A;  1QVF A;  1AWW A;  4B6M A;  3JB9 D;  2XD0 A;  3P8B B;  4HCK A;  3CCE Q;  1TUG B;  2ROT A;  1NJI U;  2FZG B;  2LX7 A;  4QVC A;  2KDS A;  3PMI A;  1OU8 A;  1SG5 A;  3FB9 A;  3FC3 A;  3PTA A;  3L2R A;  2A0F B;  2F5T X;  1NZ9 A;  2MMP A;  4XU1 A;  3MP8 A;  5D6W A;  1N9R A;  3QYG B;  5I2M A;  4M78 A;  1YIT Q;  2E3I A;  2ZPG B;  5EC7 A;  1B7T A;  4FW2 A;  4HVW A;  2XG8 D;  1D1A A;  3FRN A;  3RES A;  1EZZ B;  3CCE T;  1OX9 A;  5GAM d;  1AT1 B;  1ZA2 B;  2FVU A;  5KE2 A;  5I2S A;  2X51 A;  4AFS C;  2RNA A;  1JO8 A;  3VYG A;  2YDL A;  5KYX B;  7AT1 B;  3OW2 A;  2RI2 A;  1WYX A;  4D8K A;  1LCK A;  2QEX Q;  4KRT A;  4C0D B;  4OMM A;  2RQU A;  4GLM A;  2CSQ A;  3RKY A;  1YIT T;  1VQ7 Q;  3NMZ C;  5LJ3 e;  2A37 A;  3PE0 A;  3M0R A;  3MEU A;  1UGS B;  2DXT A;  3H41 A;  3R6O A;  5D6X A;  2RM4 A;  1YJ9 A;  2L5Q A;  1M1K U;  3QHS A;  2KRM A;  2PZ1 A;  4VUB A;  5CKH A;  2RQV A;  2AZV A;  2CYZ B;  1ZBJ A;  2RHU A;  5IAY A;  2OTJ Q;  1JEG A;  2V8J A;  2JZ2 A;  5HKC A;  2QEX T;  1SRM A;  1WLP B;  3OSV A;  4M75 F;  2Z0W A;  1VQ7 T;  1R0C B;  4M7D G;  1B07 A;  3G6E Q;  4ZTF A;  2X4W A;  3CPF A;  2O31 A;  5GAN 2;  4N4H A;  4EDU A;  3EG9 B;  5KCH A;  1RAA B;  1WXB A;  1VIF A;  2JJ9 A;  1UHF A;  1SHG A;  3CCE A;  3L2V A;  2D8H A;  4DBF A;  5C0M A;  4LDW A;  2OTJ T;  1C6V X;  4IUU A;  5GAO m;  1OX8 A;  1UGV A;  3MPU B;  1VYT A;  2IVW A;  2EJG A;  2LMJ A;  4C8Q F;  3M0P A;  4X9C A;  1R77 A;  5CKD A;  2HEQ A;  3G6E T;  1IB8 A;  4PNO A;  3OYF A;  2CH4 W;  1YIT A;  1K76 A;  3QXE B;  5CCA A;  3OMC A;  1V1C A;  1JJ2 P;  2EPD A;  1D0X A;  2CP7 A;  1NEB A;  2H3J A;  1AWX A;  1Q86 R;  1K9M U;  2YRV A;  2VXE A;  5LJ5 e;  2QQS A;  1H64 1;  4X9D A;  2MYS A;  3RNJ A;  3OYJ A;  3ME9 A;  4JS5 A;  3E1S A;  1IXD A;  3ASK A;  1X6B A;  3NHN A;  2QEX A;  1TUC A;  4M75 B;  1X75 C;  2MWO A;  4C5E A;  1C1A A;  2JW4 A;  3RER A;  5KYU B;  1VQ7 A;  4HKE A;  3CBO A;  2HMA A;  2X3X D;  2RMO A;  2YRD A;  5FLX E;  1ZUY A;  4WF2 A;  2EQJ A;  3LWH A;  4OMO A;  3VS4 A;  1KD1 R;  1WHG A;  4EMG A;  4PFO A;  1H8K A;  3DKM A;  3LGF A;  3QZ5 B;  1LJO A;  2OTJ A;  5GAO q;  2VGN A;  4C5H A;  2EWN A;  3VUB A;  3L42 A;  4XTU A;  3A98 A;  2ZAE A;  4KUD K;  1QVP A;  2CSI A;  3E2U A;  1AD5 A;  1KIK A;  5FRO A;  4MMK A;  1AHJ B;  3G6E A;  1QWF A;  4A54 A;  1B34 A;  1ZSZ C;  4AT1 B;  4F7U B;  2EYY A;  9ATC B;  1YHQ Q;  2COZ A;  1AZG B;  4M7A A;  3VS1 A;  1FMV A;  2RQT A;  1QCN A;  1M4Z A;  1X2Q A;  3QUI A;  2PTK A;  1ZX6 A;  1KSW A;  4LD9 K;  1Q86 C;  1OV3 A;  2M16 A;  4PJO G;  1QVF P;  3HFO A;  1NM7 A;  3EFR A;  2ZPH B;  1T0J A;  2KMT A;  1YHQ T;  2DD5 A;  4M78 D;  5GMK l;  1WJQ A;  4D8D A;  2PUK B;  4WCI A;  1E7O A;  1WIE A;  4C5G A;  1GBR A;  1MNE A;  1BK2 A;  2GTJ A;  2RJC A;  2VAS A;  1WHM A;  2DO3 A;  2HD0 A;  2HL5 C;  2WAC A;  1KD1 C;  1OEB A;  3ZEH A;  1R8O B;  4II1 A;  2KRS A;  4J9D A;  3X28 B;  4EMK A;  1QKX A;  3CCL Q;  3GLX A;  1TTH B;  1SF9 A;  2A08 A;  4XTY A;  2OJ2 A;  1W1F A;  3CCV Q;  4Y92 A;  2RI5 A;  3CME Q;  4M77 D;  1M3B A;  3OYN A;  5CKF A;  1NYG A;  3M57 A;  4J9I A;  2NWM A;  4C8Q C;  5A0L A;  5LJ5 g;  2DZC A;  4X34 A;  1VQP Q;  2QQ9 A;  2QA4 Q;  1YNZ A;  2BIV A;  5LL6 S;  4A4G A;  3CCL T;  2JT4 A;  1W2B A;  3V7C A;  4CI0 C;  4E7S A;  4QVZ A;  3CCV T;  2LZ6 B;  1YHQ A;  1OPL A;  3CME T;  2V1Q A;  3JCM e;  4NOY A;  3ZL7 C;  5FU6 B;  4MZP A;  2PVD B;  1K8A R;  1VQP T;  1D1C A;  2QA4 T;  1KQS A;  4TVR A;  1LPL A;  4N0A A;  4RCB A;  4ORZ A;  1WHH A;  1T3L A;  2EKH A;  3RUX A;  1K73 U;  1O9S A;  2FPD A;  2X35 A;  1Q82 R;  2E1H A;  4PJJ A;  4N4G A;  4E47 A;  5I21 A;  3JCM c;  1ARK A;  3UA6 A;  1FYN A;  3L2U A;  4JZ4 A;  1RAB B;  4X1V A;  3WVD B;  1XJW B;  4M7D F;  3EHQ A;  2IG0 A;  1U3O A;  4PFP A;  4LXC A;  1X2K A;  4PJM A;  3MCA B;  1M3A A;  2E3H A;  2I0N A;  4C5I A;  1PHT A;  1RLQ C;  3CCV A;  3JB9 I;  1RAC B;  3JCM X;  3OS1 A;  3QPH A;  5CKB A;  2X4J A;  5HCK A;  3CME A;  4BAC A;  1Y7X A;  2XKO C;  4MML A;  4NS5 A;  4A4K A;  3HRT A;  1I1J A;  2GQV A;  1YCY A;  4C92 F;  5J39 A;  2EVR A;  3A8G B;  4HCB A;  3LW5 E;  2KT1 A;  4IUV A;  4NL3 A;  1XTD A;  4F14 A;  1OZ3 A;  1WXU A;  2QA4 A;  2CS7 A;  2M9U A;  2A3L A;  2GFA A;  4Z02 A;  3X24 B;  2EQK A;  1WNL A;  1K8A C;  5KH6 A;  2MWP A;  1PG5 B;  2DRM A;  2L3Q A;  2MPX C;  4OGE A;  2E6N A;  4XU0 A;  5FU7 C;  5LJ5 f;  2QGG A;  2FYK A;  1MMA A;  1WA7 A;  2P0P A;  1VQ4 A;  1NG2 A;  4OP0 A;  1JU5 C;  2EQM A;  2L3S A;  2LQK A;  4M7A D;  1Q82 C;  2CDT A;  4HCZ A;  3SDZ A;  3IQL A;  4KGV B;  2L2P A;  2C0O A;  1IGQ A;  2DD4 A;  1W70 A;  3OYC A;  2YSQ A;  3CBM A;  3PT9 A;  4J7I A;  2LQW A;  1IRX A;  2YUP A;  3D7S B;  2RK1 A;  3MKD A;  3C12 A;  3UPU A;  3JCM W;  4C8Q E;  5KYX A;  2KNB B;  2FPF A;  2LJ0 A;  4JJB A;  3BY7 A;  2X4X A;  1YJN Q;  2XDP A;  4E7Z A;  4HT9 A;  1RAI B;  3EGX B;  3O8V A;  2L3R A;  2MI6 A;  4JUV A;  4AFQ C;  4C92 B;  4O6J A;  4EIK A;  2XHC A;  2LRQ A;  3CCJ Q;  5CQY A;  5GAO n;  2OAW A;  3G1J A;  5ECA A;  3HL8 A;  3TU4 K;  2LTO A;  2HKN A;  2HNI A;  1PSE A;  4KUI A;  4M78 G;  5IH2 A;  2ENM A;  1WI7 A;  4CC7 A;  1U5S A;  1NPR A;  3LX7 A;  3CCR Q;  2HQH A;  5CIU A;  2XDB A;  3UAT A;  4FYX B;  2Y90 A;  1YJN T;  4CC3 A;  2EGA A;  2K3B A;  1MMD A;  1X43 A;  4PJO F;  2EGE A;  3CCJ T;  2KAF A;  2LJ1 A;  1M1G A;  3H9N A;  4HCC A;  1WJR A;  1MMG A;  2GBQ A;  2K2V A;  3OSS C;  4OB3 B;  1YJW Q;  3EG9 A;  1P92 A;  1OZ2 A;  2M1H A;  5D6Y A;  3PMT A;  3QKJ A;  4M77 G;  3CCR T;  1GL5 A;  4FT4 A;  3PNW C;  3OYG A;  1QVG S;  5HK0 A;  5GAN 6;  2RF0 A;  1B3Q A;  1DJ7 B;  1RAE B;  2PU9 B;  1SSH A;  3DLL A;  1I07 A;  1G5V A;  2MF2 A;  2I2L A;  1U1T A;  1KQ1 A;  1M90 C;  2BZX A;  2LQ8 A;  2E10 A;  4J9E A;  4M7D C;  5LJ5 j;  2CP2 A;  2DTO A;  2W0Z A;  2DIL A;  1YJW T;  3TQ7 P;  2K2M A;  1QQJ A;  4JLI A;  4BD3 A;  4JRP A;  5GAO p;  3S6W A;  1BYM A;  4UC4 A;  1KJW A;  2DL3 A;  4HT8 A;  1ZLM A;  1UEC A;  4JS4 A;  3CBP A;  1UHC A;  3SHW A;  1W4S A;  5GMK m;  4FYV B;  2QQR A;  1KQS P;  4QQG A;  3EAE A;  4M75 A;  1HJD A;  1YJN A;  2H8H A;  2D9T A;  1PCX A;  2DXC A;  1Q81 R;  4FU6 A;  4J9F A;  5KYU A;  2KQW A;  5FWB A;  2BE7 D;  3HTR A;  3OYB A;  3UA7 A;  1BCM A;  2FEI A;  3I55 Q;  3L1A A;  4Z88 A;  3TRE A;  1Y96 B;  3QG1 A;  4E7J A;  4XTW A;  3V8K A;  5CQX A;  2LP5 A;  2LQN A;  2CT3 A;  5GAN e;  3CCR A;  2E64 A;  2H3E B;  2COW A;  4FSX A;  4LNP A;  1I8F A;  3GBQ A;  2DBM A;  1ACM B;  5I11 A;  1MGQ A;  4AG2 C;  3QII A;  1K0S A;  4LUD A;  2J06 A;  4BI3 A;  3I55 T;  3HFN A;  2HKQ B;  4F7U A;  1PM3 A;  4KH0 B;  1YJW A;  1YBY A;  2CKK A;  3N5B B;  2V26 A;  4JRI A;  1J3T A;  3REA B;  1NLP C;  5EG2 A;  1KHI A;  2QQB A;  2F2W A;  2LX9 A;  5GAM e;  1MV3 A;  2RK2 A;  3H6Z A;  3LWI A;  1WQW A;  4RTU A;  3QJY A;  1QCF A;  4IUR A;  2O9S A;  1T0H A;  2KBT A;  3OYY A;  4FIB A;  4XTV A;  3M0S A;  2CH4 A;  3HP9 A;  1JJ2 S;  1X01 A;  1E6G A;  2X9H A;  1R0B G;  2DX1 A;  1Q86 U;  1PRL C;  4M77 A;  3CXC P;  2RPN A;  1IHV A;  3OY9 A;  1H3H A;  2E4H A;  1Q81 C;  1WQ7 A;  2EKO A;  2KXC A;  1Y0M A;  4FT2 A;  2E65 A;  1ZBX A;  2JM8 A;  2D0Q B;  2RQR A;  4M7A G;  4RG2 A;  2DTI A;  3Q1J A;  5A2Q E;  2EYX A;  3AT1 B;  1VQ8 A;  4PJO C;  1Q95 G;  5KCO A;  5GAN 8;  5IXF A;  3SFM A;  2LT4 A;  4J9C A;  1VQ9 Q;  1V29 B;  1WDX A;  1KD1 U;  3I55 A;  2CZ7 B;  1ZSZ B;  3DB4 A;  1TOV A;  2X4Y A;  4EMH A;  2LCL A;  1G3Y A;  3NPF A;  1NJI R;  1MMN A;  1CKB A;  1VQ6 A;  1S1N A;  3G7Z A;  3QDF A;  4M7D E;  1G3W A;  1YP5 A;  4YTL A;  5LJ5 h;  2RJF A;  4K11 A;  1VQ9 T;  3FIF A;  4Z8A A;  1UUE A;  1O75 A;  1WHL A;  4RTW A;  2P4T A;  3C95 A;  4LUE A;  3ULR B;  2DA9 A;  2DE0 X;  2WSC E;  3TVT A;  3M56 A;  4OMN A;  4MZT A;  2OTL A;  2EAY A;  2LC4 A;  4C92 E;  1SPK A;  1N27 A;  1ZSG A;  4P5N A;  3RBB B;  2QGF B;  2R57 A;  1QVF S;  2O4X B;  1BB9 A;  4ZN3 A;  3OYA A;  1BI1 A;  3WVE B;  5IN1 A;  3HRU A;  4JRQ A;  2DL5 A;  4OB0 B;  2DYI A;  1GCQ A;  5A0D A;  5LJ5 d;  2XMF A;  3KFV A;  1C0M A;  2G6F X;  3TCJ A;  3V8L A;  1WXT A;  4E6R A;  4E7I A;  1SKU B;  3I9Q A;  1JB0 E;  1GXI E;  4DQ2 A;  2J6F A;  1X6O A;  4QW2 A;  2DJZ A;  3RDV A;  4OB2 B;  3QJ6 A;  4BI4 A;  5D7U A;  1NYF A;  4C8Q B;  3SWN C;  5GAM g;  2GQI A; 
#chains in the Genus database with same CATH homology
 2OTJ Q;  1NJI R;  3CCV Q;  1YIT Q;  1K9M R;  1JJ2 P;  3CCU Q;  1N8R R;  3CPW P;  1K73 R;  3CCS Q;  3CD6 Q;  1M90 R;  3OW2 P;  3CCE Q;  3CME Q;  1VQ7 Q;  1Q86 R;  1VQ6 Q;  3I56 Q;  1VQ5 Q;  1M1K R;  1KQS P;  1VQN Q;  3G71 Q;  1VQL Q;  1YJW Q;  1VQ8 Q;  3CCQ Q;  3CCR Q;  1YIJ Q;  1VQM Q;  1YHQ Q;  1W2B P;  3G6E Q;  3CXC P;  3CCM Q;  1YI2 Q;  1Q81 R;  1Q82 R;  1KD1 R;  1VQ4 Q;  1VQ9 Q;  3CMA Q;  1YJN Q;  1VQO Q;  1S72 Q;  1QVG P;  1KC8 R;  3CC4 Q;  1YJ9 Q;  1QVF P;  2OTL Q;  1VQP Q;  1K8A R;  3CCL Q;  3CC7 Q;  2QA4 Q;  3I55 Q;  1Q7Y R;  3CCJ Q;  2QEX Q;  1VQK Q;  3CC2 Q;  3G4S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...