1VQ7Q

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq7Q00
3CCRQ 1Q86R 3G71Q 3G4SQ 3CMEQ 1VQ4Q 1VQ6Q 1KC8R 3CCQQ 1VQLQ 3CCEQ 1Q7YR 1N8RR 3CCLQ 3CMAQ 3CCJQ 3CCUQ 1YJWQ 3I56Q 3G6EQ 2QA4Q 3CC4Q 1YITQ 1Q81R 1K8AR 1K9MR 1KQSP 3CCVQ 3OW2P 3CPWP 1YJNQ 1QVGP 1VQKQ 1KD1R 3CCSQ 1VQ5Q 1JJ2P 3CCMQ 1W2BP 1VQ9Q 1VQPQ 1VQ7Q 1NJIR 1S72Q 1YIJQ 1M90R 1YI2Q 1QVFP 3CD6Q 1K73R 2OTLQ 3CC2Q 2QEXQ 1VQNQ 3CXCP 3CC7Q 1Q82R 1VQOQ 2OTJQ 1YJ9Q 1M1KR 1YHQQ 3I55Q 1VQ8Q 1VQMQ
chains in the Genus database with same CATH superfamily
4C92F 4QQGA 4B9WA 5CIUA 4X9CA 1N8RC 1M1KU 1MV0B 3MCAB 2PVDB 2EGAA 1NPPA 1PKTA 5L8RE 4HT9A 1YFNA 2G6FX 4JJCA 3CC2A 1AD5A 4ORZA 2YRCA 1VQKA 1MUZA 1PSEA 2D0QB 3CC2T 1PC0A 2A08A 1IRXA 4EMHA 1WJQA 1VQKT 3ZL7C 3OQ5A 1ZBJA 1VQOA 2AT1B 1KJWA 4ME7A 1ARKA 1QWFA 5IXBA 2RHUA 1SF9A 2DXCA 2EWNA 4AFSC 3OMCA 4C92A 4XTZA 1VQOT 1OULA 2HL3A 4A4KA 1XOVA 4PJNA 3OW2S 1Q86R 1VQ5A 2J05A 1BCOA 2K2MA 3M5AA 2LX7A 2QQSA 3HTRA 4M78G 4M77B 3C95A 1TG0A 1VQ5T 2BE7D 1VQMA 3HSBA 5LL6S 4F16A 4J9GA 4DBRA 1ZUUA 3OS5A 2DETA 4QW2A 1VQMT 1QLYA 4M7DB 1GBRA 2ED1A 4FT2A 3MP6A 1LPLA 3MHXA 5KE3A 1OZ2A 2EW3A 1R8OB 3EG9A 1MNEA 3RMSA 2HBWA 5ECAA 1TOVA 1QVFP 3EH2A 2RJDA 1WIEA 1NEBA 2DXUA 2HEQA 2K3YA 1UGSB 2FO0A 2O2OA 1UJYA 2E6ZA 5IAYA 3RKYA 2D0NA 4C8QB 4M78C 3G4SQ 1OI1A 2K6DA 2CKKA 2E6NA 3KFVA 4BUGA 1N8RR 1UJ0A 3M0TA 3M9QA 2NUTB 2RPNA 1KG1A 4ZGEB 2FRWA 1PCXA 2PNIA 2FL7A 2E65A 3M0UA 3ZEHA 1QQJA 3SWNB 1YCYA 4E7SA 2XIDA 1WJSA 4KBMB 1JRIA 4ZGDB 1YJNA 1NM7A 3FRNA 3M0PA 3P8DA 4Y91A 4KT0E 2P0PA 4BD3A 1K8AC 5LJ3f 1PG5B 1YJNT 1VIEA 4DBFA 2F2VA 5AYFA 3TU4K 1M90R 1I8FA 2NUPA 4N4GA 2EAYA 1VQ6A 3JCMf 1RLPC 1ZUKA 4FW2A 2KR3A 2O01E 2BE9B 4KGXB 1VQ6T 3GOXA 1C6VX 1BU1A 2KVQG 1U1TA 3LYIA 1N8RU 1MNDA 2E10A 1V29B 4E7ZA 1UUEA 1TWBA 2LRQA 2GQVA 3JB9H 2PZ1A 3QDRB 1WGSA 2E41A 3OBWA 3INZA 5GAN3 2SRCA 2E4HA 2ZGWA 3L2VA 1ACMB 5A2QE 3LW5E 3QWXX 3OYCA 4CC4B 3NTKA 4EMKA 1QVFS 3CCVQ 4WF2A 1QCOA 2DIQA 2R57A 2KEAA 2FPFA 1P92A 4D8KA 2QTXA 1PNJA 2DBMA 3M58A 2GNCA 2LT4A 4MZMA 3LWIA 2E1HA 2PUOB 3SFMA 1U3OA 4DBQA 2KY9A 2X3WD 1FXXA 5HY6A 2KK4A 1KC8C 1YCSB 1U5SA 3CCJQ 3CCLQ 4M77E 3I56Q 2X35A 3GIBA 2KSSA 4RTXA 4BI4A 3X20B 2X51A 3VS1A 1MMDA 5I21A 1HJDA 1LOJA 5KYWB 3VUZA 2EPDA 2Y4XA 1ABQA 3V7RA 4RTTA 3FJPA 3FEOA 3LGFA 1N6AA 3R6NA 1G5VA 1E7OA 1O75A 3O8VA 5GAOl 1VQLQ 2GF7A 5J3BA 1K8AR 3CC7A 2DXBA 5FRNA 2XK0A 1GCQC 1VYUA 2QQRA 4JUVA 1E6HA 3JCMQ 2RI3A 1XTDA 3CC7T 2P4RA 2YUPA 4Z89A 1UE9A 1VYVA 3V8LA 4M7DF 4IIOA 1JXOA 3GPLA 3D7SB 2E70A 4LDWA 4M7AD 1YWPA 2EJ9A 4C8QE 1JO8A 3BW1A 5DM7R 3QYHB 1QCNA 2OTLA 3P8HA 8ATCB 1WZOA 5GAN4 1NJIC 4J6YA 1G8XA 2OTLT 2F1LA 3FDRA 4XU0A 2K79A 4NL3A 2AZVA 3M55A 1SSHA 5I11A 2F69A 1IO6A 5HK0A 3TVTA 5KYUA 2EIFA 1IHVA 2FYKA 5IHKA 2W0ZA 1QVPA 3JB9I 2QA4Q 5GAMd 1I5LA 1RL2A 4RMOA 2RJEA 3OSVA 1VQPQ 5D6XA 4M7DA 2KMTA 1K8AU 2MMPA 4EMGA 5CVIA 2QEXQ 2JMCA 2BKDN 2DIGA 2K57A 2A37A 4BI3A 2D9TA 3HPWA 1WI7A 1VQ7A 4ZNXA 2AKKA 1KK7A 3CBMA 1H3ZA 2LVMA 1VQ7T 2KRSA 1XQHA 3A8OB 3PMIA 1TS9A 4XU3A 1WXTA 3EGDA 2JMAA 1RAAB 5DY9A 2HMAA 2AK5A 3OY9A 3G1JA 1YJWQ 1PHTA 3V7CA 2RI2A 3HRTA 1TUGB 4J7FA 1LNXA 2DF6A 4C0DB 1VA7A 2V1QA 3VS3A 1UGRB 1I4K1 4M75B 1ZA1B 2ED0A 4J9DA 2DAQA 1VQ9A 2CP2A 4IURA 2VGNA 1ZSZB 4J5YA 2EKHA 4NOYA 3NFCA 1M9SA 1VQ9T 1M3BA 1NJIR 2YT6A 1KC8U 4OB0B 2NYSA 3OYYA 2MWOA 2BUDA 4IUTA 1B3QA 3C0CA 1NG2A 2DJQA 2E3IA 4RTUA 1VOMA 4X1VA 2HCKA 4XK8E 3META 1IHWA 5GJWB 3SD4A 4M78D 1SKUB 1X69A 2LJ3A 1M2VB 4OGEA 3EFRA 1KQSP 3DB3A 3CPWP 2L3PA 4D8DA 2MWPA 3EH1A 1Y07A 1OV3A 1NYFA 4BDYA 3M54A 4JS4A 2KDSA 4ELZC 2DZ9A 1W2BA 2KXDA 4Z88A 2YSQA 3QO3A 1UECA 2JT4A 1TUDA 4C92G 2AKLA 2LQKA 2QQAA 2L3SA 2VGMA 2G3RA 2X9HA 2J6OA 4LN2A 3CCMQ 3VU3C 1U8RA 1MV3A 3U23A 1M8MA 2ROLA 1W70A 1UHCA 1JJ2A 1NJIU 3EG0A 4FCYA 5GJVB 4TVRA 2HSPA 1IB8A 2O9SA 3I5RA 2RK1A 2QTVA 2RMOA 3QDFA 1OU8A 3NHNA 4M7AB 3EFOB 3VYHB 1GL5A 1NEGA 1KD1C 1M2OA 1M3AA 5LJ5e 5GAN6 1K73C 1X27A 3FC3A 2X4WA 3QIIA 3M0RA 1WXBA 4LDYA 5M9OA 4C92C 1PD0A 4M4ZA 3OYDA 3CD6A 2F2WA 4B9XA 2EGEA 2RJFA 3GF5A 4C0GA 3CD6T 1TXQA 2O4XA 4XQ3A 3OYNA 2MOXA 1XJWB 3VS7A 1FMWA 3RNJA 3CBOA 2ZCFB 2XG8D 1G3SA 4E7KA 4RTVA 1KQSS 3CXCA 1Q86C 3LGLA 3CPWS 3SEMA 2RK2A 2VASA 3CMEQ 1DJ7B 2CGHA 4HXJA 3QUIA 5IHIA 1BK2A 2RM4A 4A54A 2DTOA 3MEWA 2E3HA 3UPUA 2RHZA 5LJ5h 2JTFA 1WQ7A 4M75E 7AT1B 1M30A 2RI5A 3CCQA 3OYKA 2HDAA 1QKXA 5CQXA 4ZN3A 4GLKA 2V8IA 2B86A 2JOYA 3CCQT 1PWTA 3OSSC 5CR2A 3X24B 2XHCA 1TU0B 2QXFA 4P5NA 4M75F 2HQEA 3A98A 5EG2A 3R6OA 3OYGA 1K9AA 3OYFA 2DZCA 3GNGA 4RKUE 3PTAA 1OX8A 3OB9A 2QQBA 2PQWA 1FYNA 4F14A 3M57A 1JB0E 2CDTA 3VS6A 5GAN8 3KBGA 2WSCE 5IN1A 1RI0A 2CYZB 1KD1R 2EYQA 2GGRA 3SHWA 1K73R 2XDPA 3A1PA 2M9UA 4XTUA 2LQNA 1A0NB 1RI9A 5FWCA 2M51A 2J6KA 2EKOA 1G3WA 3JCMJ 2LDMA 1G2BA 4M75A 4OVAA 2PU9B 1R77A 3OYJA 4E7JA 3QSUA 2L3RA 3CCSQ 1K0XA 4QT7A 1JU5C 2YUOA 1M90C 2L0AA 2MYSA 1UGQB 4C0FA 5GAOn 2XU8A 5GAN2 4GLMA 2RQTA 4ATOA 2COZA 3QZ5B 4BB7A 3VV0A 4M7AE 2DX1A 4OB3B 2Z0WA 4EMKC 1JEGA 1I0CA 3ASKA 4PJMA 4DQ2A 4J7IA 2V26A 4BDZA 1YN8A 3G4SA 4HCCA 1AHJB 2ZAEA 1KD1U 1EX4A 4IUPA 3RIRA 3GP8A 1QCFA 2ZPHB 3I55Q 1K73U 4M7AF 1MMAA 1H3HA 3G4ST 3G71Q 4RTZA 1GXIE 2KT1A 4IIMA 5D6WA 1FX7A 2KBTA 2NWMA 2F2XA 4RUGA 4Q5WA 1NBEB 3PMTA 1S72Q 1HD3A 1K76A 5HCKA 3CEYA 3QJYA 3DLLA 1EFNA 2HBPA 1ZUYA 4BE0A 4DBHA 5GMKm 4KH0B 3A8HB 4PJOB 2X4YA 2DYBA 4KGVB 4CI0C 4EPCA 2DVEA 4JLIA 1JQQA 5D7UA 3BDUA 4NS5A 5CKHA 1Q86U 1YIJQ 4AFZC 3OS2A 4M7AA 1M8VA 3EFOA 1QVGA 4CC7A 3J81E 1SEMA 4GBQA 1I81A 4OF1A 3JCMX 2CP6A 3MKDA 3RR6A 1WHLA 1YHQQ 2JW4A 4M7DG 1LVKA 3GLXA 2BZXA 3CQTA 2V1RA 2CH4W 3TREA 8AT1B 1IXDA 2CS7A 3QZ9B 5L23A 1TSFA 4PNOA 1E6GA 3UF4A 2X4XA 1BIBA 3OBYA 4HVWA 1Y57A 3UWNA 3LLRA 3O5ZA 3MJXA 4J9HA 4A4EA 3RUXA 3CCVA 2R58A 2XKOC 4FW1A 5GANd 2DMOA 2OI3A 5KCHA 1K0SA 1H92A 3CCVT 2F5TX 2HKNA 5CAIA 3FJ5A 2EQKA 3ER0A 5J26A 1AWJA 2FB7A 4M7DC 2QASA 1D0ZA 3CCLA 4PLLA 3CCJA 4ZGJB 3I56A 3JB9J 2K7AA 1H641 3EG2A 1RAEB 4E47A 1WA7A 3CCLT 3CCJT 3I56T 2MPXC 4M78E 2DL7A 5LJ5f 3OMGA 1GBQA 4LUEA 3OYBA 4OGCA 5C6SA 1W1FA 2L8DA 2RA2A 2YLBA 3JV3A 3VS5A 2AIRB 4EIKA 1X2QA 1VQLA 1OPKA 2KYMA 2DXTA 2YUNA 4MZPA 3G7ZA 4F7UB 1UG1A 2DNUA 4C92D 4E7HA 1M90U 3I5SA 2RQUA 1VQLT 2XICA 5GAN7 3CCUQ 4J9BA 3UA7A 3WXMB 4HCZA 5GAOr 5GANg 4LNPA 4F04B 2FHDA 1UTIA 1B34B 1D0XA 4O5VA 3RKXA 3OYEA 2DK3A 1YNZA 5CKBA 4LD6A 1YJ9Q 2F5KA 2VUBA 3PFSA 1T3SA 2P0QA 1GRIA 1R0CB 4LDVA 2JS0A 3I35A 4M77F 1CKAA 2D8HA 2RF0A 3UA6A 4E7IA 4OMQA 3JAME 2O31A 3UDCA 1X6GA 2P84A 3A8MB 5FW9A 2EYYA 1NYGA 1OYXA 2RQVA 2GTJA 1RAFB 2CP7A 2OTJQ 2QA4A 2P4TA 1XNIA 4PJOE 2YWWA 4KUDK 5GANj 3LH5A 1VQPA 5HK3A 4LXCA 4BY6B 1Q7YC 3PE0A 2QA4T 5LJ3d 4AFQC 2QEXA 3TSWA 2FZGB 4PFPA 1VQPT 5EC7A 3S3NA 3QWYA 2YUQA 2X3XD 2QEXT 2I2LA 4E7LA 3PIPA 3KXTA 4PJOF 3RBBB 3JCMd 4C8QF 4M77A 1Q95G 2DFUA 2JN0A 1VIFA 2K9GA 4LE9A 1T0JA 2LCSA 1R0BG 2E5KA 2DD5A 4JRIA 3CMAQ 1IGQA 4FT4A 2RHIA 4HKEA 4OP0A 1M1GA 1RUWA 4ZTJA 1HSQA 2O9VA 4A63B 3ULRB 2ZZDA 3QXEB 3VUBA 3L2RA 5FU6C 4BE2A 1Q82C 4LD9K 4J9EA 1YJWA 4HVUA 2ZPEB 3WVEB 3MEVA 1D09B 2LJ0A 1RAGB 1YJWT 2J7IA 2PVGB 5CK9A 2LNHB 3JB9F 1YP5A 4OMNA 1I07A 4A4GA 4C0ZA 4PJOA 1AOJA 1NE8A 4C8QA 5LJ3g 1AZEA 1W4SA 3OS1A 3JCMV 3REAB 3MP8A 1U06A 2NUTA 1M3CA 2CT4A 2JZ2A 5KYYB 4E6RA 2H3EB 4QVZA 1WHHA 4J8OA 4MMLA 2YLCA 1I5OB 3SWNA 2DBKA 3VRZA 2DTIA 5GMKj 4JZ3A 2HD0A 1OOTA 1GFCA 2PVOB 1YI2Q 5GAMg 3ME9A 4F7UE 4X9DA 2QDYB 2QI2A 1BKBA 1YBYA 4X34A 1BCMA 5LJ3j 1Q7YR 2IVWA 1B7TA 3CC4Q 2MIOA 4JZ4A 1AVZC 4F7UF 1LJOA 3RMQA 2J6FA 1D3BB 4FSSA 4CC2A 1N5ZA 3UATA 4B6MA 3CCMA 2K2VA 3CCEQ 3HP9A 2YRVA 3CBPA 5GAMj 3G6EQ 2DO3A 2LCCA 2CZ0B 2KAFA 2DTHA 3CCMT 5FLXE 1WYXA 4II1A 2V8KA 4A4HA 2QK0A 2YRDA 4AG2C 4C5GA 5GAOq 4UC4A 3L2UA 4D6WA 3FIFA 1ZHIA 2ZPGB 1Q82R 3NMZC 2HKQB 2A36A 2KT8A 5A0GA 3DLMA 3ZFJA 4N4IA 2OAWA 2KRMA 4XU1A 4RTYA 4FL6A 4FYVB 1YITQ 1Y96B 4F7UA 5C0MA 3NGPA 4OMMA 1C0MA 2LQ8A 1Q7YU 2EQUA 3THKA 1NLPC 3OW2A 4XTXA 2EQJA 3MEAA 2ATCB 4PFZA 3EG9B 1B34A 1WJRA 4MZTA 1T0HA 1D1AA 1MHNA 2WSEE 2SEMA 4JJDA 4C0DC 4Z02A 1PSFA 2OJ2A 2DJZA 5FROA 5KYWA 4M75C 5GAMe 3X28B 1SSFA 4KUIA 2DILA 3GNFB 3QHSA 1WDXA 3OYAA 3CMEA 1VQNQ 2VVKA 4DEYA 4M7DD 4O6JA 1X6OA 5FWBA 5DLQE 4FU6A 2E12A 2RHXA 2RJCA 2CZ6B 3CMET 3FB9A 1N9RA 1Q82U 2I0NA 5CKEA 1X01A 2A3LA 3M0SA 2LZ6B 1IZ6A 3LWHA 1JBMA 3H41A 1X2KA 2Y90A 3PNWC 1NPRA 1PKSA 1WFWA 4VUBA 2DPPB 2FPEA 5GMKl 1Q81C 3PGGA 2ZPIB 5FU7C 3DKMA 1ZA2B 4WCIA 3H0FA 1W2BP 1KFZA 5GAMh 2FRYA 3RERA 4JDSA 2RD1A 4DOWA 1O9SA 2C0IA 2LTOA 3V7SA 2OX7A 4IUQA 2CP0A 1VQ8Q 1EIFA 1W6XA 3H9NA 5FRMA 2EGCA 4FYYB 2HNIA 3M53A 1JJ2P 3S6WA 3L2ZA 3V8JA 2ENMA 3EHRA 1WPYA 1QMCA 2KQWA 3PIOA 2CREA 5D6YA 2LCLA 2EYXA 2IPOB 2DYIA 1PRLC 1QP2A 2CT3A 2KYBA 3QJ6A 4KULA 2XD0A 2YXYA 3CCSA 2L2PA 1NZ9A 4XTYA 2VB6A 2AHJB 3PT9A 4FSXA 1WQWA 1KIKA 1MMGA 5KYXB 3CCST 1AEYA 1GCPA 2M1HA 4RTWA 5KYYA 4MMKA 2A7YA 2C0OA 4K11A 1SG5A 4MDWA 4DA4A 2O88A 2MK5A 1QVFA 2HL5C 1PM3A 1UGPB 2M16A 1VQ4Q 3CCQQ 2DL5A 2FVUA 2EBPA 2D6FA 2BZ8A 1X43A 3VKIA 4M78B 3MEUA 1GFDA 3A5ZB 3E2UA 2D1XA 4PL6A 3I55A 1D1CA 3EHQA 2DERA 3E9GA 3N5BB 3G71A 3CXCP 1ZSZA 3AT1B 4J6WA 2B8AA 1MMNA 1TUCA 2RNAA 3I55T 3JCMW 4F17A 1AWWA 3CCRQ 1SHGA 5IXFA 5GMKi 3G71T 4C5HA 3F70A 1AWXA 5GANf 1G3YA 1S72A 3EAEA 1W2BS 4E2FB 4N0AA 2RQWA 1D3BA 3P8BB 5DLOA 1Q81R 3OYLA 2DEUA 4L59A 3E19A 5I22A 4XTWA 1S72T 1C1AA 2DKGA 4QQDA 1M2VA 6AT1B 1M1FA 1BB9A 4GY5A 1IGUA 1YIJA 1JJ2S 1VUBA 3CC2Q 2M0YA 1VQKQ 2HSEB 4FIBA 4BACA 5KYUB 3JCMc 1YIJT 4RG8A 1YHQA 3E9FA 3H0HA 4BI8B 4J83A 1Y96A 2COWA 1KHIA 4XU2A 1VQOQ 2X4JA 1YHQT 1HYOA 3LH0A 4OMPA 1WHGA 2CUDA 4PFOA 3QYGB 3DB4A 4M77G 4PJLA 4IKFA 1EZZB 5HKCA 2LT1A 4PLIA 2FG0A 4Z8AA 2EJGA 1VQ5Q 3EG1A 2LP5A 3SB2A 1MGQA 1Q81U 3TEEA 4XTVA 1AT1B 1QKWA 3AHUA 1Y71A 2DVJA 1VQMQ 3M56A 5J39A 2V8JA 3L1AA 4J9IA 3BDLA 3EGDB 3TCJA 3CXCS 5KYNA 1WHKA 1RADB 2LC4A 1TTHB 1I1JA 3HFNA 2VXEA 2XDBA 3E1SA 4XAXB 4PJOG 4C8QG 5I2MA 1JXMA 2JNGA 4M77C 1BYMA 2RO0A 4ZTFA 1Y0MA 3LX7A 1PRMC 4RG2A 3NTHA 2VXFA 2RHYA 1D1BA 1ZQ1A 1M27C 2DD4A 4HA8A 1K4US 3QBYA 4IUVA 4QQ6A 1H8KA 5KCOA 3CCUA 4BE1A 1UHFA 3JRZA 4YTLA 1BI3A 2A0FB 1SHFA 2GQIA 3CCUT 3HRSA 1K9MC 2GTOA 5GAMf 4M75D 4A4FA 1YJNQ 3JB9G 1YJ9A 2YDLA 4AT1B 2RH2A 2H3JA 3EGXB 1WHJA 3A8LB 3C4SA 4PJOC 4C8QC 1WX6A 2QG9B 1YJ9T 3T9NA 4ESRA 3EGUA 1T3LA 1FMVA 1HK9A 1VQ6Q 3OS0A 2KXCA 2RQRA 4M78F 2IG0A 2VV5A 5A0DA 4J9CA 3EG3A 3HFOA 3A8GB 1QVGP 2XMFA 2OTJA 1KHCA 1Y7XA 5CQYA 3SWNC 5AT1B 4RCBA 1AWOA 2R5AA 4QVDA 2L89A 1ZLMA 4LUDA 4PKCC 3M59A 2OAUA 2OTJT 1UFFA 4JRKA 5KYXA 4KRTA 4HCKA 1VYTA 5KH6A 2CZ7B 5A0LA 3VS4A 2E64A 5FU6B 2CP3A 1OZ3A 1OU9A 2EYZA 3L2WA 5GAOp 3L42A 1CSKA 2LMJA 2M02A 1M5Q1 2K5FA 1OEBA 4PJJA 5GAN5 2YHTA 2XDDA 3OYIA 4F7UG 1OQKA 2JJ9A 3JCMb 2GCXA 3CMAA 5CKFA 4HVVA 4M78A 1RLQC 2GBQA 2ROTA 2GFUA 5CCAA 4M7DE 3MP1A 2KRNA 3HHTB 2E5QA 3CMAT 4ANJA 3L2QA 3CPFA 2CP5A 3H6ZA 1UEBA 3M0QA 4PK4A 2JXBA 3MO8A 2WACA 1ZX6A 2DA9A 3EFSA 4Y28E 4JJNK 3ZBDA 4JLGA 3OA6A 2RB6A 1LCKA 2HAXA 1FMKA 2JS2A 4R0KA 2O4XB 3HL8A 2K3XA 4LDUA 2Y4YA 2EJFA 3VJPA 4FM4B 1K9MR 1BBZA 2VYTA 1OX9A 1UDLA 2JM8A 2PUKB 1WHMA 2JVVA 3URGA 3H0IA 3TQ7P 3PVQA 3CC7Q 2ECZA 4QKUA 1NLOC 3J7AF 2IIMA 3JCMP 2HZYA 1YWOA 1QVGS 1YI2A 1N9SA 2D8JA 3BFMA 2K3BA 2H8HA 1BI2A 2CH4A 3VS0A 5LJ5d 5GANe 1UB4A 4NL2A 3PVLA 1YI2T 2R5MA 2MCNA 2OTLQ 2QAZA 2DE0X 1KQSA 1N27A 3CPWA 4HT8A 3CC4A 1M4ZA 1SPKA 3JCMg 1KC8R 4JRQA 3CC4T 4RCCA 3BY7A 4OMLA 2C0TA 1S1NA 2MI6A 2BTTA 3OYHA 4C5IA 2DM1A 1K9MU 2VC8A 4JS5A 1D0YA 2W10A 3CCEA 4BY6C 4DEXA 2HQXA 2VKNA 3X25B 3G6EA 1X6BA 2KE9A 2JUFA 2FPDA 3S3OA 3J80E 3M4GA 2FZKB 3CCET 3QG1A 4OMOA 3G6ET 1ZBXA 5GANh 3S3MA 1BIAA 2J06A 2C06A 4KGZB 1VQ7Q 2MAMA 5LJ5g 2JTEA 4C5EA 3IQLA 3REBB 4ZN1A 3UT1A 4QVCA 3X26B 4A53A 2CUBA 3TSZA 1YITA 3NTIA 2ZPFB 3RESA 1OPLA 3H8ZA 2LNVA 1YITT 5IT9E 4C92B 2CSIA 2QQ9A 1KSWA 1U1SA 1GCQA 2PTKA 2COYA 2RN8A 4M75G 5GMKe 2DLPA 2NUZA 3BE3A 3QKJA 5CKDA 2K4YA 4R55A 4AFUC 1M1KC 4V2SA 5GAOm 4Y92A 2DRMA 1PD1A 2P0KA 4WTOB 1WNLA 2KNBB 3EGXA 4N4HA 2EFIA 1UGVA 5LJ5j 3QPHA 2HQHA 1VQNA 9ATCB 1V76A 4J6XA 2A28A 1VQ9Q 4OB2B 5LJ3e 2CSQA 3JSCA 2DRKA 5FU7B 3M4YA 1VQNT 1KQ2A 2DL4A 1RAIB 4L6V5 2K5IA 3VYGA 4LDXA 5IH2A 3JCMe 4M77D 3KUFA 1SRMA 2ABLA 2EQIA 4L5GA 1RACB 2XI9A 1V1CA 2WSFE 2LQWA 2NLUA 1RAHB 5GMKh 3VS2A 1WLPB 2QDLA 5KE2A 2DL3A 2M0OA 1ZSZC 3RKWA 2JTMA 4FYXB 2LJ1A 1CKBA 1QW1A 1WXUA 3C12A 1Z9ZA 1HXDA 4N0AC 1SRLA 2KGTA 1RABB 1Z9QA 3MPUB 1BI1A 5LJ3h 1TH7A 1VQ8A 1IREB 1BI0A 2MF2A 3HRUA 4PJOD 4C8QD 4JPBW 2BZYA 3Q1JA 4ELYC 3FLGA 2AZSA 1VQ8T 2DEQA 3JCMh 4M7AG 2NUPB 1QP3A 5IHNA 4AG1C 2LX9A 2L3QA 4MDXA 3C94A 2JM9A 4DOVA 2QGGA 2ZPBB 4OB1B 1G83A 2L5QA 2BIVA 1KQ1A 1M1KR 1AZGB 2QYZA 3I9QA 1ZSGA 1B07A 3VRYA 4CRIA 3JB9D 2DL8A 3GBQA 1F1BB 3OW2P 2VWFA 1K1ZA 2CZ1B 4JRPA 1G3TA 3RDVA 3CD6Q 4JJBA 4EMKB 1VQ4A 2K5LA 4KH1B 4M7AC 1J3TA 2QGFB 1VQ4T 2FEIA 4HCBA 1FWZA 4CC3A 3SDZA 3NPFA 4C92E 2ESWA 2KI7A 3HKSA 2GFAA 2EYWA 4IUUA 2FZCB 3V8KA 3OYMA 4FYWB 3WVDB 2EVRA 3CCRA 1QWEA 5CO7A 2EQMA 4AMCA 4EDUA 5I2SA 4R56A 1X75C 4J9FA 1ABOA 2KROA 3CCRT 4OMFB
chains in the Genus database with same CATH topology
3CCRQ 1Q86R 3G71Q 3G4SQ 3CMEQ 1VQ4Q 1VQ6Q 1KC8R 3CCQQ 1VQLQ 3CCEQ 1Q7YR 1N8RR 3CCLQ 3CMAQ 3CCJQ 3CCUQ 1YJWQ 3I56Q 3G6EQ 2QA4Q 3CC4Q 1YITQ 1Q81R 1K8AR 1K9MR 1KQSP 3CCVQ 3OW2P 3CPWP 1YJNQ 1QVGP 1VQKQ 1KD1R 3CCSQ 1VQ5Q 1JJ2P 3CCMQ 1W2BP 1VQ9Q 1VQPQ 1VQ7Q 1NJIR 1S72Q 1YIJQ 1M90R 1YI2Q 1QVFP 3CD6Q 1K73R 2OTLQ 3CC2Q 2QEXQ 1VQNQ 3CXCP 3CC7Q 1Q82R 1VQOQ 2OTJQ 1YJ9Q 1M1KR 1YHQQ 3I55Q 1VQ8Q 1VQMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR Q;  1Q86 R;  3G71 Q;  3G4S Q;  3CME Q;  1VQ4 Q;  1VQ6 Q;  1KC8 R;  3CCQ Q;  1VQL Q;  3CCE Q;  1Q7Y R;  1N8R R;  3CCL Q;  3CMA Q;  3CCJ Q;  3CCU Q;  1YJW Q;  3I56 Q;  3G6E Q;  2QA4 Q;  3CC4 Q;  1YIT Q;  1Q81 R;  1K8A R;  1K9M R;  1KQS P;  3CCV Q;  3OW2 P;  3CPW P;  1YJN Q;  1QVG P;  1VQK Q;  1KD1 R;  3CCS Q;  1VQ5 Q;  1JJ2 P;  3CCM Q;  1W2B P;  1VQ9 Q;  1VQP Q;  1VQ7 Q;  1NJI R;  1S72 Q;  1YIJ Q;  1M90 R;  1YI2 Q;  1QVF P;  3CD6 Q;  1K73 R;  2OTL Q;  3CC2 Q;  2QEX Q;  1VQN Q;  3CXC P;  3CC7 Q;  1Q82 R;  1VQO Q;  2OTJ Q;  1YJ9 Q;  1M1K R;  1YHQ Q;  3I55 Q;  1VQ8 Q;  1VQM Q; 
#chains in the Genus database with same CATH topology
 4C92 F;  4QQG A;  4B9W A;  5CIU A;  4X9C A;  1N8R C;  1M1K U;  1MV0 B;  3MCA B;  2PVD B;  2EGA A;  1NPP A;  1PKT A;  5L8R E;  4HT9 A;  1YFN A;  2G6F X;  4JJC A;  3CC2 A;  1AD5 A;  4ORZ A;  2YRC A;  1VQK A;  1MUZ A;  1PSE A;  2D0Q B;  3CC2 T;  1PC0 A;  2A08 A;  1IRX A;  4EMH A;  1WJQ A;  1VQK T;  3ZL7 C;  3OQ5 A;  1ZBJ A;  1VQO A;  2AT1 B;  1KJW A;  4ME7 A;  1ARK A;  1QWF A;  5IXB A;  2RHU A;  1SF9 A;  2DXC A;  2EWN A;  4AFS C;  3OMC A;  4C92 A;  4XTZ A;  1VQO T;  1OUL A;  2HL3 A;  4A4K A;  1XOV A;  4PJN A;  3OW2 S;  1Q86 R;  1VQ5 A;  2J05 A;  1BCO A;  2K2M A;  3M5A A;  2LX7 A;  2QQS A;  3HTR A;  4M78 G;  4M77 B;  3C95 A;  1TG0 A;  1VQ5 T;  2BE7 D;  1VQM A;  3HSB A;  5LL6 S;  4F16 A;  4J9G A;  4DBR A;  1ZUU A;  3OS5 A;  2DET A;  4QW2 A;  1VQM T;  1QLY A;  4M7D B;  1GBR A;  2ED1 A;  4FT2 A;  3MP6 A;  1LPL A;  3MHX A;  5KE3 A;  1OZ2 A;  2EW3 A;  1R8O B;  3EG9 A;  1MNE A;  3RMS A;  2HBW A;  5ECA A;  1TOV A;  1QVF P;  3EH2 A;  2RJD A;  1WIE A;  1NEB A;  2DXU A;  2HEQ A;  2K3Y A;  1UGS B;  2FO0 A;  2O2O A;  1UJY A;  2E6Z A;  5IAY A;  3RKY A;  2D0N A;  4C8Q B;  4M78 C;  3G4S Q;  1OI1 A;  2K6D A;  2CKK A;  2E6N A;  3KFV A;  4BUG A;  1N8R R;  1UJ0 A;  3M0T A;  3M9Q A;  2NUT B;  2RPN A;  1KG1 A;  4ZGE B;  2FRW A;  1PCX A;  2PNI A;  2FL7 A;  2E65 A;  3M0U A;  3ZEH A;  1QQJ A;  3SWN B;  1YCY A;  4E7S A;  2XID A;  1WJS A;  4KBM B;  1JRI A;  4ZGD B;  1YJN A;  1NM7 A;  3FRN A;  3M0P A;  3P8D A;  4Y91 A;  4KT0 E;  2P0P A;  4BD3 A;  1K8A C;  5LJ3 f;  1PG5 B;  1YJN T;  1VIE A;  4DBF A;  2F2V A;  5AYF A;  3TU4 K;  1M90 R;  1I8F A;  2NUP A;  4N4G A;  2EAY A;  1VQ6 A;  3JCM f;  1RLP C;  1ZUK A;  4FW2 A;  2KR3 A;  2O01 E;  2BE9 B;  4KGX B;  1VQ6 T;  3GOX A;  1C6V X;  1BU1 A;  2KVQ G;  1U1T A;  3LYI A;  1N8R U;  1MND A;  2E10 A;  1V29 B;  4E7Z A;  1UUE A;  1TWB A;  2LRQ A;  2GQV A;  3JB9 H;  2PZ1 A;  3QDR B;  1WGS A;  2E41 A;  3OBW A;  3INZ A;  5GAN 3;  2SRC A;  2E4H A;  2ZGW A;  3L2V A;  1ACM B;  5A2Q E;  3LW5 E;  3QWX X;  3OYC A;  4CC4 B;  3NTK A;  4EMK A;  1QVF S;  3CCV Q;  4WF2 A;  1QCO A;  2DIQ A;  2R57 A;  2KEA A;  2FPF A;  1P92 A;  4D8K A;  2QTX A;  1PNJ A;  2DBM A;  3M58 A;  2GNC A;  2LT4 A;  4MZM A;  3LWI A;  2E1H A;  2PUO B;  3SFM A;  1U3O A;  4DBQ A;  2KY9 A;  2X3W D;  1FXX A;  5HY6 A;  2KK4 A;  1KC8 C;  1YCS B;  1U5S A;  3CCJ Q;  3CCL Q;  4M77 E;  3I56 Q;  2X35 A;  3GIB A;  2KSS A;  4RTX A;  4BI4 A;  3X20 B;  2X51 A;  3VS1 A;  1MMD A;  5I21 A;  1HJD A;  1LOJ A;  5KYW B;  3VUZ A;  2EPD A;  2Y4X A;  1ABQ A;  3V7R A;  4RTT A;  3FJP A;  3FEO A;  3LGF A;  1N6A A;  3R6N A;  1G5V A;  1E7O A;  1O75 A;  3O8V A;  5GAO l;  1VQL Q;  2GF7 A;  5J3B A;  1K8A R;  3CC7 A;  2DXB A;  5FRN A;  2XK0 A;  1GCQ C;  1VYU A;  2QQR A;  4JUV A;  1E6H A;  3JCM Q;  2RI3 A;  1XTD A;  3CC7 T;  2P4R A;  2YUP A;  4Z89 A;  1UE9 A;  1VYV A;  3V8L A;  4M7D F;  4IIO A;  1JXO A;  3GPL A;  3D7S B;  2E70 A;  4LDW A;  4M7A D;  1YWP A;  2EJ9 A;  4C8Q E;  1JO8 A;  3BW1 A;  5DM7 R;  3QYH B;  1QCN A;  2OTL A;  3P8H A;  8ATC B;  1WZO A;  5GAN 4;  1NJI C;  4J6Y A;  1G8X A;  2OTL T;  2F1L A;  3FDR A;  4XU0 A;  2K79 A;  4NL3 A;  2AZV A;  3M55 A;  1SSH A;  5I11 A;  2F69 A;  1IO6 A;  5HK0 A;  3TVT A;  5KYU A;  2EIF A;  1IHV A;  2FYK A;  5IHK A;  2W0Z A;  1QVP A;  3JB9 I;  2QA4 Q;  5GAM d;  1I5L A;  1RL2 A;  4RMO A;  2RJE A;  3OSV A;  1VQP Q;  5D6X A;  4M7D A;  2KMT A;  1K8A U;  2MMP A;  4EMG A;  5CVI A;  2QEX Q;  2JMC A;  2BKD N;  2DIG A;  2K57 A;  2A37 A;  4BI3 A;  2D9T A;  3HPW A;  1WI7 A;  1VQ7 A;  4ZNX A;  2AKK A;  1KK7 A;  3CBM A;  1H3Z A;  2LVM A;  1VQ7 T;  2KRS A;  1XQH A;  3A8O B;  3PMI A;  1TS9 A;  4XU3 A;  1WXT A;  3EGD A;  2JMA A;  1RAA B;  5DY9 A;  2HMA A;  2AK5 A;  3OY9 A;  3G1J A;  1YJW Q;  1PHT A;  3V7C A;  2RI2 A;  3HRT A;  1TUG B;  4J7F A;  1LNX A;  2DF6 A;  4C0D B;  1VA7 A;  2V1Q A;  3VS3 A;  1UGR B;  1I4K 1;  4M75 B;  1ZA1 B;  2ED0 A;  4J9D A;  2DAQ A;  1VQ9 A;  2CP2 A;  4IUR A;  2VGN A;  1ZSZ B;  4J5Y A;  2EKH A;  4NOY A;  3NFC A;  1M9S A;  1VQ9 T;  1M3B A;  1NJI R;  2YT6 A;  1KC8 U;  4OB0 B;  2NYS A;  3OYY A;  2MWO A;  2BUD A;  4IUT A;  1B3Q A;  3C0C A;  1NG2 A;  2DJQ A;  2E3I A;  4RTU A;  1VOM A;  4X1V A;  2HCK A;  4XK8 E;  3MET A;  1IHW A;  5GJW B;  3SD4 A;  4M78 D;  1SKU B;  1X69 A;  2LJ3 A;  1M2V B;  4OGE A;  3EFR A;  1KQS P;  3DB3 A;  3CPW P;  2L3P A;  4D8D A;  2MWP A;  3EH1 A;  1Y07 A;  1OV3 A;  1NYF A;  4BDY A;  3M54 A;  4JS4 A;  2KDS A;  4ELZ C;  2DZ9 A;  1W2B A;  2KXD A;  4Z88 A;  2YSQ A;  3QO3 A;  1UEC A;  2JT4 A;  1TUD A;  4C92 G;  2AKL A;  2LQK A;  2QQA A;  2L3S A;  2VGM A;  2G3R A;  2X9H A;  2J6O A;  4LN2 A;  3CCM Q;  3VU3 C;  1U8R A;  1MV3 A;  3U23 A;  1M8M A;  2ROL A;  1W70 A;  1UHC A;  1JJ2 A;  1NJI U;  3EG0 A;  4FCY A;  5GJV B;  4TVR A;  2HSP A;  1IB8 A;  2O9S A;  3I5R A;  2RK1 A;  2QTV A;  2RMO A;  3QDF A;  1OU8 A;  3NHN A;  4M7A B;  3EFO B;  3VYH B;  1GL5 A;  1NEG A;  1KD1 C;  1M2O A;  1M3A A;  5LJ5 e;  5GAN 6;  1K73 C;  1X27 A;  3FC3 A;  2X4W A;  3QII A;  3M0R A;  1WXB A;  4LDY A;  5M9O A;  4C92 C;  1PD0 A;  4M4Z A;  3OYD A;  3CD6 A;  2F2W A;  4B9X A;  2EGE A;  2RJF A;  3GF5 A;  4C0G A;  3CD6 T;  1TXQ A;  2O4X A;  4XQ3 A;  3OYN A;  2MOX A;  1XJW B;  3VS7 A;  1FMW A;  3RNJ A;  3CBO A;  2ZCF B;  2XG8 D;  1G3S A;  4E7K A;  4RTV A;  1KQS S;  3CXC A;  1Q86 C;  3LGL A;  3CPW S;  3SEM A;  2RK2 A;  2VAS A;  3CME Q;  1DJ7 B;  2CGH A;  4HXJ A;  3QUI A;  5IHI A;  1BK2 A;  2RM4 A;  4A54 A;  2DTO A;  3MEW A;  2E3H A;  3UPU A;  2RHZ A;  5LJ5 h;  2JTF A;  1WQ7 A;  4M75 E;  7AT1 B;  1M30 A;  2RI5 A;  3CCQ A;  3OYK A;  2HDA A;  1QKX A;  5CQX A;  4ZN3 A;  4GLK A;  2V8I A;  2B86 A;  2JOY A;  3CCQ T;  1PWT A;  3OSS C;  5CR2 A;  3X24 B;  2XHC A;  1TU0 B;  2QXF A;  4P5N A;  4M75 F;  2HQE A;  3A98 A;  5EG2 A;  3R6O A;  3OYG A;  1K9A A;  3OYF A;  2DZC A;  3GNG A;  4RKU E;  3PTA A;  1OX8 A;  3OB9 A;  2QQB A;  2PQW A;  1FYN A;  4F14 A;  3M57 A;  1JB0 E;  2CDT A;  3VS6 A;  5GAN 8;  3KBG A;  2WSC E;  5IN1 A;  1RI0 A;  2CYZ B;  1KD1 R;  2EYQ A;  2GGR A;  3SHW A;  1K73 R;  2XDP A;  3A1P A;  2M9U A;  4XTU A;  2LQN A;  1A0N B;  1RI9 A;  5FWC A;  2M51 A;  2J6K A;  2EKO A;  1G3W A;  3JCM J;  2LDM A;  1G2B A;  4M75 A;  4OVA A;  2PU9 B;  1R77 A;  3OYJ A;  4E7J A;  3QSU A;  2L3R A;  3CCS Q;  1K0X A;  4QT7 A;  1JU5 C;  2YUO A;  1M90 C;  2L0A A;  2MYS A;  1UGQ B;  4C0F A;  5GAO n;  2XU8 A;  5GAN 2;  4GLM A;  2RQT A;  4ATO A;  2COZ A;  3QZ5 B;  4BB7 A;  3VV0 A;  4M7A E;  2DX1 A;  4OB3 B;  2Z0W A;  4EMK C;  1JEG A;  1I0C A;  3ASK A;  4PJM A;  4DQ2 A;  4J7I A;  2V26 A;  4BDZ A;  1YN8 A;  3G4S A;  4HCC A;  1AHJ B;  2ZAE A;  1KD1 U;  1EX4 A;  4IUP A;  3RIR A;  3GP8 A;  1QCF A;  2ZPH B;  3I55 Q;  1K73 U;  4M7A F;  1MMA A;  1H3H A;  3G4S T;  3G71 Q;  4RTZ A;  1GXI E;  2KT1 A;  4IIM A;  5D6W A;  1FX7 A;  2KBT A;  2NWM A;  2F2X A;  4RUG A;  4Q5W A;  1NBE B;  3PMT A;  1S72 Q;  1HD3 A;  1K76 A;  5HCK A;  3CEY A;  3QJY A;  3DLL A;  1EFN A;  2HBP A;  1ZUY A;  4BE0 A;  4DBH A;  5GMK m;  4KH0 B;  3A8H B;  4PJO B;  2X4Y A;  2DYB A;  4KGV B;  4CI0 C;  4EPC A;  2DVE A;  4JLI A;  1JQQ A;  5D7U A;  3BDU A;  4NS5 A;  5CKH A;  1Q86 U;  1YIJ Q;  4AFZ C;  3OS2 A;  4M7A A;  1M8V A;  3EFO A;  1QVG A;  4CC7 A;  3J81 E;  1SEM A;  4GBQ A;  1I81 A;  4OF1 A;  3JCM X;  2CP6 A;  3MKD A;  3RR6 A;  1WHL A;  1YHQ Q;  2JW4 A;  4M7D G;  1LVK A;  3GLX A;  2BZX A;  3CQT A;  2V1R A;  2CH4 W;  3TRE A;  8AT1 B;  1IXD A;  2CS7 A;  3QZ9 B;  5L23 A;  1TSF A;  4PNO A;  1E6G A;  3UF4 A;  2X4X A;  1BIB A;  3OBY A;  4HVW A;  1Y57 A;  3UWN A;  3LLR A;  3O5Z A;  3MJX A;  4J9H A;  4A4E A;  3RUX A;  3CCV A;  2R58 A;  2XKO C;  4FW1 A;  5GAN d;  2DMO A;  2OI3 A;  5KCH A;  1K0S A;  1H92 A;  3CCV T;  2F5T X;  2HKN A;  5CAI A;  3FJ5 A;  2EQK A;  3ER0 A;  5J26 A;  1AWJ A;  2FB7 A;  4M7D C;  2QAS A;  1D0Z A;  3CCL A;  4PLL A;  3CCJ A;  4ZGJ B;  3I56 A;  3JB9 J;  2K7A A;  1H64 1;  3EG2 A;  1RAE B;  4E47 A;  1WA7 A;  3CCL T;  3CCJ T;  3I56 T;  2MPX C;  4M78 E;  2DL7 A;  5LJ5 f;  3OMG A;  1GBQ A;  4LUE A;  3OYB A;  4OGC A;  5C6S A;  1W1F A;  2L8D A;  2RA2 A;  2YLB A;  3JV3 A;  3VS5 A;  2AIR B;  4EIK A;  1X2Q A;  1VQL A;  1OPK A;  2KYM A;  2DXT A;  2YUN A;  4MZP A;  3G7Z A;  4F7U B;  1UG1 A;  2DNU A;  4C92 D;  4E7H A;  1M90 U;  3I5S A;  2RQU A;  1VQL T;  2XIC A;  5GAN 7;  3CCU Q;  4J9B A;  3UA7 A;  3WXM B;  4HCZ A;  5GAO r;  5GAN g;  4LNP A;  4F04 B;  2FHD A;  1UTI A;  1B34 B;  1D0X A;  4O5V A;  3RKX A;  3OYE A;  2DK3 A;  1YNZ A;  5CKB A;  4LD6 A;  1YJ9 Q;  2F5K A;  2VUB A;  3PFS A;  1T3S A;  2P0Q A;  1GRI A;  1R0C B;  4LDV A;  2JS0 A;  3I35 A;  4M77 F;  1CKA A;  2D8H A;  2RF0 A;  3UA6 A;  4E7I A;  4OMQ A;  3JAM E;  2O31 A;  3UDC A;  1X6G A;  2P84 A;  3A8M B;  5FW9 A;  2EYY A;  1NYG A;  1OYX A;  2RQV A;  2GTJ A;  1RAF B;  2CP7 A;  2OTJ Q;  2QA4 A;  2P4T A;  1XNI A;  4PJO E;  2YWW A;  4KUD K;  5GAN j;  3LH5 A;  1VQP A;  5HK3 A;  4LXC A;  4BY6 B;  1Q7Y C;  3PE0 A;  2QA4 T;  5LJ3 d;  4AFQ C;  2QEX A;  3TSW A;  2FZG B;  4PFP A;  1VQP T;  5EC7 A;  3S3N A;  3QWY A;  2YUQ A;  2X3X D;  2QEX T;  2I2L A;  4E7L A;  3PIP A;  3KXT A;  4PJO F;  3RBB B;  3JCM d;  4C8Q F;  4M77 A;  1Q95 G;  2DFU A;  2JN0 A;  1VIF A;  2K9G A;  4LE9 A;  1T0J A;  2LCS A;  1R0B G;  2E5K A;  2DD5 A;  4JRI A;  3CMA Q;  1IGQ A;  4FT4 A;  2RHI A;  4HKE A;  4OP0 A;  1M1G A;  1RUW A;  4ZTJ A;  1HSQ A;  2O9V A;  4A63 B;  3ULR B;  2ZZD A;  3QXE B;  3VUB A;  3L2R A;  5FU6 C;  4BE2 A;  1Q82 C;  4LD9 K;  4J9E A;  1YJW A;  4HVU A;  2ZPE B;  3WVE B;  3MEV A;  1D09 B;  2LJ0 A;  1RAG B;  1YJW T;  2J7I A;  2PVG B;  5CK9 A;  2LNH B;  3JB9 F;  1YP5 A;  4OMN A;  1I07 A;  4A4G A;  4C0Z A;  4PJO A;  1AOJ A;  1NE8 A;  4C8Q A;  5LJ3 g;  1AZE A;  1W4S A;  3OS1 A;  3JCM V;  3REA B;  3MP8 A;  1U06 A;  2NUT A;  1M3C A;  2CT4 A;  2JZ2 A;  5KYY B;  4E6R A;  2H3E B;  4QVZ A;  1WHH A;  4J8O A;  4MML A;  2YLC A;  1I5O B;  3SWN A;  2DBK A;  3VRZ A;  2DTI A;  5GMK j;  4JZ3 A;  2HD0 A;  1OOT A;  1GFC A;  2PVO B;  1YI2 Q;  5GAM g;  3ME9 A;  4F7U E;  4X9D A;  2QDY B;  2QI2 A;  1BKB A;  1YBY A;  4X34 A;  1BCM A;  5LJ3 j;  1Q7Y R;  2IVW A;  1B7T A;  3CC4 Q;  2MIO A;  4JZ4 A;  1AVZ C;  4F7U F;  1LJO A;  3RMQ A;  2J6F A;  1D3B B;  4FSS A;  4CC2 A;  1N5Z A;  3UAT A;  4B6M A;  3CCM A;  2K2V A;  3CCE Q;  3HP9 A;  2YRV A;  3CBP A;  5GAM j;  3G6E Q;  2DO3 A;  2LCC A;  2CZ0 B;  2KAF A;  2DTH A;  3CCM T;  5FLX E;  1WYX A;  4II1 A;  2V8K A;  4A4H A;  2QK0 A;  2YRD A;  4AG2 C;  4C5G A;  5GAO q;  4UC4 A;  3L2U A;  4D6W A;  3FIF A;  1ZHI A;  2ZPG B;  1Q82 R;  3NMZ C;  2HKQ B;  2A36 A;  2KT8 A;  5A0G A;  3DLM A;  3ZFJ A;  4N4I A;  2OAW A;  2KRM A;  4XU1 A;  4RTY A;  4FL6 A;  4FYV B;  1YIT Q;  1Y96 B;  4F7U A;  5C0M A;  3NGP A;  4OMM A;  1C0M A;  2LQ8 A;  1Q7Y U;  2EQU A;  3THK A;  1NLP C;  3OW2 A;  4XTX A;  2EQJ A;  3MEA A;  2ATC B;  4PFZ A;  3EG9 B;  1B34 A;  1WJR A;  4MZT A;  1T0H A;  1D1A A;  1MHN A;  2WSE E;  2SEM A;  4JJD A;  4C0D C;  4Z02 A;  1PSF A;  2OJ2 A;  2DJZ A;  5FRO A;  5KYW A;  4M75 C;  5GAM e;  3X28 B;  1SSF A;  4KUI A;  2DIL A;  3GNF B;  3QHS A;  1WDX A;  3OYA A;  3CME A;  1VQN Q;  2VVK A;  4DEY A;  4M7D D;  4O6J A;  1X6O A;  5FWB A;  5DLQ E;  4FU6 A;  2E12 A;  2RHX A;  2RJC A;  2CZ6 B;  3CME T;  3FB9 A;  1N9R A;  1Q82 U;  2I0N A;  5CKE A;  1X01 A;  2A3L A;  3M0S A;  2LZ6 B;  1IZ6 A;  3LWH A;  1JBM A;  3H41 A;  1X2K A;  2Y90 A;  3PNW C;  1NPR A;  1PKS A;  1WFW A;  4VUB A;  2DPP B;  2FPE A;  5GMK l;  1Q81 C;  3PGG A;  2ZPI B;  5FU7 C;  3DKM A;  1ZA2 B;  4WCI A;  3H0F A;  1W2B P;  1KFZ A;  5GAM h;  2FRY A;  3RER A;  4JDS A;  2RD1 A;  4DOW A;  1O9S A;  2C0I A;  2LTO A;  3V7S A;  2OX7 A;  4IUQ A;  2CP0 A;  1VQ8 Q;  1EIF A;  1W6X A;  3H9N A;  5FRM A;  2EGC A;  4FYY B;  2HNI A;  3M53 A;  1JJ2 P;  3S6W A;  3L2Z A;  3V8J A;  2ENM A;  3EHR A;  1WPY A;  1QMC A;  2KQW A;  3PIO A;  2CRE A;  5D6Y A;  2LCL A;  2EYX A;  2IPO B;  2DYI A;  1PRL C;  1QP2 A;  2CT3 A;  2KYB A;  3QJ6 A;  4KUL A;  2XD0 A;  2YXY A;  3CCS A;  2L2P A;  1NZ9 A;  4XTY A;  2VB6 A;  2AHJ B;  3PT9 A;  4FSX A;  1WQW A;  1KIK A;  1MMG A;  5KYX B;  3CCS T;  1AEY A;  1GCP A;  2M1H A;  4RTW A;  5KYY A;  4MMK A;  2A7Y A;  2C0O A;  4K11 A;  1SG5 A;  4MDW A;  4DA4 A;  2O88 A;  2MK5 A;  1QVF A;  2HL5 C;  1PM3 A;  1UGP B;  2M16 A;  1VQ4 Q;  3CCQ Q;  2DL5 A;  2FVU A;  2EBP A;  2D6F A;  2BZ8 A;  1X43 A;  3VKI A;  4M78 B;  3MEU A;  1GFD A;  3A5Z B;  3E2U A;  2D1X A;  4PL6 A;  3I55 A;  1D1C A;  3EHQ A;  2DER A;  3E9G A;  3N5B B;  3G71 A;  3CXC P;  1ZSZ A;  3AT1 B;  4J6W A;  2B8A A;  1MMN A;  1TUC A;  2RNA A;  3I55 T;  3JCM W;  4F17 A;  1AWW A;  3CCR Q;  1SHG A;  5IXF A;  5GMK i;  3G71 T;  4C5H A;  3F70 A;  1AWX A;  5GAN f;  1G3Y A;  1S72 A;  3EAE A;  1W2B S;  4E2F B;  4N0A A;  2RQW A;  1D3B A;  3P8B B;  5DLO A;  1Q81 R;  3OYL A;  2DEU A;  4L59 A;  3E19 A;  5I22 A;  4XTW A;  1S72 T;  1C1A A;  2DKG A;  4QQD A;  1M2V A;  6AT1 B;  1M1F A;  1BB9 A;  4GY5 A;  1IGU A;  1YIJ A;  1JJ2 S;  1VUB A;  3CC2 Q;  2M0Y A;  1VQK Q;  2HSE B;  4FIB A;  4BAC A;  5KYU B;  3JCM c;  1YIJ T;  4RG8 A;  1YHQ A;  3E9F A;  3H0H A;  4BI8 B;  4J83 A;  1Y96 A;  2COW A;  1KHI A;  4XU2 A;  1VQO Q;  2X4J A;  1YHQ T;  1HYO A;  3LH0 A;  4OMP A;  1WHG A;  2CUD A;  4PFO A;  3QYG B;  3DB4 A;  4M77 G;  4PJL A;  4IKF A;  1EZZ B;  5HKC A;  2LT1 A;  4PLI A;  2FG0 A;  4Z8A A;  2EJG A;  1VQ5 Q;  3EG1 A;  2LP5 A;  3SB2 A;  1MGQ A;  1Q81 U;  3TEE A;  4XTV A;  1AT1 B;  1QKW A;  3AHU A;  1Y71 A;  2DVJ A;  1VQM Q;  3M56 A;  5J39 A;  2V8J A;  3L1A A;  4J9I A;  3BDL A;  3EGD B;  3TCJ A;  3CXC S;  5KYN A;  1WHK A;  1RAD B;  2LC4 A;  1TTH B;  1I1J A;  3HFN A;  2VXE A;  2XDB A;  3E1S A;  4XAX B;  4PJO G;  4C8Q G;  5I2M A;  1JXM A;  2JNG A;  4M77 C;  1BYM A;  2RO0 A;  4ZTF A;  1Y0M A;  3LX7 A;  1PRM C;  4RG2 A;  3NTH A;  2VXF A;  2RHY A;  1D1B A;  1ZQ1 A;  1M27 C;  2DD4 A;  4HA8 A;  1K4U S;  3QBY A;  4IUV A;  4QQ6 A;  1H8K A;  5KCO A;  3CCU A;  4BE1 A;  1UHF A;  3JRZ A;  4YTL A;  1BI3 A;  2A0F B;  1SHF A;  2GQI A;  3CCU T;  3HRS A;  1K9M C;  2GTO A;  5GAM f;  4M75 D;  4A4F A;  1YJN Q;  3JB9 G;  1YJ9 A;  2YDL A;  4AT1 B;  2RH2 A;  2H3J A;  3EGX B;  1WHJ A;  3A8L B;  3C4S A;  4PJO C;  4C8Q C;  1WX6 A;  2QG9 B;  1YJ9 T;  3T9N A;  4ESR A;  3EGU A;  1T3L A;  1FMV A;  1HK9 A;  1VQ6 Q;  3OS0 A;  2KXC A;  2RQR A;  4M78 F;  2IG0 A;  2VV5 A;  5A0D A;  4J9C A;  3EG3 A;  3HFO A;  3A8G B;  1QVG P;  2XMF A;  2OTJ A;  1KHC A;  1Y7X A;  5CQY A;  3SWN C;  5AT1 B;  4RCB A;  1AWO A;  2R5A A;  4QVD A;  2L89 A;  1ZLM A;  4LUD A;  4PKC C;  3M59 A;  2OAU A;  2OTJ T;  1UFF A;  4JRK A;  5KYX A;  4KRT A;  4HCK A;  1VYT A;  5KH6 A;  2CZ7 B;  5A0L A;  3VS4 A;  2E64 A;  5FU6 B;  2CP3 A;  1OZ3 A;  1OU9 A;  2EYZ A;  3L2W A;  5GAO p;  3L42 A;  1CSK A;  2LMJ A;  2M02 A;  1M5Q 1;  2K5F A;  1OEB A;  4PJJ A;  5GAN 5;  2YHT A;  2XDD A;  3OYI A;  4F7U G;  1OQK A;  2JJ9 A;  3JCM b;  2GCX A;  3CMA A;  5CKF A;  4HVV A;  4M78 A;  1RLQ C;  2GBQ A;  2ROT A;  2GFU A;  5CCA A;  4M7D E;  3MP1 A;  2KRN A;  3HHT B;  2E5Q A;  3CMA T;  4ANJ A;  3L2Q A;  3CPF A;  2CP5 A;  3H6Z A;  1UEB A;  3M0Q A;  4PK4 A;  2JXB A;  3MO8 A;  2WAC A;  1ZX6 A;  2DA9 A;  3EFS A;  4Y28 E;  4JJN K;  3ZBD A;  4JLG A;  3OA6 A;  2RB6 A;  1LCK A;  2HAX A;  1FMK A;  2JS2 A;  4R0K A;  2O4X B;  3HL8 A;  2K3X A;  4LDU A;  2Y4Y A;  2EJF A;  3VJP A;  4FM4 B;  1K9M R;  1BBZ A;  2VYT A;  1OX9 A;  1UDL A;  2JM8 A;  2PUK B;  1WHM A;  2JVV A;  3URG A;  3H0I A;  3TQ7 P;  3PVQ A;  3CC7 Q;  2ECZ A;  4QKU A;  1NLO C;  3J7A F;  2IIM A;  3JCM P;  2HZY A;  1YWO A;  1QVG S;  1YI2 A;  1N9S A;  2D8J A;  3BFM A;  2K3B A;  2H8H A;  1BI2 A;  2CH4 A;  3VS0 A;  5LJ5 d;  5GAN e;  1UB4 A;  4NL2 A;  3PVL A;  1YI2 T;  2R5M A;  2MCN A;  2OTL Q;  2QAZ A;  2DE0 X;  1KQS A;  1N27 A;  3CPW A;  4HT8 A;  3CC4 A;  1M4Z A;  1SPK A;  3JCM g;  1KC8 R;  4JRQ A;  3CC4 T;  4RCC A;  3BY7 A;  4OML A;  2C0T A;  1S1N A;  2MI6 A;  2BTT A;  3OYH A;  4C5I A;  2DM1 A;  1K9M U;  2VC8 A;  4JS5 A;  1D0Y A;  2W10 A;  3CCE A;  4BY6 C;  4DEX A;  2HQX A;  2VKN A;  3X25 B;  3G6E A;  1X6B A;  2KE9 A;  2JUF A;  2FPD A;  3S3O A;  3J80 E;  3M4G A;  2FZK B;  3CCE T;  3QG1 A;  4OMO A;  3G6E T;  1ZBX A;  5GAN h;  3S3M A;  1BIA A;  2J06 A;  2C06 A;  4KGZ B;  1VQ7 Q;  2MAM A;  5LJ5 g;  2JTE A;  4C5E A;  3IQL A;  3REB B;  4ZN1 A;  3UT1 A;  4QVC A;  3X26 B;  4A53 A;  2CUB A;  3TSZ A;  1YIT A;  3NTI A;  2ZPF B;  3RES A;  1OPL A;  3H8Z A;  2LNV A;  1YIT T;  5IT9 E;  4C92 B;  2CSI A;  2QQ9 A;  1KSW A;  1U1S A;  1GCQ A;  2PTK A;  2COY A;  2RN8 A;  4M75 G;  5GMK e;  2DLP A;  2NUZ A;  3BE3 A;  3QKJ A;  5CKD A;  2K4Y A;  4R55 A;  4AFU C;  1M1K C;  4V2S A;  5GAO m;  4Y92 A;  2DRM A;  1PD1 A;  2P0K A;  4WTO B;  1WNL A;  2KNB B;  3EGX A;  4N4H A;  2EFI A;  1UGV A;  5LJ5 j;  3QPH A;  2HQH A;  1VQN A;  9ATC B;  1V76 A;  4J6X A;  2A28 A;  1VQ9 Q;  4OB2 B;  5LJ3 e;  2CSQ A;  3JSC A;  2DRK A;  5FU7 B;  3M4Y A;  1VQN T;  1KQ2 A;  2DL4 A;  1RAI B;  4L6V 5;  2K5I A;  3VYG A;  4LDX A;  5IH2 A;  3JCM e;  4M77 D;  3KUF A;  1SRM A;  2ABL A;  2EQI A;  4L5G A;  1RAC B;  2XI9 A;  1V1C A;  2WSF E;  2LQW A;  2NLU A;  1RAH B;  5GMK h;  3VS2 A;  1WLP B;  2QDL A;  5KE2 A;  2DL3 A;  2M0O A;  1ZSZ C;  3RKW A;  2JTM A;  4FYX B;  2LJ1 A;  1CKB A;  1QW1 A;  1WXU A;  3C12 A;  1Z9Z A;  1HXD A;  4N0A C;  1SRL A;  2KGT A;  1RAB B;  1Z9Q A;  3MPU B;  1BI1 A;  5LJ3 h;  1TH7 A;  1VQ8 A;  1IRE B;  1BI0 A;  2MF2 A;  3HRU A;  4PJO D;  4C8Q D;  4JPB W;  2BZY A;  3Q1J A;  4ELY C;  3FLG A;  2AZS A;  1VQ8 T;  2DEQ A;  3JCM h;  4M7A G;  2NUP B;  1QP3 A;  5IHN A;  4AG1 C;  2LX9 A;  2L3Q A;  4MDX A;  3C94 A;  2JM9 A;  4DOV A;  2QGG A;  2ZPB B;  4OB1 B;  1G83 A;  2L5Q A;  2BIV A;  1KQ1 A;  1M1K R;  1AZG B;  2QYZ A;  3I9Q A;  1ZSG A;  1B07 A;  3VRY A;  4CRI A;  3JB9 D;  2DL8 A;  3GBQ A;  1F1B B;  3OW2 P;  2VWF A;  1K1Z A;  2CZ1 B;  4JRP A;  1G3T A;  3RDV A;  3CD6 Q;  4JJB A;  4EMK B;  1VQ4 A;  2K5L A;  4KH1 B;  4M7A C;  1J3T A;  2QGF B;  1VQ4 T;  2FEI A;  4HCB A;  1FWZ A;  4CC3 A;  3SDZ A;  3NPF A;  4C92 E;  2ESW A;  2KI7 A;  3HKS A;  2GFA A;  2EYW A;  4IUU A;  2FZC B;  3V8K A;  3OYM A;  4FYW B;  3WVD B;  2EVR A;  3CCR A;  1QWE A;  5CO7 A;  2EQM A;  4AMC A;  4EDU A;  5I2S A;  4R56 A;  1X75 C;  4J9F A;  1ABO A;  2KRO A;  3CCR T;  4OMF B; 
#chains in the Genus database with same CATH homology
 3CCR Q;  1Q86 R;  3G71 Q;  3G4S Q;  3CME Q;  1VQ4 Q;  1VQ6 Q;  1KC8 R;  3CCQ Q;  1VQL Q;  3CCE Q;  1Q7Y R;  1N8R R;  3CCL Q;  3CMA Q;  3CCJ Q;  3CCU Q;  1YJW Q;  3I56 Q;  3G6E Q;  2QA4 Q;  3CC4 Q;  1YIT Q;  1Q81 R;  1K8A R;  1K9M R;  1KQS P;  3CCV Q;  3OW2 P;  3CPW P;  1YJN Q;  1QVG P;  1VQK Q;  1KD1 R;  3CCS Q;  1VQ5 Q;  1JJ2 P;  3CCM Q;  1W2B P;  1VQ9 Q;  1VQP Q;  1VQ7 Q;  1NJI R;  1S72 Q;  1YIJ Q;  1M90 R;  1YI2 Q;  1QVF P;  3CD6 Q;  1K73 R;  2OTL Q;  3CC2 Q;  2QEX Q;  1VQN Q;  3CXC P;  3CC7 Q;  1Q82 R;  1VQO Q;  2OTJ Q;  1YJ9 Q;  1M1K R;  1YHQ Q;  3I55 Q;  1VQ8 Q;  1VQM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...