1VQ7Q

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq7Q00
3CPWP 1Q81R 1KQSP 3CCQQ 1YI2Q 2QA4Q 3CD6Q 1YJWQ 1QVGP 1YJ9Q 1Q7YR 1KC8R 3CCEQ 1VQ6Q 1NJIR 1QVFP 2OTLQ 3I56Q 1YHQQ 1S72Q 1K73R 1VQOQ 1VQ9Q 3CCRQ 1YIJQ 3G6EQ 3CXCP 1JJ2P 1VQPQ 1VQNQ 1Q86R 1Q82R 3CMAQ 1VQKQ 3CCMQ 3CMEQ 1N8RR 1K9MR 1K8AR 2OTJQ 1W2BP 1M90R 1VQMQ 3OW2P 1VQ4Q 1VQ5Q 1VQ8Q 1M1KR 3CC2Q 3CC7Q 3CCLQ 1YITQ 3I55Q 3CCJQ 3CCVQ 3G4SQ 3G71Q 3CCSQ 1KD1R 1VQLQ 3CC4Q 1YJNQ 1VQ7Q 3CCUQ 2QEXQ
chains in the Genus database with same CATH superfamily
1H641 4C5HA 1PSFA 4O5VA 4ANJA 4QQ6A 4BE2A 1YHQQ 3M0RA 3TVTA 2AKLA 5GAOn 2ZCFB 4LDUA 4XAXB 1U1TA 4C0DC 3NFCA 2VVKA 3META 4KGZB 1YI2A 5AYFA 1YIJA 1MNEA 4N4HA 1UJYA 3JB9G 1VQLA 2K6DA 1D1CA 3WVDB 5FW9A 3ZEHA 3QSUA 4HT9A 5GAMd 1AZGB 1QVGS 3H0FA 5EG2A 3CCMQ 4JLIA 2MOXA 2LP5A 1MNDA 2DBKA 4PJNA 4PLIA 4QQGA 3JCMc 5KYWB 4HCBA 3M4YA 2RB6A 1VQLT 1VQ7T 5GMKi 2FZGB 1WFWA 4LXCA 1Q86U 4HXJA 3PMTA 2E1HA 1UJ0A 4XTWA 1OEBA 1OOTA 2VXFA 3A5ZB 3EFSA 2JXBA 3OYCA 1VQ5A 3SWNC 2GF7A 3CMAT 2KR3A 5FWBA 1JXMA 2K3XA 2LT4A 4E7KA 1PD1A 1B34A 3GPLA 4WF2A 3R6OA 4OVAA 4AG1C 2P84A 1KC8U 1SSHA 3OYFA 3CXCP 1NG2A 4E7JA 4PFZA 4X1VA 4CC3A 1AEYA 3AT1B 5GAOr 4FT4A 8ATCB 3EG9B 1KK7A 1TXQA 1FMWA 2QA4T 2HBPA 1H92A 2D8HA 1Q95G 4CC2A 2OTJA 2K5LA 5LJ5f 2BKDN 4FU6A 2E12A 1V29B 4A54A 1GCQC 5HY6A 3MP8A 4Y91A 4EIKA 2M0YA 1ZBJA 2DXBA 1VYTA 1WGSA 2DERA 2GBQA 1QCNA 5LJ3e 3RESA 4ZN3A 3CCLA 1D0ZA 1WYXA 2A7YA 1NYGA 2KAFA 4MZMA 3MO8A 5IHKA 1R0BG 1R77A 3E9GA 2MCNA 4NL2A 2WSFE 3JB9D 3LWHA 1I0CA 1WJSA 3JB9F 2NWMA 2RMOA 3VS4A 3RIRA 3L2RA 4Z02A 2DXTA 1VQ8Q 1JO8A 4XTUA 1WXTA 4ZGEB 3CCUA 2DETA 4IUQA 5LJ3f 4IURA 1UGSB 3CPWP 1K76A 4M78C 3OYHA 4MZTA 1YITA 1TU0B 3X20B 3QIIA 4IIMA 2RHYA 1S72T 4QT7A 3CCMT 2ZPHB 4FW2A 4BD3A 3G4SQ 1WIEA 2V1QA 2JTFA 1C6VX 1VIEA 3QDRB 1GFCA 2HQXA 3CCVT 3JSCA 1WHLA 1G3SA 4M78B 4RUGA 1K9MU 4D6WA 1BI3A 3GNFB 5LJ3g 2DBMA 3QYHB 1X01A 4PFOA 2JS0A 5I11A 1YFNA 2QQRA 2XIDA 2HEQA 3CCRT 1QVPA 3JCMf 2DFUA 3ZL7C 1UGVA 5GMKe 3P8DA 1KQSS 2ZZDA 1T0HA 2EFIA 3F70A 4J8OA 2FPFA 3CCVA 4IIOA 2KRSA 2CP0A 2X4XA 4IUPA 1G2BA 1M30A 1FMVA 3QO3A 1IZ6A 3QG1A 4FM4B 1YBYA 1SHGA 2XKOC 1YJ9A 2ROTA 3GP8A 3VJPA 4FT2A 4LDWA 1M90C 1D09B 3OYLA 2B86A 2RNAA 3RUXA 3I56A 2QASA 4PJOA 1OX9A 1M1GA 3IQLA 2LCSA 1K8AC 2A0FB 5LJ5e 4J6WA 3RKXA 4M75F 1AZEA 2HDAA 2JOYA 2RI5A 1K8AR 1HSQA 3J81E 3C94A 3OA6A 1OZ2A 5GAN3 3VS2A 4HCKA 1HK9A 2DX1A 2O4XB 4RCBA 1YJNA 3CCRA 1K73U 1P92A 4RTZA 3V8JA 2M02A 1KHCA 2SEMA 1KG1A 2EKHA 2EJGA 4KULA 3MP6A 2J06A 1WHJA 2CSIA 1Q82R 3JB9I 1I4K1 4RTYA 2IVWA 4BB7A 2YXYA 2G3RA 2CZ6B 2AT1B 1X75C 1EIFA 4GY5A 1VUBA 5IAYA 1HYOA 5EC7A 3S6WA 5GAN7 1TS9A 3OYGA 3CBOA 3OBWA 5HKCA 3EH1A 2RD1A 4DOVA 1M4ZA 3PT9A 1X6BA 4AFUC 2EGCA 4R0KA 5LJ3j 3TEEA 3V7CA 4A4FA 4UC4A 2F2VA 1J3TA 1TUCA 3GOXA 2EYYA 2X3XD 2EKOA 1AWXA 1KIKA 2ECZA 1PM3A 2RQWA 2JT4A 2E65A 2JN0A 5IH2A 4LDYA 3BDUA 2H8HA 3R6NA 3CPWA 4KH1B 1Y0MA 2DLPA 4OF1A 4OMLA 1K0SA 1RUWA 1K73C 4N0AC 1UGQB 1YJ9T 2NYSA 4HVUA 1BI2A 2KXDA 1PCXA 4DEXA 2NUPB 3CCRQ 2O9VA 3LWIA 2V1RA 3JCMW 1VQ7A 4JUVA 1UE9A 3RMQA 3VS0A 3QDFA 1Q81C 3OS0A 2E5QA 1VYVA 3H0IA 3CMET 2HL5C 1ACMB 1WHGA 2E6ZA 2X4YA 3EFOB 3EGXA 4KUIA 2XDBA 3V7SA 2AHJB 2LMJA 2GFUA 3EHQA 1VQ4A 4LNPA 4ORZA 4DBHA 3CC4A 1VQKA 2FZKB 1X2KA 2BE9B 4JRPA 3JB9J 2ZPBB 2PU9B 4EMKB 3QJYA 4AG2C 3C0CA 5CVIA 2FPDA 2RHZA 1KD1R 2V26A 2KEAA 2KROA 3FJ5A 2CUDA 4BACA 1VQMA 1PC0A 3ASKA 2I0NA 4GLKA 3KBGA 2O9SA 4JJBA 1BKBA 2DL5A 2K79A 1FWZA 3S3MA 4L59A 1GCPA 3MKDA 2EGAA 3QXEB 4XTZA 4J6XA 4KRTA 3UATA 3CCET 4N4GA 4C92G 1Y96B 1K9MC 1ABOA 2E4HA 1T3SA 5I22A 3CCMA 2QYZA 4AT1B 4J9BA 1H3ZA 2FRYA 2EJFA 1IHWA 4M75B 2KVQG 4FCYA 3CMAA 1TG0A 1I07A 2FO0A 3UA6A 3QHSA 4PJOB 1HD3A 3JCMP 2DVEA 3A8OB 1M9SA 2RO0A 4J83A 1LPLA 4RMOA 1QVGP 1WQ7A 2HD0A 1RABB 2DL7A 3M59A 3PE0A 1AHJB 4TVRA 3HHTB 1LJOA 2GTJA 3C4SA 3JCMd 4MDXA 1BI1A 3LH5A 1KD1C 1IREB 4QVCA 1VQ6A 1M1KR 3OSSC 1G83A 3L42A 2EQKA 2X4WA 4BI4A 1K8AU 3CCLT 1WJRA 5GAOl 1YJ9Q 2AK5A 2I2LA 1VQ6Q 1KQSA 2DAQA 1KQ2A 4MMKA 3VYHB 3OW2A 1M2VB 4LUEA 4QW2A 2HAXA 3SWNB 5KYUB 2EVRA 1ZSZB 2VASA 4JJNK 1M1FA 1XTDA 2BIVA 4Y92A 3RR6A 4C5GA 3FDRA 1YWPA 2MWPA 3CEYA 3UDCA 3FJPA 4M78E 5GAOp 2C06A 3M0SA 5GANf 3MHXA 5FLXE 2LRQA 3G6EQ 5KYYB 5CQYA 3G4SA 1UHCA 1YN8A 2D6FA 4PLLA 4XTXA 1N6AA 3CC4T 4C0FA 2W10A 2JMAA 4OMQA 1NEGA 2OAWA 4F7UF 5CK9A 3PTAA 1YJNQ 2QEXQ 1BCMA 2DYBA 2LQ8A 4C0GA 3HRTA 3V8LA 2YLBA 4OB3B 5M9OA 1VQOA 2DD5A 2IIMA 1X6OA 2L5QA 4ZTJA 3EH2A 1VQ8A 2HNIA 1G3YA 4DOWA 4L6V5 3M5AA 4R55A 4C8QB 4EMGA 4F17A 1HJDA 2KBTA 5KYXB 1YIJT 3A8GB 1YJWQ 3KXTA 3FIFA 2VV5A 2CP6A 1NPRA 5DM7R 1BIAA 3EFOA 1OPLA 1VQPQ 3MEAA 3X28B 3SHWA 4HVVA 2F2XA 1RACB 5DLQE 3CC7A 2CH4W 1M1KU 1O75A 1RADB 2DD4A 1B7TA 4IUTA 1Y57A 2VWFA 1PD0A 2ZGWA 2EW3A 2V8IA 2XDPA 4GLMA 4OGCA 4C8QC 3PIPA 2QGGA 1YNZA 3QZ9B 1QKWA 4XTYA 4M7AF 4CI0C 3JCMg 3OY9A 3I55T 2AIRB 4N4IA 4PFPA 3OYBA 4F04B 1G8XA 1JJ2A 3UF4A 2EQIA 2RJCA 2VKNA 3JCMV 4LD9K 5D6WA 1ZX6A 4MMLA 1B34B 3RERA 5A2QE 2EBPA 5GAOq 3RMSA 1QWEA 2EYXA 3M0QA 3OYJA 1IO6A 3GBQA 1ARKA 2QQAA 3URGA 1JU5C 4JJDA 3M0UA 4ZN1A 1D0YA 2L3RA 4A63B 3QJ6A 2FYKA 1XJWB 2J7IA 1WHKA 4DBFA 3KFVA 1YHQT 5KYWA 3UT1A 3ZFJA 3SD4A 1IB8A 1ZBXA 1B3QA 2P0PA 4OMMA 3D7SB 1XQHA 1U8RA 3TCJA 1UTIA 1WXUA 2E6NA 5KYNA 2QTXA 3JRZA 1IHVA 4RTXA 3G6ET 1G3WA 3RDVA 2AZSA 4J9HA 2OI3A 1TWBA 5HK3A 1M3CA 2DE0X 1YJWA 4M7AA 2JUFA 4D8KA 4E7HA 1Q82C 4PJOF 1UG1A 7AT1B 3NTIA 2QEXT 4PJOD 3CBPA 3WVEB 4C5IA 4GBQA 4J9IA 2LC4A 2F2WA 2OAUA 5KYYA 1SEMA 3CCSA 1YP5A 2NUZA 2OJ2A 2CP2A 2YUNA 3M0PA 4OGEA 4DBQA 5GAN5 1VQLQ 2KQWA 1ABQA 3EG1A 1VQ7Q 2VXEA 2O88A 2QEXA 1EFNA 2RI3A 4OB1B 3CD6T 4PJOC 1QCFA 3WXMB 4P5NA 1YJWT 4OB0B 4A4GA 5D7UA 1ZUUA 3JCMX 4A4KA 4XK8E 2HSPA 1UB4A 2D1XA 4JPBW 1QVFA 5CKFA 9ATCB 1ZSZC 2VUBA 1UUEA 2RHIA 2VGNA 1LCKA 2BZXA 3DLLA 1LVKA 2LZ6B 2W0ZA 5GAN8 5CQXA 2KSSA 4PKCC 3M54A 5KYXA 5KCHA 4QKUA 4M7AB 5I21A 3OYNA 1UHFA 4KGXB 4J9CA 4RKUE 1MMAA 2RN8A 4JZ3A 1UEBA 3P8HA 4ELZC 3I55Q 2ED0A 2L89A 4XU1A 2L3SA 4PJJA 5LL6S 2EWNA 2QDYB 1OYXA 1WNLA 1QQJA 1ZUKA 2WSCE 5GAN6 5GAMg 3L1AA 3J80E 3CC7T 2ZPFB 3FRNA 2D9TA 2J6KA 4BE1A 4M75A 2DO3A 1WPYA 4A4HA 5FU6B 3H41A 3CXCA 3GLXA 3FEOA 3G7ZA 1AOJA 2DKGA 2K2MA 4A4EA 1IRXA 2XHCA 2FPEA 3N5BB 4C8QF 3L2QA 1OU9A 1VQ8T 5GANd 5KCOA 1RLQC 2FZCB 4EMKC 2MPXC 5IXBA 4F16A 2DM1A 1Z9ZA 3SWNA 3QYGB 3CPFA 1UDLA 3OQ5A 4M7DB 5FRNA 1U06A 4OMNA 3QPHA 2R57A 5FWCA 2E41A 1VQ9T 2CH4A 2DK3A 2GNCA 2YSQA 5HCKA 5CR2A 3QWYA 4C92C 2GQVA 1EZZB 4HVWA 2PQWA 3EG0A 2ESWA 2QTVA 2VC8A 4E47A 3G4ST 2RI2A 2A28A 4FSXA 2JTEA 5HK0A 2L2PA 3SEMA 2QGFB 3CCVQ 3CCQQ 3DLMA 1S72A 3H0HA 3EGDA 3NTHA 3I55A 2COYA 1GCQA 3P8BB 5DLOA 1GXIE 2P4TA 4Z89A 2LCCA 2E5KA 4M4ZA 1CSKA 4N0AA 2QQSA 4IKFA 3EGUA 2CZ0B 4C92D 1K9AA 2MI6A 4JLGA 4BI8B 1WZOA 1T0JA 1I1JA 1GBQA 3X26B 1QW1A 1H8KA 1SPKA 1M3AA 5GANh 2K3BA 1XNIA 1FXXA 1NJIU 1W70A 1Q7YU 3QWXX 1M8VA 2RF0A 4RG8A 1QCOA 1RAHB 2E3HA 2PUOB 2IG0A 4JZ4A 2IPOB 3EFRA 2R58A 4LE9A 4ESRA 2DMOA 5LJ5d 3CCUQ 1RLPC 4M78A 1M2VA 3BE3A 3OYDA 3M53A 2YT6A 1TSFA 4NOYA 1M5Q1 2XU8A 1BI0A 4J9EA 2E3IA 1VQPA 1ZA2B 1G5VA 3JB9H 5GMKj 5GJWB 2EGEA 4M7DA 1SG5A 2EQMA 1MMNA 3M55A 2Y4XA 1WQWA 3CC7Q 2FEIA 5D6XA 3PVLA 4B6MA 4M78F 3MCAB 1D1AA 4FL6A 4FW1A 1KC8R 3CCEA 3CBMA 5GAN2 2XD0A 2BUDA 4OMFB 3ZBDA 3RKYA 1JEGA 1OI1A 3REAB 1UFFA 4X9CA 2EIFA 4KBMB 4EDUA 1Q86C 3HRSA 1RAGB 4KH0B 4WTOB 2X9HA 2DF6A 4OP0A 1VQ9Q 1IGUA 2C0IA 1ZUYA 4PJOG 2F69A 1N8RU 1O9SA 2FHDA 2PUKB 4O6JA 3PVQA 2YUPA 4DEYA 1QLYA 1OPKA 4J9GA 2QK0A 4JRKA 5FU7B 4KUDK 3LGLA 2FL7A 4C92F 2DL3A 1D3BB 1OULA 2P0KA 2NUTB 2HBWA 1SF9A 2LJ3A 3A8LB 2ZPEB 2VGMA 2PVOB 3RBBB 1MV0B 1RAAB 2FVUA 1U3OA 3BY7A 1MMGA 2VYTA 5IHNA 3LGFA 2L8DA 3H6ZA 2OTLA 1I5LA 3CCJQ 1VQ4T 1VQOT 3A8HB 2K3YA 1W6XA 2DYIA 4OB2B 1CKAA 4J6YA 2RH2A 3L2UA 3OS2A 1PG5B 2RQRA 3CCJA 2XG8D 1N8RC 3NTKA 3CMEQ 3QBYA 4M7DG 4M77C 4KT0E 1QVFS 3U23A 1SSFA 2CSQA 2KYMA 3VS6A 3PGGA 3V7RA 2ABLA 2QQ9A 1YI2T 1GL5A 5FU6C 3HRUA 1M8MA 2D0QB 2M9UA 3J7AF 5IHIA 3OS1A 5GAMj 1Z9QA 2GQIA 4Z8AA 3SFMA 5FROA 2RQVA 1DJ7B 4V2SA 4BDZA 2BZYA 4MZPA 4M75E 2QDLA 2CKKA 2RQUA 1SRLA 4OMPA 1E7OA 2NUPA 6AT1B 2EYWA 3M57A 3JCMQ 3ME9A 3BW1A 2GGRA 2HKQB 5IT9E 1VA7A 4J5YA 5LJ5h 3E2UA 3NPFA 1WDXA 1VQMQ 1VQ5Q 1YITQ 3FLGA 3OYKA 4RTUA 5A0DA 3CCSQ 2DTIA 2HQHA 1BU1A 5CKBA 1GFDA 4VUBA 2P4RA 3L2WA 2O2OA 3UA7A 5GAN4 4E7LA 5C0MA 1N5ZA 1K4US 1RI0A 2YUQA 1NJIC 1IGQA 1K9MR 4JDSA 3TSZA 1OX8A 3JAME 2CP3A 1WXBA 2G6FX 4ZTFA 4PK4A 3G71Q 3I56T 3CD6A 4C8QG 2LCLA 1QMCA 2GCXA 1QVFP 2OTLQ 3A98A 4E2FB 1W2BS 1TOVA 2RJFA 2FG0A 4HKEA 4M77B 1JRIA 4BY6C 1M90U 2JJ9A 4RTVA 1OQKA 3CCLQ 2K4YA 2XMFA 2GTOA 4D8DA 3DB3A 3PMIA 2P0QA 1VQOQ 2O4XA 1NE8A 2MAMA 4E7IA 2XICA 4MDWA 5IXFA 3VU3C 5I2MA 5CKEA 1FYNA 3JCMb 1U5SA 1TUGB 2KE9A 5CKDA 2EAYA 2X3WD 4J7FA 3OB9A 1KD1U 4B9XA 2YLCA 5CAIA 3RKWA 2LVMA 1NJIR 2RK2A 5GAMe 4E6RA 3OYYA 1WHHA 1VQ9A 2LQKA 1VQNQ 1QP3A 2JTMA 1YJNT 3MPUB 3CC2Q 2B8AA 1M3BA 3HKSA 1PKSA 4RTTA 3C12A 1HXDA 4M7AC 4M77D 2QA4Q 5CO7A 2CYZB 4ZGJB 4RCCA 3RNJA 4C8QE 2EJ9A 4QVZA 5D6YA 2QQBA 1RAFB 2DVJA 2K5FA 3VUBA 4M7DC 2HCKA 2K7AA 2DILA 1BIBA 2RJEA 3X24B 4PNOA 3INZA 1VQMT 1KQ1A 3EGDB 3TSWA 2RHXA 2V8JA 2J6OA 1E6HA 4XU3A 3LYIA 3O5ZA 2PZ1A 5GANj 3CCST 1VQPT 4M78G 1K73R 3OSVA 1N27A 4BE0A 3OW2S 1JB0E 1WHMA 3LX7A 3JCMh 4C8QD 5GAOm 4FYWB 1PSEA 1NLOC 4EPCA 2WSEE 1IXDA 3QZ5B 4JS4A 3C95A 5GJVB 5ECAA 1YHQA 2R5MA 2JZ2A 2EQUA 4C0ZA 1F1BB 1KFZA 3PNWC 2YWWA 4X9DA 5GAMf 1PWTA 2JM8A 3G71T 1MUZA 3I56Q 1Y7XA 1WJQA 2OTLT 1WI7A 2A3LA 5FU7C 4EMKA 3HP9A 2A37A 2EPDA 2WACA 4NL3A 3E19A 5LJ3d 4EMHA 4M78D 3LLRA 3L2ZA 2COWA 3OMGA 1S72Q 4RG2A 3JV3A 3MJXA 4Z88A 2F1LA 5KH6A 4J9DA 4M7AD 1KSWA 3MEVA 3GF5A 1X2QA 3FB9A 1Q86R 1VQKQ 1FMKA 2MWOA 2CT3A 2JMCA 2YRVA 3EG9A 3MP1A 2HL3A 4C0DB 1YCYA 1I5OB 1WA7A 1BYMA 2JM9A 2DA9A 3VS1A 4M77F 2LQWA 1QVGA 2E10A 2E70A 2F5KA 1VYUA 1JJ2P 4XU2A 3VV0A 4BI3A 2LQNA 2Z0WA 3OYAA 1JJ2S 1SKUB 1M2OA 1W4SA 2DEQA 2D8JA 1VQNT 4XQ3A 1X69A 4CC7A 3NHNA 4XU0A 2KRMA 2D0NA 4JS5A 3I5RA 2RPNA 5GMKl 2L0AA 4CC4B 3CC2T 3M4GA 4C92B 4ATOA 1H3HA 4CRIA 4LDXA 2ZPIB 1NBEB 1MHNA 5KE3A 3S3OA 5AT1B 4AFZC 3HL8A 1AT1B 3M56A 4IUUA 2SRCA 2QA4A 2NLUA 1TUDA 2ROLA 4LD6A 2M0OA 2QG9B 3VS5A 3CD6Q 3I5SA 2K2VA 2AKKA 3E9FA 2RA2A 2CS7A 3EG2A 3T9NA 5GANe 2PNIA 4HA8A 2KXCA 4OMOA 1CKBA 1VIFA 1AWWA 2DEUA 2GFAA 2KT1A 1U1SA 3THKA 2M1HA 2LJ1A 1AVZC 3O8VA 1KQSP 4DBRA 4M75G 1V1CA 3Q1JA 1I8FA 1AWJA 3EAEA 1JQQA 1QWFA 1PKTA 4C92A 1WLPB 3NGPA 1PHTA 2YHTA 4ZNXA 4F7UA 1RAIB 5GMKm 2L3PA 3KUFA 1PNJA 2CUBA 3PFSA 2LT1A 1D0XA 2DZCA 1BCOA 3HFOA 1NEBA 1K0XA 2JVVA 3OYMA 1RL2A 2NUTA 3JCMJ 5CKHA 4ZGDB 5A0GA 4HT8A 1W1FA 2M51A 2EYQA 1SRMA 2HZYA 1Y07A 2KY9A 2MF2A 2CZ1B 1W2BP 2ZAEA 1M27C 1K1ZA 1JXOA 1TTHB 4ELYC 1Y71A 1VQKT 1G3TA 5KYUA 3HTRA 3VRZA 1KHIA 1Q81U 2H3EB 1Q7YR 2CREA 2OX7A 4Q5WA 4C8QA 3TU4K 4J7IA 3E1SA 1N9RA 1D3BA 4QQDA 1S1NA 2OTJT 4BUGA 2DIGA 3CMEA 2MYSA 1W2BA 4FYXB 1NYFA 1PRMC 1Q82U 3VS7A 5KE2A 4YTLA 3H9NA 4AMCA 3X25B 3UPUA 3CQTA 5J26A 2K57A 1BK2A 2A08A 1ZQ1A 3A1PA 2HQEA 2PVDB 2XI9A 2XDDA 2MK5A 3M9QA 3CPWS 3VRYA 5GMKh 2ENMA 2LTOA 4PJLA 2KK4A 2DIQA 4F7UE 4PJOE 3EG3A 2LX7A 4PL6A 1WX6A 2JNGA 5LJ3h 1YCSB 3CCQT 8AT1B 3HFNA 2YDLA 1YWOA 3G1JA 1D1BA 2YRDA 3LH0A 3BDLA 2LX9A 4HCZA 4Y28E 4E7ZA 1NPPA 3OMCA 2LNHB 5GANg 1Y96A 2CP7A 2BE7D 2DRKA 4L5GA 4AFQC 4FYYB 4M7DD 4M77E 3V8KA 3AHUA 4KGVB 3MEUA 4B9WA 2DNUA 4FIBA 2KRNA 1B07A 1RAEB 5I2SA 4DQ2A 1UGPB 2FRWA 5CCAA 3CXCS 3HPWA 3CCEQ 2QXFA 4XTVA 3OS5A 5J39A 2H3JA 3MEWA 5LJ5g 3DB4A 2EYZA 2CP5A 4NS5A 2RJDA 3OW2P 1C0MA 3CCUT 4M7AG 3G71A 4AFSC 2ZPGB 2Y4YA 2O31A 2J05A 3DKMA 1RI9A 2COZA 2DTHA 4M7AE 2BTTA 2FB7A 1OZ3A 1Q81R 3BFMA 3TQ7P 2V8KA 2DZ9A 2ED1A 2DJQA 4LN2A 1N9SA 2L3QA 3L2VA 3I35A 4DA4A 2DL8A 3GNGA 4JJCA 4C5EA 3NMZC 2Y90A 1X6GA 1V76A 3ER0A 4M77G 1M90R 2KNBB 2CGHA 4C92E 3EGXB 1MGQA 3VKIA 3FC3A 1QP2A 4ME7A 1FX7A 3I9QA 1AWOA 1A0NB 1E6GA 2R5AA 2PVGB 1VQ6T 1T3LA 2KDSA 4E7SA 2O01E 1N8RR 2KI7A 2OTJQ 1TH7A 2EQJA 2RHUA 2HMAA 4K11A 3QUIA 3TREA 5C6SA 3OYIA 4M77A 4BDYA 2K5IA 1KC8C 3M0TA 4R56A 2KT8A 4PJMA 1X27A 1Q7YC 1SHFA 2J6FA 3OYEA 1I81A 3GIBA 1GRIA 2X4JA 4F7UG 4II1A 1VQNA 1C1AA 1EX4A 3VYGA 3CCQA 3JCMe 3H8ZA 5A0LA 1LOJA 2DRMA 1AD5A 5L23A 4FSSA 1NLPC 3SDZA 1BBZA 3OBYA 5DY9A 4M7DF 4F14A 2LNVA 2F5TX 2VB6A 2DXCA 4F7UB 1ZLMA 3CC4Q 2MMPA 1VOMA 1MV3A 2PTKA 1ZA1B 2LJ0A 2HKNA 3REBB 2KYBA 2CZ7B 2JW4A 4WCIA 2X51A 3ULRB 5LJ5j 4M75D 3CCJT 1VQ4Q 3LW5E 2DTOA 5FRMA 1PRLC 2K9GA 3PIOA 2M16A 3EHRA 4JRQA 1M1KC 2A36A 1R0CB 1X43A 2CDTA 3QKJA 5GAMh 2KMTA 1YIJQ 1R8OB 1ZSGA 2MIOA 2DPPB 2RQTA 4HCCA 3A8MB 3CMAQ 4LDVA 2QI2A 4M75C 2ATCB 1ZSZA 5IN1A 1JBMA 1OV3A 1LNXA 2AZVA 1UECA 2RM4A 1ZHIA 3M58A 1KJWA 3S3NA 1YI2Q 4JRIA 3G6EA 3VUZA 1QKXA 2C0OA 2JS2A 4BY6B 2YRCA 2YUOA 4M7DE 3SB2A 4QVDA 2RK1A 4IUVA 3CC2A 2DL4A 2QAZA 1GBRA 1NM7A 1OU8A 3HSBA 2DXUA 2XK0A 4A53A 4X34A 1MMDA 1XOVA 2KGTA 3VS3A 1VQ5T 2HSEB 5J3BA 4J9FA 2DJZA 1YITT 2C0TA 1UGRB 4RTWA 2LDMA 1BB9A 4LUDA 2E64A 5L8RE 2BZ8A 5CIUA 1NZ9A 2CT4A 3UWNA 2X35A 4FYVB
chains in the Genus database with same CATH topology
3CPWP 1Q81R 1KQSP 3CCQQ 1YI2Q 2QA4Q 3CD6Q 1YJWQ 1QVGP 1YJ9Q 1Q7YR 1KC8R 3CCEQ 1VQ6Q 1NJIR 1QVFP 2OTLQ 3I56Q 1YHQQ 1S72Q 1K73R 1VQOQ 1VQ9Q 3CCRQ 1YIJQ 3G6EQ 3CXCP 1JJ2P 1VQPQ 1VQNQ 1Q86R 1Q82R 3CMAQ 1VQKQ 3CCMQ 3CMEQ 1N8RR 1K9MR 1K8AR 2OTJQ 1W2BP 1M90R 1VQMQ 3OW2P 1VQ4Q 1VQ5Q 1VQ8Q 1M1KR 3CC2Q 3CC7Q 3CCLQ 1YITQ 3I55Q 3CCJQ 3CCVQ 3G4SQ 3G71Q 3CCSQ 1KD1R 1VQLQ 3CC4Q 1YJNQ 1VQ7Q 3CCUQ 2QEXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW P;  1Q81 R;  1KQS P;  3CCQ Q;  1YI2 Q;  2QA4 Q;  3CD6 Q;  1YJW Q;  1QVG P;  1YJ9 Q;  1Q7Y R;  1KC8 R;  3CCE Q;  1VQ6 Q;  1NJI R;  1QVF P;  2OTL Q;  3I56 Q;  1YHQ Q;  1S72 Q;  1K73 R;  1VQO Q;  1VQ9 Q;  3CCR Q;  1YIJ Q;  3G6E Q;  3CXC P;  1JJ2 P;  1VQP Q;  1VQN Q;  1Q86 R;  1Q82 R;  3CMA Q;  1VQK Q;  3CCM Q;  3CME Q;  1N8R R;  1K9M R;  1K8A R;  2OTJ Q;  1W2B P;  1M90 R;  1VQM Q;  3OW2 P;  1VQ4 Q;  1VQ5 Q;  1VQ8 Q;  1M1K R;  3CC2 Q;  3CC7 Q;  3CCL Q;  1YIT Q;  3I55 Q;  3CCJ Q;  3CCV Q;  3G4S Q;  3G71 Q;  3CCS Q;  1KD1 R;  1VQL Q;  3CC4 Q;  1YJN Q;  1VQ7 Q;  3CCU Q;  2QEX Q; 
#chains in the Genus database with same CATH topology
 1H64 1;  4C5H A;  1PSF A;  4O5V A;  4ANJ A;  4QQ6 A;  4BE2 A;  1YHQ Q;  3M0R A;  3TVT A;  2AKL A;  5GAO n;  2ZCF B;  4LDU A;  4XAX B;  1U1T A;  4C0D C;  3NFC A;  2VVK A;  3MET A;  4KGZ B;  1YI2 A;  5AYF A;  1YIJ A;  1MNE A;  4N4H A;  1UJY A;  3JB9 G;  1VQL A;  2K6D A;  1D1C A;  3WVD B;  5FW9 A;  3ZEH A;  3QSU A;  4HT9 A;  5GAM d;  1AZG B;  1QVG S;  3H0F A;  5EG2 A;  3CCM Q;  4JLI A;  2MOX A;  2LP5 A;  1MND A;  2DBK A;  4PJN A;  4PLI A;  4QQG A;  3JCM c;  5KYW B;  4HCB A;  3M4Y A;  2RB6 A;  1VQL T;  1VQ7 T;  5GMK i;  2FZG B;  1WFW A;  4LXC A;  1Q86 U;  4HXJ A;  3PMT A;  2E1H A;  1UJ0 A;  4XTW A;  1OEB A;  1OOT A;  2VXF A;  3A5Z B;  3EFS A;  2JXB A;  3OYC A;  1VQ5 A;  3SWN C;  2GF7 A;  3CMA T;  2KR3 A;  5FWB A;  1JXM A;  2K3X A;  2LT4 A;  4E7K A;  1PD1 A;  1B34 A;  3GPL A;  4WF2 A;  3R6O A;  4OVA A;  4AG1 C;  2P84 A;  1KC8 U;  1SSH A;  3OYF A;  3CXC P;  1NG2 A;  4E7J A;  4PFZ A;  4X1V A;  4CC3 A;  1AEY A;  3AT1 B;  5GAO r;  4FT4 A;  8ATC B;  3EG9 B;  1KK7 A;  1TXQ A;  1FMW A;  2QA4 T;  2HBP A;  1H92 A;  2D8H A;  1Q95 G;  4CC2 A;  2OTJ A;  2K5L A;  5LJ5 f;  2BKD N;  4FU6 A;  2E12 A;  1V29 B;  4A54 A;  1GCQ C;  5HY6 A;  3MP8 A;  4Y91 A;  4EIK A;  2M0Y A;  1ZBJ A;  2DXB A;  1VYT A;  1WGS A;  2DER A;  2GBQ A;  1QCN A;  5LJ3 e;  3RES A;  4ZN3 A;  3CCL A;  1D0Z A;  1WYX A;  2A7Y A;  1NYG A;  2KAF A;  4MZM A;  3MO8 A;  5IHK A;  1R0B G;  1R77 A;  3E9G A;  2MCN A;  4NL2 A;  2WSF E;  3JB9 D;  3LWH A;  1I0C A;  1WJS A;  3JB9 F;  2NWM A;  2RMO A;  3VS4 A;  3RIR A;  3L2R A;  4Z02 A;  2DXT A;  1VQ8 Q;  1JO8 A;  4XTU A;  1WXT A;  4ZGE B;  3CCU A;  2DET A;  4IUQ A;  5LJ3 f;  4IUR A;  1UGS B;  3CPW P;  1K76 A;  4M78 C;  3OYH A;  4MZT A;  1YIT A;  1TU0 B;  3X20 B;  3QII A;  4IIM A;  2RHY A;  1S72 T;  4QT7 A;  3CCM T;  2ZPH B;  4FW2 A;  4BD3 A;  3G4S Q;  1WIE A;  2V1Q A;  2JTF A;  1C6V X;  1VIE A;  3QDR B;  1GFC A;  2HQX A;  3CCV T;  3JSC A;  1WHL A;  1G3S A;  4M78 B;  4RUG A;  1K9M U;  4D6W A;  1BI3 A;  3GNF B;  5LJ3 g;  2DBM A;  3QYH B;  1X01 A;  4PFO A;  2JS0 A;  5I11 A;  1YFN A;  2QQR A;  2XID A;  2HEQ A;  3CCR T;  1QVP A;  3JCM f;  2DFU A;  3ZL7 C;  1UGV A;  5GMK e;  3P8D A;  1KQS S;  2ZZD A;  1T0H A;  2EFI A;  3F70 A;  4J8O A;  2FPF A;  3CCV A;  4IIO A;  2KRS A;  2CP0 A;  2X4X A;  4IUP A;  1G2B A;  1M30 A;  1FMV A;  3QO3 A;  1IZ6 A;  3QG1 A;  4FM4 B;  1YBY A;  1SHG A;  2XKO C;  1YJ9 A;  2ROT A;  3GP8 A;  3VJP A;  4FT2 A;  4LDW A;  1M90 C;  1D09 B;  3OYL A;  2B86 A;  2RNA A;  3RUX A;  3I56 A;  2QAS A;  4PJO A;  1OX9 A;  1M1G A;  3IQL A;  2LCS A;  1K8A C;  2A0F B;  5LJ5 e;  4J6W A;  3RKX A;  4M75 F;  1AZE A;  2HDA A;  2JOY A;  2RI5 A;  1K8A R;  1HSQ A;  3J81 E;  3C94 A;  3OA6 A;  1OZ2 A;  5GAN 3;  3VS2 A;  4HCK A;  1HK9 A;  2DX1 A;  2O4X B;  4RCB A;  1YJN A;  3CCR A;  1K73 U;  1P92 A;  4RTZ A;  3V8J A;  2M02 A;  1KHC A;  2SEM A;  1KG1 A;  2EKH A;  2EJG A;  4KUL A;  3MP6 A;  2J06 A;  1WHJ A;  2CSI A;  1Q82 R;  3JB9 I;  1I4K 1;  4RTY A;  2IVW A;  4BB7 A;  2YXY A;  2G3R A;  2CZ6 B;  2AT1 B;  1X75 C;  1EIF A;  4GY5 A;  1VUB A;  5IAY A;  1HYO A;  5EC7 A;  3S6W A;  5GAN 7;  1TS9 A;  3OYG A;  3CBO A;  3OBW A;  5HKC A;  3EH1 A;  2RD1 A;  4DOV A;  1M4Z A;  3PT9 A;  1X6B A;  4AFU C;  2EGC A;  4R0K A;  5LJ3 j;  3TEE A;  3V7C A;  4A4F A;  4UC4 A;  2F2V A;  1J3T A;  1TUC A;  3GOX A;  2EYY A;  2X3X D;  2EKO A;  1AWX A;  1KIK A;  2ECZ A;  1PM3 A;  2RQW A;  2JT4 A;  2E65 A;  2JN0 A;  5IH2 A;  4LDY A;  3BDU A;  2H8H A;  3R6N A;  3CPW A;  4KH1 B;  1Y0M A;  2DLP A;  4OF1 A;  4OML A;  1K0S A;  1RUW A;  1K73 C;  4N0A C;  1UGQ B;  1YJ9 T;  2NYS A;  4HVU A;  1BI2 A;  2KXD A;  1PCX A;  4DEX A;  2NUP B;  3CCR Q;  2O9V A;  3LWI A;  2V1R A;  3JCM W;  1VQ7 A;  4JUV A;  1UE9 A;  3RMQ A;  3VS0 A;  3QDF A;  1Q81 C;  3OS0 A;  2E5Q A;  1VYV A;  3H0I A;  3CME T;  2HL5 C;  1ACM B;  1WHG A;  2E6Z A;  2X4Y A;  3EFO B;  3EGX A;  4KUI A;  2XDB A;  3V7S A;  2AHJ B;  2LMJ A;  2GFU A;  3EHQ A;  1VQ4 A;  4LNP A;  4ORZ A;  4DBH A;  3CC4 A;  1VQK A;  2FZK B;  1X2K A;  2BE9 B;  4JRP A;  3JB9 J;  2ZPB B;  2PU9 B;  4EMK B;  3QJY A;  4AG2 C;  3C0C A;  5CVI A;  2FPD A;  2RHZ A;  1KD1 R;  2V26 A;  2KEA A;  2KRO A;  3FJ5 A;  2CUD A;  4BAC A;  1VQM A;  1PC0 A;  3ASK A;  2I0N A;  4GLK A;  3KBG A;  2O9S A;  4JJB A;  1BKB A;  2DL5 A;  2K79 A;  1FWZ A;  3S3M A;  4L59 A;  1GCP A;  3MKD A;  2EGA A;  3QXE B;  4XTZ A;  4J6X A;  4KRT A;  3UAT A;  3CCE T;  4N4G A;  4C92 G;  1Y96 B;  1K9M C;  1ABO A;  2E4H A;  1T3S A;  5I22 A;  3CCM A;  2QYZ A;  4AT1 B;  4J9B A;  1H3Z A;  2FRY A;  2EJF A;  1IHW A;  4M75 B;  2KVQ G;  4FCY A;  3CMA A;  1TG0 A;  1I07 A;  2FO0 A;  3UA6 A;  3QHS A;  4PJO B;  1HD3 A;  3JCM P;  2DVE A;  3A8O B;  1M9S A;  2RO0 A;  4J83 A;  1LPL A;  4RMO A;  1QVG P;  1WQ7 A;  2HD0 A;  1RAB B;  2DL7 A;  3M59 A;  3PE0 A;  1AHJ B;  4TVR A;  3HHT B;  1LJO A;  2GTJ A;  3C4S A;  3JCM d;  4MDX A;  1BI1 A;  3LH5 A;  1KD1 C;  1IRE B;  4QVC A;  1VQ6 A;  1M1K R;  3OSS C;  1G83 A;  3L42 A;  2EQK A;  2X4W A;  4BI4 A;  1K8A U;  3CCL T;  1WJR A;  5GAO l;  1YJ9 Q;  2AK5 A;  2I2L A;  1VQ6 Q;  1KQS A;  2DAQ A;  1KQ2 A;  4MMK A;  3VYH B;  3OW2 A;  1M2V B;  4LUE A;  4QW2 A;  2HAX A;  3SWN B;  5KYU B;  2EVR A;  1ZSZ B;  2VAS A;  4JJN K;  1M1F A;  1XTD A;  2BIV A;  4Y92 A;  3RR6 A;  4C5G A;  3FDR A;  1YWP A;  2MWP A;  3CEY A;  3UDC A;  3FJP A;  4M78 E;  5GAO p;  2C06 A;  3M0S A;  5GAN f;  3MHX A;  5FLX E;  2LRQ A;  3G6E Q;  5KYY B;  5CQY A;  3G4S A;  1UHC A;  1YN8 A;  2D6F A;  4PLL A;  4XTX A;  1N6A A;  3CC4 T;  4C0F A;  2W10 A;  2JMA A;  4OMQ A;  1NEG A;  2OAW A;  4F7U F;  5CK9 A;  3PTA A;  1YJN Q;  2QEX Q;  1BCM A;  2DYB A;  2LQ8 A;  4C0G A;  3HRT A;  3V8L A;  2YLB A;  4OB3 B;  5M9O A;  1VQO A;  2DD5 A;  2IIM A;  1X6O A;  2L5Q A;  4ZTJ A;  3EH2 A;  1VQ8 A;  2HNI A;  1G3Y A;  4DOW A;  4L6V 5;  3M5A A;  4R55 A;  4C8Q B;  4EMG A;  4F17 A;  1HJD A;  2KBT A;  5KYX B;  1YIJ T;  3A8G B;  1YJW Q;  3KXT A;  3FIF A;  2VV5 A;  2CP6 A;  1NPR A;  5DM7 R;  1BIA A;  3EFO A;  1OPL A;  1VQP Q;  3MEA A;  3X28 B;  3SHW A;  4HVV A;  2F2X A;  1RAC B;  5DLQ E;  3CC7 A;  2CH4 W;  1M1K U;  1O75 A;  1RAD B;  2DD4 A;  1B7T A;  4IUT A;  1Y57 A;  2VWF A;  1PD0 A;  2ZGW A;  2EW3 A;  2V8I A;  2XDP A;  4GLM A;  4OGC A;  4C8Q C;  3PIP A;  2QGG A;  1YNZ A;  3QZ9 B;  1QKW A;  4XTY A;  4M7A F;  4CI0 C;  3JCM g;  3OY9 A;  3I55 T;  2AIR B;  4N4I A;  4PFP A;  3OYB A;  4F04 B;  1G8X A;  1JJ2 A;  3UF4 A;  2EQI A;  2RJC A;  2VKN A;  3JCM V;  4LD9 K;  5D6W A;  1ZX6 A;  4MML A;  1B34 B;  3RER A;  5A2Q E;  2EBP A;  5GAO q;  3RMS A;  1QWE A;  2EYX A;  3M0Q A;  3OYJ A;  1IO6 A;  3GBQ A;  1ARK A;  2QQA A;  3URG A;  1JU5 C;  4JJD A;  3M0U A;  4ZN1 A;  1D0Y A;  2L3R A;  4A63 B;  3QJ6 A;  2FYK A;  1XJW B;  2J7I A;  1WHK A;  4DBF A;  3KFV A;  1YHQ T;  5KYW A;  3UT1 A;  3ZFJ A;  3SD4 A;  1IB8 A;  1ZBX A;  1B3Q A;  2P0P A;  4OMM A;  3D7S B;  1XQH A;  1U8R A;  3TCJ A;  1UTI A;  1WXU A;  2E6N A;  5KYN A;  2QTX A;  3JRZ A;  1IHV A;  4RTX A;  3G6E T;  1G3W A;  3RDV A;  2AZS A;  4J9H A;  2OI3 A;  1TWB A;  5HK3 A;  1M3C A;  2DE0 X;  1YJW A;  4M7A A;  2JUF A;  4D8K A;  4E7H A;  1Q82 C;  4PJO F;  1UG1 A;  7AT1 B;  3NTI A;  2QEX T;  4PJO D;  3CBP A;  3WVE B;  4C5I A;  4GBQ A;  4J9I A;  2LC4 A;  2F2W A;  2OAU A;  5KYY A;  1SEM A;  3CCS A;  1YP5 A;  2NUZ A;  2OJ2 A;  2CP2 A;  2YUN A;  3M0P A;  4OGE A;  4DBQ A;  5GAN 5;  1VQL Q;  2KQW A;  1ABQ A;  3EG1 A;  1VQ7 Q;  2VXE A;  2O88 A;  2QEX A;  1EFN A;  2RI3 A;  4OB1 B;  3CD6 T;  4PJO C;  1QCF A;  3WXM B;  4P5N A;  1YJW T;  4OB0 B;  4A4G A;  5D7U A;  1ZUU A;  3JCM X;  4A4K A;  4XK8 E;  2HSP A;  1UB4 A;  2D1X A;  4JPB W;  1QVF A;  5CKF A;  9ATC B;  1ZSZ C;  2VUB A;  1UUE A;  2RHI A;  2VGN A;  1LCK A;  2BZX A;  3DLL A;  1LVK A;  2LZ6 B;  2W0Z A;  5GAN 8;  5CQX A;  2KSS A;  4PKC C;  3M54 A;  5KYX A;  5KCH A;  4QKU A;  4M7A B;  5I21 A;  3OYN A;  1UHF A;  4KGX B;  4J9C A;  4RKU E;  1MMA A;  2RN8 A;  4JZ3 A;  1UEB A;  3P8H A;  4ELZ C;  3I55 Q;  2ED0 A;  2L89 A;  4XU1 A;  2L3S A;  4PJJ A;  5LL6 S;  2EWN A;  2QDY B;  1OYX A;  1WNL A;  1QQJ A;  1ZUK A;  2WSC E;  5GAN 6;  5GAM g;  3L1A A;  3J80 E;  3CC7 T;  2ZPF B;  3FRN A;  2D9T A;  2J6K A;  4BE1 A;  4M75 A;  2DO3 A;  1WPY A;  4A4H A;  5FU6 B;  3H41 A;  3CXC A;  3GLX A;  3FEO A;  3G7Z A;  1AOJ A;  2DKG A;  2K2M A;  4A4E A;  1IRX A;  2XHC A;  2FPE A;  3N5B B;  4C8Q F;  3L2Q A;  1OU9 A;  1VQ8 T;  5GAN d;  5KCO A;  1RLQ C;  2FZC B;  4EMK C;  2MPX C;  5IXB A;  4F16 A;  2DM1 A;  1Z9Z A;  3SWN A;  3QYG B;  3CPF A;  1UDL A;  3OQ5 A;  4M7D B;  5FRN A;  1U06 A;  4OMN A;  3QPH A;  2R57 A;  5FWC A;  2E41 A;  1VQ9 T;  2CH4 A;  2DK3 A;  2GNC A;  2YSQ A;  5HCK A;  5CR2 A;  3QWY A;  4C92 C;  2GQV A;  1EZZ B;  4HVW A;  2PQW A;  3EG0 A;  2ESW A;  2QTV A;  2VC8 A;  4E47 A;  3G4S T;  2RI2 A;  2A28 A;  4FSX A;  2JTE A;  5HK0 A;  2L2P A;  3SEM A;  2QGF B;  3CCV Q;  3CCQ Q;  3DLM A;  1S72 A;  3H0H A;  3EGD A;  3NTH A;  3I55 A;  2COY A;  1GCQ A;  3P8B B;  5DLO A;  1GXI E;  2P4T A;  4Z89 A;  2LCC A;  2E5K A;  4M4Z A;  1CSK A;  4N0A A;  2QQS A;  4IKF A;  3EGU A;  2CZ0 B;  4C92 D;  1K9A A;  2MI6 A;  4JLG A;  4BI8 B;  1WZO A;  1T0J A;  1I1J A;  1GBQ A;  3X26 B;  1QW1 A;  1H8K A;  1SPK A;  1M3A A;  5GAN h;  2K3B A;  1XNI A;  1FXX A;  1NJI U;  1W70 A;  1Q7Y U;  3QWX X;  1M8V A;  2RF0 A;  4RG8 A;  1QCO A;  1RAH B;  2E3H A;  2PUO B;  2IG0 A;  4JZ4 A;  2IPO B;  3EFR A;  2R58 A;  4LE9 A;  4ESR A;  2DMO A;  5LJ5 d;  3CCU Q;  1RLP C;  4M78 A;  1M2V A;  3BE3 A;  3OYD A;  3M53 A;  2YT6 A;  1TSF A;  4NOY A;  1M5Q 1;  2XU8 A;  1BI0 A;  4J9E A;  2E3I A;  1VQP A;  1ZA2 B;  1G5V A;  3JB9 H;  5GMK j;  5GJW B;  2EGE A;  4M7D A;  1SG5 A;  2EQM A;  1MMN A;  3M55 A;  2Y4X A;  1WQW A;  3CC7 Q;  2FEI A;  5D6X A;  3PVL A;  4B6M A;  4M78 F;  3MCA B;  1D1A A;  4FL6 A;  4FW1 A;  1KC8 R;  3CCE A;  3CBM A;  5GAN 2;  2XD0 A;  2BUD A;  4OMF B;  3ZBD A;  3RKY A;  1JEG A;  1OI1 A;  3REA B;  1UFF A;  4X9C A;  2EIF A;  4KBM B;  4EDU A;  1Q86 C;  3HRS A;  1RAG B;  4KH0 B;  4WTO B;  2X9H A;  2DF6 A;  4OP0 A;  1VQ9 Q;  1IGU A;  2C0I A;  1ZUY A;  4PJO G;  2F69 A;  1N8R U;  1O9S A;  2FHD A;  2PUK B;  4O6J A;  3PVQ A;  2YUP A;  4DEY A;  1QLY A;  1OPK A;  4J9G A;  2QK0 A;  4JRK A;  5FU7 B;  4KUD K;  3LGL A;  2FL7 A;  4C92 F;  2DL3 A;  1D3B B;  1OUL A;  2P0K A;  2NUT B;  2HBW A;  1SF9 A;  2LJ3 A;  3A8L B;  2ZPE B;  2VGM A;  2PVO B;  3RBB B;  1MV0 B;  1RAA B;  2FVU A;  1U3O A;  3BY7 A;  1MMG A;  2VYT A;  5IHN A;  3LGF A;  2L8D A;  3H6Z A;  2OTL A;  1I5L A;  3CCJ Q;  1VQ4 T;  1VQO T;  3A8H B;  2K3Y A;  1W6X A;  2DYI A;  4OB2 B;  1CKA A;  4J6Y A;  2RH2 A;  3L2U A;  3OS2 A;  1PG5 B;  2RQR A;  3CCJ A;  2XG8 D;  1N8R C;  3NTK A;  3CME Q;  3QBY A;  4M7D G;  4M77 C;  4KT0 E;  1QVF S;  3U23 A;  1SSF A;  2CSQ A;  2KYM A;  3VS6 A;  3PGG A;  3V7R A;  2ABL A;  2QQ9 A;  1YI2 T;  1GL5 A;  5FU6 C;  3HRU A;  1M8M A;  2D0Q B;  2M9U A;  3J7A F;  5IHI A;  3OS1 A;  5GAM j;  1Z9Q A;  2GQI A;  4Z8A A;  3SFM A;  5FRO A;  2RQV A;  1DJ7 B;  4V2S A;  4BDZ A;  2BZY A;  4MZP A;  4M75 E;  2QDL A;  2CKK A;  2RQU A;  1SRL A;  4OMP A;  1E7O A;  2NUP A;  6AT1 B;  2EYW A;  3M57 A;  3JCM Q;  3ME9 A;  3BW1 A;  2GGR A;  2HKQ B;  5IT9 E;  1VA7 A;  4J5Y A;  5LJ5 h;  3E2U A;  3NPF A;  1WDX A;  1VQM Q;  1VQ5 Q;  1YIT Q;  3FLG A;  3OYK A;  4RTU A;  5A0D A;  3CCS Q;  2DTI A;  2HQH A;  1BU1 A;  5CKB A;  1GFD A;  4VUB A;  2P4R A;  3L2W A;  2O2O A;  3UA7 A;  5GAN 4;  4E7L A;  5C0M A;  1N5Z A;  1K4U S;  1RI0 A;  2YUQ A;  1NJI C;  1IGQ A;  1K9M R;  4JDS A;  3TSZ A;  1OX8 A;  3JAM E;  2CP3 A;  1WXB A;  2G6F X;  4ZTF A;  4PK4 A;  3G71 Q;  3I56 T;  3CD6 A;  4C8Q G;  2LCL A;  1QMC A;  2GCX A;  1QVF P;  2OTL Q;  3A98 A;  4E2F B;  1W2B S;  1TOV A;  2RJF A;  2FG0 A;  4HKE A;  4M77 B;  1JRI A;  4BY6 C;  1M90 U;  2JJ9 A;  4RTV A;  1OQK A;  3CCL Q;  2K4Y A;  2XMF A;  2GTO A;  4D8D A;  3DB3 A;  3PMI A;  2P0Q A;  1VQO Q;  2O4X A;  1NE8 A;  2MAM A;  4E7I A;  2XIC A;  4MDW A;  5IXF A;  3VU3 C;  5I2M A;  5CKE A;  1FYN A;  3JCM b;  1U5S A;  1TUG B;  2KE9 A;  5CKD A;  2EAY A;  2X3W D;  4J7F A;  3OB9 A;  1KD1 U;  4B9X A;  2YLC A;  5CAI A;  3RKW A;  2LVM A;  1NJI R;  2RK2 A;  5GAM e;  4E6R A;  3OYY A;  1WHH A;  1VQ9 A;  2LQK A;  1VQN Q;  1QP3 A;  2JTM A;  1YJN T;  3MPU B;  3CC2 Q;  2B8A A;  1M3B A;  3HKS A;  1PKS A;  4RTT A;  3C12 A;  1HXD A;  4M7A C;  4M77 D;  2QA4 Q;  5CO7 A;  2CYZ B;  4ZGJ B;  4RCC A;  3RNJ A;  4C8Q E;  2EJ9 A;  4QVZ A;  5D6Y A;  2QQB A;  1RAF B;  2DVJ A;  2K5F A;  3VUB A;  4M7D C;  2HCK A;  2K7A A;  2DIL A;  1BIB A;  2RJE A;  3X24 B;  4PNO A;  3INZ A;  1VQM T;  1KQ1 A;  3EGD B;  3TSW A;  2RHX A;  2V8J A;  2J6O A;  1E6H A;  4XU3 A;  3LYI A;  3O5Z A;  2PZ1 A;  5GAN j;  3CCS T;  1VQP T;  4M78 G;  1K73 R;  3OSV A;  1N27 A;  4BE0 A;  3OW2 S;  1JB0 E;  1WHM A;  3LX7 A;  3JCM h;  4C8Q D;  5GAO m;  4FYW B;  1PSE A;  1NLO C;  4EPC A;  2WSE E;  1IXD A;  3QZ5 B;  4JS4 A;  3C95 A;  5GJV B;  5ECA A;  1YHQ A;  2R5M A;  2JZ2 A;  2EQU A;  4C0Z A;  1F1B B;  1KFZ A;  3PNW C;  2YWW A;  4X9D A;  5GAM f;  1PWT A;  2JM8 A;  3G71 T;  1MUZ A;  3I56 Q;  1Y7X A;  1WJQ A;  2OTL T;  1WI7 A;  2A3L A;  5FU7 C;  4EMK A;  3HP9 A;  2A37 A;  2EPD A;  2WAC A;  4NL3 A;  3E19 A;  5LJ3 d;  4EMH A;  4M78 D;  3LLR A;  3L2Z A;  2COW A;  3OMG A;  1S72 Q;  4RG2 A;  3JV3 A;  3MJX A;  4Z88 A;  2F1L A;  5KH6 A;  4J9D A;  4M7A D;  1KSW A;  3MEV A;  3GF5 A;  1X2Q A;  3FB9 A;  1Q86 R;  1VQK Q;  1FMK A;  2MWO A;  2CT3 A;  2JMC A;  2YRV A;  3EG9 A;  3MP1 A;  2HL3 A;  4C0D B;  1YCY A;  1I5O B;  1WA7 A;  1BYM A;  2JM9 A;  2DA9 A;  3VS1 A;  4M77 F;  2LQW A;  1QVG A;  2E10 A;  2E70 A;  2F5K A;  1VYU A;  1JJ2 P;  4XU2 A;  3VV0 A;  4BI3 A;  2LQN A;  2Z0W A;  3OYA A;  1JJ2 S;  1SKU B;  1M2O A;  1W4S A;  2DEQ A;  2D8J A;  1VQN T;  4XQ3 A;  1X69 A;  4CC7 A;  3NHN A;  4XU0 A;  2KRM A;  2D0N A;  4JS5 A;  3I5R A;  2RPN A;  5GMK l;  2L0A A;  4CC4 B;  3CC2 T;  3M4G A;  4C92 B;  4ATO A;  1H3H A;  4CRI A;  4LDX A;  2ZPI B;  1NBE B;  1MHN A;  5KE3 A;  3S3O A;  5AT1 B;  4AFZ C;  3HL8 A;  1AT1 B;  3M56 A;  4IUU A;  2SRC A;  2QA4 A;  2NLU A;  1TUD A;  2ROL A;  4LD6 A;  2M0O A;  2QG9 B;  3VS5 A;  3CD6 Q;  3I5S A;  2K2V A;  2AKK A;  3E9F A;  2RA2 A;  2CS7 A;  3EG2 A;  3T9N A;  5GAN e;  2PNI A;  4HA8 A;  2KXC A;  4OMO A;  1CKB A;  1VIF A;  1AWW A;  2DEU A;  2GFA A;  2KT1 A;  1U1S A;  3THK A;  2M1H A;  2LJ1 A;  1AVZ C;  3O8V A;  1KQS P;  4DBR A;  4M75 G;  1V1C A;  3Q1J A;  1I8F A;  1AWJ A;  3EAE A;  1JQQ A;  1QWF A;  1PKT A;  4C92 A;  1WLP B;  3NGP A;  1PHT A;  2YHT A;  4ZNX A;  4F7U A;  1RAI B;  5GMK m;  2L3P A;  3KUF A;  1PNJ A;  2CUB A;  3PFS A;  2LT1 A;  1D0X A;  2DZC A;  1BCO A;  3HFO A;  1NEB A;  1K0X A;  2JVV A;  3OYM A;  1RL2 A;  2NUT A;  3JCM J;  5CKH A;  4ZGD B;  5A0G A;  4HT8 A;  1W1F A;  2M51 A;  2EYQ A;  1SRM A;  2HZY A;  1Y07 A;  2KY9 A;  2MF2 A;  2CZ1 B;  1W2B P;  2ZAE A;  1M27 C;  1K1Z A;  1JXO A;  1TTH B;  4ELY C;  1Y71 A;  1VQK T;  1G3T A;  5KYU A;  3HTR A;  3VRZ A;  1KHI A;  1Q81 U;  2H3E B;  1Q7Y R;  2CRE A;  2OX7 A;  4Q5W A;  4C8Q A;  3TU4 K;  4J7I A;  3E1S A;  1N9R A;  1D3B A;  4QQD A;  1S1N A;  2OTJ T;  4BUG A;  2DIG A;  3CME A;  2MYS A;  1W2B A;  4FYX B;  1NYF A;  1PRM C;  1Q82 U;  3VS7 A;  5KE2 A;  4YTL A;  3H9N A;  4AMC A;  3X25 B;  3UPU A;  3CQT A;  5J26 A;  2K57 A;  1BK2 A;  2A08 A;  1ZQ1 A;  3A1P A;  2HQE A;  2PVD B;  2XI9 A;  2XDD A;  2MK5 A;  3M9Q A;  3CPW S;  3VRY A;  5GMK h;  2ENM A;  2LTO A;  4PJL A;  2KK4 A;  2DIQ A;  4F7U E;  4PJO E;  3EG3 A;  2LX7 A;  4PL6 A;  1WX6 A;  2JNG A;  5LJ3 h;  1YCS B;  3CCQ T;  8AT1 B;  3HFN A;  2YDL A;  1YWO A;  3G1J A;  1D1B A;  2YRD A;  3LH0 A;  3BDL A;  2LX9 A;  4HCZ A;  4Y28 E;  4E7Z A;  1NPP A;  3OMC A;  2LNH B;  5GAN g;  1Y96 A;  2CP7 A;  2BE7 D;  2DRK A;  4L5G A;  4AFQ C;  4FYY B;  4M7D D;  4M77 E;  3V8K A;  3AHU A;  4KGV B;  3MEU A;  4B9W A;  2DNU A;  4FIB A;  2KRN A;  1B07 A;  1RAE B;  5I2S A;  4DQ2 A;  1UGP B;  2FRW A;  5CCA A;  3CXC S;  3HPW A;  3CCE Q;  2QXF A;  4XTV A;  3OS5 A;  5J39 A;  2H3J A;  3MEW A;  5LJ5 g;  3DB4 A;  2EYZ A;  2CP5 A;  4NS5 A;  2RJD A;  3OW2 P;  1C0M A;  3CCU T;  4M7A G;  3G71 A;  4AFS C;  2ZPG B;  2Y4Y A;  2O31 A;  2J05 A;  3DKM A;  1RI9 A;  2COZ A;  2DTH A;  4M7A E;  2BTT A;  2FB7 A;  1OZ3 A;  1Q81 R;  3BFM A;  3TQ7 P;  2V8K A;  2DZ9 A;  2ED1 A;  2DJQ A;  4LN2 A;  1N9S A;  2L3Q A;  3L2V A;  3I35 A;  4DA4 A;  2DL8 A;  3GNG A;  4JJC A;  4C5E A;  3NMZ C;  2Y90 A;  1X6G A;  1V76 A;  3ER0 A;  4M77 G;  1M90 R;  2KNB B;  2CGH A;  4C92 E;  3EGX B;  1MGQ A;  3VKI A;  3FC3 A;  1QP2 A;  4ME7 A;  1FX7 A;  3I9Q A;  1AWO A;  1A0N B;  1E6G A;  2R5A A;  2PVG B;  1VQ6 T;  1T3L A;  2KDS A;  4E7S A;  2O01 E;  1N8R R;  2KI7 A;  2OTJ Q;  1TH7 A;  2EQJ A;  2RHU A;  2HMA A;  4K11 A;  3QUI A;  3TRE A;  5C6S A;  3OYI A;  4M77 A;  4BDY A;  2K5I A;  1KC8 C;  3M0T A;  4R56 A;  2KT8 A;  4PJM A;  1X27 A;  1Q7Y C;  1SHF A;  2J6F A;  3OYE A;  1I81 A;  3GIB A;  1GRI A;  2X4J A;  4F7U G;  4II1 A;  1VQN A;  1C1A A;  1EX4 A;  3VYG A;  3CCQ A;  3JCM e;  3H8Z A;  5A0L A;  1LOJ A;  2DRM A;  1AD5 A;  5L23 A;  4FSS A;  1NLP C;  3SDZ A;  1BBZ A;  3OBY A;  5DY9 A;  4M7D F;  4F14 A;  2LNV A;  2F5T X;  2VB6 A;  2DXC A;  4F7U B;  1ZLM A;  3CC4 Q;  2MMP A;  1VOM A;  1MV3 A;  2PTK A;  1ZA1 B;  2LJ0 A;  2HKN A;  3REB B;  2KYB A;  2CZ7 B;  2JW4 A;  4WCI A;  2X51 A;  3ULR B;  5LJ5 j;  4M75 D;  3CCJ T;  1VQ4 Q;  3LW5 E;  2DTO A;  5FRM A;  1PRL C;  2K9G A;  3PIO A;  2M16 A;  3EHR A;  4JRQ A;  1M1K C;  2A36 A;  1R0C B;  1X43 A;  2CDT A;  3QKJ A;  5GAM h;  2KMT A;  1YIJ Q;  1R8O B;  1ZSG A;  2MIO A;  2DPP B;  2RQT A;  4HCC A;  3A8M B;  3CMA Q;  4LDV A;  2QI2 A;  4M75 C;  2ATC B;  1ZSZ A;  5IN1 A;  1JBM A;  1OV3 A;  1LNX A;  2AZV A;  1UEC A;  2RM4 A;  1ZHI A;  3M58 A;  1KJW A;  3S3N A;  1YI2 Q;  4JRI A;  3G6E A;  3VUZ A;  1QKX A;  2C0O A;  2JS2 A;  4BY6 B;  2YRC A;  2YUO A;  4M7D E;  3SB2 A;  4QVD A;  2RK1 A;  4IUV A;  3CC2 A;  2DL4 A;  2QAZ A;  1GBR A;  1NM7 A;  1OU8 A;  3HSB A;  2DXU A;  2XK0 A;  4A53 A;  4X34 A;  1MMD A;  1XOV A;  2KGT A;  3VS3 A;  1VQ5 T;  2HSE B;  5J3B A;  4J9F A;  2DJZ A;  1YIT T;  2C0T A;  1UGR B;  4RTW A;  2LDM A;  1BB9 A;  4LUD A;  2E64 A;  5L8R E;  2BZ8 A;  5CIU A;  1NZ9 A;  2CT4 A;  3UWN A;  2X35 A;  4FYV B; 
#chains in the Genus database with same CATH homology
 3CPW P;  1Q81 R;  1KQS P;  3CCQ Q;  1YI2 Q;  2QA4 Q;  3CD6 Q;  1YJW Q;  1QVG P;  1YJ9 Q;  1Q7Y R;  1KC8 R;  3CCE Q;  1VQ6 Q;  1NJI R;  1QVF P;  2OTL Q;  3I56 Q;  1YHQ Q;  1S72 Q;  1K73 R;  1VQO Q;  1VQ9 Q;  3CCR Q;  1YIJ Q;  3G6E Q;  3CXC P;  1JJ2 P;  1VQP Q;  1VQN Q;  1Q86 R;  1Q82 R;  3CMA Q;  1VQK Q;  3CCM Q;  3CME Q;  1N8R R;  1K9M R;  1K8A R;  2OTJ Q;  1W2B P;  1M90 R;  1VQM Q;  3OW2 P;  1VQ4 Q;  1VQ5 Q;  1VQ8 Q;  1M1K R;  3CC2 Q;  3CC7 Q;  3CCL Q;  1YIT Q;  3I55 Q;  3CCJ Q;  3CCV Q;  3G4S Q;  3G71 Q;  3CCS Q;  1KD1 R;  1VQL Q;  3CC4 Q;  1YJN Q;  1VQ7 Q;  3CCU Q;  2QEX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...