4F7UG

The 6s snrnp assembly intermediate
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
PELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 68
sequence length 68
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uG00
3V7CA 2CGHA 3RKXA 1WNLA 3SWNA 4JLIA 4HT8A 3HSBA 5GANf 1WQWA 4JRKA 4N0AA 3RKYA 4M7AB 4NOYA 4C92A 4EMKA 5LJ5j 3JCMP 5LJ5h 1D3BB 4M7AF 4N0AC 3QO3A 4PJOF 4M77A 1JBMA 4M78C 4RCBA 3RIRA 4XU1A 4M7DB 3JB9D 1Y96B 4M7DG 3QHSA 4M75B 4XU0A 5I21A 4A54A 5GANj 4PNOA 4M75G 3L2ZA 3V7RA 2ZGWA 3JCMe 5GANh 5GAN7 4XQ3A 5GAN5 3BY7A 2FYKA 2RD1A 4F7UB 3L1AA 3JCMJ 3EFSA 4XTYA 4F7UG 3VU3C 4X9CA 1B34A 3GIBA 4NL3A 4M7AE 3JB9G 3EFRA 1BIBA 4X9DA 1KQ2A 4C8QF 4PJOA 2E64A 2DZ9A 1YCYA 3SB2A 4C92D 1I4K1 4M7DE 4M7AA 1U1SA 3QSUA 4M78D 3JCMg 1M5Q1 4EMGA 5CAIA 4M75E 5GAMf 2RB6A 3QUIA 2DZCA 2EWNA 2Y90A 4M77D 2VC8A 3SWNB 5GAOr 2E41A 3SWNC 3JCMd 1LNXA 4EMKC 3RERA 4C92C 2RM4A 4EMHA 2YLBA 4F7UE 1JRIA 1WQ7A 4M78B 4C92G 3JCMb 5GAN4 4J5YA 5LJ3f 4C8QE 4M78G 3JCMc 5GAOm 2DXTA 4XU2A 3RKWA 5LJ5e 1HK9A 4XTWA 4M77C 4M7DF 2EAYA 4J6YA 5GAN2 2FB7A 1U1TA 2QTXA 4M75F 5GAMh 5GAOp 4WF2A 4PJOD 2YHTA 4DQ2A 5LJ3j 4F7UF 5GANe 5LJ3h 3V8KA 3JB9F 4J6WA 4OP0A 3RUXA 3V8JA 5GMKm 5LJ5g 1B34B 2DKGA 1WPYA 1BIAA 2DEQA 4JUVA 3FJPA 4PJOC 3JCMW 3INZA 4M7DA 1MGQA 1LJOA 5LJ5d 5GMKj 1Y96A 4M75A 4MMLA 5GMKh 2EJ9A 4EMKB 1N9SA 1HXDA 4C92B 5GANg 2K57A 2DXUA 3JCMX 4F7UA 3V8LA 4Y91A 3AHUA 3JCMV 5GAOn 4M78F 1KQ1A 4M77B 4C8QA 5GANd 4J6XA 5GAMj 4NL2A 4M77G 3BDUA 3JB9I 2RA2A 3RESA 4C8QC 3PGGA 1N9RA 1X01A 2DTOA 3JCMf 4M7AD 1LOJA 4JRIA 2VXFA 1H641 2JN0A 5LJ3d 3BW1A 2HNIA 2YLCA 5GAMe 4XTZA 4M7DD 4C92E 1D3BA 1M8VA 2VXEA 4V2SA 4M78E 4M75D 4M7AC 5GAN8 4PJOB 4M78A 3HFNA 3BFMA 3V7SA 4M7AG 2DJZA 5GAOl 4PJOG 4M77E 3HFOA 5LJ3e 3JCMh 4A53A 5GAN6 1I8FA 4XTVA 4M7DC 2EJFA 2E10A 1I5LA 4C8QD 5GAMg 2E65A 4M75C 4C92F 1I81A 4XTUA 4QVDA 5GMKe 4HA8A 2DTIA 3FIFA 5DY9A 3JCMQ 5GAMd 3M4GA 5LJ3g 5LJ5f 5GMKl 5GAN3 3JB9H 4M77F 4XTXA 4C8QB 2E1HA 2I2LA 4PJOE 4C8QG 4MMKA 3FB9A 4QVCA 3JB9J 2DTHA 4XU3A 2EJGA 4RCCA 4HT9A 5GAOq 1TH7A 5GMKi 2DVEA
chains in the Genus database with same CATH superfamily
2PVDB 3AT1B 2R58A 1Q82U 3VKIA 5I2SA 1VQPT 1RL2A 4P5NA 2DM1A 1F1BB 1GL5A 1X2KA 4PNOA 2CP3A 5GANh 3S3MA 3REBB 1NZ9A 1JU5C 1VQ5Q 1KD1U 1BIBA 2F2XA 2P0PA 4EIKA 4JRQA 2E41A 2HKQB 3MP6A 3RERA 2F5KA 1QCNA 4EMHA 3VV0A 2RH2A 1PD0A 1VQ4A 4PJLA 3JCMc 4JDSA 5CK9A 4IIMA 1TUGB 2K2VA 1AOJA 2CZ1B 3L2UA 2VVKA 4ZNXA 2E12A 1VQMA 3E19A 3INZA 2MK5A 3CCLA 1YJ9Q 4L59A 2Y4YA 2FZCB 1FYNA 2A0FB 1BI2A 1HXDA 1K9MR 3OW2A 3CCQA 3TU4K 5GAOn 3A8MB 1UECA 2DL8A 1G3TA 2HSPA 3H41A 2VUBA 4BY6B 3THKA 1V76A 2ESWA 2JXBA 4DA4A 4C5EA 1WHLA 2JUFA 2KK4A 8AT1B 3CCVA 1K73U 3HFNA 5GJWB 5IXFA 3OYBA 2DIGA 1BI1A 1U5SA 2K79A 2EYWA 1D09B 5FU6B 2E65A 2OJ2A 3MPUB 1BBZA 2DEUA 1CKBA 2XKOC 1JJ2S 2HZYA 5GAMd 2VASA 4QQGA 4M77F 4XTXA 1RAFB 4QW2A 2CP2A 2ECZA 3OYIA 1JB0E 2DTHA 3RKXA 4J7FA 2HBPA 5LJ5j 2DMOA 3CC4T 4F16A 1D3BB 3P8DA 3M53A 3FC3A 2RF0A 1Y57A 2SRCA 4R0KA 2L3SA 2MCNA 5HK3A 3ER0A 1VQ4Q 4JJNK 1PSEA 3HL8A 4MZTA 3H0FA 2RMOA 4C8QF 1WFWA 4LDUA 3ZBDA 1W6XA 1ZA2B 1BI3A 2KBTA 3EGXB 4OGEA 4UC4A 2FPFA 1B07A 1VYVA 1X2QA 3GNFB 2RN8A 2RHZA 2VC8A 1VQMQ 2X4JA 1I0CA 4EMKC 3CCLQ 2NUPA 1H8KA 1QKXA 4FYWB 5GJVB 4FU6A 3L2RA 4IUUA 4PL6A 3CCQQ 2EGCA 1OYXA 1RI9A 4KUDK 1PCXA 1M1KC 5GANe 4OVAA 3V8JA 3CMET 5LJ5g 4GLKA 1KC8C 3EG1A 1Q7YU 4PJOC 5KCHA 5D7UA 2BKDN 1YIJA 2DAQA 1AT1B 3CCVQ 2R57A 3TEEA 1QVPA 3CCRT 3RNJA 1W2BP 3OY9A 4Z8AA 3GPLA 1K8AC 4ESRA 5A2QE 4C0DC 2K5FA 2OTLA 1Y71A 4M7DD 4C92E 1ZQ1A 3N5BB 2LCSA 3VS3A 4KGZB 2QQBA 1VQOA 1I5LA 1IGUA 3M0QA 3G1JA 4ZN3A 4QVDA 3TCJA 2CZ0B 3FRNA 4QVZA 1PRLC 4II1A 2E1HA 4E47A 2RHYA 4E6RA 1MHNA 1YJWA 1VQKT 3RDVA 2RQTA 3PFSA 4PFPA 4N0AA 4NOYA 5KYWA 1ABOA 4ANJA 2GTJA 3JAME 1VIFA 3RBBB 1Z9QA 3CCUQ 3M56A 2JTFA 2LNVA 4PJNA 2HL5C 3UF4A 3VU3C 5KYUA 3S3NA 4M7AE 4NL3A 1M2VA 3WXMB 3NGPA 2ZCFB 4HVVA 1ABQA 2DE0X 2D0NA 1EZZB 4M75E 3E9GA 2YWWA 1ZSZC 1D0XA 3QUIA 2YXYA 1PKTA 5IHIA 1G3WA 3HRSA 2DL3A 2GQIA 2BE7D 1YIJQ 1VQ8Q 2C0TA 3MCAB 3GP8A 3OMGA 2EFIA 4ATOA 2EGAA 4J6WA 1WXUA 2K2MA 4J9BA 4MZMA 1WHMA 1UB4A 2DXCA 2LT4A 2YUPA 3SDZA 1WLPB 1QW1A 2DXUA 2CP7A 3SFMA 1VQOQ 2HQEA 2HQHA 2L89A 3LWHA 3HP9A 6AT1B 3KXTA 1M2OA 1LOJA 3DB4A 5CVIA 2QXFA 3C4SA 3EHRA 1YJWQ 2J06A 3M0SA 4OMMA 2MF2A 4LXCA 4AFUC 4BE2A 4C8QD 2EYQA 3CCSA 1QVFS 1I81A 1UGRB 2O2OA 3VS4A 4AFQC 1NE8A 3J80E 3OS0A 1IXDA 1OU9A 4J9HA 3OYMA 5FWBA 1E6GA 2KRMA 1ZUYA 3EHQA 3L2QA 1WQWA 2LZ6B 1NM7A 2JOYA 4PJOF 4M77A 1QMCA 2KVQG 5GANj 4ME7A 1OQKA 2X3WD 3V7RA 3X28B 3OS5A 1XNIA 1C0MA 2WSFE 1B7TA 3NFCA 4X9DA 1U1SA 3CCJT 1KQSP 3G71T 3VS1A 2YRDA 3VUZA 1Q81C 1KK7A 1KC8U 2X4YA 3CD6T 1SSHA 3X24B 5LJ3f 4XTWA 3ZL7C 2RK1A 2FB7A 4N4GA 3H6ZA 2KRNA 3WVDB 5FROA 3EG2A 1K8AU 3M59A 2YT6A 1YWPA 3RUXA 5GMKm 1TOVA 1Q82C 2LQKA 4JUVA 1WJQA 2DETA 2CUDA 1TU0B 1PM3A 2LRQA 3URGA 3TSZA 5GANg 2K57A 4RTUA 2EW3A 5IH2A 3JCMX 3OSVA 1QVGP 3QZ9B 3OYNA 4NL2A 3CCSQ 2W10A 1KD1C 3JB9I 1K76A 1GCQA 4F17A 1W2BA 4IUPA 5IT9E 3OYAA 1H3ZA 3VJPA 2GFUA 1D3BA 1NJIC 1NEGA 4B9WA 2XIDA 3QG1A 1N8RR 2GBQA 4XTVA 4M7DC 2COZA 3OYCA 2CP6A 4FSXA 1VQ9Q 2CYZB 2L2PA 2I2LA 5A0LA 4MMKA 3FB9A 4QT7A 4ZTFA 4XU3A 2EJGA 4J9DA 3CMAA 2DX1A 3UA6A 2BE9B 2EYZA 4JRKA 2MI6A 4LDWA 1YBYA 2LT1A 1RLPC 4JS5A 2NUTB 4OMPA 2FRWA 4A63B 3VS2A 4M7AF 1BU1A 4KH1B 1ZSGA 4LDXA 3G6EA 3CCEA 3QIIA 4A54A 3FDRA 2E4HA 4XQ3A 2OAWA 3O5ZA 4C0GA 2KE9A 2E5KA 4L6V5 5C6SA 1YJNT 4BE1A 1K73C 2QYZA 1Y7XA 2E3HA 2JNGA 1ZUUA 1OPKA 2RB6A 1AWJA 2KXCA 3JCMb 1NLOC 1YITA 1YHQA 4GBQA 3TVTA 2EVRA 1AD5A 1PC0A 3ASKA 2YHTA 4Z02A 5DM7R 4DQ2A 3MEAA 3PVQA 1YNZA 5LJ3h 3VS7A 1WPYA 3FLGA 3S3OA 1MGQA 1TUDA 2YRVA 4RTXA 2DD5A 1KQSS 2OTLT 3GLXA 4PLLA 1RAEB 5KYWB 3A8GB 1KQ1A 1VQ5A 2DBKA 4N4HA 1X01A 2DTOA 3VS5A 1Q86U 1VQOT 3M0RA 2MMPA 4J83A 1SPKA 4FT4A 2EIFA 4A4GA 2VXEA 1QKWA 1UHFA 1M2VB 1UFFA 4B6MA 3CMAQ 2CUBA 2JTMA 1MUZA 4A4EA 1YJWT 3CEYA 2P0KA 1RACB 3VYGA 1JJ2P 2RHUA 2Z0WA 3LGLA 3CCEQ 4WTOB 1K4US 2DYBA 1QVGS 4CC4B 1D1AA 2F5TX 2M0OA 4E7HA 1XTDA 2C0IA 1Q7YC 4KBMB 1YJ9A 2A7YA 2V1RA 1TG0A 4EMKA 2FVUA 2YDLA 2G3RA 3I56A 2QTVA 1VUBA 2CP0A 3D7SB 1H3HA 3HTRA 5DLOA 1K0SA 3JRZA 2ZGWA 2CZ6B 3GF5A 3EGDA 2DVJA 4J9EA 1YITQ 1YHQQ 4LDVA 4JS4A 1CKAA 4PJOA 2EKOA 3PVLA 1IGQA 2JT4A 3CPWS 3TSWA 3SB2A 4C92D 1I4K1 1O75A 3M0UA 3QSUA 4BUGA 1YI2Q 3EFOA 4J9IA 3EGUA 1OV3A 4B9XA 3JCMd 5FU7B 9ATCB 4A4FA 1KQSA 1W70A 5GAOm 3QYGB 3OB9A 4M7DF 3QPHA 1IZ6A 3P8HA 4QKUA 3CXCP 4Z88A 4OMOA 3H0HA 2RI3A 2JS0A 1WYXA 2QEXT 4HCKA 1O9SA 4CRIA 3QJYA 1WXTA 1SSFA 3G4SA 1IREB 1NJIU 5HY6A 4OB0B 4KUIA 4X34A 1G83A 8ATCB 1X69A 3QJ6A 2QQAA 2VGMA 1M1KR 3HRTA 4M77B 1SEMA 2D8HA 3UPUA 1VQLA 4M77G 3A1PA 4FSSA 1UDLA 4M7AD 1QVGA 2VXFA 3J81E 1MMNA 3UWNA 2LQ8A 3CC7A 2RHIA 1VYUA 3CC2Q 2XHCA 1M8VA 2L3QA 4M75D 2KEAA 4A4KA 1VQ6T 1HJDA 5LJ3e 1T3LA 3EH2A 5D6XA 2QASA 2ABLA 4RMOA 2PNIA 3A98A 1HYOA 4BI4A 4RUGA 3UT1A 1M3CA 4RTWA 3I56Q 2O9SA 3LH5A 4BACA 2XDBA 2XDDA 3MJXA 4C8QB 2DL7A 2W0ZA 4C8QG 1X43A 2M16A 4PFZA 4HT9A 4AMCA 5GAN5 2CGHA 3MO8A 1K1ZA 2D0QB 1W1FA 2K3YA 3DLLA 2EPDA 2P0QA 4XU1A 4EPCA 1D1BA 4AG2C 5KE2A 3L2ZA 1X6BA 3PMIA 5A0DA 2O4XB 2MAMA 1Q95G 1SRLA 3JCMJ 2A37A 5FLXE 4XTYA 4ZGJB 3M55A 4RKUE 2Y4XA 1G2BA 4Q5WA 1GBQA 2DZ9A 2E64A 4E7JA 1YCYA 2FZGB 4EMGA 2JTEA 5GAMf 4BI3A 1MV3A 2EWNA 1I07A 4RTYA 3C0CA 3EG3A 3G4SQ 3M0PA 3ZEHA 3RKWA 1D0YA 4OMQA 1ZHIA 1U1TA 2MIOA 3E2UA 4JPBW 2FPDA 3L42A 2ROTA 5CKEA 4PLIA 4F7UF 1VQLQ 3NTHA 4OP0A 2H3JA 4FYVB 2D6FA 1X6OA 4MDXA 2DLPA 2JS2A 3CC7Q 4BDYA 1SF9A 3H9NA 2CZ7B 3CCUA 4JJCA 1Z9ZA 3LYIA 1OULA 5CKHA 2QQ9A 3JCMV 3BDUA 2AKLA 3R6NA 1WHGA 3VUBA 4CC3A 3PE0A 2GFAA 3CXCS 5IAYA 5D6WA 2NUTA 4L5GA 4BB7A 1CSKA 2E6ZA 2KNBB 2YUOA 2C06A 3E1SA 1M1FA 2OI3A 1VQNA 3CBOA 1QVFP 4A53A 2LC4A 3RMSA 4DOWA 3LH0A 2ZPBB 1VQ8A 2KR3A 2CH4W 2GQVA 1UUEA 1XJWB 2OTJT 4FYYB 2ROLA 2B86A 5DLQE 4HA8A 1TUCA 1KSWA 1JJ2A 4DBFA 1YP5A 3EG9B 1OU8A 1PHTA 2X9HA 1EX4A 3QYHB 3G6ET 5CQYA 3M57A 2V8JA 3LLRA 1ARKA 2R5MA 2H8HA 3QKJA 1FMKA 3MHXA 1ZBXA 2FG0A 1JBMA 2FPEA 1RAIB 4JRPA 3GBQA 2GF7A 3OSSC 2IPOB 4BI8B 3OYLA 1U3OA 1OZ2A 2FL7A 1OI1A 5HKCA 2JZ2A 2O88A 3H0IA 1RI0A 2DL4A 1U8RA 4LUEA 2MPXC 3C94A 1YITT 3ZFJA 1S72T 1TSFA 3M9QA 4OB1B 1RAGB 4C92C 2K7AA 2YLBA 1VA7A 1WQ7A 4IIOA 1BCMA 4J9FA 1AWOA 2EAYA 2K3XA 4VUBA 5GAMh 1AHJB 2MWOA 4JZ4A 3REAB 1WHJA 2KT8A 2BZ8A 5LJ3j 1Q81R 3V8KA 4PJJA 2DEQA 1VQ5T 4M7DA 1YWOA 5LJ5d 4FM4B 2LJ0A 2V1QA 2QA4Q 4EMKB 4Y92A 1VQNQ 1YCSB 1M90U 2AKKA 1JO8A 4EDUA 2AK5A 2O01E 4J6XA 1AZEA 1Q82R 1SG5A 2M02A 4F14A 1AWXA 3EGDB 2QQRA 1RABB 4V2SA 5KYXB 3CBPA 4M78E 5CKDA 4M7AC 1ZA1B 4PJOB 1PKSA 4PJOG 2DERA 4J7IA 1KD1R 2LNHB 3WVEB 2DL5A 3EFOB 3NMZC 3M5AA 4M75C 2K5LA 1VQ7Q 1SHGA 4FT2A 1YJ9T 4GLMA 5LJ3g 5GMKl 2FEIA 4C0DB 3I56T 5IN1A 2D9TA 2F2VA 3V7CA 2COWA 3PT9A 2DRKA 2PU9B 1UTIA 2E5QA 4M78C 4RCBA 3CCMA 4DEYA 1M3BA 2ED0A 1Q86C 2RQRA 2PVOB 4C5HA 1W4SA 4AT1B 1KQ2A 5KE3A 2EYYA 1B3QA 2WACA 5GAOr 3UDCA 3SWNC 3X26B 3VS6A 1JRIA 4C92G 1X6GA 1VQ9A 4PJMA 4ELZC 4MDWA 2L3RA 1OPLA 1K73R 5KH6A 3QZ5B 5HK0A 3OYEA 4FW1A 3OYFA 3G4ST 2D8JA 3R6OA 1VQ4T 3PMTA 2K4YA 1MMGA 1VQLT 1ZSZB 3NTIA 5GMKh 2JJ9A 1OX9A 1WJRA 4IUQA 3CC7T 4F7UA 4C8QA 3EAEA 1VQMT 4LNPA 4AFSC 4Y28E 3CCLT 2EQMA 2AHJB 1NEBA 2F2WA 5LJ3d 1UJYA 1MV0B 1K9AA 2K5IA 2PUKB 5GAMe 5IHNA 2P4RA 3CCQT 4OMFB 4RTTA 1NG2A 2PTKA 1VYTA 2ZPHB 1R8OB 1M30A 3O8VA 2DJZA 5EC7A 3V7SA 1ZLMA 4M7AG 4LN2A 1I8FA 4OF1A 3MKDA 3NTKA 2O4XA 2M0YA 2RJDA 4C92F 1QVFA 3CCMQ 3CCVT 2V26A 5J3BA 1K9MU 2K6DA 4HVWA 3DKMA 3JV3A 2RK2A 3RKYA 1BI0A 5HCKA 1OEBA 3TREA 2LDMA 4N0AC 1QQJA 2EQKA 2XI9A 3I5RA 3OS2A 3ME9A 1PRMC 1MMDA 1Q7YR 1X75C 1WXBA 3PIPA 3CPWP 1BKBA 3EFRA 1XOVA 1IHWA 1R77A 2L8DA 2PUOB 4E7LA 2XMFA 2X35A 3SWNB 2L5QA 1MMAA 2GCXA 3EH1A 2FHDA 3T9NA 1GFDA 5CQXA 2RJFA 1GFCA 2J7IA 1BYMA 2JMCA 2QTXA 4M75F 2LX9A 5GAOp 2NUZA 2XICA 2DO3A 3CCUT 2KYMA 4PK4A 1RAHB 1B34B 4WCIA 3OS1A 1WX6A 1KG1A 2FO0A 3QWYA 2IIMA 3RR6A 4TVRA 4M78F 1ACMB 5GANd 4X1VA 3EG9A 4HKEA 2RA2A 3CC4Q 2LMJA 1YIJT 1YI2A 1VQ8T 2KYBA 1WJSA 2OX7A 2YSQA 1VQKA 5GAOl 4M77E 3P8BB 4OGCA 2XD0A 5GMKe 1FWZA 2DTIA 2CSIA 1M3AA 3M4GA 4QQ6A 1WDXA 5EG2A 3MEVA 2DD4A 2HEQA 3JB9J 4DBQA 5CIUA 2AZSA 3HSBA 3JSCA 5I2MA 4D6WA 4D8DA 4E7SA 1UGQB 3RIRA 5M9OA 4M7DB 2RPNA 4M7DG 4E7ZA 3U23A 4JLGA 3CMEQ 2IVWA 3KFVA 2GTOA 4XAXB 2FYKA 2X51A 4PKCC 3L1AA 3I5SA 3SD4A 3CC2A 3VRZA 2L3PA 4OB2B 2FRYA 3OYHA 1XQHA 3CCRQ 1GXIE 1M5Q1 1VIEA 5KCOA 2Y90A 3X20B 2J6KA 1SRMA 5I11A 3CPFA 1WHHA 2RM4A 3OYJA 4FYXB 4FIBA 2PZ1A 2M9UA 4RG8A 2KROA 1N8RC 4RTZA 2K9GA 4BY6C 3GOXA 3LW5E 5KYXA 2KT1A 3JB9F 3M0TA 4R55A 3VS0A 2M1HA 2RQWA 2SEMA 1BK2A 3QXEB 3OW2S 3LX7A 1N9SA 3OYKA 1VQKQ 4Z89A 5FU6C 3CQTA 2DRMA 1SHFA 2LQNA 3JCMf 4JRIA 3MEWA 1M8MA 3RMQA 2KI7A 3MP8A 2RO0A 4DBRA 2KSSA 5CKBA 2DILA 4AG1C 2E10A 5GAMg 2IG0A 3M54A 2BIVA 2EYXA 1BB9A 3OBYA 1KC8R 3BDLA 1YFNA 2HMAA 3CCMT 2B8AA 1WNLA 3CCST 7AT1B 4C92A 2V8IA 1WGSA 5CO7A 4BDZA 1K8AR 3OQ5A 1M90C 3CCJA 2DXBA 4XU0A 3G71A 1HD3A 5GAN7 2A28A 2LJ3A 1IB8A 2RD1A 4C5IA 4F7UB 3EFSA 3CD6A 2KAFA 3DLMA 2HL3A 4F7UG 3L2WA 5KYYB 3PTAA 1X27A 1R0BG 1VQ9T 3QDRB 2YUQA 4E7IA 2EQUA 2JW4A 1ZSZA 4M78D 3NHNA 1BCOA 3CPWA 2LJ1A 3NPFA 1LNXA 4J9CA 2EGEA 2A36A 1UHCA 4J5YA 2KY9A 1KHIA 5IXBA 4KRTA 1P92A 2ZAEA 4R56A 2I0NA 2ENMA 1GBRA 2ZZDA 2RQUA 2H3EB 4LUDA 1KIKA 3S6WA 4HCCA 4M7AA 4LD6A 1C1AA 1WHKA 2LX7A 1LJOA 1RLQC 2LCLA 5GMKj 1Y96A 4M75A 3KBGA 2OAUA 4LE9A 3V8LA 4Y91A 1D0ZA 2KGTA 2EKHA 1N9RA 3LWIA 1TTHB 2QAZA 4HCBA 2F69A 1IO6A 4XTZA 1E7OA 4C0ZA 4M78A 3HFOA 2QGFB 2EBPA 3JCMh 5GAN6 4N4IA 2CDTA 1A0NB 1QLYA 1Y07A 3C12A 1TS9A 3FIFA 3VRYA 3CCJQ 3EG0A 3G71Q 2JMAA 2HSEB 4PJOE 5L8RE 1AEYA 2BUDA 1LPLA 3CD6Q 5GAOq 4O5VA 1TH7A 4FCYA 1T0HA 3MEUA 3SWNA 4JLIA 2QA4A 3JCMP 3HKSA 1G8XA 4KGXB 1YJNA 4CC7A 3I35A 3JB9D 4ORZA 2RQVA 3QHSA 3M4YA 4F04B 1NBEB 3CMAT 4LDYA 2V8KA 1KFZA 1D1CA 1N8RU 4X9CA 1B34A 1JQQA 5FRMA 4RG2A 3A8HB 2CT3A 1AVZC 4ZGEB 2RNAA 1N27A 1LCKA 3CCET 1OZ3A 2CT4A 5CCAA 1VQ7A 1Q86R 5GAN4 1G3SA 4GY5A 2DFUA 2DXTA 2QDYB 3BE3A 2P84A 3QDFA 1M4ZA 4RTVA 1K9MC 2XK0A 1ZX6A 2DF6A 2A3LA 4LD9K 2HDAA 2YUNA 4JJBA 1WIEA 2BTTA 2DKGA 1RUWA 3JCMW 1YHQT 3TQ7P 4MMLA 1N5ZA 2VWFA 1C6VX 5I22A 3CBMA 1YI2T 3AHUA 2M51A 2G6FX 2JM8A 2E6NA 1VOMA 2HBWA 3META 1H641 2R5AA 1I5OB 2FZKB 2MYSA 2CSQA 4HXJA 3CXCA 3A8LB 3BFMA 4IUTA 1EFNA 1FX7A 2HD0A 5C0MA 1FMVA 4QQDA 1YJNQ 3I55A 2EQIA 4FW2A 5LJ5f 3PNWC 2C0OA 3ULRB 2X4WA 4HT8A 1QCOA 2D1XA 1IRXA 2DNUA 2KMTA 4DEXA 3CC2T 2NLUA 4FL6A 3E9FA 4ELYC 3H8ZA 2VGNA 3JCMe 2DK3A 2COYA 1NJIR 1VQPA 4MZPA 2PQWA 3DB3A 2AT1B 1UEBA 1RAAB 2OTLQ 2ZPIB 1V1CA 4DBHA 2J05A 3OYYA 4IKFA 2DZCA 4M77D 1KHCA 3I9QA 2QEXA 2HCKA 4XU2A 2HQXA 1HK9A 2YRCA 1WA7A 1UJ0A 1WZOA 2O9VA 1IHVA 2LP5A 3VYHB 2K3BA 1JEGA 2DIQA 3PIOA 3QBYA 2RI5A 1QWFA 3C95A 1FMWA 2WSEE 1UG1A 5AYFA 5LL6S 4C92B 2L0AA 2VB6A 1UGSB 3MP1A 2KQWA 2E3IA 1VQ6A 2CREA 1QP2A 4K11A 4HVUA 1W2BS 2QGGA 2XG8D 3I55Q 3IQLA 3PGGA 2CH4A 1TXQA 3GNGA 2YLCA 1SKUB 4J9GA 3A8OB 1QWEA 4KT0E 2CS7A 2GGRA 1KJWA 4KGVB 2NWMA 2ZPFB 2BZYA 4XTUA 1PG5B 3G7ZA 4C5GA 5A0GA 4IUVA 3FEOA 1NYGA 2LTOA 5KYYA 1N6AA 1MNDA 5GAN3 2AIRB 2CP5A 4CC2A 1QCFA 4M4ZA 4RCCA 1VQPQ 5FW9A 1UGPB 1M1KU 4M7AB 5LJ5h 3HRUA 3OYGA 1HSQA 2DA9A 1E6HA 1Y96B 4M75B 2QEXQ 2NYSA 2X3XD 1T3SA 2BZXA 2VYTA 5I21A 3OMCA 1OX8A 4M75G 4DOVA 3OYDA 3CC4A 4A4HA 4O6JA 1GCPA 4D8KA 3GIBA 2ZPEB 3F70A 2P4TA 4BE0A 2KXDA 1M1GA 5AT1B 4M7DE 1U06A 2DPPB 4KULA 5IHKA 4KH0B 1PSFA 4M78B 2RJCA 1GRIA 4IURA 2VV5A 2HAXA 3A5ZB 4PFOA 4M78G 1LVKA 1DJ7B 4J6YA 2RJEA 3LGFA 1VQ6Q 2DYIA 3M58A 1Y0MA 1FXXA 5FWCA 1AZGB 3OW2P 1NLPC 2QDLA 2O31A 4ZGDB 2LVMA 3HHTB 2EJ9A 3Q1JA 1MNEA 3CMEA 4BD3A 2NUPB 4XK8E 1R0CB 3RESA 4C0FA 3EGXA 2X4XA 3BW1A 2OTJA 3CCRA 2HNIA 5D6YA 2QI2A 1PNJA 5ECAA 1PD1A 4CI0C 3SHWA 2EJFA 1WI7A 1RADB 4E2FB 1G5VA 2VKNA 3JCMQ 5DY9A 2J6FA 2QA4T 1K0XA 3JB9H 5J39A 3X25B 1PWTA 1QP3A 1VQNT 4AFZC 4QVCA 1NPPA 2A08A 1AWWA 2LCCA 4JZ3A 5GANf 3OBWA 2JM9A 2QK0A 3QO3A 5FU7C 2MWPA 1J3TA 5KYNA 3QWXX 1S72A 2LQWA 2QQSA 3KUFA 3BY7A 3JB9G 1VQ7T 1T0JA 2QG9B 1M90R 1JXMA 3JCMg 3UA7A 5CAIA 2GNCA 2RI2A 2XU8A 1S1NA 1I1JA 2ED1A 4OB3B 4F7UE 5J26A 2DJQA 5FRNA 2EQJA 4C8QE 5LJ5e 1YN8A 4M77C 3HPWA 1UE9A 5CR2A 1EIFA 5GAN2 2XDPA 1G3YA 4OMNA 4WF2A 4PJOD 4HCZA 4NS5A 5CKFA 1ZUKA 2MOXA 5KYUB 1BIAA 2RHXA 2OTJQ 3FJPA 4JJDA 3J7AF 2F1LA 2KRSA 2WSCE 4YTLA 1JXOA 2PVGB 3L2VA 2CKKA 1ZBJA 4ZN1A 2HKNA 3G6EQ 3FJ5A 5GAMj 2ATCB 4C8QC 4J8OA 1NPRA 2J6OA 2JN0A 2JVVA 2KDSA 1NYFA 3I55T 2DBMA 4ZTJA 5GAN8 3UATA 1H92A 1M9SA 2AZVA 5L23A 1Q81U 3OA6A 2E70A 1M27C 1OOTA 1UGVA 1S72Q 3SEMA 1V29B 4OMLA 1TWBA 2ZPGB 4E7KA 1GCQC 5GMKi 2DVEA
chains in the Genus database with same CATH topology
3V7CA 2PVDB 3MEUA 3SWNA 4JLIA 2R58A 4JRKA 2MI6A 3PT9A 1YBYA 4LDWA 2LT1A 2QA4A 3JCMP 1Q82U 4JS5A 3VKIA 3HKSA 2PU9B 4M7AF 1YJNA 5I2SA 1VQPT 1RL2A 2E5QA 4P5NA 4LDXA 4M78C 4RCBA 3CCMA 3G6EA 3JB9D 3CCEA 3QIIA 3QHSA 3M4YA 4A54A 4PNOA 3CMAT 5GANh 3FDRA 4LDYA 3S3MA 4XQ3A 1NZ9A 2V8KA 1Q86C 4C0GA 2PVOB 4C5HA 1N8RU 1W4SA 4X9CA 1B34A 1KD1U 5C6SA 4L6V5 5FRMA 4RG2A 1BIBA 1YJNT 2P0PA 1KQ2A 3A8HB 5KE3A 4BE1A 1K73C 4ZGEB 1Y7XA 1N27A 3CCET 2JNGA 2WACA 1OZ3A 2RB6A 5GAOr 4JRQA 2E41A 3UDCA 3SWNC 5CCAA 3X26B 3MP6A 3RERA 2F5KA 4EMHA 1VQ7A 3VV0A 5GAN4 1G3SA 1JRIA 2RH2A 4C92G 4GY5A 3JCMb 1VQ4A 1VQ9A 3JCMc 2DXTA 1YITA 4ELZC 1YHQA 2QDYB 4JDSA 5CK9A 4MDWA 2L3RA 5KH6A 1M4ZA 3QZ5B 2K2VA 5HK0A 3OYEA 1K9MC 2XK0A 3OYFA 3ASKA 3G4ST 2YHTA 2CZ1B 4Z02A 3L2UA 2A3LA 5DM7R 4DQ2A 3MEAA 4LD9K 5LJ3h 3R6OA 1VQ4T 2E12A 3PMTA 2DKGA 1VQMA 1WPYA 2K4YA 3FLGA 3E19A 3JCMW 3INZA 1YHQT 3S3OA 3CCLA 1MGQA 1VQLT 3NTIA 4MMLA 4L59A 2Y4YA 2YRVA 2DD5A 5GMKh 1KQSS 2OTLT 1BI2A 3GLXA 1HXDA 1WJRA 4PLLA 3A8GB 3OW2A 4IUQA 3CCQA 4F7UA 3CC7T 3CBMA 3TU4K 1YI2T 3AHUA 5GAOn 3A8MB 1KQ1A 3EAEA 4C8QA 1VQ5A 1VQMT 1G3TA 2E6NA 4N4HA 4Y28E 3CCLT 1X01A 2DTOA 2VUBA 2EQMA 3META 4BY6B 2AHJB 1H641 1Q86U 5LJ3d 2R5AA 1VQOT 2K5IA 2MMPA 2PUKB 4J83A 4FT4A 5GAMe 2EIFA 4A4GA 3CXCA 2VXEA 3CCQT 4OMFB 4DA4A 3A8LB 4C5EA 2JUFA 2KK4A 3CCVA 1K73U 2ZPHB 1R8OB 3BFMA 3HFNA 2DJZA 3O8VA 4IUTA 3V7SA 4M7AG 1FX7A 2JTMA 2HD0A 3OYBA 2DIGA 1I8FA 1BI1A 4OF1A 4A4EA 5C0MA 1YJWT 3NTKA 5FU6B 2E65A 2O4XA 3CEYA 2P0KA 4QQDA 3VYGA 3I55A 2RJDA 4C92F 2RHUA 2XKOC 1QVFA 3LGLA 1JJ2S 5GAMd 5LJ5f 1QVGS 4QQGA 4M77F 4XTXA 3CCVT 4QW2A 3OYIA 2F5TX 3PNWC 5J3BA 1JB0E 1K9MU 2M0OA 2DTHA 4E7HA 1XTDA 1Q7YC 3DKMA 2X4WA 3RKXA 4KBMB 1YJ9A 4HT8A 2A7YA 4J7FA 2HBPA 2RK2A 3RKYA 4EMKA 5LJ5j 3CC4T 2FVUA 1BI0A 1D3BB 2KMTA 3M53A 3P8DA 3TREA 2LDMA 4N0AC 2G3RA 3I56A 3FC3A 1VUBA 2EQKA 3CC2T 2NLUA 2XI9A 4FL6A 3OS2A 3E9FA 3ME9A 4ELYC 5DLOA 5HK3A 3H8ZA 3JRZA 2ZGWA 2CZ6B 2VGNA 3ER0A 2DK3A 3GF5A 3JCMe 4JJNK 1X75C 1PSEA 1VQPA 3HL8A 4LDVA 4MZTA 4MZPA 2PQWA 4JS4A 3DB3A 3PIPA 3OYDA 3CC4A 1BKBA 1UEBA 1XOVA 3EFRA 4C8QF 2EKOA 4PJOA 2ZPIB 4LDUA 2L8DA 3CPWS 2PUOB 3SB2A 4C92D 1I4K1 1O75A 3ZBDA 4E7LA 1BI3A 4OGEA 3QSUA 4UC4A 3OYYA 4BUGA 2X35A 4IKFA 3GNFB 2DZCA 4M77D 2RHZA 2VC8A 1KHCA 3SWNB 2X4JA 2L5QA 4B9XA 3JCMd 4O5VA 5FU7B 2GCXA 4EMKC 2QEXA 2FHDA 3T9NA 4A4FA 1KQSA 5CQXA 5GAOm 2RJFA 3QYGB 4XU2A 3OB9A 2HQXA 1BYMA 1HK9A 4M7DF 3L2RA 4FU6A 3QPHA 4IUUA 2QTXA 1IZ6A 2LX9A 4M75F 4PL6A 3P8HA 5GAOp 1OYXA 3VYHB 2XICA 2RI3A 4KUDK 2DO3A 2QEXT 1M1KC 5GANe 3CCUT 4OVAA 3V8JA 3CMET 2DIQA 5LJ5g 1O9SA 1B34B 2RI5A 3QBYA 4GLKA 4CRIA 3PIOA 3OS1A 3C95A 1KC8C 1Q7YU 4PJOC 5KCHA 3QJYA 2WSEE 1SSFA 3G4SA 1IREB 2BKDN 5HY6A 1YIJA 1NJIU 2DAQA 1KG1A 4OB0B 4KUIA 2R57A 4X34A 5AYFA 5LL6S 3TEEA 4C92B 4M7AE 1QVPA 3CCRT 1UGSB 3MP1A 2KQWA 3QJ6A 4TVRA 2QQAA 2VGMA 4M78F 3OY9A 3HRTA 4M77B 1VQ6A 5GANd 3GPLA 1QP2A 1K8AC 3UPUA 1W2BS 4M77G 1VQLA 4HKEA 2XG8D 2RA2A 5A2QE 3PGGA 2K5FA 4C0DC 2OTLA 4M7AD 1QVGA 2VXFA 1YIJT 3J81E 3UWNA 2LQ8A 3GNGA 3CC7A 2RHIA 2YLCA 1YI2A 1VQ8T 1Y71A 2XHCA 4M7DD 4C92E 1M8VA 1ZQ1A 3N5BB 1WJSA 3A8OB 4M75D 4A4KA 1VQ6T 2QQBA 2CS7A 4KT0E 5GAOl 1VQKA 4M77E 5LJ3e 3P8BB 5D6XA 4OGCA 1VQOA 2XD0A 4RMOA 1I5LA 4BI4A 2ZPFB 3UT1A 4XTUA 4ZN3A 4QVDA 3TCJA 5GMKe 1FWZA 2CZ0B 3FRNA 2DTIA 4BACA 3G7ZA 4C5GA 4QVZA 4IUVA 3FEOA 2LTOA 3M4GA 5A0GA 1N6AA 5GAN3 4II1A 4C8QB 4QQ6A 2XDDA 2E1HA 5EG2A 3MEVA 2RHYA 4E47A 1MHNA 4C8QG 2DD4A 1YJWA 1VQKT 3JB9J 2M16A 3PFSA 4RCCA 4HT9A 5GAN5 1UGPB 2CGHA 1M1KU 5CIUA 3MO8A 3HSBA 3JSCA 5I2MA 4N0AA 2D0QB 4M7AB 4NOYA 4D6WA 5LJ5h 2K3YA 3DLLA 2P0QA 3HRUA 1UGQB 3RIRA 5M9OA 3OYGA 4M7DB 4XU1A 3JAME 1VIFA 3CMAA 1Y96B 4M7DG 4M75B 4EPCA 5I21A 2VYTA 3M56A 3L2ZA 3OMCA 4JLGA 4M75G 3PMIA 4DOVA 2IVWA 4XAXB 2JTFA 2LNVA 2MAMA 2O4XB 2FYKA 4A4HA 4PKCC 5A0DA 3L1AA 3SD4A 3JCMJ 5FLXE 4O6JA 4XTYA 3VU3C 4ZGJB 3M55A 3S3NA 2ZPEB 3F70A 4RKUE 2Y4XA 4Q5WA 4NL3A 2P4TA 3CC2A 4BE0A 2DZ9A 2E64A 4E7JA 4OB2B 1YCYA 3WXMB 3OYHA 1XQHA 1M1GA 4M7DE 2ZCFB 1GXIE 1M5Q1 1VIEA 4EMGA 5KCOA 4M75E 2DPPB 3E9GA 5GAMf 3QUIA 4KULA 4BI3A 2EWNA 2Y90A 3X20B 1PSFA 3CPFA 2RM4A 1G3WA 3OYJA 3HRSA 4FIBA 2RJCA 4M78B 4IURA 2HAXA 2VV5A 3A5ZB 4M78G 3ZEHA 3RKWA 1DJ7B 2M9UA 4RG8A 4J6YA 3MCAB 1ZHIA 1U1TA 1N8RC 2RJEA 3GP8A 3LGFA 3L42A 3OMGA 4BY6C 3GOXA 3LW5E 3GIBA 5CKEA 2EFIA 4PLIA 4F7UF 3M58A 4ATOA 1FXXA 3NTHA 4J6WA 4OP0A 3JB9F 2H3JA 4R55A 2D6FA 4MZMA 1X6OA 4MDXA 2M1HA 4BDYA 1UB4A 2DXCA 4ZGDB 2LT4A 3QXEB 3OW2S 3LX7A 2LVMA 3HHTB 3SDZA 2EJ9A 1N9SA 2CZ7B 3OYKA 3Q1JA 3CCUA 5FU6C 3CMEA 1QW1A 2DXUA 3LYIA 4BD3A 5CKHA 3SFMA 2QQ9A 3JCMV 2HQEA 3BDUA 2L89A 4XK8E 3LWHA 3HP9A 3RESA 3KXTA 4C0FA 3VUBA 3JCMf 1LOJA 4JRIA 3MEWA 2X4XA 2GFAA 3BW1A 3DB4A 3CXCS 3CCRA 2OTJA 5CVIA 2HNIA 3RMQA 2QXFA 3C4SA 5D6YA 5IAYA 2QI2A 5D6WA 3MP8A 4L5GA 4BB7A 2E6ZA 2RO0A 2KSSA 5CKBA 2C06A 3E1SA 1M1FA 1VQNA 2MF2A 3CBOA 4A53A 2LC4A 4CI0C 3RMSA 4DOWA 2EJFA 2E10A 3LH0A 2ZPBB 4C8QD 2EYQA 5GAMg 3CCSA 2GQVA 4BE2A 1VQ8A 1QVFS 2OTJT 2IG0A 1G5VA 1I81A 3M54A 2BIVA 5DLQE 4HA8A 3JCMQ 5DY9A 2QA4T 1UGRB 3OBYA 3JB9H 5J39A 1NE8A 3J80E 3X25B 3OS0A 1QP3A 3BDLA 1JJ2A 1VQNT 4QVCA 3OYMA 3QYHB 1NPPA 3CCMT 3G6ET 5CQYA 2B8AA 1WNLA 2LCCA 3M57A 3CCST 2V8JA 3L2QA 3LLRA 1WQWA 5GANf 2R5MA 4C92A 3OBWA 3QKJA 2JOYA 2V8IA 3MHXA 3QO3A 5FU7C 1WGSA 5CO7A 4PJOF 4BDZA 3OQ5A 1ZBXA 2MWPA 1JBMA 4M77A 1M90C 4JRPA 2GF7A 3CCJA 2DXBA 3OSSC 4XU0A 2KVQG 3G71A 5GANj 4BI8B 4ME7A 1S72A 3V7RA 3OYLA 3X28B 5GAN7 2QQSA 3KUFA 3BY7A 3OS5A 2RD1A 1OZ2A 4C5IA 2FL7A 1OI1A 1XNIA 2JZ2A 4F7UB 3EFSA 5HKCA 3CD6A 2KAFA 3DLMA 1RI0A 4F7UG 2WSFE 1U8RA 3L2WA 3JB9G 3NFCA 4X9DA 1VQ7T 3PTAA 1VQ9T 3QDRB 4E7IA 2EQUA 1U1SA 3C94A 4M78D 3JCMg 3CCJT 1YITT 3G71T 3CPWA 5CAIA 3ZFJA 1S72T 2RI2A 3VUZA 1Q81C 2XU8A 1KC8U 3M9QA 2X4YA 1LNXA 4OB1B 4C92C 4OB3B 4F7UE 2YLBA 5J26A 1WQ7A 3X24B 3CD6T 5FRNA 4J5YA 2KY9A 5LJ3f 2EQJA 1KHIA 4C8QE 5LJ5e 4XTWA 4M77C 1P92A 2EAYA 3HPWA 2K3XA 2RK1A 5CR2A 1EIFA 2FB7A 5KE2A 2XDPA 1G3YA 4VUBA 5GAMh 5GAN2 4R56A 2ZZDA 3H6ZA 1AHJB 4N4GA 2MWOA 4WF2A 4PJOD 3WVDB 5FROA 4HCZA 1K8AU 4NS5A 5LJ3j 3M59A 5CKFA 3S6WA 4HCCA 4M7AA 3V8KA 4LD6A 3RUXA 5GMKm 1Q82C 1BIAA 2RHXA 2LQKA 2DEQA 4JUVA 3FJPA 1VQ5T 1WJQA 4M7DA 1LJOA 5LJ5d 2LCLA 4FM4B 5GMKj 1Y96A 3J7AF 4M75A 3KBGA 2OAUA 2LRQA 2WSCE 3URGA 4EMKB 5GANg 4YTLA 2K57A 2PVGB 3L2VA 3JCMX 3OSVA 1M90U 3V8LA 2CKKA 4Y91A 4ZN1A 3QZ9B 4EDUA 3OYNA 2O01E 4J6XA 5GAMj 4NL2A 1KD1C 3JB9I 4C8QC 1N9RA 4J8OA 3LWIA 1W2BA 1NPRA 4IUPA 5IT9E 2JN0A 2JVVA 3OYAA 1H3ZA 3VJPA 2KDSA 2QQRA 2GFUA 2F69A 4HCBA 2XDBA 4XTZA 1D3BA 3I55T 1NJIC 4V2SA 3CBPA 4M78E 4C0ZA 5CKDA 4M7AC 4ZTJA 5GAN8 4PJOB 4M78A 4B9WA 4PJOG 3HFOA 1M9SA 4J7IA 2XIDA 3QG1A 3JCMh 5GAN6 4N4IA 4XTVA 3WVEB 4M7DC 1Q81U 3M5AA 4M75C 2K5LA 3OYCA 3OA6A 4FSXA 1Y07A 2E70A 4FT2A 1YJ9T 3C12A 3FIFA 2CYZB 5LJ3g 5GMKl 1V29B 2I2LA 4C0DB 5L8RE 5A0LA 4PJOE 4MMKA 2ZPGB 4E7KA 2BUDA 3FB9A 3I56T 4ZTFA 5IN1A 2D9TA 2EJGA 4XU3A 5GAOq 1TH7A 5GMKi 2DVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  2CGH A;  3RKX A;  1WNL A;  3SWN A;  4JLI A;  4HT8 A;  3HSB A;  5GAN f;  1WQW A;  4JRK A;  4N0A A;  3RKY A;  4M7A B;  4NOY A;  4C92 A;  4EMK A;  5LJ5 j;  3JCM P;  5LJ5 h;  1D3B B;  4M7A F;  4N0A C;  3QO3 A;  4PJO F;  4M77 A;  1JBM A;  4M78 C;  4RCB A;  3RIR A;  4XU1 A;  4M7D B;  3JB9 D;  1Y96 B;  4M7D G;  3QHS A;  4M75 B;  4XU0 A;  5I21 A;  4A54 A;  5GAN j;  4PNO A;  4M75 G;  3L2Z A;  3V7R A;  2ZGW A;  3JCM e;  5GAN h;  5GAN 7;  4XQ3 A;  5GAN 5;  3BY7 A;  2FYK A;  2RD1 A;  4F7U B;  3L1A A;  3JCM J;  3EFS A;  4XTY A;  4F7U G;  3VU3 C;  4X9C A;  1B34 A;  3GIB A;  4NL3 A;  4M7A E;  3JB9 G;  3EFR A;  1BIB A;  4X9D A;  1KQ2 A;  4C8Q F;  4PJO A;  2E64 A;  2DZ9 A;  1YCY A;  3SB2 A;  4C92 D;  1I4K 1;  4M7D E;  4M7A A;  1U1S A;  3QSU A;  4M78 D;  3JCM g;  1M5Q 1;  4EMG A;  5CAI A;  4M75 E;  5GAM f;  2RB6 A;  3QUI A;  2DZC A;  2EWN A;  2Y90 A;  4M77 D;  2VC8 A;  3SWN B;  5GAO r;  2E41 A;  3SWN C;  3JCM d;  1LNX A;  4EMK C;  3RER A;  4C92 C;  2RM4 A;  4EMH A;  2YLB A;  4F7U E;  1JRI A;  1WQ7 A;  4M78 B;  4C92 G;  3JCM b;  5GAN 4;  4J5Y A;  5LJ3 f;  4C8Q E;  4M78 G;  3JCM c;  5GAO m;  2DXT A;  4XU2 A;  3RKW A;  5LJ5 e;  1HK9 A;  4XTW A;  4M77 C;  4M7D F;  2EAY A;  4J6Y A;  5GAN 2;  2FB7 A;  1U1T A;  2QTX A;  4M75 F;  5GAM h;  5GAO p;  4WF2 A;  4PJO D;  2YHT A;  4DQ2 A;  5LJ3 j;  4F7U F;  5GAN e;  5LJ3 h;  3V8K A;  3JB9 F;  4J6W A;  4OP0 A;  3RUX A;  3V8J A;  5GMK m;  5LJ5 g;  1B34 B;  2DKG A;  1WPY A;  1BIA A;  2DEQ A;  4JUV A;  3FJP A;  4PJO C;  3JCM W;  3INZ A;  4M7D A;  1MGQ A;  1LJO A;  5LJ5 d;  5GMK j;  1Y96 A;  4M75 A;  4MML A;  5GMK h;  2EJ9 A;  4EMK B;  1N9S A;  1HXD A;  4C92 B;  5GAN g;  2K57 A;  2DXU A;  3JCM X;  4F7U A;  3V8L A;  4Y91 A;  3AHU A;  3JCM V;  5GAO n;  4M78 F;  1KQ1 A;  4M77 B;  4C8Q A;  5GAN d;  4J6X A;  5GAM j;  4NL2 A;  4M77 G;  3BDU A;  3JB9 I;  2RA2 A;  3RES A;  4C8Q C;  3PGG A;  1N9R A;  1X01 A;  2DTO A;  3JCM f;  4M7A D;  1LOJ A;  4JRI A;  2VXF A;  1H64 1;  2JN0 A;  5LJ3 d;  3BW1 A;  2HNI A;  2YLC A;  5GAM e;  4XTZ A;  4M7D D;  4C92 E;  1D3B A;  1M8V A;  2VXE A;  4V2S A;  4M78 E;  4M75 D;  4M7A C;  5GAN 8;  4PJO B;  4M78 A;  3HFN A;  3BFM A;  3V7S A;  4M7A G;  2DJZ A;  5GAO l;  4PJO G;  4M77 E;  3HFO A;  5LJ3 e;  3JCM h;  4A53 A;  5GAN 6;  1I8F A;  4XTV A;  4M7D C;  2EJF A;  2E10 A;  1I5L A;  4C8Q D;  5GAM g;  2E65 A;  4M75 C;  4C92 F;  1I81 A;  4XTU A;  4QVD A;  5GMK e;  4HA8 A;  2DTI A;  3FIF A;  5DY9 A;  3JCM Q;  5GAM d;  3M4G A;  5LJ3 g;  5LJ5 f;  5GMK l;  5GAN 3;  3JB9 H;  4M77 F;  4XTX A;  4C8Q B;  2E1H A;  2I2L A;  4PJO E;  4C8Q G;  4MMK A;  3FB9 A;  4QVC A;  3JB9 J;  2DTH A;  4XU3 A;  2EJG A;  4RCC A;  4HT9 A;  5GAO q;  1TH7 A;  5GMK i;  2DVE A; 
#chains in the Genus database with same CATH topology
 2PVD B;  3AT1 B;  2R58 A;  1Q82 U;  3VKI A;  5I2S A;  1VQP T;  1RL2 A;  4P5N A;  2DM1 A;  1F1B B;  1GL5 A;  1X2K A;  4PNO A;  2CP3 A;  5GAN h;  3S3M A;  3REB B;  1NZ9 A;  1JU5 C;  1VQ5 Q;  1KD1 U;  1BIB A;  2F2X A;  2P0P A;  4EIK A;  4JRQ A;  2E41 A;  2HKQ B;  3MP6 A;  3RER A;  2F5K A;  1QCN A;  4EMH A;  3VV0 A;  2RH2 A;  1PD0 A;  1VQ4 A;  4PJL A;  3JCM c;  4JDS A;  5CK9 A;  4IIM A;  1TUG B;  2K2V A;  1AOJ A;  2CZ1 B;  3L2U A;  2VVK A;  4ZNX A;  2E12 A;  1VQM A;  3E19 A;  3INZ A;  2MK5 A;  3CCL A;  1YJ9 Q;  4L59 A;  2Y4Y A;  2FZC B;  1FYN A;  2A0F B;  1BI2 A;  1HXD A;  1K9M R;  3OW2 A;  3CCQ A;  3TU4 K;  5GAO n;  3A8M B;  1UEC A;  2DL8 A;  1G3T A;  2HSP A;  3H41 A;  2VUB A;  4BY6 B;  3THK A;  1V76 A;  2ESW A;  2JXB A;  4DA4 A;  4C5E A;  1WHL A;  2JUF A;  2KK4 A;  8AT1 B;  3CCV A;  1K73 U;  3HFN A;  5GJW B;  5IXF A;  3OYB A;  2DIG A;  1BI1 A;  1U5S A;  2K79 A;  2EYW A;  1D09 B;  5FU6 B;  2E65 A;  2OJ2 A;  3MPU B;  1BBZ A;  2DEU A;  1CKB A;  2XKO C;  1JJ2 S;  2HZY A;  5GAM d;  2VAS A;  4QQG A;  4M77 F;  4XTX A;  1RAF B;  4QW2 A;  2CP2 A;  2ECZ A;  3OYI A;  1JB0 E;  2DTH A;  3RKX A;  4J7F A;  2HBP A;  5LJ5 j;  2DMO A;  3CC4 T;  4F16 A;  1D3B B;  3P8D A;  3M53 A;  3FC3 A;  2RF0 A;  1Y57 A;  2SRC A;  4R0K A;  2L3S A;  2MCN A;  5HK3 A;  3ER0 A;  1VQ4 Q;  4JJN K;  1PSE A;  3HL8 A;  4MZT A;  3H0F A;  2RMO A;  4C8Q F;  1WFW A;  4LDU A;  3ZBD A;  1W6X A;  1ZA2 B;  1BI3 A;  2KBT A;  3EGX B;  4OGE A;  4UC4 A;  2FPF A;  1B07 A;  1VYV A;  1X2Q A;  3GNF B;  2RN8 A;  2RHZ A;  2VC8 A;  1VQM Q;  2X4J A;  1I0C A;  4EMK C;  3CCL Q;  2NUP A;  1H8K A;  1QKX A;  4FYW B;  5GJV B;  4FU6 A;  3L2R A;  4IUU A;  4PL6 A;  3CCQ Q;  2EGC A;  1OYX A;  1RI9 A;  4KUD K;  1PCX A;  1M1K C;  5GAN e;  4OVA A;  3V8J A;  3CME T;  5LJ5 g;  4GLK A;  1KC8 C;  3EG1 A;  1Q7Y U;  4PJO C;  5KCH A;  5D7U A;  2BKD N;  1YIJ A;  2DAQ A;  1AT1 B;  3CCV Q;  2R57 A;  3TEE A;  1QVP A;  3CCR T;  3RNJ A;  1W2B P;  3OY9 A;  4Z8A A;  3GPL A;  1K8A C;  4ESR A;  5A2Q E;  4C0D C;  2K5F A;  2OTL A;  1Y71 A;  4M7D D;  4C92 E;  1ZQ1 A;  3N5B B;  2LCS A;  3VS3 A;  4KGZ B;  2QQB A;  1VQO A;  1I5L A;  1IGU A;  3M0Q A;  3G1J A;  4ZN3 A;  4QVD A;  3TCJ A;  2CZ0 B;  3FRN A;  4QVZ A;  1PRL C;  4II1 A;  2E1H A;  4E47 A;  2RHY A;  4E6R A;  1MHN A;  1YJW A;  1VQK T;  3RDV A;  2RQT A;  3PFS A;  4PFP A;  4N0A A;  4NOY A;  5KYW A;  1ABO A;  4ANJ A;  2GTJ A;  3JAM E;  1VIF A;  3RBB B;  1Z9Q A;  3CCU Q;  3M56 A;  2JTF A;  2LNV A;  4PJN A;  2HL5 C;  3UF4 A;  3VU3 C;  5KYU A;  3S3N A;  4M7A E;  4NL3 A;  1M2V A;  3WXM B;  3NGP A;  2ZCF B;  4HVV A;  1ABQ A;  2DE0 X;  2D0N A;  1EZZ B;  4M75 E;  3E9G A;  2YWW A;  1ZSZ C;  1D0X A;  3QUI A;  2YXY A;  1PKT A;  5IHI A;  1G3W A;  3HRS A;  2DL3 A;  2GQI A;  2BE7 D;  1YIJ Q;  1VQ8 Q;  2C0T A;  3MCA B;  3GP8 A;  3OMG A;  2EFI A;  4ATO A;  2EGA A;  4J6W A;  1WXU A;  2K2M A;  4J9B A;  4MZM A;  1WHM A;  1UB4 A;  2DXC A;  2LT4 A;  2YUP A;  3SDZ A;  1WLP B;  1QW1 A;  2DXU A;  2CP7 A;  3SFM A;  1VQO Q;  2HQE A;  2HQH A;  2L89 A;  3LWH A;  3HP9 A;  6AT1 B;  3KXT A;  1M2O A;  1LOJ A;  3DB4 A;  5CVI A;  2QXF A;  3C4S A;  3EHR A;  1YJW Q;  2J06 A;  3M0S A;  4OMM A;  2MF2 A;  4LXC A;  4AFU C;  4BE2 A;  4C8Q D;  2EYQ A;  3CCS A;  1QVF S;  1I81 A;  1UGR B;  2O2O A;  3VS4 A;  4AFQ C;  1NE8 A;  3J80 E;  3OS0 A;  1IXD A;  1OU9 A;  4J9H A;  3OYM A;  5FWB A;  1E6G A;  2KRM A;  1ZUY A;  3EHQ A;  3L2Q A;  1WQW A;  2LZ6 B;  1NM7 A;  2JOY A;  4PJO F;  4M77 A;  1QMC A;  2KVQ G;  5GAN j;  4ME7 A;  1OQK A;  2X3W D;  3V7R A;  3X28 B;  3OS5 A;  1XNI A;  1C0M A;  2WSF E;  1B7T A;  3NFC A;  4X9D A;  1U1S A;  3CCJ T;  1KQS P;  3G71 T;  3VS1 A;  2YRD A;  3VUZ A;  1Q81 C;  1KK7 A;  1KC8 U;  2X4Y A;  3CD6 T;  1SSH A;  3X24 B;  5LJ3 f;  4XTW A;  3ZL7 C;  2RK1 A;  2FB7 A;  4N4G A;  3H6Z A;  2KRN A;  3WVD B;  5FRO A;  3EG2 A;  1K8A U;  3M59 A;  2YT6 A;  1YWP A;  3RUX A;  5GMK m;  1TOV A;  1Q82 C;  2LQK A;  4JUV A;  1WJQ A;  2DET A;  2CUD A;  1TU0 B;  1PM3 A;  2LRQ A;  3URG A;  3TSZ A;  5GAN g;  2K57 A;  4RTU A;  2EW3 A;  5IH2 A;  3JCM X;  3OSV A;  1QVG P;  3QZ9 B;  3OYN A;  4NL2 A;  3CCS Q;  2W10 A;  1KD1 C;  3JB9 I;  1K76 A;  1GCQ A;  4F17 A;  1W2B A;  4IUP A;  5IT9 E;  3OYA A;  1H3Z A;  3VJP A;  2GFU A;  1D3B A;  1NJI C;  1NEG A;  4B9W A;  2XID A;  3QG1 A;  1N8R R;  2GBQ A;  4XTV A;  4M7D C;  2COZ A;  3OYC A;  2CP6 A;  4FSX A;  1VQ9 Q;  2CYZ B;  2L2P A;  2I2L A;  5A0L A;  4MMK A;  3FB9 A;  4QT7 A;  4ZTF A;  4XU3 A;  2EJG A;  4J9D A;  3CMA A;  2DX1 A;  3UA6 A;  2BE9 B;  2EYZ A;  4JRK A;  2MI6 A;  4LDW A;  1YBY A;  2LT1 A;  1RLP C;  4JS5 A;  2NUT B;  4OMP A;  2FRW A;  4A63 B;  3VS2 A;  4M7A F;  1BU1 A;  4KH1 B;  1ZSG A;  4LDX A;  3G6E A;  3CCE A;  3QII A;  4A54 A;  3FDR A;  2E4H A;  4XQ3 A;  2OAW A;  3O5Z A;  4C0G A;  2KE9 A;  2E5K A;  4L6V 5;  5C6S A;  1YJN T;  4BE1 A;  1K73 C;  2QYZ A;  1Y7X A;  2E3H A;  2JNG A;  1ZUU A;  1OPK A;  2RB6 A;  1AWJ A;  2KXC A;  3JCM b;  1NLO C;  1YIT A;  1YHQ A;  4GBQ A;  3TVT A;  2EVR A;  1AD5 A;  1PC0 A;  3ASK A;  2YHT A;  4Z02 A;  5DM7 R;  4DQ2 A;  3MEA A;  3PVQ A;  1YNZ A;  5LJ3 h;  3VS7 A;  1WPY A;  3FLG A;  3S3O A;  1MGQ A;  1TUD A;  2YRV A;  4RTX A;  2DD5 A;  1KQS S;  2OTL T;  3GLX A;  4PLL A;  1RAE B;  5KYW B;  3A8G B;  1KQ1 A;  1VQ5 A;  2DBK A;  4N4H A;  1X01 A;  2DTO A;  3VS5 A;  1Q86 U;  1VQO T;  3M0R A;  2MMP A;  4J83 A;  1SPK A;  4FT4 A;  2EIF A;  4A4G A;  2VXE A;  1QKW A;  1UHF A;  1M2V B;  1UFF A;  4B6M A;  3CMA Q;  2CUB A;  2JTM A;  1MUZ A;  4A4E A;  1YJW T;  3CEY A;  2P0K A;  1RAC B;  3VYG A;  1JJ2 P;  2RHU A;  2Z0W A;  3LGL A;  3CCE Q;  4WTO B;  1K4U S;  2DYB A;  1QVG S;  4CC4 B;  1D1A A;  2F5T X;  2M0O A;  4E7H A;  1XTD A;  2C0I A;  1Q7Y C;  4KBM B;  1YJ9 A;  2A7Y A;  2V1R A;  1TG0 A;  4EMK A;  2FVU A;  2YDL A;  2G3R A;  3I56 A;  2QTV A;  1VUB A;  2CP0 A;  3D7S B;  1H3H A;  3HTR A;  5DLO A;  1K0S A;  3JRZ A;  2ZGW A;  2CZ6 B;  3GF5 A;  3EGD A;  2DVJ A;  4J9E A;  1YIT Q;  1YHQ Q;  4LDV A;  4JS4 A;  1CKA A;  4PJO A;  2EKO A;  3PVL A;  1IGQ A;  2JT4 A;  3CPW S;  3TSW A;  3SB2 A;  4C92 D;  1I4K 1;  1O75 A;  3M0U A;  3QSU A;  4BUG A;  1YI2 Q;  3EFO A;  4J9I A;  3EGU A;  1OV3 A;  4B9X A;  3JCM d;  5FU7 B;  9ATC B;  4A4F A;  1KQS A;  1W70 A;  5GAO m;  3QYG B;  3OB9 A;  4M7D F;  3QPH A;  1IZ6 A;  3P8H A;  4QKU A;  3CXC P;  4Z88 A;  4OMO A;  3H0H A;  2RI3 A;  2JS0 A;  1WYX A;  2QEX T;  4HCK A;  1O9S A;  4CRI A;  3QJY A;  1WXT A;  1SSF A;  3G4S A;  1IRE B;  1NJI U;  5HY6 A;  4OB0 B;  4KUI A;  4X34 A;  1G83 A;  8ATC B;  1X69 A;  3QJ6 A;  2QQA A;  2VGM A;  1M1K R;  3HRT A;  4M77 B;  1SEM A;  2D8H A;  3UPU A;  1VQL A;  4M77 G;  3A1P A;  4FSS A;  1UDL A;  4M7A D;  1QVG A;  2VXF A;  3J81 E;  1MMN A;  3UWN A;  2LQ8 A;  3CC7 A;  2RHI A;  1VYU A;  3CC2 Q;  2XHC A;  1M8V A;  2L3Q A;  4M75 D;  2KEA A;  4A4K A;  1VQ6 T;  1HJD A;  5LJ3 e;  1T3L A;  3EH2 A;  5D6X A;  2QAS A;  2ABL A;  4RMO A;  2PNI A;  3A98 A;  1HYO A;  4BI4 A;  4RUG A;  3UT1 A;  1M3C A;  4RTW A;  3I56 Q;  2O9S A;  3LH5 A;  4BAC A;  2XDB A;  2XDD A;  3MJX A;  4C8Q B;  2DL7 A;  2W0Z A;  4C8Q G;  1X43 A;  2M16 A;  4PFZ A;  4HT9 A;  4AMC A;  5GAN 5;  2CGH A;  3MO8 A;  1K1Z A;  2D0Q B;  1W1F A;  2K3Y A;  3DLL A;  2EPD A;  2P0Q A;  4XU1 A;  4EPC A;  1D1B A;  4AG2 C;  5KE2 A;  3L2Z A;  1X6B A;  3PMI A;  5A0D A;  2O4X B;  2MAM A;  1Q95 G;  1SRL A;  3JCM J;  2A37 A;  5FLX E;  4XTY A;  4ZGJ B;  3M55 A;  4RKU E;  2Y4X A;  1G2B A;  4Q5W A;  1GBQ A;  2DZ9 A;  2E64 A;  4E7J A;  1YCY A;  2FZG B;  4EMG A;  2JTE A;  5GAM f;  4BI3 A;  1MV3 A;  2EWN A;  1I07 A;  4RTY A;  3C0C A;  3EG3 A;  3G4S Q;  3M0P A;  3ZEH A;  3RKW A;  1D0Y A;  4OMQ A;  1ZHI A;  1U1T A;  2MIO A;  3E2U A;  4JPB W;  2FPD A;  3L42 A;  2ROT A;  5CKE A;  4PLI A;  4F7U F;  1VQL Q;  3NTH A;  4OP0 A;  2H3J A;  4FYV B;  2D6F A;  1X6O A;  4MDX A;  2DLP A;  2JS2 A;  3CC7 Q;  4BDY A;  1SF9 A;  3H9N A;  2CZ7 B;  3CCU A;  4JJC A;  1Z9Z A;  3LYI A;  1OUL A;  5CKH A;  2QQ9 A;  3JCM V;  3BDU A;  2AKL A;  3R6N A;  1WHG A;  3VUB A;  4CC3 A;  3PE0 A;  2GFA A;  3CXC S;  5IAY A;  5D6W A;  2NUT A;  4L5G A;  4BB7 A;  1CSK A;  2E6Z A;  2KNB B;  2YUO A;  2C06 A;  3E1S A;  1M1F A;  2OI3 A;  1VQN A;  3CBO A;  1QVF P;  4A53 A;  2LC4 A;  3RMS A;  4DOW A;  3LH0 A;  2ZPB B;  1VQ8 A;  2KR3 A;  2CH4 W;  2GQV A;  1UUE A;  1XJW B;  2OTJ T;  4FYY B;  2ROL A;  2B86 A;  5DLQ E;  4HA8 A;  1TUC A;  1KSW A;  1JJ2 A;  4DBF A;  1YP5 A;  3EG9 B;  1OU8 A;  1PHT A;  2X9H A;  1EX4 A;  3QYH B;  3G6E T;  5CQY A;  3M57 A;  2V8J A;  3LLR A;  1ARK A;  2R5M A;  2H8H A;  3QKJ A;  1FMK A;  3MHX A;  1ZBX A;  2FG0 A;  1JBM A;  2FPE A;  1RAI B;  4JRP A;  3GBQ A;  2GF7 A;  3OSS C;  2IPO B;  4BI8 B;  3OYL A;  1U3O A;  1OZ2 A;  2FL7 A;  1OI1 A;  5HKC A;  2JZ2 A;  2O88 A;  3H0I A;  1RI0 A;  2DL4 A;  1U8R A;  4LUE A;  2MPX C;  3C94 A;  1YIT T;  3ZFJ A;  1S72 T;  1TSF A;  3M9Q A;  4OB1 B;  1RAG B;  4C92 C;  2K7A A;  2YLB A;  1VA7 A;  1WQ7 A;  4IIO A;  1BCM A;  4J9F A;  1AWO A;  2EAY A;  2K3X A;  4VUB A;  5GAM h;  1AHJ B;  2MWO A;  4JZ4 A;  3REA B;  1WHJ A;  2KT8 A;  2BZ8 A;  5LJ3 j;  1Q81 R;  3V8K A;  4PJJ A;  2DEQ A;  1VQ5 T;  4M7D A;  1YWO A;  5LJ5 d;  4FM4 B;  2LJ0 A;  2V1Q A;  2QA4 Q;  4EMK B;  4Y92 A;  1VQN Q;  1YCS B;  1M90 U;  2AKK A;  1JO8 A;  4EDU A;  2AK5 A;  2O01 E;  4J6X A;  1AZE A;  1Q82 R;  1SG5 A;  2M02 A;  4F14 A;  1AWX A;  3EGD B;  2QQR A;  1RAB B;  4V2S A;  5KYX B;  3CBP A;  4M78 E;  5CKD A;  4M7A C;  1ZA1 B;  4PJO B;  1PKS A;  4PJO G;  2DER A;  4J7I A;  1KD1 R;  2LNH B;  3WVE B;  2DL5 A;  3EFO B;  3NMZ C;  3M5A A;  4M75 C;  2K5L A;  1VQ7 Q;  1SHG A;  4FT2 A;  1YJ9 T;  4GLM A;  5LJ3 g;  5GMK l;  2FEI A;  4C0D B;  3I56 T;  5IN1 A;  2D9T A;  2F2V A;  3V7C A;  2COW A;  3PT9 A;  2DRK A;  2PU9 B;  1UTI A;  2E5Q A;  4M78 C;  4RCB A;  3CCM A;  4DEY A;  1M3B A;  2ED0 A;  1Q86 C;  2RQR A;  2PVO B;  4C5H A;  1W4S A;  4AT1 B;  1KQ2 A;  5KE3 A;  2EYY A;  1B3Q A;  2WAC A;  5GAO r;  3UDC A;  3SWN C;  3X26 B;  3VS6 A;  1JRI A;  4C92 G;  1X6G A;  1VQ9 A;  4PJM A;  4ELZ C;  4MDW A;  2L3R A;  1OPL A;  1K73 R;  5KH6 A;  3QZ5 B;  5HK0 A;  3OYE A;  4FW1 A;  3OYF A;  3G4S T;  2D8J A;  3R6O A;  1VQ4 T;  3PMT A;  2K4Y A;  1MMG A;  1VQL T;  1ZSZ B;  3NTI A;  5GMK h;  2JJ9 A;  1OX9 A;  1WJR A;  4IUQ A;  3CC7 T;  4F7U A;  4C8Q A;  3EAE A;  1VQM T;  4LNP A;  4AFS C;  4Y28 E;  3CCL T;  2EQM A;  2AHJ B;  1NEB A;  2F2W A;  5LJ3 d;  1UJY A;  1MV0 B;  1K9A A;  2K5I A;  2PUK B;  5GAM e;  5IHN A;  2P4R A;  3CCQ T;  4OMF B;  4RTT A;  1NG2 A;  2PTK A;  1VYT A;  2ZPH B;  1R8O B;  1M30 A;  3O8V A;  2DJZ A;  5EC7 A;  3V7S A;  1ZLM A;  4M7A G;  4LN2 A;  1I8F A;  4OF1 A;  3MKD A;  3NTK A;  2O4X A;  2M0Y A;  2RJD A;  4C92 F;  1QVF A;  3CCM Q;  3CCV T;  2V26 A;  5J3B A;  1K9M U;  2K6D A;  4HVW A;  3DKM A;  3JV3 A;  2RK2 A;  3RKY A;  1BI0 A;  5HCK A;  1OEB A;  3TRE A;  2LDM A;  4N0A C;  1QQJ A;  2EQK A;  2XI9 A;  3I5R A;  3OS2 A;  3ME9 A;  1PRM C;  1MMD A;  1Q7Y R;  1X75 C;  1WXB A;  3PIP A;  3CPW P;  1BKB A;  3EFR A;  1XOV A;  1IHW A;  1R77 A;  2L8D A;  2PUO B;  4E7L A;  2XMF A;  2X35 A;  3SWN B;  2L5Q A;  1MMA A;  2GCX A;  3EH1 A;  2FHD A;  3T9N A;  1GFD A;  5CQX A;  2RJF A;  1GFC A;  2J7I A;  1BYM A;  2JMC A;  2QTX A;  4M75 F;  2LX9 A;  5GAO p;  2NUZ A;  2XIC A;  2DO3 A;  3CCU T;  2KYM A;  4PK4 A;  1RAH B;  1B34 B;  4WCI A;  3OS1 A;  1WX6 A;  1KG1 A;  2FO0 A;  3QWY A;  2IIM A;  3RR6 A;  4TVR A;  4M78 F;  1ACM B;  5GAN d;  4X1V A;  3EG9 A;  4HKE A;  2RA2 A;  3CC4 Q;  2LMJ A;  1YIJ T;  1YI2 A;  1VQ8 T;  2KYB A;  1WJS A;  2OX7 A;  2YSQ A;  1VQK A;  5GAO l;  4M77 E;  3P8B B;  4OGC A;  2XD0 A;  5GMK e;  1FWZ A;  2DTI A;  2CSI A;  1M3A A;  3M4G A;  4QQ6 A;  1WDX A;  5EG2 A;  3MEV A;  2DD4 A;  2HEQ A;  3JB9 J;  4DBQ A;  5CIU A;  2AZS A;  3HSB A;  3JSC A;  5I2M A;  4D6W A;  4D8D A;  4E7S A;  1UGQ B;  3RIR A;  5M9O A;  4M7D B;  2RPN A;  4M7D G;  4E7Z A;  3U23 A;  4JLG A;  3CME Q;  2IVW A;  3KFV A;  2GTO A;  4XAX B;  2FYK A;  2X51 A;  4PKC C;  3L1A A;  3I5S A;  3SD4 A;  3CC2 A;  3VRZ A;  2L3P A;  4OB2 B;  2FRY A;  3OYH A;  1XQH A;  3CCR Q;  1GXI E;  1M5Q 1;  1VIE A;  5KCO A;  2Y90 A;  3X20 B;  2J6K A;  1SRM A;  5I11 A;  3CPF A;  1WHH A;  2RM4 A;  3OYJ A;  4FYX B;  4FIB A;  2PZ1 A;  2M9U A;  4RG8 A;  2KRO A;  1N8R C;  4RTZ A;  2K9G A;  4BY6 C;  3GOX A;  3LW5 E;  5KYX A;  2KT1 A;  3JB9 F;  3M0T A;  4R55 A;  3VS0 A;  2M1H A;  2RQW A;  2SEM A;  1BK2 A;  3QXE B;  3OW2 S;  3LX7 A;  1N9S A;  3OYK A;  1VQK Q;  4Z89 A;  5FU6 C;  3CQT A;  2DRM A;  1SHF A;  2LQN A;  3JCM f;  4JRI A;  3MEW A;  1M8M A;  3RMQ A;  2KI7 A;  3MP8 A;  2RO0 A;  4DBR A;  2KSS A;  5CKB A;  2DIL A;  4AG1 C;  2E10 A;  5GAM g;  2IG0 A;  3M54 A;  2BIV A;  2EYX A;  1BB9 A;  3OBY A;  1KC8 R;  3BDL A;  1YFN A;  2HMA A;  3CCM T;  2B8A A;  1WNL A;  3CCS T;  7AT1 B;  4C92 A;  2V8I A;  1WGS A;  5CO7 A;  4BDZ A;  1K8A R;  3OQ5 A;  1M90 C;  3CCJ A;  2DXB A;  4XU0 A;  3G71 A;  1HD3 A;  5GAN 7;  2A28 A;  2LJ3 A;  1IB8 A;  2RD1 A;  4C5I A;  4F7U B;  3EFS A;  3CD6 A;  2KAF A;  3DLM A;  2HL3 A;  4F7U G;  3L2W A;  5KYY B;  3PTA A;  1X27 A;  1R0B G;  1VQ9 T;  3QDR B;  2YUQ A;  4E7I A;  2EQU A;  2JW4 A;  1ZSZ A;  4M78 D;  3NHN A;  1BCO A;  3CPW A;  2LJ1 A;  3NPF A;  1LNX A;  4J9C A;  2EGE A;  2A36 A;  1UHC A;  4J5Y A;  2KY9 A;  1KHI A;  5IXB A;  4KRT A;  1P92 A;  2ZAE A;  4R56 A;  2I0N A;  2ENM A;  1GBR A;  2ZZD A;  2RQU A;  2H3E B;  4LUD A;  1KIK A;  3S6W A;  4HCC A;  4M7A A;  4LD6 A;  1C1A A;  1WHK A;  2LX7 A;  1LJO A;  1RLQ C;  2LCL A;  5GMK j;  1Y96 A;  4M75 A;  3KBG A;  2OAU A;  4LE9 A;  3V8L A;  4Y91 A;  1D0Z A;  2KGT A;  2EKH A;  1N9R A;  3LWI A;  1TTH B;  2QAZ A;  4HCB A;  2F69 A;  1IO6 A;  4XTZ A;  1E7O A;  4C0Z A;  4M78 A;  3HFO A;  2QGF B;  2EBP A;  3JCM h;  5GAN 6;  4N4I A;  2CDT A;  1A0N B;  1QLY A;  1Y07 A;  3C12 A;  1TS9 A;  3FIF A;  3VRY A;  3CCJ Q;  3EG0 A;  3G71 Q;  2JMA A;  2HSE B;  4PJO E;  5L8R E;  1AEY A;  2BUD A;  1LPL A;  3CD6 Q;  5GAO q;  4O5V A;  1TH7 A;  4FCY A;  1T0H A;  3MEU A;  3SWN A;  4JLI A;  2QA4 A;  3JCM P;  3HKS A;  1G8X A;  4KGX B;  1YJN A;  4CC7 A;  3I35 A;  3JB9 D;  4ORZ A;  2RQV A;  3QHS A;  3M4Y A;  4F04 B;  1NBE B;  3CMA T;  4LDY A;  2V8K A;  1KFZ A;  1D1C A;  1N8R U;  4X9C A;  1B34 A;  1JQQ A;  5FRM A;  4RG2 A;  3A8H B;  2CT3 A;  1AVZ C;  4ZGE B;  2RNA A;  1N27 A;  1LCK A;  3CCE T;  1OZ3 A;  2CT4 A;  5CCA A;  1VQ7 A;  1Q86 R;  5GAN 4;  1G3S A;  4GY5 A;  2DFU A;  2DXT A;  2QDY B;  3BE3 A;  2P84 A;  3QDF A;  1M4Z A;  4RTV A;  1K9M C;  2XK0 A;  1ZX6 A;  2DF6 A;  2A3L A;  4LD9 K;  2HDA A;  2YUN A;  4JJB A;  1WIE A;  2BTT A;  2DKG A;  1RUW A;  3JCM W;  1YHQ T;  3TQ7 P;  4MML A;  1N5Z A;  2VWF A;  1C6V X;  5I22 A;  3CBM A;  1YI2 T;  3AHU A;  2M51 A;  2G6F X;  2JM8 A;  2E6N A;  1VOM A;  2HBW A;  3MET A;  1H64 1;  2R5A A;  1I5O B;  2FZK B;  2MYS A;  2CSQ A;  4HXJ A;  3CXC A;  3A8L B;  3BFM A;  4IUT A;  1EFN A;  1FX7 A;  2HD0 A;  5C0M A;  1FMV A;  4QQD A;  1YJN Q;  3I55 A;  2EQI A;  4FW2 A;  5LJ5 f;  3PNW C;  2C0O A;  3ULR B;  2X4W A;  4HT8 A;  1QCO A;  2D1X A;  1IRX A;  2DNU A;  2KMT A;  4DEX A;  3CC2 T;  2NLU A;  4FL6 A;  3E9F A;  4ELY C;  3H8Z A;  2VGN A;  3JCM e;  2DK3 A;  2COY A;  1NJI R;  1VQP A;  4MZP A;  2PQW A;  3DB3 A;  2AT1 B;  1UEB A;  1RAA B;  2OTL Q;  2ZPI B;  1V1C A;  4DBH A;  2J05 A;  3OYY A;  4IKF A;  2DZC A;  4M77 D;  1KHC A;  3I9Q A;  2QEX A;  2HCK A;  4XU2 A;  2HQX A;  1HK9 A;  2YRC A;  1WA7 A;  1UJ0 A;  1WZO A;  2O9V A;  1IHV A;  2LP5 A;  3VYH B;  2K3B A;  1JEG A;  2DIQ A;  3PIO A;  3QBY A;  2RI5 A;  1QWF A;  3C95 A;  1FMW A;  2WSE E;  1UG1 A;  5AYF A;  5LL6 S;  4C92 B;  2L0A A;  2VB6 A;  1UGS B;  3MP1 A;  2KQW A;  2E3I A;  1VQ6 A;  2CRE A;  1QP2 A;  4K11 A;  4HVU A;  1W2B S;  2QGG A;  2XG8 D;  3I55 Q;  3IQL A;  3PGG A;  2CH4 A;  1TXQ A;  3GNG A;  2YLC A;  1SKU B;  4J9G A;  3A8O B;  1QWE A;  4KT0 E;  2CS7 A;  2GGR A;  1KJW A;  4KGV B;  2NWM A;  2ZPF B;  2BZY A;  4XTU A;  1PG5 B;  3G7Z A;  4C5G A;  5A0G A;  4IUV A;  3FEO A;  1NYG A;  2LTO A;  5KYY A;  1N6A A;  1MND A;  5GAN 3;  2AIR B;  2CP5 A;  4CC2 A;  1QCF A;  4M4Z A;  4RCC A;  1VQP Q;  5FW9 A;  1UGP B;  1M1K U;  4M7A B;  5LJ5 h;  3HRU A;  3OYG A;  1HSQ A;  2DA9 A;  1E6H A;  1Y96 B;  4M75 B;  2QEX Q;  2NYS A;  2X3X D;  1T3S A;  2BZX A;  2VYT A;  5I21 A;  3OMC A;  1OX8 A;  4M75 G;  4DOV A;  3OYD A;  3CC4 A;  4A4H A;  4O6J A;  1GCP A;  4D8K A;  3GIB A;  2ZPE B;  3F70 A;  2P4T A;  4BE0 A;  2KXD A;  1M1G A;  5AT1 B;  4M7D E;  1U06 A;  2DPP B;  4KUL A;  5IHK A;  4KH0 B;  1PSF A;  4M78 B;  2RJC A;  1GRI A;  4IUR A;  2VV5 A;  2HAX A;  3A5Z B;  4PFO A;  4M78 G;  1LVK A;  1DJ7 B;  4J6Y A;  2RJE A;  3LGF A;  1VQ6 Q;  2DYI A;  3M58 A;  1Y0M A;  1FXX A;  5FWC A;  1AZG B;  3OW2 P;  1NLP C;  2QDL A;  2O31 A;  4ZGD B;  2LVM A;  3HHT B;  2EJ9 A;  3Q1J A;  1MNE A;  3CME A;  4BD3 A;  2NUP B;  4XK8 E;  1R0C B;  3RES A;  4C0F A;  3EGX A;  2X4X A;  3BW1 A;  2OTJ A;  3CCR A;  2HNI A;  5D6Y A;  2QI2 A;  1PNJ A;  5ECA A;  1PD1 A;  4CI0 C;  3SHW A;  2EJF A;  1WI7 A;  1RAD B;  4E2F B;  1G5V A;  2VKN A;  3JCM Q;  5DY9 A;  2J6F A;  2QA4 T;  1K0X A;  3JB9 H;  5J39 A;  3X25 B;  1PWT A;  1QP3 A;  1VQN T;  4AFZ C;  4QVC A;  1NPP A;  2A08 A;  1AWW A;  2LCC A;  4JZ3 A;  5GAN f;  3OBW A;  2JM9 A;  2QK0 A;  3QO3 A;  5FU7 C;  2MWP A;  1J3T A;  5KYN A;  3QWX X;  1S72 A;  2LQW A;  2QQS A;  3KUF A;  3BY7 A;  3JB9 G;  1VQ7 T;  1T0J A;  2QG9 B;  1M90 R;  1JXM A;  3JCM g;  3UA7 A;  5CAI A;  2GNC A;  2RI2 A;  2XU8 A;  1S1N A;  1I1J A;  2ED1 A;  4OB3 B;  4F7U E;  5J26 A;  2DJQ A;  5FRN A;  2EQJ A;  4C8Q E;  5LJ5 e;  1YN8 A;  4M77 C;  3HPW A;  1UE9 A;  5CR2 A;  1EIF A;  5GAN 2;  2XDP A;  1G3Y A;  4OMN A;  4WF2 A;  4PJO D;  4HCZ A;  4NS5 A;  5CKF A;  1ZUK A;  2MOX A;  5KYU B;  1BIA A;  2RHX A;  2OTJ Q;  3FJP A;  4JJD A;  3J7A F;  2F1L A;  2KRS A;  2WSC E;  4YTL A;  1JXO A;  2PVG B;  3L2V A;  2CKK A;  1ZBJ A;  4ZN1 A;  2HKN A;  3G6E Q;  3FJ5 A;  5GAM j;  2ATC B;  4C8Q C;  4J8O A;  1NPR A;  2J6O A;  2JN0 A;  2JVV A;  2KDS A;  1NYF A;  3I55 T;  2DBM A;  4ZTJ A;  5GAN 8;  3UAT A;  1H92 A;  1M9S A;  2AZV A;  5L23 A;  1Q81 U;  3OA6 A;  2E70 A;  1M27 C;  1OOT A;  1UGV A;  1S72 Q;  3SEM A;  1V29 B;  4OML A;  1TWB A;  2ZPG B;  4E7K A;  1GCQ C;  5GMK i;  2DVE A; 
#chains in the Genus database with same CATH homology
 3V7C A;  2PVD B;  3MEU A;  3SWN A;  4JLI A;  2R58 A;  4JRK A;  2MI6 A;  3PT9 A;  1YBY A;  4LDW A;  2LT1 A;  2QA4 A;  3JCM P;  1Q82 U;  4JS5 A;  3VKI A;  3HKS A;  2PU9 B;  4M7A F;  1YJN A;  5I2S A;  1VQP T;  1RL2 A;  2E5Q A;  4P5N A;  4LDX A;  4M78 C;  4RCB A;  3CCM A;  3G6E A;  3JB9 D;  3CCE A;  3QII A;  3QHS A;  3M4Y A;  4A54 A;  4PNO A;  3CMA T;  5GAN h;  3FDR A;  4LDY A;  3S3M A;  4XQ3 A;  1NZ9 A;  2V8K A;  1Q86 C;  4C0G A;  2PVO B;  4C5H A;  1N8R U;  1W4S A;  4X9C A;  1B34 A;  1KD1 U;  5C6S A;  4L6V 5;  5FRM A;  4RG2 A;  1BIB A;  1YJN T;  2P0P A;  1KQ2 A;  3A8H B;  5KE3 A;  4BE1 A;  1K73 C;  4ZGE B;  1Y7X A;  1N27 A;  3CCE T;  2JNG A;  2WAC A;  1OZ3 A;  2RB6 A;  5GAO r;  4JRQ A;  2E41 A;  3UDC A;  3SWN C;  5CCA A;  3X26 B;  3MP6 A;  3RER A;  2F5K A;  4EMH A;  1VQ7 A;  3VV0 A;  5GAN 4;  1G3S A;  1JRI A;  2RH2 A;  4C92 G;  4GY5 A;  3JCM b;  1VQ4 A;  1VQ9 A;  3JCM c;  2DXT A;  1YIT A;  4ELZ C;  1YHQ A;  2QDY B;  4JDS A;  5CK9 A;  4MDW A;  2L3R A;  5KH6 A;  1M4Z A;  3QZ5 B;  2K2V A;  5HK0 A;  3OYE A;  1K9M C;  2XK0 A;  3OYF A;  3ASK A;  3G4S T;  2YHT A;  2CZ1 B;  4Z02 A;  3L2U A;  2A3L A;  5DM7 R;  4DQ2 A;  3MEA A;  4LD9 K;  5LJ3 h;  3R6O A;  1VQ4 T;  2E12 A;  3PMT A;  2DKG A;  1VQM A;  1WPY A;  2K4Y A;  3FLG A;  3E19 A;  3JCM W;  3INZ A;  1YHQ T;  3S3O A;  3CCL A;  1MGQ A;  1VQL T;  3NTI A;  4MML A;  4L59 A;  2Y4Y A;  2YRV A;  2DD5 A;  5GMK h;  1KQS S;  2OTL T;  1BI2 A;  3GLX A;  1HXD A;  1WJR A;  4PLL A;  3A8G B;  3OW2 A;  4IUQ A;  3CCQ A;  4F7U A;  3CC7 T;  3CBM A;  3TU4 K;  1YI2 T;  3AHU A;  5GAO n;  3A8M B;  1KQ1 A;  3EAE A;  4C8Q A;  1VQ5 A;  1VQM T;  1G3T A;  2E6N A;  4N4H A;  4Y28 E;  3CCL T;  1X01 A;  2DTO A;  2VUB A;  2EQM A;  3MET A;  4BY6 B;  2AHJ B;  1H64 1;  1Q86 U;  5LJ3 d;  2R5A A;  1VQO T;  2K5I A;  2MMP A;  2PUK B;  4J83 A;  4FT4 A;  5GAM e;  2EIF A;  4A4G A;  3CXC A;  2VXE A;  3CCQ T;  4OMF B;  4DA4 A;  3A8L B;  4C5E A;  2JUF A;  2KK4 A;  3CCV A;  1K73 U;  2ZPH B;  1R8O B;  3BFM A;  3HFN A;  2DJZ A;  3O8V A;  4IUT A;  3V7S A;  4M7A G;  1FX7 A;  2JTM A;  2HD0 A;  3OYB A;  2DIG A;  1I8F A;  1BI1 A;  4OF1 A;  4A4E A;  5C0M A;  1YJW T;  3NTK A;  5FU6 B;  2E65 A;  2O4X A;  3CEY A;  2P0K A;  4QQD A;  3VYG A;  3I55 A;  2RJD A;  4C92 F;  2RHU A;  2XKO C;  1QVF A;  3LGL A;  1JJ2 S;  5GAM d;  5LJ5 f;  1QVG S;  4QQG A;  4M77 F;  4XTX A;  3CCV T;  4QW2 A;  3OYI A;  2F5T X;  3PNW C;  5J3B A;  1JB0 E;  1K9M U;  2M0O A;  2DTH A;  4E7H A;  1XTD A;  1Q7Y C;  3DKM A;  2X4W A;  3RKX A;  4KBM B;  1YJ9 A;  4HT8 A;  2A7Y A;  4J7F A;  2HBP A;  2RK2 A;  3RKY A;  4EMK A;  5LJ5 j;  3CC4 T;  2FVU A;  1BI0 A;  1D3B B;  2KMT A;  3M53 A;  3P8D A;  3TRE A;  2LDM A;  4N0A C;  2G3R A;  3I56 A;  3FC3 A;  1VUB A;  2EQK A;  3CC2 T;  2NLU A;  2XI9 A;  4FL6 A;  3OS2 A;  3E9F A;  3ME9 A;  4ELY C;  5DLO A;  5HK3 A;  3H8Z A;  3JRZ A;  2ZGW A;  2CZ6 B;  2VGN A;  3ER0 A;  2DK3 A;  3GF5 A;  3JCM e;  4JJN K;  1X75 C;  1PSE A;  1VQP A;  3HL8 A;  4LDV A;  4MZT A;  4MZP A;  2PQW A;  4JS4 A;  3DB3 A;  3PIP A;  3OYD A;  3CC4 A;  1BKB A;  1UEB A;  1XOV A;  3EFR A;  4C8Q F;  2EKO A;  4PJO A;  2ZPI B;  4LDU A;  2L8D A;  3CPW S;  2PUO B;  3SB2 A;  4C92 D;  1I4K 1;  1O75 A;  3ZBD A;  4E7L A;  1BI3 A;  4OGE A;  3QSU A;  4UC4 A;  3OYY A;  4BUG A;  2X35 A;  4IKF A;  3GNF B;  2DZC A;  4M77 D;  2RHZ A;  2VC8 A;  1KHC A;  3SWN B;  2X4J A;  2L5Q A;  4B9X A;  3JCM d;  4O5V A;  5FU7 B;  2GCX A;  4EMK C;  2QEX A;  2FHD A;  3T9N A;  4A4F A;  1KQS A;  5CQX A;  5GAO m;  2RJF A;  3QYG B;  4XU2 A;  3OB9 A;  2HQX A;  1BYM A;  1HK9 A;  4M7D F;  3L2R A;  4FU6 A;  3QPH A;  4IUU A;  2QTX A;  1IZ6 A;  2LX9 A;  4M75 F;  4PL6 A;  3P8H A;  5GAO p;  1OYX A;  3VYH B;  2XIC A;  2RI3 A;  4KUD K;  2DO3 A;  2QEX T;  1M1K C;  5GAN e;  3CCU T;  4OVA A;  3V8J A;  3CME T;  2DIQ A;  5LJ5 g;  1O9S A;  1B34 B;  2RI5 A;  3QBY A;  4GLK A;  4CRI A;  3PIO A;  3OS1 A;  3C95 A;  1KC8 C;  1Q7Y U;  4PJO C;  5KCH A;  3QJY A;  2WSE E;  1SSF A;  3G4S A;  1IRE B;  2BKD N;  5HY6 A;  1YIJ A;  1NJI U;  2DAQ A;  1KG1 A;  4OB0 B;  4KUI A;  2R57 A;  4X34 A;  5AYF A;  5LL6 S;  3TEE A;  4C92 B;  4M7A E;  1QVP A;  3CCR T;  1UGS B;  3MP1 A;  2KQW A;  3QJ6 A;  4TVR A;  2QQA A;  2VGM A;  4M78 F;  3OY9 A;  3HRT A;  4M77 B;  1VQ6 A;  5GAN d;  3GPL A;  1QP2 A;  1K8A C;  3UPU A;  1W2B S;  4M77 G;  1VQL A;  4HKE A;  2XG8 D;  2RA2 A;  5A2Q E;  3PGG A;  2K5F A;  4C0D C;  2OTL A;  4M7A D;  1QVG A;  2VXF A;  1YIJ T;  3J81 E;  3UWN A;  2LQ8 A;  3GNG A;  3CC7 A;  2RHI A;  2YLC A;  1YI2 A;  1VQ8 T;  1Y71 A;  2XHC A;  4M7D D;  4C92 E;  1M8V A;  1ZQ1 A;  3N5B B;  1WJS A;  3A8O B;  4M75 D;  4A4K A;  1VQ6 T;  2QQB A;  2CS7 A;  4KT0 E;  5GAO l;  1VQK A;  4M77 E;  5LJ3 e;  3P8B B;  5D6X A;  4OGC A;  1VQO A;  2XD0 A;  4RMO A;  1I5L A;  4BI4 A;  2ZPF B;  3UT1 A;  4XTU A;  4ZN3 A;  4QVD A;  3TCJ A;  5GMK e;  1FWZ A;  2CZ0 B;  3FRN A;  2DTI A;  4BAC A;  3G7Z A;  4C5G A;  4QVZ A;  4IUV A;  3FEO A;  2LTO A;  3M4G A;  5A0G A;  1N6A A;  5GAN 3;  4II1 A;  4C8Q B;  4QQ6 A;  2XDD A;  2E1H A;  5EG2 A;  3MEV A;  2RHY A;  4E47 A;  1MHN A;  4C8Q G;  2DD4 A;  1YJW A;  1VQK T;  3JB9 J;  2M16 A;  3PFS A;  4RCC A;  4HT9 A;  5GAN 5;  1UGP B;  2CGH A;  1M1K U;  5CIU A;  3MO8 A;  3HSB A;  3JSC A;  5I2M A;  4N0A A;  2D0Q B;  4M7A B;  4NOY A;  4D6W A;  5LJ5 h;  2K3Y A;  3DLL A;  2P0Q A;  3HRU A;  1UGQ B;  3RIR A;  5M9O A;  3OYG A;  4M7D B;  4XU1 A;  3JAM E;  1VIF A;  3CMA A;  1Y96 B;  4M7D G;  4M75 B;  4EPC A;  5I21 A;  2VYT A;  3M56 A;  3L2Z A;  3OMC A;  4JLG A;  4M75 G;  3PMI A;  4DOV A;  2IVW A;  4XAX B;  2JTF A;  2LNV A;  2MAM A;  2O4X B;  2FYK A;  4A4H A;  4PKC C;  5A0D A;  3L1A A;  3SD4 A;  3JCM J;  5FLX E;  4O6J A;  4XTY A;  3VU3 C;  4ZGJ B;  3M55 A;  3S3N A;  2ZPE B;  3F70 A;  4RKU E;  2Y4X A;  4Q5W A;  4NL3 A;  2P4T A;  3CC2 A;  4BE0 A;  2DZ9 A;  2E64 A;  4E7J A;  4OB2 B;  1YCY A;  3WXM B;  3OYH A;  1XQH A;  1M1G A;  4M7D E;  2ZCF B;  1GXI E;  1M5Q 1;  1VIE A;  4EMG A;  5KCO A;  4M75 E;  2DPP B;  3E9G A;  5GAM f;  3QUI A;  4KUL A;  4BI3 A;  2EWN A;  2Y90 A;  3X20 B;  1PSF A;  3CPF A;  2RM4 A;  1G3W A;  3OYJ A;  3HRS A;  4FIB A;  2RJC A;  4M78 B;  4IUR A;  2HAX A;  2VV5 A;  3A5Z B;  4M78 G;  3ZEH A;  3RKW A;  1DJ7 B;  2M9U A;  4RG8 A;  4J6Y A;  3MCA B;  1ZHI A;  1U1T A;  1N8R C;  2RJE A;  3GP8 A;  3LGF A;  3L42 A;  3OMG A;  4BY6 C;  3GOX A;  3LW5 E;  3GIB A;  5CKE A;  2EFI A;  4PLI A;  4F7U F;  3M58 A;  4ATO A;  1FXX A;  3NTH A;  4J6W A;  4OP0 A;  3JB9 F;  2H3J A;  4R55 A;  2D6F A;  4MZM A;  1X6O A;  4MDX A;  2M1H A;  4BDY A;  1UB4 A;  2DXC A;  4ZGD B;  2LT4 A;  3QXE B;  3OW2 S;  3LX7 A;  2LVM A;  3HHT B;  3SDZ A;  2EJ9 A;  1N9S A;  2CZ7 B;  3OYK A;  3Q1J A;  3CCU A;  5FU6 C;  3CME A;  1QW1 A;  2DXU A;  3LYI A;  4BD3 A;  5CKH A;  3SFM A;  2QQ9 A;  3JCM V;  2HQE A;  3BDU A;  2L89 A;  4XK8 E;  3LWH A;  3HP9 A;  3RES A;  3KXT A;  4C0F A;  3VUB A;  3JCM f;  1LOJ A;  4JRI A;  3MEW A;  2X4X A;  2GFA A;  3BW1 A;  3DB4 A;  3CXC S;  3CCR A;  2OTJ A;  5CVI A;  2HNI A;  3RMQ A;  2QXF A;  3C4S A;  5D6Y A;  5IAY A;  2QI2 A;  5D6W A;  3MP8 A;  4L5G A;  4BB7 A;  2E6Z A;  2RO0 A;  2KSS A;  5CKB A;  2C06 A;  3E1S A;  1M1F A;  1VQN A;  2MF2 A;  3CBO A;  4A53 A;  2LC4 A;  4CI0 C;  3RMS A;  4DOW A;  2EJF A;  2E10 A;  3LH0 A;  2ZPB B;  4C8Q D;  2EYQ A;  5GAM g;  3CCS A;  2GQV A;  4BE2 A;  1VQ8 A;  1QVF S;  2OTJ T;  2IG0 A;  1G5V A;  1I81 A;  3M54 A;  2BIV A;  5DLQ E;  4HA8 A;  3JCM Q;  5DY9 A;  2QA4 T;  1UGR B;  3OBY A;  3JB9 H;  5J39 A;  1NE8 A;  3J80 E;  3X25 B;  3OS0 A;  1QP3 A;  3BDL A;  1JJ2 A;  1VQN T;  4QVC A;  3OYM A;  3QYH B;  1NPP A;  3CCM T;  3G6E T;  5CQY A;  2B8A A;  1WNL A;  2LCC A;  3M57 A;  3CCS T;  2V8J A;  3L2Q A;  3LLR A;  1WQW A;  5GAN f;  2R5M A;  4C92 A;  3OBW A;  3QKJ A;  2JOY A;  2V8I A;  3MHX A;  3QO3 A;  5FU7 C;  1WGS A;  5CO7 A;  4PJO F;  4BDZ A;  3OQ5 A;  1ZBX A;  2MWP A;  1JBM A;  4M77 A;  1M90 C;  4JRP A;  2GF7 A;  3CCJ A;  2DXB A;  3OSS C;  4XU0 A;  2KVQ G;  3G71 A;  5GAN j;  4BI8 B;  4ME7 A;  1S72 A;  3V7R A;  3OYL A;  3X28 B;  5GAN 7;  2QQS A;  3KUF A;  3BY7 A;  3OS5 A;  2RD1 A;  1OZ2 A;  4C5I A;  2FL7 A;  1OI1 A;  1XNI A;  2JZ2 A;  4F7U B;  3EFS A;  5HKC A;  3CD6 A;  2KAF A;  3DLM A;  1RI0 A;  4F7U G;  2WSF E;  1U8R A;  3L2W A;  3JB9 G;  3NFC A;  4X9D A;  1VQ7 T;  3PTA A;  1VQ9 T;  3QDR B;  4E7I A;  2EQU A;  1U1S A;  3C94 A;  4M78 D;  3JCM g;  3CCJ T;  1YIT T;  3G71 T;  3CPW A;  5CAI A;  3ZFJ A;  1S72 T;  2RI2 A;  3VUZ A;  1Q81 C;  2XU8 A;  1KC8 U;  3M9Q A;  2X4Y A;  1LNX A;  4OB1 B;  4C92 C;  4OB3 B;  4F7U E;  2YLB A;  5J26 A;  1WQ7 A;  3X24 B;  3CD6 T;  5FRN A;  4J5Y A;  2KY9 A;  5LJ3 f;  2EQJ A;  1KHI A;  4C8Q E;  5LJ5 e;  4XTW A;  4M77 C;  1P92 A;  2EAY A;  3HPW A;  2K3X A;  2RK1 A;  5CR2 A;  1EIF A;  2FB7 A;  5KE2 A;  2XDP A;  1G3Y A;  4VUB A;  5GAM h;  5GAN 2;  4R56 A;  2ZZD A;  3H6Z A;  1AHJ B;  4N4G A;  2MWO A;  4WF2 A;  4PJO D;  3WVD B;  5FRO A;  4HCZ A;  1K8A U;  4NS5 A;  5LJ3 j;  3M59 A;  5CKF A;  3S6W A;  4HCC A;  4M7A A;  3V8K A;  4LD6 A;  3RUX A;  5GMK m;  1Q82 C;  1BIA A;  2RHX A;  2LQK A;  2DEQ A;  4JUV A;  3FJP A;  1VQ5 T;  1WJQ A;  4M7D A;  1LJO A;  5LJ5 d;  2LCL A;  4FM4 B;  5GMK j;  1Y96 A;  3J7A F;  4M75 A;  3KBG A;  2OAU A;  2LRQ A;  2WSC E;  3URG A;  4EMK B;  5GAN g;  4YTL A;  2K57 A;  2PVG B;  3L2V A;  3JCM X;  3OSV A;  1M90 U;  3V8L A;  2CKK A;  4Y91 A;  4ZN1 A;  3QZ9 B;  4EDU A;  3OYN A;  2O01 E;  4J6X A;  5GAM j;  4NL2 A;  1KD1 C;  3JB9 I;  4C8Q C;  1N9R A;  4J8O A;  3LWI A;  1W2B A;  1NPR A;  4IUP A;  5IT9 E;  2JN0 A;  2JVV A;  3OYA A;  1H3Z A;  3VJP A;  2KDS A;  2QQR A;  2GFU A;  2F69 A;  4HCB A;  2XDB A;  4XTZ A;  1D3B A;  3I55 T;  1NJI C;  4V2S A;  3CBP A;  4M78 E;  4C0Z A;  5CKD A;  4M7A C;  4ZTJ A;  5GAN 8;  4PJO B;  4M78 A;  4B9W A;  4PJO G;  3HFO A;  1M9S A;  4J7I A;  2XID A;  3QG1 A;  3JCM h;  5GAN 6;  4N4I A;  4XTV A;  3WVE B;  4M7D C;  1Q81 U;  3M5A A;  4M75 C;  2K5L A;  3OYC A;  3OA6 A;  4FSX A;  1Y07 A;  2E70 A;  4FT2 A;  1YJ9 T;  3C12 A;  3FIF A;  2CYZ B;  5LJ3 g;  5GMK l;  1V29 B;  2I2L A;  4C0D B;  5L8R E;  5A0L A;  4PJO E;  4MMK A;  2ZPG B;  4E7K A;  2BUD A;  3FB9 A;  3I56 T;  4ZTF A;  5IN1 A;  2D9T A;  2EJG A;  4XU3 A;  5GAO q;  1TH7 A;  5GMK i;  2DVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...