4F7UG

The 6s snrnp assembly intermediate
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
PELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D1
total genus 12
structure length 68
sequence length 68
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uG00
4A53A 1B34B 3QUIA 4X9DA 2EAYA 4PJOF 5GAMh 4J6YA 4M7DA 4RCCA 2RB6A 2DTOA 2DXTA 4M78B 4EMKC 5DY9A 5LJ3j 3SB2A 5GANd 3QSUA 4M78D 2JN0A 5GAOn 3JB9H 4MMLA 3JCMh 4QVDA 1M5Q1 4M77E 4NOYA 4XU0A 4C8QG 3VU3C 4M7AC 1BIAA 2DZ9A 3JB9D 5GAOl 2I2LA 3JB9G 4M7DC 2EJGA 2DKGA 3JB9I 4M7DD 2RM4A 3GIBA 1Y96A 4C8QF 1LJOA 1N9RA 2E65A 5GAMe 5GAOq 1N9SA 2Y90A 1D3BA 3EFSA 4JRKA 2YLBA 3RIRA 2FB7A 3RKYA 4C92F 5GMKj 4XTWA 3PGGA 1X01A 2EJFA 4C8QE 4EMKA 5GANe 5LJ5f 4C92E 3RERA 5GAMf 4X9CA 4PJOG 1U1TA 1I8FA 4J6WA 3SWNB 5LJ3d 4EMHA 3L1AA 3HSBA 3JCMX 4M78E 4M7AA 4HA8A 4PJOA 5GAN2 1LNXA 2YHTA 1M8VA 5GMKe 4M77D 2FYKA 3V7CA 5GMKh 4NL2A 3JCMf 3JCMW 2QTXA 4M75C 4M77B 2RA2A 3SWNA 3FB9A 4PJOB 2ZGWA 4C8QC 4N0AC 1I4K1 2VXEA 5GAOm 4PJOD 4M7AD 2HNIA 5GAN4 4RCBA 4XQ3A 2DXUA 4M77A 3JCMg 1HXDA 5GMKm 4M7AF 3BDUA 1HK9A 5LJ3e 3BFMA 3JCMJ 3FJPA 2CGHA 3V7SA 4M75F 3JCMd 4M77G 5GMKl 3INZA 3V8LA 5GAMg 1B34A 5CAIA 1YCYA 4M7DF 4M7DB 4F7UF 5GAMd 5I21A 4C8QA 1KQ2A 1LOJA 4M78G 2E41A 3BY7A 4NL3A 3HFNA 4Y91A 4M78F 3V7RA 4C92C 4EMGA 5GANh 5GAOr 2VC8A 4HT8A 1WNLA 1JRIA 2EJ9A 3EFRA 4JLIA 4PJOE 4F7UG 2YLCA 3QO3A 4M7DG 4J5YA 3RUXA 4DQ2A 2DTIA 1Y96B 2DEQA 3SWNC 3JCMc 4C8QD 4F7UA 3JCMQ 4M75G 4WF2A 4XTUA 3JB9J 5GANj 2RD1A 4JUVA 4A54A 5GANf 1I5LA 1WQ7A 4QVCA 4M78C 4EMKB 5GAN7 3RKXA 1MGQA 4M77C 4J6XA 5LJ5j 5GAMj 5LJ5g 4M7DE 4JRIA 1I81A 2EWNA 4PJOC 4F7UB 3BW1A 4M7AB 2E10A 1D3BB 3RKWA 4C92D 3FIFA 3M4GA 5GAN3 2DZCA 4V2SA 1H641 2DJZA 1TH7A 4XTXA 1U1SA 5GANg 5GAOp 3RESA 2VXFA 5LJ5e 1JBMA 3JCMP 5LJ5h 4OP0A 4XU2A 5GAN8 2E1HA 4N0AA 4M77F 4MMKA 3V8KA 3V8JA 1WQWA 3AHUA 4C92A 1WPYA 2K57A 4M75A 5GAN5 5GMKi 3JCMe 5LJ3f 4XTZA 4M7AG 2E64A 4PNOA 3HFOA 5LJ3g 4XTVA 4XTYA 4C92G 5LJ5d 2DTHA 4XU1A 1KQ1A 1BIBA 3QHSA 3L2ZA 4C92B 5GAN6 4F7UE 4M75B 4XU3A 3JCMV 3JB9F 4M75D 4M78A 4M7AE 5LJ3h 4C8QB 4HT9A 2DVEA 3JCMb 4M75E
chains in the Genus database with same CATH superfamily
1VYVA 2C0TA 2RQVA 4Z02A 3MP8A 1YITQ 2E4HA 5IT9E 3M56A 1IGQA 1AWWA 3MO8A 2MCNA 3JCMh 1Q81U 4M7DC 3QBYA 1MMDA 3CCMQ 1ZX6A 2ZPEB 4L5GA 5FU7C 3J80E 2D8HA 2CH4A 4KBMB 4OMNA 3WVDB 1QCOA 1PKTA 2LCSA 1YHQQ 3VS7A 1M1KC 1G3SA 3PIPA 3A1PA 2W10A 4ORZA 2LCCA 4LNPA 2DNUA 4DOVA 4LDXA 4CRIA 2HNIA 3CEYA 1H8KA 2Y4YA 2D1XA 1YN8A 2RF0A 5LJ3e 3NTHA 1AVZC 1QWFA 1SRMA 1E6HA 1ABOA 4DBFA 3OYHA 2LNHB 4M7DF 2QQAA 5J26A 2PUOB 1KC8R 2V8KA 1X43A 1M3AA 2EYZA 5HK3A 3HPWA 1WDXA 1LPLA 4LN2A 3EFRA 1GCQC 1UGPB 2MYSA 1Y96B 3H0FA 1XTDA 4C8QD 1UDLA 2X3WD 1WHMA 1M1GA 4J6XA 4QKUA 2QDYB 1OEBA 2P0PA 5DLQE 4N4HA 4FW2A 3QDFA 4LDVA 1T3SA 4J9EA 2Y4XA 2K57A 3CCQA 2QAZA 1YFNA 3EFOA 1V1CA 4ESRA 1TG0A 1BIBA 1QP2A 2QI2A 1QVFS 3OYKA 1WI7A 1RAIB 2O2OA 4BACA 4M7AE 2PUKB 4VUBA 3JCMb 1OULA 2F69A 2QQ9A 1NPRA 5L8RE 4L6V5 3OBWA 3TREA 3H6ZA 4MMLA 4NOYA 3M0PA 1KQSP 1ZBXA 2P4TA 2RI5A 4B9XA 3L2WA 1AWOA 2YT6A 2KROA 2PVDB 2CUBA 3SWNB 2IIMA 2J06A 2QXFA 2FPDA 2FPEA 4B9WA 1XQHA 2YUNA 3KXTA 4HCBA 2QK0A 1AHJB 5GAOm 1K1ZA 1SSFA 3G71T 5GMKm 2EVRA 1WHLA 2DA9A 2OTJT 1LCKA 4FL6A 2JMCA 1AZGB 3CXCP 2JJ9A 4QQ6A 4DBQA 1QLYA 1NLOC 2IG0A 2IVWA 3DKMA 2FL7A 1BKBA 3CCRQ 2QEXQ 2KE9A 3JSCA 1OOTA 1H641 4JJDA 1KG1A 3L2VA 2A7YA 1Q86C 2PZ1A 1VQNQ 1PNJA 1WPYA 2KR3A 4NS5A 3QXEB 4M7AG 2JM9A 2KRNA 5IHNA 1R0BG 2QDLA 3TSZA 1WHKA 3VYGA 2K3BA 3G4ST 3JCMV 3OYLA 1MV0B 4M75D 5KYUA 2EYYA 3PNWC 1R0CB 2KEAA 1PG5B 3JAME 4OGCA 5DM7R 2V8JA 3I56A 2QG9B 2RMOA 5CVIA 2VUBA 4BY6B 3CC2Q 4C5GA 1YWOA 2PVOB 1D3BA 3RKYA 1VQ4A 4QVZA 1JJ2P 4RTZA 4A4HA 3OYMA 2K7AA 4PLLA 4EMHA 3P8DA 3L1AA 3JCMX 2CH4W 3EAEA 4PJJA 3G6EA 2KI7A 2WSEE 2LRQA 1JXMA 1AWXA 4M75C 1JXOA 2LC4A 1QMCA 1C6VX 3OW2A 4M77A 2PNIA 4C0GA 1YWPA 3JCMd 4PJNA 2DK3A 4Y92A 2D6FA 3G4SQ 3CC4Q 3CCQQ 3NHNA 1OZ2A 5KYXA 4CC7A 3C12A 3M0RA 2CYZB 2HQXA 1WIEA 1FWZA 3A8MB 4FYVB 5KCHA 4JLIA 3H8ZA 2J6OA 4OMQA 2CZ1B 3META 1VQ6A 2M16A 1Q82U 4ZNXA 2DMOA 4XTUA 4MZTA 3CPWP 2D0NA 3CPWA 1PSEA 4JPBW 2EFIA 4M77C 1MGQA 5GAMj 1PRLC 3M55A 2V1QA 5D6YA 3L2UA 4RTWA 5FROA 1MMGA 1TUDA 2VXFA 1UTIA 1VQLA 2V1RA 4KGVB 1D1BA 4OB0B 3EH2A 2CP3A 4M75A 5GMKi 5D6XA 2YUOA 2YUPA 4GY5A 3QHSA 3A8HB 2OI3A 4CI0C 2COZA 4RTVA 5KE3A 2GF7A 2K9GA 1Q86U 1ZUKA 2X3XD 1ZUUA 2LQ8A 2FZGB 3E9GA 4M78B 4EMKC 5FU6B 1NYFA 3S3NA 2OTLA 2DIGA 1T0JA 3NTKA 2DKGA 1QVGS 1X6OA 3OS1A 2YXYA 1JJ2A 2G3RA 1RI9A 1YJNT 1YITA 3RERA 3M57A 1K8AC 1S72T 4M7AA 2O4XB 1VQ6T 3EHQA 1OZ3A 2J7IA 3DLLA 3CMEQ 1KD1C 2FRWA 5CKEA 2LT1A 4IURA 1AD5A 4KGZB 2DAQA 1M90C 1YCSB 5CK9A 2GQIA 1HYOA 4LDYA 3J7AF 3CBMA 5D6WA 5DLOA 5CAIA 4PFPA 2RQTA 4FYXB 1E6GA 4KH1B 1RAHB 2VASA 1QWEA 1MV3A 4M78F 2XK0A 5FU7B 1Y7XA 3X28B 2EJ9A 2XDPA 2A37A 3REBB 1RI0A 1XNIA 3ZEHA 2RH2A 1YNZA 5HK0A 1LVKA 1E7OA 2SRCA 4JJCA 2A28A 3H0IA 2DZCA 4FSSA 1ZSZA 1JBMA 2DL4A 3A98A 3R6NA 1IXDA 5GAN8 1RABB 2CZ0B 1YHQA 2DL8A 1X6BA 4HXJA 1XOVA 2A3LA 3G6EQ 2CDTA 2MWOA 1N27A 2VWFA 3QWYA 1F1BB 4EPCA 1YJ9A 4RCCA 2HAXA 1UUEA 1H3ZA 1Z9QA 3NPFA 3UDCA 1M5Q1 4XU0A 2DZ9A 3ME9A 1Q7YR 1Z9ZA 5GAOq 1NEBA 1MMNA 3MEVA 1RADB 1MHNA 2FB7A 3SD4A 4IUVA 3M0UA 1OX8A 3CQTA 1M1KR 2BUDA 4PJOB 3VUBA 4OMOA 1I4K1 1GFDA 1VQLQ 1G83A 2EIFA 1FMVA 1BB9A 4JRPA 1SHGA 1D0YA 3LWIA 4JJNK 3INZA 3NFCA 5GAMg 2V26A 5IHKA 1QVPA 4F7UF 1SEMA 1W6XA 1KC8C 5IH2A 1VOMA 1M27C 2QQBA 4TVRA 2LQNA 2CT4A 2DTIA 3QG1A 2K5FA 4MZPA 4E47A 1B07A 2RJCA 2DM1A 3QYGB 4LD6A 5GAN7 5C0MA 1K76A 5LJ5g 3P8BB 4C5EA 3SFMA 4OGEA 3CPWS 3DLMA 1V76A 4QQDA 5AYFA 4PJMA 4E7IA 2RPNA 3I5SA 3H41A 3X24B 2E1HA 3VS0A 3X20B 3QDRB 3VKIA 3C95A 2C0IA 3AHUA 2HMAA 3QPHA 3L2QA 2ROTA 2ATCB 3JRZA 3M5AA 3MEWA 4F16A 1AOJA 2ZPHB 2L3RA 4IUQA 1Y0MA 4X1VA 4B6MA 5GANd 1K8AR 4QVDA 2DE0X 3PIOA 3CMET 1SPKA 3JB9I 1VQOT 4BE1A 3CCLT 4Z8AA 5I22A 1YIJT 1N9RA 1VQ9T 4C92F 4RG8A 2BZXA 3WXMB 1GBRA 2E3IA 3OYFA 2H3EB 3CPFA 5J39A 1LNXA 2FRYA 3CD6A 5D7UA 1D0XA 3UT1A 2NLUA 2VXEA 2E12A 2FG0A 3CXCS 3A5ZB 2HCKA 1OV3A 2CP0A 3UF4A 3EG9B 1YCYA 1Q86R 4M7DB 2CP7A 2RJDA 5CKHA 4A4KA 4Y91A 2HD0A 2EQKA 4RUGA 1AWJA 4HT8A 2YLCA 4ZGJB 2JOYA 4MDWA 1BK2A 4HCZA 1GRIA 2H8HA 3JCMc 1XJWB 5A0GA 1Q81C 3M59A 4A4GA 5GANj 1VQ6Q 1ZLMA 3CMAQ 1QVGP 2DXCA 2FZCB 1UGRB 3MHXA 2CP6A 2E3HA 2F2VA 3URGA 4JS5A 2DBKA 3SDZA 1OPLA 1K8AU 1VQOQ 4OP0A 4N0AA 2XHCA 5I2MA 4C92A 4MDXA 4PLIA 3KBGA 1IRXA 1UEBA 2AZSA 2F5TX 2L0AA 1Y57A 1KQ1A 2K3XA 4IUUA 3CD6T 2JZ2A 3WVEB 3I35A 4J9CA 2ZPGB 3CC7Q 1W2BS 2BE7D 1TUCA 1UFFA 4M75E 4A53A 4X9DA 2K6DA 4BD3A 2AKLA 3C94A 1X69A 5LJ3j 4ANJA 3SB2A 3O8VA 2DEUA 4M78D 3M53A 4OVAA 3ULRB 5FRNA 2ED1A 3BE3A 2RHZA 1LJOA 2E65A 1OPKA 2R57A 3OMCA 4KRTA 1KFZA 4E6RA 2ZZDA 2NYSA 4PJOG 3IQLA 5FW9A 2ZAEA 1VQ4Q 4M78E 5GAN2 3GNGA 1OU8A 1FMKA 5GMKh 2GQVA 3FLGA 2HQHA 2LQKA 5FWCA 1T0HA 1CSKA 4J9HA 5KYXB 3CCQT 4KULA 2EQUA 3CC7T 1NBEB 2FEIA 2PTKA 3RBBB 4R0KA 5I21A 2JMAA 4NL3A 3HFNA 4PKCC 1R77A 3G6ET 3V7RA 2GTOA 3CCJQ 3CCVA 2VC8A 1QKXA 3OS5A 4F7UG 5IXFA 5IAYA 3PMIA 5HY6A 3JB9J 2OJ2A 2HEQA 1YI2A 2CS7A 3EG2A 1BYMA 1SG5A 3HP9A 3NMZC 1WGSA 4BI8B 3MCAB 2HZYA 4BY6C 1I0CA 4QW2A 1Q95G 3RKWA 3GP8A 2KVQG 4BUGA 1NJIR 4IUTA 3V8KA 2E70A 2X4YA 5IN1A 2J6KA 4LDUA 4XTZA 3THKA 4E7JA 1G3YA 1VQKQ 3MP1A 1RUWA 2XD0A 3EGDA 5KCOA 1I07A 1KHCA 5LJ3h 4E7LA 1O75A 3R6OA 1P92A 1WYXA 3HL8A 2MAMA 1B34B 4J9GA 1UGVA 2DTOA 5KYUB 2NUPB 2DJQA 2JN0A 2JS0A 4M7AC 2PQWA 2I2LA 2RHXA 5KH6A 3KUFA 1K9MU 2DYIA 2GTJA 1UJ0A 4CC3A 2IPOB 1K0XA 1VQ7Q 1VQ8T 1KQSA 3CCVT 4C8QE 2EJFA 3A8GB 3I56Q 2MK5A 2QEXT 4QT7A 3CCSA 1YJ9Q 1WJSA 1M8MA 2M51A 2J05A 5GMKe 2FYKA 2NUTB 3M4YA 1SHFA 1VQMA 3EHRA 4J8OA 4WTOB 3OA6A 4FT2A 1KJWA 1D0ZA 1RAEB 2L8DA 5GAN4 2DXUA 3X26B 1JO8A 2CGHA 2VGNA 2ZPIB 1PD1A 4DEXA 2RHUA 2PU9B 3CCEQ 2R5MA 2MPXC 5ECAA 2ZPFB 3NTIA 2KRMA 3ER0A 4HCCA 3UA6A 4M78G 4J83A 3GLXA 3CBPA 2HKQB 2BZ8A 2EPDA 1PKSA 2WACA 1RAGB 2CREA 2VV5A 1OQKA 1MMAA 3LLRA 3JCMQ 4GLMA 5KYYA 2YDLA 4J9DA 1H92A 1I81A 2EWNA 3P8HA 3UA7A 4C92D 2LMJA 4OF1A 4OMMA 1M90R 1NEGA 4E7KA 1BI0A 2DD4A 1J3TA 2FZKB 4XU2A 5AT1B 4ELYC 1Q82R 1GL5A 1U06A 3PVQA 2KBTA 4K11A 1UGQB 2LZ6B 2EKOA 3CCRA 5C6SA 2DRKA 3OS2A 1VQMT 1TWBA 1VQKA 3OYDA 2SEMA 1G8XA 4IKFA 1UECA 2MWPA 4A4FA 2EAYA 4J6YA 2K5IA 1JU5C 5A0DA 5GAOn 4AMCA 2XICA 2COYA 3PT9A 3QYHB 1OU9A 2MOXA 3OYEA 1K9MR 2VGMA 3OB9A 1IHVA 2Z0WA 3LH5A 1Q82C 1B3QA 2Y90A 4HVUA 4EMKA 5LJ5f 1N8RR 1ZA1B 1O9SA 3HSBA 3QIIA 1N8RC 2CZ6B 4FT4A 2LP5A 1PRMC 2KNBB 2X4JA 1M90U 2LCLA 1PD0A 4ATOA 1QVFP 2XMFA 3VS4A 4XK8E 1HXDA 2DFUA 3EH1A 3OSSC 1HK9A 2EYXA 5M9OA 5KE2A 5CR2A 1B34A 3EG0A 2DETA 2K3YA 2HSEB 2DD5A 3CD6Q 1G5VA 1W2BA 3OS0A 3TEEA 2L5QA 5GANh 4C92C 3L42A 4OB1B 4HVVA 1MNEA 1JRIA 2A08A 1WFWA 1GXIE 4AT1B 4Z88A 1FXXA 4DQ2A 2DEQA 1TUGB 2K2VA 4WF2A 4ZN1A 1W1FA 1NPPA 3EGXB 4M7DE 4JRIA 1WXUA 1QCNA 2KYMA 2XU8A 4O5VA 3FIFA 2F2XA 2BIVA 1KD1R 2DBMA 1OX9A 1TSFA 3EFOB 3CC2T 4MMKA 1VQPA 2K4YA 1PC0A 3OYIA 2JS2A 1X75C 5CIUA 1M30A 4FIBA 4C92G 2JTFA 2DTHA 2LTOA 4J7FA 5GAN6 2DL7A 2O9VA 4AFQC 1QKWA 2M02A 3QJ6A 1NG2A 2YRCA 4BDZA 5GAMh 2KT8A 3E2UA 4Y28E 3CBOA 2KDSA 2F5KA 1VQ5A 1VQNT 1KSWA 2XDBA 2F1LA 3OW2S 1RL2A 1GCQA 3HHTB 4PFZA 3VS1A 1K73C 5GMKj 2FO0A 2XI9A 1U1TA 1PCXA 3V7CA 2QGFB 1PHTA 1WZOA 1G3TA 2YUQA 2ABLA 1M2VA 3HKSA 2ESWA 1IREB 1KK7A 1FX7A 1KIKA 3EG9A 1I1JA 3GOXA 1TTHB 3BFMA 5FLXE 1C1AA 3CC2A 2C0OA 4RMOA 1M1KU 2AT1B 3GPLA 4BE0A 3CCUQ 2BTTA 4JS4A 1WXTA 2K79A 1WNLA 4PJOE 4M7DG 2A36A 1RAAB 1PSFA 1D09B 1VIEA 4HCKA 4F7UA 5GANf 1WQ7A 5CCAA 4R55A 3RMQA 1VQ8Q 2E10A 4XTXA 2DVJA 4C0ZA 3LW5E 5CKDA 5LJ5e 2EGCA 2KXCA 2CUDA 2HBPA 3RDVA 3CC4A 1BCOA 4IUPA 1K0SA 4E7SA 1VUBA 1U3OA 4XTVA 4UC4A 2OTLT 4J9IA 1TOVA 2EBPA 3VRZA 2RJFA 4F7UE 2LX7A 5CQYA 1K9MC 2AK5A 4PL6A 2K2MA 4D8DA 2D9TA 3A8OB 1AZEA 2HKNA 2LDMA 1YJNA 4PFOA 5DY9A 1ZA2B 4D8KA 1S72A 4M77E 3FDRA 2JNGA 5KYWA 4KH0B 2ENMA 3VYHB 2QYZA 1MNDA 4JRKA 3ZFJA 1G3WA 2FPFA 4HVWA 1W4SA 3PGGA 1EIFA 2CZ7B 4X9CA 2RK1A 5CO7A 4BDYA 3TU4K 2E6NA 3E1SA 4M77D 1WHGA 4NL2A 1M1FA 4PJLA 3JV3A 1AT1B 3SWNA 1UG1A 2JTMA 4M7AD 3L2RA 4RCBA 1Y07A 3JCMJ 1TS9A 2RI3A 1BI1A 2CSQA 2EQMA 2YWWA 3CC4T 2EQJA 3V8LA 2DXBA 2C06A 1K9AA 2M1HA 1YP5A 2DO3A 2OAUA 4AG2C 2XDDA 1M4ZA 2EYWA 1S1NA 3QO3A 4DA4A 2GBQA 5J3BA 2RK2A 4R56A 1VYTA 1K73R 1QW1A 2RQWA 4LDWA 3CMEA 1YHQT 4DBRA 1YBYA 4C0DB 3RKXA 4FYYB 3OBYA 2NWMA 3CCLA 2KQWA 1YIJA 1N8RU 1VQ9A 3DB4A 3M4GA 1WHJA 4MZMA 4V2SA 1TH7A 3S6WA 1K4US 4FU6A 4JLGA 2VVKA 1UJYA 4RTUA 5GAN5 1WA7A 2E64A 3I5RA 3HFOA 4PNOA 4ZGEB 2ZPBB 2E5KA 3O5ZA 4P5NA 3CCUT 2GFUA 3L2ZA 1YI2T 2L2PA 3F70A 4CC2A 7AT1B 2V8IA 1EFNA 2YRDA 3ZL7C 2X35A 1TXQA 1IHWA 3M9QA 3QUIA 2LQWA 4PJOF 3OW2P 2E5QA 1QCFA 3VS5A 1NLPC 3X25B 2KYBA 1D1AA 2A0FB 2COWA 4KT0E 3MKDA 2QA4A 3G4SA 2EJGA 1NJIC 3FC3A 5GJWB 2OAWA 1SF9A 2E6ZA 3I56T 4FM4B 5GANe 4RTYA 1R8OB 3CMAT 4HA8A 3CCLQ 2CP2A 2MI6A 3RNJA 4JZ4A 1VIFA 1WX6A 1UB4A 4N4IA 3I55A 4XQ3A 3FJPA 4M75F 3OQ5A 3VS3A 1FMWA 2KXDA 3MP6A 3OMGA 3OYJA 1UHFA 4OMFB 2QEXA 2F2WA 3E9FA 4E7ZA 3OYNA 3A8LB 3G71Q 2FHDA 8ATCB 2MF2A 1JQQA 1M3CA 3TVTA 3N5BB 2HBWA 3KFVA 3AT1B 5I2SA 5KYWB 4J5YA 5CQXA 4LD9K 1EZZB 2D8JA 2KT1A 3VS2A 3S3MA 2RHIA 3LX7A 4N4GA 2RD1A 4JUVA 1I5LA 1CKAA 3UPUA 2XG8D 1S72Q 3QZ5B 2HDAA 1YJWT 2L3SA 1IO6A 4A63B 2LNVA 3BW1A 4RG2A 4M7AB 1VQ7T 4A4EA 1TU0B 5GAN3 4IIMA 2QA4T 2DJZA 4LUDA 1YIJQ 2GGRA 2H3JA 4GBQA 3OYGA 3JCMP 5LJ5h 1ACMB 4BI3A 1Q7YC 1M3BA 2YRVA 3V8JA 3C4SA 4KGXB 3EG1A 3CMAA 1X27A 1BI2A 2OTJA 6AT1B 4RTXA 2JM8A 4AFZC 1UE9A 1SRLA 3GBQA 1IZ6A 4D6WA 3CC7A 4ME7A 3I55T 2MIOA 2G6FX 2RB6A 5LL6S 3QSUA 3JB9H 1ARKA 3MEAA 4C8QG 3JB9G 2FVUA 1RLPC 5GAOl 3CCMA 2JW4A 4KUIA 4M7DD 2RM4A 4L59A 3LYIA 3DB3A 4AFSC 5GAMe 1N9SA 1WJQA 1PWTA 2YLBA 2KMTA 1HD3A 1X01A 1UHCA 4C92E 1ZHIA 3QJYA 5LJ3d 2YHTA 1VQ5Q 3JCMf 2BZYA 2QTXA 4YTLA 3PTAA 3TSWA 3PVLA 4II1A 2ZGWA 1QVGA 1FYNA 1NM7A 1VQ7A 1YITT 3I55Q 3OYAA 2DL3A 2AIRB 2B86A 5GMKl 2AHJB 2DRMA 1SSHA 1NZ9A 1KD1U 2K5LA 1T3LA 2LJ3A 1X2KA 1W2BP 1QP3A 2NUPA 3HRSA 2EYQA 2RO0A 2E41A 2M0YA 2R58A 4AFUC 1ZSGA 3EGXA 3GNFB 3SWNC 1M2OA 4CC4B 1GCPA 4A54A 1VQ4T 4QVCA 4XAXB 2XKOC 2HL5C 1ZSZC 3LWHA 4KUDK 2PVGB 2KK4A 4AG1C 5KYYB 5A2QE 2CP5A 1YJWQ 1VQ8A 2W0ZA 3CCMT 1NYGA 3HRTA 4FCYA 1G2BA 1SKUB 2O01E 2JT4A 4M77F 3VS6A 3VV0A 4X34A 4ZGDB 3LH0A 2QTVA 4ZN3A 3FJ5A 2RI2A 3CCSQ 1OI1A 2EW3A 2M9UA 3EG3A 1UGSB 2RN8A 5CKFA 1I5OB 2L3PA 4XU3A 2ECZA 1C0MA 2OTJQ 1VQMQ 4HT9A 2DVEA 1ZQ1A 4E7HA 2WSCE 1QVFA 4M7DA 4QQGA 2DILA 5CKBA 2RNAA 2DX1A 1GBQA 1BU1A 2QQSA 1JB0E 3JB9D 3G71A 1X6GA 2KAFA 1M9SA 3RIRA 1DJ7B 1YJ9T 4XTWA 1WXBA 3ZBDA 3G1JA 3PMTA 1I8FA 4J6WA 3PFSA 5FRMA 4C0DC 3JCMW 1BCMA 4Z89A 4M77B 1U5SA 1EX4A 3FB9A 3H0HA 4C8QC 1N6AA 2VKNA 3JCMg 2B8AA 4HKEA 3CXCA 3T9NA 3V7SA 4M77G 1ZUYA 1BI3A 3RMSA 4F17A 1VQKT 1NE8A 1LOJA 2P0KA 2DERA 3BY7A 1A0NB 1WHHA 3UWNA 3M54A 4OB3B 4JDSA 1Q81R 3RUXA 3VJPA 3PE0A 4F14A 2EGEA 4M78C 4EMKB 5EG2A 3G7ZA 3OYYA 2DLPA 2P4RA 1D3BB 5KYNA 1VA7A 4OMLA 1VQ9Q 2D0QB 4C5HA 2LT4A 1RAFB 2BE9B 1IB8A 3LGFA 3QWXX 1WQWA 5GJVB 2QASA 5IHIA 3TQ7P 3JCMe 3QKJA 3QZ9B 2YSQA 5LJ3g 4XTYA 3VRYA 3SHWA 2DIQA 1CKBA 4C92B 2LJ0A 2O31A 5I11A 4M78A 2L89A 2L3QA 1YI2Q 5EC7A 1HSQA 1U8RA 3RR6A 3M58A 3MJXA 3CCST 2DXTA 2KY9A 1OYXA 3D7SB 1PM3A 4FSXA 3VU3C 1BIAA 2ED0A 4J9FA 2KRSA 5L23A 3H9NA 2CSIA 2X4XA 3OYBA 1Q7YU 1KHIA 2WSFE 3NGPA 2P84A 1D1CA 3OY9A 3VUZA 1KC8U 2EKHA 1B7TA 4BI4A 4RKUE 1VQPT 1GFCA 2J6FA 3UATA 4M7AF 2NUZA 1ZBJA 5FU6C 3S3OA 3HTRA 4BB7A 2XIDA 2QGGA 4C8QA 3BDLA 1VQLT 4GLKA 4LUEA 1VQPQ 2VB6A 2EGAA 5GAOr 1N5ZA 5IXBA 2AZVA 2MMPA 2OX7A 2ROLA 2JVVA 1K73U 2AKKA 1V29B 2KSSA 2X4WA 1VQ5T 1VQNA 4M75G 3EGUA 2GFAA 1RLQC 4WCIA 2QA4Q 2DYBA 5LJ5j 4C5IA 3GF5A 5HKCA 4F7UB 3CCRT 4C0FA 1IGUA 5GANg 1U1SA 4DOWA 5GAOp 2LX9A 3ASKA 3M0QA 1JJ2S 3RESA 4RTTA 2O4XA 3CCEA 1M2VB 2RJEA 5HCKA 5LJ3f 2X9HA 3OSVA 2JXBA 4EIKA 1QQJA 4M75B 4FYWB 2GCXA 3JB9F 2JUFA 4OMPA 3J81E 4LXCA 5FWBA 2OTLQ 2R5AA 5A0LA 3MPUB 4O6JA 1WLPB 3REAB 3FRNA 2HQEA 3GIBA 1Y96A 4C8QF 3C0CA 3OYCA 3CCUA 1Y71A 3EFSA 2X51A 2RQUA 3FEOA 3I9QA 3CCJA 3CCVQ 2RHYA 5GAMf 3M0TA 4ZTFA 2O9SA 9ATCB 4PJOA 4OB2B 1M8VA 1HJDA 3SEMA 2O88A 2RQRA 2CKKA 1ZSZB 2RA2A 1WJRA 4DBHA 4F04B 4E2FB 4N0AC 2VYTA 4FW1A 4IIOA 4PJOD 4J7IA 2NUTA 2M0OA 3EGDB 4ELZC 3CCET 1W70A 1AEYA 2BKDN 1X2QA 5GAMd 2ZCFB 4JRQA 1KQ2A 1RACB 4EDUA 4J9BA 4BE2A 4EMGA 1JEGA 2P0QA 1VQOA 2GNCA 3TCJA 2DL5A 1KQSS 8AT1B 2DF6A 2HL3A 1NJIU 2EQIA 3M0SA 1YJNQ 4JZ3A 4PJOC 2DPPB 2LVMA 1H3HA 4LE9A 3Q1JA 1MUZA 2HSPA 3MEUA 3HRUA 4Q5WA 3CCJT 2I0NA 3U23A 4PK4A 5LJ5d 3E19A 4M4ZA 1BBZA 4JJBA 4XU1A 2QQRA 1VYUA 2CT3A 1YJWA 1ABQA 2LJ1A 3LGLA 2KGTA 4DEYA 4C8QB 4ZTJA 3BDUA 2JTEA
chains in the Genus database with same CATH topology
2MWPA 4ME7A 4EPCA 4A4FA 3I55T 4Z02A 2EAYA 3MP8A 1YJ9A 4J6YA 5IT9E 2K5IA 2RB6A 3M56A 4RCCA 5LL6S 2HAXA 1H3ZA 3QSUA 3UDCA 5A0DA 3MO8A 5GAOn 3MEAA 3JB9H 3JCMh 1Q81U 1M5Q1 2XICA 3PT9A 4XU0A 4C8QG 3QYHB 2DZ9A 3JB9G 2FVUA 3ME9A 3QBYA 5GAOl 3OYEA 3CCMA 4M7DC 4KUIA 2VGMA 4M7DD 2RM4A 4L59A 3OB9A 3LYIA 2ZPEB 3DB3A 5GAOq 4L5GA 5FU7C 5GAMe 3J80E 1Q82C 1N9SA 2Y90A 1WJQA 3MEVA 2YLBA 2KMTA 1MHNA 2FB7A 4KBMB 3SD4A 4IUVA 3WVDB 1X01A 4EMKA 5LJ5f 4C92E 1ZHIA 1O9SA 3HSBA 3QJYA 5LJ3d 3QIIA 1N8RC 2CZ6B 4FT4A 2YHTA 2BUDA 1M1KC 3JCMf 2QTXA 4YTLA 3PTAA 1G3SA 2X4JA 3PIPA 1M90U 4II1A 4PJOB 2ZGWA 3VUBA 1QVGA 1I4K1 2LCCA 4DOVA 4LDXA 4CRIA 2LCLA 1VQ7A 2HNIA 3CEYA 4ATOA 2Y4YA 1YITT 1HXDA 4XK8E 3OSSC 1HK9A 5LJ3e 2EIFA 3OYAA 4JRPA 3LWIA 3NTHA 4JJNK 5GMKl 3INZA 3NFCA 2AHJB 5M9OA 5GAMg 5KE2A 5CR2A 1B34A 1NZ9A 2K3YA 3OYHA 2K5LA 1QVPA 4F7UF 2DD5A 1KD1U 4M7DF 1KC8C 1G5VA 2QQAA 1W2BA 1QP3A 3HRSA 2EYQA 2PUOB 5J26A 2RO0A 2E41A 3TEEA 3OS0A 2V8KA 2L5QA 2R58A 4C92C 5HK3A 3L42A 3HPWA 5GANh 4OB1B 1JRIA 3EFRA 2QQBA 4TVRA 1UGPB 1GXIE 3GNFB 2DTIA 1FXXA 1Y96B 4DQ2A 2DEQA 1XTDA 2K5FA 3QG1A 3SWNC 4MZPA 4C8QD 2K2VA 4E47A 4WF2A 4ZN1A 2RJCA 1NPPA 4A54A 1VQ4T 1M1GA 3QYGB 4LD6A 4QVCA 4XAXB 2XKOC 5GAN7 5C0MA 4J6XA 3LWHA 5LJ5g 4M7DE 4KUDK 4JRIA 3P8BB 4C5EA 2PVGB 2XU8A 4O5VA 3SFMA 3FIFA 2KK4A 4OGEA 2QDYB 3DLMA 5A2QE 3CPWS 1VQ8A 2BIVA 4QQDA 2P0PA 5AYFA 5DLQE 4N4HA 3CCMT 4E7IA 3HRTA 4LDVA 2O01E 3X24B 2E1HA 3CC2T 3X20B 4M77F 3QDRB 3VKIA 3C95A 4MMKA 2K4YA 1VQPA 3VV0A 3AHUA 2Y4XA 4X34A 2K57A 4ZGDB 3OYIA 3LH0A 1X75C 3QPHA 4ZN3A 2RI2A 5CIUA 1OI1A 4FIBA 2M9UA 4C92G 3L2QA 3CCQA 2JTFA 1UGSB 2DTHA 2LTOA 4J7FA 1BIBA 1QP2A 2QI2A 3JRZA 5CKFA 5GAN6 3OYKA 1QVFS 4XU3A 3M5AA 4BACA 4M7AE 3MEWA 3QJ6A 2PUKB 4HT9A 2DVEA 4VUBA 1ZQ1A 3JCMb 4BDZA 2F69A 2QQ9A 1NPRA 5L8RE 4E7HA 4L6V5 2WSCE 3OBWA 5GAMh 1QVFA 2ZPHB 3TREA 4Y28E 4M7DA 2L3RA 4IUQA 3CBOA 4QQGA 3H6ZA 5CKBA 5GANd 2KDSA 2F5KA 1VQ5A 1VQNT 4MMLA 4QVDA 4NOYA 2XDBA 3PIOA 3CMET 3OW2S 2QQSA 1RL2A 1JB0E 3JB9D 1ZBXA 3G71A 3HHTB 3JB9I 1VQOT 2KAFA 1M9SA 4BE1A 3CCLT 1K73C 2P4TA 2RI5A 1YIJT 1N9RA 1VQ9T 4B9XA 3RIRA 5GMKj 1DJ7B 4C92F 1YJ9T 4RG8A 3L2WA 4XTWA 3WXMB 3ZBDA 3OYFA 2PVDB 3PMTA 2XI9A 1VQ6A 1U1TA 1I8FA 3CPFA 4J6WA 3SWNB 3PFSA 5FRMA 5J39A 1LNXA 2QXFA 3CD6A 3V7CA 4B9WA 4C0DC 1XQHA 3JCMW 3KXTA 4HCBA 4M77B 3UT1A 1G3TA 2NLUA 3FB9A 4C8QC 2VXEA 1AHJB 1N6AA 2E12A 1IREB 3HKSA 5GAOm 1FX7A 1SSFA 3G71T 3GOXA 3JCMg 5GMKm 2B8AA 4HKEA 3CXCA 3BFMA 3T9NA 5FLXE 3V7SA 3CXCS 4M77G 3A5ZB 3CC2A 4RMOA 1M1KU 1BI3A 2OTJT 1YCYA 4FL6A 4M7DB 3GPLA 3RMSA 2RJDA 5CKHA 4A4KA 4BE0A 1NE8A 1LOJA 1VQKT 2P0KA 3BY7A 4Y91A 4JS4A 2HD0A 2EQKA 3UWNA 4HT8A 1WNLA 3M54A 4PJOE 4OB3B 2YLCA 4JDSA 4M7DG 4ZGJB 2JOYA 4MDWA 3RUXA 4HCZA 1PSFA 3VJPA 4QQ6A 3JCMc 1VIEA 5A0GA 4F7UA 1Q81C 3M59A 2IG0A 4A4GA 5GANj 5GANf 2IVWA 3DKMA 2FL7A 1WQ7A 4M78C 1BKBA 4EMKB 5EG2A 5CCAA 3G7ZA 3OYYA 4R55A 2DXCA 3RMQA 1UGRB 3MHXA 2E10A 1D3BB 3JSCA 1H641 4XTXA 2D0QB 4C5HA 3URGA 2LT4A 3LW5E 4C0ZA 4JS5A 3SDZA 5CKDA 1KG1A 5LJ5e 3L2VA 1K8AU 2HBPA 2A7YA 4OP0A 4N0AA 2XHCA 5I2MA 3CC4A 4IUPA 3LGFA 1Q86C 1WQWA 4C92A 1WPYA 4MDXA 4NS5A 1VUBA 3QXEB 4PLIA 3KBGA 3JCMe 4M7AG 3QKJA 1UEBA 3QZ9B 5LJ3g 4XTVA 4XTYA 2F5TX 4UC4A 2DIQA 2OTLT 1KQ1A 3VYGA 2RJFA 4C92B 2K3XA 4IUUA 4F7UE 3CD6T 2JZ2A 3WVEB 3G4ST 5CQYA 3JCMV 3OYLA 4M75D 4M78A 2L89A 2ZPGB 1K9MC 1W2BS 4PL6A 4M75E 2D9TA 3PNWC 4A53A 1U8RA 3A8OB 4OGCA 4X9DA 5DM7R 3JAME 2LDMA 2V8JA 3I56A 4BD3A 3M58A 3C94A 3CCST 2DXTA 1YJNA 5LJ3j 5DY9A 2KY9A 3O8VA 5CVIA 3SB2A 1OYXA 2VUBA 4M78D 4BY6B 1S72A 3M53A 4M77E 4FSXA 3FDRA 3VU3C 1BIAA 4OVAA 2JNGA 4C5GA 5FRNA 2RHZA 1LJOA 2X4XA 2E65A 2R57A 3OMCA 3VYHB 2PVOB 1D3BA 4JRKA 3RKYA 3ZFJA 1G3WA 1W4SA 1VQ4A 3PGGA 2ZZDA 4QVZA 3OYBA 1EIFA 2CZ7B 4X9CA 4PJOG 2RK1A 4A4HA 3OYMA 1Q7YU 4PLLA 5CO7A 1KHIA 2WSFE 3L1AA 3P8DA 4M78E 4EMHA 3JCMX 3EAEA 5GAN2 4BDYA 2E6NA 3TU4K 3E1SA 3GNGA 4M77D 3G6EA 2WSEE 5GMKh 2LRQA 1M1FA 4NL2A 4M75C 2LC4A 3OY9A 3VUZA 3SWNA 1KC8U 2JTMA 2GQVA 4BI4A 3FLGA 4RKUE 2LQKA 1VQPT 4M7AD 3OW2A 3L2RA 4RCBA 4M77A 4M7AF 1Y07A 3JCMJ 4C0GA 2RI3A 3JCMd 5FU6C 3S3OA 1BI1A 3CCQT 2EQMA 4KULA 2EQUA 2DK3A 3CC4T 2EQJA 3CC7T 3V8LA 2D6FA 2DXBA 2XIDA 4BB7A 2C06A 1OZ2A 5I21A 4C8QA 2M1HA 3BDLA 1VQLT 3C12A 4NL3A 3HFNA 4GLKA 4PKCC 2CYZB 3G6ET 3V7RA 2DO3A 2HQXA 3CCVA 2OAUA 1FWZA 2VC8A 3A8MB 5KCHA 5GAOr 4JLIA 2XDDA 3OS5A 1M4ZA 2MMPA 4F7UG 3QO3A 4DA4A 3H8ZA 5J3BA 2CZ1B 2JVVA 3META 1K73U 2RK2A 1V29B 5IAYA 2X4WA 2KSSA 3PMIA 4R56A 2M16A 1Q82U 1VQ5T 5HY6A 1VQNA 1QW1A 4M75G 4MZTA 2GFAA 4XTUA 3CMEA 4LDWA 3JB9J 2CS7A 3CPWA 1YHQT 1YI2A 3HP9A 1YBYA 1BYMA 4C0DB 1PSEA 1WGSA 2EFIA 3RKXA 1MGQA 3MCAB 3OBYA 4M77C 3M55A 4BI8B 4C5IA 5LJ5j 3GF5A 2KQWA 4BY6C 5GAMj 1YIJA 4QW2A 3CCLA 5HKCA 4F7UB 3RKWA 3DB4A 3CCRT 4C0FA 5D6YA 3GP8A 3L2UA 1N8RU 1VQ9A 2KVQG 3M4GA 5FROA 4MZMA 4V2SA 1TH7A 5GANg 1U1SA 4DOWA 5GAOp 2LX9A 3ASKA 3S6WA 4BUGA 1JJ2S 3RESA 2VXFA 4FU6A 4JLGA 1VQLA 4IUTA 2O4XA 3CCEA 3V8KA 2E70A 2RJEA 2X4YA 4OB0B 5IN1A 4LDUA 4M75A 5GAN5 5GMKi 5D6XA 5LJ3f 4XTZA 2E64A 4PNOA 3HFOA 4ZGEB 2ZPBB 3OSVA 4E7JA 4GY5A 4P5NA 3CCUT 1G3YA 3QHSA 2GFUA 3L2ZA 1YI2T 3A8HB 3MP1A 4M75B 3F70A 2XD0A 2GCXA 5KCOA 4CI0C 2V8IA 3JB9F 2JUFA 1KHCA 5LJ3h 5KE3A 2GF7A 2X35A 4E7LA 1Q86U 1O75A 3R6OA 1P92A 3J81E 3HL8A 2MAMA 1B34B 3M9QA 3QUIA 4PJOF 2LQ8A 2E5QA 2DTOA 2R5AA 3E9GA 4M78B 3X25B 4EMKC 5FU6B 5A0LA 2OTLA 3S3NA 4O6JA 2JN0A 2DIGA 4KT0E 4M7AC 2QA4A 2PQWA 2I2LA 3NTKA 3G4SA 2EJGA 2DKGA 2RHXA 5KH6A 3KUFA 3FRNA 1NJIC 2HQEA 1K9MU 3FC3A 1QVGS 3GIBA 1X6OA 1Y96A 4C8QF 3OS1A 3OYCA 3CCUA 1JJ2A 1Y71A 3EFSA 2E6ZA 1VQ8T 1KQSA 2G3RA 3FEOA 3I56T 4FM4B 3CCVT 4C8QE 2EJFA 3A8GB 5GANe 3CCJA 2QEXT 3CCSA 1YITA 1R8OB 2RHYA 5GAMf 3RERA 1WJSA 3M57A 1K8AC 4ZTFA 3CMAT 1S72T 4PJOA 4M7AA 4HA8A 2O4XB 1VQ6T 4OB2B 1M8VA 1OZ3A 5GMKe 2FYKA 2MI6A 3M4YA 1YJNT 3DLLA 1VQMA 2CKKA 1KD1C 2RA2A 1WJRA 4J8OA 3OA6A 4N0AC 4FT2A 2LT1A 2VYTA 5CKEA 4IURA 1VIFA 4N4IA 1UB4A 3I55A 4J7IA 4PJOD 5GAN4 2L8DA 2M0OA 4XQ3A 2DXUA 2DAQA 1M90C 3X26B 5CK9A 3FJPA 2CGHA 2VGNA 4M75F 2ZPIB 3OQ5A 4LDYA 4ELZC 3CCET 3MP6A 3OMGA 3J7AF 3OYJA 2RHUA 2PU9B 2R5MA 2BKDN 3CBMA 5D6WA 2ZPFB 5CAIA 5DLOA 4OMFB 3NTIA 2QEXA 5GAMd 3E9FA 3ER0A 2ZCFB 3OYNA 4JRQA 4HCCA 1KQ2A 3A8LB 4M78G 4J83A 2FHDA 4EDUA 2MF2A 3GLXA 2XK0A 3CBPA 4M78F 5FU7B 4EMGA 1Y7XA 3X28B 4BE2A 2P0QA 2EJ9A 2XDPA 3N5BB 1VQOA 5I2SA 1RI0A 4J5YA 3TCJA 5CQXA 2WACA 4LD9K 1XNIA 3ZEHA 2VV5A 2RH2A 3S3MA 3LLRA 2RHIA 3LX7A 5HK0A 3JCMQ 1KQSS 4N4GA 2RD1A 4JUVA 1I5LA 3UPUA 2XG8D 3QZ5B 1YJWT 1NJIU 1I81A 2EWNA 3P8HA 4PJOC 2LNVA 3BW1A 4RG2A 4M7AB 4C92D 1VQ7T 4OF1A 4A4EA 2DPPB 5GAN3 2DZCA 2QA4T 2DJZA 2LVMA 4E7KA 3Q1JA 1BI0A 2H3JA 3OYGA 2DD4A 1JBMA 3JCMP 5LJ5h 4XU2A 4BI3A 3MEUA 5GAN8 1Q7YC 3HRUA 2YRVA 3V8JA 1YHQA 2CZ0B 3C4SA 4Q5WA 4ELYC 1XOVA 2A3LA 3CCJT 1UGQB 5LJ5d 3CMAA 2EKOA 3E19A 2MWOA 1BI2A 3CCRA 1N27A 4XU1A 5C6SA 2OTJA 2QQRA 1YJWA 3OS2A 3LGLA 1VQMT 1VQKA 3OYDA 4C8QB 4ZTJA 3BDUA 1IZ6A 4IKFA 4D6WA 3CC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A53 A;  1B34 B;  3QUI A;  4X9D A;  2EAY A;  4PJO F;  5GAM h;  4J6Y A;  4M7D A;  4RCC A;  2RB6 A;  2DTO A;  2DXT A;  4M78 B;  4EMK C;  5DY9 A;  5LJ3 j;  3SB2 A;  5GAN d;  3QSU A;  4M78 D;  2JN0 A;  5GAO n;  3JB9 H;  4MML A;  3JCM h;  4QVD A;  1M5Q 1;  4M77 E;  4NOY A;  4XU0 A;  4C8Q G;  3VU3 C;  4M7A C;  1BIA A;  2DZ9 A;  3JB9 D;  5GAO l;  2I2L A;  3JB9 G;  4M7D C;  2EJG A;  2DKG A;  3JB9 I;  4M7D D;  2RM4 A;  3GIB A;  1Y96 A;  4C8Q F;  1LJO A;  1N9R A;  2E65 A;  5GAM e;  5GAO q;  1N9S A;  2Y90 A;  1D3B A;  3EFS A;  4JRK A;  2YLB A;  3RIR A;  2FB7 A;  3RKY A;  4C92 F;  5GMK j;  4XTW A;  3PGG A;  1X01 A;  2EJF A;  4C8Q E;  4EMK A;  5GAN e;  5LJ5 f;  4C92 E;  3RER A;  5GAM f;  4X9C A;  4PJO G;  1U1T A;  1I8F A;  4J6W A;  3SWN B;  5LJ3 d;  4EMH A;  3L1A A;  3HSB A;  3JCM X;  4M78 E;  4M7A A;  4HA8 A;  4PJO A;  5GAN 2;  1LNX A;  2YHT A;  1M8V A;  5GMK e;  4M77 D;  2FYK A;  3V7C A;  5GMK h;  4NL2 A;  3JCM f;  3JCM W;  2QTX A;  4M75 C;  4M77 B;  2RA2 A;  3SWN A;  3FB9 A;  4PJO B;  2ZGW A;  4C8Q C;  4N0A C;  1I4K 1;  2VXE A;  5GAO m;  4PJO D;  4M7A D;  2HNI A;  5GAN 4;  4RCB A;  4XQ3 A;  2DXU A;  4M77 A;  3JCM g;  1HXD A;  5GMK m;  4M7A F;  3BDU A;  1HK9 A;  5LJ3 e;  3BFM A;  3JCM J;  3FJP A;  2CGH A;  3V7S A;  4M75 F;  3JCM d;  4M77 G;  5GMK l;  3INZ A;  3V8L A;  5GAM g;  1B34 A;  5CAI A;  1YCY A;  4M7D F;  4M7D B;  4F7U F;  5GAM d;  5I21 A;  4C8Q A;  1KQ2 A;  1LOJ A;  4M78 G;  2E41 A;  3BY7 A;  4NL3 A;  3HFN A;  4Y91 A;  4M78 F;  3V7R A;  4C92 C;  4EMG A;  5GAN h;  5GAO r;  2VC8 A;  4HT8 A;  1WNL A;  1JRI A;  2EJ9 A;  3EFR A;  4JLI A;  4PJO E;  4F7U G;  2YLC A;  3QO3 A;  4M7D G;  4J5Y A;  3RUX A;  4DQ2 A;  2DTI A;  1Y96 B;  2DEQ A;  3SWN C;  3JCM c;  4C8Q D;  4F7U A;  3JCM Q;  4M75 G;  4WF2 A;  4XTU A;  3JB9 J;  5GAN j;  2RD1 A;  4JUV A;  4A54 A;  5GAN f;  1I5L A;  1WQ7 A;  4QVC A;  4M78 C;  4EMK B;  5GAN 7;  3RKX A;  1MGQ A;  4M77 C;  4J6X A;  5LJ5 j;  5GAM j;  5LJ5 g;  4M7D E;  4JRI A;  1I81 A;  2EWN A;  4PJO C;  4F7U B;  3BW1 A;  4M7A B;  2E10 A;  1D3B B;  3RKW A;  4C92 D;  3FIF A;  3M4G A;  5GAN 3;  2DZC A;  4V2S A;  1H64 1;  2DJZ A;  1TH7 A;  4XTX A;  1U1S A;  5GAN g;  5GAO p;  3RES A;  2VXF A;  5LJ5 e;  1JBM A;  3JCM P;  5LJ5 h;  4OP0 A;  4XU2 A;  5GAN 8;  2E1H A;  4N0A A;  4M77 F;  4MMK A;  3V8K A;  3V8J A;  1WQW A;  3AHU A;  4C92 A;  1WPY A;  2K57 A;  4M75 A;  5GAN 5;  5GMK i;  3JCM e;  5LJ3 f;  4XTZ A;  4M7A G;  2E64 A;  4PNO A;  3HFO A;  5LJ3 g;  4XTV A;  4XTY A;  4C92 G;  5LJ5 d;  2DTH A;  4XU1 A;  1KQ1 A;  1BIB A;  3QHS A;  3L2Z A;  4C92 B;  5GAN 6;  4F7U E;  4M75 B;  4XU3 A;  3JCM V;  3JB9 F;  4M75 D;  4M78 A;  4M7A E;  5LJ3 h;  4C8Q B;  4HT9 A;  2DVE A;  3JCM b;  4M75 E; 
#chains in the Genus database with same CATH topology
 1VYV A;  2C0T A;  2RQV A;  4Z02 A;  3MP8 A;  1YIT Q;  2E4H A;  5IT9 E;  3M56 A;  1IGQ A;  1AWW A;  3MO8 A;  2MCN A;  3JCM h;  1Q81 U;  4M7D C;  3QBY A;  1MMD A;  3CCM Q;  1ZX6 A;  2ZPE B;  4L5G A;  5FU7 C;  3J80 E;  2D8H A;  2CH4 A;  4KBM B;  4OMN A;  3WVD B;  1QCO A;  1PKT A;  2LCS A;  1YHQ Q;  3VS7 A;  1M1K C;  1G3S A;  3PIP A;  3A1P A;  2W10 A;  4ORZ A;  2LCC A;  4LNP A;  2DNU A;  4DOV A;  4LDX A;  4CRI A;  2HNI A;  3CEY A;  1H8K A;  2Y4Y A;  2D1X A;  1YN8 A;  2RF0 A;  5LJ3 e;  3NTH A;  1AVZ C;  1QWF A;  1SRM A;  1E6H A;  1ABO A;  4DBF A;  3OYH A;  2LNH B;  4M7D F;  2QQA A;  5J26 A;  2PUO B;  1KC8 R;  2V8K A;  1X43 A;  1M3A A;  2EYZ A;  5HK3 A;  3HPW A;  1WDX A;  1LPL A;  4LN2 A;  3EFR A;  1GCQ C;  1UGP B;  2MYS A;  1Y96 B;  3H0F A;  1XTD A;  4C8Q D;  1UDL A;  2X3W D;  1WHM A;  1M1G A;  4J6X A;  4QKU A;  2QDY B;  1OEB A;  2P0P A;  5DLQ E;  4N4H A;  4FW2 A;  3QDF A;  4LDV A;  1T3S A;  4J9E A;  2Y4X A;  2K57 A;  3CCQ A;  2QAZ A;  1YFN A;  3EFO A;  1V1C A;  4ESR A;  1TG0 A;  1BIB A;  1QP2 A;  2QI2 A;  1QVF S;  3OYK A;  1WI7 A;  1RAI B;  2O2O A;  4BAC A;  4M7A E;  2PUK B;  4VUB A;  3JCM b;  1OUL A;  2F69 A;  2QQ9 A;  1NPR A;  5L8R E;  4L6V 5;  3OBW A;  3TRE A;  3H6Z A;  4MML A;  4NOY A;  3M0P A;  1KQS P;  1ZBX A;  2P4T A;  2RI5 A;  4B9X A;  3L2W A;  1AWO A;  2YT6 A;  2KRO A;  2PVD B;  2CUB A;  3SWN B;  2IIM A;  2J06 A;  2QXF A;  2FPD A;  2FPE A;  4B9W A;  1XQH A;  2YUN A;  3KXT A;  4HCB A;  2QK0 A;  1AHJ B;  5GAO m;  1K1Z A;  1SSF A;  3G71 T;  5GMK m;  2EVR A;  1WHL A;  2DA9 A;  2OTJ T;  1LCK A;  4FL6 A;  2JMC A;  1AZG B;  3CXC P;  2JJ9 A;  4QQ6 A;  4DBQ A;  1QLY A;  1NLO C;  2IG0 A;  2IVW A;  3DKM A;  2FL7 A;  1BKB A;  3CCR Q;  2QEX Q;  2KE9 A;  3JSC A;  1OOT A;  1H64 1;  4JJD A;  1KG1 A;  3L2V A;  2A7Y A;  1Q86 C;  2PZ1 A;  1VQN Q;  1PNJ A;  1WPY A;  2KR3 A;  4NS5 A;  3QXE B;  4M7A G;  2JM9 A;  2KRN A;  5IHN A;  1R0B G;  2QDL A;  3TSZ A;  1WHK A;  3VYG A;  2K3B A;  3G4S T;  3JCM V;  3OYL A;  1MV0 B;  4M75 D;  5KYU A;  2EYY A;  3PNW C;  1R0C B;  2KEA A;  1PG5 B;  3JAM E;  4OGC A;  5DM7 R;  2V8J A;  3I56 A;  2QG9 B;  2RMO A;  5CVI A;  2VUB A;  4BY6 B;  3CC2 Q;  4C5G A;  1YWO A;  2PVO B;  1D3B A;  3RKY A;  1VQ4 A;  4QVZ A;  1JJ2 P;  4RTZ A;  4A4H A;  3OYM A;  2K7A A;  4PLL A;  4EMH A;  3P8D A;  3L1A A;  3JCM X;  2CH4 W;  3EAE A;  4PJJ A;  3G6E A;  2KI7 A;  2WSE E;  2LRQ A;  1JXM A;  1AWX A;  4M75 C;  1JXO A;  2LC4 A;  1QMC A;  1C6V X;  3OW2 A;  4M77 A;  2PNI A;  4C0G A;  1YWP A;  3JCM d;  4PJN A;  2DK3 A;  4Y92 A;  2D6F A;  3G4S Q;  3CC4 Q;  3CCQ Q;  3NHN A;  1OZ2 A;  5KYX A;  4CC7 A;  3C12 A;  3M0R A;  2CYZ B;  2HQX A;  1WIE A;  1FWZ A;  3A8M B;  4FYV B;  5KCH A;  4JLI A;  3H8Z A;  2J6O A;  4OMQ A;  2CZ1 B;  3MET A;  1VQ6 A;  2M16 A;  1Q82 U;  4ZNX A;  2DMO A;  4XTU A;  4MZT A;  3CPW P;  2D0N A;  3CPW A;  1PSE A;  4JPB W;  2EFI A;  4M77 C;  1MGQ A;  5GAM j;  1PRL C;  3M55 A;  2V1Q A;  5D6Y A;  3L2U A;  4RTW A;  5FRO A;  1MMG A;  1TUD A;  2VXF A;  1UTI A;  1VQL A;  2V1R A;  4KGV B;  1D1B A;  4OB0 B;  3EH2 A;  2CP3 A;  4M75 A;  5GMK i;  5D6X A;  2YUO A;  2YUP A;  4GY5 A;  3QHS A;  3A8H B;  2OI3 A;  4CI0 C;  2COZ A;  4RTV A;  5KE3 A;  2GF7 A;  2K9G A;  1Q86 U;  1ZUK A;  2X3X D;  1ZUU A;  2LQ8 A;  2FZG B;  3E9G A;  4M78 B;  4EMK C;  5FU6 B;  1NYF A;  3S3N A;  2OTL A;  2DIG A;  1T0J A;  3NTK A;  2DKG A;  1QVG S;  1X6O A;  3OS1 A;  2YXY A;  1JJ2 A;  2G3R A;  1RI9 A;  1YJN T;  1YIT A;  3RER A;  3M57 A;  1K8A C;  1S72 T;  4M7A A;  2O4X B;  1VQ6 T;  3EHQ A;  1OZ3 A;  2J7I A;  3DLL A;  3CME Q;  1KD1 C;  2FRW A;  5CKE A;  2LT1 A;  4IUR A;  1AD5 A;  4KGZ B;  2DAQ A;  1M90 C;  1YCS B;  5CK9 A;  2GQI A;  1HYO A;  4LDY A;  3J7A F;  3CBM A;  5D6W A;  5DLO A;  5CAI A;  4PFP A;  2RQT A;  4FYX B;  1E6G A;  4KH1 B;  1RAH B;  2VAS A;  1QWE A;  1MV3 A;  4M78 F;  2XK0 A;  5FU7 B;  1Y7X A;  3X28 B;  2EJ9 A;  2XDP A;  2A37 A;  3REB B;  1RI0 A;  1XNI A;  3ZEH A;  2RH2 A;  1YNZ A;  5HK0 A;  1LVK A;  1E7O A;  2SRC A;  4JJC A;  2A28 A;  3H0I A;  2DZC A;  4FSS A;  1ZSZ A;  1JBM A;  2DL4 A;  3A98 A;  3R6N A;  1IXD A;  5GAN 8;  1RAB B;  2CZ0 B;  1YHQ A;  2DL8 A;  1X6B A;  4HXJ A;  1XOV A;  2A3L A;  3G6E Q;  2CDT A;  2MWO A;  1N27 A;  2VWF A;  3QWY A;  1F1B B;  4EPC A;  1YJ9 A;  4RCC A;  2HAX A;  1UUE A;  1H3Z A;  1Z9Q A;  3NPF A;  3UDC A;  1M5Q 1;  4XU0 A;  2DZ9 A;  3ME9 A;  1Q7Y R;  1Z9Z A;  5GAO q;  1NEB A;  1MMN A;  3MEV A;  1RAD B;  1MHN A;  2FB7 A;  3SD4 A;  4IUV A;  3M0U A;  1OX8 A;  3CQT A;  1M1K R;  2BUD A;  4PJO B;  3VUB A;  4OMO A;  1I4K 1;  1GFD A;  1VQL Q;  1G83 A;  2EIF A;  1FMV A;  1BB9 A;  4JRP A;  1SHG A;  1D0Y A;  3LWI A;  4JJN K;  3INZ A;  3NFC A;  5GAM g;  2V26 A;  5IHK A;  1QVP A;  4F7U F;  1SEM A;  1W6X A;  1KC8 C;  5IH2 A;  1VOM A;  1M27 C;  2QQB A;  4TVR A;  2LQN A;  2CT4 A;  2DTI A;  3QG1 A;  2K5F A;  4MZP A;  4E47 A;  1B07 A;  2RJC A;  2DM1 A;  3QYG B;  4LD6 A;  5GAN 7;  5C0M A;  1K76 A;  5LJ5 g;  3P8B B;  4C5E A;  3SFM A;  4OGE A;  3CPW S;  3DLM A;  1V76 A;  4QQD A;  5AYF A;  4PJM A;  4E7I A;  2RPN A;  3I5S A;  3H41 A;  3X24 B;  2E1H A;  3VS0 A;  3X20 B;  3QDR B;  3VKI A;  3C95 A;  2C0I A;  3AHU A;  2HMA A;  3QPH A;  3L2Q A;  2ROT A;  2ATC B;  3JRZ A;  3M5A A;  3MEW A;  4F16 A;  1AOJ A;  2ZPH B;  2L3R A;  4IUQ A;  1Y0M A;  4X1V A;  4B6M A;  5GAN d;  1K8A R;  4QVD A;  2DE0 X;  3PIO A;  3CME T;  1SPK A;  3JB9 I;  1VQO T;  4BE1 A;  3CCL T;  4Z8A A;  5I22 A;  1YIJ T;  1N9R A;  1VQ9 T;  4C92 F;  4RG8 A;  2BZX A;  3WXM B;  1GBR A;  2E3I A;  3OYF A;  2H3E B;  3CPF A;  5J39 A;  1LNX A;  2FRY A;  3CD6 A;  5D7U A;  1D0X A;  3UT1 A;  2NLU A;  2VXE A;  2E12 A;  2FG0 A;  3CXC S;  3A5Z B;  2HCK A;  1OV3 A;  2CP0 A;  3UF4 A;  3EG9 B;  1YCY A;  1Q86 R;  4M7D B;  2CP7 A;  2RJD A;  5CKH A;  4A4K A;  4Y91 A;  2HD0 A;  2EQK A;  4RUG A;  1AWJ A;  4HT8 A;  2YLC A;  4ZGJ B;  2JOY A;  4MDW A;  1BK2 A;  4HCZ A;  1GRI A;  2H8H A;  3JCM c;  1XJW B;  5A0G A;  1Q81 C;  3M59 A;  4A4G A;  5GAN j;  1VQ6 Q;  1ZLM A;  3CMA Q;  1QVG P;  2DXC A;  2FZC B;  1UGR B;  3MHX A;  2CP6 A;  2E3H A;  2F2V A;  3URG A;  4JS5 A;  2DBK A;  3SDZ A;  1OPL A;  1K8A U;  1VQO Q;  4OP0 A;  4N0A A;  2XHC A;  5I2M A;  4C92 A;  4MDX A;  4PLI A;  3KBG A;  1IRX A;  1UEB A;  2AZS A;  2F5T X;  2L0A A;  1Y57 A;  1KQ1 A;  2K3X A;  4IUU A;  3CD6 T;  2JZ2 A;  3WVE B;  3I35 A;  4J9C A;  2ZPG B;  3CC7 Q;  1W2B S;  2BE7 D;  1TUC A;  1UFF A;  4M75 E;  4A53 A;  4X9D A;  2K6D A;  4BD3 A;  2AKL A;  3C94 A;  1X69 A;  5LJ3 j;  4ANJ A;  3SB2 A;  3O8V A;  2DEU A;  4M78 D;  3M53 A;  4OVA A;  3ULR B;  5FRN A;  2ED1 A;  3BE3 A;  2RHZ A;  1LJO A;  2E65 A;  1OPK A;  2R57 A;  3OMC A;  4KRT A;  1KFZ A;  4E6R A;  2ZZD A;  2NYS A;  4PJO G;  3IQL A;  5FW9 A;  2ZAE A;  1VQ4 Q;  4M78 E;  5GAN 2;  3GNG A;  1OU8 A;  1FMK A;  5GMK h;  2GQV A;  3FLG A;  2HQH A;  2LQK A;  5FWC A;  1T0H A;  1CSK A;  4J9H A;  5KYX B;  3CCQ T;  4KUL A;  2EQU A;  3CC7 T;  1NBE B;  2FEI A;  2PTK A;  3RBB B;  4R0K A;  5I21 A;  2JMA A;  4NL3 A;  3HFN A;  4PKC C;  1R77 A;  3G6E T;  3V7R A;  2GTO A;  3CCJ Q;  3CCV A;  2VC8 A;  1QKX A;  3OS5 A;  4F7U G;  5IXF A;  5IAY A;  3PMI A;  5HY6 A;  3JB9 J;  2OJ2 A;  2HEQ A;  1YI2 A;  2CS7 A;  3EG2 A;  1BYM A;  1SG5 A;  3HP9 A;  3NMZ C;  1WGS A;  4BI8 B;  3MCA B;  2HZY A;  4BY6 C;  1I0C A;  4QW2 A;  1Q95 G;  3RKW A;  3GP8 A;  2KVQ G;  4BUG A;  1NJI R;  4IUT A;  3V8K A;  2E70 A;  2X4Y A;  5IN1 A;  2J6K A;  4LDU A;  4XTZ A;  3THK A;  4E7J A;  1G3Y A;  1VQK Q;  3MP1 A;  1RUW A;  2XD0 A;  3EGD A;  5KCO A;  1I07 A;  1KHC A;  5LJ3 h;  4E7L A;  1O75 A;  3R6O A;  1P92 A;  1WYX A;  3HL8 A;  2MAM A;  1B34 B;  4J9G A;  1UGV A;  2DTO A;  5KYU B;  2NUP B;  2DJQ A;  2JN0 A;  2JS0 A;  4M7A C;  2PQW A;  2I2L A;  2RHX A;  5KH6 A;  3KUF A;  1K9M U;  2DYI A;  2GTJ A;  1UJ0 A;  4CC3 A;  2IPO B;  1K0X A;  1VQ7 Q;  1VQ8 T;  1KQS A;  3CCV T;  4C8Q E;  2EJF A;  3A8G B;  3I56 Q;  2MK5 A;  2QEX T;  4QT7 A;  3CCS A;  1YJ9 Q;  1WJS A;  1M8M A;  2M51 A;  2J05 A;  5GMK e;  2FYK A;  2NUT B;  3M4Y A;  1SHF A;  1VQM A;  3EHR A;  4J8O A;  4WTO B;  3OA6 A;  4FT2 A;  1KJW A;  1D0Z A;  1RAE B;  2L8D A;  5GAN 4;  2DXU A;  3X26 B;  1JO8 A;  2CGH A;  2VGN A;  2ZPI B;  1PD1 A;  4DEX A;  2RHU A;  2PU9 B;  3CCE Q;  2R5M A;  2MPX C;  5ECA A;  2ZPF B;  3NTI A;  2KRM A;  3ER0 A;  4HCC A;  3UA6 A;  4M78 G;  4J83 A;  3GLX A;  3CBP A;  2HKQ B;  2BZ8 A;  2EPD A;  1PKS A;  2WAC A;  1RAG B;  2CRE A;  2VV5 A;  1OQK A;  1MMA A;  3LLR A;  3JCM Q;  4GLM A;  5KYY A;  2YDL A;  4J9D A;  1H92 A;  1I81 A;  2EWN A;  3P8H A;  3UA7 A;  4C92 D;  2LMJ A;  4OF1 A;  4OMM A;  1M90 R;  1NEG A;  4E7K A;  1BI0 A;  2DD4 A;  1J3T A;  2FZK B;  4XU2 A;  5AT1 B;  4ELY C;  1Q82 R;  1GL5 A;  1U06 A;  3PVQ A;  2KBT A;  4K11 A;  1UGQ B;  2LZ6 B;  2EKO A;  3CCR A;  5C6S A;  2DRK A;  3OS2 A;  1VQM T;  1TWB A;  1VQK A;  3OYD A;  2SEM A;  1G8X A;  4IKF A;  1UEC A;  2MWP A;  4A4F A;  2EAY A;  4J6Y A;  2K5I A;  1JU5 C;  5A0D A;  5GAO n;  4AMC A;  2XIC A;  2COY A;  3PT9 A;  3QYH B;  1OU9 A;  2MOX A;  3OYE A;  1K9M R;  2VGM A;  3OB9 A;  1IHV A;  2Z0W A;  3LH5 A;  1Q82 C;  1B3Q A;  2Y90 A;  4HVU A;  4EMK A;  5LJ5 f;  1N8R R;  1ZA1 B;  1O9S A;  3HSB A;  3QII A;  1N8R C;  2CZ6 B;  4FT4 A;  2LP5 A;  1PRM C;  2KNB B;  2X4J A;  1M90 U;  2LCL A;  1PD0 A;  4ATO A;  1QVF P;  2XMF A;  3VS4 A;  4XK8 E;  1HXD A;  2DFU A;  3EH1 A;  3OSS C;  1HK9 A;  2EYX A;  5M9O A;  5KE2 A;  5CR2 A;  1B34 A;  3EG0 A;  2DET A;  2K3Y A;  2HSE B;  2DD5 A;  3CD6 Q;  1G5V A;  1W2B A;  3OS0 A;  3TEE A;  2L5Q A;  5GAN h;  4C92 C;  3L42 A;  4OB1 B;  4HVV A;  1MNE A;  1JRI A;  2A08 A;  1WFW A;  1GXI E;  4AT1 B;  4Z88 A;  1FXX A;  4DQ2 A;  2DEQ A;  1TUG B;  2K2V A;  4WF2 A;  4ZN1 A;  1W1F A;  1NPP A;  3EGX B;  4M7D E;  4JRI A;  1WXU A;  1QCN A;  2KYM A;  2XU8 A;  4O5V A;  3FIF A;  2F2X A;  2BIV A;  1KD1 R;  2DBM A;  1OX9 A;  1TSF A;  3EFO B;  3CC2 T;  4MMK A;  1VQP A;  2K4Y A;  1PC0 A;  3OYI A;  2JS2 A;  1X75 C;  5CIU A;  1M30 A;  4FIB A;  4C92 G;  2JTF A;  2DTH A;  2LTO A;  4J7F A;  5GAN 6;  2DL7 A;  2O9V A;  4AFQ C;  1QKW A;  2M02 A;  3QJ6 A;  1NG2 A;  2YRC A;  4BDZ A;  5GAM h;  2KT8 A;  3E2U A;  4Y28 E;  3CBO A;  2KDS A;  2F5K A;  1VQ5 A;  1VQN T;  1KSW A;  2XDB A;  2F1L A;  3OW2 S;  1RL2 A;  1GCQ A;  3HHT B;  4PFZ A;  3VS1 A;  1K73 C;  5GMK j;  2FO0 A;  2XI9 A;  1U1T A;  1PCX A;  3V7C A;  2QGF B;  1PHT A;  1WZO A;  1G3T A;  2YUQ A;  2ABL A;  1M2V A;  3HKS A;  2ESW A;  1IRE B;  1KK7 A;  1FX7 A;  1KIK A;  3EG9 A;  1I1J A;  3GOX A;  1TTH B;  3BFM A;  5FLX E;  1C1A A;  3CC2 A;  2C0O A;  4RMO A;  1M1K U;  2AT1 B;  3GPL A;  4BE0 A;  3CCU Q;  2BTT A;  4JS4 A;  1WXT A;  2K79 A;  1WNL A;  4PJO E;  4M7D G;  2A36 A;  1RAA B;  1PSF A;  1D09 B;  1VIE A;  4HCK A;  4F7U A;  5GAN f;  1WQ7 A;  5CCA A;  4R55 A;  3RMQ A;  1VQ8 Q;  2E10 A;  4XTX A;  2DVJ A;  4C0Z A;  3LW5 E;  5CKD A;  5LJ5 e;  2EGC A;  2KXC A;  2CUD A;  2HBP A;  3RDV A;  3CC4 A;  1BCO A;  4IUP A;  1K0S A;  4E7S A;  1VUB A;  1U3O A;  4XTV A;  4UC4 A;  2OTL T;  4J9I A;  1TOV A;  2EBP A;  3VRZ A;  2RJF A;  4F7U E;  2LX7 A;  5CQY A;  1K9M C;  2AK5 A;  4PL6 A;  2K2M A;  4D8D A;  2D9T A;  3A8O B;  1AZE A;  2HKN A;  2LDM A;  1YJN A;  4PFO A;  5DY9 A;  1ZA2 B;  4D8K A;  1S72 A;  4M77 E;  3FDR A;  2JNG A;  5KYW A;  4KH0 B;  2ENM A;  3VYH B;  2QYZ A;  1MND A;  4JRK A;  3ZFJ A;  1G3W A;  2FPF A;  4HVW A;  1W4S A;  3PGG A;  1EIF A;  2CZ7 B;  4X9C A;  2RK1 A;  5CO7 A;  4BDY A;  3TU4 K;  2E6N A;  3E1S A;  4M77 D;  1WHG A;  4NL2 A;  1M1F A;  4PJL A;  3JV3 A;  1AT1 B;  3SWN A;  1UG1 A;  2JTM A;  4M7A D;  3L2R A;  4RCB A;  1Y07 A;  3JCM J;  1TS9 A;  2RI3 A;  1BI1 A;  2CSQ A;  2EQM A;  2YWW A;  3CC4 T;  2EQJ A;  3V8L A;  2DXB A;  2C06 A;  1K9A A;  2M1H A;  1YP5 A;  2DO3 A;  2OAU A;  4AG2 C;  2XDD A;  1M4Z A;  2EYW A;  1S1N A;  3QO3 A;  4DA4 A;  2GBQ A;  5J3B A;  2RK2 A;  4R56 A;  1VYT A;  1K73 R;  1QW1 A;  2RQW A;  4LDW A;  3CME A;  1YHQ T;  4DBR A;  1YBY A;  4C0D B;  3RKX A;  4FYY B;  3OBY A;  2NWM A;  3CCL A;  2KQW A;  1YIJ A;  1N8R U;  1VQ9 A;  3DB4 A;  3M4G A;  1WHJ A;  4MZM A;  4V2S A;  1TH7 A;  3S6W A;  1K4U S;  4FU6 A;  4JLG A;  2VVK A;  1UJY A;  4RTU A;  5GAN 5;  1WA7 A;  2E64 A;  3I5R A;  3HFO A;  4PNO A;  4ZGE B;  2ZPB B;  2E5K A;  3O5Z A;  4P5N A;  3CCU T;  2GFU A;  3L2Z A;  1YI2 T;  2L2P A;  3F70 A;  4CC2 A;  7AT1 B;  2V8I A;  1EFN A;  2YRD A;  3ZL7 C;  2X35 A;  1TXQ A;  1IHW A;  3M9Q A;  3QUI A;  2LQW A;  4PJO F;  3OW2 P;  2E5Q A;  1QCF A;  3VS5 A;  1NLP C;  3X25 B;  2KYB A;  1D1A A;  2A0F B;  2COW A;  4KT0 E;  3MKD A;  2QA4 A;  3G4S A;  2EJG A;  1NJI C;  3FC3 A;  5GJW B;  2OAW A;  1SF9 A;  2E6Z A;  3I56 T;  4FM4 B;  5GAN e;  4RTY A;  1R8O B;  3CMA T;  4HA8 A;  3CCL Q;  2CP2 A;  2MI6 A;  3RNJ A;  4JZ4 A;  1VIF A;  1WX6 A;  1UB4 A;  4N4I A;  3I55 A;  4XQ3 A;  3FJP A;  4M75 F;  3OQ5 A;  3VS3 A;  1FMW A;  2KXD A;  3MP6 A;  3OMG A;  3OYJ A;  1UHF A;  4OMF B;  2QEX A;  2F2W A;  3E9F A;  4E7Z A;  3OYN A;  3A8L B;  3G71 Q;  2FHD A;  8ATC B;  2MF2 A;  1JQQ A;  1M3C A;  3TVT A;  3N5B B;  2HBW A;  3KFV A;  3AT1 B;  5I2S A;  5KYW B;  4J5Y A;  5CQX A;  4LD9 K;  1EZZ B;  2D8J A;  2KT1 A;  3VS2 A;  3S3M A;  2RHI A;  3LX7 A;  4N4G A;  2RD1 A;  4JUV A;  1I5L A;  1CKA A;  3UPU A;  2XG8 D;  1S72 Q;  3QZ5 B;  2HDA A;  1YJW T;  2L3S A;  1IO6 A;  4A63 B;  2LNV A;  3BW1 A;  4RG2 A;  4M7A B;  1VQ7 T;  4A4E A;  1TU0 B;  5GAN 3;  4IIM A;  2QA4 T;  2DJZ A;  4LUD A;  1YIJ Q;  2GGR A;  2H3J A;  4GBQ A;  3OYG A;  3JCM P;  5LJ5 h;  1ACM B;  4BI3 A;  1Q7Y C;  1M3B A;  2YRV A;  3V8J A;  3C4S A;  4KGX B;  3EG1 A;  3CMA A;  1X27 A;  1BI2 A;  2OTJ A;  6AT1 B;  4RTX A;  2JM8 A;  4AFZ C;  1UE9 A;  1SRL A;  3GBQ A;  1IZ6 A;  4D6W A;  3CC7 A;  4ME7 A;  3I55 T;  2MIO A;  2G6F X;  2RB6 A;  5LL6 S;  3QSU A;  3JB9 H;  1ARK A;  3MEA A;  4C8Q G;  3JB9 G;  2FVU A;  1RLP C;  5GAO l;  3CCM A;  2JW4 A;  4KUI A;  4M7D D;  2RM4 A;  4L59 A;  3LYI A;  3DB3 A;  4AFS C;  5GAM e;  1N9S A;  1WJQ A;  1PWT A;  2YLB A;  2KMT A;  1HD3 A;  1X01 A;  1UHC A;  4C92 E;  1ZHI A;  3QJY A;  5LJ3 d;  2YHT A;  1VQ5 Q;  3JCM f;  2BZY A;  2QTX A;  4YTL A;  3PTA A;  3TSW A;  3PVL A;  4II1 A;  2ZGW A;  1QVG A;  1FYN A;  1NM7 A;  1VQ7 A;  1YIT T;  3I55 Q;  3OYA A;  2DL3 A;  2AIR B;  2B86 A;  5GMK l;  2AHJ B;  2DRM A;  1SSH A;  1NZ9 A;  1KD1 U;  2K5L A;  1T3L A;  2LJ3 A;  1X2K A;  1W2B P;  1QP3 A;  2NUP A;  3HRS A;  2EYQ A;  2RO0 A;  2E41 A;  2M0Y A;  2R58 A;  4AFU C;  1ZSG A;  3EGX A;  3GNF B;  3SWN C;  1M2O A;  4CC4 B;  1GCP A;  4A54 A;  1VQ4 T;  4QVC A;  4XAX B;  2XKO C;  2HL5 C;  1ZSZ C;  3LWH A;  4KUD K;  2PVG B;  2KK4 A;  4AG1 C;  5KYY B;  5A2Q E;  2CP5 A;  1YJW Q;  1VQ8 A;  2W0Z A;  3CCM T;  1NYG A;  3HRT A;  4FCY A;  1G2B A;  1SKU B;  2O01 E;  2JT4 A;  4M77 F;  3VS6 A;  3VV0 A;  4X34 A;  4ZGD B;  3LH0 A;  2QTV A;  4ZN3 A;  3FJ5 A;  2RI2 A;  3CCS Q;  1OI1 A;  2EW3 A;  2M9U A;  3EG3 A;  1UGS B;  2RN8 A;  5CKF A;  1I5O B;  2L3P A;  4XU3 A;  2ECZ A;  1C0M A;  2OTJ Q;  1VQM Q;  4HT9 A;  2DVE A;  1ZQ1 A;  4E7H A;  2WSC E;  1QVF A;  4M7D A;  4QQG A;  2DIL A;  5CKB A;  2RNA A;  2DX1 A;  1GBQ A;  1BU1 A;  2QQS A;  1JB0 E;  3JB9 D;  3G71 A;  1X6G A;  2KAF A;  1M9S A;  3RIR A;  1DJ7 B;  1YJ9 T;  4XTW A;  1WXB A;  3ZBD A;  3G1J A;  3PMT A;  1I8F A;  4J6W A;  3PFS A;  5FRM A;  4C0D C;  3JCM W;  1BCM A;  4Z89 A;  4M77 B;  1U5S A;  1EX4 A;  3FB9 A;  3H0H A;  4C8Q C;  1N6A A;  2VKN A;  3JCM g;  2B8A A;  4HKE A;  3CXC A;  3T9N A;  3V7S A;  4M77 G;  1ZUY A;  1BI3 A;  3RMS A;  4F17 A;  1VQK T;  1NE8 A;  1LOJ A;  2P0K A;  2DER A;  3BY7 A;  1A0N B;  1WHH A;  3UWN A;  3M54 A;  4OB3 B;  4JDS A;  1Q81 R;  3RUX A;  3VJP A;  3PE0 A;  4F14 A;  2EGE A;  4M78 C;  4EMK B;  5EG2 A;  3G7Z A;  3OYY A;  2DLP A;  2P4R A;  1D3B B;  5KYN A;  1VA7 A;  4OML A;  1VQ9 Q;  2D0Q B;  4C5H A;  2LT4 A;  1RAF B;  2BE9 B;  1IB8 A;  3LGF A;  3QWX X;  1WQW A;  5GJV B;  2QAS A;  5IHI A;  3TQ7 P;  3JCM e;  3QKJ A;  3QZ9 B;  2YSQ A;  5LJ3 g;  4XTY A;  3VRY A;  3SHW A;  2DIQ A;  1CKB A;  4C92 B;  2LJ0 A;  2O31 A;  5I11 A;  4M78 A;  2L89 A;  2L3Q A;  1YI2 Q;  5EC7 A;  1HSQ A;  1U8R A;  3RR6 A;  3M58 A;  3MJX A;  3CCS T;  2DXT A;  2KY9 A;  1OYX A;  3D7S B;  1PM3 A;  4FSX A;  3VU3 C;  1BIA A;  2ED0 A;  4J9F A;  2KRS A;  5L23 A;  3H9N A;  2CSI A;  2X4X A;  3OYB A;  1Q7Y U;  1KHI A;  2WSF E;  3NGP A;  2P84 A;  1D1C A;  3OY9 A;  3VUZ A;  1KC8 U;  2EKH A;  1B7T A;  4BI4 A;  4RKU E;  1VQP T;  1GFC A;  2J6F A;  3UAT A;  4M7A F;  2NUZ A;  1ZBJ A;  5FU6 C;  3S3O A;  3HTR A;  4BB7 A;  2XID A;  2QGG A;  4C8Q A;  3BDL A;  1VQL T;  4GLK A;  4LUE A;  1VQP Q;  2VB6 A;  2EGA A;  5GAO r;  1N5Z A;  5IXB A;  2AZV A;  2MMP A;  2OX7 A;  2ROL A;  2JVV A;  1K73 U;  2AKK A;  1V29 B;  2KSS A;  2X4W A;  1VQ5 T;  1VQN A;  4M75 G;  3EGU A;  2GFA A;  1RLQ C;  4WCI A;  2QA4 Q;  2DYB A;  5LJ5 j;  4C5I A;  3GF5 A;  5HKC A;  4F7U B;  3CCR T;  4C0F A;  1IGU A;  5GAN g;  1U1S A;  4DOW A;  5GAO p;  2LX9 A;  3ASK A;  3M0Q A;  1JJ2 S;  3RES A;  4RTT A;  2O4X A;  3CCE A;  1M2V B;  2RJE A;  5HCK A;  5LJ3 f;  2X9H A;  3OSV A;  2JXB A;  4EIK A;  1QQJ A;  4M75 B;  4FYW B;  2GCX A;  3JB9 F;  2JUF A;  4OMP A;  3J81 E;  4LXC A;  5FWB A;  2OTL Q;  2R5A A;  5A0L A;  3MPU B;  4O6J A;  1WLP B;  3REA B;  3FRN A;  2HQE A;  3GIB A;  1Y96 A;  4C8Q F;  3C0C A;  3OYC A;  3CCU A;  1Y71 A;  3EFS A;  2X51 A;  2RQU A;  3FEO A;  3I9Q A;  3CCJ A;  3CCV Q;  2RHY A;  5GAM f;  3M0T A;  4ZTF A;  2O9S A;  9ATC B;  4PJO A;  4OB2 B;  1M8V A;  1HJD A;  3SEM A;  2O88 A;  2RQR A;  2CKK A;  1ZSZ B;  2RA2 A;  1WJR A;  4DBH A;  4F04 B;  4E2F B;  4N0A C;  2VYT A;  4FW1 A;  4IIO A;  4PJO D;  4J7I A;  2NUT A;  2M0O A;  3EGD B;  4ELZ C;  3CCE T;  1W70 A;  1AEY A;  2BKD N;  1X2Q A;  5GAM d;  2ZCF B;  4JRQ A;  1KQ2 A;  1RAC B;  4EDU A;  4J9B A;  4BE2 A;  4EMG A;  1JEG A;  2P0Q A;  1VQO A;  2GNC A;  3TCJ A;  2DL5 A;  1KQS S;  8AT1 B;  2DF6 A;  2HL3 A;  1NJI U;  2EQI A;  3M0S A;  1YJN Q;  4JZ3 A;  4PJO C;  2DPP B;  2LVM A;  1H3H A;  4LE9 A;  3Q1J A;  1MUZ A;  2HSP A;  3MEU A;  3HRU A;  4Q5W A;  3CCJ T;  2I0N A;  3U23 A;  4PK4 A;  5LJ5 d;  3E19 A;  4M4Z A;  1BBZ A;  4JJB A;  4XU1 A;  2QQR A;  1VYU A;  2CT3 A;  1YJW A;  1ABQ A;  2LJ1 A;  3LGL A;  2KGT A;  4DEY A;  4C8Q B;  4ZTJ A;  3BDU A;  2JTE A; 
#chains in the Genus database with same CATH homology
 2MWP A;  4ME7 A;  4EPC A;  4A4F A;  3I55 T;  4Z02 A;  2EAY A;  3MP8 A;  1YJ9 A;  4J6Y A;  5IT9 E;  2K5I A;  2RB6 A;  3M56 A;  4RCC A;  5LL6 S;  2HAX A;  1H3Z A;  3QSU A;  3UDC A;  5A0D A;  3MO8 A;  5GAO n;  3MEA A;  3JB9 H;  3JCM h;  1Q81 U;  1M5Q 1;  2XIC A;  3PT9 A;  4XU0 A;  4C8Q G;  3QYH B;  2DZ9 A;  3JB9 G;  2FVU A;  3ME9 A;  3QBY A;  5GAO l;  3OYE A;  3CCM A;  4M7D C;  4KUI A;  2VGM A;  4M7D D;  2RM4 A;  4L59 A;  3OB9 A;  3LYI A;  2ZPE B;  3DB3 A;  5GAO q;  4L5G A;  5FU7 C;  5GAM e;  3J80 E;  1Q82 C;  1N9S A;  2Y90 A;  1WJQ A;  3MEV A;  2YLB A;  2KMT A;  1MHN A;  2FB7 A;  4KBM B;  3SD4 A;  4IUV A;  3WVD B;  1X01 A;  4EMK A;  5LJ5 f;  4C92 E;  1ZHI A;  1O9S A;  3HSB A;  3QJY A;  5LJ3 d;  3QII A;  1N8R C;  2CZ6 B;  4FT4 A;  2YHT A;  2BUD A;  1M1K C;  3JCM f;  2QTX A;  4YTL A;  3PTA A;  1G3S A;  2X4J A;  3PIP A;  1M90 U;  4II1 A;  4PJO B;  2ZGW A;  3VUB A;  1QVG A;  1I4K 1;  2LCC A;  4DOV A;  4LDX A;  4CRI A;  2LCL A;  1VQ7 A;  2HNI A;  3CEY A;  4ATO A;  2Y4Y A;  1YIT T;  1HXD A;  4XK8 E;  3OSS C;  1HK9 A;  5LJ3 e;  2EIF A;  3OYA A;  4JRP A;  3LWI A;  3NTH A;  4JJN K;  5GMK l;  3INZ A;  3NFC A;  2AHJ B;  5M9O A;  5GAM g;  5KE2 A;  5CR2 A;  1B34 A;  1NZ9 A;  2K3Y A;  3OYH A;  2K5L A;  1QVP A;  4F7U F;  2DD5 A;  1KD1 U;  4M7D F;  1KC8 C;  1G5V A;  2QQA A;  1W2B A;  1QP3 A;  3HRS A;  2EYQ A;  2PUO B;  5J26 A;  2RO0 A;  2E41 A;  3TEE A;  3OS0 A;  2V8K A;  2L5Q A;  2R58 A;  4C92 C;  5HK3 A;  3L42 A;  3HPW A;  5GAN h;  4OB1 B;  1JRI A;  3EFR A;  2QQB A;  4TVR A;  1UGP B;  1GXI E;  3GNF B;  2DTI A;  1FXX A;  1Y96 B;  4DQ2 A;  2DEQ A;  1XTD A;  2K5F A;  3QG1 A;  3SWN C;  4MZP A;  4C8Q D;  2K2V A;  4E47 A;  4WF2 A;  4ZN1 A;  2RJC A;  1NPP A;  4A54 A;  1VQ4 T;  1M1G A;  3QYG B;  4LD6 A;  4QVC A;  4XAX B;  2XKO C;  5GAN 7;  5C0M A;  4J6X A;  3LWH A;  5LJ5 g;  4M7D E;  4KUD K;  4JRI A;  3P8B B;  4C5E A;  2PVG B;  2XU8 A;  4O5V A;  3SFM A;  3FIF A;  2KK4 A;  4OGE A;  2QDY B;  3DLM A;  5A2Q E;  3CPW S;  1VQ8 A;  2BIV A;  4QQD A;  2P0P A;  5AYF A;  5DLQ E;  4N4H A;  3CCM T;  4E7I A;  3HRT A;  4LDV A;  2O01 E;  3X24 B;  2E1H A;  3CC2 T;  3X20 B;  4M77 F;  3QDR B;  3VKI A;  3C95 A;  4MMK A;  2K4Y A;  1VQP A;  3VV0 A;  3AHU A;  2Y4X A;  4X34 A;  2K57 A;  4ZGD B;  3OYI A;  3LH0 A;  1X75 C;  3QPH A;  4ZN3 A;  2RI2 A;  5CIU A;  1OI1 A;  4FIB A;  2M9U A;  4C92 G;  3L2Q A;  3CCQ A;  2JTF A;  1UGS B;  2DTH A;  2LTO A;  4J7F A;  1BIB A;  1QP2 A;  2QI2 A;  3JRZ A;  5CKF A;  5GAN 6;  3OYK A;  1QVF S;  4XU3 A;  3M5A A;  4BAC A;  4M7A E;  3MEW A;  3QJ6 A;  2PUK B;  4HT9 A;  2DVE A;  4VUB A;  1ZQ1 A;  3JCM b;  4BDZ A;  2F69 A;  2QQ9 A;  1NPR A;  5L8R E;  4E7H A;  4L6V 5;  2WSC E;  3OBW A;  5GAM h;  1QVF A;  2ZPH B;  3TRE A;  4Y28 E;  4M7D A;  2L3R A;  4IUQ A;  3CBO A;  4QQG A;  3H6Z A;  5CKB A;  5GAN d;  2KDS A;  2F5K A;  1VQ5 A;  1VQN T;  4MML A;  4QVD A;  4NOY A;  2XDB A;  3PIO A;  3CME T;  3OW2 S;  2QQS A;  1RL2 A;  1JB0 E;  3JB9 D;  1ZBX A;  3G71 A;  3HHT B;  3JB9 I;  1VQO T;  2KAF A;  1M9S A;  4BE1 A;  3CCL T;  1K73 C;  2P4T A;  2RI5 A;  1YIJ T;  1N9R A;  1VQ9 T;  4B9X A;  3RIR A;  5GMK j;  1DJ7 B;  4C92 F;  1YJ9 T;  4RG8 A;  3L2W A;  4XTW A;  3WXM B;  3ZBD A;  3OYF A;  2PVD B;  3PMT A;  2XI9 A;  1VQ6 A;  1U1T A;  1I8F A;  3CPF A;  4J6W A;  3SWN B;  3PFS A;  5FRM A;  5J39 A;  1LNX A;  2QXF A;  3CD6 A;  3V7C A;  4B9W A;  4C0D C;  1XQH A;  3JCM W;  3KXT A;  4HCB A;  4M77 B;  3UT1 A;  1G3T A;  2NLU A;  3FB9 A;  4C8Q C;  2VXE A;  1AHJ B;  1N6A A;  2E12 A;  1IRE B;  3HKS A;  5GAO m;  1FX7 A;  1SSF A;  3G71 T;  3GOX A;  3JCM g;  5GMK m;  2B8A A;  4HKE A;  3CXC A;  3BFM A;  3T9N A;  5FLX E;  3V7S A;  3CXC S;  4M77 G;  3A5Z B;  3CC2 A;  4RMO A;  1M1K U;  1BI3 A;  2OTJ T;  1YCY A;  4FL6 A;  4M7D B;  3GPL A;  3RMS A;  2RJD A;  5CKH A;  4A4K A;  4BE0 A;  1NE8 A;  1LOJ A;  1VQK T;  2P0K A;  3BY7 A;  4Y91 A;  4JS4 A;  2HD0 A;  2EQK A;  3UWN A;  4HT8 A;  1WNL A;  3M54 A;  4PJO E;  4OB3 B;  2YLC A;  4JDS A;  4M7D G;  4ZGJ B;  2JOY A;  4MDW A;  3RUX A;  4HCZ A;  1PSF A;  3VJP A;  4QQ6 A;  3JCM c;  1VIE A;  5A0G A;  4F7U A;  1Q81 C;  3M59 A;  2IG0 A;  4A4G A;  5GAN j;  5GAN f;  2IVW A;  3DKM A;  2FL7 A;  1WQ7 A;  4M78 C;  1BKB A;  4EMK B;  5EG2 A;  5CCA A;  3G7Z A;  3OYY A;  4R55 A;  2DXC A;  3RMQ A;  1UGR B;  3MHX A;  2E10 A;  1D3B B;  3JSC A;  1H64 1;  4XTX A;  2D0Q B;  4C5H A;  3URG A;  2LT4 A;  3LW5 E;  4C0Z A;  4JS5 A;  3SDZ A;  5CKD A;  1KG1 A;  5LJ5 e;  3L2V A;  1K8A U;  2HBP A;  2A7Y A;  4OP0 A;  4N0A A;  2XHC A;  5I2M A;  3CC4 A;  4IUP A;  3LGF A;  1Q86 C;  1WQW A;  4C92 A;  1WPY A;  4MDX A;  4NS5 A;  1VUB A;  3QXE B;  4PLI A;  3KBG A;  3JCM e;  4M7A G;  3QKJ A;  1UEB A;  3QZ9 B;  5LJ3 g;  4XTV A;  4XTY A;  2F5T X;  4UC4 A;  2DIQ A;  2OTL T;  1KQ1 A;  3VYG A;  2RJF A;  4C92 B;  2K3X A;  4IUU A;  4F7U E;  3CD6 T;  2JZ2 A;  3WVE B;  3G4S T;  5CQY A;  3JCM V;  3OYL A;  4M75 D;  4M78 A;  2L89 A;  2ZPG B;  1K9M C;  1W2B S;  4PL6 A;  4M75 E;  2D9T A;  3PNW C;  4A53 A;  1U8R A;  3A8O B;  4OGC A;  4X9D A;  5DM7 R;  3JAM E;  2LDM A;  2V8J A;  3I56 A;  4BD3 A;  3M58 A;  3C94 A;  3CCS T;  2DXT A;  1YJN A;  5LJ3 j;  5DY9 A;  2KY9 A;  3O8V A;  5CVI A;  3SB2 A;  1OYX A;  2VUB A;  4M78 D;  4BY6 B;  1S72 A;  3M53 A;  4M77 E;  4FSX A;  3FDR A;  3VU3 C;  1BIA A;  4OVA A;  2JNG A;  4C5G A;  5FRN A;  2RHZ A;  1LJO A;  2X4X A;  2E65 A;  2R57 A;  3OMC A;  3VYH B;  2PVO B;  1D3B A;  4JRK A;  3RKY A;  3ZFJ A;  1G3W A;  1W4S A;  1VQ4 A;  3PGG A;  2ZZD A;  4QVZ A;  3OYB A;  1EIF A;  2CZ7 B;  4X9C A;  4PJO G;  2RK1 A;  4A4H A;  3OYM A;  1Q7Y U;  4PLL A;  5CO7 A;  1KHI A;  2WSF E;  3L1A A;  3P8D A;  4M78 E;  4EMH A;  3JCM X;  3EAE A;  5GAN 2;  4BDY A;  2E6N A;  3TU4 K;  3E1S A;  3GNG A;  4M77 D;  3G6E A;  2WSE E;  5GMK h;  2LRQ A;  1M1F A;  4NL2 A;  4M75 C;  2LC4 A;  3OY9 A;  3VUZ A;  3SWN A;  1KC8 U;  2JTM A;  2GQV A;  4BI4 A;  3FLG A;  4RKU E;  2LQK A;  1VQP T;  4M7A D;  3OW2 A;  3L2R A;  4RCB A;  4M77 A;  4M7A F;  1Y07 A;  3JCM J;  4C0G A;  2RI3 A;  3JCM d;  5FU6 C;  3S3O A;  1BI1 A;  3CCQ T;  2EQM A;  4KUL A;  2EQU A;  2DK3 A;  3CC4 T;  2EQJ A;  3CC7 T;  3V8L A;  2D6F A;  2DXB A;  2XID A;  4BB7 A;  2C06 A;  1OZ2 A;  5I21 A;  4C8Q A;  2M1H A;  3BDL A;  1VQL T;  3C12 A;  4NL3 A;  3HFN A;  4GLK A;  4PKC C;  2CYZ B;  3G6E T;  3V7R A;  2DO3 A;  2HQX A;  3CCV A;  2OAU A;  1FWZ A;  2VC8 A;  3A8M B;  5KCH A;  5GAO r;  4JLI A;  2XDD A;  3OS5 A;  1M4Z A;  2MMP A;  4F7U G;  3QO3 A;  4DA4 A;  3H8Z A;  5J3B A;  2CZ1 B;  2JVV A;  3MET A;  1K73 U;  2RK2 A;  1V29 B;  5IAY A;  2X4W A;  2KSS A;  3PMI A;  4R56 A;  2M16 A;  1Q82 U;  1VQ5 T;  5HY6 A;  1VQN A;  1QW1 A;  4M75 G;  4MZT A;  2GFA A;  4XTU A;  3CME A;  4LDW A;  3JB9 J;  2CS7 A;  3CPW A;  1YHQ T;  1YI2 A;  3HP9 A;  1YBY A;  1BYM A;  4C0D B;  1PSE A;  1WGS A;  2EFI A;  3RKX A;  1MGQ A;  3MCA B;  3OBY A;  4M77 C;  3M55 A;  4BI8 B;  4C5I A;  5LJ5 j;  3GF5 A;  2KQW A;  4BY6 C;  5GAM j;  1YIJ A;  4QW2 A;  3CCL A;  5HKC A;  4F7U B;  3RKW A;  3DB4 A;  3CCR T;  4C0F A;  5D6Y A;  3GP8 A;  3L2U A;  1N8R U;  1VQ9 A;  2KVQ G;  3M4G A;  5FRO A;  4MZM A;  4V2S A;  1TH7 A;  5GAN g;  1U1S A;  4DOW A;  5GAO p;  2LX9 A;  3ASK A;  3S6W A;  4BUG A;  1JJ2 S;  3RES A;  2VXF A;  4FU6 A;  4JLG A;  1VQL A;  4IUT A;  2O4X A;  3CCE A;  3V8K A;  2E70 A;  2RJE A;  2X4Y A;  4OB0 B;  5IN1 A;  4LDU A;  4M75 A;  5GAN 5;  5GMK i;  5D6X A;  5LJ3 f;  4XTZ A;  2E64 A;  4PNO A;  3HFO A;  4ZGE B;  2ZPB B;  3OSV A;  4E7J A;  4GY5 A;  4P5N A;  3CCU T;  1G3Y A;  3QHS A;  2GFU A;  3L2Z A;  1YI2 T;  3A8H B;  3MP1 A;  4M75 B;  3F70 A;  2XD0 A;  2GCX A;  5KCO A;  4CI0 C;  2V8I A;  3JB9 F;  2JUF A;  1KHC A;  5LJ3 h;  5KE3 A;  2GF7 A;  2X35 A;  4E7L A;  1Q86 U;  1O75 A;  3R6O A;  1P92 A;  3J81 E;  3HL8 A;  2MAM A;  1B34 B;  3M9Q A;  3QUI A;  4PJO F;  2LQ8 A;  2E5Q A;  2DTO A;  2R5A A;  3E9G A;  4M78 B;  3X25 B;  4EMK C;  5FU6 B;  5A0L A;  2OTL A;  3S3N A;  4O6J A;  2JN0 A;  2DIG A;  4KT0 E;  4M7A C;  2QA4 A;  2PQW A;  2I2L A;  3NTK A;  3G4S A;  2EJG A;  2DKG A;  2RHX A;  5KH6 A;  3KUF A;  3FRN A;  1NJI C;  2HQE A;  1K9M U;  3FC3 A;  1QVG S;  3GIB A;  1X6O A;  1Y96 A;  4C8Q F;  3OS1 A;  3OYC A;  3CCU A;  1JJ2 A;  1Y71 A;  3EFS A;  2E6Z A;  1VQ8 T;  1KQS A;  2G3R A;  3FEO A;  3I56 T;  4FM4 B;  3CCV T;  4C8Q E;  2EJF A;  3A8G B;  5GAN e;  3CCJ A;  2QEX T;  3CCS A;  1YIT A;  1R8O B;  2RHY A;  5GAM f;  3RER A;  1WJS A;  3M57 A;  1K8A C;  4ZTF A;  3CMA T;  1S72 T;  4PJO A;  4M7A A;  4HA8 A;  2O4X B;  1VQ6 T;  4OB2 B;  1M8V A;  1OZ3 A;  5GMK e;  2FYK A;  2MI6 A;  3M4Y A;  1YJN T;  3DLL A;  1VQM A;  2CKK A;  1KD1 C;  2RA2 A;  1WJR A;  4J8O A;  3OA6 A;  4N0A C;  4FT2 A;  2LT1 A;  2VYT A;  5CKE A;  4IUR A;  1VIF A;  4N4I A;  1UB4 A;  3I55 A;  4J7I A;  4PJO D;  5GAN 4;  2L8D A;  2M0O A;  4XQ3 A;  2DXU A;  2DAQ A;  1M90 C;  3X26 B;  5CK9 A;  3FJP A;  2CGH A;  2VGN A;  4M75 F;  2ZPI B;  3OQ5 A;  4LDY A;  4ELZ C;  3CCE T;  3MP6 A;  3OMG A;  3J7A F;  3OYJ A;  2RHU A;  2PU9 B;  2R5M A;  2BKD N;  3CBM A;  5D6W A;  2ZPF B;  5CAI A;  5DLO A;  4OMF B;  3NTI A;  2QEX A;  5GAM d;  3E9F A;  3ER0 A;  2ZCF B;  3OYN A;  4JRQ A;  4HCC A;  1KQ2 A;  3A8L B;  4M78 G;  4J83 A;  2FHD A;  4EDU A;  2MF2 A;  3GLX A;  2XK0 A;  3CBP A;  4M78 F;  5FU7 B;  4EMG A;  1Y7X A;  3X28 B;  4BE2 A;  2P0Q A;  2EJ9 A;  2XDP A;  3N5B B;  1VQO A;  5I2S A;  1RI0 A;  4J5Y A;  3TCJ A;  5CQX A;  2WAC A;  4LD9 K;  1XNI A;  3ZEH A;  2VV5 A;  2RH2 A;  3S3M A;  3LLR A;  2RHI A;  3LX7 A;  5HK0 A;  3JCM Q;  1KQS S;  4N4G A;  2RD1 A;  4JUV A;  1I5L A;  3UPU A;  2XG8 D;  3QZ5 B;  1YJW T;  1NJI U;  1I81 A;  2EWN A;  3P8H A;  4PJO C;  2LNV A;  3BW1 A;  4RG2 A;  4M7A B;  4C92 D;  1VQ7 T;  4OF1 A;  4A4E A;  2DPP B;  5GAN 3;  2DZC A;  2QA4 T;  2DJZ A;  2LVM A;  4E7K A;  3Q1J A;  1BI0 A;  2H3J A;  3OYG A;  2DD4 A;  1JBM A;  3JCM P;  5LJ5 h;  4XU2 A;  4BI3 A;  3MEU A;  5GAN 8;  1Q7Y C;  3HRU A;  2YRV A;  3V8J A;  1YHQ A;  2CZ0 B;  3C4S A;  4Q5W A;  4ELY C;  1XOV A;  2A3L A;  3CCJ T;  1UGQ B;  5LJ5 d;  3CMA A;  2EKO A;  3E19 A;  2MWO A;  1BI2 A;  3CCR A;  1N27 A;  4XU1 A;  5C6S A;  2OTJ A;  2QQR A;  1YJW A;  3OS2 A;  3LGL A;  1VQM T;  1VQK A;  3OYD A;  4C8Q B;  4ZTJ A;  3BDU A;  1IZ6 A;  4IKF A;  4D6W A;  3CC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...