4F7UG

The 6s snrnp assembly intermediate
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
PELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 12
structure length 68
sequence length 68
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uG00
1X01A 3V7CA 4J6YA 2DTIA 4M75B 5GMKj 4PJOG 2RM4A 1D3BA 5LJ3e 5LJ3g 1JBMA 4NL2A 3JCMQ 5GAN5 1HXDA 2VXEA 5LJ5g 3AHUA 2DTOA 2EJGA 4M78B 3V8JA 5LJ5e 5GAOp 3RERA 3JCMe 5GANh 1U1TA 3L2ZA 4X9CA 4F7UB 2DXTA 4NL3A 2VC8A 1WQ7A 3FJPA 4F7UA 3RESA 5GAOr 1Y96B 4Y91A 2JN0A 4C8QD 5GMKl 3JB9J 5DY9A 1I5LA 4M7AA 4PJOC 3M4GA 5GAN6 2CGHA 1KQ2A 4V2SA 2HNIA 5LJ3d 4XU3A 2RB6A 4A54A 3BW1A 4J6XA 5GMKi 1JRIA 2RA2A 4M77D 4PJOE 4NOYA 3JCMV 3JCMc 5LJ5d 3SWNC 4J5YA 5GMKe 5CAIA 4M77G 2K57A 4XTUA 4XU1A 3HSBA 1BIBA 4PJOF 4M7DB 2EJFA 5GAMf 4N0AC 3EFRA 2EWNA 5LJ5h 1I4K1 4M75A 2DXUA 4M7DD 2VXFA 3JCMg 3JB9D 2DKGA 2DVEA 4C8QC 4QVDA 5GANj 1MGQA 5GAOq 5GAOm 4M78A 4MMKA 4EMGA 4M7DG 3BFMA 3JB9G 1M5Q1 4M7AD 1LOJA 4C8QE 4C92D 2E10A 4X9DA 3QSUA 1B34B 2DTHA 3QO3A 4M77C 4C92G 5GAMj 1Y96A 2YLBA 3HFOA 3V7SA 4C8QF 1B34A 4C8QG 3RUXA 4M77E 4JRIA 5GANf 2YLCA 3RIRA 1I8FA 5GMKh 4PJOB 3V8LA 4JRKA 4M77F 2DZ9A 2E64A 3V8KA 1LNXA 3SB2A 4M75D 4XTYA 3JCMd 4RCBA 3JCMJ 4M7DC 1M8VA 1HK9A 5LJ3h 4HA8A 3SWNB 4M75G 4M7DE 2ZGWA 3VU3C 5GANe 1LJOA 4M7AC 4RCCA 3JCMh 4C92C 3FIFA 2DJZA 2YHTA 4M7DF 4M7AE 4JUVA 4MMLA 5GAN7 4EMKC 3JB9F 4C92E 1WQWA 4XTZA 2FYKA 4XTXA 4F7UG 5I21A 1H641 3V7RA 3BY7A 5GAMg 4C8QB 5GAMe 1N9SA 3L1AA 4M7AF 4A53A 5GAOl 4M7AG 3INZA 4C92F 4XTWA 4XU2A 5LJ5f 1BIAA 4XQ3A 4OP0A 3RKXA 2Y90A 4M75C 5GAN8 4M77B 2QTXA 1D3BB 2DEQA 2EJ9A 3QUIA 4HT8A 2FB7A 2E65A 1YCYA 4M78C 4M75E 2EAYA 4M77A 4XTVA 3JCMW 1WNLA 4DQ2A 4EMHA 4PJOA 3JCMb 5LJ3j 4M78E 3EFSA 4M75F 3GIBA 3FB9A 1I81A 2E1HA 4M78D 1TH7A 3HFNA 4F7UE 5LJ5j 5GAMd 5GANg 3SWNA 5GMKm 3JCMX 4M78F 2RD1A 2I2LA 4M7DA 4M78G 2E41A 4XU0A 2DZCA 4M7AB 4QVCA 4WF2A 1N9RA 3RKYA 4F7UF 4C92B 5GAN3 5GAN4 5GAMh 3JB9H 4N0AA 3JB9I 4HT9A 5LJ3f 4C92A 4JLIA 4EMKB 5GAOn 3PGGA 4C8QA 1WPYA 4J6WA 3JCMP 3BDUA 4PNOA 4EMKA 3QHSA 3JCMf 3RKWA 5GAN2 4PJOD 1U1SA 1KQ1A 5GANd
chains in the Genus database with same CATH superfamily
1TUDA 3EG9A 3P8HA 4E6RA 2FPEA 4RTUA 1HXDA 3CPFA 2DTOA 3RERA 1I5OB 3M58A 4OMMA 3L2QA 3THKA 4V2SA 3PFSA 1R0BG 2O01E 1KQ2A 1VQ4T 2AHJB 4FYVB 4F14A 2KY9A 4PJOE 3R6NA 1FMKA 3SWNC 4PLIA 2YRVA 1ZBXA 1NLPC 2KYBA 4F17A 2EWNA 4JRPA 3CXCP 2EYQA 4HXJA 2XDDA 3TREA 4C92D 3I55A 3CCQT 2LQKA 2YLBA 1PC0A 2W0ZA 3CCJA 1MMNA 2BKDN 2A3LA 1WHJA 3EGXB 1I8FA 1WLPB 4M77F 3EGXA 2AKLA 5HKCA 1Q81R 2R5AA 3FEOA 4PFZA 4BDYA 1X75C 4M75G 1HYOA 2FZGB 2P0KA 2DL8A 4QQGA 1MV3A 2HKQB 1W4SA 2P0QA 3TQ7P 2KE9A 3CC7Q 1T3LA 3QG1A 1R8OB 1WIEA 1W2BA 5CK9A 1GBRA 2O4XB 2MWOA 4LUEA 1GFCA 2RI2A 4HVUA 5D7UA 4OGCA 1QVFS 2JS0A 2EAYA 1NPRA 4EIKA 1NM7A 1H3ZA 3S3NA 4OB3B 2BZYA 5LJ5j 2E41A 2RJDA 4FSXA 5GAMh 1YI2A 4N0AA 3QYHB 4DBRA 5LJ3f 1AEYA 1TG0A 4LDUA 3QIIA 1Q82R 4HCKA 1SF9A 1M9SA 3URGA 1WJRA 3OS0A 1WX6A 2EQIA 3CCJT 1X01A 4A4FA 4M75B 2J7IA 3UWNA 1WDXA 1W1FA 3M0RA 4M78B 3T9NA 1K9MR 2PQWA 2DD5A 2GBQA 1AWWA 5GMKl 1WHHA 2HL3A 1VIEA 2V8KA 5GAN6 4GLKA 2I0NA 2CT3A 1JXMA 1ABOA 2KNBB 3NMZC 4N0AC 3UF4A 3A8GB 1VQ6A 3CBPA 1S72Q 3M0QA 2MIOA 1PWTA 1X69A 2XKOC 1ZBJA 4MMKA 1M90C 1O75A 1T0HA 1M5Q1 2KEAA 1WFWA 3LLRA 3OMGA 3JV3A 2NUTB 3QXEB 4C92G 2DXBA 2CP6A 3KXTA 1HSQA 2F1LA 3G7ZA 4BI4A 4JRKA 2GCXA 2E64A 2QDYB 1M3AA 4BE1A 2DRKA 1D1CA 3X26B 1JQQA 4KBMB 2DJZA 4KGZB 3CMEQ 4M7AE 3TEEA 4F16A 1G3TA 3OW2S 1T0JA 2KXDA 2SEMA 1FXXA 1B7TA 2CUDA 3BY7A 1H3HA 3S6WA 1VIFA 2C0IA 2NUPB 3GLXA 1WJQA 4RG8A 2RHXA 2NUPA 2JNGA 1A0NB 1AHJB 1PKSA 2K2MA 2YUNA 3NGPA 4E7ZA 1TOVA 3GNGA 2QXFA 1WNLA 2HDAA 1D0XA 2EFIA 1OZ3A 1C0MA 2QYZA 2OAWA 2GQIA 2I2LA 1D0YA 3OMCA 4QQDA 2YUQA 2JMCA 1VQ6T 4C92B 1VQ7A 2LX7A 4PJNA 3C4SA 3DLLA 2BUDA 3X20B 2LC4A 4C92A 3PGGA 3JCMP 4DEYA 4PNOA 2Y4YA 2DLPA 3GNFB 2HL5C 3E9GA 3JSCA 4J6YA 3CC2A 3H9NA 2A7YA 2CZ7B 1Q86R 2CSIA 3QDRB 3U23A 3JCMe 4Q5WA 5GAOr 3VRYA 2DBKA 3P8DA 1MMGA 4EPCA 3CCRT 2VWFA 4L59A 2L3SA 3VS7A 2DJQA 2G6FX 2E6ZA 2JW4A 2GFAA 2KMTA 3X24B 3LWIA 1JO8A 1W2BS 2L8DA 2LQNA 1IREB 3PE0A 1UFFA 2H3JA 1UJYA 1WA7A 3L2UA 1LOJA 1M1KR 1YCSB 1M8MA 2O9VA 4R55A 1UUEA 4C8QG 1AWXA 2MYSA 5IN1A 4KGXB 1ZA2B 1VQ7T 4C5GA 3A5ZB 3KFVA 1BCOA 4OF1A 3RIRA 1I1JA 2FL7A 4NS5A 2DZ9A 3VKIA 1JU5C 1TTHB 5DLOA 4IKFA 3VU3C 5L8RE 3I56Q 3CC2T 2KDSA 3M57A 4EMKC 4XTXA 5IXBA 1ZUUA 4OVAA 2CDTA 2DEUA 1BI0A 1ZHIA 3HRSA 2DIGA 2DPPB 1W70A 1CKAA 2EGEA 2E65A 2MPXC 5HK0A 3JRZA 5DM7R 2RHZA 2HMAA 4QVZA 5LJ3j 4M75F 4PFOA 4MDWA 4F7UE 1K8AC 4M78F 3EGUA 2EPDA 1K1ZA 7AT1B 1AOJA 2G3RA 1VQOA 3CBOA 4ZTJA 4C8QA 2PUKB 4J6WA 3BDUA 4B9XA 1PG5B 1ZSZA 5EG2A 5D6WA 3UPUA 2HCKA 1R0CB 1I07A 1KIKA 2XI9A 5FWBA 2CP2A 4ANJA 2W10A 1ZLMA 1Q7YU 1KC8R 1I5LA 2A08A 1SHGA 1KD1C 2RA2A 2YWWA 5GMKe 5CAIA 1QKWA 4AT1B 3OYYA 4CRIA 1NYFA 3UT1A 4C8QC 1IGQA 1PKTA 3VS2A 1EIFA 4J9EA 4OMPA 5KYUA 3QSUA 1TUGB 1MMDA 1LCKA 3G71T 1H92A 5GANf 1VQOT 1AT1B 4PK4A 1Y71A 1YJ9Q 3CMEA 1HK9A 4BY6B 1UHFA 4HCCA 1IO6A 3JCMh 3UDCA 2X3XD 4E7HA 2ZPFB 1JJ2A 3MKDA 3X25B 4YTLA 5GAN7 1KG1A 3EAEA 1YJWA 2LCCA 2KAFA 3L1AA 4A63B 3E1SA 4C92F 4XU2A 2VASA 3H8ZA 5AT1B 3CMAT 5I11A 2QA4Q 4XTVA 5A0DA 2KK4A 2Y4XA 1RI0A 1N8RU 3EFSA 1QVPA 4IURA 1KD1R 2V8IA 1I81A 1TH7A 3CCMQ 2QI2A 2RD1A 3TU4K 1K73R 1NJIU 2EQMA 1X2KA 3H0IA 4II1A 2QTVA 3TSZA 2XG8D 5GAN2 5CIUA 1U3OA 1NPPA 3FLGA 4FT4A 2VYTA 1D3BA 4NL2A 2Z0WA 1G3WA 2H3EB 2VXEA 2M0OA 3E19A 2FO0A 2ZZDA 4LE9A 4LDWA 3CMET 2DXTA 2RJCA 1KJWA 1Y96B 2EKOA 1AWJA 3JB9J 2DE0X 3QKJA 4KT0E 1MNEA 3VUZA 3L2VA 1YJWT 1NZ9A 1RAHB 2KSSA 3M0PA 5IHNA 2ROLA 3LWHA 2K5FA 4HVVA 1BIBA 1IB8A 2RMOA 4CC3A 5LJ5h 4M7DD 3JB9D 1QVFA 1MGQA 4A4KA 3BFMA 1PSEA 1NEBA 1UGVA 3QO3A 4M77C 1AZEA 2RJEA 1VQLQ 2LNVA 1WGSA 2EYZA 3IQLA 2LZ6B 2LJ3A 2C0OA 3VS5A 4ZTFA 2PZ1A 1M4ZA 1OX9A 1IRXA 3QJ6A 1UB4A 3MEVA 1WYXA 2X35A 2JTFA 3V7RA 5GAMe 1NBEB 3REAB 3LYIA 3QWYA 2YT6A 1E6GA 1TXQA 1FMVA 4MZPA 5M9OA 5FU7C 2X9HA 3LGFA 9ATCB 2DA9A 3CD6T 1VQ9Q 4EMHA 2ATCB 3OB9A 5CO7A 4IIOA 3EFOB 3VS4A 4M78D 3A1PA 3EFOA 2K3YA 2SRCA 1WJSA 5KCHA 1VQKQ 1Y57A 3M0SA 2RK1A 5FU6C 1PSFA 3OBYA 1KQSA 2DAQA 1VQ8A 3JCMQ 4DEXA 4J9IA 2MK5A 3BE3A 3MP6A 4DOVA 2COWA 3C95A 4WCIA 5HK3A 3H41A 2PVOB 4OMFB 2A36A 1ABQA 2PVDB 2EYYA 2H8HA 4ESRA 2QEXA 4IUUA 4LDYA 2R57A 3JCMV 1JJ2S 1D1BA 2EW3A 1YN8A 1IZ6A 2K5IA 2GGRA 3CXCA 4BI3A 1VQPQ 1WXTA 5GANj 3O8VA 2OTLQ 2OTJQ 4M7DG 3JB9G 2CSQA 4AG2C 4C8QE 2E10A 1B34B 3TCJA 1UGRB 2XHCA 1B34A 1YITQ 3CC4Q 1G5VA 2E12A 1YWOA 4ZN1A 3CPWA 2RO0A 2RQTA 3PMTA 1QVGP 1HD3A 4RCCA 1VQ8T 1G83A 2X4WA 1EFNA 2IIMA 2HAXA 3ULRB 2FYKA 2ED0A 2RHYA 5GAOl 2KT8A 2YUPA 2VV5A 4OP0A 1EZZB 3OW2P 1CKBA 3QDFA 4BE2A 4Z02A 2FB7A 3CCMA 2YRCA 2QEXT 2JM8A 5GJVB 2QG9B 5AYFA 3GIBA 3FB9A 4M7DB 1MUZA 2HBWA 4M7DA 4M78G 1M3CA 1YHQA 8ATCB 2DZCA 3O5ZA 5GAN3 4WF2A 3S3OA 2GTOA 5FRMA 2ZPIB 3GBQA 4OB1B 4JLIA 3MCAB 3OSVA 2O4XA 3OS2A 1SRMA 2JTEA 2M9UA 2LCLA 3DLMA 2KI7A 2QQBA 1BKBA 5A0LA 2P84A 1IHWA 1BI2A 4FW2A 2DF6A 1QP2A 3A8OB 3VS3A 1M1GA 1MV0B 4A4EA 2HZYA 4R56A 1RLQC 1Q81U 1VQNQ 4L6V5 3HTRA 3OYDA 2RJFA 2L3RA 3KUFA 3JCMc 3I55T 2QDLA 4JZ3A 1TUCA 4QT7A 5GAMf 2KRNA 5CKBA 4LD9K 4M75A 3F70A 3CCMT 2DXUA 1GRIA 3HRUA 1VQLA 2DO3A 4M78A 2EYWA 4P5NA 4OGEA 2ZCFB 3TSWA 2XDPA 3OQ5A 3VUBA 3EH1A 1W2BP 1YHQT 1G3SA 4QQ6A 4E2FB 4M77E 5A2QE 2K7AA 2DFUA 1VQ5A 3SDZA 1QCOA 2XMFA 2RI3A 3PIOA 4RUGA 2D6FA 3HL8A 1Q82U 3A8HB 4UC4A 4JUVA 3MEAA 3CCVQ 1OZ2A 4RG2A 1KQSS 4J9HA 5ECAA 4HKEA 4RTVA 3EGDB 2NUTA 1BIAA 2ZPEB 3VV0A 4M75C 3D7SB 1YI2T 1K9MU 4M78C 3VJPA 4AFZC 1YIJQ 2M0YA 2RHIA 1X6OA 5GANg 1OV3A 2QGGA 1RAFB 4QVCA 5IAYA 3RKYA 2K6DA 3OYCA 1VQLT 1UTIA 2E5QA 5J26A 2AKKA 1UHCA 2GNCA 3DB3A 3OA6A 3CXCS 3KBGA 4PJOD 1RL2A 5GANd 4JDSA 3M59A 3V7CA 1YJNQ 2M16A 2C0TA 5GAN5 3HPWA 3EHQA 1VQ5T 3AHUA 4CC7A 1OU8A 2D1XA 1VQMQ 4OMQA 4JJBA 3OS1A 3REBB 2HQEA 4J9CA 3CCUQ 3G4SQ 2ABLA 1W6XA 1NYGA 2HD0A 1OOTA 1JB0E 3CPWS 2VB6A 2HKNA 4BDZA 1M90R 2OJ2A 5C6SA 2RQRA 3RNJA 2K57A 4IUTA 2EBPA 3ZEHA 1BBZA 2EJFA 3OY9A 3RBBB 3FRNA 4M4ZA 1M1FA 2DVEA 2V1QA 2RI5A 1QQJA 1ARKA 1YITA 2COYA 2KT1A 2M51A 2XICA 1SSFA 2X51A 2CYZB 3RUXA 3OYGA 4PL6A 4OMNA 2OX7A 1SG5A 2JTMA 4BB7A 4LDVA 2E5KA 3V8KA 1LNXA 3CCSQ 2QASA 4J9BA 1C1AA 4ZGJB 2RQWA 2DL5A 4OB0B 4ZGEB 5L23A 4C92C 4LD6A 4M7DF 2JMAA 4IUVA 4RTXA 3JB9F 2B86A 1Q7YC 2RQVA 2MI6A 1X2QA 3BDLA 3ASKA 1Q86U 5GJWB 3OYEA 1PM3A 4ME7A 4GY5A 3JCMW 1PD0A 4HVWA 3I35A 3CC7A 3PNWC 5CCAA 4QW2A 4GBQA 2LQWA 2DNUA 2IPOB 2CP7A 4VUBA 2KRMA 2DL7A 1H8KA 5KYXB 1WHLA 5GAOn 1YITT 5KYXA 5KE3A 5I2MA 3ZL7C 2CUBA 1PCXA 4PJOG 1M1KU 2WACA 2EGAA 1GL5A 5LJ5e 3OSSC 1VQNA 4X9CA 2GF7A 3CQTA 3FJPA 3LX7A 4N4GA 1D1AA 1RABB 2J05A 4BD3A 5FWCA 2DILA 3HRTA 2LJ1A 4RKUE 2QQRA 4PJJA 2CT4A 3META 2VGNA 4NOYA 1Q95G 4J5YA 2O88A 2GFUA 2NYSA 2LQ8A 4EDUA 1N8RC 4JZ4A 1V76A 2A0FB 1HJDA 1Y0MA 1NG2A 4FW1A 4QVDA 4FYYB 3H0HA 4RTWA 2A37A 1NJIC 3CC7T 4M7AD 4C5IA 5J3BA 2NUZA 1LVKA 3OS5A 1VQ4Q 5DLQE 1QWEA 2ENMA 4FSSA 4R0KA 1JEGA 1GCPA 3Q1JA 4PJOB 2FEIA 1SRLA 1S72A 8AT1B 2CP5A 3PT9A 2DXCA 6AT1B 3SEMA 4E7SA 1OEBA 3VYHB 2DERA 4A4GA 1KHIA 2DRMA 4RTYA 2DMOA 2ESWA 1V1CA 2JS2A 2HEQA 3CCQQ 2LT4A 1ZSZC 1OYXA 2BTTA 4FIBA 4PJMA 4XQ3A 3OYJA 1XNIA 3LH0A 1K8AR 1RAIB 2QK0A 3VYGA 4PJLA 3CCEQ 5C0MA 1YCYA 4M75E 4JJDA 1Y7XA 1QCFA 3GPLA 2E70A 1WHGA 1KC8U 4M78E 3S3MA 3HFNA 2V1RA 3SD4A 1OPKA 4FU6A 4XU0A 2MCNA 2FPFA 3OYNA 2DBMA 1J3TA 2P4RA 2AK5A 2NWMA 4MDXA 3JCMf 4E7LA 4CC4B 3H6ZA 3QBYA 2DTIA 3PTAA 1VQMA 2RM4A 1Z9ZA 5CR2A 3G4SA 3NTKA 1SSHA 1S72T 3HP9A 3L2ZA 3OBWA 1M3BA 5FRNA 3FJ5A 4BI8B 4XK8E 3RESA 2DYBA 4Y91A 1MNDA 1O9SA 1UEBA 2A28A 4Y28E 2LT1A 4J7IA 1JRIA 1RACB 4BY6C 3LW5E 4XTUA 3HHTB 2RQUA 2ZPBB 5HY6A 1I4K1 5CKDA 2CH4W 5IHIA 2DKGA 1TWBA 1JJ2P 2DIQA 3QPHA 4KRTA 1X43A 1YBYA 3H0FA 2CP0A 1UECA 1Y96A 3M56A 4DBHA 1BU1A 1U8RA 1KD1U 2K3BA 2YLCA 1EX4A 4ZN3A 3DB4A 1K73U 3SB2A 1QWFA 4XTYA 2VGMA 3C94A 2L5QA 4JS5A 2KQWA 4AFQC 2DD4A 4JRQA 1G8XA 4C92E 1WQWA 5GAMg 1BK2A 2DL4A 2BIVA 3OYBA 5LJ5f 1Z9QA 3I56A 5J39A 4O6JA 2O2OA 1UDLA 4FM4B 1PNJA 3M0UA 4WTOB 5GAMd 1QP3A 3E2UA 2CP3A 3PMIA 3EG0A 5KYYB 4M7AB 1NE8A 1M27C 5KYYA 3QZ9B 1UG1A 4C0GA 5LL6S 4L5GA 3WXMB 1WHMA 4ELYC 2PU9B 3QHSA 3ZFJA 2EYXA 1M30A 3A98A 5LJ3e 1SHFA 2COZA 5CKFA 3L2WA 1QVFP 5CQXA 2HBPA 2KR3A 2E4HA 2VC8A 2BE7D 1ZA1B 1VQ6Q 4MZMA 2JUFA 4C0FA 1R77A 4C0DB 2D0NA 4BACA 1F1BB 1OQKA 3M4GA 1DJ7B 3CEYA 1KSWA 2HNIA 2M02A 3BW1A 1K0XA 3QYGB 2JZ2A 1BI1A 4A4HA 1FX7A 2JOYA 4PJOF 3JAME 3M5AA 1PRMC 3EFRA 2DX1A 3I56T 2WSCE 3OYFA 2EIFA 2KBTA 1U5SA 1B07A 1T3SA 2IG0A 4AFUC 2L89A 1KHCA 1K9AA 3CCRQ 3RR6A 2VUBA 1YFNA 2K79A 2K9GA 2FHDA 1D0ZA 3PIPA 3JCMJ 3SWNB 5KYWB 1QVGA 4ZNXA 4N4HA 1WHKA 5IT9E 2KVQG 1AWOA 2LP5A 4LNPA 3VS0A 2J6KA 1NEGA 4F7UG 2EQJA 1Q81C 3CCEA 4N4IA 3LGLA 4LDXA 3INZA 4XTWA 1I0CA 4JS4A 1YJ9A 2CZ0B 5FLXE 1VQ7Q 4B9WA 2AT1B 2DEQA 2EJ9A 1MMAA 4HT8A 3ER0A 1KQSP 5KYNA 2J6FA 2D9TA 2F5KA 4KUIA 4LXCA 4HCZA 4X34A 3CC2Q 5GMKm 2O9SA 4D8DA 1OI1A 3MO8A 2LJ0A 1JXOA 5HCKA 1FYNA 2QA4A 1ZQ1A 4XAXB 4LUDA 2RHUA 2OI3A 5FROA 3L42A 3P8BB 3NFCA 3E9FA 1JBMA 3A8LB 3RDVA 3WVEB 1U1TA 1Q82C 1OU9A 1VOMA 2V8JA 4F7UB 1UE9A 1TS9A 4F7UA 1VYUA 2LTOA 3MEWA 4KH0B 4ATOA 2LRQA 4XU3A 5GMKi 4J6XA 3CCET 5IXFA 1K9MC 1YJ9T 4KUDK 1IXDA 2QGFB 4KGVB 3CPWP 1MHNA 2QAZA 5GAOq 3MPUB 1X6GA 3DKMA 4O5VA 4Y92A 4J8OA 1ZX6A 2QA4T 1QKXA 4M7DC 4RCBA 5LJ3h 2D8JA 4J9GA 2KGTA 3MP1A 2VVKA 1N6AA 3I5RA 4MZTA 4Z88A 2BZ8A 4C5HA 4AMCA 4DOWA 4M7AF 4A53A 1SPKA 3G71Q 2Y90A 2QQSA 1VQOQ 3QUIA 1QCNA 1XQHA 4GLMA 1RLPC 3EG1A 1OX8A 3A8MB 1UGPB 1WI7A 3NHNA 4E7IA 2GTJA 1K4US 5GAN4 4DBFA 2GQVA 4HT9A 4D6WA 5D6YA 1M2VB 2ZPHB 2K2VA 1XJWB 1VQ9A 1YNZA 1M2VA 3RKWA 3G6EQ 3CMAQ 3EGDA 2DK3A 3VRZA 2F5TX 3CCLQ 5GMKj 5IH2A 2EJGA 2PNIA 1VQKA 2JM9A 1QLYA 2J6OA 2F69A 2WSEE 4NL3A 2E3IA 3OYMA 2JN0A 2PUOB 4C8QD 4QKUA 1Q86C 2EGCA 2AZSA 1QVGS 3OYHA 3OYKA 3UATA 1KFZA 2BZXA 5KE2A 5CKHA 1OPLA 2VXFA 3JCMg 4JLGA 1N5ZA 2LX9A 4BE0A 3CCRA 3C0CA 2RF0A 4CC2A 5KCOA 3NTIA 2L3QA 1RUWA 4KH1B 1YJWQ 3V8LA 3UA7A 3JCMd 1M8VA 1VQPA 4JJCA 5IHKA 1VQ9T 1M1KC 2AZVA 2OTLA 2OTJA 4HA8A 4PKCC 5GANe 1UGSB 3AT1B 4HCBA 1XTDA 2VKNA 4C0ZA 2D8HA 4KULA 4CI0C 4MMLA 1E6HA 2JJ9A 4XTZA 1VQKT 2RNAA 1D09B 2YRDA 3CC4A 3EHRA 2LDMA 1QW1A 1S1NA 2EQUA 2JVVA 2RPNA 5GAN8 2AIRB 1VYVA 2HSPA 3NTHA 2EKHA 2X4XA 4DQ2A 4OMLA 4PLLA 2IVWA 4RTTA 1IGUA 1K76A 3ZBDA 1M90U 4F7UF 1IHVA 1YP5A 3JB9H 2J06A 2X4YA 3JB9I 2MMPA 2CS7A 4EMKB 2OAUA 1WPYA 4E47A 2MOXA 4EMKA 4K11A 4J83A 3CD6Q 1P92A 5LJ5g 3V8JA 2K5LA 1VQPT 4B6MA 2OTLT 2OTJT 4FYXB 3MHXA 1SEMA 4BUGA 4F04B 3J7AF 2KYMA 5DY9A 4ZGDB 2CREA 1BYMA 2CGHA 5A0GA 2HSEB 1RAGB 2JXBA 2X4JA 4M77D 3CC4T 5LJ5d 1YWPA 1X6BA 3HSBA 2WSFE 2E6NA 1KC8C 1VA7A 3FDRA 2F2WA 4FCYA 1NLOC 5I2SA 3LH5A 3C12A 4IUQA 2HQHA 1WXUA 2V26A 2YUOA 3J81E 1ZUYA 1BB9A 4X9DA 2DTHA 5GAMj 1WXBA 3HFOA 1ACMB 2KROA 4C5EA 3NPFA 1PHTA 2ZPGB 1Q7YR 3M4YA 2L3PA 4OMOA 1FWZA 4M7DE 3R6OA 2ZGWA 3FIFA 1UGQB 3CBMA 3L2RA 2CZ6B 3G71A 1OULA 1H641 1QMCA 4C8QB 5D6XA 1FMWA 1ZSZB 2HQXA 2C06A 3PVLA 2CH4A 1RI9A 3UA6A 3TVTA 4RMOA 4PJOA 3SFMA 1GFDA 3SHWA 2K4YA 3M9QA 5EC7A 4TVRA 2XIDA 3CCVA 2E1HA 1VQ8Q 2XU8A 2F2VA 1XOVA 1LPLA 1RAAB 3G6EA 3CMAA 1VQNT 2DETA 3QZ5B 2XK0A 3CCLA 3I5SA 1YIJA 2P0PA 4X1VA 2FRWA 1KQ1A 1K73C 4LN2A 2QEXQ 3VS1A 5I22A 2LCSA 3MP8A 3MEUA 1K0SA 5GAOp 5GANh 5KH6A 1G2BA 2QQAA 1AD5A 4E7KA 3J80E 5KYUB 4ORZA 3MJXA 2MF2A 4ELZC 1AZGB 3EG3A 1N8RR 1PRLC 4PJOC 1YJNA 2RB6A 2XD0A 1NJIR 3PVQA 4J7FA 2ROTA 4M77G 1VUBA 3I9QA 3CCUA 3QWXX 3M55A 1V29B 2RK2A 1CSKA 2YDLA 1K8AU 2K3XA 3M0TA 1C6VX 3WVDB 3CCVT 5CQYA 1RADB 3G6ET 4Z8AA 3ME9A 1PD1A 2FZKB 4JPBW 5CKEA 3I55Q 3CCLT 1X27A 1YIJT 3CCJQ 2RH2A 1ZSGA 4J9FA 1TSFA 5FW9A 5I21A 2JT4A 4M7AG 4DBQA 1YHQQ 3OYAA 3CCSA 1Y07A 3RKXA 4M77B 1D3BB 2M1HA 2NLUA 4M77A 1YJNT 2P4TA 4Z89A 1WZOA 2F2XA 2FRYA 3JCMb 3RMSA 2FZCB 2X3WD 3OYIA 1VQMT 3JCMX 3CCUT 4IIMA 3G4ST 1ZUKA 4FL6A 2YSQA 3N5BB 2KXCA 1B3QA 2DM1A 3CD6A 1TU0B 4FYWB 1YI2Q 4OB2B 4DA4A 5LJ3g 5FU7B 5CVIA 3QJYA 1AVZC 1WQ7A 1BCMA 2PTKA 2EVRA 4M7AA 3GF5A 4RTZA 3GP8A 5LJ3d 1UJ0A 4A54A 2ZAEA 3HKSA 2EQKA 2ECZA 1N27A 2CZ1B 2KRSA 3CCST 4XU1A 3GOXA 4AFSC 5FU6B 2O31A 3M54A 1VQ5Q 1GCQA 2DL3A 2CKKA 5GAOm 4EMGA 2MWPA 1E7OA 1SKUB 2B8AA 2R5MA 3G1JA 3V7SA 4C8QF 2PVGB 2E3HA 4JRIA 3EH2A 4FT2A 3X28B 5GMKh 2MAMA 4M75D 3VS6A 3FC3A 1GXIE 1U06A 2QQ9A 4M7AC 1LJOA 4AG1C 2LNHB 2BE9B 4E7JA 2YHTA 2L2PA 1VQ4A 1N9SA 1GCQC 2XDBA 2QTXA 1M2OA 1VYTA 3OYLA 1GBQA 1RAEB 1BI3A 1KK7A 2FG0A 2L0AA 2FVUA 2RN8A 4JJNK 3EG2A 3SWNA 5KYWA 4C0DC 3CCQA 3M53A 4IUPA 2LVMA 2LMJA 1N9RA 2R58A 2DYIA 2DVJA 3RMQA 2ED1A 2D0QB 4D8KA 1G3YA 3OW2A 2FPDA 2YXYA 1U1SA 3EG9B 4PFPA 4J9DA
chains in the Genus database with same CATH topology
3FLGA 3P8HA 5GMKj 4FT4A 2VYTA 1D3BA 4PJOG 1M1KU 2WACA 4NL2A 1G3WA 1HXDA 2VXEA 3CPFA 2DTOA 2EJGA 2M0OA 5LJ5e 3RERA 3E19A 4LDWA 2ZZDA 3OSSC 1VQKA 1VQNA 3M58A 4X9CA 2F69A 2GF7A 2WSEE 3CMET 2DXTA 4NL3A 2RJCA 3FJPA 3OYMA 1Y96B 3LX7A 4N4GA 2JN0A 2PUOB 4C8QD 3L2QA 2EKOA 3JB9J 4BD3A 1Q86C 3HRTA 3PFSA 3QKJA 2O01E 4KT0E 1VQ4T 1KQ2A 3VUZA 3L2VA 1QVGS 1YJWT 2AHJB 1NZ9A 4RKUE 2KSSA 2QQRA 3OYKA 2KY9A 3META 2VGNA 4NOYA 3OYHA 4PJOE 3SWNC 3LWHA 4J5YA 4PLIA 2K5FA 2GFUA 2YRVA 1ZBXA 1BIBA 2LQ8A 4EDUA 1N8RC 5KE2A 2EWNA 5LJ5h 5CKHA 4JRPA 4M7DD 2VXFA 3JCMg 2EYQA 4QVDA 3JB9D 1QVFA 1MGQA 4JLGA 1NJIC 4A4KA 2LX9A 3BFMA 2XDDA 3TREA 1PSEA 3CCRA 4BE0A 3CC7T 4M7AD 4C5IA 4C92D 5J3BA 3QO3A 4M77C 3I55A 3CCQT 2LQKA 2RJEA 5KCOA 3NTIA 2LNVA 1WGSA 2YLBA 3OS5A 3CCJA 2BKDN 5DLQE 2A3LA 3Q1JA 1I8FA 4PJOB 4ZTFA 3V8LA 1M4ZA 4M77F 1S72A 3JCMd 1M8VA 5HKCA 1VQPA 1M1KC 2R5AA 3FEOA 3PT9A 1VQ9T 2DXCA 2OTLA 2OTJA 3QJ6A 4HA8A 5CIUA 1UB4A 1X75C 4M75G 2P0KA 4PKCC 4BDYA 5GANe 1UGSB 3MEVA 4HCBA 1XTDA 4QQGA 3VYHB 4A4GA 4C0ZA 2P0QA 4KULA 1KHIA 1W4SA 4MMLA 4CI0C 2X35A 3QG1A 2JTFA 4XTZA 1R8OB 1VQKT 3V7RA 5GAMe 3CC4A 2LDMA 3LYIA 1W2BA 2LT4A 5CK9A 1OYXA 4FIBA 2O4XB 2MWOA 4XQ3A 3OYJA 2RI2A 1QW1A 1XNIA 2EQUA 2JVVA 3LH0A 4OGCA 5GAN8 1QVFS 4MZPA 3VYGA 5M9OA 5FU7C 5C0MA 3LGFA 1YCYA 4M75E 2EAYA 3NTHA 1Y7XA 2X4XA 4DQ2A 3CD6T 3GPLA 4EMHA 2E70A 1NPRA 1KC8U 3OB9A 4M78E 5CO7A 4PLLA 1H3ZA 3S3NA 3S3MA 2IVWA 4M78D 4OB3B 3HFNA 3SD4A 5LJ5j 2K3YA 3ZBDA 1WJSA 2E41A 2RJDA 4FU6A 4XU0A 5KCHA 1M90U 4F7UF 4FSXA 5GAMh 1YI2A 2X4YA 4N0AA 3JB9I 3OYNA 3JB9H 2MMPA 3QYHB 5LJ3f 2CS7A 4EMKB 4LDUA 2OAUA 2RK1A 1WPYA 3QIIA 4E47A 1M9SA 3URGA 1WJRA 4EMKA 5FU6C 3JCMf 4E7LA 4MDXA 1PSFA 3OS0A 3H6ZA 3QBYA 3OBYA 3CCJT 2DAQA 1X01A 4J83A 4A4FA 2DTIA 4M75B 3PTAA 1VQMA 2RM4A 3UWNA 1VQ8A 3JCMQ 1P92A 5CR2A 3G4SA 5LJ5g 3V8JA 3NTKA 4M78B 3T9NA 2K5LA 1S72T 3HP9A 3MP6A 1VQPT 3L2ZA 3OBWA 5FRNA 2OTLT 2OTJT 4DOVA 2PQWA 4BI8B 3C95A 4XK8E 3RESA 3MHXA 5HK3A 2PVOB 4Y91A 4BUGA 2DD5A 1O9SA 4OMFB 3J7AF 2PVDB 5GMKl 5DY9A 4ZGDB 1BYMA 1UEBA 1VIEA 2CGHA 2V8KA 4GLKA 5GAN6 4Y28E 5A0GA 2LT1A 4J7IA 2X4JA 1JRIA 4IUUA 4LDYA 2R57A 4M77D 2QEXA 3CC4T 3JCMV 5LJ5d 4BY6C 3LW5E 1JJ2S 4XTUA 3HSBA 2WSFE 2E6NA 1KC8C 3HHTB 1IZ6A 2K5IA 3FDRA 2ZPBB 4N0AC 3A8GB 1VQ6A 3CBPA 5HY6A 1I4K1 3CXCA 5CKDA 5I2SA 4BI3A 2DKGA 5GANj 3C12A 3O8VA 2XKOC 4IUQA 4MMKA 2DIQA 3QPHA 1M90C 4M7DG 1O75A 3JB9G 1M5Q1 3LLRA 3OMGA 4C8QE 1YBYA 3J81E 2E10A 4X9DA 3QXEB 1B34B 2DTHA 3OYAA 3TCJA 4C92G 5GAMj 1Y96A 3HFOA 1UGRB 3M56A 2XHCA 1B34A 1U8RA 1KD1U 4C5EA 2DXBA 2YLCA 3KXTA 2ZPGB 4ZN3A 3G7ZA 3DB4A 4JRKA 2GCXA 4BI4A 2E64A 1K73U 2QDYB 3M4YA 4XTYA 3SB2A 2VGMA 2E12A 4BE1A 1FWZA 3C94A 2L5QA 4ZN1A 4JS5A 3CPWA 2RO0A 3PMTA 2KQWA 3R6OA 2ZGWA 3X26B 4M7DE 4RCCA 1VQ8T 2X4WA 3FIFA 1UGQB 3CBMA 4KBMB 2DJZA 2DD4A 2HAXA 3L2RA 4JRQA 4M7AE 3TEEA 1G3TA 2CZ6B 3G71A 4C92E 1WQWA 3OW2S 2FYKA 1FXXA 1H641 3BY7A 5GAMg 4C8QB 1KQSA 3S6WA 1VIFA 5D6XA 2BIVA 2RHYA 1WJQA 3GLXA 5GAOl 3OYBA 4RG8A 2RHXA 2VV5A 5LJ5f 4OP0A 2JNGA 4BE2A 2HQXA 1AHJB 4Z02A 2FB7A 2C06A 3I56A 5J39A 3CCMA 3GNGA 2QXFA 1WNLA 4O6JA 4RMOA 2QEXT 4PJOA 3SFMA 4FM4B 2EFIA 1OZ3A 2K4YA 3M9QA 5AYFA 4TVRA 2XIDA 3CCVA 3GIBA 3FB9A 2E1HA 5GAMd 4M7DB 1QP3A 2XU8A 3PMIA 2I2LA 4M7DA 3OMCA 1XOVA 4M78G 4QQDA 1VQ6T 1YHQA 2DZCA 4M7AB 5GAN3 4WF2A 3S3OA 5FRMA 4C92B 1NE8A 2ZPIB 4OB1B 3G6EA 3CMAA 1VQ7A 1VQNT 3QZ5B 3QZ9B 3C4SA 4C0GA 2BUDA 4JLIA 2LC4A 3X20B 2XK0A 4C92A 3DLLA 5LL6S 3MCAB 4L5GA 3WXMB 3PGGA 1YIJA 3CCLA 3OSVA 4ELYC 2P0PA 4PNOA 2PU9B 3JCMP 3QHSA 3ZFJA 2O4XA 2Y4YA 3OS2A 3GNFB 1KQ1A 1K73C 2M9UA 2LCLA 3E9GA 3DLMA 3JSCA 4J6YA 3CC2A 2QQBA 2A7YA 2CZ7B 5LJ3e 1BKBA 5A0LA 3QDRB 3MP8A 3MEUA 5CKFA 5GAOp 3L2WA 1BI2A 3JCMe 5GANh 4Q5WA 1QP2A 5KH6A 3A8OB 2QQAA 2HBPA 5CQXA 4E7KA 3J80E 2VC8A 2MF2A 4ELZC 5GAOr 1M1GA 4MZMA 2JUFA 4A4EA 4C0FA 4R56A 3P8DA 4C0DB 1Q81U 4BACA 4PJOC 4L6V5 3M4GA 1DJ7B 3CEYA 4EPCA 3OYDA 2HNIA 3CCRT 4L59A 1YJNA 2RJFA 2L3RA 2RB6A 3BW1A 3QYGB 2XD0A 2JZ2A 2E6ZA 3KUFA 1BI1A 3JCMc 3I55T 4A4HA 1FX7A 4J7FA 4M77G 1VUBA 2JOYA 4PJOF 3JAME 3M5AA 2GFAA 5GAMf 2KMTA 3EFRA 5CKBA 3X24B 3LWIA 3CCUA 4LD9K 4M75A 3F70A 3I56T 3CCMT 2DXUA 2WSCE 2L8DA 3M55A 1IREB 1W2BS 3OYFA 1V29B 2EIFA 2H3JA 2RK2A 3HRUA 1VQLA 1K8AU 2DO3A 4M78A 2K3XA 4P5NA 3L2UA 4OGEA 3WVDB 1LOJA 2ZCFB 3CCVT 4V2SA 2XDPA 2IG0A 3OQ5A 3VUBA 2L89A 3CCSA 4R55A 1KHCA 1YHQT 1G3SA 4QQ6A 5CQYA 4C8QG 5IN1A 4M77E 3G6ET 1VQ7T 5A2QE 3ME9A 3A5ZB 4C5GA 2VUBA 4OF1A 3RIRA 1VQ5A 3SDZA 5CKEA 3CCLT 2FL7A 4NS5A 2DZ9A 2FHDA 3VKIA 3PIPA 3JCMJ 1YIJT 2RH2A 5DLOA 3SWNB 1QVGA 4IKFA 2RI3A 4N4HA 3PIOA 3VU3C 5L8RE 5IT9E 2KVQG 2D6FA 3CC2T 3HL8A 2KDSA 3M57A 1Q82U 3A8HB 4UC4A 4JUVA 3MEAA 4EMKC 4F7UG 4XTXA 5I21A 1OZ2A 4RG2A 2EQJA 1Q81C 3CCEA 1KQSS 4N4IA 4OVAA 3LGLA 4LDXA 4M7AG 3INZA 4HKEA 4XTWA 4JS4A 1BIAA 1BI0A 1Y07A 1ZHIA 2ZPEB 3HRSA 4M75C 2CZ0B 2DIGA 3RKXA 3VV0A 4M77B 4B9WA 5FLXE 1YI2T 1D3BB 2DEQA 2EJ9A 2DPPB 2M1HA 2NLUA 4HT8A 3ER0A 1K9MU 4M77A 2E65A 4M78C 3VJPA 5HK0A 3JRZA 1YJNT 5DM7R 2P4TA 2D9TA 2RHIA 3JCMb 2RHZA 4QVZA 2F5KA 5LJ3j 4KUIA 4M75F 3RMSA 4MDWA 1X6OA 5GANg 4HCZA 4X34A 4F7UE 5GMKm 3OYIA 3JCMX 1VQMT 4M78F 1K8AC 1OI1A 3MO8A 3CCUT 3G4ST 4QVCA 5IAYA 3RKYA 3OYCA 2G3RA 4FL6A 1VQOA 1VQLT 3CBOA 3N5BB 2QA4A 2E5QA 4ZTJA 1ZQ1A 5J26A 4C8QA 3CD6A 2PUKB 4XAXB 4J6WA 3DB3A 3BDUA 3OA6A 3CXCS 3KBGA 2RHUA 4B9XA 4PJOD 4OB2B 5FROA 3L42A 1RL2A 4DA4A 3P8BB 5GANd 4JDSA 3M59A 3NFCA 3V7CA 3E9FA 5LJ3g 2M16A 5EG2A 1JBMA 5GAN5 3HPWA 5D6WA 5FU7B 3UPUA 1VQ5T 3AHUA 3A8LB 3WVEB 1U1TA 5CVIA 1Q82C 3QJYA 2V8JA 4F7UB 2XI9A 3OS1A 2HQEA 1WQ7A 4F7UA 2LTOA 1Q7YU 3MEWA 4ATOA 2HD0A 1I5LA 4M7AA 3GF5A 2LRQA 3GP8A 5LJ3d 4XU3A 1JB0E 3CPWS 4A54A 5GMKi 4J6XA 1KD1C 3CCET 2RA2A 3HKSA 2EQKA 4BDZA 5C6SA 1K9MC 5GMKe 5CAIA 1N27A 2CZ1B 2K57A 4IUTA 3CCST 4XU1A 1YJ9T 3ZEHA 3GOXA 4KUDK 5FU6B 2EJFA 3OY9A 3M54A 3OYYA 1YJ9A 4CRIA 1MHNA 3FRNA 1M1FA 3UT1A 2DVEA 4C8QC 2CKKA 2RI5A 5GAOq 5GAOm 4EMGA 2MWPA 1EIFA 1YITA 3DKMA 3QSUA 4O5VA 2B8AA 2R5MA 3V7SA 2XICA 2PVGB 1SSFA 4C8QF 2CYZB 3G71T 3RUXA 4J8OA 3OYGA 4PL6A 4JRIA 5GANf 1VQOT 2JTMA 4BB7A 4FT2A 3X28B 2QA4T 5GMKh 4LDVA 1Y71A 2MAMA 3V8KA 1LNXA 4M7DC 4M75D 4RCBA 3CMEA 1HK9A 5LJ3h 3FC3A 1GXIE 4ZGJB 4BY6B 3MP1A 2QQ9A 4M7AC 1LJOA 1N6AA 4OB0B 4ZGEB 4HCCA 3UDCA 3JCMh 4C92C 4MZTA 4E7HA 4E7JA 4LD6A 2YHTA 2ZPFB 1JJ2A 4M7DF 4IUVA 3X25B 4YTLA 5GAN7 3JB9F 4C5HA 1VQ4A 1KG1A 3EAEA 1Q7YC 1YJWA 2LCCA 1N9SA 2KAFA 3L1AA 4DOWA 2MI6A 3BDLA 4M7AF 4A53A 3ASKA 3E1SA 4C92F 4XU2A 1Q86U 1G5VA 3H8ZA 2Y90A 3OYEA 2QQSA 2XDBA 3CMAT 2QTXA 3QUIA 1XQHA 4ME7A 3OYLA 4GY5A 4XTVA 5A0DA 3JCMW 2KK4A 1BI3A 2Y4XA 1RI0A 1N8RU 3EFSA 3A8MB 3PNWC 1QVPA 5CCAA 2FVUA 4IURA 4QW2A 3CC7A 2V8IA 4JJNK 1I81A 1UGPB 1TH7A 4VUBA 3SWNA 2QI2A 4C0DC 2RD1A 3CCQA 4E7IA 3TU4K 3M53A 4IUPA 2LVMA 1NJIU 5GAN4 1N9RA 2EQMA 2GQVA 4HT9A 4D6WA 2R58A 4II1A 5D6YA 5GAOn 1YITT 3RMQA 2ZPHB 5KE3A 2K2VA 1VQ9A 2D0QB 2XG8D 5I2MA 1G3YA 3OW2A 3RKWA 5GAN2 1U1SA 2DK3A 1NPPA 2F5TX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X01 A;  3V7C A;  4J6Y A;  2DTI A;  4M75 B;  5GMK j;  4PJO G;  2RM4 A;  1D3B A;  5LJ3 e;  5LJ3 g;  1JBM A;  4NL2 A;  3JCM Q;  5GAN 5;  1HXD A;  2VXE A;  5LJ5 g;  3AHU A;  2DTO A;  2EJG A;  4M78 B;  3V8J A;  5LJ5 e;  5GAO p;  3RER A;  3JCM e;  5GAN h;  1U1T A;  3L2Z A;  4X9C A;  4F7U B;  2DXT A;  4NL3 A;  2VC8 A;  1WQ7 A;  3FJP A;  4F7U A;  3RES A;  5GAO r;  1Y96 B;  4Y91 A;  2JN0 A;  4C8Q D;  5GMK l;  3JB9 J;  5DY9 A;  1I5L A;  4M7A A;  4PJO C;  3M4G A;  5GAN 6;  2CGH A;  1KQ2 A;  4V2S A;  2HNI A;  5LJ3 d;  4XU3 A;  2RB6 A;  4A54 A;  3BW1 A;  4J6X A;  5GMK i;  1JRI A;  2RA2 A;  4M77 D;  4PJO E;  4NOY A;  3JCM V;  3JCM c;  5LJ5 d;  3SWN C;  4J5Y A;  5GMK e;  5CAI A;  4M77 G;  2K57 A;  4XTU A;  4XU1 A;  3HSB A;  1BIB A;  4PJO F;  4M7D B;  2EJF A;  5GAM f;  4N0A C;  3EFR A;  2EWN A;  5LJ5 h;  1I4K 1;  4M75 A;  2DXU A;  4M7D D;  2VXF A;  3JCM g;  3JB9 D;  2DKG A;  2DVE A;  4C8Q C;  4QVD A;  5GAN j;  1MGQ A;  5GAO q;  5GAO m;  4M78 A;  4MMK A;  4EMG A;  4M7D G;  3BFM A;  3JB9 G;  1M5Q 1;  4M7A D;  1LOJ A;  4C8Q E;  4C92 D;  2E10 A;  4X9D A;  3QSU A;  1B34 B;  2DTH A;  3QO3 A;  4M77 C;  4C92 G;  5GAM j;  1Y96 A;  2YLB A;  3HFO A;  3V7S A;  4C8Q F;  1B34 A;  4C8Q G;  3RUX A;  4M77 E;  4JRI A;  5GAN f;  2YLC A;  3RIR A;  1I8F A;  5GMK h;  4PJO B;  3V8L A;  4JRK A;  4M77 F;  2DZ9 A;  2E64 A;  3V8K A;  1LNX A;  3SB2 A;  4M75 D;  4XTY A;  3JCM d;  4RCB A;  3JCM J;  4M7D C;  1M8V A;  1HK9 A;  5LJ3 h;  4HA8 A;  3SWN B;  4M75 G;  4M7D E;  2ZGW A;  3VU3 C;  5GAN e;  1LJO A;  4M7A C;  4RCC A;  3JCM h;  4C92 C;  3FIF A;  2DJZ A;  2YHT A;  4M7D F;  4M7A E;  4JUV A;  4MML A;  5GAN 7;  4EMK C;  3JB9 F;  4C92 E;  1WQW A;  4XTZ A;  2FYK A;  4XTX A;  4F7U G;  5I21 A;  1H64 1;  3V7R A;  3BY7 A;  5GAM g;  4C8Q B;  5GAM e;  1N9S A;  3L1A A;  4M7A F;  4A53 A;  5GAO l;  4M7A G;  3INZ A;  4C92 F;  4XTW A;  4XU2 A;  5LJ5 f;  1BIA A;  4XQ3 A;  4OP0 A;  3RKX A;  2Y90 A;  4M75 C;  5GAN 8;  4M77 B;  2QTX A;  1D3B B;  2DEQ A;  2EJ9 A;  3QUI A;  4HT8 A;  2FB7 A;  2E65 A;  1YCY A;  4M78 C;  4M75 E;  2EAY A;  4M77 A;  4XTV A;  3JCM W;  1WNL A;  4DQ2 A;  4EMH A;  4PJO A;  3JCM b;  5LJ3 j;  4M78 E;  3EFS A;  4M75 F;  3GIB A;  3FB9 A;  1I81 A;  2E1H A;  4M78 D;  1TH7 A;  3HFN A;  4F7U E;  5LJ5 j;  5GAM d;  5GAN g;  3SWN A;  5GMK m;  3JCM X;  4M78 F;  2RD1 A;  2I2L A;  4M7D A;  4M78 G;  2E41 A;  4XU0 A;  2DZC A;  4M7A B;  4QVC A;  4WF2 A;  1N9R A;  3RKY A;  4F7U F;  4C92 B;  5GAN 3;  5GAN 4;  5GAM h;  3JB9 H;  4N0A A;  3JB9 I;  4HT9 A;  5LJ3 f;  4C92 A;  4JLI A;  4EMK B;  5GAO n;  3PGG A;  4C8Q A;  1WPY A;  4J6W A;  3JCM P;  3BDU A;  4PNO A;  4EMK A;  3QHS A;  3JCM f;  3RKW A;  5GAN 2;  4PJO D;  1U1S A;  1KQ1 A;  5GAN d; 
#chains in the Genus database with same CATH topology
 1TUD A;  3EG9 A;  3P8H A;  4E6R A;  2FPE A;  4RTU A;  1HXD A;  3CPF A;  2DTO A;  3RER A;  1I5O B;  3M58 A;  4OMM A;  3L2Q A;  3THK A;  4V2S A;  3PFS A;  1R0B G;  2O01 E;  1KQ2 A;  1VQ4 T;  2AHJ B;  4FYV B;  4F14 A;  2KY9 A;  4PJO E;  3R6N A;  1FMK A;  3SWN C;  4PLI A;  2YRV A;  1ZBX A;  1NLP C;  2KYB A;  4F17 A;  2EWN A;  4JRP A;  3CXC P;  2EYQ A;  4HXJ A;  2XDD A;  3TRE A;  4C92 D;  3I55 A;  3CCQ T;  2LQK A;  2YLB A;  1PC0 A;  2W0Z A;  3CCJ A;  1MMN A;  2BKD N;  2A3L A;  1WHJ A;  3EGX B;  1I8F A;  1WLP B;  4M77 F;  3EGX A;  2AKL A;  5HKC A;  1Q81 R;  2R5A A;  3FEO A;  4PFZ A;  4BDY A;  1X75 C;  4M75 G;  1HYO A;  2FZG B;  2P0K A;  2DL8 A;  4QQG A;  1MV3 A;  2HKQ B;  1W4S A;  2P0Q A;  3TQ7 P;  2KE9 A;  3CC7 Q;  1T3L A;  3QG1 A;  1R8O B;  1WIE A;  1W2B A;  5CK9 A;  1GBR A;  2O4X B;  2MWO A;  4LUE A;  1GFC A;  2RI2 A;  4HVU A;  5D7U A;  4OGC A;  1QVF S;  2JS0 A;  2EAY A;  1NPR A;  4EIK A;  1NM7 A;  1H3Z A;  3S3N A;  4OB3 B;  2BZY A;  5LJ5 j;  2E41 A;  2RJD A;  4FSX A;  5GAM h;  1YI2 A;  4N0A A;  3QYH B;  4DBR A;  5LJ3 f;  1AEY A;  1TG0 A;  4LDU A;  3QII A;  1Q82 R;  4HCK A;  1SF9 A;  1M9S A;  3URG A;  1WJR A;  3OS0 A;  1WX6 A;  2EQI A;  3CCJ T;  1X01 A;  4A4F A;  4M75 B;  2J7I A;  3UWN A;  1WDX A;  1W1F A;  3M0R A;  4M78 B;  3T9N A;  1K9M R;  2PQW A;  2DD5 A;  2GBQ A;  1AWW A;  5GMK l;  1WHH A;  2HL3 A;  1VIE A;  2V8K A;  5GAN 6;  4GLK A;  2I0N A;  2CT3 A;  1JXM A;  1ABO A;  2KNB B;  3NMZ C;  4N0A C;  3UF4 A;  3A8G B;  1VQ6 A;  3CBP A;  1S72 Q;  3M0Q A;  2MIO A;  1PWT A;  1X69 A;  2XKO C;  1ZBJ A;  4MMK A;  1M90 C;  1O75 A;  1T0H A;  1M5Q 1;  2KEA A;  1WFW A;  3LLR A;  3OMG A;  3JV3 A;  2NUT B;  3QXE B;  4C92 G;  2DXB A;  2CP6 A;  3KXT A;  1HSQ A;  2F1L A;  3G7Z A;  4BI4 A;  4JRK A;  2GCX A;  2E64 A;  2QDY B;  1M3A A;  4BE1 A;  2DRK A;  1D1C A;  3X26 B;  1JQQ A;  4KBM B;  2DJZ A;  4KGZ B;  3CME Q;  4M7A E;  3TEE A;  4F16 A;  1G3T A;  3OW2 S;  1T0J A;  2KXD A;  2SEM A;  1FXX A;  1B7T A;  2CUD A;  3BY7 A;  1H3H A;  3S6W A;  1VIF A;  2C0I A;  2NUP B;  3GLX A;  1WJQ A;  4RG8 A;  2RHX A;  2NUP A;  2JNG A;  1A0N B;  1AHJ B;  1PKS A;  2K2M A;  2YUN A;  3NGP A;  4E7Z A;  1TOV A;  3GNG A;  2QXF A;  1WNL A;  2HDA A;  1D0X A;  2EFI A;  1OZ3 A;  1C0M A;  2QYZ A;  2OAW A;  2GQI A;  2I2L A;  1D0Y A;  3OMC A;  4QQD A;  2YUQ A;  2JMC A;  1VQ6 T;  4C92 B;  1VQ7 A;  2LX7 A;  4PJN A;  3C4S A;  3DLL A;  2BUD A;  3X20 B;  2LC4 A;  4C92 A;  3PGG A;  3JCM P;  4DEY A;  4PNO A;  2Y4Y A;  2DLP A;  3GNF B;  2HL5 C;  3E9G A;  3JSC A;  4J6Y A;  3CC2 A;  3H9N A;  2A7Y A;  2CZ7 B;  1Q86 R;  2CSI A;  3QDR B;  3U23 A;  3JCM e;  4Q5W A;  5GAO r;  3VRY A;  2DBK A;  3P8D A;  1MMG A;  4EPC A;  3CCR T;  2VWF A;  4L59 A;  2L3S A;  3VS7 A;  2DJQ A;  2G6F X;  2E6Z A;  2JW4 A;  2GFA A;  2KMT A;  3X24 B;  3LWI A;  1JO8 A;  1W2B S;  2L8D A;  2LQN A;  1IRE B;  3PE0 A;  1UFF A;  2H3J A;  1UJY A;  1WA7 A;  3L2U A;  1LOJ A;  1M1K R;  1YCS B;  1M8M A;  2O9V A;  4R55 A;  1UUE A;  4C8Q G;  1AWX A;  2MYS A;  5IN1 A;  4KGX B;  1ZA2 B;  1VQ7 T;  4C5G A;  3A5Z B;  3KFV A;  1BCO A;  4OF1 A;  3RIR A;  1I1J A;  2FL7 A;  4NS5 A;  2DZ9 A;  3VKI A;  1JU5 C;  1TTH B;  5DLO A;  4IKF A;  3VU3 C;  5L8R E;  3I56 Q;  3CC2 T;  2KDS A;  3M57 A;  4EMK C;  4XTX A;  5IXB A;  1ZUU A;  4OVA A;  2CDT A;  2DEU A;  1BI0 A;  1ZHI A;  3HRS A;  2DIG A;  2DPP B;  1W70 A;  1CKA A;  2EGE A;  2E65 A;  2MPX C;  5HK0 A;  3JRZ A;  5DM7 R;  2RHZ A;  2HMA A;  4QVZ A;  5LJ3 j;  4M75 F;  4PFO A;  4MDW A;  4F7U E;  1K8A C;  4M78 F;  3EGU A;  2EPD A;  1K1Z A;  7AT1 B;  1AOJ A;  2G3R A;  1VQO A;  3CBO A;  4ZTJ A;  4C8Q A;  2PUK B;  4J6W A;  3BDU A;  4B9X A;  1PG5 B;  1ZSZ A;  5EG2 A;  5D6W A;  3UPU A;  2HCK A;  1R0C B;  1I07 A;  1KIK A;  2XI9 A;  5FWB A;  2CP2 A;  4ANJ A;  2W10 A;  1ZLM A;  1Q7Y U;  1KC8 R;  1I5L A;  2A08 A;  1SHG A;  1KD1 C;  2RA2 A;  2YWW A;  5GMK e;  5CAI A;  1QKW A;  4AT1 B;  3OYY A;  4CRI A;  1NYF A;  3UT1 A;  4C8Q C;  1IGQ A;  1PKT A;  3VS2 A;  1EIF A;  4J9E A;  4OMP A;  5KYU A;  3QSU A;  1TUG B;  1MMD A;  1LCK A;  3G71 T;  1H92 A;  5GAN f;  1VQO T;  1AT1 B;  4PK4 A;  1Y71 A;  1YJ9 Q;  3CME A;  1HK9 A;  4BY6 B;  1UHF A;  4HCC A;  1IO6 A;  3JCM h;  3UDC A;  2X3X D;  4E7H A;  2ZPF B;  1JJ2 A;  3MKD A;  3X25 B;  4YTL A;  5GAN 7;  1KG1 A;  3EAE A;  1YJW A;  2LCC A;  2KAF A;  3L1A A;  4A63 B;  3E1S A;  4C92 F;  4XU2 A;  2VAS A;  3H8Z A;  5AT1 B;  3CMA T;  5I11 A;  2QA4 Q;  4XTV A;  5A0D A;  2KK4 A;  2Y4X A;  1RI0 A;  1N8R U;  3EFS A;  1QVP A;  4IUR A;  1KD1 R;  2V8I A;  1I81 A;  1TH7 A;  3CCM Q;  2QI2 A;  2RD1 A;  3TU4 K;  1K73 R;  1NJI U;  2EQM A;  1X2K A;  3H0I A;  4II1 A;  2QTV A;  3TSZ A;  2XG8 D;  5GAN 2;  5CIU A;  1U3O A;  1NPP A;  3FLG A;  4FT4 A;  2VYT A;  1D3B A;  4NL2 A;  2Z0W A;  1G3W A;  2H3E B;  2VXE A;  2M0O A;  3E19 A;  2FO0 A;  2ZZD A;  4LE9 A;  4LDW A;  3CME T;  2DXT A;  2RJC A;  1KJW A;  1Y96 B;  2EKO A;  1AWJ A;  3JB9 J;  2DE0 X;  3QKJ A;  4KT0 E;  1MNE A;  3VUZ A;  3L2V A;  1YJW T;  1NZ9 A;  1RAH B;  2KSS A;  3M0P A;  5IHN A;  2ROL A;  3LWH A;  2K5F A;  4HVV A;  1BIB A;  1IB8 A;  2RMO A;  4CC3 A;  5LJ5 h;  4M7D D;  3JB9 D;  1QVF A;  1MGQ A;  4A4K A;  3BFM A;  1PSE A;  1NEB A;  1UGV A;  3QO3 A;  4M77 C;  1AZE A;  2RJE A;  1VQL Q;  2LNV A;  1WGS A;  2EYZ A;  3IQL A;  2LZ6 B;  2LJ3 A;  2C0O A;  3VS5 A;  4ZTF A;  2PZ1 A;  1M4Z A;  1OX9 A;  1IRX A;  3QJ6 A;  1UB4 A;  3MEV A;  1WYX A;  2X35 A;  2JTF A;  3V7R A;  5GAM e;  1NBE B;  3REA B;  3LYI A;  3QWY A;  2YT6 A;  1E6G A;  1TXQ A;  1FMV A;  4MZP A;  5M9O A;  5FU7 C;  2X9H A;  3LGF A;  9ATC B;  2DA9 A;  3CD6 T;  1VQ9 Q;  4EMH A;  2ATC B;  3OB9 A;  5CO7 A;  4IIO A;  3EFO B;  3VS4 A;  4M78 D;  3A1P A;  3EFO A;  2K3Y A;  2SRC A;  1WJS A;  5KCH A;  1VQK Q;  1Y57 A;  3M0S A;  2RK1 A;  5FU6 C;  1PSF A;  3OBY A;  1KQS A;  2DAQ A;  1VQ8 A;  3JCM Q;  4DEX A;  4J9I A;  2MK5 A;  3BE3 A;  3MP6 A;  4DOV A;  2COW A;  3C95 A;  4WCI A;  5HK3 A;  3H41 A;  2PVO B;  4OMF B;  2A36 A;  1ABQ A;  2PVD B;  2EYY A;  2H8H A;  4ESR A;  2QEX A;  4IUU A;  4LDY A;  2R57 A;  3JCM V;  1JJ2 S;  1D1B A;  2EW3 A;  1YN8 A;  1IZ6 A;  2K5I A;  2GGR A;  3CXC A;  4BI3 A;  1VQP Q;  1WXT A;  5GAN j;  3O8V A;  2OTL Q;  2OTJ Q;  4M7D G;  3JB9 G;  2CSQ A;  4AG2 C;  4C8Q E;  2E10 A;  1B34 B;  3TCJ A;  1UGR B;  2XHC A;  1B34 A;  1YIT Q;  3CC4 Q;  1G5V A;  2E12 A;  1YWO A;  4ZN1 A;  3CPW A;  2RO0 A;  2RQT A;  3PMT A;  1QVG P;  1HD3 A;  4RCC A;  1VQ8 T;  1G83 A;  2X4W A;  1EFN A;  2IIM A;  2HAX A;  3ULR B;  2FYK A;  2ED0 A;  2RHY A;  5GAO l;  2KT8 A;  2YUP A;  2VV5 A;  4OP0 A;  1EZZ B;  3OW2 P;  1CKB A;  3QDF A;  4BE2 A;  4Z02 A;  2FB7 A;  3CCM A;  2YRC A;  2QEX T;  2JM8 A;  5GJV B;  2QG9 B;  5AYF A;  3GIB A;  3FB9 A;  4M7D B;  1MUZ A;  2HBW A;  4M7D A;  4M78 G;  1M3C A;  1YHQ A;  8ATC B;  2DZC A;  3O5Z A;  5GAN 3;  4WF2 A;  3S3O A;  2GTO A;  5FRM A;  2ZPI B;  3GBQ A;  4OB1 B;  4JLI A;  3MCA B;  3OSV A;  2O4X A;  3OS2 A;  1SRM A;  2JTE A;  2M9U A;  2LCL A;  3DLM A;  2KI7 A;  2QQB A;  1BKB A;  5A0L A;  2P84 A;  1IHW A;  1BI2 A;  4FW2 A;  2DF6 A;  1QP2 A;  3A8O B;  3VS3 A;  1M1G A;  1MV0 B;  4A4E A;  2HZY A;  4R56 A;  1RLQ C;  1Q81 U;  1VQN Q;  4L6V 5;  3HTR A;  3OYD A;  2RJF A;  2L3R A;  3KUF A;  3JCM c;  3I55 T;  2QDL A;  4JZ3 A;  1TUC A;  4QT7 A;  5GAM f;  2KRN A;  5CKB A;  4LD9 K;  4M75 A;  3F70 A;  3CCM T;  2DXU A;  1GRI A;  3HRU A;  1VQL A;  2DO3 A;  4M78 A;  2EYW A;  4P5N A;  4OGE A;  2ZCF B;  3TSW A;  2XDP A;  3OQ5 A;  3VUB A;  3EH1 A;  1W2B P;  1YHQ T;  1G3S A;  4QQ6 A;  4E2F B;  4M77 E;  5A2Q E;  2K7A A;  2DFU A;  1VQ5 A;  3SDZ A;  1QCO A;  2XMF A;  2RI3 A;  3PIO A;  4RUG A;  2D6F A;  3HL8 A;  1Q82 U;  3A8H B;  4UC4 A;  4JUV A;  3MEA A;  3CCV Q;  1OZ2 A;  4RG2 A;  1KQS S;  4J9H A;  5ECA A;  4HKE A;  4RTV A;  3EGD B;  2NUT A;  1BIA A;  2ZPE B;  3VV0 A;  4M75 C;  3D7S B;  1YI2 T;  1K9M U;  4M78 C;  3VJP A;  4AFZ C;  1YIJ Q;  2M0Y A;  2RHI A;  1X6O A;  5GAN g;  1OV3 A;  2QGG A;  1RAF B;  4QVC A;  5IAY A;  3RKY A;  2K6D A;  3OYC A;  1VQL T;  1UTI A;  2E5Q A;  5J26 A;  2AKK A;  1UHC A;  2GNC A;  3DB3 A;  3OA6 A;  3CXC S;  3KBG A;  4PJO D;  1RL2 A;  5GAN d;  4JDS A;  3M59 A;  3V7C A;  1YJN Q;  2M16 A;  2C0T A;  5GAN 5;  3HPW A;  3EHQ A;  1VQ5 T;  3AHU A;  4CC7 A;  1OU8 A;  2D1X A;  1VQM Q;  4OMQ A;  4JJB A;  3OS1 A;  3REB B;  2HQE A;  4J9C A;  3CCU Q;  3G4S Q;  2ABL A;  1W6X A;  1NYG A;  2HD0 A;  1OOT A;  1JB0 E;  3CPW S;  2VB6 A;  2HKN A;  4BDZ A;  1M90 R;  2OJ2 A;  5C6S A;  2RQR A;  3RNJ A;  2K57 A;  4IUT A;  2EBP A;  3ZEH A;  1BBZ A;  2EJF A;  3OY9 A;  3RBB B;  3FRN A;  4M4Z A;  1M1F A;  2DVE A;  2V1Q A;  2RI5 A;  1QQJ A;  1ARK A;  1YIT A;  2COY A;  2KT1 A;  2M51 A;  2XIC A;  1SSF A;  2X51 A;  2CYZ B;  3RUX A;  3OYG A;  4PL6 A;  4OMN A;  2OX7 A;  1SG5 A;  2JTM A;  4BB7 A;  4LDV A;  2E5K A;  3V8K A;  1LNX A;  3CCS Q;  2QAS A;  4J9B A;  1C1A A;  4ZGJ B;  2RQW A;  2DL5 A;  4OB0 B;  4ZGE B;  5L23 A;  4C92 C;  4LD6 A;  4M7D F;  2JMA A;  4IUV A;  4RTX A;  3JB9 F;  2B86 A;  1Q7Y C;  2RQV A;  2MI6 A;  1X2Q A;  3BDL A;  3ASK A;  1Q86 U;  5GJW B;  3OYE A;  1PM3 A;  4ME7 A;  4GY5 A;  3JCM W;  1PD0 A;  4HVW A;  3I35 A;  3CC7 A;  3PNW C;  5CCA A;  4QW2 A;  4GBQ A;  2LQW A;  2DNU A;  2IPO B;  2CP7 A;  4VUB A;  2KRM A;  2DL7 A;  1H8K A;  5KYX B;  1WHL A;  5GAO n;  1YIT T;  5KYX A;  5KE3 A;  5I2M A;  3ZL7 C;  2CUB A;  1PCX A;  4PJO G;  1M1K U;  2WAC A;  2EGA A;  1GL5 A;  5LJ5 e;  3OSS C;  1VQN A;  4X9C A;  2GF7 A;  3CQT A;  3FJP A;  3LX7 A;  4N4G A;  1D1A A;  1RAB B;  2J05 A;  4BD3 A;  5FWC A;  2DIL A;  3HRT A;  2LJ1 A;  4RKU E;  2QQR A;  4PJJ A;  2CT4 A;  3MET A;  2VGN A;  4NOY A;  1Q95 G;  4J5Y A;  2O88 A;  2GFU A;  2NYS A;  2LQ8 A;  4EDU A;  1N8R C;  4JZ4 A;  1V76 A;  2A0F B;  1HJD A;  1Y0M A;  1NG2 A;  4FW1 A;  4QVD A;  4FYY B;  3H0H A;  4RTW A;  2A37 A;  1NJI C;  3CC7 T;  4M7A D;  4C5I A;  5J3B A;  2NUZ A;  1LVK A;  3OS5 A;  1VQ4 Q;  5DLQ E;  1QWE A;  2ENM A;  4FSS A;  4R0K A;  1JEG A;  1GCP A;  3Q1J A;  4PJO B;  2FEI A;  1SRL A;  1S72 A;  8AT1 B;  2CP5 A;  3PT9 A;  2DXC A;  6AT1 B;  3SEM A;  4E7S A;  1OEB A;  3VYH B;  2DER A;  4A4G A;  1KHI A;  2DRM A;  4RTY A;  2DMO A;  2ESW A;  1V1C A;  2JS2 A;  2HEQ A;  3CCQ Q;  2LT4 A;  1ZSZ C;  1OYX A;  2BTT A;  4FIB A;  4PJM A;  4XQ3 A;  3OYJ A;  1XNI A;  3LH0 A;  1K8A R;  1RAI B;  2QK0 A;  3VYG A;  4PJL A;  3CCE Q;  5C0M A;  1YCY A;  4M75 E;  4JJD A;  1Y7X A;  1QCF A;  3GPL A;  2E70 A;  1WHG A;  1KC8 U;  4M78 E;  3S3M A;  3HFN A;  2V1R A;  3SD4 A;  1OPK A;  4FU6 A;  4XU0 A;  2MCN A;  2FPF A;  3OYN A;  2DBM A;  1J3T A;  2P4R A;  2AK5 A;  2NWM A;  4MDX A;  3JCM f;  4E7L A;  4CC4 B;  3H6Z A;  3QBY A;  2DTI A;  3PTA A;  1VQM A;  2RM4 A;  1Z9Z A;  5CR2 A;  3G4S A;  3NTK A;  1SSH A;  1S72 T;  3HP9 A;  3L2Z A;  3OBW A;  1M3B A;  5FRN A;  3FJ5 A;  4BI8 B;  4XK8 E;  3RES A;  2DYB A;  4Y91 A;  1MND A;  1O9S A;  1UEB A;  2A28 A;  4Y28 E;  2LT1 A;  4J7I A;  1JRI A;  1RAC B;  4BY6 C;  3LW5 E;  4XTU A;  3HHT B;  2RQU A;  2ZPB B;  5HY6 A;  1I4K 1;  5CKD A;  2CH4 W;  5IHI A;  2DKG A;  1TWB A;  1JJ2 P;  2DIQ A;  3QPH A;  4KRT A;  1X43 A;  1YBY A;  3H0F A;  2CP0 A;  1UEC A;  1Y96 A;  3M56 A;  4DBH A;  1BU1 A;  1U8R A;  1KD1 U;  2K3B A;  2YLC A;  1EX4 A;  4ZN3 A;  3DB4 A;  1K73 U;  3SB2 A;  1QWF A;  4XTY A;  2VGM A;  3C94 A;  2L5Q A;  4JS5 A;  2KQW A;  4AFQ C;  2DD4 A;  4JRQ A;  1G8X A;  4C92 E;  1WQW A;  5GAM g;  1BK2 A;  2DL4 A;  2BIV A;  3OYB A;  5LJ5 f;  1Z9Q A;  3I56 A;  5J39 A;  4O6J A;  2O2O A;  1UDL A;  4FM4 B;  1PNJ A;  3M0U A;  4WTO B;  5GAM d;  1QP3 A;  3E2U A;  2CP3 A;  3PMI A;  3EG0 A;  5KYY B;  4M7A B;  1NE8 A;  1M27 C;  5KYY A;  3QZ9 B;  1UG1 A;  4C0G A;  5LL6 S;  4L5G A;  3WXM B;  1WHM A;  4ELY C;  2PU9 B;  3QHS A;  3ZFJ A;  2EYX A;  1M30 A;  3A98 A;  5LJ3 e;  1SHF A;  2COZ A;  5CKF A;  3L2W A;  1QVF P;  5CQX A;  2HBP A;  2KR3 A;  2E4H A;  2VC8 A;  2BE7 D;  1ZA1 B;  1VQ6 Q;  4MZM A;  2JUF A;  4C0F A;  1R77 A;  4C0D B;  2D0N A;  4BAC A;  1F1B B;  1OQK A;  3M4G A;  1DJ7 B;  3CEY A;  1KSW A;  2HNI A;  2M02 A;  3BW1 A;  1K0X A;  3QYG B;  2JZ2 A;  1BI1 A;  4A4H A;  1FX7 A;  2JOY A;  4PJO F;  3JAM E;  3M5A A;  1PRM C;  3EFR A;  2DX1 A;  3I56 T;  2WSC E;  3OYF A;  2EIF A;  2KBT A;  1U5S A;  1B07 A;  1T3S A;  2IG0 A;  4AFU C;  2L89 A;  1KHC A;  1K9A A;  3CCR Q;  3RR6 A;  2VUB A;  1YFN A;  2K79 A;  2K9G A;  2FHD A;  1D0Z A;  3PIP A;  3JCM J;  3SWN B;  5KYW B;  1QVG A;  4ZNX A;  4N4H A;  1WHK A;  5IT9 E;  2KVQ G;  1AWO A;  2LP5 A;  4LNP A;  3VS0 A;  2J6K A;  1NEG A;  4F7U G;  2EQJ A;  1Q81 C;  3CCE A;  4N4I A;  3LGL A;  4LDX A;  3INZ A;  4XTW A;  1I0C A;  4JS4 A;  1YJ9 A;  2CZ0 B;  5FLX E;  1VQ7 Q;  4B9W A;  2AT1 B;  2DEQ A;  2EJ9 A;  1MMA A;  4HT8 A;  3ER0 A;  1KQS P;  5KYN A;  2J6F A;  2D9T A;  2F5K A;  4KUI A;  4LXC A;  4HCZ A;  4X34 A;  3CC2 Q;  5GMK m;  2O9S A;  4D8D A;  1OI1 A;  3MO8 A;  2LJ0 A;  1JXO A;  5HCK A;  1FYN A;  2QA4 A;  1ZQ1 A;  4XAX B;  4LUD A;  2RHU A;  2OI3 A;  5FRO A;  3L42 A;  3P8B B;  3NFC A;  3E9F A;  1JBM A;  3A8L B;  3RDV A;  3WVE B;  1U1T A;  1Q82 C;  1OU9 A;  1VOM A;  2V8J A;  4F7U B;  1UE9 A;  1TS9 A;  4F7U A;  1VYU A;  2LTO A;  3MEW A;  4KH0 B;  4ATO A;  2LRQ A;  4XU3 A;  5GMK i;  4J6X A;  3CCE T;  5IXF A;  1K9M C;  1YJ9 T;  4KUD K;  1IXD A;  2QGF B;  4KGV B;  3CPW P;  1MHN A;  2QAZ A;  5GAO q;  3MPU B;  1X6G A;  3DKM A;  4O5V A;  4Y92 A;  4J8O A;  1ZX6 A;  2QA4 T;  1QKX A;  4M7D C;  4RCB A;  5LJ3 h;  2D8J A;  4J9G A;  2KGT A;  3MP1 A;  2VVK A;  1N6A A;  3I5R A;  4MZT A;  4Z88 A;  2BZ8 A;  4C5H A;  4AMC A;  4DOW A;  4M7A F;  4A53 A;  1SPK A;  3G71 Q;  2Y90 A;  2QQS A;  1VQO Q;  3QUI A;  1QCN A;  1XQH A;  4GLM A;  1RLP C;  3EG1 A;  1OX8 A;  3A8M B;  1UGP B;  1WI7 A;  3NHN A;  4E7I A;  2GTJ A;  1K4U S;  5GAN 4;  4DBF A;  2GQV A;  4HT9 A;  4D6W A;  5D6Y A;  1M2V B;  2ZPH B;  2K2V A;  1XJW B;  1VQ9 A;  1YNZ A;  1M2V A;  3RKW A;  3G6E Q;  3CMA Q;  3EGD A;  2DK3 A;  3VRZ A;  2F5T X;  3CCL Q;  5GMK j;  5IH2 A;  2EJG A;  2PNI A;  1VQK A;  2JM9 A;  1QLY A;  2J6O A;  2F69 A;  2WSE E;  4NL3 A;  2E3I A;  3OYM A;  2JN0 A;  2PUO B;  4C8Q D;  4QKU A;  1Q86 C;  2EGC A;  2AZS A;  1QVG S;  3OYH A;  3OYK A;  3UAT A;  1KFZ A;  2BZX A;  5KE2 A;  5CKH A;  1OPL A;  2VXF A;  3JCM g;  4JLG A;  1N5Z A;  2LX9 A;  4BE0 A;  3CCR A;  3C0C A;  2RF0 A;  4CC2 A;  5KCO A;  3NTI A;  2L3Q A;  1RUW A;  4KH1 B;  1YJW Q;  3V8L A;  3UA7 A;  3JCM d;  1M8V A;  1VQP A;  4JJC A;  5IHK A;  1VQ9 T;  1M1K C;  2AZV A;  2OTL A;  2OTJ A;  4HA8 A;  4PKC C;  5GAN e;  1UGS B;  3AT1 B;  4HCB A;  1XTD A;  2VKN A;  4C0Z A;  2D8H A;  4KUL A;  4CI0 C;  4MML A;  1E6H A;  2JJ9 A;  4XTZ A;  1VQK T;  2RNA A;  1D09 B;  2YRD A;  3CC4 A;  3EHR A;  2LDM A;  1QW1 A;  1S1N A;  2EQU A;  2JVV A;  2RPN A;  5GAN 8;  2AIR B;  1VYV A;  2HSP A;  3NTH A;  2EKH A;  2X4X A;  4DQ2 A;  4OML A;  4PLL A;  2IVW A;  4RTT A;  1IGU A;  1K76 A;  3ZBD A;  1M90 U;  4F7U F;  1IHV A;  1YP5 A;  3JB9 H;  2J06 A;  2X4Y A;  3JB9 I;  2MMP A;  2CS7 A;  4EMK B;  2OAU A;  1WPY A;  4E47 A;  2MOX A;  4EMK A;  4K11 A;  4J83 A;  3CD6 Q;  1P92 A;  5LJ5 g;  3V8J A;  2K5L A;  1VQP T;  4B6M A;  2OTL T;  2OTJ T;  4FYX B;  3MHX A;  1SEM A;  4BUG A;  4F04 B;  3J7A F;  2KYM A;  5DY9 A;  4ZGD B;  2CRE A;  1BYM A;  2CGH A;  5A0G A;  2HSE B;  1RAG B;  2JXB A;  2X4J A;  4M77 D;  3CC4 T;  5LJ5 d;  1YWP A;  1X6B A;  3HSB A;  2WSF E;  2E6N A;  1KC8 C;  1VA7 A;  3FDR A;  2F2W A;  4FCY A;  1NLO C;  5I2S A;  3LH5 A;  3C12 A;  4IUQ A;  2HQH A;  1WXU A;  2V26 A;  2YUO A;  3J81 E;  1ZUY A;  1BB9 A;  4X9D A;  2DTH A;  5GAM j;  1WXB A;  3HFO A;  1ACM B;  2KRO A;  4C5E A;  3NPF A;  1PHT A;  2ZPG B;  1Q7Y R;  3M4Y A;  2L3P A;  4OMO A;  1FWZ A;  4M7D E;  3R6O A;  2ZGW A;  3FIF A;  1UGQ B;  3CBM A;  3L2R A;  2CZ6 B;  3G71 A;  1OUL A;  1H64 1;  1QMC A;  4C8Q B;  5D6X A;  1FMW A;  1ZSZ B;  2HQX A;  2C06 A;  3PVL A;  2CH4 A;  1RI9 A;  3UA6 A;  3TVT A;  4RMO A;  4PJO A;  3SFM A;  1GFD A;  3SHW A;  2K4Y A;  3M9Q A;  5EC7 A;  4TVR A;  2XID A;  3CCV A;  2E1H A;  1VQ8 Q;  2XU8 A;  2F2V A;  1XOV A;  1LPL A;  1RAA B;  3G6E A;  3CMA A;  1VQN T;  2DET A;  3QZ5 B;  2XK0 A;  3CCL A;  3I5S A;  1YIJ A;  2P0P A;  4X1V A;  2FRW A;  1KQ1 A;  1K73 C;  4LN2 A;  2QEX Q;  3VS1 A;  5I22 A;  2LCS A;  3MP8 A;  3MEU A;  1K0S A;  5GAO p;  5GAN h;  5KH6 A;  1G2B A;  2QQA A;  1AD5 A;  4E7K A;  3J80 E;  5KYU B;  4ORZ A;  3MJX A;  2MF2 A;  4ELZ C;  1AZG B;  3EG3 A;  1N8R R;  1PRL C;  4PJO C;  1YJN A;  2RB6 A;  2XD0 A;  1NJI R;  3PVQ A;  4J7F A;  2ROT A;  4M77 G;  1VUB A;  3I9Q A;  3CCU A;  3QWX X;  3M55 A;  1V29 B;  2RK2 A;  1CSK A;  2YDL A;  1K8A U;  2K3X A;  3M0T A;  1C6V X;  3WVD B;  3CCV T;  5CQY A;  1RAD B;  3G6E T;  4Z8A A;  3ME9 A;  1PD1 A;  2FZK B;  4JPB W;  5CKE A;  3I55 Q;  3CCL T;  1X27 A;  1YIJ T;  3CCJ Q;  2RH2 A;  1ZSG A;  4J9F A;  1TSF A;  5FW9 A;  5I21 A;  2JT4 A;  4M7A G;  4DBQ A;  1YHQ Q;  3OYA A;  3CCS A;  1Y07 A;  3RKX A;  4M77 B;  1D3B B;  2M1H A;  2NLU A;  4M77 A;  1YJN T;  2P4T A;  4Z89 A;  1WZO A;  2F2X A;  2FRY A;  3JCM b;  3RMS A;  2FZC B;  2X3W D;  3OYI A;  1VQM T;  3JCM X;  3CCU T;  4IIM A;  3G4S T;  1ZUK A;  4FL6 A;  2YSQ A;  3N5B B;  2KXC A;  1B3Q A;  2DM1 A;  3CD6 A;  1TU0 B;  4FYW B;  1YI2 Q;  4OB2 B;  4DA4 A;  5LJ3 g;  5FU7 B;  5CVI A;  3QJY A;  1AVZ C;  1WQ7 A;  1BCM A;  2PTK A;  2EVR A;  4M7A A;  3GF5 A;  4RTZ A;  3GP8 A;  5LJ3 d;  1UJ0 A;  4A54 A;  2ZAE A;  3HKS A;  2EQK A;  2ECZ A;  1N27 A;  2CZ1 B;  2KRS A;  3CCS T;  4XU1 A;  3GOX A;  4AFS C;  5FU6 B;  2O31 A;  3M54 A;  1VQ5 Q;  1GCQ A;  2DL3 A;  2CKK A;  5GAO m;  4EMG A;  2MWP A;  1E7O A;  1SKU B;  2B8A A;  2R5M A;  3G1J A;  3V7S A;  4C8Q F;  2PVG B;  2E3H A;  4JRI A;  3EH2 A;  4FT2 A;  3X28 B;  5GMK h;  2MAM A;  4M75 D;  3VS6 A;  3FC3 A;  1GXI E;  1U06 A;  2QQ9 A;  4M7A C;  1LJO A;  4AG1 C;  2LNH B;  2BE9 B;  4E7J A;  2YHT A;  2L2P A;  1VQ4 A;  1N9S A;  1GCQ C;  2XDB A;  2QTX A;  1M2O A;  1VYT A;  3OYL A;  1GBQ A;  1RAE B;  1BI3 A;  1KK7 A;  2FG0 A;  2L0A A;  2FVU A;  2RN8 A;  4JJN K;  3EG2 A;  3SWN A;  5KYW A;  4C0D C;  3CCQ A;  3M53 A;  4IUP A;  2LVM A;  2LMJ A;  1N9R A;  2R58 A;  2DYI A;  2DVJ A;  3RMQ A;  2ED1 A;  2D0Q B;  4D8K A;  1G3Y A;  3OW2 A;  2FPD A;  2YXY A;  1U1S A;  3EG9 B;  4PFP A;  4J9D A; 
#chains in the Genus database with same CATH homology
 3FLG A;  3P8H A;  5GMK j;  4FT4 A;  2VYT A;  1D3B A;  4PJO G;  1M1K U;  2WAC A;  4NL2 A;  1G3W A;  1HXD A;  2VXE A;  3CPF A;  2DTO A;  2EJG A;  2M0O A;  5LJ5 e;  3RER A;  3E19 A;  4LDW A;  2ZZD A;  3OSS C;  1VQK A;  1VQN A;  3M58 A;  4X9C A;  2F69 A;  2GF7 A;  2WSE E;  3CME T;  2DXT A;  4NL3 A;  2RJC A;  3FJP A;  3OYM A;  1Y96 B;  3LX7 A;  4N4G A;  2JN0 A;  2PUO B;  4C8Q D;  3L2Q A;  2EKO A;  3JB9 J;  4BD3 A;  1Q86 C;  3HRT A;  3PFS A;  3QKJ A;  2O01 E;  4KT0 E;  1VQ4 T;  1KQ2 A;  3VUZ A;  3L2V A;  1QVG S;  1YJW T;  2AHJ B;  1NZ9 A;  4RKU E;  2KSS A;  2QQR A;  3OYK A;  2KY9 A;  3MET A;  2VGN A;  4NOY A;  3OYH A;  4PJO E;  3SWN C;  3LWH A;  4J5Y A;  4PLI A;  2K5F A;  2GFU A;  2YRV A;  1ZBX A;  1BIB A;  2LQ8 A;  4EDU A;  1N8R C;  5KE2 A;  2EWN A;  5LJ5 h;  5CKH A;  4JRP A;  4M7D D;  2VXF A;  3JCM g;  2EYQ A;  4QVD A;  3JB9 D;  1QVF A;  1MGQ A;  4JLG A;  1NJI C;  4A4K A;  2LX9 A;  3BFM A;  2XDD A;  3TRE A;  1PSE A;  3CCR A;  4BE0 A;  3CC7 T;  4M7A D;  4C5I A;  4C92 D;  5J3B A;  3QO3 A;  4M77 C;  3I55 A;  3CCQ T;  2LQK A;  2RJE A;  5KCO A;  3NTI A;  2LNV A;  1WGS A;  2YLB A;  3OS5 A;  3CCJ A;  2BKD N;  5DLQ E;  2A3L A;  3Q1J A;  1I8F A;  4PJO B;  4ZTF A;  3V8L A;  1M4Z A;  4M77 F;  1S72 A;  3JCM d;  1M8V A;  5HKC A;  1VQP A;  1M1K C;  2R5A A;  3FEO A;  3PT9 A;  1VQ9 T;  2DXC A;  2OTL A;  2OTJ A;  3QJ6 A;  4HA8 A;  5CIU A;  1UB4 A;  1X75 C;  4M75 G;  2P0K A;  4PKC C;  4BDY A;  5GAN e;  1UGS B;  3MEV A;  4HCB A;  1XTD A;  4QQG A;  3VYH B;  4A4G A;  4C0Z A;  2P0Q A;  4KUL A;  1KHI A;  1W4S A;  4MML A;  4CI0 C;  2X35 A;  3QG1 A;  2JTF A;  4XTZ A;  1R8O B;  1VQK T;  3V7R A;  5GAM e;  3CC4 A;  2LDM A;  3LYI A;  1W2B A;  2LT4 A;  5CK9 A;  1OYX A;  4FIB A;  2O4X B;  2MWO A;  4XQ3 A;  3OYJ A;  2RI2 A;  1QW1 A;  1XNI A;  2EQU A;  2JVV A;  3LH0 A;  4OGC A;  5GAN 8;  1QVF S;  4MZP A;  3VYG A;  5M9O A;  5FU7 C;  5C0M A;  3LGF A;  1YCY A;  4M75 E;  2EAY A;  3NTH A;  1Y7X A;  2X4X A;  4DQ2 A;  3CD6 T;  3GPL A;  4EMH A;  2E70 A;  1NPR A;  1KC8 U;  3OB9 A;  4M78 E;  5CO7 A;  4PLL A;  1H3Z A;  3S3N A;  3S3M A;  2IVW A;  4M78 D;  4OB3 B;  3HFN A;  3SD4 A;  5LJ5 j;  2K3Y A;  3ZBD A;  1WJS A;  2E41 A;  2RJD A;  4FU6 A;  4XU0 A;  5KCH A;  1M90 U;  4F7U F;  4FSX A;  5GAM h;  1YI2 A;  2X4Y A;  4N0A A;  3JB9 I;  3OYN A;  3JB9 H;  2MMP A;  3QYH B;  5LJ3 f;  2CS7 A;  4EMK B;  4LDU A;  2OAU A;  2RK1 A;  1WPY A;  3QII A;  4E47 A;  1M9S A;  3URG A;  1WJR A;  4EMK A;  5FU6 C;  3JCM f;  4E7L A;  4MDX A;  1PSF A;  3OS0 A;  3H6Z A;  3QBY A;  3OBY A;  3CCJ T;  2DAQ A;  1X01 A;  4J83 A;  4A4F A;  2DTI A;  4M75 B;  3PTA A;  1VQM A;  2RM4 A;  3UWN A;  1VQ8 A;  3JCM Q;  1P92 A;  5CR2 A;  3G4S A;  5LJ5 g;  3V8J A;  3NTK A;  4M78 B;  3T9N A;  2K5L A;  1S72 T;  3HP9 A;  3MP6 A;  1VQP T;  3L2Z A;  3OBW A;  5FRN A;  2OTL T;  2OTJ T;  4DOV A;  2PQW A;  4BI8 B;  3C95 A;  4XK8 E;  3RES A;  3MHX A;  5HK3 A;  2PVO B;  4Y91 A;  4BUG A;  2DD5 A;  1O9S A;  4OMF B;  3J7A F;  2PVD B;  5GMK l;  5DY9 A;  4ZGD B;  1BYM A;  1UEB A;  1VIE A;  2CGH A;  2V8K A;  4GLK A;  5GAN 6;  4Y28 E;  5A0G A;  2LT1 A;  4J7I A;  2X4J A;  1JRI A;  4IUU A;  4LDY A;  2R57 A;  4M77 D;  2QEX A;  3CC4 T;  3JCM V;  5LJ5 d;  4BY6 C;  3LW5 E;  1JJ2 S;  4XTU A;  3HSB A;  2WSF E;  2E6N A;  1KC8 C;  3HHT B;  1IZ6 A;  2K5I A;  3FDR A;  2ZPB B;  4N0A C;  3A8G B;  1VQ6 A;  3CBP A;  5HY6 A;  1I4K 1;  3CXC A;  5CKD A;  5I2S A;  4BI3 A;  2DKG A;  5GAN j;  3C12 A;  3O8V A;  2XKO C;  4IUQ A;  4MMK A;  2DIQ A;  3QPH A;  1M90 C;  4M7D G;  1O75 A;  3JB9 G;  1M5Q 1;  3LLR A;  3OMG A;  4C8Q E;  1YBY A;  3J81 E;  2E10 A;  4X9D A;  3QXE B;  1B34 B;  2DTH A;  3OYA A;  3TCJ A;  4C92 G;  5GAM j;  1Y96 A;  3HFO A;  1UGR B;  3M56 A;  2XHC A;  1B34 A;  1U8R A;  1KD1 U;  4C5E A;  2DXB A;  2YLC A;  3KXT A;  2ZPG B;  4ZN3 A;  3G7Z A;  3DB4 A;  4JRK A;  2GCX A;  4BI4 A;  2E64 A;  1K73 U;  2QDY B;  3M4Y A;  4XTY A;  3SB2 A;  2VGM A;  2E12 A;  4BE1 A;  1FWZ A;  3C94 A;  2L5Q A;  4ZN1 A;  4JS5 A;  3CPW A;  2RO0 A;  3PMT A;  2KQW A;  3R6O A;  2ZGW A;  3X26 B;  4M7D E;  4RCC A;  1VQ8 T;  2X4W A;  3FIF A;  1UGQ B;  3CBM A;  4KBM B;  2DJZ A;  2DD4 A;  2HAX A;  3L2R A;  4JRQ A;  4M7A E;  3TEE A;  1G3T A;  2CZ6 B;  3G71 A;  4C92 E;  1WQW A;  3OW2 S;  2FYK A;  1FXX A;  1H64 1;  3BY7 A;  5GAM g;  4C8Q B;  1KQS A;  3S6W A;  1VIF A;  5D6X A;  2BIV A;  2RHY A;  1WJQ A;  3GLX A;  5GAO l;  3OYB A;  4RG8 A;  2RHX A;  2VV5 A;  5LJ5 f;  4OP0 A;  2JNG A;  4BE2 A;  2HQX A;  1AHJ B;  4Z02 A;  2FB7 A;  2C06 A;  3I56 A;  5J39 A;  3CCM A;  3GNG A;  2QXF A;  1WNL A;  4O6J A;  4RMO A;  2QEX T;  4PJO A;  3SFM A;  4FM4 B;  2EFI A;  1OZ3 A;  2K4Y A;  3M9Q A;  5AYF A;  4TVR A;  2XID A;  3CCV A;  3GIB A;  3FB9 A;  2E1H A;  5GAM d;  4M7D B;  1QP3 A;  2XU8 A;  3PMI A;  2I2L A;  4M7D A;  3OMC A;  1XOV A;  4M78 G;  4QQD A;  1VQ6 T;  1YHQ A;  2DZC A;  4M7A B;  5GAN 3;  4WF2 A;  3S3O A;  5FRM A;  4C92 B;  1NE8 A;  2ZPI B;  4OB1 B;  3G6E A;  3CMA A;  1VQ7 A;  1VQN T;  3QZ5 B;  3QZ9 B;  3C4S A;  4C0G A;  2BUD A;  4JLI A;  2LC4 A;  3X20 B;  2XK0 A;  4C92 A;  3DLL A;  5LL6 S;  3MCA B;  4L5G A;  3WXM B;  3PGG A;  1YIJ A;  3CCL A;  3OSV A;  4ELY C;  2P0P A;  4PNO A;  2PU9 B;  3JCM P;  3QHS A;  3ZFJ A;  2O4X A;  2Y4Y A;  3OS2 A;  3GNF B;  1KQ1 A;  1K73 C;  2M9U A;  2LCL A;  3E9G A;  3DLM A;  3JSC A;  4J6Y A;  3CC2 A;  2QQB A;  2A7Y A;  2CZ7 B;  5LJ3 e;  1BKB A;  5A0L A;  3QDR B;  3MP8 A;  3MEU A;  5CKF A;  5GAO p;  3L2W A;  1BI2 A;  3JCM e;  5GAN h;  4Q5W A;  1QP2 A;  5KH6 A;  3A8O B;  2QQA A;  2HBP A;  5CQX A;  4E7K A;  3J80 E;  2VC8 A;  2MF2 A;  4ELZ C;  5GAO r;  1M1G A;  4MZM A;  2JUF A;  4A4E A;  4C0F A;  4R56 A;  3P8D A;  4C0D B;  1Q81 U;  4BAC A;  4PJO C;  4L6V 5;  3M4G A;  1DJ7 B;  3CEY A;  4EPC A;  3OYD A;  2HNI A;  3CCR T;  4L59 A;  1YJN A;  2RJF A;  2L3R A;  2RB6 A;  3BW1 A;  3QYG B;  2XD0 A;  2JZ2 A;  2E6Z A;  3KUF A;  1BI1 A;  3JCM c;  3I55 T;  4A4H A;  1FX7 A;  4J7F A;  4M77 G;  1VUB A;  2JOY A;  4PJO F;  3JAM E;  3M5A A;  2GFA A;  5GAM f;  2KMT A;  3EFR A;  5CKB A;  3X24 B;  3LWI A;  3CCU A;  4LD9 K;  4M75 A;  3F70 A;  3I56 T;  3CCM T;  2DXU A;  2WSC E;  2L8D A;  3M55 A;  1IRE B;  1W2B S;  3OYF A;  1V29 B;  2EIF A;  2H3J A;  2RK2 A;  3HRU A;  1VQL A;  1K8A U;  2DO3 A;  4M78 A;  2K3X A;  4P5N A;  3L2U A;  4OGE A;  3WVD B;  1LOJ A;  2ZCF B;  3CCV T;  4V2S A;  2XDP A;  2IG0 A;  3OQ5 A;  3VUB A;  2L89 A;  3CCS A;  4R55 A;  1KHC A;  1YHQ T;  1G3S A;  4QQ6 A;  5CQY A;  4C8Q G;  5IN1 A;  4M77 E;  3G6E T;  1VQ7 T;  5A2Q E;  3ME9 A;  3A5Z B;  4C5G A;  2VUB A;  4OF1 A;  3RIR A;  1VQ5 A;  3SDZ A;  5CKE A;  3CCL T;  2FL7 A;  4NS5 A;  2DZ9 A;  2FHD A;  3VKI A;  3PIP A;  3JCM J;  1YIJ T;  2RH2 A;  5DLO A;  3SWN B;  1QVG A;  4IKF A;  2RI3 A;  4N4H A;  3PIO A;  3VU3 C;  5L8R E;  5IT9 E;  2KVQ G;  2D6F A;  3CC2 T;  3HL8 A;  2KDS A;  3M57 A;  1Q82 U;  3A8H B;  4UC4 A;  4JUV A;  3MEA A;  4EMK C;  4F7U G;  4XTX A;  5I21 A;  1OZ2 A;  4RG2 A;  2EQJ A;  1Q81 C;  3CCE A;  1KQS S;  4N4I A;  4OVA A;  3LGL A;  4LDX A;  4M7A G;  3INZ A;  4HKE A;  4XTW A;  4JS4 A;  1BIA A;  1BI0 A;  1Y07 A;  1ZHI A;  2ZPE B;  3HRS A;  4M75 C;  2CZ0 B;  2DIG A;  3RKX A;  3VV0 A;  4M77 B;  4B9W A;  5FLX E;  1YI2 T;  1D3B B;  2DEQ A;  2EJ9 A;  2DPP B;  2M1H A;  2NLU A;  4HT8 A;  3ER0 A;  1K9M U;  4M77 A;  2E65 A;  4M78 C;  3VJP A;  5HK0 A;  3JRZ A;  1YJN T;  5DM7 R;  2P4T A;  2D9T A;  2RHI A;  3JCM b;  2RHZ A;  4QVZ A;  2F5K A;  5LJ3 j;  4KUI A;  4M75 F;  3RMS A;  4MDW A;  1X6O A;  5GAN g;  4HCZ A;  4X34 A;  4F7U E;  5GMK m;  3OYI A;  3JCM X;  1VQM T;  4M78 F;  1K8A C;  1OI1 A;  3MO8 A;  3CCU T;  3G4S T;  4QVC A;  5IAY A;  3RKY A;  3OYC A;  2G3R A;  4FL6 A;  1VQO A;  1VQL T;  3CBO A;  3N5B B;  2QA4 A;  2E5Q A;  4ZTJ A;  1ZQ1 A;  5J26 A;  4C8Q A;  3CD6 A;  2PUK B;  4XAX B;  4J6W A;  3DB3 A;  3BDU A;  3OA6 A;  3CXC S;  3KBG A;  2RHU A;  4B9X A;  4PJO D;  4OB2 B;  5FRO A;  3L42 A;  1RL2 A;  4DA4 A;  3P8B B;  5GAN d;  4JDS A;  3M59 A;  3NFC A;  3V7C A;  3E9F A;  5LJ3 g;  2M16 A;  5EG2 A;  1JBM A;  5GAN 5;  3HPW A;  5D6W A;  5FU7 B;  3UPU A;  1VQ5 T;  3AHU A;  3A8L B;  3WVE B;  1U1T A;  5CVI A;  1Q82 C;  3QJY A;  2V8J A;  4F7U B;  2XI9 A;  3OS1 A;  2HQE A;  1WQ7 A;  4F7U A;  2LTO A;  1Q7Y U;  3MEW A;  4ATO A;  2HD0 A;  1I5L A;  4M7A A;  3GF5 A;  2LRQ A;  3GP8 A;  5LJ3 d;  4XU3 A;  1JB0 E;  3CPW S;  4A54 A;  5GMK i;  4J6X A;  1KD1 C;  3CCE T;  2RA2 A;  3HKS A;  2EQK A;  4BDZ A;  5C6S A;  1K9M C;  5GMK e;  5CAI A;  1N27 A;  2CZ1 B;  2K57 A;  4IUT A;  3CCS T;  4XU1 A;  1YJ9 T;  3ZEH A;  3GOX A;  4KUD K;  5FU6 B;  2EJF A;  3OY9 A;  3M54 A;  3OYY A;  1YJ9 A;  4CRI A;  1MHN A;  3FRN A;  1M1F A;  3UT1 A;  2DVE A;  4C8Q C;  2CKK A;  2RI5 A;  5GAO q;  5GAO m;  4EMG A;  2MWP A;  1EIF A;  1YIT A;  3DKM A;  3QSU A;  4O5V A;  2B8A A;  2R5M A;  3V7S A;  2XIC A;  2PVG B;  1SSF A;  4C8Q F;  2CYZ B;  3G71 T;  3RUX A;  4J8O A;  3OYG A;  4PL6 A;  4JRI A;  5GAN f;  1VQO T;  2JTM A;  4BB7 A;  4FT2 A;  3X28 B;  2QA4 T;  5GMK h;  4LDV A;  1Y71 A;  2MAM A;  3V8K A;  1LNX A;  4M7D C;  4M75 D;  4RCB A;  3CME A;  1HK9 A;  5LJ3 h;  3FC3 A;  1GXI E;  4ZGJ B;  4BY6 B;  3MP1 A;  2QQ9 A;  4M7A C;  1LJO A;  1N6A A;  4OB0 B;  4ZGE B;  4HCC A;  3UDC A;  3JCM h;  4C92 C;  4MZT A;  4E7H A;  4E7J A;  4LD6 A;  2YHT A;  2ZPF B;  1JJ2 A;  4M7D F;  4IUV A;  3X25 B;  4YTL A;  5GAN 7;  3JB9 F;  4C5H A;  1VQ4 A;  1KG1 A;  3EAE A;  1Q7Y C;  1YJW A;  2LCC A;  1N9S A;  2KAF A;  3L1A A;  4DOW A;  2MI6 A;  3BDL A;  4M7A F;  4A53 A;  3ASK A;  3E1S A;  4C92 F;  4XU2 A;  1Q86 U;  1G5V A;  3H8Z A;  2Y90 A;  3OYE A;  2QQS A;  2XDB A;  3CMA T;  2QTX A;  3QUI A;  1XQH A;  4ME7 A;  3OYL A;  4GY5 A;  4XTV A;  5A0D A;  3JCM W;  2KK4 A;  1BI3 A;  2Y4X A;  1RI0 A;  1N8R U;  3EFS A;  3A8M B;  3PNW C;  1QVP A;  5CCA A;  2FVU A;  4IUR A;  4QW2 A;  3CC7 A;  2V8I A;  4JJN K;  1I81 A;  1UGP B;  1TH7 A;  4VUB A;  3SWN A;  2QI2 A;  4C0D C;  2RD1 A;  3CCQ A;  4E7I A;  3TU4 K;  3M53 A;  4IUP A;  2LVM A;  1NJI U;  5GAN 4;  1N9R A;  2EQM A;  2GQV A;  4HT9 A;  4D6W A;  2R58 A;  4II1 A;  5D6Y A;  5GAO n;  1YIT T;  3RMQ A;  2ZPH B;  5KE3 A;  2K2V A;  1VQ9 A;  2D0Q B;  2XG8 D;  5I2M A;  1G3Y A;  3OW2 A;  3RKW A;  5GAN 2;  1U1S A;  2DK3 A;  1NPP A;  2F5T X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...