1VQNQ

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqnQ00
1VQ7Q 3OW2P 1K73R 1NJIR 1K9MR 3CCLQ 3CCJQ 1VQOQ 2OTJQ 1VQMQ 1Q7YR 1VQ6Q 3I56Q 1VQ8Q 1YI2Q 2QA4Q 3CCEQ 3CCQQ 1QVGP 3CMAQ 2OTLQ 1S72Q 1YIJQ 1W2BP 1Q82R 3CC2Q 1VQNQ 1YHQQ 3CMEQ 1M1KR 3CCVQ 1KC8R 1YITQ 1Q81R 1M90R 1JJ2P 1VQLQ 1KD1R 2QEXQ 3G6EQ 1VQ5Q 3CCSQ 3CC7Q 3CC4Q 3CD6Q 1VQPQ 1VQ9Q 3CPWP 1QVFP 1YJWQ 1KQSP 3G4SQ 1VQKQ 3G71Q 1N8RR 1YJ9Q 1K8AR 1VQ4Q 3CCMQ 1YJNQ 3CXCP 3I55Q 1Q86R 3CCRQ 3CCUQ
chains in the Genus database with same CATH superfamily
2M0OA 3CCEA 1XTDA 1UGVA 4OMNA 1JXOA 3QDRB 4XU1A 4JS4A 1I8FA 1VQLQ 2HSPA 1MV3A 1HD3A 5LJ3g 3EGXA 2H8HA 1YITA 3WVEB 3EH1A 4M75E 4JLIA 2LX9A 1N5ZA 3QZ5B 3JCMX 1OPLA 3OS1A 3I55T 3HRTA 1SKUB 2K5IA 3CCSA 3EFRA 1WHGA 1Y96A 2MYSA 1VQKQ 2MIOA 1WXTA 1N8RR 4EMKC 5DM7R 3CCMT 5KE3A 4PJJA 3TCJA 2LP5A 4JJNK 3V7RA 3RKWA 4NOYA 1YI2T 2FPEA 4RCBA 2ZPIB 2V8KA 4CRIA 5GAMj 4CC2A 3LWIA 3TREA 4LUEA 1E6GA 2AT1B 5DLQE 2D1XA 1D0YA 4PNOA 2NUTA 2LT4A 1ZA1B 2K57A 3HP9A 4K11A 4RTTA 2RM4A 3NHNA 1W2BP 4OB2B 4NS5A 2V1RA 2DXCA 1FMKA 4RTUA 2R57A 1FXXA 3CBMA 2LX7A 2MWOA 4FT2A 1XOVA 1RABB 2COZA 3V8JA 3D7SB 2DL7A 3NFCA 2L3RA 1X2KA 4J7IA 4XU2A 2IVWA 3LW5E 5IHIA 2X3WD 2YLCA 3CCVA 4HT9A 3BE3A 2R58A 2L3PA 3SFMA 4MZMA 5M9OA 1K0SA 1UJYA 4M75D 3TEEA 1YJ9A 4OMFB 3CC2A 3JRZA 1AWWA 1QKWA 1ZA2B 1O75A 1WYXA 5KYYA 1PRMC 2HMAA 2KE9A 2HDAA 4KRTA 1UG1A 1OPKA 2CP5A 5A2QE 5FWBA 5IHKA 1F1BB 3CMEA 4Y28E 3A5ZB 3VS6A 2W10A 1YIJT 2D0NA 3OS0A 3CMAA 5HCKA 2D0QB 2D9TA 5A0GA 1M5Q1 4XTXA 2EJGA 1WA7A 4QVDA 2HBPA 4IUTA 2XMFA 3HRUA 4M75F 3JB9H 2KROA 3JCMc 3H0IA 2RHZA 2MCNA 1FX7A 1XJWB 3R6OA 5KYUB 5HKCA 1AZEA 5IXBA 2DO3A 3M55A 4AFQC 1RAEB 1WDXA 4DBFA 1KC8C 2VASA 1OX8A 2ED1A 1JRIA 2JTEA 1NM7A 1W6XA 2QASA 3NTIA 3L2VA 4DEXA 4PJNA 4FIBA 2F5TX 1VQ7Q 4FYWB 1UEBA 3OS2A 1PSEA 4P5NA 1M1FA 2JTMA 4HKEA 1VQ6T 2RD1A 3CC2Q 4AMCA 1YHQT 2P0QA 5IT9E 5ECAA 1YFNA 3T9NA 1WXBA 4M7DC 3SWNA 2F2WA 3CCJA 4PKCC 4WF2A 1D09B 2X3XD 1SHGA 1ZLMA 3O5ZA 4LXCA 3KFVA 2HEQA 1PNJA 2XKOC 2J6OA 3UA6A 5J3BA 2OX7A 2C06A 2M0YA 5GAN6 3BDUA 1NLPC 2HAXA 3EGDB 1ZUYA 4DOWA 1VYVA 4J8OA 2KI7A 4ZGJB 2L3SA 2DL5A 1K8AC 1VQNA 1WQ7A 4ZTFA 1T3LA 4LDVA 2RJCA 3EHRA 3C0CA 2RJFA 4GY5A 3JCMW 1IGQA 2LJ1A 5LJ5h 2HCKA 2QTXA 5CK9A 2E10A 4BUGA 3M0UA 2LCCA 3ULRB 3IQLA 3PMIA 3CCQT 4E7HA 5CKDA 1GFCA 3UDCA 2DD4A 3CMAQ 1PHTA 1K9AA 1M30A 4AG2C 3OYCA 4M7DE 5L23A 4J9GA 3REAB 1G3WA 2YUOA 2EW3A 2VWFA 3OYKA 1GBQA 2DTIA 3QG1A 4N4HA 4LN2A 5CKHA 1M8MA 5GAN7 3PVLA 1R0CB 4PJOA 5KYWB 3HKSA 4O6JA 3CCMA 5GMKi 4BD3A 4C0ZA 1TTHB 2QEXT 2AZVA 2E5KA 4F04B 2EGEA 5IXFA 2HQHA 5GMKj 1YI2A 5C6SA 1SRMA 4F7UA 1HSQA 4FYVB 1QVGS 4R56A 1B34B 3VS5A 1D3BA 2YXYA 5GAOr 2CDTA 1KD1U 2DMOA 1VQ9T 3V8KA 3R6NA 1G3YA 1NLOC 2LQKA 2HD0A 1K73U 2DVJA 4L5GA 1UUEA 3OMCA 4M78D 2VC8A 5GAN4 1Q7YC 4HCCA 1SSHA 5GANh 3VKIA 5KH6A 1VQKT 2KVQG 2LJ0A 4MZPA 1OYXA 3P8HA 1GCPA 5LJ5f 2DYIA 1W70A 1Q81C 4LNPA 2EPDA 2QYZA 1S1NA 2E6NA 4IIMA 2EJFA 3MCAB 1D1CA 3CC2T 1RI0A 2WSCE 1AOJA 2LQ8A 4M7DB 2A37A 1Q81R 5GANj 3BW1A 2QG9B 3GOXA 5FRMA 1PKTA 3I56A 3GBQA 3HFNA 4HVUA 4OP0A 2JS0A 3CPFA 4MDXA 3EFOB 1I07A 2M02A 2KNBB 2VXEA 2XK0A 2L0AA 4RTZA 5I21A 1SPKA 4KGZB 1JBMA 3VS3A 1PRLC 4KBMB 3VRZA 2OAWA 2G6FX 1X6BA 2JM8A 3G4SQ 3OMGA 3ME9A 1VIFA 2YUPA 1N9RA 3I55Q 1RAGB 4E7KA 3OYJA 3OYYA 3I56Q 1YJWA 4JLGA 3A8HB 1WHLA 4FSSA 2SEMA 4E7IA 3VUZA 4RMOA 4LDXA 1YP5A 4PJOD 2EAYA 5CIUA 2X4JA 4DBQA 3VUBA 3MEVA 2Z0WA 3OY9A 2A7YA 2MAMA 2A0FB 4A4FA 1YITT 3G7ZA 1KC8R 5LJ3d 3OYIA 4JRQA 1D3BB 2XU8A 3HPWA 4OMMA 3N5BB 2E65A 1QKXA 3I35A 5D6XA 1CKBA 2KT1A 2EGAA 3ZBDA 1WZOA 1M9SA 3LLRA 2Y4XA 2EQKA 4YTLA 5GAOn 4HT8A 2CP6A 1CSKA 5CVIA 1M1GA 3MJXA 2GNCA 4D6WA 2HL5C 3HSBA 3M9QA 1VQMT 2IIMA 2J6KA 4JRKA 3SHWA 2XI9A 2E70A 5I22A 1N6AA 3OYDA 1D0ZA 2KGTA 5LJ5e 1J3TA 3CC7Q 2L8DA 2D6FA 1QP3A 2DXBA 3CPWP 3H0FA 2FZGB 4BACA 4PFZA 3E1SA 1GBRA 5FROA 1MGQA 2CH4W 4C92F 1AWOA 4M7AG 1WJRA 3QJ6A 4ATOA 1OOTA 2CZ0B 3VS2A 1WHKA 3UWNA 1K9MU 1KK7A 3OBWA 3L42A 3GF5A 2QEXQ 1BU1A 1UB4A 2VKNA 2VYTA 2YRDA 4M7AA 4BE2A 2RNAA 3CCVT 1QVFS 2DERA 1KQSS 1LVKA 2BKDN 2BIVA 4E7SA 2R5AA 3UT1A 3LGLA 1UE9A 1GRIA 1OZ2A 4KT0E 3JCMQ 3MP1A 1X01A 2FPFA 4J9BA 1YCYA 2E4HA 3A8LB 2WACA 1HK9A 2X9HA 4LD6A 5KYXB 4DBHA 1P92A 1KHIA 2BZYA 2JTFA 1KD1C 1VQNQ 1PG5B 3M53A 1RL2A 2QEXA 3L2UA 2LQNA 2CKKA 3RR6A 2EYXA 3CCVQ 1X6OA 4M75G 3VYGA 2DJZA 2DA9A 2O9VA 2KRSA 2EIFA 2CZ7B 1WFWA 2XDDA 2CT3A 2QDLA 5FWCA 3VS0A 4JPBW 1YWPA 1VQ4Q 3ZFJA 2YRCA 1RACB 1HYOA 2X4WA 4D8DA 2ZPFB 1X43A 2EQMA 4BI4A 5GJWB 4HA8A 1GXIE 2QDYB 1M1KC 1WHHA 3EAEA 4M7AF 2RQWA 3OYGA 3CQTA 3NTHA 4DEYA 4QVZA 1C6VX 2P84A 2OAUA 4C92C 5LL6S 4BDYA 2MOXA 1Q81U 3S3OA 1BI3A 2DF6A 2YT6A 1BBZA 3JB9F 2PVOB 1TWBA 2OTJA 2ZPGB 2VVKA 2K2VA 3G1JA 4M77E 2VV5A 4OVAA 3JCMg 4OMLA 3OSVA 1AZGB 2MMPA 3LYIA 3NGPA 5KYWA 5GAOm 2F69A 1AWJA 3EG2A 4CC7A 1YWOA 2LMJA 1NJIR 3CCJQ 3MKDA 1PCXA 2DL3A 1Q82R 2EBPA 2KXCA 2A36A 3PE0A 1KG1A 1H8KA 2YLBA 1M3CA 4NL2A 4F7UB 1JB0E 1NPRA 1I5OB 1V1CA 4PK4A 5AT1B 2KAFA 1K8AR 3Q1JA 3QBYA 3FC3A 2QQSA 1PD0A 3CCEQ 3OYEA 1A0NB 2RK1A 1K1ZA 3OYAA 5HK3A 2GFUA 4OMOA 4QQDA 3QZ9B 2LT1A 5KE2A 8ATCB 1WGSA 4ZN1A 1MNEA 3HHTB 2DBKA 3PNWC 4UC4A 4RG8A 1NYGA 4AFSC 2PZ1A 3ZL7C 3OW2A 1U1TA 1KJWA 4PLIA 2CSQA 2C0OA 4FYYB 3O8VA 2RB6A 2FRWA 1W4SA 3SDZA 2RK2A 3MEAA 2COYA 2L2PA 4IIOA 2JVVA 3FEOA 2MF2A 3GP8A 4F16A 4M7DA 4J6WA 2NUPB 2V8JA 4JJCA 1TH7A 1U1SA 1G8XA 1Q7YU 1QVGP 2OTLQ 2JUFA 5CCAA 4PJLA 4CC4B 4R55A 3CCUT 3RKXA 2CUBA 2CZ1B 4BI3A 2X4XA 1S72A 1VIEA 1ZSZC 2DM1A 2VGMA 3FJPA 1H3ZA 5GAN2 4HCKA 1E7OA 5FU7C 3CC7A 2M16A 3JCMV 2P0KA 1X27A 2LCLA 1ZUUA 1U3OA 5CKEA 4EIKA 4JRIA 2RO0A 2ZPBB 3RNJA 1UJ0A 1QCOA 1X75C 1JJ2A 3CPWA 3UATA 2LQWA 3ER0A 3M4GA 2V8IA 1TOVA 1IGUA 2FB7A 3CCUQ 2K79A 3I9QA 2FG0A 3SWNB 4ZN3A 1S72Q 2PQWA 1WJQA 2DILA 2LC4A 2RA2A 2L89A 2ATCB 2DX1A 4M7AB 2ZPHB 3KUFA 3JSCA 3V7SA 2RQRA 3I56T 3OYBA 4LD9K 3JV3A 3CEYA 3CCRQ 4RTWA 2D8HA 4A4KA 3X20B 4HXJA 1XQHA 1JO8A 1LJOA 2GBQA 2XG8D 2B8AA 4M77C 5GAN8 3KXTA 1SRLA 1WQWA 1YITQ 3C12A 1M27C 3S3NA 5GANf 2JMAA 2EWNA 2O88A 2DL8A 1D1BA 3EGXB 4C8QC 2KRNA 1VA7A 4BB7A 2HQXA 4X9DA 1Q7YR 4Z88A 5CR2A 4X9CA 1YJWT 1W2BA 4ZGDB 2A28A 3VRYA 5HY6A 2RJDA 2DETA 3VYHB 2EJ9A 2F5KA 3QO3A 3JAME 4HVWA 1Y7XA 1VQOA 3JCMb 3HRSA 2HNIA 1IHVA 3FDRA 2QK0A 2F2VA 3A8GB 1AWXA 4J9CA 4J9EA 1HXDA 2ECZA 3UPUA 2ZGWA 1VQLA 1M2VB 2AIRB 2P4RA 4PFPA 5A0DA 2EGCA 5LJ5d 4J6XA 1OI1A 2JT4A 4JRPA 1GCQA 2LZ6B 3FB9A 4D8KA 3G6EQ 1VQ5Q 5FU6B 3CD6Q 2QA4A 2DEUA 1UTIA 1MNDA 1WLPB 3CXCA 3QIIA 1VYUA 2WSFE 4E47A 5LJ3h 1VQMA 2FVUA 2NWMA 1Y07A 1IXDA 5GAMd 1TS9A 2FPDA 1DJ7B 4LUDA 4M75B 2O31A 2RPNA 4A4HA 2DTOA 3QXEB 4M7AD 5GAOp 2CT4A 2I2LA 1TUCA 1Y96B 2HKNA 1R77A 3QYGB 1Q86R 3EFSA 3M58A 3H0HA 3VJPA 2QA4Q 4WTOB 1QCFA 1YHQQ 3FJ5A 2DZCA 2NYSA 2RMOA 3C94A 3M57A 3RIRA 3C4SA 1BCMA 3SEMA 2GQIA 2KBTA 1OU9A 4C0GA 4PJOF 1KQSP 1WJSA 3RESA 3CCMQ 3CXCP 2DRMA 2AHJB 4JDSA 1VQ8T 1H641 4AFUC 3X28B 5FW9A 2GTJA 4F7UF 4MMKA 4DOVA 4M7AC 4C5GA 3CXCS 3M0TA 1IHWA 2CGHA 1B34A 3FLGA 4B9WA 4OB3B 3QPHA 2EYQA 4FL6A 1YJ9Q 5GMKm 4MZTA 1M90C 1BYMA 1K0XA 1BIAA 1VQPA 1QLYA 2JS2A 4O5VA 1I4K1 3TSWA 4JZ3A 3EG9B 4XTUA 2CS7A 3X24B 4PJMA 3M4YA 3CCUA 1MHNA 4RUGA 3L1AA 5GAMh 3CC4Q 1M2VA 1MMGA 1RUWA 2JNGA 3H9NA 1WPYA 2LTOA 1ZSZB 3OSSC 3CC7T 3L2ZA 2J6FA 1BB9A 2DBMA 5CQXA 4QW2A 1FWZA 1VUBA 2KMTA 1WXUA 1IB8A 1NE8A 2F1LA 2CYZB 4KH1B 1IRXA 2I0NA 2JOYA 1XNIA 3E9GA 2CZ6B 2FO0A 4C8QD 4C8QE 2JJ9A 3GNGA 2V26A 4AT1B 2G3RA 3V8LA 2LNHB 3U23A 1H92A 2OTJQ 5GMKh 2OTJT 1GL5A 4OGCA 5A0LA 2DKGA 5FU7B 2A08A 4ELYC 4OB0B 5D7UA 3GPLA 1HJDA 4XTWA 1M4ZA 2DL4A 5I11A 2K7AA 3CD6T 1NEBA 1VQ9Q 1QWEA 3L2WA 1OU8A 4F7UE 2FEIA 5GAOq 2ZCFB 1M90U 1ZUKA 2MWPA 3THKA 1VQ6Q 2J7IA 3EHQA 1B7TA 4FCYA 2K2MA 1ABQA 2K6DA 3CBOA 3NTKA 1ZSZA 2P0PA 2CUDA 2XDPA 4J9HA 3OYFA 4IKFA 2PTKA 2JM9A 3JB9D 4A54A 1RLPC 1NJIU 3G6ET 1VQ5T 3FRNA 2JN0A 2FZCB 1M2OA 2E41A 1PC0A 1QWFA 1YCSB 1KQ2A 2AK5A 3G4ST 2YSQA 3JB9J 2F2XA 6AT1B 2O01E 3OW2S 3E2UA 3KBGA 1NEGA 1NBEB 2K3BA 3OB9A 1TUGB 2LVMA 1VQLT 2RHIA 2RHXA 4JUVA 2KDSA 4HVVA 1M1KR 1GCQC 2K4YA 4OMPA 3RDVA 2ABLA 2NUTB 4XK8E 3QUIA 2DXTA 1K73C 3PIOA 1JEGA 2ROTA 4GLMA 4JS5A 1U06A 5CAIA 1NPPA 1IZ6A 5KYUA 4AG1C 3E19A 4F14A 4XTVA 2X4YA 1Q95G 1V76A 2K5LA 1K4US 2RN8A 5GAMe 4AFZC 3P8DA 4RTVA 2DNUA 2X35A 1S72T 3DB3A 1BIBA 1BKBA 2PVDB 4EMHA 5KYYB 1WHMA 4FSXA 3BY7A 2E12A 1R8OB 3EGDA 4QQGA 3VV0A 1SHFA 4ELZC 1KHCA 2BUDA 1Q82C 2EKOA 3VU3C 2HQEA 2KSSA 3SD4A 4F7UG 5CKBA 5KYXA 3FIFA 2EQUA 3RMSA 4FYXB 4IUPA 2A3LA 2VGNA 3JCMf 1LPLA 1I0CA 4A53A 2IPOB 4XAXB 3DLLA 4J6YA 5CQYA 3G71A 2QQRA 4DQ2A 1KIKA 4B6MA 3EG1A 4J7FA 2E5QA 1OEBA 1UGSB 4KUIA 3QKJA 1ACMB 1G3SA 4PJOB 1YBYA 3M5AA 5CKFA 3X25B 2EFIA 3RBBB 3L2RA 3M59A 4II1A 1AHJB 1UGPB 4OF1A 2C0TA 2PUKB 2NLUA 1QW1A 3EG0A 1WX6A 4C92D 2H3JA 1NYFA 3REBB 3G71Q 2KYMA 4FW2A 3AT1B 4RKUE 3HTRA 4Z02A 4M77F 1X6GA 2RI2A 3RUXA 1OZ3A 2ZPEB 5GMKe 4XU0A 3OYHA 2QQ9A 1WNLA 2FHDA 1N27A 1EIFA 2DTHA 1ARKA 3JCMh 5I2MA 1VQOT 4J9FA 3QJYA 3HFOA 2AZSA 3V7CA 1OULA 1T0HA 1JQQA 3LH0A 3I5SA 1B3QA 2K3XA 3H41A 3M0RA 3PT9A 5I2SA 2EQJA 4A63B 5IN1A 4J5YA 3MHXA 2M51A 1MMNA 5LJ5g 1YN8A 1QVPA 5GANe 4ANJA 1MV0B 3CD6A 1ZSGA 3M0SA 4A4GA 4B9XA 2QA4T 4Y91A 3QSUA 1BCOA 1Y71A 2DEQA 4J83A 4M75A 5IHNA 4ZGEB 5D6WA 2RQTA 2JMCA 2QI2A 1JXMA 1RADB 2FYKA 3J80E 1Y57A 2RHYA 4RTYA 2RHUA 5FLXE 2DRKA 4QQ6A 2CP3A 5GAN3 1PD1A 2B86A 1TG0A 3UF4A 5DY9A 3PMTA 3M54A 1RAHB 3MP8A 1PM3A 5GANd 5GAOl 2DFUA 4M78B 5KCOA 2DLPA 2GF7A 2HSEB 4L6V5 3CC4T 9ATCB 5J26A 4PJOG 1YIJQ 4Y92A 1VQ7A 1UECA 3EH2A 2GCXA 4JJDA 1YJNA 2MI6A 4C92B 1KD1R 2CREA 2FRYA 1VQ4A 4LDUA 4N4IA 2M1HA 4LDYA 1VQ8A 2BZ8A 2DK3A 1VQMQ 4F17A 3EFOA 4E7ZA 1M8VA 1IREB 1SG5A 1K8AU 3J7AF 1V29B 3ZEHA 3WXMB 2X51A 4N4GA 4KUDK 4X1VA 5L8RE 2GFAA 4M77B 4BE1A 4RTXA 1KSWA 2RI3A 1G5VA 2BTTA 1YJWQ 4R0KA 2P4TA 3CPWS 7AT1B 4OB1B 2GGRA 1YJNQ 1UFFA 2O2OA 4M4ZA 4EMKA 2HKQB 1K9MR 2ED0A 1ZX6A 3A98A 1Q86U 2DE0X 1AD5A 4LDWA 1VQPT 4A4EA 2VXFA 2XICA 4QVCA 3SB2A 3M0QA 3JCMJ 1FMWA 1UGRB 3I55A 5LJ3j 4C8QA 2RQUA 2KR3A 5CO7A 5GAMf 4IURA 3BFMA 2QAZA 1X69A 2M9UA 1QVFP 2XD0A 3M56A 3OYMA 4ESRA 4V2SA 1KQSA 2KQWA 4M7DF 5HK0A 2DVEA 3H8ZA 4C8QG 4PJOC 3MEWA 1Z9ZA 4DA4A 2CH4A 3PVQA 1Q82U 4FM4B 1BK2A 2PUOB 3JCMe 3S3MA 4ZNXA 2K5FA 3X26B 3RMQA 1SSFA 3DB4A 1W1FA 2OJ2A 2EQIA 2JZ2A 4NL3A 1Q86C 2RJEA 4BDZA 3META 1AVZC 2K9GA 1VOMA 2JXBA 1M3AA 2YWWA 2ENMA 4M78G 5GAN5 3OA6A 4RCCA 2CP2A 3OS5A 3GIBA 2E6ZA 3ASKA 2KY9A 1MUZA 1UHCA 2EYYA 2ZZDA 1NZ9A 1FMVA 2DAQA 2YDLA 2MK5A 1AT1B 1G3TA 1IO6A 3PGGA 4EMKB 4X34A 1N8RC 1PKSA 2DIGA 2KXDA 5FRNA 4EPCA 3MO8A 2RI5A 1YNZA 1I1JA 3MP6A 1O9SA 3CCLA 2NUZA 4FW1A 1QVGA 1EFNA 5FU6C 4HCZA 2OTLT 1SEMA 4M77D 4WCIA 3OYLA 1LCKA 1M3BA 2EYWA 1LNXA 4M7DG 4GBQA 2XIDA 1N9SA 3WVDB 4C0FA 1ABOA 4PL6A 4EDUA 3RERA 1TU0B 3BDLA 1C1AA 4J9DA 2KT8A 4CC3A 2DJQA 3J81E 3E9FA 1UGQB 2J06A 2QQAA 1YI2Q 2CP0A 3HL8A 3CCQQ 2QGFB 3G6EA 1VQ5A 4GLKA 3CMET 3CMEQ 1SF9A 4KGXB 1C0MA 3EG9A 3TQ7P 3URGA 5AYFA 1N8RU 4C5IA 4M78C 1AEYA 2KK4A 1U8RA 3I5RA 1KFZA 3G4SA 4BI8B 1NJIC 5C0MA 1W2BS 3LX7A 1KC8U 3CCRT 3CCET 1E6HA 3MEUA 4C8QB 1QMCA 4BE0A 4XTYA 3OQ5A 1FYNA 3GLXA 1M1KU 4C0DB 2L5QA 3P8BB 4KH0B 3F70A 4L59A 4Z89A 4FT4A 2YUNA 4M78F 1CKAA 2W0ZA 2QGGA 1PWTA 4IUQA 4PFOA 4KULA 2E3HA 2QXFA 3H6ZA 2LJ3A 4OGEA 4JZ4A 4IUVA 4N0AA 2Y4YA 5DLOA 1ZBXA 2LRQA 1EX4A 3CCLQ 1I5LA 2FL7A 2K3YA 2BE7D 4CI0C 1KQ1A 1NG2A 1EZZB 3QWYA 2YRVA 4OMQA 3OYNA 3CCST 1RAFB 3CCJT 3MPUB 2PNIA 2EKHA 1BI2A 1GFDA 2MPXC 1Y0MA 4HCBA 4N0AC 4BY6B 4C92A 5GAMg 2QTVA 4VUBA 1QQJA 4TVRA 2IG0A 3PIPA 2XDBA 3JCMP 2HZYA 1UHFA 1T0JA 2PVGB 3VS4A 1VQ7T 1PSFA 4RG2A 2XHCA 1I81A 2BE9B 5D6YA 1WHJA 4M77G 2VUBA 4C92G 5GMKl 1QP2A 3CCSQ 2SRCA 3C95A 1VQPQ 2O4XA 2QQBA 1RAIB 2O4XB 4C5EA 3LH5A 3S6WA 3A1PA 1Z9QA 4PJOE 4ZTJA 1VQOQ 4M77A 1RLQC 5GJVB 4DBRA 2J05A 4M78E 3SWNC 3G71T 3RKYA 4Z8AA 4XTZA 2R5MA 4Q5WA 2LCSA 1M90R 4FU6A 2L3QA 1G2BA 3CCQA 2O9SA 1ZBJA 3A8OB 4J9IA 2OI3A 3PFSA 2KYBA 2E1HA 2C0IA 4ORZA 3CBPA 4M7DD 1LOJA 2GTOA 2EYZA 2RQVA 4LE9A 1YJ9T 1RAAB 2ESWA 4KGVB 3PTAA 1JU5C 4MMLA 3QYHB 2DD5A 1X2QA 2Y90A 8AT1B 3NMZC 1B07A 4MDWA 3UA7A 3OW2P 1K73R 4BY6C 1TUDA 2GQVA 2YUQA 1U5SA 1G83A 2EVRA 1BI0A 2HL3A 2E64A 2LDMA 1YIJA 1K76A 2HBWA 2COWA 3CMAT 3EGUA 1MMDA 2VB6A 2DPPB 3OBYA 3DKMA 1WIEA 2KEAA 2DXUA 1VQ9A 1QVFA 4E7LA 5IAYA 2NUPA 4XQ3A 3GNFB 3LGFA 4IUUA 2RF0A 2JW4A 2DZ9A 4ME7A 3EG3A 1VQ8Q 5J39A 5KYNA 1QCNA 2PU9B 1MMAA 1UDLA 3JB9G 1ZHIA 2CP7A 2E3IA 4PLLA 1OQKA 3JCMd 5LJ3f 1VQKA 3QHSA 2BZXA 2H3EB 3L2QA 1D0XA 1OV3A 3INZA 1ZQ1A 3AHUA 2LNVA 2D8JA 3VS7A 5KCHA 2DYBA 2ZAEA 3JB9I 5LJ3e 3A8MB 1D1AA 5LJ5j 3CCLT 1JJ2S 2V1QA 1RI9A 4XU3A 1VQ6A 3LWHA 1YHQA 4E6RA 2OTLA 1R0BG 2FZKB 4M75C 4M78A 3DLMA 3M0PA 1JJ2P 4E7JA 4JJBA 3VS1A 2YHTA 2KRMA 2AKKA 1T3SA 4QT7A 3NPFA 2DIQA 4M7AE 1VYTA 2CSIA 3TSZA 5GANg 4QKUA 4C0DC 5EG2A 3CC4A 4EMGA 5EC7A 1TSFA 2ROLA 1YJNT 1TXQA 2WSEE 4C8QF 1WI7A 3QWXX 5IH2A 2AKLA 1OX9A 2RH2A 3TVTA 1VQ4T 1K9MC 1H3HA 4C92E 4E2FB 1BI1A 3CCRA 3QDFA 4C5HA 3TU4K 1VQNT
chains in the Genus database with same CATH topology
1VQ7Q 3OW2P 1K73R 1NJIR 1K9MR 3CCLQ 3CCJQ 1VQOQ 2OTJQ 1VQMQ 1Q7YR 1VQ6Q 3I56Q 1VQ8Q 1YI2Q 2QA4Q 3CCEQ 3CCQQ 1QVGP 3CMAQ 2OTLQ 1S72Q 1YIJQ 1W2BP 1Q82R 3CC2Q 1VQNQ 1YHQQ 3CMEQ 1M1KR 3CCVQ 1KC8R 1YITQ 1Q81R 1M90R 1JJ2P 1VQLQ 1KD1R 2QEXQ 3G6EQ 1VQ5Q 3CCSQ 3CC7Q 3CC4Q 3CD6Q 1VQPQ 1VQ9Q 3CPWP 1QVFP 1YJWQ 1KQSP 3G4SQ 1VQKQ 3G71Q 1N8RR 1YJ9Q 1K8AR 1VQ4Q 3CCMQ 1YJNQ 3CXCP 3I55Q 1Q86R 3CCRQ 3CCUQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 Q;  3OW2 P;  1K73 R;  1NJI R;  1K9M R;  3CCL Q;  3CCJ Q;  1VQO Q;  2OTJ Q;  1VQM Q;  1Q7Y R;  1VQ6 Q;  3I56 Q;  1VQ8 Q;  1YI2 Q;  2QA4 Q;  3CCE Q;  3CCQ Q;  1QVG P;  3CMA Q;  2OTL Q;  1S72 Q;  1YIJ Q;  1W2B P;  1Q82 R;  3CC2 Q;  1VQN Q;  1YHQ Q;  3CME Q;  1M1K R;  3CCV Q;  1KC8 R;  1YIT Q;  1Q81 R;  1M90 R;  1JJ2 P;  1VQL Q;  1KD1 R;  2QEX Q;  3G6E Q;  1VQ5 Q;  3CCS Q;  3CC7 Q;  3CC4 Q;  3CD6 Q;  1VQP Q;  1VQ9 Q;  3CPW P;  1QVF P;  1YJW Q;  1KQS P;  3G4S Q;  1VQK Q;  3G71 Q;  1N8R R;  1YJ9 Q;  1K8A R;  1VQ4 Q;  3CCM Q;  1YJN Q;  3CXC P;  3I55 Q;  1Q86 R;  3CCR Q;  3CCU Q; 
#chains in the Genus database with same CATH topology
 2M0O A;  3CCE A;  1XTD A;  1UGV A;  4OMN A;  1JXO A;  3QDR B;  4XU1 A;  4JS4 A;  1I8F A;  1VQL Q;  2HSP A;  1MV3 A;  1HD3 A;  5LJ3 g;  3EGX A;  2H8H A;  1YIT A;  3WVE B;  3EH1 A;  4M75 E;  4JLI A;  2LX9 A;  1N5Z A;  3QZ5 B;  3JCM X;  1OPL A;  3OS1 A;  3I55 T;  3HRT A;  1SKU B;  2K5I A;  3CCS A;  3EFR A;  1WHG A;  1Y96 A;  2MYS A;  1VQK Q;  2MIO A;  1WXT A;  1N8R R;  4EMK C;  5DM7 R;  3CCM T;  5KE3 A;  4PJJ A;  3TCJ A;  2LP5 A;  4JJN K;  3V7R A;  3RKW A;  4NOY A;  1YI2 T;  2FPE A;  4RCB A;  2ZPI B;  2V8K A;  4CRI A;  5GAM j;  4CC2 A;  3LWI A;  3TRE A;  4LUE A;  1E6G A;  2AT1 B;  5DLQ E;  2D1X A;  1D0Y A;  4PNO A;  2NUT A;  2LT4 A;  1ZA1 B;  2K57 A;  3HP9 A;  4K11 A;  4RTT A;  2RM4 A;  3NHN A;  1W2B P;  4OB2 B;  4NS5 A;  2V1R A;  2DXC A;  1FMK A;  4RTU A;  2R57 A;  1FXX A;  3CBM A;  2LX7 A;  2MWO A;  4FT2 A;  1XOV A;  1RAB B;  2COZ A;  3V8J A;  3D7S B;  2DL7 A;  3NFC A;  2L3R A;  1X2K A;  4J7I A;  4XU2 A;  2IVW A;  3LW5 E;  5IHI A;  2X3W D;  2YLC A;  3CCV A;  4HT9 A;  3BE3 A;  2R58 A;  2L3P A;  3SFM A;  4MZM A;  5M9O A;  1K0S A;  1UJY A;  4M75 D;  3TEE A;  1YJ9 A;  4OMF B;  3CC2 A;  3JRZ A;  1AWW A;  1QKW A;  1ZA2 B;  1O75 A;  1WYX A;  5KYY A;  1PRM C;  2HMA A;  2KE9 A;  2HDA A;  4KRT A;  1UG1 A;  1OPK A;  2CP5 A;  5A2Q E;  5FWB A;  5IHK A;  1F1B B;  3CME A;  4Y28 E;  3A5Z B;  3VS6 A;  2W10 A;  1YIJ T;  2D0N A;  3OS0 A;  3CMA A;  5HCK A;  2D0Q B;  2D9T A;  5A0G A;  1M5Q 1;  4XTX A;  2EJG A;  1WA7 A;  4QVD A;  2HBP A;  4IUT A;  2XMF A;  3HRU A;  4M75 F;  3JB9 H;  2KRO A;  3JCM c;  3H0I A;  2RHZ A;  2MCN A;  1FX7 A;  1XJW B;  3R6O A;  5KYU B;  5HKC A;  1AZE A;  5IXB A;  2DO3 A;  3M55 A;  4AFQ C;  1RAE B;  1WDX A;  4DBF A;  1KC8 C;  2VAS A;  1OX8 A;  2ED1 A;  1JRI A;  2JTE A;  1NM7 A;  1W6X A;  2QAS A;  3NTI A;  3L2V A;  4DEX A;  4PJN A;  4FIB A;  2F5T X;  1VQ7 Q;  4FYW B;  1UEB A;  3OS2 A;  1PSE A;  4P5N A;  1M1F A;  2JTM A;  4HKE A;  1VQ6 T;  2RD1 A;  3CC2 Q;  4AMC A;  1YHQ T;  2P0Q A;  5IT9 E;  5ECA A;  1YFN A;  3T9N A;  1WXB A;  4M7D C;  3SWN A;  2F2W A;  3CCJ A;  4PKC C;  4WF2 A;  1D09 B;  2X3X D;  1SHG A;  1ZLM A;  3O5Z A;  4LXC A;  3KFV A;  2HEQ A;  1PNJ A;  2XKO C;  2J6O A;  3UA6 A;  5J3B A;  2OX7 A;  2C06 A;  2M0Y A;  5GAN 6;  3BDU A;  1NLP C;  2HAX A;  3EGD B;  1ZUY A;  4DOW A;  1VYV A;  4J8O A;  2KI7 A;  4ZGJ B;  2L3S A;  2DL5 A;  1K8A C;  1VQN A;  1WQ7 A;  4ZTF A;  1T3L A;  4LDV A;  2RJC A;  3EHR A;  3C0C A;  2RJF A;  4GY5 A;  3JCM W;  1IGQ A;  2LJ1 A;  5LJ5 h;  2HCK A;  2QTX A;  5CK9 A;  2E10 A;  4BUG A;  3M0U A;  2LCC A;  3ULR B;  3IQL A;  3PMI A;  3CCQ T;  4E7H A;  5CKD A;  1GFC A;  3UDC A;  2DD4 A;  3CMA Q;  1PHT A;  1K9A A;  1M30 A;  4AG2 C;  3OYC A;  4M7D E;  5L23 A;  4J9G A;  3REA B;  1G3W A;  2YUO A;  2EW3 A;  2VWF A;  3OYK A;  1GBQ A;  2DTI A;  3QG1 A;  4N4H A;  4LN2 A;  5CKH A;  1M8M A;  5GAN 7;  3PVL A;  1R0C B;  4PJO A;  5KYW B;  3HKS A;  4O6J A;  3CCM A;  5GMK i;  4BD3 A;  4C0Z A;  1TTH B;  2QEX T;  2AZV A;  2E5K A;  4F04 B;  2EGE A;  5IXF A;  2HQH A;  5GMK j;  1YI2 A;  5C6S A;  1SRM A;  4F7U A;  1HSQ A;  4FYV B;  1QVG S;  4R56 A;  1B34 B;  3VS5 A;  1D3B A;  2YXY A;  5GAO r;  2CDT A;  1KD1 U;  2DMO A;  1VQ9 T;  3V8K A;  3R6N A;  1G3Y A;  1NLO C;  2LQK A;  2HD0 A;  1K73 U;  2DVJ A;  4L5G A;  1UUE A;  3OMC A;  4M78 D;  2VC8 A;  5GAN 4;  1Q7Y C;  4HCC A;  1SSH A;  5GAN h;  3VKI A;  5KH6 A;  1VQK T;  2KVQ G;  2LJ0 A;  4MZP A;  1OYX A;  3P8H A;  1GCP A;  5LJ5 f;  2DYI A;  1W70 A;  1Q81 C;  4LNP A;  2EPD A;  2QYZ A;  1S1N A;  2E6N A;  4IIM A;  2EJF A;  3MCA B;  1D1C A;  3CC2 T;  1RI0 A;  2WSC E;  1AOJ A;  2LQ8 A;  4M7D B;  2A37 A;  1Q81 R;  5GAN j;  3BW1 A;  2QG9 B;  3GOX A;  5FRM A;  1PKT A;  3I56 A;  3GBQ A;  3HFN A;  4HVU A;  4OP0 A;  2JS0 A;  3CPF A;  4MDX A;  3EFO B;  1I07 A;  2M02 A;  2KNB B;  2VXE A;  2XK0 A;  2L0A A;  4RTZ A;  5I21 A;  1SPK A;  4KGZ B;  1JBM A;  3VS3 A;  1PRL C;  4KBM B;  3VRZ A;  2OAW A;  2G6F X;  1X6B A;  2JM8 A;  3G4S Q;  3OMG A;  3ME9 A;  1VIF A;  2YUP A;  1N9R A;  3I55 Q;  1RAG B;  4E7K A;  3OYJ A;  3OYY A;  3I56 Q;  1YJW A;  4JLG A;  3A8H B;  1WHL A;  4FSS A;  2SEM A;  4E7I A;  3VUZ A;  4RMO A;  4LDX A;  1YP5 A;  4PJO D;  2EAY A;  5CIU A;  2X4J A;  4DBQ A;  3VUB A;  3MEV A;  2Z0W A;  3OY9 A;  2A7Y A;  2MAM A;  2A0F B;  4A4F A;  1YIT T;  3G7Z A;  1KC8 R;  5LJ3 d;  3OYI A;  4JRQ A;  1D3B B;  2XU8 A;  3HPW A;  4OMM A;  3N5B B;  2E65 A;  1QKX A;  3I35 A;  5D6X A;  1CKB A;  2KT1 A;  2EGA A;  3ZBD A;  1WZO A;  1M9S A;  3LLR A;  2Y4X A;  2EQK A;  4YTL A;  5GAO n;  4HT8 A;  2CP6 A;  1CSK A;  5CVI A;  1M1G A;  3MJX A;  2GNC A;  4D6W A;  2HL5 C;  3HSB A;  3M9Q A;  1VQM T;  2IIM A;  2J6K A;  4JRK A;  3SHW A;  2XI9 A;  2E70 A;  5I22 A;  1N6A A;  3OYD A;  1D0Z A;  2KGT A;  5LJ5 e;  1J3T A;  3CC7 Q;  2L8D A;  2D6F A;  1QP3 A;  2DXB A;  3CPW P;  3H0F A;  2FZG B;  4BAC A;  4PFZ A;  3E1S A;  1GBR A;  5FRO A;  1MGQ A;  2CH4 W;  4C92 F;  1AWO A;  4M7A G;  1WJR A;  3QJ6 A;  4ATO A;  1OOT A;  2CZ0 B;  3VS2 A;  1WHK A;  3UWN A;  1K9M U;  1KK7 A;  3OBW A;  3L42 A;  3GF5 A;  2QEX Q;  1BU1 A;  1UB4 A;  2VKN A;  2VYT A;  2YRD A;  4M7A A;  4BE2 A;  2RNA A;  3CCV T;  1QVF S;  2DER A;  1KQS S;  1LVK A;  2BKD N;  2BIV A;  4E7S A;  2R5A A;  3UT1 A;  3LGL A;  1UE9 A;  1GRI A;  1OZ2 A;  4KT0 E;  3JCM Q;  3MP1 A;  1X01 A;  2FPF A;  4J9B A;  1YCY A;  2E4H A;  3A8L B;  2WAC A;  1HK9 A;  2X9H A;  4LD6 A;  5KYX B;  4DBH A;  1P92 A;  1KHI A;  2BZY A;  2JTF A;  1KD1 C;  1VQN Q;  1PG5 B;  3M53 A;  1RL2 A;  2QEX A;  3L2U A;  2LQN A;  2CKK A;  3RR6 A;  2EYX A;  3CCV Q;  1X6O A;  4M75 G;  3VYG A;  2DJZ A;  2DA9 A;  2O9V A;  2KRS A;  2EIF A;  2CZ7 B;  1WFW A;  2XDD A;  2CT3 A;  2QDL A;  5FWC A;  3VS0 A;  4JPB W;  1YWP A;  1VQ4 Q;  3ZFJ A;  2YRC A;  1RAC B;  1HYO A;  2X4W A;  4D8D A;  2ZPF B;  1X43 A;  2EQM A;  4BI4 A;  5GJW B;  4HA8 A;  1GXI E;  2QDY B;  1M1K C;  1WHH A;  3EAE A;  4M7A F;  2RQW A;  3OYG A;  3CQT A;  3NTH A;  4DEY A;  4QVZ A;  1C6V X;  2P84 A;  2OAU A;  4C92 C;  5LL6 S;  4BDY A;  2MOX A;  1Q81 U;  3S3O A;  1BI3 A;  2DF6 A;  2YT6 A;  1BBZ A;  3JB9 F;  2PVO B;  1TWB A;  2OTJ A;  2ZPG B;  2VVK A;  2K2V A;  3G1J A;  4M77 E;  2VV5 A;  4OVA A;  3JCM g;  4OML A;  3OSV A;  1AZG B;  2MMP A;  3LYI A;  3NGP A;  5KYW A;  5GAO m;  2F69 A;  1AWJ A;  3EG2 A;  4CC7 A;  1YWO A;  2LMJ A;  1NJI R;  3CCJ Q;  3MKD A;  1PCX A;  2DL3 A;  1Q82 R;  2EBP A;  2KXC A;  2A36 A;  3PE0 A;  1KG1 A;  1H8K A;  2YLB A;  1M3C A;  4NL2 A;  4F7U B;  1JB0 E;  1NPR A;  1I5O B;  1V1C A;  4PK4 A;  5AT1 B;  2KAF A;  1K8A R;  3Q1J A;  3QBY A;  3FC3 A;  2QQS A;  1PD0 A;  3CCE Q;  3OYE A;  1A0N B;  2RK1 A;  1K1Z A;  3OYA A;  5HK3 A;  2GFU A;  4OMO A;  4QQD A;  3QZ9 B;  2LT1 A;  5KE2 A;  8ATC B;  1WGS A;  4ZN1 A;  1MNE A;  3HHT B;  2DBK A;  3PNW C;  4UC4 A;  4RG8 A;  1NYG A;  4AFS C;  2PZ1 A;  3ZL7 C;  3OW2 A;  1U1T A;  1KJW A;  4PLI A;  2CSQ A;  2C0O A;  4FYY B;  3O8V A;  2RB6 A;  2FRW A;  1W4S A;  3SDZ A;  2RK2 A;  3MEA A;  2COY A;  2L2P A;  4IIO A;  2JVV A;  3FEO A;  2MF2 A;  3GP8 A;  4F16 A;  4M7D A;  4J6W A;  2NUP B;  2V8J A;  4JJC A;  1TH7 A;  1U1S A;  1G8X A;  1Q7Y U;  1QVG P;  2OTL Q;  2JUF A;  5CCA A;  4PJL A;  4CC4 B;  4R55 A;  3CCU T;  3RKX A;  2CUB A;  2CZ1 B;  4BI3 A;  2X4X A;  1S72 A;  1VIE A;  1ZSZ C;  2DM1 A;  2VGM A;  3FJP A;  1H3Z A;  5GAN 2;  4HCK A;  1E7O A;  5FU7 C;  3CC7 A;  2M16 A;  3JCM V;  2P0K A;  1X27 A;  2LCL A;  1ZUU A;  1U3O A;  5CKE A;  4EIK A;  4JRI A;  2RO0 A;  2ZPB B;  3RNJ A;  1UJ0 A;  1QCO A;  1X75 C;  1JJ2 A;  3CPW A;  3UAT A;  2LQW A;  3ER0 A;  3M4G A;  2V8I A;  1TOV A;  1IGU A;  2FB7 A;  3CCU Q;  2K79 A;  3I9Q A;  2FG0 A;  3SWN B;  4ZN3 A;  1S72 Q;  2PQW A;  1WJQ A;  2DIL A;  2LC4 A;  2RA2 A;  2L89 A;  2ATC B;  2DX1 A;  4M7A B;  2ZPH B;  3KUF A;  3JSC A;  3V7S A;  2RQR A;  3I56 T;  3OYB A;  4LD9 K;  3JV3 A;  3CEY A;  3CCR Q;  4RTW A;  2D8H A;  4A4K A;  3X20 B;  4HXJ A;  1XQH A;  1JO8 A;  1LJO A;  2GBQ A;  2XG8 D;  2B8A A;  4M77 C;  5GAN 8;  3KXT A;  1SRL A;  1WQW A;  1YIT Q;  3C12 A;  1M27 C;  3S3N A;  5GAN f;  2JMA A;  2EWN A;  2O88 A;  2DL8 A;  1D1B A;  3EGX B;  4C8Q C;  2KRN A;  1VA7 A;  4BB7 A;  2HQX A;  4X9D A;  1Q7Y R;  4Z88 A;  5CR2 A;  4X9C A;  1YJW T;  1W2B A;  4ZGD B;  2A28 A;  3VRY A;  5HY6 A;  2RJD A;  2DET A;  3VYH B;  2EJ9 A;  2F5K A;  3QO3 A;  3JAM E;  4HVW A;  1Y7X A;  1VQO A;  3JCM b;  3HRS A;  2HNI A;  1IHV A;  3FDR A;  2QK0 A;  2F2V A;  3A8G B;  1AWX A;  4J9C A;  4J9E A;  1HXD A;  2ECZ A;  3UPU A;  2ZGW A;  1VQL A;  1M2V B;  2AIR B;  2P4R A;  4PFP A;  5A0D A;  2EGC A;  5LJ5 d;  4J6X A;  1OI1 A;  2JT4 A;  4JRP A;  1GCQ A;  2LZ6 B;  3FB9 A;  4D8K A;  3G6E Q;  1VQ5 Q;  5FU6 B;  3CD6 Q;  2QA4 A;  2DEU A;  1UTI A;  1MND A;  1WLP B;  3CXC A;  3QII A;  1VYU A;  2WSF E;  4E47 A;  5LJ3 h;  1VQM A;  2FVU A;  2NWM A;  1Y07 A;  1IXD A;  5GAM d;  1TS9 A;  2FPD A;  1DJ7 B;  4LUD A;  4M75 B;  2O31 A;  2RPN A;  4A4H A;  2DTO A;  3QXE B;  4M7A D;  5GAO p;  2CT4 A;  2I2L A;  1TUC A;  1Y96 B;  2HKN A;  1R77 A;  3QYG B;  1Q86 R;  3EFS A;  3M58 A;  3H0H A;  3VJP A;  2QA4 Q;  4WTO B;  1QCF A;  1YHQ Q;  3FJ5 A;  2DZC A;  2NYS A;  2RMO A;  3C94 A;  3M57 A;  3RIR A;  3C4S A;  1BCM A;  3SEM A;  2GQI A;  2KBT A;  1OU9 A;  4C0G A;  4PJO F;  1KQS P;  1WJS A;  3RES A;  3CCM Q;  3CXC P;  2DRM A;  2AHJ B;  4JDS A;  1VQ8 T;  1H64 1;  4AFU C;  3X28 B;  5FW9 A;  2GTJ A;  4F7U F;  4MMK A;  4DOV A;  4M7A C;  4C5G A;  3CXC S;  3M0T A;  1IHW A;  2CGH A;  1B34 A;  3FLG A;  4B9W A;  4OB3 B;  3QPH A;  2EYQ A;  4FL6 A;  1YJ9 Q;  5GMK m;  4MZT A;  1M90 C;  1BYM A;  1K0X A;  1BIA A;  1VQP A;  1QLY A;  2JS2 A;  4O5V A;  1I4K 1;  3TSW A;  4JZ3 A;  3EG9 B;  4XTU A;  2CS7 A;  3X24 B;  4PJM A;  3M4Y A;  3CCU A;  1MHN A;  4RUG A;  3L1A A;  5GAM h;  3CC4 Q;  1M2V A;  1MMG A;  1RUW A;  2JNG A;  3H9N A;  1WPY A;  2LTO A;  1ZSZ B;  3OSS C;  3CC7 T;  3L2Z A;  2J6F A;  1BB9 A;  2DBM A;  5CQX A;  4QW2 A;  1FWZ A;  1VUB A;  2KMT A;  1WXU A;  1IB8 A;  1NE8 A;  2F1L A;  2CYZ B;  4KH1 B;  1IRX A;  2I0N A;  2JOY A;  1XNI A;  3E9G A;  2CZ6 B;  2FO0 A;  4C8Q D;  4C8Q E;  2JJ9 A;  3GNG A;  2V26 A;  4AT1 B;  2G3R A;  3V8L A;  2LNH B;  3U23 A;  1H92 A;  2OTJ Q;  5GMK h;  2OTJ T;  1GL5 A;  4OGC A;  5A0L A;  2DKG A;  5FU7 B;  2A08 A;  4ELY C;  4OB0 B;  5D7U A;  3GPL A;  1HJD A;  4XTW A;  1M4Z A;  2DL4 A;  5I11 A;  2K7A A;  3CD6 T;  1NEB A;  1VQ9 Q;  1QWE A;  3L2W A;  1OU8 A;  4F7U E;  2FEI A;  5GAO q;  2ZCF B;  1M90 U;  1ZUK A;  2MWP A;  3THK A;  1VQ6 Q;  2J7I A;  3EHQ A;  1B7T A;  4FCY A;  2K2M A;  1ABQ A;  2K6D A;  3CBO A;  3NTK A;  1ZSZ A;  2P0P A;  2CUD A;  2XDP A;  4J9H A;  3OYF A;  4IKF A;  2PTK A;  2JM9 A;  3JB9 D;  4A54 A;  1RLP C;  1NJI U;  3G6E T;  1VQ5 T;  3FRN A;  2JN0 A;  2FZC B;  1M2O A;  2E41 A;  1PC0 A;  1QWF A;  1YCS B;  1KQ2 A;  2AK5 A;  3G4S T;  2YSQ A;  3JB9 J;  2F2X A;  6AT1 B;  2O01 E;  3OW2 S;  3E2U A;  3KBG A;  1NEG A;  1NBE B;  2K3B A;  3OB9 A;  1TUG B;  2LVM A;  1VQL T;  2RHI A;  2RHX A;  4JUV A;  2KDS A;  4HVV A;  1M1K R;  1GCQ C;  2K4Y A;  4OMP A;  3RDV A;  2ABL A;  2NUT B;  4XK8 E;  3QUI A;  2DXT A;  1K73 C;  3PIO A;  1JEG A;  2ROT A;  4GLM A;  4JS5 A;  1U06 A;  5CAI A;  1NPP A;  1IZ6 A;  5KYU A;  4AG1 C;  3E19 A;  4F14 A;  4XTV A;  2X4Y A;  1Q95 G;  1V76 A;  2K5L A;  1K4U S;  2RN8 A;  5GAM e;  4AFZ C;  3P8D A;  4RTV A;  2DNU A;  2X35 A;  1S72 T;  3DB3 A;  1BIB A;  1BKB A;  2PVD B;  4EMH A;  5KYY B;  1WHM A;  4FSX A;  3BY7 A;  2E12 A;  1R8O B;  3EGD A;  4QQG A;  3VV0 A;  1SHF A;  4ELZ C;  1KHC A;  2BUD A;  1Q82 C;  2EKO A;  3VU3 C;  2HQE A;  2KSS A;  3SD4 A;  4F7U G;  5CKB A;  5KYX A;  3FIF A;  2EQU A;  3RMS A;  4FYX B;  4IUP A;  2A3L A;  2VGN A;  3JCM f;  1LPL A;  1I0C A;  4A53 A;  2IPO B;  4XAX B;  3DLL A;  4J6Y A;  5CQY A;  3G71 A;  2QQR A;  4DQ2 A;  1KIK A;  4B6M A;  3EG1 A;  4J7F A;  2E5Q A;  1OEB A;  1UGS B;  4KUI A;  3QKJ A;  1ACM B;  1G3S A;  4PJO B;  1YBY A;  3M5A A;  5CKF A;  3X25 B;  2EFI A;  3RBB B;  3L2R A;  3M59 A;  4II1 A;  1AHJ B;  1UGP B;  4OF1 A;  2C0T A;  2PUK B;  2NLU A;  1QW1 A;  3EG0 A;  1WX6 A;  4C92 D;  2H3J A;  1NYF A;  3REB B;  3G71 Q;  2KYM A;  4FW2 A;  3AT1 B;  4RKU E;  3HTR A;  4Z02 A;  4M77 F;  1X6G A;  2RI2 A;  3RUX A;  1OZ3 A;  2ZPE B;  5GMK e;  4XU0 A;  3OYH A;  2QQ9 A;  1WNL A;  2FHD A;  1N27 A;  1EIF A;  2DTH A;  1ARK A;  3JCM h;  5I2M A;  1VQO T;  4J9F A;  3QJY A;  3HFO A;  2AZS A;  3V7C A;  1OUL A;  1T0H A;  1JQQ A;  3LH0 A;  3I5S A;  1B3Q A;  2K3X A;  3H41 A;  3M0R A;  3PT9 A;  5I2S A;  2EQJ A;  4A63 B;  5IN1 A;  4J5Y A;  3MHX A;  2M51 A;  1MMN A;  5LJ5 g;  1YN8 A;  1QVP A;  5GAN e;  4ANJ A;  1MV0 B;  3CD6 A;  1ZSG A;  3M0S A;  4A4G A;  4B9X A;  2QA4 T;  4Y91 A;  3QSU A;  1BCO A;  1Y71 A;  2DEQ A;  4J83 A;  4M75 A;  5IHN A;  4ZGE B;  5D6W A;  2RQT A;  2JMC A;  2QI2 A;  1JXM A;  1RAD B;  2FYK A;  3J80 E;  1Y57 A;  2RHY A;  4RTY A;  2RHU A;  5FLX E;  2DRK A;  4QQ6 A;  2CP3 A;  5GAN 3;  1PD1 A;  2B86 A;  1TG0 A;  3UF4 A;  5DY9 A;  3PMT A;  3M54 A;  1RAH B;  3MP8 A;  1PM3 A;  5GAN d;  5GAO l;  2DFU A;  4M78 B;  5KCO A;  2DLP A;  2GF7 A;  2HSE B;  4L6V 5;  3CC4 T;  9ATC B;  5J26 A;  4PJO G;  1YIJ Q;  4Y92 A;  1VQ7 A;  1UEC A;  3EH2 A;  2GCX A;  4JJD A;  1YJN A;  2MI6 A;  4C92 B;  1KD1 R;  2CRE A;  2FRY A;  1VQ4 A;  4LDU A;  4N4I A;  2M1H A;  4LDY A;  1VQ8 A;  2BZ8 A;  2DK3 A;  1VQM Q;  4F17 A;  3EFO A;  4E7Z A;  1M8V A;  1IRE B;  1SG5 A;  1K8A U;  3J7A F;  1V29 B;  3ZEH A;  3WXM B;  2X51 A;  4N4G A;  4KUD K;  4X1V A;  5L8R E;  2GFA A;  4M77 B;  4BE1 A;  4RTX A;  1KSW A;  2RI3 A;  1G5V A;  2BTT A;  1YJW Q;  4R0K A;  2P4T A;  3CPW S;  7AT1 B;  4OB1 B;  2GGR A;  1YJN Q;  1UFF A;  2O2O A;  4M4Z A;  4EMK A;  2HKQ B;  1K9M R;  2ED0 A;  1ZX6 A;  3A98 A;  1Q86 U;  2DE0 X;  1AD5 A;  4LDW A;  1VQP T;  4A4E A;  2VXF A;  2XIC A;  4QVC A;  3SB2 A;  3M0Q A;  3JCM J;  1FMW A;  1UGR B;  3I55 A;  5LJ3 j;  4C8Q A;  2RQU A;  2KR3 A;  5CO7 A;  5GAM f;  4IUR A;  3BFM A;  2QAZ A;  1X69 A;  2M9U A;  1QVF P;  2XD0 A;  3M56 A;  3OYM A;  4ESR A;  4V2S A;  1KQS A;  2KQW A;  4M7D F;  5HK0 A;  2DVE A;  3H8Z A;  4C8Q G;  4PJO C;  3MEW A;  1Z9Z A;  4DA4 A;  2CH4 A;  3PVQ A;  1Q82 U;  4FM4 B;  1BK2 A;  2PUO B;  3JCM e;  3S3M A;  4ZNX A;  2K5F A;  3X26 B;  3RMQ A;  1SSF A;  3DB4 A;  1W1F A;  2OJ2 A;  2EQI A;  2JZ2 A;  4NL3 A;  1Q86 C;  2RJE A;  4BDZ A;  3MET A;  1AVZ C;  2K9G A;  1VOM A;  2JXB A;  1M3A A;  2YWW A;  2ENM A;  4M78 G;  5GAN 5;  3OA6 A;  4RCC A;  2CP2 A;  3OS5 A;  3GIB A;  2E6Z A;  3ASK A;  2KY9 A;  1MUZ A;  1UHC A;  2EYY A;  2ZZD A;  1NZ9 A;  1FMV A;  2DAQ A;  2YDL A;  2MK5 A;  1AT1 B;  1G3T A;  1IO6 A;  3PGG A;  4EMK B;  4X34 A;  1N8R C;  1PKS A;  2DIG A;  2KXD A;  5FRN A;  4EPC A;  3MO8 A;  2RI5 A;  1YNZ A;  1I1J A;  3MP6 A;  1O9S A;  3CCL A;  2NUZ A;  4FW1 A;  1QVG A;  1EFN A;  5FU6 C;  4HCZ A;  2OTL T;  1SEM A;  4M77 D;  4WCI A;  3OYL A;  1LCK A;  1M3B A;  2EYW A;  1LNX A;  4M7D G;  4GBQ A;  2XID A;  1N9S A;  3WVD B;  4C0F A;  1ABO A;  4PL6 A;  4EDU A;  3RER A;  1TU0 B;  3BDL A;  1C1A A;  4J9D A;  2KT8 A;  4CC3 A;  2DJQ A;  3J81 E;  3E9F A;  1UGQ B;  2J06 A;  2QQA A;  1YI2 Q;  2CP0 A;  3HL8 A;  3CCQ Q;  2QGF B;  3G6E A;  1VQ5 A;  4GLK A;  3CME T;  3CME Q;  1SF9 A;  4KGX B;  1C0M A;  3EG9 A;  3TQ7 P;  3URG A;  5AYF A;  1N8R U;  4C5I A;  4M78 C;  1AEY A;  2KK4 A;  1U8R A;  3I5R A;  1KFZ A;  3G4S A;  4BI8 B;  1NJI C;  5C0M A;  1W2B S;  3LX7 A;  1KC8 U;  3CCR T;  3CCE T;  1E6H A;  3MEU A;  4C8Q B;  1QMC A;  4BE0 A;  4XTY A;  3OQ5 A;  1FYN A;  3GLX A;  1M1K U;  4C0D B;  2L5Q A;  3P8B B;  4KH0 B;  3F70 A;  4L59 A;  4Z89 A;  4FT4 A;  2YUN A;  4M78 F;  1CKA A;  2W0Z A;  2QGG A;  1PWT A;  4IUQ A;  4PFO A;  4KUL A;  2E3H A;  2QXF A;  3H6Z A;  2LJ3 A;  4OGE A;  4JZ4 A;  4IUV A;  4N0A A;  2Y4Y A;  5DLO A;  1ZBX A;  2LRQ A;  1EX4 A;  3CCL Q;  1I5L A;  2FL7 A;  2K3Y A;  2BE7 D;  4CI0 C;  1KQ1 A;  1NG2 A;  1EZZ B;  3QWY A;  2YRV A;  4OMQ A;  3OYN A;  3CCS T;  1RAF B;  3CCJ T;  3MPU B;  2PNI A;  2EKH A;  1BI2 A;  1GFD A;  2MPX C;  1Y0M A;  4HCB A;  4N0A C;  4BY6 B;  4C92 A;  5GAM g;  2QTV A;  4VUB A;  1QQJ A;  4TVR A;  2IG0 A;  3PIP A;  2XDB A;  3JCM P;  2HZY A;  1UHF A;  1T0J A;  2PVG B;  3VS4 A;  1VQ7 T;  1PSF A;  4RG2 A;  2XHC A;  1I81 A;  2BE9 B;  5D6Y A;  1WHJ A;  4M77 G;  2VUB A;  4C92 G;  5GMK l;  1QP2 A;  3CCS Q;  2SRC A;  3C95 A;  1VQP Q;  2O4X A;  2QQB A;  1RAI B;  2O4X B;  4C5E A;  3LH5 A;  3S6W A;  3A1P A;  1Z9Q A;  4PJO E;  4ZTJ A;  1VQO Q;  4M77 A;  1RLQ C;  5GJV B;  4DBR A;  2J05 A;  4M78 E;  3SWN C;  3G71 T;  3RKY A;  4Z8A A;  4XTZ A;  2R5M A;  4Q5W A;  2LCS A;  1M90 R;  4FU6 A;  2L3Q A;  1G2B A;  3CCQ A;  2O9S A;  1ZBJ A;  3A8O B;  4J9I A;  2OI3 A;  3PFS A;  2KYB A;  2E1H A;  2C0I A;  4ORZ A;  3CBP A;  4M7D D;  1LOJ A;  2GTO A;  2EYZ A;  2RQV A;  4LE9 A;  1YJ9 T;  1RAA B;  2ESW A;  4KGV B;  3PTA A;  1JU5 C;  4MML A;  3QYH B;  2DD5 A;  1X2Q A;  2Y90 A;  8AT1 B;  3NMZ C;  1B07 A;  4MDW A;  3UA7 A;  3OW2 P;  1K73 R;  4BY6 C;  1TUD A;  2GQV A;  2YUQ A;  1U5S A;  1G83 A;  2EVR A;  1BI0 A;  2HL3 A;  2E64 A;  2LDM A;  1YIJ A;  1K76 A;  2HBW A;  2COW A;  3CMA T;  3EGU A;  1MMD A;  2VB6 A;  2DPP B;  3OBY A;  3DKM A;  1WIE A;  2KEA A;  2DXU A;  1VQ9 A;  1QVF A;  4E7L A;  5IAY A;  2NUP A;  4XQ3 A;  3GNF B;  3LGF A;  4IUU A;  2RF0 A;  2JW4 A;  2DZ9 A;  4ME7 A;  3EG3 A;  1VQ8 Q;  5J39 A;  5KYN A;  1QCN A;  2PU9 B;  1MMA A;  1UDL A;  3JB9 G;  1ZHI A;  2CP7 A;  2E3I A;  4PLL A;  1OQK A;  3JCM d;  5LJ3 f;  1VQK A;  3QHS A;  2BZX A;  2H3E B;  3L2Q A;  1D0X A;  1OV3 A;  3INZ A;  1ZQ1 A;  3AHU A;  2LNV A;  2D8J A;  3VS7 A;  5KCH A;  2DYB A;  2ZAE A;  3JB9 I;  5LJ3 e;  3A8M B;  1D1A A;  5LJ5 j;  3CCL T;  1JJ2 S;  2V1Q A;  1RI9 A;  4XU3 A;  1VQ6 A;  3LWH A;  1YHQ A;  4E6R A;  2OTL A;  1R0B G;  2FZK B;  4M75 C;  4M78 A;  3DLM A;  3M0P A;  1JJ2 P;  4E7J A;  4JJB A;  3VS1 A;  2YHT A;  2KRM A;  2AKK A;  1T3S A;  4QT7 A;  3NPF A;  2DIQ A;  4M7A E;  1VYT A;  2CSI A;  3TSZ A;  5GAN g;  4QKU A;  4C0D C;  5EG2 A;  3CC4 A;  4EMG A;  5EC7 A;  1TSF A;  2ROL A;  1YJN T;  1TXQ A;  2WSE E;  4C8Q F;  1WI7 A;  3QWX X;  5IH2 A;  2AKL A;  1OX9 A;  2RH2 A;  3TVT A;  1VQ4 T;  1K9M C;  1H3H A;  4C92 E;  4E2F B;  1BI1 A;  3CCR A;  3QDF A;  4C5H A;  3TU4 K;  1VQN T; 
#chains in the Genus database with same CATH homology
 1VQ7 Q;  3OW2 P;  1K73 R;  1NJI R;  1K9M R;  3CCL Q;  3CCJ Q;  1VQO Q;  2OTJ Q;  1VQM Q;  1Q7Y R;  1VQ6 Q;  3I56 Q;  1VQ8 Q;  1YI2 Q;  2QA4 Q;  3CCE Q;  3CCQ Q;  1QVG P;  3CMA Q;  2OTL Q;  1S72 Q;  1YIJ Q;  1W2B P;  1Q82 R;  3CC2 Q;  1VQN Q;  1YHQ Q;  3CME Q;  1M1K R;  3CCV Q;  1KC8 R;  1YIT Q;  1Q81 R;  1M90 R;  1JJ2 P;  1VQL Q;  1KD1 R;  2QEX Q;  3G6E Q;  1VQ5 Q;  3CCS Q;  3CC7 Q;  3CC4 Q;  3CD6 Q;  1VQP Q;  1VQ9 Q;  3CPW P;  1QVF P;  1YJW Q;  1KQS P;  3G4S Q;  1VQK Q;  3G71 Q;  1N8R R;  1YJ9 Q;  1K8A R;  1VQ4 Q;  3CCM Q;  1YJN Q;  3CXC P;  3I55 Q;  1Q86 R;  3CCR Q;  3CCU Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...