1VQNQ

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqnQ00
1QVFP 1KC8R 3CCVQ 1JJ2P 1VQLQ 1VQ7Q 3G71Q 1VQKQ 1YJ9Q 3CCUQ 2QA4Q 3CC4Q 2OTLQ 1VQNQ 1YJNQ 1YIJQ 1KD1R 2OTJQ 3CCLQ 1Q81R 1W2BP 3G4SQ 1S72Q 3CXCP 3CCMQ 1YJWQ 1VQMQ 3G6EQ 1N8RR 1K9MR 1QVGP 1K8AR 1Q82R 3CC2Q 3CPWP 3CCQQ 1VQPQ 2QEXQ 1VQ8Q 3I55Q 3CCJQ 1Q7YR 1KQSP 1VQ5Q 1M90R 3CMAQ 3CCRQ 1YI2Q 1Q86R 3CCSQ 1VQ6Q 3CD6Q 1VQ9Q 1YHQQ 1K73R 1NJIR 3CMEQ 3I56Q 1VQOQ 3CC7Q 3CCEQ 1YITQ 1M1KR 3OW2P 1VQ4Q
chains in the Genus database with same CATH superfamily
3L2UA 1A0NB 3EFOA 4CC3A 4JRPA 3P8HA 4F7UA 2LC4A 1M27C 1QWFA 3X26B 4L5GA 1VIEA 2P4RA 1V76A 2RJCA 5D6WA 3JCMh 2YLBA 1WHLA 1NLOC 1Q81R 4J6WA 1NE8A 3L2VA 4C8QA 1X01A 4OGCA 1KQ2A 1GL5A 1SRLA 2DJZA 3OYBA 4DBFA 3RNJA 1OYXA 4XTVA 2DF6A 1WFWA 3E19A 1YJ9Q 3S6WA 2QYZA 5KYXB 2E3HA 2KYMA 1M4ZA 2V1QA 3LH0A 4F7UF 3I5RA 4XU1A 4QQ6A 2V8JA 4MZTA 3JCMd 1M3CA 1OOTA 3CC7A 3CPWP 3LGFA 2OTJT 3CPWS 1JB0E 2RK2A 1WJQA 3M59A 2VWFA 4C8QF 2CH4W 4OMLA 5IAYA 4AFUC 2DL8A 2FHDA 2ZPEB 2NYSA 4HCKA 3JCMe 2HD0A 2QGFB 3EG0A 1GCQC 5CR2A 1LOJA 4ZN1A 5HK0A 1UUEA 4HCCA 3NTKA 5ECAA 3HFOA 2X3WD 4M78B 3RUXA 4DOVA 4M7AB 3QXEB 3MCAB 1BBZA 1FMWA 2DIGA 1K0SA 4XAXB 4C0GA 2WSCE 1YIJQ 1R8OB 1ZUYA 2LJ1A 3BDUA 2OAUA 5D6XA 2CP6A 9ATCB 3CCSA 3GP8A 2QAZA 5GAOp 1KHCA 2JMAA 3I9QA 3VYGA 2GQVA 4D8KA 2A0FB 4GY5A 1TXQA 2QG9B 5A0LA 3U23A 2XG8D 3G7ZA 3JB9D 4DBHA 3NHNA 2RQVA 3H8ZA 1UHFA 1EX4A 4KUDK 1M2VA 1V1CA 2LQNA 3VRYA 3I56T 3QPHA 2JS2A 5LJ3d 4RKUE 3X28B 3MO8A 1H3HA 3D7SB 4M77G 2XI9A 2LQWA 4FYWB 4D6WA 1PM3A 2ZPHB 4GBQA 1H3ZA 3CPFA 5IHNA 2DNUA 4J9HA 3CCUQ 1OX8A 5LJ3e 2JXBA 2KI7A 4BI3A 5IN1A 2PUKB 1OX9A 2EVRA 2GQIA 2JTMA 3CCEA 5CQYA 1CSKA 1I81A 4M75B 3CCRQ 1IB8A 4OMOA 1KJWA 3UA7A 2QGGA 3CC4Q 2LT1A 2RNAA 2J05A 3CMAA 4QQDA 2GF7A 3M0RA 2SRCA 1Z9QA 4EPCA 3PVQA 4AFSC 4O6JA 3QZ9B 3VYHB 3CQTA 5I22A 3RIRA 1UGRB 1M1FA 1RI0A 2LX9A 4F04B 1VQLQ 4BY6B 4KH0B 3HP9A 5KYNA 2HKQB 4J9DA 1RACB 5CKDA 3EFOB 3EG9B 2DILA 3V8KA 1W4SA 2QEXA 1RI9A 3THKA 4N4HA 2HL3A 3FIFA 4IUPA 5IH2A 1TOVA 2EYQA 3WXMB 4C8QB 1VYVA 2HBPA 4M77A 1NLPC 2QTXA 2XK0A 3F70A 3M53A 4LUDA 1ZQ1A 1VQ4Q 3HKSA 5D7UA 3UPUA 1WXBA 2DXCA 1KC8C 1KC8U 2V8KA 1X43A 2ROLA 3VV0A 2L5QA 5I21A 2HDAA 3TCJA 3LYIA 1TUCA 2K2MA 1VQ4T 1PSFA 3EG1A 4KGZB 3UATA 1G3YA 2LZ6B 2FRWA 2KRSA 3NPFA 4Q5WA 2DL7A 4X9DA 1HYOA 4BI4A 5A0DA 1ZA2B 5C0MA 4M77F 1D0ZA 2D0QB 1PKSA 2O88A 2O4XA 1IGQA 2LTOA 3TVTA 2CH4A 4B9WA 1SG5A 4FL6A 3CXCP 4HT8A 2HSPA 1WHHA 1YJ9T 1Y71A 2PVDB 2F1LA 1KQ1A 2LJ0A 1B34A 3CCVQ 2A08A 3J7AF 2QA4Q 2OTLQ 1BI2A 2CS7A 1UEBA 2YUPA 2FZCB 2DYBA 3FLGA 4LD9K 1QVGA 3EGXB 3KUFA 4ELZC 1OI1A 1M2OA 2A36A 3OYGA 5FRNA 2DTHA 2JS0A 2A3LA 1WXTA 2EYYA 2QDLA 5J3BA 2DBKA 2LJ3A 4C0DC 2JZ2A 2QDYB 3GPLA 1OQKA 1UGQB 4GLKA 2RA2A 2AKKA 2MIOA 1M2VB 3UDCA 1I4K1 1VUBA 4FYYB 3VJPA 2MI6A 5KYUA 2GBQA 1K8AU 1NZ9A 3VS5A 1YIJT 4E7SA 2M16A 4J9CA 3EH2A 2RI3A 4RTWA 1VQOQ 2P84A 4JRKA 5FWBA 2DM1A 2DO3A 1VQKQ 4FCYA 1E6HA 3R6OA 1FMVA 3OBWA 2RQTA 1BI3A 2MF2A 3SWNA 2ZPBB 4M78E 1UGPB 3WVDB 5FW9A 4FYVB 4LUEA 3LLRA 3QO3A 4M7AE 4BD3A 4EMKA 2RMOA 1OPLA 2O9VA 1LPLA 2PU9B 4M7DG 4OB0B 1VQPT 3RKXA 3FRNA 3ZBDA 1OZ2A 3CCLA 1O75A 4CC2A 1ABOA 4M78C 2DVJA 1U5SA 5GAOl 3E2UA 3PIOA 2Y4YA 3CCUT 3VS2A 4C0ZA 4MZPA 1Q86R 3KFVA 1UTIA 5FWCA 4A54A 2YWWA 4Z8AA 5CVIA 3EGDA 4E47A 2VV5A 3PMIA 1RAFB 1RAHB 2LCLA 3CCRT 2K57A 2E5KA 4OP0A 3JCMX 2OTJQ 4C0FA 4JUVA 3QYGB 5AT1B 2L8DA 3CC4T 1VQ9A 3JCMg 4XU0A 3A5ZB 3CBMA 1U06A 3PT9A 3M4YA 1I8FA 1K73C 1K73U 5GAOm 2V26A 1T3LA 1X2KA 2YRVA 4B6MA 4J83A 1D0YA 2G3RA 2XICA 3JV3A 4QW2A 1VOMA 2JMCA 4M75E 3I55A 3CEYA 1VQLT 3A8GB 2VVKA 1K9MU 3PGGA 3QWXX 1KK7A 3IQLA 4FW1A 4JJDA 2O01E 1NBEB 3CCEQ 2ED1A 2HSEB 3INZA 2XHCA 1VQNA 4M7DA 4M78D 5GMKh 1M1KC 1M1KU 3RKWA 1X6BA 5FRMA 4FT2A 4M7AD 5CKEA 4PJMA 1X75C 2FVUA 2GFAA 4ZN3A 1YJWA 3PNWC 4J6XA 4KUIA 2O4XB 1M30A 2YLCA 1XNIA 3JSCA 1ABQA 1QCFA 2HMAA 3T9NA 1Q7YR 2WSFE 3OB9A 3OYLA 4FW2A 4C92E 1R0CB 2CP7A 2KXDA 2YDLA 3M0SA 4XTWA 5GAN7 4AT1B 2OI3A 1VQMA 3OS0A 1WX6A 4C8QE 4J9FA 4M7DF 2HZYA 1Q81U 1MNEA 1VYUA 1IXDA 4BY6C 1VQ6A 2IVWA 2QEXQ 5LJ3g 2VGMA 3NMZC 3REBB 4PFPA 2PZ1A 1WZOA 1X2QA 1BI0A 4BB7A 3M0PA 2AT1B 3VS1A 5GMKe 2A28A 4F7UG 4C8QC 3MP6A 4XTYA 3EFSA 3TU4K 5GAN3 3CCVT 2MYSA 1YJNT 2QA4T 2FZGB 1NPRA 3LH5A 5KYUB 3OW2A 3GLXA 1IZ6A 2EQMA 4EMHA 4M75D 2H8HA 4KULA 2RJDA 1AWOA 3QJYA 2Z0WA 1WQ7A 1RAIB 2KT8A 5GAN2 2H3JA 2DXBA 1WDXA 3GBQA 5EG2A 1T0HA 3S3OA 2EW3A 3AHUA 1SSHA 5GANh 4JS5A 3SWNB 1ZSGA 4DQ2A 4A53A 3QHSA 8AT1B 2D6FA 3OMGA 2LCCA 2WSEE 2FO0A 3PTAA 1MHNA 1I07A 2JVVA 5KCOA 2FPFA 2D8JA 4LD6A 1NPPA 2CUBA 4N4IA 1IREB 3CC7T 4LDYA 4C92D 3MEUA 1N8RR 2FL7A 3ER0A 3QDRB 5CQXA 5GANd 3MEAA 4RTXA 3CBPA 3EG3A 4C8QD 2DPPB 1EZZB 3V8LA 2K6DA 2EKHA 3ZFJA 3EGDB 4ESRA 2K5FA 3CCQA 1YCYA 2KRMA 1D0XA 2RH2A 1FX7A 4C0DB 4V2SA 5GANe 3VS6A 2DAQA 4OB3B 4C5EA 4RTYA 2QQAA 3RMSA 1JJ2P 2RHYA 3BFMA 3MEWA 3O8VA 3CCST 1JJ2S 4AFQC 4JLGA 1TU0B 2SEMA 2DFUA 4LDUA 5GMKl 1B7TA 2EJ9A 4Z89A 3JCMP 3M0TA 2BKDN 1JEGA 1P92A 3GIBA 3VS3A 1Q82C 2OX7A 1Q82U 5IXBA 3TQ7P 2L89A 4QT7A 1Y7XA 2EQKA 3G1JA 2P4TA 3DLMA 2KE9A 1WYXA 1OZ3A 2JM8A 2XU8A 1X69A 5HK3A 4OF1A 1UGSB 4XTXA 2V8IA 4WF2A 1U1SA 3CCLQ 3OS5A 2M51A 3X20B 1AZEA 3L1AA 1OU8A 2EGAA 1RAGB 4JDSA 4Y28E 4ANJA 2LNHB 4PJOG 2MK5A 3VS4A 2EYWA 2CT4A 1N6AA 5GMKm 5HY6A 3FEOA 2HQHA 2RB6A 3V7RA 1QCOA 4JJNK 3A8HB 3LWHA 2VXFA 2L3QA 3HTRA 5LJ3h 2E6NA 3CCET 3RERA 1KSWA 1VQ8A 3META 5CIUA 4C5HA 2AHJB 3MJXA 2AK5A 2JUFA 4PFOA 1N9SA 3V8JA 1I5LA 4OMNA 1VQ9Q 2COYA 1M90C 3J80E 1M90U 2MCNA 3QWYA 5KYWB 1JXMA 4P5NA 2Y4XA 4AG2C 2ZGWA 4E7LA 2MAMA 1G83A 2P0PA 3CMAT 2EBPA 4XK8E 2CZ0B 2RHZA 3H9NA 3CC2A 2H3EB 5DM7R 4M77C 2C0TA 4IKFA 1UHCA 2RN8A 1KQSA 2D8HA 1VQPQ 3UWNA 2KK4A 2DEQA 3I55Q 1MMNA 1KIKA 1WI7A 4MDXA 2KAFA 2KEAA 2GGRA 2CP3A 3DB3A 1BU1A 2QEXT 1PG5B 1RAEB 5KE2A 1YWPA 1VQNQ 4FSSA 4L6V5 4E6RA 2JN0A 1LNXA 3JCMb 2F5TX 3CCJA 4OB2B 4R55A 3E9GA 1EIFA 1FXXA 2ZZDA 1YJWQ 3CD6A 1W1FA 4PJOA 1Y07A 2M02A 3OBYA 4OMPA 1VYTA 2DXUA 1WLPB 2KYBA 3JCMf 3CCMA 1OV3A 2VASA 2J6OA 5GAN8 3CPWA 1X6GA 4K11A 3RDVA 1BIAA 2HNIA 2L3SA 2M9UA 4RMOA 2EGEA 2XD0A 1VQ6Q 1LCKA 2M0YA 4QVDA 1SRMA 3HPWA 4J9EA 3JB9F 4PJOF 1UE9A 4PK4A 5LJ5h 4F7UB 1KD1C 3L2ZA 1KD1U 1PKTA 3FJPA 1VQ5A 4JJCA 1B3QA 1QWEA 4EMGA 2NUPA 2C0IA 2PNIA 1RL2A 1BK2A 4J9IA 2DD5A 1ZUKA 3UT1A 4C5IA 1K76A 2K3XA 1CKBA 1QQJA 2A37A 4E2FB 4HA8A 3R6NA 1ZBJA 2G6FX 2HBWA 3NFCA 4FIBA 5LJ5d 2K2VA 3OYYA 4XTZA 2NUTA 2PUOB 3H0IA 3M54A 2VKNA 5GJWB 2MPXC 4BE1A 1WPYA 3HHTB 4EDUA 2CDTA 2X35A 5I2MA 3OSSC 2DKGA 1IHWA 3ULRB 4XTUA 3SWNC 2CREA 5LJ3f 4A4KA 4Y91A 5LJ5e 2R57A 5GAMh 2YT6A 3A8LB 2RPNA 2E65A 1F1BB 1O9SA 2LQ8A 2RHXA 3CMEA 5J26A 1ZBXA 3SFMA 1WHGA 4LE9A 3OYEA 1MV3A 1YNZA 4MDWA 1AWJA 2KMTA 1WHMA 3GNFB 3I5SA 1K1ZA 1YJNQ 1S72A 2QQ9A 4OMFB 1YCSB 2PTKA 1G3TA 4A4HA 1BIBA 3NGPA 5GAMd 4PLLA 3QUIA 2JW4A 3CCQQ 1GRIA 2ENMA 4FT4A 3OYKA 3CCLT 2L3PA 1BB9A 2FRYA 3ASKA 4PFZA 2X4YA 4LDXA 2DA9A 5GAMe 2EAYA 1W2BA 1Z9ZA 1I1JA 5GAN4 4FU6A 4R56A 2AZSA 4F14A 1M1GA 1K8AC 4IUUA 2DBMA 4E7IA 1ZX6A 2K4YA 4ZNXA 3CC7Q 3EH1A 1T3SA 1I5OB 2KNBB 4JZ4A 4JS4A 4AMCA 3OYAA 2VB6A 4NS5A 3N5BB 3OYMA 2DE0X 2ZPGB 1VQ9T 1FMKA 4QKUA 2KQWA 1WHJA 2CSIA 3MHXA 2K79A 1QLYA 4M7DC 2X4WA 2YUQA 1JRIA 8ATCB 4N0AA 4PJOB 5GANg 1TWBA 1QVFP 4RTZA 3I55T 1QVFS 1MMDA 2K3YA 1PHTA 4LNPA 2BIVA 2AZVA 4DEYA 5GMKj 2RJEA 3C12A 4E7HA 1PD1A 1Y96A 4ATOA 3M57A 2MWOA 1VQNT 1TS9A 4UC4A 1VQ8Q 1G8XA 1JXOA 2XKOC 1N9RA 2WACA 2DVEA 2CZ7B 2HQXA 4IIMA 3CCSQ 1IO6A 1YJWT 2E1HA 1ZHIA 1H641 2M1HA 3C4SA 2A7YA 4VUBA 3CXCA 5CK9A 1AEYA 4ZTFA 4E7ZA 2DRKA 3CC2Q 1WIEA 2LP5A 5KYYA 4M7AG 1UECA 5A0GA 1UGVA 1M3BA 1RAAB 4Y92A 3PE0A 3FC3A 5IT9E 5KCHA 4M77B 1SHFA 4WTOB 1AD5A 3RR6A 4DA4A 1VQ6T 4KRTA 2BZXA 3PIPA 4MMKA 1K9MC 2RQRA 3CCJQ 2X4XA 2NUTB 4DEXA 3CD6Q 1ZSZA 1NYFA 3PVLA 1QW1A 3QDFA 4RTUA 2JT4A 5KYXA 5CKFA 2JJ9A 5AYFA 1PSEA 2D9TA 1JBMA 2CKKA 4BUGA 4J8OA 1EFNA 2ECZA 3OYNA 3KXTA 3OA6A 2J6KA 2GCXA 1TSFA 4CRIA 2J6FA 1N8RU 3MP1A 1K4US 1SEMA 2DTOA 2DXTA 3CMAQ 1OEBA 2FZKB 2QI2A 2IPOB 1NJIC 5GANj 1NJIU 2QTVA 4F7UE 1U1TA 2RI5A 4L59A 1B34B 2ESWA 1X27A 4HCBA 1Q81C 2L0AA 4M75G 4BE2A 1YHQA 5EC7A 2HEQA 4M7AA 3OY9A 1NG2A 2BE9B 1UB4A 3QZ5B 4AG1C 5CAIA 1XTDA 4KT0E 3BE3A 5I11A 4MZMA 1M5Q1 3VU3C 3G4SA 3A8OB 5GAOq 3X25B 2DD4A 4BDZA 1YI2A 2F2VA 1PNJA 5FROA 1YJNA 3Q1JA 2KRNA 4PL6A 3V7CA 3QKJA 5C6SA 4C92G 3JCMc 5FLXE 3CCQT 4DBQA 3E9FA 1GXIE 2QQBA 4M7AF 3BDLA 2E6ZA 2XIDA 4FYXB 2C0OA 3C95A 3G6EA 1AHJB 1RUWA 3DKMA 3JAME 4BI8B 2EFIA 4QVCA 4XU3A 3X24B 2V1RA 2CUDA 3JCMW 2FG0A 2BZ8A 4A4FA 2ATCB 3PMTA 2ABLA 3RESA 4EMKB 1Q95G 1U8RA 1WNLA 2E5QA 2LCSA 4C5GA 1N27A 1NM7A 5CO7A 2HQEA 3EAEA 2K7AA 2EYXA 1S72Q 4XQ3A 3SB2A 1YP5A 4M75A 2BUDA 3SD4A 4YTLA 2LQKA 2YRDA 1M1KR 1UG1A 2LRQA 4ME7A 1WQWA 1X6OA 3EG2A 4DOWA 1BCOA 1M8MA 1D09B 1D1AA 1YBYA 2VYTA 5LJ5g 3A98A 4OVAA 3EHQA 4FSXA 3OYHA 5LJ3j 1AWWA 4BDYA 2OTLA 5KYYB 1HD3A 3G71A 4M75F 4C92A 5CKBA 4DBRA 3EG9A 1AVZC 4TVRA 1VQ8T 2KY9A 1QP3A 1W70A 2IG0A 2XMFA 4J6YA 4J7IA 1C6VX 4IUTA 4JPBW 2PVOB 2X51A 4PJOE 2HKNA 3CBOA 1YITA 1VA7A 2EQIA 2RM4A 4ZGDB 5KH6A 1VQ7A 4J5YA 1MV0B 3VUBA 1ZSZB 3ZEHA 3CC2T 4ELYC 4RG8A 1I0CA 2HCKA 2KROA 4M7DB 4PJOC 4C92F 1LVKA 2ED0A 3ME9A 3TEEA 1QVPA 2LT4A 3JB9G 5GAMg 2DRMA 1VQOA 4F16A 3QJ6A 4E7KA 1HSQA 3M55A 5IHIA 1VQKA 4F17A 1OPKA 2VGNA 2R5MA 1ZA1B 3CCJT 2QXFA 3QYHB 3CD6T 5L8RE 2RD1A 4RCBA 4JLIA 2XDDA 2GTJA 3M9QA 4M77E 1WJRA 4X1VA 4Z88A 1FWZA 2EGCA 3CCMT 2B86A 3JB9J 3MEVA 2J7IA 3EGXA 2EWNA 3OS1A 2ZCFB 3L2QA 4ORZA 3JRZA 3LGLA 5GANf 4KBMB 2QQRA 5L23A 1Y0MA 2AIRB 5LJ5j 2RF0A 2ZPIB 3JCMJ 5KE3A 5J39A 1RLQC 4OB1B 3OYIA 4EIKA 1MNDA 1PC0A 1VIFA 3MP8A 4PJOD 2OTJA 1MMAA 2QQSA 2X9HA 5FU7C 1VQ5T 1BI1A 2JTFA 2COZA 3REAB 4RG2A 2RQUA 1GBQA 3AT1B 2DETA 2LX7A 1M9SA 3EGUA 4RUGA 1NYGA 2CGHA 3QIIA 1JJ2A 2K5IA 1GFDA 2E70A 3FJ5A 4IUVA 3EFRA 1RABB 3L2WA 2NWMA 4PKCC 4RCCA 1PRLC 1QCNA 1U3OA 4N4GA 2RJFA 2DIQA 1SF9A 3ZL7C 4HVWA 2FYKA 4ZGJB 1G3SA 1VQMQ 2OAWA 3NTHA 2VUBA 1QVGP 1Q82R 2DZ9A 5GAMj 4X34A 2KDSA 2X4JA 1QVGS 4KGXB 1GCQA 2QASA 2VXEA 2B8AA 1YHQQ 5LL6S 3A8MB 4JRIA 1D1BA 1E7OA 5M9OA 2IIMA 4M77D 3CMET 2JNGA 2ZPFB 1YN8A 2E10A 4FM4B 1W2BP 3G4SQ 1D3BA 1W2BS 1WHKA 1RLPC 4GLMA 3I56A 1TUGB 1G3WA 1QKWA 1QP2A 2COWA 1YI2Q 3SHWA 1PD0A 2O9SA 4HVVA 1S72T 3DLLA 4OMMA 3UF4A 2NLUA 2CT3A 4C92B 1D1CA 2DK3A 3BW1A 4RTTA 1XQHA 1NEGA 1XJWB 3VS7A 1KG1A 2W0ZA 5GAOn 2K9GA 1UFFA 1G2BA 3G6EQ 5DY9A 2EIFA 2KT1A 3WVEB 1M3AA 1IRXA 1TG0A 1M90R 1KFZA 4A63B 4O5VA 2HAXA 2YHTA 4NL3A 2DL5A 2K5LA 2FB7A 4XU2A 2F69A 3TREA 2KVQG 5FU6C 2RI2A 4HVUA 2JM9A 1JO8A 3TSZA 3OYCA 4J9BA 1J3TA 1K0XA 3M0UA 2DYIA 1B07A 1AOJA 4N0AC 1RADB 3FDRA 2OJ2A 4J7FA 1WA7A 4EMKC 3QSUA 1HJDA 1Q86C 3TSWA 1Q86U 3JB9I 1ACMB 4MMLA 4II1A 3VUZA 1YWOA 5HCKA 5A2QE 2RK1A 3C94A 2L3RA 3VS0A 2CZ6B 1V29B 3OYFA 4R0KA 2MOXA 2W10A 1SHGA 3CXCS 1QKXA 1MGQA 2L2PA 2HL5C 3OS2A 3LW5E 4HT9A 1LJOA 1UJ0A 3C0CA 1H92A 2AKLA 1R77A 2DTIA 2FPDA 2DERA 2PQWA 3G71Q 3J81E 2E4HA 4LDWA 4PJNA 3HSBA 3VRZA 5GAOr 3M4GA 2D1XA 4KH1B 1QMCA 4CI0C 1VQ4A 1PWTA 5D6YA 4M7DE 4E7JA 2YSQA 3L42A 1YITQ 1W6XA 3H6ZA 1OULA 2EPDA 2KXCA 2DX1A 1VQ7Q 1IHVA 2DMOA 1E6GA 5I2SA 1KD1R 3MKDA 2KBTA 5CCAA 1ZSZC 2LVMA 2DLPA 3GF5A 3SDZA 3QBYA 4X9CA 2RHIA 6AT1B 5IHKA 1Q7YU 2DZCA 1Q7YC 4Z02A 1TTHB 1YJ9A 5LJ5f 4ZGEB 1KC8R 1AWXA 2ROTA 2BZYA 1JQQA 3BY7A 1GBRA 2E12A 2KSSA 2JTEA 2JOYA 1YFNA 3HRTA 3UA6A 3H0FA 4JRQA 4NOYA 1DJ7B 1PCXA 1OU9A 1CKAA 3URGA 3SEMA 2E64A 2M0OA 5DLOA 4LN2A 2RHUA 1MUZA 2KGTA 4QVZA 3OQ5A 5GJVB 2E41A 3E1SA 4A4EA 4A4GA 4M7AC 2K3BA 2CSQA 2CYZB 2EJGA 4M78G 4PNOA 2MWPA 1D3BB 1C0MA 2LDMA 2RO0A 2NUPB 3RKYA 1VQMT 3OW2P 1ARKA 4JJBA 1YIJA 3DB4A 5GAMf 3OW2S 3OSVA 4IIOA 3OYDA 5GMKi 1YHQT 2ZAEA 4JZ3A 1ZLMA 4M7DD 1G5VA 3PFSA 2EKOA 4BACA 5FU7B 1MMGA 4B9XA 1PRMC 3S3MA 3OMCA 2EYZA 3G4ST 2F2XA 2CP2A 4ZTJA 2FPEA 2O2OA 2CP5A 2DJQA 1UJYA 4LXCA 4IURA 1SPKA 1YI2T 2MMPA 3HRSA 1VQPA 2QK0A 3JCMQ 2Y90A 2KR3A 3CCMQ 2LMJA 1K8AR 2XDPA 1N8RC 2LNVA 1AT1B 2O31A 3QG1A 3LX7A 3CCUA 3G6ET 1H8KA 3RBBB 2VC8A 1TUDA 1ZUUA 2RQWA 1IGUA 2GTOA 4M75C 1AZGB 1SSFA 1S1NA 4HXJA 3HL8A 4CC7A 1K9AA 3CCRA 4OMQA 1KHIA 4M78A 2YXYA 2F5KA 2EQUA 1VQ5Q 4HCZA 1QVFA 2E3IA 3I56Q 3M5AA 3M58A 7AT1B 3CC4A 3V7SA 5CKHA 2I0NA 4HKEA 2R5AA 3JCMV 4QQGA 2I2LA 1T0JA 3NTIA 4D8DA 3VKIA 5GAN6 2X3XD 4J9GA 4C92C 2NUZA 1XOVA 5KYWA 3KBGA 3OYJA 2D0NA 1VQLA 4AFZC 3L2RA 4WCIA 2P0QA 4M78F 2P0KA 4PLIA 2GFUA 1WXUA 3H41A 1Y57A 3FB9A 1GFCA 1FYNA 1M8VA 4C8QG 2BTTA 1BKBA 2OTLT 3G71T 4RTVA 4CC4B 3RMQA 5GAN5 2YUNA 1TH7A 5FU6B 2EQJA 2GNCA 1K73R 3CMEQ 4BE0A 2CZ1B 1N5ZA 4KGVB 2YRCA 2J06A 2R58A 2DEUA 4IUQA 2F2WA 2PVGB 3HFNA 4M4ZA 3GNGA 4OGEA 1YITT 3JB9H 1WJSA 1K9MR 3P8DA 1VQ7T 1Y96B 4LDVA 2C06A 2YUOA 3LWIA 1BCMA 1HXDA 3I35A 4PJJA 3GOXA 1BYMA 3H0HA 2EJFA 5DLQE 4NL2A 3EHRA 2XDBA 1R0BG 1HK9A 5IXFA 1GCPA 3HRUA 2BE7D 3S3NA 3M0QA 1VQOT 2DL4A 1C1AA 1JU5C 3M56A 5HKCA 1NEBA 3P8BB 1VQKT 2FEIA 1SKUB 4PJLA 3A1PA 3MPUB 1KQSP 1UDLA 3CCVA 1NJIR 1KQSS 2DL3A 3O5ZA 1WGSA 2QA4A 2CP0A
chains in the Genus database with same CATH topology
1QVFP 1KC8R 3CCVQ 1JJ2P 1VQLQ 1VQ7Q 3G71Q 1VQKQ 1YJ9Q 3CCUQ 2QA4Q 3CC4Q 2OTLQ 1VQNQ 1YJNQ 1YIJQ 1KD1R 2OTJQ 3CCLQ 1Q81R 1W2BP 3G4SQ 1S72Q 3CXCP 3CCMQ 1YJWQ 1VQMQ 3G6EQ 1N8RR 1K9MR 1QVGP 1K8AR 1Q82R 3CC2Q 3CPWP 3CCQQ 1VQPQ 2QEXQ 1VQ8Q 3I55Q 3CCJQ 1Q7YR 1KQSP 1VQ5Q 1M90R 3CMAQ 3CCRQ 1YI2Q 1Q86R 3CCSQ 1VQ6Q 3CD6Q 1VQ9Q 1YHQQ 1K73R 1NJIR 3CMEQ 3I56Q 1VQOQ 3CC7Q 3CCEQ 1YITQ 1M1KR 3OW2P 1VQ4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF P;  1KC8 R;  3CCV Q;  1JJ2 P;  1VQL Q;  1VQ7 Q;  3G71 Q;  1VQK Q;  1YJ9 Q;  3CCU Q;  2QA4 Q;  3CC4 Q;  2OTL Q;  1VQN Q;  1YJN Q;  1YIJ Q;  1KD1 R;  2OTJ Q;  3CCL Q;  1Q81 R;  1W2B P;  3G4S Q;  1S72 Q;  3CXC P;  3CCM Q;  1YJW Q;  1VQM Q;  3G6E Q;  1N8R R;  1K9M R;  1QVG P;  1K8A R;  1Q82 R;  3CC2 Q;  3CPW P;  3CCQ Q;  1VQP Q;  2QEX Q;  1VQ8 Q;  3I55 Q;  3CCJ Q;  1Q7Y R;  1KQS P;  1VQ5 Q;  1M90 R;  3CMA Q;  3CCR Q;  1YI2 Q;  1Q86 R;  3CCS Q;  1VQ6 Q;  3CD6 Q;  1VQ9 Q;  1YHQ Q;  1K73 R;  1NJI R;  3CME Q;  3I56 Q;  1VQO Q;  3CC7 Q;  3CCE Q;  1YIT Q;  1M1K R;  3OW2 P;  1VQ4 Q; 
#chains in the Genus database with same CATH topology
 3L2U A;  1A0N B;  3EFO A;  4CC3 A;  4JRP A;  3P8H A;  4F7U A;  2LC4 A;  1M27 C;  1QWF A;  3X26 B;  4L5G A;  1VIE A;  2P4R A;  1V76 A;  2RJC A;  5D6W A;  3JCM h;  2YLB A;  1WHL A;  1NLO C;  1Q81 R;  4J6W A;  1NE8 A;  3L2V A;  4C8Q A;  1X01 A;  4OGC A;  1KQ2 A;  1GL5 A;  1SRL A;  2DJZ A;  3OYB A;  4DBF A;  3RNJ A;  1OYX A;  4XTV A;  2DF6 A;  1WFW A;  3E19 A;  1YJ9 Q;  3S6W A;  2QYZ A;  5KYX B;  2E3H A;  2KYM A;  1M4Z A;  2V1Q A;  3LH0 A;  4F7U F;  3I5R A;  4XU1 A;  4QQ6 A;  2V8J A;  4MZT A;  3JCM d;  1M3C A;  1OOT A;  3CC7 A;  3CPW P;  3LGF A;  2OTJ T;  3CPW S;  1JB0 E;  2RK2 A;  1WJQ A;  3M59 A;  2VWF A;  4C8Q F;  2CH4 W;  4OML A;  5IAY A;  4AFU C;  2DL8 A;  2FHD A;  2ZPE B;  2NYS A;  4HCK A;  3JCM e;  2HD0 A;  2QGF B;  3EG0 A;  1GCQ C;  5CR2 A;  1LOJ A;  4ZN1 A;  5HK0 A;  1UUE A;  4HCC A;  3NTK A;  5ECA A;  3HFO A;  2X3W D;  4M78 B;  3RUX A;  4DOV A;  4M7A B;  3QXE B;  3MCA B;  1BBZ A;  1FMW A;  2DIG A;  1K0S A;  4XAX B;  4C0G A;  2WSC E;  1YIJ Q;  1R8O B;  1ZUY A;  2LJ1 A;  3BDU A;  2OAU A;  5D6X A;  2CP6 A;  9ATC B;  3CCS A;  3GP8 A;  2QAZ A;  5GAO p;  1KHC A;  2JMA A;  3I9Q A;  3VYG A;  2GQV A;  4D8K A;  2A0F B;  4GY5 A;  1TXQ A;  2QG9 B;  5A0L A;  3U23 A;  2XG8 D;  3G7Z A;  3JB9 D;  4DBH A;  3NHN A;  2RQV A;  3H8Z A;  1UHF A;  1EX4 A;  4KUD K;  1M2V A;  1V1C A;  2LQN A;  3VRY A;  3I56 T;  3QPH A;  2JS2 A;  5LJ3 d;  4RKU E;  3X28 B;  3MO8 A;  1H3H A;  3D7S B;  4M77 G;  2XI9 A;  2LQW A;  4FYW B;  4D6W A;  1PM3 A;  2ZPH B;  4GBQ A;  1H3Z A;  3CPF A;  5IHN A;  2DNU A;  4J9H A;  3CCU Q;  1OX8 A;  5LJ3 e;  2JXB A;  2KI7 A;  4BI3 A;  5IN1 A;  2PUK B;  1OX9 A;  2EVR A;  2GQI A;  2JTM A;  3CCE A;  5CQY A;  1CSK A;  1I81 A;  4M75 B;  3CCR Q;  1IB8 A;  4OMO A;  1KJW A;  3UA7 A;  2QGG A;  3CC4 Q;  2LT1 A;  2RNA A;  2J05 A;  3CMA A;  4QQD A;  2GF7 A;  3M0R A;  2SRC A;  1Z9Q A;  4EPC A;  3PVQ A;  4AFS C;  4O6J A;  3QZ9 B;  3VYH B;  3CQT A;  5I22 A;  3RIR A;  1UGR B;  1M1F A;  1RI0 A;  2LX9 A;  4F04 B;  1VQL Q;  4BY6 B;  4KH0 B;  3HP9 A;  5KYN A;  2HKQ B;  4J9D A;  1RAC B;  5CKD A;  3EFO B;  3EG9 B;  2DIL A;  3V8K A;  1W4S A;  2QEX A;  1RI9 A;  3THK A;  4N4H A;  2HL3 A;  3FIF A;  4IUP A;  5IH2 A;  1TOV A;  2EYQ A;  3WXM B;  4C8Q B;  1VYV A;  2HBP A;  4M77 A;  1NLP C;  2QTX A;  2XK0 A;  3F70 A;  3M53 A;  4LUD A;  1ZQ1 A;  1VQ4 Q;  3HKS A;  5D7U A;  3UPU A;  1WXB A;  2DXC A;  1KC8 C;  1KC8 U;  2V8K A;  1X43 A;  2ROL A;  3VV0 A;  2L5Q A;  5I21 A;  2HDA A;  3TCJ A;  3LYI A;  1TUC A;  2K2M A;  1VQ4 T;  1PSF A;  3EG1 A;  4KGZ B;  3UAT A;  1G3Y A;  2LZ6 B;  2FRW A;  2KRS A;  3NPF A;  4Q5W A;  2DL7 A;  4X9D A;  1HYO A;  4BI4 A;  5A0D A;  1ZA2 B;  5C0M A;  4M77 F;  1D0Z A;  2D0Q B;  1PKS A;  2O88 A;  2O4X A;  1IGQ A;  2LTO A;  3TVT A;  2CH4 A;  4B9W A;  1SG5 A;  4FL6 A;  3CXC P;  4HT8 A;  2HSP A;  1WHH A;  1YJ9 T;  1Y71 A;  2PVD B;  2F1L A;  1KQ1 A;  2LJ0 A;  1B34 A;  3CCV Q;  2A08 A;  3J7A F;  2QA4 Q;  2OTL Q;  1BI2 A;  2CS7 A;  1UEB A;  2YUP A;  2FZC B;  2DYB A;  3FLG A;  4LD9 K;  1QVG A;  3EGX B;  3KUF A;  4ELZ C;  1OI1 A;  1M2O A;  2A36 A;  3OYG A;  5FRN A;  2DTH A;  2JS0 A;  2A3L A;  1WXT A;  2EYY A;  2QDL A;  5J3B A;  2DBK A;  2LJ3 A;  4C0D C;  2JZ2 A;  2QDY B;  3GPL A;  1OQK A;  1UGQ B;  4GLK A;  2RA2 A;  2AKK A;  2MIO A;  1M2V B;  3UDC A;  1I4K 1;  1VUB A;  4FYY B;  3VJP A;  2MI6 A;  5KYU A;  2GBQ A;  1K8A U;  1NZ9 A;  3VS5 A;  1YIJ T;  4E7S A;  2M16 A;  4J9C A;  3EH2 A;  2RI3 A;  4RTW A;  1VQO Q;  2P84 A;  4JRK A;  5FWB A;  2DM1 A;  2DO3 A;  1VQK Q;  4FCY A;  1E6H A;  3R6O A;  1FMV A;  3OBW A;  2RQT A;  1BI3 A;  2MF2 A;  3SWN A;  2ZPB B;  4M78 E;  1UGP B;  3WVD B;  5FW9 A;  4FYV B;  4LUE A;  3LLR A;  3QO3 A;  4M7A E;  4BD3 A;  4EMK A;  2RMO A;  1OPL A;  2O9V A;  1LPL A;  2PU9 B;  4M7D G;  4OB0 B;  1VQP T;  3RKX A;  3FRN A;  3ZBD A;  1OZ2 A;  3CCL A;  1O75 A;  4CC2 A;  1ABO A;  4M78 C;  2DVJ A;  1U5S A;  5GAO l;  3E2U A;  3PIO A;  2Y4Y A;  3CCU T;  3VS2 A;  4C0Z A;  4MZP A;  1Q86 R;  3KFV A;  1UTI A;  5FWC A;  4A54 A;  2YWW A;  4Z8A A;  5CVI A;  3EGD A;  4E47 A;  2VV5 A;  3PMI A;  1RAF B;  1RAH B;  2LCL A;  3CCR T;  2K57 A;  2E5K A;  4OP0 A;  3JCM X;  2OTJ Q;  4C0F A;  4JUV A;  3QYG B;  5AT1 B;  2L8D A;  3CC4 T;  1VQ9 A;  3JCM g;  4XU0 A;  3A5Z B;  3CBM A;  1U06 A;  3PT9 A;  3M4Y A;  1I8F A;  1K73 C;  1K73 U;  5GAO m;  2V26 A;  1T3L A;  1X2K A;  2YRV A;  4B6M A;  4J83 A;  1D0Y A;  2G3R A;  2XIC A;  3JV3 A;  4QW2 A;  1VOM A;  2JMC A;  4M75 E;  3I55 A;  3CEY A;  1VQL T;  3A8G B;  2VVK A;  1K9M U;  3PGG A;  3QWX X;  1KK7 A;  3IQL A;  4FW1 A;  4JJD A;  2O01 E;  1NBE B;  3CCE Q;  2ED1 A;  2HSE B;  3INZ A;  2XHC A;  1VQN A;  4M7D A;  4M78 D;  5GMK h;  1M1K C;  1M1K U;  3RKW A;  1X6B A;  5FRM A;  4FT2 A;  4M7A D;  5CKE A;  4PJM A;  1X75 C;  2FVU A;  2GFA A;  4ZN3 A;  1YJW A;  3PNW C;  4J6X A;  4KUI A;  2O4X B;  1M30 A;  2YLC A;  1XNI A;  3JSC A;  1ABQ A;  1QCF A;  2HMA A;  3T9N A;  1Q7Y R;  2WSF E;  3OB9 A;  3OYL A;  4FW2 A;  4C92 E;  1R0C B;  2CP7 A;  2KXD A;  2YDL A;  3M0S A;  4XTW A;  5GAN 7;  4AT1 B;  2OI3 A;  1VQM A;  3OS0 A;  1WX6 A;  4C8Q E;  4J9F A;  4M7D F;  2HZY A;  1Q81 U;  1MNE A;  1VYU A;  1IXD A;  4BY6 C;  1VQ6 A;  2IVW A;  2QEX Q;  5LJ3 g;  2VGM A;  3NMZ C;  3REB B;  4PFP A;  2PZ1 A;  1WZO A;  1X2Q A;  1BI0 A;  4BB7 A;  3M0P A;  2AT1 B;  3VS1 A;  5GMK e;  2A28 A;  4F7U G;  4C8Q C;  3MP6 A;  4XTY A;  3EFS A;  3TU4 K;  5GAN 3;  3CCV T;  2MYS A;  1YJN T;  2QA4 T;  2FZG B;  1NPR A;  3LH5 A;  5KYU B;  3OW2 A;  3GLX A;  1IZ6 A;  2EQM A;  4EMH A;  4M75 D;  2H8H A;  4KUL A;  2RJD A;  1AWO A;  3QJY A;  2Z0W A;  1WQ7 A;  1RAI B;  2KT8 A;  5GAN 2;  2H3J A;  2DXB A;  1WDX A;  3GBQ A;  5EG2 A;  1T0H A;  3S3O A;  2EW3 A;  3AHU A;  1SSH A;  5GAN h;  4JS5 A;  3SWN B;  1ZSG A;  4DQ2 A;  4A53 A;  3QHS A;  8AT1 B;  2D6F A;  3OMG A;  2LCC A;  2WSE E;  2FO0 A;  3PTA A;  1MHN A;  1I07 A;  2JVV A;  5KCO A;  2FPF A;  2D8J A;  4LD6 A;  1NPP A;  2CUB A;  4N4I A;  1IRE B;  3CC7 T;  4LDY A;  4C92 D;  3MEU A;  1N8R R;  2FL7 A;  3ER0 A;  3QDR B;  5CQX A;  5GAN d;  3MEA A;  4RTX A;  3CBP A;  3EG3 A;  4C8Q D;  2DPP B;  1EZZ B;  3V8L A;  2K6D A;  2EKH A;  3ZFJ A;  3EGD B;  4ESR A;  2K5F A;  3CCQ A;  1YCY A;  2KRM A;  1D0X A;  2RH2 A;  1FX7 A;  4C0D B;  4V2S A;  5GAN e;  3VS6 A;  2DAQ A;  4OB3 B;  4C5E A;  4RTY A;  2QQA A;  3RMS A;  1JJ2 P;  2RHY A;  3BFM A;  3MEW A;  3O8V A;  3CCS T;  1JJ2 S;  4AFQ C;  4JLG A;  1TU0 B;  2SEM A;  2DFU A;  4LDU A;  5GMK l;  1B7T A;  2EJ9 A;  4Z89 A;  3JCM P;  3M0T A;  2BKD N;  1JEG A;  1P92 A;  3GIB A;  3VS3 A;  1Q82 C;  2OX7 A;  1Q82 U;  5IXB A;  3TQ7 P;  2L89 A;  4QT7 A;  1Y7X A;  2EQK A;  3G1J A;  2P4T A;  3DLM A;  2KE9 A;  1WYX A;  1OZ3 A;  2JM8 A;  2XU8 A;  1X69 A;  5HK3 A;  4OF1 A;  1UGS B;  4XTX A;  2V8I A;  4WF2 A;  1U1S A;  3CCL Q;  3OS5 A;  2M51 A;  3X20 B;  1AZE A;  3L1A A;  1OU8 A;  2EGA A;  1RAG B;  4JDS A;  4Y28 E;  4ANJ A;  2LNH B;  4PJO G;  2MK5 A;  3VS4 A;  2EYW A;  2CT4 A;  1N6A A;  5GMK m;  5HY6 A;  3FEO A;  2HQH A;  2RB6 A;  3V7R A;  1QCO A;  4JJN K;  3A8H B;  3LWH A;  2VXF A;  2L3Q A;  3HTR A;  5LJ3 h;  2E6N A;  3CCE T;  3RER A;  1KSW A;  1VQ8 A;  3MET A;  5CIU A;  4C5H A;  2AHJ B;  3MJX A;  2AK5 A;  2JUF A;  4PFO A;  1N9S A;  3V8J A;  1I5L A;  4OMN A;  1VQ9 Q;  2COY A;  1M90 C;  3J80 E;  1M90 U;  2MCN A;  3QWY A;  5KYW B;  1JXM A;  4P5N A;  2Y4X A;  4AG2 C;  2ZGW A;  4E7L A;  2MAM A;  1G83 A;  2P0P A;  3CMA T;  2EBP A;  4XK8 E;  2CZ0 B;  2RHZ A;  3H9N A;  3CC2 A;  2H3E B;  5DM7 R;  4M77 C;  2C0T A;  4IKF A;  1UHC A;  2RN8 A;  1KQS A;  2D8H A;  1VQP Q;  3UWN A;  2KK4 A;  2DEQ A;  3I55 Q;  1MMN A;  1KIK A;  1WI7 A;  4MDX A;  2KAF A;  2KEA A;  2GGR A;  2CP3 A;  3DB3 A;  1BU1 A;  2QEX T;  1PG5 B;  1RAE B;  5KE2 A;  1YWP A;  1VQN Q;  4FSS A;  4L6V 5;  4E6R A;  2JN0 A;  1LNX A;  3JCM b;  2F5T X;  3CCJ A;  4OB2 B;  4R55 A;  3E9G A;  1EIF A;  1FXX A;  2ZZD A;  1YJW Q;  3CD6 A;  1W1F A;  4PJO A;  1Y07 A;  2M02 A;  3OBY A;  4OMP A;  1VYT A;  2DXU A;  1WLP B;  2KYB A;  3JCM f;  3CCM A;  1OV3 A;  2VAS A;  2J6O A;  5GAN 8;  3CPW A;  1X6G A;  4K11 A;  3RDV A;  1BIA A;  2HNI A;  2L3S A;  2M9U A;  4RMO A;  2EGE A;  2XD0 A;  1VQ6 Q;  1LCK A;  2M0Y A;  4QVD A;  1SRM A;  3HPW A;  4J9E A;  3JB9 F;  4PJO F;  1UE9 A;  4PK4 A;  5LJ5 h;  4F7U B;  1KD1 C;  3L2Z A;  1KD1 U;  1PKT A;  3FJP A;  1VQ5 A;  4JJC A;  1B3Q A;  1QWE A;  4EMG A;  2NUP A;  2C0I A;  2PNI A;  1RL2 A;  1BK2 A;  4J9I A;  2DD5 A;  1ZUK A;  3UT1 A;  4C5I A;  1K76 A;  2K3X A;  1CKB A;  1QQJ A;  2A37 A;  4E2F B;  4HA8 A;  3R6N A;  1ZBJ A;  2G6F X;  2HBW A;  3NFC A;  4FIB A;  5LJ5 d;  2K2V A;  3OYY A;  4XTZ A;  2NUT A;  2PUO B;  3H0I A;  3M54 A;  2VKN A;  5GJW B;  2MPX C;  4BE1 A;  1WPY A;  3HHT B;  4EDU A;  2CDT A;  2X35 A;  5I2M A;  3OSS C;  2DKG A;  1IHW A;  3ULR B;  4XTU A;  3SWN C;  2CRE A;  5LJ3 f;  4A4K A;  4Y91 A;  5LJ5 e;  2R57 A;  5GAM h;  2YT6 A;  3A8L B;  2RPN A;  2E65 A;  1F1B B;  1O9S A;  2LQ8 A;  2RHX A;  3CME A;  5J26 A;  1ZBX A;  3SFM A;  1WHG A;  4LE9 A;  3OYE A;  1MV3 A;  1YNZ A;  4MDW A;  1AWJ A;  2KMT A;  1WHM A;  3GNF B;  3I5S A;  1K1Z A;  1YJN Q;  1S72 A;  2QQ9 A;  4OMF B;  1YCS B;  2PTK A;  1G3T A;  4A4H A;  1BIB A;  3NGP A;  5GAM d;  4PLL A;  3QUI A;  2JW4 A;  3CCQ Q;  1GRI A;  2ENM A;  4FT4 A;  3OYK A;  3CCL T;  2L3P A;  1BB9 A;  2FRY A;  3ASK A;  4PFZ A;  2X4Y A;  4LDX A;  2DA9 A;  5GAM e;  2EAY A;  1W2B A;  1Z9Z A;  1I1J A;  5GAN 4;  4FU6 A;  4R56 A;  2AZS A;  4F14 A;  1M1G A;  1K8A C;  4IUU A;  2DBM A;  4E7I A;  1ZX6 A;  2K4Y A;  4ZNX A;  3CC7 Q;  3EH1 A;  1T3S A;  1I5O B;  2KNB B;  4JZ4 A;  4JS4 A;  4AMC A;  3OYA A;  2VB6 A;  4NS5 A;  3N5B B;  3OYM A;  2DE0 X;  2ZPG B;  1VQ9 T;  1FMK A;  4QKU A;  2KQW A;  1WHJ A;  2CSI A;  3MHX A;  2K79 A;  1QLY A;  4M7D C;  2X4W A;  2YUQ A;  1JRI A;  8ATC B;  4N0A A;  4PJO B;  5GAN g;  1TWB A;  1QVF P;  4RTZ A;  3I55 T;  1QVF S;  1MMD A;  2K3Y A;  1PHT A;  4LNP A;  2BIV A;  2AZV A;  4DEY A;  5GMK j;  2RJE A;  3C12 A;  4E7H A;  1PD1 A;  1Y96 A;  4ATO A;  3M57 A;  2MWO A;  1VQN T;  1TS9 A;  4UC4 A;  1VQ8 Q;  1G8X A;  1JXO A;  2XKO C;  1N9R A;  2WAC A;  2DVE A;  2CZ7 B;  2HQX A;  4IIM A;  3CCS Q;  1IO6 A;  1YJW T;  2E1H A;  1ZHI A;  1H64 1;  2M1H A;  3C4S A;  2A7Y A;  4VUB A;  3CXC A;  5CK9 A;  1AEY A;  4ZTF A;  4E7Z A;  2DRK A;  3CC2 Q;  1WIE A;  2LP5 A;  5KYY A;  4M7A G;  1UEC A;  5A0G A;  1UGV A;  1M3B A;  1RAA B;  4Y92 A;  3PE0 A;  3FC3 A;  5IT9 E;  5KCH A;  4M77 B;  1SHF A;  4WTO B;  1AD5 A;  3RR6 A;  4DA4 A;  1VQ6 T;  4KRT A;  2BZX A;  3PIP A;  4MMK A;  1K9M C;  2RQR A;  3CCJ Q;  2X4X A;  2NUT B;  4DEX A;  3CD6 Q;  1ZSZ A;  1NYF A;  3PVL A;  1QW1 A;  3QDF A;  4RTU A;  2JT4 A;  5KYX A;  5CKF A;  2JJ9 A;  5AYF A;  1PSE A;  2D9T A;  1JBM A;  2CKK A;  4BUG A;  4J8O A;  1EFN A;  2ECZ A;  3OYN A;  3KXT A;  3OA6 A;  2J6K A;  2GCX A;  1TSF A;  4CRI A;  2J6F A;  1N8R U;  3MP1 A;  1K4U S;  1SEM A;  2DTO A;  2DXT A;  3CMA Q;  1OEB A;  2FZK B;  2QI2 A;  2IPO B;  1NJI C;  5GAN j;  1NJI U;  2QTV A;  4F7U E;  1U1T A;  2RI5 A;  4L59 A;  1B34 B;  2ESW A;  1X27 A;  4HCB A;  1Q81 C;  2L0A A;  4M75 G;  4BE2 A;  1YHQ A;  5EC7 A;  2HEQ A;  4M7A A;  3OY9 A;  1NG2 A;  2BE9 B;  1UB4 A;  3QZ5 B;  4AG1 C;  5CAI A;  1XTD A;  4KT0 E;  3BE3 A;  5I11 A;  4MZM A;  1M5Q 1;  3VU3 C;  3G4S A;  3A8O B;  5GAO q;  3X25 B;  2DD4 A;  4BDZ A;  1YI2 A;  2F2V A;  1PNJ A;  5FRO A;  1YJN A;  3Q1J A;  2KRN A;  4PL6 A;  3V7C A;  3QKJ A;  5C6S A;  4C92 G;  3JCM c;  5FLX E;  3CCQ T;  4DBQ A;  3E9F A;  1GXI E;  2QQB A;  4M7A F;  3BDL A;  2E6Z A;  2XID A;  4FYX B;  2C0O A;  3C95 A;  3G6E A;  1AHJ B;  1RUW A;  3DKM A;  3JAM E;  4BI8 B;  2EFI A;  4QVC A;  4XU3 A;  3X24 B;  2V1R A;  2CUD A;  3JCM W;  2FG0 A;  2BZ8 A;  4A4F A;  2ATC B;  3PMT A;  2ABL A;  3RES A;  4EMK B;  1Q95 G;  1U8R A;  1WNL A;  2E5Q A;  2LCS A;  4C5G A;  1N27 A;  1NM7 A;  5CO7 A;  2HQE A;  3EAE A;  2K7A A;  2EYX A;  1S72 Q;  4XQ3 A;  3SB2 A;  1YP5 A;  4M75 A;  2BUD A;  3SD4 A;  4YTL A;  2LQK A;  2YRD A;  1M1K R;  1UG1 A;  2LRQ A;  4ME7 A;  1WQW A;  1X6O A;  3EG2 A;  4DOW A;  1BCO A;  1M8M A;  1D09 B;  1D1A A;  1YBY A;  2VYT A;  5LJ5 g;  3A98 A;  4OVA A;  3EHQ A;  4FSX A;  3OYH A;  5LJ3 j;  1AWW A;  4BDY A;  2OTL A;  5KYY B;  1HD3 A;  3G71 A;  4M75 F;  4C92 A;  5CKB A;  4DBR A;  3EG9 A;  1AVZ C;  4TVR A;  1VQ8 T;  2KY9 A;  1QP3 A;  1W70 A;  2IG0 A;  2XMF A;  4J6Y A;  4J7I A;  1C6V X;  4IUT A;  4JPB W;  2PVO B;  2X51 A;  4PJO E;  2HKN A;  3CBO A;  1YIT A;  1VA7 A;  2EQI A;  2RM4 A;  4ZGD B;  5KH6 A;  1VQ7 A;  4J5Y A;  1MV0 B;  3VUB A;  1ZSZ B;  3ZEH A;  3CC2 T;  4ELY C;  4RG8 A;  1I0C A;  2HCK A;  2KRO A;  4M7D B;  4PJO C;  4C92 F;  1LVK A;  2ED0 A;  3ME9 A;  3TEE A;  1QVP A;  2LT4 A;  3JB9 G;  5GAM g;  2DRM A;  1VQO A;  4F16 A;  3QJ6 A;  4E7K A;  1HSQ A;  3M55 A;  5IHI A;  1VQK A;  4F17 A;  1OPK A;  2VGN A;  2R5M A;  1ZA1 B;  3CCJ T;  2QXF A;  3QYH B;  3CD6 T;  5L8R E;  2RD1 A;  4RCB A;  4JLI A;  2XDD A;  2GTJ A;  3M9Q A;  4M77 E;  1WJR A;  4X1V A;  4Z88 A;  1FWZ A;  2EGC A;  3CCM T;  2B86 A;  3JB9 J;  3MEV A;  2J7I A;  3EGX A;  2EWN A;  3OS1 A;  2ZCF B;  3L2Q A;  4ORZ A;  3JRZ A;  3LGL A;  5GAN f;  4KBM B;  2QQR A;  5L23 A;  1Y0M A;  2AIR B;  5LJ5 j;  2RF0 A;  2ZPI B;  3JCM J;  5KE3 A;  5J39 A;  1RLQ C;  4OB1 B;  3OYI A;  4EIK A;  1MND A;  1PC0 A;  1VIF A;  3MP8 A;  4PJO D;  2OTJ A;  1MMA A;  2QQS A;  2X9H A;  5FU7 C;  1VQ5 T;  1BI1 A;  2JTF A;  2COZ A;  3REA B;  4RG2 A;  2RQU A;  1GBQ A;  3AT1 B;  2DET A;  2LX7 A;  1M9S A;  3EGU A;  4RUG A;  1NYG A;  2CGH A;  3QII A;  1JJ2 A;  2K5I A;  1GFD A;  2E70 A;  3FJ5 A;  4IUV A;  3EFR A;  1RAB B;  3L2W A;  2NWM A;  4PKC C;  4RCC A;  1PRL C;  1QCN A;  1U3O A;  4N4G A;  2RJF A;  2DIQ A;  1SF9 A;  3ZL7 C;  4HVW A;  2FYK A;  4ZGJ B;  1G3S A;  1VQM Q;  2OAW A;  3NTH A;  2VUB A;  1QVG P;  1Q82 R;  2DZ9 A;  5GAM j;  4X34 A;  2KDS A;  2X4J A;  1QVG S;  4KGX B;  1GCQ A;  2QAS A;  2VXE A;  2B8A A;  1YHQ Q;  5LL6 S;  3A8M B;  4JRI A;  1D1B A;  1E7O A;  5M9O A;  2IIM A;  4M77 D;  3CME T;  2JNG A;  2ZPF B;  1YN8 A;  2E10 A;  4FM4 B;  1W2B P;  3G4S Q;  1D3B A;  1W2B S;  1WHK A;  1RLP C;  4GLM A;  3I56 A;  1TUG B;  1G3W A;  1QKW A;  1QP2 A;  2COW A;  1YI2 Q;  3SHW A;  1PD0 A;  2O9S A;  4HVV A;  1S72 T;  3DLL A;  4OMM A;  3UF4 A;  2NLU A;  2CT3 A;  4C92 B;  1D1C A;  2DK3 A;  3BW1 A;  4RTT A;  1XQH A;  1NEG A;  1XJW B;  3VS7 A;  1KG1 A;  2W0Z A;  5GAO n;  2K9G A;  1UFF A;  1G2B A;  3G6E Q;  5DY9 A;  2EIF A;  2KT1 A;  3WVE B;  1M3A A;  1IRX A;  1TG0 A;  1M90 R;  1KFZ A;  4A63 B;  4O5V A;  2HAX A;  2YHT A;  4NL3 A;  2DL5 A;  2K5L A;  2FB7 A;  4XU2 A;  2F69 A;  3TRE A;  2KVQ G;  5FU6 C;  2RI2 A;  4HVU A;  2JM9 A;  1JO8 A;  3TSZ A;  3OYC A;  4J9B A;  1J3T A;  1K0X A;  3M0U A;  2DYI A;  1B07 A;  1AOJ A;  4N0A C;  1RAD B;  3FDR A;  2OJ2 A;  4J7F A;  1WA7 A;  4EMK C;  3QSU A;  1HJD A;  1Q86 C;  3TSW A;  1Q86 U;  3JB9 I;  1ACM B;  4MML A;  4II1 A;  3VUZ A;  1YWO A;  5HCK A;  5A2Q E;  2RK1 A;  3C94 A;  2L3R A;  3VS0 A;  2CZ6 B;  1V29 B;  3OYF A;  4R0K A;  2MOX A;  2W10 A;  1SHG A;  3CXC S;  1QKX A;  1MGQ A;  2L2P A;  2HL5 C;  3OS2 A;  3LW5 E;  4HT9 A;  1LJO A;  1UJ0 A;  3C0C A;  1H92 A;  2AKL A;  1R77 A;  2DTI A;  2FPD A;  2DER A;  2PQW A;  3G71 Q;  3J81 E;  2E4H A;  4LDW A;  4PJN A;  3HSB A;  3VRZ A;  5GAO r;  3M4G A;  2D1X A;  4KH1 B;  1QMC A;  4CI0 C;  1VQ4 A;  1PWT A;  5D6Y A;  4M7D E;  4E7J A;  2YSQ A;  3L42 A;  1YIT Q;  1W6X A;  3H6Z A;  1OUL A;  2EPD A;  2KXC A;  2DX1 A;  1VQ7 Q;  1IHV A;  2DMO A;  1E6G A;  5I2S A;  1KD1 R;  3MKD A;  2KBT A;  5CCA A;  1ZSZ C;  2LVM A;  2DLP A;  3GF5 A;  3SDZ A;  3QBY A;  4X9C A;  2RHI A;  6AT1 B;  5IHK A;  1Q7Y U;  2DZC A;  1Q7Y C;  4Z02 A;  1TTH B;  1YJ9 A;  5LJ5 f;  4ZGE B;  1KC8 R;  1AWX A;  2ROT A;  2BZY A;  1JQQ A;  3BY7 A;  1GBR A;  2E12 A;  2KSS A;  2JTE A;  2JOY A;  1YFN A;  3HRT A;  3UA6 A;  3H0F A;  4JRQ A;  4NOY A;  1DJ7 B;  1PCX A;  1OU9 A;  1CKA A;  3URG A;  3SEM A;  2E64 A;  2M0O A;  5DLO A;  4LN2 A;  2RHU A;  1MUZ A;  2KGT A;  4QVZ A;  3OQ5 A;  5GJV B;  2E41 A;  3E1S A;  4A4E A;  4A4G A;  4M7A C;  2K3B A;  2CSQ A;  2CYZ B;  2EJG A;  4M78 G;  4PNO A;  2MWP A;  1D3B B;  1C0M A;  2LDM A;  2RO0 A;  2NUP B;  3RKY A;  1VQM T;  3OW2 P;  1ARK A;  4JJB A;  1YIJ A;  3DB4 A;  5GAM f;  3OW2 S;  3OSV A;  4IIO A;  3OYD A;  5GMK i;  1YHQ T;  2ZAE A;  4JZ3 A;  1ZLM A;  4M7D D;  1G5V A;  3PFS A;  2EKO A;  4BAC A;  5FU7 B;  1MMG A;  4B9X A;  1PRM C;  3S3M A;  3OMC A;  2EYZ A;  3G4S T;  2F2X A;  2CP2 A;  4ZTJ A;  2FPE A;  2O2O A;  2CP5 A;  2DJQ A;  1UJY A;  4LXC A;  4IUR A;  1SPK A;  1YI2 T;  2MMP A;  3HRS A;  1VQP A;  2QK0 A;  3JCM Q;  2Y90 A;  2KR3 A;  3CCM Q;  2LMJ A;  1K8A R;  2XDP A;  1N8R C;  2LNV A;  1AT1 B;  2O31 A;  3QG1 A;  3LX7 A;  3CCU A;  3G6E T;  1H8K A;  3RBB B;  2VC8 A;  1TUD A;  1ZUU A;  2RQW A;  1IGU A;  2GTO A;  4M75 C;  1AZG B;  1SSF A;  1S1N A;  4HXJ A;  3HL8 A;  4CC7 A;  1K9A A;  3CCR A;  4OMQ A;  1KHI A;  4M78 A;  2YXY A;  2F5K A;  2EQU A;  1VQ5 Q;  4HCZ A;  1QVF A;  2E3I A;  3I56 Q;  3M5A A;  3M58 A;  7AT1 B;  3CC4 A;  3V7S A;  5CKH A;  2I0N A;  4HKE A;  2R5A A;  3JCM V;  4QQG A;  2I2L A;  1T0J A;  3NTI A;  4D8D A;  3VKI A;  5GAN 6;  2X3X D;  4J9G A;  4C92 C;  2NUZ A;  1XOV A;  5KYW A;  3KBG A;  3OYJ A;  2D0N A;  1VQL A;  4AFZ C;  3L2R A;  4WCI A;  2P0Q A;  4M78 F;  2P0K A;  4PLI A;  2GFU A;  1WXU A;  3H41 A;  1Y57 A;  3FB9 A;  1GFC A;  1FYN A;  1M8V A;  4C8Q G;  2BTT A;  1BKB A;  2OTL T;  3G71 T;  4RTV A;  4CC4 B;  3RMQ A;  5GAN 5;  2YUN A;  1TH7 A;  5FU6 B;  2EQJ A;  2GNC A;  1K73 R;  3CME Q;  4BE0 A;  2CZ1 B;  1N5Z A;  4KGV B;  2YRC A;  2J06 A;  2R58 A;  2DEU A;  4IUQ A;  2F2W A;  2PVG B;  3HFN A;  4M4Z A;  3GNG A;  4OGE A;  1YIT T;  3JB9 H;  1WJS A;  1K9M R;  3P8D A;  1VQ7 T;  1Y96 B;  4LDV A;  2C06 A;  2YUO A;  3LWI A;  1BCM A;  1HXD A;  3I35 A;  4PJJ A;  3GOX A;  1BYM A;  3H0H A;  2EJF A;  5DLQ E;  4NL2 A;  3EHR A;  2XDB A;  1R0B G;  1HK9 A;  5IXF A;  1GCP A;  3HRU A;  2BE7 D;  3S3N A;  3M0Q A;  1VQO T;  2DL4 A;  1C1A A;  1JU5 C;  3M56 A;  5HKC A;  1NEB A;  3P8B B;  1VQK T;  2FEI A;  1SKU B;  4PJL A;  3A1P A;  3MPU B;  1KQS P;  1UDL A;  3CCV A;  1NJI R;  1KQS S;  2DL3 A;  3O5Z A;  1WGS A;  2QA4 A;  2CP0 A; 
#chains in the Genus database with same CATH homology
 1QVF P;  1KC8 R;  3CCV Q;  1JJ2 P;  1VQL Q;  1VQ7 Q;  3G71 Q;  1VQK Q;  1YJ9 Q;  3CCU Q;  2QA4 Q;  3CC4 Q;  2OTL Q;  1VQN Q;  1YJN Q;  1YIJ Q;  1KD1 R;  2OTJ Q;  3CCL Q;  1Q81 R;  1W2B P;  3G4S Q;  1S72 Q;  3CXC P;  3CCM Q;  1YJW Q;  1VQM Q;  3G6E Q;  1N8R R;  1K9M R;  1QVG P;  1K8A R;  1Q82 R;  3CC2 Q;  3CPW P;  3CCQ Q;  1VQP Q;  2QEX Q;  1VQ8 Q;  3I55 Q;  3CCJ Q;  1Q7Y R;  1KQS P;  1VQ5 Q;  1M90 R;  3CMA Q;  3CCR Q;  1YI2 Q;  1Q86 R;  3CCS Q;  1VQ6 Q;  3CD6 Q;  1VQ9 Q;  1YHQ Q;  1K73 R;  1NJI R;  3CME Q;  3I56 Q;  1VQO Q;  3CC7 Q;  3CCE Q;  1YIT Q;  1M1K R;  3OW2 P;  1VQ4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...