1VQNQ

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqnQ00
2OTLQ 3G6EQ 1VQ9Q 1YITQ 1YI2Q 3CC4Q 1JJ2P 3CXCP 3CCJQ 1Q86R 1K73R 1VQNQ 1M90R 3CC7Q 1VQLQ 3CMEQ 3CCMQ 3G71Q 1N8RR 1Q7YR 2OTJQ 2QEXQ 1YHQQ 1S72Q 1NJIR 1YJWQ 3G4SQ 1VQPQ 3I56Q 3CCQQ 1QVGP 1VQ7Q 3CC2Q 1VQ8Q 1VQ4Q 1QVFP 3CMAQ 3CD6Q 3CCLQ 1KQSP 1VQMQ 1KD1R 1VQ6Q 1K8AR 1M1KR 1Q82R 3CCVQ 3CCSQ 3CCEQ 1W2BP 1YJNQ 1Q81R 1KC8R 1YIJQ 3CCRQ 3CCUQ 1YJ9Q 1VQ5Q 3I55Q 1VQKQ 3OW2P 1K9MR 2QA4Q 3CPWP 1VQOQ
chains in the Genus database with same CATH superfamily
2XMFA 5I21A 2ENMA 3WVDB 2A3LA 1VQLQ 2M16A 3L2ZA 1PD1A 2D8JA 1TXQA 1RAAB 1TSFA 4M7AF 3VS0A 4UC4A 2DTHA 4M78A 4ELZC 4CC7A 4FT4A 2AHJB 1W70A 3EG9B 1VQOA 4BACA 2YRCA 5CR2A 4XTXA 1NJIU 1VQ8T 4AT1B 3OS1A 4DA4A 1ZBXA 3A8LB 1VQPQ 5KYWB 2LT1A 2P0KA 4OMFB 5IN1A 1SRMA 3OYLA 1VQ4A 2RJCA 2XICA 2EQMA 4RG8A 4N0AA 2FPFA 3FJPA 1GCQA 2YWWA 2NUTB 1D1AA 1UB4A 2VKNA 5A2QE 5GAMf 2L89A 5A0GA 2OAUA 1ZSZB 3V8JA 4M78G 3OSSC 3EFOA 3X28B 3EG1A 5AYFA 3JB9F 2YRDA 3OBWA 2RQUA 1PNJA 3LH0A 4IUVA 4LDWA 3BW1A 1JBMA 1K8AU 2HDAA 4ZN1A 2SRCA 2VXEA 2OTLT 2SEMA 3L42A 3PIOA 5CKDA 2QGGA 4E6RA 4WTOB 1BI1A 3CMEA 3RKYA 3VU3C 4JJNK 1KQ1A 2AT1B 1MUZA 2O31A 2P4RA 3QJ6A 1VQ6T 1ZBJA 2D1XA 1VQ7A 2HZYA 5LJ5e 1NYFA 1H3ZA 1JQQA 4M77B 4GBQA 2QI2A 1KJWA 3EHRA 4D8KA 1RUWA 2K4YA 1LPLA 1YBYA 4RTXA 1YJ9A 3JB9J 2FPDA 2DL4A 3IQLA 5LJ3j 2MAMA 2YHTA 4PK4A 3JCMV 2KGTA 5KYUB 2LDMA 5GAN8 3OYGA 4FYVB 3I56T 4JLIA 4ME7A 5CQYA 2CP2A 3GNFB 1BU1A 1OI1A 1I81A 1WGSA 2EPDA 3HP9A 4C8QF 3X20B 2K57A 2CZ0B 4J9HA 1TS9A 2AZSA 3CCUT 3MKDA 1PKSA 2J06A 2MYSA 4OMPA 5I22A 1B7TA 5M9OA 1YJNQ 3I55A 3D7SB 1WXUA 4HVWA 4Y28E 1H8KA 4PJOC 2NYSA 2HL5C 3THKA 1YITA 3MO8A 1YI2A 4PJOD 1TWBA 4M75A 2V1QA 4EMGA 4GY5A 1SHFA 4PL6A 2DETA 2HAXA 3OQ5A 2HD0A 1PSFA 1XJWB 2C06A 3TVTA 1ABQA 1R0BG 1OPKA 5IHIA 2K3YA 1M27C 3CCSA 2BZYA 2ATCB 2RI2A 2LC4A 1JJ2S 3VS1A 1X6GA 4NL2A 1XTDA 4FW1A 3M55A 4LDUA 3JCMQ 3L1AA 4NS5A 1N6AA 2KYMA 2O9SA 2CDTA 2QQAA 5FRNA 3CC2Q 1UE9A 3E2UA 4M75G 2LCLA 3L2VA 3RDVA 1VQKQ 2QQ9A 1LCKA 3UA7A 2MPXC 2ED0A 4XQ3A 1JXOA 3SDZA 1BBZA 4M78B 4RTZA 1S72Q 5GAOl 4M77C 3G4SQ 3CCQA 4M77D 1LJOA 2D0QB 4ZTJA 3CD6Q 3CCLQ 1KD1C 4OVAA 4BUGA 3E9FA 2COYA 1Q81C 3QYGB 5FWCA 2DK3A 2OTJT 2K6DA 1OEBA 1VQMT 5DLOA 4M4ZA 2O9VA 2M9UA 5CCAA 4JRPA 3SWNA 4L59A 1YIJA 2W0ZA 3EFOB 4F16A 4XAXB 4DOVA 2XK0A 1U1SA 3EG2A 4JPBW 3FC3A 1RADB 2MK5A 2EQKA 2CZ7B 2CREA 5GANg 1ZUKA 4XK8E 5A0LA 4F7UA 1VQ8Q 3MPUB 1QVFP 2XD0A 1PM3A 2RPNA 4RTUA 1KD1R 1M1KC 4Y92A 3CBPA 1Q81R 4HVVA 4BE1A 1PRMC 3JB9I 1MMAA 5LJ3e 1AT1B 2ZPFB 3HSBA 2ESWA 1UGQB 2AIRB 3JV3A 1YJWA 5GJWB 1GBQA 2LNVA 4AFZC 1NEGA 2WSFE 1WHLA 4C92A 3CCVA 4C8QB 3A8GB 3A8HB 4DQ2A 4GLMA 2HBWA 1C6VX 5J26A 4F7UG 3VV0A 1M90U 3RR6A 2QK0A 2OTLQ 3CXCP 4M78C 4MDXA 4C5HA 4M78D 3CBOA 2X4XA 2KAFA 5KYNA 1NJIC 3H41A 3MEAA 2IG0A 1VQ6Q 1QKWA 1M1KR 2YXYA 3OYYA 2BTTA 2PVOB 2QDYB 4OMOA 4FT2A 2DXUA 1HK9A 3C4SA 4OMNA 1Q86U 4FCYA 2VYTA 3F70A 4C92G 4N0AC 1X6OA 4BY6B 2EKHA 3DLLA 2D6FA 1VA7A 2L3RA 3PFSA 3UA6A 1OPLA 1RLPC 3I56Q 2DLPA 1IB8A 1OOTA 4JJBA 1OZ3A 3JCMc 3CCUQ 1KQSA 1WXBA 1KHIA 1WHKA 3LYIA 2RQWA 2DL3A 2XHCA 1LNXA 2JVVA 4A4HA 1QP2A 4OMMA 1ZX6A 2QEXA 6AT1B 1B07A 1NJIR 3TU4K 4A63B 2P0QA 1PWTA 3RNJA 1P92A 5KYXB 3PIPA 2DTIA 1IZ6A 4PJLA 3LX7A 2RI5A 3X24B 1D3BA 3H6ZA 5GANd 4KT0E 4VUBA 2YSQA 1RACB 4M7DB 1OX8A 1HXDA 5GAN4 4L6V5 3OS0A 1NZ9A 1RI0A 2HSEB 2OI3A 2L3SA 3NTKA 3C0CA 2FZGB 4XTZA 3BFMA 2R5AA 3PTAA 2DZCA 4B9XA 2LJ1A 1KSWA 3S3MA 4QQGA 2CP6A 4OGEA 1YP5A 4M7AE 1UGPB 3JCMJ 1VQOQ 3BY7A 4LDYA 5FROA 5FU6B 3VKIA 4EPCA 3SD4A 4J83A 3ZEHA 4KGXB 2E70A 4A4FA 2DEQA 2RQVA 4RUGA 1D09B 2KEAA 4A4EA 5CQXA 4X9DA 4M75C 4PJOF 2X35A 2FZCB 2EQIA 4WF2A 3G6EA 2DTOA 4BY6C 5HCKA 1D0YA 4JUVA 1HSQA 2PVGB 4IIOA 1UGVA 5LJ3f 2OTJQ 1OQKA 3Q1JA 2EJ9A 3V8KA 1VQMQ 3M5AA 3OS5A 5FU7B 3MP6A 3M58A 5GAMe 4JDSA 5CAIA 2CGHA 4ESRA 1FYNA 1RABB 2DL8A 1G2BA 4HCZA 3ZBDA 3QWYA 3A98A 4FSXA 2ZCFB 5D6XA 1QVFS 1M5Q1 1TU0B 2CH4W 3HRUA 4XTVA 2RNAA 1FMVA 5EC7A 3UATA 4KH1B 2COZA 3REAB 4QQ6A 3BDLA 1SHGA 4Z88A 3JCMh 2AZVA 1NM7A 1FXXA 5GMKl 2HMAA 4YTLA 3OYIA 2P0PA 1Z9QA 2FEIA 2JT4A 2MF2A 2RJDA 4CI0C 1UFFA 1A0NB 4M7DD 4M77F 3VUZA 1K1ZA 4E7KA 2CUBA 1IHVA 3M57A 1KD1U 4ZNXA 2E10A 4DOWA 4OB2B 4C8QE 1K9MU 2B8AA 3VUBA 2QA4A 3QKJA 5GMKh 1AVZC 2DD5A 1EZZB 2QXFA 2XDPA 4LDVA 3LGLA 1MMNA 2K5FA 3SWNC 5LJ5g 3TREA 2DKGA 3DB3A 2C0OA 2RK1A 3OMCA 3EGUA 3OW2S 3MEUA 3CCSQ 4D6WA 3EH2A 3V7CA 2DNUA 1VQNT 1Y57A 2LMJA 4AG1C 1TH7A 1UDLA 3BE3A 2CH4A 2KI7A 1YHQT 5L23A 1X69A 7AT1B 4IUTA 2VGMA 4EMHA 1K0XA 3REBB 4PFPA 5L8RE 2KVQG 2FHDA 2RD1A 1IHWA 1NG2A 2GTOA 2ROTA 8AT1B 3AT1B 2GF7A 2DJZA 3V7RA 1GBRA 2RH2A 1MV3A 3V8LA 5GMKj 4BE2A 1D3BB 3URGA 2FO0A 3OSVA 2JJ9A 3A8MB 3EGXA 4BD3A 1JXMA 1BIAA 4C92C 3G71A 1M90C 1AZGB 2E4HA 4C92D 1Q7YC 2VGNA 4JJDA 5DLQE 3JCMb 3EG0A 2LCCA 4JRIA 4JLGA 3OYHA 1C1AA 2WSCE 3P8BB 4KRTA 4FW2A 5FWBA 2DA9A 1RI9A 4J9CA 3M59A 3OYBA 1X75C 2QTXA 1VQ9T 4MZTA 4OB3B 1WNLA 4Z89A 4M78F 1Q86C 2DRMA 3CCMA 4PJOB 2RHUA 4O6JA 3M54A 4M7DE 5CKHA 3QUIA 3EGDA 2V8IA 2HQEA 2HSPA 3TSWA 4CC3A 4QT7A 2KRSA 1VQ5T 4RCCA 3CC4T 2GNCA 2Y90A 2O01E 2ABLA 2DBKA 2HBPA 1RL2A 1VOMA 2KK4A 1N8RU 4KUDK 3ULRB 1M30A 3FJ5A 5GAN6 1M90R 4HCKA 3OYJA 2RHZA 1FX7A 2J6KA 1J3TA 1UGRB 1TUGB 4M7AG 1MHNA 4EMKC 2VUBA 1WQWA 1I5OB 2KRNA 2K5IA 3GF5A 3DKMA 5HY6A 5FRMA 2HNIA 1Y0MA 4ZTFA 3CEYA 2DPPB 5CVIA 5LJ5d 4K11A 4J9IA 3CC7A 4CC4B 1Q86R 3QJYA 1ABOA 4C5GA 1AEYA 1KK7A 2RO0A 4LUDA 5KH6A 3HFOA 1IRXA 1WJRA 2J6FA 4LUEA 2DVEA 3CMAA 1KG1A 1UG1A 3OBYA 5GAOn 3CCEA 2RN8A 3EHQA 2GTJA 2OJ2A 5GAN5 1SKUB 2BKDN 1NPPA 3I5RA 3CCJA 4D8DA 4R55A 5CO7A 1E7OA 3GLXA 3HPWA 2JMCA 2JW4A 1ZSGA 3JB9G 3HHTB 4ZGDB 2RB6A 1NYGA 3J80E 2GCXA 5CIUA 4KGVB 4C0ZA 2M0YA 2JTEA 3NHNA 3CCRA 5J3BA 5LJ3g 3JSCA 2VASA 2FB7A 4LXCA 3VRZA 1K0SA 1SRLA 3ZFJA 1TG0A 2CKKA 1EX4A 5DM7R 1GFCA 4PFOA 2M0OA 2HKNA 4OB1B 5IHNA 4XTYA 2FVUA 4C0DC 2KMTA 4TVRA 2XKOC 1XOVA 2EW3A 2K7AA 2J6OA 1TOVA 2B86A 2M02A 1M2OA 3MEWA 1VYUA 1E6HA 3J7AF 2DFUA 1FWZA 1BYMA 3M53A 2EQJA 2QDLA 4JZ3A 4BI3A 4RTYA 1VQOT 2FYKA 4BE0A 4JJCA 3T9NA 2BE7D 3WXMB 5GAOq 1UUEA 1I0CA 1KHCA 1FMKA 1XNIA 1VQNQ 3EFSA 2V26A 2QYZA 4RTWA 1VQ4T 3FRNA 2KT1A 1YHQQ 4N4GA 2IVWA 2BIVA 3GPLA 2DXCA 2KYBA 1OU8A 5GANh 2R5MA 3I35A 1QWFA 2P84A 1K9MC 2MI6A 4BDZA 1EFNA 2X3XD 4M7DF 4J9DA 4BI4A 1MMDA 1VQLA 4X34A 3JB9H 1RAFB 3VS2A 2X4WA 5GMKi 2QTVA 1Q82U 4Y91A 3CPWS 3FLGA 2KROA 4XU2A 2DJQA 2JXBA 2Y4XA 2CZ6B 2YUOA 3CMET 2ZPEB 2YLCA 4HT9A 1PSEA 1VQ9Q 1OYXA 3UPUA 1VQ7T 4PJOE 1Y96A 3FIFA 4E47A 2F5KA 2YDLA 1VQPA 5GANj 1W2BS 5LJ3d 2F2WA 4X1VA 1YJ9T 2A28A 2F2XA 3SFMA 3HFNA 2LX7A 4LD6A 2DXTA 4F7UF 2DAQA 1K9MR 1VQ5Q 4JRQA 3CC4Q 3MP8A 2EKOA 3L2QA 3UWNA 2R57A 1BI0A 4MMLA 3G7ZA 3PVLA 3C12A 4IURA 2RI3A 1ZA2B 3V7SA 3N5BB 1UHFA 2L2PA 3I55T 4RG2A 2GQVA 1I07A 3JCMf 1W4SA 2LQ8A 2EYYA 1YITT 1YI2T 3CPFA 5KYYA 1PRLC 2CT3A 1ZQ1A 3LLRA 1IGQA 4C92F 1BCOA 1S1NA 1Q7YU 2YUQA 3S6WA 3JCMW 2J05A 3CCST 1MV0B 2MMPA 5GAMg 4M7AC 3NTHA 3M9QA 4M77E 2X4JA 1D1CA 1QQJA 1RAIB 2E65A 3HRTA 4M75B 3P8HA 3OW2P 2DIGA 3RIRA 1VYTA 3C94A 3MJXA 1X2KA 2ZPBB 2DIQA 4E7JA 2PU9B 1M9SA 1G3SA 1JB0E 1N8RC 3H0IA 1M1FA 2E5QA 2E64A 2DYIA 1H92A 2DL7A 5I2MA 1WX6A 1GL5A 1KC8U 2DILA 1YJNA 2ZGWA 1PCXA 1PC0A 1HD3A 2M51A 2MIOA 4QW2A 5IT9E 1CKAA 2I0NA 4EMKA 3CCQT 2EIFA 5CKFA 3JCMX 2QQSA 1GXIE 3E19A 3JRZA 1N27A 1JJ2A 2DO3A 4HA8A 4RMOA 2VWFA 2CP5A 1D0XA 1I5LA 2LQNA 2JMAA 1QVGS 2BZXA 4C5EA 1UHCA 1Q95G 3H8ZA 1N8RR 2VVKA 4FYXB 3CC2A 2C0TA 1YIJT 2ZAEA 3CQTA 2DXBA 2YT6A 4QVDA 4LN2A 4A53A 4JZ4A 1VQKA 3NGPA 1YWOA 2NWMA 4IKFA 4DBFA 2EGAA 2DD4A 3RESA 3BDUA 1VUBA 1IGUA 2X51A 1R77A 4Z8AA 1S72A 3G4SA 4IIMA 4E7ZA 1MNEA 2DMOA 3SWNB 4M78E 2RMOA 5I11A 3EH1A 3CD6A 3CCLA 1VQ4Q 2FRYA 2HQXA 4E2FB 2HL3A 1PKTA 4AFQC 1IXDA 4M75D 3VJPA 5ECAA 1KQ2A 3UF4A 4J9EA 3PT9A 1K73U 3QXEB 5IXFA 1YJWT 2XDDA 1PD0A 2CS7A 2GFUA 4OB0B 4F7UB 5GAMd 4R0KA 3QBYA 3CCVT 3L2RA 4QKUA 3NPFA 3ER0A 5C6SA 3OYFA 2DERA 2IPOB 4OP0A 5IXBA 1UECA 4MMKA 1QLYA 2L3QA 2KE9A 2XIDA 4FYYB 2NUTA 3HKSA 3CMEQ 1ACMB 2EYZA 4AFUC 4C0GA 4DBRA 2ED1A 2JOYA 4C92B 1ZSZA 3RUXA 4QQDA 1VQ8A 2FPEA 3L2UA 1WDXA 3GOXA 1VQ7Q 1HJDA 5KYYB 1V1CA 2K9GA 1B34A 5LJ5h 2E3IA 2DBMA 1YJ9Q 3PMIA 2YRVA 2MOXA 4NOYA 3C95A 1M3BA 3RBBB 1IREB 1UJYA 1IO6A 1Y71A 4GLKA 2QASA 5KCHA 4II1A 3LGFA 2K79A 1C0MA 2JM9A 3VS5A 1Q82C 1O9SA 1ZUYA 2L3PA 4MZMA 3I55Q 2OTLA 1JO8A 4HVUA 3INZA 1M3AA 2QEXT 1WIEA 1YITQ 1WI7A 1YI2Q 4F14A 4MDWA 3OYAA 1BCMA 2M1HA 2ZPHB 5GAN7 2CYZB 2W10A 2EAYA 3GP8A 5LJ5j 1SF9A 4BB7A 2D8HA 4AFSC 1VQ6A 2O2OA 1CSKA 4J6XA 3JAME 2EGCA 3O8VA 4CC2A 4EMKB 3OS2A 2XG8D 1W1FA 3TSZA 2JN0A 2PZ1A 4XTWA 3QIIA 2G3RA 4M75E 4J7IA 1U8RA 4KH0B 2PNIA 1UGSB 1I8FA 2RHIA 2XU8A 5KE2A 4XTUA 4FIBA 3I56A 3LWIA 2QG9B 2LZ6B 1QMCA 3O5ZA 4B6MA 2PUKB 4DEYA 1Q82R 1Z9ZA 2Z0WA 1V29B 2DE0X 1G83A 2CP3A 3M0QA 2L5QA 1X43A 2LVMA 2KNBB 2KQWA 1X6BA 4O5VA 5GAOp 2EYXA 2QGFB 4RCBA 3P8DA 1AHJB 3CCQQ 1I4K1 3QSUA 3PMTA 2JZ2A 3KUFA 3G6ET 5GANf 2CUDA 2V8KA 4ATOA 3CPWP 2F1LA 4M7AA 2PUOB 1V76A 1N5ZA 4ZGEB 1W6XA 3OYMA 1N9SA 5GAOm 1GCPA 2JS2A 4J6WA 4CRIA 1OU9A 5DY9A 4C0DB 1W2BP 1KC8C 1YIJQ 4PKCC 1QW1A 4KUIA 1KFZA 3TCJA 2RHXA 2RQTA 2DL5A 1F1BB 1AD5A 2RHYA 1PHTA 1Q7YR 3QDFA 1WYXA 4J8OA 2EBPA 1WXTA 3OYDA 3DLMA 2VXFA 1DJ7B 4FU6A 3LWHA 1BB9A 3HTRA 2E6NA 2P4TA 1SSHA 4P5NA 2EQUA 5LJ3h 4J9GA 3FB9A 2NUZA 2OTJA 2WSEE 2X4YA 1B34B 1VIFA 4F7UE 1YJWQ 1AOJA 2LP5A 3E9GA 2RF0A 4MZPA 2LJ3A 5D7UA 3OYEA 4A4GA 1VQMA 1ARKA 4FM4B 2FG0A 4OMQA 2QA4T 3ASKA 3FDRA 4XU1A 3CCVQ 3NTIA 1JEGA 1KC8R 1QVFA 3JCMd 4PJNA 1HYOA 5GJVB 2O88A 1G5VA 3QZ5B 1WA7A 2GQIA 3KFVA 2EFIA 2KR3A 3MEVA 2G6FX 4C92E 3OA6A 4FSSA 3JCMe 2FRWA 2LT4A 4IUQA 1SG5A 5HK3A 2NUPA 4ZGJB 4C8QA 2K3BA 2CSIA 2PQWA 4HKEA 2YUNA 4HXJA 1K73C 4E7SA 2MWPA 4RTTA 3I5SA 4E7IA 3PE0A 1FMWA 4PLLA 5IHKA 4J6YA 2ZZDA 3M4GA 8ATCB 3CXCA 4HCBA 1BI2A 4M75F 3G1JA 3QZ9B 3H0HA 4R56A 3MCAB 3VS3A 5IAYA 5GMKe 2DVJA 2GBQA 3WVEB 3G71T 1GFDA 1WHJA 2MWOA 2KRMA 4A4KA 2DF6A 1BK2A 1WZOA 1KQSS 2ZPIB 3OW2A 1BI3A 2QEXQ 3GIBA 2LRQA 4DEXA 3VS4A 1M8VA 4C8QG 1QCOA 1QVGP 3H9NA 3EGXB 2YUPA 1ZSZC 1BKBA 3LW5E 1WHGA 3CCMT 3A5ZB 4PLIA 1YCSB 1WQ7A 3GBQA 1OX9A 1H3HA 1K73R 2LJ0A 3RKWA 1D0ZA 3RKXA 3VRYA 3PGGA 4Q5WA 2DYBA 1WFWA 4J9FA 1D1BA 2VC8A 4M7AB 2X3WD 5GAN2 5KYXA 3A1PA 2LQKA 4Z02A 2RA2A 2GGRA 2O4XA 1T3SA 3QO3A 3EGDB 3QDRB 1R0CB 1M2VA 4PJMA 1PG5B 4BI8B 1K76A 2K3XA 3NFCA 2LX9A 3RMQA 4M7DA 1VIEA 4QVZA 1AWXA 2H3JA 1OZ2A 3VS7A 3CC7T 2K2VA 3G6EQ 2H3EB 4LE9A 3J81E 4AG2C 3VYHB 2RM4A 2OX7A 2HKQB 4B9WA 4J5YA 2I2LA 2D9TA 3CMAT 2KDSA 1K4US 1YNZA 3CCET 1U5SA 2KY9A 9ATCB 3UDCA 2L8DA 1SEMA 1X01A 1G3TA 3L2WA 4QVCA 2ZPGB 3SB2A 2A08A 3CCJT 1LVKA 2J7IA 2VV5A 5GAMh 5GAOr 2XDBA 1I1JA 4M7DG 2X9HA 2E5KA 5A0DA 3FEOA 2JUFA 2JM8A 1WPYA 1T0HA 4E7HA 4ANJA 1WLPB 1X27A 2E3HA 3CCRT 1NPRA 3ME9A 1R8OB 5LJ5f 1WHHA 2FZKB 1YWPA 4AMCA 2H8HA 5GAN3 2OAWA 2E6ZA 2QQRA 1AZEA 5D6WA 4DBQA 4F04B 2CT4A 2RK2A 2WACA 5CKBA 2NUPB 3M56A 4C5IA 1H641 5EG2A 3EG3A 4LDXA 5GAMj 2BZ8A 1M1GA 2JTMA 4M7AD 2A36A 1MGQA 1JRIA 2KBTA 2KT8A 2QA4Q 5HKCA 5GMKm 2L0AA 3OYCA 2DM1A 2NLUA 2R58A 3RMSA 4KGZB 3ZL7C 1Y07A 3TEEA 1UTIA 2JNGA 5D6YA 2A0FB 2KXCA 5HK0A 2C0IA 1TTHB 4HT8A 3H0FA 3X26B 1WHMA 3OYNA 2DX1A 2KSSA 2Y4YA 4WCIA 3E1SA 3RERA 1NBEB 2QAZA 1G8XA 2V8JA 1MNDA 4A54A 1LOJA 1GCQC 2GFAA 2RQRA 3R6OA 2CP7A 1SPKA 2E41A 3JB9D 2HQHA 2EVRA 1K8AC 2K5LA 3PNWC 1ZA1B 2QQBA 4RTVA 5KE3A 4J7FA 1VQLT 4LNPA 2IIMA 4EDUA 4E7LA 3DB4A 4JS5A 1K9AA 1VYVA 4DBHA 4ZN3A 3G71Q 4V2SA 1ZLMA 4ORZA 3M0UA 2E12A 1B3QA 1QP3A 2O4XB 1NLPC 1EIFA 1ZUUA 3TQ7P 2AKKA 1M2VB 4PJJA 1O75A 2COWA 3OYKA 1VQPT 3MHXA 1VQNA 5CK9A 3CCMQ 1YHQA 2DEUA 4ELYC 1OULA 3U23A 1T0JA 3I9QA 3SEMA 4C8QC 5GANe 4LD9K 1AWWA 4C8QD 4X9CA 2EYWA 1AWOA 1K8AR 3PVQA 2YLBA 1M4ZA 2EJGA 2F2VA 2LQWA 3X25B 1YN8A 2EGEA 3VS6A 1Y96B 3R6NA 1ZHIA 4OGCA 2PTKA 3EG9A 2AKLA 5IH2A 2BE9B 5J39A 3CPWA 1M3CA 1U3OA 4PJOA 3OB9A 1OV3A 1QCNA 3META 2F5TX 4XU0A 5AT1B 2K2MA 2RJEA 1Y7XA 1UJ0A 1CKBA 1WJQA 5KYWA 1G3WA 1G3YA 3M0TA 5I2SA 3KXTA 1RAHB 4N4IA 1VQ9A 3QHSA 5LL6S 4OF1A 4L5GA 1W2BA 3CC7Q 3M0PA 2JS0A 4XU3A 5CKEA 2JTFA 3CMAQ 3CBMA 2V1RA 1MMGA 3CCEQ 4PJOG 2E1HA 1VQ5A 2DZ9A 4RKUE 1M8MA 1YCYA 2BUDA 3CC4A 1E6GA 2EWNA 3CCJQ 2LNHB 1AWJA 3SHWA 3MP1A 4HCCA 3UT1A 1KIKA 3EFRA 3NMZC 4FL6A 5FLXE 1WJSA 3S3OA 3A8OB 1YJNT 3EAEA 1UEBA 4F17A 1QWEA 2ECZA 3HRSA 2MCNA 4M77A 3CCRQ 3QG1A 1NLOC 4N4HA 2HEQA 4JS4A 4M7DC 1BIBA 3M4YA 4IUPA 4EIKA 3QYHB 1XQHA 5KYUA 1QCFA 3GNGA 2AK5A 1KQSP 1Q81U 2ROLA 2LTOA 1U1TA 4IUUA 5KCOA 3CXCS 1RAEB 2A37A 2DRKA 4OMLA 5FU6C 2XI9A 2FL7A 2VB6A 1JJ2P 2HCKA 4J9BA 2RJFA 3CC2T 4FYWB 1RLQC 5C0MA 4M77G 3JCMg 3OY9A 4KBMB 1T3LA 4BDYA 2CZ1B 2LCSA 1GRIA 1N9RA 4KULA 1VQKT 5FW9A 3JCMP 1NEBA 3QWXX 3KBGA 3LH5A 1X2QA 3AHUA 3CCUA 2EJFA 4PFZA 1SSFA 1QVPA 3OMGA 2CSQA 1S72T 3M0RA 3G4ST 4PNOA 1RAGB 2A7YA 1QKXA 2KXDA 3CD6T 3CCLT 4C0FA 1JU5C 3S3NA 5FU7C 2F69A 2CP0A 1M1KU 1TUDA 1NE8A 4NL3A 1YFNA 2D0NA 2PVDB 3HL8A 4JRKA 3VYGA 1U06A 3QPHA 1QVGA 3M0SA 2EYQA 1TUCA
chains in the Genus database with same CATH topology
2OTLQ 3G6EQ 1VQ9Q 1YITQ 1YI2Q 3CC4Q 1JJ2P 3CXCP 3CCJQ 1Q86R 1K73R 1VQNQ 1M90R 3CC7Q 1VQLQ 3CMEQ 3CCMQ 3G71Q 1N8RR 1Q7YR 2OTJQ 2QEXQ 1YHQQ 1S72Q 1NJIR 1YJWQ 3G4SQ 1VQPQ 3I56Q 3CCQQ 1QVGP 1VQ7Q 3CC2Q 1VQ8Q 1VQ4Q 1QVFP 3CMAQ 3CD6Q 3CCLQ 1KQSP 1VQMQ 1KD1R 1VQ6Q 1K8AR 1M1KR 1Q82R 3CCVQ 3CCSQ 3CCEQ 1W2BP 1YJNQ 1Q81R 1KC8R 1YIJQ 3CCRQ 3CCUQ 1YJ9Q 1VQ5Q 3I55Q 1VQKQ 3OW2P 1K9MR 2QA4Q 3CPWP 1VQOQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL Q;  3G6E Q;  1VQ9 Q;  1YIT Q;  1YI2 Q;  3CC4 Q;  1JJ2 P;  3CXC P;  3CCJ Q;  1Q86 R;  1K73 R;  1VQN Q;  1M90 R;  3CC7 Q;  1VQL Q;  3CME Q;  3CCM Q;  3G71 Q;  1N8R R;  1Q7Y R;  2OTJ Q;  2QEX Q;  1YHQ Q;  1S72 Q;  1NJI R;  1YJW Q;  3G4S Q;  1VQP Q;  3I56 Q;  3CCQ Q;  1QVG P;  1VQ7 Q;  3CC2 Q;  1VQ8 Q;  1VQ4 Q;  1QVF P;  3CMA Q;  3CD6 Q;  3CCL Q;  1KQS P;  1VQM Q;  1KD1 R;  1VQ6 Q;  1K8A R;  1M1K R;  1Q82 R;  3CCV Q;  3CCS Q;  3CCE Q;  1W2B P;  1YJN Q;  1Q81 R;  1KC8 R;  1YIJ Q;  3CCR Q;  3CCU Q;  1YJ9 Q;  1VQ5 Q;  3I55 Q;  1VQK Q;  3OW2 P;  1K9M R;  2QA4 Q;  3CPW P;  1VQO Q; 
#chains in the Genus database with same CATH topology
 2XMF A;  5I21 A;  2ENM A;  3WVD B;  2A3L A;  1VQL Q;  2M16 A;  3L2Z A;  1PD1 A;  2D8J A;  1TXQ A;  1RAA B;  1TSF A;  4M7A F;  3VS0 A;  4UC4 A;  2DTH A;  4M78 A;  4ELZ C;  4CC7 A;  4FT4 A;  2AHJ B;  1W70 A;  3EG9 B;  1VQO A;  4BAC A;  2YRC A;  5CR2 A;  4XTX A;  1NJI U;  1VQ8 T;  4AT1 B;  3OS1 A;  4DA4 A;  1ZBX A;  3A8L B;  1VQP Q;  5KYW B;  2LT1 A;  2P0K A;  4OMF B;  5IN1 A;  1SRM A;  3OYL A;  1VQ4 A;  2RJC A;  2XIC A;  2EQM A;  4RG8 A;  4N0A A;  2FPF A;  3FJP A;  1GCQ A;  2YWW A;  2NUT B;  1D1A A;  1UB4 A;  2VKN A;  5A2Q E;  5GAM f;  2L89 A;  5A0G A;  2OAU A;  1ZSZ B;  3V8J A;  4M78 G;  3OSS C;  3EFO A;  3X28 B;  3EG1 A;  5AYF A;  3JB9 F;  2YRD A;  3OBW A;  2RQU A;  1PNJ A;  3LH0 A;  4IUV A;  4LDW A;  3BW1 A;  1JBM A;  1K8A U;  2HDA A;  4ZN1 A;  2SRC A;  2VXE A;  2OTL T;  2SEM A;  3L42 A;  3PIO A;  5CKD A;  2QGG A;  4E6R A;  4WTO B;  1BI1 A;  3CME A;  3RKY A;  3VU3 C;  4JJN K;  1KQ1 A;  2AT1 B;  1MUZ A;  2O31 A;  2P4R A;  3QJ6 A;  1VQ6 T;  1ZBJ A;  2D1X A;  1VQ7 A;  2HZY A;  5LJ5 e;  1NYF A;  1H3Z A;  1JQQ A;  4M77 B;  4GBQ A;  2QI2 A;  1KJW A;  3EHR A;  4D8K A;  1RUW A;  2K4Y A;  1LPL A;  1YBY A;  4RTX A;  1YJ9 A;  3JB9 J;  2FPD A;  2DL4 A;  3IQL A;  5LJ3 j;  2MAM A;  2YHT A;  4PK4 A;  3JCM V;  2KGT A;  5KYU B;  2LDM A;  5GAN 8;  3OYG A;  4FYV B;  3I56 T;  4JLI A;  4ME7 A;  5CQY A;  2CP2 A;  3GNF B;  1BU1 A;  1OI1 A;  1I81 A;  1WGS A;  2EPD A;  3HP9 A;  4C8Q F;  3X20 B;  2K57 A;  2CZ0 B;  4J9H A;  1TS9 A;  2AZS A;  3CCU T;  3MKD A;  1PKS A;  2J06 A;  2MYS A;  4OMP A;  5I22 A;  1B7T A;  5M9O A;  1YJN Q;  3I55 A;  3D7S B;  1WXU A;  4HVW A;  4Y28 E;  1H8K A;  4PJO C;  2NYS A;  2HL5 C;  3THK A;  1YIT A;  3MO8 A;  1YI2 A;  4PJO D;  1TWB A;  4M75 A;  2V1Q A;  4EMG A;  4GY5 A;  1SHF A;  4PL6 A;  2DET A;  2HAX A;  3OQ5 A;  2HD0 A;  1PSF A;  1XJW B;  2C06 A;  3TVT A;  1ABQ A;  1R0B G;  1OPK A;  5IHI A;  2K3Y A;  1M27 C;  3CCS A;  2BZY A;  2ATC B;  2RI2 A;  2LC4 A;  1JJ2 S;  3VS1 A;  1X6G A;  4NL2 A;  1XTD A;  4FW1 A;  3M55 A;  4LDU A;  3JCM Q;  3L1A A;  4NS5 A;  1N6A A;  2KYM A;  2O9S A;  2CDT A;  2QQA A;  5FRN A;  3CC2 Q;  1UE9 A;  3E2U A;  4M75 G;  2LCL A;  3L2V A;  3RDV A;  1VQK Q;  2QQ9 A;  1LCK A;  3UA7 A;  2MPX C;  2ED0 A;  4XQ3 A;  1JXO A;  3SDZ A;  1BBZ A;  4M78 B;  4RTZ A;  1S72 Q;  5GAO l;  4M77 C;  3G4S Q;  3CCQ A;  4M77 D;  1LJO A;  2D0Q B;  4ZTJ A;  3CD6 Q;  3CCL Q;  1KD1 C;  4OVA A;  4BUG A;  3E9F A;  2COY A;  1Q81 C;  3QYG B;  5FWC A;  2DK3 A;  2OTJ T;  2K6D A;  1OEB A;  1VQM T;  5DLO A;  4M4Z A;  2O9V A;  2M9U A;  5CCA A;  4JRP A;  3SWN A;  4L59 A;  1YIJ A;  2W0Z A;  3EFO B;  4F16 A;  4XAX B;  4DOV A;  2XK0 A;  1U1S A;  3EG2 A;  4JPB W;  3FC3 A;  1RAD B;  2MK5 A;  2EQK A;  2CZ7 B;  2CRE A;  5GAN g;  1ZUK A;  4XK8 E;  5A0L A;  4F7U A;  1VQ8 Q;  3MPU B;  1QVF P;  2XD0 A;  1PM3 A;  2RPN A;  4RTU A;  1KD1 R;  1M1K C;  4Y92 A;  3CBP A;  1Q81 R;  4HVV A;  4BE1 A;  1PRM C;  3JB9 I;  1MMA A;  5LJ3 e;  1AT1 B;  2ZPF B;  3HSB A;  2ESW A;  1UGQ B;  2AIR B;  3JV3 A;  1YJW A;  5GJW B;  1GBQ A;  2LNV A;  4AFZ C;  1NEG A;  2WSF E;  1WHL A;  4C92 A;  3CCV A;  4C8Q B;  3A8G B;  3A8H B;  4DQ2 A;  4GLM A;  2HBW A;  1C6V X;  5J26 A;  4F7U G;  3VV0 A;  1M90 U;  3RR6 A;  2QK0 A;  2OTL Q;  3CXC P;  4M78 C;  4MDX A;  4C5H A;  4M78 D;  3CBO A;  2X4X A;  2KAF A;  5KYN A;  1NJI C;  3H41 A;  3MEA A;  2IG0 A;  1VQ6 Q;  1QKW A;  1M1K R;  2YXY A;  3OYY A;  2BTT A;  2PVO B;  2QDY B;  4OMO A;  4FT2 A;  2DXU A;  1HK9 A;  3C4S A;  4OMN A;  1Q86 U;  4FCY A;  2VYT A;  3F70 A;  4C92 G;  4N0A C;  1X6O A;  4BY6 B;  2EKH A;  3DLL A;  2D6F A;  1VA7 A;  2L3R A;  3PFS A;  3UA6 A;  1OPL A;  1RLP C;  3I56 Q;  2DLP A;  1IB8 A;  1OOT A;  4JJB A;  1OZ3 A;  3JCM c;  3CCU Q;  1KQS A;  1WXB A;  1KHI A;  1WHK A;  3LYI A;  2RQW A;  2DL3 A;  2XHC A;  1LNX A;  2JVV A;  4A4H A;  1QP2 A;  4OMM A;  1ZX6 A;  2QEX A;  6AT1 B;  1B07 A;  1NJI R;  3TU4 K;  4A63 B;  2P0Q A;  1PWT A;  3RNJ A;  1P92 A;  5KYX B;  3PIP A;  2DTI A;  1IZ6 A;  4PJL A;  3LX7 A;  2RI5 A;  3X24 B;  1D3B A;  3H6Z A;  5GAN d;  4KT0 E;  4VUB A;  2YSQ A;  1RAC B;  4M7D B;  1OX8 A;  1HXD A;  5GAN 4;  4L6V 5;  3OS0 A;  1NZ9 A;  1RI0 A;  2HSE B;  2OI3 A;  2L3S A;  3NTK A;  3C0C A;  2FZG B;  4XTZ A;  3BFM A;  2R5A A;  3PTA A;  2DZC A;  4B9X A;  2LJ1 A;  1KSW A;  3S3M A;  4QQG A;  2CP6 A;  4OGE A;  1YP5 A;  4M7A E;  1UGP B;  3JCM J;  1VQO Q;  3BY7 A;  4LDY A;  5FRO A;  5FU6 B;  3VKI A;  4EPC A;  3SD4 A;  4J83 A;  3ZEH A;  4KGX B;  2E70 A;  4A4F A;  2DEQ A;  2RQV A;  4RUG A;  1D09 B;  2KEA A;  4A4E A;  5CQX A;  4X9D A;  4M75 C;  4PJO F;  2X35 A;  2FZC B;  2EQI A;  4WF2 A;  3G6E A;  2DTO A;  4BY6 C;  5HCK A;  1D0Y A;  4JUV A;  1HSQ A;  2PVG B;  4IIO A;  1UGV A;  5LJ3 f;  2OTJ Q;  1OQK A;  3Q1J A;  2EJ9 A;  3V8K A;  1VQM Q;  3M5A A;  3OS5 A;  5FU7 B;  3MP6 A;  3M58 A;  5GAM e;  4JDS A;  5CAI A;  2CGH A;  4ESR A;  1FYN A;  1RAB B;  2DL8 A;  1G2B A;  4HCZ A;  3ZBD A;  3QWY A;  3A98 A;  4FSX A;  2ZCF B;  5D6X A;  1QVF S;  1M5Q 1;  1TU0 B;  2CH4 W;  3HRU A;  4XTV A;  2RNA A;  1FMV A;  5EC7 A;  3UAT A;  4KH1 B;  2COZ A;  3REA B;  4QQ6 A;  3BDL A;  1SHG A;  4Z88 A;  3JCM h;  2AZV A;  1NM7 A;  1FXX A;  5GMK l;  2HMA A;  4YTL A;  3OYI A;  2P0P A;  1Z9Q A;  2FEI A;  2JT4 A;  2MF2 A;  2RJD A;  4CI0 C;  1UFF A;  1A0N B;  4M7D D;  4M77 F;  3VUZ A;  1K1Z A;  4E7K A;  2CUB A;  1IHV A;  3M57 A;  1KD1 U;  4ZNX A;  2E10 A;  4DOW A;  4OB2 B;  4C8Q E;  1K9M U;  2B8A A;  3VUB A;  2QA4 A;  3QKJ A;  5GMK h;  1AVZ C;  2DD5 A;  1EZZ B;  2QXF A;  2XDP A;  4LDV A;  3LGL A;  1MMN A;  2K5F A;  3SWN C;  5LJ5 g;  3TRE A;  2DKG A;  3DB3 A;  2C0O A;  2RK1 A;  3OMC A;  3EGU A;  3OW2 S;  3MEU A;  3CCS Q;  4D6W A;  3EH2 A;  3V7C A;  2DNU A;  1VQN T;  1Y57 A;  2LMJ A;  4AG1 C;  1TH7 A;  1UDL A;  3BE3 A;  2CH4 A;  2KI7 A;  1YHQ T;  5L23 A;  1X69 A;  7AT1 B;  4IUT A;  2VGM A;  4EMH A;  1K0X A;  3REB B;  4PFP A;  5L8R E;  2KVQ G;  2FHD A;  2RD1 A;  1IHW A;  1NG2 A;  2GTO A;  2ROT A;  8AT1 B;  3AT1 B;  2GF7 A;  2DJZ A;  3V7R A;  1GBR A;  2RH2 A;  1MV3 A;  3V8L A;  5GMK j;  4BE2 A;  1D3B B;  3URG A;  2FO0 A;  3OSV A;  2JJ9 A;  3A8M B;  3EGX A;  4BD3 A;  1JXM A;  1BIA A;  4C92 C;  3G71 A;  1M90 C;  1AZG B;  2E4H A;  4C92 D;  1Q7Y C;  2VGN A;  4JJD A;  5DLQ E;  3JCM b;  3EG0 A;  2LCC A;  4JRI A;  4JLG A;  3OYH A;  1C1A A;  2WSC E;  3P8B B;  4KRT A;  4FW2 A;  5FWB A;  2DA9 A;  1RI9 A;  4J9C A;  3M59 A;  3OYB A;  1X75 C;  2QTX A;  1VQ9 T;  4MZT A;  4OB3 B;  1WNL A;  4Z89 A;  4M78 F;  1Q86 C;  2DRM A;  3CCM A;  4PJO B;  2RHU A;  4O6J A;  3M54 A;  4M7D E;  5CKH A;  3QUI A;  3EGD A;  2V8I A;  2HQE A;  2HSP A;  3TSW A;  4CC3 A;  4QT7 A;  2KRS A;  1VQ5 T;  4RCC A;  3CC4 T;  2GNC A;  2Y90 A;  2O01 E;  2ABL A;  2DBK A;  2HBP A;  1RL2 A;  1VOM A;  2KK4 A;  1N8R U;  4KUD K;  3ULR B;  1M30 A;  3FJ5 A;  5GAN 6;  1M90 R;  4HCK A;  3OYJ A;  2RHZ A;  1FX7 A;  2J6K A;  1J3T A;  1UGR B;  1TUG B;  4M7A G;  1MHN A;  4EMK C;  2VUB A;  1WQW A;  1I5O B;  2KRN A;  2K5I A;  3GF5 A;  3DKM A;  5HY6 A;  5FRM A;  2HNI A;  1Y0M A;  4ZTF A;  3CEY A;  2DPP B;  5CVI A;  5LJ5 d;  4K11 A;  4J9I A;  3CC7 A;  4CC4 B;  1Q86 R;  3QJY A;  1ABO A;  4C5G A;  1AEY A;  1KK7 A;  2RO0 A;  4LUD A;  5KH6 A;  3HFO A;  1IRX A;  1WJR A;  2J6F A;  4LUE A;  2DVE A;  3CMA A;  1KG1 A;  1UG1 A;  3OBY A;  5GAO n;  3CCE A;  2RN8 A;  3EHQ A;  2GTJ A;  2OJ2 A;  5GAN 5;  1SKU B;  2BKD N;  1NPP A;  3I5R A;  3CCJ A;  4D8D A;  4R55 A;  5CO7 A;  1E7O A;  3GLX A;  3HPW A;  2JMC A;  2JW4 A;  1ZSG A;  3JB9 G;  3HHT B;  4ZGD B;  2RB6 A;  1NYG A;  3J80 E;  2GCX A;  5CIU A;  4KGV B;  4C0Z A;  2M0Y A;  2JTE A;  3NHN A;  3CCR A;  5J3B A;  5LJ3 g;  3JSC A;  2VAS A;  2FB7 A;  4LXC A;  3VRZ A;  1K0S A;  1SRL A;  3ZFJ A;  1TG0 A;  2CKK A;  1EX4 A;  5DM7 R;  1GFC A;  4PFO A;  2M0O A;  2HKN A;  4OB1 B;  5IHN A;  4XTY A;  2FVU A;  4C0D C;  2KMT A;  4TVR A;  2XKO C;  1XOV A;  2EW3 A;  2K7A A;  2J6O A;  1TOV A;  2B86 A;  2M02 A;  1M2O A;  3MEW A;  1VYU A;  1E6H A;  3J7A F;  2DFU A;  1FWZ A;  1BYM A;  3M53 A;  2EQJ A;  2QDL A;  4JZ3 A;  4BI3 A;  4RTY A;  1VQO T;  2FYK A;  4BE0 A;  4JJC A;  3T9N A;  2BE7 D;  3WXM B;  5GAO q;  1UUE A;  1I0C A;  1KHC A;  1FMK A;  1XNI A;  1VQN Q;  3EFS A;  2V26 A;  2QYZ A;  4RTW A;  1VQ4 T;  3FRN A;  2KT1 A;  1YHQ Q;  4N4G A;  2IVW A;  2BIV A;  3GPL A;  2DXC A;  2KYB A;  1OU8 A;  5GAN h;  2R5M A;  3I35 A;  1QWF A;  2P84 A;  1K9M C;  2MI6 A;  4BDZ A;  1EFN A;  2X3X D;  4M7D F;  4J9D A;  4BI4 A;  1MMD A;  1VQL A;  4X34 A;  3JB9 H;  1RAF B;  3VS2 A;  2X4W A;  5GMK i;  2QTV A;  1Q82 U;  4Y91 A;  3CPW S;  3FLG A;  2KRO A;  4XU2 A;  2DJQ A;  2JXB A;  2Y4X A;  2CZ6 B;  2YUO A;  3CME T;  2ZPE B;  2YLC A;  4HT9 A;  1PSE A;  1VQ9 Q;  1OYX A;  3UPU A;  1VQ7 T;  4PJO E;  1Y96 A;  3FIF A;  4E47 A;  2F5K A;  2YDL A;  1VQP A;  5GAN j;  1W2B S;  5LJ3 d;  2F2W A;  4X1V A;  1YJ9 T;  2A28 A;  2F2X A;  3SFM A;  3HFN A;  2LX7 A;  4LD6 A;  2DXT A;  4F7U F;  2DAQ A;  1K9M R;  1VQ5 Q;  4JRQ A;  3CC4 Q;  3MP8 A;  2EKO A;  3L2Q A;  3UWN A;  2R57 A;  1BI0 A;  4MML A;  3G7Z A;  3PVL A;  3C12 A;  4IUR A;  2RI3 A;  1ZA2 B;  3V7S A;  3N5B B;  1UHF A;  2L2P A;  3I55 T;  4RG2 A;  2GQV A;  1I07 A;  3JCM f;  1W4S A;  2LQ8 A;  2EYY A;  1YIT T;  1YI2 T;  3CPF A;  5KYY A;  1PRL C;  2CT3 A;  1ZQ1 A;  3LLR A;  1IGQ A;  4C92 F;  1BCO A;  1S1N A;  1Q7Y U;  2YUQ A;  3S6W A;  3JCM W;  2J05 A;  3CCS T;  1MV0 B;  2MMP A;  5GAM g;  4M7A C;  3NTH A;  3M9Q A;  4M77 E;  2X4J A;  1D1C A;  1QQJ A;  1RAI B;  2E65 A;  3HRT A;  4M75 B;  3P8H A;  3OW2 P;  2DIG A;  3RIR A;  1VYT A;  3C94 A;  3MJX A;  1X2K A;  2ZPB B;  2DIQ A;  4E7J A;  2PU9 B;  1M9S A;  1G3S A;  1JB0 E;  1N8R C;  3H0I A;  1M1F A;  2E5Q A;  2E64 A;  2DYI A;  1H92 A;  2DL7 A;  5I2M A;  1WX6 A;  1GL5 A;  1KC8 U;  2DIL A;  1YJN A;  2ZGW A;  1PCX A;  1PC0 A;  1HD3 A;  2M51 A;  2MIO A;  4QW2 A;  5IT9 E;  1CKA A;  2I0N A;  4EMK A;  3CCQ T;  2EIF A;  5CKF A;  3JCM X;  2QQS A;  1GXI E;  3E19 A;  3JRZ A;  1N27 A;  1JJ2 A;  2DO3 A;  4HA8 A;  4RMO A;  2VWF A;  2CP5 A;  1D0X A;  1I5L A;  2LQN A;  2JMA A;  1QVG S;  2BZX A;  4C5E A;  1UHC A;  1Q95 G;  3H8Z A;  1N8R R;  2VVK A;  4FYX B;  3CC2 A;  2C0T A;  1YIJ T;  2ZAE A;  3CQT A;  2DXB A;  2YT6 A;  4QVD A;  4LN2 A;  4A53 A;  4JZ4 A;  1VQK A;  3NGP A;  1YWO A;  2NWM A;  4IKF A;  4DBF A;  2EGA A;  2DD4 A;  3RES A;  3BDU A;  1VUB A;  1IGU A;  2X51 A;  1R77 A;  4Z8A A;  1S72 A;  3G4S A;  4IIM A;  4E7Z A;  1MNE A;  2DMO A;  3SWN B;  4M78 E;  2RMO A;  5I11 A;  3EH1 A;  3CD6 A;  3CCL A;  1VQ4 Q;  2FRY A;  2HQX A;  4E2F B;  2HL3 A;  1PKT A;  4AFQ C;  1IXD A;  4M75 D;  3VJP A;  5ECA A;  1KQ2 A;  3UF4 A;  4J9E A;  3PT9 A;  1K73 U;  3QXE B;  5IXF A;  1YJW T;  2XDD A;  1PD0 A;  2CS7 A;  2GFU A;  4OB0 B;  4F7U B;  5GAM d;  4R0K A;  3QBY A;  3CCV T;  3L2R A;  4QKU A;  3NPF A;  3ER0 A;  5C6S A;  3OYF A;  2DER A;  2IPO B;  4OP0 A;  5IXB A;  1UEC A;  4MMK A;  1QLY A;  2L3Q A;  2KE9 A;  2XID A;  4FYY B;  2NUT A;  3HKS A;  3CME Q;  1ACM B;  2EYZ A;  4AFU C;  4C0G A;  4DBR A;  2ED1 A;  2JOY A;  4C92 B;  1ZSZ A;  3RUX A;  4QQD A;  1VQ8 A;  2FPE A;  3L2U A;  1WDX A;  3GOX A;  1VQ7 Q;  1HJD A;  5KYY B;  1V1C A;  2K9G A;  1B34 A;  5LJ5 h;  2E3I A;  2DBM A;  1YJ9 Q;  3PMI A;  2YRV A;  2MOX A;  4NOY A;  3C95 A;  1M3B A;  3RBB B;  1IRE B;  1UJY A;  1IO6 A;  1Y71 A;  4GLK A;  2QAS A;  5KCH A;  4II1 A;  3LGF A;  2K79 A;  1C0M A;  2JM9 A;  3VS5 A;  1Q82 C;  1O9S A;  1ZUY A;  2L3P A;  4MZM A;  3I55 Q;  2OTL A;  1JO8 A;  4HVU A;  3INZ A;  1M3A A;  2QEX T;  1WIE A;  1YIT Q;  1WI7 A;  1YI2 Q;  4F14 A;  4MDW A;  3OYA A;  1BCM A;  2M1H A;  2ZPH B;  5GAN 7;  2CYZ B;  2W10 A;  2EAY A;  3GP8 A;  5LJ5 j;  1SF9 A;  4BB7 A;  2D8H A;  4AFS C;  1VQ6 A;  2O2O A;  1CSK A;  4J6X A;  3JAM E;  2EGC A;  3O8V A;  4CC2 A;  4EMK B;  3OS2 A;  2XG8 D;  1W1F A;  3TSZ A;  2JN0 A;  2PZ1 A;  4XTW A;  3QII A;  2G3R A;  4M75 E;  4J7I A;  1U8R A;  4KH0 B;  2PNI A;  1UGS B;  1I8F A;  2RHI A;  2XU8 A;  5KE2 A;  4XTU A;  4FIB A;  3I56 A;  3LWI A;  2QG9 B;  2LZ6 B;  1QMC A;  3O5Z A;  4B6M A;  2PUK B;  4DEY A;  1Q82 R;  1Z9Z A;  2Z0W A;  1V29 B;  2DE0 X;  1G83 A;  2CP3 A;  3M0Q A;  2L5Q A;  1X43 A;  2LVM A;  2KNB B;  2KQW A;  1X6B A;  4O5V A;  5GAO p;  2EYX A;  2QGF B;  4RCB A;  3P8D A;  1AHJ B;  3CCQ Q;  1I4K 1;  3QSU A;  3PMT A;  2JZ2 A;  3KUF A;  3G6E T;  5GAN f;  2CUD A;  2V8K A;  4ATO A;  3CPW P;  2F1L A;  4M7A A;  2PUO B;  1V76 A;  1N5Z A;  4ZGE B;  1W6X A;  3OYM A;  1N9S A;  5GAO m;  1GCP A;  2JS2 A;  4J6W A;  4CRI A;  1OU9 A;  5DY9 A;  4C0D B;  1W2B P;  1KC8 C;  1YIJ Q;  4PKC C;  1QW1 A;  4KUI A;  1KFZ A;  3TCJ A;  2RHX A;  2RQT A;  2DL5 A;  1F1B B;  1AD5 A;  2RHY A;  1PHT A;  1Q7Y R;  3QDF A;  1WYX A;  4J8O A;  2EBP A;  1WXT A;  3OYD A;  3DLM A;  2VXF A;  1DJ7 B;  4FU6 A;  3LWH A;  1BB9 A;  3HTR A;  2E6N A;  2P4T A;  1SSH A;  4P5N A;  2EQU A;  5LJ3 h;  4J9G A;  3FB9 A;  2NUZ A;  2OTJ A;  2WSE E;  2X4Y A;  1B34 B;  1VIF A;  4F7U E;  1YJW Q;  1AOJ A;  2LP5 A;  3E9G A;  2RF0 A;  4MZP A;  2LJ3 A;  5D7U A;  3OYE A;  4A4G A;  1VQM A;  1ARK A;  4FM4 B;  2FG0 A;  4OMQ A;  2QA4 T;  3ASK A;  3FDR A;  4XU1 A;  3CCV Q;  3NTI A;  1JEG A;  1KC8 R;  1QVF A;  3JCM d;  4PJN A;  1HYO A;  5GJV B;  2O88 A;  1G5V A;  3QZ5 B;  1WA7 A;  2GQI A;  3KFV A;  2EFI A;  2KR3 A;  3MEV A;  2G6F X;  4C92 E;  3OA6 A;  4FSS A;  3JCM e;  2FRW A;  2LT4 A;  4IUQ A;  1SG5 A;  5HK3 A;  2NUP A;  4ZGJ B;  4C8Q A;  2K3B A;  2CSI A;  2PQW A;  4HKE A;  2YUN A;  4HXJ A;  1K73 C;  4E7S A;  2MWP A;  4RTT A;  3I5S A;  4E7I A;  3PE0 A;  1FMW A;  4PLL A;  5IHK A;  4J6Y A;  2ZZD A;  3M4G A;  8ATC B;  3CXC A;  4HCB A;  1BI2 A;  4M75 F;  3G1J A;  3QZ9 B;  3H0H A;  4R56 A;  3MCA B;  3VS3 A;  5IAY A;  5GMK e;  2DVJ A;  2GBQ A;  3WVE B;  3G71 T;  1GFD A;  1WHJ A;  2MWO A;  2KRM A;  4A4K A;  2DF6 A;  1BK2 A;  1WZO A;  1KQS S;  2ZPI B;  3OW2 A;  1BI3 A;  2QEX Q;  3GIB A;  2LRQ A;  4DEX A;  3VS4 A;  1M8V A;  4C8Q G;  1QCO A;  1QVG P;  3H9N A;  3EGX B;  2YUP A;  1ZSZ C;  1BKB A;  3LW5 E;  1WHG A;  3CCM T;  3A5Z B;  4PLI A;  1YCS B;  1WQ7 A;  3GBQ A;  1OX9 A;  1H3H A;  1K73 R;  2LJ0 A;  3RKW A;  1D0Z A;  3RKX A;  3VRY A;  3PGG A;  4Q5W A;  2DYB A;  1WFW A;  4J9F A;  1D1B A;  2VC8 A;  4M7A B;  2X3W D;  5GAN 2;  5KYX A;  3A1P A;  2LQK A;  4Z02 A;  2RA2 A;  2GGR A;  2O4X A;  1T3S A;  3QO3 A;  3EGD B;  3QDR B;  1R0C B;  1M2V A;  4PJM A;  1PG5 B;  4BI8 B;  1K76 A;  2K3X A;  3NFC A;  2LX9 A;  3RMQ A;  4M7D A;  1VIE A;  4QVZ A;  1AWX A;  2H3J A;  1OZ2 A;  3VS7 A;  3CC7 T;  2K2V A;  3G6E Q;  2H3E B;  4LE9 A;  3J81 E;  4AG2 C;  3VYH B;  2RM4 A;  2OX7 A;  2HKQ B;  4B9W A;  4J5Y A;  2I2L A;  2D9T A;  3CMA T;  2KDS A;  1K4U S;  1YNZ A;  3CCE T;  1U5S A;  2KY9 A;  9ATC B;  3UDC A;  2L8D A;  1SEM A;  1X01 A;  1G3T A;  3L2W A;  4QVC A;  2ZPG B;  3SB2 A;  2A08 A;  3CCJ T;  1LVK A;  2J7I A;  2VV5 A;  5GAM h;  5GAO r;  2XDB A;  1I1J A;  4M7D G;  2X9H A;  2E5K A;  5A0D A;  3FEO A;  2JUF A;  2JM8 A;  1WPY A;  1T0H A;  4E7H A;  4ANJ A;  1WLP B;  1X27 A;  2E3H A;  3CCR T;  1NPR A;  3ME9 A;  1R8O B;  5LJ5 f;  1WHH A;  2FZK B;  1YWP A;  4AMC A;  2H8H A;  5GAN 3;  2OAW A;  2E6Z A;  2QQR A;  1AZE A;  5D6W A;  4DBQ A;  4F04 B;  2CT4 A;  2RK2 A;  2WAC A;  5CKB A;  2NUP B;  3M56 A;  4C5I A;  1H64 1;  5EG2 A;  3EG3 A;  4LDX A;  5GAM j;  2BZ8 A;  1M1G A;  2JTM A;  4M7A D;  2A36 A;  1MGQ A;  1JRI A;  2KBT A;  2KT8 A;  2QA4 Q;  5HKC A;  5GMK m;  2L0A A;  3OYC A;  2DM1 A;  2NLU A;  2R58 A;  3RMS A;  4KGZ B;  3ZL7 C;  1Y07 A;  3TEE A;  1UTI A;  2JNG A;  5D6Y A;  2A0F B;  2KXC A;  5HK0 A;  2C0I A;  1TTH B;  4HT8 A;  3H0F A;  3X26 B;  1WHM A;  3OYN A;  2DX1 A;  2KSS A;  2Y4Y A;  4WCI A;  3E1S A;  3RER A;  1NBE B;  2QAZ A;  1G8X A;  2V8J A;  1MND A;  4A54 A;  1LOJ A;  1GCQ C;  2GFA A;  2RQR A;  3R6O A;  2CP7 A;  1SPK A;  2E41 A;  3JB9 D;  2HQH A;  2EVR A;  1K8A C;  2K5L A;  3PNW C;  1ZA1 B;  2QQB A;  4RTV A;  5KE3 A;  4J7F A;  1VQL T;  4LNP A;  2IIM A;  4EDU A;  4E7L A;  3DB4 A;  4JS5 A;  1K9A A;  1VYV A;  4DBH A;  4ZN3 A;  3G71 Q;  4V2S A;  1ZLM A;  4ORZ A;  3M0U A;  2E12 A;  1B3Q A;  1QP3 A;  2O4X B;  1NLP C;  1EIF A;  1ZUU A;  3TQ7 P;  2AKK A;  1M2V B;  4PJJ A;  1O75 A;  2COW A;  3OYK A;  1VQP T;  3MHX A;  1VQN A;  5CK9 A;  3CCM Q;  1YHQ A;  2DEU A;  4ELY C;  1OUL A;  3U23 A;  1T0J A;  3I9Q A;  3SEM A;  4C8Q C;  5GAN e;  4LD9 K;  1AWW A;  4C8Q D;  4X9C A;  2EYW A;  1AWO A;  1K8A R;  3PVQ A;  2YLB A;  1M4Z A;  2EJG A;  2F2V A;  2LQW A;  3X25 B;  1YN8 A;  2EGE A;  3VS6 A;  1Y96 B;  3R6N A;  1ZHI A;  4OGC A;  2PTK A;  3EG9 A;  2AKL A;  5IH2 A;  2BE9 B;  5J39 A;  3CPW A;  1M3C A;  1U3O A;  4PJO A;  3OB9 A;  1OV3 A;  1QCN A;  3MET A;  2F5T X;  4XU0 A;  5AT1 B;  2K2M A;  2RJE A;  1Y7X A;  1UJ0 A;  1CKB A;  1WJQ A;  5KYW A;  1G3W A;  1G3Y A;  3M0T A;  5I2S A;  3KXT A;  1RAH B;  4N4I A;  1VQ9 A;  3QHS A;  5LL6 S;  4OF1 A;  4L5G A;  1W2B A;  3CC7 Q;  3M0P A;  2JS0 A;  4XU3 A;  5CKE A;  2JTF A;  3CMA Q;  3CBM A;  2V1R A;  1MMG A;  3CCE Q;  4PJO G;  2E1H A;  1VQ5 A;  2DZ9 A;  4RKU E;  1M8M A;  1YCY A;  2BUD A;  3CC4 A;  1E6G A;  2EWN A;  3CCJ Q;  2LNH B;  1AWJ A;  3SHW A;  3MP1 A;  4HCC A;  3UT1 A;  1KIK A;  3EFR A;  3NMZ C;  4FL6 A;  5FLX E;  1WJS A;  3S3O A;  3A8O B;  1YJN T;  3EAE A;  1UEB A;  4F17 A;  1QWE A;  2ECZ A;  3HRS A;  2MCN A;  4M77 A;  3CCR Q;  3QG1 A;  1NLO C;  4N4H A;  2HEQ A;  4JS4 A;  4M7D C;  1BIB A;  3M4Y A;  4IUP A;  4EIK A;  3QYH B;  1XQH A;  5KYU A;  1QCF A;  3GNG A;  2AK5 A;  1KQS P;  1Q81 U;  2ROL A;  2LTO A;  1U1T A;  4IUU A;  5KCO A;  3CXC S;  1RAE B;  2A37 A;  2DRK A;  4OML A;  5FU6 C;  2XI9 A;  2FL7 A;  2VB6 A;  1JJ2 P;  2HCK A;  4J9B A;  2RJF A;  3CC2 T;  4FYW B;  1RLQ C;  5C0M A;  4M77 G;  3JCM g;  3OY9 A;  4KBM B;  1T3L A;  4BDY A;  2CZ1 B;  2LCS A;  1GRI A;  1N9R A;  4KUL A;  1VQK T;  5FW9 A;  3JCM P;  1NEB A;  3QWX X;  3KBG A;  3LH5 A;  1X2Q A;  3AHU A;  3CCU A;  2EJF A;  4PFZ A;  1SSF A;  1QVP A;  3OMG A;  2CSQ A;  1S72 T;  3M0R A;  3G4S T;  4PNO A;  1RAG B;  2A7Y A;  1QKX A;  2KXD A;  3CD6 T;  3CCL T;  4C0F A;  1JU5 C;  3S3N A;  5FU7 C;  2F69 A;  2CP0 A;  1M1K U;  1TUD A;  1NE8 A;  4NL3 A;  1YFN A;  2D0N A;  2PVD B;  3HL8 A;  4JRK A;  3VYG A;  1U06 A;  3QPH A;  1QVG A;  3M0S A;  2EYQ A;  1TUC A; 
#chains in the Genus database with same CATH homology
 2OTL Q;  3G6E Q;  1VQ9 Q;  1YIT Q;  1YI2 Q;  3CC4 Q;  1JJ2 P;  3CXC P;  3CCJ Q;  1Q86 R;  1K73 R;  1VQN Q;  1M90 R;  3CC7 Q;  1VQL Q;  3CME Q;  3CCM Q;  3G71 Q;  1N8R R;  1Q7Y R;  2OTJ Q;  2QEX Q;  1YHQ Q;  1S72 Q;  1NJI R;  1YJW Q;  3G4S Q;  1VQP Q;  3I56 Q;  3CCQ Q;  1QVG P;  1VQ7 Q;  3CC2 Q;  1VQ8 Q;  1VQ4 Q;  1QVF P;  3CMA Q;  3CD6 Q;  3CCL Q;  1KQS P;  1VQM Q;  1KD1 R;  1VQ6 Q;  1K8A R;  1M1K R;  1Q82 R;  3CCV Q;  3CCS Q;  3CCE Q;  1W2B P;  1YJN Q;  1Q81 R;  1KC8 R;  1YIJ Q;  3CCR Q;  3CCU Q;  1YJ9 Q;  1VQ5 Q;  3I55 Q;  1VQK Q;  3OW2 P;  1K9M R;  2QA4 Q;  3CPW P;  1VQO Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...