1VQNQ

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqnQ00
1VQPQ 3CMAQ 1NJIR 1KQSP 2OTJQ 3CC2Q 3OW2P 1N8RR 3CD6Q 1Q81R 3I56Q 3CCRQ 1YJWQ 1VQOQ 3CCJQ 3G71Q 1Q82R 1JJ2P 3CCVQ 1YI2Q 1M90R 1YJ9Q 3CCLQ 1VQKQ 1VQ5Q 3CCMQ 1VQ9Q 2QEXQ 3CPWP 1M1KR 1VQNQ 1VQ8Q 3CMEQ 1K73R 3CC7Q 1S72Q 3I55Q 2QA4Q 1W2BP 1Q86R 1YITQ 1KD1R 1VQLQ 1VQMQ 3CCEQ 1KC8R 1YIJQ 1VQ6Q 3G6EQ 3CCQQ 1K8AR 3G4SQ 1K9MR 3CCUQ 3CCSQ 2OTLQ 1Q7YR 1QVFP 1QVGP 1YJNQ 1VQ7Q 1VQ4Q 3CXCP 3CC4Q 1YHQQ
chains in the Genus database with same CATH superfamily
3CD6T 3S3OA 3H9NA 3CEYA 2D8JA 3TSWA 2VGMA 2R57A 3CMAA 2I0NA 1IGUA 5GANe 3QKJA 2LZ6B 3JCMJ 2DRMA 2IIMA 3V7CA 1OX9A 3CC7T 3CBPA 4RCCA 1VQMQ 1VQ9A 5C0MA 2M51A 3OYNA 3M4GA 2P0QA 2DL8A 1VYUA 5CVIA 2E41A 5IT9E 2O4XA 1YJNA 4BDYA 4VUBA 3VKIA 3LWHA 2KGTA 2C0IA 1LCKA 4PJOD 1SKUB 2BTTA 2DA9A 3I55T 2QAZA 3C12A 4QW2A 3VS7A 2MAMA 3KUFA 3CCQT 3G6ET 3V8JA 2YXYA 2RI5A 1PSFA 4NOYA 4XTZA 4RUGA 2RM4A 3CMAT 3NHNA 3CCUA 3OW2P 2GF7A 2ZAEA 2ZPFB 4DQ2A 1VIEA 1VQ9T 1OOTA 4C0FA 3GP8A 2ZCFB 3NPFA 2EIFA 5KYUB 2E6ZA 3LH5A 1YJNT 1YCYA 3QBYA 3L2UA 3G4SA 1BI1A 1SSFA 3G71T 1QMCA 1XNIA 1VQKT 2F69A 2VKNA 4RTTA 4WF2A 4WTOB 1RAIB 2O31A 1G3TA 1R8OB 1NLPC 1AZGB 3EH2A 2KEAA 3CCUT 4M75D 2PQWA 2DTOA 2P84A 4FW2A 4QQ6A 4HXJA 5GANj 2P4TA 2EQIA 3H0FA 1M27C 2JS0A 2LQKA 4C8QE 2JTEA 4LNPA 4M7DB 1FWZA 2R58A 2DETA 1NE8A 3GNFB 3RNJA 2A36A 4XU1A 2HL5C 2E70A 2FZGB 2HZYA 4C8QG 4F7UB 2EJ9A 2P0PA 5ECAA 3DKMA 2GQIA 2L89A 4DBRA 1Y96A 3G4ST 1EZZB 1LJOA 4X1VA 1Q7YC 4E7JA 2D1XA 4ZTFA 4EIKA 1M2OA 4KUIA 4MZMA 2PVOB 4XK8E 3EFSA 2GFUA 3QDRB 4AG1C 4QVZA 3A8LB 1SHGA 1KQ1A 2QGFB 5L8RE 2C0OA 3A1PA 4XU3A 2PUKB 3R6NA 3EGXB 2J6OA 4IUTA 4A4KA 4HA8A 1K8AR 2HL3A 4M7AD 4M78E 4IIMA 4C5IA 2PU9B 3CCEA 1ZX6A 1TOVA 2DLPA 3LWIA 1D0YA 3LYIA 4RG8A 4M78G 2EBPA 4OB0B 2DK3A 4HVWA 3BDUA 1VQ5Q 4KULA 4JJBA 2CZ6B 4LDYA 4ZTJA 1SEMA 4JRQA 1BI3A 3VRYA 4Y91A 1H3ZA 2OTLQ 3I5SA 2XD0A 4F17A 2DD4A 1KK7A 3JB9G 3CC2T 2M9UA 1YJWT 1VQOQ 3THKA 2EYXA 2X4YA 1UEBA 4L5GA 5LJ3h 1V29B 4C92D 1UJ0A 1TSFA 4OVAA 1LOJA 3CCET 3QSUA 2CP5A 5CAIA 1N9RA 1K8AC 1VA7A 4M77D 1TH7A 3RR6A 5KYWA 3F70A 1N8RR 1I5OB 1ZHIA 3M0TA 2LRQA 2O4XB 1RUWA 3M0UA 4DA4A 1AD5A 2JZ2A 2AKLA 4D8DA 3VV0A 2DEQA 3CPWP 1V76A 4E2FB 1XQHA 1YBYA 3OYEA 1IRXA 2LX7A 4A4GA 2JNGA 3SWNA 2RPNA 4MZPA 1RAHB 5D7UA 2OTJQ 1NEBA 2RN8A 3VUBA 5GAN2 1RAAB 2R5AA 3I5RA 2MWOA 2VWFA 5IN1A 6AT1B 4M4ZA 2CUBA 2YRVA 1W70A 4IURA 3CCLA 5GAMg 2EGEA 2RK1A 2LX9A 2GFAA 3L2WA 1QVFA 2FPDA 3KXTA 1YWPA 5LJ3f 4GLMA 1GFCA 4GBQA 2EYQA 2O2OA 4OMQA 1N8RC 1QKWA 1WHHA 4E7KA 2W10A 1IB8A 3MEVA 5KCOA 5LJ5h 4PJLA 1D3BA 3MP8A 3S6WA 2MWPA 3UWNA 2LCSA 2XK0A 2YUQA 1Z9ZA 5J26A 4HT9A 2YT6A 1QVFS 1T0HA 4D6WA 1BYMA 1S1NA 5HCKA 3ER0A 4ORZA 1BBZA 1T3SA 3L2VA 2AK5A 1VQ7A 2CH4A 3OA6A 1KSWA 3JCMh 3EG1A 3I56A 3L42A 3CBOA 2X9HA 1R0BG 3P8BB 3PE0A 2LJ0A 3E2UA 2DIQA 1YITA 1AEYA 2KXDA 1AOJA 4F7UE 4M7DG 2HQXA 3X25B 2A37A 4V2SA 1OZ3A 4IKFA 4JRKA 1QW1A 1Q81R 1XOVA 2D0QB 3M0SA 3A8OB 2FRYA 4QT7A 4F7UG 2VUBA 3FC3A 1NYFA 2IVWA 3NTKA 4LDXA 1K4US 1B7TA 5I2MA 2V1QA 3H0IA 2EWNA 3H41A 1M3AA 3EHRA 5LJ5f 2LCLA 4YTLA 2QDYB 1VQ7T 2CZ7B 3RIRA 3TCJA 2CZ1B 1BU1A 1P92A 1WIEA 4AFSC 3I56T 2XMFA 2PTKA 4J9BA 1KJWA 2PNIA 4J5YA 4X9CA 8AT1B 2RJCA 4IUQA 4J9HA 2DNUA 2JM9A 1M2VB 3RKWA 2X35A 4JPBW 1TUGB 4A4EA 1M1GA 1YITT 2VASA 3M53A 2C0TA 4BUGA 2MK5A 5D6XA 4EMKA 2FL7A 3JCMf 1RAGB 2QDLA 3OSSC 1G3SA 1K8AU 2FPEA 2DTHA 5FWCA 5KE2A 1JB0E 4ZNXA 3EG3A 5GAN7 1Q81C 1QP2A 3V7SA 1H92A 4PJOA 2MYSA 1RADB 3CCLQ 3ZEHA 3M56A 4J7IA 3TEEA 1YJ9A 2QQRA 9ATCB 1IGQA 2QEXA 4FU6A 1YIJQ 5GAN6 5FU6C 3QUIA 1MNEA 1UGRB 4JRPA 2BIVA 3OW2A 3JSCA 5FU6B 1I4K1 4X34A 4P5NA 1YI2Q 1T3LA 3V8LA 1KD1R 1Q86R 2ZPHB 4DBHA 2KYBA 3QYHB 4A4HA 3SWNC 3CCSQ 3TU4K 1U06A 2EQUA 4ATOA 2HSPA 2JM8A 3OW2S 3SWNB 2F5TX 4J9GA 5J39A 4Z89A 2HQHA 1G3YA 3N5BB 3RKYA 4JS5A 1YJ9T 1N8RU 2E5KA 2FYKA 2QEXT 1PM3A 4ESRA 4M75A 3LW5E 4B6MA 5AYFA 3FJ5A 3MP6A 4FT4A 3JAME 4Y28E 4ZGDB 1AWJA 1HYOA 1PWTA 2LTOA 1VQMA 1VQ4Q 3QWXX 1XTDA 2EW3A 2XDPA 2KE9A 1GRIA 1X6GA 2DZ9A 2J06A 1RACB 4Z8AA 3TQ7P 2JW4A 1NEGA 1D3BB 3O5ZA 3M0RA 1KD1C 1D0ZA 1Q86C 1ZA2B 1I0CA 2RI3A 4E7ZA 3VU3C 2KMTA 1HK9A 2RHZA 1RI9A 4E7IA 2JOYA 2L0AA 1DJ7B 1QKXA 5GAN8 3CCRA 2RHUA 4C0ZA 4CC4B 3L2RA 2CSQA 5GMKm 1G5VA 3QWYA 4RKUE 3VYGA 3S3MA 2EVRA 3MCAB 1RABB 3HRUA 2JUFA 1MUZA 2K6DA 4F04B 3HFOA 1ZUUA 3M0PA 4M7AF 1Y0MA 3EG2A 1JO8A 4O6JA 3Q1JA 2K5IA 1X6BA 2E3HA 1N27A 4HCZA 2LCCA 2RQUA 2MMPA 2AT1B 2EKHA 3QXEB 2K2MA 3CCMQ 7AT1B 2GTOA 3C0CA 4N4GA 2KXCA 1H3HA 2DM1A 2LQ8A 4JJDA 3EGUA 2HQEA 3GLXA 1GL5A 2ROLA 2ED0A 2GGRA 1RLQC 2QQ9A 3RKXA 1F1BB 2PVGB 2O9VA 4QQDA 2B86A 3PIOA 4BY6B 5GAMe 1PKTA 2LDMA 1X01A 5GMKj 1GBQA 1WHJA 4C92F 2CP2A 3MO8A 1VQLQ 1GFDA 4PKCC 1SRLA 2DJQA 4A4FA 4R0KA 4LN2A 5CKHA 3DLLA 4F16A 4EMKB 5CKFA 4M77F 2RQRA 2YUPA 3FIFA 3X20B 2VXFA 1UB4A 1CKBA 2ZGWA 3JV3A 4PJOC 1SPKA 1UHCA 2DX1A 2IPOB 3CPWA 4PJOB 4M78D 1OPKA 2KRNA 3HRSA 2MI6A 2DVEA 2V1RA 2BZYA 2XDBA 1YWOA 2HDAA 4BE1A 2MIOA 2RA2A 2E5QA 4AFUC 2LT4A 1PD1A 1YNZA 4MMKA 3JB9D 2EGCA 4B9XA 5GAOr 4XU0A 5EG2A 1I07A 2V8JA 3CPWS 4ELZC 1VQ5A 2K7AA 1D09B 4L59A 2JTFA 4KGXB 1PRLC 2YWWA 1RI0A 4HT8A 4LDUA 2OTLA 1G3WA 4R55A 3J81E 3CCRQ 3BDLA 3EG0A 3OMGA 4C0GA 4FIBA 4JUVA 5EC7A 1BI0A 5LJ5g 1VQOA 4M75C 1JXOA 3KBGA 3PTAA 4HCKA 4M75B 3GNGA 2A28A 2KI7A 4O5VA 1TUDA 4E7SA 5FU7C 1KD1U 1Q86U 2F1LA 1Q7YR 5GAMj 3VS6A 1UFFA 1MHNA 5FU7B 5CQYA 2FRWA 1WDXA 3QJ6A 1VQ5T 5KYYA 3GF5A 3JCMg 2DZCA 3QO3A 4J6YA 2OAUA 1GCQC 2L3RA 3FJPA 5CO7A 3QHSA 3CMEA 1HSQA 2OTLT 2L3QA 2CP6A 5GMKi 2QQBA 2E12A 2EAYA 1KIKA 1X2KA 3CD6Q 1VQOT 2OTJA 4LE9A 2KBTA 1O75A 1K76A 2XG8D 5GAOl 4DEXA 4M7AC 1IHWA 2L5QA 1K0SA 1PNJA 2DIGA 2F5KA 3HHTB 2M0YA 4FW1A 2YRDA 1AWOA 3OYIA 4KGVB 1M4ZA 1B07A 1WLPB 2NUPA 5KYNA 1LVKA 1NZ9A 4AFQC 2XHCA 3FLGA 1Q95G 4ANJA 2YSQA 3JB9H 4KUDK 1IHVA 5IXFA 3G6EQ 3OYLA 5KCHA 4UC4A 1I5LA 1NLOC 2CGHA 3PFSA 4K11A 1PC0A 4OGEA 3SDZA 5KYXB 2OTJT 3OS0A 2RQTA 4C5HA 4M7DD 4C92C 1MV3A 1UUEA 2D9TA 2L3SA 2ED1A 2YUOA 3HKSA 2DFUA 1ZUYA 5GAMd 1IZ6A 1UE9A 3I35A 2K3YA 1M2VA 1U8RA 1FYNA 2RMOA 2LNHB 1VQ8Q 2CP3A 3VS1A 4M77C 2YLBA 2FPFA 1VQNA 2EYZA 2K3XA 2KRMA 2KAFA 2X3WD 1OI1A 4ZGJB 2DL5A 2L2PA 1QCFA 3KFVA 5CIUA 1YHQQ 1VQPQ 2J05A 1OV3A 4XQ3A 4NS5A 2EPDA 2XDDA 5GANd 1QP3A 2E4HA 4WCIA 4CRIA 2D6FA 3MHXA 1WZOA 2XKOC 2LQNA 2WSFE 1PKSA 1N6AA 2GNCA 3NFCA 3V8KA 4PJOE 3QJYA 3CC4Q 3M0QA 2COZA 3C4SA 1LNXA 2MCNA 4BI4A 5CKDA 1D1AA 5GAN4 4L6V5 4PJOG 3O8VA 4PLLA 3ZFJA 2DF6A 2FB7A 2RHXA 3OYKA 1Y07A 4JLIA 4RTWA 3CMEQ 1BCOA 1C6VX 1VQ6Q 1N9SA 2V8IA 1QWEA 3WVDB 2HMAA 2BUDA 5FROA 2ZPGB 1W1FA 3GIBA 2JVVA 4D8KA 4XTVA 1VYTA 2RQWA 2J6KA 1UJYA 2YLCA 1M8MA 3C94A 3T9NA 1WPYA 3E19A 2PVDB 4BI8B 4A53A 1D1CA 3DB3A 2DMOA 1YIJA 2ENMA 3MPUB 1NJIC 4OMMA 4RTZA 2QTVA 4M75E 2K4YA 1M90R 4XAXB 5LJ3e 3X24B 1W6XA 3OMCA 1WJQA 2K3BA 3OYCA 1YI2A 5KYYB 4PFOA 3JCMV 4M75G 1W2BP 2LJ1A 1QLYA 3OS5A 2FZCB 2JTMA 2X4WA 3NTIA 2BE9B 1H641 4BE0A 2E65A 3CC2Q 5L23A 2LP5A 3CCSA 4NL2A 2LMJA 1OQKA 1Q7YU 4PK4A 3SHWA 1WXTA 3CCLT 3U23A 1X27A 2XIDA 3OS1A 2JN0A 3OYBA 5KE3A 2LNVA 1VQNQ 3S3NA 4C8QF 3G1JA 4BD3A 2QA4Q 2X3XD 1YIJT 4IUPA 2FO0A 4LUEA 3SEMA 3X26B 1M30A 2DVJA 1VQ4A 2LVMA 3CCJQ 1M90C 2A3LA 1WI7A 2NUPB 2VC8A 3LLRA 3QDFA 1ZUKA 4HVVA 2E3IA 5FWBA 1WHLA 2DXCA 1H8KA 1J3TA 2R5MA 3EFRA 2KDSA 2GCXA 2RHIA 3QG1A 3MEWA 5GAOn 2DXUA 2RO0A 3A8MB 1S72A 3CCST 1K9MR 3M59A 3EGDA 2O88A 3RESA 1PD0A 2EJFA 3EFOB 5LJ5e 5FRMA 3HL8A 2J6FA 4A54A 4Z02A 1M5Q1 4OB1B 4M78F 2CH4W 4AT1B 8ATCB 4N4HA 2AKKA 3TREA 5CR2A 1VIFA 4OMOA 2LJ3A 4OB3B 2JS2A 2CDTA 5LJ3j 2H3JA 1VQ4T 1HXDA 4OMPA 1D1BA 2QGGA 4Y92A 3HP9A 1SHFA 3JB9F 1TWBA 3JCMe 3L2QA 2ESWA 3AHUA 3UA6A 5HKCA 3LGLA 3CCVA 1X43A 4BDZA 1PSEA 2WACA 4JS4A 3META 3R6OA 1TS9A 1K73R 1WYXA 3CCMA 2L8DA 2BKDN 4EMGA 3FDRA 3PT9A 4RMOA 1WHMA 2M02A 2RH2A 4FYYB 1K9MC 3REAB 2WSEE 5GMKh 2HD0A 1D0XA 3D7SB 3ULRB 2JMCA 5C6SA 1FMWA 1E6GA 1ABOA 1FMKA 2DO3A 4JRIA 4JZ3A 3PMIA 4AG2C 3RDVA 3ZL7C 4KBMB 3CXCA 2VYTA 2NUZA 3VS5A 3OBYA 3OYJA 1EIFA 1VQLA 4DEYA 4J9FA 2X4JA 4KH0B 4JDSA 3LGFA 1GBRA 3OYFA 4IUVA 2P0KA 3GBQA 3DLMA 3CCMT 2OJ2A 4Z88A 5FLXE 3OYMA 5D6WA 3NTHA 1TU0B 5CCAA 2ZPEB 1M1FA 1K73C 2KNBB 2HAXA 5DY9A 5LJ5j 1QQJA 5GAN3 2EJGA 1R77A 2DL7A 5FW9A 2RK2A 5GAOq 1YCSB 1IXDA 2DL4A 3QZ9B 3P8HA 1HD3A 2AZVA 1BCMA 4N0AC 2KT1A 2VB6A 1VQLT 3PMTA 1S72Q 3RMQA 1Z9QA 2K9GA 1U1TA 2VVKA 1GCQA 4J6WA 2CREA 2KT8A 3RBBB 1TG0A 2KVQG 1WJRA 1MMDA 2OI3A 5FRNA 1WQWA 1OEBA 1M90U 2KROA 3UA7A 4JLGA 2A08A 3SFMA 1VQMT 4M7AA 4IUUA 3A5ZB 2P4RA 3A8HB 4Q5WA 4M7DF 3HPWA 4IIOA 3CCVQ 1PG5B 1WJSA 5M9OA 4J6XA 3JCMW 4PFPA 3M58A 4F7UF 3FB9A 4FL6A 5GANh 1M1KR 4BI3A 2ZPIB 1A0NB 1VOMA 1VUBA 3A98A 2DBMA 4C8QD 2RD1A 1KC8R 2K5FA 4BB7A 5GAN5 5KYXA 3A8GB 4II1A 4QQGA 1WHGA 3EGDB 1OZ2A 3RMSA 3CCRT 5LJ5d 1SRMA 4PFZA 4C92A 3CD6A 1HJDA 2HCKA 1Q81U 3JCMc 4RCBA 3ZBDA 3URGA 1G8XA 3V7RA 5DLOA 1MNDA 3QPHA 5LJ3g 5IHIA 2DYIA 2VV5A 3CC7A 4M77A 1TXQA 3EG9A 5I22A 2K79A 4C5GA 2KY9A 1FX7A 1K9MU 1YN8A 2JJ9A 1ZSZC 3JCMd 2JMAA 2DXBA 3UT1A 1QWFA 3BW1A 4RTYA 2KK4A 2LC4A 1ZSZB 3LH0A 2YDLA 1M1KC 5HY6A 1JRIA 1KC8C 1U3OA 2EYWA 3CCQA 5GANf 2QQSA 3G6EA 1ARKA 5I11A 4LDWA 2ZZDA 1JJ2P 2DD5A 2DL3A 2Y4YA 4ZN3A 2QQAA 1LPLA 1NM7A 3QYGB 5J3BA 3CQTA 1M3CA 4OP0A 1MMAA 4JJCA 4NL3A 2I2LA 1VQ8A 1K73U 1PRMC 5GJWB 2E6NA 4FSXA 3JCMQ 4CC3A 3HTRA 5A0LA 1K1ZA 3PIPA 1Q82R 2FEIA 1E7OA 1KG1A 1YHQA 1VQPA 4KT0E 3HFNA 3BY7A 1NPPA 4XTWA 1TTHB 3G71A 2HSEB 3PNWC 4AFZC 1W2BA 1I81A 1VQKA 2NWMA 2CP7A 2OX7A 1WXBA 3UF4A 1JXMA 1C1AA 1BB9A 3MP1A 1UG1A 1WNLA 2LT1A 1QVGP 3CXCP 4FCYA 4J9EA 1I1JA 1UGVA 2A7YA 2RI2A 4TVRA 3CC4A 1AWXA 4N4IA 4PL6A 2K5LA 1VQ8T 1BKBA 1W2BS 1YFNA 1MMNA 4J9IA 1G83A 2CS7A 1YHQT 1VQPT 1VQ6A 2W0ZA 2ROTA 4ELYC 2RJFA 2O9SA 1AHJB 3SB2A 4HCBA 1Q82C 1GXIE 2KR3A 3ME9A 5HK3A 4E47A 1JQQA 3UDCA 4XU2A 4HKEA 2DKGA 1V1CA 2EGAA 3CC7Q 2DE0X 2CT3A 4M7DC 1K9AA 4PNOA 4M7AB 1KQSA 1B3QA 2LQWA 4OMNA 4RTXA 3GPLA 3CC4T 3H0HA 1UECA 5I2SA 1MMGA 1GCPA 2E10A 1K0XA 2GTJA 1OU8A 3MJXA 2CT4A 4QKUA 3JCMP 4HVUA 3G7ZA 4MDXA 4ME7A 3CMET 3I55Q 1VQ6T 2AIRB 1WGSA 4BACA 3CCQQ 5GJVB 1X2QA 1KQSS 2AHJB 2SRCA 1M9SA 3EFOA 3CMAQ 3EAEA 1ZBJA 2GBQA 2D8HA 3M57A 1UTIA 1PCXA 2CKKA 1X69A 3TVTA 2KSSA 1ZBXA 3CC2A 1YJWA 3E9GA 4MDWA 4C92B 1VQ9Q 5GAOm 3PGGA 4OGCA 4PJNA 1NG2A 3H6ZA 1M1KU 4CC2A 2K57A 2QA4A 4M77B 1YJNQ 3EG9B 2XU8A 1KC8U 4ZN1A 4KH1B 2RQVA 3JCMb 2ATCB 3J80E 3G71Q 2M1HA 4FYWB 4FYVB 2DYBA 2RJEA 4EDUA 5IHKA 5CQXA 1VQKQ 3CCJA 4A63B 2D0NA 2YUNA 2DERA 2Z0WA 4R56A 5IH2A 3QZ5B 4JZ4A 2BZXA 4C5EA 2Y4XA 2HBPA 2G6FX 2H8HA 2F2XA 3CCUQ 3WVEB 3M54A 1Y7XA 3OSVA 5HK0A 1NJIR 1KHIA 2YRCA 4EPCA 1IREB 1OPLA 2Y90A 1QCNA 2ECZA 1JU5C 2X4XA 1VQNT 3M9QA 2IG0A 2QA4T 4OF1A 3BE3A 5DLQE 3HRTA 4OMLA 3G4SQ 2VXEA 1IO6A 1RAFB 1E6HA 2F2VA 5A2QE 3OBWA 2NYSA 1NBEB 3CCJT 4E7LA 3VS2A 2DAQA 3M55A 1TUCA 2H3EB 1KFZA 1CSKA 2FG0A 3GOXA 1R0CB 1ZSGA 2WSCE 2NLUA 1ZA1B 2M0OA 5A0DA 1MGQA 2M16A 3VJPA 3ASKA 3NMZC 4FT2A 4F14A 1QCOA 3MKDA 3OYAA 4J9CA 1BI2A 4OB2B 4C0DC 1OX8A 3PVLA 3SD4A 4C0DB 1Q82U 3C95A 3OQ5A 5CKBA 1BIAA 3P8DA 4N0AA 2C06A 2FZKB 1BIBA 1EX4A 2HKQB 3INZA 2CSIA 4DOWA 2KYMA 1YJWQ 2PZ1A 1UDLA 3REBB 5D6YA 4EMHA 2BZ8A 2XICA 3MEAA 4C8QA 1SF9A 2DBKA 2BE7D 1B34A 1CKAA 2HNIA 5GANg 3CCEQ 3E1SA 4LD6A 1EFNA 3VS4A 5A0GA 4GY5A 3JRZA 1UHFA 2COWA 2A0FB 2FVUA 2RNAA 1AWWA 1WXUA 3RUXA 3VS0A 3OYDA 1YI2T 4M7AE 1ACMB 3M4YA 2DPPB 2RJDA 3CBMA 1RL2A 4CI0C 4M7DE 4OMFB 4FM4B 1U1SA 1XJWB 2CYZB 4MZTA 4M7AG 1I8FA 1Y96B 5CKEA 3UATA 3J7AF 1KQSP 4DBFA 1WX6A 4AMCA 2DXTA 4M78A 2CP0A 4RG2A 1BK2A 2X51A 2HKNA 4J7FA 5DM7R 2NUTA 1AT1B 3DB4A 2QG9B 2FHDA 2JXBA 1X6OA 1Y57A 5IXBA 5I21A 2HEQA 4C92E 2PUOB 3TSZA 2DTIA 1JJ2A 2MF2A 2GQVA 2QTXA 4ZGEB 4QVDA 5AT1B 2ZPBB 4C92G 1AVZC 1O9SA 1ZSZA 4M77E 5CK9A 1M3BA 1S72T 3IQLA 1OULA 1OYXA 1QVPA 4M77G 3L1AA 3OB9A 1YP5A 3PVQA 3CPFA 1JJ2S 4E7HA 3FEOA 3HSBA 3JCMX 4XTXA 4PJOF 2QXFA 2J7IA 4KGZB 4PLIA 2E64A 2CUDA 1UGSB 2EYYA 3EH1A 5IAYA 4LD9K 3WXMB 1JEGA 1QVGA 2EFIA 1NPRA 5LL6S 2EKOA 2HBWA 5KYWB 3CCVT 1NJIU 4X9DA 3EHQA 4J9DA 5IHNA 2DEUA 1Y71A 1UGPB 2DJZA 2F2WA 2V8KA 1SG5A 2E1HA 1U5SA 1QVGS 3CXCS 4HCCA 1VYVA 1VQ7Q 3VRZA 2AZSA 3OY9A 1G2BA 4E6RA 1UGQB 1KQ2A 2EQKA 2K2VA 3NGPA 3I56Q 2QI2A 3QIIA 5LJ3d 3E9FA 3BFMA 5GMKl 2KRSA 3OYYA 5KYUA 4DOVA 3LX7A 5GAOp 4JJNK 1YITQ 4PJMA 4M75F 5GMKe 2QASA 1WQ7A 2MOXA 1WHKA 3X28B 1NYGA 2ABLA 3OYGA 4RTVA 4LDVA 4MMLA 3RERA 1RLPC 2CZ0B 2XI9A 4C8QC 3JB9J 1FMVA 2SEMA 1T0JA 1WA7A 5GAMh 1AZEA 4C8QB 1C0MA 1KHCA 1B34B 5KH6A 2JT4A 2COYA 4LXCA 1QVFP 4M7DA 1W4SA 4KRTA 1JBMA 1ZQ1A 2DILA 3I9QA 1ZLMA 4F7UA 1FXXA 2QK0A 2RF0A 2RB6A 4B9WA 4BE2A 3JB9I 2L3PA 2KQWA 2OAWA 3H8ZA 3M5AA 1OU9A 1ABQA 4M78C 2YHTA 3MEUA 3FRNA 2O01E 1YJ9Q 4M78B 4XTUA 1SSHA 4FSSA 2QEXQ 2EQJA 3EGXA 2NUTB 3L2ZA 2MPXC 1RAEB 2V26A 5GAMf 1PHTA 3VUZA 4BY6C 4J83A 2G3RA 2RHYA 4J8OA 1N5ZA 1M8VA 4FYXB 4LUDA 4GLKA 4XTYA 2VGNA 3OYHA 3VS3A 3OS2A 3AT1B 1X75C 4EMKC 1WFWA 2QYZA 4QVCA 2DRKA 1MV0B 3VYHB 4CC7A 4PJJA 4RTUA 4DBQA 2B8AA 3UPUA 3I55A 2EQMA
chains in the Genus database with same CATH topology
1VQPQ 3CMAQ 1NJIR 1KQSP 2OTJQ 3CC2Q 3OW2P 1N8RR 3CD6Q 1Q81R 3I56Q 3CCRQ 1YJWQ 1VQOQ 3CCJQ 3G71Q 1Q82R 1JJ2P 3CCVQ 1YI2Q 1M90R 1YJ9Q 3CCLQ 1VQKQ 1VQ5Q 3CCMQ 1VQ9Q 2QEXQ 3CPWP 1M1KR 1VQNQ 1VQ8Q 3CMEQ 1K73R 3CC7Q 1S72Q 3I55Q 2QA4Q 1W2BP 1Q86R 1YITQ 1KD1R 1VQLQ 1VQMQ 3CCEQ 1KC8R 1YIJQ 1VQ6Q 3G6EQ 3CCQQ 1K8AR 3G4SQ 1K9MR 3CCUQ 3CCSQ 2OTLQ 1Q7YR 1QVFP 1QVGP 1YJNQ 1VQ7Q 1VQ4Q 3CXCP 3CC4Q 1YHQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP Q;  3CMA Q;  1NJI R;  1KQS P;  2OTJ Q;  3CC2 Q;  3OW2 P;  1N8R R;  3CD6 Q;  1Q81 R;  3I56 Q;  3CCR Q;  1YJW Q;  1VQO Q;  3CCJ Q;  3G71 Q;  1Q82 R;  1JJ2 P;  3CCV Q;  1YI2 Q;  1M90 R;  1YJ9 Q;  3CCL Q;  1VQK Q;  1VQ5 Q;  3CCM Q;  1VQ9 Q;  2QEX Q;  3CPW P;  1M1K R;  1VQN Q;  1VQ8 Q;  3CME Q;  1K73 R;  3CC7 Q;  1S72 Q;  3I55 Q;  2QA4 Q;  1W2B P;  1Q86 R;  1YIT Q;  1KD1 R;  1VQL Q;  1VQM Q;  3CCE Q;  1KC8 R;  1YIJ Q;  1VQ6 Q;  3G6E Q;  3CCQ Q;  1K8A R;  3G4S Q;  1K9M R;  3CCU Q;  3CCS Q;  2OTL Q;  1Q7Y R;  1QVF P;  1QVG P;  1YJN Q;  1VQ7 Q;  1VQ4 Q;  3CXC P;  3CC4 Q;  1YHQ Q; 
#chains in the Genus database with same CATH topology
 3CD6 T;  3S3O A;  3H9N A;  3CEY A;  2D8J A;  3TSW A;  2VGM A;  2R57 A;  3CMA A;  2I0N A;  1IGU A;  5GAN e;  3QKJ A;  2LZ6 B;  3JCM J;  2DRM A;  2IIM A;  3V7C A;  1OX9 A;  3CC7 T;  3CBP A;  4RCC A;  1VQM Q;  1VQ9 A;  5C0M A;  2M51 A;  3OYN A;  3M4G A;  2P0Q A;  2DL8 A;  1VYU A;  5CVI A;  2E41 A;  5IT9 E;  2O4X A;  1YJN A;  4BDY A;  4VUB A;  3VKI A;  3LWH A;  2KGT A;  2C0I A;  1LCK A;  4PJO D;  1SKU B;  2BTT A;  2DA9 A;  3I55 T;  2QAZ A;  3C12 A;  4QW2 A;  3VS7 A;  2MAM A;  3KUF A;  3CCQ T;  3G6E T;  3V8J A;  2YXY A;  2RI5 A;  1PSF A;  4NOY A;  4XTZ A;  4RUG A;  2RM4 A;  3CMA T;  3NHN A;  3CCU A;  3OW2 P;  2GF7 A;  2ZAE A;  2ZPF B;  4DQ2 A;  1VIE A;  1VQ9 T;  1OOT A;  4C0F A;  3GP8 A;  2ZCF B;  3NPF A;  2EIF A;  5KYU B;  2E6Z A;  3LH5 A;  1YJN T;  1YCY A;  3QBY A;  3L2U A;  3G4S A;  1BI1 A;  1SSF A;  3G71 T;  1QMC A;  1XNI A;  1VQK T;  2F69 A;  2VKN A;  4RTT A;  4WF2 A;  4WTO B;  1RAI B;  2O31 A;  1G3T A;  1R8O B;  1NLP C;  1AZG B;  3EH2 A;  2KEA A;  3CCU T;  4M75 D;  2PQW A;  2DTO A;  2P84 A;  4FW2 A;  4QQ6 A;  4HXJ A;  5GAN j;  2P4T A;  2EQI A;  3H0F A;  1M27 C;  2JS0 A;  2LQK A;  4C8Q E;  2JTE A;  4LNP A;  4M7D B;  1FWZ A;  2R58 A;  2DET A;  1NE8 A;  3GNF B;  3RNJ A;  2A36 A;  4XU1 A;  2HL5 C;  2E70 A;  2FZG B;  2HZY A;  4C8Q G;  4F7U B;  2EJ9 A;  2P0P A;  5ECA A;  3DKM A;  2GQI A;  2L89 A;  4DBR A;  1Y96 A;  3G4S T;  1EZZ B;  1LJO A;  4X1V A;  1Q7Y C;  4E7J A;  2D1X A;  4ZTF A;  4EIK A;  1M2O A;  4KUI A;  4MZM A;  2PVO B;  4XK8 E;  3EFS A;  2GFU A;  3QDR B;  4AG1 C;  4QVZ A;  3A8L B;  1SHG A;  1KQ1 A;  2QGF B;  5L8R E;  2C0O A;  3A1P A;  4XU3 A;  2PUK B;  3R6N A;  3EGX B;  2J6O A;  4IUT A;  4A4K A;  4HA8 A;  1K8A R;  2HL3 A;  4M7A D;  4M78 E;  4IIM A;  4C5I A;  2PU9 B;  3CCE A;  1ZX6 A;  1TOV A;  2DLP A;  3LWI A;  1D0Y A;  3LYI A;  4RG8 A;  4M78 G;  2EBP A;  4OB0 B;  2DK3 A;  4HVW A;  3BDU A;  1VQ5 Q;  4KUL A;  4JJB A;  2CZ6 B;  4LDY A;  4ZTJ A;  1SEM A;  4JRQ A;  1BI3 A;  3VRY A;  4Y91 A;  1H3Z A;  2OTL Q;  3I5S A;  2XD0 A;  4F17 A;  2DD4 A;  1KK7 A;  3JB9 G;  3CC2 T;  2M9U A;  1YJW T;  1VQO Q;  3THK A;  2EYX A;  2X4Y A;  1UEB A;  4L5G A;  5LJ3 h;  1V29 B;  4C92 D;  1UJ0 A;  1TSF A;  4OVA A;  1LOJ A;  3CCE T;  3QSU A;  2CP5 A;  5CAI A;  1N9R A;  1K8A C;  1VA7 A;  4M77 D;  1TH7 A;  3RR6 A;  5KYW A;  3F70 A;  1N8R R;  1I5O B;  1ZHI A;  3M0T A;  2LRQ A;  2O4X B;  1RUW A;  3M0U A;  4DA4 A;  1AD5 A;  2JZ2 A;  2AKL A;  4D8D A;  3VV0 A;  2DEQ A;  3CPW P;  1V76 A;  4E2F B;  1XQH A;  1YBY A;  3OYE A;  1IRX A;  2LX7 A;  4A4G A;  2JNG A;  3SWN A;  2RPN A;  4MZP A;  1RAH B;  5D7U A;  2OTJ Q;  1NEB A;  2RN8 A;  3VUB A;  5GAN 2;  1RAA B;  2R5A A;  3I5R A;  2MWO A;  2VWF A;  5IN1 A;  6AT1 B;  4M4Z A;  2CUB A;  2YRV A;  1W70 A;  4IUR A;  3CCL A;  5GAM g;  2EGE A;  2RK1 A;  2LX9 A;  2GFA A;  3L2W A;  1QVF A;  2FPD A;  3KXT A;  1YWP A;  5LJ3 f;  4GLM A;  1GFC A;  4GBQ A;  2EYQ A;  2O2O A;  4OMQ A;  1N8R C;  1QKW A;  1WHH A;  4E7K A;  2W10 A;  1IB8 A;  3MEV A;  5KCO A;  5LJ5 h;  4PJL A;  1D3B A;  3MP8 A;  3S6W A;  2MWP A;  3UWN A;  2LCS A;  2XK0 A;  2YUQ A;  1Z9Z A;  5J26 A;  4HT9 A;  2YT6 A;  1QVF S;  1T0H A;  4D6W A;  1BYM A;  1S1N A;  5HCK A;  3ER0 A;  4ORZ A;  1BBZ A;  1T3S A;  3L2V A;  2AK5 A;  1VQ7 A;  2CH4 A;  3OA6 A;  1KSW A;  3JCM h;  3EG1 A;  3I56 A;  3L42 A;  3CBO A;  2X9H A;  1R0B G;  3P8B B;  3PE0 A;  2LJ0 A;  3E2U A;  2DIQ A;  1YIT A;  1AEY A;  2KXD A;  1AOJ A;  4F7U E;  4M7D G;  2HQX A;  3X25 B;  2A37 A;  4V2S A;  1OZ3 A;  4IKF A;  4JRK A;  1QW1 A;  1Q81 R;  1XOV A;  2D0Q B;  3M0S A;  3A8O B;  2FRY A;  4QT7 A;  4F7U G;  2VUB A;  3FC3 A;  1NYF A;  2IVW A;  3NTK A;  4LDX A;  1K4U S;  1B7T A;  5I2M A;  2V1Q A;  3H0I A;  2EWN A;  3H41 A;  1M3A A;  3EHR A;  5LJ5 f;  2LCL A;  4YTL A;  2QDY B;  1VQ7 T;  2CZ7 B;  3RIR A;  3TCJ A;  2CZ1 B;  1BU1 A;  1P92 A;  1WIE A;  4AFS C;  3I56 T;  2XMF A;  2PTK A;  4J9B A;  1KJW A;  2PNI A;  4J5Y A;  4X9C A;  8AT1 B;  2RJC A;  4IUQ A;  4J9H A;  2DNU A;  2JM9 A;  1M2V B;  3RKW A;  2X35 A;  4JPB W;  1TUG B;  4A4E A;  1M1G A;  1YIT T;  2VAS A;  3M53 A;  2C0T A;  4BUG A;  2MK5 A;  5D6X A;  4EMK A;  2FL7 A;  3JCM f;  1RAG B;  2QDL A;  3OSS C;  1G3S A;  1K8A U;  2FPE A;  2DTH A;  5FWC A;  5KE2 A;  1JB0 E;  4ZNX A;  3EG3 A;  5GAN 7;  1Q81 C;  1QP2 A;  3V7S A;  1H92 A;  4PJO A;  2MYS A;  1RAD B;  3CCL Q;  3ZEH A;  3M56 A;  4J7I A;  3TEE A;  1YJ9 A;  2QQR A;  9ATC B;  1IGQ A;  2QEX A;  4FU6 A;  1YIJ Q;  5GAN 6;  5FU6 C;  3QUI A;  1MNE A;  1UGR B;  4JRP A;  2BIV A;  3OW2 A;  3JSC A;  5FU6 B;  1I4K 1;  4X34 A;  4P5N A;  1YI2 Q;  1T3L A;  3V8L A;  1KD1 R;  1Q86 R;  2ZPH B;  4DBH A;  2KYB A;  3QYH B;  4A4H A;  3SWN C;  3CCS Q;  3TU4 K;  1U06 A;  2EQU A;  4ATO A;  2HSP A;  2JM8 A;  3OW2 S;  3SWN B;  2F5T X;  4J9G A;  5J39 A;  4Z89 A;  2HQH A;  1G3Y A;  3N5B B;  3RKY A;  4JS5 A;  1YJ9 T;  1N8R U;  2E5K A;  2FYK A;  2QEX T;  1PM3 A;  4ESR A;  4M75 A;  3LW5 E;  4B6M A;  5AYF A;  3FJ5 A;  3MP6 A;  4FT4 A;  3JAM E;  4Y28 E;  4ZGD B;  1AWJ A;  1HYO A;  1PWT A;  2LTO A;  1VQM A;  1VQ4 Q;  3QWX X;  1XTD A;  2EW3 A;  2XDP A;  2KE9 A;  1GRI A;  1X6G A;  2DZ9 A;  2J06 A;  1RAC B;  4Z8A A;  3TQ7 P;  2JW4 A;  1NEG A;  1D3B B;  3O5Z A;  3M0R A;  1KD1 C;  1D0Z A;  1Q86 C;  1ZA2 B;  1I0C A;  2RI3 A;  4E7Z A;  3VU3 C;  2KMT A;  1HK9 A;  2RHZ A;  1RI9 A;  4E7I A;  2JOY A;  2L0A A;  1DJ7 B;  1QKX A;  5GAN 8;  3CCR A;  2RHU A;  4C0Z A;  4CC4 B;  3L2R A;  2CSQ A;  5GMK m;  1G5V A;  3QWY A;  4RKU E;  3VYG A;  3S3M A;  2EVR A;  3MCA B;  1RAB B;  3HRU A;  2JUF A;  1MUZ A;  2K6D A;  4F04 B;  3HFO A;  1ZUU A;  3M0P A;  4M7A F;  1Y0M A;  3EG2 A;  1JO8 A;  4O6J A;  3Q1J A;  2K5I A;  1X6B A;  2E3H A;  1N27 A;  4HCZ A;  2LCC A;  2RQU A;  2MMP A;  2AT1 B;  2EKH A;  3QXE B;  2K2M A;  3CCM Q;  7AT1 B;  2GTO A;  3C0C A;  4N4G A;  2KXC A;  1H3H A;  2DM1 A;  2LQ8 A;  4JJD A;  3EGU A;  2HQE A;  3GLX A;  1GL5 A;  2ROL A;  2ED0 A;  2GGR A;  1RLQ C;  2QQ9 A;  3RKX A;  1F1B B;  2PVG B;  2O9V A;  4QQD A;  2B86 A;  3PIO A;  4BY6 B;  5GAM e;  1PKT A;  2LDM A;  1X01 A;  5GMK j;  1GBQ A;  1WHJ A;  4C92 F;  2CP2 A;  3MO8 A;  1VQL Q;  1GFD A;  4PKC C;  1SRL A;  2DJQ A;  4A4F A;  4R0K A;  4LN2 A;  5CKH A;  3DLL A;  4F16 A;  4EMK B;  5CKF A;  4M77 F;  2RQR A;  2YUP A;  3FIF A;  3X20 B;  2VXF A;  1UB4 A;  1CKB A;  2ZGW A;  3JV3 A;  4PJO C;  1SPK A;  1UHC A;  2DX1 A;  2IPO B;  3CPW A;  4PJO B;  4M78 D;  1OPK A;  2KRN A;  3HRS A;  2MI6 A;  2DVE A;  2V1R A;  2BZY A;  2XDB A;  1YWO A;  2HDA A;  4BE1 A;  2MIO A;  2RA2 A;  2E5Q A;  4AFU C;  2LT4 A;  1PD1 A;  1YNZ A;  4MMK A;  3JB9 D;  2EGC A;  4B9X A;  5GAO r;  4XU0 A;  5EG2 A;  1I07 A;  2V8J A;  3CPW S;  4ELZ C;  1VQ5 A;  2K7A A;  1D09 B;  4L59 A;  2JTF A;  4KGX B;  1PRL C;  2YWW A;  1RI0 A;  4HT8 A;  4LDU A;  2OTL A;  1G3W A;  4R55 A;  3J81 E;  3CCR Q;  3BDL A;  3EG0 A;  3OMG A;  4C0G A;  4FIB A;  4JUV A;  5EC7 A;  1BI0 A;  5LJ5 g;  1VQO A;  4M75 C;  1JXO A;  3KBG A;  3PTA A;  4HCK A;  4M75 B;  3GNG A;  2A28 A;  2KI7 A;  4O5V A;  1TUD A;  4E7S A;  5FU7 C;  1KD1 U;  1Q86 U;  2F1L A;  1Q7Y R;  5GAM j;  3VS6 A;  1UFF A;  1MHN A;  5FU7 B;  5CQY A;  2FRW A;  1WDX A;  3QJ6 A;  1VQ5 T;  5KYY A;  3GF5 A;  3JCM g;  2DZC A;  3QO3 A;  4J6Y A;  2OAU A;  1GCQ C;  2L3R A;  3FJP A;  5CO7 A;  3QHS A;  3CME A;  1HSQ A;  2OTL T;  2L3Q A;  2CP6 A;  5GMK i;  2QQB A;  2E12 A;  2EAY A;  1KIK A;  1X2K A;  3CD6 Q;  1VQO T;  2OTJ A;  4LE9 A;  2KBT A;  1O75 A;  1K76 A;  2XG8 D;  5GAO l;  4DEX A;  4M7A C;  1IHW A;  2L5Q A;  1K0S A;  1PNJ A;  2DIG A;  2F5K A;  3HHT B;  2M0Y A;  4FW1 A;  2YRD A;  1AWO A;  3OYI A;  4KGV B;  1M4Z A;  1B07 A;  1WLP B;  2NUP A;  5KYN A;  1LVK A;  1NZ9 A;  4AFQ C;  2XHC A;  3FLG A;  1Q95 G;  4ANJ A;  2YSQ A;  3JB9 H;  4KUD K;  1IHV A;  5IXF A;  3G6E Q;  3OYL A;  5KCH A;  4UC4 A;  1I5L A;  1NLO C;  2CGH A;  3PFS A;  4K11 A;  1PC0 A;  4OGE A;  3SDZ A;  5KYX B;  2OTJ T;  3OS0 A;  2RQT A;  4C5H A;  4M7D D;  4C92 C;  1MV3 A;  1UUE A;  2D9T A;  2L3S A;  2ED1 A;  2YUO A;  3HKS A;  2DFU A;  1ZUY A;  5GAM d;  1IZ6 A;  1UE9 A;  3I35 A;  2K3Y A;  1M2V A;  1U8R A;  1FYN A;  2RMO A;  2LNH B;  1VQ8 Q;  2CP3 A;  3VS1 A;  4M77 C;  2YLB A;  2FPF A;  1VQN A;  2EYZ A;  2K3X A;  2KRM A;  2KAF A;  2X3W D;  1OI1 A;  4ZGJ B;  2DL5 A;  2L2P A;  1QCF A;  3KFV A;  5CIU A;  1YHQ Q;  1VQP Q;  2J05 A;  1OV3 A;  4XQ3 A;  4NS5 A;  2EPD A;  2XDD A;  5GAN d;  1QP3 A;  2E4H A;  4WCI A;  4CRI A;  2D6F A;  3MHX A;  1WZO A;  2XKO C;  2LQN A;  2WSF E;  1PKS A;  1N6A A;  2GNC A;  3NFC A;  3V8K A;  4PJO E;  3QJY A;  3CC4 Q;  3M0Q A;  2COZ A;  3C4S A;  1LNX A;  2MCN A;  4BI4 A;  5CKD A;  1D1A A;  5GAN 4;  4L6V 5;  4PJO G;  3O8V A;  4PLL A;  3ZFJ A;  2DF6 A;  2FB7 A;  2RHX A;  3OYK A;  1Y07 A;  4JLI A;  4RTW A;  3CME Q;  1BCO A;  1C6V X;  1VQ6 Q;  1N9S A;  2V8I A;  1QWE A;  3WVD B;  2HMA A;  2BUD A;  5FRO A;  2ZPG B;  1W1F A;  3GIB A;  2JVV A;  4D8K A;  4XTV A;  1VYT A;  2RQW A;  2J6K A;  1UJY A;  2YLC A;  1M8M A;  3C94 A;  3T9N A;  1WPY A;  3E19 A;  2PVD B;  4BI8 B;  4A53 A;  1D1C A;  3DB3 A;  2DMO A;  1YIJ A;  2ENM A;  3MPU B;  1NJI C;  4OMM A;  4RTZ A;  2QTV A;  4M75 E;  2K4Y A;  1M90 R;  4XAX B;  5LJ3 e;  3X24 B;  1W6X A;  3OMC A;  1WJQ A;  2K3B A;  3OYC A;  1YI2 A;  5KYY B;  4PFO A;  3JCM V;  4M75 G;  1W2B P;  2LJ1 A;  1QLY A;  3OS5 A;  2FZC B;  2JTM A;  2X4W A;  3NTI A;  2BE9 B;  1H64 1;  4BE0 A;  2E65 A;  3CC2 Q;  5L23 A;  2LP5 A;  3CCS A;  4NL2 A;  2LMJ A;  1OQK A;  1Q7Y U;  4PK4 A;  3SHW A;  1WXT A;  3CCL T;  3U23 A;  1X27 A;  2XID A;  3OS1 A;  2JN0 A;  3OYB A;  5KE3 A;  2LNV A;  1VQN Q;  3S3N A;  4C8Q F;  3G1J A;  4BD3 A;  2QA4 Q;  2X3X D;  1YIJ T;  4IUP A;  2FO0 A;  4LUE A;  3SEM A;  3X26 B;  1M30 A;  2DVJ A;  1VQ4 A;  2LVM A;  3CCJ Q;  1M90 C;  2A3L A;  1WI7 A;  2NUP B;  2VC8 A;  3LLR A;  3QDF A;  1ZUK A;  4HVV A;  2E3I A;  5FWB A;  1WHL A;  2DXC A;  1H8K A;  1J3T A;  2R5M A;  3EFR A;  2KDS A;  2GCX A;  2RHI A;  3QG1 A;  3MEW A;  5GAO n;  2DXU A;  2RO0 A;  3A8M B;  1S72 A;  3CCS T;  1K9M R;  3M59 A;  3EGD A;  2O88 A;  3RES A;  1PD0 A;  2EJF A;  3EFO B;  5LJ5 e;  5FRM A;  3HL8 A;  2J6F A;  4A54 A;  4Z02 A;  1M5Q 1;  4OB1 B;  4M78 F;  2CH4 W;  4AT1 B;  8ATC B;  4N4H A;  2AKK A;  3TRE A;  5CR2 A;  1VIF A;  4OMO A;  2LJ3 A;  4OB3 B;  2JS2 A;  2CDT A;  5LJ3 j;  2H3J A;  1VQ4 T;  1HXD A;  4OMP A;  1D1B A;  2QGG A;  4Y92 A;  3HP9 A;  1SHF A;  3JB9 F;  1TWB A;  3JCM e;  3L2Q A;  2ESW A;  3AHU A;  3UA6 A;  5HKC A;  3LGL A;  3CCV A;  1X43 A;  4BDZ A;  1PSE A;  2WAC A;  4JS4 A;  3MET A;  3R6O A;  1TS9 A;  1K73 R;  1WYX A;  3CCM A;  2L8D A;  2BKD N;  4EMG A;  3FDR A;  3PT9 A;  4RMO A;  1WHM A;  2M02 A;  2RH2 A;  4FYY B;  1K9M C;  3REA B;  2WSE E;  5GMK h;  2HD0 A;  1D0X A;  3D7S B;  3ULR B;  2JMC A;  5C6S A;  1FMW A;  1E6G A;  1ABO A;  1FMK A;  2DO3 A;  4JRI A;  4JZ3 A;  3PMI A;  4AG2 C;  3RDV A;  3ZL7 C;  4KBM B;  3CXC A;  2VYT A;  2NUZ A;  3VS5 A;  3OBY A;  3OYJ A;  1EIF A;  1VQL A;  4DEY A;  4J9F A;  2X4J A;  4KH0 B;  4JDS A;  3LGF A;  1GBR A;  3OYF A;  4IUV A;  2P0K A;  3GBQ A;  3DLM A;  3CCM T;  2OJ2 A;  4Z88 A;  5FLX E;  3OYM A;  5D6W A;  3NTH A;  1TU0 B;  5CCA A;  2ZPE B;  1M1F A;  1K73 C;  2KNB B;  2HAX A;  5DY9 A;  5LJ5 j;  1QQJ A;  5GAN 3;  2EJG A;  1R77 A;  2DL7 A;  5FW9 A;  2RK2 A;  5GAO q;  1YCS B;  1IXD A;  2DL4 A;  3QZ9 B;  3P8H A;  1HD3 A;  2AZV A;  1BCM A;  4N0A C;  2KT1 A;  2VB6 A;  1VQL T;  3PMT A;  1S72 Q;  3RMQ A;  1Z9Q A;  2K9G A;  1U1T A;  2VVK A;  1GCQ A;  4J6W A;  2CRE A;  2KT8 A;  3RBB B;  1TG0 A;  2KVQ G;  1WJR A;  1MMD A;  2OI3 A;  5FRN A;  1WQW A;  1OEB A;  1M90 U;  2KRO A;  3UA7 A;  4JLG A;  2A08 A;  3SFM A;  1VQM T;  4M7A A;  4IUU A;  3A5Z B;  2P4R A;  3A8H B;  4Q5W A;  4M7D F;  3HPW A;  4IIO A;  3CCV Q;  1PG5 B;  1WJS A;  5M9O A;  4J6X A;  3JCM W;  4PFP A;  3M58 A;  4F7U F;  3FB9 A;  4FL6 A;  5GAN h;  1M1K R;  4BI3 A;  2ZPI B;  1A0N B;  1VOM A;  1VUB A;  3A98 A;  2DBM A;  4C8Q D;  2RD1 A;  1KC8 R;  2K5F A;  4BB7 A;  5GAN 5;  5KYX A;  3A8G B;  4II1 A;  4QQG A;  1WHG A;  3EGD B;  1OZ2 A;  3RMS A;  3CCR T;  5LJ5 d;  1SRM A;  4PFZ A;  4C92 A;  3CD6 A;  1HJD A;  2HCK A;  1Q81 U;  3JCM c;  4RCB A;  3ZBD A;  3URG A;  1G8X A;  3V7R A;  5DLO A;  1MND A;  3QPH A;  5LJ3 g;  5IHI A;  2DYI A;  2VV5 A;  3CC7 A;  4M77 A;  1TXQ A;  3EG9 A;  5I22 A;  2K79 A;  4C5G A;  2KY9 A;  1FX7 A;  1K9M U;  1YN8 A;  2JJ9 A;  1ZSZ C;  3JCM d;  2JMA A;  2DXB A;  3UT1 A;  1QWF A;  3BW1 A;  4RTY A;  2KK4 A;  2LC4 A;  1ZSZ B;  3LH0 A;  2YDL A;  1M1K C;  5HY6 A;  1JRI A;  1KC8 C;  1U3O A;  2EYW A;  3CCQ A;  5GAN f;  2QQS A;  3G6E A;  1ARK A;  5I11 A;  4LDW A;  2ZZD A;  1JJ2 P;  2DD5 A;  2DL3 A;  2Y4Y A;  4ZN3 A;  2QQA A;  1LPL A;  1NM7 A;  3QYG B;  5J3B A;  3CQT A;  1M3C A;  4OP0 A;  1MMA A;  4JJC A;  4NL3 A;  2I2L A;  1VQ8 A;  1K73 U;  1PRM C;  5GJW B;  2E6N A;  4FSX A;  3JCM Q;  4CC3 A;  3HTR A;  5A0L A;  1K1Z A;  3PIP A;  1Q82 R;  2FEI A;  1E7O A;  1KG1 A;  1YHQ A;  1VQP A;  4KT0 E;  3HFN A;  3BY7 A;  1NPP A;  4XTW A;  1TTH B;  3G71 A;  2HSE B;  3PNW C;  4AFZ C;  1W2B A;  1I81 A;  1VQK A;  2NWM A;  2CP7 A;  2OX7 A;  1WXB A;  3UF4 A;  1JXM A;  1C1A A;  1BB9 A;  3MP1 A;  1UG1 A;  1WNL A;  2LT1 A;  1QVG P;  3CXC P;  4FCY A;  4J9E A;  1I1J A;  1UGV A;  2A7Y A;  2RI2 A;  4TVR A;  3CC4 A;  1AWX A;  4N4I A;  4PL6 A;  2K5L A;  1VQ8 T;  1BKB A;  1W2B S;  1YFN A;  1MMN A;  4J9I A;  1G83 A;  2CS7 A;  1YHQ T;  1VQP T;  1VQ6 A;  2W0Z A;  2ROT A;  4ELY C;  2RJF A;  2O9S A;  1AHJ B;  3SB2 A;  4HCB A;  1Q82 C;  1GXI E;  2KR3 A;  3ME9 A;  5HK3 A;  4E47 A;  1JQQ A;  3UDC A;  4XU2 A;  4HKE A;  2DKG A;  1V1C A;  2EGA A;  3CC7 Q;  2DE0 X;  2CT3 A;  4M7D C;  1K9A A;  4PNO A;  4M7A B;  1KQS A;  1B3Q A;  2LQW A;  4OMN A;  4RTX A;  3GPL A;  3CC4 T;  3H0H A;  1UEC A;  5I2S A;  1MMG A;  1GCP A;  2E10 A;  1K0X A;  2GTJ A;  1OU8 A;  3MJX A;  2CT4 A;  4QKU A;  3JCM P;  4HVU A;  3G7Z A;  4MDX A;  4ME7 A;  3CME T;  3I55 Q;  1VQ6 T;  2AIR B;  1WGS A;  4BAC A;  3CCQ Q;  5GJV B;  1X2Q A;  1KQS S;  2AHJ B;  2SRC A;  1M9S A;  3EFO A;  3CMA Q;  3EAE A;  1ZBJ A;  2GBQ A;  2D8H A;  3M57 A;  1UTI A;  1PCX A;  2CKK A;  1X69 A;  3TVT A;  2KSS A;  1ZBX A;  3CC2 A;  1YJW A;  3E9G A;  4MDW A;  4C92 B;  1VQ9 Q;  5GAO m;  3PGG A;  4OGC A;  4PJN A;  1NG2 A;  3H6Z A;  1M1K U;  4CC2 A;  2K57 A;  2QA4 A;  4M77 B;  1YJN Q;  3EG9 B;  2XU8 A;  1KC8 U;  4ZN1 A;  4KH1 B;  2RQV A;  3JCM b;  2ATC B;  3J80 E;  3G71 Q;  2M1H A;  4FYW B;  4FYV B;  2DYB A;  2RJE A;  4EDU A;  5IHK A;  5CQX A;  1VQK Q;  3CCJ A;  4A63 B;  2D0N A;  2YUN A;  2DER A;  2Z0W A;  4R56 A;  5IH2 A;  3QZ5 B;  4JZ4 A;  2BZX A;  4C5E A;  2Y4X A;  2HBP A;  2G6F X;  2H8H A;  2F2X A;  3CCU Q;  3WVE B;  3M54 A;  1Y7X A;  3OSV A;  5HK0 A;  1NJI R;  1KHI A;  2YRC A;  4EPC A;  1IRE B;  1OPL A;  2Y90 A;  1QCN A;  2ECZ A;  1JU5 C;  2X4X A;  1VQN T;  3M9Q A;  2IG0 A;  2QA4 T;  4OF1 A;  3BE3 A;  5DLQ E;  3HRT A;  4OML A;  3G4S Q;  2VXE A;  1IO6 A;  1RAF B;  1E6H A;  2F2V A;  5A2Q E;  3OBW A;  2NYS A;  1NBE B;  3CCJ T;  4E7L A;  3VS2 A;  2DAQ A;  3M55 A;  1TUC A;  2H3E B;  1KFZ A;  1CSK A;  2FG0 A;  3GOX A;  1R0C B;  1ZSG A;  2WSC E;  2NLU A;  1ZA1 B;  2M0O A;  5A0D A;  1MGQ A;  2M16 A;  3VJP A;  3ASK A;  3NMZ C;  4FT2 A;  4F14 A;  1QCO A;  3MKD A;  3OYA A;  4J9C A;  1BI2 A;  4OB2 B;  4C0D C;  1OX8 A;  3PVL A;  3SD4 A;  4C0D B;  1Q82 U;  3C95 A;  3OQ5 A;  5CKB A;  1BIA A;  3P8D A;  4N0A A;  2C06 A;  2FZK B;  1BIB A;  1EX4 A;  2HKQ B;  3INZ A;  2CSI A;  4DOW A;  2KYM A;  1YJW Q;  2PZ1 A;  1UDL A;  3REB B;  5D6Y A;  4EMH A;  2BZ8 A;  2XIC A;  3MEA A;  4C8Q A;  1SF9 A;  2DBK A;  2BE7 D;  1B34 A;  1CKA A;  2HNI A;  5GAN g;  3CCE Q;  3E1S A;  4LD6 A;  1EFN A;  3VS4 A;  5A0G A;  4GY5 A;  3JRZ A;  1UHF A;  2COW A;  2A0F B;  2FVU A;  2RNA A;  1AWW A;  1WXU A;  3RUX A;  3VS0 A;  3OYD A;  1YI2 T;  4M7A E;  1ACM B;  3M4Y A;  2DPP B;  2RJD A;  3CBM A;  1RL2 A;  4CI0 C;  4M7D E;  4OMF B;  4FM4 B;  1U1S A;  1XJW B;  2CYZ B;  4MZT A;  4M7A G;  1I8F A;  1Y96 B;  5CKE A;  3UAT A;  3J7A F;  1KQS P;  4DBF A;  1WX6 A;  4AMC A;  2DXT A;  4M78 A;  2CP0 A;  4RG2 A;  1BK2 A;  2X51 A;  2HKN A;  4J7F A;  5DM7 R;  2NUT A;  1AT1 B;  3DB4 A;  2QG9 B;  2FHD A;  2JXB A;  1X6O A;  1Y57 A;  5IXB A;  5I21 A;  2HEQ A;  4C92 E;  2PUO B;  3TSZ A;  2DTI A;  1JJ2 A;  2MF2 A;  2GQV A;  2QTX A;  4ZGE B;  4QVD A;  5AT1 B;  2ZPB B;  4C92 G;  1AVZ C;  1O9S A;  1ZSZ A;  4M77 E;  5CK9 A;  1M3B A;  1S72 T;  3IQL A;  1OUL A;  1OYX A;  1QVP A;  4M77 G;  3L1A A;  3OB9 A;  1YP5 A;  3PVQ A;  3CPF A;  1JJ2 S;  4E7H A;  3FEO A;  3HSB A;  3JCM X;  4XTX A;  4PJO F;  2QXF A;  2J7I A;  4KGZ B;  4PLI A;  2E64 A;  2CUD A;  1UGS B;  2EYY A;  3EH1 A;  5IAY A;  4LD9 K;  3WXM B;  1JEG A;  1QVG A;  2EFI A;  1NPR A;  5LL6 S;  2EKO A;  2HBW A;  5KYW B;  3CCV T;  1NJI U;  4X9D A;  3EHQ A;  4J9D A;  5IHN A;  2DEU A;  1Y71 A;  1UGP B;  2DJZ A;  2F2W A;  2V8K A;  1SG5 A;  2E1H A;  1U5S A;  1QVG S;  3CXC S;  4HCC A;  1VYV A;  1VQ7 Q;  3VRZ A;  2AZS A;  3OY9 A;  1G2B A;  4E6R A;  1UGQ B;  1KQ2 A;  2EQK A;  2K2V A;  3NGP A;  3I56 Q;  2QI2 A;  3QII A;  5LJ3 d;  3E9F A;  3BFM A;  5GMK l;  2KRS A;  3OYY A;  5KYU A;  4DOV A;  3LX7 A;  5GAO p;  4JJN K;  1YIT Q;  4PJM A;  4M75 F;  5GMK e;  2QAS A;  1WQ7 A;  2MOX A;  1WHK A;  3X28 B;  1NYG A;  2ABL A;  3OYG A;  4RTV A;  4LDV A;  4MML A;  3RER A;  1RLP C;  2CZ0 B;  2XI9 A;  4C8Q C;  3JB9 J;  1FMV A;  2SEM A;  1T0J A;  1WA7 A;  5GAM h;  1AZE A;  4C8Q B;  1C0M A;  1KHC A;  1B34 B;  5KH6 A;  2JT4 A;  2COY A;  4LXC A;  1QVF P;  4M7D A;  1W4S A;  4KRT A;  1JBM A;  1ZQ1 A;  2DIL A;  3I9Q A;  1ZLM A;  4F7U A;  1FXX A;  2QK0 A;  2RF0 A;  2RB6 A;  4B9W A;  4BE2 A;  3JB9 I;  2L3P A;  2KQW A;  2OAW A;  3H8Z A;  3M5A A;  1OU9 A;  1ABQ A;  4M78 C;  2YHT A;  3MEU A;  3FRN A;  2O01 E;  1YJ9 Q;  4M78 B;  4XTU A;  1SSH A;  4FSS A;  2QEX Q;  2EQJ A;  3EGX A;  2NUT B;  3L2Z A;  2MPX C;  1RAE B;  2V26 A;  5GAM f;  1PHT A;  3VUZ A;  4BY6 C;  4J83 A;  2G3R A;  2RHY A;  4J8O A;  1N5Z A;  1M8V A;  4FYX B;  4LUD A;  4GLK A;  4XTY A;  2VGN A;  3OYH A;  3VS3 A;  3OS2 A;  3AT1 B;  1X75 C;  4EMK C;  1WFW A;  2QYZ A;  4QVC A;  2DRK A;  1MV0 B;  3VYH B;  4CC7 A;  4PJJ A;  4RTU A;  4DBQ A;  2B8A A;  3UPU A;  3I55 A;  2EQM A; 
#chains in the Genus database with same CATH homology
 1VQP Q;  3CMA Q;  1NJI R;  1KQS P;  2OTJ Q;  3CC2 Q;  3OW2 P;  1N8R R;  3CD6 Q;  1Q81 R;  3I56 Q;  3CCR Q;  1YJW Q;  1VQO Q;  3CCJ Q;  3G71 Q;  1Q82 R;  1JJ2 P;  3CCV Q;  1YI2 Q;  1M90 R;  1YJ9 Q;  3CCL Q;  1VQK Q;  1VQ5 Q;  3CCM Q;  1VQ9 Q;  2QEX Q;  3CPW P;  1M1K R;  1VQN Q;  1VQ8 Q;  3CME Q;  1K73 R;  3CC7 Q;  1S72 Q;  3I55 Q;  2QA4 Q;  1W2B P;  1Q86 R;  1YIT Q;  1KD1 R;  1VQL Q;  1VQM Q;  3CCE Q;  1KC8 R;  1YIJ Q;  1VQ6 Q;  3G6E Q;  3CCQ Q;  1K8A R;  3G4S Q;  1K9M R;  3CCU Q;  3CCS Q;  2OTL Q;  1Q7Y R;  1QVF P;  1QVG P;  1YJN Q;  1VQ7 Q;  1VQ4 Q;  3CXC P;  3CC4 Q;  1YHQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...