1VQNQ

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqnQ00
1W2BP 1KD1R 3G6EQ 3CPWP 3CCLQ 3CCQQ 1YI2Q 1VQ8Q 1KC8R 1K8AR 3G71Q 1Q81R 3CCMQ 1YITQ 3CCEQ 1YJNQ 2OTLQ 1VQ7Q 1K73R 1VQ5Q 1VQ9Q 3CC7Q 2OTJQ 1Q82R 3CCRQ 1QVGP 1N8RR 1NJIR 3CCVQ 1S72Q 1JJ2P 1YJWQ 2QEXQ 3CD6Q 3CC2Q 3I56Q 1YJ9Q 1YHQQ 1KQSP 3CXCP 3I55Q 3CMEQ 1VQMQ 1YIJQ 1VQLQ 3CMAQ 3CCJQ 1Q7YR 1QVFP 1VQKQ 1VQPQ 1VQ6Q 1M1KR 1VQOQ 1K9MR 3OW2P 1M90R 1VQ4Q 1VQNQ 3CC4Q 2QA4Q 3CCUQ 3CCSQ 3G4SQ 1Q86R
chains in the Genus database with same CATH superfamily
2RHXA 2OJ2A 1SPKA 2BUDA 2CGHA 1UJ0A 5KYWA 2VXFA 4XTWA 1VQ8A 2P0PA 2GFAA 4M78A 3X26B 4AG1C 3TEEA 2FZKB 4XQ3A 2GFUA 4C0ZA 4AFUC 3QIIA 3OBWA 4C5HA 1HYOA 2QQSA 2CH4A 2KR3A 3CCVT 1T0JA 2JZ2A 1EX4A 2KY9A 1AVZC 5IHIA 3E1SA 2CYZB 1UGQB 3OYEA 2LP5A 2MPXC 2KI7A 3CMEQ 4BDZA 3P8HA 1H8KA 1UG1A 3OSSC 2X4XA 3C94A 1RAFB 1YN8A 5FRMA 4JPBW 1HJDA 3JCMe 4BACA 1AHJB 1M9SA 2LQ8A 4K11A 2KVQG 2ZGWA 5KE3A 1T3LA 3C0CA 2E6NA 1BCMA 1BKBA 1Q95G 2YUPA 1PD0A 4QKUA 3GNFB 3QJYA 4GBQA 2H3EB 2F2VA 1MGQA 2RJFA 3CMET 3HKSA 3LH5A 5I2SA 1G3TA 5DLOA 2JS2A 2DIGA 2XDPA 4M78C 1Q81R 3RMQA 5EC7A 3UA7A 3ZBDA 4FIBA 4EPCA 1UFFA 4ME7A 1OULA 2V8JA 3A8MB 3CCVA 2QDLA 4BD3A 1Q7YR 2A08A 2BZYA 1B7TA 3BE3A 1G83A 4P5NA 2HZYA 1LOJA 4JS5A 2C06A 1KQ2A 4ANJA 2MCNA 1I1JA 3MHXA 4KBMB 1QMCA 2HQXA 4QVCA 1VQOT 2QI2A 2RQVA 3FC3A 1MMAA 2E5QA 2EJGA 2KXDA 1GCPA 2P0KA 4FCYA 2CSQA 4A63B 4F7UF 3JCMW 4M7DD 2HBWA 2COZA 4HVUA 3M58A 4E47A 2LCLA 4Y28E 3IQLA 5GAMf 4QVZA 3MEUA 1SSHA 1I0CA 1WX6A 1S1NA 3VRZA 2DL7A 2QEXA 3CCVQ 2EGCA 4ATOA 4F16A 5GAMh 1MNEA 3J7AF 1R8OB 1BI0A 1KJWA 5CR2A 4F7UE 4E2FB 4IIMA 4IUTA 2L89A 2JMAA 3CBPA 1RLQC 2DRMA 1M8MA 2DZ9A 1WJSA 4KRTA 2DPPB 4AMCA 1D0XA 3FDRA 2MMPA 4JUVA 2D1XA 3X24B 1B07A 1YIJA 2YUOA 4Z8AA 2KSSA 1MV0B 4CC3A 3OMCA 2ENMA 2RA2A 4OMQA 1NJIR 4M7DF 2DD5A 5LJ3e 3ZFJA 4KGZB 3I9QA 1JJ2S 1QCNA 2L8DA 1IGQA 2LNHB 1NE8A 4X9CA 2QGGA 1BCOA 1JB0E 2EGAA 4ORZA 2K5FA 5FRNA 1K1ZA 2CREA 3X25B 4BE2A 4M7DG 4RTTA 3OSVA 1PNJA 1LNXA 4LD6A 5FW9A 1K9MC 1U3OA 2QAZA 4EMKC 3CCEA 1ZLMA 1K0SA 2E12A 1SEMA 2HD0A 1GL5A 4DBQA 3QWYA 5GANd 2EPDA 3GP8A 2KDSA 4M77C 2E3HA 5LJ5g 5AYFA 1VQ7T 4ZN1A 1W2BA 4JDSA 3OW2P 2HKQB 3RDVA 3H41A 1ZA1B 5KCHA 3A98A 2RHZA 3WXMB 2G3RA 2KGTA 3CBOA 1NLPC 3ER0A 1N8RR 2Y4YA 3EHRA 1WHHA 4F17A 2ZPHB 2VKNA 4LDXA 3QKJA 2OX7A 2R57A 2YUQA 2K4YA 3OYYA 3EGDA 2CH4W 5D6YA 5GANh 3KUFA 1MUZA 5GAOm 2EVRA 5GAN4 5CKEA 3OYMA 4DOWA 5IT9E 2FPEA 3OS0A 4C0DC 2EYZA 4Q5WA 4D8KA 4GLKA 1HD3A 1C6VX 3ASKA 5GAN2 1K9MU 2PNIA 2JJ9A 1PG5B 4JJCA 3OYDA 2EWNA 3PVLA 1I07A 4C8QA 1PRLC 1WJQA 1WLPB 4M75G 2YRVA 2ZCFB 3P8DA 3JRZA 5GANj 3TREA 1H3ZA 2CZ7B 1VYTA 1PKSA 1KC8U 4L6V5 4PFPA 2JXBA 5GAN6 4M78B 4L59A 1VQNQ 2HCKA 2XMFA 2Y4XA 4J9EA 3EG0A 1UHCA 1MNDA 2HDAA 3QYGB 3MEAA 4ELYC 4CC4B 2OTLQ 2EJFA 1VIEA 1YITT 4OF1A 3A8GB 3OYBA 2DD4A 1Y96A 3UT1A 2XHCA 2DXBA 3FEOA 3QUIA 1M1FA 2X3WD 1YI2A 1OOTA 2DF6A 2EQJA 1U06A 3QSUA 5LJ5h 4M75E 4PLIA 4BY6B 3UWNA 1Q82R 4WTOB 2EKOA 3QPHA 3UF4A 2LX9A 5FROA 2RH2A 4TVRA 1BI2A 1VQOA 4C92D 2QASA 5LJ5f 2VUBA 2V8IA 3I55A 3QDRB 2O9SA 1K73R 4JRPA 4JZ3A 5KYWB 3OYGA 3MP1A 1RI0A 5ECAA 3G71A 1WHMA 2OTJT 2HNIA 4FU6A 2B8AA 2V26A 1WYXA 1QW1A 4KUDK 2QEXT 4FYYB 4AFZC 5KYYA 2Z0WA 1VQOQ 3NTIA 5D6WA 2OTJQ 4GLMA 2WACA 4ZNXA 5DY9A 4L5GA 2C0IA 2DRKA 2ZPGB 1Z9QA 2K7AA 3U23A 2V8KA 1KFZA 4NL3A 2RI3A 2DL3A 3A8LB 2AKKA 5CO7A 3WVDB 3DB3A 1UGPB 4M7AB 4N4GA 1I5OB 5A2QE 1EFNA 4M7AF 1K8AR 1H92A 3VS3A 2OTLA 2EYQA 2LQKA 1KQSS 2CUBA 1KK7A 1K9AA 5IAYA 3PIPA 1GXIE 4C8QF 2KT8A 3DKMA 1IGUA 3HPWA 1JJ2P 1RAIB 3OYJA 4JJNK 3E9FA 2L3PA 3URGA 3QYHB 9ATCB 3G71T 3DLLA 1JXMA 1X75C 2E70A 2IIMA 5LJ3f 1M90U 2PVOB 1UB4A 3GNGA 1D1CA 1KQSA 3MJXA 3EFRA 1T0HA 2LC4A 2LQWA 1I4K1 2K6DA 2WSFE 2YHTA 3V8LA 5KE2A 1M2OA 4J9DA 2XU8A 3RNJA 4ZN3A 3GIBA 1WJRA 2NUPB 1AWXA 4FL6A 2QYZA 1KSWA 2P4TA 1YHQA 3HRTA 3VS0A 3G6EQ 1YBYA 2JTEA 3RR6A 3OYCA 1D3BA 1TU0B 1YWPA 1PM3A 2JN0A 1BU1A 3SHWA 1V76A 2PVDB 1YJWQ 2RK2A 2J05A 1GFDA 3OQ5A 3M53A 2RB6A 3WVEB 3JB9I 4M7AG 1M3CA 2ECZA 1N9RA 4X9DA 1QWFA 1RACB 4DEXA 1XNIA 2GQIA 3CCRA 2YDLA 2YXYA 5GAOn 4Z88A 4J5YA 2KQWA 1FX7A 4BI8B 1TUDA 1QKXA 2RJCA 1AWJA 3I56Q 3TQ7P 4BB7A 3OYFA 1GRIA 3M57A 1X6BA 4E7IA 2ROTA 3OYIA 1QVFP 2JUFA 2DZCA 1NPRA 2ZPEB 2DXTA 2IPOB 2COYA 2K9GA 1RI9A 1D09B 1VQKA 2RHYA 1BYMA 4BY6C 3LLRA 3V8JA 5GMKj 1VOMA 1K73C 4YTLA 1B3QA 1SF9A 2RHUA 4MMKA 3OW2S 2E3IA 1ZQ1A 4HKEA 2A28A 1WHKA 4HA8A 1IZ6A 2LCSA 3I35A 3M0RA 3HFOA 4Y92A 3CMAT 1VQMA 1IO6A 3OBYA 4FT4A 1M2VA 1M30A 2OAWA 2EQKA 3META 2LJ3A 3QDFA 2X4JA 3MKDA 2AHJB 3EGDB 3MEWA 3EH1A 1SHFA 1UHFA 4C5IA 2DYBA 1NZ9A 2X51A 3PVQA 5CQYA 4KH0B 3VS7A 4FM4B 2MIOA 1PCXA 2H3JA 1VQ8T 2P4RA 1Q81U 2VB6A 1NYGA 1KC8R 1RAHB 3EGXB 3LWHA 1X27A 1VQLA 2RD1A 1B34B 2QQ9A 2RPNA 4F7UG 3EH2A 1IHVA 4C92A 5KH6A 3CC7A 1E7OA 3L2UA 1YJWT 2JTMA 3M0UA 2FRYA 5KYUB 2VYTA 3BFMA 3CD6T 3LX7A 1JO8A 1JU5C 3RKYA 1SKUB 3C4SA 1VQ5Q 2DETA 2JNGA 2NUTA 1GFCA 5LJ3d 3I5SA 4DBFA 2NUPA 1XOVA 2FYKA 1VA7A 3RKXA 3KXTA 1M8VA 2NLUA 2CUDA 3EAEA 4J9HA 2VXEA 2DVJA 2CT4A 1VQLT 1RUWA 3QHSA 5EG2A 5HKCA 4A4FA 3SWNA 1NLOC 2D9TA 2DYIA 1JQQA 1C1AA 2ZPBB 5FU6B 3CXCP 2RNAA 4IUUA 5GMKm 5GANg 2BZ8A 4C5EA 3N5BB 1WQWA 1AEYA 1YCYA 1U5SA 2SEMA 3CCUT 2HSPA 2EGEA 3BDUA 1Q7YC 2LJ0A 4AG2C 1KD1R 2QQBA 1G3YA 4HCZA 2AIRB 1BBZA 3NTHA 1VQ9T 1SSFA 2DXCA 3JCMQ 2RJDA 2VVKA 3CCRQ 1TSFA 5LJ5e 4PL6A 1H641 4NOYA 4XTUA 8AT1B 4LUEA 3BW1A 2DFUA 4CC2A 3V7CA 4E7JA 2F1LA 2GBQA 2L5QA 1GCQA 2RQRA 1YJWA 2X4WA 1XTDA 3CCLQ 1X6GA 3MEVA 1WZOA 3NPFA 2AKLA 2X3XD 3VUZA 1QCOA 2M51A 4HCBA 1D0YA 3CC4A 3EHQA 1R77A 1YITA 1Y07A 3L2ZA 1N27A 5FWCA 1VQ4Q 3JAME 4XTZA 1ZUUA 5HK3A 1VIFA 4J9GA 3CEYA 3CCQQ 5KYXB 5J3BA 4NL2A 2E1HA 1QVGA 2XICA 2YLCA 2K5IA 3SD4A 4M7AA 1G3SA 3NMZC 5I22A 4AT1B 4M78E 4E7HA 3G4ST 4ZTJA 4J9FA 4JRKA 3CCJQ 2JTFA 4C0FA 4N4IA 1VQPQ 2Y90A 2KRNA 1KG1A 1OI1A 4EMHA 2CP6A 1BI3A 3PE0A 2BE9B 3M0QA 4M75C 4PJOD 1YI2Q 1D3BB 1UTIA 1VQ8Q 1QVFS 3EG3A 1G5VA 1AWOA 2YRDA 3CQTA 5L8RE 2FO0A 3M5AA 1K76A 5IXBA 4N0AC 4BDYA 2FRWA 1GCQC 2M1HA 3JV3A 4QQGA 2LRQA 4IUQA 2HAXA 3A8HB 2DBKA 1KQ1A 3VS4A 4M75D 3LW5E 4D8DA 3H8ZA 3CCJA 1D1AA 2HQEA 1YCSB 4DA4A 4M7AE 2MAMA 1N8RU 2QTVA 3VS2A 1RABB 5FU7B 3CC2Q 2OTJA 4C8QE 1B34A 2QQAA 5CCAA 1TWBA 2RMOA 1TG0A 3FJ5A 1JBMA 3CBMA 4C92B 3CCST 1M1KR 2DTOA 5C6SA 3G4SA 2LMJA 2DILA 4E7LA 3OS5A 3MCAB 1J3TA 1M27C 4IUVA 3OS2A 4ESRA 1M4ZA 3BDLA 4RCCA 1TUCA 2M0YA 2RQUA 2RN8A 2ZPIB 2HKNA 3LWIA 1G2BA 1MMGA 3TCJA 1PKTA 3QXEB 1JRIA 4DQ2A 2DO3A 1HSQA 2PZ1A 2F2WA 3RERA 3J80E 4JRIA 1UJYA 2DA9A 4UC4A 1WDXA 4IIOA 4RTVA 3HL8A 1WQ7A 5HCKA 4RMOA 3M9QA 3MP6A 1CKBA 3RKWA 1YJNT 1KQSP 3KBGA 2VC8A 1PC0A 3SWNB 1I81A 3PMTA 4C0DB 4LXCA 4A4EA 1OEBA 2DIQA 4XU3A 1FMVA 4PK4A 4FYXB 2L3SA 4E7ZA 5CKHA 2ATCB 1OV3A 4N0AA 4MZPA 2JM8A 4R55A 1PHTA 2PTKA 3OA6A 1AWWA 1QVPA 3R6NA 1KHIA 3DB4A 2R5AA 4KGXB 4M75B 3M55A 4XAXB 1X69A 1E6HA 2JOYA 3EFOA 1UDLA 1RAEB 2ABLA 2GTJA 4J6YA 4FYWB 2IVWA 5GAN8 3CCSQ 1Q86R 4M77E 3PIOA 2A3LA 2PUOB 4RTWA 4PLLA 2XDDA 2RM4A 2QTXA 1VQ9Q 2L0AA 2DMOA 5CAIA 3VS5A 2M02A 3HRSA 3INZA 1T3SA 4XU1A 4XU0A 2DL8A 2O9VA 1QWEA 5C0MA 3HRUA 1M5Q1 3CC7T 3CC7Q 5GAMj 2DL5A 5FLXE 4NS5A 3CPWA 1WHJA 3PFSA 1A0NB 4ZTFA 3HFNA 3T9NA 2P84A 2GTOA 4MZTA 2VASA 5FWBA 3VU3C 2NUZA 3M4YA 1WHLA 1OU8A 3CC2T 2DTHA 4IKFA 2YWWA 2DTIA 2ESWA 2DLPA 2VWFA 1DJ7B 3NHNA 1VQ7Q 1OPLA 1Y57A 1ABQA 2M16A 5GAOp 4C92F 4FSXA 2QEXQ 2H8HA 1NEBA 4LUDA 8ATCB 1VQ6A 1WFWA 3M59A 4LDUA 3VYGA 2ROLA 2EBPA 2EW3A 2BIVA 3G6ET 2XKOC 3CPFA 2O01E 1PSFA 5IXFA 1R0BG 3CCMQ 1I5LA 3CCEQ 2KRSA 2LVMA 2RF0A 1KD1U 1G3WA 3A5ZB 2DEUA 3JB9F 1QKWA 2HBPA 4EDUA 2A36A 2C0TA 3OYKA 5GAN3 3G1JA 1N5ZA 2F2XA 5A0LA 2FPDA 4EMGA 5IHNA 4JRQA 1W1FA 3CXCS 2E4HA 3TSWA 4XTYA 1QLYA 4J7FA 1IREB 1MHNA 4F7UA 4WCIA 3VS1A 5L23A 4ZGDB 3GBQA 1VQ5A 3ZL7C 1FYNA 1RADB 2JT4A 4C5GA 2OAUA 1S72A 2A7YA 4QT7A 3ZEHA 4A4HA 4O5VA 1OQKA 1VQ7A 4JJDA 1W4SA 4HT8A 2CZ0B 1ZSGA 1HK9A 4BI4A 2I2LA 3EGUA 4M7AD 1LJOA 4M78G 4DOVA 4M7DE 2LZ6B 2CP2A 2K2VA 2GCXA 2LNVA 2FZCB 4N4HA 2P0QA 2F5KA 1NJIU 1AOJA 2XIDA 2DJQA 4BE1A 1LPLA 2IG0A 5CKBA 5KYNA 3OYHA 1PRMC 3UA6A 2J7IA 3EG1A 3V7SA 4MDXA 4Z02A 1BI1A 1WPYA 3QG1A 2CZ1B 3M56A 2MYSA 1VYUA 2LTOA 2RQTA 1CKAA 4RTUA 3FLGA 2L3QA 1GBQA 4HCKA 3LGFA 3SDZA 2MOXA 4DEYA 4PJOB 5KYYB 3RIRA 4HXJA 1VQ9A 3EG9A 1YFNA 1VQMQ 1N9SA 2DAQA 3QZ5B 3F70A 5GAOr 4EIKA 5GANe 2AT1B 4OP0A 4RKUE 3CCSA 2ZPFB 1WXBA 1Q81C 2KROA 2PVGB 2O31A 4A4KA 1Q82C 2RK1A 3JCMh 4OGEA 3HSBA 3QJ6A 3DLMA 1KC8C 2YLBA 3MO8A 4GY5A 1VQPT 1RLPC 1QP2A 1KHCA 2BTTA 4PJLA 3RESA 1VQ6Q 3MPUB 5KYXA 2X35A 3OYAA 3I56A 1QVGS 3VKIA 2DXUA 2QGFB 5KYUA 3TU4K 1VQ5T 4WF2A 4KUIA 2GF7A 2LX7A 3H9NA 4M78F 2G6FX 1YHQT 4OMPA 2GQVA 1F1BB 2MK5A 1VQ4T 4J8OA 3PT9A 3SB2A 2FHDA 1NPPA 1SG5A 3EG9B 3MP8A 1OZ2A 2EYWA 4M77F 5LJ3j 3L2RA 3QBYA 2QA4T 3JCMd 2W10A 1K0XA 2MWPA 4O6JA 1P92A 2E41A 4IUPA 2E64A 3E19A 1ZSZA 2EJ9A 3QZ9B 4XK8E 1K4US 1RAAB 1E6GA 4R56A 4JLGA 3CMAA 1TOVA 3CMEA 3VV0A 4ELZC 4PJJA 4B9XA 4BUGA 2DNUA 2EIFA 4PJOE 1G8XA 4HT9A 3CCRT 3M54A 3J81E 3OY9A 1AD5A 1IHWA 3RUXA 2KE9A 5LJ3h 4M77B 3REAB 4MDWA 3FJPA 2OI3A 3CC2A 1W2BS 3PNWC 2FEIA 1NM7A 3SFMA 3OMGA 3O5ZA 4RG2A 4M78D 2J6OA 1BB9A 2OTLT 4V2SA 1HXDA 1X2KA 3CCUQ 1VQ6T 2EKHA 3SEMA 1ACMB 3LH0A 1OX9A 2JS0A 2RJEA 1K73U 2W0ZA 2HL3A 4PJOF 2HEQA 5M9OA 3CXCA 4KULA 1LCKA 4XU2A 1ABOA 2J6FA 3FB9A 4M7DB 1JJ2A 1ARKA 4A53A 3NTKA 3PGGA 4J6WA 3O8VA 4OB0B 4J9CA 2ZAEA 2QA4A 3CCQT 2JMCA 2LT4A 4J9IA 1D0ZA 2RI2A 3V8KA 5HK0A 4PFOA 2DE0X 4RTYA 2QXFA 1Q86C 1WI7A 1Y7XA 1YNZA 3JSCA 4J83A 4PKCC 2COWA 2E6ZA 2L2PA 5FU6C 3QO3A 2D8HA 1AT1B 1M90C 4OMMA 2VV5A 3VS6A 3D7SB 1K8AU 1XJWB 2HL5C 1MV3A 2DJZA 1TUGB 3G71Q 3PTAA 1I8FA 2QK0A 2B86A 4ZGEB 2EYXA 2C0OA 4Y91A 2WSCE 1UGSB 3I55Q 4OMFB 2LJ1A 3CPWS 2KK4A 1O9SA 1X43A 3CCJT 2QDYB 4E7KA 4JS4A 4PJOG 4XTVA 3X28B 4RCBA 1KD1C 5A0DA 4LD9K 5LJ3g 3OB9A 2KEAA 3UDCA 2RO0A 2D8JA 2VGMA 1NBEB 2FL7A 2GNCA 4KGVB 2DVEA 1SHGA 2PUKB 4OMNA 4M77D 5IH2A 2JM9A 2FZGB 1VYVA 2RQWA 1M2VB 4A54A 3JB9G 4OMLA 3S3MA 1BIAA 3CCUA 1YJ9A 2MWOA 1VQNA 1VUBA 1VQPA 5CKDA 2YSQA 1Q7YU 1OPKA 1QCFA 1WNLA 4J7IA 2QQRA 4C92C 1ZX6A 3JB9J 1YJNA 5GMKi 5D6XA 4E7SA 2XD0A 1X2QA 3CC4T 3CCQA 2AZSA 2SRCA 1W70A 4C92E 1O75A 3C12A 5CKFA 2EAYA 2FB7A 1VQ4A 1N6AA 1UGVA 3CMAQ 4DBRA 2CKKA 1M1KU 5GMKh 3CC4Q 4FSSA 4Z89A 4RTZA 3E2UA 4OB2B 4HCCA 2KBTA 4LDWA 2MI6A 1PSEA 1NJIC 3TSZA 4FYVB 2RHIA 3CCMT 5A0GA 3TVTA 4M7DA 5J39A 4PJMA 1Y0MA 5I21A 2EQIA 4LE9A 1VQLQ 3AT1B 2A37A 4R0KA 4PFZA 4F14A 5LJ5j 3LYIA 3EG2A 3CD6A 4QVDA 2D0NA 5CVIA 1Q86U 4M75F 4DBHA 5GAOq 1U8RA 5GAMe 1YJ9T 1S72Q 1C0MA 4XTXA 1UGRB 1SRMA 4QQ6A 3GLXA 3H6ZA 1TXQA 4OB1B 4FW1A 2KYMA 5D7UA 1IXDA 1K8AC 2K79A 2E65A 4EMKA 2HMAA 4LDYA 2GGRA 1JXOA 2DX1A 4FW2A 5IN1A 2DBMA 1R0CB 1TTHB 2A0FB 4KH1B 1JEGA 2CS7A 1X6OA 4OGCA 2YT6A 2HSEB 1QQJA 3L2WA 3UPUA 2FPFA 2LT1A 1ZHIA 3JCMP 1WXUA 2ED0A 2KXCA 2F69A 1FMWA 5GMKe 4X34A 2JVVA 3CCMA 3AHUA 1YI2T 1VQKQ 4M7DC 2DKGA 5DM7R 3S3OA 3GPLA 2DERA 1W2BP 5GAN7 1QVFA 3HP9A 3M4GA 2KAFA 1ZA2B 3M0TA 2CP5A 1NG2A 3KFVA 4OMOA 4VUBA 3R6OA 3VJPA 4C8QG 5IHKA 1YIJQ 1LVKA 5LJ5d 2D0QB 3A1PA 1S72T 4HVWA 2K57A 3L2VA 5CK9A 1YP5A 1UECA 3JCMV 1UE9A 2O4XA 2K3YA 4J6XA 4F04B 4JLIA 4M7AC 3HTRA 3UATA 4MMLA 1OX8A 3NFCA 2EFIA 4C8QC 4M75A 3L2QA 2RI5A 5GAOl 5GJVB 1TS9A 3REBB 2DEQA 1N8RC 1FWZA 1AZGB 2FVUA 4X1VA 2YRCA 2ZZDA 2JW4A 2FG0A 1QP3A 1VQKT 1ZSZC 4CRIA 4OB3B 3JCMb 1QVGP 2XG8D 3FIFA 2LQNA 1VQMT 3LGLA 3X20B 3QWXX 2F5TX 1Y96B 4C92G 4CC7A 1WHGA 5CIUA 4JZ4A 1H3HA 1MMDA 4OVAA 3C95A 2J06A 1M3BA 4J9BA 2X9HA 3ULRB 4M4ZA 3L42A 3E9GA 2R58A 6AT1B 1FMKA 2O4XB 2XI9A 4C8QD 2K5LA 2K3XA 2EYYA 2VGNA 3S3NA 1M90R 3RBBB 1VQNT 3M0PA 1SRLA 2CZ6B 3SWNC 2CSIA 4ZGJB 3CCET 2K2MA 2I0NA 4FT2A 2XDBA 1ZUYA 1Q82U 2J6KA 3CD6Q 2AZVA 2DK3A 5I2MA 1WA7A 2WSEE 4B6MA 3BY7A 2QG9B 5I11A 2XK0A 2YUNA 3VYHB 2ED1A 1ZBXA 4CI0C 5GAMg 4PJOC 3FRNA 1W6XA 4JJBA 1X01A 1IRXA 3JCMg 3Q1JA 3H0IA 2O2OA 3V7RA 4LDVA 1EZZB 3G6EA 1WXTA 4LN2A 4C0GA 3EFOB 2NWMA 2KRMA 1EIFA 3CCLT 1U1TA 3S6WA 2CP3A 1UEBA 1M3AA 4RUGA 2V1QA 1WIEA 3JCMf 3G4SQ 2KNBB 4II1A 3THKA 1CSKA 3CPWP 1NEGA 2L3RA 1IB8A 3H0FA 1YJNQ 5GAN5 5FU7C 4QQDA 1ZBJA 1OU9A 3JB9H 5HY6A 3VUBA 3PMIA 4M77G 5CQXA 1V1CA 1BIBA 5GMKl 4RTXA 1K9MR 4MZMA 1YJ9Q 2QA4Q 3JCMc 1RL2A 2O88A 3H0HA 5AT1B 2KT1A 7AT1B 2PQWA 2X4YA 2CDTA 4BI3A 2KMTA 3JCMJ 1M1GA 4F7UB 1PWTA 1BK2A 3NGPA 1YHQQ 5GANf 2E10A 1ZSZB 1KIKA 3OW2A 3HHTB 2BE7D 3A8OB 3I5RA 5LL6S 2V1RA 4KT0E 3GF5A 1M1KC 2MF2A 4QW2A 5GJWB 4E6RA 3EFSA 4RG8A 4C8QB 1Z9ZA 2KYBA 1RAGB 3I55T 2CP0A 2R5MA 4AFQC 3P8BB 4PJOA 3OYLA 3VRYA 2NYSA 4PJNA 2AK5A 2M0OA 1U1SA 2LDMA 4A4GA 2BZXA 2HQHA 3ME9A 4BE0A 4EMKB 3OYNA 1V29B 2E5KA 1TH7A 1FXXA 5J26A 3JCMX 2PU9B 1YITQ 1YWOA 4IURA 5GAMd 4LNPA 1OZ3A 2DL4A 4AFSC 1WGSA 4PNOA 4D6WA 4B9WA 1Y71A 1MMNA 3CCLA 1OYXA 2DM1A 3L1AA 1YIJT 1ZUKA 2D6FA 1GBRA 5KCOA 3G7ZA 1UUEA 4HVVA 2K3BA 2LCCA 5DLQE 3OS1A 1XQHA 2CT3A 2CP7A 3GOXA 2EQUA 1AZEA 1D1BA 3M0SA 2NUTB 2M9UA 1NYFA 3I56T 3RMSA 3JB9D 1PD1A 2BKDN 4M77A 2EQMA 3EGXA
chains in the Genus database with same CATH topology
1W2BP 1KD1R 3G6EQ 3CPWP 3CCLQ 3CCQQ 1YI2Q 1VQ8Q 1KC8R 1K8AR 3G71Q 1Q81R 3CCMQ 1YITQ 3CCEQ 1YJNQ 2OTLQ 1VQ7Q 1K73R 1VQ5Q 1VQ9Q 3CC7Q 2OTJQ 1Q82R 3CCRQ 1QVGP 1N8RR 1NJIR 3CCVQ 1S72Q 1JJ2P 1YJWQ 2QEXQ 3CD6Q 3CC2Q 3I56Q 1YJ9Q 1YHQQ 1KQSP 3CXCP 3I55Q 3CMEQ 1VQMQ 1YIJQ 1VQLQ 3CMAQ 3CCJQ 1Q7YR 1QVFP 1VQKQ 1VQPQ 1VQ6Q 1M1KR 1VQOQ 1K9MR 3OW2P 1M90R 1VQ4Q 1VQNQ 3CC4Q 2QA4Q 3CCUQ 3CCSQ 3G4SQ 1Q86R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B P;  1KD1 R;  3G6E Q;  3CPW P;  3CCL Q;  3CCQ Q;  1YI2 Q;  1VQ8 Q;  1KC8 R;  1K8A R;  3G71 Q;  1Q81 R;  3CCM Q;  1YIT Q;  3CCE Q;  1YJN Q;  2OTL Q;  1VQ7 Q;  1K73 R;  1VQ5 Q;  1VQ9 Q;  3CC7 Q;  2OTJ Q;  1Q82 R;  3CCR Q;  1QVG P;  1N8R R;  1NJI R;  3CCV Q;  1S72 Q;  1JJ2 P;  1YJW Q;  2QEX Q;  3CD6 Q;  3CC2 Q;  3I56 Q;  1YJ9 Q;  1YHQ Q;  1KQS P;  3CXC P;  3I55 Q;  3CME Q;  1VQM Q;  1YIJ Q;  1VQL Q;  3CMA Q;  3CCJ Q;  1Q7Y R;  1QVF P;  1VQK Q;  1VQP Q;  1VQ6 Q;  1M1K R;  1VQO Q;  1K9M R;  3OW2 P;  1M90 R;  1VQ4 Q;  1VQN Q;  3CC4 Q;  2QA4 Q;  3CCU Q;  3CCS Q;  3G4S Q;  1Q86 R; 
#chains in the Genus database with same CATH topology
 2RHX A;  2OJ2 A;  1SPK A;  2BUD A;  2CGH A;  1UJ0 A;  5KYW A;  2VXF A;  4XTW A;  1VQ8 A;  2P0P A;  2GFA A;  4M78 A;  3X26 B;  4AG1 C;  3TEE A;  2FZK B;  4XQ3 A;  2GFU A;  4C0Z A;  4AFU C;  3QII A;  3OBW A;  4C5H A;  1HYO A;  2QQS A;  2CH4 A;  2KR3 A;  3CCV T;  1T0J A;  2JZ2 A;  1EX4 A;  2KY9 A;  1AVZ C;  5IHI A;  3E1S A;  2CYZ B;  1UGQ B;  3OYE A;  2LP5 A;  2MPX C;  2KI7 A;  3CME Q;  4BDZ A;  3P8H A;  1H8K A;  1UG1 A;  3OSS C;  2X4X A;  3C94 A;  1RAF B;  1YN8 A;  5FRM A;  4JPB W;  1HJD A;  3JCM e;  4BAC A;  1AHJ B;  1M9S A;  2LQ8 A;  4K11 A;  2KVQ G;  2ZGW A;  5KE3 A;  1T3L A;  3C0C A;  2E6N A;  1BCM A;  1BKB A;  1Q95 G;  2YUP A;  1PD0 A;  4QKU A;  3GNF B;  3QJY A;  4GBQ A;  2H3E B;  2F2V A;  1MGQ A;  2RJF A;  3CME T;  3HKS A;  3LH5 A;  5I2S A;  1G3T A;  5DLO A;  2JS2 A;  2DIG A;  2XDP A;  4M78 C;  1Q81 R;  3RMQ A;  5EC7 A;  3UA7 A;  3ZBD A;  4FIB A;  4EPC A;  1UFF A;  4ME7 A;  1OUL A;  2V8J A;  3A8M B;  3CCV A;  2QDL A;  4BD3 A;  1Q7Y R;  2A08 A;  2BZY A;  1B7T A;  3BE3 A;  1G83 A;  4P5N A;  2HZY A;  1LOJ A;  4JS5 A;  2C06 A;  1KQ2 A;  4ANJ A;  2MCN A;  1I1J A;  3MHX A;  4KBM B;  1QMC A;  2HQX A;  4QVC A;  1VQO T;  2QI2 A;  2RQV A;  3FC3 A;  1MMA A;  2E5Q A;  2EJG A;  2KXD A;  1GCP A;  2P0K A;  4FCY A;  2CSQ A;  4A63 B;  4F7U F;  3JCM W;  4M7D D;  2HBW A;  2COZ A;  4HVU A;  3M58 A;  4E47 A;  2LCL A;  4Y28 E;  3IQL A;  5GAM f;  4QVZ A;  3MEU A;  1SSH A;  1I0C A;  1WX6 A;  1S1N A;  3VRZ A;  2DL7 A;  2QEX A;  3CCV Q;  2EGC A;  4ATO A;  4F16 A;  5GAM h;  1MNE A;  3J7A F;  1R8O B;  1BI0 A;  1KJW A;  5CR2 A;  4F7U E;  4E2F B;  4IIM A;  4IUT A;  2L89 A;  2JMA A;  3CBP A;  1RLQ C;  2DRM A;  1M8M A;  2DZ9 A;  1WJS A;  4KRT A;  2DPP B;  4AMC A;  1D0X A;  3FDR A;  2MMP A;  4JUV A;  2D1X A;  3X24 B;  1B07 A;  1YIJ A;  2YUO A;  4Z8A A;  2KSS A;  1MV0 B;  4CC3 A;  3OMC A;  2ENM A;  2RA2 A;  4OMQ A;  1NJI R;  4M7D F;  2DD5 A;  5LJ3 e;  3ZFJ A;  4KGZ B;  3I9Q A;  1JJ2 S;  1QCN A;  2L8D A;  1IGQ A;  2LNH B;  1NE8 A;  4X9C A;  2QGG A;  1BCO A;  1JB0 E;  2EGA A;  4ORZ A;  2K5F A;  5FRN A;  1K1Z A;  2CRE A;  3X25 B;  4BE2 A;  4M7D G;  4RTT A;  3OSV A;  1PNJ A;  1LNX A;  4LD6 A;  5FW9 A;  1K9M C;  1U3O A;  2QAZ A;  4EMK C;  3CCE A;  1ZLM A;  1K0S A;  2E12 A;  1SEM A;  2HD0 A;  1GL5 A;  4DBQ A;  3QWY A;  5GAN d;  2EPD A;  3GP8 A;  2KDS A;  4M77 C;  2E3H A;  5LJ5 g;  5AYF A;  1VQ7 T;  4ZN1 A;  1W2B A;  4JDS A;  3OW2 P;  2HKQ B;  3RDV A;  3H41 A;  1ZA1 B;  5KCH A;  3A98 A;  2RHZ A;  3WXM B;  2G3R A;  2KGT A;  3CBO A;  1NLP C;  3ER0 A;  1N8R R;  2Y4Y A;  3EHR A;  1WHH A;  4F17 A;  2ZPH B;  2VKN A;  4LDX A;  3QKJ A;  2OX7 A;  2R57 A;  2YUQ A;  2K4Y A;  3OYY A;  3EGD A;  2CH4 W;  5D6Y A;  5GAN h;  3KUF A;  1MUZ A;  5GAO m;  2EVR A;  5GAN 4;  5CKE A;  3OYM A;  4DOW A;  5IT9 E;  2FPE A;  3OS0 A;  4C0D C;  2EYZ A;  4Q5W A;  4D8K A;  4GLK A;  1HD3 A;  1C6V X;  3ASK A;  5GAN 2;  1K9M U;  2PNI A;  2JJ9 A;  1PG5 B;  4JJC A;  3OYD A;  2EWN A;  3PVL A;  1I07 A;  4C8Q A;  1PRL C;  1WJQ A;  1WLP B;  4M75 G;  2YRV A;  2ZCF B;  3P8D A;  3JRZ A;  5GAN j;  3TRE A;  1H3Z A;  2CZ7 B;  1VYT A;  1PKS A;  1KC8 U;  4L6V 5;  4PFP A;  2JXB A;  5GAN 6;  4M78 B;  4L59 A;  1VQN Q;  2HCK A;  2XMF A;  2Y4X A;  4J9E A;  3EG0 A;  1UHC A;  1MND A;  2HDA A;  3QYG B;  3MEA A;  4ELY C;  4CC4 B;  2OTL Q;  2EJF A;  1VIE A;  1YIT T;  4OF1 A;  3A8G B;  3OYB A;  2DD4 A;  1Y96 A;  3UT1 A;  2XHC A;  2DXB A;  3FEO A;  3QUI A;  1M1F A;  2X3W D;  1YI2 A;  1OOT A;  2DF6 A;  2EQJ A;  1U06 A;  3QSU A;  5LJ5 h;  4M75 E;  4PLI A;  4BY6 B;  3UWN A;  1Q82 R;  4WTO B;  2EKO A;  3QPH A;  3UF4 A;  2LX9 A;  5FRO A;  2RH2 A;  4TVR A;  1BI2 A;  1VQO A;  4C92 D;  2QAS A;  5LJ5 f;  2VUB A;  2V8I A;  3I55 A;  3QDR B;  2O9S A;  1K73 R;  4JRP A;  4JZ3 A;  5KYW B;  3OYG A;  3MP1 A;  1RI0 A;  5ECA A;  3G71 A;  1WHM A;  2OTJ T;  2HNI A;  4FU6 A;  2B8A A;  2V26 A;  1WYX A;  1QW1 A;  4KUD K;  2QEX T;  4FYY B;  4AFZ C;  5KYY A;  2Z0W A;  1VQO Q;  3NTI A;  5D6W A;  2OTJ Q;  4GLM A;  2WAC A;  4ZNX A;  5DY9 A;  4L5G A;  2C0I A;  2DRK A;  2ZPG B;  1Z9Q A;  2K7A A;  3U23 A;  2V8K A;  1KFZ A;  4NL3 A;  2RI3 A;  2DL3 A;  3A8L B;  2AKK A;  5CO7 A;  3WVD B;  3DB3 A;  1UGP B;  4M7A B;  4N4G A;  1I5O B;  5A2Q E;  1EFN A;  4M7A F;  1K8A R;  1H92 A;  3VS3 A;  2OTL A;  2EYQ A;  2LQK A;  1KQS S;  2CUB A;  1KK7 A;  1K9A A;  5IAY A;  3PIP A;  1GXI E;  4C8Q F;  2KT8 A;  3DKM A;  1IGU A;  3HPW A;  1JJ2 P;  1RAI B;  3OYJ A;  4JJN K;  3E9F A;  2L3P A;  3URG A;  3QYH B;  9ATC B;  3G71 T;  3DLL A;  1JXM A;  1X75 C;  2E70 A;  2IIM A;  5LJ3 f;  1M90 U;  2PVO B;  1UB4 A;  3GNG A;  1D1C A;  1KQS A;  3MJX A;  3EFR A;  1T0H A;  2LC4 A;  2LQW A;  1I4K 1;  2K6D A;  2WSF E;  2YHT A;  3V8L A;  5KE2 A;  1M2O A;  4J9D A;  2XU8 A;  3RNJ A;  4ZN3 A;  3GIB A;  1WJR A;  2NUP B;  1AWX A;  4FL6 A;  2QYZ A;  1KSW A;  2P4T A;  1YHQ A;  3HRT A;  3VS0 A;  3G6E Q;  1YBY A;  2JTE A;  3RR6 A;  3OYC A;  1D3B A;  1TU0 B;  1YWP A;  1PM3 A;  2JN0 A;  1BU1 A;  3SHW A;  1V76 A;  2PVD B;  1YJW Q;  2RK2 A;  2J05 A;  1GFD A;  3OQ5 A;  3M53 A;  2RB6 A;  3WVE B;  3JB9 I;  4M7A G;  1M3C A;  2ECZ A;  1N9R A;  4X9D A;  1QWF A;  1RAC B;  4DEX A;  1XNI A;  2GQI A;  3CCR A;  2YDL A;  2YXY A;  5GAO n;  4Z88 A;  4J5Y A;  2KQW A;  1FX7 A;  4BI8 B;  1TUD A;  1QKX A;  2RJC A;  1AWJ A;  3I56 Q;  3TQ7 P;  4BB7 A;  3OYF A;  1GRI A;  3M57 A;  1X6B A;  4E7I A;  2ROT A;  3OYI A;  1QVF P;  2JUF A;  2DZC A;  1NPR A;  2ZPE B;  2DXT A;  2IPO B;  2COY A;  2K9G A;  1RI9 A;  1D09 B;  1VQK A;  2RHY A;  1BYM A;  4BY6 C;  3LLR A;  3V8J A;  5GMK j;  1VOM A;  1K73 C;  4YTL A;  1B3Q A;  1SF9 A;  2RHU A;  4MMK A;  3OW2 S;  2E3I A;  1ZQ1 A;  4HKE A;  2A28 A;  1WHK A;  4HA8 A;  1IZ6 A;  2LCS A;  3I35 A;  3M0R A;  3HFO A;  4Y92 A;  3CMA T;  1VQM A;  1IO6 A;  3OBY A;  4FT4 A;  1M2V A;  1M30 A;  2OAW A;  2EQK A;  3MET A;  2LJ3 A;  3QDF A;  2X4J A;  3MKD A;  2AHJ B;  3EGD B;  3MEW A;  3EH1 A;  1SHF A;  1UHF A;  4C5I A;  2DYB A;  1NZ9 A;  2X51 A;  3PVQ A;  5CQY A;  4KH0 B;  3VS7 A;  4FM4 B;  2MIO A;  1PCX A;  2H3J A;  1VQ8 T;  2P4R A;  1Q81 U;  2VB6 A;  1NYG A;  1KC8 R;  1RAH B;  3EGX B;  3LWH A;  1X27 A;  1VQL A;  2RD1 A;  1B34 B;  2QQ9 A;  2RPN A;  4F7U G;  3EH2 A;  1IHV A;  4C92 A;  5KH6 A;  3CC7 A;  1E7O A;  3L2U A;  1YJW T;  2JTM A;  3M0U A;  2FRY A;  5KYU B;  2VYT A;  3BFM A;  3CD6 T;  3LX7 A;  1JO8 A;  1JU5 C;  3RKY A;  1SKU B;  3C4S A;  1VQ5 Q;  2DET A;  2JNG A;  2NUT A;  1GFC A;  5LJ3 d;  3I5S A;  4DBF A;  2NUP A;  1XOV A;  2FYK A;  1VA7 A;  3RKX A;  3KXT A;  1M8V A;  2NLU A;  2CUD A;  3EAE A;  4J9H A;  2VXE A;  2DVJ A;  2CT4 A;  1VQL T;  1RUW A;  3QHS A;  5EG2 A;  5HKC A;  4A4F A;  3SWN A;  1NLO C;  2D9T A;  2DYI A;  1JQQ A;  1C1A A;  2ZPB B;  5FU6 B;  3CXC P;  2RNA A;  4IUU A;  5GMK m;  5GAN g;  2BZ8 A;  4C5E A;  3N5B B;  1WQW A;  1AEY A;  1YCY A;  1U5S A;  2SEM A;  3CCU T;  2HSP A;  2EGE A;  3BDU A;  1Q7Y C;  2LJ0 A;  4AG2 C;  1KD1 R;  2QQB A;  1G3Y A;  4HCZ A;  2AIR B;  1BBZ A;  3NTH A;  1VQ9 T;  1SSF A;  2DXC A;  3JCM Q;  2RJD A;  2VVK A;  3CCR Q;  1TSF A;  5LJ5 e;  4PL6 A;  1H64 1;  4NOY A;  4XTU A;  8AT1 B;  4LUE A;  3BW1 A;  2DFU A;  4CC2 A;  3V7C A;  4E7J A;  2F1L A;  2GBQ A;  2L5Q A;  1GCQ A;  2RQR A;  1YJW A;  2X4W A;  1XTD A;  3CCL Q;  1X6G A;  3MEV A;  1WZO A;  3NPF A;  2AKL A;  2X3X D;  3VUZ A;  1QCO A;  2M51 A;  4HCB A;  1D0Y A;  3CC4 A;  3EHQ A;  1R77 A;  1YIT A;  1Y07 A;  3L2Z A;  1N27 A;  5FWC A;  1VQ4 Q;  3JAM E;  4XTZ A;  1ZUU A;  5HK3 A;  1VIF A;  4J9G A;  3CEY A;  3CCQ Q;  5KYX B;  5J3B A;  4NL2 A;  2E1H A;  1QVG A;  2XIC A;  2YLC A;  2K5I A;  3SD4 A;  4M7A A;  1G3S A;  3NMZ C;  5I22 A;  4AT1 B;  4M78 E;  4E7H A;  3G4S T;  4ZTJ A;  4J9F A;  4JRK A;  3CCJ Q;  2JTF A;  4C0F A;  4N4I A;  1VQP Q;  2Y90 A;  2KRN A;  1KG1 A;  1OI1 A;  4EMH A;  2CP6 A;  1BI3 A;  3PE0 A;  2BE9 B;  3M0Q A;  4M75 C;  4PJO D;  1YI2 Q;  1D3B B;  1UTI A;  1VQ8 Q;  1QVF S;  3EG3 A;  1G5V A;  1AWO A;  2YRD A;  3CQT A;  5L8R E;  2FO0 A;  3M5A A;  1K76 A;  5IXB A;  4N0A C;  4BDY A;  2FRW A;  1GCQ C;  2M1H A;  3JV3 A;  4QQG A;  2LRQ A;  4IUQ A;  2HAX A;  3A8H B;  2DBK A;  1KQ1 A;  3VS4 A;  4M75 D;  3LW5 E;  4D8D A;  3H8Z A;  3CCJ A;  1D1A A;  2HQE A;  1YCS B;  4DA4 A;  4M7A E;  2MAM A;  1N8R U;  2QTV A;  3VS2 A;  1RAB B;  5FU7 B;  3CC2 Q;  2OTJ A;  4C8Q E;  1B34 A;  2QQA A;  5CCA A;  1TWB A;  2RMO A;  1TG0 A;  3FJ5 A;  1JBM A;  3CBM A;  4C92 B;  3CCS T;  1M1K R;  2DTO A;  5C6S A;  3G4S A;  2LMJ A;  2DIL A;  4E7L A;  3OS5 A;  3MCA B;  1J3T A;  1M27 C;  4IUV A;  3OS2 A;  4ESR A;  1M4Z A;  3BDL A;  4RCC A;  1TUC A;  2M0Y A;  2RQU A;  2RN8 A;  2ZPI B;  2HKN A;  3LWI A;  1G2B A;  1MMG A;  3TCJ A;  1PKT A;  3QXE B;  1JRI A;  4DQ2 A;  2DO3 A;  1HSQ A;  2PZ1 A;  2F2W A;  3RER A;  3J80 E;  4JRI A;  1UJY A;  2DA9 A;  4UC4 A;  1WDX A;  4IIO A;  4RTV A;  3HL8 A;  1WQ7 A;  5HCK A;  4RMO A;  3M9Q A;  3MP6 A;  1CKB A;  3RKW A;  1YJN T;  1KQS P;  3KBG A;  2VC8 A;  1PC0 A;  3SWN B;  1I81 A;  3PMT A;  4C0D B;  4LXC A;  4A4E A;  1OEB A;  2DIQ A;  4XU3 A;  1FMV A;  4PK4 A;  4FYX B;  2L3S A;  4E7Z A;  5CKH A;  2ATC B;  1OV3 A;  4N0A A;  4MZP A;  2JM8 A;  4R55 A;  1PHT A;  2PTK A;  3OA6 A;  1AWW A;  1QVP A;  3R6N A;  1KHI A;  3DB4 A;  2R5A A;  4KGX B;  4M75 B;  3M55 A;  4XAX B;  1X69 A;  1E6H A;  2JOY A;  3EFO A;  1UDL A;  1RAE B;  2ABL A;  2GTJ A;  4J6Y A;  4FYW B;  2IVW A;  5GAN 8;  3CCS Q;  1Q86 R;  4M77 E;  3PIO A;  2A3L A;  2PUO B;  4RTW A;  4PLL A;  2XDD A;  2RM4 A;  2QTX A;  1VQ9 Q;  2L0A A;  2DMO A;  5CAI A;  3VS5 A;  2M02 A;  3HRS A;  3INZ A;  1T3S A;  4XU1 A;  4XU0 A;  2DL8 A;  2O9V A;  1QWE A;  5C0M A;  3HRU A;  1M5Q 1;  3CC7 T;  3CC7 Q;  5GAM j;  2DL5 A;  5FLX E;  4NS5 A;  3CPW A;  1WHJ A;  3PFS A;  1A0N B;  4ZTF A;  3HFN A;  3T9N A;  2P84 A;  2GTO A;  4MZT A;  2VAS A;  5FWB A;  3VU3 C;  2NUZ A;  3M4Y A;  1WHL A;  1OU8 A;  3CC2 T;  2DTH A;  4IKF A;  2YWW A;  2DTI A;  2ESW A;  2DLP A;  2VWF A;  1DJ7 B;  3NHN A;  1VQ7 Q;  1OPL A;  1Y57 A;  1ABQ A;  2M16 A;  5GAO p;  4C92 F;  4FSX A;  2QEX Q;  2H8H A;  1NEB A;  4LUD A;  8ATC B;  1VQ6 A;  1WFW A;  3M59 A;  4LDU A;  3VYG A;  2ROL A;  2EBP A;  2EW3 A;  2BIV A;  3G6E T;  2XKO C;  3CPF A;  2O01 E;  1PSF A;  5IXF A;  1R0B G;  3CCM Q;  1I5L A;  3CCE Q;  2KRS A;  2LVM A;  2RF0 A;  1KD1 U;  1G3W A;  3A5Z B;  2DEU A;  3JB9 F;  1QKW A;  2HBP A;  4EDU A;  2A36 A;  2C0T A;  3OYK A;  5GAN 3;  3G1J A;  1N5Z A;  2F2X A;  5A0L A;  2FPD A;  4EMG A;  5IHN A;  4JRQ A;  1W1F A;  3CXC S;  2E4H A;  3TSW A;  4XTY A;  1QLY A;  4J7F A;  1IRE B;  1MHN A;  4F7U A;  4WCI A;  3VS1 A;  5L23 A;  4ZGD B;  3GBQ A;  1VQ5 A;  3ZL7 C;  1FYN A;  1RAD B;  2JT4 A;  4C5G A;  2OAU A;  1S72 A;  2A7Y A;  4QT7 A;  3ZEH A;  4A4H A;  4O5V A;  1OQK A;  1VQ7 A;  4JJD A;  1W4S A;  4HT8 A;  2CZ0 B;  1ZSG A;  1HK9 A;  4BI4 A;  2I2L A;  3EGU A;  4M7A D;  1LJO A;  4M78 G;  4DOV A;  4M7D E;  2LZ6 B;  2CP2 A;  2K2V A;  2GCX A;  2LNV A;  2FZC B;  4N4H A;  2P0Q A;  2F5K A;  1NJI U;  1AOJ A;  2XID A;  2DJQ A;  4BE1 A;  1LPL A;  2IG0 A;  5CKB A;  5KYN A;  3OYH A;  1PRM C;  3UA6 A;  2J7I A;  3EG1 A;  3V7S A;  4MDX A;  4Z02 A;  1BI1 A;  1WPY A;  3QG1 A;  2CZ1 B;  3M56 A;  2MYS A;  1VYU A;  2LTO A;  2RQT A;  1CKA A;  4RTU A;  3FLG A;  2L3Q A;  1GBQ A;  4HCK A;  3LGF A;  3SDZ A;  2MOX A;  4DEY A;  4PJO B;  5KYY B;  3RIR A;  4HXJ A;  1VQ9 A;  3EG9 A;  1YFN A;  1VQM Q;  1N9S A;  2DAQ A;  3QZ5 B;  3F70 A;  5GAO r;  4EIK A;  5GAN e;  2AT1 B;  4OP0 A;  4RKU E;  3CCS A;  2ZPF B;  1WXB A;  1Q81 C;  2KRO A;  2PVG B;  2O31 A;  4A4K A;  1Q82 C;  2RK1 A;  3JCM h;  4OGE A;  3HSB A;  3QJ6 A;  3DLM A;  1KC8 C;  2YLB A;  3MO8 A;  4GY5 A;  1VQP T;  1RLP C;  1QP2 A;  1KHC A;  2BTT A;  4PJL A;  3RES A;  1VQ6 Q;  3MPU B;  5KYX A;  2X35 A;  3OYA A;  3I56 A;  1QVG S;  3VKI A;  2DXU A;  2QGF B;  5KYU A;  3TU4 K;  1VQ5 T;  4WF2 A;  4KUI A;  2GF7 A;  2LX7 A;  3H9N A;  4M78 F;  2G6F X;  1YHQ T;  4OMP A;  2GQV A;  1F1B B;  2MK5 A;  1VQ4 T;  4J8O A;  3PT9 A;  3SB2 A;  2FHD A;  1NPP A;  1SG5 A;  3EG9 B;  3MP8 A;  1OZ2 A;  2EYW A;  4M77 F;  5LJ3 j;  3L2R A;  3QBY A;  2QA4 T;  3JCM d;  2W10 A;  1K0X A;  2MWP A;  4O6J A;  1P92 A;  2E41 A;  4IUP A;  2E64 A;  3E19 A;  1ZSZ A;  2EJ9 A;  3QZ9 B;  4XK8 E;  1K4U S;  1RAA B;  1E6G A;  4R56 A;  4JLG A;  3CMA A;  1TOV A;  3CME A;  3VV0 A;  4ELZ C;  4PJJ A;  4B9X A;  4BUG A;  2DNU A;  2EIF A;  4PJO E;  1G8X A;  4HT9 A;  3CCR T;  3M54 A;  3J81 E;  3OY9 A;  1AD5 A;  1IHW A;  3RUX A;  2KE9 A;  5LJ3 h;  4M77 B;  3REA B;  4MDW A;  3FJP A;  2OI3 A;  3CC2 A;  1W2B S;  3PNW C;  2FEI A;  1NM7 A;  3SFM A;  3OMG A;  3O5Z A;  4RG2 A;  4M78 D;  2J6O A;  1BB9 A;  2OTL T;  4V2S A;  1HXD A;  1X2K A;  3CCU Q;  1VQ6 T;  2EKH A;  3SEM A;  1ACM B;  3LH0 A;  1OX9 A;  2JS0 A;  2RJE A;  1K73 U;  2W0Z A;  2HL3 A;  4PJO F;  2HEQ A;  5M9O A;  3CXC A;  4KUL A;  1LCK A;  4XU2 A;  1ABO A;  2J6F A;  3FB9 A;  4M7D B;  1JJ2 A;  1ARK A;  4A53 A;  3NTK A;  3PGG A;  4J6W A;  3O8V A;  4OB0 B;  4J9C A;  2ZAE A;  2QA4 A;  3CCQ T;  2JMC A;  2LT4 A;  4J9I A;  1D0Z A;  2RI2 A;  3V8K A;  5HK0 A;  4PFO A;  2DE0 X;  4RTY A;  2QXF A;  1Q86 C;  1WI7 A;  1Y7X A;  1YNZ A;  3JSC A;  4J83 A;  4PKC C;  2COW A;  2E6Z A;  2L2P A;  5FU6 C;  3QO3 A;  2D8H A;  1AT1 B;  1M90 C;  4OMM A;  2VV5 A;  3VS6 A;  3D7S B;  1K8A U;  1XJW B;  2HL5 C;  1MV3 A;  2DJZ A;  1TUG B;  3G71 Q;  3PTA A;  1I8F A;  2QK0 A;  2B86 A;  4ZGE B;  2EYX A;  2C0O A;  4Y91 A;  2WSC E;  1UGS B;  3I55 Q;  4OMF B;  2LJ1 A;  3CPW S;  2KK4 A;  1O9S A;  1X43 A;  3CCJ T;  2QDY B;  4E7K A;  4JS4 A;  4PJO G;  4XTV A;  3X28 B;  4RCB A;  1KD1 C;  5A0D A;  4LD9 K;  5LJ3 g;  3OB9 A;  2KEA A;  3UDC A;  2RO0 A;  2D8J A;  2VGM A;  1NBE B;  2FL7 A;  2GNC A;  4KGV B;  2DVE A;  1SHG A;  2PUK B;  4OMN A;  4M77 D;  5IH2 A;  2JM9 A;  2FZG B;  1VYV A;  2RQW A;  1M2V B;  4A54 A;  3JB9 G;  4OML A;  3S3M A;  1BIA A;  3CCU A;  1YJ9 A;  2MWO A;  1VQN A;  1VUB A;  1VQP A;  5CKD A;  2YSQ A;  1Q7Y U;  1OPK A;  1QCF A;  1WNL A;  4J7I A;  2QQR A;  4C92 C;  1ZX6 A;  3JB9 J;  1YJN A;  5GMK i;  5D6X A;  4E7S A;  2XD0 A;  1X2Q A;  3CC4 T;  3CCQ A;  2AZS A;  2SRC A;  1W70 A;  4C92 E;  1O75 A;  3C12 A;  5CKF A;  2EAY A;  2FB7 A;  1VQ4 A;  1N6A A;  1UGV A;  3CMA Q;  4DBR A;  2CKK A;  1M1K U;  5GMK h;  3CC4 Q;  4FSS A;  4Z89 A;  4RTZ A;  3E2U A;  4OB2 B;  4HCC A;  2KBT A;  4LDW A;  2MI6 A;  1PSE A;  1NJI C;  3TSZ A;  4FYV B;  2RHI A;  3CCM T;  5A0G A;  3TVT A;  4M7D A;  5J39 A;  4PJM A;  1Y0M A;  5I21 A;  2EQI A;  4LE9 A;  1VQL Q;  3AT1 B;  2A37 A;  4R0K A;  4PFZ A;  4F14 A;  5LJ5 j;  3LYI A;  3EG2 A;  3CD6 A;  4QVD A;  2D0N A;  5CVI A;  1Q86 U;  4M75 F;  4DBH A;  5GAO q;  1U8R A;  5GAM e;  1YJ9 T;  1S72 Q;  1C0M A;  4XTX A;  1UGR B;  1SRM A;  4QQ6 A;  3GLX A;  3H6Z A;  1TXQ A;  4OB1 B;  4FW1 A;  2KYM A;  5D7U A;  1IXD A;  1K8A C;  2K79 A;  2E65 A;  4EMK A;  2HMA A;  4LDY A;  2GGR A;  1JXO A;  2DX1 A;  4FW2 A;  5IN1 A;  2DBM A;  1R0C B;  1TTH B;  2A0F B;  4KH1 B;  1JEG A;  2CS7 A;  1X6O A;  4OGC A;  2YT6 A;  2HSE B;  1QQJ A;  3L2W A;  3UPU A;  2FPF A;  2LT1 A;  1ZHI A;  3JCM P;  1WXU A;  2ED0 A;  2KXC A;  2F69 A;  1FMW A;  5GMK e;  4X34 A;  2JVV A;  3CCM A;  3AHU A;  1YI2 T;  1VQK Q;  4M7D C;  2DKG A;  5DM7 R;  3S3O A;  3GPL A;  2DER A;  1W2B P;  5GAN 7;  1QVF A;  3HP9 A;  3M4G A;  2KAF A;  1ZA2 B;  3M0T A;  2CP5 A;  1NG2 A;  3KFV A;  4OMO A;  4VUB A;  3R6O A;  3VJP A;  4C8Q G;  5IHK A;  1YIJ Q;  1LVK A;  5LJ5 d;  2D0Q B;  3A1P A;  1S72 T;  4HVW A;  2K57 A;  3L2V A;  5CK9 A;  1YP5 A;  1UEC A;  3JCM V;  1UE9 A;  2O4X A;  2K3Y A;  4J6X A;  4F04 B;  4JLI A;  4M7A C;  3HTR A;  3UAT A;  4MML A;  1OX8 A;  3NFC A;  2EFI A;  4C8Q C;  4M75 A;  3L2Q A;  2RI5 A;  5GAO l;  5GJV B;  1TS9 A;  3REB B;  2DEQ A;  1N8R C;  1FWZ A;  1AZG B;  2FVU A;  4X1V A;  2YRC A;  2ZZD A;  2JW4 A;  2FG0 A;  1QP3 A;  1VQK T;  1ZSZ C;  4CRI A;  4OB3 B;  3JCM b;  1QVG P;  2XG8 D;  3FIF A;  2LQN A;  1VQM T;  3LGL A;  3X20 B;  3QWX X;  2F5T X;  1Y96 B;  4C92 G;  4CC7 A;  1WHG A;  5CIU A;  4JZ4 A;  1H3H A;  1MMD A;  4OVA A;  3C95 A;  2J06 A;  1M3B A;  4J9B A;  2X9H A;  3ULR B;  4M4Z A;  3L42 A;  3E9G A;  2R58 A;  6AT1 B;  1FMK A;  2O4X B;  2XI9 A;  4C8Q D;  2K5L A;  2K3X A;  2EYY A;  2VGN A;  3S3N A;  1M90 R;  3RBB B;  1VQN T;  3M0P A;  1SRL A;  2CZ6 B;  3SWN C;  2CSI A;  4ZGJ B;  3CCE T;  2K2M A;  2I0N A;  4FT2 A;  2XDB A;  1ZUY A;  1Q82 U;  2J6K A;  3CD6 Q;  2AZV A;  2DK3 A;  5I2M A;  1WA7 A;  2WSE E;  4B6M A;  3BY7 A;  2QG9 B;  5I11 A;  2XK0 A;  2YUN A;  3VYH B;  2ED1 A;  1ZBX A;  4CI0 C;  5GAM g;  4PJO C;  3FRN A;  1W6X A;  4JJB A;  1X01 A;  1IRX A;  3JCM g;  3Q1J A;  3H0I A;  2O2O A;  3V7R A;  4LDV A;  1EZZ B;  3G6E A;  1WXT A;  4LN2 A;  4C0G A;  3EFO B;  2NWM A;  2KRM A;  1EIF A;  3CCL T;  1U1T A;  3S6W A;  2CP3 A;  1UEB A;  1M3A A;  4RUG A;  2V1Q A;  1WIE A;  3JCM f;  3G4S Q;  2KNB B;  4II1 A;  3THK A;  1CSK A;  3CPW P;  1NEG A;  2L3R A;  1IB8 A;  3H0F A;  1YJN Q;  5GAN 5;  5FU7 C;  4QQD A;  1ZBJ A;  1OU9 A;  3JB9 H;  5HY6 A;  3VUB A;  3PMI A;  4M77 G;  5CQX A;  1V1C A;  1BIB A;  5GMK l;  4RTX A;  1K9M R;  4MZM A;  1YJ9 Q;  2QA4 Q;  3JCM c;  1RL2 A;  2O88 A;  3H0H A;  5AT1 B;  2KT1 A;  7AT1 B;  2PQW A;  2X4Y A;  2CDT A;  4BI3 A;  2KMT A;  3JCM J;  1M1G A;  4F7U B;  1PWT A;  1BK2 A;  3NGP A;  1YHQ Q;  5GAN f;  2E10 A;  1ZSZ B;  1KIK A;  3OW2 A;  3HHT B;  2BE7 D;  3A8O B;  3I5R A;  5LL6 S;  2V1R A;  4KT0 E;  3GF5 A;  1M1K C;  2MF2 A;  4QW2 A;  5GJW B;  4E6R A;  3EFS A;  4RG8 A;  4C8Q B;  1Z9Z A;  2KYB A;  1RAG B;  3I55 T;  2CP0 A;  2R5M A;  4AFQ C;  3P8B B;  4PJO A;  3OYL A;  3VRY A;  2NYS A;  4PJN A;  2AK5 A;  2M0O A;  1U1S A;  2LDM A;  4A4G A;  2BZX A;  2HQH A;  3ME9 A;  4BE0 A;  4EMK B;  3OYN A;  1V29 B;  2E5K A;  1TH7 A;  1FXX A;  5J26 A;  3JCM X;  2PU9 B;  1YIT Q;  1YWO A;  4IUR A;  5GAM d;  4LNP A;  1OZ3 A;  2DL4 A;  4AFS C;  1WGS A;  4PNO A;  4D6W A;  4B9W A;  1Y71 A;  1MMN A;  3CCL A;  1OYX A;  2DM1 A;  3L1A A;  1YIJ T;  1ZUK A;  2D6F A;  1GBR A;  5KCO A;  3G7Z A;  1UUE A;  4HVV A;  2K3B A;  2LCC A;  5DLQ E;  3OS1 A;  1XQH A;  2CT3 A;  2CP7 A;  3GOX A;  2EQU A;  1AZE A;  1D1B A;  3M0S A;  2NUT B;  2M9U A;  1NYF A;  3I56 T;  3RMS A;  3JB9 D;  1PD1 A;  2BKD N;  4M77 A;  2EQM A;  3EGX A; 
#chains in the Genus database with same CATH homology
 1W2B P;  1KD1 R;  3G6E Q;  3CPW P;  3CCL Q;  3CCQ Q;  1YI2 Q;  1VQ8 Q;  1KC8 R;  1K8A R;  3G71 Q;  1Q81 R;  3CCM Q;  1YIT Q;  3CCE Q;  1YJN Q;  2OTL Q;  1VQ7 Q;  1K73 R;  1VQ5 Q;  1VQ9 Q;  3CC7 Q;  2OTJ Q;  1Q82 R;  3CCR Q;  1QVG P;  1N8R R;  1NJI R;  3CCV Q;  1S72 Q;  1JJ2 P;  1YJW Q;  2QEX Q;  3CD6 Q;  3CC2 Q;  3I56 Q;  1YJ9 Q;  1YHQ Q;  1KQS P;  3CXC P;  3I55 Q;  3CME Q;  1VQM Q;  1YIJ Q;  1VQL Q;  3CMA Q;  3CCJ Q;  1Q7Y R;  1QVF P;  1VQK Q;  1VQP Q;  1VQ6 Q;  1M1K R;  1VQO Q;  1K9M R;  3OW2 P;  1M90 R;  1VQ4 Q;  1VQN Q;  3CC4 Q;  2QA4 Q;  3CCU Q;  3CCS Q;  3G4S Q;  1Q86 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...