2YUOA

Solution structure of the sh3 domain of mouse run and tbc1 domain containing 3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUN and TBC1 domain containing 3
molecule tags Signaling protein
source organism Mus musculus
publication title Solution structure of the SH3 domain of mouse RUN and TBC1 domain containing 3
rcsb
total genus 8
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yuoA00
4AFSC 1BU1A 2FG0A 1SRLA 4LN2A 1ABOA 2QDLA 2FPDA 2DL5A 2KRSA 1WFWA 2F2VA 2K2MA 2W10A 1U5SA 1X43A 2GTJA 1S1NA 1UUEA 1E7OA 2W0ZA 2V1QA 3ZL7C 2AZSA 2RQVA 1MUZA 3REBB 2RQUA 1ZUKA 2J05A 3U23A 2A36A 1PHTA 1JO8A 2DL8A 1N5ZA 4D8DA 1TG0A 4Y92A 2VWFA 4AG2C 1AZEA 2KNBB 5ECAA 1EFNA 2RN8A 4JZ3A 1UECA 2ROTA 4R0KA 5I22A 1HSQA 1JXOA 2DYBA 1QLYA 1WX6A 4OMNA 1CKBA 2ED1A 1PKTA 4RTYA 3TSZA 2KEAA 4F14A 2CH4A 2I0NA 1WI7A 2AK5A 2KYBA 3M0SA 1ZSGA 2A28A 2L0AA 2VVKA 3PVQA 2HCKA 1W1FA 1AWXA 1JU5C 3UF4A 2FO0A 2BZYA 3I5SA 1UDLA 2ENMA 2YSQA 2BZXA 4LUDA 4K11A 2CH4W 1UFFA 1TUCA 2DILA 4HCKA 1NLPC 2JMCA 2YUNA 1SHFA 1UJYA 2V1RA 2DBMA 5IHNA 2ROLA 1PNJA 1X2QA 1M8MA 4AFZC 3M0TA 3FJ5A 2EPDA 1YNZA 2KR3A 4CC7A 2EVRA 1RUWA 2EW3A 2KT8A 4X1VA 2DRMA 2OAWA 3EG1A 3M0PA 3VS2A 5IHKA 1JQQA 4Z88A 2MOXA 4HVVA 1H8KA 1T0JA 2DBKA 3IQLA 1T3LA 1K0SA 1WLPB 3M0QA 1OEBA 4IIOA 4J9EA 2F2XA 4GBQA 1KIKA 2LJ3A 2NWMA 1QWFA 4WCIA 2JM8A 1M3CA 3R6NA 1GFDA 1G83A 2KXCA 1M30A 1UHFA 1GRIA 3SHWA 1Z9QA 3ULRB 4Z8AA 3QWXX 2DX1A 2PNIA 2RQWA 2ECZA 1SSHA 2J6KA 1AD5A 2KE9A 3TVTA 1E6HA 2JS2A 4A63B 4RUGA 5FWCA 1QWEA 1X69A 1AOJA 1I07A 1RI9A 3I35A 5FW9A 2DRKA 2DL7A 2K3BA 3VRZA 2C0OA 1CSKA 3O5ZA 2LP5A 4J9IA 2DVJA 1SHGA 2CUBA 3THKA 3EHRA 4J9CA 2J6FA 4AFQC 5IXBA 2O2OA 1SEMA 2O9VA 1MV0B 2KRNA 2L3QA 2M51A 2PZ1A 2A08A 3NGPA 4F17A 2O31A 2LQNA 3REAB 5GJVB 4RTXA 2FRWA 2LZ6B 1NYFA 3M0UA 1RLQC 3A98A 4J9BA 5FWBA 2PTKA 3UA6A 2KGTA 1AWWA 1V1CA 1M27C 2JW4A 2O9SA 4CC4B 2EBPA 4OMQA 1W6XA 2H8HA 2YUPA 1HJDA 3PVLA 1MV3A 4JPBW 2NUZA 1K1ZA 2BZ8A 1X6GA 1YWOA 1NEBA 2EGAA 1YP5A 1X27A 2GTOA 1Y57A 3NMZC 2RPNA 3SEMA 1JEGA 2B86A 2CT4A 1H3HA 2GNCA 2F2WA 1E6GA 3RNJA 2JMAA 1U3OA 2EYZA 2G6FX 3C0CA 3H0IA 3EG3A 4AG1C 3EG2A 1UJ0A 1W70A 4HXJA 1VYTA 1WDXA 1ARKA 1I1JA 4QT7A 1QKXA 2DNUA 4HVUA 3UA7A 4AFUC 2IIMA 2SRCA 2CSQA 3VS3A 3NPFA 3H41A 1UE9A 3UATA 2D1XA 2RQRA 4CC2A 1SPKA 2KYMA 2EGCA 1SRMA 2KROA 4E6RA 2DL3A 4OMOA 1RLPC 2OI3A 1YWPA 3VRYA 2ESWA 2HSPA 1ZBJA 2SEMA 4FSSA 4HVWA 1WXTA 1UTIA 1OPKA 2M0YA 1WXUA 3EHQA 3CQTA 1GL5A 2L3SA 2GBQA 4J9GA 1IO6A 1PKSA 2RNAA 2O88A 1VA7A 2K7AA 2FEIA 2J7IA 1OOTA 2C0IA 2ABLA 1AZGB 1WA7A 1T0HA 2JS0A 2LX7A 3QWYA 2MCNA 1T3SA 3VS5A 5IH2A 1K4US 3KFVA 2LNHB 2LCSA 2J06A 1GCQA 1KFZA 3VS1A 2GGRA 2LJ0A 4F16A 2DM1A 3EG0A 1PRLC 1GBQA 3I9QA 1U06A 1GBRA 2RMOA 1UG1A 1TUDA 1VYUA 4RTTA 2HBWA 1GFCA 1AEYA 1K9AA 2JXBA 5I11A 2DL4A 1ZUYA 4LUEA 2LJ1A 2AKKA 1NM7A 1J3TA 1FYNA 4DEYA 1UGVA 4LE9A 1I0CA 2FPEA 2FRYA 1YN8A 1ABQA 3NHNA 1KJWA 2X3WD 2K79A 4OMMA 1BBZA 1GCPA 2KBTA 2XMFA 2OJ2A 1A0NB 1M3BA 1WXBA 2BTTA 2EYXA 4OMLA 1PRMC 2DA9A 4J9FA 4ESRA 2CDTA 5L23A 2D8HA 2AKLA 4RTVA 2KXDA 4RTZA 5GJWB 2LMJA 2AZVA 2D8JA 2DJQA 1ZUUA 2EGEA 5HCKA 1XOVA 2C0TA 4RTUA 3VS7A 4Z89A 3LH5A 2EKHA 2D0NA 4OMPA 2K9GA 2X3XD 2DMOA 1OPLA 2EQIA 1K76A 3JV3A 4D8KA 2JM9A 5IXFA 1NYGA 1NLOC 2P4RA 2MIOA 2FPFA 4M4ZA 3RBBB 1Z9ZA 2E5KA 2J6OA 4GLMA 4J9DA 2RF0A 4JJCA 3H0HA 1WIEA 1JXMA 2JT4A 1HD3A 3H0FA 2YDLA 2CUDA 1ZX6A 1CKAA 1QKWA 4IIMA 5EC7A 2YUOA 1K0XA 1QCFA 4KRTA 2LQWA 1B3QA 2L2PA 1AVZC 4CC3A 1NG2A 1M3AA 4RTWA 3EGUA 2A37A 1X6BA 1G2BA 1UHCA 4EIKA 2YT6A 3I5RA 2VKNA 4JZ4A 1H92A 4DEXA 2ED0A 2L3PA 4ZNXA 1VYVA 3GBQA 2KT1A 1B07A 1GCQC 4JJDA 4ORZA 4LNPA 2EYWA 4JJBA 2K6DA 5IHIA 2EYYA 2GQIA 2JTEA 1YCSB 1X2KA 2HEQA 2YUQA 2CREA 3PE0A 2HDAA 1PWTA 2KRMA 3VS6A 3VS4A 1BK2A 3VS0A 1NEGA 1AWJA 2DF6A 4J9HA 1LCKA 1BB9A 1AWOA 3M0RA 2DLPA 2CSIA 1KSWA 1FMKA 1WYXA 2RQTA 2CT3A 2DE0X 1ZLMA 3TSWA 1OV3A 1Y0MA
chains in the Genus database with same CATH superfamily
4AFSC 1BU1A 3M55A 3QJ6A 3ZBDA 4LN2A 1ABOA 1RABB 1ACMB 3QPHA 2DL5A 1I8FA 1TS9A 2F2VA 4PK4A 2W10A 1YCYA 3QXEB 1X43A 4IKFA 3CPFA 4C92G 2V1QA 3MP8A 4M7DF 3JCMV 5LJ5h 3CCJA 3C95A 4ANJA 2KMTA 1Q81U 2BE7D 3REBB 5LJ5d 2DL8A 3F70A 3FIFA 3OB9A 3V7CA 4ZTJA 4M7AA 2EJ9A 4AG2C 1AZEA 2KNBB 2K5IA 5FU7B 5GAMj 3LLRA 1QLYA 5LJ3f 5LJ3e 2E3HA 1CKBA 1IRXA 4M77B 5GAMf 2K57A 2K4YA 3CCRQ 5KYXB 1VQ4T 1GXIE 1KD1R 3LGFA 1M90C 1ZSGA 2RHZA 4BE1A 1ZSZA 4C5GA 4PJOA 3CPWP 1UDLA 2ENMA 4NL2A 4K11A 2BIVA 4ELZC 1K8AU 3G1JA 4BY6C 1K8AC 3UT1A 2JMCA 1UJYA 5GAMd 2DBMA 4C8QC 2HQXA 4X34A 3G71Q 4KH0B 3FJ5A 4XAXB 3X24B 2FYKA 1RUWA 2ZPIB 2EW3A 2JZ2A 4KT0E 2OAWA 4NOYA 3MP6A 2JOYA 3WVDB 3SDZA 3CC7T 1T0JA 3EGDB 2KSSA 4NS5A 1Q7YR 1T3LA 2CP7A 4WF2A 3CCVT 2RHYA 3M0QA 5GAN3 4JS4A 1I81A 2OTJQ 2VASA 3CCUQ 2LJ3A 1VQNA 2DTIA 5KCHA 2Y4YA 3R6NA 2O4XB 1GFDA 2QQSA 1G83A 4IUPA 4BE2A 1BI1A 1K9MC 1GRIA 8ATCB 3VV0A 3SWNB 2CYZB 2PNIA 4FSXA 1N9RA 3V7RA 1WHGA 2JS2A 1YITQ 4A63B 3G7ZA 1QWEA 2XICA 1AOJA 3GPLA 1Y96B 1M1GA 1RI9A 3I35A 1N8RU 2M02A 2YWWA 3I56Q 4F7UF 4QVZA 1EZZB 3CCEA 3R6OA 1PCXA 1MGQA 1QP2A 1VQLA 2QASA 4PFZA 5AT1B 1UGRB 2J6FA 3VYGA 4KGVB 3EFRA 2KRNA 3JB9G 3TQ7P 3EFSA 2PZ1A 3PNWC 5GJVB 1YI2Q 3M0UA 2DYIA 1M27C 3OYAA 1M5Q1 4A4EA 1MV3A 1D09B 4PJOF 2NUZA 4HT9A 1SKUB 3CCMQ 3CCVA 3OW2A 4DBQA 1X27A 4MZTA 2QAZA 1OZ2A 3BDLA 1BI3A 1MMGA 3NMZC 2RPNA 1VIFA 3I56A 4OMFB 1TUGB 2GNCA 2F2WA 4E7IA 2XDBA 1FWZA 5CKHA 3RNJA 3JCMQ 2EYZA 1NJIC 2G6FX 2IVWA 3KUFA 1VYTA 3TCJA 1WDXA 2QA4Q 1YJNQ 3HL8A 1QKXA 3A8GB 1W2BA 3QDRB 4DBFA 4UC4A 4PJOB 2SRCA 3CD6Q 2PU9B 1KK7A 4EMHA 2QEXT 1UEBA 5KYNA 3GNFB 2D1XA 4MDWA 2E41A 2E1HA 4OMOA 2QGGA 2Y90A 5KE3A 2OI3A 3VRYA 5CAIA 1DJ7B 3CCVQ 3CCMA 2CZ7B 4M7DC 3S3NA 3QZ9B 1XTDA 3SWNC 4C0FA 1G3YA 5FRNA 4M7DG 4N0AC 1OI1A 4JS5A 3RERA 1PKSA 1BCOA 1HK9A 1QQJA 2EKOA 1NZ9A 4PJMA 1YIJT 2C0IA 2R5AA 2DTOA 1IHVA 3CCJT 1T3SA 1YITT 2K3YA 3GIBA 2ZAEA 4M77A 2I2LA 2LDMA 2XDPA 2EQKA 4C92D 1OULA 3EG0A 3I9QA 4BUGA 2D0QB 4M7AD 3DLLA 1Q95G 4RTTA 1ZSZB 2HBWA 1TSFA 4PL6A 1AEYA 1K9AA 2GF7A 2KY9A 3Q1JA 8AT1B 4LUEA 2DL4A 1ZUYA 1XJWB 4ZN3A 1RAFB 3CC2T 4DEYA 1I5LA 4LE9A 2FPEA 2L5QA 2FRYA 3OYKA 1F1BB 3ZFJA 1QCNA 1TTHB 4ZTFA 1PD0A 1GCPA 2QXFA 2LVMA 1KQSP 4OMLA 3CCQA 4ESRA 5L23A 3OYEA 4RTZA 3GOXA 1Y7XA 5LJ3d 5GJWB 5DLOA 1XOVA 2C0TA 4RTUA 3LW5E 5KE2A 2EJGA 4PJOG 2EAYA 1OPLA 1YJ9A 2EQIA 3CCLA 1NLOC 4DBRA 3PT9A 1FX7A 2AIRB 3CC4Q 5GAOq 2FPFA 1WJRA 4M4ZA 2QK0A 3WVEB 1Z9ZA 2J6OA 4N4GA 2OTJA 3EG9A 4NL3A 4JJCA 4C0DB 1Q82U 4C8QB 2RD1A 3T9NA 1VQ7Q 4P5NA 4CRIA 2CUDA 1ZX6A 3FEOA 2E4HA 1QW1A 3VJPA 3NTKA 2YUOA 2AHJB 3JRZA 5GAMe 1AVZC 4YTLA 4CC3A 1W2BP 4RTWA 2AT1B 2DK3A 1VQOT 4DBHA 1LPLA 4M78C 2RK2A 1RADB 1H92A 4F7UB 3HRTA 1VYVA 1GCQC 4LNPA 2EYWA 4PJNA 2F5TX 4M77D 4M78D 5GAN6 2L89A 2HEQA 2CREA 3PMTA 5FU6B 3HHTB 3M54A 1VOMA 2RO0A 2JTFA 4HKEA 1AWJA 1KHIA 1IZ6A 4J9HA 1MMAA 1BB9A 3M0RA 2V8KA 5GAMg 2CSIA 2LQ8A 1X6OA 2DFUA 3CMET 4M75B 1Y0MA 2E70A 2VGNA 1HXDA 2FG0A 1B7TA 2E3IA 2HNIA 4E47A 1Q82R 4E7SA 1FMWA 2K5LA 2KDSA 1WFWA 2GTJA 3OW2S 4XU1A 1S1NA 1D0XA 3CMAT 3I56T 2FL7A 4HCZA 5GANd 1MUZA 1ZUKA 2VB6A 2A36A 4OB2B 4Q5WA 3OYCA 1TG0A 1VQ6T 3X26B 2PVGB 3OW2P 4RMOA 2RN8A 4XTXA 1UECA 3X25B 2ROTA 5I22A 1HSQA 1JXOA 1MMNA 5CKFA 1OX9A 1WX6A 1NE8A 1WQ7A 2MF2A 3TSZA 2HKNA 3OBYA 1WNLA 1P92A 1G3WA 4IUTA 4F14A 2DETA 4O6JA 2I0NA 2AK5A 4QKUA 2LT4A 1UGPB 2DO3A 5DY9A 3H8ZA 1ZBXA 4Z02A 3PVQA 2HCKA 1W1FA 1AWXA 3CCUT 1D1CA 3I5SA 4FCYA 4M75E 3VYHB 2BZXA 4OB0B 2HZYA 1TUCA 1VQMA 5C6SA 1NLPC 4JLGA 1I5OB 2YUNA 3L2WA 2BKDN 4IURA 2Y4XA 1HYOA 2V1RA 5IHNA 1BIAA 4GY5A 4MMKA 1YBYA 1X75C 1RAGB 4FT2A 1MNEA 4M75G 2O01E 5I21A 4CC7A 5FROA 2EVRA 1NPPA 2KT8A 4X1VA 2DRMA 4E7JA 2DIGA 5M9OA 3HKSA 3VS2A 5IHKA 5GMKe 2RM4A 1JQQA 1YITA 3MHXA 4Z88A 4HVVA 1H8KA 1YJ9T 3META 3EG9B 4JRKA 4BDYA 4OB3B 1WLPB 3MJXA 4C8QA 4KGZB 3OYLA 1YIJQ 4LDUA 3MKDA 4IIOA 5LJ5g 4JRPA 3QZ5B 1BI0A 2COYA 4WCIA 4E7HA 1RAAB 3G6ET 4BACA 3QBYA 2KXCA 2LCCA 4J8OA 3H6ZA 2V8JA 4PJOC 2EJFA 3ULRB 4QVCA 4J6WA 1YHQT 1MMDA 2DX1A 1ZSZC 1SSHA 2J6KA 2A7YA 2QEXA 2KE9A 3TVTA 1B34A 3RMSA 1O75A 1E6HA 1QCOA 1OU9A 1WHJA 2DZCA 3NTHA 4BB7A 2R57A 5FW9A 2MYSA 2DRKA 4PJOE 4M7AG 3CMEQ 3VRZA 1M1KC 1IGUA 2C0OA 1CSKA 3O5ZA 4J9IA 5GMKh 3BY7A 1SHGA 2RJDA 1YJNT 5FU7C 5J3BA 1UGQB 3J80E 3G6EQ 4AFQC 5IXBA 1YHQQ 3S3OA 1SEMA 4LXCA 1MV0B 1K73C 4M78G 4PKCC 2QTVA 4MZMA 3NGPA 4F17A 1Q81C 1WHKA 2YHTA 1OX8A 5KYUA 2LZ6B 2L8DA 3A98A 5FWBA 3UA6A 1KD1C 1M90R 2X4JA 1AWWA 1VQKQ 1SF9A 5KH6A 5CR2A 1V1CA 1NPRA 1U1SA 2JW4A 4CC4B 5DM7R 2YRCA 1W6XA 2P0KA 3PVLA 4ME7A 1VQ8T 2QEXQ 2BZ8A 1K8AR 3CC2A 3FDRA 4OF1A 4M7DB 5CKBA 2GTOA 2HL5C 3JCMc 2K5FA 1JEGA 3RESA 1H3HA 3SB2A 5GANg 1EIFA 1TH7A 2ZGWA 2EQUA 2JMAA 4FW2A 2QQRA 2VXEA 3C0CA 1D0YA 2YLCA 3L1AA 3EG3A 1UJ0A 4HXJA 2H3EB 2VYTA 4M77E 4EDUA 4A54A 1ARKA 5EG2A 4QT7A 2RHXA 3UA7A 3OS0A 5IT9E 3M5AA 4FT4A 2CSQA 3JCMP 3NPFA 1VQNQ 4F04B 4CC2A 1SPKA 2KYMA 4M75C 2H3JA 7AT1B 3JCMX 2EGCA 4PLIA 1SRMA 4E6RA 2EQMA 3JCMW 5IAYA 5GAOn 5CCAA 1RL2A 1ZBJA 2SEMA 4FSSA 4ATOA 2DEUA 3CC2Q 4HVWA 1U8RA 2HBPA 4IUQA 1OPKA 2RI5A 1BCMA 2M0YA 2CGHA 3EHQA 3CQTA 2QI2A 2GBQA 4VUBA 3G4SQ 1OYXA 2K7AA 2FEIA 3A8LB 2MAMA 4RKUE 1OOTA 2ABLA 2ATCB 2JS0A 2CS7A 4LDXA 3GNGA 1XNIA 4C8QG 3VS5A 2QGFB 5IH2A 4M7DE 1K4US 4E7LA 1GCQA 1QVFS 4GLKA 3I55A 2DM1A 1PRLC 4RCBA 1U06A 5HY6A 2RMOA 1GFCA 2DAQA 4M78A 3EAEA 2JXBA 4KBMB 3PTAA 2R5MA 4E2FB 3OYFA 1NM7A 2V26A 1FYNA 1UGVA 3JB9F 2KI7A 5KYYB 3S6WA 1ABQA 3NHNA 3MEVA 4JLIA 3QSUA 2E5QA 2KBTA 2XMFA 1A0NB 1Y07A 2RB6A 3I55T 2EYXA 2BTTA 2DA9A 2D8HA 2AKLA 1VQMQ 3UPUA 3FRNA 1S72A 3MEWA 2DJQA 2EGEA 5HCKA 3LH5A 2EKHA 5C0MA 5GAOm 2D0NA 2EWNA 2K9GA 4OMPA 2WSCE 4D6WA 1K76A 2JM9A 1NYGA 1PSEA 1ZA2B 3HTRA 1AHJB 1PM3A 4TVRA 2MPXC 4IUVA 3JB9J 4GLMA 5HK0A 3J81E 1WIEA 1WJQA 1JXMA 3G71T 3OYJA 3RKWA 4OVAA 3H0FA 4BI8B 4O5VA 2JTMA 3A8MB 1Q86C 1QKWA 1K0XA 5GMKl 2LQWA 1B3QA 4M75D 2KQWA 4EPCA 3OYIA 3P8HA 1X6BA 1G2BA 2YT6A 1V76A 2LNVA 2X35A 2ED0A 2IG0A 4FW1A 4ZNXA 2OTLQ 4XU3A 3JCMJ 1VQ6Q 2KT1A 1VQNT 3OYNA 4JJDA 5LL6S 3CCSA 4JDSA 2K6DA 2MWOA 5IHIA 2GQIA 3C12A 1YJWQ 1M1KR 4C92A 3JB9D 2DD5A 2YUQA 2QG9B 4DA4A 3PE0A 2HDAA 1PWTA 1VQLT 2FVUA 4MZPA 3VS4A 3VS0A 5CQXA 1VQPA 1LCKA 2P4TA 5CK9A 1FMKA 2V8IA 2RQTA 2LX9A 2DE0X 2R58A 2ZPEB 1N8RC 1OV3A 2HMAA 3JCMh 5DLQE 3V7SA 3G4ST 1VQKA 5I2MA 1SRLA 4PNOA 5GMKj 5KYWA 2YXYA 1KQ1A 3WXMB 5KYUB 2DEQA 3JAME 2QDLA 3QIIA 2K2MA 2F1LA 3HFOA 1U5SA 2RK1A 1OZ3A 1UB4A 4WTOB 1VQLQ 1FMVA 2FZGB 3ZL7C 2AZSA 1Q7YC 2RQVA 5KCOA 3U23A 3X20B 3CCQT 2OTLA 4M7DA 1PHTA 1JRIA 3KXTA 1N5ZA 2RI3A 4D8DA 3CCRA 4Y92A 5ECAA 3CC7Q 2ZPBB 3MPUB 1QVFA 1BIBA 1VQ5Q 2DYBA 3QYHB 1N6AA 2FHDA 2D6FA 2LTOA 4OMNA 2ED1A 1PKTA 2M16A 3QUIA 3UDCA 4J6XA 1JJ2P 1ZHIA 2KYBA 1BYMA 1UGSB 1R8OB 3OYDA 1H3ZA 2A28A 2L0AA 1JU5C 3UF4A 2VC8A 1M9SA 4AMCA 1KC8R 4B9WA 1G3TA 2CKKA 1IGQA 2PVDB 1UFFA 1SSFA 2QA4T 4HCKA 4FYVB 1QP3A 1SHFA 2O4XA 1VQ5T 1LOJA 2HQHA 1IXDA 1V29B 2KK4A 1PNJA 5A0LA 1Y71A 1X2QA 3M0TA 5GAMh 5GAN7 4L5GA 3CCST 1D1BA 3MEUA 4KULA 2CP0A 3M0PA 4C5HA 1YFNA 2EFIA 5D6XA 1ZA1B 2Z0WA 2RHIA 3LH0A 1VQPT 2DBKA 4M75F 2P0QA 5A0GA 2OX7A 1LJOA 2BE9B 3M53A 4XTYA 3VUBA 2QQAA 3NFCA 5J26A 1OEBA 4J9EA 1O9SA 3M4YA 1WJSA 3JCMb 1QWFA 1U1TA 2JM8A 2E10A 3RR6A 3OBWA 4M78E 4XTVA 4J7FA 3JCMd 1Z9QA 1KHCA 3V8KA 4C5EA 5HKCA 2ECZA 1AD5A 4CI0C 4JUVA 4QQDA 2X4YA 3P8DA 4RUGA 4XU0A 1W4SA 1I07A 1VQOA 3SD4A 3FJPA 4A4KA 3OS5A 1FXXA 2K3BA 3EGDA 3OYBA 4E7KA 2PUKB 2LP5A 2RI2A 4C5IA 2RJEA 1WZOA 2CUBA 3THKA 3EHRA 4J9CA 3CC4T 4BE0A 2QTXA 5GAOr 2E65A 3QYGB 3QG1A 5GMKi 1X01A 5GAOp 1M8VA 2L3QA 2OTJT 2BUDA 1R77A 2A08A 3ME9A 4PJJA 1JJ2A 2O31A 2LQNA 3REAB 4RTXA 2FRWA 3EGXA 2DKGA 4J9BA 2PTKA 1RAIB 1BKBA 2ZPFB 3CMAQ 3E19A 3M58A 2O9SA 1KC8U 2EBPA 4OMQA 2YUPA 4LD9K 1HJDA 5FU6C 2GCXA 4QQGA 4JPBW 4OP0A 2CP5A 3CCRT 2ZZDA 2A3LA 3QO3A 1YWOA 1VQ7A 1YP5A 2EGAA 4XTUA 2QQBA 2M9UA 3PIPA 1Y57A 4FYYB 2OTLT 5CO7A 2CT4A 3CXCS 1M90U 1G8XA 2EIFA 1RAHB 3AT1B 2XU8A 1VQ6A 1E6GA 1NJIU 2B8AA 3H0IA 4AG1C 5I2SA 3EG2A 1W70A 2JJ9A 3TEEA 4R55A 4LD6A 2DD4A 2X51A 4QW2A 1I1JA 3C4SA 4HVUA 5LJ3h 3QJYA 5HK3A 2XKOC 2IIMA 5L8RE 3VS3A 3H41A 1RAEB 1UE9A 2PUOB 3UATA 2DVEA 1M2VB 3OMGA 3CMAA 4BD3A 4R56A 3CBMA 1JBMA 2JVVA 9ATCB 1KQSA 5LJ3j 3HSBA 2CP6A 2NUPB 1UTIA 5IN1A 1WXUA 2NYSA 2XIDA 2NLUA 1GL5A 3QDFA 2F5KA 2RNAA 2O88A 3L2ZA 1VA7A 3M4GA 2J7IA 1M1FA 1PG5B 1T0HA 2LX7A 3N5BB 1D3BA 5CQYA 3QWYA 5A2QE 3L2RA 3KFVA 2LNHB 2WACA 2CZ0B 1KFZA 4ZGJB 2FB7A 2EQJA 3VS1A 2LJ0A 3G6EA 2E6NA 1GBQA 1VQ5A 1UG1A 4M7AE 2HKQB 4A4FA 2ZPGB 2EYQA 3M57A 3PMIA 3CCQQ 4F7UE 2LJ1A 4J5YA 2AKKA 1J3TA 5GAN4 2G3RA 4J7IA 3CCEQ 1YN8A 3OYGA 2IPOB 1KJWA 3NTIA 2LRQA 1C0MA 2K79A 4DQ2A 1M1KU 1D0ZA 2OJ2A 2KVQG 4N4HA 1M3BA 1QVGS 3CC4A 4II1A 2CDTA 3L2VA 3RDVA 2KXDA 3A8HB 3X28B 2LCLA 3VS7A 3TU4K 4C8QE 2M1HA 2HAXA 4FIBA 4XK8E 4HCBA 3JV3A 5IXFA 3A1PA 5D6YA 5AYFA 4J83A 3RBBB 2E5KA 3CBOA 2RF0A 2A0FB 3V8JA 3CCJQ 4BDZA 3H0HA 3OYMA 3HRSA 2E6ZA 3E9FA 3CCLQ 5EC7A 4B9XA 4ZN1A 2L2PA 3DLMA 5GANe 4EMKA 4HT8A 1PSFA 2DPPB 2FZCB 1M3AA 3MP1A 3EGUA 2ZPHB 2A37A 2VXFA 4X9CA 3JCMf 3KBGA 2X4XA 4FL6A 2DERA 3G71A 4JZ4A 1YIJA 1G5VA 2QA4A 3OS1A 3GBQA 4ORZA 3BW1A 4JJBA 2EYYA 2JTEA 1YCSB 4QVDA 1X2KA 2F69A 3RUXA 2XDDA 2KRMA 1BK2A 1NEGA 2RHUA 3E2UA 4M7AB 5GAOl 1AWOA 4M7AF 4OGCA 2HL3A 1VQOQ 1KSWA 1WYXA 1LNXA 1OQKA 3S3MA 3J7AF 1LVKA 1MHNA 2DXBA 1QVPA 4IUUA 4N4IA 4PFPA 3BE3A 3VKIA 1C6VX 1K9MR 4XU2A 4LDVA 3GP8A 1VQ7T 2XI9A 2GFAA 2FPDA 3DB3A 2KRSA 1NBEB 1WHLA 5GMKm 1UUEA 3JSCA 1E7OA 2W0ZA 2COWA 3HFNA 1ZQ1A 2PQWA 3GF5A 3EH1A 3CBPA 3M56A 1YI2T 3FLGA 2NUPA 1Q7YU 4MMLA 1EX4A 2RQUA 2J05A 4KUIA 1JO8A 5D6WA 4C92B 3FC3A 2OAUA 4HCCA 1OU8A 3LX7A 2DTHA 4C92E 4MDXA 1RACB 2VWFA 4B6MA 2RJCA 1EFNA 4JZ3A 3OA6A 2PVOB 4R0KA 1YJWT 4BY6B 2CP2A 5J39A 4RTYA 2KEAA 1N9SA 1WGSA 2CH4A 5CKEA 5KYWB 1WI7A 3INZA 3M0SA 4J6YA 5LJ5f 5A0DA 2RA2A 4FU6A 3D7SB 2NUTB 2VVKA 4M77G 3O8VA 2FO0A 2BZYA 5LJ5j 3OYHA 2QQ9A 4M77C 4PJOD 3OY9A 2YSQA 3BFMA 4LUDA 1W2BS 2CH4W 1G3SA 1YJ9Q 2DILA 1VQPQ 2XK0A 3LYIA 4Y91A 3OSSC 3EFOA 3JB9I 2GQVA 2MMPA 2ROLA 4N0AA 4M78F 4M77F 3SWNA 3M59A 1K73R 1M8MA 4AFZC 1N27A 1AT1B 1YNZA 2EPDA 2KR3A 1XQHA 1Q81R 3HPWA 1Q82C 3BDUA 1MNDA 3EG1A 2RH2A 3DKMA 3V8LA 3URGA 1NJIR 2KAFA 4XTZA 2FZKB 4V2SA 3JCMe 2DXCA 1H641 2MOXA 2VGMA 3TREA 1D3BB 2HD0A 1PC0A 3IQLA 1K0SA 2C06A 1QVGP 2VUBA 4RG8A 4JRQA 1KQSS 2M0OA 5D7UA 2F2XA 4GBQA 2DZ9A 4C8QF 1KIKA 1KQ2A 2NWMA 3RMQA 1M3CA 1WPYA 4FYXB 4KUDK 1K9MU 4LDWA 1M30A 1UHFA 3SHWA 3VUZA 4A4HA 1WHMA 4Z8AA 1Q86R 3QWXX 3PFSA 2RQWA 3M9QA 3PGGA 2WSFE 1VQ8Q 4JRIA 3UWNA 1VQ4A 1JB0E 3HRUA 5FWCA 1X69A 3H9NA 5GANj 1VQKT 4XQ3A 2DL7A 3CCMT 4BI4A 5GANf 3LWIA 2HSEB 5LJ5e 2DVJA 2JN0A 3EH2A 2XHCA 1TXQA 2DXTA 3RKYA 2O2OA 2K2VA 2O9VA 1VQ9T 2XD0A 1TWBA 2M51A 2E12A 4RCCA 1S72Q 3FB9A 4C92F 1NYFA 1RLQC 2KGTA 1N8RR 1I4K1 4LDYA 4EMGA 4EMKB 1M2OA 1B34B 1KC8C 2H8HA 2L3RA 2WSEE 1Q86U 1K1ZA 1TOVA 1X6GA 1VQ4Q 1NEBA 4PJLA 5GAN8 2XG8D 3LWHA 4PFOA 1WHHA 3SEMA 2B86A 4ZGEB 3PIOA 4C92C 1R0CB 2DJZA 1JJ2S 3ZEHA 3AHUA 1U3OA 3LGLA 2CZ1B 2MK5A 4Y28E 1SG5A 4FYWB 5KYXA 3CPWA 2RJFA 3EGXB 3OSVA 4BI3A 2DNUA 3MO8A 1S72T 4AFUC 1YJWA 1IREB 2QYZA 2DXUA 4M7DD 2RQRA 4DOWA 3RKXA 3JCMg 3CCET 3GLXA 1BI2A 3OS2A 2KROA 2DL3A 3CXCP 1RLPC 1YWPA 3ASKA 2ESWA 2HSPA 1WXTA 5CIUA 2CZ6B 4JJNK 3OYYA 2LC4A 2DIQA 2L3SA 4J9GA 4QQ6A 1IO6A 3MEAA 4E7ZA 2E64A 2VV5A 3I55Q 4C0DC 4A4GA 2COZA 2JNGA 3E1SA 1AZGB 1WA7A 4KH1B 5GAN2 5CKDA 1PD1A 3A8OB 3L2UA 6AT1B 2CP3A 2MCNA 3RIRA 3MCAB 3CD6A 5FRMA 2X4WA 2GFUA 2MWPA 2LCSA 2J06A 4L59A 4L6V5 3G4SA 2GGRA 4F16A 1GBRA 2MI6A 1TUDA 1VYUA 1VIEA 1M2VA 2NUTA 3C94A 3VU3C 5I11A 3DB4A 4AT1B 2LT1A 3CC7A 3CMEA 1I0CA 4C0ZA 4DOVA 5FLXE 3L2QA 4EMKC 3CCUA 5CVIA 3CCLT 2QDYB 2X3WD 3EFOB 4OMMA 1BBZA 3SFMA 2P0PA 3OMCA 2D9TA 4M7AC 4C0GA 1YHQA 1WXBA 3A5ZB 1PRMC 4J9FA 5GAN5 4RTVA 2LMJA 2AZVA 2D8JA 4F7UA 1ZUUA 1RI0A 4Z89A 1K73U 2X3XD 2DMOA 5LJ3g 4HA8A 4D8KA 4PLLA 2P4RA 4KGXB 2MIOA 1KG1A 1KD1U 1YI2A 1VQ9Q 3CEYA 3QKJA 4M78B 4J9DA 1D1AA 1IB8A 2JT4A 1HD3A 2YDLA 3OQ5A 1CKAA 2LQKA 4IIMA 4OGEA 3P8BB 3QHSA 1M4ZA 1QCFA 4KRTA 5KYYA 4M75A 1TU0B 2YRVA 1QVGA 2ZCFB 4FM4B 3CCSQ 1VQ8A 3ER0A 1NG2A 4C8QD 1UHCA 1WQWA 4XTWA 4A53A 4EIKA 3I5RA 1VUBA 2VKNA 5GANh 2P84A 4DEXA 3CXCA 2L3PA 1VQMT 1R0BG 3E9GA 1IHWA 1B07A 4ZGDB 1Y96A 2JUFA 2YLBA 4F7UG 3CD6T 4ELYC 1QMCA 1QVFP 2YRDA 3VS6A 1YJNA 3CPWS 2DF6A 2DLPA 2X9HA 3HP9A 2HQEA 1VQ9A 2K3XA 3L42A 4OB1B 4X9DA 1C1AA 2CT3A 1ZLMA 3TSWA 3JB9H 4RG2A
chains in the Genus database with same CATH topology
4AFSC 1BU1A 2FG0A 1SRLA 4LN2A 1ABOA 2QDLA 2FPDA 2DL5A 2KRSA 1WFWA 2F2VA 2K2MA 2W10A 1U5SA 1X43A 2GTJA 1S1NA 1UUEA 1E7OA 2W0ZA 2V1QA 3ZL7C 2AZSA 2RQVA 1MUZA 3REBB 2RQUA 1ZUKA 2J05A 3U23A 2A36A 1PHTA 1JO8A 2DL8A 1N5ZA 4D8DA 1TG0A 4Y92A 2VWFA 4AG2C 1AZEA 2KNBB 5ECAA 1EFNA 2RN8A 4JZ3A 1UECA 2ROTA 4R0KA 5I22A 1HSQA 1JXOA 2DYBA 1QLYA 1WX6A 4OMNA 1CKBA 2ED1A 1PKTA 4RTYA 3TSZA 2KEAA 4F14A 2CH4A 2I0NA 1WI7A 2AK5A 2KYBA 3M0SA 1ZSGA 2A28A 2L0AA 2VVKA 3PVQA 2HCKA 1W1FA 1AWXA 1JU5C 3UF4A 2FO0A 2BZYA 3I5SA 1UDLA 2ENMA 2YSQA 2BZXA 4LUDA 4K11A 2CH4W 1UFFA 1TUCA 2DILA 4HCKA 1NLPC 2JMCA 2YUNA 1SHFA 1UJYA 2V1RA 2DBMA 5IHNA 2ROLA 1PNJA 1X2QA 1M8MA 4AFZC 3M0TA 3FJ5A 2EPDA 1YNZA 2KR3A 4CC7A 2EVRA 1RUWA 2EW3A 2KT8A 4X1VA 2DRMA 2OAWA 3EG1A 3M0PA 3VS2A 5IHKA 1JQQA 4Z88A 2MOXA 4HVVA 1H8KA 1T0JA 2DBKA 3IQLA 1T3LA 1K0SA 1WLPB 3M0QA 1OEBA 4IIOA 4J9EA 2F2XA 4GBQA 1KIKA 2LJ3A 2NWMA 1QWFA 4WCIA 2JM8A 1M3CA 3R6NA 1GFDA 1G83A 2KXCA 1M30A 1UHFA 1GRIA 3SHWA 1Z9QA 3ULRB 4Z8AA 3QWXX 2DX1A 2PNIA 2RQWA 2ECZA 1SSHA 2J6KA 1AD5A 2KE9A 3TVTA 1E6HA 2JS2A 4A63B 4RUGA 5FWCA 1QWEA 1X69A 1AOJA 1I07A 1RI9A 3I35A 5FW9A 2DRKA 2DL7A 2K3BA 3VRZA 2C0OA 1CSKA 3O5ZA 2LP5A 4J9IA 2DVJA 1SHGA 2CUBA 3THKA 3EHRA 4J9CA 2J6FA 4AFQC 5IXBA 2O2OA 1SEMA 2O9VA 1MV0B 2KRNA 2L3QA 2M51A 2PZ1A 2A08A 3NGPA 4F17A 2O31A 2LQNA 3REAB 5GJVB 4RTXA 2FRWA 2LZ6B 1NYFA 3M0UA 1RLQC 3A98A 4J9BA 5FWBA 2PTKA 3UA6A 2KGTA 1AWWA 1V1CA 1M27C 2JW4A 2O9SA 4CC4B 2EBPA 4OMQA 1W6XA 2H8HA 2YUPA 1HJDA 3PVLA 1MV3A 4JPBW 2NUZA 1K1ZA 2BZ8A 1X6GA 1YWOA 1NEBA 2EGAA 1YP5A 1X27A 2GTOA 1Y57A 3NMZC 2RPNA 3SEMA 1JEGA 2B86A 2CT4A 1H3HA 2GNCA 2F2WA 1E6GA 3RNJA 2JMAA 1U3OA 2EYZA 2G6FX 3C0CA 3H0IA 3EG3A 4AG1C 3EG2A 1UJ0A 1W70A 4HXJA 1VYTA 1WDXA 1ARKA 1I1JA 4QT7A 1QKXA 2DNUA 4HVUA 3UA7A 4AFUC 2IIMA 2SRCA 2CSQA 3VS3A 3NPFA 3H41A 1UE9A 3UATA 2D1XA 2RQRA 4CC2A 1SPKA 2KYMA 2EGCA 1SRMA 2KROA 4E6RA 2DL3A 4OMOA 1RLPC 2OI3A 1YWPA 3VRYA 2ESWA 2HSPA 1ZBJA 2SEMA 4FSSA 4HVWA 1WXTA 1UTIA 1OPKA 2M0YA 1WXUA 3EHQA 3CQTA 1GL5A 2L3SA 2GBQA 4J9GA 1IO6A 1PKSA 2RNAA 2O88A 1VA7A 2K7AA 2FEIA 2J7IA 1OOTA 2C0IA 2ABLA 1AZGB 1WA7A 1T0HA 2JS0A 2LX7A 3QWYA 2MCNA 1T3SA 3VS5A 5IH2A 1K4US 3KFVA 2LNHB 2LCSA 2J06A 1GCQA 1KFZA 3VS1A 2GGRA 2LJ0A 4F16A 2DM1A 3EG0A 1PRLC 1GBQA 3I9QA 1U06A 1GBRA 2RMOA 1UG1A 1TUDA 1VYUA 4RTTA 2HBWA 1GFCA 1AEYA 1K9AA 2JXBA 5I11A 2DL4A 1ZUYA 4LUEA 2LJ1A 2AKKA 1NM7A 1J3TA 1FYNA 4DEYA 1UGVA 4LE9A 1I0CA 2FPEA 2FRYA 1YN8A 1ABQA 3NHNA 1KJWA 2X3WD 2K79A 4OMMA 1BBZA 1GCPA 2KBTA 2XMFA 2OJ2A 1A0NB 1M3BA 1WXBA 2BTTA 2EYXA 4OMLA 1PRMC 2DA9A 4J9FA 4ESRA 2CDTA 5L23A 2D8HA 2AKLA 4RTVA 2KXDA 4RTZA 5GJWB 2LMJA 2AZVA 2D8JA 2DJQA 1ZUUA 2EGEA 5HCKA 1XOVA 2C0TA 4RTUA 3VS7A 4Z89A 3LH5A 2EKHA 2D0NA 4OMPA 2K9GA 2X3XD 2DMOA 1OPLA 2EQIA 1K76A 3JV3A 4D8KA 2JM9A 5IXFA 1NYGA 1NLOC 2P4RA 2MIOA 2FPFA 4M4ZA 3RBBB 1Z9ZA 2E5KA 2J6OA 4GLMA 4J9DA 2RF0A 4JJCA 3H0HA 1WIEA 1JXMA 2JT4A 1HD3A 3H0FA 2YDLA 2CUDA 1ZX6A 1CKAA 1QKWA 4IIMA 5EC7A 2YUOA 1K0XA 1QCFA 4KRTA 2LQWA 1B3QA 2L2PA 1AVZC 4CC3A 1NG2A 1M3AA 4RTWA 3EGUA 2A37A 1X6BA 1G2BA 1UHCA 4EIKA 2YT6A 3I5RA 2VKNA 4JZ4A 1H92A 4DEXA 2ED0A 2L3PA 4ZNXA 1VYVA 3GBQA 2KT1A 1B07A 1GCQC 4JJDA 4ORZA 4LNPA 2EYWA 4JJBA 2K6DA 5IHIA 2EYYA 2GQIA 2JTEA 1YCSB 1X2KA 2HEQA 2YUQA 2CREA 3PE0A 2HDAA 1PWTA 2KRMA 3VS6A 3VS4A 1BK2A 3VS0A 1NEGA 1AWJA 2DF6A 4J9HA 1LCKA 1BB9A 1AWOA 3M0RA 2DLPA 2CSIA 1KSWA 1FMKA 1WYXA 2RQTA 2CT3A 2DE0X 1ZLMA 3TSWA 1OV3A 1Y0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFS C;  1BU1 A;  2FG0 A;  1SRL A;  4LN2 A;  1ABO A;  2QDL A;  2FPD A;  2DL5 A;  2KRS A;  1WFW A;  2F2V A;  2K2M A;  2W10 A;  1U5S A;  1X43 A;  2GTJ A;  1S1N A;  1UUE A;  1E7O A;  2W0Z A;  2V1Q A;  3ZL7 C;  2AZS A;  2RQV A;  1MUZ A;  3REB B;  2RQU A;  1ZUK A;  2J05 A;  3U23 A;  2A36 A;  1PHT A;  1JO8 A;  2DL8 A;  1N5Z A;  4D8D A;  1TG0 A;  4Y92 A;  2VWF A;  4AG2 C;  1AZE A;  2KNB B;  5ECA A;  1EFN A;  2RN8 A;  4JZ3 A;  1UEC A;  2ROT A;  4R0K A;  5I22 A;  1HSQ A;  1JXO A;  2DYB A;  1QLY A;  1WX6 A;  4OMN A;  1CKB A;  2ED1 A;  1PKT A;  4RTY A;  3TSZ A;  2KEA A;  4F14 A;  2CH4 A;  2I0N A;  1WI7 A;  2AK5 A;  2KYB A;  3M0S A;  1ZSG A;  2A28 A;  2L0A A;  2VVK A;  3PVQ A;  2HCK A;  1W1F A;  1AWX A;  1JU5 C;  3UF4 A;  2FO0 A;  2BZY A;  3I5S A;  1UDL A;  2ENM A;  2YSQ A;  2BZX A;  4LUD A;  4K11 A;  2CH4 W;  1UFF A;  1TUC A;  2DIL A;  4HCK A;  1NLP C;  2JMC A;  2YUN A;  1SHF A;  1UJY A;  2V1R A;  2DBM A;  5IHN A;  2ROL A;  1PNJ A;  1X2Q A;  1M8M A;  4AFZ C;  3M0T A;  3FJ5 A;  2EPD A;  1YNZ A;  2KR3 A;  4CC7 A;  2EVR A;  1RUW A;  2EW3 A;  2KT8 A;  4X1V A;  2DRM A;  2OAW A;  3EG1 A;  3M0P A;  3VS2 A;  5IHK A;  1JQQ A;  4Z88 A;  2MOX A;  4HVV A;  1H8K A;  1T0J A;  2DBK A;  3IQL A;  1T3L A;  1K0S A;  1WLP B;  3M0Q A;  1OEB A;  4IIO A;  4J9E A;  2F2X A;  4GBQ A;  1KIK A;  2LJ3 A;  2NWM A;  1QWF A;  4WCI A;  2JM8 A;  1M3C A;  3R6N A;  1GFD A;  1G83 A;  2KXC A;  1M30 A;  1UHF A;  1GRI A;  3SHW A;  1Z9Q A;  3ULR B;  4Z8A A;  3QWX X;  2DX1 A;  2PNI A;  2RQW A;  2ECZ A;  1SSH A;  2J6K A;  1AD5 A;  2KE9 A;  3TVT A;  1E6H A;  2JS2 A;  4A63 B;  4RUG A;  5FWC A;  1QWE A;  1X69 A;  1AOJ A;  1I07 A;  1RI9 A;  3I35 A;  5FW9 A;  2DRK A;  2DL7 A;  2K3B A;  3VRZ A;  2C0O A;  1CSK A;  3O5Z A;  2LP5 A;  4J9I A;  2DVJ A;  1SHG A;  2CUB A;  3THK A;  3EHR A;  4J9C A;  2J6F A;  4AFQ C;  5IXB A;  2O2O A;  1SEM A;  2O9V A;  1MV0 B;  2KRN A;  2L3Q A;  2M51 A;  2PZ1 A;  2A08 A;  3NGP A;  4F17 A;  2O31 A;  2LQN A;  3REA B;  5GJV B;  4RTX A;  2FRW A;  2LZ6 B;  1NYF A;  3M0U A;  1RLQ C;  3A98 A;  4J9B A;  5FWB A;  2PTK A;  3UA6 A;  2KGT A;  1AWW A;  1V1C A;  1M27 C;  2JW4 A;  2O9S A;  4CC4 B;  2EBP A;  4OMQ A;  1W6X A;  2H8H A;  2YUP A;  1HJD A;  3PVL A;  1MV3 A;  4JPB W;  2NUZ A;  1K1Z A;  2BZ8 A;  1X6G A;  1YWO A;  1NEB A;  2EGA A;  1YP5 A;  1X27 A;  2GTO A;  1Y57 A;  3NMZ C;  2RPN A;  3SEM A;  1JEG A;  2B86 A;  2CT4 A;  1H3H A;  2GNC A;  2F2W A;  1E6G A;  3RNJ A;  2JMA A;  1U3O A;  2EYZ A;  2G6F X;  3C0C A;  3H0I A;  3EG3 A;  4AG1 C;  3EG2 A;  1UJ0 A;  1W70 A;  4HXJ A;  1VYT A;  1WDX A;  1ARK A;  1I1J A;  4QT7 A;  1QKX A;  2DNU A;  4HVU A;  3UA7 A;  4AFU C;  2IIM A;  2SRC A;  2CSQ A;  3VS3 A;  3NPF A;  3H41 A;  1UE9 A;  3UAT A;  2D1X A;  2RQR A;  4CC2 A;  1SPK A;  2KYM A;  2EGC A;  1SRM A;  2KRO A;  4E6R A;  2DL3 A;  4OMO A;  1RLP C;  2OI3 A;  1YWP A;  3VRY A;  2ESW A;  2HSP A;  1ZBJ A;  2SEM A;  4FSS A;  4HVW A;  1WXT A;  1UTI A;  1OPK A;  2M0Y A;  1WXU A;  3EHQ A;  3CQT A;  1GL5 A;  2L3S A;  2GBQ A;  4J9G A;  1IO6 A;  1PKS A;  2RNA A;  2O88 A;  1VA7 A;  2K7A A;  2FEI A;  2J7I A;  1OOT A;  2C0I A;  2ABL A;  1AZG B;  1WA7 A;  1T0H A;  2JS0 A;  2LX7 A;  3QWY A;  2MCN A;  1T3S A;  3VS5 A;  5IH2 A;  1K4U S;  3KFV A;  2LNH B;  2LCS A;  2J06 A;  1GCQ A;  1KFZ A;  3VS1 A;  2GGR A;  2LJ0 A;  4F16 A;  2DM1 A;  3EG0 A;  1PRL C;  1GBQ A;  3I9Q A;  1U06 A;  1GBR A;  2RMO A;  1UG1 A;  1TUD A;  1VYU A;  4RTT A;  2HBW A;  1GFC A;  1AEY A;  1K9A A;  2JXB A;  5I11 A;  2DL4 A;  1ZUY A;  4LUE A;  2LJ1 A;  2AKK A;  1NM7 A;  1J3T A;  1FYN A;  4DEY A;  1UGV A;  4LE9 A;  1I0C A;  2FPE A;  2FRY A;  1YN8 A;  1ABQ A;  3NHN A;  1KJW A;  2X3W D;  2K79 A;  4OMM A;  1BBZ A;  1GCP A;  2KBT A;  2XMF A;  2OJ2 A;  1A0N B;  1M3B A;  1WXB A;  2BTT A;  2EYX A;  4OML A;  1PRM C;  2DA9 A;  4J9F A;  4ESR A;  2CDT A;  5L23 A;  2D8H A;  2AKL A;  4RTV A;  2KXD A;  4RTZ A;  5GJW B;  2LMJ A;  2AZV A;  2D8J A;  2DJQ A;  1ZUU A;  2EGE A;  5HCK A;  1XOV A;  2C0T A;  4RTU A;  3VS7 A;  4Z89 A;  3LH5 A;  2EKH A;  2D0N A;  4OMP A;  2K9G A;  2X3X D;  2DMO A;  1OPL A;  2EQI A;  1K76 A;  3JV3 A;  4D8K A;  2JM9 A;  5IXF A;  1NYG A;  1NLO C;  2P4R A;  2MIO A;  2FPF A;  4M4Z A;  3RBB B;  1Z9Z A;  2E5K A;  2J6O A;  4GLM A;  4J9D A;  2RF0 A;  4JJC A;  3H0H A;  1WIE A;  1JXM A;  2JT4 A;  1HD3 A;  3H0F A;  2YDL A;  2CUD A;  1ZX6 A;  1CKA A;  1QKW A;  4IIM A;  5EC7 A;  2YUO A;  1K0X A;  1QCF A;  4KRT A;  2LQW A;  1B3Q A;  2L2P A;  1AVZ C;  4CC3 A;  1NG2 A;  1M3A A;  4RTW A;  3EGU A;  2A37 A;  1X6B A;  1G2B A;  1UHC A;  4EIK A;  2YT6 A;  3I5R A;  2VKN A;  4JZ4 A;  1H92 A;  4DEX A;  2ED0 A;  2L3P A;  4ZNX A;  1VYV A;  3GBQ A;  2KT1 A;  1B07 A;  1GCQ C;  4JJD A;  4ORZ A;  4LNP A;  2EYW A;  4JJB A;  2K6D A;  5IHI A;  2EYY A;  2GQI A;  2JTE A;  1YCS B;  1X2K A;  2HEQ A;  2YUQ A;  2CRE A;  3PE0 A;  2HDA A;  1PWT A;  2KRM A;  3VS6 A;  3VS4 A;  1BK2 A;  3VS0 A;  1NEG A;  1AWJ A;  2DF6 A;  4J9H A;  1LCK A;  1BB9 A;  1AWO A;  3M0R A;  2DLP A;  2CSI A;  1KSW A;  1FMK A;  1WYX A;  2RQT A;  2CT3 A;  2DE0 X;  1ZLM A;  3TSW A;  1OV3 A;  1Y0M A; 
#chains in the Genus database with same CATH topology
 4AFS C;  1BU1 A;  3M55 A;  3QJ6 A;  3ZBD A;  4LN2 A;  1ABO A;  1RAB B;  1ACM B;  3QPH A;  2DL5 A;  1I8F A;  1TS9 A;  2F2V A;  4PK4 A;  2W10 A;  1YCY A;  3QXE B;  1X43 A;  4IKF A;  3CPF A;  4C92 G;  2V1Q A;  3MP8 A;  4M7D F;  3JCM V;  5LJ5 h;  3CCJ A;  3C95 A;  4ANJ A;  2KMT A;  1Q81 U;  2BE7 D;  3REB B;  5LJ5 d;  2DL8 A;  3F70 A;  3FIF A;  3OB9 A;  3V7C A;  4ZTJ A;  4M7A A;  2EJ9 A;  4AG2 C;  1AZE A;  2KNB B;  2K5I A;  5FU7 B;  5GAM j;  3LLR A;  1QLY A;  5LJ3 f;  5LJ3 e;  2E3H A;  1CKB A;  1IRX A;  4M77 B;  5GAM f;  2K57 A;  2K4Y A;  3CCR Q;  5KYX B;  1VQ4 T;  1GXI E;  1KD1 R;  3LGF A;  1M90 C;  1ZSG A;  2RHZ A;  4BE1 A;  1ZSZ A;  4C5G A;  4PJO A;  3CPW P;  1UDL A;  2ENM A;  4NL2 A;  4K11 A;  2BIV A;  4ELZ C;  1K8A U;  3G1J A;  4BY6 C;  1K8A C;  3UT1 A;  2JMC A;  1UJY A;  5GAM d;  2DBM A;  4C8Q C;  2HQX A;  4X34 A;  3G71 Q;  4KH0 B;  3FJ5 A;  4XAX B;  3X24 B;  2FYK A;  1RUW A;  2ZPI B;  2EW3 A;  2JZ2 A;  4KT0 E;  2OAW A;  4NOY A;  3MP6 A;  2JOY A;  3WVD B;  3SDZ A;  3CC7 T;  1T0J A;  3EGD B;  2KSS A;  4NS5 A;  1Q7Y R;  1T3L A;  2CP7 A;  4WF2 A;  3CCV T;  2RHY A;  3M0Q A;  5GAN 3;  4JS4 A;  1I81 A;  2OTJ Q;  2VAS A;  3CCU Q;  2LJ3 A;  1VQN A;  2DTI A;  5KCH A;  2Y4Y A;  3R6N A;  2O4X B;  1GFD A;  2QQS A;  1G83 A;  4IUP A;  4BE2 A;  1BI1 A;  1K9M C;  1GRI A;  8ATC B;  3VV0 A;  3SWN B;  2CYZ B;  2PNI A;  4FSX A;  1N9R A;  3V7R A;  1WHG A;  2JS2 A;  1YIT Q;  4A63 B;  3G7Z A;  1QWE A;  2XIC A;  1AOJ A;  3GPL A;  1Y96 B;  1M1G A;  1RI9 A;  3I35 A;  1N8R U;  2M02 A;  2YWW A;  3I56 Q;  4F7U F;  4QVZ A;  1EZZ B;  3CCE A;  3R6O A;  1PCX A;  1MGQ A;  1QP2 A;  1VQL A;  2QAS A;  4PFZ A;  5AT1 B;  1UGR B;  2J6F A;  3VYG A;  4KGV B;  3EFR A;  2KRN A;  3JB9 G;  3TQ7 P;  3EFS A;  2PZ1 A;  3PNW C;  5GJV B;  1YI2 Q;  3M0U A;  2DYI A;  1M27 C;  3OYA A;  1M5Q 1;  4A4E A;  1MV3 A;  1D09 B;  4PJO F;  2NUZ A;  4HT9 A;  1SKU B;  3CCM Q;  3CCV A;  3OW2 A;  4DBQ A;  1X27 A;  4MZT A;  2QAZ A;  1OZ2 A;  3BDL A;  1BI3 A;  1MMG A;  3NMZ C;  2RPN A;  1VIF A;  3I56 A;  4OMF B;  1TUG B;  2GNC A;  2F2W A;  4E7I A;  2XDB A;  1FWZ A;  5CKH A;  3RNJ A;  3JCM Q;  2EYZ A;  1NJI C;  2G6F X;  2IVW A;  3KUF A;  1VYT A;  3TCJ A;  1WDX A;  2QA4 Q;  1YJN Q;  3HL8 A;  1QKX A;  3A8G B;  1W2B A;  3QDR B;  4DBF A;  4UC4 A;  4PJO B;  2SRC A;  3CD6 Q;  2PU9 B;  1KK7 A;  4EMH A;  2QEX T;  1UEB A;  5KYN A;  3GNF B;  2D1X A;  4MDW A;  2E41 A;  2E1H A;  4OMO A;  2QGG A;  2Y90 A;  5KE3 A;  2OI3 A;  3VRY A;  5CAI A;  1DJ7 B;  3CCV Q;  3CCM A;  2CZ7 B;  4M7D C;  3S3N A;  3QZ9 B;  1XTD A;  3SWN C;  4C0F A;  1G3Y A;  5FRN A;  4M7D G;  4N0A C;  1OI1 A;  4JS5 A;  3RER A;  1PKS A;  1BCO A;  1HK9 A;  1QQJ A;  2EKO A;  1NZ9 A;  4PJM A;  1YIJ T;  2C0I A;  2R5A A;  2DTO A;  1IHV A;  3CCJ T;  1T3S A;  1YIT T;  2K3Y A;  3GIB A;  2ZAE A;  4M77 A;  2I2L A;  2LDM A;  2XDP A;  2EQK A;  4C92 D;  1OUL A;  3EG0 A;  3I9Q A;  4BUG A;  2D0Q B;  4M7A D;  3DLL A;  1Q95 G;  4RTT A;  1ZSZ B;  2HBW A;  1TSF A;  4PL6 A;  1AEY A;  1K9A A;  2GF7 A;  2KY9 A;  3Q1J A;  8AT1 B;  4LUE A;  2DL4 A;  1ZUY A;  1XJW B;  4ZN3 A;  1RAF B;  3CC2 T;  4DEY A;  1I5L A;  4LE9 A;  2FPE A;  2L5Q A;  2FRY A;  3OYK A;  1F1B B;  3ZFJ A;  1QCN A;  1TTH B;  4ZTF A;  1PD0 A;  1GCP A;  2QXF A;  2LVM A;  1KQS P;  4OML A;  3CCQ A;  4ESR A;  5L23 A;  3OYE A;  4RTZ A;  3GOX A;  1Y7X A;  5LJ3 d;  5GJW B;  5DLO A;  1XOV A;  2C0T A;  4RTU A;  3LW5 E;  5KE2 A;  2EJG A;  4PJO G;  2EAY A;  1OPL A;  1YJ9 A;  2EQI A;  3CCL A;  1NLO C;  4DBR A;  3PT9 A;  1FX7 A;  2AIR B;  3CC4 Q;  5GAO q;  2FPF A;  1WJR A;  4M4Z A;  2QK0 A;  3WVE B;  1Z9Z A;  2J6O A;  4N4G A;  2OTJ A;  3EG9 A;  4NL3 A;  4JJC A;  4C0D B;  1Q82 U;  4C8Q B;  2RD1 A;  3T9N A;  1VQ7 Q;  4P5N A;  4CRI A;  2CUD A;  1ZX6 A;  3FEO A;  2E4H A;  1QW1 A;  3VJP A;  3NTK A;  2YUO A;  2AHJ B;  3JRZ A;  5GAM e;  1AVZ C;  4YTL A;  4CC3 A;  1W2B P;  4RTW A;  2AT1 B;  2DK3 A;  1VQO T;  4DBH A;  1LPL A;  4M78 C;  2RK2 A;  1RAD B;  1H92 A;  4F7U B;  3HRT A;  1VYV A;  1GCQ C;  4LNP A;  2EYW A;  4PJN A;  2F5T X;  4M77 D;  4M78 D;  5GAN 6;  2L89 A;  2HEQ A;  2CRE A;  3PMT A;  5FU6 B;  3HHT B;  3M54 A;  1VOM A;  2RO0 A;  2JTF A;  4HKE A;  1AWJ A;  1KHI A;  1IZ6 A;  4J9H A;  1MMA A;  1BB9 A;  3M0R A;  2V8K A;  5GAM g;  2CSI A;  2LQ8 A;  1X6O A;  2DFU A;  3CME T;  4M75 B;  1Y0M A;  2E70 A;  2VGN A;  1HXD A;  2FG0 A;  1B7T A;  2E3I A;  2HNI A;  4E47 A;  1Q82 R;  4E7S A;  1FMW A;  2K5L A;  2KDS A;  1WFW A;  2GTJ A;  3OW2 S;  4XU1 A;  1S1N A;  1D0X A;  3CMA T;  3I56 T;  2FL7 A;  4HCZ A;  5GAN d;  1MUZ A;  1ZUK A;  2VB6 A;  2A36 A;  4OB2 B;  4Q5W A;  3OYC A;  1TG0 A;  1VQ6 T;  3X26 B;  2PVG B;  3OW2 P;  4RMO A;  2RN8 A;  4XTX A;  1UEC A;  3X25 B;  2ROT A;  5I22 A;  1HSQ A;  1JXO A;  1MMN A;  5CKF A;  1OX9 A;  1WX6 A;  1NE8 A;  1WQ7 A;  2MF2 A;  3TSZ A;  2HKN A;  3OBY A;  1WNL A;  1P92 A;  1G3W A;  4IUT A;  4F14 A;  2DET A;  4O6J A;  2I0N A;  2AK5 A;  4QKU A;  2LT4 A;  1UGP B;  2DO3 A;  5DY9 A;  3H8Z A;  1ZBX A;  4Z02 A;  3PVQ A;  2HCK A;  1W1F A;  1AWX A;  3CCU T;  1D1C A;  3I5S A;  4FCY A;  4M75 E;  3VYH B;  2BZX A;  4OB0 B;  2HZY A;  1TUC A;  1VQM A;  5C6S A;  1NLP C;  4JLG A;  1I5O B;  2YUN A;  3L2W A;  2BKD N;  4IUR A;  2Y4X A;  1HYO A;  2V1R A;  5IHN A;  1BIA A;  4GY5 A;  4MMK A;  1YBY A;  1X75 C;  1RAG B;  4FT2 A;  1MNE A;  4M75 G;  2O01 E;  5I21 A;  4CC7 A;  5FRO A;  2EVR A;  1NPP A;  2KT8 A;  4X1V A;  2DRM A;  4E7J A;  2DIG A;  5M9O A;  3HKS A;  3VS2 A;  5IHK A;  5GMK e;  2RM4 A;  1JQQ A;  1YIT A;  3MHX A;  4Z88 A;  4HVV A;  1H8K A;  1YJ9 T;  3MET A;  3EG9 B;  4JRK A;  4BDY A;  4OB3 B;  1WLP B;  3MJX A;  4C8Q A;  4KGZ B;  3OYL A;  1YIJ Q;  4LDU A;  3MKD A;  4IIO A;  5LJ5 g;  4JRP A;  3QZ5 B;  1BI0 A;  2COY A;  4WCI A;  4E7H A;  1RAA B;  3G6E T;  4BAC A;  3QBY A;  2KXC A;  2LCC A;  4J8O A;  3H6Z A;  2V8J A;  4PJO C;  2EJF A;  3ULR B;  4QVC A;  4J6W A;  1YHQ T;  1MMD A;  2DX1 A;  1ZSZ C;  1SSH A;  2J6K A;  2A7Y A;  2QEX A;  2KE9 A;  3TVT A;  1B34 A;  3RMS A;  1O75 A;  1E6H A;  1QCO A;  1OU9 A;  1WHJ A;  2DZC A;  3NTH A;  4BB7 A;  2R57 A;  5FW9 A;  2MYS A;  2DRK A;  4PJO E;  4M7A G;  3CME Q;  3VRZ A;  1M1K C;  1IGU A;  2C0O A;  1CSK A;  3O5Z A;  4J9I A;  5GMK h;  3BY7 A;  1SHG A;  2RJD A;  1YJN T;  5FU7 C;  5J3B A;  1UGQ B;  3J80 E;  3G6E Q;  4AFQ C;  5IXB A;  1YHQ Q;  3S3O A;  1SEM A;  4LXC A;  1MV0 B;  1K73 C;  4M78 G;  4PKC C;  2QTV A;  4MZM A;  3NGP A;  4F17 A;  1Q81 C;  1WHK A;  2YHT A;  1OX8 A;  5KYU A;  2LZ6 B;  2L8D A;  3A98 A;  5FWB A;  3UA6 A;  1KD1 C;  1M90 R;  2X4J A;  1AWW A;  1VQK Q;  1SF9 A;  5KH6 A;  5CR2 A;  1V1C A;  1NPR A;  1U1S A;  2JW4 A;  4CC4 B;  5DM7 R;  2YRC A;  1W6X A;  2P0K A;  3PVL A;  4ME7 A;  1VQ8 T;  2QEX Q;  2BZ8 A;  1K8A R;  3CC2 A;  3FDR A;  4OF1 A;  4M7D B;  5CKB A;  2GTO A;  2HL5 C;  3JCM c;  2K5F A;  1JEG A;  3RES A;  1H3H A;  3SB2 A;  5GAN g;  1EIF A;  1TH7 A;  2ZGW A;  2EQU A;  2JMA A;  4FW2 A;  2QQR A;  2VXE A;  3C0C A;  1D0Y A;  2YLC A;  3L1A A;  3EG3 A;  1UJ0 A;  4HXJ A;  2H3E B;  2VYT A;  4M77 E;  4EDU A;  4A54 A;  1ARK A;  5EG2 A;  4QT7 A;  2RHX A;  3UA7 A;  3OS0 A;  5IT9 E;  3M5A A;  4FT4 A;  2CSQ A;  3JCM P;  3NPF A;  1VQN Q;  4F04 B;  4CC2 A;  1SPK A;  2KYM A;  4M75 C;  2H3J A;  7AT1 B;  3JCM X;  2EGC A;  4PLI A;  1SRM A;  4E6R A;  2EQM A;  3JCM W;  5IAY A;  5GAO n;  5CCA A;  1RL2 A;  1ZBJ A;  2SEM A;  4FSS A;  4ATO A;  2DEU A;  3CC2 Q;  4HVW A;  1U8R A;  2HBP A;  4IUQ A;  1OPK A;  2RI5 A;  1BCM A;  2M0Y A;  2CGH A;  3EHQ A;  3CQT A;  2QI2 A;  2GBQ A;  4VUB A;  3G4S Q;  1OYX A;  2K7A A;  2FEI A;  3A8L B;  2MAM A;  4RKU E;  1OOT A;  2ABL A;  2ATC B;  2JS0 A;  2CS7 A;  4LDX A;  3GNG A;  1XNI A;  4C8Q G;  3VS5 A;  2QGF B;  5IH2 A;  4M7D E;  1K4U S;  4E7L A;  1GCQ A;  1QVF S;  4GLK A;  3I55 A;  2DM1 A;  1PRL C;  4RCB A;  1U06 A;  5HY6 A;  2RMO A;  1GFC A;  2DAQ A;  4M78 A;  3EAE A;  2JXB A;  4KBM B;  3PTA A;  2R5M A;  4E2F B;  3OYF A;  1NM7 A;  2V26 A;  1FYN A;  1UGV A;  3JB9 F;  2KI7 A;  5KYY B;  3S6W A;  1ABQ A;  3NHN A;  3MEV A;  4JLI A;  3QSU A;  2E5Q A;  2KBT A;  2XMF A;  1A0N B;  1Y07 A;  2RB6 A;  3I55 T;  2EYX A;  2BTT A;  2DA9 A;  2D8H A;  2AKL A;  1VQM Q;  3UPU A;  3FRN A;  1S72 A;  3MEW A;  2DJQ A;  2EGE A;  5HCK A;  3LH5 A;  2EKH A;  5C0M A;  5GAO m;  2D0N A;  2EWN A;  2K9G A;  4OMP A;  2WSC E;  4D6W A;  1K76 A;  2JM9 A;  1NYG A;  1PSE A;  1ZA2 B;  3HTR A;  1AHJ B;  1PM3 A;  4TVR A;  2MPX C;  4IUV A;  3JB9 J;  4GLM A;  5HK0 A;  3J81 E;  1WIE A;  1WJQ A;  1JXM A;  3G71 T;  3OYJ A;  3RKW A;  4OVA A;  3H0F A;  4BI8 B;  4O5V A;  2JTM A;  3A8M B;  1Q86 C;  1QKW A;  1K0X A;  5GMK l;  2LQW A;  1B3Q A;  4M75 D;  2KQW A;  4EPC A;  3OYI A;  3P8H A;  1X6B A;  1G2B A;  2YT6 A;  1V76 A;  2LNV A;  2X35 A;  2ED0 A;  2IG0 A;  4FW1 A;  4ZNX A;  2OTL Q;  4XU3 A;  3JCM J;  1VQ6 Q;  2KT1 A;  1VQN T;  3OYN A;  4JJD A;  5LL6 S;  3CCS A;  4JDS A;  2K6D A;  2MWO A;  5IHI A;  2GQI A;  3C12 A;  1YJW Q;  1M1K R;  4C92 A;  3JB9 D;  2DD5 A;  2YUQ A;  2QG9 B;  4DA4 A;  3PE0 A;  2HDA A;  1PWT A;  1VQL T;  2FVU A;  4MZP A;  3VS4 A;  3VS0 A;  5CQX A;  1VQP A;  1LCK A;  2P4T A;  5CK9 A;  1FMK A;  2V8I A;  2RQT A;  2LX9 A;  2DE0 X;  2R58 A;  2ZPE B;  1N8R C;  1OV3 A;  2HMA A;  3JCM h;  5DLQ E;  3V7S A;  3G4S T;  1VQK A;  5I2M A;  1SRL A;  4PNO A;  5GMK j;  5KYW A;  2YXY A;  1KQ1 A;  3WXM B;  5KYU B;  2DEQ A;  3JAM E;  2QDL A;  3QII A;  2K2M A;  2F1L A;  3HFO A;  1U5S A;  2RK1 A;  1OZ3 A;  1UB4 A;  4WTO B;  1VQL Q;  1FMV A;  2FZG B;  3ZL7 C;  2AZS A;  1Q7Y C;  2RQV A;  5KCO A;  3U23 A;  3X20 B;  3CCQ T;  2OTL A;  4M7D A;  1PHT A;  1JRI A;  3KXT A;  1N5Z A;  2RI3 A;  4D8D A;  3CCR A;  4Y92 A;  5ECA A;  3CC7 Q;  2ZPB B;  3MPU B;  1QVF A;  1BIB A;  1VQ5 Q;  2DYB A;  3QYH B;  1N6A A;  2FHD A;  2D6F A;  2LTO A;  4OMN A;  2ED1 A;  1PKT A;  2M16 A;  3QUI A;  3UDC A;  4J6X A;  1JJ2 P;  1ZHI A;  2KYB A;  1BYM A;  1UGS B;  1R8O B;  3OYD A;  1H3Z A;  2A28 A;  2L0A A;  1JU5 C;  3UF4 A;  2VC8 A;  1M9S A;  4AMC A;  1KC8 R;  4B9W A;  1G3T A;  2CKK A;  1IGQ A;  2PVD B;  1UFF A;  1SSF A;  2QA4 T;  4HCK A;  4FYV B;  1QP3 A;  1SHF A;  2O4X A;  1VQ5 T;  1LOJ A;  2HQH A;  1IXD A;  1V29 B;  2KK4 A;  1PNJ A;  5A0L A;  1Y71 A;  1X2Q A;  3M0T A;  5GAM h;  5GAN 7;  4L5G A;  3CCS T;  1D1B A;  3MEU A;  4KUL A;  2CP0 A;  3M0P A;  4C5H A;  1YFN A;  2EFI A;  5D6X A;  1ZA1 B;  2Z0W A;  2RHI A;  3LH0 A;  1VQP T;  2DBK A;  4M75 F;  2P0Q A;  5A0G A;  2OX7 A;  1LJO A;  2BE9 B;  3M53 A;  4XTY A;  3VUB A;  2QQA A;  3NFC A;  5J26 A;  1OEB A;  4J9E A;  1O9S A;  3M4Y A;  1WJS A;  3JCM b;  1QWF A;  1U1T A;  2JM8 A;  2E10 A;  3RR6 A;  3OBW A;  4M78 E;  4XTV A;  4J7F A;  3JCM d;  1Z9Q A;  1KHC A;  3V8K A;  4C5E A;  5HKC A;  2ECZ A;  1AD5 A;  4CI0 C;  4JUV A;  4QQD A;  2X4Y A;  3P8D A;  4RUG A;  4XU0 A;  1W4S A;  1I07 A;  1VQO A;  3SD4 A;  3FJP A;  4A4K A;  3OS5 A;  1FXX A;  2K3B A;  3EGD A;  3OYB A;  4E7K A;  2PUK B;  2LP5 A;  2RI2 A;  4C5I A;  2RJE A;  1WZO A;  2CUB A;  3THK A;  3EHR A;  4J9C A;  3CC4 T;  4BE0 A;  2QTX A;  5GAO r;  2E65 A;  3QYG B;  3QG1 A;  5GMK i;  1X01 A;  5GAO p;  1M8V A;  2L3Q A;  2OTJ T;  2BUD A;  1R77 A;  2A08 A;  3ME9 A;  4PJJ A;  1JJ2 A;  2O31 A;  2LQN A;  3REA B;  4RTX A;  2FRW A;  3EGX A;  2DKG A;  4J9B A;  2PTK A;  1RAI B;  1BKB A;  2ZPF B;  3CMA Q;  3E19 A;  3M58 A;  2O9S A;  1KC8 U;  2EBP A;  4OMQ A;  2YUP A;  4LD9 K;  1HJD A;  5FU6 C;  2GCX A;  4QQG A;  4JPB W;  4OP0 A;  2CP5 A;  3CCR T;  2ZZD A;  2A3L A;  3QO3 A;  1YWO A;  1VQ7 A;  1YP5 A;  2EGA A;  4XTU A;  2QQB A;  2M9U A;  3PIP A;  1Y57 A;  4FYY B;  2OTL T;  5CO7 A;  2CT4 A;  3CXC S;  1M90 U;  1G8X A;  2EIF A;  1RAH B;  3AT1 B;  2XU8 A;  1VQ6 A;  1E6G A;  1NJI U;  2B8A A;  3H0I A;  4AG1 C;  5I2S A;  3EG2 A;  1W70 A;  2JJ9 A;  3TEE A;  4R55 A;  4LD6 A;  2DD4 A;  2X51 A;  4QW2 A;  1I1J A;  3C4S A;  4HVU A;  5LJ3 h;  3QJY A;  5HK3 A;  2XKO C;  2IIM A;  5L8R E;  3VS3 A;  3H41 A;  1RAE B;  1UE9 A;  2PUO B;  3UAT A;  2DVE A;  1M2V B;  3OMG A;  3CMA A;  4BD3 A;  4R56 A;  3CBM A;  1JBM A;  2JVV A;  9ATC B;  1KQS A;  5LJ3 j;  3HSB A;  2CP6 A;  2NUP B;  1UTI A;  5IN1 A;  1WXU A;  2NYS A;  2XID A;  2NLU A;  1GL5 A;  3QDF A;  2F5K A;  2RNA A;  2O88 A;  3L2Z A;  1VA7 A;  3M4G A;  2J7I A;  1M1F A;  1PG5 B;  1T0H A;  2LX7 A;  3N5B B;  1D3B A;  5CQY A;  3QWY A;  5A2Q E;  3L2R A;  3KFV A;  2LNH B;  2WAC A;  2CZ0 B;  1KFZ A;  4ZGJ B;  2FB7 A;  2EQJ A;  3VS1 A;  2LJ0 A;  3G6E A;  2E6N A;  1GBQ A;  1VQ5 A;  1UG1 A;  4M7A E;  2HKQ B;  4A4F A;  2ZPG B;  2EYQ A;  3M57 A;  3PMI A;  3CCQ Q;  4F7U E;  2LJ1 A;  4J5Y A;  2AKK A;  1J3T A;  5GAN 4;  2G3R A;  4J7I A;  3CCE Q;  1YN8 A;  3OYG A;  2IPO B;  1KJW A;  3NTI A;  2LRQ A;  1C0M A;  2K79 A;  4DQ2 A;  1M1K U;  1D0Z A;  2OJ2 A;  2KVQ G;  4N4H A;  1M3B A;  1QVG S;  3CC4 A;  4II1 A;  2CDT A;  3L2V A;  3RDV A;  2KXD A;  3A8H B;  3X28 B;  2LCL A;  3VS7 A;  3TU4 K;  4C8Q E;  2M1H A;  2HAX A;  4FIB A;  4XK8 E;  4HCB A;  3JV3 A;  5IXF A;  3A1P A;  5D6Y A;  5AYF A;  4J83 A;  3RBB B;  2E5K A;  3CBO A;  2RF0 A;  2A0F B;  3V8J A;  3CCJ Q;  4BDZ A;  3H0H A;  3OYM A;  3HRS A;  2E6Z A;  3E9F A;  3CCL Q;  5EC7 A;  4B9X A;  4ZN1 A;  2L2P A;  3DLM A;  5GAN e;  4EMK A;  4HT8 A;  1PSF A;  2DPP B;  2FZC B;  1M3A A;  3MP1 A;  3EGU A;  2ZPH B;  2A37 A;  2VXF A;  4X9C A;  3JCM f;  3KBG A;  2X4X A;  4FL6 A;  2DER A;  3G71 A;  4JZ4 A;  1YIJ A;  1G5V A;  2QA4 A;  3OS1 A;  3GBQ A;  4ORZ A;  3BW1 A;  4JJB A;  2EYY A;  2JTE A;  1YCS B;  4QVD A;  1X2K A;  2F69 A;  3RUX A;  2XDD A;  2KRM A;  1BK2 A;  1NEG A;  2RHU A;  3E2U A;  4M7A B;  5GAO l;  1AWO A;  4M7A F;  4OGC A;  2HL3 A;  1VQO Q;  1KSW A;  1WYX A;  1LNX A;  1OQK A;  3S3M A;  3J7A F;  1LVK A;  1MHN A;  2DXB A;  1QVP A;  4IUU A;  4N4I A;  4PFP A;  3BE3 A;  3VKI A;  1C6V X;  1K9M R;  4XU2 A;  4LDV A;  3GP8 A;  1VQ7 T;  2XI9 A;  2GFA A;  2FPD A;  3DB3 A;  2KRS A;  1NBE B;  1WHL A;  5GMK m;  1UUE A;  3JSC A;  1E7O A;  2W0Z A;  2COW A;  3HFN A;  1ZQ1 A;  2PQW A;  3GF5 A;  3EH1 A;  3CBP A;  3M56 A;  1YI2 T;  3FLG A;  2NUP A;  1Q7Y U;  4MML A;  1EX4 A;  2RQU A;  2J05 A;  4KUI A;  1JO8 A;  5D6W A;  4C92 B;  3FC3 A;  2OAU A;  4HCC A;  1OU8 A;  3LX7 A;  2DTH A;  4C92 E;  4MDX A;  1RAC B;  2VWF A;  4B6M A;  2RJC A;  1EFN A;  4JZ3 A;  3OA6 A;  2PVO B;  4R0K A;  1YJW T;  4BY6 B;  2CP2 A;  5J39 A;  4RTY A;  2KEA A;  1N9S A;  1WGS A;  2CH4 A;  5CKE A;  5KYW B;  1WI7 A;  3INZ A;  3M0S A;  4J6Y A;  5LJ5 f;  5A0D A;  2RA2 A;  4FU6 A;  3D7S B;  2NUT B;  2VVK A;  4M77 G;  3O8V A;  2FO0 A;  2BZY A;  5LJ5 j;  3OYH A;  2QQ9 A;  4M77 C;  4PJO D;  3OY9 A;  2YSQ A;  3BFM A;  4LUD A;  1W2B S;  2CH4 W;  1G3S A;  1YJ9 Q;  2DIL A;  1VQP Q;  2XK0 A;  3LYI A;  4Y91 A;  3OSS C;  3EFO A;  3JB9 I;  2GQV A;  2MMP A;  2ROL A;  4N0A A;  4M78 F;  4M77 F;  3SWN A;  3M59 A;  1K73 R;  1M8M A;  4AFZ C;  1N27 A;  1AT1 B;  1YNZ A;  2EPD A;  2KR3 A;  1XQH A;  1Q81 R;  3HPW A;  1Q82 C;  3BDU A;  1MND A;  3EG1 A;  2RH2 A;  3DKM A;  3V8L A;  3URG A;  1NJI R;  2KAF A;  4XTZ A;  2FZK B;  4V2S A;  3JCM e;  2DXC A;  1H64 1;  2MOX A;  2VGM A;  3TRE A;  1D3B B;  2HD0 A;  1PC0 A;  3IQL A;  1K0S A;  2C06 A;  1QVG P;  2VUB A;  4RG8 A;  4JRQ A;  1KQS S;  2M0O A;  5D7U A;  2F2X A;  4GBQ A;  2DZ9 A;  4C8Q F;  1KIK A;  1KQ2 A;  2NWM A;  3RMQ A;  1M3C A;  1WPY A;  4FYX B;  4KUD K;  1K9M U;  4LDW A;  1M30 A;  1UHF A;  3SHW A;  3VUZ A;  4A4H A;  1WHM A;  4Z8A A;  1Q86 R;  3QWX X;  3PFS A;  2RQW A;  3M9Q A;  3PGG A;  2WSF E;  1VQ8 Q;  4JRI A;  3UWN A;  1VQ4 A;  1JB0 E;  3HRU A;  5FWC A;  1X69 A;  3H9N A;  5GAN j;  1VQK T;  4XQ3 A;  2DL7 A;  3CCM T;  4BI4 A;  5GAN f;  3LWI A;  2HSE B;  5LJ5 e;  2DVJ A;  2JN0 A;  3EH2 A;  2XHC A;  1TXQ A;  2DXT A;  3RKY A;  2O2O A;  2K2V A;  2O9V A;  1VQ9 T;  2XD0 A;  1TWB A;  2M51 A;  2E12 A;  4RCC A;  1S72 Q;  3FB9 A;  4C92 F;  1NYF A;  1RLQ C;  2KGT A;  1N8R R;  1I4K 1;  4LDY A;  4EMG A;  4EMK B;  1M2O A;  1B34 B;  1KC8 C;  2H8H A;  2L3R A;  2WSE E;  1Q86 U;  1K1Z A;  1TOV A;  1X6G A;  1VQ4 Q;  1NEB A;  4PJL A;  5GAN 8;  2XG8 D;  3LWH A;  4PFO A;  1WHH A;  3SEM A;  2B86 A;  4ZGE B;  3PIO A;  4C92 C;  1R0C B;  2DJZ A;  1JJ2 S;  3ZEH A;  3AHU A;  1U3O A;  3LGL A;  2CZ1 B;  2MK5 A;  4Y28 E;  1SG5 A;  4FYW B;  5KYX A;  3CPW A;  2RJF A;  3EGX B;  3OSV A;  4BI3 A;  2DNU A;  3MO8 A;  1S72 T;  4AFU C;  1YJW A;  1IRE B;  2QYZ A;  2DXU A;  4M7D D;  2RQR A;  4DOW A;  3RKX A;  3JCM g;  3CCE T;  3GLX A;  1BI2 A;  3OS2 A;  2KRO A;  2DL3 A;  3CXC P;  1RLP C;  1YWP A;  3ASK A;  2ESW A;  2HSP A;  1WXT A;  5CIU A;  2CZ6 B;  4JJN K;  3OYY A;  2LC4 A;  2DIQ A;  2L3S A;  4J9G A;  4QQ6 A;  1IO6 A;  3MEA A;  4E7Z A;  2E64 A;  2VV5 A;  3I55 Q;  4C0D C;  4A4G A;  2COZ A;  2JNG A;  3E1S A;  1AZG B;  1WA7 A;  4KH1 B;  5GAN 2;  5CKD A;  1PD1 A;  3A8O B;  3L2U A;  6AT1 B;  2CP3 A;  2MCN A;  3RIR A;  3MCA B;  3CD6 A;  5FRM A;  2X4W A;  2GFU A;  2MWP A;  2LCS A;  2J06 A;  4L59 A;  4L6V 5;  3G4S A;  2GGR A;  4F16 A;  1GBR A;  2MI6 A;  1TUD A;  1VYU A;  1VIE A;  1M2V A;  2NUT A;  3C94 A;  3VU3 C;  5I11 A;  3DB4 A;  4AT1 B;  2LT1 A;  3CC7 A;  3CME A;  1I0C A;  4C0Z A;  4DOV A;  5FLX E;  3L2Q A;  4EMK C;  3CCU A;  5CVI A;  3CCL T;  2QDY B;  2X3W D;  3EFO B;  4OMM A;  1BBZ A;  3SFM A;  2P0P A;  3OMC A;  2D9T A;  4M7A C;  4C0G A;  1YHQ A;  1WXB A;  3A5Z B;  1PRM C;  4J9F A;  5GAN 5;  4RTV A;  2LMJ A;  2AZV A;  2D8J A;  4F7U A;  1ZUU A;  1RI0 A;  4Z89 A;  1K73 U;  2X3X D;  2DMO A;  5LJ3 g;  4HA8 A;  4D8K A;  4PLL A;  2P4R A;  4KGX B;  2MIO A;  1KG1 A;  1KD1 U;  1YI2 A;  1VQ9 Q;  3CEY A;  3QKJ A;  4M78 B;  4J9D A;  1D1A A;  1IB8 A;  2JT4 A;  1HD3 A;  2YDL A;  3OQ5 A;  1CKA A;  2LQK A;  4IIM A;  4OGE A;  3P8B B;  3QHS A;  1M4Z A;  1QCF A;  4KRT A;  5KYY A;  4M75 A;  1TU0 B;  2YRV A;  1QVG A;  2ZCF B;  4FM4 B;  3CCS Q;  1VQ8 A;  3ER0 A;  1NG2 A;  4C8Q D;  1UHC A;  1WQW A;  4XTW A;  4A53 A;  4EIK A;  3I5R A;  1VUB A;  2VKN A;  5GAN h;  2P84 A;  4DEX A;  3CXC A;  2L3P A;  1VQM T;  1R0B G;  3E9G A;  1IHW A;  1B07 A;  4ZGD B;  1Y96 A;  2JUF A;  2YLB A;  4F7U G;  3CD6 T;  4ELY C;  1QMC A;  1QVF P;  2YRD A;  3VS6 A;  1YJN A;  3CPW S;  2DF6 A;  2DLP A;  2X9H A;  3HP9 A;  2HQE A;  1VQ9 A;  2K3X A;  3L42 A;  4OB1 B;  4X9D A;  1C1A A;  2CT3 A;  1ZLM A;  3TSW A;  3JB9 H;  4RG2 A; 
#chains in the Genus database with same CATH homology
 4AFS C;  1BU1 A;  2FG0 A;  1SRL A;  4LN2 A;  1ABO A;  2QDL A;  2FPD A;  2DL5 A;  2KRS A;  1WFW A;  2F2V A;  2K2M A;  2W10 A;  1U5S A;  1X43 A;  2GTJ A;  1S1N A;  1UUE A;  1E7O A;  2W0Z A;  2V1Q A;  3ZL7 C;  2AZS A;  2RQV A;  1MUZ A;  3REB B;  2RQU A;  1ZUK A;  2J05 A;  3U23 A;  2A36 A;  1PHT A;  1JO8 A;  2DL8 A;  1N5Z A;  4D8D A;  1TG0 A;  4Y92 A;  2VWF A;  4AG2 C;  1AZE A;  2KNB B;  5ECA A;  1EFN A;  2RN8 A;  4JZ3 A;  1UEC A;  2ROT A;  4R0K A;  5I22 A;  1HSQ A;  1JXO A;  2DYB A;  1QLY A;  1WX6 A;  4OMN A;  1CKB A;  2ED1 A;  1PKT A;  4RTY A;  3TSZ A;  2KEA A;  4F14 A;  2CH4 A;  2I0N A;  1WI7 A;  2AK5 A;  2KYB A;  3M0S A;  1ZSG A;  2A28 A;  2L0A A;  2VVK A;  3PVQ A;  2HCK A;  1W1F A;  1AWX A;  1JU5 C;  3UF4 A;  2FO0 A;  2BZY A;  3I5S A;  1UDL A;  2ENM A;  2YSQ A;  2BZX A;  4LUD A;  4K11 A;  2CH4 W;  1UFF A;  1TUC A;  2DIL A;  4HCK A;  1NLP C;  2JMC A;  2YUN A;  1SHF A;  1UJY A;  2V1R A;  2DBM A;  5IHN A;  2ROL A;  1PNJ A;  1X2Q A;  1M8M A;  4AFZ C;  3M0T A;  3FJ5 A;  2EPD A;  1YNZ A;  2KR3 A;  4CC7 A;  2EVR A;  1RUW A;  2EW3 A;  2KT8 A;  4X1V A;  2DRM A;  2OAW A;  3EG1 A;  3M0P A;  3VS2 A;  5IHK A;  1JQQ A;  4Z88 A;  2MOX A;  4HVV A;  1H8K A;  1T0J A;  2DBK A;  3IQL A;  1T3L A;  1K0S A;  1WLP B;  3M0Q A;  1OEB A;  4IIO A;  4J9E A;  2F2X A;  4GBQ A;  1KIK A;  2LJ3 A;  2NWM A;  1QWF A;  4WCI A;  2JM8 A;  1M3C A;  3R6N A;  1GFD A;  1G83 A;  2KXC A;  1M30 A;  1UHF A;  1GRI A;  3SHW A;  1Z9Q A;  3ULR B;  4Z8A A;  3QWX X;  2DX1 A;  2PNI A;  2RQW A;  2ECZ A;  1SSH A;  2J6K A;  1AD5 A;  2KE9 A;  3TVT A;  1E6H A;  2JS2 A;  4A63 B;  4RUG A;  5FWC A;  1QWE A;  1X69 A;  1AOJ A;  1I07 A;  1RI9 A;  3I35 A;  5FW9 A;  2DRK A;  2DL7 A;  2K3B A;  3VRZ A;  2C0O A;  1CSK A;  3O5Z A;  2LP5 A;  4J9I A;  2DVJ A;  1SHG A;  2CUB A;  3THK A;  3EHR A;  4J9C A;  2J6F A;  4AFQ C;  5IXB A;  2O2O A;  1SEM A;  2O9V A;  1MV0 B;  2KRN A;  2L3Q A;  2M51 A;  2PZ1 A;  2A08 A;  3NGP A;  4F17 A;  2O31 A;  2LQN A;  3REA B;  5GJV B;  4RTX A;  2FRW A;  2LZ6 B;  1NYF A;  3M0U A;  1RLQ C;  3A98 A;  4J9B A;  5FWB A;  2PTK A;  3UA6 A;  2KGT A;  1AWW A;  1V1C A;  1M27 C;  2JW4 A;  2O9S A;  4CC4 B;  2EBP A;  4OMQ A;  1W6X A;  2H8H A;  2YUP A;  1HJD A;  3PVL A;  1MV3 A;  4JPB W;  2NUZ A;  1K1Z A;  2BZ8 A;  1X6G A;  1YWO A;  1NEB A;  2EGA A;  1YP5 A;  1X27 A;  2GTO A;  1Y57 A;  3NMZ C;  2RPN A;  3SEM A;  1JEG A;  2B86 A;  2CT4 A;  1H3H A;  2GNC A;  2F2W A;  1E6G A;  3RNJ A;  2JMA A;  1U3O A;  2EYZ A;  2G6F X;  3C0C A;  3H0I A;  3EG3 A;  4AG1 C;  3EG2 A;  1UJ0 A;  1W70 A;  4HXJ A;  1VYT A;  1WDX A;  1ARK A;  1I1J A;  4QT7 A;  1QKX A;  2DNU A;  4HVU A;  3UA7 A;  4AFU C;  2IIM A;  2SRC A;  2CSQ A;  3VS3 A;  3NPF A;  3H41 A;  1UE9 A;  3UAT A;  2D1X A;  2RQR A;  4CC2 A;  1SPK A;  2KYM A;  2EGC A;  1SRM A;  2KRO A;  4E6R A;  2DL3 A;  4OMO A;  1RLP C;  2OI3 A;  1YWP A;  3VRY A;  2ESW A;  2HSP A;  1ZBJ A;  2SEM A;  4FSS A;  4HVW A;  1WXT A;  1UTI A;  1OPK A;  2M0Y A;  1WXU A;  3EHQ A;  3CQT A;  1GL5 A;  2L3S A;  2GBQ A;  4J9G A;  1IO6 A;  1PKS A;  2RNA A;  2O88 A;  1VA7 A;  2K7A A;  2FEI A;  2J7I A;  1OOT A;  2C0I A;  2ABL A;  1AZG B;  1WA7 A;  1T0H A;  2JS0 A;  2LX7 A;  3QWY A;  2MCN A;  1T3S A;  3VS5 A;  5IH2 A;  1K4U S;  3KFV A;  2LNH B;  2LCS A;  2J06 A;  1GCQ A;  1KFZ A;  3VS1 A;  2GGR A;  2LJ0 A;  4F16 A;  2DM1 A;  3EG0 A;  1PRL C;  1GBQ A;  3I9Q A;  1U06 A;  1GBR A;  2RMO A;  1UG1 A;  1TUD A;  1VYU A;  4RTT A;  2HBW A;  1GFC A;  1AEY A;  1K9A A;  2JXB A;  5I11 A;  2DL4 A;  1ZUY A;  4LUE A;  2LJ1 A;  2AKK A;  1NM7 A;  1J3T A;  1FYN A;  4DEY A;  1UGV A;  4LE9 A;  1I0C A;  2FPE A;  2FRY A;  1YN8 A;  1ABQ A;  3NHN A;  1KJW A;  2X3W D;  2K79 A;  4OMM A;  1BBZ A;  1GCP A;  2KBT A;  2XMF A;  2OJ2 A;  1A0N B;  1M3B A;  1WXB A;  2BTT A;  2EYX A;  4OML A;  1PRM C;  2DA9 A;  4J9F A;  4ESR A;  2CDT A;  5L23 A;  2D8H A;  2AKL A;  4RTV A;  2KXD A;  4RTZ A;  5GJW B;  2LMJ A;  2AZV A;  2D8J A;  2DJQ A;  1ZUU A;  2EGE A;  5HCK A;  1XOV A;  2C0T A;  4RTU A;  3VS7 A;  4Z89 A;  3LH5 A;  2EKH A;  2D0N A;  4OMP A;  2K9G A;  2X3X D;  2DMO A;  1OPL A;  2EQI A;  1K76 A;  3JV3 A;  4D8K A;  2JM9 A;  5IXF A;  1NYG A;  1NLO C;  2P4R A;  2MIO A;  2FPF A;  4M4Z A;  3RBB B;  1Z9Z A;  2E5K A;  2J6O A;  4GLM A;  4J9D A;  2RF0 A;  4JJC A;  3H0H A;  1WIE A;  1JXM A;  2JT4 A;  1HD3 A;  3H0F A;  2YDL A;  2CUD A;  1ZX6 A;  1CKA A;  1QKW A;  4IIM A;  5EC7 A;  2YUO A;  1K0X A;  1QCF A;  4KRT A;  2LQW A;  1B3Q A;  2L2P A;  1AVZ C;  4CC3 A;  1NG2 A;  1M3A A;  4RTW A;  3EGU A;  2A37 A;  1X6B A;  1G2B A;  1UHC A;  4EIK A;  2YT6 A;  3I5R A;  2VKN A;  4JZ4 A;  1H92 A;  4DEX A;  2ED0 A;  2L3P A;  4ZNX A;  1VYV A;  3GBQ A;  2KT1 A;  1B07 A;  1GCQ C;  4JJD A;  4ORZ A;  4LNP A;  2EYW A;  4JJB A;  2K6D A;  5IHI A;  2EYY A;  2GQI A;  2JTE A;  1YCS B;  1X2K A;  2HEQ A;  2YUQ A;  2CRE A;  3PE0 A;  2HDA A;  1PWT A;  2KRM A;  3VS6 A;  3VS4 A;  1BK2 A;  3VS0 A;  1NEG A;  1AWJ A;  2DF6 A;  4J9H A;  1LCK A;  1BB9 A;  1AWO A;  3M0R A;  2DLP A;  2CSI A;  1KSW A;  1FMK A;  1WYX A;  2RQT A;  2CT3 A;  2DE0 X;  1ZLM A;  3TSW A;  1OV3 A;  1Y0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...