2YUOA

Solution structure of the sh3 domain of mouse run and tbc1 domain containing 3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
78
structure length
78
Chain Sequence
GSSGSSGRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RUN and TBC1 domain containing 3
publication title Solution structure of the SH3 domain of mouse RUN and TBC1 domain containing 3
rcsb
source organism Mus musculus
total genus 8
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yuoA00
3UATA 2EYZA 4D8KA 1VYVA 2KYMA 1HSQA 2CSQA 4Y92A 1NEBA 2FPFA 2GNCA 2KRSA 1YWPA 4AFUC 1IO6A 1OV3A 2LCSA 2FRWA 2L3PA 4J9HA 3PE0A 4ZNXA 2ROLA 4A63B 1YCSB 1YP5A 2EYYA 2LJ3A 1WA7A 3VS2A 1I07A 3EG1A 2DL5A 1I1JA 1PWTA 4IIOA 2QDLA 3NHNA 5GJWB 2RN8A 2W0ZA 3QWXX 1K1ZA 1RI9A 1X2KA 4KRTA 4OMLA 1QWFA 3VS6A 1X6GA 1KSWA 1M3BA 4RTUA 1WFWA 1K0XA 2K9GA 1ABOA 1SRMA 1NYGA 2L3QA 2DYBA 4J9FA 4J9CA 5IH2A 2EYWA 1PHTA 1H3HA 1X2QA 4CC3A 1T0HA 2K6DA 2RQUA 3KFVA 3TVTA 2DILA 4AFQC 5IXFA 1WIEA 5I11A 1ZLMA 2BZ8A 1YN8A 2O9SA 4J9DA 3M0RA 2KR3A 2FPEA 1AEYA 1KJWA 1GBRA 1UE9A 2L0AA 3GBQA 4GLMA 3QWYA 2KEAA 1X6BA 2JMCA 1W1FA 4OMNA 3VS5A 1UHFA 2FG0A 2AK5A 2ESWA 2H8HA 2YUNA 2LX7A 2VWFA 2F2XA 1BU1A 1JQQA 4F14A 1AZGB 2AKLA 1VYTA 2ENMA 2O9VA 3LH5A 3M0PA 2YT6A 1ABQA 2JM8A 3VS4A 2EGAA 3VRZA 4Z8AA 1UG1A 1JO8A 3PVQA 1GCQC 1UGVA 4JJDA 2PNIA 2YUQA 2KBTA 3FJ5A 1CSKA 2LP5A 4RTXA 2RQVA 2EPDA 4F17A 1GFDA 5IXBA 1NEGA 2JW4A 2P4RA 3M0TA 1VYUA 2O88A 4DEXA 2SRCA 2KT8A 1U5SA 1GBQA 1UUEA 1BB9A 4RTVA 4RTTA 2B86A 1BBZA 1M8MA 2DA9A 4RTWA 2OAWA 1G2BA 1UECA 2ECZA 2DRMA 2KXDA 4AFZC 2GBQA 5FWBA 2GTOA 1H92A 2LQWA 1CKAA 1JU5C 2DLPA 1SPKA 1Y0MA 2YUOA 1SRLA 1B3QA 1I0CA 2J05A 1TUDA 2DBMA 2KXCA 1BK2A 3VS1A 4AG2C 1HJDA 3ZL7C 4J9IA 4LUEA 2LJ0A 2DL7A 2J6KA 1OOTA 1WLPB 4M4ZA 2CT4A 4HCKA 3UF4A 4R0KA 2DJQA 1T3SA 3EGUA 2O31A 4J9GA 4LNPA 1YNZA 2HEQA 1E7OA 1NLPC 1KIKA 2J7IA 1SSHA 3H0IA 3REAB 2JMAA 1ARKA 1S1NA 4OMPA 2GTJA 4JZ3A 5ECAA 5IHIA 2DX1A 2EVRA 5IHKA 1FYNA 1K9AA 3I5RA 3TSWA 2VVKA 2AKKA 3U23A 1ZBJA 1JXMA 2A37A 1NG2A 2DE0X 2HDAA 1U3OA 2M51A 3SHWA 4OMQA 1JXOA 4FSSA 5FWCA 1AWWA 4JZ4A 2EW3A 3ULRB 2JM9A 3NGPA 4CC2A 4LE9A 3IQLA 2CREA 2RPNA 2KYBA 4IIMA 1TUCA 2O2OA 3I9QA 5L23A 2F2WA 2NUZA 2BZYA 3VRYA 1GFCA 4X1VA 1M3CA 1VA7A 2MOXA 2NWMA 2W10A 2RQTA 1M27C 3PVLA 3VS0A 3VS3A 2K2MA 1WDXA 2CSIA 4AG1C 2E5KA 1RLQC 1UHCA 2J06A 3JV3A 2K7AA 2JTEA 1PRLC 1ZUKA 1HD3A 1U06A 1AOJA 2K3BA 3REBB 4HVWA 1SHFA 2F2VA 2BTTA 2L3SA 1EFNA 4WCIA 1WXBA 2EKHA 2LZ6B 2JXBA 1X43A 2FRYA 2M0YA 2EYXA 4ORZA 2DMOA 1ZUYA 1UJ0A 1V1CA 3RBBB 4RTYA 2CUBA 2VKNA 3SEMA 2ROTA 1AZEA 1NLOC 1CKBA 1UJYA 2EGEA 2CDTA 1WXTA 2EQIA 5EC7A 4JPBW 1M30A 4HXJA 3RNJA 3THKA 3H41A 2KRMA 4CC7A 1WYXA 3EG2A 5IHNA 2KROA 2DNUA 2LNHB 1OPKA 1GL5A 4J9BA 4E6RA 2YSQA 2JT4A 2AZSA 4F16A 1Y57A 1N5ZA 2D8HA 2DF6A 4JJCA 1QWEA 3EG3A 3O5ZA 1JEGA 1GCPA 4HVUA 1QCFA 2GQIA 1ZSGA 2KE9A 2LQNA 1Z9QA 1UDLA 2KT1A 1MV0B 1A0NB 4RTZA 2CUDA 5FW9A 2J6FA 1RUWA 3I35A 1MV3A 2JS2A 2HSPA 1K76A 1X69A 2L2PA 2X3XD 2ED1A 2EBPA 1W70A 2DRKA 1AD5A 1ZX6A 4OMMA 1SHGA 1OPLA 2KNBB 4RUGA 3EG0A 2CH4W 4LN2A 1ZUUA 1AWXA 4EIKA 3H0FA 3NMZC 2MCNA 2FPDA 1YWOA 2EGCA 4K11A 2OI3A 1QLYA 3CQTA 3EHRA 2RF0A 2BZXA 3VS7A 1SEMA 4JJBA 4Z88A 2PZ1A 2J6OA 2YDLA 1TG0A 3TSZA 2C0IA 2V1RA 2YUPA 1OEBA 2A28A 2MIOA 3UA7A 1X27A 3UA6A 4AFSC 4ESRA 1UFFA 1W6XA 4J9EA 2DL3A 4HVVA 5I22A 3H0HA 1K0SA 2C0TA 2DL4A 3A98A 2D8JA 1WXUA 1XOVA 1GRIA 1UTIA 2RMOA 2D0NA 1PRMC 2DL8A 3NPFA 2HCKA 1E6HA 1NYFA 2RNAA 1WX6A 1T3LA 1B07A 2HBWA 1AVZC 5HCKA 4D8DA 2FEIA 2IIMA 1E6GA 1PNJA 3M0QA 2C0OA 4OMOA 3EHQA 2ABLA 2FO0A 2X3WD 4LUDA 2G6FX 2A08A 1PKSA 2DVJA 2JS0A 1QKWA 1H8KA 4GBQA 3I5SA 1MUZA 1PKTA 1Z9ZA 2A36A 5GJVB 3R6NA 1K4US 3M0SA 1AWOA 2LMJA 2KRNA 2K79A 2SEMA 1WI7A 2D1XA 2KGTA 1GCQA 2OJ2A 2RQRA 2CT3A 3M0UA 2CH4A 2LJ1A 2V1QA 2XMFA 4QT7A 4CC4B 1NM7A 2ED0A 1LCKA 2AZVA 3C0CA 1RLPC 2RQWA 1KFZA 1J3TA 4DEYA 2PTKA 1AWJA 1T0JA 2GGRA 4Z89A 1G83A 1FMKA 2I0NA 1M3AA 2DBKA 1QKXA 2DM1A
chains in the Genus database with same CATH superfamily
3UATA 4QW2A 1U8RA 2YRVA 1VYVA 4PL6A 2NUTB 1B7TA 2DXBA 1HSQA 5FU6B 1NEBA 4M78E 3CCRA 1V76A 4AFUC 1IO6A 4BDZA 2FRWA 2BE9B 4J9HA 3RMQA 3FJPA 4ZNXA 1VQ6T 1YCSB 2NUPB 1MMDA 4QQ6A 3LLRA 3EH2A 3HRUA 3CC7T 2LRQA 4IIOA 4X9DA 5GJWB 5KCOA 2W0ZA 1B34B 1UGPB 4M75C 4XQ3A 2COWA 1ABOA 1SRMA 3LH0A 4LDYA 2DIQA 4J9FA 3MEWA 1VQ7Q 1IHVA 2YHTA 1YJNA 1I5OB 1VQ5Q 3MEVA 1QW1A 2K6DA 3CCLA 2DILA 3LW5E 1ZLMA 2XK0A 3FIFA 5GAN8 1BCOA 5GANh 2PVDB 1YHQT 3DB4A 2FPEA 2PU9B 1KJWA 3MKDA 3ER0A 2L0AA 4M77D 4GLMA 2KEAA 3INZA 5GANj 4KGZB 2JMCA 3G71T 3J81E 4LD6A 2FG0A 1I4K1 4C8QG 2ESWA 2OTJT 2K5LA 3G7ZA 4PJOB 3FLGA 3CCQQ 2WSEE 2P84A 4IUPA 2DD4A 2HQEA 3X28B 3LH5A 2MPXC 3M0PA 4BI4A 2A3LA 3HP9A 2OX7A 2QTXA 2MK5A 4OP0A 3A8OB 3FJ5A 3OSVA 3KXTA 4RTXA 2P4RA 2KQWA 2SRCA 1U5SA 2KT8A 1GBQA 4F7UE 1D1AA 2ZAEA 4MMLA 2QTVA 1NJIU 1DJ7B 3CCMT 1UECA 2ECZA 3M4YA 5GAMe 2DRMA 3V7RA 5FWBA 4M7DB 1P92A 3GLXA 3WXMB 3G4SA 3MJXA 1YJWT 2L89A 2E64A 1SRLA 1B3QA 2J05A 1PC0A 4QVDA 2KXCA 1TOVA 1NBEB 2L8DA 2ZPEB 4LUEA 2LJ0A 1ZSZC 3PGGA 2J6KA 1WLPB 1I81A 2E70A 5GMKl 2O01E 1VQ4Q 1OX9A 4LDVA 3UF4A 3M5AA 4R0KA 1BI1A 3QDRB 1YNZA 3ZBDA 1NLPC 3S3MA 3NTIA 3JCMh 1TXQA 4IUTA 4OMPA 4M75D 3DB3A 3M53A 3JB9D 3OB9A 2DVEA 5M9OA 1M90C 1FMVA 2COYA 2E12A 4KH0B 2JN0A 3RERA 4O6JA 3TSWA 1VQMQ 2F69A 3OYKA 2MYSA 2D9TA 3LX7A 4M75E 2ZPBB 2LQ8A 1OYXA 2PUKB 3OS2A 1HYOA 4OMQA 3TQ7P 4JZ4A 2JM9A 4PJOG 5LJ3f 4J6YA 1F1BB 2CREA 1TTHB 2KYBA 3I9QA 1WHKA 1GFCA 3PMTA 1NZ9A 1SG5A 3QSUA 4JDSA 5KE3A 3OBYA 2W10A 2NWMA 1WNLA 2R5AA 3I55Q 1M27C 2EQKA 3VS3A 3LGFA 4TVRA 2JTEA 1U06A 1RADB 3AHUA 2JJ9A 1SHFA 2F2VA 1LNXA 2QQBA 2L3SA 1R0BG 2RI2A 4M78B 1QP3A 4M7DG 1WXBA 1YITQ 1ZA1B 3CXCS 5CKHA 1X43A 2FRYA 1OX8A 2RJFA 4BI8B 4J7IA 1VOMA 2DMOA 1YIJA 4FT4A 2CUBA 3V7SA 1BYMA 1YBYA 1WXTA 3UWNA 5EC7A 1KC8C 4C5EA 4JPBW 1M30A 4Z02A 2H3JA 2R5MA 4HXJA 4OB1B 3RNJA 3FC3A 2EFIA 3H41A 2M1HA 4CC7A 1WYXA 4PLLA 2OTLQ 3P8DA 3GNGA 3JCMV 3EG2A 5IHNA 2KROA 4NS5A 4B9WA 1QVFA 2DXUA 2AZSA 4MZMA 2RO0A 1Y57A 2D8HA 4JJCA 5KYUB 2A7YA 3QZ9B 2AIRB 4XU2A 1YI2Q 3CCUA 1AHJB 1LOJA 5IAYA 3HHTB 1M90U 4R55A 2KT1A 1MV0B 1A0NB 4RTZA 5A2QE 1Y96A 5FROA 5FW9A 2HSPA 2I2LA 1RL2A 1YJ9Q 2EBPA 3CMEA 4ELZC 4JRKA 4OMMA 1PD0A 3CEYA 1OPLA 3OYEA 4EIKA 4QVZA 2DAQA 2MCNA 5HY6A 1OI1A 2VXEA 4K11A 3CQTA 3EHRA 4II1A 1YCYA 1JB0E 2BKDN 1I8FA 3LGLA 1PG5B 2GQVA 1SEMA 2L5QA 5DLQE 1JJ2P 2PZ1A 2J6OA 4F7UB 4FYXB 1KQSP 3OYAA 2MIOA 1Y07A 2RJCA 4FM4B 4HCZA 4E7JA 2X35A 1VQ9T 5I22A 3JCMc 4M78G 4QQDA 1K0SA 2DL4A 1WXUA 3JCMQ 4CI0C 2YXYA 4KGVB 4EPCA 2RMOA 3PTAA 1WJRA 4MZTA 1E6HA 2DJZA 1TH7A 1MMGA 3CC2A 2E41A 4MDXA 2BE7D 4E7HA 4XU1A 2EAYA 4F04B 4ME7A 4JLGA 2P0QA 2AHJB 1KC8U 4M77A 5HCKA 2WSFE 4D8DA 1VUBA 5CQXA 1E6GA 1PNJA 3G1JA 2RI5A 3CCJT 4M77F 3CCRQ 2X3WD 2COZA 5KYXA 1G5VA 3I56Q 3JCMJ 1TS9A 3QXEB 4PNOA 1QKWA 1M90R 2ZPGB 3GNFB 2Y4XA 5GJVB 3M0SA 1N27A 2KGTA 4AMCA 5CCAA 1QQJA 2RQRA 2EQUA 3O8VA 4MMKA 1D3BA 4A54A 2E3IA 2XMFA 4QT7A 1M1GA 1VQ6A 3QHSA 2FL7A 5GAMh 3CC7A 3MHXA 3SWNB 3CCLQ 1VQ7T 1EZZB 3A1PA 2QXFA 3OQ5A 3FDRA 2QA4Q 1VQ5T 4OF1A 4LDWA 3QYHB 2DTHA 1QCNA 1VQPQ 4Y91A 3E2UA 5GAMj 3V7CA 3E19A 3CPWS 4E7ZA 4OB0B 2KRSA 3CPWA 1OV3A 1S72T 5CKBA 2ROLA 3OYGA 5AYFA 2LJ3A 5LJ5f 3VS2A 3ASKA 2KMTA 4F7UG 3G6EA 1I1JA 5FU7C 3QPHA 1W2BS 8ATCB 1SF9A 2RN8A 3QWXX 4E7KA 1YHQA 1W2BA 3HKSA 4DQ2A 1X2KA 4KRTA 1QWFA 4JRPA 3CCQT 3OW2S 1X6GA 1M3BA 1WFWA 3OW2A 4C92C 5LJ3e 5CIUA 3OYFA 3OSSC 2XHCA 4J9CA 5IH2A 3G71A 1KC8R 2OTJA 1H3HA 4CC3A 1KD1C 2LNVA 1T0HA 2RQUA 4AFQC 1RI0A 2CYZB 2KVQG 3JB9F 2BZ8A 1H641 3AT1B 2EQJA 5HK3A 3FRNA 3M0RA 4N4HA 2QEXQ 1AEYA 2XG8D 1EIFA 5GAN7 4JUVA 1UE9A 2ATCB 2V8JA 5AT1B 3QWYA 3G4SQ 3S3NA 3CCEA 1BCMA 4BY6B 3GPLA 4RMOA 1UHFA 3OYJA 2AK5A 2LX7A 2VWFA 1BU1A 4F14A 1RACB 2MMPA 3OYDA 4XU3A 1AZGB 2XDDA 1O75A 3CCMA 3HRTA 2AKLA 2YT6A 3VRZA 3EGXA 3C4SA 1JO8A 1G8XA 1YJWA 4D6WA 2YUQA 1SKUB 1VQ4T 3QBYA 7AT1B 1QVPA 1VQNA 4F17A 5IXBA 2O88A 4PJMA 1UUEA 3OYMA 4RTTA 4J6XA 3MP6A 1BBZA 2OAWA 1D0YA 4ATOA 4AFZC 2GTOA 2O4XA 5CQYA 3HFOA 3C95A 5CAIA 1VQMT 2EKOA 3LWIA 5KYYA 4NL3A 1I0CA 4JRQA 1TUDA 1TU0B 2DBMA 3VS1A 4FW2A 2DL7A 3HRSA 3KUFA 1OOTA 1LJOA 4E47A 1KQ1A 3OA6A 4XU0A 5CR2A 9ATCB 4HCBA 4LNPA 1ZSZA 4ZGJB 3CCVT 3P8HA 1KIKA 4PK4A 2J7IA 2HL3A 2JMAA 4JS5A 2GTJA 1WHLA 4JS4A 4JZ3A 1KD1U 1KK7A 3MEUA 5IHKA 4C92D 3BDUA 4OB3B 2VVKA 3C94A 1MNDA 4DBRA 4C8QA 3RESA 1HK9A 4PFZA 3PMIA 1JXMA 1NG2A 2DE0X 1N9SA 3E1SA 2DZ9A 4C8QF 2F5TX 5GMKm 2M51A 1YITT 3UDCA 3SHWA 1JXOA 4FSSA 5FWCA 5GANd 1AWWA 2EW3A 4CC2A 2O2OA 3J80E 2HMAA 1K9MC 2F2WA 2R58A 3EG9A 2HSEB 3Q1JA 2QQAA 1M4ZA 4KH1B 3VUBA 3PIOA 2OTLT 3ZEHA 3VS0A 2FB7A 3QZ5B 4C0DB 4AG1C 4HT8A 3CBPA 2CKKA 4M77E 2NUTA 4XK8E 3L2QA 3CCUQ 3REBB 4DA4A 3EAEA 2FYKA 2QASA 5KYWA 4M7AB 2NUPA 3WVDB 1PSEA 2EKHA 4QKUA 5HK0A 3L2RA 1VQ8A 2K3YA 1JRIA 4BUGA 4DBQA 1Q86C 1V1CA 1B34A 3CMEQ 3SEMA 5KCHA 2VKNA 1AZEA 4N4GA 2MF2A 1OU8A 3CBOA 1M2VB 5GANg 4L59A 2CDTA 1K73C 3VU3C 2EQIA 2KY9A 3THKA 3QIIA 1JJ2S 5GAN3 1KD1R 2DNUA 1JJ2A 1GL5A 4J9BA 3DKMA 2EQMA 2H3EB 1N5ZA 3O5ZA 3OBWA 5J3BA 4Y28E 3A5ZB 5GAOq 1V29B 2HZYA 2DTOA 4HVUA 2DZCA 1Z9QA 2Z0WA 1WQ7A 3JCMX 5LJ5e 3BW1A 4C0ZA 1OULA 4HT9A 2XIDA 4PFOA 3SDZA 1Y7XA 2LTOA 2DRKA 4J6WA 3RKYA 4C8QC 4RUGA 3EG0A 2CH4W 5CVIA 3CC2Q 4BACA 1AWXA 1MMAA 3CC4T 4FCYA 1K9MU 1VQ9A 1YWOA 4KULA 2DEQA 4RG8A 1QLYA 4P5NA 1FXXA 2EJGA 3VS7A 5KH6A 1R0CB 1IZ6A 3L2VA 2MAMA 3I56T 1RAFB 2C0IA 2V1RA 4M7DA 2YUPA 3JCMP 2A28A 1FWZA 3TCJA 1VQKA 5LJ3h 2R57A 1VQOA 2LCCA 3UA6A 3RR6A 3TEEA 1W6XA 4J9EA 5FU6C 3CCJA 3H0HA 2LDMA 2C0TA 4M7AG 2D8JA 3M55A 1MHNA 2XI9A 5LJ3j 2D0NA 5C0MA 3RKXA 2DL8A 4YTLA 1Q86U 1VQ6Q 2HCKA 1IREB 1NYFA 3CD6A 1D1CA 1LVKA 4IUVA 2YRDA 3META 1BIBA 2HL5C 4V2SA 3VKIA 1K73U 2HBWA 3CCLT 1C0MA 2FEIA 2QA4T 4GY5A 2FO0A 1VQPT 4J5YA 2G6FX 2VYTA 2DVJA 4IUQA 5GAOl 1LPLA 4QQGA 3F70A 1X6OA 3I5SA 2XDPA 2IPOB 4RG2A 3OS5A 3G6EQ 2D1XA 2OJ2A 1QVFS 2CT3A 2HD0A 2G3RA 2CH4A 1YHQQ 5CK9A 3M4GA 2LJ1A 2XKOC 2E65A 2XICA 2JTMA 1S72A 4KGXB 1IHWA 2AZVA 2RQWA 3G71Q 1K9MR 4DEYA 1NPRA 2RA2A 1T0JA 2GGRA 4PJOC 2M02A 3URGA 4A4HA 1G83A 1FMKA 2I0NA 3H9NA 2KAFA 3GF5A 4EMKA 2KYMA 4HA8A 3JAME 2FPFA 5C6SA 3N5BB 4C8QD 3RMSA 1YWPA 2VUBA 4O5VA 2VGNA 2QEXT 5GMKe 2L3PA 3HSBA 2PUOB 3CCEQ 2DO3A 1VQLT 2KDSA 1Q7YC 4KUDK 1ZA2B 2QYZA 2D0QB 4IKFA 1I07A 2MWOA 4M77B 3EG1A 3CMAQ 1PWTA 3L1AA 1KHCA 2QDLA 3NHNA 4RCBA 3EFRA 4C8QE 1K1ZA 1RI9A 3PIPA 3CCMQ 3QJ6A 3CCST 2CP2A 4OMLA 3SFMA 1Q86R 3M57A 3VS6A 2P0PA 1KSWA 1HXDA 4M7DC 1Q81C 4RTUA 1XTDA 2K9GA 4HCCA 2MWPA 4EDUA 1MGQA 2L3QA 1YJWQ 2DFUA 2DYBA 1K73R 1TSFA 1PHTA 6AT1B 1X2QA 2DK3A 1VQNQ 1M1KC 3KFVA 2VGMA 5IXFA 4C92A 1D3BB 1PM3A 2EJ9A 1U1TA 2VC8A 2O9SA 4J9DA 4C92F 2KR3A 4WTOB 5KYUA 3X26B 3CBMA 4PJLA 1ZQ1A 1X6BA 2GCXA 2GFUA 3C12A 1M8VA 2JNGA 4OMNA 5CKDA 1ACMB 2JUFA 3VS5A 4ZN3A 2QDYB 2H8HA 2YUNA 2F2XA 3OY9A 5IN1A 1VYTA 1XQHA 2O9VA 4FT2A 1UEBA 3OYNA 1ABQA 2JM8A 3VS4A 3PVQA 3OS0A 1OZ2A 1WHHA 2PNIA 4JJDA 5I2MA 4OGCA 1CSKA 2LP5A 3OYLA 2RQVA 1QVGP 1NEGA 1VYUA 4DEXA 3J7AF 1BB9A 3RKWA 2L3RA 3SD4A 3EFOB 4M75B 2KXDA 2GBQA 2HQHA 2HBPA 3CCVA 2LQWA 1CKAA 1JU5C 2DLPA 3JSCA 5GAMd 1YJNQ 3M9QA 4PJOD 1FMWA 2A0FB 3BY7A 1N8RC 2YUOA 4EMKC 2E4HA 1N9RA 2F1LA 1BK2A 1UGQB 4AG2C 1Q7YU 4M77G 1HJDA 4J9IA 5IT9E 2LT4A 3E9GA 3LWHA 4VUBA 4M7AD 5CKEA 4L5GA 3H6ZA 2CT4A 2VV5A 3EGDA 2DJQA 1Q81U 2O31A 3VJPA 3QO3A 2HEQA 2QQSA 3OYIA 1SSHA 1XNIA 3FB9A 4KBMB 1YITA 1ARKA 1S1NA 1QCOA 2KK4A 2M16A 3MO8A 4ZTFA 3QJYA 4ZGDB 2WSCE 5GAN5 2C06A 2CP7A 1M1KU 3NTKA 5LJ5h 5ECAA 2DX1A 4M7DD 3EGXB 2LT1A 1YFNA 1K9AA 1IB8A 4PFPA 3CXCP 5D7UA 2AKKA 4CRIA 1ZBJA 5LJ5j 1VQ8Q 2HDAA 5GAOp 5GAMg 4M7DE 1D1BA 3PFSA 2VXFA 1M1FA 3ULRB 3NGPA 3IQLA 4NL2A 2RPNA 2ZZDA 1TUCA 1WGSA 4ELYC 5L23A 2NUZA 5CO7A 4AT1B 4X1VA 3EFSA 5KYYB 2B8AA 1M3CA 3SWNA 2MOXA 1Q82C 4ANJA 2K4YA 2RQTA 3HTRA 3QDFA 2K2MA 4L6V5 4E7SA 5J26A 2CSIA 1RLQC 2J06A 3JV3A 3OMGA 2K7AA 4ZN1A 3M58A 1XJWB 1AOJA 1PD1A 4XTUA 3A8HB 1ZSZB 4C5IA 1W4SA 4HVWA 4NOYA 4M75G 2BTTA 2X9HA 4JLIA 2VASA 4PKCC 1JBMA 4N0AA 1Q7YR 1VIFA 5FLXE 4B6MA 2M0YA 2EYXA 5FRMA 4ORZA 3BDLA 1ZUYA 2DTIA 1N8RU 2JOYA 3RBBB 2CP0A 2XD0A 2ROTA 2X51A 1NLOC 1Q81R 1UJYA 3V8JA 2CP5A 3OYHA 2DEUA 2YRCA 1C1AA 2PVGB 4BD3A 1MMNA 3H8ZA 2RB6A 1VQ9Q 4KUIA 4DOVA 2RHZA 4C5HA 2LNHB 1M1KR 1QMCA 4A4KA 1OPKA 2VB6A 3OYCA 1IRXA 3M59A 4ZGEB 2JT4A 2FHDA 1WQWA 1QWEA 3EG3A 3X20B 1JEGA 4M78D 4N4IA 1GCPA 3CC4A 4XTVA 1ZSGA 1VQKQ 1VQOQ 2HAXA 4X9CA 1NJIC 1UDLA 3CCJQ 2J6FA 3I35A 2JS2A 2L2PA 3I55T 2X3XD 1W70A 1BI2A 3I56A 1H3ZA 1BI0A 5KE2A 2RHXA 3CD6Q 1Y71A 3PNWC 5KYWB 1C6VX 3H0FA 4FSXA 5GMKh 3VV0A 3NMZC 1UGSB 2IG0A 1BKBA 4XTWA 3D7SB 1YIJQ 2RF0A 2DXTA 2HNIA 1Q82U 4C92E 5GMKj 4OGEA 1Q95G 4JJBA 3SWNC 4BE1A 1TG0A 5GANf 1OEBA 3UA7A 2Y4YA 3MP1A 4BE0A 3A8LB 2CGHA 4RCCA 1N8RR 2QA4A 4AFSC 3G6ET 4ESRA 1UFFA 3KBGA 2YWWA 4A4FA 1OU9A 1KQ2A 3A98A 1VQPA 1PSFA 1S72Q 1UGRB 1GRIA 3T9NA 2RHUA 3X24B 1PRMC 2E10A 4N0AC 2PVOB 1BI3A 4C0GA 2KSSA 3NTHA 1WX6A 4E2FB 1YI2T 3CPWP 3S6WA 2DYIA 4XTZA 2IIMA 3M0QA 2C0OA 3FEOA 4OMOA 1U1SA 4LDUA 4LUDA 4JJNK 4GLKA 2A08A 1YJ9T 2JS0A 2F5KA 3NFCA 4GBQA 1W2BP 1GXIE 4PJJA 4X34A 1OZ3A 2A36A 3R6NA 1K4US 2LMJA 3CCET 2K79A 2K2VA 1K8AC 3OW2P 2ZPIB 4RKUE 1WI7A 1GCQA 3DLMA 3M0UA 3CMAT 3SB2A 1KQSS 1KG1A 3QUIA 4KT0E 2X4YA 2GF7A 1KQSA 3MP8A 2OAUA 2QEXA 3RDVA 1NM7A 2GFAA 2ED0A 3C0CA 4BY6C 1RLPC 1VQLA 4MDWA 4MZPA 2PTKA 5GAN2 2LCLA 4Z89A 2EWNA 3OS1A 1M3AA 3TU4K 1QKXA 3JCMd 1VQNT 1UB4A 3CCSA 1D09B 1Q82R 1NPPA 8AT1B 5GAOm 2FZCB 2EYZA 4D8KA 4PJOA 2KI7A 2CSQA 4Y92A 2GNCA 3JCMf 2LCSA 4PJOF 3JRZA 1RAHB 2RH2A 3PE0A 4A63B 1YP5A 2EYYA 1WA7A 4OMFB 2CZ1B 2DL5A 4XTXA 4C0FA 5J39A 2LC4A 3P8BB 4M7AA 4HKEA 3HFNA 5FRNA 2HKQB 5EG2A 4M7AF 1QVGS 3GIBA 1G3WA 1K0XA 2RK2A 1QVGA 1NYGA 1WHGA 5A0GA 3CCRT 5GAN6 1M2VA 4FYVB 2RJDA 3MPUB 2EYWA 2K57A 5LJ3d 3TVTA 2QQRA 3JB9I 3S3OA 1WIEA 5I11A 4M7DF 1YN8A 2HKNA 3JCMg 1GBRA 3QG1A 3A8MB 3PT9A 2V8IA 3CCVQ 3GBQA 4DOWA 3L42A 1M9SA 3CC7Q 2DD5A 3L2UA 1W1FA 4IUUA 4FIBA 2JVVA 2ZPFB 1N6AA 5DY9A 1YJNT 1Y96B 2YLCA 4BI3A 1NJIR 4EMKB 1JQQA 4FYWB 2ZPHB 3M54A 1K8AU 2FVUA 2ENMA 1G3TA 1MNEA 3VUZA 2EGAA 2QGFB 4Z8AA 1UG1A 4LDXA 1IGUA 3WVEB 1GCQC 1UGVA 2KBTA 1ZHIA 1VQ7A 3TREA 2XDBA 1VQ5A 4QVCA 2EPDA 1GFDA 2X4JA 3ZFJA 2JW4A 3M0TA 2AT1B 2EJFA 3CXCA 2RI3A 5FU7B 5LJ3g 4RTVA 1RAIB 3OMCA 4A4EA 2B86A 1M8MA 2DA9A 2DKGA 4RTWA 1G2BA 2V8KA 1WHMA 4XTYA 3V8LA 2IVWA 4ZTJA 4E7LA 1H92A 4C92B 1SPKA 1Y0MA 1D0ZA 2OTJQ 1OQKA 2RD1A 2EIFA 4C0DC 2D6FA 2Y90A 1VQ8T 1TWBA 3ZL7C 3CCQA 2M0OA 4FW1A 2EYQA 5A0LA 4E7IA 3A8GB 2QQ9A 4BE2A 5D6WA 4M4ZA 2RM4A 4M7AC 1X75C 4HCKA 2M9UA 1T3SA 1FX7A 2FZGB 3EGUA 4J9GA 4LD9K 1E7OA 4B9XA 3G4ST 3H0IA 3REAB 3JB9J 4M78A 2PQWA 1WJQA 4OVAA 2K3XA 2V26A 2NYSA 5KYXB 4M78F 5IHIA 2EVRA 3BE3A 1FYNA 2QI2A 3I5RA 2RHIA 2RK1A 4FU6A 1PCXA 3QYGB 3U23A 2A37A 5GANe 1K8AR 1U3OA 2CZ7B 1NE8A 2XU8A 2P4TA 4DBFA 4LE9A 5GAOn 3UPUA 4IIMA 1M2OA 4JRIA 2BZYA 3VRYA 1VQ4A 2LQKA 1X01A 1VA7A 2JZ2A 4PJNA 4J7FA 5L8RE 1SSFA 3PVLA 3L2ZA 3ME9A 1WPYA 1WDXA 3HL8A 2DIGA 2E5KA 1UHCA 2X4WA 1EX4A 1G3YA 1PRLC 1ZUKA 1HD3A 2JTFA 1G3SA 3EGDB 5I2SA 2K3BA 2E3HA 2HQXA 3CC4Q 4BDYA 1RAGB 1VQMA 4LXCA 1EFNA 5CKFA 4WCIA 4BB7A 2ZCFB 1VQKT 1VQOT 2LZ6B 1IGQA 2JXBA 4C92G 5D6YA 5DM7R 3RIRA 1UJ0A 3MCAB 1AT1B 2CZ0B 4RTYA 3R6OA 2P0KA 1CKBA 2CP6A 4UC4A 2EGEA 1WZOA 3JCMb 3HPWA 2CZ6B 3CD6T 1O9SA 4F7UA 2KRMA 2E6NA 2MI6A 3DLLA 4F7UF 3I55A 4E6RA 2YSQA 5GAMf 4F16A 2DF6A 2K5IA 1YIJT 5A0DA 2WACA 4OB2B 2QG9B 5KYNA 1R77A 4PJOE 4M78C 3JCMe 1QCFA 2GQIA 4DBHA 2KE9A 2LQNA 1RABB 2CUDA 1RUWA 1MV3A 1K76A 1X69A 2ED1A 5LJ5d 1RAAB 4M7AE 1AD5A 1ZX6A 1SHGA 2QAZA 1QP2A 3OYBA 4Q5WA 2KNBB 2QGGA 5HKCA 3JB9H 4IURA 4LN2A 1ZUUA 2BUDA 2LVMA 2DETA 3CCUT 3JCMW 2OTLA 2FPDA 5GAN4 2EGCA 3E9FA 1BIAA 2OI3A 1D0XA 4WF2A 2BZXA 2CP3A 2O4XB 5GMKi 3CMET 3EFOA 1WJSA 4M75A 1QVFP 4Z88A 5DLOA 2YDLA 3L2WA 1TUGB 3TSZA 3CPFA 1R8OB 1YI2A 2NLUA 4M75F 4J83A 1IXDA 1X27A 2BIVA 4EMGA 2DL3A 4HVVA 4FYYB 3M56A 1XOVA 2YLBA 1YJ9A 2CS7A 1UTIA 3X25B 4A4GA 2E1HA 3BFMA 1VQLQ 3NPFA 4M77C 5LJ5g 2RNAA 1T3LA 4R56A 1B07A 3CMAA 3JB9G 3EH1A 3CCSQ 1AVZC 4EMHA 2K5FA 3GP8A 2FZKB 3VYGA 3EHQA 2ABLA 2RHYA 4C5GA 1PKSA 4PLIA 2DERA 1H8KA 4FL6A 4A53A 2RJEA 1MUZA 4C8QB 1PKTA 5LL6S 1Z9ZA 5GAOr 1M5Q1 3QKJA 1AWOA 2KRNA 2SEMA 3CC2T 2X4XA 3OYYA 5D6XA 1WHJA 1ZBXA 4J8OA 3VYHB 2QK0A 3GOXA 2V1QA 3RUXA 4XAXB 4CC4B 1VIEA 3LYIA 1I5LA 1LCKA 3MEAA 2ZGWA 3V8KA 3UT1A 1KFZA 1J3TA 3EG9B 2E5QA 1AWJA 2LX9A 2DPPB 2DXCA 1RAEB 5I21A 2DBKA 1KHIA 2E6ZA 2DM1A
chains in the Genus database with same CATH topology
3UATA 2EYZA 4D8KA 1VYVA 2KYMA 1HSQA 2CSQA 4Y92A 1NEBA 2FPFA 2GNCA 2KRSA 1YWPA 4AFUC 1IO6A 1OV3A 2LCSA 2FRWA 2L3PA 4J9HA 3PE0A 4ZNXA 2ROLA 4A63B 1YCSB 1YP5A 2EYYA 2LJ3A 1WA7A 3VS2A 1I07A 3EG1A 2DL5A 1I1JA 1PWTA 4IIOA 2QDLA 3NHNA 5GJWB 2RN8A 2W0ZA 3QWXX 1K1ZA 1RI9A 1X2KA 4KRTA 4OMLA 1QWFA 3VS6A 1X6GA 1KSWA 1M3BA 4RTUA 1WFWA 1K0XA 2K9GA 1ABOA 1SRMA 1NYGA 2L3QA 2DYBA 4J9FA 4J9CA 5IH2A 2EYWA 1PHTA 1H3HA 1X2QA 4CC3A 1T0HA 2K6DA 2RQUA 3KFVA 3TVTA 2DILA 4AFQC 5IXFA 1WIEA 5I11A 1ZLMA 2BZ8A 1YN8A 2O9SA 4J9DA 3M0RA 2KR3A 2FPEA 1AEYA 1KJWA 1GBRA 1UE9A 2L0AA 3GBQA 4GLMA 3QWYA 2KEAA 1X6BA 2JMCA 1W1FA 4OMNA 3VS5A 1UHFA 2FG0A 2AK5A 2ESWA 2H8HA 2YUNA 2LX7A 2VWFA 2F2XA 1BU1A 1JQQA 4F14A 1AZGB 2AKLA 1VYTA 2ENMA 2O9VA 3LH5A 3M0PA 2YT6A 1ABQA 2JM8A 3VS4A 2EGAA 3VRZA 4Z8AA 1UG1A 1JO8A 3PVQA 1GCQC 1UGVA 4JJDA 2PNIA 2YUQA 2KBTA 3FJ5A 1CSKA 2LP5A 4RTXA 2RQVA 2EPDA 4F17A 1GFDA 5IXBA 1NEGA 2JW4A 2P4RA 3M0TA 1VYUA 2O88A 4DEXA 2SRCA 2KT8A 1U5SA 1GBQA 1UUEA 1BB9A 4RTVA 4RTTA 2B86A 1BBZA 1M8MA 2DA9A 4RTWA 2OAWA 1G2BA 1UECA 2ECZA 2DRMA 2KXDA 4AFZC 2GBQA 5FWBA 2GTOA 1H92A 2LQWA 1CKAA 1JU5C 2DLPA 1SPKA 1Y0MA 2YUOA 1SRLA 1B3QA 1I0CA 2J05A 1TUDA 2DBMA 2KXCA 1BK2A 3VS1A 4AG2C 1HJDA 3ZL7C 4J9IA 4LUEA 2LJ0A 2DL7A 2J6KA 1OOTA 1WLPB 4M4ZA 2CT4A 4HCKA 3UF4A 4R0KA 2DJQA 1T3SA 3EGUA 2O31A 4J9GA 4LNPA 1YNZA 2HEQA 1E7OA 1NLPC 1KIKA 2J7IA 1SSHA 3H0IA 3REAB 2JMAA 1ARKA 1S1NA 4OMPA 2GTJA 4JZ3A 5ECAA 5IHIA 2DX1A 2EVRA 5IHKA 1FYNA 1K9AA 3I5RA 3TSWA 2VVKA 2AKKA 3U23A 1ZBJA 1JXMA 2A37A 1NG2A 2DE0X 2HDAA 1U3OA 2M51A 3SHWA 4OMQA 1JXOA 4FSSA 5FWCA 1AWWA 4JZ4A 2EW3A 3ULRB 2JM9A 3NGPA 4CC2A 4LE9A 3IQLA 2CREA 2RPNA 2KYBA 4IIMA 1TUCA 2O2OA 3I9QA 5L23A 2F2WA 2NUZA 2BZYA 3VRYA 1GFCA 4X1VA 1M3CA 1VA7A 2MOXA 2NWMA 2W10A 2RQTA 1M27C 3PVLA 3VS0A 3VS3A 2K2MA 1WDXA 2CSIA 4AG1C 2E5KA 1RLQC 1UHCA 2J06A 3JV3A 2K7AA 2JTEA 1PRLC 1ZUKA 1HD3A 1U06A 1AOJA 2K3BA 3REBB 4HVWA 1SHFA 2F2VA 2BTTA 2L3SA 1EFNA 4WCIA 1WXBA 2EKHA 2LZ6B 2JXBA 1X43A 2FRYA 2M0YA 2EYXA 4ORZA 2DMOA 1ZUYA 1UJ0A 1V1CA 3RBBB 4RTYA 2CUBA 2VKNA 3SEMA 2ROTA 1AZEA 1NLOC 1CKBA 1UJYA 2EGEA 2CDTA 1WXTA 2EQIA 5EC7A 4JPBW 1M30A 4HXJA 3RNJA 3THKA 3H41A 2KRMA 4CC7A 1WYXA 3EG2A 5IHNA 2KROA 2DNUA 2LNHB 1OPKA 1GL5A 4J9BA 4E6RA 2YSQA 2JT4A 2AZSA 4F16A 1Y57A 1N5ZA 2D8HA 2DF6A 4JJCA 1QWEA 3EG3A 3O5ZA 1JEGA 1GCPA 4HVUA 1QCFA 2GQIA 1ZSGA 2KE9A 2LQNA 1Z9QA 1UDLA 2KT1A 1MV0B 1A0NB 4RTZA 2CUDA 5FW9A 2J6FA 1RUWA 3I35A 1MV3A 2JS2A 2HSPA 1K76A 1X69A 2L2PA 2X3XD 2ED1A 2EBPA 1W70A 2DRKA 1AD5A 1ZX6A 4OMMA 1SHGA 1OPLA 2KNBB 4RUGA 3EG0A 2CH4W 4LN2A 1ZUUA 1AWXA 4EIKA 3H0FA 3NMZC 2MCNA 2FPDA 1YWOA 2EGCA 4K11A 2OI3A 1QLYA 3CQTA 3EHRA 2RF0A 2BZXA 3VS7A 1SEMA 4JJBA 4Z88A 2PZ1A 2J6OA 2YDLA 1TG0A 3TSZA 2C0IA 2V1RA 2YUPA 1OEBA 2A28A 2MIOA 3UA7A 1X27A 3UA6A 4AFSC 4ESRA 1UFFA 1W6XA 4J9EA 2DL3A 4HVVA 5I22A 3H0HA 1K0SA 2C0TA 2DL4A 3A98A 2D8JA 1WXUA 1XOVA 1GRIA 1UTIA 2RMOA 2D0NA 1PRMC 2DL8A 3NPFA 2HCKA 1E6HA 1NYFA 2RNAA 1WX6A 1T3LA 1B07A 2HBWA 1AVZC 5HCKA 4D8DA 2FEIA 2IIMA 1E6GA 1PNJA 3M0QA 2C0OA 4OMOA 3EHQA 2ABLA 2FO0A 2X3WD 4LUDA 2G6FX 2A08A 1PKSA 2DVJA 2JS0A 1QKWA 1H8KA 4GBQA 3I5SA 1MUZA 1PKTA 1Z9ZA 2A36A 5GJVB 3R6NA 1K4US 3M0SA 1AWOA 2LMJA 2KRNA 2K79A 2SEMA 1WI7A 2D1XA 2KGTA 1GCQA 2OJ2A 2RQRA 2CT3A 3M0UA 2CH4A 2LJ1A 2V1QA 2XMFA 4QT7A 4CC4B 1NM7A 2ED0A 1LCKA 2AZVA 3C0CA 1RLPC 2RQWA 1KFZA 1J3TA 4DEYA 2PTKA 1AWJA 1T0JA 2GGRA 4Z89A 1G83A 1FMKA 2I0NA 1M3AA 2DBKA 1QKXA 2DM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UAT A;  2EYZ A;  4D8K A;  1VYV A;  2KYM A;  1HSQ A;  2CSQ A;  4Y92 A;  1NEB A;  2FPF A;  2GNC A;  2KRS A;  1YWP A;  4AFU C;  1IO6 A;  1OV3 A;  2LCS A;  2FRW A;  2L3P A;  4J9H A;  3PE0 A;  4ZNX A;  2ROL A;  4A63 B;  1YCS B;  1YP5 A;  2EYY A;  2LJ3 A;  1WA7 A;  3VS2 A;  1I07 A;  3EG1 A;  2DL5 A;  1I1J A;  1PWT A;  4IIO A;  2QDL A;  3NHN A;  5GJW B;  2RN8 A;  2W0Z A;  3QWX X;  1K1Z A;  1RI9 A;  1X2K A;  4KRT A;  4OML A;  1QWF A;  3VS6 A;  1X6G A;  1KSW A;  1M3B A;  4RTU A;  1WFW A;  1K0X A;  2K9G A;  1ABO A;  1SRM A;  1NYG A;  2L3Q A;  2DYB A;  4J9F A;  4J9C A;  5IH2 A;  2EYW A;  1PHT A;  1H3H A;  1X2Q A;  4CC3 A;  1T0H A;  2K6D A;  2RQU A;  3KFV A;  3TVT A;  2DIL A;  4AFQ C;  5IXF A;  1WIE A;  5I11 A;  1ZLM A;  2BZ8 A;  1YN8 A;  2O9S A;  4J9D A;  3M0R A;  2KR3 A;  2FPE A;  1AEY A;  1KJW A;  1GBR A;  1UE9 A;  2L0A A;  3GBQ A;  4GLM A;  3QWY A;  2KEA A;  1X6B A;  2JMC A;  1W1F A;  4OMN A;  3VS5 A;  1UHF A;  2FG0 A;  2AK5 A;  2ESW A;  2H8H A;  2YUN A;  2LX7 A;  2VWF A;  2F2X A;  1BU1 A;  1JQQ A;  4F14 A;  1AZG B;  2AKL A;  1VYT A;  2ENM A;  2O9V A;  3LH5 A;  3M0P A;  2YT6 A;  1ABQ A;  2JM8 A;  3VS4 A;  2EGA A;  3VRZ A;  4Z8A A;  1UG1 A;  1JO8 A;  3PVQ A;  1GCQ C;  1UGV A;  4JJD A;  2PNI A;  2YUQ A;  2KBT A;  3FJ5 A;  1CSK A;  2LP5 A;  4RTX A;  2RQV A;  2EPD A;  4F17 A;  1GFD A;  5IXB A;  1NEG A;  2JW4 A;  2P4R A;  3M0T A;  1VYU A;  2O88 A;  4DEX A;  2SRC A;  2KT8 A;  1U5S A;  1GBQ A;  1UUE A;  1BB9 A;  4RTV A;  4RTT A;  2B86 A;  1BBZ A;  1M8M A;  2DA9 A;  4RTW A;  2OAW A;  1G2B A;  1UEC A;  2ECZ A;  2DRM A;  2KXD A;  4AFZ C;  2GBQ A;  5FWB A;  2GTO A;  1H92 A;  2LQW A;  1CKA A;  1JU5 C;  2DLP A;  1SPK A;  1Y0M A;  2YUO A;  1SRL A;  1B3Q A;  1I0C A;  2J05 A;  1TUD A;  2DBM A;  2KXC A;  1BK2 A;  3VS1 A;  4AG2 C;  1HJD A;  3ZL7 C;  4J9I A;  4LUE A;  2LJ0 A;  2DL7 A;  2J6K A;  1OOT A;  1WLP B;  4M4Z A;  2CT4 A;  4HCK A;  3UF4 A;  4R0K A;  2DJQ A;  1T3S A;  3EGU A;  2O31 A;  4J9G A;  4LNP A;  1YNZ A;  2HEQ A;  1E7O A;  1NLP C;  1KIK A;  2J7I A;  1SSH A;  3H0I A;  3REA B;  2JMA A;  1ARK A;  1S1N A;  4OMP A;  2GTJ A;  4JZ3 A;  5ECA A;  5IHI A;  2DX1 A;  2EVR A;  5IHK A;  1FYN A;  1K9A A;  3I5R A;  3TSW A;  2VVK A;  2AKK A;  3U23 A;  1ZBJ A;  1JXM A;  2A37 A;  1NG2 A;  2DE0 X;  2HDA A;  1U3O A;  2M51 A;  3SHW A;  4OMQ A;  1JXO A;  4FSS A;  5FWC A;  1AWW A;  4JZ4 A;  2EW3 A;  3ULR B;  2JM9 A;  3NGP A;  4CC2 A;  4LE9 A;  3IQL A;  2CRE A;  2RPN A;  2KYB A;  4IIM A;  1TUC A;  2O2O A;  3I9Q A;  5L23 A;  2F2W A;  2NUZ A;  2BZY A;  3VRY A;  1GFC A;  4X1V A;  1M3C A;  1VA7 A;  2MOX A;  2NWM A;  2W10 A;  2RQT A;  1M27 C;  3PVL A;  3VS0 A;  3VS3 A;  2K2M A;  1WDX A;  2CSI A;  4AG1 C;  2E5K A;  1RLQ C;  1UHC A;  2J06 A;  3JV3 A;  2K7A A;  2JTE A;  1PRL C;  1ZUK A;  1HD3 A;  1U06 A;  1AOJ A;  2K3B A;  3REB B;  4HVW A;  1SHF A;  2F2V A;  2BTT A;  2L3S A;  1EFN A;  4WCI A;  1WXB A;  2EKH A;  2LZ6 B;  2JXB A;  1X43 A;  2FRY A;  2M0Y A;  2EYX A;  4ORZ A;  2DMO A;  1ZUY A;  1UJ0 A;  1V1C A;  3RBB B;  4RTY A;  2CUB A;  2VKN A;  3SEM A;  2ROT A;  1AZE A;  1NLO C;  1CKB A;  1UJY A;  2EGE A;  2CDT A;  1WXT A;  2EQI A;  5EC7 A;  4JPB W;  1M30 A;  4HXJ A;  3RNJ A;  3THK A;  3H41 A;  2KRM A;  4CC7 A;  1WYX A;  3EG2 A;  5IHN A;  2KRO A;  2DNU A;  2LNH B;  1OPK A;  1GL5 A;  4J9B A;  4E6R A;  2YSQ A;  2JT4 A;  2AZS A;  4F16 A;  1Y57 A;  1N5Z A;  2D8H A;  2DF6 A;  4JJC A;  1QWE A;  3EG3 A;  3O5Z A;  1JEG A;  1GCP A;  4HVU A;  1QCF A;  2GQI A;  1ZSG A;  2KE9 A;  2LQN A;  1Z9Q A;  1UDL A;  2KT1 A;  1MV0 B;  1A0N B;  4RTZ A;  2CUD A;  5FW9 A;  2J6F A;  1RUW A;  3I35 A;  1MV3 A;  2JS2 A;  2HSP A;  1K76 A;  1X69 A;  2L2P A;  2X3X D;  2ED1 A;  2EBP A;  1W70 A;  2DRK A;  1AD5 A;  1ZX6 A;  4OMM A;  1SHG A;  1OPL A;  2KNB B;  4RUG A;  3EG0 A;  2CH4 W;  4LN2 A;  1ZUU A;  1AWX A;  4EIK A;  3H0F A;  3NMZ C;  2MCN A;  2FPD A;  1YWO A;  2EGC A;  4K11 A;  2OI3 A;  1QLY A;  3CQT A;  3EHR A;  2RF0 A;  2BZX A;  3VS7 A;  1SEM A;  4JJB A;  4Z88 A;  2PZ1 A;  2J6O A;  2YDL A;  1TG0 A;  3TSZ A;  2C0I A;  2V1R A;  2YUP A;  1OEB A;  2A28 A;  2MIO A;  3UA7 A;  1X27 A;  3UA6 A;  4AFS C;  4ESR A;  1UFF A;  1W6X A;  4J9E A;  2DL3 A;  4HVV A;  5I22 A;  3H0H A;  1K0S A;  2C0T A;  2DL4 A;  3A98 A;  2D8J A;  1WXU A;  1XOV A;  1GRI A;  1UTI A;  2RMO A;  2D0N A;  1PRM C;  2DL8 A;  3NPF A;  2HCK A;  1E6H A;  1NYF A;  2RNA A;  1WX6 A;  1T3L A;  1B07 A;  2HBW A;  1AVZ C;  5HCK A;  4D8D A;  2FEI A;  2IIM A;  1E6G A;  1PNJ A;  3M0Q A;  2C0O A;  4OMO A;  3EHQ A;  2ABL A;  2FO0 A;  2X3W D;  4LUD A;  2G6F X;  2A08 A;  1PKS A;  2DVJ A;  2JS0 A;  1QKW A;  1H8K A;  4GBQ A;  3I5S A;  1MUZ A;  1PKT A;  1Z9Z A;  2A36 A;  5GJV B;  3R6N A;  1K4U S;  3M0S A;  1AWO A;  2LMJ A;  2KRN A;  2K79 A;  2SEM A;  1WI7 A;  2D1X A;  2KGT A;  1GCQ A;  2OJ2 A;  2RQR A;  2CT3 A;  3M0U A;  2CH4 A;  2LJ1 A;  2V1Q A;  2XMF A;  4QT7 A;  4CC4 B;  1NM7 A;  2ED0 A;  1LCK A;  2AZV A;  3C0C A;  1RLP C;  2RQW A;  1KFZ A;  1J3T A;  4DEY A;  2PTK A;  1AWJ A;  1T0J A;  2GGR A;  4Z89 A;  1G83 A;  1FMK A;  2I0N A;  1M3A A;  2DBK A;  1QKX A;  2DM1 A; 
#chains in the Genus database with same CATH topology
 3UAT A;  4QW2 A;  1U8R A;  2YRV A;  1VYV A;  4PL6 A;  2NUT B;  1B7T A;  2DXB A;  1HSQ A;  5FU6 B;  1NEB A;  4M78 E;  3CCR A;  1V76 A;  4AFU C;  1IO6 A;  4BDZ A;  2FRW A;  2BE9 B;  4J9H A;  3RMQ A;  3FJP A;  4ZNX A;  1VQ6 T;  1YCS B;  2NUP B;  1MMD A;  4QQ6 A;  3LLR A;  3EH2 A;  3HRU A;  3CC7 T;  2LRQ A;  4IIO A;  4X9D A;  5GJW B;  5KCO A;  2W0Z A;  1B34 B;  1UGP B;  4M75 C;  4XQ3 A;  2COW A;  1ABO A;  1SRM A;  3LH0 A;  4LDY A;  2DIQ A;  4J9F A;  3MEW A;  1VQ7 Q;  1IHV A;  2YHT A;  1YJN A;  1I5O B;  1VQ5 Q;  3MEV A;  1QW1 A;  2K6D A;  3CCL A;  2DIL A;  3LW5 E;  1ZLM A;  2XK0 A;  3FIF A;  5GAN 8;  1BCO A;  5GAN h;  2PVD B;  1YHQ T;  3DB4 A;  2FPE A;  2PU9 B;  1KJW A;  3MKD A;  3ER0 A;  2L0A A;  4M77 D;  4GLM A;  2KEA A;  3INZ A;  5GAN j;  4KGZ B;  2JMC A;  3G71 T;  3J81 E;  4LD6 A;  2FG0 A;  1I4K 1;  4C8Q G;  2ESW A;  2OTJ T;  2K5L A;  3G7Z A;  4PJO B;  3FLG A;  3CCQ Q;  2WSE E;  2P84 A;  4IUP A;  2DD4 A;  2HQE A;  3X28 B;  3LH5 A;  2MPX C;  3M0P A;  4BI4 A;  2A3L A;  3HP9 A;  2OX7 A;  2QTX A;  2MK5 A;  4OP0 A;  3A8O B;  3FJ5 A;  3OSV A;  3KXT A;  4RTX A;  2P4R A;  2KQW A;  2SRC A;  1U5S A;  2KT8 A;  1GBQ A;  4F7U E;  1D1A A;  2ZAE A;  4MML A;  2QTV A;  1NJI U;  1DJ7 B;  3CCM T;  1UEC A;  2ECZ A;  3M4Y A;  5GAM e;  2DRM A;  3V7R A;  5FWB A;  4M7D B;  1P92 A;  3GLX A;  3WXM B;  3G4S A;  3MJX A;  1YJW T;  2L89 A;  2E64 A;  1SRL A;  1B3Q A;  2J05 A;  1PC0 A;  4QVD A;  2KXC A;  1TOV A;  1NBE B;  2L8D A;  2ZPE B;  4LUE A;  2LJ0 A;  1ZSZ C;  3PGG A;  2J6K A;  1WLP B;  1I81 A;  2E70 A;  5GMK l;  2O01 E;  1VQ4 Q;  1OX9 A;  4LDV A;  3UF4 A;  3M5A A;  4R0K A;  1BI1 A;  3QDR B;  1YNZ A;  3ZBD A;  1NLP C;  3S3M A;  3NTI A;  3JCM h;  1TXQ A;  4IUT A;  4OMP A;  4M75 D;  3DB3 A;  3M53 A;  3JB9 D;  3OB9 A;  2DVE A;  5M9O A;  1M90 C;  1FMV A;  2COY A;  2E12 A;  4KH0 B;  2JN0 A;  3RER A;  4O6J A;  3TSW A;  1VQM Q;  2F69 A;  3OYK A;  2MYS A;  2D9T A;  3LX7 A;  4M75 E;  2ZPB B;  2LQ8 A;  1OYX A;  2PUK B;  3OS2 A;  1HYO A;  4OMQ A;  3TQ7 P;  4JZ4 A;  2JM9 A;  4PJO G;  5LJ3 f;  4J6Y A;  1F1B B;  2CRE A;  1TTH B;  2KYB A;  3I9Q A;  1WHK A;  1GFC A;  3PMT A;  1NZ9 A;  1SG5 A;  3QSU A;  4JDS A;  5KE3 A;  3OBY A;  2W10 A;  2NWM A;  1WNL A;  2R5A A;  3I55 Q;  1M27 C;  2EQK A;  3VS3 A;  3LGF A;  4TVR A;  2JTE A;  1U06 A;  1RAD B;  3AHU A;  2JJ9 A;  1SHF A;  2F2V A;  1LNX A;  2QQB A;  2L3S A;  1R0B G;  2RI2 A;  4M78 B;  1QP3 A;  4M7D G;  1WXB A;  1YIT Q;  1ZA1 B;  3CXC S;  5CKH A;  1X43 A;  2FRY A;  1OX8 A;  2RJF A;  4BI8 B;  4J7I A;  1VOM A;  2DMO A;  1YIJ A;  4FT4 A;  2CUB A;  3V7S A;  1BYM A;  1YBY A;  1WXT A;  3UWN A;  5EC7 A;  1KC8 C;  4C5E A;  4JPB W;  1M30 A;  4Z02 A;  2H3J A;  2R5M A;  4HXJ A;  4OB1 B;  3RNJ A;  3FC3 A;  2EFI A;  3H41 A;  2M1H A;  4CC7 A;  1WYX A;  4PLL A;  2OTL Q;  3P8D A;  3GNG A;  3JCM V;  3EG2 A;  5IHN A;  2KRO A;  4NS5 A;  4B9W A;  1QVF A;  2DXU A;  2AZS A;  4MZM A;  2RO0 A;  1Y57 A;  2D8H A;  4JJC A;  5KYU B;  2A7Y A;  3QZ9 B;  2AIR B;  4XU2 A;  1YI2 Q;  3CCU A;  1AHJ B;  1LOJ A;  5IAY A;  3HHT B;  1M90 U;  4R55 A;  2KT1 A;  1MV0 B;  1A0N B;  4RTZ A;  5A2Q E;  1Y96 A;  5FRO A;  5FW9 A;  2HSP A;  2I2L A;  1RL2 A;  1YJ9 Q;  2EBP A;  3CME A;  4ELZ C;  4JRK A;  4OMM A;  1PD0 A;  3CEY A;  1OPL A;  3OYE A;  4EIK A;  4QVZ A;  2DAQ A;  2MCN A;  5HY6 A;  1OI1 A;  2VXE A;  4K11 A;  3CQT A;  3EHR A;  4II1 A;  1YCY A;  1JB0 E;  2BKD N;  1I8F A;  3LGL A;  1PG5 B;  2GQV A;  1SEM A;  2L5Q A;  5DLQ E;  1JJ2 P;  2PZ1 A;  2J6O A;  4F7U B;  4FYX B;  1KQS P;  3OYA A;  2MIO A;  1Y07 A;  2RJC A;  4FM4 B;  4HCZ A;  4E7J A;  2X35 A;  1VQ9 T;  5I22 A;  3JCM c;  4M78 G;  4QQD A;  1K0S A;  2DL4 A;  1WXU A;  3JCM Q;  4CI0 C;  2YXY A;  4KGV B;  4EPC A;  2RMO A;  3PTA A;  1WJR A;  4MZT A;  1E6H A;  2DJZ A;  1TH7 A;  1MMG A;  3CC2 A;  2E41 A;  4MDX A;  2BE7 D;  4E7H A;  4XU1 A;  2EAY A;  4F04 B;  4ME7 A;  4JLG A;  2P0Q A;  2AHJ B;  1KC8 U;  4M77 A;  5HCK A;  2WSF E;  4D8D A;  1VUB A;  5CQX A;  1E6G A;  1PNJ A;  3G1J A;  2RI5 A;  3CCJ T;  4M77 F;  3CCR Q;  2X3W D;  2COZ A;  5KYX A;  1G5V A;  3I56 Q;  3JCM J;  1TS9 A;  3QXE B;  4PNO A;  1QKW A;  1M90 R;  2ZPG B;  3GNF B;  2Y4X A;  5GJV B;  3M0S A;  1N27 A;  2KGT A;  4AMC A;  5CCA A;  1QQJ A;  2RQR A;  2EQU A;  3O8V A;  4MMK A;  1D3B A;  4A54 A;  2E3I A;  2XMF A;  4QT7 A;  1M1G A;  1VQ6 A;  3QHS A;  2FL7 A;  5GAM h;  3CC7 A;  3MHX A;  3SWN B;  3CCL Q;  1VQ7 T;  1EZZ B;  3A1P A;  2QXF A;  3OQ5 A;  3FDR A;  2QA4 Q;  1VQ5 T;  4OF1 A;  4LDW A;  3QYH B;  2DTH A;  1QCN A;  1VQP Q;  4Y91 A;  3E2U A;  5GAM j;  3V7C A;  3E19 A;  3CPW S;  4E7Z A;  4OB0 B;  2KRS A;  3CPW A;  1OV3 A;  1S72 T;  5CKB A;  2ROL A;  3OYG A;  5AYF A;  2LJ3 A;  5LJ5 f;  3VS2 A;  3ASK A;  2KMT A;  4F7U G;  3G6E A;  1I1J A;  5FU7 C;  3QPH A;  1W2B S;  8ATC B;  1SF9 A;  2RN8 A;  3QWX X;  4E7K A;  1YHQ A;  1W2B A;  3HKS A;  4DQ2 A;  1X2K A;  4KRT A;  1QWF A;  4JRP A;  3CCQ T;  3OW2 S;  1X6G A;  1M3B A;  1WFW A;  3OW2 A;  4C92 C;  5LJ3 e;  5CIU A;  3OYF A;  3OSS C;  2XHC A;  4J9C A;  5IH2 A;  3G71 A;  1KC8 R;  2OTJ A;  1H3H A;  4CC3 A;  1KD1 C;  2LNV A;  1T0H A;  2RQU A;  4AFQ C;  1RI0 A;  2CYZ B;  2KVQ G;  3JB9 F;  2BZ8 A;  1H64 1;  3AT1 B;  2EQJ A;  5HK3 A;  3FRN A;  3M0R A;  4N4H A;  2QEX Q;  1AEY A;  2XG8 D;  1EIF A;  5GAN 7;  4JUV A;  1UE9 A;  2ATC B;  2V8J A;  5AT1 B;  3QWY A;  3G4S Q;  3S3N A;  3CCE A;  1BCM A;  4BY6 B;  3GPL A;  4RMO A;  1UHF A;  3OYJ A;  2AK5 A;  2LX7 A;  2VWF A;  1BU1 A;  4F14 A;  1RAC B;  2MMP A;  3OYD A;  4XU3 A;  1AZG B;  2XDD A;  1O75 A;  3CCM A;  3HRT A;  2AKL A;  2YT6 A;  3VRZ A;  3EGX A;  3C4S A;  1JO8 A;  1G8X A;  1YJW A;  4D6W A;  2YUQ A;  1SKU B;  1VQ4 T;  3QBY A;  7AT1 B;  1QVP A;  1VQN A;  4F17 A;  5IXB A;  2O88 A;  4PJM A;  1UUE A;  3OYM A;  4RTT A;  4J6X A;  3MP6 A;  1BBZ A;  2OAW A;  1D0Y A;  4ATO A;  4AFZ C;  2GTO A;  2O4X A;  5CQY A;  3HFO A;  3C95 A;  5CAI A;  1VQM T;  2EKO A;  3LWI A;  5KYY A;  4NL3 A;  1I0C A;  4JRQ A;  1TUD A;  1TU0 B;  2DBM A;  3VS1 A;  4FW2 A;  2DL7 A;  3HRS A;  3KUF A;  1OOT A;  1LJO A;  4E47 A;  1KQ1 A;  3OA6 A;  4XU0 A;  5CR2 A;  9ATC B;  4HCB A;  4LNP A;  1ZSZ A;  4ZGJ B;  3CCV T;  3P8H A;  1KIK A;  4PK4 A;  2J7I A;  2HL3 A;  2JMA A;  4JS5 A;  2GTJ A;  1WHL A;  4JS4 A;  4JZ3 A;  1KD1 U;  1KK7 A;  3MEU A;  5IHK A;  4C92 D;  3BDU A;  4OB3 B;  2VVK A;  3C94 A;  1MND A;  4DBR A;  4C8Q A;  3RES A;  1HK9 A;  4PFZ A;  3PMI A;  1JXM A;  1NG2 A;  2DE0 X;  1N9S A;  3E1S A;  2DZ9 A;  4C8Q F;  2F5T X;  5GMK m;  2M51 A;  1YIT T;  3UDC A;  3SHW A;  1JXO A;  4FSS A;  5FWC A;  5GAN d;  1AWW A;  2EW3 A;  4CC2 A;  2O2O A;  3J80 E;  2HMA A;  1K9M C;  2F2W A;  2R58 A;  3EG9 A;  2HSE B;  3Q1J A;  2QQA A;  1M4Z A;  4KH1 B;  3VUB A;  3PIO A;  2OTL T;  3ZEH A;  3VS0 A;  2FB7 A;  3QZ5 B;  4C0D B;  4AG1 C;  4HT8 A;  3CBP A;  2CKK A;  4M77 E;  2NUT A;  4XK8 E;  3L2Q A;  3CCU Q;  3REB B;  4DA4 A;  3EAE A;  2FYK A;  2QAS A;  5KYW A;  4M7A B;  2NUP A;  3WVD B;  1PSE A;  2EKH A;  4QKU A;  5HK0 A;  3L2R A;  1VQ8 A;  2K3Y A;  1JRI A;  4BUG A;  4DBQ A;  1Q86 C;  1V1C A;  1B34 A;  3CME Q;  3SEM A;  5KCH A;  2VKN A;  1AZE A;  4N4G A;  2MF2 A;  1OU8 A;  3CBO A;  1M2V B;  5GAN g;  4L59 A;  2CDT A;  1K73 C;  3VU3 C;  2EQI A;  2KY9 A;  3THK A;  3QII A;  1JJ2 S;  5GAN 3;  1KD1 R;  2DNU A;  1JJ2 A;  1GL5 A;  4J9B A;  3DKM A;  2EQM A;  2H3E B;  1N5Z A;  3O5Z A;  3OBW A;  5J3B A;  4Y28 E;  3A5Z B;  5GAO q;  1V29 B;  2HZY A;  2DTO A;  4HVU A;  2DZC A;  1Z9Q A;  2Z0W A;  1WQ7 A;  3JCM X;  5LJ5 e;  3BW1 A;  4C0Z A;  1OUL A;  4HT9 A;  2XID A;  4PFO A;  3SDZ A;  1Y7X A;  2LTO A;  2DRK A;  4J6W A;  3RKY A;  4C8Q C;  4RUG A;  3EG0 A;  2CH4 W;  5CVI A;  3CC2 Q;  4BAC A;  1AWX A;  1MMA A;  3CC4 T;  4FCY A;  1K9M U;  1VQ9 A;  1YWO A;  4KUL A;  2DEQ A;  4RG8 A;  1QLY A;  4P5N A;  1FXX A;  2EJG A;  3VS7 A;  5KH6 A;  1R0C B;  1IZ6 A;  3L2V A;  2MAM A;  3I56 T;  1RAF B;  2C0I A;  2V1R A;  4M7D A;  2YUP A;  3JCM P;  2A28 A;  1FWZ A;  3TCJ A;  1VQK A;  5LJ3 h;  2R57 A;  1VQO A;  2LCC A;  3UA6 A;  3RR6 A;  3TEE A;  1W6X A;  4J9E A;  5FU6 C;  3CCJ A;  3H0H A;  2LDM A;  2C0T A;  4M7A G;  2D8J A;  3M55 A;  1MHN A;  2XI9 A;  5LJ3 j;  2D0N A;  5C0M A;  3RKX A;  2DL8 A;  4YTL A;  1Q86 U;  1VQ6 Q;  2HCK A;  1IRE B;  1NYF A;  3CD6 A;  1D1C A;  1LVK A;  4IUV A;  2YRD A;  3MET A;  1BIB A;  2HL5 C;  4V2S A;  3VKI A;  1K73 U;  2HBW A;  3CCL T;  1C0M A;  2FEI A;  2QA4 T;  4GY5 A;  2FO0 A;  1VQP T;  4J5Y A;  2G6F X;  2VYT A;  2DVJ A;  4IUQ A;  5GAO l;  1LPL A;  4QQG A;  3F70 A;  1X6O A;  3I5S A;  2XDP A;  2IPO B;  4RG2 A;  3OS5 A;  3G6E Q;  2D1X A;  2OJ2 A;  1QVF S;  2CT3 A;  2HD0 A;  2G3R A;  2CH4 A;  1YHQ Q;  5CK9 A;  3M4G A;  2LJ1 A;  2XKO C;  2E65 A;  2XIC A;  2JTM A;  1S72 A;  4KGX B;  1IHW A;  2AZV A;  2RQW A;  3G71 Q;  1K9M R;  4DEY A;  1NPR A;  2RA2 A;  1T0J A;  2GGR A;  4PJO C;  2M02 A;  3URG A;  4A4H A;  1G83 A;  1FMK A;  2I0N A;  3H9N A;  2KAF A;  3GF5 A;  4EMK A;  2KYM A;  4HA8 A;  3JAM E;  2FPF A;  5C6S A;  3N5B B;  4C8Q D;  3RMS A;  1YWP A;  2VUB A;  4O5V A;  2VGN A;  2QEX T;  5GMK e;  2L3P A;  3HSB A;  2PUO B;  3CCE Q;  2DO3 A;  1VQL T;  2KDS A;  1Q7Y C;  4KUD K;  1ZA2 B;  2QYZ A;  2D0Q B;  4IKF A;  1I07 A;  2MWO A;  4M77 B;  3EG1 A;  3CMA Q;  1PWT A;  3L1A A;  1KHC A;  2QDL A;  3NHN A;  4RCB A;  3EFR A;  4C8Q E;  1K1Z A;  1RI9 A;  3PIP A;  3CCM Q;  3QJ6 A;  3CCS T;  2CP2 A;  4OML A;  3SFM A;  1Q86 R;  3M57 A;  3VS6 A;  2P0P A;  1KSW A;  1HXD A;  4M7D C;  1Q81 C;  4RTU A;  1XTD A;  2K9G A;  4HCC A;  2MWP A;  4EDU A;  1MGQ A;  2L3Q A;  1YJW Q;  2DFU A;  2DYB A;  1K73 R;  1TSF A;  1PHT A;  6AT1 B;  1X2Q A;  2DK3 A;  1VQN Q;  1M1K C;  3KFV A;  2VGM A;  5IXF A;  4C92 A;  1D3B B;  1PM3 A;  2EJ9 A;  1U1T A;  2VC8 A;  2O9S A;  4J9D A;  4C92 F;  2KR3 A;  4WTO B;  5KYU A;  3X26 B;  3CBM A;  4PJL A;  1ZQ1 A;  1X6B A;  2GCX A;  2GFU A;  3C12 A;  1M8V A;  2JNG A;  4OMN A;  5CKD A;  1ACM B;  2JUF A;  3VS5 A;  4ZN3 A;  2QDY B;  2H8H A;  2YUN A;  2F2X A;  3OY9 A;  5IN1 A;  1VYT A;  1XQH A;  2O9V A;  4FT2 A;  1UEB A;  3OYN A;  1ABQ A;  2JM8 A;  3VS4 A;  3PVQ A;  3OS0 A;  1OZ2 A;  1WHH A;  2PNI A;  4JJD A;  5I2M A;  4OGC A;  1CSK A;  2LP5 A;  3OYL A;  2RQV A;  1QVG P;  1NEG A;  1VYU A;  4DEX A;  3J7A F;  1BB9 A;  3RKW A;  2L3R A;  3SD4 A;  3EFO B;  4M75 B;  2KXD A;  2GBQ A;  2HQH A;  2HBP A;  3CCV A;  2LQW A;  1CKA A;  1JU5 C;  2DLP A;  3JSC A;  5GAM d;  1YJN Q;  3M9Q A;  4PJO D;  1FMW A;  2A0F B;  3BY7 A;  1N8R C;  2YUO A;  4EMK C;  2E4H A;  1N9R A;  2F1L A;  1BK2 A;  1UGQ B;  4AG2 C;  1Q7Y U;  4M77 G;  1HJD A;  4J9I A;  5IT9 E;  2LT4 A;  3E9G A;  3LWH A;  4VUB A;  4M7A D;  5CKE A;  4L5G A;  3H6Z A;  2CT4 A;  2VV5 A;  3EGD A;  2DJQ A;  1Q81 U;  2O31 A;  3VJP A;  3QO3 A;  2HEQ A;  2QQS A;  3OYI A;  1SSH A;  1XNI A;  3FB9 A;  4KBM B;  1YIT A;  1ARK A;  1S1N A;  1QCO A;  2KK4 A;  2M16 A;  3MO8 A;  4ZTF A;  3QJY A;  4ZGD B;  2WSC E;  5GAN 5;  2C06 A;  2CP7 A;  1M1K U;  3NTK A;  5LJ5 h;  5ECA A;  2DX1 A;  4M7D D;  3EGX B;  2LT1 A;  1YFN A;  1K9A A;  1IB8 A;  4PFP A;  3CXC P;  5D7U A;  2AKK A;  4CRI A;  1ZBJ A;  5LJ5 j;  1VQ8 Q;  2HDA A;  5GAO p;  5GAM g;  4M7D E;  1D1B A;  3PFS A;  2VXF A;  1M1F A;  3ULR B;  3NGP A;  3IQL A;  4NL2 A;  2RPN A;  2ZZD A;  1TUC A;  1WGS A;  4ELY C;  5L23 A;  2NUZ A;  5CO7 A;  4AT1 B;  4X1V A;  3EFS A;  5KYY B;  2B8A A;  1M3C A;  3SWN A;  2MOX A;  1Q82 C;  4ANJ A;  2K4Y A;  2RQT A;  3HTR A;  3QDF A;  2K2M A;  4L6V 5;  4E7S A;  5J26 A;  2CSI A;  1RLQ C;  2J06 A;  3JV3 A;  3OMG A;  2K7A A;  4ZN1 A;  3M58 A;  1XJW B;  1AOJ A;  1PD1 A;  4XTU A;  3A8H B;  1ZSZ B;  4C5I A;  1W4S A;  4HVW A;  4NOY A;  4M75 G;  2BTT A;  2X9H A;  4JLI A;  2VAS A;  4PKC C;  1JBM A;  4N0A A;  1Q7Y R;  1VIF A;  5FLX E;  4B6M A;  2M0Y A;  2EYX A;  5FRM A;  4ORZ A;  3BDL A;  1ZUY A;  2DTI A;  1N8R U;  2JOY A;  3RBB B;  2CP0 A;  2XD0 A;  2ROT A;  2X51 A;  1NLO C;  1Q81 R;  1UJY A;  3V8J A;  2CP5 A;  3OYH A;  2DEU A;  2YRC A;  1C1A A;  2PVG B;  4BD3 A;  1MMN A;  3H8Z A;  2RB6 A;  1VQ9 Q;  4KUI A;  4DOV A;  2RHZ A;  4C5H A;  2LNH B;  1M1K R;  1QMC A;  4A4K A;  1OPK A;  2VB6 A;  3OYC A;  1IRX A;  3M59 A;  4ZGE B;  2JT4 A;  2FHD A;  1WQW A;  1QWE A;  3EG3 A;  3X20 B;  1JEG A;  4M78 D;  4N4I A;  1GCP A;  3CC4 A;  4XTV A;  1ZSG A;  1VQK Q;  1VQO Q;  2HAX A;  4X9C A;  1NJI C;  1UDL A;  3CCJ Q;  2J6F A;  3I35 A;  2JS2 A;  2L2P A;  3I55 T;  2X3X D;  1W70 A;  1BI2 A;  3I56 A;  1H3Z A;  1BI0 A;  5KE2 A;  2RHX A;  3CD6 Q;  1Y71 A;  3PNW C;  5KYW B;  1C6V X;  3H0F A;  4FSX A;  5GMK h;  3VV0 A;  3NMZ C;  1UGS B;  2IG0 A;  1BKB A;  4XTW A;  3D7S B;  1YIJ Q;  2RF0 A;  2DXT A;  2HNI A;  1Q82 U;  4C92 E;  5GMK j;  4OGE A;  1Q95 G;  4JJB A;  3SWN C;  4BE1 A;  1TG0 A;  5GAN f;  1OEB A;  3UA7 A;  2Y4Y A;  3MP1 A;  4BE0 A;  3A8L B;  2CGH A;  4RCC A;  1N8R R;  2QA4 A;  4AFS C;  3G6E T;  4ESR A;  1UFF A;  3KBG A;  2YWW A;  4A4F A;  1OU9 A;  1KQ2 A;  3A98 A;  1VQP A;  1PSF A;  1S72 Q;  1UGR B;  1GRI A;  3T9N A;  2RHU A;  3X24 B;  1PRM C;  2E10 A;  4N0A C;  2PVO B;  1BI3 A;  4C0G A;  2KSS A;  3NTH A;  1WX6 A;  4E2F B;  1YI2 T;  3CPW P;  3S6W A;  2DYI A;  4XTZ A;  2IIM A;  3M0Q A;  2C0O A;  3FEO A;  4OMO A;  1U1S A;  4LDU A;  4LUD A;  4JJN K;  4GLK A;  2A08 A;  1YJ9 T;  2JS0 A;  2F5K A;  3NFC A;  4GBQ A;  1W2B P;  1GXI E;  4PJJ A;  4X34 A;  1OZ3 A;  2A36 A;  3R6N A;  1K4U S;  2LMJ A;  3CCE T;  2K79 A;  2K2V A;  1K8A C;  3OW2 P;  2ZPI B;  4RKU E;  1WI7 A;  1GCQ A;  3DLM A;  3M0U A;  3CMA T;  3SB2 A;  1KQS S;  1KG1 A;  3QUI A;  4KT0 E;  2X4Y A;  2GF7 A;  1KQS A;  3MP8 A;  2OAU A;  2QEX A;  3RDV A;  1NM7 A;  2GFA A;  2ED0 A;  3C0C A;  4BY6 C;  1RLP C;  1VQL A;  4MDW A;  4MZP A;  2PTK A;  5GAN 2;  2LCL A;  4Z89 A;  2EWN A;  3OS1 A;  1M3A A;  3TU4 K;  1QKX A;  3JCM d;  1VQN T;  1UB4 A;  3CCS A;  1D09 B;  1Q82 R;  1NPP A;  8AT1 B;  5GAO m;  2FZC B;  2EYZ A;  4D8K A;  4PJO A;  2KI7 A;  2CSQ A;  4Y92 A;  2GNC A;  3JCM f;  2LCS A;  4PJO F;  3JRZ A;  1RAH B;  2RH2 A;  3PE0 A;  4A63 B;  1YP5 A;  2EYY A;  1WA7 A;  4OMF B;  2CZ1 B;  2DL5 A;  4XTX A;  4C0F A;  5J39 A;  2LC4 A;  3P8B B;  4M7A A;  4HKE A;  3HFN A;  5FRN A;  2HKQ B;  5EG2 A;  4M7A F;  1QVG S;  3GIB A;  1G3W A;  1K0X A;  2RK2 A;  1QVG A;  1NYG A;  1WHG A;  5A0G A;  3CCR T;  5GAN 6;  1M2V A;  4FYV B;  2RJD A;  3MPU B;  2EYW A;  2K57 A;  5LJ3 d;  3TVT A;  2QQR A;  3JB9 I;  3S3O A;  1WIE A;  5I11 A;  4M7D F;  1YN8 A;  2HKN A;  3JCM g;  1GBR A;  3QG1 A;  3A8M B;  3PT9 A;  2V8I A;  3CCV Q;  3GBQ A;  4DOW A;  3L42 A;  1M9S A;  3CC7 Q;  2DD5 A;  3L2U A;  1W1F A;  4IUU A;  4FIB A;  2JVV A;  2ZPF B;  1N6A A;  5DY9 A;  1YJN T;  1Y96 B;  2YLC A;  4BI3 A;  1NJI R;  4EMK B;  1JQQ A;  4FYW B;  2ZPH B;  3M54 A;  1K8A U;  2FVU A;  2ENM A;  1G3T A;  1MNE A;  3VUZ A;  2EGA A;  2QGF B;  4Z8A A;  1UG1 A;  4LDX A;  1IGU A;  3WVE B;  1GCQ C;  1UGV A;  2KBT A;  1ZHI A;  1VQ7 A;  3TRE A;  2XDB A;  1VQ5 A;  4QVC A;  2EPD A;  1GFD A;  2X4J A;  3ZFJ A;  2JW4 A;  3M0T A;  2AT1 B;  2EJF A;  3CXC A;  2RI3 A;  5FU7 B;  5LJ3 g;  4RTV A;  1RAI B;  3OMC A;  4A4E A;  2B86 A;  1M8M A;  2DA9 A;  2DKG A;  4RTW A;  1G2B A;  2V8K A;  1WHM A;  4XTY A;  3V8L A;  2IVW A;  4ZTJ A;  4E7L A;  1H92 A;  4C92 B;  1SPK A;  1Y0M A;  1D0Z A;  2OTJ Q;  1OQK A;  2RD1 A;  2EIF A;  4C0D C;  2D6F A;  2Y90 A;  1VQ8 T;  1TWB A;  3ZL7 C;  3CCQ A;  2M0O A;  4FW1 A;  2EYQ A;  5A0L A;  4E7I A;  3A8G B;  2QQ9 A;  4BE2 A;  5D6W A;  4M4Z A;  2RM4 A;  4M7A C;  1X75 C;  4HCK A;  2M9U A;  1T3S A;  1FX7 A;  2FZG B;  3EGU A;  4J9G A;  4LD9 K;  1E7O A;  4B9X A;  3G4S T;  3H0I A;  3REA B;  3JB9 J;  4M78 A;  2PQW A;  1WJQ A;  4OVA A;  2K3X A;  2V26 A;  2NYS A;  5KYX B;  4M78 F;  5IHI A;  2EVR A;  3BE3 A;  1FYN A;  2QI2 A;  3I5R A;  2RHI A;  2RK1 A;  4FU6 A;  1PCX A;  3QYG B;  3U23 A;  2A37 A;  5GAN e;  1K8A R;  1U3O A;  2CZ7 B;  1NE8 A;  2XU8 A;  2P4T A;  4DBF A;  4LE9 A;  5GAO n;  3UPU A;  4IIM A;  1M2O A;  4JRI A;  2BZY A;  3VRY A;  1VQ4 A;  2LQK A;  1X01 A;  1VA7 A;  2JZ2 A;  4PJN A;  4J7F A;  5L8R E;  1SSF A;  3PVL A;  3L2Z A;  3ME9 A;  1WPY A;  1WDX A;  3HL8 A;  2DIG A;  2E5K A;  1UHC A;  2X4W A;  1EX4 A;  1G3Y A;  1PRL C;  1ZUK A;  1HD3 A;  2JTF A;  1G3S A;  3EGD B;  5I2S A;  2K3B A;  2E3H A;  2HQX A;  3CC4 Q;  4BDY A;  1RAG B;  1VQM A;  4LXC A;  1EFN A;  5CKF A;  4WCI A;  4BB7 A;  2ZCF B;  1VQK T;  1VQO T;  2LZ6 B;  1IGQ A;  2JXB A;  4C92 G;  5D6Y A;  5DM7 R;  3RIR A;  1UJ0 A;  3MCA B;  1AT1 B;  2CZ0 B;  4RTY A;  3R6O A;  2P0K A;  1CKB A;  2CP6 A;  4UC4 A;  2EGE A;  1WZO A;  3JCM b;  3HPW A;  2CZ6 B;  3CD6 T;  1O9S A;  4F7U A;  2KRM A;  2E6N A;  2MI6 A;  3DLL A;  4F7U F;  3I55 A;  4E6R A;  2YSQ A;  5GAM f;  4F16 A;  2DF6 A;  2K5I A;  1YIJ T;  5A0D A;  2WAC A;  4OB2 B;  2QG9 B;  5KYN A;  1R77 A;  4PJO E;  4M78 C;  3JCM e;  1QCF A;  2GQI A;  4DBH A;  2KE9 A;  2LQN A;  1RAB B;  2CUD A;  1RUW A;  1MV3 A;  1K76 A;  1X69 A;  2ED1 A;  5LJ5 d;  1RAA B;  4M7A E;  1AD5 A;  1ZX6 A;  1SHG A;  2QAZ A;  1QP2 A;  3OYB A;  4Q5W A;  2KNB B;  2QGG A;  5HKC A;  3JB9 H;  4IUR A;  4LN2 A;  1ZUU A;  2BUD A;  2LVM A;  2DET A;  3CCU T;  3JCM W;  2OTL A;  2FPD A;  5GAN 4;  2EGC A;  3E9F A;  1BIA A;  2OI3 A;  1D0X A;  4WF2 A;  2BZX A;  2CP3 A;  2O4X B;  5GMK i;  3CME T;  3EFO A;  1WJS A;  4M75 A;  1QVF P;  4Z88 A;  5DLO A;  2YDL A;  3L2W A;  1TUG B;  3TSZ A;  3CPF A;  1R8O B;  1YI2 A;  2NLU A;  4M75 F;  4J83 A;  1IXD A;  1X27 A;  2BIV A;  4EMG A;  2DL3 A;  4HVV A;  4FYY B;  3M56 A;  1XOV A;  2YLB A;  1YJ9 A;  2CS7 A;  1UTI A;  3X25 B;  4A4G A;  2E1H A;  3BFM A;  1VQL Q;  3NPF A;  4M77 C;  5LJ5 g;  2RNA A;  1T3L A;  4R56 A;  1B07 A;  3CMA A;  3JB9 G;  3EH1 A;  3CCS Q;  1AVZ C;  4EMH A;  2K5F A;  3GP8 A;  2FZK B;  3VYG A;  3EHQ A;  2ABL A;  2RHY A;  4C5G A;  1PKS A;  4PLI A;  2DER A;  1H8K A;  4FL6 A;  4A53 A;  2RJE A;  1MUZ A;  4C8Q B;  1PKT A;  5LL6 S;  1Z9Z A;  5GAO r;  1M5Q 1;  3QKJ A;  1AWO A;  2KRN A;  2SEM A;  3CC2 T;  2X4X A;  3OYY A;  5D6X A;  1WHJ A;  1ZBX A;  4J8O A;  3VYH B;  2QK0 A;  3GOX A;  2V1Q A;  3RUX A;  4XAX B;  4CC4 B;  1VIE A;  3LYI A;  1I5L A;  1LCK A;  3MEA A;  2ZGW A;  3V8K A;  3UT1 A;  1KFZ A;  1J3T A;  3EG9 B;  2E5Q A;  1AWJ A;  2LX9 A;  2DPP B;  2DXC A;  1RAE B;  5I21 A;  2DBK A;  1KHI A;  2E6Z A;  2DM1 A; 
#chains in the Genus database with same CATH homology
 3UAT A;  2EYZ A;  4D8K A;  1VYV A;  2KYM A;  1HSQ A;  2CSQ A;  4Y92 A;  1NEB A;  2FPF A;  2GNC A;  2KRS A;  1YWP A;  4AFU C;  1IO6 A;  1OV3 A;  2LCS A;  2FRW A;  2L3P A;  4J9H A;  3PE0 A;  4ZNX A;  2ROL A;  4A63 B;  1YCS B;  1YP5 A;  2EYY A;  2LJ3 A;  1WA7 A;  3VS2 A;  1I07 A;  3EG1 A;  2DL5 A;  1I1J A;  1PWT A;  4IIO A;  2QDL A;  3NHN A;  5GJW B;  2RN8 A;  2W0Z A;  3QWX X;  1K1Z A;  1RI9 A;  1X2K A;  4KRT A;  4OML A;  1QWF A;  3VS6 A;  1X6G A;  1KSW A;  1M3B A;  4RTU A;  1WFW A;  1K0X A;  2K9G A;  1ABO A;  1SRM A;  1NYG A;  2L3Q A;  2DYB A;  4J9F A;  4J9C A;  5IH2 A;  2EYW A;  1PHT A;  1H3H A;  1X2Q A;  4CC3 A;  1T0H A;  2K6D A;  2RQU A;  3KFV A;  3TVT A;  2DIL A;  4AFQ C;  5IXF A;  1WIE A;  5I11 A;  1ZLM A;  2BZ8 A;  1YN8 A;  2O9S A;  4J9D A;  3M0R A;  2KR3 A;  2FPE A;  1AEY A;  1KJW A;  1GBR A;  1UE9 A;  2L0A A;  3GBQ A;  4GLM A;  3QWY A;  2KEA A;  1X6B A;  2JMC A;  1W1F A;  4OMN A;  3VS5 A;  1UHF A;  2FG0 A;  2AK5 A;  2ESW A;  2H8H A;  2YUN A;  2LX7 A;  2VWF A;  2F2X A;  1BU1 A;  1JQQ A;  4F14 A;  1AZG B;  2AKL A;  1VYT A;  2ENM A;  2O9V A;  3LH5 A;  3M0P A;  2YT6 A;  1ABQ A;  2JM8 A;  3VS4 A;  2EGA A;  3VRZ A;  4Z8A A;  1UG1 A;  1JO8 A;  3PVQ A;  1GCQ C;  1UGV A;  4JJD A;  2PNI A;  2YUQ A;  2KBT A;  3FJ5 A;  1CSK A;  2LP5 A;  4RTX A;  2RQV A;  2EPD A;  4F17 A;  1GFD A;  5IXB A;  1NEG A;  2JW4 A;  2P4R A;  3M0T A;  1VYU A;  2O88 A;  4DEX A;  2SRC A;  2KT8 A;  1U5S A;  1GBQ A;  1UUE A;  1BB9 A;  4RTV A;  4RTT A;  2B86 A;  1BBZ A;  1M8M A;  2DA9 A;  4RTW A;  2OAW A;  1G2B A;  1UEC A;  2ECZ A;  2DRM A;  2KXD A;  4AFZ C;  2GBQ A;  5FWB A;  2GTO A;  1H92 A;  2LQW A;  1CKA A;  1JU5 C;  2DLP A;  1SPK A;  1Y0M A;  2YUO A;  1SRL A;  1B3Q A;  1I0C A;  2J05 A;  1TUD A;  2DBM A;  2KXC A;  1BK2 A;  3VS1 A;  4AG2 C;  1HJD A;  3ZL7 C;  4J9I A;  4LUE A;  2LJ0 A;  2DL7 A;  2J6K A;  1OOT A;  1WLP B;  4M4Z A;  2CT4 A;  4HCK A;  3UF4 A;  4R0K A;  2DJQ A;  1T3S A;  3EGU A;  2O31 A;  4J9G A;  4LNP A;  1YNZ A;  2HEQ A;  1E7O A;  1NLP C;  1KIK A;  2J7I A;  1SSH A;  3H0I A;  3REA B;  2JMA A;  1ARK A;  1S1N A;  4OMP A;  2GTJ A;  4JZ3 A;  5ECA A;  5IHI A;  2DX1 A;  2EVR A;  5IHK A;  1FYN A;  1K9A A;  3I5R A;  3TSW A;  2VVK A;  2AKK A;  3U23 A;  1ZBJ A;  1JXM A;  2A37 A;  1NG2 A;  2DE0 X;  2HDA A;  1U3O A;  2M51 A;  3SHW A;  4OMQ A;  1JXO A;  4FSS A;  5FWC A;  1AWW A;  4JZ4 A;  2EW3 A;  3ULR B;  2JM9 A;  3NGP A;  4CC2 A;  4LE9 A;  3IQL A;  2CRE A;  2RPN A;  2KYB A;  4IIM A;  1TUC A;  2O2O A;  3I9Q A;  5L23 A;  2F2W A;  2NUZ A;  2BZY A;  3VRY A;  1GFC A;  4X1V A;  1M3C A;  1VA7 A;  2MOX A;  2NWM A;  2W10 A;  2RQT A;  1M27 C;  3PVL A;  3VS0 A;  3VS3 A;  2K2M A;  1WDX A;  2CSI A;  4AG1 C;  2E5K A;  1RLQ C;  1UHC A;  2J06 A;  3JV3 A;  2K7A A;  2JTE A;  1PRL C;  1ZUK A;  1HD3 A;  1U06 A;  1AOJ A;  2K3B A;  3REB B;  4HVW A;  1SHF A;  2F2V A;  2BTT A;  2L3S A;  1EFN A;  4WCI A;  1WXB A;  2EKH A;  2LZ6 B;  2JXB A;  1X43 A;  2FRY A;  2M0Y A;  2EYX A;  4ORZ A;  2DMO A;  1ZUY A;  1UJ0 A;  1V1C A;  3RBB B;  4RTY A;  2CUB A;  2VKN A;  3SEM A;  2ROT A;  1AZE A;  1NLO C;  1CKB A;  1UJY A;  2EGE A;  2CDT A;  1WXT A;  2EQI A;  5EC7 A;  4JPB W;  1M30 A;  4HXJ A;  3RNJ A;  3THK A;  3H41 A;  2KRM A;  4CC7 A;  1WYX A;  3EG2 A;  5IHN A;  2KRO A;  2DNU A;  2LNH B;  1OPK A;  1GL5 A;  4J9B A;  4E6R A;  2YSQ A;  2JT4 A;  2AZS A;  4F16 A;  1Y57 A;  1N5Z A;  2D8H A;  2DF6 A;  4JJC A;  1QWE A;  3EG3 A;  3O5Z A;  1JEG A;  1GCP A;  4HVU A;  1QCF A;  2GQI A;  1ZSG A;  2KE9 A;  2LQN A;  1Z9Q A;  1UDL A;  2KT1 A;  1MV0 B;  1A0N B;  4RTZ A;  2CUD A;  5FW9 A;  2J6F A;  1RUW A;  3I35 A;  1MV3 A;  2JS2 A;  2HSP A;  1K76 A;  1X69 A;  2L2P A;  2X3X D;  2ED1 A;  2EBP A;  1W70 A;  2DRK A;  1AD5 A;  1ZX6 A;  4OMM A;  1SHG A;  1OPL A;  2KNB B;  4RUG A;  3EG0 A;  2CH4 W;  4LN2 A;  1ZUU A;  1AWX A;  4EIK A;  3H0F A;  3NMZ C;  2MCN A;  2FPD A;  1YWO A;  2EGC A;  4K11 A;  2OI3 A;  1QLY A;  3CQT A;  3EHR A;  2RF0 A;  2BZX A;  3VS7 A;  1SEM A;  4JJB A;  4Z88 A;  2PZ1 A;  2J6O A;  2YDL A;  1TG0 A;  3TSZ A;  2C0I A;  2V1R A;  2YUP A;  1OEB A;  2A28 A;  2MIO A;  3UA7 A;  1X27 A;  3UA6 A;  4AFS C;  4ESR A;  1UFF A;  1W6X A;  4J9E A;  2DL3 A;  4HVV A;  5I22 A;  3H0H A;  1K0S A;  2C0T A;  2DL4 A;  3A98 A;  2D8J A;  1WXU A;  1XOV A;  1GRI A;  1UTI A;  2RMO A;  2D0N A;  1PRM C;  2DL8 A;  3NPF A;  2HCK A;  1E6H A;  1NYF A;  2RNA A;  1WX6 A;  1T3L A;  1B07 A;  2HBW A;  1AVZ C;  5HCK A;  4D8D A;  2FEI A;  2IIM A;  1E6G A;  1PNJ A;  3M0Q A;  2C0O A;  4OMO A;  3EHQ A;  2ABL A;  2FO0 A;  2X3W D;  4LUD A;  2G6F X;  2A08 A;  1PKS A;  2DVJ A;  2JS0 A;  1QKW A;  1H8K A;  4GBQ A;  3I5S A;  1MUZ A;  1PKT A;  1Z9Z A;  2A36 A;  5GJV B;  3R6N A;  1K4U S;  3M0S A;  1AWO A;  2LMJ A;  2KRN A;  2K79 A;  2SEM A;  1WI7 A;  2D1X A;  2KGT A;  1GCQ A;  2OJ2 A;  2RQR A;  2CT3 A;  3M0U A;  2CH4 A;  2LJ1 A;  2V1Q A;  2XMF A;  4QT7 A;  4CC4 B;  1NM7 A;  2ED0 A;  1LCK A;  2AZV A;  3C0C A;  1RLP C;  2RQW A;  1KFZ A;  1J3T A;  4DEY A;  2PTK A;  1AWJ A;  1T0J A;  2GGR A;  4Z89 A;  1G83 A;  1FMK A;  2I0N A;  1M3A A;  2DBK A;  1QKX A;  2DM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...