2A37A

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (drkn sh3 domain)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E(sev)2B
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a37A00
1WFWA 4HCKA 1TUDA 1W6XA 1AZGB 2FEIA 2K79A 2OI3A 2K3BA 4OMOA 1NG2A 3NGPA 2FRWA 1W1FA 4J9DA 4J9EA 4CC3A 2HBWA 2DYBA 2EVRA 1E6HA 3VRZA 4RTWA 3TVTA 2PNIA 2DVJA 1OPLA 2KT1A 2ROTA 1CSKA 2O88A 1YN8A 1NYFA 2CDTA 2KT8A 3UF4A 3EG0A 4LUEA 1GBQA 2A37A 1VYVA 2LJ1A 3QWYA 2FPEA 1T0JA 2XMFA 4D8KA 4WCIA 1H3HA 2DILA 3GBQA 1BK2A 1JQQA 2J6OA 2DMOA 1K76A 2DNUA 3SHWA 1ZUKA 3ZL7C 1M30A 2KRMA 3VS5A 1OEBA 2DE0X 3QWXX 4F14A 5IXBA 4AG2C 4RUGA 1W70A 4R0KA 2NWMA 1WYXA 4AFSC 1K0XA 1U5SA 4OMNA 4JZ3A 2RQTA 2GNCA 2KBTA 2J6KA 1EFNA 3M0RA 4CC4B 1ARKA 2EQIA 2EGCA 3NHNA 4ESRA 1JXMA 1QCFA 1QKXA 3REAB 1U3OA 1PWTA 1X43A 3SEMA 4JJCA 1UDLA 2EGEA 2KRSA 3H0FA 1VYUA 2KRNA 3VS1A 1B07A 4LE9A 3EG2A 4Z89A 1JXOA 4OMPA 2YDLA 1BU1A 1HJDA 2DLPA 2MCNA 2JM9A 1LCKA 1I0CA 5IH2A 3REBB 1X2KA 2JXBA 2D1XA 2LJ3A 1VA7A 1GBRA 3U23A 2I0NA 2K6DA 1K1ZA 2DM1A 1NYGA 2GTJA 1FMKA 2AZVA 2YUNA 2RF0A 2CSIA 1H8KA 2KE9A 2W0ZA 3RBBB 1Z9QA 3M0SA 2L3SA 1AWWA 2BZYA 1HSQA 4RTUA 5ECAA 4LUDA 1E7OA 4RTXA 1PNJA 2AKKA 2MIOA 3A98A 2CUDA 4F16A 2AKLA 1UFFA 3EHQA 2BZ8A 1RLPC 2LQNA 4J9CA 2YUQA 2RQUA 1T0HA 4JPBW 1JU5C 1RI9A 3UA6A 2NUZA 2VKNA 1WIEA 2L0AA 1YNZA 2DRMA 1SRLA 2FO0A 2ED1A 1ZSGA 1ZX6A 1I1JA 2DA9A 1PHTA 2RQVA 1AZEA 1ZUYA 1SHGA 1G83A 2CSQA 2FPFA 1KIKA 5IHKA 2DL3A 2KROA 1MUZA 4GLMA 1X6BA 2OAWA 4JJDA 1OOTA 2JW4A 3I35A 2HEQA 4AG1C 1WXTA 2FPDA 3EHRA 4K11A 2M0YA 4HVWA 1WA7A 4Z8AA 2J06A 2EYZA 1KJWA 3TSZA 3H0HA 2CUBA 1HD3A 2EGAA 1NEBA 1YWPA 2CH4W 2B86A 3NPFA 2FRYA 3ULRB 2K7AA 3VRYA 4Z88A 1A0NB 4OMLA 1OPKA 4RTTA 4F17A 2LMJA 2L2PA 1AWXA 1Y0MA 4LN2A 1B3QA 1NM7A 2F2VA 1SRMA 4LNPA 1UTIA 2GGRA 1S1NA 5IHIA 5I22A 2E5KA 2JT4A 4J9BA 4QT7A 2VVKA 3EG3A 3M0TA 1I07A 1M3AA 1GCQA 1MV3A 2ESWA 3THKA 1H92A 1RLQC 2ROLA 2JTEA 2KXDA 1PRMC 1YWOA 1WDXA 4HVVA 5GJVB 1M8MA 1GFCA 1ZUUA 1M27C 2A36A 2DRKA 2M51A 2YSQA 2HDAA 2K9GA 3JV3A 1ABOA 3I5SA 2W10A 1NEGA 4AFZC 2O9SA 2KR3A 3LH5A 3VS0A 2DJQA 4DEXA 1YP5A 2RQRA 2LJ0A 3RNJA 2GBQA 1VYTA 1M3CA 3VS4A 4HXJA 4J9IA 1J3TA 2C0TA 2GTOA 5GJWB 2RNAA 2EKHA 4RTYA 4OMQA 4M4ZA 1YCSB 1ABQA 1WLPB 2EPDA 2O31A 1AWOA 2KEAA 1QLYA 4FSSA 1RUWA 1PKSA 5HCKA 2L3QA 3M0UA 4ZNXA 1E6GA 1UJ0A 1ZLMA 1SSHA 2CREA 2DL5A 1X6GA 2PZ1A 1NLPC 3EGUA 5L23A 3KFVA 2LCSA 2DL7A 1ZBJA 3VS7A 2LP5A 2K2MA 4J9HA 2RMOA 3O5ZA 1SEMA 3VS6A 2YUPA 1TG0A 4D8DA 1XOVA 4Y92A 1WXBA 2J7IA 3M0QA 4AFUC 1K4US 3H41A 1GFDA 5IXFA 2RN8A 1T3SA 1OV3A 2C0IA 3I9QA 5IHNA 2X3WD 2ECZA 4JZ4A 2CT4A 2V1RA 1UE9A 1AEYA 3VS2A 2DL8A 2F2XA 1GRIA 1BBZA 2AZSA 2HCKA 2C0OA 2P4RA 1WXUA 2GQIA 2CT3A 3FJ5A 3PE0A 2A28A 4RTVA 2JS2A 2CH4A 1NLOC 2O2OA 1K9AA 3CQTA 2D8JA 2ENMA 1X69A 1GL5A 3UATA 2EYXA 5FWBA 1Z9ZA 2A08A 2KNBB 4IIOA 2YUOA 4JJBA 2LX7A 4CC7A 2PTKA 4EIKA 4IIMA 3TSWA 2ED0A 1CKBA 1V1CA 4J9GA 1CKAA 4HVUA 2KXCA 1JO8A 1KFZA 3VS3A 2JS0A 1AWJA 4E6RA 2AK5A 2J6FA 2H8HA 2F2WA 4OMMA 2L3PA 2VWFA 2RQWA 1KSWA 1QKWA 1N5ZA 2DBKA 1G2BA 1K0SA 2JMAA 2MOXA 2DF6A 2RPNA 1SPKA 2IIMA 2JMCA 1GCPA 1M3BA 1AVZC 2HSPA 2G6FX 4DEYA 1UECA 5FWCA 1UUEA 1WX6A 2D8HA 2DL4A 4X1VA 1AOJA 2BTTA 3EG1A 1GCQC 4GBQA 4A63B 2O9VA 1UJYA 2V1QA 3C0CA 1WI7A 2J05A 1PKTA 2OJ2A 4KRTA 5EC7A 1UHFA 1UG1A 2D0NA 3M0PA 2EW3A 3PVQA 2EBPA 1T3LA 2DX1A 1MV0B 1QWEA 1IO6A 3UA7A 5I11A 1BB9A 2KYBA 2SEMA 2DBMA 1AD5A 2ABLA 3I5RA 1X27A 2LQWA 1X2QA 1JEGA 1TUCA 1FYNA 4CC2A 1Y57A 2YT6A 3R6NA 2KYMA 2X3XD 3NMZC 2QDLA 2SRCA 2EYYA 3H0IA 3IQLA 2FG0A 4RTZA 1UGVA 2BZXA 1SHFA 2LNHB 1QWFA 1U06A 1PRLC 2JM8A 5FW9A 4J9FA 4ORZA 2LZ6B 2KGTA 2EYWA 1UHCA 4AFQC 3PVLA
chains in the Genus database with same CATH superfamily
1WFWA 1TUDA 3VKIA 2DD5A 1RI0A 2DZCA 3OYIA 3LWHA 4OB1B 1N9RA 2K3BA 1RL2A 4RG8A 3URGA 1NG2A 3JB9D 2LX9A 4X34A 3PNWC 2FRWA 4CC3A 2DYBA 1FMWA 1TU0B 2QG9B 4OB0B 3QDRB 2O88A 1YN8A 1Y7XA 1TS9A 2RM4A 4MDXA 2X51A 4C92E 2A37A 2CGHA 1K8AC 2LJ1A 5CIUA 3QWYA 2XMFA 4M75E 2ZAEA 2J6OA 2DNUA 3SHWA 1ZUKA 2D0QB 3ZL7C 1VIEA 4EMKA 4EMGA 3QWXX 5KYYA 4F14A 4BY6B 4JJNK 2PU9B 3A8GB 4XU0A 3CCEA 2RI5A 1G3TA 5LJ5f 2DTHA 1KQSP 2RQTA 2RK1A 4DBHA 1VQMT 2DYIA 3EG9A 1VQPQ 2ATCB 2KBTA 4JDSA 3JCMd 3M0RA 1Q86U 4M7AG 4N0AC 1RAHB 1U1SA 3QJYA 4ZN3A 1U3OA 1I5OB 4JJCA 1UDLA 4EMKC 1TUGB 1B07A 1M90R 1N8RR 4Z89A 4OMPA 2CS7A 3DB4A 2MCNA 4O5VA 2JM9A 3L42A 3NTKA 3OA6A 3CC4T 5IH2A 3V7SA 2JZ2A 4JRKA 4PLLA 2QQRA 2QTVA 2NYSA 1YJ9A 2H3EB 1GBRA 3CCRQ 4M7AD 2GFUA 4FYYB 1NYGA 3HL8A 5EG2A 2RHIA 5CR2A 2Z0WA 3JCMh 2AZVA 2YUNA 3FDRA 1V76A 3RBBB 1JRIA 1G3SA 2CP0A 2L3SA 2DAQA 9ATCB 3R6OA 1KQSA 3CXCP 1VQOT 3QXEB 8ATCB 4JRPA 2EJGA 1UFFA 5LJ5j 1V29B 5I21A 5DM7R 1WIEA 1RAFB 2D9TA 5A2QE 5KYXA 1PD1A 1UGQB 1MMGA 1LJOA 1ZSGA 4M78D 1ZX6A 1I1JA 1IZ6A 2DA9A 1PHTA 2RQVA 1VQNQ 4C0DC 2VASA 2FPFA 2R5MA 5IHKA 4A4FA 2WACA 1X6BA 1AHJB 2MMPA 2EQUA 1OOTA 3M4YA 2HEQA 1YJWT 4AG1C 4DOVA 1YJNQ 3AT1B 5GAN2 3CCMA 2EYZA 2COYA 2ZPBB 1VQ9Q 1NEBA 3EAEA 1U8RA 1VQKQ 3DLMA 2FRYA 2YWWA 4XTZA 5I2SA 3M5AA 3A8OB 1YIJQ 1A0NB 2R57A 4RTTA 2LQ8A 1Q82R 1B7TA 3M53A 4EMKB 1VOMA 2F2VA 1MMDA 5KYYB 1VQLA 3J7AF 4C0GA 1S1NA 5I22A 4OB3B 3M0TA 4BUGA 1KC8U 1NBEB 2X4JA 1M3AA 1GCQA 4E47A 3EG9B 1N27A 2LC4A 2JTEA 5GJVB 2V8KA 1ZUUA 2M51A 2L5QA 1MGQA 5CKFA 1TWBA 4FYVB 4FW2A 2O9SA 1LOJA 3C4SA 3LH5A 3VS0A 4OGEA 4DEXA 2LJ0A 1G3YA 2GBQA 1VQMA 3META 2C0TA 3MJXA 4JLGA 1S72T 5GJWB 4PKCC 4RTYA 4HA8A 4OMQA 3V8LA 1ABQA 4IUUA 4E7ZA 1WLPB 2O31A 4BE1A 5D6XA 1AWOA 2KEAA 4FCYA 1RUWA 1PKSA 2XKOC 2K5FA 1XJWB 3M59A 5CCAA 3M0UA 3EH1A 3MEVA 1E6GA 1UJ0A 1Q86R 1SSHA 2CREA 5D6WA 2DL5A 5GAMe 1O75A 4A4EA 1JBMA 1QP2A 3BDUA 4PLIA 5CKBA 2K2MA 4L6V5 4C0DB 1SEMA 3VS6A 2YUPA 4M77C 2YXYA 1YITQ 3OYYA 3M0QA 1FX7A 4M7AE 2QI2A 2E70A 3MKDA 5GMKm 1D1AA 2CP3A 3CXCS 4RG2A 3H41A 4FYXB 3VYGA 5IXFA 2VYTA 2O4XA 5KYXB 5D6YA 2X9HA 5IHNA 1VQOA 2ECZA 1JJ2S 1MNEA 4OF1A 4O6JA 5KH6A 2KMTA 1RAEB 3OW2P 1BBZA 2C0OA 2ZGWA 4ELZC 3CC2Q 1VQ5Q 2GQIA 2CT3A 2A28A 4RTVA 4RMOA 2JS2A 3TQ7P 1OQKA 3QIIA 4IURA 1VQPT 2O2OA 2MK5A 1R8OB 3CQTA 4QQGA 4XTUA 3OS0A 2OTLQ 2CP6A 2DXUA 2FVUA 4PJOG 1U1TA 3UATA 4M78E 2R5AA 1BI2A 3OYDA 1SF9A 2KNBB 3CPWP 2JJ9A 2DTOA 4JJBA 2P0PA 2XDPA 5GMKj 2LX7A 4C5IA 1MHNA 4CC7A 2QQBA 3CCSQ 1YFNA 4JRIA 1IGUA 1V1CA 1QVGA 1CKAA 2P0QA 2RJEA 3CCLQ 2VXEA 3CCRT 4JUVA 2AK5A 1IHWA 2L3PA 2AIRB 2LQKA 5CKDA 2L8DA 1KSWA 4PJOD 2DBKA 2YLCA 3MHXA 3OW2A 2JMAA 2VXFA 1ZQ1A 4DOWA 3GNFB 2RPNA 1SPKA 2JMCA 2HSPA 4LDVA 2AT1B 2E41A 5FWCA 3BW1A 2FZCB 1YHQQ 2DL4A 3INZA 3MEWA 2BTTA 2GFAA 4PFZA 2WSCE 3X28B 3PMIA 1M1KU 2V8JA 1QCOA 2NLUA 1RABB 3ZEHA 1UJYA 3CD6Q 3OYMA 2QDYB 4NL2A 2J05A 1PKTA 2RI2A 3CPWA 4KH1B 1UG1A 2D0NA 4C92G 1VQNT 3OYGA 3I55A 4BB7A 1MV0B 1KC8R 2YRDA 3OYEA 4L5GA 4FU6A 5I11A 2ABLA 2LQWA 3QBYA 1X2QA 3JRZA 1S72A 1Y57A 1JB0E 2YT6A 4IUPA 3JCMe 2K5IA 3R6NA 3PGGA 1YCYA 1YJNT 1BCOA 3NMZC 5GAN3 2SRCA 1TTHB 4RTZA 1VQ9T 1UGVA 1VQKT 1M5Q1 1QVFA 2MYSA 3FEOA 4EMHA 1U06A 4ATOA 1Q81R 2CZ6B 1PD0A 5DLOA 1YI2Q 2K3XA 2LZ6B 2DO3A 2ZPIB 4F7UF 1YIJT 2ZPHB 4FIBA 4MZTA 4F7UA 2O4XB 3PVLA 2QASA 1OI1A 2V26A 2OI3A 1W2BA 2NUPA 3JCMg 5LJ3h 2ZPEB 2K5LA 5L8RE 1I81A 4J9EA 2FB7A 1LVKA 4BE0A 1E6HA 3HRSA 4BI8B 1OPLA 4CRIA 3LGLA 2EKOA 1OX9A 2FL7A 3EG0A 1GBQA 1RACB 3N5BB 1VUBA 1FXXA 1T0JA 3EFSA 3D7SB 1BK2A 3JB9I 1VQPA 1K73R 3VS5A 3QO3A 1NJIU 1BIBA 5IXBA 4AG2C 1W70A 4KGVB 1Q82C 4ZGEB 3RERA 2MWPA 4FM4B 1EFNA 4YTLA 1K9MU 5FLXE 1IREB 2EGCA 2RI3A 3NHNA 4ESRA 1JXMA 4M7DF 4Q5WA 2EQJA 4M7DA 3OS2A 2EGEA 3H0FA 1VYUA 3H9NA 2PQWA 3CCRA 3C95A 3EH2A 3QDFA 5FRNA 4R56A 3PT9A 1X6OA 2YDLA 1YITT 1X01A 5A0GA 1X2KA 3HRUA 5AYFA 4PJLA 2QYZA 3HTRA 4PJOE 4FW1A 5GAMf 5FU7B 3U23A 2I0NA 3RUXA 2DM1A 4ANJA 3V8KA 7AT1B 3CC2T 1OX8A 2CSIA 2KE9A 3E2UA 1VQ5T 3GPLA 1Z9QA 3H8ZA 4QVZA 1HSQA 3A1PA 2K4YA 4M77G 1PM3A 3MP8A 1PNJA 4PJMA 2AKKA 2QGFB 4F16A 2AKLA 3S3NA 1KHCA 2BZ8A 5C6SA 1VQNA 2OTLT 1RLPC 1WHMA 2IVWA 1T0HA 4JPBW 1RI9A 1ZSZA 1M1KR 2E64A 4NL3A 2VKNA 2L0AA 2RB6A 3CCQQ 1SRLA 4FT4A 2DXBA 3CCST 2KQWA 4AMCA 1RAIB 2MF2A 3JCMb 3JB9J 3G4SQ 5KYWB 1YJNA 1G83A 2JTFA 4M77D 3S3OA 3CCLT 4F7UB 2D6FA 4B6MA 3QPHA 1VQ9A 3BY7A 4JJDA 2NUPB 3HFNA 2JW4A 1ZSZC 1WHJA 1WXTA 1UGPB 5LJ5d 4HVWA 1WA7A 1WJRA 5GAMj 3I56Q 3JAME 1BCMA 1QQJA 4E7HA 2FZGB 1KD1U 2DPPB 5GAN4 3MEAA 2RK2A 3A8MB 3JSCA 1YHQT 1Q7YC 2B86A 3NPFA 2LVMA 3ULRB 4LDWA 3OYAA 3CMEQ 1VQ7A 1BI3A 4OMLA 2M1HA 3KXTA 2L2PA 4LXCA 1D1BA 1SRMA 2B8AA 3J80E 2QA4T 3PTAA 4QT7A 2RJFA 4J7FA 1I07A 1IHVA 3THKA 1RLQC 1NPRA 4A4KA 1YWOA 1WDXA 1M8MA 2LCCA 4MMKA 2DRKA 2K9GA 3OBWA 3JV3A 1F1BB 5HK3A 1P92A 4OVAA 2W10A 1KHIA 4PL6A 1NEGA 1M8VA 2F5TX 4OGCA 4UC4A 1VYTA 1M3CA 2HAXA 3VS4A 3FJPA 4J9IA 1J3TA 3QJ6A 2KY9A 1NJIR 2X4XA 3MEUA 4ZGDB 1YI2T 4KH0B 3G71Q 4M75F 2CKKA 4M4ZA 2HL5C 2EQMA 4C8QG 1B34B 3M57A 4M75A 3CCVA 4M78G 3HKSA 3OB9A 3JCMf 4FSSA 2DXCA 2XHCA 1YITA 4ZNXA 1PG5B 4N4GA 4WF2A 4XTYA 3NTHA 3EGUA 5CK9A 3PIOA 1ZBJA 1R0CB 4P5NA 3RDVA 4J9HA 1UGRB 2E6NA 3JCMX 2DVEA 3P8BB 1XOVA 4Y92A 2J7IA 4C8QD 3SFMA 3OYHA 3CC2A 2RH2A 1VQ5A 3CC7T 5D7UA 1K4US 1ZSZB 2A7YA 2ZPFB 1K8AU 5M9OA 4NS5A 1T3SA 3ZFJA 1SSFA 4JZ4A 2CT4A 2RA2A 2LCLA 4D6WA 4XK8E 2DL8A 5HK0A 3WVEB 1GRIA 2DIGA 2E10A 2HCKA 1I8FA 3VU3C 2P4RA 2VB6A 1WXUA 3PE0A 2EJFA 4KUDK 2BIVA 3CCSA 1M9SA 1K9AA 2HQEA 2LNVA 4DBFA 5LJ3e 2D8JA 4HT9A 1GL5A 2HZYA 3JCMP 3CCLA 2DEQA 3X20B 2HQXA 3M9QA 5FWBA 4LDYA 4M77E 4EIKA 5GAN8 3OYFA 2PVOB 3CMAQ 2ED0A 1K73C 3L1AA 1CKBA 3CCJQ 4HVUA 3UDCA 2XG8D 3CBPA 1KFZA 1D3BA 2V8IA 3VS3A 2KSSA 2H8HA 2BE9B 4J7IA 1YHQA 2RQWA 5LJ3g 3GNGA 3L2ZA 1QKWA 1KQSS 2MOXA 2DF6A 3GP8A 4JS4A 3OSVA 1KD1R 1GCPA 4E7JA 2G6FX 3RKYA 2QA4A 1UECA 1WX6A 1D09B 1AOJA 4A54A 1ZHIA 2QXFA 3CCQT 1GCQC 4RCCA 2O9VA 2RHUA 1WI7A 2WSFE 2OJ2A 3M0PA 1VQ6Q 3G4ST 4ZN1A 3MP6A 1LNXA 2DEUA 2DX1A 3CC4A 3JB9F 3MO8A 5J26A 1IO6A 5GAOm 2DBMA 3CBMA 1QVPA 1R77A 3TREA 3MP1A 1X27A 1JEGA 1TUCA 1FYNA 1YI2A 1QVGP 2IPOB 2DD4A 4DQ2A 2KYMA 4II1A 4PK4A 2QTXA 3S3MA 4JRQA 4NOYA 1YJ9Q 2QDLA 3I56T 4QKUA 3H0IA 4XTXA 3IQLA 2F1LA 2OTJQ 2FG0A 3X25B 3F70A 1I4K1 2LNHB 4GY5A 1QWFA 5LL6S 4ORZA 4J9FA 2DFUA 1X75C 3CMET 4IKFA 3C12A 4RCBA 1ZBXA 5DY9A 1D0ZA 4PNOA 4XTWA 2LDMA 1W6XA 1AZGB 4RKUE 2K79A 4X9DA 3BDLA 2P0KA 3NGPA 1WHLA 2CZ1B 2LT4A 3CC7A 1PSEA 2HBWA 4C0ZA 2EVRA 4C8QE 2XICA 3TVTA 1G3WA 3T9NA 2KT1A 1D1CA 1D0YA 2M02A 2KT8A 1EIFA 3WVDB 3EGDA 1XQHA 1IB8A 1HYOA 4WCIA 1H3HA 3GBQA 4IUTA 1YJWA 1K8AR 3OYKA 2DMOA 2M16A 3HPWA 4E7SA 1M30A 2KRMA 2DE0X 4LDUA 1FWZA 4RUGA 4M7AF 1WYXA 2GF7A 4KBMB 3TEEA 2FHDA 1HK9A 5I2MA 4M7AA 1K0XA 1PCXA 2CZ0B 1D3BB 2CP7A 4JZ3A 5GANd 3PFSA 1UEBA 1ARKA 1QVFP 1UB4A 2EQIA 1QKXA 2YHTA 3REAB 2CYZB 4KGXB 1DJ7B 1PWTA 1X43A 3SEMA 4J5YA 1M90C 3QYHB 1N8RC 2MI6A 4XU3A 2KRSA 2KRNA 3M55A 3RKXA 3VS1A 2RO0A 3EG2A 1VQLQ 2K57A 5CVIA 1W2BP 1HJDA 4M7AC 3S6WA 2MAMA 3CPFA 1KQ2A 1I0CA 3RIRA 5GAOn 2D1XA 5KCHA 3QKJA 5KYUA 1VA7A 3L2WA 4ZGJB 2YRCA 4DBRA 1WHHA 5GANh 2O01E 2GTJA 1FMKA 4C5GA 4Z02A 3GIBA 2M9UA 2RF0A 2W0ZA 3M0SA 4AT1B 1AWWA 2BZYA 3CCQA 3A5ZB 3P8HA 5FU7C 1E7OA 4RTXA 5IN1A 2MIOA 2CUDA 5GAN7 3EHQA 3G4SA 2PVGB 4J9CA 4MZMA 2RQUA 2NUZA 3M58A 3OMCA 2DRMA 1MNDA 1NPPA 1QVGS 2FO0A 1M2OA 3EGXA 3CMAT 4LDXA 3SD4A 1QMCA 3CCJT 1AZEA 1SHGA 2DETA 3V7RA 3I56A 4V2SA 1KIKA 1Y96A 2XDDA 5LJ3f 1MUZA 4GLMA 4A4GA 2EWNA 2OAWA 3OW2S 5GAN5 3HHTB 1MMAA 3I35A 2FPDA 3SWNA 4K11A 4A4HA 3CMEA 2M0YA 4Z8AA 3G7ZA 8AT1B 3H0HA 2CUBA 3P8DA 3VJPA 1HD3A 2EGAA 1GXIE 4MDWA 5GAN6 3OYCA 3EGDB 1H641 4Y28E 4Z88A 3CPWS 5GMKl 2E5QA 4F17A 1AWXA 1Y0MA 3OY9A 1B3QA 1SG5A 4PJJA 2A0FB 1VQ6T 2CZ7B 3GLXA 5IT9E 2GGRA 5IHIA 3FC3A 4M7AB 4J9BA 3JCMV 3UPUA 2VVKA 4BE2A 2LTOA 5J39A 2DZ9A 2QEXQ 1YBYA 1H92A 1IGQA 5GAMd 2ROLA 3SB2A 2KXDA 1PRMC 3MCAB 1GFCA 1KQ1A 2HDAA 1YJ9T 3I5SA 2VC8A 4VUBA 5LJ3j 2DJQA 1QVFS 3RNJA 4EDUA 4OMFB 2OTJT 3E1SA 4J83A 3RKWA 2QGGA 2E3IA 2K2VA 3O8VA 3VYHB 4QVCA 5GAOq 1YCSB 2COZA 3J81E 1WJQA 4M7DC 4GLKA 2EPDA 2XI9A 4E7KA 1W2BS 3C94A 1Q86C 5GAMh 2JN0A 3GF5A 4F04B 2L3QA 2X35A 1ZLMA 2Y90A 3JCMW 1QCNA 2LRQA 2KDSA 1WJSA 1NLPC 5CO7A 3CBOA 5KYNA 2LCSA 2DL7A 3VS7A 2QK0A 2LP5A 2RJDA 2HL3A 1IRXA 2RMOA 3O5ZA 1TG0A 2X4YA 3NFCA 4B9XA 3I55Q 2XIDA 3A8LB 4E7LA 4AFUC 3FLGA 3FB9A 2YRVA 2HKQB 1TXQA 3BFMA 3QZ5B 3AHUA 2RD1A 2C0IA 2V1RA 5AT1B 1AEYA 3VS2A 2F2XA 1VQKA 3E9GA 2HNIA 3FJ5A 4PJOF 1Q82U 1Y96B 3JCMc 2CH4A 1YIJA 4PJOA 4A53A 3CMAA 3RESA 2CP5A 2QQ9A 3NTIA 3OYNA 3CCJA 3SWNB 2E1HA 1QP3A 1X69A 2A08A 2YUOA 3OYBA 3M56A 1VQLT 4B9WA 3CD6T 2OX7A 2WSEE 5FU6C 4IIMA 2RHYA 3LYIA 1C0MA 4N0AA 2JVVA 4PJOC 2YLBA 1QW1A 1BIAA 5FRMA 2KXCA 2ZZDA 2C06A 5LJ5h 2JS0A 1AWJA 2L3RA 3QYGB 1VQ4Q 2VGMA 2XU8A 4OMMA 1KG1A 3X24B 3CCUQ 4BDYA 4FSXA 2NUTA 2KVQG 1EX4A 4R55A 3ZBDA 2IIMA 4M7DB 1WPYA 1M3BA 1AVZC 4E2FB 1VQ6A 3LLRA 2D8HA 4C92F 4X1VA 4C92A 3BE3A 1VQ8Q 3CEYA 1OZ2A 1ZA2B 1Q95G 4A63B 1O9SA 2V1QA 3C0CA 5KE2A 1UHFA 2EW3A 2DKGA 4BD3A 1KC8C 1K9MR 1T3LA 4BDZA 2COWA 3UA7A 2KYBA 2OTJA 5GANe 2QQAA 3LW5E 4XU2A 4QQDA 3E19A 4C92C 4Y91A 4ZTJA 2MPXC 2GCXA 1PC0A 3M54A 4M75C 5GAOp 2P4TA 1XNIA 2EYYA 1ZA1B 2F69A 2DTIA 1BI0A 2JUFA 2RHZA 2RHXA 1Q81C 3L2UA 1JJ2P 3G6EQ 1PRLC 2JOYA 2KI7A 1Q7YU 2KGTA 2OTLA 1TOVA 4C5EA 4ELYC 5GANg 3E9FA 4HCKA 2FEIA 3ME9A 4L59A 2DJZA 2G3RA 4OMOA 1TH7A 1W1FA 4J9DA 5FU6B 4F7UG 5CQXA 5HY6A 2QEXT 3VRZA 2HBPA 3ASKA 4RTWA 2PNIA 4PJOB 2DVJA 2XK0A 2E65A 2H3JA 2ROTA 1CSKA 4KULA 1NYFA 3HFOA 3EFRA 1N6AA 2CDTA 4OB2B 3UF4A 4XU1A 4LUEA 1C6VX 3PMTA 1VYVA 1RAAB 1I5LA 2FPEA 4D8KA 2VV5A 2DILA 2A3LA 1JQQA 1K76A 1W4SA 2EQKA 3CXCA 4ME7A 4CI0C 3L2RA 1OEBA 4R0KA 2NWMA 1PSFA 1JJ2A 4AFSC 1U5SA 4OMNA 1OU8A 2GNCA 2HQHA 4PFOA 3CD6A 2J6KA 5C0MA 4CC4B 2F5KA 2QAZA 2KAFA 4C0FA 1KK7A 1QCFA 1VQ7Q 2NUTB 3CCEQ 2E4HA 4XQ3A 3HSBA 4LD6A 4LE9A 4J6YA 3DKMA 4HCCA 1JXOA 3I55T 1BU1A 2MWOA 2DLPA 4J8OA 1LCKA 4M7DG 3REBB 3VUZA 2JXBA 2LJ3A 4C92B 3QUIA 5CQYA 2XDBA 4M75B 4M77F 2K6DA 2QQSA 1K1ZA 1Q81U 4M77A 4C5HA 2DIQA 6AT1B 2P84A 1H8KA 1WHGA 2HSEB 4ZTFA 5GMKh 4X9CA 4RTUA 5ECAA 4LUDA 2VGNA 3A98A 2AHJB 4M7DD 4HCBA 2LQNA 1M1KC 2R58A 3CCVQ 4FT2A 2YUQA 4QVDA 1JU5C 2E3HA 3UA6A 1NE8A 5A0DA 1YNZA 4PFPA 2ED1A 1RAGB 3QSUA 1WZOA 1ZUYA 2CSQA 3OYJA 4QQ6A 3LGFA 3OS1A 1K73U 3OBYA 4TVRA 2HKNA 2DL3A 3QHSA 3VV0A 2KROA 1VQ4T 5GAMg 2I2LA 3CCUT 2K3YA 4QW2A 1OZ3A 4IUQA 1TSFA 2E12A 3H6ZA 4KT0E 3EHRA 3TU4K 5IAYA 2J06A 3DB3A 1KJWA 2PUOB 3TSZA 1C1AA 1H3ZA 4KUIA 4XTVA 3QG1A 3QZ9B 1YWPA 2CH4W 1M2VA 2EFIA 2XD0A 1MMNA 1Q7YR 2E6ZA 3LWIA 3GOXA 2K7AA 1VQ8T 3G71T 2QEXA 2RJCA 3VRYA 3A8HB 1OPKA 3UWNA 3RR6A 3CCMQ 1G5VA 2LMJA 3X26B 4LN2A 2ZCFB 5J3BA 1NM7A 2M0OA 2DXTA 4LNPA 3WXMB 1UTIA 2Y4XA 1WGSA 4JS5A 1UGSB 4MMLA 3JB9H 2E5KA 4EPCA 2JT4A 3EG3A 4FL6A 3SDZA 1MV3A 2ESWA 1D0XA 2IG0A 3PIPA 5LJ5e 4HVVA 4BACA 1RADB 1BKBA 2ZPGB 1M27C 2A36A 2YSQA 1IXDA 4HKEA 3LH0A 1ABOA 2HMAA 3V8JA 3EFOA 4AFZC 4C8QF 4F7UE 2KR3A 4M78F 1YP5A 2RQRA 4C8QA 1NJIC 4OP0A 4M78A 4HXJA 3G6ET 1M1FA 2GTOA 2EIFA 2FYKA 2RNAA 2EKHA 2BUDA 2KK4A 4HCZA 2DK3A 2CP2A 5GAOr 5GANf 1QLYA 5LJ5g 1K9MC 3OQ5A 2QA4Q 1VQMQ 5HCKA 1R0BG 4M77B 3MPUB 4KGZB 4M75G 2BKDN 1X6GA 4C8QC 2PZ1A 5L23A 3KFVA 4M78C 1OYXA 5HKCA 3JCMQ 1M4ZA 1WNLA 5LJ3d 1XTDA 4D8DA 1Y71A 1WXBA 2EAYA 3Q1JA 4HT8A 4DBQA 3KUFA 3CC4Q 5CKEA 3V7CA 1GFDA 4C92D 2EJ9A 2RN8A 3L2VA 2PVDB 3ER0A 1OV3A 3I9QA 3OSSC 2X3WD 4M75D 2X4WA 1UE9A 5KYWA 2VUBA 4XAXB 5DLQE 2AZSA 3OMGA 4J6WA 3FRNA 4M7DE 1ACMB 3KBGA 4IUVA 3VUBA 1NLOC 5GAOl 1OU9A 1VQOQ 1G8XA 5GANj 2JTMA 1VQ7T 1WHKA 2ENMA 3RMSA 3CCET 4BI4A 2EYXA 2OAUA 1Z9ZA 1WQ7A 4IIOA 1VQ4A 3M4GA 1SKUB 1M90U 1N8RU 4MZPA 2PTKA 3DLLA 1M2VB 3CCUA 2Y4YA 3LX7A 3TSWA 3CC7Q 3SWNC 4J9GA 4PJNA 1JO8A 3UT1A 4E6RA 3RMQA 5CAIA 2J6FA 2F2WA 2BE7D 1WQWA 2VWFA 1EZZB 5KCOA 2L89A 1YJWQ 1N5ZA 3HRTA 1G2BA 2DERA 1KD1C 5KE3A 1VQ8A 3G71A 1K0SA 4J6XA 1AT1B 5FROA 5A0LA 4BY6C 1FMVA 1OULA 4WTOB 4DEYA 1UUEA 5GMKi 3CCVT 4JLIA 4N4HA 1N9SA 2JNGA 3EFOB 3EG1A 4C8QB 4GBQA 4E7IA 5KYUB 4M78B 5EC7A 4KRTA 2FZKB 1B34A 4N4IA 4DA4A 1Y07A 2EBPA 3PVQA 2HD0A 1VIFA 3OYLA 2LT1A 4BI3A 2PUKB 1QWEA 1BB9A 2SEMA 3FIFA 3G1JA 1AD5A 3I5RA 3TCJA 3G6EA 1LPLA 2GQVA 4CC2A 1BYMA 2X3XD 1M1GA 3HP9A 3JB9G 5CKHA 5GMKe 4LD9K 4FYWB 3JCMJ 2BZXA 1SHFA 3OS5A 1BI1A 2JM8A 1S72Q 5FW9A 3EGXB 3L2QA 2EYWA 1NZ9A 1UHCA 3CCMT 2EYQA 4AFQC 1HXDA
chains in the Genus database with same CATH topology
1WFWA 4HCKA 1TUDA 1W6XA 1AZGB 2FEIA 2K79A 2OI3A 2K3BA 4OMOA 1NG2A 3NGPA 2FRWA 1W1FA 4J9DA 4J9EA 4CC3A 2HBWA 2DYBA 2EVRA 1E6HA 3VRZA 4RTWA 3TVTA 2PNIA 2DVJA 1OPLA 2KT1A 2ROTA 1CSKA 2O88A 1YN8A 1NYFA 2CDTA 2KT8A 3UF4A 3EG0A 4LUEA 1GBQA 2A37A 1VYVA 2LJ1A 3QWYA 2FPEA 1T0JA 2XMFA 4D8KA 4WCIA 1H3HA 2DILA 3GBQA 1BK2A 1JQQA 2J6OA 2DMOA 1K76A 2DNUA 3SHWA 1ZUKA 3ZL7C 1M30A 2KRMA 3VS5A 1OEBA 2DE0X 3QWXX 4F14A 5IXBA 4AG2C 4RUGA 1W70A 4R0KA 2NWMA 1WYXA 4AFSC 1K0XA 1U5SA 4OMNA 4JZ3A 2RQTA 2GNCA 2KBTA 2J6KA 1EFNA 3M0RA 4CC4B 1ARKA 2EQIA 2EGCA 3NHNA 4ESRA 1JXMA 1QCFA 1QKXA 3REAB 1U3OA 1PWTA 1X43A 3SEMA 4JJCA 1UDLA 2EGEA 2KRSA 3H0FA 1VYUA 2KRNA 3VS1A 1B07A 4LE9A 3EG2A 4Z89A 1JXOA 4OMPA 2YDLA 1BU1A 1HJDA 2DLPA 2MCNA 2JM9A 1LCKA 1I0CA 5IH2A 3REBB 1X2KA 2JXBA 2D1XA 2LJ3A 1VA7A 1GBRA 3U23A 2I0NA 2K6DA 1K1ZA 2DM1A 1NYGA 2GTJA 1FMKA 2AZVA 2YUNA 2RF0A 2CSIA 1H8KA 2KE9A 2W0ZA 3RBBB 1Z9QA 3M0SA 2L3SA 1AWWA 2BZYA 1HSQA 4RTUA 5ECAA 4LUDA 1E7OA 4RTXA 1PNJA 2AKKA 2MIOA 3A98A 2CUDA 4F16A 2AKLA 1UFFA 3EHQA 2BZ8A 1RLPC 2LQNA 4J9CA 2YUQA 2RQUA 1T0HA 4JPBW 1JU5C 1RI9A 3UA6A 2NUZA 2VKNA 1WIEA 2L0AA 1YNZA 2DRMA 1SRLA 2FO0A 2ED1A 1ZSGA 1ZX6A 1I1JA 2DA9A 1PHTA 2RQVA 1AZEA 1ZUYA 1SHGA 1G83A 2CSQA 2FPFA 1KIKA 5IHKA 2DL3A 2KROA 1MUZA 4GLMA 1X6BA 2OAWA 4JJDA 1OOTA 2JW4A 3I35A 2HEQA 4AG1C 1WXTA 2FPDA 3EHRA 4K11A 2M0YA 4HVWA 1WA7A 4Z8AA 2J06A 2EYZA 1KJWA 3TSZA 3H0HA 2CUBA 1HD3A 2EGAA 1NEBA 1YWPA 2CH4W 2B86A 3NPFA 2FRYA 3ULRB 2K7AA 3VRYA 4Z88A 1A0NB 4OMLA 1OPKA 4RTTA 4F17A 2LMJA 2L2PA 1AWXA 1Y0MA 4LN2A 1B3QA 1NM7A 2F2VA 1SRMA 4LNPA 1UTIA 2GGRA 1S1NA 5IHIA 5I22A 2E5KA 2JT4A 4J9BA 4QT7A 2VVKA 3EG3A 3M0TA 1I07A 1M3AA 1GCQA 1MV3A 2ESWA 3THKA 1H92A 1RLQC 2ROLA 2JTEA 2KXDA 1PRMC 1YWOA 1WDXA 4HVVA 5GJVB 1M8MA 1GFCA 1ZUUA 1M27C 2A36A 2DRKA 2M51A 2YSQA 2HDAA 2K9GA 3JV3A 1ABOA 3I5SA 2W10A 1NEGA 4AFZC 2O9SA 2KR3A 3LH5A 3VS0A 2DJQA 4DEXA 1YP5A 2RQRA 2LJ0A 3RNJA 2GBQA 1VYTA 1M3CA 3VS4A 4HXJA 4J9IA 1J3TA 2C0TA 2GTOA 5GJWB 2RNAA 2EKHA 4RTYA 4OMQA 4M4ZA 1YCSB 1ABQA 1WLPB 2EPDA 2O31A 1AWOA 2KEAA 1QLYA 4FSSA 1RUWA 1PKSA 5HCKA 2L3QA 3M0UA 4ZNXA 1E6GA 1UJ0A 1ZLMA 1SSHA 2CREA 2DL5A 1X6GA 2PZ1A 1NLPC 3EGUA 5L23A 3KFVA 2LCSA 2DL7A 1ZBJA 3VS7A 2LP5A 2K2MA 4J9HA 2RMOA 3O5ZA 1SEMA 3VS6A 2YUPA 1TG0A 4D8DA 1XOVA 4Y92A 1WXBA 2J7IA 3M0QA 4AFUC 1K4US 3H41A 1GFDA 5IXFA 2RN8A 1T3SA 1OV3A 2C0IA 3I9QA 5IHNA 2X3WD 2ECZA 4JZ4A 2CT4A 2V1RA 1UE9A 1AEYA 3VS2A 2DL8A 2F2XA 1GRIA 1BBZA 2AZSA 2HCKA 2C0OA 2P4RA 1WXUA 2GQIA 2CT3A 3FJ5A 3PE0A 2A28A 4RTVA 2JS2A 2CH4A 1NLOC 2O2OA 1K9AA 3CQTA 2D8JA 2ENMA 1X69A 1GL5A 3UATA 2EYXA 5FWBA 1Z9ZA 2A08A 2KNBB 4IIOA 2YUOA 4JJBA 2LX7A 4CC7A 2PTKA 4EIKA 4IIMA 3TSWA 2ED0A 1CKBA 1V1CA 4J9GA 1CKAA 4HVUA 2KXCA 1JO8A 1KFZA 3VS3A 2JS0A 1AWJA 4E6RA 2AK5A 2J6FA 2H8HA 2F2WA 4OMMA 2L3PA 2VWFA 2RQWA 1KSWA 1QKWA 1N5ZA 2DBKA 1G2BA 1K0SA 2JMAA 2MOXA 2DF6A 2RPNA 1SPKA 2IIMA 2JMCA 1GCPA 1M3BA 1AVZC 2HSPA 2G6FX 4DEYA 1UECA 5FWCA 1UUEA 1WX6A 2D8HA 2DL4A 4X1VA 1AOJA 2BTTA 3EG1A 1GCQC 4GBQA 4A63B 2O9VA 1UJYA 2V1QA 3C0CA 1WI7A 2J05A 1PKTA 2OJ2A 4KRTA 5EC7A 1UHFA 1UG1A 2D0NA 3M0PA 2EW3A 3PVQA 2EBPA 1T3LA 2DX1A 1MV0B 1QWEA 1IO6A 3UA7A 5I11A 1BB9A 2KYBA 2SEMA 2DBMA 1AD5A 2ABLA 3I5RA 1X27A 2LQWA 1X2QA 1JEGA 1TUCA 1FYNA 4CC2A 1Y57A 2YT6A 3R6NA 2KYMA 2X3XD 3NMZC 2QDLA 2SRCA 2EYYA 3H0IA 3IQLA 2FG0A 4RTZA 1UGVA 2BZXA 1SHFA 2LNHB 1QWFA 1U06A 1PRLC 2JM8A 5FW9A 4J9FA 4ORZA 2LZ6B 2KGTA 2EYWA 1UHCA 4AFQC 3PVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFW A;  4HCK A;  1TUD A;  1W6X A;  1AZG B;  2FEI A;  2K79 A;  2OI3 A;  2K3B A;  4OMO A;  1NG2 A;  3NGP A;  2FRW A;  1W1F A;  4J9D A;  4J9E A;  4CC3 A;  2HBW A;  2DYB A;  2EVR A;  1E6H A;  3VRZ A;  4RTW A;  3TVT A;  2PNI A;  2DVJ A;  1OPL A;  2KT1 A;  2ROT A;  1CSK A;  2O88 A;  1YN8 A;  1NYF A;  2CDT A;  2KT8 A;  3UF4 A;  3EG0 A;  4LUE A;  1GBQ A;  2A37 A;  1VYV A;  2LJ1 A;  3QWY A;  2FPE A;  1T0J A;  2XMF A;  4D8K A;  4WCI A;  1H3H A;  2DIL A;  3GBQ A;  1BK2 A;  1JQQ A;  2J6O A;  2DMO A;  1K76 A;  2DNU A;  3SHW A;  1ZUK A;  3ZL7 C;  1M30 A;  2KRM A;  3VS5 A;  1OEB A;  2DE0 X;  3QWX X;  4F14 A;  5IXB A;  4AG2 C;  4RUG A;  1W70 A;  4R0K A;  2NWM A;  1WYX A;  4AFS C;  1K0X A;  1U5S A;  4OMN A;  4JZ3 A;  2RQT A;  2GNC A;  2KBT A;  2J6K A;  1EFN A;  3M0R A;  4CC4 B;  1ARK A;  2EQI A;  2EGC A;  3NHN A;  4ESR A;  1JXM A;  1QCF A;  1QKX A;  3REA B;  1U3O A;  1PWT A;  1X43 A;  3SEM A;  4JJC A;  1UDL A;  2EGE A;  2KRS A;  3H0F A;  1VYU A;  2KRN A;  3VS1 A;  1B07 A;  4LE9 A;  3EG2 A;  4Z89 A;  1JXO A;  4OMP A;  2YDL A;  1BU1 A;  1HJD A;  2DLP A;  2MCN A;  2JM9 A;  1LCK A;  1I0C A;  5IH2 A;  3REB B;  1X2K A;  2JXB A;  2D1X A;  2LJ3 A;  1VA7 A;  1GBR A;  3U23 A;  2I0N A;  2K6D A;  1K1Z A;  2DM1 A;  1NYG A;  2GTJ A;  1FMK A;  2AZV A;  2YUN A;  2RF0 A;  2CSI A;  1H8K A;  2KE9 A;  2W0Z A;  3RBB B;  1Z9Q A;  3M0S A;  2L3S A;  1AWW A;  2BZY A;  1HSQ A;  4RTU A;  5ECA A;  4LUD A;  1E7O A;  4RTX A;  1PNJ A;  2AKK A;  2MIO A;  3A98 A;  2CUD A;  4F16 A;  2AKL A;  1UFF A;  3EHQ A;  2BZ8 A;  1RLP C;  2LQN A;  4J9C A;  2YUQ A;  2RQU A;  1T0H A;  4JPB W;  1JU5 C;  1RI9 A;  3UA6 A;  2NUZ A;  2VKN A;  1WIE A;  2L0A A;  1YNZ A;  2DRM A;  1SRL A;  2FO0 A;  2ED1 A;  1ZSG A;  1ZX6 A;  1I1J A;  2DA9 A;  1PHT A;  2RQV A;  1AZE A;  1ZUY A;  1SHG A;  1G83 A;  2CSQ A;  2FPF A;  1KIK A;  5IHK A;  2DL3 A;  2KRO A;  1MUZ A;  4GLM A;  1X6B A;  2OAW A;  4JJD A;  1OOT A;  2JW4 A;  3I35 A;  2HEQ A;  4AG1 C;  1WXT A;  2FPD A;  3EHR A;  4K11 A;  2M0Y A;  4HVW A;  1WA7 A;  4Z8A A;  2J06 A;  2EYZ A;  1KJW A;  3TSZ A;  3H0H A;  2CUB A;  1HD3 A;  2EGA A;  1NEB A;  1YWP A;  2CH4 W;  2B86 A;  3NPF A;  2FRY A;  3ULR B;  2K7A A;  3VRY A;  4Z88 A;  1A0N B;  4OML A;  1OPK A;  4RTT A;  4F17 A;  2LMJ A;  2L2P A;  1AWX A;  1Y0M A;  4LN2 A;  1B3Q A;  1NM7 A;  2F2V A;  1SRM A;  4LNP A;  1UTI A;  2GGR A;  1S1N A;  5IHI A;  5I22 A;  2E5K A;  2JT4 A;  4J9B A;  4QT7 A;  2VVK A;  3EG3 A;  3M0T A;  1I07 A;  1M3A A;  1GCQ A;  1MV3 A;  2ESW A;  3THK A;  1H92 A;  1RLQ C;  2ROL A;  2JTE A;  2KXD A;  1PRM C;  1YWO A;  1WDX A;  4HVV A;  5GJV B;  1M8M A;  1GFC A;  1ZUU A;  1M27 C;  2A36 A;  2DRK A;  2M51 A;  2YSQ A;  2HDA A;  2K9G A;  3JV3 A;  1ABO A;  3I5S A;  2W10 A;  1NEG A;  4AFZ C;  2O9S A;  2KR3 A;  3LH5 A;  3VS0 A;  2DJQ A;  4DEX A;  1YP5 A;  2RQR A;  2LJ0 A;  3RNJ A;  2GBQ A;  1VYT A;  1M3C A;  3VS4 A;  4HXJ A;  4J9I A;  1J3T A;  2C0T A;  2GTO A;  5GJW B;  2RNA A;  2EKH A;  4RTY A;  4OMQ A;  4M4Z A;  1YCS B;  1ABQ A;  1WLP B;  2EPD A;  2O31 A;  1AWO A;  2KEA A;  1QLY A;  4FSS A;  1RUW A;  1PKS A;  5HCK A;  2L3Q A;  3M0U A;  4ZNX A;  1E6G A;  1UJ0 A;  1ZLM A;  1SSH A;  2CRE A;  2DL5 A;  1X6G A;  2PZ1 A;  1NLP C;  3EGU A;  5L23 A;  3KFV A;  2LCS A;  2DL7 A;  1ZBJ A;  3VS7 A;  2LP5 A;  2K2M A;  4J9H A;  2RMO A;  3O5Z A;  1SEM A;  3VS6 A;  2YUP A;  1TG0 A;  4D8D A;  1XOV A;  4Y92 A;  1WXB A;  2J7I A;  3M0Q A;  4AFU C;  1K4U S;  3H41 A;  1GFD A;  5IXF A;  2RN8 A;  1T3S A;  1OV3 A;  2C0I A;  3I9Q A;  5IHN A;  2X3W D;  2ECZ A;  4JZ4 A;  2CT4 A;  2V1R A;  1UE9 A;  1AEY A;  3VS2 A;  2DL8 A;  2F2X A;  1GRI A;  1BBZ A;  2AZS A;  2HCK A;  2C0O A;  2P4R A;  1WXU A;  2GQI A;  2CT3 A;  3FJ5 A;  3PE0 A;  2A28 A;  4RTV A;  2JS2 A;  2CH4 A;  1NLO C;  2O2O A;  1K9A A;  3CQT A;  2D8J A;  2ENM A;  1X69 A;  1GL5 A;  3UAT A;  2EYX A;  5FWB A;  1Z9Z A;  2A08 A;  2KNB B;  4IIO A;  2YUO A;  4JJB A;  2LX7 A;  4CC7 A;  2PTK A;  4EIK A;  4IIM A;  3TSW A;  2ED0 A;  1CKB A;  1V1C A;  4J9G A;  1CKA A;  4HVU A;  2KXC A;  1JO8 A;  1KFZ A;  3VS3 A;  2JS0 A;  1AWJ A;  4E6R A;  2AK5 A;  2J6F A;  2H8H A;  2F2W A;  4OMM A;  2L3P A;  2VWF A;  2RQW A;  1KSW A;  1QKW A;  1N5Z A;  2DBK A;  1G2B A;  1K0S A;  2JMA A;  2MOX A;  2DF6 A;  2RPN A;  1SPK A;  2IIM A;  2JMC A;  1GCP A;  1M3B A;  1AVZ C;  2HSP A;  2G6F X;  4DEY A;  1UEC A;  5FWC A;  1UUE A;  1WX6 A;  2D8H A;  2DL4 A;  4X1V A;  1AOJ A;  2BTT A;  3EG1 A;  1GCQ C;  4GBQ A;  4A63 B;  2O9V A;  1UJY A;  2V1Q A;  3C0C A;  1WI7 A;  2J05 A;  1PKT A;  2OJ2 A;  4KRT A;  5EC7 A;  1UHF A;  1UG1 A;  2D0N A;  3M0P A;  2EW3 A;  3PVQ A;  2EBP A;  1T3L A;  2DX1 A;  1MV0 B;  1QWE A;  1IO6 A;  3UA7 A;  5I11 A;  1BB9 A;  2KYB A;  2SEM A;  2DBM A;  1AD5 A;  2ABL A;  3I5R A;  1X27 A;  2LQW A;  1X2Q A;  1JEG A;  1TUC A;  1FYN A;  4CC2 A;  1Y57 A;  2YT6 A;  3R6N A;  2KYM A;  2X3X D;  3NMZ C;  2QDL A;  2SRC A;  2EYY A;  3H0I A;  3IQL A;  2FG0 A;  4RTZ A;  1UGV A;  2BZX A;  1SHF A;  2LNH B;  1QWF A;  1U06 A;  1PRL C;  2JM8 A;  5FW9 A;  4J9F A;  4ORZ A;  2LZ6 B;  2KGT A;  2EYW A;  1UHC A;  4AFQ C;  3PVL A; 
#chains in the Genus database with same CATH topology
 1WFW A;  1TUD A;  3VKI A;  2DD5 A;  1RI0 A;  2DZC A;  3OYI A;  3LWH A;  4OB1 B;  1N9R A;  2K3B A;  1RL2 A;  4RG8 A;  3URG A;  1NG2 A;  3JB9 D;  2LX9 A;  4X34 A;  3PNW C;  2FRW A;  4CC3 A;  2DYB A;  1FMW A;  1TU0 B;  2QG9 B;  4OB0 B;  3QDR B;  2O88 A;  1YN8 A;  1Y7X A;  1TS9 A;  2RM4 A;  4MDX A;  2X51 A;  4C92 E;  2A37 A;  2CGH A;  1K8A C;  2LJ1 A;  5CIU A;  3QWY A;  2XMF A;  4M75 E;  2ZAE A;  2J6O A;  2DNU A;  3SHW A;  1ZUK A;  2D0Q B;  3ZL7 C;  1VIE A;  4EMK A;  4EMG A;  3QWX X;  5KYY A;  4F14 A;  4BY6 B;  4JJN K;  2PU9 B;  3A8G B;  4XU0 A;  3CCE A;  2RI5 A;  1G3T A;  5LJ5 f;  2DTH A;  1KQS P;  2RQT A;  2RK1 A;  4DBH A;  1VQM T;  2DYI A;  3EG9 A;  1VQP Q;  2ATC B;  2KBT A;  4JDS A;  3JCM d;  3M0R A;  1Q86 U;  4M7A G;  4N0A C;  1RAH B;  1U1S A;  3QJY A;  4ZN3 A;  1U3O A;  1I5O B;  4JJC A;  1UDL A;  4EMK C;  1TUG B;  1B07 A;  1M90 R;  1N8R R;  4Z89 A;  4OMP A;  2CS7 A;  3DB4 A;  2MCN A;  4O5V A;  2JM9 A;  3L42 A;  3NTK A;  3OA6 A;  3CC4 T;  5IH2 A;  3V7S A;  2JZ2 A;  4JRK A;  4PLL A;  2QQR A;  2QTV A;  2NYS A;  1YJ9 A;  2H3E B;  1GBR A;  3CCR Q;  4M7A D;  2GFU A;  4FYY B;  1NYG A;  3HL8 A;  5EG2 A;  2RHI A;  5CR2 A;  2Z0W A;  3JCM h;  2AZV A;  2YUN A;  3FDR A;  1V76 A;  3RBB B;  1JRI A;  1G3S A;  2CP0 A;  2L3S A;  2DAQ A;  9ATC B;  3R6O A;  1KQS A;  3CXC P;  1VQO T;  3QXE B;  8ATC B;  4JRP A;  2EJG A;  1UFF A;  5LJ5 j;  1V29 B;  5I21 A;  5DM7 R;  1WIE A;  1RAF B;  2D9T A;  5A2Q E;  5KYX A;  1PD1 A;  1UGQ B;  1MMG A;  1LJO A;  1ZSG A;  4M78 D;  1ZX6 A;  1I1J A;  1IZ6 A;  2DA9 A;  1PHT A;  2RQV A;  1VQN Q;  4C0D C;  2VAS A;  2FPF A;  2R5M A;  5IHK A;  4A4F A;  2WAC A;  1X6B A;  1AHJ B;  2MMP A;  2EQU A;  1OOT A;  3M4Y A;  2HEQ A;  1YJW T;  4AG1 C;  4DOV A;  1YJN Q;  3AT1 B;  5GAN 2;  3CCM A;  2EYZ A;  2COY A;  2ZPB B;  1VQ9 Q;  1NEB A;  3EAE A;  1U8R A;  1VQK Q;  3DLM A;  2FRY A;  2YWW A;  4XTZ A;  5I2S A;  3M5A A;  3A8O B;  1YIJ Q;  1A0N B;  2R57 A;  4RTT A;  2LQ8 A;  1Q82 R;  1B7T A;  3M53 A;  4EMK B;  1VOM A;  2F2V A;  1MMD A;  5KYY B;  1VQL A;  3J7A F;  4C0G A;  1S1N A;  5I22 A;  4OB3 B;  3M0T A;  4BUG A;  1KC8 U;  1NBE B;  2X4J A;  1M3A A;  1GCQ A;  4E47 A;  3EG9 B;  1N27 A;  2LC4 A;  2JTE A;  5GJV B;  2V8K A;  1ZUU A;  2M51 A;  2L5Q A;  1MGQ A;  5CKF A;  1TWB A;  4FYV B;  4FW2 A;  2O9S A;  1LOJ A;  3C4S A;  3LH5 A;  3VS0 A;  4OGE A;  4DEX A;  2LJ0 A;  1G3Y A;  2GBQ A;  1VQM A;  3MET A;  2C0T A;  3MJX A;  4JLG A;  1S72 T;  5GJW B;  4PKC C;  4RTY A;  4HA8 A;  4OMQ A;  3V8L A;  1ABQ A;  4IUU A;  4E7Z A;  1WLP B;  2O31 A;  4BE1 A;  5D6X A;  1AWO A;  2KEA A;  4FCY A;  1RUW A;  1PKS A;  2XKO C;  2K5F A;  1XJW B;  3M59 A;  5CCA A;  3M0U A;  3EH1 A;  3MEV A;  1E6G A;  1UJ0 A;  1Q86 R;  1SSH A;  2CRE A;  5D6W A;  2DL5 A;  5GAM e;  1O75 A;  4A4E A;  1JBM A;  1QP2 A;  3BDU A;  4PLI A;  5CKB A;  2K2M A;  4L6V 5;  4C0D B;  1SEM A;  3VS6 A;  2YUP A;  4M77 C;  2YXY A;  1YIT Q;  3OYY A;  3M0Q A;  1FX7 A;  4M7A E;  2QI2 A;  2E70 A;  3MKD A;  5GMK m;  1D1A A;  2CP3 A;  3CXC S;  4RG2 A;  3H41 A;  4FYX B;  3VYG A;  5IXF A;  2VYT A;  2O4X A;  5KYX B;  5D6Y A;  2X9H A;  5IHN A;  1VQO A;  2ECZ A;  1JJ2 S;  1MNE A;  4OF1 A;  4O6J A;  5KH6 A;  2KMT A;  1RAE B;  3OW2 P;  1BBZ A;  2C0O A;  2ZGW A;  4ELZ C;  3CC2 Q;  1VQ5 Q;  2GQI A;  2CT3 A;  2A28 A;  4RTV A;  4RMO A;  2JS2 A;  3TQ7 P;  1OQK A;  3QII A;  4IUR A;  1VQP T;  2O2O A;  2MK5 A;  1R8O B;  3CQT A;  4QQG A;  4XTU A;  3OS0 A;  2OTL Q;  2CP6 A;  2DXU A;  2FVU A;  4PJO G;  1U1T A;  3UAT A;  4M78 E;  2R5A A;  1BI2 A;  3OYD A;  1SF9 A;  2KNB B;  3CPW P;  2JJ9 A;  2DTO A;  4JJB A;  2P0P A;  2XDP A;  5GMK j;  2LX7 A;  4C5I A;  1MHN A;  4CC7 A;  2QQB A;  3CCS Q;  1YFN A;  4JRI A;  1IGU A;  1V1C A;  1QVG A;  1CKA A;  2P0Q A;  2RJE A;  3CCL Q;  2VXE A;  3CCR T;  4JUV A;  2AK5 A;  1IHW A;  2L3P A;  2AIR B;  2LQK A;  5CKD A;  2L8D A;  1KSW A;  4PJO D;  2DBK A;  2YLC A;  3MHX A;  3OW2 A;  2JMA A;  2VXF A;  1ZQ1 A;  4DOW A;  3GNF B;  2RPN A;  1SPK A;  2JMC A;  2HSP A;  4LDV A;  2AT1 B;  2E41 A;  5FWC A;  3BW1 A;  2FZC B;  1YHQ Q;  2DL4 A;  3INZ A;  3MEW A;  2BTT A;  2GFA A;  4PFZ A;  2WSC E;  3X28 B;  3PMI A;  1M1K U;  2V8J A;  1QCO A;  2NLU A;  1RAB B;  3ZEH A;  1UJY A;  3CD6 Q;  3OYM A;  2QDY B;  4NL2 A;  2J05 A;  1PKT A;  2RI2 A;  3CPW A;  4KH1 B;  1UG1 A;  2D0N A;  4C92 G;  1VQN T;  3OYG A;  3I55 A;  4BB7 A;  1MV0 B;  1KC8 R;  2YRD A;  3OYE A;  4L5G A;  4FU6 A;  5I11 A;  2ABL A;  2LQW A;  3QBY A;  1X2Q A;  3JRZ A;  1S72 A;  1Y57 A;  1JB0 E;  2YT6 A;  4IUP A;  3JCM e;  2K5I A;  3R6N A;  3PGG A;  1YCY A;  1YJN T;  1BCO A;  3NMZ C;  5GAN 3;  2SRC A;  1TTH B;  4RTZ A;  1VQ9 T;  1UGV A;  1VQK T;  1M5Q 1;  1QVF A;  2MYS A;  3FEO A;  4EMH A;  1U06 A;  4ATO A;  1Q81 R;  2CZ6 B;  1PD0 A;  5DLO A;  1YI2 Q;  2K3X A;  2LZ6 B;  2DO3 A;  2ZPI B;  4F7U F;  1YIJ T;  2ZPH B;  4FIB A;  4MZT A;  4F7U A;  2O4X B;  3PVL A;  2QAS A;  1OI1 A;  2V26 A;  2OI3 A;  1W2B A;  2NUP A;  3JCM g;  5LJ3 h;  2ZPE B;  2K5L A;  5L8R E;  1I81 A;  4J9E A;  2FB7 A;  1LVK A;  4BE0 A;  1E6H A;  3HRS A;  4BI8 B;  1OPL A;  4CRI A;  3LGL A;  2EKO A;  1OX9 A;  2FL7 A;  3EG0 A;  1GBQ A;  1RAC B;  3N5B B;  1VUB A;  1FXX A;  1T0J A;  3EFS A;  3D7S B;  1BK2 A;  3JB9 I;  1VQP A;  1K73 R;  3VS5 A;  3QO3 A;  1NJI U;  1BIB A;  5IXB A;  4AG2 C;  1W70 A;  4KGV B;  1Q82 C;  4ZGE B;  3RER A;  2MWP A;  4FM4 B;  1EFN A;  4YTL A;  1K9M U;  5FLX E;  1IRE B;  2EGC A;  2RI3 A;  3NHN A;  4ESR A;  1JXM A;  4M7D F;  4Q5W A;  2EQJ A;  4M7D A;  3OS2 A;  2EGE A;  3H0F A;  1VYU A;  3H9N A;  2PQW A;  3CCR A;  3C95 A;  3EH2 A;  3QDF A;  5FRN A;  4R56 A;  3PT9 A;  1X6O A;  2YDL A;  1YIT T;  1X01 A;  5A0G A;  1X2K A;  3HRU A;  5AYF A;  4PJL A;  2QYZ A;  3HTR A;  4PJO E;  4FW1 A;  5GAM f;  5FU7 B;  3U23 A;  2I0N A;  3RUX A;  2DM1 A;  4ANJ A;  3V8K A;  7AT1 B;  3CC2 T;  1OX8 A;  2CSI A;  2KE9 A;  3E2U A;  1VQ5 T;  3GPL A;  1Z9Q A;  3H8Z A;  4QVZ A;  1HSQ A;  3A1P A;  2K4Y A;  4M77 G;  1PM3 A;  3MP8 A;  1PNJ A;  4PJM A;  2AKK A;  2QGF B;  4F16 A;  2AKL A;  3S3N A;  1KHC A;  2BZ8 A;  5C6S A;  1VQN A;  2OTL T;  1RLP C;  1WHM A;  2IVW A;  1T0H A;  4JPB W;  1RI9 A;  1ZSZ A;  1M1K R;  2E64 A;  4NL3 A;  2VKN A;  2L0A A;  2RB6 A;  3CCQ Q;  1SRL A;  4FT4 A;  2DXB A;  3CCS T;  2KQW A;  4AMC A;  1RAI B;  2MF2 A;  3JCM b;  3JB9 J;  3G4S Q;  5KYW B;  1YJN A;  1G83 A;  2JTF A;  4M77 D;  3S3O A;  3CCL T;  4F7U B;  2D6F A;  4B6M A;  3QPH A;  1VQ9 A;  3BY7 A;  4JJD A;  2NUP B;  3HFN A;  2JW4 A;  1ZSZ C;  1WHJ A;  1WXT A;  1UGP B;  5LJ5 d;  4HVW A;  1WA7 A;  1WJR A;  5GAM j;  3I56 Q;  3JAM E;  1BCM A;  1QQJ A;  4E7H A;  2FZG B;  1KD1 U;  2DPP B;  5GAN 4;  3MEA A;  2RK2 A;  3A8M B;  3JSC A;  1YHQ T;  1Q7Y C;  2B86 A;  3NPF A;  2LVM A;  3ULR B;  4LDW A;  3OYA A;  3CME Q;  1VQ7 A;  1BI3 A;  4OML A;  2M1H A;  3KXT A;  2L2P A;  4LXC A;  1D1B A;  1SRM A;  2B8A A;  3J80 E;  2QA4 T;  3PTA A;  4QT7 A;  2RJF A;  4J7F A;  1I07 A;  1IHV A;  3THK A;  1RLQ C;  1NPR A;  4A4K A;  1YWO A;  1WDX A;  1M8M A;  2LCC A;  4MMK A;  2DRK A;  2K9G A;  3OBW A;  3JV3 A;  1F1B B;  5HK3 A;  1P92 A;  4OVA A;  2W10 A;  1KHI A;  4PL6 A;  1NEG A;  1M8V A;  2F5T X;  4OGC A;  4UC4 A;  1VYT A;  1M3C A;  2HAX A;  3VS4 A;  3FJP A;  4J9I A;  1J3T A;  3QJ6 A;  2KY9 A;  1NJI R;  2X4X A;  3MEU A;  4ZGD B;  1YI2 T;  4KH0 B;  3G71 Q;  4M75 F;  2CKK A;  4M4Z A;  2HL5 C;  2EQM A;  4C8Q G;  1B34 B;  3M57 A;  4M75 A;  3CCV A;  4M78 G;  3HKS A;  3OB9 A;  3JCM f;  4FSS A;  2DXC A;  2XHC A;  1YIT A;  4ZNX A;  1PG5 B;  4N4G A;  4WF2 A;  4XTY A;  3NTH A;  3EGU A;  5CK9 A;  3PIO A;  1ZBJ A;  1R0C B;  4P5N A;  3RDV A;  4J9H A;  1UGR B;  2E6N A;  3JCM X;  2DVE A;  3P8B B;  1XOV A;  4Y92 A;  2J7I A;  4C8Q D;  3SFM A;  3OYH A;  3CC2 A;  2RH2 A;  1VQ5 A;  3CC7 T;  5D7U A;  1K4U S;  1ZSZ B;  2A7Y A;  2ZPF B;  1K8A U;  5M9O A;  4NS5 A;  1T3S A;  3ZFJ A;  1SSF A;  4JZ4 A;  2CT4 A;  2RA2 A;  2LCL A;  4D6W A;  4XK8 E;  2DL8 A;  5HK0 A;  3WVE B;  1GRI A;  2DIG A;  2E10 A;  2HCK A;  1I8F A;  3VU3 C;  2P4R A;  2VB6 A;  1WXU A;  3PE0 A;  2EJF A;  4KUD K;  2BIV A;  3CCS A;  1M9S A;  1K9A A;  2HQE A;  2LNV A;  4DBF A;  5LJ3 e;  2D8J A;  4HT9 A;  1GL5 A;  2HZY A;  3JCM P;  3CCL A;  2DEQ A;  3X20 B;  2HQX A;  3M9Q A;  5FWB A;  4LDY A;  4M77 E;  4EIK A;  5GAN 8;  3OYF A;  2PVO B;  3CMA Q;  2ED0 A;  1K73 C;  3L1A A;  1CKB A;  3CCJ Q;  4HVU A;  3UDC A;  2XG8 D;  3CBP A;  1KFZ A;  1D3B A;  2V8I A;  3VS3 A;  2KSS A;  2H8H A;  2BE9 B;  4J7I A;  1YHQ A;  2RQW A;  5LJ3 g;  3GNG A;  3L2Z A;  1QKW A;  1KQS S;  2MOX A;  2DF6 A;  3GP8 A;  4JS4 A;  3OSV A;  1KD1 R;  1GCP A;  4E7J A;  2G6F X;  3RKY A;  2QA4 A;  1UEC A;  1WX6 A;  1D09 B;  1AOJ A;  4A54 A;  1ZHI A;  2QXF A;  3CCQ T;  1GCQ C;  4RCC A;  2O9V A;  2RHU A;  1WI7 A;  2WSF E;  2OJ2 A;  3M0P A;  1VQ6 Q;  3G4S T;  4ZN1 A;  3MP6 A;  1LNX A;  2DEU A;  2DX1 A;  3CC4 A;  3JB9 F;  3MO8 A;  5J26 A;  1IO6 A;  5GAO m;  2DBM A;  3CBM A;  1QVP A;  1R77 A;  3TRE A;  3MP1 A;  1X27 A;  1JEG A;  1TUC A;  1FYN A;  1YI2 A;  1QVG P;  2IPO B;  2DD4 A;  4DQ2 A;  2KYM A;  4II1 A;  4PK4 A;  2QTX A;  3S3M A;  4JRQ A;  4NOY A;  1YJ9 Q;  2QDL A;  3I56 T;  4QKU A;  3H0I A;  4XTX A;  3IQL A;  2F1L A;  2OTJ Q;  2FG0 A;  3X25 B;  3F70 A;  1I4K 1;  2LNH B;  4GY5 A;  1QWF A;  5LL6 S;  4ORZ A;  4J9F A;  2DFU A;  1X75 C;  3CME T;  4IKF A;  3C12 A;  4RCB A;  1ZBX A;  5DY9 A;  1D0Z A;  4PNO A;  4XTW A;  2LDM A;  1W6X A;  1AZG B;  4RKU E;  2K79 A;  4X9D A;  3BDL A;  2P0K A;  3NGP A;  1WHL A;  2CZ1 B;  2LT4 A;  3CC7 A;  1PSE A;  2HBW A;  4C0Z A;  2EVR A;  4C8Q E;  2XIC A;  3TVT A;  1G3W A;  3T9N A;  2KT1 A;  1D1C A;  1D0Y A;  2M02 A;  2KT8 A;  1EIF A;  3WVD B;  3EGD A;  1XQH A;  1IB8 A;  1HYO A;  4WCI A;  1H3H A;  3GBQ A;  4IUT A;  1YJW A;  1K8A R;  3OYK A;  2DMO A;  2M16 A;  3HPW A;  4E7S A;  1M30 A;  2KRM A;  2DE0 X;  4LDU A;  1FWZ A;  4RUG A;  4M7A F;  1WYX A;  2GF7 A;  4KBM B;  3TEE A;  2FHD A;  1HK9 A;  5I2M A;  4M7A A;  1K0X A;  1PCX A;  2CZ0 B;  1D3B B;  2CP7 A;  4JZ3 A;  5GAN d;  3PFS A;  1UEB A;  1ARK A;  1QVF P;  1UB4 A;  2EQI A;  1QKX A;  2YHT A;  3REA B;  2CYZ B;  4KGX B;  1DJ7 B;  1PWT A;  1X43 A;  3SEM A;  4J5Y A;  1M90 C;  3QYH B;  1N8R C;  2MI6 A;  4XU3 A;  2KRS A;  2KRN A;  3M55 A;  3RKX A;  3VS1 A;  2RO0 A;  3EG2 A;  1VQL Q;  2K57 A;  5CVI A;  1W2B P;  1HJD A;  4M7A C;  3S6W A;  2MAM A;  3CPF A;  1KQ2 A;  1I0C A;  3RIR A;  5GAO n;  2D1X A;  5KCH A;  3QKJ A;  5KYU A;  1VA7 A;  3L2W A;  4ZGJ B;  2YRC A;  4DBR A;  1WHH A;  5GAN h;  2O01 E;  2GTJ A;  1FMK A;  4C5G A;  4Z02 A;  3GIB A;  2M9U A;  2RF0 A;  2W0Z A;  3M0S A;  4AT1 B;  1AWW A;  2BZY A;  3CCQ A;  3A5Z B;  3P8H A;  5FU7 C;  1E7O A;  4RTX A;  5IN1 A;  2MIO A;  2CUD A;  5GAN 7;  3EHQ A;  3G4S A;  2PVG B;  4J9C A;  4MZM A;  2RQU A;  2NUZ A;  3M58 A;  3OMC A;  2DRM A;  1MND A;  1NPP A;  1QVG S;  2FO0 A;  1M2O A;  3EGX A;  3CMA T;  4LDX A;  3SD4 A;  1QMC A;  3CCJ T;  1AZE A;  1SHG A;  2DET A;  3V7R A;  3I56 A;  4V2S A;  1KIK A;  1Y96 A;  2XDD A;  5LJ3 f;  1MUZ A;  4GLM A;  4A4G A;  2EWN A;  2OAW A;  3OW2 S;  5GAN 5;  3HHT B;  1MMA A;  3I35 A;  2FPD A;  3SWN A;  4K11 A;  4A4H A;  3CME A;  2M0Y A;  4Z8A A;  3G7Z A;  8AT1 B;  3H0H A;  2CUB A;  3P8D A;  3VJP A;  1HD3 A;  2EGA A;  1GXI E;  4MDW A;  5GAN 6;  3OYC A;  3EGD B;  1H64 1;  4Y28 E;  4Z88 A;  3CPW S;  5GMK l;  2E5Q A;  4F17 A;  1AWX A;  1Y0M A;  3OY9 A;  1B3Q A;  1SG5 A;  4PJJ A;  2A0F B;  1VQ6 T;  2CZ7 B;  3GLX A;  5IT9 E;  2GGR A;  5IHI A;  3FC3 A;  4M7A B;  4J9B A;  3JCM V;  3UPU A;  2VVK A;  4BE2 A;  2LTO A;  5J39 A;  2DZ9 A;  2QEX Q;  1YBY A;  1H92 A;  1IGQ A;  5GAM d;  2ROL A;  3SB2 A;  2KXD A;  1PRM C;  3MCA B;  1GFC A;  1KQ1 A;  2HDA A;  1YJ9 T;  3I5S A;  2VC8 A;  4VUB A;  5LJ3 j;  2DJQ A;  1QVF S;  3RNJ A;  4EDU A;  4OMF B;  2OTJ T;  3E1S A;  4J83 A;  3RKW A;  2QGG A;  2E3I A;  2K2V A;  3O8V A;  3VYH B;  4QVC A;  5GAO q;  1YCS B;  2COZ A;  3J81 E;  1WJQ A;  4M7D C;  4GLK A;  2EPD A;  2XI9 A;  4E7K A;  1W2B S;  3C94 A;  1Q86 C;  5GAM h;  2JN0 A;  3GF5 A;  4F04 B;  2L3Q A;  2X35 A;  1ZLM A;  2Y90 A;  3JCM W;  1QCN A;  2LRQ A;  2KDS A;  1WJS A;  1NLP C;  5CO7 A;  3CBO A;  5KYN A;  2LCS A;  2DL7 A;  3VS7 A;  2QK0 A;  2LP5 A;  2RJD A;  2HL3 A;  1IRX A;  2RMO A;  3O5Z A;  1TG0 A;  2X4Y A;  3NFC A;  4B9X A;  3I55 Q;  2XID A;  3A8L B;  4E7L A;  4AFU C;  3FLG A;  3FB9 A;  2YRV A;  2HKQ B;  1TXQ A;  3BFM A;  3QZ5 B;  3AHU A;  2RD1 A;  2C0I A;  2V1R A;  5AT1 B;  1AEY A;  3VS2 A;  2F2X A;  1VQK A;  3E9G A;  2HNI A;  3FJ5 A;  4PJO F;  1Q82 U;  1Y96 B;  3JCM c;  2CH4 A;  1YIJ A;  4PJO A;  4A53 A;  3CMA A;  3RES A;  2CP5 A;  2QQ9 A;  3NTI A;  3OYN A;  3CCJ A;  3SWN B;  2E1H A;  1QP3 A;  1X69 A;  2A08 A;  2YUO A;  3OYB A;  3M56 A;  1VQL T;  4B9W A;  3CD6 T;  2OX7 A;  2WSE E;  5FU6 C;  4IIM A;  2RHY A;  3LYI A;  1C0M A;  4N0A A;  2JVV A;  4PJO C;  2YLB A;  1QW1 A;  1BIA A;  5FRM A;  2KXC A;  2ZZD A;  2C06 A;  5LJ5 h;  2JS0 A;  1AWJ A;  2L3R A;  3QYG B;  1VQ4 Q;  2VGM A;  2XU8 A;  4OMM A;  1KG1 A;  3X24 B;  3CCU Q;  4BDY A;  4FSX A;  2NUT A;  2KVQ G;  1EX4 A;  4R55 A;  3ZBD A;  2IIM A;  4M7D B;  1WPY A;  1M3B A;  1AVZ C;  4E2F B;  1VQ6 A;  3LLR A;  2D8H A;  4C92 F;  4X1V A;  4C92 A;  3BE3 A;  1VQ8 Q;  3CEY A;  1OZ2 A;  1ZA2 B;  1Q95 G;  4A63 B;  1O9S A;  2V1Q A;  3C0C A;  5KE2 A;  1UHF A;  2EW3 A;  2DKG A;  4BD3 A;  1KC8 C;  1K9M R;  1T3L A;  4BDZ A;  2COW A;  3UA7 A;  2KYB A;  2OTJ A;  5GAN e;  2QQA A;  3LW5 E;  4XU2 A;  4QQD A;  3E19 A;  4C92 C;  4Y91 A;  4ZTJ A;  2MPX C;  2GCX A;  1PC0 A;  3M54 A;  4M75 C;  5GAO p;  2P4T A;  1XNI A;  2EYY A;  1ZA1 B;  2F69 A;  2DTI A;  1BI0 A;  2JUF A;  2RHZ A;  2RHX A;  1Q81 C;  3L2U A;  1JJ2 P;  3G6E Q;  1PRL C;  2JOY A;  2KI7 A;  1Q7Y U;  2KGT A;  2OTL A;  1TOV A;  4C5E A;  4ELY C;  5GAN g;  3E9F A;  4HCK A;  2FEI A;  3ME9 A;  4L59 A;  2DJZ A;  2G3R A;  4OMO A;  1TH7 A;  1W1F A;  4J9D A;  5FU6 B;  4F7U G;  5CQX A;  5HY6 A;  2QEX T;  3VRZ A;  2HBP A;  3ASK A;  4RTW A;  2PNI A;  4PJO B;  2DVJ A;  2XK0 A;  2E65 A;  2H3J A;  2ROT A;  1CSK A;  4KUL A;  1NYF A;  3HFO A;  3EFR A;  1N6A A;  2CDT A;  4OB2 B;  3UF4 A;  4XU1 A;  4LUE A;  1C6V X;  3PMT A;  1VYV A;  1RAA B;  1I5L A;  2FPE A;  4D8K A;  2VV5 A;  2DIL A;  2A3L A;  1JQQ A;  1K76 A;  1W4S A;  2EQK A;  3CXC A;  4ME7 A;  4CI0 C;  3L2R A;  1OEB A;  4R0K A;  2NWM A;  1PSF A;  1JJ2 A;  4AFS C;  1U5S A;  4OMN A;  1OU8 A;  2GNC A;  2HQH A;  4PFO A;  3CD6 A;  2J6K A;  5C0M A;  4CC4 B;  2F5K A;  2QAZ A;  2KAF A;  4C0F A;  1KK7 A;  1QCF A;  1VQ7 Q;  2NUT B;  3CCE Q;  2E4H A;  4XQ3 A;  3HSB A;  4LD6 A;  4LE9 A;  4J6Y A;  3DKM A;  4HCC A;  1JXO A;  3I55 T;  1BU1 A;  2MWO A;  2DLP A;  4J8O A;  1LCK A;  4M7D G;  3REB B;  3VUZ A;  2JXB A;  2LJ3 A;  4C92 B;  3QUI A;  5CQY A;  2XDB A;  4M75 B;  4M77 F;  2K6D A;  2QQS A;  1K1Z A;  1Q81 U;  4M77 A;  4C5H A;  2DIQ A;  6AT1 B;  2P84 A;  1H8K A;  1WHG A;  2HSE B;  4ZTF A;  5GMK h;  4X9C A;  4RTU A;  5ECA A;  4LUD A;  2VGN A;  3A98 A;  2AHJ B;  4M7D D;  4HCB A;  2LQN A;  1M1K C;  2R58 A;  3CCV Q;  4FT2 A;  2YUQ A;  4QVD A;  1JU5 C;  2E3H A;  3UA6 A;  1NE8 A;  5A0D A;  1YNZ A;  4PFP A;  2ED1 A;  1RAG B;  3QSU A;  1WZO A;  1ZUY A;  2CSQ A;  3OYJ A;  4QQ6 A;  3LGF A;  3OS1 A;  1K73 U;  3OBY A;  4TVR A;  2HKN A;  2DL3 A;  3QHS A;  3VV0 A;  2KRO A;  1VQ4 T;  5GAM g;  2I2L A;  3CCU T;  2K3Y A;  4QW2 A;  1OZ3 A;  4IUQ A;  1TSF A;  2E12 A;  3H6Z A;  4KT0 E;  3EHR A;  3TU4 K;  5IAY A;  2J06 A;  3DB3 A;  1KJW A;  2PUO B;  3TSZ A;  1C1A A;  1H3Z A;  4KUI A;  4XTV A;  3QG1 A;  3QZ9 B;  1YWP A;  2CH4 W;  1M2V A;  2EFI A;  2XD0 A;  1MMN A;  1Q7Y R;  2E6Z A;  3LWI A;  3GOX A;  2K7A A;  1VQ8 T;  3G71 T;  2QEX A;  2RJC A;  3VRY A;  3A8H B;  1OPK A;  3UWN A;  3RR6 A;  3CCM Q;  1G5V A;  2LMJ A;  3X26 B;  4LN2 A;  2ZCF B;  5J3B A;  1NM7 A;  2M0O A;  2DXT A;  4LNP A;  3WXM B;  1UTI A;  2Y4X A;  1WGS A;  4JS5 A;  1UGS B;  4MML A;  3JB9 H;  2E5K A;  4EPC A;  2JT4 A;  3EG3 A;  4FL6 A;  3SDZ A;  1MV3 A;  2ESW A;  1D0X A;  2IG0 A;  3PIP A;  5LJ5 e;  4HVV A;  4BAC A;  1RAD B;  1BKB A;  2ZPG B;  1M27 C;  2A36 A;  2YSQ A;  1IXD A;  4HKE A;  3LH0 A;  1ABO A;  2HMA A;  3V8J A;  3EFO A;  4AFZ C;  4C8Q F;  4F7U E;  2KR3 A;  4M78 F;  1YP5 A;  2RQR A;  4C8Q A;  1NJI C;  4OP0 A;  4M78 A;  4HXJ A;  3G6E T;  1M1F A;  2GTO A;  2EIF A;  2FYK A;  2RNA A;  2EKH A;  2BUD A;  2KK4 A;  4HCZ A;  2DK3 A;  2CP2 A;  5GAO r;  5GAN f;  1QLY A;  5LJ5 g;  1K9M C;  3OQ5 A;  2QA4 Q;  1VQM Q;  5HCK A;  1R0B G;  4M77 B;  3MPU B;  4KGZ B;  4M75 G;  2BKD N;  1X6G A;  4C8Q C;  2PZ1 A;  5L23 A;  3KFV A;  4M78 C;  1OYX A;  5HKC A;  3JCM Q;  1M4Z A;  1WNL A;  5LJ3 d;  1XTD A;  4D8D A;  1Y71 A;  1WXB A;  2EAY A;  3Q1J A;  4HT8 A;  4DBQ A;  3KUF A;  3CC4 Q;  5CKE A;  3V7C A;  1GFD A;  4C92 D;  2EJ9 A;  2RN8 A;  3L2V A;  2PVD B;  3ER0 A;  1OV3 A;  3I9Q A;  3OSS C;  2X3W D;  4M75 D;  2X4W A;  1UE9 A;  5KYW A;  2VUB A;  4XAX B;  5DLQ E;  2AZS A;  3OMG A;  4J6W A;  3FRN A;  4M7D E;  1ACM B;  3KBG A;  4IUV A;  3VUB A;  1NLO C;  5GAO l;  1OU9 A;  1VQO Q;  1G8X A;  5GAN j;  2JTM A;  1VQ7 T;  1WHK A;  2ENM A;  3RMS A;  3CCE T;  4BI4 A;  2EYX A;  2OAU A;  1Z9Z A;  1WQ7 A;  4IIO A;  1VQ4 A;  3M4G A;  1SKU B;  1M90 U;  1N8R U;  4MZP A;  2PTK A;  3DLL A;  1M2V B;  3CCU A;  2Y4Y A;  3LX7 A;  3TSW A;  3CC7 Q;  3SWN C;  4J9G A;  4PJN A;  1JO8 A;  3UT1 A;  4E6R A;  3RMQ A;  5CAI A;  2J6F A;  2F2W A;  2BE7 D;  1WQW A;  2VWF A;  1EZZ B;  5KCO A;  2L89 A;  1YJW Q;  1N5Z A;  3HRT A;  1G2B A;  2DER A;  1KD1 C;  5KE3 A;  1VQ8 A;  3G71 A;  1K0S A;  4J6X A;  1AT1 B;  5FRO A;  5A0L A;  4BY6 C;  1FMV A;  1OUL A;  4WTO B;  4DEY A;  1UUE A;  5GMK i;  3CCV T;  4JLI A;  4N4H A;  1N9S A;  2JNG A;  3EFO B;  3EG1 A;  4C8Q B;  4GBQ A;  4E7I A;  5KYU B;  4M78 B;  5EC7 A;  4KRT A;  2FZK B;  1B34 A;  4N4I A;  4DA4 A;  1Y07 A;  2EBP A;  3PVQ A;  2HD0 A;  1VIF A;  3OYL A;  2LT1 A;  4BI3 A;  2PUK B;  1QWE A;  1BB9 A;  2SEM A;  3FIF A;  3G1J A;  1AD5 A;  3I5R A;  3TCJ A;  3G6E A;  1LPL A;  2GQV A;  4CC2 A;  1BYM A;  2X3X D;  1M1G A;  3HP9 A;  3JB9 G;  5CKH A;  5GMK e;  4LD9 K;  4FYW B;  3JCM J;  2BZX A;  1SHF A;  3OS5 A;  1BI1 A;  2JM8 A;  1S72 Q;  5FW9 A;  3EGX B;  3L2Q A;  2EYW A;  1NZ9 A;  1UHC A;  3CCM T;  2EYQ A;  4AFQ C;  1HXD A; 
#chains in the Genus database with same CATH homology
 1WFW A;  4HCK A;  1TUD A;  1W6X A;  1AZG B;  2FEI A;  2K79 A;  2OI3 A;  2K3B A;  4OMO A;  1NG2 A;  3NGP A;  2FRW A;  1W1F A;  4J9D A;  4J9E A;  4CC3 A;  2HBW A;  2DYB A;  2EVR A;  1E6H A;  3VRZ A;  4RTW A;  3TVT A;  2PNI A;  2DVJ A;  1OPL A;  2KT1 A;  2ROT A;  1CSK A;  2O88 A;  1YN8 A;  1NYF A;  2CDT A;  2KT8 A;  3UF4 A;  3EG0 A;  4LUE A;  1GBQ A;  2A37 A;  1VYV A;  2LJ1 A;  3QWY A;  2FPE A;  1T0J A;  2XMF A;  4D8K A;  4WCI A;  1H3H A;  2DIL A;  3GBQ A;  1BK2 A;  1JQQ A;  2J6O A;  2DMO A;  1K76 A;  2DNU A;  3SHW A;  1ZUK A;  3ZL7 C;  1M30 A;  2KRM A;  3VS5 A;  1OEB A;  2DE0 X;  3QWX X;  4F14 A;  5IXB A;  4AG2 C;  4RUG A;  1W70 A;  4R0K A;  2NWM A;  1WYX A;  4AFS C;  1K0X A;  1U5S A;  4OMN A;  4JZ3 A;  2RQT A;  2GNC A;  2KBT A;  2J6K A;  1EFN A;  3M0R A;  4CC4 B;  1ARK A;  2EQI A;  2EGC A;  3NHN A;  4ESR A;  1JXM A;  1QCF A;  1QKX A;  3REA B;  1U3O A;  1PWT A;  1X43 A;  3SEM A;  4JJC A;  1UDL A;  2EGE A;  2KRS A;  3H0F A;  1VYU A;  2KRN A;  3VS1 A;  1B07 A;  4LE9 A;  3EG2 A;  4Z89 A;  1JXO A;  4OMP A;  2YDL A;  1BU1 A;  1HJD A;  2DLP A;  2MCN A;  2JM9 A;  1LCK A;  1I0C A;  5IH2 A;  3REB B;  1X2K A;  2JXB A;  2D1X A;  2LJ3 A;  1VA7 A;  1GBR A;  3U23 A;  2I0N A;  2K6D A;  1K1Z A;  2DM1 A;  1NYG A;  2GTJ A;  1FMK A;  2AZV A;  2YUN A;  2RF0 A;  2CSI A;  1H8K A;  2KE9 A;  2W0Z A;  3RBB B;  1Z9Q A;  3M0S A;  2L3S A;  1AWW A;  2BZY A;  1HSQ A;  4RTU A;  5ECA A;  4LUD A;  1E7O A;  4RTX A;  1PNJ A;  2AKK A;  2MIO A;  3A98 A;  2CUD A;  4F16 A;  2AKL A;  1UFF A;  3EHQ A;  2BZ8 A;  1RLP C;  2LQN A;  4J9C A;  2YUQ A;  2RQU A;  1T0H A;  4JPB W;  1JU5 C;  1RI9 A;  3UA6 A;  2NUZ A;  2VKN A;  1WIE A;  2L0A A;  1YNZ A;  2DRM A;  1SRL A;  2FO0 A;  2ED1 A;  1ZSG A;  1ZX6 A;  1I1J A;  2DA9 A;  1PHT A;  2RQV A;  1AZE A;  1ZUY A;  1SHG A;  1G83 A;  2CSQ A;  2FPF A;  1KIK A;  5IHK A;  2DL3 A;  2KRO A;  1MUZ A;  4GLM A;  1X6B A;  2OAW A;  4JJD A;  1OOT A;  2JW4 A;  3I35 A;  2HEQ A;  4AG1 C;  1WXT A;  2FPD A;  3EHR A;  4K11 A;  2M0Y A;  4HVW A;  1WA7 A;  4Z8A A;  2J06 A;  2EYZ A;  1KJW A;  3TSZ A;  3H0H A;  2CUB A;  1HD3 A;  2EGA A;  1NEB A;  1YWP A;  2CH4 W;  2B86 A;  3NPF A;  2FRY A;  3ULR B;  2K7A A;  3VRY A;  4Z88 A;  1A0N B;  4OML A;  1OPK A;  4RTT A;  4F17 A;  2LMJ A;  2L2P A;  1AWX A;  1Y0M A;  4LN2 A;  1B3Q A;  1NM7 A;  2F2V A;  1SRM A;  4LNP A;  1UTI A;  2GGR A;  1S1N A;  5IHI A;  5I22 A;  2E5K A;  2JT4 A;  4J9B A;  4QT7 A;  2VVK A;  3EG3 A;  3M0T A;  1I07 A;  1M3A A;  1GCQ A;  1MV3 A;  2ESW A;  3THK A;  1H92 A;  1RLQ C;  2ROL A;  2JTE A;  2KXD A;  1PRM C;  1YWO A;  1WDX A;  4HVV A;  5GJV B;  1M8M A;  1GFC A;  1ZUU A;  1M27 C;  2A36 A;  2DRK A;  2M51 A;  2YSQ A;  2HDA A;  2K9G A;  3JV3 A;  1ABO A;  3I5S A;  2W10 A;  1NEG A;  4AFZ C;  2O9S A;  2KR3 A;  3LH5 A;  3VS0 A;  2DJQ A;  4DEX A;  1YP5 A;  2RQR A;  2LJ0 A;  3RNJ A;  2GBQ A;  1VYT A;  1M3C A;  3VS4 A;  4HXJ A;  4J9I A;  1J3T A;  2C0T A;  2GTO A;  5GJW B;  2RNA A;  2EKH A;  4RTY A;  4OMQ A;  4M4Z A;  1YCS B;  1ABQ A;  1WLP B;  2EPD A;  2O31 A;  1AWO A;  2KEA A;  1QLY A;  4FSS A;  1RUW A;  1PKS A;  5HCK A;  2L3Q A;  3M0U A;  4ZNX A;  1E6G A;  1UJ0 A;  1ZLM A;  1SSH A;  2CRE A;  2DL5 A;  1X6G A;  2PZ1 A;  1NLP C;  3EGU A;  5L23 A;  3KFV A;  2LCS A;  2DL7 A;  1ZBJ A;  3VS7 A;  2LP5 A;  2K2M A;  4J9H A;  2RMO A;  3O5Z A;  1SEM A;  3VS6 A;  2YUP A;  1TG0 A;  4D8D A;  1XOV A;  4Y92 A;  1WXB A;  2J7I A;  3M0Q A;  4AFU C;  1K4U S;  3H41 A;  1GFD A;  5IXF A;  2RN8 A;  1T3S A;  1OV3 A;  2C0I A;  3I9Q A;  5IHN A;  2X3W D;  2ECZ A;  4JZ4 A;  2CT4 A;  2V1R A;  1UE9 A;  1AEY A;  3VS2 A;  2DL8 A;  2F2X A;  1GRI A;  1BBZ A;  2AZS A;  2HCK A;  2C0O A;  2P4R A;  1WXU A;  2GQI A;  2CT3 A;  3FJ5 A;  3PE0 A;  2A28 A;  4RTV A;  2JS2 A;  2CH4 A;  1NLO C;  2O2O A;  1K9A A;  3CQT A;  2D8J A;  2ENM A;  1X69 A;  1GL5 A;  3UAT A;  2EYX A;  5FWB A;  1Z9Z A;  2A08 A;  2KNB B;  4IIO A;  2YUO A;  4JJB A;  2LX7 A;  4CC7 A;  2PTK A;  4EIK A;  4IIM A;  3TSW A;  2ED0 A;  1CKB A;  1V1C A;  4J9G A;  1CKA A;  4HVU A;  2KXC A;  1JO8 A;  1KFZ A;  3VS3 A;  2JS0 A;  1AWJ A;  4E6R A;  2AK5 A;  2J6F A;  2H8H A;  2F2W A;  4OMM A;  2L3P A;  2VWF A;  2RQW A;  1KSW A;  1QKW A;  1N5Z A;  2DBK A;  1G2B A;  1K0S A;  2JMA A;  2MOX A;  2DF6 A;  2RPN A;  1SPK A;  2IIM A;  2JMC A;  1GCP A;  1M3B A;  1AVZ C;  2HSP A;  2G6F X;  4DEY A;  1UEC A;  5FWC A;  1UUE A;  1WX6 A;  2D8H A;  2DL4 A;  4X1V A;  1AOJ A;  2BTT A;  3EG1 A;  1GCQ C;  4GBQ A;  4A63 B;  2O9V A;  1UJY A;  2V1Q A;  3C0C A;  1WI7 A;  2J05 A;  1PKT A;  2OJ2 A;  4KRT A;  5EC7 A;  1UHF A;  1UG1 A;  2D0N A;  3M0P A;  2EW3 A;  3PVQ A;  2EBP A;  1T3L A;  2DX1 A;  1MV0 B;  1QWE A;  1IO6 A;  3UA7 A;  5I11 A;  1BB9 A;  2KYB A;  2SEM A;  2DBM A;  1AD5 A;  2ABL A;  3I5R A;  1X27 A;  2LQW A;  1X2Q A;  1JEG A;  1TUC A;  1FYN A;  4CC2 A;  1Y57 A;  2YT6 A;  3R6N A;  2KYM A;  2X3X D;  3NMZ C;  2QDL A;  2SRC A;  2EYY A;  3H0I A;  3IQL A;  2FG0 A;  4RTZ A;  1UGV A;  2BZX A;  1SHF A;  2LNH B;  1QWF A;  1U06 A;  1PRL C;  2JM8 A;  5FW9 A;  4J9F A;  4ORZ A;  2LZ6 B;  2KGT A;  2EYW A;  1UHC A;  4AFQ C;  3PVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...