2A37A

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (drkn sh3 domain)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein E(sev)2B
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a37A00
3SEMA 1WXUA 2YDLA 4LE9A 1YP5A 4OMMA 4EIKA 2HSPA 1WI7A 2DL4A 2RNAA 2JMAA 2RPNA 1X69A 1YN8A 1UG1A 2JS2A 2RQTA 1QWEA 2YUOA 3VS5A 1PHTA 1CSKA 1ZX6A 4JJBA 1QLYA 4OMPA 5IH2A 2J06A 1T3SA 2KYMA 1K0XA 1NYGA 1M8MA 1VYVA 1Z9ZA 2SRCA 4Z89A 2KRSA 1H8KA 2LQWA 1UECA 2EPDA 3PVLA 4F16A 2M0YA 1OV3A 3M0PA 1YWOA 1JXOA 2DVJA 1NLPC 3NGPA 3THKA 1AOJA 1Z9QA 2BTTA 2KNBB 1I1JA 5I22A 2DX1A 2FRWA 3EGUA 2NWMA 1RLQC 2JT4A 2W0ZA 2DA9A 1OOTA 3M0TA 2DMOA 4RTVA 1AWOA 2LZ6B 2GGRA 1AZGB 4JZ3A 1QCFA 1KSWA 2FPEA 1JO8A 1NYFA 3EHQA 2OI3A 2A28A 3PE0A 1M30A 2VKNA 4RTXA 4R0KA 3VRZA 4DEYA 2OAWA 5IHKA 1A0NB 2DRMA 1E6GA 2YUQA 1BK2A 4LNPA 1M3AA 3EG3A 2NUZA 5IXFA 1AWXA 1AZEA 2DF6A 4RTTA 1GRIA 2KRNA 2JS0A 1TUDA 3M0RA 1TG0A 4D8DA 2RQVA 2VWFA 2OJ2A 2DJQA 5FWCA 2CSQA 4J9HA 1FYNA 4F14A 2GNCA 1LCKA 4OMQA 4GBQA 2RQRA 3UATA 1WIEA 2FRYA 2IIMA 1NEBA 1KIKA 1J3TA 3UF4A 1AEYA 1TUCA 1NEGA 3M0UA 2C0IA 1KJWA 2DM1A 2K3BA 1HJDA 3I5RA 1M27C 1T0HA 2YUPA 3GBQA 4JZ4A 4RTZA 1AWWA 1OEBA 2CSIA 3O5ZA 1V1CA 4HVUA 1RI9A 4J9DA 3REBB 2A36A 2L3SA 2D8HA 1U3OA 2GTJA 1M3CA 4F17A 1QKXA 2K2MA 2J6OA 1UFFA 1QWFA 1T3LA 2EYYA 3NHNA 2KXDA 4CC2A 2J7IA 5GJWB 3QWYA 2KT1A 1SHFA 3IQLA 3EG0A 3A98A 1W6XA 1AVZC 2EVRA 4AG2C 1OPLA 2C0OA 2EYXA 2KR3A 1ZUUA 2DLPA 3RNJA 1G83A 1VYUA 2RN8A 1GBQA 4ESRA 1SSHA 2CDTA 2KGTA 1PKTA 2HEQA 1M3BA 5FWBA 1X2QA 1GFCA 2F2VA 2KRMA 3UA6A 1E6HA 4J9BA 1H3HA 4IIMA 1WDXA 4Z8AA 2X3XD 1SRMA 2F2WA 2DNUA 4AFUC 5EC7A 1UJ0A 4RTYA 2PNIA 2RQUA 2A08A 2KXCA 4ORZA 1YCSB 2RMOA 1X43A 4JJDA 2K9GA 2LP5A 2KROA 2W10A 5IHNA 2X3WD 1NLOC 5IXBA 2AKLA 2ED1A 2AZSA 3VS0A 3QWXX 2LQNA 1K1ZA 2DE0X 4LUDA 2CUDA 1X6GA 1WXTA 1I07A 3H0HA 1YNZA 2DL7A 2GQIA 2EKHA 1K4US 2FO0A 4LN2A 1UUEA 3I5SA 2G6FX 4OMLA 3VS7A 2O9VA 1NG2A 3C0CA 1WLPB 1T0JA 1SPKA 3NMZC 2HDAA 2DBMA 1AWJA 2AK5A 1ZUKA 1U06A 2BZ8A 1X2KA 1GCPA 2XMFA 1RUWA 1WA7A 2JW4A 2BZYA 1ABQA 4RTWA 2AZVA 2L2PA 5FW9A 2FPDA 3VS4A 4AG1C 3H0IA 1PWTA 1PRLC 1SHGA 4FSSA 1KFZA 1JU5C 3PVQA 1FMKA 1PRMC 2EGEA 3LH5A 1B07A 2DBKA 4LUEA 5IHIA 4JJCA 2RQWA 1UHFA 2PZ1A 3UA7A 4A63B 3REAB 3NPFA 1K76A 2DYBA 5I11A 2D0NA 4Y92A 4Z88A 3RBBB 2B86A 2H8HA 2KT8A 3TSZA 4RUGA 3CQTA 1Y0MA 2ENMA 2E5KA 1UJYA 4HVWA 5HCKA 4OMNA 3VS3A 2C0TA 2DILA 2V1RA 1G2BA 3TVTA 2LX7A 2ED0A 2DL3A 1VYTA 1K0SA 1X27A 1ZSGA 3EG1A 2FG0A 2I0NA 1QKWA 2YT6A 1BU1A 2CT4A 3M0SA 1GFDA 3EG2A 3TSWA 1BBZA 1I0CA 1Y57A 1W70A 2ECZA 3JV3A 2JM9A 2KE9A 5ECAA 1H92A 2PTKA 4GLMA 1JXMA 1B3QA 1ARKA 2F2XA 4HXJA 4CC7A 4IIOA 1NM7A 3VRYA 1MUZA 3H0FA 1PKSA 2FPFA 4CC3A 4X1VA 2A37A 2EGAA 1UGVA 4AFSC 4JPBW 2SEMA 2JXBA 1EFNA 2J05A 1UDLA 2EW3A 2YUNA 2CT3A 1E7OA 2LJ3A 2O2OA 4J9GA 1JQQA 4DEXA 3VS6A 2ABLA 1W1FA 1ZLMA 2FEIA 2O88A 1YWPA 2YSQA 1RLPC 2DRKA 2O9SA 4CC4B 2KEAA 4AFQC 5L23A 1SEMA 4ZNXA 2MOXA 2P4RA 4K11A 4KRTA 4RTUA 2LJ0A 2L3PA 1OPKA 2KBTA 2MCNA 1VA7A 1ABOA 2CH4W 3I35A 2K6DA 1GBRA 1WXBA 2AKKA 1N5ZA 2CUBA 2J6FA 2RF0A 2ESWA 2EYZA 2KYBA 2BZXA 2CH4A 1UTIA 3M0QA 4HVVA 1ZBJA 1UE9A 1GCQC 1JEGA 1U5SA 2K7AA 1ZUYA 2M51A 3I9QA 4M4ZA 4D8KA 4QT7A 2JMCA 2HBWA 2LNHB 4J9IA 1AD5A 2ROTA 1HSQA 2LMJA 3VS1A 2HCKA 1WX6A 4HCKA 3FJ5A 1HD3A 2D1XA 2D8JA 2O31A 1GL5A 1GCQA 2L3QA 2EGCA 2EYWA 2K79A 2VVKA 1X6BA 2ROLA 4J9EA 3SHWA 1CKAA 1MV3A 1WYXA 2J6KA 3KFVA 2EQIA 4E6RA 1UHCA 2GTOA 1MV0B 2CREA 2V1QA 4J9CA 1XOVA 2GBQA 3VS2A 2JTEA 3ZL7C 4AFZC 2EBPA 2JM8A 1PNJA 4J9FA 3H41A 1S1NA 2LCSA 3ULRB 2L0AA 2DL8A 1K9AA 3EHRA 1BB9A 1IO6A 2DL5A 2LJ1A 1CKBA 3U23A 3R6NA 2QDLA 4WCIA 4OMOA 1SRLA 5GJVB 2MIOA 1WFWA
chains in the Genus database with same CATH superfamily
5CCAA 3SEMA 3CMEQ 2QK0A 3ASKA 4LE9A 2RB6A 2YRCA 3GPLA 2CYZB 2JOYA 1YN8A 2D6FA 2YUOA 1CSKA 4PFPA 5IH2A 4XTWA 1PC0A 2CGHA 1NPPA 5KCOA 2I2LA 3HKSA 1KQ1A 4M7DC 1PG5B 5CO7A 2SRCA 1R0BG 4XU0A 1OQKA 1UEBA 3F70A 1PM3A 1YWOA 3OYJA 3S6WA 1C1AA 2BTTA 2KNBB 1I1JA 4II1A 4XU2A 4M7DF 4EMGA 3QJYA 1AWOA 3CD6T 4C0FA 2X4JA 1OX8A 2LZ6B 5HY6A 1AZGB 3GNFB 4ZGDB 2DTOA 1R8OB 3M56A 2VXFA 5CKHA 2OI3A 3BFMA 3PE0A 1UB4A 4RTXA 4R0KA 1VQNA 3VRZA 3HPWA 3EG3A 4N0AA 1YJWT 3HTRA 3M0RA 1TG0A 2DTHA 2XG8D 2VWFA 1OZ2A 2DJQA 4FT4A 3HRSA 2COWA 2KQWA 3CMAQ 3JCMg 2HKNA 1WIEA 4F04B 3PMIA 1RAEB 1VQ4Q 2IIMA 1NEBA 4DBQA 1KIKA 1J3TA 4FYWB 3G71A 3G4SA 1TUCA 1YJ9Q 3JCMP 1Q81R 3PNWC 2XKOC 4B9WA 1TXQA 2DM1A 3L2UA 3I5RA 3FJPA 4JZ4A 2OTLT 4RTZA 1WHMA 3HFNA 1K9MR 3VV0A 4J9DA 3REBB 2A36A 2L3SA 2QQRA 3CXCS 3H8ZA 1KC8C 2J6OA 4Z02A 3OA6A 2QEXQ 4OGCA 3ZBDA 3NHNA 2KXDA 3CMAT 2KT1A 1KQSP 5KYUB 3EG0A 2EKOA 5CKEA 1VQ5A 1M1KC 4P5NA 1K73U 2X51A 2KR3A 2DLPA 2EQJA 4FYYB 4PL6A 4WF2A 2CZ0B 2RHUA 4FIBA 2CDTA 5GMKm 4F7UG 1JJ2A 5I2SA 5KYXA 4L59A 4M77D 5GANe 3UA6A 3OYCA 1Q81U 4J9BA 5GAOr 3V7RA 3VKIA 4MMKA 1D0XA 4PJOC 4RTYA 2PNIA 5GAN2 2A08A 2KXCA 3CCLQ 3CPWS 3C12A 1YCSB 3OB9A 2RMOA 4JJDA 2K9GA 4E7ZA 1M1GA 5FRMA 1M2VA 4E7JA 3MP1A 2X3WD 4PFOA 5IXBA 1K9MU 3QSUA 2ED1A 4M77A 3VS0A 4ZGJB 2XDPA 4C92D 2QEXT 5LJ3f 2LVMA 1X6GA 2CZ7B 4PJOF 3QZ5B 1YNZA 2GQIA 4CI0C 2EKHA 1X6OA 4PLIA 1K4US 3VJPA 3CCUQ 3TEEA 5GMKh 1B34A 4OMLA 3CCRQ 1K73C 3C0CA 1KK7A 2HDAA 2EJFA 1QVPA 4MDXA 3L1AA 2DBMA 4C92A 4FU6A 2AK5A 3CCEQ 2BZ8A 1U06A 3AHUA 2XMFA 3CBOA 2JW4A 1ABQA 2QG9B 3EH2A 2QGGA 4AG1C 2KY9A 4FSSA 1JJ2P 1KFZA 2EYQA 3PVQA 1FMKA 2F69A 3CCVT 2KDSA 4C5HA 1UHFA 1N8RU 3UA7A 3MCAB 1VQLA 3REAB 1Q82C 3VUZA 1VQOQ 4DBRA 1NBEB 2DYBA 5I11A 4PJJA 3RBBB 2RI3A 1Q86C 4XTZA 4RUGA 3L2VA 4C8QB 2QA4Q 4M75E 1ZBXA 4OMNA 3MJXA 5A0DA 1G2BA 1K0SA 1VYTA 1Q7YR 1U1SA 3LWHA 3BDUA 3CCET 2MAMA 3M0SA 2HSEB 2QQAA 1I0CA 4IURA 1NJIU 4CRIA 1SKUB 1W70A 4B6MA 2ECZA 2G3RA 4C5EA 4JDSA 4X34A 1UGRB 4GLMA 1PD1A 1Y71A 4KULA 4J6WA 2F2XA 4CC7A 3VRYA 1PKSA 4OP0A 2OTJQ 1N8RC 1VQKA 1BI0A 3EAEA 5GMKi 2A37A 3JCMh 3OSVA 1VQOT 4PJMA 2XHCA 1EFNA 2CT3A 3E19A 1YJNT 4PK4A 4LDUA 1VQ7A 3FIFA 3CC2A 4LDVA 2QA4T 4AT1B 5GAMh 2ABLA 5GAOm 1ZLMA 2FEIA 2O88A 4HT8A 5D6WA 1YWPA 2YSQA 2E6ZA 1XNIA 3TU4K 4M7AB 5L23A 3JCMV 4C8QG 1KHCA 1NJIC 1OX9A 2L3PA 2XU8A 2K4YA 2LNVA 3JAME 5D6YA 1ABOA 3HRUA 3M57A 1Q7YU 3E9FA 1N6AA 2CP3A 3ME9A 4C5GA 2K6DA 1WXBA 2AKKA 4M78F 4J8OA 3QIIA 5FU7B 5LJ5d 2KYBA 3M5AA 2CH4A 2L89A 4EMKC 2LCLA 4BACA 3M0QA 1GCQC 5CAIA 1JEGA 2MPXC 3I9QA 4LDWA 2H3JA 3QPHA 4OVAA 3CXCA 1D0YA 3M55A 3MO8A 4IUQA 3WXMB 3NFCA 3M9QA 3VS1A 1VQ8Q 1R0CB 1HD3A 2D8JA 4LXCA 2QAZA 2O31A 4M7DE 1GL5A 4JS4A 4QQGA 2BE7D 2ZPHB 2Y90A 2EQMA 2FZKB 3LWIA 5A0GA 2GTOA 5CKDA 1QP3A 2CREA 1VQPQ 4BE2A 1VQMQ 3OW2S 4QQ6A 3M54A 4QQDA 5D6XA 5GAOq 3MP6A 1HXDA 1QCOA 1X01A 1ZSZC 5CQYA 4J9FA 2K2VA 5FROA 3H41A 2HMAA 2M16A 4TVRA 2LCSA 5KYUA 3SB2A 2L0AA 2VB6A 3OYAA 3CPWA 1EIFA 4JJNK 1VQ5T 3G7ZA 4WCIA 2HL3A 3PFSA 3CCJA 3P8BB 1WXUA 2RJFA 4N4IA 3OYKA 1VQ8T 1M9SA 3CXCP 2HSPA 3V8JA 3OBYA 2RPNA 1RACB 4GY5A 1UG1A 1PSFA 2RQTA 1QWEA 4XU1A 1PHTA 4JUVA 3LGLA 4OMPA 1AHJB 5GAN8 1T3SA 3UT1A 1I8FA 1K0XA 2QTXA 3JCMW 1NYGA 1VYVA 4M7DD 2ZAEA 1VQPT 3MP8A 4KT0E 1YITT 2HAXA 3PVLA 4F16A 5IAYA 2MWPA 5KCHA 1EX4A 1JB0E 1W2BS 1S72Q 1JXOA 1VQ4A 3NGPA 3THKA 4RG2A 4M75C 5DM7R 5KYYB 2Y4XA 3OYEA 1YJ9A 3I55Q 2DX1A 3EFRA 1YI2A 2YHTA 2NWMA 3RIRA 1RLQC 2JT4A 3SWNB 2DA9A 1OOTA 3CCSA 4RTVA 1QVFS 3LYIA 1KSWA 2FPEA 2XICA 3JB9D 2AT1B 1NYFA 3VYHB 4FYVB 2VKNA 4M75F 4B9XA 5IHKA 2LX9A 2DRMA 4O5VA 2QTVA 1BK2A 2JUFA 1M3AA 1AWXA 1AZEA 5GAMj 4BD3A 2A7YA 2DF6A 1GRIA 3JB9J 4D8DA 1FWZA 2QQSA 2GNCA 2EQKA 2P0KA 4OMQA 2HBPA 2RQRA 2E5QA 1S72T 4E7IA 4F7UF 1DJ7B 2AIRB 3EG9B 4QKUA 3UF4A 4V2SA 4C8QA 4PJOE 1NEGA 3I55T 3SDZA 2C0IA 1MMDA 4EMKB 1NPRA 1BCOA 3BY7A 4N4GA 2E3HA 4D6WA 2CSIA 3MKDA 2RJEA 3CCLA 4ZN1A 3META 2DVEA 3OYYA 2MYSA 4M77G 2NUPA 3SFMA 2D8HA 2WSEE 2GTJA 3CD6Q 4ELZC 2K2MA 1QWFA 4C0DC 4Y91A 4CC2A 2VXEA 2ATCB 4KUIA 5L8RE 3V7SA 1KC8R 3CCUA 4M7AD 4AG2C 2EVRA 3CCRA 4C92G 1RL2A 5KYWB 2QYZA 1YJWQ 2LTOA 5LJ3h 1YIJA 4JRKA 1LJOA 1ZSZB 2Y4YA 4X9CA 1GBQA 4ESRA 1SSHA 2DKGA 1M1KR 2HEQA 1M3BA 2COZA 4EDUA 3A8OB 4M7AA 2HKQB 2KRMA 2P4TA 1E6HA 3URGA 5GANh 1WDXA 2GFUA 1K8AC 1IHWA 1SRMA 1BKBA 2RQUA 1V29B 2DPPB 1KQ2A 1QW1A 4R56A 2LQNA 2OTLQ 5HKCA 3NTHA 3CC4T 4LUDA 2JZ2A 3I56A 1WXTA 1I07A 1R77A 2FO0A 3CCMA 1VQ6Q 3X20B 2P84A 3E9GA 2RHXA 1HK9A 3OW2A 1WQWA 1SPKA 3G6EA 5KYNA 1KC8U 4BDZA 3A8GB 4A4EA 1ZUKA 1X2KA 1GCPA 1K73R 2X4WA 4M75B 2PQWA 4RTWA 3RKXA 2L2PA 2FPDA 3VS4A 3JCMd 1D1BA 3H0IA 1M1KU 1SHGA 1PRLC 4ZN3A 3UDCA 2E41A 2M0OA 2VASA 3OYIA 8ATCB 2EGEA 3LH5A 5GAMg 1B07A 2DBKA 2R57A 4ATOA 2MK5A 4JJCA 4JLIA 5FU6C 5GAMd 4M78E 5FLXE 2ZPIB 2D0NA 2P0PA 1D1CA 2CP2A 2B86A 2H8HA 1YHQT 2YLCA 3TSZA 2Z0WA 2ENMA 1Q82R 1UJYA 2MWOA 1VQ6T 1OU8A 3VS3A 1WZOA 1IRXA 2LX7A 2ED0A 2DL3A 3EGXB 1Q86R 1X27A 1FMVA 2FG0A 2I0NA 1W2BA 3OW2P 2CT4A 3EG2A 3TSWA 3JCMb 2JM9A 1YBYA 1WHHA 1B3QA 3MEUA 5LJ3e 3OS0A 4HXJA 1QVFA 1MUZA 2QXFA 3H0FA 3CC7Q 3EFOB 5C0MA 3QYGB 4IKFA 4CC3A 2VGMA 2EGAA 5HK0A 4AFSC 2HNIA 3CCQA 4HKEA 2LDMA 5KYYA 1N8RR 3HRTA 2YUNA 2CKKA 3S3MA 7AT1B 2O2OA 4C0DB 3CCVQ 1NE8A 3SWNA 5CR2A 1G5VA 1RADB 3L42A 1QCNA 2DRKA 2O9SA 4AFQC 1Q82U 5LJ5f 4RTUA 3L2WA 5GAOl 2LRQA 5LJ3j 2FL7A 1Q86U 2KBTA 2MCNA 3A8HB 1W2BP 2NUTA 2KAFA 4M7DB 3OSSC 2CH4W 3GNGA 1KD1C 1NJIR 2RF0A 5GANj 2EYZA 1VQ9A 3CC7T 4A4FA 1TUGB 4XAXB 1N9RA 1QVFP 1ZBJA 3RUXA 1M4ZA 2K7AA 1MNDA 2M51A 3AT1B 4QT7A 2L5QA 5KH6A 3EG9A 3GP8A 2LNHB 4J9IA 1AD5A 1TH7A 3TCJA 2NYSA 4BE0A 4EMKA 4KGZB 3FEOA 4OB1B 2D1XA 4IUTA 3OYBA 2R58A 3CPFA 3PIPA 1GCQA 1MHNA 1QP2A 2VVKA 3SD4A 2L3RA 2ROLA 3PIOA 3J7AF 1CKAA 2IG0A 3VU3C 1WYXA 1TOVA 3JCMQ 4DBFA 1TU0B 1YJNQ 4DBHA 3JCMc 3S3NA 2V1QA 3HFOA 4E7SA 4AFZC 1WHLA 1WHKA 4HCZA 2DXUA 4M7DG 5J3BA 1FMWA 3QDFA 2XDBA 3V8KA 1TSFA 1IO6A 1D0ZA 1O75A 5KYWA 4A4GA 1QVGS 4QW2A 2QDLA 4F7UE 4OMOA 2MIOA 2DEQA 1F1BB 1IGUA 3JRZA 1ZSZA 1MNEA 2CZ6B 1N9SA 1IZ6A 2F5KA 1YP5A 4EIKA 2RNAA 1WI7A 3V8LA 2JMAA 1PSEA 3P8DA 2JS2A 4LD6A 2RI5A 4XTUA 1ZX6A 4JJBA 4RCBA 3X28B 3JB9G 5GAOn 3G71Q 3BW1A 3G4SQ 1Z9ZA 3OYLA 1QMCA 5I21A 4Z89A 4M78C 1RAGB 2BIVA 4A4KA 2M0YA 1X75C 3PT9A 4M77C 1B7TA 2DVJA 2VC8A 4Q5WA 4M75D 1AOJA 2F5TX 2FB7A 5I22A 1VQNT 1SG5A 2YRDA 2DZ9A 2W0ZA 2DMOA 4OMFB 3D7SB 2X9HA 1QCFA 3MEVA 4M77F 3RKYA 4BY6C 3QG1A 3HSBA 4M75A 4PJOB 2A28A 2K5FA 2H3EB 2HQHA 4DEYA 2OAWA 1A0NB 2MMPA 1E6GA 2YUQA 1VQ5Q 2CP6A 5IXFA 3QHSA 5LJ3g 4RTTA 2XDDA 3CD6A 1G8XA 4RMOA 3INZA 1AT1B 2RI2A 3CMEA 3G71T 3G4ST 1M8VA 3M4GA 4C92F 2GQVA 2CSQA 4J9HA 4NL2A 1WHGA 1I81A 1LCKA 4KUDK 1O9SA 5GANg 4GBQA 3UATA 1YJWA 5GANd 3TREA 1AEYA 1LOJA 4QVCA 1G3TA 2E64A 3M0UA 3WVDB 1YITQ 4M7AG 3OS5A 2XD0A 3EGXA 1JRIA 2K3BA 1HJDA 1M27C 1T0HA 3GBQA 2ZPBB 1AWWA 4J5YA 4HA8A 1SF9A 3JCMX 4XTXA 4OGEA 2OAUA 1V1CA 4HVUA 5CIUA 1RI9A 3GF5A 3LW5E 2M1HA 3RDVA 3LGFA 4X9DA 1U3OA 4JRPA 1QKXA 1KQSS 1T3LA 4E7LA 1SHFA 3JSCA 3IQLA 2V8JA 3HHTB 2C0OA 2FZGB 4DOVA 3RNJA 1VYUA 3OYFA 1MMAA 2KGTA 3CMAA 2B8AA 3PTAA 5FWBA 4NS5A 5A0LA 1VQLQ 1GFCA 2F2VA 2RO0A 3OS2A 1H3HA 4FW1A 4XTVA 2F2WA 2DNUA 2VUBA 4AFUC 5EC7A 2HQXA 2JJ9A 4GLKA 4M7DA 2DD4A 3OMGA 3UWNA 1K8AR 3FRNA 3GLXA 3OY9A 1G3WA 2KROA 1M2OA 1VOMA 2W10A 1IREB 4DA4A 2LT1A 3CPWP 1RAAB 1XTDA 2DIGA 5KYXB 2DTIA 2DE0X 2K3YA 2CUDA 1VQ9T 3QUIA 3H0HA 2DL7A 4LN2A 1UUEA 3N5BB 2DD5A 3I5SA 3NTIA 2O9VA 4M78B 1WLPB 2ZGWA 1JBMA 3JCMf 2K3XA 2YRVA 2QEXA 1OYXA 1I5LA 2XK0A 1OI1A 1BYMA 1RUWA 4BE1A 2BZYA 1RAIB 2WSFE 4FM4B 3C4SA 2EQUA 2AZVA 3QJ6A 1VQLT 1M90U 1QVGA 3HP9A 3QYHB 1PRMC 1QQJA 3OYMA 1VQ7Q 3CC2Q 3KBGA 4LUEA 5IHIA 3V7CA 4A63B 2DAQA 3L2RA 1K8AU 4Z88A 4BUGA 1FX7A 3QDRB 3Q1JA 3FLGA 2ZZDA 3CQTA 1Y0MA 2DJZA 2E5KA 1VIFA 3CCVA 2C0TA 3O8VA 2V1RA 1ZA2B 3EG1A 2KSSA 1QKWA 2DFUA 1LVKA 2YT6A 3M59A 3CC4Q 3BDLA 1BBZA 3OYDA 2NLUA 1Y57A 4IUPA 3FC3A 1VQKT 4JRQA 2PTKA 1M90C 2RJCA 5I2MA 1JXMA 3UPUA 4C0ZA 2EJ9A 3J81E 5GAN4 4WTOB 3CCEA 1ZA1B 1QVGP 1VQ7T 2HQEA 3CC2T 3CBMA 3RMSA 4L6V5 1RAFB 2XI9A 2CS7A 5CK9A 4X1VA 4AMCA 4JPBW 2SEMA 2CP7A 4QVZA 2X4XA 5GMKl 2JXBA 2BUDA 3GOXA 4PJOD 1PCXA 4XTYA 2EW3A 2GFAA 2LJ3A 2XIDA 4J9GA 2ZPFB 3L2QA 3BE3A 1IB8A 2DEUA 4IUVA 1W1FA 3DKMA 3JCMJ 1EZZB 1RLPC 4CC4B 1VQOA 3RMQA 3S3OA 3A8LB 5EG2A 1SEMA 4PJNA 4VUBA 8AT1B 4PJOA 1IXDA 1YHQQ 2RK1A 1YJNA 3OQ5A 2CZ1B 1Q95G 1OPKA 4JS5A 1VA7A 2QA4A 3H6ZA 4DQ2A 2QI2A 2E10A 4PFZA 2F1LA 1GBRA 1D3BB 1N5ZA 2CUBA 2J6FA 1WJSA 3OYHA 4R55A 2CP0A 3CCJQ 4IUUA 1LPLA 1NZ9A 3EGDB 3CMET 2BZXA 2A0FB 3EH1A 4OB3B 1UTIA 1KD1R 2FZCB 2DO3A 1BI2A 3A1PA 4HVVA 1UE9A 1RI0A 1U5SA 4LD9K 1UGSB 3P8HA 2HZYA 2JN0A 2HBWA 4PJLA 4RKUE 2ROTA 4BDYA 1HSQA 4HT9A 1MMGA 1KQSA 4C8QC 4HCKA 3FJ5A 2OTJA 3JB9F 1OZ3A 5HK3A 1UGPB 1X6BA 3SHWA 4F7UB 1Y96B 2J6KA 4M77E 2K57A 3T9NA 4E6RA 1WJQA 1FXXA 1KHIA 1WGSA 1MV0B 2WACA 4MZPA 1YI2Q 5KE2A 4C8QF 2O01E 2MF2A 5J26A 4J9CA 1XOVA 1G3YA 3ZL7C 3CCSQ 2EBPA 2E70A 3CCJT 3JB9I 4C92E 6AT1B 2R5AA 1S1NA 3RKWA 3C95A 2DZCA 1WJRA 3EHRA 2KI7A 4E2FB 1C0MA 2EIFA 1G3SA 4FYXB 5LL6S 4BI8B 4E47A 2WSCE 5LJ5e 4OF1A 1KD1U 3R6NA 3GIBA 5GJVB 3X26B 4LDXA 1WFWA 4M75G 2YDLA 2IVWA 4KH1B 1V76A 4OMMA 2DL4A 5IN1A 2LC4A 1X69A 1VUBA 1D1AA 3VS5A 4M7AC 5C6SA 2V26A 2FHDA 1QLYA 2LQ8A 4OB0B 4L5GA 2J06A 1VQ4T 2KYMA 3QKJA 2VYTA 1VQ8A 1M8MA 1YJ9T 2BKDN 1YI2T 1H3ZA 4M78D 2KRSA 1M1FA 1H8KA 2LQWA 2O4XB 1UECA 2EPDA 3FDRA 2PVOB 1OV3A 3M0PA 4MZTA 4ZTFA 3CCST 5FU7C 2FYKA 2VGNA 4M7AF 4JLGA 1NLPC 4J7FA 2HL5C 5LJ5j 1Z9QA 1BI3A 1VQPA 2M9UA 2FRWA 1YITA 3QBYA 4OB2B 4M78A 3VYGA 1VQMA 3EGUA 9ATCB 4C5IA 3M0TA 4N0AC 1U8RA 3QO3A 2GGRA 4PLLA 3VUBA 1PD0A 4JZ3A 4ZTJA 1JO8A 3EHQA 4ZGEB 4NL3A 1M30A 1YCYA 3PGGA 4LNPA 2NUZA 1Y07A 2COYA 2DXCA 1Y7XA 1RABB 2KRNA 2JS0A 1TUDA 5GANf 2FVUA 1YIJQ 3J80E 2RQVA 2OJ2A 2E3IA 1GXIE 1SSFA 5FWCA 3HL8A 3L2ZA 1FYNA 4F14A 4ELYC 5FRNA 3FB9A 3RR6A 2BE9B 1Q81C 1H641 1OULA 3JB9H 3M58A 5IT9E 2FRYA 1WQ7A 1WNLA 4MDWA 3CCLT 3WVEB 2DXTA 3X25B 1KJWA 1D09B 1K9MC 2RHZA 1S72A 2YUPA 4J7IA 2E1HA 4J6YA 3A5ZB 1OEBA 4BB7A 3I56Q 2R5MA 2RM4A 1HYOA 3O5ZA 2E65A 3I55A 4YTLA 1ZQ1A 1VQNQ 2EJGA 2LQKA 3CCMQ 3CCUT 2GF7A 2P0QA 2DXBA 3CCRT 1BIAA 1M3CA 4KH0B 2ZCFB 5FU6B 1BCMA 4F17A 3G6EQ 3EFSA 1TWBA 2RJDA 4DOWA 2QQ9A 4QVDA 1UFFA 1YIJT 2PVDB 4ANJA 2EYYA 2J7IA 5GJWB 3QWYA 3R6OA 4J6XA 2V8KA 4ME7A 1XQHA 3A98A 1W6XA 1AVZC 3ZFJA 1OPLA 5DY9A 3OBWA 2RA2A 2NUPB 2EYXA 2PVGB 1ZUUA 4UC4A 1G83A 4J83A 2RN8A 1IHVA 4JRIA 2DYIA 1PKTA 3SWNC 2C06A 4HCBA 1X2QA 2V8IA 4O6JA 2RD1A 4IIMA 3NTKA 4Z8AA 2E4HA 2X3XD 1UJ0A 3I56T 4ORZA 1X43A 3CCMT 2LP5A 1D3BA 3KUFA 3LLRA 4E7HA 4FSXA 5IHNA 1NLOC 2K5IA 5M9OA 3G6ET 2AKLA 2AZSA 3QWXX 3EGDA 1K1ZA 2D9TA 4C92C 3MHXA 1UGQB 3OYGA 2A3LA 5CKBA 1TS9A 2QASA 2RHYA 2G6FX 5GMKe 3VS7A 3X24B 5CQXA 2PU9B 5LJ5g 1NG2A 2EAYA 1T0JA 3NMZC 3DB3A 4FT2A 1AWJA 1VIEA 3CC4A 4BI4A 3MPUB 5LJ3d 1WA7A 2OTJT 1RAHB 2MI6A 1M5Q1 2GCXA 2ZPGB 5AT1B 5FW9A 4F7UA 2HD0A 1Y96A 4RCCA 1PWTA 3CCQQ 5KE3A 2YLBA 2KMTA 1JU5C 4KGXB 1N27A 2RQWA 3OMCA 2PZ1A 4KGVB 1LNXA 3NPFA 1K76A 2E6NA 2OX7A 5GMKj 1I5OB 4Y92A 5AYFA 2KT8A 3C94A 1Q7YC 4RG8A 4HVWA 5HCKA 5GAN7 2DILA 2L8DA 3TVTA 1XJWB 4PJOG 3MEWA 1ZSGA 2RHIA 4KBMB 2OTLA 3EFOA 3OS1A 1BU1A 1YHQA 1VQ9Q 1WHJA 2JTMA 2M02A 3M4YA 4XK8E 1GFDA 2QDYB 3JV3A 2KE9A 3PMTA 5ECAA 2AHJB 1VQ6A 1H92A 5GAN3 2JVVA 1MMNA 3DB4A 1ARKA 4A53A 4A54A 2PUKB 3CCQT 4NOYA 2D0QB 2X4YA 3LX7A 1MGQA 4IIOA 1NM7A 3A8MB 1M90R 2JTFA 2PUOB 2DERA 2FPFA 2O4XA 3H9NA 4C8QE 1P92A 2QGFB 2E12A 3JCMe 1KG1A 1UGVA 4MMLA 1OU9A 2EWNA 4XQ3A 2J05A 1UDLA 3RERA 1E7OA 4LDYA 4HCCA 1JQQA 2LCCA 1ACMB 4DEXA 3VS6A 5GAMe 1VQMT 2VV5A 4Y28E 4XU3A 5D7UA 2KEAA 2ZPEB 2IPOB 4ZNXA 2MOXA 2P4RA 4K11A 4KRTA 2LJ0A 3M53A 2YXYA 3E2UA 2LT4A 5DLQE 3CBPA 3LH0A 2K5LA 3QXEB 4EPCA 3I35A 1M2VB 2EFIA 5J39A 5GAN6 2ESWA 4M77B 3DLLA 3CEYA 1W4SA 1JJ2S 1YFNA 1VQKQ 4A4HA 3TQ7P 5GAMf 5GAOp 1ZHIA 1BI1A 2NUTB 1ZUYA 4M4ZA 1B34B 3E1SA 4N4HA 2JMCA 4M7AE 2KK4A 5DLOA 4C8QD 2LMJA 2HCKA 3MEAA 1TTHB 4C92B 3CC7A 1WX6A 4EMHA 4C0GA 4BY6B 2RH2A 3ZEHA 2L3QA 2EGCA 2EYWA 2K79A 3OYNA 2RK2A 4J9EA 2JNGA 5A2QE 1MV3A 2X35A 4FW2A 3KFVA 2CP5A 2EQIA 4E7KA 1UHCA 2KVQG 4PNOA 3KXTA 2DIQA 4BI3A 2DETA 2GBQA 3VS2A 2JTEA 3ER0A 4FL6A 2QQBA 2YWWA 2JM8A 1PNJA 5CVIA 1U1TA 4M78G 1C6VX 3ULRB 2DL8A 1IGQA 4MZMA 1K9AA 1WPYA 1BIBA 3QZ9B 4PKCC 1BB9A 3RESA 3G1JA 4FCYA 2LJ1A 2DL5A 1CKBA 3U23A 1I4K1 3DLMA 5CKFA 5LJ5h 2DK3A 5GAN5 1SRLA 4D8KA
chains in the Genus database with same CATH topology
3SEMA 1WXUA 2YDLA 4LE9A 1YP5A 4OMMA 4EIKA 2HSPA 1WI7A 2DL4A 2RNAA 2JMAA 2RPNA 1X69A 1YN8A 1UG1A 2JS2A 2RQTA 1QWEA 2YUOA 3VS5A 1PHTA 1CSKA 1ZX6A 4JJBA 1QLYA 4OMPA 5IH2A 2J06A 1T3SA 2KYMA 1K0XA 1NYGA 1M8MA 1VYVA 1Z9ZA 2SRCA 4Z89A 2KRSA 1H8KA 2LQWA 1UECA 2EPDA 3PVLA 4F16A 2M0YA 1OV3A 3M0PA 1YWOA 1JXOA 2DVJA 1NLPC 3NGPA 3THKA 1AOJA 1Z9QA 2BTTA 2KNBB 1I1JA 5I22A 2DX1A 2FRWA 3EGUA 2NWMA 1RLQC 2JT4A 2W0ZA 2DA9A 1OOTA 3M0TA 2DMOA 4RTVA 1AWOA 2LZ6B 2GGRA 1AZGB 4JZ3A 1QCFA 1KSWA 2FPEA 1JO8A 1NYFA 3EHQA 2OI3A 2A28A 3PE0A 1M30A 2VKNA 4RTXA 4R0KA 3VRZA 4DEYA 2OAWA 5IHKA 1A0NB 2DRMA 1E6GA 2YUQA 1BK2A 4LNPA 1M3AA 3EG3A 2NUZA 5IXFA 1AWXA 1AZEA 2DF6A 4RTTA 1GRIA 2KRNA 2JS0A 1TUDA 3M0RA 1TG0A 4D8DA 2RQVA 2VWFA 2OJ2A 2DJQA 5FWCA 2CSQA 4J9HA 1FYNA 4F14A 2GNCA 1LCKA 4OMQA 4GBQA 2RQRA 3UATA 1WIEA 2FRYA 2IIMA 1NEBA 1KIKA 1J3TA 3UF4A 1AEYA 1TUCA 1NEGA 3M0UA 2C0IA 1KJWA 2DM1A 2K3BA 1HJDA 3I5RA 1M27C 1T0HA 2YUPA 3GBQA 4JZ4A 4RTZA 1AWWA 1OEBA 2CSIA 3O5ZA 1V1CA 4HVUA 1RI9A 4J9DA 3REBB 2A36A 2L3SA 2D8HA 1U3OA 2GTJA 1M3CA 4F17A 1QKXA 2K2MA 2J6OA 1UFFA 1QWFA 1T3LA 2EYYA 3NHNA 2KXDA 4CC2A 2J7IA 5GJWB 3QWYA 2KT1A 1SHFA 3IQLA 3EG0A 3A98A 1W6XA 1AVZC 2EVRA 4AG2C 1OPLA 2C0OA 2EYXA 2KR3A 1ZUUA 2DLPA 3RNJA 1G83A 1VYUA 2RN8A 1GBQA 4ESRA 1SSHA 2CDTA 2KGTA 1PKTA 2HEQA 1M3BA 5FWBA 1X2QA 1GFCA 2F2VA 2KRMA 3UA6A 1E6HA 4J9BA 1H3HA 4IIMA 1WDXA 4Z8AA 2X3XD 1SRMA 2F2WA 2DNUA 4AFUC 5EC7A 1UJ0A 4RTYA 2PNIA 2RQUA 2A08A 2KXCA 4ORZA 1YCSB 2RMOA 1X43A 4JJDA 2K9GA 2LP5A 2KROA 2W10A 5IHNA 2X3WD 1NLOC 5IXBA 2AKLA 2ED1A 2AZSA 3VS0A 3QWXX 2LQNA 1K1ZA 2DE0X 4LUDA 2CUDA 1X6GA 1WXTA 1I07A 3H0HA 1YNZA 2DL7A 2GQIA 2EKHA 1K4US 2FO0A 4LN2A 1UUEA 3I5SA 2G6FX 4OMLA 3VS7A 2O9VA 1NG2A 3C0CA 1WLPB 1T0JA 1SPKA 3NMZC 2HDAA 2DBMA 1AWJA 2AK5A 1ZUKA 1U06A 2BZ8A 1X2KA 1GCPA 2XMFA 1RUWA 1WA7A 2JW4A 2BZYA 1ABQA 4RTWA 2AZVA 2L2PA 5FW9A 2FPDA 3VS4A 4AG1C 3H0IA 1PWTA 1PRLC 1SHGA 4FSSA 1KFZA 1JU5C 3PVQA 1FMKA 1PRMC 2EGEA 3LH5A 1B07A 2DBKA 4LUEA 5IHIA 4JJCA 2RQWA 1UHFA 2PZ1A 3UA7A 4A63B 3REAB 3NPFA 1K76A 2DYBA 5I11A 2D0NA 4Y92A 4Z88A 3RBBB 2B86A 2H8HA 2KT8A 3TSZA 4RUGA 3CQTA 1Y0MA 2ENMA 2E5KA 1UJYA 4HVWA 5HCKA 4OMNA 3VS3A 2C0TA 2DILA 2V1RA 1G2BA 3TVTA 2LX7A 2ED0A 2DL3A 1VYTA 1K0SA 1X27A 1ZSGA 3EG1A 2FG0A 2I0NA 1QKWA 2YT6A 1BU1A 2CT4A 3M0SA 1GFDA 3EG2A 3TSWA 1BBZA 1I0CA 1Y57A 1W70A 2ECZA 3JV3A 2JM9A 2KE9A 5ECAA 1H92A 2PTKA 4GLMA 1JXMA 1B3QA 1ARKA 2F2XA 4HXJA 4CC7A 4IIOA 1NM7A 3VRYA 1MUZA 3H0FA 1PKSA 2FPFA 4CC3A 4X1VA 2A37A 2EGAA 1UGVA 4AFSC 4JPBW 2SEMA 2JXBA 1EFNA 2J05A 1UDLA 2EW3A 2YUNA 2CT3A 1E7OA 2LJ3A 2O2OA 4J9GA 1JQQA 4DEXA 3VS6A 2ABLA 1W1FA 1ZLMA 2FEIA 2O88A 1YWPA 2YSQA 1RLPC 2DRKA 2O9SA 4CC4B 2KEAA 4AFQC 5L23A 1SEMA 4ZNXA 2MOXA 2P4RA 4K11A 4KRTA 4RTUA 2LJ0A 2L3PA 1OPKA 2KBTA 2MCNA 1VA7A 1ABOA 2CH4W 3I35A 2K6DA 1GBRA 1WXBA 2AKKA 1N5ZA 2CUBA 2J6FA 2RF0A 2ESWA 2EYZA 2KYBA 2BZXA 2CH4A 1UTIA 3M0QA 4HVVA 1ZBJA 1UE9A 1GCQC 1JEGA 1U5SA 2K7AA 1ZUYA 2M51A 3I9QA 4M4ZA 4D8KA 4QT7A 2JMCA 2HBWA 2LNHB 4J9IA 1AD5A 2ROTA 1HSQA 2LMJA 3VS1A 2HCKA 1WX6A 4HCKA 3FJ5A 1HD3A 2D1XA 2D8JA 2O31A 1GL5A 1GCQA 2L3QA 2EGCA 2EYWA 2K79A 2VVKA 1X6BA 2ROLA 4J9EA 3SHWA 1CKAA 1MV3A 1WYXA 2J6KA 3KFVA 2EQIA 4E6RA 1UHCA 2GTOA 1MV0B 2CREA 2V1QA 4J9CA 1XOVA 2GBQA 3VS2A 2JTEA 3ZL7C 4AFZC 2EBPA 2JM8A 1PNJA 4J9FA 3H41A 1S1NA 2LCSA 3ULRB 2L0AA 2DL8A 1K9AA 3EHRA 1BB9A 1IO6A 2DL5A 2LJ1A 1CKBA 3U23A 3R6NA 2QDLA 4WCIA 4OMOA 1SRLA 5GJVB 2MIOA 1WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEM A;  1WXU A;  2YDL A;  4LE9 A;  1YP5 A;  4OMM A;  4EIK A;  2HSP A;  1WI7 A;  2DL4 A;  2RNA A;  2JMA A;  2RPN A;  1X69 A;  1YN8 A;  1UG1 A;  2JS2 A;  2RQT A;  1QWE A;  2YUO A;  3VS5 A;  1PHT A;  1CSK A;  1ZX6 A;  4JJB A;  1QLY A;  4OMP A;  5IH2 A;  2J06 A;  1T3S A;  2KYM A;  1K0X A;  1NYG A;  1M8M A;  1VYV A;  1Z9Z A;  2SRC A;  4Z89 A;  2KRS A;  1H8K A;  2LQW A;  1UEC A;  2EPD A;  3PVL A;  4F16 A;  2M0Y A;  1OV3 A;  3M0P A;  1YWO A;  1JXO A;  2DVJ A;  1NLP C;  3NGP A;  3THK A;  1AOJ A;  1Z9Q A;  2BTT A;  2KNB B;  1I1J A;  5I22 A;  2DX1 A;  2FRW A;  3EGU A;  2NWM A;  1RLQ C;  2JT4 A;  2W0Z A;  2DA9 A;  1OOT A;  3M0T A;  2DMO A;  4RTV A;  1AWO A;  2LZ6 B;  2GGR A;  1AZG B;  4JZ3 A;  1QCF A;  1KSW A;  2FPE A;  1JO8 A;  1NYF A;  3EHQ A;  2OI3 A;  2A28 A;  3PE0 A;  1M30 A;  2VKN A;  4RTX A;  4R0K A;  3VRZ A;  4DEY A;  2OAW A;  5IHK A;  1A0N B;  2DRM A;  1E6G A;  2YUQ A;  1BK2 A;  4LNP A;  1M3A A;  3EG3 A;  2NUZ A;  5IXF A;  1AWX A;  1AZE A;  2DF6 A;  4RTT A;  1GRI A;  2KRN A;  2JS0 A;  1TUD A;  3M0R A;  1TG0 A;  4D8D A;  2RQV A;  2VWF A;  2OJ2 A;  2DJQ A;  5FWC A;  2CSQ A;  4J9H A;  1FYN A;  4F14 A;  2GNC A;  1LCK A;  4OMQ A;  4GBQ A;  2RQR A;  3UAT A;  1WIE A;  2FRY A;  2IIM A;  1NEB A;  1KIK A;  1J3T A;  3UF4 A;  1AEY A;  1TUC A;  1NEG A;  3M0U A;  2C0I A;  1KJW A;  2DM1 A;  2K3B A;  1HJD A;  3I5R A;  1M27 C;  1T0H A;  2YUP A;  3GBQ A;  4JZ4 A;  4RTZ A;  1AWW A;  1OEB A;  2CSI A;  3O5Z A;  1V1C A;  4HVU A;  1RI9 A;  4J9D A;  3REB B;  2A36 A;  2L3S A;  2D8H A;  1U3O A;  2GTJ A;  1M3C A;  4F17 A;  1QKX A;  2K2M A;  2J6O A;  1UFF A;  1QWF A;  1T3L A;  2EYY A;  3NHN A;  2KXD A;  4CC2 A;  2J7I A;  5GJW B;  3QWY A;  2KT1 A;  1SHF A;  3IQL A;  3EG0 A;  3A98 A;  1W6X A;  1AVZ C;  2EVR A;  4AG2 C;  1OPL A;  2C0O A;  2EYX A;  2KR3 A;  1ZUU A;  2DLP A;  3RNJ A;  1G83 A;  1VYU A;  2RN8 A;  1GBQ A;  4ESR A;  1SSH A;  2CDT A;  2KGT A;  1PKT A;  2HEQ A;  1M3B A;  5FWB A;  1X2Q A;  1GFC A;  2F2V A;  2KRM A;  3UA6 A;  1E6H A;  4J9B A;  1H3H A;  4IIM A;  1WDX A;  4Z8A A;  2X3X D;  1SRM A;  2F2W A;  2DNU A;  4AFU C;  5EC7 A;  1UJ0 A;  4RTY A;  2PNI A;  2RQU A;  2A08 A;  2KXC A;  4ORZ A;  1YCS B;  2RMO A;  1X43 A;  4JJD A;  2K9G A;  2LP5 A;  2KRO A;  2W10 A;  5IHN A;  2X3W D;  1NLO C;  5IXB A;  2AKL A;  2ED1 A;  2AZS A;  3VS0 A;  3QWX X;  2LQN A;  1K1Z A;  2DE0 X;  4LUD A;  2CUD A;  1X6G A;  1WXT A;  1I07 A;  3H0H A;  1YNZ A;  2DL7 A;  2GQI A;  2EKH A;  1K4U S;  2FO0 A;  4LN2 A;  1UUE A;  3I5S A;  2G6F X;  4OML A;  3VS7 A;  2O9V A;  1NG2 A;  3C0C A;  1WLP B;  1T0J A;  1SPK A;  3NMZ C;  2HDA A;  2DBM A;  1AWJ A;  2AK5 A;  1ZUK A;  1U06 A;  2BZ8 A;  1X2K A;  1GCP A;  2XMF A;  1RUW A;  1WA7 A;  2JW4 A;  2BZY A;  1ABQ A;  4RTW A;  2AZV A;  2L2P A;  5FW9 A;  2FPD A;  3VS4 A;  4AG1 C;  3H0I A;  1PWT A;  1PRL C;  1SHG A;  4FSS A;  1KFZ A;  1JU5 C;  3PVQ A;  1FMK A;  1PRM C;  2EGE A;  3LH5 A;  1B07 A;  2DBK A;  4LUE A;  5IHI A;  4JJC A;  2RQW A;  1UHF A;  2PZ1 A;  3UA7 A;  4A63 B;  3REA B;  3NPF A;  1K76 A;  2DYB A;  5I11 A;  2D0N A;  4Y92 A;  4Z88 A;  3RBB B;  2B86 A;  2H8H A;  2KT8 A;  3TSZ A;  4RUG A;  3CQT A;  1Y0M A;  2ENM A;  2E5K A;  1UJY A;  4HVW A;  5HCK A;  4OMN A;  3VS3 A;  2C0T A;  2DIL A;  2V1R A;  1G2B A;  3TVT A;  2LX7 A;  2ED0 A;  2DL3 A;  1VYT A;  1K0S A;  1X27 A;  1ZSG A;  3EG1 A;  2FG0 A;  2I0N A;  1QKW A;  2YT6 A;  1BU1 A;  2CT4 A;  3M0S A;  1GFD A;  3EG2 A;  3TSW A;  1BBZ A;  1I0C A;  1Y57 A;  1W70 A;  2ECZ A;  3JV3 A;  2JM9 A;  2KE9 A;  5ECA A;  1H92 A;  2PTK A;  4GLM A;  1JXM A;  1B3Q A;  1ARK A;  2F2X A;  4HXJ A;  4CC7 A;  4IIO A;  1NM7 A;  3VRY A;  1MUZ A;  3H0F A;  1PKS A;  2FPF A;  4CC3 A;  4X1V A;  2A37 A;  2EGA A;  1UGV A;  4AFS C;  4JPB W;  2SEM A;  2JXB A;  1EFN A;  2J05 A;  1UDL A;  2EW3 A;  2YUN A;  2CT3 A;  1E7O A;  2LJ3 A;  2O2O A;  4J9G A;  1JQQ A;  4DEX A;  3VS6 A;  2ABL A;  1W1F A;  1ZLM A;  2FEI A;  2O88 A;  1YWP A;  2YSQ A;  1RLP C;  2DRK A;  2O9S A;  4CC4 B;  2KEA A;  4AFQ C;  5L23 A;  1SEM A;  4ZNX A;  2MOX A;  2P4R A;  4K11 A;  4KRT A;  4RTU A;  2LJ0 A;  2L3P A;  1OPK A;  2KBT A;  2MCN A;  1VA7 A;  1ABO A;  2CH4 W;  3I35 A;  2K6D A;  1GBR A;  1WXB A;  2AKK A;  1N5Z A;  2CUB A;  2J6F A;  2RF0 A;  2ESW A;  2EYZ A;  2KYB A;  2BZX A;  2CH4 A;  1UTI A;  3M0Q A;  4HVV A;  1ZBJ A;  1UE9 A;  1GCQ C;  1JEG A;  1U5S A;  2K7A A;  1ZUY A;  2M51 A;  3I9Q A;  4M4Z A;  4D8K A;  4QT7 A;  2JMC A;  2HBW A;  2LNH B;  4J9I A;  1AD5 A;  2ROT A;  1HSQ A;  2LMJ A;  3VS1 A;  2HCK A;  1WX6 A;  4HCK A;  3FJ5 A;  1HD3 A;  2D1X A;  2D8J A;  2O31 A;  1GL5 A;  1GCQ A;  2L3Q A;  2EGC A;  2EYW A;  2K79 A;  2VVK A;  1X6B A;  2ROL A;  4J9E A;  3SHW A;  1CKA A;  1MV3 A;  1WYX A;  2J6K A;  3KFV A;  2EQI A;  4E6R A;  1UHC A;  2GTO A;  1MV0 B;  2CRE A;  2V1Q A;  4J9C A;  1XOV A;  2GBQ A;  3VS2 A;  2JTE A;  3ZL7 C;  4AFZ C;  2EBP A;  2JM8 A;  1PNJ A;  4J9F A;  3H41 A;  1S1N A;  2LCS A;  3ULR B;  2L0A A;  2DL8 A;  1K9A A;  3EHR A;  1BB9 A;  1IO6 A;  2DL5 A;  2LJ1 A;  1CKB A;  3U23 A;  3R6N A;  2QDL A;  4WCI A;  4OMO A;  1SRL A;  5GJV B;  2MIO A;  1WFW A; 
#chains in the Genus database with same CATH topology
 5CCA A;  3SEM A;  3CME Q;  2QK0 A;  3ASK A;  4LE9 A;  2RB6 A;  2YRC A;  3GPL A;  2CYZ B;  2JOY A;  1YN8 A;  2D6F A;  2YUO A;  1CSK A;  4PFP A;  5IH2 A;  4XTW A;  1PC0 A;  2CGH A;  1NPP A;  5KCO A;  2I2L A;  3HKS A;  1KQ1 A;  4M7D C;  1PG5 B;  5CO7 A;  2SRC A;  1R0B G;  4XU0 A;  1OQK A;  1UEB A;  3F70 A;  1PM3 A;  1YWO A;  3OYJ A;  3S6W A;  1C1A A;  2BTT A;  2KNB B;  1I1J A;  4II1 A;  4XU2 A;  4M7D F;  4EMG A;  3QJY A;  1AWO A;  3CD6 T;  4C0F A;  2X4J A;  1OX8 A;  2LZ6 B;  5HY6 A;  1AZG B;  3GNF B;  4ZGD B;  2DTO A;  1R8O B;  3M56 A;  2VXF A;  5CKH A;  2OI3 A;  3BFM A;  3PE0 A;  1UB4 A;  4RTX A;  4R0K A;  1VQN A;  3VRZ A;  3HPW A;  3EG3 A;  4N0A A;  1YJW T;  3HTR A;  3M0R A;  1TG0 A;  2DTH A;  2XG8 D;  2VWF A;  1OZ2 A;  2DJQ A;  4FT4 A;  3HRS A;  2COW A;  2KQW A;  3CMA Q;  3JCM g;  2HKN A;  1WIE A;  4F04 B;  3PMI A;  1RAE B;  1VQ4 Q;  2IIM A;  1NEB A;  4DBQ A;  1KIK A;  1J3T A;  4FYW B;  3G71 A;  3G4S A;  1TUC A;  1YJ9 Q;  3JCM P;  1Q81 R;  3PNW C;  2XKO C;  4B9W A;  1TXQ A;  2DM1 A;  3L2U A;  3I5R A;  3FJP A;  4JZ4 A;  2OTL T;  4RTZ A;  1WHM A;  3HFN A;  1K9M R;  3VV0 A;  4J9D A;  3REB B;  2A36 A;  2L3S A;  2QQR A;  3CXC S;  3H8Z A;  1KC8 C;  2J6O A;  4Z02 A;  3OA6 A;  2QEX Q;  4OGC A;  3ZBD A;  3NHN A;  2KXD A;  3CMA T;  2KT1 A;  1KQS P;  5KYU B;  3EG0 A;  2EKO A;  5CKE A;  1VQ5 A;  1M1K C;  4P5N A;  1K73 U;  2X51 A;  2KR3 A;  2DLP A;  2EQJ A;  4FYY B;  4PL6 A;  4WF2 A;  2CZ0 B;  2RHU A;  4FIB A;  2CDT A;  5GMK m;  4F7U G;  1JJ2 A;  5I2S A;  5KYX A;  4L59 A;  4M77 D;  5GAN e;  3UA6 A;  3OYC A;  1Q81 U;  4J9B A;  5GAO r;  3V7R A;  3VKI A;  4MMK A;  1D0X A;  4PJO C;  4RTY A;  2PNI A;  5GAN 2;  2A08 A;  2KXC A;  3CCL Q;  3CPW S;  3C12 A;  1YCS B;  3OB9 A;  2RMO A;  4JJD A;  2K9G A;  4E7Z A;  1M1G A;  5FRM A;  1M2V A;  4E7J A;  3MP1 A;  2X3W D;  4PFO A;  5IXB A;  1K9M U;  3QSU A;  2ED1 A;  4M77 A;  3VS0 A;  4ZGJ B;  2XDP A;  4C92 D;  2QEX T;  5LJ3 f;  2LVM A;  1X6G A;  2CZ7 B;  4PJO F;  3QZ5 B;  1YNZ A;  2GQI A;  4CI0 C;  2EKH A;  1X6O A;  4PLI A;  1K4U S;  3VJP A;  3CCU Q;  3TEE A;  5GMK h;  1B34 A;  4OML A;  3CCR Q;  1K73 C;  3C0C A;  1KK7 A;  2HDA A;  2EJF A;  1QVP A;  4MDX A;  3L1A A;  2DBM A;  4C92 A;  4FU6 A;  2AK5 A;  3CCE Q;  2BZ8 A;  1U06 A;  3AHU A;  2XMF A;  3CBO A;  2JW4 A;  1ABQ A;  2QG9 B;  3EH2 A;  2QGG A;  4AG1 C;  2KY9 A;  4FSS A;  1JJ2 P;  1KFZ A;  2EYQ A;  3PVQ A;  1FMK A;  2F69 A;  3CCV T;  2KDS A;  4C5H A;  1UHF A;  1N8R U;  3UA7 A;  3MCA B;  1VQL A;  3REA B;  1Q82 C;  3VUZ A;  1VQO Q;  4DBR A;  1NBE B;  2DYB A;  5I11 A;  4PJJ A;  3RBB B;  2RI3 A;  1Q86 C;  4XTZ A;  4RUG A;  3L2V A;  4C8Q B;  2QA4 Q;  4M75 E;  1ZBX A;  4OMN A;  3MJX A;  5A0D A;  1G2B A;  1K0S A;  1VYT A;  1Q7Y R;  1U1S A;  3LWH A;  3BDU A;  3CCE T;  2MAM A;  3M0S A;  2HSE B;  2QQA A;  1I0C A;  4IUR A;  1NJI U;  4CRI A;  1SKU B;  1W70 A;  4B6M A;  2ECZ A;  2G3R A;  4C5E A;  4JDS A;  4X34 A;  1UGR B;  4GLM A;  1PD1 A;  1Y71 A;  4KUL A;  4J6W A;  2F2X A;  4CC7 A;  3VRY A;  1PKS A;  4OP0 A;  2OTJ Q;  1N8R C;  1VQK A;  1BI0 A;  3EAE A;  5GMK i;  2A37 A;  3JCM h;  3OSV A;  1VQO T;  4PJM A;  2XHC A;  1EFN A;  2CT3 A;  3E19 A;  1YJN T;  4PK4 A;  4LDU A;  1VQ7 A;  3FIF A;  3CC2 A;  4LDV A;  2QA4 T;  4AT1 B;  5GAM h;  2ABL A;  5GAO m;  1ZLM A;  2FEI A;  2O88 A;  4HT8 A;  5D6W A;  1YWP A;  2YSQ A;  2E6Z A;  1XNI A;  3TU4 K;  4M7A B;  5L23 A;  3JCM V;  4C8Q G;  1KHC A;  1NJI C;  1OX9 A;  2L3P A;  2XU8 A;  2K4Y A;  2LNV A;  3JAM E;  5D6Y A;  1ABO A;  3HRU A;  3M57 A;  1Q7Y U;  3E9F A;  1N6A A;  2CP3 A;  3ME9 A;  4C5G A;  2K6D A;  1WXB A;  2AKK A;  4M78 F;  4J8O A;  3QII A;  5FU7 B;  5LJ5 d;  2KYB A;  3M5A A;  2CH4 A;  2L89 A;  4EMK C;  2LCL A;  4BAC A;  3M0Q A;  1GCQ C;  5CAI A;  1JEG A;  2MPX C;  3I9Q A;  4LDW A;  2H3J A;  3QPH A;  4OVA A;  3CXC A;  1D0Y A;  3M55 A;  3MO8 A;  4IUQ A;  3WXM B;  3NFC A;  3M9Q A;  3VS1 A;  1VQ8 Q;  1R0C B;  1HD3 A;  2D8J A;  4LXC A;  2QAZ A;  2O31 A;  4M7D E;  1GL5 A;  4JS4 A;  4QQG A;  2BE7 D;  2ZPH B;  2Y90 A;  2EQM A;  2FZK B;  3LWI A;  5A0G A;  2GTO A;  5CKD A;  1QP3 A;  2CRE A;  1VQP Q;  4BE2 A;  1VQM Q;  3OW2 S;  4QQ6 A;  3M54 A;  4QQD A;  5D6X A;  5GAO q;  3MP6 A;  1HXD A;  1QCO A;  1X01 A;  1ZSZ C;  5CQY A;  4J9F A;  2K2V A;  5FRO A;  3H41 A;  2HMA A;  2M16 A;  4TVR A;  2LCS A;  5KYU A;  3SB2 A;  2L0A A;  2VB6 A;  3OYA A;  3CPW A;  1EIF A;  4JJN K;  1VQ5 T;  3G7Z A;  4WCI A;  2HL3 A;  3PFS A;  3CCJ A;  3P8B B;  1WXU A;  2RJF A;  4N4I A;  3OYK A;  1VQ8 T;  1M9S A;  3CXC P;  2HSP A;  3V8J A;  3OBY A;  2RPN A;  1RAC B;  4GY5 A;  1UG1 A;  1PSF A;  2RQT A;  1QWE A;  4XU1 A;  1PHT A;  4JUV A;  3LGL A;  4OMP A;  1AHJ B;  5GAN 8;  1T3S A;  3UT1 A;  1I8F A;  1K0X A;  2QTX A;  3JCM W;  1NYG A;  1VYV A;  4M7D D;  2ZAE A;  1VQP T;  3MP8 A;  4KT0 E;  1YIT T;  2HAX A;  3PVL A;  4F16 A;  5IAY A;  2MWP A;  5KCH A;  1EX4 A;  1JB0 E;  1W2B S;  1S72 Q;  1JXO A;  1VQ4 A;  3NGP A;  3THK A;  4RG2 A;  4M75 C;  5DM7 R;  5KYY B;  2Y4X A;  3OYE A;  1YJ9 A;  3I55 Q;  2DX1 A;  3EFR A;  1YI2 A;  2YHT A;  2NWM A;  3RIR A;  1RLQ C;  2JT4 A;  3SWN B;  2DA9 A;  1OOT A;  3CCS A;  4RTV A;  1QVF S;  3LYI A;  1KSW A;  2FPE A;  2XIC A;  3JB9 D;  2AT1 B;  1NYF A;  3VYH B;  4FYV B;  2VKN A;  4M75 F;  4B9X A;  5IHK A;  2LX9 A;  2DRM A;  4O5V A;  2QTV A;  1BK2 A;  2JUF A;  1M3A A;  1AWX A;  1AZE A;  5GAM j;  4BD3 A;  2A7Y A;  2DF6 A;  1GRI A;  3JB9 J;  4D8D A;  1FWZ A;  2QQS A;  2GNC A;  2EQK A;  2P0K A;  4OMQ A;  2HBP A;  2RQR A;  2E5Q A;  1S72 T;  4E7I A;  4F7U F;  1DJ7 B;  2AIR B;  3EG9 B;  4QKU A;  3UF4 A;  4V2S A;  4C8Q A;  4PJO E;  1NEG A;  3I55 T;  3SDZ A;  2C0I A;  1MMD A;  4EMK B;  1NPR A;  1BCO A;  3BY7 A;  4N4G A;  2E3H A;  4D6W A;  2CSI A;  3MKD A;  2RJE A;  3CCL A;  4ZN1 A;  3MET A;  2DVE A;  3OYY A;  2MYS A;  4M77 G;  2NUP A;  3SFM A;  2D8H A;  2WSE E;  2GTJ A;  3CD6 Q;  4ELZ C;  2K2M A;  1QWF A;  4C0D C;  4Y91 A;  4CC2 A;  2VXE A;  2ATC B;  4KUI A;  5L8R E;  3V7S A;  1KC8 R;  3CCU A;  4M7A D;  4AG2 C;  2EVR A;  3CCR A;  4C92 G;  1RL2 A;  5KYW B;  2QYZ A;  1YJW Q;  2LTO A;  5LJ3 h;  1YIJ A;  4JRK A;  1LJO A;  1ZSZ B;  2Y4Y A;  4X9C A;  1GBQ A;  4ESR A;  1SSH A;  2DKG A;  1M1K R;  2HEQ A;  1M3B A;  2COZ A;  4EDU A;  3A8O B;  4M7A A;  2HKQ B;  2KRM A;  2P4T A;  1E6H A;  3URG A;  5GAN h;  1WDX A;  2GFU A;  1K8A C;  1IHW A;  1SRM A;  1BKB A;  2RQU A;  1V29 B;  2DPP B;  1KQ2 A;  1QW1 A;  4R56 A;  2LQN A;  2OTL Q;  5HKC A;  3NTH A;  3CC4 T;  4LUD A;  2JZ2 A;  3I56 A;  1WXT A;  1I07 A;  1R77 A;  2FO0 A;  3CCM A;  1VQ6 Q;  3X20 B;  2P84 A;  3E9G A;  2RHX A;  1HK9 A;  3OW2 A;  1WQW A;  1SPK A;  3G6E A;  5KYN A;  1KC8 U;  4BDZ A;  3A8G B;  4A4E A;  1ZUK A;  1X2K A;  1GCP A;  1K73 R;  2X4W A;  4M75 B;  2PQW A;  4RTW A;  3RKX A;  2L2P A;  2FPD A;  3VS4 A;  3JCM d;  1D1B A;  3H0I A;  1M1K U;  1SHG A;  1PRL C;  4ZN3 A;  3UDC A;  2E41 A;  2M0O A;  2VAS A;  3OYI A;  8ATC B;  2EGE A;  3LH5 A;  5GAM g;  1B07 A;  2DBK A;  2R57 A;  4ATO A;  2MK5 A;  4JJC A;  4JLI A;  5FU6 C;  5GAM d;  4M78 E;  5FLX E;  2ZPI B;  2D0N A;  2P0P A;  1D1C A;  2CP2 A;  2B86 A;  2H8H A;  1YHQ T;  2YLC A;  3TSZ A;  2Z0W A;  2ENM A;  1Q82 R;  1UJY A;  2MWO A;  1VQ6 T;  1OU8 A;  3VS3 A;  1WZO A;  1IRX A;  2LX7 A;  2ED0 A;  2DL3 A;  3EGX B;  1Q86 R;  1X27 A;  1FMV A;  2FG0 A;  2I0N A;  1W2B A;  3OW2 P;  2CT4 A;  3EG2 A;  3TSW A;  3JCM b;  2JM9 A;  1YBY A;  1WHH A;  1B3Q A;  3MEU A;  5LJ3 e;  3OS0 A;  4HXJ A;  1QVF A;  1MUZ A;  2QXF A;  3H0F A;  3CC7 Q;  3EFO B;  5C0M A;  3QYG B;  4IKF A;  4CC3 A;  2VGM A;  2EGA A;  5HK0 A;  4AFS C;  2HNI A;  3CCQ A;  4HKE A;  2LDM A;  5KYY A;  1N8R R;  3HRT A;  2YUN A;  2CKK A;  3S3M A;  7AT1 B;  2O2O A;  4C0D B;  3CCV Q;  1NE8 A;  3SWN A;  5CR2 A;  1G5V A;  1RAD B;  3L42 A;  1QCN A;  2DRK A;  2O9S A;  4AFQ C;  1Q82 U;  5LJ5 f;  4RTU A;  3L2W A;  5GAO l;  2LRQ A;  5LJ3 j;  2FL7 A;  1Q86 U;  2KBT A;  2MCN A;  3A8H B;  1W2B P;  2NUT A;  2KAF A;  4M7D B;  3OSS C;  2CH4 W;  3GNG A;  1KD1 C;  1NJI R;  2RF0 A;  5GAN j;  2EYZ A;  1VQ9 A;  3CC7 T;  4A4F A;  1TUG B;  4XAX B;  1N9R A;  1QVF P;  1ZBJ A;  3RUX A;  1M4Z A;  2K7A A;  1MND A;  2M51 A;  3AT1 B;  4QT7 A;  2L5Q A;  5KH6 A;  3EG9 A;  3GP8 A;  2LNH B;  4J9I A;  1AD5 A;  1TH7 A;  3TCJ A;  2NYS A;  4BE0 A;  4EMK A;  4KGZ B;  3FEO A;  4OB1 B;  2D1X A;  4IUT A;  3OYB A;  2R58 A;  3CPF A;  3PIP A;  1GCQ A;  1MHN A;  1QP2 A;  2VVK A;  3SD4 A;  2L3R A;  2ROL A;  3PIO A;  3J7A F;  1CKA A;  2IG0 A;  3VU3 C;  1WYX A;  1TOV A;  3JCM Q;  4DBF A;  1TU0 B;  1YJN Q;  4DBH A;  3JCM c;  3S3N A;  2V1Q A;  3HFO A;  4E7S A;  4AFZ C;  1WHL A;  1WHK A;  4HCZ A;  2DXU A;  4M7D G;  5J3B A;  1FMW A;  3QDF A;  2XDB A;  3V8K A;  1TSF A;  1IO6 A;  1D0Z A;  1O75 A;  5KYW A;  4A4G A;  1QVG S;  4QW2 A;  2QDL A;  4F7U E;  4OMO A;  2MIO A;  2DEQ A;  1F1B B;  1IGU A;  3JRZ A;  1ZSZ A;  1MNE A;  2CZ6 B;  1N9S A;  1IZ6 A;  2F5K A;  1YP5 A;  4EIK A;  2RNA A;  1WI7 A;  3V8L A;  2JMA A;  1PSE A;  3P8D A;  2JS2 A;  4LD6 A;  2RI5 A;  4XTU A;  1ZX6 A;  4JJB A;  4RCB A;  3X28 B;  3JB9 G;  5GAO n;  3G71 Q;  3BW1 A;  3G4S Q;  1Z9Z A;  3OYL A;  1QMC A;  5I21 A;  4Z89 A;  4M78 C;  1RAG B;  2BIV A;  4A4K A;  2M0Y A;  1X75 C;  3PT9 A;  4M77 C;  1B7T A;  2DVJ A;  2VC8 A;  4Q5W A;  4M75 D;  1AOJ A;  2F5T X;  2FB7 A;  5I22 A;  1VQN T;  1SG5 A;  2YRD A;  2DZ9 A;  2W0Z A;  2DMO A;  4OMF B;  3D7S B;  2X9H A;  1QCF A;  3MEV A;  4M77 F;  3RKY A;  4BY6 C;  3QG1 A;  3HSB A;  4M75 A;  4PJO B;  2A28 A;  2K5F A;  2H3E B;  2HQH A;  4DEY A;  2OAW A;  1A0N B;  2MMP A;  1E6G A;  2YUQ A;  1VQ5 Q;  2CP6 A;  5IXF A;  3QHS A;  5LJ3 g;  4RTT A;  2XDD A;  3CD6 A;  1G8X A;  4RMO A;  3INZ A;  1AT1 B;  2RI2 A;  3CME A;  3G71 T;  3G4S T;  1M8V A;  3M4G A;  4C92 F;  2GQV A;  2CSQ A;  4J9H A;  4NL2 A;  1WHG A;  1I81 A;  1LCK A;  4KUD K;  1O9S A;  5GAN g;  4GBQ A;  3UAT A;  1YJW A;  5GAN d;  3TRE A;  1AEY A;  1LOJ A;  4QVC A;  1G3T A;  2E64 A;  3M0U A;  3WVD B;  1YIT Q;  4M7A G;  3OS5 A;  2XD0 A;  3EGX A;  1JRI A;  2K3B A;  1HJD A;  1M27 C;  1T0H A;  3GBQ A;  2ZPB B;  1AWW A;  4J5Y A;  4HA8 A;  1SF9 A;  3JCM X;  4XTX A;  4OGE A;  2OAU A;  1V1C A;  4HVU A;  5CIU A;  1RI9 A;  3GF5 A;  3LW5 E;  2M1H A;  3RDV A;  3LGF A;  4X9D A;  1U3O A;  4JRP A;  1QKX A;  1KQS S;  1T3L A;  4E7L A;  1SHF A;  3JSC A;  3IQL A;  2V8J A;  3HHT B;  2C0O A;  2FZG B;  4DOV A;  3RNJ A;  1VYU A;  3OYF A;  1MMA A;  2KGT A;  3CMA A;  2B8A A;  3PTA A;  5FWB A;  4NS5 A;  5A0L A;  1VQL Q;  1GFC A;  2F2V A;  2RO0 A;  3OS2 A;  1H3H A;  4FW1 A;  4XTV A;  2F2W A;  2DNU A;  2VUB A;  4AFU C;  5EC7 A;  2HQX A;  2JJ9 A;  4GLK A;  4M7D A;  2DD4 A;  3OMG A;  3UWN A;  1K8A R;  3FRN A;  3GLX A;  3OY9 A;  1G3W A;  2KRO A;  1M2O A;  1VOM A;  2W10 A;  1IRE B;  4DA4 A;  2LT1 A;  3CPW P;  1RAA B;  1XTD A;  2DIG A;  5KYX B;  2DTI A;  2DE0 X;  2K3Y A;  2CUD A;  1VQ9 T;  3QUI A;  3H0H A;  2DL7 A;  4LN2 A;  1UUE A;  3N5B B;  2DD5 A;  3I5S A;  3NTI A;  2O9V A;  4M78 B;  1WLP B;  2ZGW A;  1JBM A;  3JCM f;  2K3X A;  2YRV A;  2QEX A;  1OYX A;  1I5L A;  2XK0 A;  1OI1 A;  1BYM A;  1RUW A;  4BE1 A;  2BZY A;  1RAI B;  2WSF E;  4FM4 B;  3C4S A;  2EQU A;  2AZV A;  3QJ6 A;  1VQL T;  1M90 U;  1QVG A;  3HP9 A;  3QYH B;  1PRM C;  1QQJ A;  3OYM A;  1VQ7 Q;  3CC2 Q;  3KBG A;  4LUE A;  5IHI A;  3V7C A;  4A63 B;  2DAQ A;  3L2R A;  1K8A U;  4Z88 A;  4BUG A;  1FX7 A;  3QDR B;  3Q1J A;  3FLG A;  2ZZD A;  3CQT A;  1Y0M A;  2DJZ A;  2E5K A;  1VIF A;  3CCV A;  2C0T A;  3O8V A;  2V1R A;  1ZA2 B;  3EG1 A;  2KSS A;  1QKW A;  2DFU A;  1LVK A;  2YT6 A;  3M59 A;  3CC4 Q;  3BDL A;  1BBZ A;  3OYD A;  2NLU A;  1Y57 A;  4IUP A;  3FC3 A;  1VQK T;  4JRQ A;  2PTK A;  1M90 C;  2RJC A;  5I2M A;  1JXM A;  3UPU A;  4C0Z A;  2EJ9 A;  3J81 E;  5GAN 4;  4WTO B;  3CCE A;  1ZA1 B;  1QVG P;  1VQ7 T;  2HQE A;  3CC2 T;  3CBM A;  3RMS A;  4L6V 5;  1RAF B;  2XI9 A;  2CS7 A;  5CK9 A;  4X1V A;  4AMC A;  4JPB W;  2SEM A;  2CP7 A;  4QVZ A;  2X4X A;  5GMK l;  2JXB A;  2BUD A;  3GOX A;  4PJO D;  1PCX A;  4XTY A;  2EW3 A;  2GFA A;  2LJ3 A;  2XID A;  4J9G A;  2ZPF B;  3L2Q A;  3BE3 A;  1IB8 A;  2DEU A;  4IUV A;  1W1F A;  3DKM A;  3JCM J;  1EZZ B;  1RLP C;  4CC4 B;  1VQO A;  3RMQ A;  3S3O A;  3A8L B;  5EG2 A;  1SEM A;  4PJN A;  4VUB A;  8AT1 B;  4PJO A;  1IXD A;  1YHQ Q;  2RK1 A;  1YJN A;  3OQ5 A;  2CZ1 B;  1Q95 G;  1OPK A;  4JS5 A;  1VA7 A;  2QA4 A;  3H6Z A;  4DQ2 A;  2QI2 A;  2E10 A;  4PFZ A;  2F1L A;  1GBR A;  1D3B B;  1N5Z A;  2CUB A;  2J6F A;  1WJS A;  3OYH A;  4R55 A;  2CP0 A;  3CCJ Q;  4IUU A;  1LPL A;  1NZ9 A;  3EGD B;  3CME T;  2BZX A;  2A0F B;  3EH1 A;  4OB3 B;  1UTI A;  1KD1 R;  2FZC B;  2DO3 A;  1BI2 A;  3A1P A;  4HVV A;  1UE9 A;  1RI0 A;  1U5S A;  4LD9 K;  1UGS B;  3P8H A;  2HZY A;  2JN0 A;  2HBW A;  4PJL A;  4RKU E;  2ROT A;  4BDY A;  1HSQ A;  4HT9 A;  1MMG A;  1KQS A;  4C8Q C;  4HCK A;  3FJ5 A;  2OTJ A;  3JB9 F;  1OZ3 A;  5HK3 A;  1UGP B;  1X6B A;  3SHW A;  4F7U B;  1Y96 B;  2J6K A;  4M77 E;  2K57 A;  3T9N A;  4E6R A;  1WJQ A;  1FXX A;  1KHI A;  1WGS A;  1MV0 B;  2WAC A;  4MZP A;  1YI2 Q;  5KE2 A;  4C8Q F;  2O01 E;  2MF2 A;  5J26 A;  4J9C A;  1XOV A;  1G3Y A;  3ZL7 C;  3CCS Q;  2EBP A;  2E70 A;  3CCJ T;  3JB9 I;  4C92 E;  6AT1 B;  2R5A A;  1S1N A;  3RKW A;  3C95 A;  2DZC A;  1WJR A;  3EHR A;  2KI7 A;  4E2F B;  1C0M A;  2EIF A;  1G3S A;  4FYX B;  5LL6 S;  4BI8 B;  4E47 A;  2WSC E;  5LJ5 e;  4OF1 A;  1KD1 U;  3R6N A;  3GIB A;  5GJV B;  3X26 B;  4LDX A;  1WFW A;  4M75 G;  2YDL A;  2IVW A;  4KH1 B;  1V76 A;  4OMM A;  2DL4 A;  5IN1 A;  2LC4 A;  1X69 A;  1VUB A;  1D1A A;  3VS5 A;  4M7A C;  5C6S A;  2V26 A;  2FHD A;  1QLY A;  2LQ8 A;  4OB0 B;  4L5G A;  2J06 A;  1VQ4 T;  2KYM A;  3QKJ A;  2VYT A;  1VQ8 A;  1M8M A;  1YJ9 T;  2BKD N;  1YI2 T;  1H3Z A;  4M78 D;  2KRS A;  1M1F A;  1H8K A;  2LQW A;  2O4X B;  1UEC A;  2EPD A;  3FDR A;  2PVO B;  1OV3 A;  3M0P A;  4MZT A;  4ZTF A;  3CCS T;  5FU7 C;  2FYK A;  2VGN A;  4M7A F;  4JLG A;  1NLP C;  4J7F A;  2HL5 C;  5LJ5 j;  1Z9Q A;  1BI3 A;  1VQP A;  2M9U A;  2FRW A;  1YIT A;  3QBY A;  4OB2 B;  4M78 A;  3VYG A;  1VQM A;  3EGU A;  9ATC B;  4C5I A;  3M0T A;  4N0A C;  1U8R A;  3QO3 A;  2GGR A;  4PLL A;  3VUB A;  1PD0 A;  4JZ3 A;  4ZTJ A;  1JO8 A;  3EHQ A;  4ZGE B;  4NL3 A;  1M30 A;  1YCY A;  3PGG A;  4LNP A;  2NUZ A;  1Y07 A;  2COY A;  2DXC A;  1Y7X A;  1RAB B;  2KRN A;  2JS0 A;  1TUD A;  5GAN f;  2FVU A;  1YIJ Q;  3J80 E;  2RQV A;  2OJ2 A;  2E3I A;  1GXI E;  1SSF A;  5FWC A;  3HL8 A;  3L2Z A;  1FYN A;  4F14 A;  4ELY C;  5FRN A;  3FB9 A;  3RR6 A;  2BE9 B;  1Q81 C;  1H64 1;  1OUL A;  3JB9 H;  3M58 A;  5IT9 E;  2FRY A;  1WQ7 A;  1WNL A;  4MDW A;  3CCL T;  3WVE B;  2DXT A;  3X25 B;  1KJW A;  1D09 B;  1K9M C;  2RHZ A;  1S72 A;  2YUP A;  4J7I A;  2E1H A;  4J6Y A;  3A5Z B;  1OEB A;  4BB7 A;  3I56 Q;  2R5M A;  2RM4 A;  1HYO A;  3O5Z A;  2E65 A;  3I55 A;  4YTL A;  1ZQ1 A;  1VQN Q;  2EJG A;  2LQK A;  3CCM Q;  3CCU T;  2GF7 A;  2P0Q A;  2DXB A;  3CCR T;  1BIA A;  1M3C A;  4KH0 B;  2ZCF B;  5FU6 B;  1BCM A;  4F17 A;  3G6E Q;  3EFS A;  1TWB A;  2RJD A;  4DOW A;  2QQ9 A;  4QVD A;  1UFF A;  1YIJ T;  2PVD B;  4ANJ A;  2EYY A;  2J7I A;  5GJW B;  3QWY A;  3R6O A;  4J6X A;  2V8K A;  4ME7 A;  1XQH A;  3A98 A;  1W6X A;  1AVZ C;  3ZFJ A;  1OPL A;  5DY9 A;  3OBW A;  2RA2 A;  2NUP B;  2EYX A;  2PVG B;  1ZUU A;  4UC4 A;  1G83 A;  4J83 A;  2RN8 A;  1IHV A;  4JRI A;  2DYI A;  1PKT A;  3SWN C;  2C06 A;  4HCB A;  1X2Q A;  2V8I A;  4O6J A;  2RD1 A;  4IIM A;  3NTK A;  4Z8A A;  2E4H A;  2X3X D;  1UJ0 A;  3I56 T;  4ORZ A;  1X43 A;  3CCM T;  2LP5 A;  1D3B A;  3KUF A;  3LLR A;  4E7H A;  4FSX A;  5IHN A;  1NLO C;  2K5I A;  5M9O A;  3G6E T;  2AKL A;  2AZS A;  3QWX X;  3EGD A;  1K1Z A;  2D9T A;  4C92 C;  3MHX A;  1UGQ B;  3OYG A;  2A3L A;  5CKB A;  1TS9 A;  2QAS A;  2RHY A;  2G6F X;  5GMK e;  3VS7 A;  3X24 B;  5CQX A;  2PU9 B;  5LJ5 g;  1NG2 A;  2EAY A;  1T0J A;  3NMZ C;  3DB3 A;  4FT2 A;  1AWJ A;  1VIE A;  3CC4 A;  4BI4 A;  3MPU B;  5LJ3 d;  1WA7 A;  2OTJ T;  1RAH B;  2MI6 A;  1M5Q 1;  2GCX A;  2ZPG B;  5AT1 B;  5FW9 A;  4F7U A;  2HD0 A;  1Y96 A;  4RCC A;  1PWT A;  3CCQ Q;  5KE3 A;  2YLB A;  2KMT A;  1JU5 C;  4KGX B;  1N27 A;  2RQW A;  3OMC A;  2PZ1 A;  4KGV B;  1LNX A;  3NPF A;  1K76 A;  2E6N A;  2OX7 A;  5GMK j;  1I5O B;  4Y92 A;  5AYF A;  2KT8 A;  3C94 A;  1Q7Y C;  4RG8 A;  4HVW A;  5HCK A;  5GAN 7;  2DIL A;  2L8D A;  3TVT A;  1XJW B;  4PJO G;  3MEW A;  1ZSG A;  2RHI A;  4KBM B;  2OTL A;  3EFO A;  3OS1 A;  1BU1 A;  1YHQ A;  1VQ9 Q;  1WHJ A;  2JTM A;  2M02 A;  3M4Y A;  4XK8 E;  1GFD A;  2QDY B;  3JV3 A;  2KE9 A;  3PMT A;  5ECA A;  2AHJ B;  1VQ6 A;  1H92 A;  5GAN 3;  2JVV A;  1MMN A;  3DB4 A;  1ARK A;  4A53 A;  4A54 A;  2PUK B;  3CCQ T;  4NOY A;  2D0Q B;  2X4Y A;  3LX7 A;  1MGQ A;  4IIO A;  1NM7 A;  3A8M B;  1M90 R;  2JTF A;  2PUO B;  2DER A;  2FPF A;  2O4X A;  3H9N A;  4C8Q E;  1P92 A;  2QGF B;  2E12 A;  3JCM e;  1KG1 A;  1UGV A;  4MML A;  1OU9 A;  2EWN A;  4XQ3 A;  2J05 A;  1UDL A;  3RER A;  1E7O A;  4LDY A;  4HCC A;  1JQQ A;  2LCC A;  1ACM B;  4DEX A;  3VS6 A;  5GAM e;  1VQM T;  2VV5 A;  4Y28 E;  4XU3 A;  5D7U A;  2KEA A;  2ZPE B;  2IPO B;  4ZNX A;  2MOX A;  2P4R A;  4K11 A;  4KRT A;  2LJ0 A;  3M53 A;  2YXY A;  3E2U A;  2LT4 A;  5DLQ E;  3CBP A;  3LH0 A;  2K5L A;  3QXE B;  4EPC A;  3I35 A;  1M2V B;  2EFI A;  5J39 A;  5GAN 6;  2ESW A;  4M77 B;  3DLL A;  3CEY A;  1W4S A;  1JJ2 S;  1YFN A;  1VQK Q;  4A4H A;  3TQ7 P;  5GAM f;  5GAO p;  1ZHI A;  1BI1 A;  2NUT B;  1ZUY A;  4M4Z A;  1B34 B;  3E1S A;  4N4H A;  2JMC A;  4M7A E;  2KK4 A;  5DLO A;  4C8Q D;  2LMJ A;  2HCK A;  3MEA A;  1TTH B;  4C92 B;  3CC7 A;  1WX6 A;  4EMH A;  4C0G A;  4BY6 B;  2RH2 A;  3ZEH A;  2L3Q A;  2EGC A;  2EYW A;  2K79 A;  3OYN A;  2RK2 A;  4J9E A;  2JNG A;  5A2Q E;  1MV3 A;  2X35 A;  4FW2 A;  3KFV A;  2CP5 A;  2EQI A;  4E7K A;  1UHC A;  2KVQ G;  4PNO A;  3KXT A;  2DIQ A;  4BI3 A;  2DET A;  2GBQ A;  3VS2 A;  2JTE A;  3ER0 A;  4FL6 A;  2QQB A;  2YWW A;  2JM8 A;  1PNJ A;  5CVI A;  1U1T A;  4M78 G;  1C6V X;  3ULR B;  2DL8 A;  1IGQ A;  4MZM A;  1K9A A;  1WPY A;  1BIB A;  3QZ9 B;  4PKC C;  1BB9 A;  3RES A;  3G1J A;  4FCY A;  2LJ1 A;  2DL5 A;  1CKB A;  3U23 A;  1I4K 1;  3DLM A;  5CKF A;  5LJ5 h;  2DK3 A;  5GAN 5;  1SRL A;  4D8K A; 
#chains in the Genus database with same CATH homology
 3SEM A;  1WXU A;  2YDL A;  4LE9 A;  1YP5 A;  4OMM A;  4EIK A;  2HSP A;  1WI7 A;  2DL4 A;  2RNA A;  2JMA A;  2RPN A;  1X69 A;  1YN8 A;  1UG1 A;  2JS2 A;  2RQT A;  1QWE A;  2YUO A;  3VS5 A;  1PHT A;  1CSK A;  1ZX6 A;  4JJB A;  1QLY A;  4OMP A;  5IH2 A;  2J06 A;  1T3S A;  2KYM A;  1K0X A;  1NYG A;  1M8M A;  1VYV A;  1Z9Z A;  2SRC A;  4Z89 A;  2KRS A;  1H8K A;  2LQW A;  1UEC A;  2EPD A;  3PVL A;  4F16 A;  2M0Y A;  1OV3 A;  3M0P A;  1YWO A;  1JXO A;  2DVJ A;  1NLP C;  3NGP A;  3THK A;  1AOJ A;  1Z9Q A;  2BTT A;  2KNB B;  1I1J A;  5I22 A;  2DX1 A;  2FRW A;  3EGU A;  2NWM A;  1RLQ C;  2JT4 A;  2W0Z A;  2DA9 A;  1OOT A;  3M0T A;  2DMO A;  4RTV A;  1AWO A;  2LZ6 B;  2GGR A;  1AZG B;  4JZ3 A;  1QCF A;  1KSW A;  2FPE A;  1JO8 A;  1NYF A;  3EHQ A;  2OI3 A;  2A28 A;  3PE0 A;  1M30 A;  2VKN A;  4RTX A;  4R0K A;  3VRZ A;  4DEY A;  2OAW A;  5IHK A;  1A0N B;  2DRM A;  1E6G A;  2YUQ A;  1BK2 A;  4LNP A;  1M3A A;  3EG3 A;  2NUZ A;  5IXF A;  1AWX A;  1AZE A;  2DF6 A;  4RTT A;  1GRI A;  2KRN A;  2JS0 A;  1TUD A;  3M0R A;  1TG0 A;  4D8D A;  2RQV A;  2VWF A;  2OJ2 A;  2DJQ A;  5FWC A;  2CSQ A;  4J9H A;  1FYN A;  4F14 A;  2GNC A;  1LCK A;  4OMQ A;  4GBQ A;  2RQR A;  3UAT A;  1WIE A;  2FRY A;  2IIM A;  1NEB A;  1KIK A;  1J3T A;  3UF4 A;  1AEY A;  1TUC A;  1NEG A;  3M0U A;  2C0I A;  1KJW A;  2DM1 A;  2K3B A;  1HJD A;  3I5R A;  1M27 C;  1T0H A;  2YUP A;  3GBQ A;  4JZ4 A;  4RTZ A;  1AWW A;  1OEB A;  2CSI A;  3O5Z A;  1V1C A;  4HVU A;  1RI9 A;  4J9D A;  3REB B;  2A36 A;  2L3S A;  2D8H A;  1U3O A;  2GTJ A;  1M3C A;  4F17 A;  1QKX A;  2K2M A;  2J6O A;  1UFF A;  1QWF A;  1T3L A;  2EYY A;  3NHN A;  2KXD A;  4CC2 A;  2J7I A;  5GJW B;  3QWY A;  2KT1 A;  1SHF A;  3IQL A;  3EG0 A;  3A98 A;  1W6X A;  1AVZ C;  2EVR A;  4AG2 C;  1OPL A;  2C0O A;  2EYX A;  2KR3 A;  1ZUU A;  2DLP A;  3RNJ A;  1G83 A;  1VYU A;  2RN8 A;  1GBQ A;  4ESR A;  1SSH A;  2CDT A;  2KGT A;  1PKT A;  2HEQ A;  1M3B A;  5FWB A;  1X2Q A;  1GFC A;  2F2V A;  2KRM A;  3UA6 A;  1E6H A;  4J9B A;  1H3H A;  4IIM A;  1WDX A;  4Z8A A;  2X3X D;  1SRM A;  2F2W A;  2DNU A;  4AFU C;  5EC7 A;  1UJ0 A;  4RTY A;  2PNI A;  2RQU A;  2A08 A;  2KXC A;  4ORZ A;  1YCS B;  2RMO A;  1X43 A;  4JJD A;  2K9G A;  2LP5 A;  2KRO A;  2W10 A;  5IHN A;  2X3W D;  1NLO C;  5IXB A;  2AKL A;  2ED1 A;  2AZS A;  3VS0 A;  3QWX X;  2LQN A;  1K1Z A;  2DE0 X;  4LUD A;  2CUD A;  1X6G A;  1WXT A;  1I07 A;  3H0H A;  1YNZ A;  2DL7 A;  2GQI A;  2EKH A;  1K4U S;  2FO0 A;  4LN2 A;  1UUE A;  3I5S A;  2G6F X;  4OML A;  3VS7 A;  2O9V A;  1NG2 A;  3C0C A;  1WLP B;  1T0J A;  1SPK A;  3NMZ C;  2HDA A;  2DBM A;  1AWJ A;  2AK5 A;  1ZUK A;  1U06 A;  2BZ8 A;  1X2K A;  1GCP A;  2XMF A;  1RUW A;  1WA7 A;  2JW4 A;  2BZY A;  1ABQ A;  4RTW A;  2AZV A;  2L2P A;  5FW9 A;  2FPD A;  3VS4 A;  4AG1 C;  3H0I A;  1PWT A;  1PRL C;  1SHG A;  4FSS A;  1KFZ A;  1JU5 C;  3PVQ A;  1FMK A;  1PRM C;  2EGE A;  3LH5 A;  1B07 A;  2DBK A;  4LUE A;  5IHI A;  4JJC A;  2RQW A;  1UHF A;  2PZ1 A;  3UA7 A;  4A63 B;  3REA B;  3NPF A;  1K76 A;  2DYB A;  5I11 A;  2D0N A;  4Y92 A;  4Z88 A;  3RBB B;  2B86 A;  2H8H A;  2KT8 A;  3TSZ A;  4RUG A;  3CQT A;  1Y0M A;  2ENM A;  2E5K A;  1UJY A;  4HVW A;  5HCK A;  4OMN A;  3VS3 A;  2C0T A;  2DIL A;  2V1R A;  1G2B A;  3TVT A;  2LX7 A;  2ED0 A;  2DL3 A;  1VYT A;  1K0S A;  1X27 A;  1ZSG A;  3EG1 A;  2FG0 A;  2I0N A;  1QKW A;  2YT6 A;  1BU1 A;  2CT4 A;  3M0S A;  1GFD A;  3EG2 A;  3TSW A;  1BBZ A;  1I0C A;  1Y57 A;  1W70 A;  2ECZ A;  3JV3 A;  2JM9 A;  2KE9 A;  5ECA A;  1H92 A;  2PTK A;  4GLM A;  1JXM A;  1B3Q A;  1ARK A;  2F2X A;  4HXJ A;  4CC7 A;  4IIO A;  1NM7 A;  3VRY A;  1MUZ A;  3H0F A;  1PKS A;  2FPF A;  4CC3 A;  4X1V A;  2A37 A;  2EGA A;  1UGV A;  4AFS C;  4JPB W;  2SEM A;  2JXB A;  1EFN A;  2J05 A;  1UDL A;  2EW3 A;  2YUN A;  2CT3 A;  1E7O A;  2LJ3 A;  2O2O A;  4J9G A;  1JQQ A;  4DEX A;  3VS6 A;  2ABL A;  1W1F A;  1ZLM A;  2FEI A;  2O88 A;  1YWP A;  2YSQ A;  1RLP C;  2DRK A;  2O9S A;  4CC4 B;  2KEA A;  4AFQ C;  5L23 A;  1SEM A;  4ZNX A;  2MOX A;  2P4R A;  4K11 A;  4KRT A;  4RTU A;  2LJ0 A;  2L3P A;  1OPK A;  2KBT A;  2MCN A;  1VA7 A;  1ABO A;  2CH4 W;  3I35 A;  2K6D A;  1GBR A;  1WXB A;  2AKK A;  1N5Z A;  2CUB A;  2J6F A;  2RF0 A;  2ESW A;  2EYZ A;  2KYB A;  2BZX A;  2CH4 A;  1UTI A;  3M0Q A;  4HVV A;  1ZBJ A;  1UE9 A;  1GCQ C;  1JEG A;  1U5S A;  2K7A A;  1ZUY A;  2M51 A;  3I9Q A;  4M4Z A;  4D8K A;  4QT7 A;  2JMC A;  2HBW A;  2LNH B;  4J9I A;  1AD5 A;  2ROT A;  1HSQ A;  2LMJ A;  3VS1 A;  2HCK A;  1WX6 A;  4HCK A;  3FJ5 A;  1HD3 A;  2D1X A;  2D8J A;  2O31 A;  1GL5 A;  1GCQ A;  2L3Q A;  2EGC A;  2EYW A;  2K79 A;  2VVK A;  1X6B A;  2ROL A;  4J9E A;  3SHW A;  1CKA A;  1MV3 A;  1WYX A;  2J6K A;  3KFV A;  2EQI A;  4E6R A;  1UHC A;  2GTO A;  1MV0 B;  2CRE A;  2V1Q A;  4J9C A;  1XOV A;  2GBQ A;  3VS2 A;  2JTE A;  3ZL7 C;  4AFZ C;  2EBP A;  2JM8 A;  1PNJ A;  4J9F A;  3H41 A;  1S1N A;  2LCS A;  3ULR B;  2L0A A;  2DL8 A;  1K9A A;  3EHR A;  1BB9 A;  1IO6 A;  2DL5 A;  2LJ1 A;  1CKB A;  3U23 A;  3R6N A;  2QDL A;  4WCI A;  4OMO A;  1SRL A;  5GJV B;  2MIO A;  1WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...