2A37A

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (drkn sh3 domain)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E(sev)2B
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a37A00
3VS6A 5HCKA 2D1XA 3PE0A 4AFUC 4EIKA 1UJYA 4J9HA 1QLYA 3VS3A 4A63B 1WYXA 3EHQA 1A0NB 1BB9A 4DEYA 1CSKA 1YWOA 1WXTA 3KFVA 1T3LA 2EPDA 2LZ6B 2MCNA 1EFNA 1U5SA 4J9CA 3I5SA 1NLOC 1OOTA 1H92A 2EYZA 1SRMA 2YT6A 1SPKA 3RNJA 2OAWA 1AVZC 3LH5A 2KRNA 2DILA 1T0HA 1UTIA 2DL7A 3SHWA 2ABLA 3QWXX 1M8MA 1OPLA 2CUBA 2MOXA 1H3HA 3VS5A 1Y0MA 1T0JA 4K11A 1HSQA 3EG3A 3VS2A 2GNCA 1UE9A 1NYGA 1NM7A 4ORZA 2DX1A 4DEXA 4LN2A 1AD5A 2LJ1A 2L3QA 2K79A 1PNJA 4JPBW 4OMNA 2RMOA 1WFWA 2KE9A 1GRIA 2I0NA 2JM9A 2A37A 2X3WD 1BBZA 3M0TA 1BU1A 1OEBA 2RF0A 2GTOA 2A08A 1W70A 2EYYA 2EYXA 4D8DA 2FO0A 2RQVA 2F2XA 4M4ZA 2L2PA 2RQWA 1UDLA 1AWOA 1KSWA 2O9SA 1KIKA 1JO8A 4LUEA 1E6GA 2K3BA 2E5KA 2J6OA 3REAB 1SSHA 4HXJA 1G83A 2KXDA 1CKBA 1JXOA 2A28A 2EGCA 4WCIA 2BZXA 2RN8A 3THKA 1WI7A 4OMQA 4J9EA 1GL5A 2LP5A 1M27C 2MIOA 2V1RA 1ZBJA 1GCQA 2EYWA 1J3TA 1H8KA 4RUGA 1QWFA 2AKLA 2D8HA 4J9DA 4OMLA 1GCPA 4ZNXA 1NYFA 1X2QA 1Z9QA 1RUWA 1AZGB 2KEAA 3VRYA 1VYTA 2JM8A 3U23A 2W10A 2L3SA 1Z9ZA 2JMAA 3TVTA 2EW3A 1GFCA 1PRLC 2O2OA 2P4RA 3EG2A 3VS1A 1NLPC 2AKKA 2KT1A 2BZ8A 4R0KA 1AZEA 1K9AA 5IXFA 1YCSB 1ABOA 2HEQA 1WDXA 2M0YA 1CKAA 2XMFA 1N5ZA 4AFZC 2ED0A 2ROLA 3C0CA 2KT8A 1PWTA 1VYVA 2D8JA 1ABQA 3TSWA 3M0QA 2O31A 2OJ2A 3H0HA 2K7AA 2VKNA 1UHCA 2CREA 1QCFA 1ZX6A 2DNUA 1HD3A 1M3CA 1TUDA 4HVVA 3RBBB 1RLPC 3VS7A 2YUPA 1ZLMA 1G2BA 1T3SA 5FWBA 5GJVB 1FYNA 4J9IA 4X1VA 3EG0A 1X27A 4JZ3A 2BZYA 2X3XD 1ZUYA 1PHTA 4AG1C 1GCQC 4QT7A 2DLPA 2VWFA 4JJDA 2DRKA 2DL8A 2GGRA 2YUOA 1JXMA 1KFZA 2SRCA 3NGPA 2AZSA 1UJ0A 1WX6A 1TG0A 2C0TA 2CH4W 1MV0B 2VVKA 3H0FA 1K4US 2JW4A 2B86A 1YWPA 3R6NA 1ZUUA 3JV3A 4RTZA 1WXUA 4CC2A 2OI3A 3M0RA 2JXBA 1VYUA 2ESWA 1AWXA 1AWJA 2LX7A 2RPNA 1ARKA 2J7IA 2DMOA 3I35A 4HCKA 2FRYA 1X2KA 2LNHB 1PKSA 2CH4A 5FW9A 2PNIA 4RTVA 3NHNA 3UATA 4F14A 2FG0A 4AG2C 2YDLA 4JJBA 1HJDA 1UUEA 2CUDA 4IIMA 4RTUA 1UHFA 2ECZA 2ENMA 1UFFA 2BTTA 2CSIA 3VS4A 1K1ZA 4KRTA 4Z89A 4E6RA 1W6XA 2EVRA 2GBQA 3CQTA 1M3BA 4ESRA 2KYBA 2LQWA 2C0OA 3O5ZA 2EQIA 1X6GA 2HDAA 2DVJA 1X6BA 2J05A 2K2MA 2CT4A 5I22A 2KROA 3A98A 1W1FA 1IO6A 1NG2A 1UECA 3TSZA 3UA6A 2DJQA 3ULRB 2J6KA 1GBRA 2KNBB 1JEGA 2DBMA 4HVWA 4J9BA 1YN8A 3EG1A 1X69A 3PVQA 2KR3A 4JJCA 1SRLA 3ZL7C 3EGUA 5FWCA 1ZUKA 2CT3A 2M51A 2DM1A 2L3PA 2C0IA 2JS0A 2DRMA 2ED1A 3VS0A 1M30A 3REBB 3H41A 5GJWB 2FPDA 1Y57A 1K76A 2KRMA 3M0SA 1U3OA 1RI9A 2JMCA 3VRZA 2PZ1A 4AFQC 4FSSA 2EKHA 5IXBA 1B07A 1JQQA 2G6FX 1PKTA 2ROTA 1AEYA 1QKXA 2YSQA 1ZSGA 1PRMC 2IIMA 1OV3A 1QKWA 2AK5A 5ECAA 4D8KA 1S1NA 3I5RA 4RTYA 5I11A 2KBTA 2EGEA 1V1CA 2LQNA 4LNPA 1NEBA 2EBPA 1X43A 3UA7A 3NPFA 2JS2A 5L23A 4JZ4A 2PTKA 1JU5C 2DA9A 4OMMA 1UGVA 1NEGA 2GTJA 2NUZA 1AWWA 2FRWA 2RNAA 3EHRA 1TUCA 2O9VA 1I1JA 2K6DA 1XOVA 2YUNA 3M0UA 3UF4A 5EC7A 2DE0X 1M3AA 3M0PA 4F16A 2F2WA 2FPFA 2YUQA 1QWEA 1U06A 2LJ3A 4J9FA 2CDTA 2DL5A 2JT4A 1RLQC 2EGAA 4OMPA 4CC4B 4GBQA 2CSQA 4LUDA 2RQUA 2QDLA 2AZVA 2RQRA 3PVLA 2DL3A 2KYMA 3NMZC 2K9GA 2L0AA 2DBKA 2HSPA 3GBQA 1UG1A 2LMJA 4J9GA 1YNZA 1I0CA 4IIOA 2KXCA 4RTXA 1BK2A 2NWMA 2DYBA 2FPEA 2A36A 3I9QA 1YP5A 3FJ5A 2JTEA 1I07A 1WLPB 2FEIA 3QWYA 5IHKA 1OPKA 1E6HA 2O88A 4OMOA 2LCSA 2D0NA 2GQIA 1LCKA 4LE9A 2W0ZA 1WA7A 2HCKA 1K0XA 3IQLA 2SEMA 2H8HA 3H0IA 4RTWA 2KRSA 1MUZA 5IHIA 1VA7A 1K0SA 4GLMA 1WIEA 2HBWA 3SEMA 4F17A 1SHGA 5IH2A 2DF6A 4RTTA 1GFDA 1SHFA 4Z8AA 1SEMA 2RQTA 2V1QA 5IHNA 4CC7A 1WXBA 1FMKA 2F2VA 2LJ0A 4AFSC 2J06A 2KGTA 4HVUA 2J6FA 1KJWA 1AOJA 4Y92A 4CC3A 2DL4A 1GBQA 4Z88A 1MV3A 1B3QA 1E7OA
chains in the Genus database with same CATH superfamily
2PUOB 3CCRT 1YBYA 5KYNA 2D1XA 1UJYA 1Q82U 4A63B 1A0NB 2LVMA 5FU6C 1YWOA 1BKBA 3P8DA 2JVVA 3M57A 5CCAA 3I5SA 2FL7A 1SRMA 2YT6A 2X4YA 4OF1A 3QKJA 4QVZA 3RNJA 4ZTJA 3A1PA 1BI0A 2OAWA 2F5KA 3LYIA 3OB9A 1RAGB 4HCZA 1UTIA 4J83A 2DZCA 2QEXA 1OPLA 4PJLA 2MOXA 4M75C 4XAXB 1H3HA 3T9NA 2QG9B 1IGUA 2QQSA 1SF9A 1VQ7T 1K8AU 3OW2P 4LN2A 1V29B 1AD5A 1YHQQ 2DZ9A 2L3QA 5GMKe 1IREB 3H8ZA 2E64A 2EFIA 4QVDA 2A37A 1KQSP 3MP1A 5KYXB 3GF5A 3MP6A 1BU1A 4J5YA 2LTOA 1YJNA 1OEBA 2QASA 5CAIA 3JB9I 1W70A 4QVCA 4IUPA 5C0MA 3HRTA 4AT1B 3JCMX 1RL2A 3BDUA 1FX7A 2RQVA 2F2XA 2RQWA 4N0AC 1VQNQ 3VKIA 2O9SA 4LUEA 2J6OA 3P8BB 5LJ5e 3M59A 1WHLA 2EGCA 4GY5A 1S72T 1VQ5A 3CMET 2BE9B 3OYJA 4PJMA 4OMQA 4J9EA 1D3BB 2LQ8A 3QJYA 1YI2T 3CC2A 1OZ2A 3FJPA 5KYWA 1ZBJA 1NE8A 4RUGA 1QWFA 4PJOE 4WTOB 1EIFA 5GAOm 3QBYA 1X2QA 4FM4B 1AZGB 2ATCB 3S3MA 1VUBA 3GNGA 1U8RA 1Q81U 1GFCA 2K5FA 1KC8U 4DQ2A 2P4RA 3QZ9B 2K2VA 2KT1A 3M4YA 4R0KA 4XTWA 3M4GA 1YJWT 1K73R 5IXFA 4ZTFA 4M75F 2VV5A 4MZPA 5L8RE 3SWNC 2KT8A 2OTJA 5GMKh 1AT1B 3HL8A 5CK9A 4KBMB 4QKUA 3V8LA 4EMKC 4BACA 2O01E 3A5ZB 2FVUA 3CCVT 3RMSA 1OYXA 1QCNA 4M77C 2CREA 1LVKA 3RR6A 1WQWA 2RM4A 1TUDA 2YUPA 3JCMV 4PJOB 4J7IA 1Q7YC 2L89A 1X27A 2X3XD 3CCLA 1M90C 4C8QE 5LJ5h 3BFMA 3HSBA 4JRKA 3CCSQ 3G6ET 1N9RA 2VXFA 4M77D 2HNIA 2M16A 3HFNA 2YUOA 3TQ7P 2E6NA 4EPCA 1KFZA 2SRCA 2DD5A 4M78D 3EGDB 2AZSA 1UJ0A 3PNWC 1N8RC 1ZQ1A 1KD1R 3OBWA 3X24B 4M7AG 2P84A 3SDZA 1D1BA 3M0RA 1U1SA 5LJ3j 5KYXA 3G71T 2OTLT 4LDYA 5DLOA 1ZSZC 3C95A 3E9GA 2CH4A 2X51A 3NHNA 3UATA 4AG2C 2YDLA 4IIMA 4TVRA 2LC4A 5CVIA 1UHFA 2ENMA 2BTTA 1B34B 5KE2A 3CXCP 4C8QB 1VOMA 3MPUB 3CQTA 1NJIR 1YHQA 3PIOA 5I21A 2EQIA 4OB3B 5FRNA 2J05A 3CD6T 4MZMA 1QVPA 4DBHA 1YIJQ 1VQ4Q 1D3BA 3UA6A 5GMKl 2QQ9A 4B9WA 4M7AC 3QYGB 4M77F 5GAN7 2DBMA 3CCQT 1TU0B 4X34A 4PFOA 4J9BA 1YN8A 4ANJA 4BE0A 1X69A 3PVQA 2KR3A 3UT1A 3ZL7C 3ZEHA 5FWCA 1VQNA 2QQBA 3TU4K 3EGXB 4JUVA 1QQJA 2L3PA 3OBYA 2RHZA 2EQMA 5CKFA 4KUDK 1WZOA 3QO3A 1M30A 1TSFA 3H41A 1WJSA 1Y57A 1Q86U 2O4XB 4C92C 3SFMA 3UDCA 3VRZA 2PZ1A 3OYCA 3FDRA 2EKOA 5AYFA 2QQAA 4OP0A 2X4XA 2G6FX 4FYYB 3C94A 1QKXA 1ZSGA 5J39A 2QA4Q 2R5AA 1OV3A 5KYUB 4B9XA 2C06A 3HHTB 4EMGA 2ZGWA 3CCUT 2MPXC 3CCJT 4FU6A 1VQ8Q 1V1CA 2LQNA 2K4YA 3G4SQ 4C92D 4C5IA 1OU9A 1ZA2B 1MMAA 2KSSA 4PJOA 1RACB 1RADB 1LPLA 1JU5C 4PKCC 1JRIA 3PGGA 4M7DC 2GTJA 2NUZA 1AWWA 3EFOB 2FRWA 2RNAA 2O9VA 2P0QA 2IPOB 1OX8A 3CXCA 2JTFA 2COWA 2L8DA 1XTDA 2DL5A 3GPLA 3RUXA 4ZGDB 3EGDA 4CC4B 4E7IA 2CSQA 2WSCE 4MMKA 4ELZC 2NUPB 2HAXA 3PVLA 4M7DD 2DL3A 4KH1B 3O8VA 2K9GA 4M7AF 4XTUA 2HSPA 5HKCA 4OGEA 4PJNA 4J9GA 2RJDA 3OA6A 4IKFA 2E12A 4F7UF 1VQKT 4EMHA 2ZPGB 2KK4A 3CCSA 3JCMP 4KULA 3AHUA 2DYBA 4FYVB 1D1AA 3V8JA 3FEOA 5KCOA 2EJ9A 4BY6C 1EX4A 2VXEA 4FW2A 4JRPA 1B34A 5A0LA 4C92F 4C8QA 6AT1B 2LCSA 3GNFB 2HCKA 1WHHA 2BE7D 2H8HA 2EQUA 2NLUA 4DBRA 1MUZA 1VA7A 3ER0A 1K0SA 2X35A 3V7RA 5GAMg 3HRUA 3OS2A 3SEMA 5CQYA 2V1QA 3JB9H 1G3YA 2R5MA 1TUGB 3EGXA 2DO3A 2Y90A 5GANg 1VQ9Q 2P0PA 2QEXT 1UGRB 4RKUE 4M7DF 2DXBA 4Y92A 4Z88A 2O4XA 1YIJA 1VQ4A 2XG8D 1Q7YR 4ZGJB 1Y71A 3MJXA 3PE0A 2D0QB 4AFUC 1OZ3A 1M90R 1UB4A 3VUZA 2HSEB 3WVEB 3EHQA 2DXCA 1BB9A 5KYUA 3JCMf 3KFVA 2EPDA 3QZ5B 2EWNA 2MCNA 1U5SA 1NLOC 2HBPA 1YJNT 2EYZA 3L2VA 2LX9A 1N8RR 1AVZC 2LRQA 5A0GA 3A8LB 3QHSA 3LH5A 1T0HA 4PLLA 4XU1A 4E47A 1TH7A 3M5AA 3VS5A 4CRIA 1WNLA 2BKDN 1KQ2A 2OX7A 3OYYA 4XTYA 3EFOA 1HXDA 3VS2A 3A8OB 4XK8E 1UE9A 3DB3A 4BI8B 2DX1A 3VU3C 4A4FA 2DK3A 2FZCB 4DEXA 2QA4A 1VQ5T 4JDSA 2K79A 1WFWA 3CC2T 2I0NA 2PUKB 3MHXA 1BBZA 3M0TA 2NUPA 3CMAA 2GTOA 4LD6A 3V7SA 3HKSA 2RJEA 5LL6S 4C0DB 3EH1A 3F70A 5HY6A 2FO0A 4MDWA 1G5VA 1SKUB 1KSWA 5GAOl 3J7AF 2A0FB 1KIKA 3NTKA 2VGNA 2PVOB 2DD4A 1VQMQ 4WCIA 3QJ6A 5GAOn 3CC7Q 3QIIA 1BI2A 2BZXA 4NOYA 1NBEB 1VQPA 2OTJT 2DEQA 4OB2B 3A8HB 3C12A 3L2WA 3JCMc 1W2BA 3VYHB 2EYWA 1H8KA 4HCCA 2PQWA 2DTOA 3VRYA 1B7TA 1Z9QA 4RMOA 1QP2A 2JM8A 4Y28E 2CP0A 1Z9ZA 1W2BS 4V2SA 1O9SA 1RAFB 2O2OA 2LT1A 3TCJA 1MHNA 2A7YA 5KYYB 4FSXA 1VQLQ 1UEBA 3VYGA 3CCET 1NLPC 3JCMd 3CCLT 4FW1A 1K9AA 1OQKA 3RIRA 1YCSB 1ABOA 2HEQA 1VIFA 2L3RA 3HTRA 2CZ0B 2DXUA 2QGFB 2YRCA 1PWTA 4HA8A 2D8JA 3I55Q 3M0QA 2O31A 2OJ2A 4N4GA 1OULA 5GMKj 2RA2A 3OS0A 2MK5A 1ZX6A 4DBQA 4IUQA 1LNXA 4BE1A 3C4SA 1BI3A 1HD3A 4HVVA 3VS7A 1ZLMA 5FWBA 1FYNA 2ZPIB 4PJJA 4X1VA 4JRIA 3EG0A 4JZ3A 2BZYA 1HYOA 1QVGA 1IGQA 3S3NA 1GCQC 4QT7A 1VQ6Q 3QPHA 4PFZA 5LJ5j 2K5LA 5FROA 1QVGS 2FZKB 3MEUA 2HZYA 3A8MB 1WX6A 3V8KA 1YHQT 2VVKA 2E3HA 2GFAA 4PJOG 4KGXB 4M75D 3MEAA 2QTVA 1M1KC 3R6NA 2XHCA 5A0DA 4CC2A 3I56A 3LGFA 1LJOA 2FB7A 1AWXA 4C0ZA 2RPNA 2DMOA 3I35A 4HCKA 1N9SA 1FMVA 3RDVA 3BDLA 4IURA 4RTVA 1W4SA 3DB4A 4QQGA 1VQNT 3OMGA 4X9CA 4F14A 2FG0A 4PLIA 2CUDA 2XICA 3QXEB 2KI7A 4GLKA 2ZPEB 2DIQA 5HK3A 3H6ZA 1UFFA 2CSIA 3JCMJ 1K1ZA 4Z89A 1W6XA 3LGLA 3EFSA 2GBQA 2MWOA 5CKHA 2BIVA 4ESRA 1GXIE 2LQWA 2C0OA 1I5OB 1RI0A 3CBPA 1X6GA 2DVJA 1X6BA 2IVWA 2K2MA 2CT4A 1W1FA 1NG2A 3PTAA 1RAHB 1KQ1A 5FLXE 1K8AR 3OMCA 1WGSA 1S72Q 3CMEQ 4PJOC 2KNBB 1YI2Q 1JEGA 2DFUA 3OYHA 5GAMf 4X9DA 3EG1A 3CC4Q 5GAMe 4C8QG 4JJCA 3EGUA 4XU3A 2CT3A 2DM1A 2JS0A 2DRMA 3VS0A 5KYYA 1IHWA 2PU9B 3REBB 3OYKA 4JRQA 5GANf 2DXTA 1VQMA 3NTHA 3VJPA 1MNDA 5GANe 3CC7A 4AMCA 2QTXA 3M0SA 4WF2A 4RG8A 4D6WA 3JAME 2EKHA 4DA4A 1YJWQ 4BD3A 1B07A 1O75A 2MF2A 2QK0A 1JQQA 1P92A 1R77A 2F69A 4JLGA 2MI6A 3PMTA 1Y96B 3JCMg 1KD1U 3G1JA 2IIMA 2LDMA 4QW2A 3OYMA 5D6YA 2B8AA 2CP2A 3JSCA 1M2VB 4RTYA 5I11A 1MGQA 3JCMW 3GLXA 3S6WA 3UA7A 3NPFA 2JS2A 4Y91A 4C8QC 4M78E 5IAYA 2VGMA 2DA9A 2YWWA 3CCST 2E4HA 2HL3A 5GAN4 2RJFA 1I1JA 1XOVA 5DY9A 1K9MC 1MNEA 3M0UA 3UF4A 5EC7A 3M0PA 3DLLA 4BDYA 1NJIU 3MP8A 4J9FA 1X01A 3H9NA 2BUDA 2LQKA 4BDZA 1FWZA 3KBGA 4LDWA 1C0MA 1NPPA 2Y4XA 4NS5A 3M58A 2RQRA 5GAMh 3P8HA 4PJOF 3ME9A 4OB1B 2XDBA 3OYEA 3V7CA 1JJ2A 3HRSA 5GANh 3G71Q 2OTLQ 4FYWB 4LDUA 1VQ6A 4RTXA 2NWMA 2A36A 1YJ9Q 4PNOA 2FZGB 3MCAB 3RMQA 5GAMd 3URGA 2FEIA 3JB9G 3J80E 4M78B 1WHGA 2GCXA 1JJ2S 5IHKA 1E6HA 1PD1A 2GQIA 1LCKA 4LE9A 1BI1A 1YIJT 1VQ4T 1K0XA 3IQLA 5GANd 2Z0WA 3BY7A 2QXFA 3CPWS 3CD6Q 3MEWA 4J8OA 2RI3A 1SHGA 1YITQ 1GFDA 3MO8A 1SEMA 4HT8A 1PG5B 1WXBA 1FMKA 2F2VA 1NPRA 2LJ0A 2KGTA 3QYHB 4C8QF 2XDDA 4M7AD 2J6FA 1AOJA 1ZSZB 4J6YA 5I2SA 1H92A 2RH2A 1D0YA 4A4HA 2Y4YA 3Q1JA 5HCKA 4PK4A 2PVDB 4A4EA 2L5QA 2QA4T 1QLYA 1Y96A 4BB7A 1D0XA 4DEYA 8AT1B 4KGZB 3CC4A 4KGVB 1T3LA 4JS5A 1EFNA 4J9CA 3SB2A 1M2VA 1OOTA 3CMAT 3PFSA 5CQXA 2ZCFB 3SD4A 2DKGA 2RI2A 3L2RA 2DL7A 1JBMA 2ABLA 3QWXX 1M1KR 1M8MA 1LOJA 4C0GA 2RHIA 4K11A 1HSQA 4LXCA 1YJWA 2MYSA 4QQ6A 1NM7A 1X6OA 1QVFS 4PFPA 5IT9E 2RD1A 2LJ1A 1VQPT 4Z02A 2X4JA 3X28B 1VQOQ 4OMNA 2RMOA 3OSVA 2E10A 1AHJB 4C92B 1Y7XA 3OQ5A 1WHJA 2DJZA 2DERA 1UGPB 2CP5A 5J3BA 1PD0A 1IB8A 4N4HA 2QDYB 3CPFA 3LLRA 4D8DA 2NUTB 5EG2A 2COZA 1Q82C 2KY9A 2L2PA 1UDLA 2M9UA 2EJFA 4MZTA 4B6MA 4A4GA 4E2FB 1QMCA 2DTHA 2E5KA 1VQKQ 2IG0A 3REAB 1SSHA 4M78A 1JXOA 2A28A 1KG1A 4FIBA 3THKA 5FU7C 4OVAA 2FHDA 1WI7A 1Q7YU 2LP5A 1M90U 4M7DB 1M27C 2HMAA 2V1RA 1TOVA 4ZNXA 1H641 4KT0E 2ZAEA 1D1CA 3U23A 2E70A 2W10A 2L3SA 2OAUA 3TVTA 2EW3A 1K8AC 1N8RU 1YJ9A 1SSFA 4E7HA 5DM7R 3FIFA 2BZ8A 5A2QE 1RAEB 1WDXA 2VASA 2M0YA 1CKAA 3E1SA 1PC0A 1W2BP 3C0CA 1ZSZA 1VYVA 3TSWA 1ABQA 3H0HA 1G8XA 2RHYA 2K7AA 2VKNA 3RKWA 2HD0A 1UHCA 2RK1A 1I5LA 4N4IA 2CP6A 1I8FA 3JCMe 1M4ZA 1EZZB 4C0DC 1QCFA 2WSEE 4BY6B 2DNUA 4IUTA 1YITA 2EQJA 1K9MR 1M3CA 1RLPC 3UPUA 2GQVA 1T3SA 5GJVB 3I56T 2AHJB 4J9IA 4HCBA 4J7FA 1ZUYA 2CZ1B 1PHTA 4F04B 3WXMB 3JRZA 1MMNA 2ZPFB 4RCCA 2DLPA 2VWFA 4JJDA 2HKNA 4BE2A 3X26B 4C0FA 2GGRA 3D7SB 2VUBA 3GP8A 1IHVA 1RABB 1Q81C 2C0TA 2CH4W 1MV0B 4PL6A 1KC8C 1VQ8A 3G4SA 2JW4A 2B86A 3L2UA 3CCMQ 1YFNA 2HQEA 1WXUA 4E7LA 2OI3A 4C92A 2JXBA 1VYUA 2ESWA 1QVGP 2CP7A 3QUIA 1AWJA 4FL6A 1ARKA 2LNHB 1PKSA 3HPWA 2JNGA 5HK0A 2NUTA 1G3SA 3WVDB 4XTXA 1HJDA 4RTUA 4OMFB 1TXQA 5CKDA 5KCHA 3VUBA 3PT9A 2KVQG 3KXTA 3CC7T 1ZBXA 1M3BA 1N27A 2KYBA 3JCMh 2HDAA 1KK7A 2XK0A 1VQOA 3L42A 3CBMA 4OB0B 5I22A 2KROA 1IO6A 3QDRB 1R0CB 1UECA 3TSZA 2DJQA 4XTVA 3ULRB 4M7DA 3FRNA 1GBRA 3M55A 5LJ3g 2CZ7B 4FT4A 3E19A 1X75C 1ZUKA 2M51A 2YXYA 1OU8A 2C0IA 4YTLA 2FPDA 1K76A 5AT1B 2RI5A 2KRMA 1U3OA 1RI9A 4AFQC 4FSSA 3CCLQ 3CCEQ 4XQ3A 3RERA 2QYZA 5IXBA 4DBFA 1WJRA 3X20B 2QI2A 4HKEA 3CCRQ 1PKTA 3BW1A 2ROTA 1AEYA 3RESA 1QKWA 3L2ZA 4CI0C 2AK5A 5M9OA 1PSEA 3GOXA 4D8KA 1ZHIA 4DOVA 2EGEA 1VQ9A 4LNPA 3A8GB 1NEBA 2EBPA 5GAOr 2PTKA 5KH6A 1NZ9A 4L5GA 3OYDA 1R0BG 4OMMA 2GF7A 3OYLA 1VQ6T 4M75E 4R55A 1VIEA 5DLQE 2YUNA 5GAOq 2DE0X 1M3AA 2XI9A 3TEEA 4F16A 3QG1A 1M9SA 2F2WA 2FPFA 1U06A 3DLMA 3QDFA 1Q82R 3RKXA 2KQWA 1VQ7Q 2R58A 4GBQA 1ACMB 2H3EB 1SG5A 4ZGEB 2QDLA 2AZVA 1Q86C 1F1BB 4E7ZA 2MAMA 3NMZC 2L0AA 1KHCA 4VUBA 1M1GA 2M0OA 5GAMj 2LMJA 3CBOA 8ATCB 5FU6B 2KXCA 1K73U 2KDSA 1BK2A 3MKDA 1YP5A 3FJ5A 4C5GA 3BE3A 2JTEA 5GANj 1I07A 3KUFA 3QWYA 1Y07A 2O88A 5CIUA 5LJ5f 2D0NA 4M75B 1IXDA 5CKEA 1WA7A 3X25B 4JLIA 3CCMA 1G3WA 2AIRB 4L6V5 3JB9J 1D09B 2XD0A 1XNIA 3CEYA 2JUFA 1JJ2P 2EJGA 4M77G 4EDUA 1TWBA 4GLMA 3LX7A 3CC4T 1G3TA 1YCYA 1WIEA 2MWPA 2HBWA 4M78G 4F17A 3EG9B 5IH2A 1SHFA 5IHNA 4FYXB 5D6WA 3CPWP 4E7KA 3N5BB 4PJOD 1Q95G 2AT1B 1TTHB 4CC3A 2DL4A 1GBQA 3GIBA 1B3QA 2VB6A 1E7OA 3VS6A 2JOYA 2K5IA 2LCLA 4EIKA 2RO0A 2EAYA 4J9HA 1ZA1B 4KH0B 3VS3A 1WYXA 3CCVQ 1OX9A 1CSKA 1WXTA 2YRVA 4M77E 2LCCA 3OW2A 1VQLA 4II1A 2LZ6B 2LNVA 2RB6A 4Q5WA 2A3LA 2WSFE 1SPKA 1Q81R 1R8OB 1H3ZA 2KAFA 1KQSA 1KC8R 4M78C 2K3YA 4P5NA 1I81A 2KRNA 2DILA 3SHWA 3ZBDA 4A54A 2DYIA 3OW2S 1M5Q1 3I55A 2CUBA 1Y0MA 3CCEA 1T0JA 4BUGA 3EG3A 4NL2A 2X4WA 3FB9A 3VV0A 2GNCA 1KQSS 3G6EQ 3CCRA 4JS4A 3NFCA 1NYGA 2QAZA 4ORZA 4C8QD 1JB0E 2DIGA 1PSFA 1XQHA 2D6FA 1PNJA 1UGSB 4JPBW 2KE9A 3SWNB 1GRIA 2JM9A 2CKKA 2X3WD 4ZN3A 1M8VA 1FXXA 5LJ5d 4EMKB 3R6OA 5GAOp 2RF0A 2A08A 1QVFP 1FMWA 2EYYA 4M77B 1WHMA 4F7UG 2HQXA 4KUIA 2EYXA 3META 1YJ9T 4M4ZA 1AWOA 1UGQB 1BIBA 3NTIA 3CPWA 1JO8A 1E6GA 2K3BA 3FC3A 3FLGA 4C92G 3OS5A 4HXJA 1G83A 2KXDA 1IZ6A 1CKBA 4XU2A 1VQ7A 5CKBA 2I2LA 2RN8A 4C5EA 4M75A 2P0KA 1GL5A 2MIOA 2HL5C 1KHIA 2E65A 1GCQA 2ZZDA 1J3TA 1WJQA 4QQDA 2AKLA 2D8HA 5LJ3f 4J9DA 4OMLA 4M7AE 1GCPA 1NYFA 2KEAA 1RUWA 5LJ3e 1YITT 3CCQQ 1VYTA 4JJNK 4ATOA 3EG9A 2G3RA 2JMAA 4BI4A 4F7UE 1PRLC 4A4KA 3M54A 3EG2A 3ZFJA 3OY9A 4M78F 3VS1A 2AKKA 1M1KU 2QGGA 3OYBA 3OSSC 1AZEA 4M7DG 4BI3A 4IUUA 2XMFA 2CZ6B 1N5ZA 1S72A 1WHKA 4AFZC 4C92E 3CMEA 2ED0A 2ROLA 2KMTA 4FCYA 2D9TA 2RHXA 1YI2A 4N0AA 3JCMQ 4L59A 4LDXA 2COYA 1VQ8T 2LT4A 3G4ST 1TS9A 3OYIA 3JB9D 4J6XA 5CO7A 3RBBB 3CCUQ 3CCJQ 1G2BA 1QVFA 1QCOA 2EIFA 2FYKA 4M7AB 3OYNA 3CMAQ 2E3IA 4AG1C 1Q86R 1MMGA 4M7DE 2K57A 2GFUA 3EFRA 4F7UB 2VC8A 2DRKA 2DL8A 7AT1B 1JXMA 2X9HA 1MMDA 3NGPA 1XJWB 2MMPA 1TG0A 3CCVA 1VQOT 3H0FA 4O6JA 3J81E 1K4US 5LJ3h 1YWPA 1ZUUA 3JV3A 4RTZA 2WACA 3SWNA 1RAIB 4A53A 3EH2A 1HK9A 1VQPQ 3M56A 5I2MA 4C5HA 3UWNA 2LX7A 4EMKA 3CXCS 2J7IA 4OGCA 2FRYA 1X2KA 2RK2A 4ELYC 3PMIA 5FW9A 2PNIA 4M77A 1C6VX 2M1HA 4JJBA 1UUEA 2XDPA 3OYAA 5LJ3d 4ZN1A 3G6EA 2ECZA 5LJ5g 3VS4A 4KRTA 4E6RA 3JB9F 4O5VA 2YLBA 2EVRA 2V26A 3O5ZA 1BCMA 2QQRA 4NL3A 3A98A 3E2UA 4LDVA 3M53A 2VYTA 5GAN5 2J6KA 4HT9A 2DVEA 4MMLA 2HQHA 3G71A 2OTLA 2CGHA 5C6SA 4HVWA 5GAN2 1K9MU 3TREA 5KE3A 3OS1A 1SRLA 2DPPB 1VQ9T 4ME7A 3E9FA 2ED1A 2DETA 1I4K1 5GJWB 5GAN6 4E7JA 5FRMA 1PM3A 2F1LA 5GMKm 2EQKA 2JTMA 2QEXQ 2PVGB 2YLCA 2JMCA 2V8KA 1QP3A 5J26A 3CD6A 2CP3A 3DKMA 3JCMb 2E41A 4LD9K 2R57A 4MDXA 4XTZA 2YSQA 3S3OA 1PRMC 3AT1B 2RJCA 1V76A 3CCQA 3PIPA 1K73C 2ZPHB 5ECAA 1S1NA 3I5RA 5IN1A 2KBTA 5D6XA 5FU7B 4RG2A 1YJNQ 1X43A 4RCBA 2XKOC 1BCOA 5L23A 1C1AA 4JZ4A 2DEUA 4M7AA 4E7SA 3I56Q 2RHUA 1UGVA 1NEGA 3EHRA 2F5TX 1TUCA 4F7UA 2K6DA 1D0ZA 1WQ7A 2E5QA 1BIAA 4R56A 2YUQA 1QWEA 2LJ3A 2E6ZA 2H3JA 2CDTA 1WPYA 2XU8A 3HFOA 1QW1A 2JT4A 1RLQC 2EGAA 4OMPA 5D7UA 5GAN3 2ZPBB 3L2QA 4LUDA 5CR2A 3LWHA 3CCMT 2RQUA 1VQ5Q 2HKQB 1PCXA 3CC2Q 3HP9A 3CCUA 3LW5E 3CCJA 2KYMA 4IUVA 3OYGA 4DOWA 2CYZB 2DBKA 2K3XA 3GBQA 1UG1A 3RKYA 1YNZA 1I0CA 1M1FA 3QSUA 3G7ZA 4IIOA 2DAQA 3INZA 2NYSA 1KD1C 1VQMT 2FPEA 2YHTA 3I9QA 2V8JA 3EAEA 1WLPB 9ATCB 2M02A 2CS7A 1OPKA 2JN0A 4OMOA 1M2OA 1N6AA 2W0ZA 2YRDA 2OTJQ 2V8IA 2JJ9A 2SEMA 5KYWB 3L1AA 3H0IA 4RTWA 4XU0A 3OYFA 3MEVA 2KRSA 1BYMA 3ASKA 2JZ2A 5IHIA 1VQLT 3LH0A 2DF6A 1RAAB 2XIDA 4RTTA 1NJIC 4Z8AA 2RQTA 1DJ7B 1U1TA 4CC7A 1VQKA 2DTIA 2P4TA 2EYQA 3M9QA 4M75G 3LWIA 4AFSC 2J06A 4HVUA 1OI1A 3I55T 4FT2A 1IRXA 2E1HA 5GAN8 1KJWA 4J6WA 5GMKi 1MV3A 4UC4A
chains in the Genus database with same CATH topology
3VS6A 5HCKA 2D1XA 3PE0A 4AFUC 4EIKA 1UJYA 4J9HA 1QLYA 3VS3A 4A63B 1WYXA 3EHQA 1A0NB 1BB9A 4DEYA 1CSKA 1YWOA 1WXTA 3KFVA 1T3LA 2EPDA 2LZ6B 2MCNA 1EFNA 1U5SA 4J9CA 3I5SA 1NLOC 1OOTA 1H92A 2EYZA 1SRMA 2YT6A 1SPKA 3RNJA 2OAWA 1AVZC 3LH5A 2KRNA 2DILA 1T0HA 1UTIA 2DL7A 3SHWA 2ABLA 3QWXX 1M8MA 1OPLA 2CUBA 2MOXA 1H3HA 3VS5A 1Y0MA 1T0JA 4K11A 1HSQA 3EG3A 3VS2A 2GNCA 1UE9A 1NYGA 1NM7A 4ORZA 2DX1A 4DEXA 4LN2A 1AD5A 2LJ1A 2L3QA 2K79A 1PNJA 4JPBW 4OMNA 2RMOA 1WFWA 2KE9A 1GRIA 2I0NA 2JM9A 2A37A 2X3WD 1BBZA 3M0TA 1BU1A 1OEBA 2RF0A 2GTOA 2A08A 1W70A 2EYYA 2EYXA 4D8DA 2FO0A 2RQVA 2F2XA 4M4ZA 2L2PA 2RQWA 1UDLA 1AWOA 1KSWA 2O9SA 1KIKA 1JO8A 4LUEA 1E6GA 2K3BA 2E5KA 2J6OA 3REAB 1SSHA 4HXJA 1G83A 2KXDA 1CKBA 1JXOA 2A28A 2EGCA 4WCIA 2BZXA 2RN8A 3THKA 1WI7A 4OMQA 4J9EA 1GL5A 2LP5A 1M27C 2MIOA 2V1RA 1ZBJA 1GCQA 2EYWA 1J3TA 1H8KA 4RUGA 1QWFA 2AKLA 2D8HA 4J9DA 4OMLA 1GCPA 4ZNXA 1NYFA 1X2QA 1Z9QA 1RUWA 1AZGB 2KEAA 3VRYA 1VYTA 2JM8A 3U23A 2W10A 2L3SA 1Z9ZA 2JMAA 3TVTA 2EW3A 1GFCA 1PRLC 2O2OA 2P4RA 3EG2A 3VS1A 1NLPC 2AKKA 2KT1A 2BZ8A 4R0KA 1AZEA 1K9AA 5IXFA 1YCSB 1ABOA 2HEQA 1WDXA 2M0YA 1CKAA 2XMFA 1N5ZA 4AFZC 2ED0A 2ROLA 3C0CA 2KT8A 1PWTA 1VYVA 2D8JA 1ABQA 3TSWA 3M0QA 2O31A 2OJ2A 3H0HA 2K7AA 2VKNA 1UHCA 2CREA 1QCFA 1ZX6A 2DNUA 1HD3A 1M3CA 1TUDA 4HVVA 3RBBB 1RLPC 3VS7A 2YUPA 1ZLMA 1G2BA 1T3SA 5FWBA 5GJVB 1FYNA 4J9IA 4X1VA 3EG0A 1X27A 4JZ3A 2BZYA 2X3XD 1ZUYA 1PHTA 4AG1C 1GCQC 4QT7A 2DLPA 2VWFA 4JJDA 2DRKA 2DL8A 2GGRA 2YUOA 1JXMA 1KFZA 2SRCA 3NGPA 2AZSA 1UJ0A 1WX6A 1TG0A 2C0TA 2CH4W 1MV0B 2VVKA 3H0FA 1K4US 2JW4A 2B86A 1YWPA 3R6NA 1ZUUA 3JV3A 4RTZA 1WXUA 4CC2A 2OI3A 3M0RA 2JXBA 1VYUA 2ESWA 1AWXA 1AWJA 2LX7A 2RPNA 1ARKA 2J7IA 2DMOA 3I35A 4HCKA 2FRYA 1X2KA 2LNHB 1PKSA 2CH4A 5FW9A 2PNIA 4RTVA 3NHNA 3UATA 4F14A 2FG0A 4AG2C 2YDLA 4JJBA 1HJDA 1UUEA 2CUDA 4IIMA 4RTUA 1UHFA 2ECZA 2ENMA 1UFFA 2BTTA 2CSIA 3VS4A 1K1ZA 4KRTA 4Z89A 4E6RA 1W6XA 2EVRA 2GBQA 3CQTA 1M3BA 4ESRA 2KYBA 2LQWA 2C0OA 3O5ZA 2EQIA 1X6GA 2HDAA 2DVJA 1X6BA 2J05A 2K2MA 2CT4A 5I22A 2KROA 3A98A 1W1FA 1IO6A 1NG2A 1UECA 3TSZA 3UA6A 2DJQA 3ULRB 2J6KA 1GBRA 2KNBB 1JEGA 2DBMA 4HVWA 4J9BA 1YN8A 3EG1A 1X69A 3PVQA 2KR3A 4JJCA 1SRLA 3ZL7C 3EGUA 5FWCA 1ZUKA 2CT3A 2M51A 2DM1A 2L3PA 2C0IA 2JS0A 2DRMA 2ED1A 3VS0A 1M30A 3REBB 3H41A 5GJWB 2FPDA 1Y57A 1K76A 2KRMA 3M0SA 1U3OA 1RI9A 2JMCA 3VRZA 2PZ1A 4AFQC 4FSSA 2EKHA 5IXBA 1B07A 1JQQA 2G6FX 1PKTA 2ROTA 1AEYA 1QKXA 2YSQA 1ZSGA 1PRMC 2IIMA 1OV3A 1QKWA 2AK5A 5ECAA 4D8KA 1S1NA 3I5RA 4RTYA 5I11A 2KBTA 2EGEA 1V1CA 2LQNA 4LNPA 1NEBA 2EBPA 1X43A 3UA7A 3NPFA 2JS2A 5L23A 4JZ4A 2PTKA 1JU5C 2DA9A 4OMMA 1UGVA 1NEGA 2GTJA 2NUZA 1AWWA 2FRWA 2RNAA 3EHRA 1TUCA 2O9VA 1I1JA 2K6DA 1XOVA 2YUNA 3M0UA 3UF4A 5EC7A 2DE0X 1M3AA 3M0PA 4F16A 2F2WA 2FPFA 2YUQA 1QWEA 1U06A 2LJ3A 4J9FA 2CDTA 2DL5A 2JT4A 1RLQC 2EGAA 4OMPA 4CC4B 4GBQA 2CSQA 4LUDA 2RQUA 2QDLA 2AZVA 2RQRA 3PVLA 2DL3A 2KYMA 3NMZC 2K9GA 2L0AA 2DBKA 2HSPA 3GBQA 1UG1A 2LMJA 4J9GA 1YNZA 1I0CA 4IIOA 2KXCA 4RTXA 1BK2A 2NWMA 2DYBA 2FPEA 2A36A 3I9QA 1YP5A 3FJ5A 2JTEA 1I07A 1WLPB 2FEIA 3QWYA 5IHKA 1OPKA 1E6HA 2O88A 4OMOA 2LCSA 2D0NA 2GQIA 1LCKA 4LE9A 2W0ZA 1WA7A 2HCKA 1K0XA 3IQLA 2SEMA 2H8HA 3H0IA 4RTWA 2KRSA 1MUZA 5IHIA 1VA7A 1K0SA 4GLMA 1WIEA 2HBWA 3SEMA 4F17A 1SHGA 5IH2A 2DF6A 4RTTA 1GFDA 1SHFA 4Z8AA 1SEMA 2RQTA 2V1QA 5IHNA 4CC7A 1WXBA 1FMKA 2F2VA 2LJ0A 4AFSC 2J06A 2KGTA 4HVUA 2J6FA 1KJWA 1AOJA 4Y92A 4CC3A 2DL4A 1GBQA 4Z88A 1MV3A 1B3QA 1E7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS6 A;  5HCK A;  2D1X A;  3PE0 A;  4AFU C;  4EIK A;  1UJY A;  4J9H A;  1QLY A;  3VS3 A;  4A63 B;  1WYX A;  3EHQ A;  1A0N B;  1BB9 A;  4DEY A;  1CSK A;  1YWO A;  1WXT A;  3KFV A;  1T3L A;  2EPD A;  2LZ6 B;  2MCN A;  1EFN A;  1U5S A;  4J9C A;  3I5S A;  1NLO C;  1OOT A;  1H92 A;  2EYZ A;  1SRM A;  2YT6 A;  1SPK A;  3RNJ A;  2OAW A;  1AVZ C;  3LH5 A;  2KRN A;  2DIL A;  1T0H A;  1UTI A;  2DL7 A;  3SHW A;  2ABL A;  3QWX X;  1M8M A;  1OPL A;  2CUB A;  2MOX A;  1H3H A;  3VS5 A;  1Y0M A;  1T0J A;  4K11 A;  1HSQ A;  3EG3 A;  3VS2 A;  2GNC A;  1UE9 A;  1NYG A;  1NM7 A;  4ORZ A;  2DX1 A;  4DEX A;  4LN2 A;  1AD5 A;  2LJ1 A;  2L3Q A;  2K79 A;  1PNJ A;  4JPB W;  4OMN A;  2RMO A;  1WFW A;  2KE9 A;  1GRI A;  2I0N A;  2JM9 A;  2A37 A;  2X3W D;  1BBZ A;  3M0T A;  1BU1 A;  1OEB A;  2RF0 A;  2GTO A;  2A08 A;  1W70 A;  2EYY A;  2EYX A;  4D8D A;  2FO0 A;  2RQV A;  2F2X A;  4M4Z A;  2L2P A;  2RQW A;  1UDL A;  1AWO A;  1KSW A;  2O9S A;  1KIK A;  1JO8 A;  4LUE A;  1E6G A;  2K3B A;  2E5K A;  2J6O A;  3REA B;  1SSH A;  4HXJ A;  1G83 A;  2KXD A;  1CKB A;  1JXO A;  2A28 A;  2EGC A;  4WCI A;  2BZX A;  2RN8 A;  3THK A;  1WI7 A;  4OMQ A;  4J9E A;  1GL5 A;  2LP5 A;  1M27 C;  2MIO A;  2V1R A;  1ZBJ A;  1GCQ A;  2EYW A;  1J3T A;  1H8K A;  4RUG A;  1QWF A;  2AKL A;  2D8H A;  4J9D A;  4OML A;  1GCP A;  4ZNX A;  1NYF A;  1X2Q A;  1Z9Q A;  1RUW A;  1AZG B;  2KEA A;  3VRY A;  1VYT A;  2JM8 A;  3U23 A;  2W10 A;  2L3S A;  1Z9Z A;  2JMA A;  3TVT A;  2EW3 A;  1GFC A;  1PRL C;  2O2O A;  2P4R A;  3EG2 A;  3VS1 A;  1NLP C;  2AKK A;  2KT1 A;  2BZ8 A;  4R0K A;  1AZE A;  1K9A A;  5IXF A;  1YCS B;  1ABO A;  2HEQ A;  1WDX A;  2M0Y A;  1CKA A;  2XMF A;  1N5Z A;  4AFZ C;  2ED0 A;  2ROL A;  3C0C A;  2KT8 A;  1PWT A;  1VYV A;  2D8J A;  1ABQ A;  3TSW A;  3M0Q A;  2O31 A;  2OJ2 A;  3H0H A;  2K7A A;  2VKN A;  1UHC A;  2CRE A;  1QCF A;  1ZX6 A;  2DNU A;  1HD3 A;  1M3C A;  1TUD A;  4HVV A;  3RBB B;  1RLP C;  3VS7 A;  2YUP A;  1ZLM A;  1G2B A;  1T3S A;  5FWB A;  5GJV B;  1FYN A;  4J9I A;  4X1V A;  3EG0 A;  1X27 A;  4JZ3 A;  2BZY A;  2X3X D;  1ZUY A;  1PHT A;  4AG1 C;  1GCQ C;  4QT7 A;  2DLP A;  2VWF A;  4JJD A;  2DRK A;  2DL8 A;  2GGR A;  2YUO A;  1JXM A;  1KFZ A;  2SRC A;  3NGP A;  2AZS A;  1UJ0 A;  1WX6 A;  1TG0 A;  2C0T A;  2CH4 W;  1MV0 B;  2VVK A;  3H0F A;  1K4U S;  2JW4 A;  2B86 A;  1YWP A;  3R6N A;  1ZUU A;  3JV3 A;  4RTZ A;  1WXU A;  4CC2 A;  2OI3 A;  3M0R A;  2JXB A;  1VYU A;  2ESW A;  1AWX A;  1AWJ A;  2LX7 A;  2RPN A;  1ARK A;  2J7I A;  2DMO A;  3I35 A;  4HCK A;  2FRY A;  1X2K A;  2LNH B;  1PKS A;  2CH4 A;  5FW9 A;  2PNI A;  4RTV A;  3NHN A;  3UAT A;  4F14 A;  2FG0 A;  4AG2 C;  2YDL A;  4JJB A;  1HJD A;  1UUE A;  2CUD A;  4IIM A;  4RTU A;  1UHF A;  2ECZ A;  2ENM A;  1UFF A;  2BTT A;  2CSI A;  3VS4 A;  1K1Z A;  4KRT A;  4Z89 A;  4E6R A;  1W6X A;  2EVR A;  2GBQ A;  3CQT A;  1M3B A;  4ESR A;  2KYB A;  2LQW A;  2C0O A;  3O5Z A;  2EQI A;  1X6G A;  2HDA A;  2DVJ A;  1X6B A;  2J05 A;  2K2M A;  2CT4 A;  5I22 A;  2KRO A;  3A98 A;  1W1F A;  1IO6 A;  1NG2 A;  1UEC A;  3TSZ A;  3UA6 A;  2DJQ A;  3ULR B;  2J6K A;  1GBR A;  2KNB B;  1JEG A;  2DBM A;  4HVW A;  4J9B A;  1YN8 A;  3EG1 A;  1X69 A;  3PVQ A;  2KR3 A;  4JJC A;  1SRL A;  3ZL7 C;  3EGU A;  5FWC A;  1ZUK A;  2CT3 A;  2M51 A;  2DM1 A;  2L3P A;  2C0I A;  2JS0 A;  2DRM A;  2ED1 A;  3VS0 A;  1M30 A;  3REB B;  3H41 A;  5GJW B;  2FPD A;  1Y57 A;  1K76 A;  2KRM A;  3M0S A;  1U3O A;  1RI9 A;  2JMC A;  3VRZ A;  2PZ1 A;  4AFQ C;  4FSS A;  2EKH A;  5IXB A;  1B07 A;  1JQQ A;  2G6F X;  1PKT A;  2ROT A;  1AEY A;  1QKX A;  2YSQ A;  1ZSG A;  1PRM C;  2IIM A;  1OV3 A;  1QKW A;  2AK5 A;  5ECA A;  4D8K A;  1S1N A;  3I5R A;  4RTY A;  5I11 A;  2KBT A;  2EGE A;  1V1C A;  2LQN A;  4LNP A;  1NEB A;  2EBP A;  1X43 A;  3UA7 A;  3NPF A;  2JS2 A;  5L23 A;  4JZ4 A;  2PTK A;  1JU5 C;  2DA9 A;  4OMM A;  1UGV A;  1NEG A;  2GTJ A;  2NUZ A;  1AWW A;  2FRW A;  2RNA A;  3EHR A;  1TUC A;  2O9V A;  1I1J A;  2K6D A;  1XOV A;  2YUN A;  3M0U A;  3UF4 A;  5EC7 A;  2DE0 X;  1M3A A;  3M0P A;  4F16 A;  2F2W A;  2FPF A;  2YUQ A;  1QWE A;  1U06 A;  2LJ3 A;  4J9F A;  2CDT A;  2DL5 A;  2JT4 A;  1RLQ C;  2EGA A;  4OMP A;  4CC4 B;  4GBQ A;  2CSQ A;  4LUD A;  2RQU A;  2QDL A;  2AZV A;  2RQR A;  3PVL A;  2DL3 A;  2KYM A;  3NMZ C;  2K9G A;  2L0A A;  2DBK A;  2HSP A;  3GBQ A;  1UG1 A;  2LMJ A;  4J9G A;  1YNZ A;  1I0C A;  4IIO A;  2KXC A;  4RTX A;  1BK2 A;  2NWM A;  2DYB A;  2FPE A;  2A36 A;  3I9Q A;  1YP5 A;  3FJ5 A;  2JTE A;  1I07 A;  1WLP B;  2FEI A;  3QWY A;  5IHK A;  1OPK A;  1E6H A;  2O88 A;  4OMO A;  2LCS A;  2D0N A;  2GQI A;  1LCK A;  4LE9 A;  2W0Z A;  1WA7 A;  2HCK A;  1K0X A;  3IQL A;  2SEM A;  2H8H A;  3H0I A;  4RTW A;  2KRS A;  1MUZ A;  5IHI A;  1VA7 A;  1K0S A;  4GLM A;  1WIE A;  2HBW A;  3SEM A;  4F17 A;  1SHG A;  5IH2 A;  2DF6 A;  4RTT A;  1GFD A;  1SHF A;  4Z8A A;  1SEM A;  2RQT A;  2V1Q A;  5IHN A;  4CC7 A;  1WXB A;  1FMK A;  2F2V A;  2LJ0 A;  4AFS C;  2J06 A;  2KGT A;  4HVU A;  2J6F A;  1KJW A;  1AOJ A;  4Y92 A;  4CC3 A;  2DL4 A;  1GBQ A;  4Z88 A;  1MV3 A;  1B3Q A;  1E7O A; 
#chains in the Genus database with same CATH topology
 2PUO B;  3CCR T;  1YBY A;  5KYN A;  2D1X A;  1UJY A;  1Q82 U;  4A63 B;  1A0N B;  2LVM A;  5FU6 C;  1YWO A;  1BKB A;  3P8D A;  2JVV A;  3M57 A;  5CCA A;  3I5S A;  2FL7 A;  1SRM A;  2YT6 A;  2X4Y A;  4OF1 A;  3QKJ A;  4QVZ A;  3RNJ A;  4ZTJ A;  3A1P A;  1BI0 A;  2OAW A;  2F5K A;  3LYI A;  3OB9 A;  1RAG B;  4HCZ A;  1UTI A;  4J83 A;  2DZC A;  2QEX A;  1OPL A;  4PJL A;  2MOX A;  4M75 C;  4XAX B;  1H3H A;  3T9N A;  2QG9 B;  1IGU A;  2QQS A;  1SF9 A;  1VQ7 T;  1K8A U;  3OW2 P;  4LN2 A;  1V29 B;  1AD5 A;  1YHQ Q;  2DZ9 A;  2L3Q A;  5GMK e;  1IRE B;  3H8Z A;  2E64 A;  2EFI A;  4QVD A;  2A37 A;  1KQS P;  3MP1 A;  5KYX B;  3GF5 A;  3MP6 A;  1BU1 A;  4J5Y A;  2LTO A;  1YJN A;  1OEB A;  2QAS A;  5CAI A;  3JB9 I;  1W70 A;  4QVC A;  4IUP A;  5C0M A;  3HRT A;  4AT1 B;  3JCM X;  1RL2 A;  3BDU A;  1FX7 A;  2RQV A;  2F2X A;  2RQW A;  4N0A C;  1VQN Q;  3VKI A;  2O9S A;  4LUE A;  2J6O A;  3P8B B;  5LJ5 e;  3M59 A;  1WHL A;  2EGC A;  4GY5 A;  1S72 T;  1VQ5 A;  3CME T;  2BE9 B;  3OYJ A;  4PJM A;  4OMQ A;  4J9E A;  1D3B B;  2LQ8 A;  3QJY A;  1YI2 T;  3CC2 A;  1OZ2 A;  3FJP A;  5KYW A;  1ZBJ A;  1NE8 A;  4RUG A;  1QWF A;  4PJO E;  4WTO B;  1EIF A;  5GAO m;  3QBY A;  1X2Q A;  4FM4 B;  1AZG B;  2ATC B;  3S3M A;  1VUB A;  3GNG A;  1U8R A;  1Q81 U;  1GFC A;  2K5F A;  1KC8 U;  4DQ2 A;  2P4R A;  3QZ9 B;  2K2V A;  2KT1 A;  3M4Y A;  4R0K A;  4XTW A;  3M4G A;  1YJW T;  1K73 R;  5IXF A;  4ZTF A;  4M75 F;  2VV5 A;  4MZP A;  5L8R E;  3SWN C;  2KT8 A;  2OTJ A;  5GMK h;  1AT1 B;  3HL8 A;  5CK9 A;  4KBM B;  4QKU A;  3V8L A;  4EMK C;  4BAC A;  2O01 E;  3A5Z B;  2FVU A;  3CCV T;  3RMS A;  1OYX A;  1QCN A;  4M77 C;  2CRE A;  1LVK A;  3RR6 A;  1WQW A;  2RM4 A;  1TUD A;  2YUP A;  3JCM V;  4PJO B;  4J7I A;  1Q7Y C;  2L89 A;  1X27 A;  2X3X D;  3CCL A;  1M90 C;  4C8Q E;  5LJ5 h;  3BFM A;  3HSB A;  4JRK A;  3CCS Q;  3G6E T;  1N9R A;  2VXF A;  4M77 D;  2HNI A;  2M16 A;  3HFN A;  2YUO A;  3TQ7 P;  2E6N A;  4EPC A;  1KFZ A;  2SRC A;  2DD5 A;  4M78 D;  3EGD B;  2AZS A;  1UJ0 A;  3PNW C;  1N8R C;  1ZQ1 A;  1KD1 R;  3OBW A;  3X24 B;  4M7A G;  2P84 A;  3SDZ A;  1D1B A;  3M0R A;  1U1S A;  5LJ3 j;  5KYX A;  3G71 T;  2OTL T;  4LDY A;  5DLO A;  1ZSZ C;  3C95 A;  3E9G A;  2CH4 A;  2X51 A;  3NHN A;  3UAT A;  4AG2 C;  2YDL A;  4IIM A;  4TVR A;  2LC4 A;  5CVI A;  1UHF A;  2ENM A;  2BTT A;  1B34 B;  5KE2 A;  3CXC P;  4C8Q B;  1VOM A;  3MPU B;  3CQT A;  1NJI R;  1YHQ A;  3PIO A;  5I21 A;  2EQI A;  4OB3 B;  5FRN A;  2J05 A;  3CD6 T;  4MZM A;  1QVP A;  4DBH A;  1YIJ Q;  1VQ4 Q;  1D3B A;  3UA6 A;  5GMK l;  2QQ9 A;  4B9W A;  4M7A C;  3QYG B;  4M77 F;  5GAN 7;  2DBM A;  3CCQ T;  1TU0 B;  4X34 A;  4PFO A;  4J9B A;  1YN8 A;  4ANJ A;  4BE0 A;  1X69 A;  3PVQ A;  2KR3 A;  3UT1 A;  3ZL7 C;  3ZEH A;  5FWC A;  1VQN A;  2QQB A;  3TU4 K;  3EGX B;  4JUV A;  1QQJ A;  2L3P A;  3OBY A;  2RHZ A;  2EQM A;  5CKF A;  4KUD K;  1WZO A;  3QO3 A;  1M30 A;  1TSF A;  3H41 A;  1WJS A;  1Y57 A;  1Q86 U;  2O4X B;  4C92 C;  3SFM A;  3UDC A;  3VRZ A;  2PZ1 A;  3OYC A;  3FDR A;  2EKO A;  5AYF A;  2QQA A;  4OP0 A;  2X4X A;  2G6F X;  4FYY B;  3C94 A;  1QKX A;  1ZSG A;  5J39 A;  2QA4 Q;  2R5A A;  1OV3 A;  5KYU B;  4B9X A;  2C06 A;  3HHT B;  4EMG A;  2ZGW A;  3CCU T;  2MPX C;  3CCJ T;  4FU6 A;  1VQ8 Q;  1V1C A;  2LQN A;  2K4Y A;  3G4S Q;  4C92 D;  4C5I A;  1OU9 A;  1ZA2 B;  1MMA A;  2KSS A;  4PJO A;  1RAC B;  1RAD B;  1LPL A;  1JU5 C;  4PKC C;  1JRI A;  3PGG A;  4M7D C;  2GTJ A;  2NUZ A;  1AWW A;  3EFO B;  2FRW A;  2RNA A;  2O9V A;  2P0Q A;  2IPO B;  1OX8 A;  3CXC A;  2JTF A;  2COW A;  2L8D A;  1XTD A;  2DL5 A;  3GPL A;  3RUX A;  4ZGD B;  3EGD A;  4CC4 B;  4E7I A;  2CSQ A;  2WSC E;  4MMK A;  4ELZ C;  2NUP B;  2HAX A;  3PVL A;  4M7D D;  2DL3 A;  4KH1 B;  3O8V A;  2K9G A;  4M7A F;  4XTU A;  2HSP A;  5HKC A;  4OGE A;  4PJN A;  4J9G A;  2RJD A;  3OA6 A;  4IKF A;  2E12 A;  4F7U F;  1VQK T;  4EMH A;  2ZPG B;  2KK4 A;  3CCS A;  3JCM P;  4KUL A;  3AHU A;  2DYB A;  4FYV B;  1D1A A;  3V8J A;  3FEO A;  5KCO A;  2EJ9 A;  4BY6 C;  1EX4 A;  2VXE A;  4FW2 A;  4JRP A;  1B34 A;  5A0L A;  4C92 F;  4C8Q A;  6AT1 B;  2LCS A;  3GNF B;  2HCK A;  1WHH A;  2BE7 D;  2H8H A;  2EQU A;  2NLU A;  4DBR A;  1MUZ A;  1VA7 A;  3ER0 A;  1K0S A;  2X35 A;  3V7R A;  5GAM g;  3HRU A;  3OS2 A;  3SEM A;  5CQY A;  2V1Q A;  3JB9 H;  1G3Y A;  2R5M A;  1TUG B;  3EGX A;  2DO3 A;  2Y90 A;  5GAN g;  1VQ9 Q;  2P0P A;  2QEX T;  1UGR B;  4RKU E;  4M7D F;  2DXB A;  4Y92 A;  4Z88 A;  2O4X A;  1YIJ A;  1VQ4 A;  2XG8 D;  1Q7Y R;  4ZGJ B;  1Y71 A;  3MJX A;  3PE0 A;  2D0Q B;  4AFU C;  1OZ3 A;  1M90 R;  1UB4 A;  3VUZ A;  2HSE B;  3WVE B;  3EHQ A;  2DXC A;  1BB9 A;  5KYU A;  3JCM f;  3KFV A;  2EPD A;  3QZ5 B;  2EWN A;  2MCN A;  1U5S A;  1NLO C;  2HBP A;  1YJN T;  2EYZ A;  3L2V A;  2LX9 A;  1N8R R;  1AVZ C;  2LRQ A;  5A0G A;  3A8L B;  3QHS A;  3LH5 A;  1T0H A;  4PLL A;  4XU1 A;  4E47 A;  1TH7 A;  3M5A A;  3VS5 A;  4CRI A;  1WNL A;  2BKD N;  1KQ2 A;  2OX7 A;  3OYY A;  4XTY A;  3EFO A;  1HXD A;  3VS2 A;  3A8O B;  4XK8 E;  1UE9 A;  3DB3 A;  4BI8 B;  2DX1 A;  3VU3 C;  4A4F A;  2DK3 A;  2FZC B;  4DEX A;  2QA4 A;  1VQ5 T;  4JDS A;  2K79 A;  1WFW A;  3CC2 T;  2I0N A;  2PUK B;  3MHX A;  1BBZ A;  3M0T A;  2NUP A;  3CMA A;  2GTO A;  4LD6 A;  3V7S A;  3HKS A;  2RJE A;  5LL6 S;  4C0D B;  3EH1 A;  3F70 A;  5HY6 A;  2FO0 A;  4MDW A;  1G5V A;  1SKU B;  1KSW A;  5GAO l;  3J7A F;  2A0F B;  1KIK A;  3NTK A;  2VGN A;  2PVO B;  2DD4 A;  1VQM Q;  4WCI A;  3QJ6 A;  5GAO n;  3CC7 Q;  3QII A;  1BI2 A;  2BZX A;  4NOY A;  1NBE B;  1VQP A;  2OTJ T;  2DEQ A;  4OB2 B;  3A8H B;  3C12 A;  3L2W A;  3JCM c;  1W2B A;  3VYH B;  2EYW A;  1H8K A;  4HCC A;  2PQW A;  2DTO A;  3VRY A;  1B7T A;  1Z9Q A;  4RMO A;  1QP2 A;  2JM8 A;  4Y28 E;  2CP0 A;  1Z9Z A;  1W2B S;  4V2S A;  1O9S A;  1RAF B;  2O2O A;  2LT1 A;  3TCJ A;  1MHN A;  2A7Y A;  5KYY B;  4FSX A;  1VQL Q;  1UEB A;  3VYG A;  3CCE T;  1NLP C;  3JCM d;  3CCL T;  4FW1 A;  1K9A A;  1OQK A;  3RIR A;  1YCS B;  1ABO A;  2HEQ A;  1VIF A;  2L3R A;  3HTR A;  2CZ0 B;  2DXU A;  2QGF B;  2YRC A;  1PWT A;  4HA8 A;  2D8J A;  3I55 Q;  3M0Q A;  2O31 A;  2OJ2 A;  4N4G A;  1OUL A;  5GMK j;  2RA2 A;  3OS0 A;  2MK5 A;  1ZX6 A;  4DBQ A;  4IUQ A;  1LNX A;  4BE1 A;  3C4S A;  1BI3 A;  1HD3 A;  4HVV A;  3VS7 A;  1ZLM A;  5FWB A;  1FYN A;  2ZPI B;  4PJJ A;  4X1V A;  4JRI A;  3EG0 A;  4JZ3 A;  2BZY A;  1HYO A;  1QVG A;  1IGQ A;  3S3N A;  1GCQ C;  4QT7 A;  1VQ6 Q;  3QPH A;  4PFZ A;  5LJ5 j;  2K5L A;  5FRO A;  1QVG S;  2FZK B;  3MEU A;  2HZY A;  3A8M B;  1WX6 A;  3V8K A;  1YHQ T;  2VVK A;  2E3H A;  2GFA A;  4PJO G;  4KGX B;  4M75 D;  3MEA A;  2QTV A;  1M1K C;  3R6N A;  2XHC A;  5A0D A;  4CC2 A;  3I56 A;  3LGF A;  1LJO A;  2FB7 A;  1AWX A;  4C0Z A;  2RPN A;  2DMO A;  3I35 A;  4HCK A;  1N9S A;  1FMV A;  3RDV A;  3BDL A;  4IUR A;  4RTV A;  1W4S A;  3DB4 A;  4QQG A;  1VQN T;  3OMG A;  4X9C A;  4F14 A;  2FG0 A;  4PLI A;  2CUD A;  2XIC A;  3QXE B;  2KI7 A;  4GLK A;  2ZPE B;  2DIQ A;  5HK3 A;  3H6Z A;  1UFF A;  2CSI A;  3JCM J;  1K1Z A;  4Z89 A;  1W6X A;  3LGL A;  3EFS A;  2GBQ A;  2MWO A;  5CKH A;  2BIV A;  4ESR A;  1GXI E;  2LQW A;  2C0O A;  1I5O B;  1RI0 A;  3CBP A;  1X6G A;  2DVJ A;  1X6B A;  2IVW A;  2K2M A;  2CT4 A;  1W1F A;  1NG2 A;  3PTA A;  1RAH B;  1KQ1 A;  5FLX E;  1K8A R;  3OMC A;  1WGS A;  1S72 Q;  3CME Q;  4PJO C;  2KNB B;  1YI2 Q;  1JEG A;  2DFU A;  3OYH A;  5GAM f;  4X9D A;  3EG1 A;  3CC4 Q;  5GAM e;  4C8Q G;  4JJC A;  3EGU A;  4XU3 A;  2CT3 A;  2DM1 A;  2JS0 A;  2DRM A;  3VS0 A;  5KYY A;  1IHW A;  2PU9 B;  3REB B;  3OYK A;  4JRQ A;  5GAN f;  2DXT A;  1VQM A;  3NTH A;  3VJP A;  1MND A;  5GAN e;  3CC7 A;  4AMC A;  2QTX A;  3M0S A;  4WF2 A;  4RG8 A;  4D6W A;  3JAM E;  2EKH A;  4DA4 A;  1YJW Q;  4BD3 A;  1B07 A;  1O75 A;  2MF2 A;  2QK0 A;  1JQQ A;  1P92 A;  1R77 A;  2F69 A;  4JLG A;  2MI6 A;  3PMT A;  1Y96 B;  3JCM g;  1KD1 U;  3G1J A;  2IIM A;  2LDM A;  4QW2 A;  3OYM A;  5D6Y A;  2B8A A;  2CP2 A;  3JSC A;  1M2V B;  4RTY A;  5I11 A;  1MGQ A;  3JCM W;  3GLX A;  3S6W A;  3UA7 A;  3NPF A;  2JS2 A;  4Y91 A;  4C8Q C;  4M78 E;  5IAY A;  2VGM A;  2DA9 A;  2YWW A;  3CCS T;  2E4H A;  2HL3 A;  5GAN 4;  2RJF A;  1I1J A;  1XOV A;  5DY9 A;  1K9M C;  1MNE A;  3M0U A;  3UF4 A;  5EC7 A;  3M0P A;  3DLL A;  4BDY A;  1NJI U;  3MP8 A;  4J9F A;  1X01 A;  3H9N A;  2BUD A;  2LQK A;  4BDZ A;  1FWZ A;  3KBG A;  4LDW A;  1C0M A;  1NPP A;  2Y4X A;  4NS5 A;  3M58 A;  2RQR A;  5GAM h;  3P8H A;  4PJO F;  3ME9 A;  4OB1 B;  2XDB A;  3OYE A;  3V7C A;  1JJ2 A;  3HRS A;  5GAN h;  3G71 Q;  2OTL Q;  4FYW B;  4LDU A;  1VQ6 A;  4RTX A;  2NWM A;  2A36 A;  1YJ9 Q;  4PNO A;  2FZG B;  3MCA B;  3RMQ A;  5GAM d;  3URG A;  2FEI A;  3JB9 G;  3J80 E;  4M78 B;  1WHG A;  2GCX A;  1JJ2 S;  5IHK A;  1E6H A;  1PD1 A;  2GQI A;  1LCK A;  4LE9 A;  1BI1 A;  1YIJ T;  1VQ4 T;  1K0X A;  3IQL A;  5GAN d;  2Z0W A;  3BY7 A;  2QXF A;  3CPW S;  3CD6 Q;  3MEW A;  4J8O A;  2RI3 A;  1SHG A;  1YIT Q;  1GFD A;  3MO8 A;  1SEM A;  4HT8 A;  1PG5 B;  1WXB A;  1FMK A;  2F2V A;  1NPR A;  2LJ0 A;  2KGT A;  3QYH B;  4C8Q F;  2XDD A;  4M7A D;  2J6F A;  1AOJ A;  1ZSZ B;  4J6Y A;  5I2S A;  1H92 A;  2RH2 A;  1D0Y A;  4A4H A;  2Y4Y A;  3Q1J A;  5HCK A;  4PK4 A;  2PVD B;  4A4E A;  2L5Q A;  2QA4 T;  1QLY A;  1Y96 A;  4BB7 A;  1D0X A;  4DEY A;  8AT1 B;  4KGZ B;  3CC4 A;  4KGV B;  1T3L A;  4JS5 A;  1EFN A;  4J9C A;  3SB2 A;  1M2V A;  1OOT A;  3CMA T;  3PFS A;  5CQX A;  2ZCF B;  3SD4 A;  2DKG A;  2RI2 A;  3L2R A;  2DL7 A;  1JBM A;  2ABL A;  3QWX X;  1M1K R;  1M8M A;  1LOJ A;  4C0G A;  2RHI A;  4K11 A;  1HSQ A;  4LXC A;  1YJW A;  2MYS A;  4QQ6 A;  1NM7 A;  1X6O A;  1QVF S;  4PFP A;  5IT9 E;  2RD1 A;  2LJ1 A;  1VQP T;  4Z02 A;  2X4J A;  3X28 B;  1VQO Q;  4OMN A;  2RMO A;  3OSV A;  2E10 A;  1AHJ B;  4C92 B;  1Y7X A;  3OQ5 A;  1WHJ A;  2DJZ A;  2DER A;  1UGP B;  2CP5 A;  5J3B A;  1PD0 A;  1IB8 A;  4N4H A;  2QDY B;  3CPF A;  3LLR A;  4D8D A;  2NUT B;  5EG2 A;  2COZ A;  1Q82 C;  2KY9 A;  2L2P A;  1UDL A;  2M9U A;  2EJF A;  4MZT A;  4B6M A;  4A4G A;  4E2F B;  1QMC A;  2DTH A;  2E5K A;  1VQK Q;  2IG0 A;  3REA B;  1SSH A;  4M78 A;  1JXO A;  2A28 A;  1KG1 A;  4FIB A;  3THK A;  5FU7 C;  4OVA A;  2FHD A;  1WI7 A;  1Q7Y U;  2LP5 A;  1M90 U;  4M7D B;  1M27 C;  2HMA A;  2V1R A;  1TOV A;  4ZNX A;  1H64 1;  4KT0 E;  2ZAE A;  1D1C A;  3U23 A;  2E70 A;  2W10 A;  2L3S A;  2OAU A;  3TVT A;  2EW3 A;  1K8A C;  1N8R U;  1YJ9 A;  1SSF A;  4E7H A;  5DM7 R;  3FIF A;  2BZ8 A;  5A2Q E;  1RAE B;  1WDX A;  2VAS A;  2M0Y A;  1CKA A;  3E1S A;  1PC0 A;  1W2B P;  3C0C A;  1ZSZ A;  1VYV A;  3TSW A;  1ABQ A;  3H0H A;  1G8X A;  2RHY A;  2K7A A;  2VKN A;  3RKW A;  2HD0 A;  1UHC A;  2RK1 A;  1I5L A;  4N4I A;  2CP6 A;  1I8F A;  3JCM e;  1M4Z A;  1EZZ B;  4C0D C;  1QCF A;  2WSE E;  4BY6 B;  2DNU A;  4IUT A;  1YIT A;  2EQJ A;  1K9M R;  1M3C A;  1RLP C;  3UPU A;  2GQV A;  1T3S A;  5GJV B;  3I56 T;  2AHJ B;  4J9I A;  4HCB A;  4J7F A;  1ZUY A;  2CZ1 B;  1PHT A;  4F04 B;  3WXM B;  3JRZ A;  1MMN A;  2ZPF B;  4RCC A;  2DLP A;  2VWF A;  4JJD A;  2HKN A;  4BE2 A;  3X26 B;  4C0F A;  2GGR A;  3D7S B;  2VUB A;  3GP8 A;  1IHV A;  1RAB B;  1Q81 C;  2C0T A;  2CH4 W;  1MV0 B;  4PL6 A;  1KC8 C;  1VQ8 A;  3G4S A;  2JW4 A;  2B86 A;  3L2U A;  3CCM Q;  1YFN A;  2HQE A;  1WXU A;  4E7L A;  2OI3 A;  4C92 A;  2JXB A;  1VYU A;  2ESW A;  1QVG P;  2CP7 A;  3QUI A;  1AWJ A;  4FL6 A;  1ARK A;  2LNH B;  1PKS A;  3HPW A;  2JNG A;  5HK0 A;  2NUT A;  1G3S A;  3WVD B;  4XTX A;  1HJD A;  4RTU A;  4OMF B;  1TXQ A;  5CKD A;  5KCH A;  3VUB A;  3PT9 A;  2KVQ G;  3KXT A;  3CC7 T;  1ZBX A;  1M3B A;  1N27 A;  2KYB A;  3JCM h;  2HDA A;  1KK7 A;  2XK0 A;  1VQO A;  3L42 A;  3CBM A;  4OB0 B;  5I22 A;  2KRO A;  1IO6 A;  3QDR B;  1R0C B;  1UEC A;  3TSZ A;  2DJQ A;  4XTV A;  3ULR B;  4M7D A;  3FRN A;  1GBR A;  3M55 A;  5LJ3 g;  2CZ7 B;  4FT4 A;  3E19 A;  1X75 C;  1ZUK A;  2M51 A;  2YXY A;  1OU8 A;  2C0I A;  4YTL A;  2FPD A;  1K76 A;  5AT1 B;  2RI5 A;  2KRM A;  1U3O A;  1RI9 A;  4AFQ C;  4FSS A;  3CCL Q;  3CCE Q;  4XQ3 A;  3RER A;  2QYZ A;  5IXB A;  4DBF A;  1WJR A;  3X20 B;  2QI2 A;  4HKE A;  3CCR Q;  1PKT A;  3BW1 A;  2ROT A;  1AEY A;  3RES A;  1QKW A;  3L2Z A;  4CI0 C;  2AK5 A;  5M9O A;  1PSE A;  3GOX A;  4D8K A;  1ZHI A;  4DOV A;  2EGE A;  1VQ9 A;  4LNP A;  3A8G B;  1NEB A;  2EBP A;  5GAO r;  2PTK A;  5KH6 A;  1NZ9 A;  4L5G A;  3OYD A;  1R0B G;  4OMM A;  2GF7 A;  3OYL A;  1VQ6 T;  4M75 E;  4R55 A;  1VIE A;  5DLQ E;  2YUN A;  5GAO q;  2DE0 X;  1M3A A;  2XI9 A;  3TEE A;  4F16 A;  3QG1 A;  1M9S A;  2F2W A;  2FPF A;  1U06 A;  3DLM A;  3QDF A;  1Q82 R;  3RKX A;  2KQW A;  1VQ7 Q;  2R58 A;  4GBQ A;  1ACM B;  2H3E B;  1SG5 A;  4ZGE B;  2QDL A;  2AZV A;  1Q86 C;  1F1B B;  4E7Z A;  2MAM A;  3NMZ C;  2L0A A;  1KHC A;  4VUB A;  1M1G A;  2M0O A;  5GAM j;  2LMJ A;  3CBO A;  8ATC B;  5FU6 B;  2KXC A;  1K73 U;  2KDS A;  1BK2 A;  3MKD A;  1YP5 A;  3FJ5 A;  4C5G A;  3BE3 A;  2JTE A;  5GAN j;  1I07 A;  3KUF A;  3QWY A;  1Y07 A;  2O88 A;  5CIU A;  5LJ5 f;  2D0N A;  4M75 B;  1IXD A;  5CKE A;  1WA7 A;  3X25 B;  4JLI A;  3CCM A;  1G3W A;  2AIR B;  4L6V 5;  3JB9 J;  1D09 B;  2XD0 A;  1XNI A;  3CEY A;  2JUF A;  1JJ2 P;  2EJG A;  4M77 G;  4EDU A;  1TWB A;  4GLM A;  3LX7 A;  3CC4 T;  1G3T A;  1YCY A;  1WIE A;  2MWP A;  2HBW A;  4M78 G;  4F17 A;  3EG9 B;  5IH2 A;  1SHF A;  5IHN A;  4FYX B;  5D6W A;  3CPW P;  4E7K A;  3N5B B;  4PJO D;  1Q95 G;  2AT1 B;  1TTH B;  4CC3 A;  2DL4 A;  1GBQ A;  3GIB A;  1B3Q A;  2VB6 A;  1E7O A;  3VS6 A;  2JOY A;  2K5I A;  2LCL A;  4EIK A;  2RO0 A;  2EAY A;  4J9H A;  1ZA1 B;  4KH0 B;  3VS3 A;  1WYX A;  3CCV Q;  1OX9 A;  1CSK A;  1WXT A;  2YRV A;  4M77 E;  2LCC A;  3OW2 A;  1VQL A;  4II1 A;  2LZ6 B;  2LNV A;  2RB6 A;  4Q5W A;  2A3L A;  2WSF E;  1SPK A;  1Q81 R;  1R8O B;  1H3Z A;  2KAF A;  1KQS A;  1KC8 R;  4M78 C;  2K3Y A;  4P5N A;  1I81 A;  2KRN A;  2DIL A;  3SHW A;  3ZBD A;  4A54 A;  2DYI A;  3OW2 S;  1M5Q 1;  3I55 A;  2CUB A;  1Y0M A;  3CCE A;  1T0J A;  4BUG A;  3EG3 A;  4NL2 A;  2X4W A;  3FB9 A;  3VV0 A;  2GNC A;  1KQS S;  3G6E Q;  3CCR A;  4JS4 A;  3NFC A;  1NYG A;  2QAZ A;  4ORZ A;  4C8Q D;  1JB0 E;  2DIG A;  1PSF A;  1XQH A;  2D6F A;  1PNJ A;  1UGS B;  4JPB W;  2KE9 A;  3SWN B;  1GRI A;  2JM9 A;  2CKK A;  2X3W D;  4ZN3 A;  1M8V A;  1FXX A;  5LJ5 d;  4EMK B;  3R6O A;  5GAO p;  2RF0 A;  2A08 A;  1QVF P;  1FMW A;  2EYY A;  4M77 B;  1WHM A;  4F7U G;  2HQX A;  4KUI A;  2EYX A;  3MET A;  1YJ9 T;  4M4Z A;  1AWO A;  1UGQ B;  1BIB A;  3NTI A;  3CPW A;  1JO8 A;  1E6G A;  2K3B A;  3FC3 A;  3FLG A;  4C92 G;  3OS5 A;  4HXJ A;  1G83 A;  2KXD A;  1IZ6 A;  1CKB A;  4XU2 A;  1VQ7 A;  5CKB A;  2I2L A;  2RN8 A;  4C5E A;  4M75 A;  2P0K A;  1GL5 A;  2MIO A;  2HL5 C;  1KHI A;  2E65 A;  1GCQ A;  2ZZD A;  1J3T A;  1WJQ A;  4QQD A;  2AKL A;  2D8H A;  5LJ3 f;  4J9D A;  4OML A;  4M7A E;  1GCP A;  1NYF A;  2KEA A;  1RUW A;  5LJ3 e;  1YIT T;  3CCQ Q;  1VYT A;  4JJN K;  4ATO A;  3EG9 A;  2G3R A;  2JMA A;  4BI4 A;  4F7U E;  1PRL C;  4A4K A;  3M54 A;  3EG2 A;  3ZFJ A;  3OY9 A;  4M78 F;  3VS1 A;  2AKK A;  1M1K U;  2QGG A;  3OYB A;  3OSS C;  1AZE A;  4M7D G;  4BI3 A;  4IUU A;  2XMF A;  2CZ6 B;  1N5Z A;  1S72 A;  1WHK A;  4AFZ C;  4C92 E;  3CME A;  2ED0 A;  2ROL A;  2KMT A;  4FCY A;  2D9T A;  2RHX A;  1YI2 A;  4N0A A;  3JCM Q;  4L59 A;  4LDX A;  2COY A;  1VQ8 T;  2LT4 A;  3G4S T;  1TS9 A;  3OYI A;  3JB9 D;  4J6X A;  5CO7 A;  3RBB B;  3CCU Q;  3CCJ Q;  1G2B A;  1QVF A;  1QCO A;  2EIF A;  2FYK A;  4M7A B;  3OYN A;  3CMA Q;  2E3I A;  4AG1 C;  1Q86 R;  1MMG A;  4M7D E;  2K57 A;  2GFU A;  3EFR A;  4F7U B;  2VC8 A;  2DRK A;  2DL8 A;  7AT1 B;  1JXM A;  2X9H A;  1MMD A;  3NGP A;  1XJW B;  2MMP A;  1TG0 A;  3CCV A;  1VQO T;  3H0F A;  4O6J A;  3J81 E;  1K4U S;  5LJ3 h;  1YWP A;  1ZUU A;  3JV3 A;  4RTZ A;  2WAC A;  3SWN A;  1RAI B;  4A53 A;  3EH2 A;  1HK9 A;  1VQP Q;  3M56 A;  5I2M A;  4C5H A;  3UWN A;  2LX7 A;  4EMK A;  3CXC S;  2J7I A;  4OGC A;  2FRY A;  1X2K A;  2RK2 A;  4ELY C;  3PMI A;  5FW9 A;  2PNI A;  4M77 A;  1C6V X;  2M1H A;  4JJB A;  1UUE A;  2XDP A;  3OYA A;  5LJ3 d;  4ZN1 A;  3G6E A;  2ECZ A;  5LJ5 g;  3VS4 A;  4KRT A;  4E6R A;  3JB9 F;  4O5V A;  2YLB A;  2EVR A;  2V26 A;  3O5Z A;  1BCM A;  2QQR A;  4NL3 A;  3A98 A;  3E2U A;  4LDV A;  3M53 A;  2VYT A;  5GAN 5;  2J6K A;  4HT9 A;  2DVE A;  4MML A;  2HQH A;  3G71 A;  2OTL A;  2CGH A;  5C6S A;  4HVW A;  5GAN 2;  1K9M U;  3TRE A;  5KE3 A;  3OS1 A;  1SRL A;  2DPP B;  1VQ9 T;  4ME7 A;  3E9F A;  2ED1 A;  2DET A;  1I4K 1;  5GJW B;  5GAN 6;  4E7J A;  5FRM A;  1PM3 A;  2F1L A;  5GMK m;  2EQK A;  2JTM A;  2QEX Q;  2PVG B;  2YLC A;  2JMC A;  2V8K A;  1QP3 A;  5J26 A;  3CD6 A;  2CP3 A;  3DKM A;  3JCM b;  2E41 A;  4LD9 K;  2R57 A;  4MDX A;  4XTZ A;  2YSQ A;  3S3O A;  1PRM C;  3AT1 B;  2RJC A;  1V76 A;  3CCQ A;  3PIP A;  1K73 C;  2ZPH B;  5ECA A;  1S1N A;  3I5R A;  5IN1 A;  2KBT A;  5D6X A;  5FU7 B;  4RG2 A;  1YJN Q;  1X43 A;  4RCB A;  2XKO C;  1BCO A;  5L23 A;  1C1A A;  4JZ4 A;  2DEU A;  4M7A A;  4E7S A;  3I56 Q;  2RHU A;  1UGV A;  1NEG A;  3EHR A;  2F5T X;  1TUC A;  4F7U A;  2K6D A;  1D0Z A;  1WQ7 A;  2E5Q A;  1BIA A;  4R56 A;  2YUQ A;  1QWE A;  2LJ3 A;  2E6Z A;  2H3J A;  2CDT A;  1WPY A;  2XU8 A;  3HFO A;  1QW1 A;  2JT4 A;  1RLQ C;  2EGA A;  4OMP A;  5D7U A;  5GAN 3;  2ZPB B;  3L2Q A;  4LUD A;  5CR2 A;  3LWH A;  3CCM T;  2RQU A;  1VQ5 Q;  2HKQ B;  1PCX A;  3CC2 Q;  3HP9 A;  3CCU A;  3LW5 E;  3CCJ A;  2KYM A;  4IUV A;  3OYG A;  4DOW A;  2CYZ B;  2DBK A;  2K3X A;  3GBQ A;  1UG1 A;  3RKY A;  1YNZ A;  1I0C A;  1M1F A;  3QSU A;  3G7Z A;  4IIO A;  2DAQ A;  3INZ A;  2NYS A;  1KD1 C;  1VQM T;  2FPE A;  2YHT A;  3I9Q A;  2V8J A;  3EAE A;  1WLP B;  9ATC B;  2M02 A;  2CS7 A;  1OPK A;  2JN0 A;  4OMO A;  1M2O A;  1N6A A;  2W0Z A;  2YRD A;  2OTJ Q;  2V8I A;  2JJ9 A;  2SEM A;  5KYW B;  3L1A A;  3H0I A;  4RTW A;  4XU0 A;  3OYF A;  3MEV A;  2KRS A;  1BYM A;  3ASK A;  2JZ2 A;  5IHI A;  1VQL T;  3LH0 A;  2DF6 A;  1RAA B;  2XID A;  4RTT A;  1NJI C;  4Z8A A;  2RQT A;  1DJ7 B;  1U1T A;  4CC7 A;  1VQK A;  2DTI A;  2P4T A;  2EYQ A;  3M9Q A;  4M75 G;  3LWI A;  4AFS C;  2J06 A;  4HVU A;  1OI1 A;  3I55 T;  4FT2 A;  1IRX A;  2E1H A;  5GAN 8;  1KJW A;  4J6W A;  5GMK i;  1MV3 A;  4UC4 A; 
#chains in the Genus database with same CATH homology
 3VS6 A;  5HCK A;  2D1X A;  3PE0 A;  4AFU C;  4EIK A;  1UJY A;  4J9H A;  1QLY A;  3VS3 A;  4A63 B;  1WYX A;  3EHQ A;  1A0N B;  1BB9 A;  4DEY A;  1CSK A;  1YWO A;  1WXT A;  3KFV A;  1T3L A;  2EPD A;  2LZ6 B;  2MCN A;  1EFN A;  1U5S A;  4J9C A;  3I5S A;  1NLO C;  1OOT A;  1H92 A;  2EYZ A;  1SRM A;  2YT6 A;  1SPK A;  3RNJ A;  2OAW A;  1AVZ C;  3LH5 A;  2KRN A;  2DIL A;  1T0H A;  1UTI A;  2DL7 A;  3SHW A;  2ABL A;  3QWX X;  1M8M A;  1OPL A;  2CUB A;  2MOX A;  1H3H A;  3VS5 A;  1Y0M A;  1T0J A;  4K11 A;  1HSQ A;  3EG3 A;  3VS2 A;  2GNC A;  1UE9 A;  1NYG A;  1NM7 A;  4ORZ A;  2DX1 A;  4DEX A;  4LN2 A;  1AD5 A;  2LJ1 A;  2L3Q A;  2K79 A;  1PNJ A;  4JPB W;  4OMN A;  2RMO A;  1WFW A;  2KE9 A;  1GRI A;  2I0N A;  2JM9 A;  2A37 A;  2X3W D;  1BBZ A;  3M0T A;  1BU1 A;  1OEB A;  2RF0 A;  2GTO A;  2A08 A;  1W70 A;  2EYY A;  2EYX A;  4D8D A;  2FO0 A;  2RQV A;  2F2X A;  4M4Z A;  2L2P A;  2RQW A;  1UDL A;  1AWO A;  1KSW A;  2O9S A;  1KIK A;  1JO8 A;  4LUE A;  1E6G A;  2K3B A;  2E5K A;  2J6O A;  3REA B;  1SSH A;  4HXJ A;  1G83 A;  2KXD A;  1CKB A;  1JXO A;  2A28 A;  2EGC A;  4WCI A;  2BZX A;  2RN8 A;  3THK A;  1WI7 A;  4OMQ A;  4J9E A;  1GL5 A;  2LP5 A;  1M27 C;  2MIO A;  2V1R A;  1ZBJ A;  1GCQ A;  2EYW A;  1J3T A;  1H8K A;  4RUG A;  1QWF A;  2AKL A;  2D8H A;  4J9D A;  4OML A;  1GCP A;  4ZNX A;  1NYF A;  1X2Q A;  1Z9Q A;  1RUW A;  1AZG B;  2KEA A;  3VRY A;  1VYT A;  2JM8 A;  3U23 A;  2W10 A;  2L3S A;  1Z9Z A;  2JMA A;  3TVT A;  2EW3 A;  1GFC A;  1PRL C;  2O2O A;  2P4R A;  3EG2 A;  3VS1 A;  1NLP C;  2AKK A;  2KT1 A;  2BZ8 A;  4R0K A;  1AZE A;  1K9A A;  5IXF A;  1YCS B;  1ABO A;  2HEQ A;  1WDX A;  2M0Y A;  1CKA A;  2XMF A;  1N5Z A;  4AFZ C;  2ED0 A;  2ROL A;  3C0C A;  2KT8 A;  1PWT A;  1VYV A;  2D8J A;  1ABQ A;  3TSW A;  3M0Q A;  2O31 A;  2OJ2 A;  3H0H A;  2K7A A;  2VKN A;  1UHC A;  2CRE A;  1QCF A;  1ZX6 A;  2DNU A;  1HD3 A;  1M3C A;  1TUD A;  4HVV A;  3RBB B;  1RLP C;  3VS7 A;  2YUP A;  1ZLM A;  1G2B A;  1T3S A;  5FWB A;  5GJV B;  1FYN A;  4J9I A;  4X1V A;  3EG0 A;  1X27 A;  4JZ3 A;  2BZY A;  2X3X D;  1ZUY A;  1PHT A;  4AG1 C;  1GCQ C;  4QT7 A;  2DLP A;  2VWF A;  4JJD A;  2DRK A;  2DL8 A;  2GGR A;  2YUO A;  1JXM A;  1KFZ A;  2SRC A;  3NGP A;  2AZS A;  1UJ0 A;  1WX6 A;  1TG0 A;  2C0T A;  2CH4 W;  1MV0 B;  2VVK A;  3H0F A;  1K4U S;  2JW4 A;  2B86 A;  1YWP A;  3R6N A;  1ZUU A;  3JV3 A;  4RTZ A;  1WXU A;  4CC2 A;  2OI3 A;  3M0R A;  2JXB A;  1VYU A;  2ESW A;  1AWX A;  1AWJ A;  2LX7 A;  2RPN A;  1ARK A;  2J7I A;  2DMO A;  3I35 A;  4HCK A;  2FRY A;  1X2K A;  2LNH B;  1PKS A;  2CH4 A;  5FW9 A;  2PNI A;  4RTV A;  3NHN A;  3UAT A;  4F14 A;  2FG0 A;  4AG2 C;  2YDL A;  4JJB A;  1HJD A;  1UUE A;  2CUD A;  4IIM A;  4RTU A;  1UHF A;  2ECZ A;  2ENM A;  1UFF A;  2BTT A;  2CSI A;  3VS4 A;  1K1Z A;  4KRT A;  4Z89 A;  4E6R A;  1W6X A;  2EVR A;  2GBQ A;  3CQT A;  1M3B A;  4ESR A;  2KYB A;  2LQW A;  2C0O A;  3O5Z A;  2EQI A;  1X6G A;  2HDA A;  2DVJ A;  1X6B A;  2J05 A;  2K2M A;  2CT4 A;  5I22 A;  2KRO A;  3A98 A;  1W1F A;  1IO6 A;  1NG2 A;  1UEC A;  3TSZ A;  3UA6 A;  2DJQ A;  3ULR B;  2J6K A;  1GBR A;  2KNB B;  1JEG A;  2DBM A;  4HVW A;  4J9B A;  1YN8 A;  3EG1 A;  1X69 A;  3PVQ A;  2KR3 A;  4JJC A;  1SRL A;  3ZL7 C;  3EGU A;  5FWC A;  1ZUK A;  2CT3 A;  2M51 A;  2DM1 A;  2L3P A;  2C0I A;  2JS0 A;  2DRM A;  2ED1 A;  3VS0 A;  1M30 A;  3REB B;  3H41 A;  5GJW B;  2FPD A;  1Y57 A;  1K76 A;  2KRM A;  3M0S A;  1U3O A;  1RI9 A;  2JMC A;  3VRZ A;  2PZ1 A;  4AFQ C;  4FSS A;  2EKH A;  5IXB A;  1B07 A;  1JQQ A;  2G6F X;  1PKT A;  2ROT A;  1AEY A;  1QKX A;  2YSQ A;  1ZSG A;  1PRM C;  2IIM A;  1OV3 A;  1QKW A;  2AK5 A;  5ECA A;  4D8K A;  1S1N A;  3I5R A;  4RTY A;  5I11 A;  2KBT A;  2EGE A;  1V1C A;  2LQN A;  4LNP A;  1NEB A;  2EBP A;  1X43 A;  3UA7 A;  3NPF A;  2JS2 A;  5L23 A;  4JZ4 A;  2PTK A;  1JU5 C;  2DA9 A;  4OMM A;  1UGV A;  1NEG A;  2GTJ A;  2NUZ A;  1AWW A;  2FRW A;  2RNA A;  3EHR A;  1TUC A;  2O9V A;  1I1J A;  2K6D A;  1XOV A;  2YUN A;  3M0U A;  3UF4 A;  5EC7 A;  2DE0 X;  1M3A A;  3M0P A;  4F16 A;  2F2W A;  2FPF A;  2YUQ A;  1QWE A;  1U06 A;  2LJ3 A;  4J9F A;  2CDT A;  2DL5 A;  2JT4 A;  1RLQ C;  2EGA A;  4OMP A;  4CC4 B;  4GBQ A;  2CSQ A;  4LUD A;  2RQU A;  2QDL A;  2AZV A;  2RQR A;  3PVL A;  2DL3 A;  2KYM A;  3NMZ C;  2K9G A;  2L0A A;  2DBK A;  2HSP A;  3GBQ A;  1UG1 A;  2LMJ A;  4J9G A;  1YNZ A;  1I0C A;  4IIO A;  2KXC A;  4RTX A;  1BK2 A;  2NWM A;  2DYB A;  2FPE A;  2A36 A;  3I9Q A;  1YP5 A;  3FJ5 A;  2JTE A;  1I07 A;  1WLP B;  2FEI A;  3QWY A;  5IHK A;  1OPK A;  1E6H A;  2O88 A;  4OMO A;  2LCS A;  2D0N A;  2GQI A;  1LCK A;  4LE9 A;  2W0Z A;  1WA7 A;  2HCK A;  1K0X A;  3IQL A;  2SEM A;  2H8H A;  3H0I A;  4RTW A;  2KRS A;  1MUZ A;  5IHI A;  1VA7 A;  1K0S A;  4GLM A;  1WIE A;  2HBW A;  3SEM A;  4F17 A;  1SHG A;  5IH2 A;  2DF6 A;  4RTT A;  1GFD A;  1SHF A;  4Z8A A;  1SEM A;  2RQT A;  2V1Q A;  5IHN A;  4CC7 A;  1WXB A;  1FMK A;  2F2V A;  2LJ0 A;  4AFS C;  2J06 A;  2KGT A;  4HVU A;  2J6F A;  1KJW A;  1AOJ A;  4Y92 A;  4CC3 A;  2DL4 A;  1GBQ A;  4Z88 A;  1MV3 A;  1B3Q A;  1E7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...