2A37A

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (drkn sh3 domain)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
b'MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E(sev)2B
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a37A00
2FRWA 2FPEA 1ZUUA 4F17A 1WXUA 4RTZA 2K9GA 3JV3A 1QLYA 1IO6A 4ESRA 2J05A 1UECA 1PKTA 2EYWA 2HCKA 4LUDA 5IXBA 4RTXA 5L23A 2LMJA 4OMOA 1HJDA 2FRYA 3H0HA 1PHTA 4JZ3A 4OMQA 2JS2A 2ECZA 4E6RA 4GLMA 2YSQA 5ECAA 1KIKA 2M51A 2DL3A 3QWXX 1FYNA 3I9QA 2EW3A 1X6GA 3VS7A 4F14A 1RLPC 3FJ5A 1YNZA 1QCFA 2RPNA 2PNIA 1LCKA 2GQIA 4Y92A 4F16A 2KT1A 2V1QA 1W6XA 1SRLA 2DMOA 5GJWB 1SPKA 2JM8A 5GJVB 1FMKA 1RI9A 4K11A 2D0NA 2LJ3A 4LN2A 4LNPA 3ZL7C 2MOXA 3M0RA 3SHWA 2GBQA 4AFZC 3REBB 2JT4A 4RTVA 4JJBA 2JMCA 1AD5A 2CUDA 2EGCA 4HCKA 2JM9A 3NPFA 3VS6A 1GCQC 3RBBB 4Z88A 2KEAA 2NWMA 2LQNA 2GTOA 2ABLA 2DVJA 5I22A 2LP5A 2YDLA 1Z9ZA 2CT3A 3REAB 4R0KA 1QKXA 1U3OA 1G2BA 1OPLA 4J9DA 2AZSA 2HEQA 4A63B 1AWJA 3IQLA 2DL7A 5I11A 3M0TA 1M3CA 4RTYA 1CKAA 1ZLMA 1AWWA 4AFQC 3GBQA 2B86A 4HVVA 1S1NA 2QDLA 3VS1A 3TVTA 1U06A 3H41A 4JZ4A 4M4ZA 1WIEA 1GCQA 3RNJA 1KFZA 2RMOA 2W0ZA 3R6NA 2YUPA 2K3BA 4HVWA 5IHNA 4RTTA 3QWYA 2KNBB 2K6DA 1PWTA 2DRKA 1B07A 5IXFA 2ED0A 2EGAA 2MCNA 1U5SA 2CDTA 4JPBW 1NG2A 1MV0B 1NEBA 2A08A 2XMFA 3H0FA 1CKBA 2ROTA 1NYFA 1QKWA 4RTWA 2EYZA 2AKLA 1UGVA 1SHGA 1ARKA 4OMNA 1NLPC 2A28A 2KE9A 3VRZA 1AWOA 4OMLA 1PRLC 1B3QA 1AOJA 2AKKA 2KR3A 1W1FA 2H8HA 2JXBA 1UDLA 1SRMA 2A37A 4RTUA 2L2PA 2RQWA 3EG2A 1H3HA 2K2MA 1UE9A 1NLOC 1YCSB 2EVRA 2J6FA 2C0OA 4AG1C 1BB9A 1K0SA 2CSIA 2LX7A 2DILA 3UA7A 1JQQA 2CH4W 2ROLA 2NUZA 4KRTA 2F2WA 1KJWA 1N5ZA 3U23A 1WA7A 2DF6A 3I5RA 1T0JA 2KRMA 1TG0A 1AZEA 4OMPA 1RUWA 2O88A 2G6FX 1VYUA 1GBRA 1SEMA 1GRIA 1VA7A 2CT4A 2PZ1A 4LE9A 3VS5A 1K0XA 2RQUA 3PVLA 1UTIA 2E5KA 5IH2A 2P4RA 2OJ2A 1T0HA 1WI7A 1H92A 2KYBA 2GNCA 4D8DA 2KXCA 3NHNA 1WX6A 1GL5A 5IHIA 3NMZC 2K79A 2DL4A 1BK2A 1AEYA 1YP5A 2VVKA 1K76A 4X1VA 1KSWA 2RNAA 1UJYA 1OPKA 1NEGA 1UHCA 2O31A 4QT7A 1UG1A 4J9CA 1T3LA 2JW4A 2KXDA 2O9SA 2EBPA 2EKHA 1K1ZA 2DX1A 3M0SA 5HCKA 1H8KA 2L3SA 1X69A 4J9BA 1M3BA 3VS2A 2BZ8A 4HVUA 4J9GA 1AVZC 1VYVA 1ZX6A 2FO0A 4LUEA 2L3PA 1E6HA 3TSWA 1WDXA 5FW9A 1UFFA 5EC7A 4EIKA 2KRNA 1A0NB 2D8JA 2K7AA 2DBKA 1K4US 1JEGA 4ZNXA 2JMAA 1QWFA 1E6GA 3M0QA 2YT6A 3PVQA 2JTEA 1GCPA 2FG0A 4IIMA 1I07A 1M3AA 1X27A 1YWPA 1CSKA 4DEYA 2O9VA 2BTTA 2EPDA 1M27C 3PE0A 2HSPA 1AWXA 3NGPA 4Z8AA 2RF0A 2LZ6B 3EG1A 2AZVA 4CC4B 2DM1A 1ZSGA 2EGEA 2V1RA 4IIOA 2OAWA 1G83A 2EYYA 1X6BA 4J9HA 4FSSA 2DE0X 1JU5C 2DL8A 3VS3A 2M0YA 1SSHA 2KROA 3VS0A 1HD3A 1ZUKA 2RQVA 2DYBA 2YUNA 4DEXA 2J06A 2J6KA 2SEMA 2YUOA 2C0IA 1GFCA 1TUCA 2OI3A 3I35A 3EGUA 2X3WD 1BU1A 2W10A 3CQTA 3ULRB 2F2XA 2C0TA 2VKNA 3I5SA 1J3TA 2EQIA 4OMMA 1E7OA 3M0UA 1X2QA 1V1CA 2AK5A 2HBWA 2VWFA 2CSQA 1Y0MA 4GBQA 2L3QA 2IIMA 1MUZA 3EG0A 1X2KA 2JS0A 1W70A 3TSZA 1I0CA 2LQWA 1VYTA 2DJQA 3VRYA 2DNUA 2KT8A 1T3SA 2O2OA 1EFNA 5FWBA 2BZYA 2SRCA 1QWEA 2I0NA 1OOTA 2CH4A 3VS4A 3SEMA 2HDAA 1GBQA 4J9IA 1SHFA 1ABOA 1PNJA 2CUBA 1ZUYA 2ESWA 2RN8A 2J6OA 2A36A 2RQTA 2F2VA 2DLPA 3H0IA 2ED1A 2D8HA 4CC2A 2DBMA 2KYMA 3A98A 4Z89A 2DRMA 2ENMA 1OV3A 3KFVA 4AFSC 4WCIA 1UJ0A 3EHQA 2LJ1A 2EYXA 2KGTA 5IHKA 2PTKA 1PKSA 1TUDA 1UUEA 1WXBA 2J7IA 2D1XA 4HXJA 4JJDA 4J9EA 1HSQA 3O5ZA 2YUQA 4ORZA 5FWCA 1WXTA 1X43A 2MIOA 1WFWA 2CREA 1Y57A 1I1JA 3THKA 1GFDA 1PRMC 2FPFA 4AFUC 4D8KA 4J9FA 1OEBA 1JXMA 1XOVA 1YN8A 4CC3A 1AZGB 1WYXA 3EHRA 1Z9QA 1MV3A 4RUGA 2BZXA 2GGRA 1ABQA 1UHFA 1BBZA 1YWOA 3UF4A 2KBTA 2KRSA 2DA9A 4JJCA 1NM7A 2LJ0A 1RLQC 2LNHB 1ZBJA 2L0AA 2FEIA 2X3XD 4CC7A 2FPDA 1JXOA 2GTJA 3EG3A 3LH5A 3UATA 3UA6A 3M0PA 4AG2C 2RQRA 3C0CA 1M8MA 1JO8A 2LCSA 1NYGA 1K9AA 1M30A 1WLPB 2DL5A
chains in the Genus database with same CATH superfamily
3OYJA 1K73R 3OYYA 4A4EA 4KT0E 2BKDN 3E1SA 4MZTA 4LD9K 3A8MB 2MI6A 4C92D 1IO6A 2J05A 1PKTA 2HCKA 3RESA 3FRNA 4IKFA 4ELZC 7AT1B 8ATCB 4OMOA 4E7IA 4JZ3A 1D3BA 4JDSA 2ECZA 2MMPA 4RCCA 2YSQA 1ZA1B 1W2BA 2LNVA 3WXMB 2M51A 2QTVA 3OYBA 3EFSA 5GAMh 1FYNA 3JAME 5GANf 2DEQA 3I9QA 1X6GA 3QZ5B 5FRMA 2X9HA 1RLPC 1NBEB 2RI5A 1QCFA 3HP9A 4Y92A 4OMFB 2V1QA 3UDCA 1SRLA 1MNDA 4MMKA 1QMCA 2R58A 2CP7A 5GJVB 1RI9A 2D6FA 2QQ9A 1VQNQ 2RHYA 1MMGA 2Y4XA 2LJ3A 1K9MU 3ZL7C 2XDBA 3M0RA 1VQ6A 2GBQA 3QUIA 3REBB 1M5Q1 1IRXA 4RTVA 3OS0A 2DVEA 1AD5A 1MNEA 1VUBA 4BDZA 1GCQC 4AMCA 2COWA 3META 1Y71A 3QZ9B 1VQOQ 2E41A 3A8LB 3OMGA 2CT3A 4KGZB 1Q81R 2OTJQ 3REAB 4NS5A 2GCXA 1U3OA 2AZSA 2V8IA 2QXFA 2K5FA 1VQMT 5I11A 5GAMj 5CKHA 5GMKe 4M7DD 2DXCA 2DEUA 2RD1A 4RTYA 1CKAA 3QDFA 1UGQB 3CCUA 1VQ7Q 3QKJA 3GBQA 3OBWA 3VYGA 4A4FA 2C06A 3LGLA 1S1NA 1TXQA 2QDLA 4FW1A 1X75C 2LX9A 1U06A 1W4SA 1KC8C 5LJ5g 4KGVB 5GAN5 3JB9H 5KE2A 1WIEA 1GCQA 3RNJA 2H3JA 2RMOA 3R6NA 1I81A 4II1A 1ZBXA 4HVWA 5IHNA 2KNBB 2JZ2A 4M75C 2K6DA 3CPFA 2DRKA 1WNLA 2F5TX 4PLIA 2QI2A 2ED0A 4C5HA 1U5SA 3P8HA 2CDTA 5DM7R 2V8KA 2AKLA 1M2VA 4ZGJB 5GAOp 1UGVA 3M56A 4LDWA 5D6YA 3SWNB 3MO8A 4EMKB 3G71A 1ARKA 4GLKA 1AWOA 1PRLC 3CD6T 2H8HA 2DPPB 2IPOB 1UDLA 4RTUA 2RQWA 3EG2A 1H3HA 2K2MA 2LT1A 2MAMA 2RM4A 2J6FA 5GMKi 1C0MA 2OTLQ 5GAMe 4M75A 1MMAA 4AG1C 1K0SA 2CSIA 2DILA 2VASA 3X28B 4KRTA 3EGXA 3OY9A 4PJJA 2E6ZA 3OBYA 1ZSZB 4A4GA 3GLXA 3CCET 4E7KA 4M7AD 1MMDA 3INZA 1TG0A 3M4GA 3FC3A 2DYIA 3PFSA 1AZEA 1RUWA 4E7LA 1EX4A 2FZCB 1SEMA 2EFIA 1M9SA 1Q95G 1GRIA 2OTLT 2O4XA 1QCNA 4HCZA 3OS2A 1X6OA 4OGCA 1YIJQ 1UTIA 2E5KA 2P4RA 5J3BA 1T0HA 3URGA 3CC2A 4UC4A 2DTHA 1TWBA 2KXCA 1WX6A 2KSSA 1GL5A 3BW1A 8AT1B 3NMZC 9ATCB 1OZ2A 2K79A 2RK2A 3I56Q 1YP5A 1QP3A 2GFAA 1D1AA 1YFNA 2EKHA 1K1ZA 3HPWA 2DTOA 1H8KA 2EYQA 2HMAA 2L3SA 4ELYC 2BE7D 2BZ8A 3L2RA 2YXYA 3I56T 1JBMA 5FRNA 1VQ8Q 3RERA 5GMKl 5A2QE 5AT1B 5KCOA 1K4US 2P0QA 4J8OA 2QEXA 3E9GA 3OMCA 2K3YA 3P8DA 2JTEA 1VQLT 4XTVA 4PJOB 2RO0A 1M3AA 1YJWA 3CBOA 1FWZA 1VQMA 1VQ8T 2YRDA 2BTTA 3O8VA 1M27C 5KE3A 1AWXA 4OB0B 1K73U 2RJEA 3EG1A 3OA6A 2DM1A 2EGEA 2V1RA 1NPPA 2OAWA 2CP5A 4J6XA 3QJYA 2DL8A 5A0DA 2M0YA 1VQ4Q 4ZTFA 4DEXA 2J06A 3N5BB 2SEMA 2C0IA 1GFCA 1TUCA 2OI3A 3LWHA 2WSEE 5KYWA 3PTAA 1BU1A 3OYFA 3HL8A 2F2XA 2QYZA 2VKNA 1KHIA 4OMMA 1QCOA 3M5AA 1KQSA 4RG8A 2X4XA 2X4YA 2VWFA 3WVEB 5C6SA 3CCJQ 1KC8R 4M77D 4FW2A 3CD6A 4BI4A 2MK5A 5LL6S 4BE2A 1X2KA 2KVQG 1W70A 2LQWA 2DNUA 5J26A 3G4SQ 3RMSA 5GAMg 5CAIA 4XTZA 3M59A 4OVAA 4B6MA 2HDAA 1KQ1A 2ESWA 2J6OA 1YITQ 4M77G 3CMEA 2DLPA 2YWWA 3PMIA 4F7UF 4CC2A 3CCEA 3VJPA 1D09B 3KFVA 3EHQA 2CP6A 1FMVA 2E64A 1ZA2B 1TUDA 4EDUA 2XIDA 2LDMA 1N6AA 3NTHA 4J9EA 4PFPA 1Q81U 1I5LA 5HKCA 1WHMA 3O5ZA 2YUQA 3QDRB 4PJOE 1WXTA 1X43A 2MIOA 4M78D 2KQWA 2CREA 1I1JA 3RMQA 1GFDA 1PRMC 3MEAA 1ZHIA 4AFUC 4EPCA 2K5IA 4DBRA 1SG5A 2E65A 3OQ5A 1EZZB 3CPWP 2XK0A 4M78G 1WYXA 4M7AC 2B8AA 3LLRA 3OYAA 1ABQA 4OB1B 3L2QA 4EMKC 1N9RA 1H641 3QO3A 1OX8A 2X3XD 2FPDA 1PD1A 5FU6B 3I56A 3TREA 3EG3A 3LH5A 2DZ9A 2RQRA 4DBHA 3C0CA 1KG1A 2V26A 1FX7A 5LJ5f 1VQ6Q 3AT1B 2L8DA 2DKGA 3WVDB 3JCMc 2GQVA 2K5LA 2FRWA 1LNXA 2FYKA 1ZUUA 4F17A 1WXUA 1QLYA 1VQLA 1ZSZC 1UECA 3QHSA 3GIBA 4BI3A 4RTXA 4J83A 1JJ2P 1RAHB 3SWNA 1PHTA 4OMQA 5IT9E 4FIBA 3FLGA 4JUVA 3E9FA 3HHTB 3UPUA 1RAAB 3OYDA 2GFUA 5LJ3f 4JJNK 2EW3A 2ZPGB 2GF7A 4IUPA 2HBPA 1YNZA 3CCUQ 1LCKA 2KT1A 3EG9B 1AHJB 4KULA 4K11A 4FT4A 4LNPA 2MOXA 4Z02A 3SHWA 3CPWS 1B7TA 4AFZC 4LDVA 2WSFE 2E6NA 4XU1A 2JT4A 3A8OB 4PJLA 2JMCA 3KUFA 2CUDA 2ZPHB 2BE9B 3VS6A 1V29B 2VC8A 4A54A 4C8QD 3JCMP 1YJNT 4C0DB 4Z88A 2YHTA 2GTOA 1R0CB 3G71Q 3J7AF 1Z9ZA 3OYHA 2F1LA 4R0KA 1S72T 3V8KA 1MMNA 1OPLA 4PJOC 4M75G 3JB9F 4A63B 1M1FA 1AWJA 2HKQB 2MF2A 1Y07A 4C92B 5GMKh 3M55A 3QSUA 2XI9A 4HKEA 5KYUB 2CKKA 3G71T 4QQGA 1JJ2S 4MZPA 3GOXA 2QAZA 5AYFA 4ZN1A 4JZ4A 2D0QB 4X34A 1KFZA 2E3IA 4B9XA 5GAN2 3H8ZA 2YUPA 2K3BA 3LH0A 1NJIC 4RKUE 4WTOB 2RB6A 4BY6B 4YTLA 4HA8A 5DY9A 4BE0A 4A4KA 4KH0B 2CZ6B 1LVKA 1XQHA 4QVZA 4C0FA 1NEBA 3C12A 1G3YA 4KGXB 1NYFA 4XU3A 2EYZA 2QGFB 5GANh 4JRPA 3CC2Q 3HRSA 2A28A 2VB6A 1AOJA 2HSEB 2KR3A 2NUTA 3HFOA 1VQPA 1SRMA 4QKUA 1BCMA 2RA2A 1LOJA 3AHUA 3ASKA 3GNGA 3HSBA 4DBFA 1Q82C 5HK0A 5GMKj 4BE1A 2C0OA 3DB3A 4KBMB 1C6VX 2X51A 3CC2T 1KC8U 5GMKm 5A0LA 3P8BB 2F2WA 1N5ZA 4XU0A 1QP2A 3U23A 1QVPA 4ZGDB 3CCMT 1RADB 5I2SA 1WA7A 3DKMA 4HCBA 2VV5A 4QW2A 2RHUA 2KRMA 4OB2B 2X4JA 2G6FX 1VYUA 1GBRA 2HL3A 3VU3C 2QEXQ 4M7DB 1G3TA 4C92F 3JB9J 4E7JA 1ACMB 1VA7A 2CT4A 1EIFA 2PZ1A 4LE9A 5FROA 1K0XA 2LT4A 3H9NA 2QDYB 2L89A 1Y96B 1YJWQ 1QVFP 4C92E 5IH2A 2YLCA 3OYMA 1VQMQ 1KK7A 4D8DA 1B34B 5GANj 2ATCB 3JCMe 4WF2A 4A53A 3JSCA 2PVGB 2PUOB 2WSCE 2QEXT 5M9OA 2KAFA 1UJYA 1UHCA 2DD5A 3JCMb 4QT7A 1T3LA 3BDUA 2JW4A 2EBPA 2MWOA 1LJOA 2CYZB 1YJWT 4IUTA 5HCKA 3VS2A 2CZ0B 2A0FB 2K2VA 4J9GA 5FU6C 2FHDA 2DIGA 2L3PA 2YLBA 1I5OB 1UFFA 1YJNA 2KRNA 1OZ3A 4C5IA 2D8JA 2K7AA 4ZNXA 1JB0E 1QWFA 1E6GA 1G3SA 1YHQT 1F1BB 3CD6Q 1S72A 3G6ET 3MEWA 3LW5E 3RKXA 1CSKA 4DEYA 4ME7A 2EPDA 2HQEA 3PE0A 3MPUB 4M7AB 4MZMA 5FU7B 3NGPA 5GANe 3CXCP 2ZPIB 3CMEQ 1Y7XA 3G1JA 2AZVA 3L2VA 5HY6A 4M7DF 4JRIA 4BUGA 3CCEQ 2DXUA 3QIIA 1SSHA 3BY7A 1NE8A 2IG0A 4ZTJA 2YUNA 5GAMd 3MP1A 4M7DE 4BDYA 1O75A 2M1HA 1QVFS 2ZZDA 5CR2A 4LXCA 3CCRQ 2CGHA 1WZOA 1RAIB 2EQIA 3CMET 1V76A 5CO7A 2LQKA 3VV0A 2CSQA 1Y0MA 3QYGB 4GBQA 3J81E 5GAOm 1NJIR 1N9SA 3CBMA 2NUPB 2O01E 3VRYA 2DJQA 1UB4A 3CCRT 1UGSB 4C0DC 2SRCA 2E12A 2JJ9A 2OX7A 4DBQA 2WACA 3VS4A 2NLUA 1GBQA 1Q7YC 1ABOA 1PNJA 1ZUYA 3EG9A 1BIBA 1BKBA 2Y4YA 3NFCA 3CCMA 2DBMA 1D0ZA 4Z89A 4C92C 2DRMA 3CMAT 2E70A 5IHKA 2EIFA 1VQ5A 1UUEA 4MDWA 4JJDA 5CVIA 4EMGA 1Q82R 4XK8E 4M7AF 4ORZA 1VQLQ 3EGDB 4P5NA 2DIQA 3KBGA 3CXCS 4HCCA 4RCBA 3JCMg 1Y57A 2RHIA 2ZPEB 3L42A 4BY6C 2FPFA 4M7AE 4D8KA 1RL2A 2P0PA 2AHJB 2QQSA 4J9FA 1XOVA 3JCMW 1BI3A 4CC3A 1AZGB 4C92A 1MV3A 3MP6A 1G5VA 4AT1B 2EQJA 2KMTA 1YWOA 4OGEA 3UF4A 1OU8A 3OYNA 2LJ0A 2RHZA 1BI0A 2L0AA 4CC7A 1JXOA 4M77B 2HAXA 3UA6A 4AG2C 1M8MA 2BUDA 1JO8A 1IHWA 1XJWB 1QVGP 3EFOB 1K9AA 3CCQT 3M58A 3X25B 1WLPB 1X6BA 4DA4A 4NOYA 2FPEA 1P92A 2EAYA 1YHQA 1IGQA 4ESRA 1BCOA 3G6EA 2EYWA 4LUDA 3TQ7P 2LMJA 3CPWA 5DLQE 4J7FA 4PFZA 1HJDA 5GAN7 1VQ9Q 2COYA 2FRYA 3H0HA 4X9DA 5GANg 3MP8A 1M90U 1PC0A 2R5MA 4M7DC 3OYEA 1OYXA 4E6RA 4CRIA 4KH1B 1U1SA 2EQKA 2DO3A 5CQXA 1HK9A 3C94A 4F14A 2CS7A 1UGRB 3FJ5A 4M78B 3ZEHA 2QA4T 3S3OA 1VQ9T 2GQIA 2L3RA 1W6XA 4C0GA 3KXTA 2DMOA 3E2UA 1SPKA 5GJWB 4F7UG 4LDXA 2DAQA 1FMKA 2QQRA 2D0NA 4FYWB 3JB9I 2RHXA 1R0BG 2EJ9A 1G8XA 2XDDA 1JJ2A 4M7DA 3BE3A 1M1KR 3E19A 4E7HA 4JJBA 5CCAA 4PJOF 3MHXA 3M53A 2EGCA 1Y96A 2JM9A 3NPFA 3CCRA 2FZKB 2JTMA 2A3LA 1B34A 3I55T 1D0YA 2KEAA 2ABLA 2DVJA 2HD0A 5I22A 2YDLA 2XICA 4E7ZA 4FL6A 1HYOA 1FMWA 1QKXA 1QVGS 1G2BA 2DFUA 3HTRA 4R56A 4M77E 1VQPQ 4J9DA 2HEQA 1SSFA 3FB9A 4XAXB 1M90C 3CMAA 2R5AA 3ME9A 2DL7A 1M3CA 3T9NA 5KYNA 5HK3A 1VQKA 1ZLMA 2VGNA 1AWWA 5FU7C 4KUDK 4C5EA 5I2MA 4L5GA 1XTDA 2PVOB 1TH7A 3TVTA 3H41A 1Q7YR 4JS4A 2I2LA 3ZFJA 1VQPT 5I21A 5GAN6 3QWYA 2DETA 2LCCA 1PWTA 3CC4T 2MCNA 3CCLT 1UGPB 2LQ8A 4JPBW 2JN0A 2LTOA 2DERA 2COZA 5IAYA 2M0OA 1N8RC 1MV0B 1HXDA 2A08A 2XMFA 5LJ3h 3H0FA 3VUBA 2EKOA 1CKBA 2ROTA 1QKWA 4M78E 4M7AA 1SHGA 2AT1B 2FVUA 4OMNA 4XTUA 4J7IA 1VOMA 2KE9A 4EMKA 3OYKA 1PSFA 2JXBA 2HNIA 1WJSA 2A37A 4D6WA 2VYTA 4IUQA 3QYHB 1IHVA 3OYLA 1NLOC 1YCSB 4XTWA 3CCQA 1RI0A 4C8QB 2CH4W 2MPXC 1KJWA 2E1HA 1NJIU 4VUBA 3RDVA 1TSFA 1T0JA 1ZSZA 4FU6A 3GP8A 1YJNQ 3PGGA 1XNIA 4CI0C 1YJ9T 1OX9A 2NUPA 3RKWA 3JB9D 1S72Q 2CP2A 1PCXA 2FL7A 2LCLA 3EAEA 3L2UA 1PM3A 2OJ2A 5LJ3j 4M75D 1H92A 3VUZA 2GNCA 3NHNA 4JRKA 3ER0A 2FZGB 3JCMh 4MDXA 2QA4A 5IHIA 2E4HA 1VQ9A 2M16A 2DL4A 2VXFA 4V2SA 1AEYA 2VVKA 2EJFA 1K76A 3JB9G 5CQYA 3HRTA 1OPKA 1Q82U 2O31A 3JCMX 1UG1A 4PK4A 4FT2A 2ZAEA 2RI3A 3M0SA 1GXIE 4OB3B 1X69A 5CKDA 4J9BA 1YI2T 2X4WA 2KI7A 2K4YA 3QG1A 3EGDA 1QW1A 4M77C 5LJ5e 4DOVA 2PU9B 3V7RA 1ZX6A 2RJCA 5KYXB 3TSWA 5FW9A 5EC7A 1I4K1 3I55A 4EIKA 1QVFA 1WHGA 1A0NB 1WQWA 1JEGA 2JMAA 2R57A 2CZ1B 4XQ3A 3FIFA 2YT6A 3PVQA 3GF5A 4IURA 2FG0A 4L59A 3CCSQ 4IIMA 4C8QF 1I07A 1WQ7A 2RI2A 3CC7Q 1X27A 4PJOA 1YWPA 3BDLA 1IREB 2O9VA 4RMOA 3RUXA 2ZPFB 5LJ3e 2HSPA 4C8QE 2RJFA 4Z8AA 4C5GA 3D7SB 3TCJA 4PL6A 1K8AR 1WGSA 1C1AA 4CC4B 1ZSGA 4IIOA 3CCVQ 2QK0A 3CCMQ 2EYYA 2JTFA 4J6YA 3EFOA 3CCST 4FSSA 1JU5C 3VS3A 3CC7T 4M78C 2KROA 3VS0A 2E3HA 3MJXA 2RQVA 3X24B 1M8VA 3A5ZB 1VQ5Q 5KYWB 3CC4A 1M90R 3CCLA 1FXXA 3EGUA 3M57A 3CQTA 3ULRB 3RKYA 1J3TA 1E7OA 4JS5A 3M0UA 4J6WA 1V1CA 3EH2A 3CCVT 2HBWA 2F69A 4C92G 1R77A 2IIMA 2DXBA 1MUZA 1VQ5T 2JS0A 3CXCA 2Z0WA 3TSZA 1I0CA 1VYTA 2DJZA 4DQ2A 1T3SA 2O2OA 1EFNA 2DD4A 1QWEA 2I0NA 1OOTA 4M78A 2CH4A 3SEMA 3PT9A 5KYYB 2EQUA 3A8GB 2ZPBB 4J5YA 2VGMA 2AIRB 3QWXX 1X01A 2CUBA 1Q86C 2RN8A 2A36A 2RQTA 3JCMd 1M1KU 1N8RR 2XU8A 2HZYA 5GAMf 2KYMA 3A98A 2A7YA 1OV3A 1WHKA 3G7ZA 4AFSC 3OW2P 2EYXA 4PKCC 4JLGA 2NYSA 3PMTA 4L6V5 3MEVA 2PTKA 1G3WA 3C95A 2JOYA 4HXJA 4Y28E 1YJ9A 1HSQA 1YHQQ 1VQNT 5FWCA 5D7UA 2PUKB 3G6EQ 1WFWA 2E5QA 1BYMA 3S6WA 1TTHB 3LX7A 3S3MA 3THKA 2MYSA 3MCAB 4OP0A 2XHCA 2P4TA 3TU4K 3CEYA 4FSXA 1YN8A 3EHRA 2CP0A 1Q7YU 3CBPA 1BBZA 1O9SA 1VQOT 5KCHA 3C4SA 4FCYA 1W2BP 2H3EB 2DA9A 2KRSA 1NM7A 2OTJT 1RLQC 2LNHB 3MKDA 1YI2A 1ZBJA 5GANd 2FEIA 3QXEB 1PSEA 3PNWC 2GTJA 4M7DG 1D1BA 2LCSA 1M1KC 1NYGA 5L8RE 1VQ7T 4JLIA 3RR6A 1M30A 4C8QC 1K9MC 2DL5A 4Y91A 4E47A 1DJ7B 4RTZA 2K9GA 3JV3A 5IXBA 5L23A 2QASA 3SD4A 5LJ3g 2M9UA 3M9QA 4N4IA 5KH6A 3A1PA 5C0MA 2JS2A 2HQXA 4GLMA 4X9CA 4OF1A 5ECAA 3OW2S 5GAOq 3EFRA 1KIKA 3PIPA 1KQ2A 2DL3A 2XD0A 1TU0B 4Q5WA 4XTXA 4NL3A 3VS7A 3CCSA 3CMAQ 3X26B 3CC7A 3DLMA 4C8QA 1VQKQ 1NPRA 4N4GA 1QVGA 2RPNA 2PNIA 4F16A 3V7CA 3QPHA 2JM8A 2D9TA 3EH1A 1U8RA 2VUBA 2HQHA 4LN2A 3J80E 4BI8B 3CCVA 3JCMQ 3RIRA 4XTYA 3V8LA 1VQKT 4M7AG 4ZGEB 1W2BS 4HCKA 4B9WA 2K57A 4LDUA 3RBBB 5CK9A 2F5KA 3JCMV 2MWPA 2NWMA 2Y90A 2LQNA 5GAN8 3MEUA 4TVRA 2LP5A 3V7SA 1RAFB 3FDRA 1YIJT 4KUIA 2KY9A 5J39A 3IQLA 3OYIA 2G3RA 3BFMA 3LYIA 3M0TA 3H6ZA 3L2ZA 1RACB 4E7SA 3CCQQ 2PVDB 1WJQA 4AFQC 2XG8D 1SKUB 2B86A 4HVVA 3ZBDA 5KYUA 1H3ZA 1VQNA 3VS1A 3NTKA 2DTIA 5KYXA 1WJRA 1WHLA 1D1CA 2QGGA 4M4ZA 4O5VA 4F7UB 4FM4B 2ZGWA 1Q86R 2W0ZA 1M2OA 1VIEA 4RTTA 4FYYB 1OI1A 1B07A 5IXFA 2EGAA 1K8AU 4ATOA 1KD1U 1NG2A 3F70A 2XKOC 3OSVA 1M4ZA 5D6XA 4RTWA 4PJMA 1VQOA 2YRVA 5GAOr 3OSSC 1NLPC 2NUTB 2QA4Q 1D3BB 1WHHA 3VRZA 2OTJA 4OMLA 1B3QA 2AKKA 1WPYA 1W1FA 2YRCA 2L2PA 4LDYA 3M54A 3JCMJ 1UE9A 2QQAA 2EVRA 1N27A 2E10A 1VQ7A 3NTIA 1BB9A 5A0GA 3UA7A 2LX7A 4PJOD 1JQQA 2ROLA 2NUZA 4QVDA 2FB7A 3OS1A 2EWNA 2DF6A 4N4HA 4RG2A 3I5RA 4E2FB 3OS5A 5IN1A 5GAN4 1VQ4T 1D0XA 3I55Q 4OMPA 2O88A 5CKBA 4PJOG 5GAN3 1N8RU 3VS5A 1VIFA 2RQUA 3PVLA 4HT9A 4PLLA 2DXTA 1K9MR 5D6WA 5KYYA 2P84A 1WI7A 4ANJA 2KYBA 3M4YA 3JRZA 1K8AC 3CCJT 3DB4A 1KD1C 1BK2A 4M77F 4X1VA 1KSWA 1IXDA 2RNAA 1NEGA 1K73C 4F7UE 3G4ST 4J9CA 3V8JA 2PQWA 2KXDA 2O9SA 2EJGA 3TEEA 2OTLA 2DX1A 1TS9A 2HKNA 4BACA 1YITT 2LC4A 1PG5B 1M3BA 3VYHB 4HVUA 3PIOA 3CC4Q 4XU2A 3CCLQ 5LJ5h 1AVZC 1OQKA 1QQJA 2LVMA 1M1GA 1VYVA 3X20B 2FO0A 4LUEA 1E6HA 1WDXA 2DBKA 2X35A 1KHCA 2KDSA 3M0QA 3VKIA 2M02A 4PNOA 3QJ6A 5GAOl 3HRUA 1GCPA 1YIJA 2OAUA 2HL5C 2JNGA 2BIVA 3SWNC 3OB9A 1U1TA 1KQSP 2QTXA 4M78F 2QQBA 3Q1JA 4N0AC 6AT1B 1M2VB 2V8JA 1IZ6A 2CZ7B 4BD3A 4JRQA 5CKFA 3GNFB 3SB2A 2RF0A 2XDPA 2LZ6B 3LWIA 1G83A 4J9HA 2DE0X 2RH2A 2CP3A 1HD3A 1IGUA 1ZUKA 2IVWA 4QVCA 2DYBA 1MGQA 4MMLA 2J6KA 4M75B 2YUOA 3R6OA 3I35A 1YJ9Q 2X3WD 5CKEA 2W10A 2VXEA 2C0TA 3UT1A 3EGXB 1VQ8A 3I5SA 1Q81C 5LJ5j 2K3XA 3A8HB 4R55A 1X2QA 4QQDA 4N0AA 2AK5A 1YCYA 1VQ6T 1OULA 2L3QA 1IB8A 1ZQ1A 3EG0A 1RAGB 5EG2A 3SDZA 2O4XB 4BB7A 3GPLA 1BI1A 2P0KA 1RABB 2KT8A 4FYXB 1TUGB 2JUFA 5FWBA 2BZYA 3QBYA 1SF9A 3DLLA 4J9IA 1SHFA 2F2VA 1YI2Q 3H0IA 1PD0A 2ED1A 2D8HA 3HKSA 1BI2A 4EMHA 4PJNA 2ENMA 4F04B 4WCIA 1UJ0A 4LD6A 2LJ1A 1VQ4A 4GY5A 2KGTA 2KK4A 3CCUT 4DOWA 4ZN3A 1PKSA 4C0ZA 1WXBA 1KQSS 4A4HA 2J7IA 2D1XA 3OYCA 3SFMA 4HT8A 1MHNA 4FYVB 2RJDA 3HFNA 5LJ5d 1RAEB 5GAOn 2QG9B 4PFOA 4NL2A 4IUVA 1LPLA 1R8OB 3CCJA 1UEBA 1I8FA 3FEOA 3OYGA 5CIUA 3FJPA 1OEBA 1JXMA 5FLXE 4O6JA 3UWNA 1NZ9A 4C8QG 3JCMf 3G4SA 4M75F 1Z9QA 2LRQA 5DLOA 2DZCA 4RUGA 2BZXA 2GGRA 3L2WA 2JVVA 4QQ6A 1Q86U 1UHFA 3OW2A 2DK3A 2KBTA 1YITA 5LJ3d 4M75E 4JJCA 2ZCFB 3LGFA 3L1AA 1OU9A 1YBYA 4F7UA 3UATA 1WHJA 3M0PA 1AT1B 1BIAA 3S3NA 4M77A 1KD1R 2RK1A 2EQMA 1JRIA 4IUUA 1TOVA 2L5QA
chains in the Genus database with same CATH topology
2FRWA 2FPEA 1ZUUA 4F17A 1WXUA 4RTZA 2K9GA 3JV3A 1QLYA 1IO6A 4ESRA 2J05A 1UECA 1PKTA 2EYWA 2HCKA 4LUDA 5IXBA 4RTXA 5L23A 2LMJA 4OMOA 1HJDA 2FRYA 3H0HA 1PHTA 4JZ3A 4OMQA 2JS2A 2ECZA 4E6RA 4GLMA 2YSQA 5ECAA 1KIKA 2M51A 2DL3A 3QWXX 1FYNA 3I9QA 2EW3A 1X6GA 3VS7A 4F14A 1RLPC 3FJ5A 1YNZA 1QCFA 2RPNA 2PNIA 1LCKA 2GQIA 4Y92A 4F16A 2KT1A 2V1QA 1W6XA 1SRLA 2DMOA 5GJWB 1SPKA 2JM8A 5GJVB 1FMKA 1RI9A 4K11A 2D0NA 2LJ3A 4LN2A 4LNPA 3ZL7C 2MOXA 3M0RA 3SHWA 2GBQA 4AFZC 3REBB 2JT4A 4RTVA 4JJBA 2JMCA 1AD5A 2CUDA 2EGCA 4HCKA 2JM9A 3NPFA 3VS6A 1GCQC 3RBBB 4Z88A 2KEAA 2NWMA 2LQNA 2GTOA 2ABLA 2DVJA 5I22A 2LP5A 2YDLA 1Z9ZA 2CT3A 3REAB 4R0KA 1QKXA 1U3OA 1G2BA 1OPLA 4J9DA 2AZSA 2HEQA 4A63B 1AWJA 3IQLA 2DL7A 5I11A 3M0TA 1M3CA 4RTYA 1CKAA 1ZLMA 1AWWA 4AFQC 3GBQA 2B86A 4HVVA 1S1NA 2QDLA 3VS1A 3TVTA 1U06A 3H41A 4JZ4A 4M4ZA 1WIEA 1GCQA 3RNJA 1KFZA 2RMOA 2W0ZA 3R6NA 2YUPA 2K3BA 4HVWA 5IHNA 4RTTA 3QWYA 2KNBB 2K6DA 1PWTA 2DRKA 1B07A 5IXFA 2ED0A 2EGAA 2MCNA 1U5SA 2CDTA 4JPBW 1NG2A 1MV0B 1NEBA 2A08A 2XMFA 3H0FA 1CKBA 2ROTA 1NYFA 1QKWA 4RTWA 2EYZA 2AKLA 1UGVA 1SHGA 1ARKA 4OMNA 1NLPC 2A28A 2KE9A 3VRZA 1AWOA 4OMLA 1PRLC 1B3QA 1AOJA 2AKKA 2KR3A 1W1FA 2H8HA 2JXBA 1UDLA 1SRMA 2A37A 4RTUA 2L2PA 2RQWA 3EG2A 1H3HA 2K2MA 1UE9A 1NLOC 1YCSB 2EVRA 2J6FA 2C0OA 4AG1C 1BB9A 1K0SA 2CSIA 2LX7A 2DILA 3UA7A 1JQQA 2CH4W 2ROLA 2NUZA 4KRTA 2F2WA 1KJWA 1N5ZA 3U23A 1WA7A 2DF6A 3I5RA 1T0JA 2KRMA 1TG0A 1AZEA 4OMPA 1RUWA 2O88A 2G6FX 1VYUA 1GBRA 1SEMA 1GRIA 1VA7A 2CT4A 2PZ1A 4LE9A 3VS5A 1K0XA 2RQUA 3PVLA 1UTIA 2E5KA 5IH2A 2P4RA 2OJ2A 1T0HA 1WI7A 1H92A 2KYBA 2GNCA 4D8DA 2KXCA 3NHNA 1WX6A 1GL5A 5IHIA 3NMZC 2K79A 2DL4A 1BK2A 1AEYA 1YP5A 2VVKA 1K76A 4X1VA 1KSWA 2RNAA 1UJYA 1OPKA 1NEGA 1UHCA 2O31A 4QT7A 1UG1A 4J9CA 1T3LA 2JW4A 2KXDA 2O9SA 2EBPA 2EKHA 1K1ZA 2DX1A 3M0SA 5HCKA 1H8KA 2L3SA 1X69A 4J9BA 1M3BA 3VS2A 2BZ8A 4HVUA 4J9GA 1AVZC 1VYVA 1ZX6A 2FO0A 4LUEA 2L3PA 1E6HA 3TSWA 1WDXA 5FW9A 1UFFA 5EC7A 4EIKA 2KRNA 1A0NB 2D8JA 2K7AA 2DBKA 1K4US 1JEGA 4ZNXA 2JMAA 1QWFA 1E6GA 3M0QA 2YT6A 3PVQA 2JTEA 1GCPA 2FG0A 4IIMA 1I07A 1M3AA 1X27A 1YWPA 1CSKA 4DEYA 2O9VA 2BTTA 2EPDA 1M27C 3PE0A 2HSPA 1AWXA 3NGPA 4Z8AA 2RF0A 2LZ6B 3EG1A 2AZVA 4CC4B 2DM1A 1ZSGA 2EGEA 2V1RA 4IIOA 2OAWA 1G83A 2EYYA 1X6BA 4J9HA 4FSSA 2DE0X 1JU5C 2DL8A 3VS3A 2M0YA 1SSHA 2KROA 3VS0A 1HD3A 1ZUKA 2RQVA 2DYBA 2YUNA 4DEXA 2J06A 2J6KA 2SEMA 2YUOA 2C0IA 1GFCA 1TUCA 2OI3A 3I35A 3EGUA 2X3WD 1BU1A 2W10A 3CQTA 3ULRB 2F2XA 2C0TA 2VKNA 3I5SA 1J3TA 2EQIA 4OMMA 1E7OA 3M0UA 1X2QA 1V1CA 2AK5A 2HBWA 2VWFA 2CSQA 1Y0MA 4GBQA 2L3QA 2IIMA 1MUZA 3EG0A 1X2KA 2JS0A 1W70A 3TSZA 1I0CA 2LQWA 1VYTA 2DJQA 3VRYA 2DNUA 2KT8A 1T3SA 2O2OA 1EFNA 5FWBA 2BZYA 2SRCA 1QWEA 2I0NA 1OOTA 2CH4A 3VS4A 3SEMA 2HDAA 1GBQA 4J9IA 1SHFA 1ABOA 1PNJA 2CUBA 1ZUYA 2ESWA 2RN8A 2J6OA 2A36A 2RQTA 2F2VA 2DLPA 3H0IA 2ED1A 2D8HA 4CC2A 2DBMA 2KYMA 3A98A 4Z89A 2DRMA 2ENMA 1OV3A 3KFVA 4AFSC 4WCIA 1UJ0A 3EHQA 2LJ1A 2EYXA 2KGTA 5IHKA 2PTKA 1PKSA 1TUDA 1UUEA 1WXBA 2J7IA 2D1XA 4HXJA 4JJDA 4J9EA 1HSQA 3O5ZA 2YUQA 4ORZA 5FWCA 1WXTA 1X43A 2MIOA 1WFWA 2CREA 1Y57A 1I1JA 3THKA 1GFDA 1PRMC 2FPFA 4AFUC 4D8KA 4J9FA 1OEBA 1JXMA 1XOVA 1YN8A 4CC3A 1AZGB 1WYXA 3EHRA 1Z9QA 1MV3A 4RUGA 2BZXA 2GGRA 1ABQA 1UHFA 1BBZA 1YWOA 3UF4A 2KBTA 2KRSA 2DA9A 4JJCA 1NM7A 2LJ0A 1RLQC 2LNHB 1ZBJA 2L0AA 2FEIA 2X3XD 4CC7A 2FPDA 1JXOA 2GTJA 3EG3A 3LH5A 3UATA 3UA6A 3M0PA 4AG2C 2RQRA 3C0CA 1M8MA 1JO8A 2LCSA 1NYGA 1K9AA 1M30A 1WLPB 2DL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRW A;  2FPE A;  1ZUU A;  4F17 A;  1WXU A;  4RTZ A;  2K9G A;  3JV3 A;  1QLY A;  1IO6 A;  4ESR A;  2J05 A;  1UEC A;  1PKT A;  2EYW A;  2HCK A;  4LUD A;  5IXB A;  4RTX A;  5L23 A;  2LMJ A;  4OMO A;  1HJD A;  2FRY A;  3H0H A;  1PHT A;  4JZ3 A;  4OMQ A;  2JS2 A;  2ECZ A;  4E6R A;  4GLM A;  2YSQ A;  5ECA A;  1KIK A;  2M51 A;  2DL3 A;  3QWX X;  1FYN A;  3I9Q A;  2EW3 A;  1X6G A;  3VS7 A;  4F14 A;  1RLP C;  3FJ5 A;  1YNZ A;  1QCF A;  2RPN A;  2PNI A;  1LCK A;  2GQI A;  4Y92 A;  4F16 A;  2KT1 A;  2V1Q A;  1W6X A;  1SRL A;  2DMO A;  5GJW B;  1SPK A;  2JM8 A;  5GJV B;  1FMK A;  1RI9 A;  4K11 A;  2D0N A;  2LJ3 A;  4LN2 A;  4LNP A;  3ZL7 C;  2MOX A;  3M0R A;  3SHW A;  2GBQ A;  4AFZ C;  3REB B;  2JT4 A;  4RTV A;  4JJB A;  2JMC A;  1AD5 A;  2CUD A;  2EGC A;  4HCK A;  2JM9 A;  3NPF A;  3VS6 A;  1GCQ C;  3RBB B;  4Z88 A;  2KEA A;  2NWM A;  2LQN A;  2GTO A;  2ABL A;  2DVJ A;  5I22 A;  2LP5 A;  2YDL A;  1Z9Z A;  2CT3 A;  3REA B;  4R0K A;  1QKX A;  1U3O A;  1G2B A;  1OPL A;  4J9D A;  2AZS A;  2HEQ A;  4A63 B;  1AWJ A;  3IQL A;  2DL7 A;  5I11 A;  3M0T A;  1M3C A;  4RTY A;  1CKA A;  1ZLM A;  1AWW A;  4AFQ C;  3GBQ A;  2B86 A;  4HVV A;  1S1N A;  2QDL A;  3VS1 A;  3TVT A;  1U06 A;  3H41 A;  4JZ4 A;  4M4Z A;  1WIE A;  1GCQ A;  3RNJ A;  1KFZ A;  2RMO A;  2W0Z A;  3R6N A;  2YUP A;  2K3B A;  4HVW A;  5IHN A;  4RTT A;  3QWY A;  2KNB B;  2K6D A;  1PWT A;  2DRK A;  1B07 A;  5IXF A;  2ED0 A;  2EGA A;  2MCN A;  1U5S A;  2CDT A;  4JPB W;  1NG2 A;  1MV0 B;  1NEB A;  2A08 A;  2XMF A;  3H0F A;  1CKB A;  2ROT A;  1NYF A;  1QKW A;  4RTW A;  2EYZ A;  2AKL A;  1UGV A;  1SHG A;  1ARK A;  4OMN A;  1NLP C;  2A28 A;  2KE9 A;  3VRZ A;  1AWO A;  4OML A;  1PRL C;  1B3Q A;  1AOJ A;  2AKK A;  2KR3 A;  1W1F A;  2H8H A;  2JXB A;  1UDL A;  1SRM A;  2A37 A;  4RTU A;  2L2P A;  2RQW A;  3EG2 A;  1H3H A;  2K2M A;  1UE9 A;  1NLO C;  1YCS B;  2EVR A;  2J6F A;  2C0O A;  4AG1 C;  1BB9 A;  1K0S A;  2CSI A;  2LX7 A;  2DIL A;  3UA7 A;  1JQQ A;  2CH4 W;  2ROL A;  2NUZ A;  4KRT A;  2F2W A;  1KJW A;  1N5Z A;  3U23 A;  1WA7 A;  2DF6 A;  3I5R A;  1T0J A;  2KRM A;  1TG0 A;  1AZE A;  4OMP A;  1RUW A;  2O88 A;  2G6F X;  1VYU A;  1GBR A;  1SEM A;  1GRI A;  1VA7 A;  2CT4 A;  2PZ1 A;  4LE9 A;  3VS5 A;  1K0X A;  2RQU A;  3PVL A;  1UTI A;  2E5K A;  5IH2 A;  2P4R A;  2OJ2 A;  1T0H A;  1WI7 A;  1H92 A;  2KYB A;  2GNC A;  4D8D A;  2KXC A;  3NHN A;  1WX6 A;  1GL5 A;  5IHI A;  3NMZ C;  2K79 A;  2DL4 A;  1BK2 A;  1AEY A;  1YP5 A;  2VVK A;  1K76 A;  4X1V A;  1KSW A;  2RNA A;  1UJY A;  1OPK A;  1NEG A;  1UHC A;  2O31 A;  4QT7 A;  1UG1 A;  4J9C A;  1T3L A;  2JW4 A;  2KXD A;  2O9S A;  2EBP A;  2EKH A;  1K1Z A;  2DX1 A;  3M0S A;  5HCK A;  1H8K A;  2L3S A;  1X69 A;  4J9B A;  1M3B A;  3VS2 A;  2BZ8 A;  4HVU A;  4J9G A;  1AVZ C;  1VYV A;  1ZX6 A;  2FO0 A;  4LUE A;  2L3P A;  1E6H A;  3TSW A;  1WDX A;  5FW9 A;  1UFF A;  5EC7 A;  4EIK A;  2KRN A;  1A0N B;  2D8J A;  2K7A A;  2DBK A;  1K4U S;  1JEG A;  4ZNX A;  2JMA A;  1QWF A;  1E6G A;  3M0Q A;  2YT6 A;  3PVQ A;  2JTE A;  1GCP A;  2FG0 A;  4IIM A;  1I07 A;  1M3A A;  1X27 A;  1YWP A;  1CSK A;  4DEY A;  2O9V A;  2BTT A;  2EPD A;  1M27 C;  3PE0 A;  2HSP A;  1AWX A;  3NGP A;  4Z8A A;  2RF0 A;  2LZ6 B;  3EG1 A;  2AZV A;  4CC4 B;  2DM1 A;  1ZSG A;  2EGE A;  2V1R A;  4IIO A;  2OAW A;  1G83 A;  2EYY A;  1X6B A;  4J9H A;  4FSS A;  2DE0 X;  1JU5 C;  2DL8 A;  3VS3 A;  2M0Y A;  1SSH A;  2KRO A;  3VS0 A;  1HD3 A;  1ZUK A;  2RQV A;  2DYB A;  2YUN A;  4DEX A;  2J06 A;  2J6K A;  2SEM A;  2YUO A;  2C0I A;  1GFC A;  1TUC A;  2OI3 A;  3I35 A;  3EGU A;  2X3W D;  1BU1 A;  2W10 A;  3CQT A;  3ULR B;  2F2X A;  2C0T A;  2VKN A;  3I5S A;  1J3T A;  2EQI A;  4OMM A;  1E7O A;  3M0U A;  1X2Q A;  1V1C A;  2AK5 A;  2HBW A;  2VWF A;  2CSQ A;  1Y0M A;  4GBQ A;  2L3Q A;  2IIM A;  1MUZ A;  3EG0 A;  1X2K A;  2JS0 A;  1W70 A;  3TSZ A;  1I0C A;  2LQW A;  1VYT A;  2DJQ A;  3VRY A;  2DNU A;  2KT8 A;  1T3S A;  2O2O A;  1EFN A;  5FWB A;  2BZY A;  2SRC A;  1QWE A;  2I0N A;  1OOT A;  2CH4 A;  3VS4 A;  3SEM A;  2HDA A;  1GBQ A;  4J9I A;  1SHF A;  1ABO A;  1PNJ A;  2CUB A;  1ZUY A;  2ESW A;  2RN8 A;  2J6O A;  2A36 A;  2RQT A;  2F2V A;  2DLP A;  3H0I A;  2ED1 A;  2D8H A;  4CC2 A;  2DBM A;  2KYM A;  3A98 A;  4Z89 A;  2DRM A;  2ENM A;  1OV3 A;  3KFV A;  4AFS C;  4WCI A;  1UJ0 A;  3EHQ A;  2LJ1 A;  2EYX A;  2KGT A;  5IHK A;  2PTK A;  1PKS A;  1TUD A;  1UUE A;  1WXB A;  2J7I A;  2D1X A;  4HXJ A;  4JJD A;  4J9E A;  1HSQ A;  3O5Z A;  2YUQ A;  4ORZ A;  5FWC A;  1WXT A;  1X43 A;  2MIO A;  1WFW A;  2CRE A;  1Y57 A;  1I1J A;  3THK A;  1GFD A;  1PRM C;  2FPF A;  4AFU C;  4D8K A;  4J9F A;  1OEB A;  1JXM A;  1XOV A;  1YN8 A;  4CC3 A;  1AZG B;  1WYX A;  3EHR A;  1Z9Q A;  1MV3 A;  4RUG A;  2BZX A;  2GGR A;  1ABQ A;  1UHF A;  1BBZ A;  1YWO A;  3UF4 A;  2KBT A;  2KRS A;  2DA9 A;  4JJC A;  1NM7 A;  2LJ0 A;  1RLQ C;  2LNH B;  1ZBJ A;  2L0A A;  2FEI A;  2X3X D;  4CC7 A;  2FPD A;  1JXO A;  2GTJ A;  3EG3 A;  3LH5 A;  3UAT A;  3UA6 A;  3M0P A;  4AG2 C;  2RQR A;  3C0C A;  1M8M A;  1JO8 A;  2LCS A;  1NYG A;  1K9A A;  1M30 A;  1WLP B;  2DL5 A; 
#chains in the Genus database with same CATH topology
 3OYJ A;  1K73 R;  3OYY A;  4A4E A;  4KT0 E;  2BKD N;  3E1S A;  4MZT A;  4LD9 K;  3A8M B;  2MI6 A;  4C92 D;  1IO6 A;  2J05 A;  1PKT A;  2HCK A;  3RES A;  3FRN A;  4IKF A;  4ELZ C;  7AT1 B;  8ATC B;  4OMO A;  4E7I A;  4JZ3 A;  1D3B A;  4JDS A;  2ECZ A;  2MMP A;  4RCC A;  2YSQ A;  1ZA1 B;  1W2B A;  2LNV A;  3WXM B;  2M51 A;  2QTV A;  3OYB A;  3EFS A;  5GAM h;  1FYN A;  3JAM E;  5GAN f;  2DEQ A;  3I9Q A;  1X6G A;  3QZ5 B;  5FRM A;  2X9H A;  1RLP C;  1NBE B;  2RI5 A;  1QCF A;  3HP9 A;  4Y92 A;  4OMF B;  2V1Q A;  3UDC A;  1SRL A;  1MND A;  4MMK A;  1QMC A;  2R58 A;  2CP7 A;  5GJV B;  1RI9 A;  2D6F A;  2QQ9 A;  1VQN Q;  2RHY A;  1MMG A;  2Y4X A;  2LJ3 A;  1K9M U;  3ZL7 C;  2XDB A;  3M0R A;  1VQ6 A;  2GBQ A;  3QUI A;  3REB B;  1M5Q 1;  1IRX A;  4RTV A;  3OS0 A;  2DVE A;  1AD5 A;  1MNE A;  1VUB A;  4BDZ A;  1GCQ C;  4AMC A;  2COW A;  3MET A;  1Y71 A;  3QZ9 B;  1VQO Q;  2E41 A;  3A8L B;  3OMG A;  2CT3 A;  4KGZ B;  1Q81 R;  2OTJ Q;  3REA B;  4NS5 A;  2GCX A;  1U3O A;  2AZS A;  2V8I A;  2QXF A;  2K5F A;  1VQM T;  5I11 A;  5GAM j;  5CKH A;  5GMK e;  4M7D D;  2DXC A;  2DEU A;  2RD1 A;  4RTY A;  1CKA A;  3QDF A;  1UGQ B;  3CCU A;  1VQ7 Q;  3QKJ A;  3GBQ A;  3OBW A;  3VYG A;  4A4F A;  2C06 A;  3LGL A;  1S1N A;  1TXQ A;  2QDL A;  4FW1 A;  1X75 C;  2LX9 A;  1U06 A;  1W4S A;  1KC8 C;  5LJ5 g;  4KGV B;  5GAN 5;  3JB9 H;  5KE2 A;  1WIE A;  1GCQ A;  3RNJ A;  2H3J A;  2RMO A;  3R6N A;  1I81 A;  4II1 A;  1ZBX A;  4HVW A;  5IHN A;  2KNB B;  2JZ2 A;  4M75 C;  2K6D A;  3CPF A;  2DRK A;  1WNL A;  2F5T X;  4PLI A;  2QI2 A;  2ED0 A;  4C5H A;  1U5S A;  3P8H A;  2CDT A;  5DM7 R;  2V8K A;  2AKL A;  1M2V A;  4ZGJ B;  5GAO p;  1UGV A;  3M56 A;  4LDW A;  5D6Y A;  3SWN B;  3MO8 A;  4EMK B;  3G71 A;  1ARK A;  4GLK A;  1AWO A;  1PRL C;  3CD6 T;  2H8H A;  2DPP B;  2IPO B;  1UDL A;  4RTU A;  2RQW A;  3EG2 A;  1H3H A;  2K2M A;  2LT1 A;  2MAM A;  2RM4 A;  2J6F A;  5GMK i;  1C0M A;  2OTL Q;  5GAM e;  4M75 A;  1MMA A;  4AG1 C;  1K0S A;  2CSI A;  2DIL A;  2VAS A;  3X28 B;  4KRT A;  3EGX A;  3OY9 A;  4PJJ A;  2E6Z A;  3OBY A;  1ZSZ B;  4A4G A;  3GLX A;  3CCE T;  4E7K A;  4M7A D;  1MMD A;  3INZ A;  1TG0 A;  3M4G A;  3FC3 A;  2DYI A;  3PFS A;  1AZE A;  1RUW A;  4E7L A;  1EX4 A;  2FZC B;  1SEM A;  2EFI A;  1M9S A;  1Q95 G;  1GRI A;  2OTL T;  2O4X A;  1QCN A;  4HCZ A;  3OS2 A;  1X6O A;  4OGC A;  1YIJ Q;  1UTI A;  2E5K A;  2P4R A;  5J3B A;  1T0H A;  3URG A;  3CC2 A;  4UC4 A;  2DTH A;  1TWB A;  2KXC A;  1WX6 A;  2KSS A;  1GL5 A;  3BW1 A;  8AT1 B;  3NMZ C;  9ATC B;  1OZ2 A;  2K79 A;  2RK2 A;  3I56 Q;  1YP5 A;  1QP3 A;  2GFA A;  1D1A A;  1YFN A;  2EKH A;  1K1Z A;  3HPW A;  2DTO A;  1H8K A;  2EYQ A;  2HMA A;  2L3S A;  4ELY C;  2BE7 D;  2BZ8 A;  3L2R A;  2YXY A;  3I56 T;  1JBM A;  5FRN A;  1VQ8 Q;  3RER A;  5GMK l;  5A2Q E;  5AT1 B;  5KCO A;  1K4U S;  2P0Q A;  4J8O A;  2QEX A;  3E9G A;  3OMC A;  2K3Y A;  3P8D A;  2JTE A;  1VQL T;  4XTV A;  4PJO B;  2RO0 A;  1M3A A;  1YJW A;  3CBO A;  1FWZ A;  1VQM A;  1VQ8 T;  2YRD A;  2BTT A;  3O8V A;  1M27 C;  5KE3 A;  1AWX A;  4OB0 B;  1K73 U;  2RJE A;  3EG1 A;  3OA6 A;  2DM1 A;  2EGE A;  2V1R A;  1NPP A;  2OAW A;  2CP5 A;  4J6X A;  3QJY A;  2DL8 A;  5A0D A;  2M0Y A;  1VQ4 Q;  4ZTF A;  4DEX A;  2J06 A;  3N5B B;  2SEM A;  2C0I A;  1GFC A;  1TUC A;  2OI3 A;  3LWH A;  2WSE E;  5KYW A;  3PTA A;  1BU1 A;  3OYF A;  3HL8 A;  2F2X A;  2QYZ A;  2VKN A;  1KHI A;  4OMM A;  1QCO A;  3M5A A;  1KQS A;  4RG8 A;  2X4X A;  2X4Y A;  2VWF A;  3WVE B;  5C6S A;  3CCJ Q;  1KC8 R;  4M77 D;  4FW2 A;  3CD6 A;  4BI4 A;  2MK5 A;  5LL6 S;  4BE2 A;  1X2K A;  2KVQ G;  1W70 A;  2LQW A;  2DNU A;  5J26 A;  3G4S Q;  3RMS A;  5GAM g;  5CAI A;  4XTZ A;  3M59 A;  4OVA A;  4B6M A;  2HDA A;  1KQ1 A;  2ESW A;  2J6O A;  1YIT Q;  4M77 G;  3CME A;  2DLP A;  2YWW A;  3PMI A;  4F7U F;  4CC2 A;  3CCE A;  3VJP A;  1D09 B;  3KFV A;  3EHQ A;  2CP6 A;  1FMV A;  2E64 A;  1ZA2 B;  1TUD A;  4EDU A;  2XID A;  2LDM A;  1N6A A;  3NTH A;  4J9E A;  4PFP A;  1Q81 U;  1I5L A;  5HKC A;  1WHM A;  3O5Z A;  2YUQ A;  3QDR B;  4PJO E;  1WXT A;  1X43 A;  2MIO A;  4M78 D;  2KQW A;  2CRE A;  1I1J A;  3RMQ A;  1GFD A;  1PRM C;  3MEA A;  1ZHI A;  4AFU C;  4EPC A;  2K5I A;  4DBR A;  1SG5 A;  2E65 A;  3OQ5 A;  1EZZ B;  3CPW P;  2XK0 A;  4M78 G;  1WYX A;  4M7A C;  2B8A A;  3LLR A;  3OYA A;  1ABQ A;  4OB1 B;  3L2Q A;  4EMK C;  1N9R A;  1H64 1;  3QO3 A;  1OX8 A;  2X3X D;  2FPD A;  1PD1 A;  5FU6 B;  3I56 A;  3TRE A;  3EG3 A;  3LH5 A;  2DZ9 A;  2RQR A;  4DBH A;  3C0C A;  1KG1 A;  2V26 A;  1FX7 A;  5LJ5 f;  1VQ6 Q;  3AT1 B;  2L8D A;  2DKG A;  3WVD B;  3JCM c;  2GQV A;  2K5L A;  2FRW A;  1LNX A;  2FYK A;  1ZUU A;  4F17 A;  1WXU A;  1QLY A;  1VQL A;  1ZSZ C;  1UEC A;  3QHS A;  3GIB A;  4BI3 A;  4RTX A;  4J83 A;  1JJ2 P;  1RAH B;  3SWN A;  1PHT A;  4OMQ A;  5IT9 E;  4FIB A;  3FLG A;  4JUV A;  3E9F A;  3HHT B;  3UPU A;  1RAA B;  3OYD A;  2GFU A;  5LJ3 f;  4JJN K;  2EW3 A;  2ZPG B;  2GF7 A;  4IUP A;  2HBP A;  1YNZ A;  3CCU Q;  1LCK A;  2KT1 A;  3EG9 B;  1AHJ B;  4KUL A;  4K11 A;  4FT4 A;  4LNP A;  2MOX A;  4Z02 A;  3SHW A;  3CPW S;  1B7T A;  4AFZ C;  4LDV A;  2WSF E;  2E6N A;  4XU1 A;  2JT4 A;  3A8O B;  4PJL A;  2JMC A;  3KUF A;  2CUD A;  2ZPH B;  2BE9 B;  3VS6 A;  1V29 B;  2VC8 A;  4A54 A;  4C8Q D;  3JCM P;  1YJN T;  4C0D B;  4Z88 A;  2YHT A;  2GTO A;  1R0C B;  3G71 Q;  3J7A F;  1Z9Z A;  3OYH A;  2F1L A;  4R0K A;  1S72 T;  3V8K A;  1MMN A;  1OPL A;  4PJO C;  4M75 G;  3JB9 F;  4A63 B;  1M1F A;  1AWJ A;  2HKQ B;  2MF2 A;  1Y07 A;  4C92 B;  5GMK h;  3M55 A;  3QSU A;  2XI9 A;  4HKE A;  5KYU B;  2CKK A;  3G71 T;  4QQG A;  1JJ2 S;  4MZP A;  3GOX A;  2QAZ A;  5AYF A;  4ZN1 A;  4JZ4 A;  2D0Q B;  4X34 A;  1KFZ A;  2E3I A;  4B9X A;  5GAN 2;  3H8Z A;  2YUP A;  2K3B A;  3LH0 A;  1NJI C;  4RKU E;  4WTO B;  2RB6 A;  4BY6 B;  4YTL A;  4HA8 A;  5DY9 A;  4BE0 A;  4A4K A;  4KH0 B;  2CZ6 B;  1LVK A;  1XQH A;  4QVZ A;  4C0F A;  1NEB A;  3C12 A;  1G3Y A;  4KGX B;  1NYF A;  4XU3 A;  2EYZ A;  2QGF B;  5GAN h;  4JRP A;  3CC2 Q;  3HRS A;  2A28 A;  2VB6 A;  1AOJ A;  2HSE B;  2KR3 A;  2NUT A;  3HFO A;  1VQP A;  1SRM A;  4QKU A;  1BCM A;  2RA2 A;  1LOJ A;  3AHU A;  3ASK A;  3GNG A;  3HSB A;  4DBF A;  1Q82 C;  5HK0 A;  5GMK j;  4BE1 A;  2C0O A;  3DB3 A;  4KBM B;  1C6V X;  2X51 A;  3CC2 T;  1KC8 U;  5GMK m;  5A0L A;  3P8B B;  2F2W A;  1N5Z A;  4XU0 A;  1QP2 A;  3U23 A;  1QVP A;  4ZGD B;  3CCM T;  1RAD B;  5I2S A;  1WA7 A;  3DKM A;  4HCB A;  2VV5 A;  4QW2 A;  2RHU A;  2KRM A;  4OB2 B;  2X4J A;  2G6F X;  1VYU A;  1GBR A;  2HL3 A;  3VU3 C;  2QEX Q;  4M7D B;  1G3T A;  4C92 F;  3JB9 J;  4E7J A;  1ACM B;  1VA7 A;  2CT4 A;  1EIF A;  2PZ1 A;  4LE9 A;  5FRO A;  1K0X A;  2LT4 A;  3H9N A;  2QDY B;  2L89 A;  1Y96 B;  1YJW Q;  1QVF P;  4C92 E;  5IH2 A;  2YLC A;  3OYM A;  1VQM Q;  1KK7 A;  4D8D A;  1B34 B;  5GAN j;  2ATC B;  3JCM e;  4WF2 A;  4A53 A;  3JSC A;  2PVG B;  2PUO B;  2WSC E;  2QEX T;  5M9O A;  2KAF A;  1UJY A;  1UHC A;  2DD5 A;  3JCM b;  4QT7 A;  1T3L A;  3BDU A;  2JW4 A;  2EBP A;  2MWO A;  1LJO A;  2CYZ B;  1YJW T;  4IUT A;  5HCK A;  3VS2 A;  2CZ0 B;  2A0F B;  2K2V A;  4J9G A;  5FU6 C;  2FHD A;  2DIG A;  2L3P A;  2YLB A;  1I5O B;  1UFF A;  1YJN A;  2KRN A;  1OZ3 A;  4C5I A;  2D8J A;  2K7A A;  4ZNX A;  1JB0 E;  1QWF A;  1E6G A;  1G3S A;  1YHQ T;  1F1B B;  3CD6 Q;  1S72 A;  3G6E T;  3MEW A;  3LW5 E;  3RKX A;  1CSK A;  4DEY A;  4ME7 A;  2EPD A;  2HQE A;  3PE0 A;  3MPU B;  4M7A B;  4MZM A;  5FU7 B;  3NGP A;  5GAN e;  3CXC P;  2ZPI B;  3CME Q;  1Y7X A;  3G1J A;  2AZV A;  3L2V A;  5HY6 A;  4M7D F;  4JRI A;  4BUG A;  3CCE Q;  2DXU A;  3QII A;  1SSH A;  3BY7 A;  1NE8 A;  2IG0 A;  4ZTJ A;  2YUN A;  5GAM d;  3MP1 A;  4M7D E;  4BDY A;  1O75 A;  2M1H A;  1QVF S;  2ZZD A;  5CR2 A;  4LXC A;  3CCR Q;  2CGH A;  1WZO A;  1RAI B;  2EQI A;  3CME T;  1V76 A;  5CO7 A;  2LQK A;  3VV0 A;  2CSQ A;  1Y0M A;  3QYG B;  4GBQ A;  3J81 E;  5GAO m;  1NJI R;  1N9S A;  3CBM A;  2NUP B;  2O01 E;  3VRY A;  2DJQ A;  1UB4 A;  3CCR T;  1UGS B;  4C0D C;  2SRC A;  2E12 A;  2JJ9 A;  2OX7 A;  4DBQ A;  2WAC A;  3VS4 A;  2NLU A;  1GBQ A;  1Q7Y C;  1ABO A;  1PNJ A;  1ZUY A;  3EG9 A;  1BIB A;  1BKB A;  2Y4Y A;  3NFC A;  3CCM A;  2DBM A;  1D0Z A;  4Z89 A;  4C92 C;  2DRM A;  3CMA T;  2E70 A;  5IHK A;  2EIF A;  1VQ5 A;  1UUE A;  4MDW A;  4JJD A;  5CVI A;  4EMG A;  1Q82 R;  4XK8 E;  4M7A F;  4ORZ A;  1VQL Q;  3EGD B;  4P5N A;  2DIQ A;  3KBG A;  3CXC S;  4HCC A;  4RCB A;  3JCM g;  1Y57 A;  2RHI A;  2ZPE B;  3L42 A;  4BY6 C;  2FPF A;  4M7A E;  4D8K A;  1RL2 A;  2P0P A;  2AHJ B;  2QQS A;  4J9F A;  1XOV A;  3JCM W;  1BI3 A;  4CC3 A;  1AZG B;  4C92 A;  1MV3 A;  3MP6 A;  1G5V A;  4AT1 B;  2EQJ A;  2KMT A;  1YWO A;  4OGE A;  3UF4 A;  1OU8 A;  3OYN A;  2LJ0 A;  2RHZ A;  1BI0 A;  2L0A A;  4CC7 A;  1JXO A;  4M77 B;  2HAX A;  3UA6 A;  4AG2 C;  1M8M A;  2BUD A;  1JO8 A;  1IHW A;  1XJW B;  1QVG P;  3EFO B;  1K9A A;  3CCQ T;  3M58 A;  3X25 B;  1WLP B;  1X6B A;  4DA4 A;  4NOY A;  2FPE A;  1P92 A;  2EAY A;  1YHQ A;  1IGQ A;  4ESR A;  1BCO A;  3G6E A;  2EYW A;  4LUD A;  3TQ7 P;  2LMJ A;  3CPW A;  5DLQ E;  4J7F A;  4PFZ A;  1HJD A;  5GAN 7;  1VQ9 Q;  2COY A;  2FRY A;  3H0H A;  4X9D A;  5GAN g;  3MP8 A;  1M90 U;  1PC0 A;  2R5M A;  4M7D C;  3OYE A;  1OYX A;  4E6R A;  4CRI A;  4KH1 B;  1U1S A;  2EQK A;  2DO3 A;  5CQX A;  1HK9 A;  3C94 A;  4F14 A;  2CS7 A;  1UGR B;  3FJ5 A;  4M78 B;  3ZEH A;  2QA4 T;  3S3O A;  1VQ9 T;  2GQI A;  2L3R A;  1W6X A;  4C0G A;  3KXT A;  2DMO A;  3E2U A;  1SPK A;  5GJW B;  4F7U G;  4LDX A;  2DAQ A;  1FMK A;  2QQR A;  2D0N A;  4FYW B;  3JB9 I;  2RHX A;  1R0B G;  2EJ9 A;  1G8X A;  2XDD A;  1JJ2 A;  4M7D A;  3BE3 A;  1M1K R;  3E19 A;  4E7H A;  4JJB A;  5CCA A;  4PJO F;  3MHX A;  3M53 A;  2EGC A;  1Y96 A;  2JM9 A;  3NPF A;  3CCR A;  2FZK B;  2JTM A;  2A3L A;  1B34 A;  3I55 T;  1D0Y A;  2KEA A;  2ABL A;  2DVJ A;  2HD0 A;  5I22 A;  2YDL A;  2XIC A;  4E7Z A;  4FL6 A;  1HYO A;  1FMW A;  1QKX A;  1QVG S;  1G2B A;  2DFU A;  3HTR A;  4R56 A;  4M77 E;  1VQP Q;  4J9D A;  2HEQ A;  1SSF A;  3FB9 A;  4XAX B;  1M90 C;  3CMA A;  2R5A A;  3ME9 A;  2DL7 A;  1M3C A;  3T9N A;  5KYN A;  5HK3 A;  1VQK A;  1ZLM A;  2VGN A;  1AWW A;  5FU7 C;  4KUD K;  4C5E A;  5I2M A;  4L5G A;  1XTD A;  2PVO B;  1TH7 A;  3TVT A;  3H41 A;  1Q7Y R;  4JS4 A;  2I2L A;  3ZFJ A;  1VQP T;  5I21 A;  5GAN 6;  3QWY A;  2DET A;  2LCC A;  1PWT A;  3CC4 T;  2MCN A;  3CCL T;  1UGP B;  2LQ8 A;  4JPB W;  2JN0 A;  2LTO A;  2DER A;  2COZ A;  5IAY A;  2M0O A;  1N8R C;  1MV0 B;  1HXD A;  2A08 A;  2XMF A;  5LJ3 h;  3H0F A;  3VUB A;  2EKO A;  1CKB A;  2ROT A;  1QKW A;  4M78 E;  4M7A A;  1SHG A;  2AT1 B;  2FVU A;  4OMN A;  4XTU A;  4J7I A;  1VOM A;  2KE9 A;  4EMK A;  3OYK A;  1PSF A;  2JXB A;  2HNI A;  1WJS A;  2A37 A;  4D6W A;  2VYT A;  4IUQ A;  3QYH B;  1IHV A;  3OYL A;  1NLO C;  1YCS B;  4XTW A;  3CCQ A;  1RI0 A;  4C8Q B;  2CH4 W;  2MPX C;  1KJW A;  2E1H A;  1NJI U;  4VUB A;  3RDV A;  1TSF A;  1T0J A;  1ZSZ A;  4FU6 A;  3GP8 A;  1YJN Q;  3PGG A;  1XNI A;  4CI0 C;  1YJ9 T;  1OX9 A;  2NUP A;  3RKW A;  3JB9 D;  1S72 Q;  2CP2 A;  1PCX A;  2FL7 A;  2LCL A;  3EAE A;  3L2U A;  1PM3 A;  2OJ2 A;  5LJ3 j;  4M75 D;  1H92 A;  3VUZ A;  2GNC A;  3NHN A;  4JRK A;  3ER0 A;  2FZG B;  3JCM h;  4MDX A;  2QA4 A;  5IHI A;  2E4H A;  1VQ9 A;  2M16 A;  2DL4 A;  2VXF A;  4V2S A;  1AEY A;  2VVK A;  2EJF A;  1K76 A;  3JB9 G;  5CQY A;  3HRT A;  1OPK A;  1Q82 U;  2O31 A;  3JCM X;  1UG1 A;  4PK4 A;  4FT2 A;  2ZAE A;  2RI3 A;  3M0S A;  1GXI E;  4OB3 B;  1X69 A;  5CKD A;  4J9B A;  1YI2 T;  2X4W A;  2KI7 A;  2K4Y A;  3QG1 A;  3EGD A;  1QW1 A;  4M77 C;  5LJ5 e;  4DOV A;  2PU9 B;  3V7R A;  1ZX6 A;  2RJC A;  5KYX B;  3TSW A;  5FW9 A;  5EC7 A;  1I4K 1;  3I55 A;  4EIK A;  1QVF A;  1WHG A;  1A0N B;  1WQW A;  1JEG A;  2JMA A;  2R57 A;  2CZ1 B;  4XQ3 A;  3FIF A;  2YT6 A;  3PVQ A;  3GF5 A;  4IUR A;  2FG0 A;  4L59 A;  3CCS Q;  4IIM A;  4C8Q F;  1I07 A;  1WQ7 A;  2RI2 A;  3CC7 Q;  1X27 A;  4PJO A;  1YWP A;  3BDL A;  1IRE B;  2O9V A;  4RMO A;  3RUX A;  2ZPF B;  5LJ3 e;  2HSP A;  4C8Q E;  2RJF A;  4Z8A A;  4C5G A;  3D7S B;  3TCJ A;  4PL6 A;  1K8A R;  1WGS A;  1C1A A;  4CC4 B;  1ZSG A;  4IIO A;  3CCV Q;  2QK0 A;  3CCM Q;  2EYY A;  2JTF A;  4J6Y A;  3EFO A;  3CCS T;  4FSS A;  1JU5 C;  3VS3 A;  3CC7 T;  4M78 C;  2KRO A;  3VS0 A;  2E3H A;  3MJX A;  2RQV A;  3X24 B;  1M8V A;  3A5Z B;  1VQ5 Q;  5KYW B;  3CC4 A;  1M90 R;  3CCL A;  1FXX A;  3EGU A;  3M57 A;  3CQT A;  3ULR B;  3RKY A;  1J3T A;  1E7O A;  4JS5 A;  3M0U A;  4J6W A;  1V1C A;  3EH2 A;  3CCV T;  2HBW A;  2F69 A;  4C92 G;  1R77 A;  2IIM A;  2DXB A;  1MUZ A;  1VQ5 T;  2JS0 A;  3CXC A;  2Z0W A;  3TSZ A;  1I0C A;  1VYT A;  2DJZ A;  4DQ2 A;  1T3S A;  2O2O A;  1EFN A;  2DD4 A;  1QWE A;  2I0N A;  1OOT A;  4M78 A;  2CH4 A;  3SEM A;  3PT9 A;  5KYY B;  2EQU A;  3A8G B;  2ZPB B;  4J5Y A;  2VGM A;  2AIR B;  3QWX X;  1X01 A;  2CUB A;  1Q86 C;  2RN8 A;  2A36 A;  2RQT A;  3JCM d;  1M1K U;  1N8R R;  2XU8 A;  2HZY A;  5GAM f;  2KYM A;  3A98 A;  2A7Y A;  1OV3 A;  1WHK A;  3G7Z A;  4AFS C;  3OW2 P;  2EYX A;  4PKC C;  4JLG A;  2NYS A;  3PMT A;  4L6V 5;  3MEV A;  2PTK A;  1G3W A;  3C95 A;  2JOY A;  4HXJ A;  4Y28 E;  1YJ9 A;  1HSQ A;  1YHQ Q;  1VQN T;  5FWC A;  5D7U A;  2PUK B;  3G6E Q;  1WFW A;  2E5Q A;  1BYM A;  3S6W A;  1TTH B;  3LX7 A;  3S3M A;  3THK A;  2MYS A;  3MCA B;  4OP0 A;  2XHC A;  2P4T A;  3TU4 K;  3CEY A;  4FSX A;  1YN8 A;  3EHR A;  2CP0 A;  1Q7Y U;  3CBP A;  1BBZ A;  1O9S A;  1VQO T;  5KCH A;  3C4S A;  4FCY A;  1W2B P;  2H3E B;  2DA9 A;  2KRS A;  1NM7 A;  2OTJ T;  1RLQ C;  2LNH B;  3MKD A;  1YI2 A;  1ZBJ A;  5GAN d;  2FEI A;  3QXE B;  1PSE A;  3PNW C;  2GTJ A;  4M7D G;  1D1B A;  2LCS A;  1M1K C;  1NYG A;  5L8R E;  1VQ7 T;  4JLI A;  3RR6 A;  1M30 A;  4C8Q C;  1K9M C;  2DL5 A;  4Y91 A;  4E47 A;  1DJ7 B;  4RTZ A;  2K9G A;  3JV3 A;  5IXB A;  5L23 A;  2QAS A;  3SD4 A;  5LJ3 g;  2M9U A;  3M9Q A;  4N4I A;  5KH6 A;  3A1P A;  5C0M A;  2JS2 A;  2HQX A;  4GLM A;  4X9C A;  4OF1 A;  5ECA A;  3OW2 S;  5GAO q;  3EFR A;  1KIK A;  3PIP A;  1KQ2 A;  2DL3 A;  2XD0 A;  1TU0 B;  4Q5W A;  4XTX A;  4NL3 A;  3VS7 A;  3CCS A;  3CMA Q;  3X26 B;  3CC7 A;  3DLM A;  4C8Q A;  1VQK Q;  1NPR A;  4N4G A;  1QVG A;  2RPN A;  2PNI A;  4F16 A;  3V7C A;  3QPH A;  2JM8 A;  2D9T A;  3EH1 A;  1U8R A;  2VUB A;  2HQH A;  4LN2 A;  3J80 E;  4BI8 B;  3CCV A;  3JCM Q;  3RIR A;  4XTY A;  3V8L A;  1VQK T;  4M7A G;  4ZGE B;  1W2B S;  4HCK A;  4B9W A;  2K57 A;  4LDU A;  3RBB B;  5CK9 A;  2F5K A;  3JCM V;  2MWP A;  2NWM A;  2Y90 A;  2LQN A;  5GAN 8;  3MEU A;  4TVR A;  2LP5 A;  3V7S A;  1RAF B;  3FDR A;  1YIJ T;  4KUI A;  2KY9 A;  5J39 A;  3IQL A;  3OYI A;  2G3R A;  3BFM A;  3LYI A;  3M0T A;  3H6Z A;  3L2Z A;  1RAC B;  4E7S A;  3CCQ Q;  2PVD B;  1WJQ A;  4AFQ C;  2XG8 D;  1SKU B;  2B86 A;  4HVV A;  3ZBD A;  5KYU A;  1H3Z A;  1VQN A;  3VS1 A;  3NTK A;  2DTI A;  5KYX A;  1WJR A;  1WHL A;  1D1C A;  2QGG A;  4M4Z A;  4O5V A;  4F7U B;  4FM4 B;  2ZGW A;  1Q86 R;  2W0Z A;  1M2O A;  1VIE A;  4RTT A;  4FYY B;  1OI1 A;  1B07 A;  5IXF A;  2EGA A;  1K8A U;  4ATO A;  1KD1 U;  1NG2 A;  3F70 A;  2XKO C;  3OSV A;  1M4Z A;  5D6X A;  4RTW A;  4PJM A;  1VQO A;  2YRV A;  5GAO r;  3OSS C;  1NLP C;  2NUT B;  2QA4 Q;  1D3B B;  1WHH A;  3VRZ A;  2OTJ A;  4OML A;  1B3Q A;  2AKK A;  1WPY A;  1W1F A;  2YRC A;  2L2P A;  4LDY A;  3M54 A;  3JCM J;  1UE9 A;  2QQA A;  2EVR A;  1N27 A;  2E10 A;  1VQ7 A;  3NTI A;  1BB9 A;  5A0G A;  3UA7 A;  2LX7 A;  4PJO D;  1JQQ A;  2ROL A;  2NUZ A;  4QVD A;  2FB7 A;  3OS1 A;  2EWN A;  2DF6 A;  4N4H A;  4RG2 A;  3I5R A;  4E2F B;  3OS5 A;  5IN1 A;  5GAN 4;  1VQ4 T;  1D0X A;  3I55 Q;  4OMP A;  2O88 A;  5CKB A;  4PJO G;  5GAN 3;  1N8R U;  3VS5 A;  1VIF A;  2RQU A;  3PVL A;  4HT9 A;  4PLL A;  2DXT A;  1K9M R;  5D6W A;  5KYY A;  2P84 A;  1WI7 A;  4ANJ A;  2KYB A;  3M4Y A;  3JRZ A;  1K8A C;  3CCJ T;  3DB4 A;  1KD1 C;  1BK2 A;  4M77 F;  4X1V A;  1KSW A;  1IXD A;  2RNA A;  1NEG A;  1K73 C;  4F7U E;  3G4S T;  4J9C A;  3V8J A;  2PQW A;  2KXD A;  2O9S A;  2EJG A;  3TEE A;  2OTL A;  2DX1 A;  1TS9 A;  2HKN A;  4BAC A;  1YIT T;  2LC4 A;  1PG5 B;  1M3B A;  3VYH B;  4HVU A;  3PIO A;  3CC4 Q;  4XU2 A;  3CCL Q;  5LJ5 h;  1AVZ C;  1OQK A;  1QQJ A;  2LVM A;  1M1G A;  1VYV A;  3X20 B;  2FO0 A;  4LUE A;  1E6H A;  1WDX A;  2DBK A;  2X35 A;  1KHC A;  2KDS A;  3M0Q A;  3VKI A;  2M02 A;  4PNO A;  3QJ6 A;  5GAO l;  3HRU A;  1GCP A;  1YIJ A;  2OAU A;  2HL5 C;  2JNG A;  2BIV A;  3SWN C;  3OB9 A;  1U1T A;  1KQS P;  2QTX A;  4M78 F;  2QQB A;  3Q1J A;  4N0A C;  6AT1 B;  1M2V B;  2V8J A;  1IZ6 A;  2CZ7 B;  4BD3 A;  4JRQ A;  5CKF A;  3GNF B;  3SB2 A;  2RF0 A;  2XDP A;  2LZ6 B;  3LWI A;  1G83 A;  4J9H A;  2DE0 X;  2RH2 A;  2CP3 A;  1HD3 A;  1IGU A;  1ZUK A;  2IVW A;  4QVC A;  2DYB A;  1MGQ A;  4MML A;  2J6K A;  4M75 B;  2YUO A;  3R6O A;  3I35 A;  1YJ9 Q;  2X3W D;  5CKE A;  2W10 A;  2VXE A;  2C0T A;  3UT1 A;  3EGX B;  1VQ8 A;  3I5S A;  1Q81 C;  5LJ5 j;  2K3X A;  3A8H B;  4R55 A;  1X2Q A;  4QQD A;  4N0A A;  2AK5 A;  1YCY A;  1VQ6 T;  1OUL A;  2L3Q A;  1IB8 A;  1ZQ1 A;  3EG0 A;  1RAG B;  5EG2 A;  3SDZ A;  2O4X B;  4BB7 A;  3GPL A;  1BI1 A;  2P0K A;  1RAB B;  2KT8 A;  4FYX B;  1TUG B;  2JUF A;  5FWB A;  2BZY A;  3QBY A;  1SF9 A;  3DLL A;  4J9I A;  1SHF A;  2F2V A;  1YI2 Q;  3H0I A;  1PD0 A;  2ED1 A;  2D8H A;  3HKS A;  1BI2 A;  4EMH A;  4PJN A;  2ENM A;  4F04 B;  4WCI A;  1UJ0 A;  4LD6 A;  2LJ1 A;  1VQ4 A;  4GY5 A;  2KGT A;  2KK4 A;  3CCU T;  4DOW A;  4ZN3 A;  1PKS A;  4C0Z A;  1WXB A;  1KQS S;  4A4H A;  2J7I A;  2D1X A;  3OYC A;  3SFM A;  4HT8 A;  1MHN A;  4FYV B;  2RJD A;  3HFN A;  5LJ5 d;  1RAE B;  5GAO n;  2QG9 B;  4PFO A;  4NL2 A;  4IUV A;  1LPL A;  1R8O B;  3CCJ A;  1UEB A;  1I8F A;  3FEO A;  3OYG A;  5CIU A;  3FJP A;  1OEB A;  1JXM A;  5FLX E;  4O6J A;  3UWN A;  1NZ9 A;  4C8Q G;  3JCM f;  3G4S A;  4M75 F;  1Z9Q A;  2LRQ A;  5DLO A;  2DZC A;  4RUG A;  2BZX A;  2GGR A;  3L2W A;  2JVV A;  4QQ6 A;  1Q86 U;  1UHF A;  3OW2 A;  2DK3 A;  2KBT A;  1YIT A;  5LJ3 d;  4M75 E;  4JJC A;  2ZCF B;  3LGF A;  3L1A A;  1OU9 A;  1YBY A;  4F7U A;  3UAT A;  1WHJ A;  3M0P A;  1AT1 B;  1BIA A;  3S3N A;  4M77 A;  1KD1 R;  2RK1 A;  2EQM A;  1JRI A;  4IUU A;  1TOV A;  2L5Q A; 
#chains in the Genus database with same CATH homology
 2FRW A;  2FPE A;  1ZUU A;  4F17 A;  1WXU A;  4RTZ A;  2K9G A;  3JV3 A;  1QLY A;  1IO6 A;  4ESR A;  2J05 A;  1UEC A;  1PKT A;  2EYW A;  2HCK A;  4LUD A;  5IXB A;  4RTX A;  5L23 A;  2LMJ A;  4OMO A;  1HJD A;  2FRY A;  3H0H A;  1PHT A;  4JZ3 A;  4OMQ A;  2JS2 A;  2ECZ A;  4E6R A;  4GLM A;  2YSQ A;  5ECA A;  1KIK A;  2M51 A;  2DL3 A;  3QWX X;  1FYN A;  3I9Q A;  2EW3 A;  1X6G A;  3VS7 A;  4F14 A;  1RLP C;  3FJ5 A;  1YNZ A;  1QCF A;  2RPN A;  2PNI A;  1LCK A;  2GQI A;  4Y92 A;  4F16 A;  2KT1 A;  2V1Q A;  1W6X A;  1SRL A;  2DMO A;  5GJW B;  1SPK A;  2JM8 A;  5GJV B;  1FMK A;  1RI9 A;  4K11 A;  2D0N A;  2LJ3 A;  4LN2 A;  4LNP A;  3ZL7 C;  2MOX A;  3M0R A;  3SHW A;  2GBQ A;  4AFZ C;  3REB B;  2JT4 A;  4RTV A;  4JJB A;  2JMC A;  1AD5 A;  2CUD A;  2EGC A;  4HCK A;  2JM9 A;  3NPF A;  3VS6 A;  1GCQ C;  3RBB B;  4Z88 A;  2KEA A;  2NWM A;  2LQN A;  2GTO A;  2ABL A;  2DVJ A;  5I22 A;  2LP5 A;  2YDL A;  1Z9Z A;  2CT3 A;  3REA B;  4R0K A;  1QKX A;  1U3O A;  1G2B A;  1OPL A;  4J9D A;  2AZS A;  2HEQ A;  4A63 B;  1AWJ A;  3IQL A;  2DL7 A;  5I11 A;  3M0T A;  1M3C A;  4RTY A;  1CKA A;  1ZLM A;  1AWW A;  4AFQ C;  3GBQ A;  2B86 A;  4HVV A;  1S1N A;  2QDL A;  3VS1 A;  3TVT A;  1U06 A;  3H41 A;  4JZ4 A;  4M4Z A;  1WIE A;  1GCQ A;  3RNJ A;  1KFZ A;  2RMO A;  2W0Z A;  3R6N A;  2YUP A;  2K3B A;  4HVW A;  5IHN A;  4RTT A;  3QWY A;  2KNB B;  2K6D A;  1PWT A;  2DRK A;  1B07 A;  5IXF A;  2ED0 A;  2EGA A;  2MCN A;  1U5S A;  2CDT A;  4JPB W;  1NG2 A;  1MV0 B;  1NEB A;  2A08 A;  2XMF A;  3H0F A;  1CKB A;  2ROT A;  1NYF A;  1QKW A;  4RTW A;  2EYZ A;  2AKL A;  1UGV A;  1SHG A;  1ARK A;  4OMN A;  1NLP C;  2A28 A;  2KE9 A;  3VRZ A;  1AWO A;  4OML A;  1PRL C;  1B3Q A;  1AOJ A;  2AKK A;  2KR3 A;  1W1F A;  2H8H A;  2JXB A;  1UDL A;  1SRM A;  2A37 A;  4RTU A;  2L2P A;  2RQW A;  3EG2 A;  1H3H A;  2K2M A;  1UE9 A;  1NLO C;  1YCS B;  2EVR A;  2J6F A;  2C0O A;  4AG1 C;  1BB9 A;  1K0S A;  2CSI A;  2LX7 A;  2DIL A;  3UA7 A;  1JQQ A;  2CH4 W;  2ROL A;  2NUZ A;  4KRT A;  2F2W A;  1KJW A;  1N5Z A;  3U23 A;  1WA7 A;  2DF6 A;  3I5R A;  1T0J A;  2KRM A;  1TG0 A;  1AZE A;  4OMP A;  1RUW A;  2O88 A;  2G6F X;  1VYU A;  1GBR A;  1SEM A;  1GRI A;  1VA7 A;  2CT4 A;  2PZ1 A;  4LE9 A;  3VS5 A;  1K0X A;  2RQU A;  3PVL A;  1UTI A;  2E5K A;  5IH2 A;  2P4R A;  2OJ2 A;  1T0H A;  1WI7 A;  1H92 A;  2KYB A;  2GNC A;  4D8D A;  2KXC A;  3NHN A;  1WX6 A;  1GL5 A;  5IHI A;  3NMZ C;  2K79 A;  2DL4 A;  1BK2 A;  1AEY A;  1YP5 A;  2VVK A;  1K76 A;  4X1V A;  1KSW A;  2RNA A;  1UJY A;  1OPK A;  1NEG A;  1UHC A;  2O31 A;  4QT7 A;  1UG1 A;  4J9C A;  1T3L A;  2JW4 A;  2KXD A;  2O9S A;  2EBP A;  2EKH A;  1K1Z A;  2DX1 A;  3M0S A;  5HCK A;  1H8K A;  2L3S A;  1X69 A;  4J9B A;  1M3B A;  3VS2 A;  2BZ8 A;  4HVU A;  4J9G A;  1AVZ C;  1VYV A;  1ZX6 A;  2FO0 A;  4LUE A;  2L3P A;  1E6H A;  3TSW A;  1WDX A;  5FW9 A;  1UFF A;  5EC7 A;  4EIK A;  2KRN A;  1A0N B;  2D8J A;  2K7A A;  2DBK A;  1K4U S;  1JEG A;  4ZNX A;  2JMA A;  1QWF A;  1E6G A;  3M0Q A;  2YT6 A;  3PVQ A;  2JTE A;  1GCP A;  2FG0 A;  4IIM A;  1I07 A;  1M3A A;  1X27 A;  1YWP A;  1CSK A;  4DEY A;  2O9V A;  2BTT A;  2EPD A;  1M27 C;  3PE0 A;  2HSP A;  1AWX A;  3NGP A;  4Z8A A;  2RF0 A;  2LZ6 B;  3EG1 A;  2AZV A;  4CC4 B;  2DM1 A;  1ZSG A;  2EGE A;  2V1R A;  4IIO A;  2OAW A;  1G83 A;  2EYY A;  1X6B A;  4J9H A;  4FSS A;  2DE0 X;  1JU5 C;  2DL8 A;  3VS3 A;  2M0Y A;  1SSH A;  2KRO A;  3VS0 A;  1HD3 A;  1ZUK A;  2RQV A;  2DYB A;  2YUN A;  4DEX A;  2J06 A;  2J6K A;  2SEM A;  2YUO A;  2C0I A;  1GFC A;  1TUC A;  2OI3 A;  3I35 A;  3EGU A;  2X3W D;  1BU1 A;  2W10 A;  3CQT A;  3ULR B;  2F2X A;  2C0T A;  2VKN A;  3I5S A;  1J3T A;  2EQI A;  4OMM A;  1E7O A;  3M0U A;  1X2Q A;  1V1C A;  2AK5 A;  2HBW A;  2VWF A;  2CSQ A;  1Y0M A;  4GBQ A;  2L3Q A;  2IIM A;  1MUZ A;  3EG0 A;  1X2K A;  2JS0 A;  1W70 A;  3TSZ A;  1I0C A;  2LQW A;  1VYT A;  2DJQ A;  3VRY A;  2DNU A;  2KT8 A;  1T3S A;  2O2O A;  1EFN A;  5FWB A;  2BZY A;  2SRC A;  1QWE A;  2I0N A;  1OOT A;  2CH4 A;  3VS4 A;  3SEM A;  2HDA A;  1GBQ A;  4J9I A;  1SHF A;  1ABO A;  1PNJ A;  2CUB A;  1ZUY A;  2ESW A;  2RN8 A;  2J6O A;  2A36 A;  2RQT A;  2F2V A;  2DLP A;  3H0I A;  2ED1 A;  2D8H A;  4CC2 A;  2DBM A;  2KYM A;  3A98 A;  4Z89 A;  2DRM A;  2ENM A;  1OV3 A;  3KFV A;  4AFS C;  4WCI A;  1UJ0 A;  3EHQ A;  2LJ1 A;  2EYX A;  2KGT A;  5IHK A;  2PTK A;  1PKS A;  1TUD A;  1UUE A;  1WXB A;  2J7I A;  2D1X A;  4HXJ A;  4JJD A;  4J9E A;  1HSQ A;  3O5Z A;  2YUQ A;  4ORZ A;  5FWC A;  1WXT A;  1X43 A;  2MIO A;  1WFW A;  2CRE A;  1Y57 A;  1I1J A;  3THK A;  1GFD A;  1PRM C;  2FPF A;  4AFU C;  4D8K A;  4J9F A;  1OEB A;  1JXM A;  1XOV A;  1YN8 A;  4CC3 A;  1AZG B;  1WYX A;  3EHR A;  1Z9Q A;  1MV3 A;  4RUG A;  2BZX A;  2GGR A;  1ABQ A;  1UHF A;  1BBZ A;  1YWO A;  3UF4 A;  2KBT A;  2KRS A;  2DA9 A;  4JJC A;  1NM7 A;  2LJ0 A;  1RLQ C;  2LNH B;  1ZBJ A;  2L0A A;  2FEI A;  2X3X D;  4CC7 A;  2FPD A;  1JXO A;  2GTJ A;  3EG3 A;  3LH5 A;  3UAT A;  3UA6 A;  3M0P A;  4AG2 C;  2RQR A;  3C0C A;  1M8M A;  1JO8 A;  2LCS A;  1NYG A;  1K9A A;  1M30 A;  1WLP B;  2DL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...