2A37A

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (drkn sh3 domain)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords Protein E(sev)2B
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2a37A00
2GBQA 1WYXA 1U3OA 4J9BA 2CREA 2C0OA 1PKSA 1M8MA 2V1RA 3EG2A 2D8HA 3C0CA 2KT1A 1UECA 1Y0MA 2H8HA 4J9DA 1UGVA 3CQTA 1WLPB 1ABOA 1GCPA 2X3WD 1KFZA 1EFNA 1W1FA 4CC3A 2LJ0A 4D8DA 1SSHA 3I9QA 2PTKA 1X2KA 1YWPA 3M0QA 1I07A 2CDTA 1IO6A 1E7OA 2LP5A 1ZSGA 2A37A 1AEYA 2EKHA 2DE0X 1KIKA 1NM7A 2KYMA 4HCKA 3VS1A 1T0JA 3VS2A 1ZUUA 1A0NB 1ZX6A 4LNPA 1X27A 2EBPA 1OPLA 1WA7A 2KROA 3VS0A 1Z9ZA 1PHTA 1T3SA 1G2BA 4RTXA 2B86A 2DL7A 1MV0B 4DEXA 2JM9A 3UA6A 2ABLA 1I0CA 2OJ2A 1UHFA 3NGPA 2L2PA 4RTUA 5IH2A 1WIEA 3M0RA 2BZXA 2P4RA 2DLPA 2YUPA 1K76A 4LUEA 4KRTA 4RTWA 2MCNA 3H0HA 2VVKA 2AKKA 3NPFA 3THKA 2RQUA 2KT8A 2RNAA 2YDLA 1WFWA 2KE9A 2DM1A 2YT6A 4RTYA 2LZ6B 5GJWB 5IXBA 1OOTA 2KR3A 2DRMA 2K9GA 2LJ3A 1HJDA 2K79A 2JMAA 2LJ1A 3NHNA 2DRKA 1GRIA 2CT4A 4OMPA 1TUCA 1GFCA 4J9EA 1QWFA 4IIMA 2EQIA 4JZ4A 1KJWA 1E6GA 2AKLA 1NLPC 2LMJA 1X43A 5EC7A 2NUZA 1GCQA 2ROLA 2YUNA 1K0SA 1ZUKA 3VS7A 2RQWA 1OV3A 2W0ZA 1M3AA 1RLQC 1NYFA 1G83A 4GLMA 3VS4A 4F17A 3TSZA 1ABQA 2EYWA 2NWMA 2SEMA 3H0IA 3PE0A 2DL3A 2K6DA 2D0NA 2PZ1A 2G6FX 3EHRA 2BZ8A 4HXJA 4OMQA 1AWJA 1U06A 2CUBA 1JXOA 2L3PA 2KXCA 1JEGA 1M3CA 1WDXA 2CT3A 2A28A 2IIMA 2F2WA 3O5ZA 2HDAA 3QWYA 4RTZA 1J3TA 1NLOC 3EHQA 2CH4A 4J9IA 2LX7A 3ZL7C 1Z9QA 3EGUA 4Z89A 3UATA 1T3LA 1SRMA 2EW3A 3U23A 1HSQA 2KYBA 1X6GA 2RN8A 2RPNA 2KXDA 3R6NA 4JJDA 3VS3A 3VRZA 1QKXA 2KRMA 2JS0A 1H8KA 4ESRA 1ARKA 5IHKA 1BB9A 4HVUA 4K11A 1UFFA 1AWOA 2KRNA 3FJ5A 1HD3A 4QT7A 3RBBB 4A63B 2FG0A 4AG1C 1X2QA 3PVLA 1MUZA 1K9AA 1WI7A 2DNUA 2K2MA 1SPKA 2L3SA 1AWWA 4Z88A 1WXUA 1UTIA 2JM8A 2O9VA 2HEQA 4ORZA 1CKAA 3A98A 1M3BA 2OI3A 3KFVA 3REAB 2VWFA 2ESWA 1QWEA 2EYZA 1B07A 1B3QA 4HVWA 2EGCA 2O9SA 1UUEA 3M0TA 2RQTA 3IQLA 1Y57A 2J7IA 3M0PA 2J6FA 5GJVB 2YUQA 2LCSA 2D8JA 4AG2C 1OPKA 1VYTA 2C0IA 2K7AA 2ED0A 1VYUA 4OMMA 2DL8A 1CSKA 4EIKA 4DEYA 1H3HA 2D1XA 2AK5A 2O31A 5FWCA 4JZ3A 3ULRB 2F2XA 2X3XD 1JO8A 1CKBA 4J9FA 3SHWA 3H41A 3I5RA 4RTVA 2FPFA 5L23A 2LQNA 4J9HA 1PNJA 1RLPC 2O2OA 2CSQA 2SRCA 4CC7A 3LH5A 4AFUC 1GBQA 1UJ0A 2RQRA 1YN8A 1QLYA 1FYNA 1JXMA 2DA9A 2F2VA 4J9CA 1GFDA 1H92A 1X6BA 1YNZA 2BZYA 3REBB 4CC2A 1AZGB 1V1CA 4HVVA 1QKWA 1AWXA 2J05A 2FPEA 1NYGA 2KGTA 2GGRA 2V1QA 2L3QA 2KNBB 4LE9A 1K0XA 1X69A 1UDLA 1ZUYA 1S1NA 2FO0A 4J9GA 2ROTA 1I1JA 2KBTA 2GTOA 4OMOA 3TVTA 2DBMA 1M27C 1E6HA 2GTJA 3TSWA 3UA7A 4R0KA 1T0HA 2DL5A 2L0AA 4JJBA 1VYVA 1UG1A 4JPBW 2J6KA 2HCKA 1XOVA 2ED1A 4Y92A 1BU1A 1OEBA 4AFSC 1PRLC 4RUGA 1SHGA 5FW9A 3UF4A 2A08A 1JQQA 3VS5A 2JTEA 4CC4B 4WCIA 2YSQA 2EGEA 2LNHB 1GCQC 1FMKA 2DX1A 2JW4A 1RI9A 4M4ZA 2J6OA 4LUDA 4GBQA 1QCFA 1KSWA 2DILA 2DMOA 2ENMA 2BTTA 4LN2A 5HCKA 1W70A 1ZLMA 2C0TA 1N5ZA 2ECZA 1M30A 3I35A 1NG2A 2M0YA 2EYXA 5IXFA 2JXBA 5ECAA 2EPDA 4FSSA 1LCKA 1VA7A 2FEIA 1PRMC 2RMOA 2YUOA 2DYBA 2OAWA 2RF0A 3GBQA 2I0NA 3EG3A 4X1VA 2DL4A 1AOJA 4E6RA 2GQIA 3JV3A 1WXTA 5I11A 2JMCA 1YWOA 5IHIA 2MOXA 4OMNA 1UJYA 2QDLA 1BK2A 1NEGA 1SEMA 3SEMA 1ZBJA 2FRYA 1GBRA 1AVZC 2M51A 1JU5C 2PNIA 4F16A 2E5KA 2MIOA 3RNJA 3VS6A 1W6XA 1UE9A 2W10A 2CSIA 2DBKA 2JS2A 3NMZC 4AFQC 5IHNA 2EYYA 2HSPA 5I22A 3M0UA 3H0FA 1SRLA 2VKNA 2O88A 2AZSA 2DVJA 1TUDA 4RTTA 1SHFA 1U5SA 1YCSB 1GL5A 1UHCA 1AZEA 2FRWA 2AZVA 5FWBA 2KEAA 1K1ZA 2HBWA 3PVQA 1AD5A 1PKTA 2CUDA 2EVRA 4OMLA 4Z8AA 1RUWA 4JJCA 2J06A 1BBZA 4D8KA 4F14A 2XMFA 2EGAA 2JT4A 1NEBA 2KRSA 1PWTA 2GNCA 1WX6A 2RQVA 3M0SA 2DJQA 1YP5A 4ZNXA 3VRYA 3EG0A 1MV3A 3EG1A 1WXBA 4IIOA 3I5SA 1TG0A 2LQWA 3QWXX 4AFZC 2DF6A 2K3BA 1K4US 2CH4W 2FPDA 2A36A
chains in the Genus database with same CATH superfamily
2CKKA 1WYXA 4RG8A 3URGA 2LC4A 1RADB 2CREA 3EGXA 1B34A 3EG2A 3C0CA 3V7SA 2EYQA 1FMVA 1ABOA 5D6XA 2X3WD 1X2KA 4UC4A 4M7AC 2RI3A 4OVAA 1QVGA 2B8AA 2LQKA 4BI8B 2A7YA 1JJ2S 1KIKA 5GMKh 1NM7A 1LVKA 4PLLA 1PG5B 1K9MU 3MP1A 2ZPIB 2H3JA 1X27A 2EBPA 1WA7A 3M55A 1EIFA 3VS0A 4C92D 1PHTA 1I5LA 4RTXA 3QUIA 2DL7A 1MV0B 4J6WA 4JRKA 4IUUA 5I2MA 2RJDA 1WHHA 3CC2T 4WTOB 2BZXA 2P4RA 1IHVA 2YHTA 2XDPA 3UT1A 1K76A 3OMGA 4RTWA 4M78A 1YFNA 1PD1A 2QAZA 3DKMA 5HKCA 1WFWA 2OTLT 3QO3A 4BB7A 5IAYA 3ZFJA 3OYJA 5GJWB 3WVEB 3HFNA 4E2FB 2KR3A 2DRMA 4L59A 4RG2A 3M56A 2JMAA 1YJ9A 3HPWA 3QG1A 2H3EB 2YWWA 3G4ST 1GRIA 3FEOA 3MJXA 4OMPA 1VQNT 1GFCA 1S72Q 1M90C 2LX9A 3V7RA 2V8KA 4X34A 1HK9A 1KJWA 1RAIB 2AKLA 2NUTB 1VQOQ 3TU4K 2LMJA 3ZEHA 2PU9B 1G3SA 5EC7A 1K8AU 1GCQA 2ROLA 2V26A 2YUNA 3Q1JA 4PFZA 2NYSA 2EKOA 1G83A 4AMCA 3VS4A 1QVGS 4F17A 3V7CA 2DXTA 2QGFB 1IGQA 4PK4A 2D0NA 2PZ1A 1U06A 1D0XA 1UEBA 2MK5A 4E7LA 3AHUA 1EX4A 2KXCA 1JEGA 1M3CA 4ATOA 4JS4A 1AHJB 2A28A 3QWYA 3CD6T 1NLOC 4MDWA 3EHQA 2CH4A 4J9IA 2VXEA 3ZL7C 1Z9QA 3EGUA 1M90U 1TH7A 3L2VA 4FIBA 2NUPA 2FHDA 1HSQA 5A0GA 2RPNA 4N0AA 3R6NA 4PFPA 2CP0A 2KRMA 4C8QB 4EMKA 1ARKA 4K11A 2DZ9A 1HYOA 4C0ZA 3RBBB 4A63B 3LLRA 2DYIA 2DXUA 2F69A 2DAQA 2K3YA 3JCMd 1MUZA 2K4YA 3X24B 5KYNA 1D3BB 4MMKA 1SPKA 2L3SA 1VQLQ 4FYVB 2JM8A 2L8DA 1YJ9T 1BKBA 1BI2A 2OI3A 2O01E 2LVMA 1TSFA 5CK9A 3REAB 2KVQG 5KH6A 1B07A 2QEXQ 2EGCA 1C0MA 2DXBA 1UGSB 3ME9A 4ELYC 2V8IA 4M75G 1D09B 2LCSA 1YI2Q 4C92E 5GAN7 3CXCS 1K9MR 2Y4YA 1XJWB 1NZ9A 2K7AA 2RB6A 1VYUA 4OMMA 4NL3A 1VQLA 3NTHA 5IT9E 4DEYA 4M7AA 4F7UG 1M1KC 1BYMA 3ULRB 5KCOA 4J9FA 4PJOB 2FPFA 4ZGDB 5GAN2 3KXTA 2RI5A 1RLPC 3LH5A 3M54A 1UJ0A 2EAYA 1JXMA 2CP6A 4J9CA 3QXEB 7AT1B 3JCMX 5GAOq 4DBRA 2NLUA 3E1SA 3GLXA 3MEWA 1IXDA 1V1CA 4IURA 4HVVA 2KAFA 1OULA 1AWXA 1VQOA 4BDZA 1O9SA 3BY7A 1NYGA 3FB9A 1SSFA 2K5FA 2V1QA 2L3QA 2M1HA 4XK8E 1WHJA 1QVGP 1X69A 1ZUYA 1S1NA 4PJOC 1LJOA 2ROTA 1I1JA 2KBTA 2GTOA 4OMOA 3TVTA 4C0DC 3CCUT 4QVCA 2LCCA 1RABB 3VKIA 3C94A 1OI1A 2MPXC 1K8AR 4XU3A 1T0HA 5C0MA 2DTOA 4J8OA 2QXFA 5GAN4 1VQMA 4JPBW 2HCKA 4C0DB 2EQMA 2P0QA 3QYHB 2HKQB 4Y92A 1PRLC 4BY6C 2A08A 4WCIA 2YSQA 3AT1B 3CPWA 4KUIA 1GCQC 2DPPB 2DX1A 2JW4A 2VC8A 1RI9A 4M4ZA 2HMAA 3A8MB 5D6WA 2BTTA 3QHSA 2FYKA 3CCLQ 1W70A 1ZLMA 4KH1B 1N5ZA 3X26B 4KULA 2C06A 4KBMB 2EYXA 3HHTB 5ECAA 2IG0A 5FROA 3SFMA 1BCOA 2QASA 4N4HA 3V8KA 2M16A 3S3MA 2D0QB 3EG9A 4A4EA 1PRMC 5DLOA 4XU0A 2OAWA 3GBQA 2HNIA 4RMOA 3EG3A 3CCST 3SWNC 2GQIA 4C5EA 3JV3A 4BI3A 5GAMg 1VQPA 1YIJA 3CCVT 2JMCA 1PM3A 1G3YA 5IHIA 3CMEQ 3CCLA 4N4GA 1UJYA 4DA4A 4A4GA 3CCJQ 3QYGB 1ZBJA 1NPRA 2M51A 3G1JA 2HQHA 2QQAA 3RNJA 3VS6A 1IB8A 4MDXA 4JS5A 1W6XA 1UE9A 2JVVA 2RHXA 4LDXA 4AFQC 1NE8A 3E9GA 1N6AA 5LJ5d 4GLKA 3GF5A 4FU6A 3M0UA 1SRLA 2JNGA 1Y7XA 4B9WA 1M2VB 3OBWA 5GAOr 3UWNA 3KBGA 4EPCA 3JCMc 3SDZA 1K8AC 3OYGA 2GF7A 3CPWS 3CCSA 1U8RA 3I56Q 4B6MA 5FWBA 4M7AF 1W2BA 1BIBA 4A54A 2CUDA 1YJNA 4EMHA 1RUWA 1BBZA 1WZOA 2CP3A 4HCCA 3OS1A 3MEVA 3E2UA 4F14A 2XMFA 2EGAA 1PCXA 1KQ1A 1N8RC 4EDUA 4PL6A 1PWTA 4XTUA 3PMIA 2GNCA 1KD1U 1SF9A 5GMKm 1YBYA 2RQVA 1ZQ1A 3WVDB 4ZNXA 3T9NA 3OS0A 3R6OA 1WQWA 3OSVA 4E7HA 1YJNQ 2DF6A 3QPHA 5CKEA 1ZSZB 3VV0A 4J6YA 2M9UA 2BUDA 2A36A 3VU3C 1YJWA 1QQJA 2KK4A 2HQEA 5GANh 2C0OA 2RK2A 4PJLA 1S72T 1XTDA 2KT1A 1OYXA 4BE2A 2H8HA 3E9FA 3JB9F 3HL8A 3UDCA 2DK3A 1VQOT 1N8RU 2LJ0A 2Z0WA 2G3RA 4D8DA 3I9QA 3S3NA 2PTKA 3M0QA 8AT1B 2LP5A 1SG5A 4C92F 1LPLA 2A37A 3FLGA 2QYZA 2DE0X 2KYMA 4HCKA 3G71T 1Q81R 1VQMQ 1A0NB 4LNPA 3CMEA 2HBPA 1QP2A 1IGUA 2YRDA 5DY9A 2KROA 2DERA 5I21A 4A4KA 1T3SA 1G2BA 1ZSZC 4JJNK 1BCMA 1KHCA 3QJ6A 1I0CA 3NGPA 5J3BA 3MEUA 1M5Q1 3M0RA 1Q82C 2DLPA 2YUPA 4LUEA 4KRTA 4N4IA 5GANg 2VVKA 2L3RA 5J39A 3NPFA 3THKA 2RQUA 1Q7YR 1PSEA 5KYWA 1HXDA 2PUKB 4RTYA 2K9GA 1QMCA 4QVZA 4N0AC 2LJ1A 3MHXA 4BE0A 1NJIU 3TREA 2ZPGB 2DRKA 1U1SA 2VV5A 3CC4T 5GAOm 1TUCA 5LJ5e 4J9EA 3HSBA 2QQ9A 4O6JA 1E6GA 4L5GA 1Y96B 4XTVA 2CP5A 3VS7A 4BI4A 3C12A 2RHIA 1OV3A 3M4GA 1M3AA 3GIBA 2M02A 3JCMV 2MWOA 1WJRA 3CCJA 3EFOA 1ABQA 2K57A 1D1BA 4FM4B 2NWMA 2SEMA 3PE0A 2E3HA 3EHRA 2BZ8A 4HXJA 4OMQA 3LWHA 1C1AA 1U1TA 1AWJA 3LYIA 3PNWC 1WDXA 2CT3A 4M7DB 4XU1A 2A3LA 3L2RA 1G8XA 4QQDA 1J3TA 1KC8R 5D7UA 3CC4A 3BE3A 3UATA 1SRMA 2EW3A 2R5MA 3OS5A 2KXDA 4JJDA 2FZKB 3VS3A 3L42A 3VRZA 2XHCA 4X9CA 2JS0A 5IHKA 1BB9A 1UFFA 4M77C 1AWOA 2FG0A 4AG1C 1X2QA 1WI7A 4KH0B 1AWWA 4Z88A 1WXUA 3V8LA 4ORZA 2MMPA 3KFVA 2LNVA 4ZN3A 2QA4A 2VWFA 3P8DA 3CCJT 1D3BA 1B3QA 2JUFA 1VQKT 4CI0C 3PFSA 1R8OB 2VB6A 3D7SB 1FWZA 2J7IA 3JCMJ 2J6FA 3CCVQ 3HFOA 2DO3A 1MGQA 1BIAA 2D8JA 2PVGB 5I2SA 1YHQA 5LJ3g 2COZA 4BD3A 4LDWA 2C0IA 2QQSA 3EH1A 5GANe 1M1KU 1QP3A 1B34B 1EZZB 4KT0E 2D1XA 3VUBA 5FWCA 1NJIR 3FRNA 5LJ3f 5GAOp 2F2XA 4C0FA 2X3XD 5GANd 1JO8A 4F7UB 1H3ZA 3G7ZA 3SHWA 3H41A 4DBQA 4RTVA 5J26A 3OYNA 2LQNA 5LJ5g 3QKJA 2RD1A 5KCHA 2CSQA 1OZ2A 2SRCA 4CC7A 2RHZA 2RQRA 3RR6A 4PKCC 3LGFA 1QLYA 1H92A 4X9DA 1YJWT 3OYDA 4LDYA 1YNZA 4VUBA 1QW1A 3RKWA 2BZYA 3FDRA 3REBB 4CC2A 2CZ0B 1OQKA 3H8ZA 5KYUB 2GGRA 4XTXA 1TWBA 4FCYA 2KMTA 3CCSQ 4KGVB 4MMLA 2R58A 3LGLA 4J9GA 5CKBA 2QQBA 4M75E 1M27C 1E6HA 2LRQA 2HQXA 4ANJA 1RI0A 1KD1R 3NTKA 4PFOA 4A4FA 2P84A 2DIQA 2DL5A 3M4YA 1Q7YC 1Q81U 2L0AA 3J80E 2EQUA 3OYFA 1N27A 5FRMA 2M0OA 3H9NA 1XOVA 4JUVA 2RO0A 3JSCA 4JLGA 2DVEA 3BFMA 2ED1A 1BU1A 1OEBA 2EJ9A 1D0ZA 3OYCA 1N8RR 4RUGA 4XTWA 2E6ZA 1X75C 1S72A 1ZSZA 2JTEA 3OYKA 3H6ZA 5FRNA 4B9XA 4HA8A 5CKHA 4ELZC 5AT1B 4XQ3A 4RCBA 1K9MC 4LUDA 3OYHA 5GAN3 1Q7YU 1KSWA 2QTXA 2D9TA 3M59A 2XICA 4A4HA 2OX7A 1XQHA 4LN2A 2HZYA 4AT1B 1G3TA 2XIDA 3I56A 3I55Q 2QEXT 3HKSA 2ECZA 2JOYA 3TEEA 1NG2A 2ZAEA 5GMKe 1VOMA 2COWA 3TQ7P 1YITA 2M0YA 3CCVA 5CIUA 1VA7A 1DJ7B 1JJ2P 2COYA 2FEIA 3EFRA 2RMOA 2YUOA 2DYBA 2DJZA 2RF0A 4X1VA 2DL4A 4C8QD 1AOJA 3VYHB 1YHQQ 3F70A 4M7AE 1VQ4Q 3BDUA 4OMNA 2QDLA 1BK2A 3GP8A 3SEMA 2WSCE 4OF1A 2FRYA 4F7UA 1PD0A 2PNIA 4F16A 3CMAT 2DD5A 1VQ9Q 3EGXB 3OB9A 5GAMe 2W10A 4DBFA 2CSIA 3OW2S 3OYAA 2DBKA 2PVOB 4M75A 5IHNA 2EYYA 2HSPA 1YIJQ 1VQPQ 3H0FA 3CBOA 2AZSA 4MZMA 2QEXA 2MYSA 4R55A 2VGNA 5GAN8 2X35A 2CP7A 3E19A 3OBYA 3JB9G 1AZEA 2FRWA 2AZVA 2KEAA 4M78C 1PKTA 3CC7Q 4E7JA 5CQXA 1KK7A 2J06A 1I81A 9ATCB 2LDMA 3EGDA 5CKFA 5CQYA 2PVDB 4D8KA 2K5IA 1NEBA 1NBEB 1K73U 1G5VA 4EMGA 3INZA 1WX6A 3GOXA 3ER0A 2XU8A 3JCMQ 2ZPFB 3EAEA 3VRYA 4J5YA 2LT4A 1MV3A 3EFSA 1WXBA 2E41A 1TG0A 4J7IA 3CCMA 3QWXX 4M78B 5LJ3j 4AFZC 1IZ6A 1KC8U 2K3BA 4OB3B 2CH4W 1ACMB 1NJIC 2R5AA 4HCZA 1TOVA 4FW1A 1V76A 2BKDN 4FYYB 1U3OA 4J9BA 2HL3A 2PUOB 2CZ6B 1M8MA 3CC4Q 2O4XA 3MEAA 1UECA 3X20B 4J9DA 1UGVA 5HK3A 1GCPA 1SKUB 5FU6B 1W1FA 3UPUA 2OAUA 1VQKQ 1YWPA 4M75D 3X25B 2VYTA 2DTIA 1I07A 1ZA1B 3LH0A 1YITQ 1VQNQ 2XG8D 1IO6A 1E7OA 2YRCA 2YXYA 4OP0A 4PNOA 1AEYA 1YJWQ 4E7IA 5GAMj 1MMAA 2FB7A 1ZX6A 1OPLA 2E4HA 1QVFP 5DM7R 2YLCA 4OB2B 1AT1B 2BIVA 1NPPA 4EMKC 2ZGWA 3RDVA 1JBMA 4DEXA 3S3OA 3DLMA 4KGZB 3UA6A 1GXIE 2ABLA 2OJ2A 2L2PA 5IH2A 1WIEA 4C5HA 5FU7B 3OYLA 4M7DE 2L5QA 3C4SA 1TTHB 5M9OA 4EMKB 1F1BB 4V2SA 3QIIA 2RNAA 3JB9D 2VXFA 2X4JA 2X4WA 2DM1A 3G4SQ 2YT6A 2XDBA 2LZ6B 5IXBA 5A0LA 4DQ2A 2LJ3A 1HJDA 2E6NA 1W2BP 2FZGB 2LCLA 5L8RE 3I56T 1Y71A 1TS9A 2HSEB 3OYMA 3NHNA 2NUTA 4OMFB 3RERA 2CT4A 5FU7C 5CKDA 4WF2A 3VJPA 3OMCA 1QWFA 2JTMA 4LXCA 4IIMA 2CZ1B 5IN1A 2EQIA 2DIGA 4JZ4A 3DLLA 3ZBDA 1H641 1X43A 1RACB 3WXMB 1VQ4A 4M7DF 1ZUKA 5D6YA 3JCMe 2ZPBB 2QA4T 1W2BS 2RQWA 3CCEQ 1Y07A 2W0ZA 1OX8A 3JB9H 3I55T 4GLMA 1K73C 1G3WA 2X9HA 3H0IA 1X01A 1PC0A 2DL3A 2BE7D 2VGMA 1VQ8T 2G6FX 4PJMA 4IUPA 3JB9I 2CUBA 2K2VA 2L3PA 3RUXA 4FT4A 4ZGEB 4F04B 3O5ZA 4NOYA 1VQ5T 3G6ET 1VQ9T 3NFCA 2Y4XA 1X6OA 5CVIA 5LJ3h 3JCMf 3RIRA 4QW2A 1VQKA 4Z89A 1T3LA 4PJOA 1X6GA 2RN8A 3RESA 3G6EA 1RAAB 3CCRA 1FX7A 5GAMd 1RAHB 1FXXA 5KE3A 4ESRA 4HVUA 3FJ5A 1BI1A 1VQNA 1D0YA 1RAEB 3RMSA 3PVLA 3OW2A 1YCYA 1K9AA 2DNUA 3S6WA 2CGHA 5GAOl 1UTIA 1OX9A 4M75F 1CKAA 3A98A 4RCCA 5FLXE 3MP6A 4KUDK 1QWEA 2EYZA 4HVWA 1TXQA 3M0TA 3CCRQ 4OGEA 1VQLT 3IQLA 1WPYA 4F7UF 3OYEA 3CMET 1VQ4T 5HK0A 2P0PA 2RK1A 2YUQA 3QDRB 4GY5A 4AG2C 3CCMT 1VYTA 2IVWA 2DL8A 3PGGA 4ZTJA 2AK5A 2O31A 4JZ3A 4C5IA 4C92C 1BI0A 2OTLA 1CKBA 1WHLA 3I5RA 4J9HA 3BDLA 8ATCB 1PNJA 2O2OA 4M77G 1YN8A 2DA9A 1GFDA 2DXCA 4FW2A 1X6BA 3CC2A 4PJOD 1AZGB 2L89A 3A8LB 2KI7A 2EQKA 3QJYA 2LT1A 3I55A 2ZZDA 4ZTFA 4M7AG 1M4ZA 3PT9A 1WJSA 2PQWA 2KNBB 4BY6B 1M1GA 4ZN1A 4QQGA 1K0XA 2EIFA 1D1CA 1UDLA 3HRTA 3CCET 2DKGA 3TSWA 2E1HA 1UGPB 2ZPEB 5CAIA 3UA7A 3BW1A 3RKXA 3L2WA 4J7FA 4QVDA 1UG1A 4PJNA 2J6KA 1YJNT 4IUQA 1RAGB 3OYBA 2QG9B 2CZ7B 2QGGA 2XK0A 1JJ2A 2DFUA 1SHGA 3MPUB 3UF4A 2NUPB 1JQQA 4OB1B 3VS5A 3VYGA 3G6EQ 3TCJA 3JCMg 4CC4B 2QI2A 3QZ5B 2CS7A 2EGEA 1IHWA 2KSSA 3QDFA 3CPFA 1WJQA 2CYZB 4GBQA 1QCFA 3A1PA 2DMOA 2K5LA 5LJ3e 2ENMA 3GNFB 2C0TA 1VQ6A 1UGQB 3JB9J 3EFOB 4BE1A 5CO7A 4NS5A 5IXFA 2CP2A 2JXBA 1YIJT 1VQPT 1I5OB 1LCKA 3CPWP 1C6VX 4RKUE 4DOVA 3G71Q 3M58A 2JTFA 2RI2A 4II1A 1M9SA 4E6RA 5KYXB 4ME7A 4C8QE 1KC8C 2JZ2A 1WXTA 3EH2A 5KYYA 1Q86C 5LJ5f 3LWIA 5LJ3d 1PSFA 1SEMA 4J6XA 3CCMQ 1GBRA 3QBYA 1AVZC 2RM4A 1JU5C 4PJOF 2EQJA 2EFIA 1RAFB 2FVUA 1TU0B 2E5KA 2HKNA 1QVPA 1D1AA 3CCQA 4OGCA 4Y28E 4HKEA 2JS2A 2QDYB 5I22A 2BE9B 2VKNA 2GFUA 2QA4Q 2O88A 2DETA 4LDVA 3O8VA 1SHFA 1GL5A 5LL6S 3JAME 1UHCA 4IUVA 2LQ8A 3LW5E 4M78G 4Z8AA 3SD4A 3P8BB 2RJEA 4M7DG 2ATCB 5GMKi 3OQ5A 3RKYA 1IREB 3CCQT 2E70A 3NTIA 4DOWA 1TUGB 1RL2A 1VQ6T 1OZ3A 3M57A 2F5KA 3M0SA 4M77B 2DJQA 1IRXA 1YP5A 1KQSP 2DEQA 2OTLQ 3HRUA 2F5TX 5CR2A 4BDYA 2K3XA 3EG1A 3CC7A 1R0CB 4IIOA 1ZHIA 2AHJB 5GAOn 1YHQT 1WHKA 5KE2A 2QTVA 3META 3PTAA 3SWNB 2E65A 2GBQA 1LOJA 2XI9A 1QVFA 1PKSA 4YTLA 2V1RA 3CCLT 1ZA2B 2D8HA 1Y0MA 2DTHA 3CQTA 1WLPB 4FT2A 1WGSA 2QK0A 1KFZA 1EFNA 2KY9A 4CC3A 4QQ6A 1VQMT 1SSHA 3OS2A 3JCMb 2IPOB 2CDTA 1N9RA 2MAMA 4JRIA 1ZSGA 4QKUA 1R77A 5LJ5j 2EJFA 2EKHA 4C8QA 3VS1A 1T0JA 3VS2A 1ZUUA 5GAN6 2GQVA 3EGDB 2GCXA 3CCEA 2HD0A 4HT9A 1Q82U 4C92A 3GPLA 2FL7A 1Z9ZA 2XD0A 1Q82R 2YLBA 2B86A 2JM9A 4DBHA 3CEYA 2RHUA 5KYYB 1UHFA 4FL6A 4L6V5 4RTUA 1VUBA 3CXCP 2MCNA 3H0HA 2AKKA 2X51A 1I8FA 2KT8A 2D6FA 2YDLA 2KE9A 4PLIA 2P0KA 1VQ8Q 1OOTA 2MI6A 4JDSA 3L2ZA 2K79A 3L1AA 4D6WA 2RA2A 4Q5WA 4M7AB 4C92G 1W4SA 2HL5C 1M1KR 1WHMA 4C92B 3CD6A 4C8QG 1M2OA 2MF2A 1K73R 3HP9A 2EWNA 2E3IA 2E5QA 1NLPC 2JN0A 4JRPA 1VQ7Q 4PJOE 2NUZA 3CBPA 4M78E 4Z02A 1K0SA 2MWPA 2AT1B 1RLQC 1NYFA 4KGXB 3TSZA 2EYWA 1VQ9A 4FYXB 2YRVA 1R0BG 4XTZA 2K6DA 2DD4A 2WSFE 2KDSA 3OYIA 2RHYA 1JXOA 3FIFA 4P5NA 3CCUQ 3OW2P 3CD6Q 2IIMA 2F2WA 4RTZA 2HDAA 3SWNA 5C6SA 3JRZA 3CCRT 2LX7A 3VUZA 1VQ7A 3FC3A 2I2LA 4F7UE 3M9QA 5GMKj 2DEUA 2E12A 3U23A 2WACA 2KYBA 3J7AF 5KYUA 4Y91A 1QKXA 1H8KA 2KRNA 1HD3A 4QT7A 3OY9A 2VUBA 3SB2A 2A0FB 4M7DA 4IUTA 2K2MA 3L2UA 1KQ2A 4XTYA 1KG1A 2P4TA 2O9VA 2WSEE 4MZPA 2HEQA 1M3BA 5DLQE 2ESWA 5GAN5 4E47A 1MHNA 2O9SA 2KQWA 1UUEA 2RQTA 4LD9K 4ZGJB 1Y57A 3M0PA 5GJVB 4O5VA 4PJJA 3DB3A 4C5GA 1OPKA 1Q95G 2E10A 2ED0A 3M53A 1V29B 1N9SA 2ZCFB 3OA6A 1CSKA 4EIKA 2O4XB 1H3HA 1OU8A 1QCNA 3RMQA 4JRQA 3QZ9B 5GAMf 5L23A 3P8HA 2VASA 4E7ZA 1WNLA 1VQ5Q 4C8QC 4AFUC 1GBQA 4C0GA 1MMDA 1FYNA 2JJ9A 2F2VA 4XU2A 3MO8A 3QSUA 3CCQQ 3JCMh 1Q81C 1QCOA 4NL2A 1QKWA 3FJPA 3MP8A 2J05A 3A8HB 5GANf 1VQ6Q 1Q86U 2FPEA 2R57A 3KUFA 2KGTA 5LJ5h 1Y96A 1I4K1 4M77F 4LE9A 1VIFA 4IKFA 5CCAA 1UB4A 2LTOA 3L2QA 1KHIA 5EG2A 2FO0A 1VQ7T 2XKOC 5GANj 4OB0B 1VQ5A 1M1FA 2DBMA 1Q86R 2GTJA 3J81E 3HTRA 3G4SA 4R0KA 2AIRB 1YI2A 4JJBA 1VYVA 2OTJQ 2RJFA 5GMKl 1VQ8A 3GNGA 1M2VA 4FYWB 3OSSC 4AFSC 1KD1C 3MCAB 5KYXA 5FW9A 2V8JA 1KQSS 3CXCA 4E7KA 1XNIA 4M78F 4XAXB 1JRIA 4BUGA 3LX7A 2LNHB 3PMTA 1VIEA 1FMKA 2J6OA 2E64A 4M7DC 5A2QE 2DILA 3C95A 3JCMP 1YITT 6AT1B 4HCBA 3JCMW 1MNEA 5HCKA 4LDUA 3MKDA 2QQRA 1M30A 3I35A 4BACA 2HAXA 1M8VA 2X4YA 5GAMh 1WQ7A 3N5BB 2F1LA 2EPDA 4FSSA 2Y90A 2I0NA 4M75B 4M77A 3CMAQ 4M7AD 4E7SA 1P92A 2RH2A 5I11A 1YWOA 2MOXA 1NEGA 3OYYA 1QVFS 1BI3A 1O75A 3V8JA 4M77D 2MIOA 5AYFA 4R56A 3ASKA 5HY6A 1JB0E 3G71A 1MMGA 1LNXA 3NMZC 4M75C 2FZCB 4J83A 3CBMA 3CMAA 2DVJA 1YJ9Q 1TUDA 4RTTA 1KQSA 4M77E 4TVRA 5KYWB 1U5SA 1YCSB 1MNDA 2XDDA 4M7DD 1K1ZA 4C8QF 2DZCA 2HBWA 3PVQA 2GFAA 1AD5A 2EVRA 4OMLA 4JJCA 2RJCA 1M90R 1YI2T 4LD6A 4JLIA 4MZTA 3HRSA 2JT4A 2KRSA 3EG9B 2EJGA 1WHGA 3CC7T 2OTJA 4M78D 3PIPA 3M5AA 4FSXA 3A8GB 3A8OB 1B7TA 3EG0A 4PJOG 4A53A 5FU6C 4HT8A 2OTJT 1OU9A 1UGRB 2X4XA 3I5SA 2ZPHB 2LQWA 5A0DA 3A5ZB 3CC2Q 4CRIA 3PIOA 1K4US 3DB4A 3CCUA 1ZBXA 3X28B 2FPDA 1MMNA 1FMWA
chains in the Genus database with same CATH topology
2GBQA 1WYXA 1U3OA 4J9BA 2CREA 2C0OA 1PKSA 1M8MA 2V1RA 3EG2A 2D8HA 3C0CA 2KT1A 1UECA 1Y0MA 2H8HA 4J9DA 1UGVA 3CQTA 1WLPB 1ABOA 1GCPA 2X3WD 1KFZA 1EFNA 1W1FA 4CC3A 2LJ0A 4D8DA 1SSHA 3I9QA 2PTKA 1X2KA 1YWPA 3M0QA 1I07A 2CDTA 1IO6A 1E7OA 2LP5A 1ZSGA 2A37A 1AEYA 2EKHA 2DE0X 1KIKA 1NM7A 2KYMA 4HCKA 3VS1A 1T0JA 3VS2A 1ZUUA 1A0NB 1ZX6A 4LNPA 1X27A 2EBPA 1OPLA 1WA7A 2KROA 3VS0A 1Z9ZA 1PHTA 1T3SA 1G2BA 4RTXA 2B86A 2DL7A 1MV0B 4DEXA 2JM9A 3UA6A 2ABLA 1I0CA 2OJ2A 1UHFA 3NGPA 2L2PA 4RTUA 5IH2A 1WIEA 3M0RA 2BZXA 2P4RA 2DLPA 2YUPA 1K76A 4LUEA 4KRTA 4RTWA 2MCNA 3H0HA 2VVKA 2AKKA 3NPFA 3THKA 2RQUA 2KT8A 2RNAA 2YDLA 1WFWA 2KE9A 2DM1A 2YT6A 4RTYA 2LZ6B 5GJWB 5IXBA 1OOTA 2KR3A 2DRMA 2K9GA 2LJ3A 1HJDA 2K79A 2JMAA 2LJ1A 3NHNA 2DRKA 1GRIA 2CT4A 4OMPA 1TUCA 1GFCA 4J9EA 1QWFA 4IIMA 2EQIA 4JZ4A 1KJWA 1E6GA 2AKLA 1NLPC 2LMJA 1X43A 5EC7A 2NUZA 1GCQA 2ROLA 2YUNA 1K0SA 1ZUKA 3VS7A 2RQWA 1OV3A 2W0ZA 1M3AA 1RLQC 1NYFA 1G83A 4GLMA 3VS4A 4F17A 3TSZA 1ABQA 2EYWA 2NWMA 2SEMA 3H0IA 3PE0A 2DL3A 2K6DA 2D0NA 2PZ1A 2G6FX 3EHRA 2BZ8A 4HXJA 4OMQA 1AWJA 1U06A 2CUBA 1JXOA 2L3PA 2KXCA 1JEGA 1M3CA 1WDXA 2CT3A 2A28A 2IIMA 2F2WA 3O5ZA 2HDAA 3QWYA 4RTZA 1J3TA 1NLOC 3EHQA 2CH4A 4J9IA 2LX7A 3ZL7C 1Z9QA 3EGUA 4Z89A 3UATA 1T3LA 1SRMA 2EW3A 3U23A 1HSQA 2KYBA 1X6GA 2RN8A 2RPNA 2KXDA 3R6NA 4JJDA 3VS3A 3VRZA 1QKXA 2KRMA 2JS0A 1H8KA 4ESRA 1ARKA 5IHKA 1BB9A 4HVUA 4K11A 1UFFA 1AWOA 2KRNA 3FJ5A 1HD3A 4QT7A 3RBBB 4A63B 2FG0A 4AG1C 1X2QA 3PVLA 1MUZA 1K9AA 1WI7A 2DNUA 2K2MA 1SPKA 2L3SA 1AWWA 4Z88A 1WXUA 1UTIA 2JM8A 2O9VA 2HEQA 4ORZA 1CKAA 3A98A 1M3BA 2OI3A 3KFVA 3REAB 2VWFA 2ESWA 1QWEA 2EYZA 1B07A 1B3QA 4HVWA 2EGCA 2O9SA 1UUEA 3M0TA 2RQTA 3IQLA 1Y57A 2J7IA 3M0PA 2J6FA 5GJVB 2YUQA 2LCSA 2D8JA 4AG2C 1OPKA 1VYTA 2C0IA 2K7AA 2ED0A 1VYUA 4OMMA 2DL8A 1CSKA 4EIKA 4DEYA 1H3HA 2D1XA 2AK5A 2O31A 5FWCA 4JZ3A 3ULRB 2F2XA 2X3XD 1JO8A 1CKBA 4J9FA 3SHWA 3H41A 3I5RA 4RTVA 2FPFA 5L23A 2LQNA 4J9HA 1PNJA 1RLPC 2O2OA 2CSQA 2SRCA 4CC7A 3LH5A 4AFUC 1GBQA 1UJ0A 2RQRA 1YN8A 1QLYA 1FYNA 1JXMA 2DA9A 2F2VA 4J9CA 1GFDA 1H92A 1X6BA 1YNZA 2BZYA 3REBB 4CC2A 1AZGB 1V1CA 4HVVA 1QKWA 1AWXA 2J05A 2FPEA 1NYGA 2KGTA 2GGRA 2V1QA 2L3QA 2KNBB 4LE9A 1K0XA 1X69A 1UDLA 1ZUYA 1S1NA 2FO0A 4J9GA 2ROTA 1I1JA 2KBTA 2GTOA 4OMOA 3TVTA 2DBMA 1M27C 1E6HA 2GTJA 3TSWA 3UA7A 4R0KA 1T0HA 2DL5A 2L0AA 4JJBA 1VYVA 1UG1A 4JPBW 2J6KA 2HCKA 1XOVA 2ED1A 4Y92A 1BU1A 1OEBA 4AFSC 1PRLC 4RUGA 1SHGA 5FW9A 3UF4A 2A08A 1JQQA 3VS5A 2JTEA 4CC4B 4WCIA 2YSQA 2EGEA 2LNHB 1GCQC 1FMKA 2DX1A 2JW4A 1RI9A 4M4ZA 2J6OA 4LUDA 4GBQA 1QCFA 1KSWA 2DILA 2DMOA 2ENMA 2BTTA 4LN2A 5HCKA 1W70A 1ZLMA 2C0TA 1N5ZA 2ECZA 1M30A 3I35A 1NG2A 2M0YA 2EYXA 5IXFA 2JXBA 5ECAA 2EPDA 4FSSA 1LCKA 1VA7A 2FEIA 1PRMC 2RMOA 2YUOA 2DYBA 2OAWA 2RF0A 3GBQA 2I0NA 3EG3A 4X1VA 2DL4A 1AOJA 4E6RA 2GQIA 3JV3A 1WXTA 5I11A 2JMCA 1YWOA 5IHIA 2MOXA 4OMNA 1UJYA 2QDLA 1BK2A 1NEGA 1SEMA 3SEMA 1ZBJA 2FRYA 1GBRA 1AVZC 2M51A 1JU5C 2PNIA 4F16A 2E5KA 2MIOA 3RNJA 3VS6A 1W6XA 1UE9A 2W10A 2CSIA 2DBKA 2JS2A 3NMZC 4AFQC 5IHNA 2EYYA 2HSPA 5I22A 3M0UA 3H0FA 1SRLA 2VKNA 2O88A 2AZSA 2DVJA 1TUDA 4RTTA 1SHFA 1U5SA 1YCSB 1GL5A 1UHCA 1AZEA 2FRWA 2AZVA 5FWBA 2KEAA 1K1ZA 2HBWA 3PVQA 1AD5A 1PKTA 2CUDA 2EVRA 4OMLA 4Z8AA 1RUWA 4JJCA 2J06A 1BBZA 4D8KA 4F14A 2XMFA 2EGAA 2JT4A 1NEBA 2KRSA 1PWTA 2GNCA 1WX6A 2RQVA 3M0SA 2DJQA 1YP5A 4ZNXA 3VRYA 3EG0A 1MV3A 3EG1A 1WXBA 4IIOA 3I5SA 1TG0A 2LQWA 3QWXX 4AFZC 2DF6A 2K3BA 1K4US 2CH4W 2FPDA 2A36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBQ A;  1WYX A;  1U3O A;  4J9B A;  2CRE A;  2C0O A;  1PKS A;  1M8M A;  2V1R A;  3EG2 A;  2D8H A;  3C0C A;  2KT1 A;  1UEC A;  1Y0M A;  2H8H A;  4J9D A;  1UGV A;  3CQT A;  1WLP B;  1ABO A;  1GCP A;  2X3W D;  1KFZ A;  1EFN A;  1W1F A;  4CC3 A;  2LJ0 A;  4D8D A;  1SSH A;  3I9Q A;  2PTK A;  1X2K A;  1YWP A;  3M0Q A;  1I07 A;  2CDT A;  1IO6 A;  1E7O A;  2LP5 A;  1ZSG A;  2A37 A;  1AEY A;  2EKH A;  2DE0 X;  1KIK A;  1NM7 A;  2KYM A;  4HCK A;  3VS1 A;  1T0J A;  3VS2 A;  1ZUU A;  1A0N B;  1ZX6 A;  4LNP A;  1X27 A;  2EBP A;  1OPL A;  1WA7 A;  2KRO A;  3VS0 A;  1Z9Z A;  1PHT A;  1T3S A;  1G2B A;  4RTX A;  2B86 A;  2DL7 A;  1MV0 B;  4DEX A;  2JM9 A;  3UA6 A;  2ABL A;  1I0C A;  2OJ2 A;  1UHF A;  3NGP A;  2L2P A;  4RTU A;  5IH2 A;  1WIE A;  3M0R A;  2BZX A;  2P4R A;  2DLP A;  2YUP A;  1K76 A;  4LUE A;  4KRT A;  4RTW A;  2MCN A;  3H0H A;  2VVK A;  2AKK A;  3NPF A;  3THK A;  2RQU A;  2KT8 A;  2RNA A;  2YDL A;  1WFW A;  2KE9 A;  2DM1 A;  2YT6 A;  4RTY A;  2LZ6 B;  5GJW B;  5IXB A;  1OOT A;  2KR3 A;  2DRM A;  2K9G A;  2LJ3 A;  1HJD A;  2K79 A;  2JMA A;  2LJ1 A;  3NHN A;  2DRK A;  1GRI A;  2CT4 A;  4OMP A;  1TUC A;  1GFC A;  4J9E A;  1QWF A;  4IIM A;  2EQI A;  4JZ4 A;  1KJW A;  1E6G A;  2AKL A;  1NLP C;  2LMJ A;  1X43 A;  5EC7 A;  2NUZ A;  1GCQ A;  2ROL A;  2YUN A;  1K0S A;  1ZUK A;  3VS7 A;  2RQW A;  1OV3 A;  2W0Z A;  1M3A A;  1RLQ C;  1NYF A;  1G83 A;  4GLM A;  3VS4 A;  4F17 A;  3TSZ A;  1ABQ A;  2EYW A;  2NWM A;  2SEM A;  3H0I A;  3PE0 A;  2DL3 A;  2K6D A;  2D0N A;  2PZ1 A;  2G6F X;  3EHR A;  2BZ8 A;  4HXJ A;  4OMQ A;  1AWJ A;  1U06 A;  2CUB A;  1JXO A;  2L3P A;  2KXC A;  1JEG A;  1M3C A;  1WDX A;  2CT3 A;  2A28 A;  2IIM A;  2F2W A;  3O5Z A;  2HDA A;  3QWY A;  4RTZ A;  1J3T A;  1NLO C;  3EHQ A;  2CH4 A;  4J9I A;  2LX7 A;  3ZL7 C;  1Z9Q A;  3EGU A;  4Z89 A;  3UAT A;  1T3L A;  1SRM A;  2EW3 A;  3U23 A;  1HSQ A;  2KYB A;  1X6G A;  2RN8 A;  2RPN A;  2KXD A;  3R6N A;  4JJD A;  3VS3 A;  3VRZ A;  1QKX A;  2KRM A;  2JS0 A;  1H8K A;  4ESR A;  1ARK A;  5IHK A;  1BB9 A;  4HVU A;  4K11 A;  1UFF A;  1AWO A;  2KRN A;  3FJ5 A;  1HD3 A;  4QT7 A;  3RBB B;  4A63 B;  2FG0 A;  4AG1 C;  1X2Q A;  3PVL A;  1MUZ A;  1K9A A;  1WI7 A;  2DNU A;  2K2M A;  1SPK A;  2L3S A;  1AWW A;  4Z88 A;  1WXU A;  1UTI A;  2JM8 A;  2O9V A;  2HEQ A;  4ORZ A;  1CKA A;  3A98 A;  1M3B A;  2OI3 A;  3KFV A;  3REA B;  2VWF A;  2ESW A;  1QWE A;  2EYZ A;  1B07 A;  1B3Q A;  4HVW A;  2EGC A;  2O9S A;  1UUE A;  3M0T A;  2RQT A;  3IQL A;  1Y57 A;  2J7I A;  3M0P A;  2J6F A;  5GJV B;  2YUQ A;  2LCS A;  2D8J A;  4AG2 C;  1OPK A;  1VYT A;  2C0I A;  2K7A A;  2ED0 A;  1VYU A;  4OMM A;  2DL8 A;  1CSK A;  4EIK A;  4DEY A;  1H3H A;  2D1X A;  2AK5 A;  2O31 A;  5FWC A;  4JZ3 A;  3ULR B;  2F2X A;  2X3X D;  1JO8 A;  1CKB A;  4J9F A;  3SHW A;  3H41 A;  3I5R A;  4RTV A;  2FPF A;  5L23 A;  2LQN A;  4J9H A;  1PNJ A;  1RLP C;  2O2O A;  2CSQ A;  2SRC A;  4CC7 A;  3LH5 A;  4AFU C;  1GBQ A;  1UJ0 A;  2RQR A;  1YN8 A;  1QLY A;  1FYN A;  1JXM A;  2DA9 A;  2F2V A;  4J9C A;  1GFD A;  1H92 A;  1X6B A;  1YNZ A;  2BZY A;  3REB B;  4CC2 A;  1AZG B;  1V1C A;  4HVV A;  1QKW A;  1AWX A;  2J05 A;  2FPE A;  1NYG A;  2KGT A;  2GGR A;  2V1Q A;  2L3Q A;  2KNB B;  4LE9 A;  1K0X A;  1X69 A;  1UDL A;  1ZUY A;  1S1N A;  2FO0 A;  4J9G A;  2ROT A;  1I1J A;  2KBT A;  2GTO A;  4OMO A;  3TVT A;  2DBM A;  1M27 C;  1E6H A;  2GTJ A;  3TSW A;  3UA7 A;  4R0K A;  1T0H A;  2DL5 A;  2L0A A;  4JJB A;  1VYV A;  1UG1 A;  4JPB W;  2J6K A;  2HCK A;  1XOV A;  2ED1 A;  4Y92 A;  1BU1 A;  1OEB A;  4AFS C;  1PRL C;  4RUG A;  1SHG A;  5FW9 A;  3UF4 A;  2A08 A;  1JQQ A;  3VS5 A;  2JTE A;  4CC4 B;  4WCI A;  2YSQ A;  2EGE A;  2LNH B;  1GCQ C;  1FMK A;  2DX1 A;  2JW4 A;  1RI9 A;  4M4Z A;  2J6O A;  4LUD A;  4GBQ A;  1QCF A;  1KSW A;  2DIL A;  2DMO A;  2ENM A;  2BTT A;  4LN2 A;  5HCK A;  1W70 A;  1ZLM A;  2C0T A;  1N5Z A;  2ECZ A;  1M30 A;  3I35 A;  1NG2 A;  2M0Y A;  2EYX A;  5IXF A;  2JXB A;  5ECA A;  2EPD A;  4FSS A;  1LCK A;  1VA7 A;  2FEI A;  1PRM C;  2RMO A;  2YUO A;  2DYB A;  2OAW A;  2RF0 A;  3GBQ A;  2I0N A;  3EG3 A;  4X1V A;  2DL4 A;  1AOJ A;  4E6R A;  2GQI A;  3JV3 A;  1WXT A;  5I11 A;  2JMC A;  1YWO A;  5IHI A;  2MOX A;  4OMN A;  1UJY A;  2QDL A;  1BK2 A;  1NEG A;  1SEM A;  3SEM A;  1ZBJ A;  2FRY A;  1GBR A;  1AVZ C;  2M51 A;  1JU5 C;  2PNI A;  4F16 A;  2E5K A;  2MIO A;  3RNJ A;  3VS6 A;  1W6X A;  1UE9 A;  2W10 A;  2CSI A;  2DBK A;  2JS2 A;  3NMZ C;  4AFQ C;  5IHN A;  2EYY A;  2HSP A;  5I22 A;  3M0U A;  3H0F A;  1SRL A;  2VKN A;  2O88 A;  2AZS A;  2DVJ A;  1TUD A;  4RTT A;  1SHF A;  1U5S A;  1YCS B;  1GL5 A;  1UHC A;  1AZE A;  2FRW A;  2AZV A;  5FWB A;  2KEA A;  1K1Z A;  2HBW A;  3PVQ A;  1AD5 A;  1PKT A;  2CUD A;  2EVR A;  4OML A;  4Z8A A;  1RUW A;  4JJC A;  2J06 A;  1BBZ A;  4D8K A;  4F14 A;  2XMF A;  2EGA A;  2JT4 A;  1NEB A;  2KRS A;  1PWT A;  2GNC A;  1WX6 A;  2RQV A;  3M0S A;  2DJQ A;  1YP5 A;  4ZNX A;  3VRY A;  3EG0 A;  1MV3 A;  3EG1 A;  1WXB A;  4IIO A;  3I5S A;  1TG0 A;  2LQW A;  3QWX X;  4AFZ C;  2DF6 A;  2K3B A;  1K4U S;  2CH4 W;  2FPD A;  2A36 A; 
#chains in the Genus database with same CATH topology
 2CKK A;  1WYX A;  4RG8 A;  3URG A;  2LC4 A;  1RAD B;  2CRE A;  3EGX A;  1B34 A;  3EG2 A;  3C0C A;  3V7S A;  2EYQ A;  1FMV A;  1ABO A;  5D6X A;  2X3W D;  1X2K A;  4UC4 A;  4M7A C;  2RI3 A;  4OVA A;  1QVG A;  2B8A A;  2LQK A;  4BI8 B;  2A7Y A;  1JJ2 S;  1KIK A;  5GMK h;  1NM7 A;  1LVK A;  4PLL A;  1PG5 B;  1K9M U;  3MP1 A;  2ZPI B;  2H3J A;  1X27 A;  2EBP A;  1WA7 A;  3M55 A;  1EIF A;  3VS0 A;  4C92 D;  1PHT A;  1I5L A;  4RTX A;  3QUI A;  2DL7 A;  1MV0 B;  4J6W A;  4JRK A;  4IUU A;  5I2M A;  2RJD A;  1WHH A;  3CC2 T;  4WTO B;  2BZX A;  2P4R A;  1IHV A;  2YHT A;  2XDP A;  3UT1 A;  1K76 A;  3OMG A;  4RTW A;  4M78 A;  1YFN A;  1PD1 A;  2QAZ A;  3DKM A;  5HKC A;  1WFW A;  2OTL T;  3QO3 A;  4BB7 A;  5IAY A;  3ZFJ A;  3OYJ A;  5GJW B;  3WVE B;  3HFN A;  4E2F B;  2KR3 A;  2DRM A;  4L59 A;  4RG2 A;  3M56 A;  2JMA A;  1YJ9 A;  3HPW A;  3QG1 A;  2H3E B;  2YWW A;  3G4S T;  1GRI A;  3FEO A;  3MJX A;  4OMP A;  1VQN T;  1GFC A;  1S72 Q;  1M90 C;  2LX9 A;  3V7R A;  2V8K A;  4X34 A;  1HK9 A;  1KJW A;  1RAI B;  2AKL A;  2NUT B;  1VQO Q;  3TU4 K;  2LMJ A;  3ZEH A;  2PU9 B;  1G3S A;  5EC7 A;  1K8A U;  1GCQ A;  2ROL A;  2V26 A;  2YUN A;  3Q1J A;  4PFZ A;  2NYS A;  2EKO A;  1G83 A;  4AMC A;  3VS4 A;  1QVG S;  4F17 A;  3V7C A;  2DXT A;  2QGF B;  1IGQ A;  4PK4 A;  2D0N A;  2PZ1 A;  1U06 A;  1D0X A;  1UEB A;  2MK5 A;  4E7L A;  3AHU A;  1EX4 A;  2KXC A;  1JEG A;  1M3C A;  4ATO A;  4JS4 A;  1AHJ B;  2A28 A;  3QWY A;  3CD6 T;  1NLO C;  4MDW A;  3EHQ A;  2CH4 A;  4J9I A;  2VXE A;  3ZL7 C;  1Z9Q A;  3EGU A;  1M90 U;  1TH7 A;  3L2V A;  4FIB A;  2NUP A;  2FHD A;  1HSQ A;  5A0G A;  2RPN A;  4N0A A;  3R6N A;  4PFP A;  2CP0 A;  2KRM A;  4C8Q B;  4EMK A;  1ARK A;  4K11 A;  2DZ9 A;  1HYO A;  4C0Z A;  3RBB B;  4A63 B;  3LLR A;  2DYI A;  2DXU A;  2F69 A;  2DAQ A;  2K3Y A;  3JCM d;  1MUZ A;  2K4Y A;  3X24 B;  5KYN A;  1D3B B;  4MMK A;  1SPK A;  2L3S A;  1VQL Q;  4FYV B;  2JM8 A;  2L8D A;  1YJ9 T;  1BKB A;  1BI2 A;  2OI3 A;  2O01 E;  2LVM A;  1TSF A;  5CK9 A;  3REA B;  2KVQ G;  5KH6 A;  1B07 A;  2QEX Q;  2EGC A;  1C0M A;  2DXB A;  1UGS B;  3ME9 A;  4ELY C;  2V8I A;  4M75 G;  1D09 B;  2LCS A;  1YI2 Q;  4C92 E;  5GAN 7;  3CXC S;  1K9M R;  2Y4Y A;  1XJW B;  1NZ9 A;  2K7A A;  2RB6 A;  1VYU A;  4OMM A;  4NL3 A;  1VQL A;  3NTH A;  5IT9 E;  4DEY A;  4M7A A;  4F7U G;  1M1K C;  1BYM A;  3ULR B;  5KCO A;  4J9F A;  4PJO B;  2FPF A;  4ZGD B;  5GAN 2;  3KXT A;  2RI5 A;  1RLP C;  3LH5 A;  3M54 A;  1UJ0 A;  2EAY A;  1JXM A;  2CP6 A;  4J9C A;  3QXE B;  7AT1 B;  3JCM X;  5GAO q;  4DBR A;  2NLU A;  3E1S A;  3GLX A;  3MEW A;  1IXD A;  1V1C A;  4IUR A;  4HVV A;  2KAF A;  1OUL A;  1AWX A;  1VQO A;  4BDZ A;  1O9S A;  3BY7 A;  1NYG A;  3FB9 A;  1SSF A;  2K5F A;  2V1Q A;  2L3Q A;  2M1H A;  4XK8 E;  1WHJ A;  1QVG P;  1X69 A;  1ZUY A;  1S1N A;  4PJO C;  1LJO A;  2ROT A;  1I1J A;  2KBT A;  2GTO A;  4OMO A;  3TVT A;  4C0D C;  3CCU T;  4QVC A;  2LCC A;  1RAB B;  3VKI A;  3C94 A;  1OI1 A;  2MPX C;  1K8A R;  4XU3 A;  1T0H A;  5C0M A;  2DTO A;  4J8O A;  2QXF A;  5GAN 4;  1VQM A;  4JPB W;  2HCK A;  4C0D B;  2EQM A;  2P0Q A;  3QYH B;  2HKQ B;  4Y92 A;  1PRL C;  4BY6 C;  2A08 A;  4WCI A;  2YSQ A;  3AT1 B;  3CPW A;  4KUI A;  1GCQ C;  2DPP B;  2DX1 A;  2JW4 A;  2VC8 A;  1RI9 A;  4M4Z A;  2HMA A;  3A8M B;  5D6W A;  2BTT A;  3QHS A;  2FYK A;  3CCL Q;  1W70 A;  1ZLM A;  4KH1 B;  1N5Z A;  3X26 B;  4KUL A;  2C06 A;  4KBM B;  2EYX A;  3HHT B;  5ECA A;  2IG0 A;  5FRO A;  3SFM A;  1BCO A;  2QAS A;  4N4H A;  3V8K A;  2M16 A;  3S3M A;  2D0Q B;  3EG9 A;  4A4E A;  1PRM C;  5DLO A;  4XU0 A;  2OAW A;  3GBQ A;  2HNI A;  4RMO A;  3EG3 A;  3CCS T;  3SWN C;  2GQI A;  4C5E A;  3JV3 A;  4BI3 A;  5GAM g;  1VQP A;  1YIJ A;  3CCV T;  2JMC A;  1PM3 A;  1G3Y A;  5IHI A;  3CME Q;  3CCL A;  4N4G A;  1UJY A;  4DA4 A;  4A4G A;  3CCJ Q;  3QYG B;  1ZBJ A;  1NPR A;  2M51 A;  3G1J A;  2HQH A;  2QQA A;  3RNJ A;  3VS6 A;  1IB8 A;  4MDX A;  4JS5 A;  1W6X A;  1UE9 A;  2JVV A;  2RHX A;  4LDX A;  4AFQ C;  1NE8 A;  3E9G A;  1N6A A;  5LJ5 d;  4GLK A;  3GF5 A;  4FU6 A;  3M0U A;  1SRL A;  2JNG A;  1Y7X A;  4B9W A;  1M2V B;  3OBW A;  5GAO r;  3UWN A;  3KBG A;  4EPC A;  3JCM c;  3SDZ A;  1K8A C;  3OYG A;  2GF7 A;  3CPW S;  3CCS A;  1U8R A;  3I56 Q;  4B6M A;  5FWB A;  4M7A F;  1W2B A;  1BIB A;  4A54 A;  2CUD A;  1YJN A;  4EMH A;  1RUW A;  1BBZ A;  1WZO A;  2CP3 A;  4HCC A;  3OS1 A;  3MEV A;  3E2U A;  4F14 A;  2XMF A;  2EGA A;  1PCX A;  1KQ1 A;  1N8R C;  4EDU A;  4PL6 A;  1PWT A;  4XTU A;  3PMI A;  2GNC A;  1KD1 U;  1SF9 A;  5GMK m;  1YBY A;  2RQV A;  1ZQ1 A;  3WVD B;  4ZNX A;  3T9N A;  3OS0 A;  3R6O A;  1WQW A;  3OSV A;  4E7H A;  1YJN Q;  2DF6 A;  3QPH A;  5CKE A;  1ZSZ B;  3VV0 A;  4J6Y A;  2M9U A;  2BUD A;  2A36 A;  3VU3 C;  1YJW A;  1QQJ A;  2KK4 A;  2HQE A;  5GAN h;  2C0O A;  2RK2 A;  4PJL A;  1S72 T;  1XTD A;  2KT1 A;  1OYX A;  4BE2 A;  2H8H A;  3E9F A;  3JB9 F;  3HL8 A;  3UDC A;  2DK3 A;  1VQO T;  1N8R U;  2LJ0 A;  2Z0W A;  2G3R A;  4D8D A;  3I9Q A;  3S3N A;  2PTK A;  3M0Q A;  8AT1 B;  2LP5 A;  1SG5 A;  4C92 F;  1LPL A;  2A37 A;  3FLG A;  2QYZ A;  2DE0 X;  2KYM A;  4HCK A;  3G71 T;  1Q81 R;  1VQM Q;  1A0N B;  4LNP A;  3CME A;  2HBP A;  1QP2 A;  1IGU A;  2YRD A;  5DY9 A;  2KRO A;  2DER A;  5I21 A;  4A4K A;  1T3S A;  1G2B A;  1ZSZ C;  4JJN K;  1BCM A;  1KHC A;  3QJ6 A;  1I0C A;  3NGP A;  5J3B A;  3MEU A;  1M5Q 1;  3M0R A;  1Q82 C;  2DLP A;  2YUP A;  4LUE A;  4KRT A;  4N4I A;  5GAN g;  2VVK A;  2L3R A;  5J39 A;  3NPF A;  3THK A;  2RQU A;  1Q7Y R;  1PSE A;  5KYW A;  1HXD A;  2PUK B;  4RTY A;  2K9G A;  1QMC A;  4QVZ A;  4N0A C;  2LJ1 A;  3MHX A;  4BE0 A;  1NJI U;  3TRE A;  2ZPG B;  2DRK A;  1U1S A;  2VV5 A;  3CC4 T;  5GAO m;  1TUC A;  5LJ5 e;  4J9E A;  3HSB A;  2QQ9 A;  4O6J A;  1E6G A;  4L5G A;  1Y96 B;  4XTV A;  2CP5 A;  3VS7 A;  4BI4 A;  3C12 A;  2RHI A;  1OV3 A;  3M4G A;  1M3A A;  3GIB A;  2M02 A;  3JCM V;  2MWO A;  1WJR A;  3CCJ A;  3EFO A;  1ABQ A;  2K57 A;  1D1B A;  4FM4 B;  2NWM A;  2SEM A;  3PE0 A;  2E3H A;  3EHR A;  2BZ8 A;  4HXJ A;  4OMQ A;  3LWH A;  1C1A A;  1U1T A;  1AWJ A;  3LYI A;  3PNW C;  1WDX A;  2CT3 A;  4M7D B;  4XU1 A;  2A3L A;  3L2R A;  1G8X A;  4QQD A;  1J3T A;  1KC8 R;  5D7U A;  3CC4 A;  3BE3 A;  3UAT A;  1SRM A;  2EW3 A;  2R5M A;  3OS5 A;  2KXD A;  4JJD A;  2FZK B;  3VS3 A;  3L42 A;  3VRZ A;  2XHC A;  4X9C A;  2JS0 A;  5IHK A;  1BB9 A;  1UFF A;  4M77 C;  1AWO A;  2FG0 A;  4AG1 C;  1X2Q A;  1WI7 A;  4KH0 B;  1AWW A;  4Z88 A;  1WXU A;  3V8L A;  4ORZ A;  2MMP A;  3KFV A;  2LNV A;  4ZN3 A;  2QA4 A;  2VWF A;  3P8D A;  3CCJ T;  1D3B A;  1B3Q A;  2JUF A;  1VQK T;  4CI0 C;  3PFS A;  1R8O B;  2VB6 A;  3D7S B;  1FWZ A;  2J7I A;  3JCM J;  2J6F A;  3CCV Q;  3HFO A;  2DO3 A;  1MGQ A;  1BIA A;  2D8J A;  2PVG B;  5I2S A;  1YHQ A;  5LJ3 g;  2COZ A;  4BD3 A;  4LDW A;  2C0I A;  2QQS A;  3EH1 A;  5GAN e;  1M1K U;  1QP3 A;  1B34 B;  1EZZ B;  4KT0 E;  2D1X A;  3VUB A;  5FWC A;  1NJI R;  3FRN A;  5LJ3 f;  5GAO p;  2F2X A;  4C0F A;  2X3X D;  5GAN d;  1JO8 A;  4F7U B;  1H3Z A;  3G7Z A;  3SHW A;  3H41 A;  4DBQ A;  4RTV A;  5J26 A;  3OYN A;  2LQN A;  5LJ5 g;  3QKJ A;  2RD1 A;  5KCH A;  2CSQ A;  1OZ2 A;  2SRC A;  4CC7 A;  2RHZ A;  2RQR A;  3RR6 A;  4PKC C;  3LGF A;  1QLY A;  1H92 A;  4X9D A;  1YJW T;  3OYD A;  4LDY A;  1YNZ A;  4VUB A;  1QW1 A;  3RKW A;  2BZY A;  3FDR A;  3REB B;  4CC2 A;  2CZ0 B;  1OQK A;  3H8Z A;  5KYU B;  2GGR A;  4XTX A;  1TWB A;  4FCY A;  2KMT A;  3CCS Q;  4KGV B;  4MML A;  2R58 A;  3LGL A;  4J9G A;  5CKB A;  2QQB A;  4M75 E;  1M27 C;  1E6H A;  2LRQ A;  2HQX A;  4ANJ A;  1RI0 A;  1KD1 R;  3NTK A;  4PFO A;  4A4F A;  2P84 A;  2DIQ A;  2DL5 A;  3M4Y A;  1Q7Y C;  1Q81 U;  2L0A A;  3J80 E;  2EQU A;  3OYF A;  1N27 A;  5FRM A;  2M0O A;  3H9N A;  1XOV A;  4JUV A;  2RO0 A;  3JSC A;  4JLG A;  2DVE A;  3BFM A;  2ED1 A;  1BU1 A;  1OEB A;  2EJ9 A;  1D0Z A;  3OYC A;  1N8R R;  4RUG A;  4XTW A;  2E6Z A;  1X75 C;  1S72 A;  1ZSZ A;  2JTE A;  3OYK A;  3H6Z A;  5FRN A;  4B9X A;  4HA8 A;  5CKH A;  4ELZ C;  5AT1 B;  4XQ3 A;  4RCB A;  1K9M C;  4LUD A;  3OYH A;  5GAN 3;  1Q7Y U;  1KSW A;  2QTX A;  2D9T A;  3M59 A;  2XIC A;  4A4H A;  2OX7 A;  1XQH A;  4LN2 A;  2HZY A;  4AT1 B;  1G3T A;  2XID A;  3I56 A;  3I55 Q;  2QEX T;  3HKS A;  2ECZ A;  2JOY A;  3TEE A;  1NG2 A;  2ZAE A;  5GMK e;  1VOM A;  2COW A;  3TQ7 P;  1YIT A;  2M0Y A;  3CCV A;  5CIU A;  1VA7 A;  1DJ7 B;  1JJ2 P;  2COY A;  2FEI A;  3EFR A;  2RMO A;  2YUO A;  2DYB A;  2DJZ A;  2RF0 A;  4X1V A;  2DL4 A;  4C8Q D;  1AOJ A;  3VYH B;  1YHQ Q;  3F70 A;  4M7A E;  1VQ4 Q;  3BDU A;  4OMN A;  2QDL A;  1BK2 A;  3GP8 A;  3SEM A;  2WSC E;  4OF1 A;  2FRY A;  4F7U A;  1PD0 A;  2PNI A;  4F16 A;  3CMA T;  2DD5 A;  1VQ9 Q;  3EGX B;  3OB9 A;  5GAM e;  2W10 A;  4DBF A;  2CSI A;  3OW2 S;  3OYA A;  2DBK A;  2PVO B;  4M75 A;  5IHN A;  2EYY A;  2HSP A;  1YIJ Q;  1VQP Q;  3H0F A;  3CBO A;  2AZS A;  4MZM A;  2QEX A;  2MYS A;  4R55 A;  2VGN A;  5GAN 8;  2X35 A;  2CP7 A;  3E19 A;  3OBY A;  3JB9 G;  1AZE A;  2FRW A;  2AZV A;  2KEA A;  4M78 C;  1PKT A;  3CC7 Q;  4E7J A;  5CQX A;  1KK7 A;  2J06 A;  1I81 A;  9ATC B;  2LDM A;  3EGD A;  5CKF A;  5CQY A;  2PVD B;  4D8K A;  2K5I A;  1NEB A;  1NBE B;  1K73 U;  1G5V A;  4EMG A;  3INZ A;  1WX6 A;  3GOX A;  3ER0 A;  2XU8 A;  3JCM Q;  2ZPF B;  3EAE A;  3VRY A;  4J5Y A;  2LT4 A;  1MV3 A;  3EFS A;  1WXB A;  2E41 A;  1TG0 A;  4J7I A;  3CCM A;  3QWX X;  4M78 B;  5LJ3 j;  4AFZ C;  1IZ6 A;  1KC8 U;  2K3B A;  4OB3 B;  2CH4 W;  1ACM B;  1NJI C;  2R5A A;  4HCZ A;  1TOV A;  4FW1 A;  1V76 A;  2BKD N;  4FYY B;  1U3O A;  4J9B A;  2HL3 A;  2PUO B;  2CZ6 B;  1M8M A;  3CC4 Q;  2O4X A;  3MEA A;  1UEC A;  3X20 B;  4J9D A;  1UGV A;  5HK3 A;  1GCP A;  1SKU B;  5FU6 B;  1W1F A;  3UPU A;  2OAU A;  1VQK Q;  1YWP A;  4M75 D;  3X25 B;  2VYT A;  2DTI A;  1I07 A;  1ZA1 B;  3LH0 A;  1YIT Q;  1VQN Q;  2XG8 D;  1IO6 A;  1E7O A;  2YRC A;  2YXY A;  4OP0 A;  4PNO A;  1AEY A;  1YJW Q;  4E7I A;  5GAM j;  1MMA A;  2FB7 A;  1ZX6 A;  1OPL A;  2E4H A;  1QVF P;  5DM7 R;  2YLC A;  4OB2 B;  1AT1 B;  2BIV A;  1NPP A;  4EMK C;  2ZGW A;  3RDV A;  1JBM A;  4DEX A;  3S3O A;  3DLM A;  4KGZ B;  3UA6 A;  1GXI E;  2ABL A;  2OJ2 A;  2L2P A;  5IH2 A;  1WIE A;  4C5H A;  5FU7 B;  3OYL A;  4M7D E;  2L5Q A;  3C4S A;  1TTH B;  5M9O A;  4EMK B;  1F1B B;  4V2S A;  3QII A;  2RNA A;  3JB9 D;  2VXF A;  2X4J A;  2X4W A;  2DM1 A;  3G4S Q;  2YT6 A;  2XDB A;  2LZ6 B;  5IXB A;  5A0L A;  4DQ2 A;  2LJ3 A;  1HJD A;  2E6N A;  1W2B P;  2FZG B;  2LCL A;  5L8R E;  3I56 T;  1Y71 A;  1TS9 A;  2HSE B;  3OYM A;  3NHN A;  2NUT A;  4OMF B;  3RER A;  2CT4 A;  5FU7 C;  5CKD A;  4WF2 A;  3VJP A;  3OMC A;  1QWF A;  2JTM A;  4LXC A;  4IIM A;  2CZ1 B;  5IN1 A;  2EQI A;  2DIG A;  4JZ4 A;  3DLL A;  3ZBD A;  1H64 1;  1X43 A;  1RAC B;  3WXM B;  1VQ4 A;  4M7D F;  1ZUK A;  5D6Y A;  3JCM e;  2ZPB B;  2QA4 T;  1W2B S;  2RQW A;  3CCE Q;  1Y07 A;  2W0Z A;  1OX8 A;  3JB9 H;  3I55 T;  4GLM A;  1K73 C;  1G3W A;  2X9H A;  3H0I A;  1X01 A;  1PC0 A;  2DL3 A;  2BE7 D;  2VGM A;  1VQ8 T;  2G6F X;  4PJM A;  4IUP A;  3JB9 I;  2CUB A;  2K2V A;  2L3P A;  3RUX A;  4FT4 A;  4ZGE B;  4F04 B;  3O5Z A;  4NOY A;  1VQ5 T;  3G6E T;  1VQ9 T;  3NFC A;  2Y4X A;  1X6O A;  5CVI A;  5LJ3 h;  3JCM f;  3RIR A;  4QW2 A;  1VQK A;  4Z89 A;  1T3L A;  4PJO A;  1X6G A;  2RN8 A;  3RES A;  3G6E A;  1RAA B;  3CCR A;  1FX7 A;  5GAM d;  1RAH B;  1FXX A;  5KE3 A;  4ESR A;  4HVU A;  3FJ5 A;  1BI1 A;  1VQN A;  1D0Y A;  1RAE B;  3RMS A;  3PVL A;  3OW2 A;  1YCY A;  1K9A A;  2DNU A;  3S6W A;  2CGH A;  5GAO l;  1UTI A;  1OX9 A;  4M75 F;  1CKA A;  3A98 A;  4RCC A;  5FLX E;  3MP6 A;  4KUD K;  1QWE A;  2EYZ A;  4HVW A;  1TXQ A;  3M0T A;  3CCR Q;  4OGE A;  1VQL T;  3IQL A;  1WPY A;  4F7U F;  3OYE A;  3CME T;  1VQ4 T;  5HK0 A;  2P0P A;  2RK1 A;  2YUQ A;  3QDR B;  4GY5 A;  4AG2 C;  3CCM T;  1VYT A;  2IVW A;  2DL8 A;  3PGG A;  4ZTJ A;  2AK5 A;  2O31 A;  4JZ3 A;  4C5I A;  4C92 C;  1BI0 A;  2OTL A;  1CKB A;  1WHL A;  3I5R A;  4J9H A;  3BDL A;  8ATC B;  1PNJ A;  2O2O A;  4M77 G;  1YN8 A;  2DA9 A;  1GFD A;  2DXC A;  4FW2 A;  1X6B A;  3CC2 A;  4PJO D;  1AZG B;  2L89 A;  3A8L B;  2KI7 A;  2EQK A;  3QJY A;  2LT1 A;  3I55 A;  2ZZD A;  4ZTF A;  4M7A G;  1M4Z A;  3PT9 A;  1WJS A;  2PQW A;  2KNB B;  4BY6 B;  1M1G A;  4ZN1 A;  4QQG A;  1K0X A;  2EIF A;  1D1C A;  1UDL A;  3HRT A;  3CCE T;  2DKG A;  3TSW A;  2E1H A;  1UGP B;  2ZPE B;  5CAI A;  3UA7 A;  3BW1 A;  3RKX A;  3L2W A;  4J7F A;  4QVD A;  1UG1 A;  4PJN A;  2J6K A;  1YJN T;  4IUQ A;  1RAG B;  3OYB A;  2QG9 B;  2CZ7 B;  2QGG A;  2XK0 A;  1JJ2 A;  2DFU A;  1SHG A;  3MPU B;  3UF4 A;  2NUP B;  1JQQ A;  4OB1 B;  3VS5 A;  3VYG A;  3G6E Q;  3TCJ A;  3JCM g;  4CC4 B;  2QI2 A;  3QZ5 B;  2CS7 A;  2EGE A;  1IHW A;  2KSS A;  3QDF A;  3CPF A;  1WJQ A;  2CYZ B;  4GBQ A;  1QCF A;  3A1P A;  2DMO A;  2K5L A;  5LJ3 e;  2ENM A;  3GNF B;  2C0T A;  1VQ6 A;  1UGQ B;  3JB9 J;  3EFO B;  4BE1 A;  5CO7 A;  4NS5 A;  5IXF A;  2CP2 A;  2JXB A;  1YIJ T;  1VQP T;  1I5O B;  1LCK A;  3CPW P;  1C6V X;  4RKU E;  4DOV A;  3G71 Q;  3M58 A;  2JTF A;  2RI2 A;  4II1 A;  1M9S A;  4E6R A;  5KYX B;  4ME7 A;  4C8Q E;  1KC8 C;  2JZ2 A;  1WXT A;  3EH2 A;  5KYY A;  1Q86 C;  5LJ5 f;  3LWI A;  5LJ3 d;  1PSF A;  1SEM A;  4J6X A;  3CCM Q;  1GBR A;  3QBY A;  1AVZ C;  2RM4 A;  1JU5 C;  4PJO F;  2EQJ A;  2EFI A;  1RAF B;  2FVU A;  1TU0 B;  2E5K A;  2HKN A;  1QVP A;  1D1A A;  3CCQ A;  4OGC A;  4Y28 E;  4HKE A;  2JS2 A;  2QDY B;  5I22 A;  2BE9 B;  2VKN A;  2GFU A;  2QA4 Q;  2O88 A;  2DET A;  4LDV A;  3O8V A;  1SHF A;  1GL5 A;  5LL6 S;  3JAM E;  1UHC A;  4IUV A;  2LQ8 A;  3LW5 E;  4M78 G;  4Z8A A;  3SD4 A;  3P8B B;  2RJE A;  4M7D G;  2ATC B;  5GMK i;  3OQ5 A;  3RKY A;  1IRE B;  3CCQ T;  2E70 A;  3NTI A;  4DOW A;  1TUG B;  1RL2 A;  1VQ6 T;  1OZ3 A;  3M57 A;  2F5K A;  3M0S A;  4M77 B;  2DJQ A;  1IRX A;  1YP5 A;  1KQS P;  2DEQ A;  2OTL Q;  3HRU A;  2F5T X;  5CR2 A;  4BDY A;  2K3X A;  3EG1 A;  3CC7 A;  1R0C B;  4IIO A;  1ZHI A;  2AHJ B;  5GAO n;  1YHQ T;  1WHK A;  5KE2 A;  2QTV A;  3MET A;  3PTA A;  3SWN B;  2E65 A;  2GBQ A;  1LOJ A;  2XI9 A;  1QVF A;  1PKS A;  4YTL A;  2V1R A;  3CCL T;  1ZA2 B;  2D8H A;  1Y0M A;  2DTH A;  3CQT A;  1WLP B;  4FT2 A;  1WGS A;  2QK0 A;  1KFZ A;  1EFN A;  2KY9 A;  4CC3 A;  4QQ6 A;  1VQM T;  1SSH A;  3OS2 A;  3JCM b;  2IPO B;  2CDT A;  1N9R A;  2MAM A;  4JRI A;  1ZSG A;  4QKU A;  1R77 A;  5LJ5 j;  2EJF A;  2EKH A;  4C8Q A;  3VS1 A;  1T0J A;  3VS2 A;  1ZUU A;  5GAN 6;  2GQV A;  3EGD B;  2GCX A;  3CCE A;  2HD0 A;  4HT9 A;  1Q82 U;  4C92 A;  3GPL A;  2FL7 A;  1Z9Z A;  2XD0 A;  1Q82 R;  2YLB A;  2B86 A;  2JM9 A;  4DBH A;  3CEY A;  2RHU A;  5KYY B;  1UHF A;  4FL6 A;  4L6V 5;  4RTU A;  1VUB A;  3CXC P;  2MCN A;  3H0H A;  2AKK A;  2X51 A;  1I8F A;  2KT8 A;  2D6F A;  2YDL A;  2KE9 A;  4PLI A;  2P0K A;  1VQ8 Q;  1OOT A;  2MI6 A;  4JDS A;  3L2Z A;  2K79 A;  3L1A A;  4D6W A;  2RA2 A;  4Q5W A;  4M7A B;  4C92 G;  1W4S A;  2HL5 C;  1M1K R;  1WHM A;  4C92 B;  3CD6 A;  4C8Q G;  1M2O A;  2MF2 A;  1K73 R;  3HP9 A;  2EWN A;  2E3I A;  2E5Q A;  1NLP C;  2JN0 A;  4JRP A;  1VQ7 Q;  4PJO E;  2NUZ A;  3CBP A;  4M78 E;  4Z02 A;  1K0S A;  2MWP A;  2AT1 B;  1RLQ C;  1NYF A;  4KGX B;  3TSZ A;  2EYW A;  1VQ9 A;  4FYX B;  2YRV A;  1R0B G;  4XTZ A;  2K6D A;  2DD4 A;  2WSF E;  2KDS A;  3OYI A;  2RHY A;  1JXO A;  3FIF A;  4P5N A;  3CCU Q;  3OW2 P;  3CD6 Q;  2IIM A;  2F2W A;  4RTZ A;  2HDA A;  3SWN A;  5C6S A;  3JRZ A;  3CCR T;  2LX7 A;  3VUZ A;  1VQ7 A;  3FC3 A;  2I2L A;  4F7U E;  3M9Q A;  5GMK j;  2DEU A;  2E12 A;  3U23 A;  2WAC A;  2KYB A;  3J7A F;  5KYU A;  4Y91 A;  1QKX A;  1H8K A;  2KRN A;  1HD3 A;  4QT7 A;  3OY9 A;  2VUB A;  3SB2 A;  2A0F B;  4M7D A;  4IUT A;  2K2M A;  3L2U A;  1KQ2 A;  4XTY A;  1KG1 A;  2P4T A;  2O9V A;  2WSE E;  4MZP A;  2HEQ A;  1M3B A;  5DLQ E;  2ESW A;  5GAN 5;  4E47 A;  1MHN A;  2O9S A;  2KQW A;  1UUE A;  2RQT A;  4LD9 K;  4ZGJ B;  1Y57 A;  3M0P A;  5GJV B;  4O5V A;  4PJJ A;  3DB3 A;  4C5G A;  1OPK A;  1Q95 G;  2E10 A;  2ED0 A;  3M53 A;  1V29 B;  1N9S A;  2ZCF B;  3OA6 A;  1CSK A;  4EIK A;  2O4X B;  1H3H A;  1OU8 A;  1QCN A;  3RMQ A;  4JRQ A;  3QZ9 B;  5GAM f;  5L23 A;  3P8H A;  2VAS A;  4E7Z A;  1WNL A;  1VQ5 Q;  4C8Q C;  4AFU C;  1GBQ A;  4C0G A;  1MMD A;  1FYN A;  2JJ9 A;  2F2V A;  4XU2 A;  3MO8 A;  3QSU A;  3CCQ Q;  3JCM h;  1Q81 C;  1QCO A;  4NL2 A;  1QKW A;  3FJP A;  3MP8 A;  2J05 A;  3A8H B;  5GAN f;  1VQ6 Q;  1Q86 U;  2FPE A;  2R57 A;  3KUF A;  2KGT A;  5LJ5 h;  1Y96 A;  1I4K 1;  4M77 F;  4LE9 A;  1VIF A;  4IKF A;  5CCA A;  1UB4 A;  2LTO A;  3L2Q A;  1KHI A;  5EG2 A;  2FO0 A;  1VQ7 T;  2XKO C;  5GAN j;  4OB0 B;  1VQ5 A;  1M1F A;  2DBM A;  1Q86 R;  2GTJ A;  3J81 E;  3HTR A;  3G4S A;  4R0K A;  2AIR B;  1YI2 A;  4JJB A;  1VYV A;  2OTJ Q;  2RJF A;  5GMK l;  1VQ8 A;  3GNG A;  1M2V A;  4FYW B;  3OSS C;  4AFS C;  1KD1 C;  3MCA B;  5KYX A;  5FW9 A;  2V8J A;  1KQS S;  3CXC A;  4E7K A;  1XNI A;  4M78 F;  4XAX B;  1JRI A;  4BUG A;  3LX7 A;  2LNH B;  3PMT A;  1VIE A;  1FMK A;  2J6O A;  2E64 A;  4M7D C;  5A2Q E;  2DIL A;  3C95 A;  3JCM P;  1YIT T;  6AT1 B;  4HCB A;  3JCM W;  1MNE A;  5HCK A;  4LDU A;  3MKD A;  2QQR A;  1M30 A;  3I35 A;  4BAC A;  2HAX A;  1M8V A;  2X4Y A;  5GAM h;  1WQ7 A;  3N5B B;  2F1L A;  2EPD A;  4FSS A;  2Y90 A;  2I0N A;  4M75 B;  4M77 A;  3CMA Q;  4M7A D;  4E7S A;  1P92 A;  2RH2 A;  5I11 A;  1YWO A;  2MOX A;  1NEG A;  3OYY A;  1QVF S;  1BI3 A;  1O75 A;  3V8J A;  4M77 D;  2MIO A;  5AYF A;  4R56 A;  3ASK A;  5HY6 A;  1JB0 E;  3G71 A;  1MMG A;  1LNX A;  3NMZ C;  4M75 C;  2FZC B;  4J83 A;  3CBM A;  3CMA A;  2DVJ A;  1YJ9 Q;  1TUD A;  4RTT A;  1KQS A;  4M77 E;  4TVR A;  5KYW B;  1U5S A;  1YCS B;  1MND A;  2XDD A;  4M7D D;  1K1Z A;  4C8Q F;  2DZC A;  2HBW A;  3PVQ A;  2GFA A;  1AD5 A;  2EVR A;  4OML A;  4JJC A;  2RJC A;  1M90 R;  1YI2 T;  4LD6 A;  4JLI A;  4MZT A;  3HRS A;  2JT4 A;  2KRS A;  3EG9 B;  2EJG A;  1WHG A;  3CC7 T;  2OTJ A;  4M78 D;  3PIP A;  3M5A A;  4FSX A;  3A8G B;  3A8O B;  1B7T A;  3EG0 A;  4PJO G;  4A53 A;  5FU6 C;  4HT8 A;  2OTJ T;  1OU9 A;  1UGR B;  2X4X A;  3I5S A;  2ZPH B;  2LQW A;  5A0D A;  3A5Z B;  3CC2 Q;  4CRI A;  3PIO A;  1K4U S;  3DB4 A;  3CCU A;  1ZBX A;  3X28 B;  2FPD A;  1MMN A;  1FMW A; 
#chains in the Genus database with same CATH homology
 2GBQ A;  1WYX A;  1U3O A;  4J9B A;  2CRE A;  2C0O A;  1PKS A;  1M8M A;  2V1R A;  3EG2 A;  2D8H A;  3C0C A;  2KT1 A;  1UEC A;  1Y0M A;  2H8H A;  4J9D A;  1UGV A;  3CQT A;  1WLP B;  1ABO A;  1GCP A;  2X3W D;  1KFZ A;  1EFN A;  1W1F A;  4CC3 A;  2LJ0 A;  4D8D A;  1SSH A;  3I9Q A;  2PTK A;  1X2K A;  1YWP A;  3M0Q A;  1I07 A;  2CDT A;  1IO6 A;  1E7O A;  2LP5 A;  1ZSG A;  2A37 A;  1AEY A;  2EKH A;  2DE0 X;  1KIK A;  1NM7 A;  2KYM A;  4HCK A;  3VS1 A;  1T0J A;  3VS2 A;  1ZUU A;  1A0N B;  1ZX6 A;  4LNP A;  1X27 A;  2EBP A;  1OPL A;  1WA7 A;  2KRO A;  3VS0 A;  1Z9Z A;  1PHT A;  1T3S A;  1G2B A;  4RTX A;  2B86 A;  2DL7 A;  1MV0 B;  4DEX A;  2JM9 A;  3UA6 A;  2ABL A;  1I0C A;  2OJ2 A;  1UHF A;  3NGP A;  2L2P A;  4RTU A;  5IH2 A;  1WIE A;  3M0R A;  2BZX A;  2P4R A;  2DLP A;  2YUP A;  1K76 A;  4LUE A;  4KRT A;  4RTW A;  2MCN A;  3H0H A;  2VVK A;  2AKK A;  3NPF A;  3THK A;  2RQU A;  2KT8 A;  2RNA A;  2YDL A;  1WFW A;  2KE9 A;  2DM1 A;  2YT6 A;  4RTY A;  2LZ6 B;  5GJW B;  5IXB A;  1OOT A;  2KR3 A;  2DRM A;  2K9G A;  2LJ3 A;  1HJD A;  2K79 A;  2JMA A;  2LJ1 A;  3NHN A;  2DRK A;  1GRI A;  2CT4 A;  4OMP A;  1TUC A;  1GFC A;  4J9E A;  1QWF A;  4IIM A;  2EQI A;  4JZ4 A;  1KJW A;  1E6G A;  2AKL A;  1NLP C;  2LMJ A;  1X43 A;  5EC7 A;  2NUZ A;  1GCQ A;  2ROL A;  2YUN A;  1K0S A;  1ZUK A;  3VS7 A;  2RQW A;  1OV3 A;  2W0Z A;  1M3A A;  1RLQ C;  1NYF A;  1G83 A;  4GLM A;  3VS4 A;  4F17 A;  3TSZ A;  1ABQ A;  2EYW A;  2NWM A;  2SEM A;  3H0I A;  3PE0 A;  2DL3 A;  2K6D A;  2D0N A;  2PZ1 A;  2G6F X;  3EHR A;  2BZ8 A;  4HXJ A;  4OMQ A;  1AWJ A;  1U06 A;  2CUB A;  1JXO A;  2L3P A;  2KXC A;  1JEG A;  1M3C A;  1WDX A;  2CT3 A;  2A28 A;  2IIM A;  2F2W A;  3O5Z A;  2HDA A;  3QWY A;  4RTZ A;  1J3T A;  1NLO C;  3EHQ A;  2CH4 A;  4J9I A;  2LX7 A;  3ZL7 C;  1Z9Q A;  3EGU A;  4Z89 A;  3UAT A;  1T3L A;  1SRM A;  2EW3 A;  3U23 A;  1HSQ A;  2KYB A;  1X6G A;  2RN8 A;  2RPN A;  2KXD A;  3R6N A;  4JJD A;  3VS3 A;  3VRZ A;  1QKX A;  2KRM A;  2JS0 A;  1H8K A;  4ESR A;  1ARK A;  5IHK A;  1BB9 A;  4HVU A;  4K11 A;  1UFF A;  1AWO A;  2KRN A;  3FJ5 A;  1HD3 A;  4QT7 A;  3RBB B;  4A63 B;  2FG0 A;  4AG1 C;  1X2Q A;  3PVL A;  1MUZ A;  1K9A A;  1WI7 A;  2DNU A;  2K2M A;  1SPK A;  2L3S A;  1AWW A;  4Z88 A;  1WXU A;  1UTI A;  2JM8 A;  2O9V A;  2HEQ A;  4ORZ A;  1CKA A;  3A98 A;  1M3B A;  2OI3 A;  3KFV A;  3REA B;  2VWF A;  2ESW A;  1QWE A;  2EYZ A;  1B07 A;  1B3Q A;  4HVW A;  2EGC A;  2O9S A;  1UUE A;  3M0T A;  2RQT A;  3IQL A;  1Y57 A;  2J7I A;  3M0P A;  2J6F A;  5GJV B;  2YUQ A;  2LCS A;  2D8J A;  4AG2 C;  1OPK A;  1VYT A;  2C0I A;  2K7A A;  2ED0 A;  1VYU A;  4OMM A;  2DL8 A;  1CSK A;  4EIK A;  4DEY A;  1H3H A;  2D1X A;  2AK5 A;  2O31 A;  5FWC A;  4JZ3 A;  3ULR B;  2F2X A;  2X3X D;  1JO8 A;  1CKB A;  4J9F A;  3SHW A;  3H41 A;  3I5R A;  4RTV A;  2FPF A;  5L23 A;  2LQN A;  4J9H A;  1PNJ A;  1RLP C;  2O2O A;  2CSQ A;  2SRC A;  4CC7 A;  3LH5 A;  4AFU C;  1GBQ A;  1UJ0 A;  2RQR A;  1YN8 A;  1QLY A;  1FYN A;  1JXM A;  2DA9 A;  2F2V A;  4J9C A;  1GFD A;  1H92 A;  1X6B A;  1YNZ A;  2BZY A;  3REB B;  4CC2 A;  1AZG B;  1V1C A;  4HVV A;  1QKW A;  1AWX A;  2J05 A;  2FPE A;  1NYG A;  2KGT A;  2GGR A;  2V1Q A;  2L3Q A;  2KNB B;  4LE9 A;  1K0X A;  1X69 A;  1UDL A;  1ZUY A;  1S1N A;  2FO0 A;  4J9G A;  2ROT A;  1I1J A;  2KBT A;  2GTO A;  4OMO A;  3TVT A;  2DBM A;  1M27 C;  1E6H A;  2GTJ A;  3TSW A;  3UA7 A;  4R0K A;  1T0H A;  2DL5 A;  2L0A A;  4JJB A;  1VYV A;  1UG1 A;  4JPB W;  2J6K A;  2HCK A;  1XOV A;  2ED1 A;  4Y92 A;  1BU1 A;  1OEB A;  4AFS C;  1PRL C;  4RUG A;  1SHG A;  5FW9 A;  3UF4 A;  2A08 A;  1JQQ A;  3VS5 A;  2JTE A;  4CC4 B;  4WCI A;  2YSQ A;  2EGE A;  2LNH B;  1GCQ C;  1FMK A;  2DX1 A;  2JW4 A;  1RI9 A;  4M4Z A;  2J6O A;  4LUD A;  4GBQ A;  1QCF A;  1KSW A;  2DIL A;  2DMO A;  2ENM A;  2BTT A;  4LN2 A;  5HCK A;  1W70 A;  1ZLM A;  2C0T A;  1N5Z A;  2ECZ A;  1M30 A;  3I35 A;  1NG2 A;  2M0Y A;  2EYX A;  5IXF A;  2JXB A;  5ECA A;  2EPD A;  4FSS A;  1LCK A;  1VA7 A;  2FEI A;  1PRM C;  2RMO A;  2YUO A;  2DYB A;  2OAW A;  2RF0 A;  3GBQ A;  2I0N A;  3EG3 A;  4X1V A;  2DL4 A;  1AOJ A;  4E6R A;  2GQI A;  3JV3 A;  1WXT A;  5I11 A;  2JMC A;  1YWO A;  5IHI A;  2MOX A;  4OMN A;  1UJY A;  2QDL A;  1BK2 A;  1NEG A;  1SEM A;  3SEM A;  1ZBJ A;  2FRY A;  1GBR A;  1AVZ C;  2M51 A;  1JU5 C;  2PNI A;  4F16 A;  2E5K A;  2MIO A;  3RNJ A;  3VS6 A;  1W6X A;  1UE9 A;  2W10 A;  2CSI A;  2DBK A;  2JS2 A;  3NMZ C;  4AFQ C;  5IHN A;  2EYY A;  2HSP A;  5I22 A;  3M0U A;  3H0F A;  1SRL A;  2VKN A;  2O88 A;  2AZS A;  2DVJ A;  1TUD A;  4RTT A;  1SHF A;  1U5S A;  1YCS B;  1GL5 A;  1UHC A;  1AZE A;  2FRW A;  2AZV A;  5FWB A;  2KEA A;  1K1Z A;  2HBW A;  3PVQ A;  1AD5 A;  1PKT A;  2CUD A;  2EVR A;  4OML A;  4Z8A A;  1RUW A;  4JJC A;  2J06 A;  1BBZ A;  4D8K A;  4F14 A;  2XMF A;  2EGA A;  2JT4 A;  1NEB A;  2KRS A;  1PWT A;  2GNC A;  1WX6 A;  2RQV A;  3M0S A;  2DJQ A;  1YP5 A;  4ZNX A;  3VRY A;  3EG0 A;  1MV3 A;  3EG1 A;  1WXB A;  4IIO A;  3I5S A;  1TG0 A;  2LQW A;  3QWX X;  4AFZ C;  2DF6 A;  2K3B A;  1K4U S;  2CH4 W;  2FPD A;  2A36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...