2E5KA

Solution structure of sh3 domain in suppressor of t-cell receptor signaling 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
GSSGSSGSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor of T-cell receptor signaling 1
publication title Solution structure of SH3 domain in Suppressor of T-cell receptor signaling 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2e5kA01
2HEQA 4OMNA 4JJBA 4LUEA 3I5RA 5I22A 2K7AA 1NLPC 4HVWA 2J6KA 3H0HA 4J9CA 4CC2A 1I0CA 4DEXA 3TSZA 1SPKA 2MIOA 1GBQA 1U06A 1E6GA 3EG3A 3C0CA 1HJDA 1PHTA 2D1XA 2CUBA 2V1RA 4AFZC 2KR3A 2HCKA 2L3PA 2KRNA 3VS4A 2DRMA 3SEMA 2OI3A 3NGPA 1ZLMA 1YP5A 2DL3A 3FJ5A 1UTIA 1RI9A 2ED1A 2KNBB 2JT4A 3EG1A 2LZ6B 2L3SA 1NLOC 1QLYA 3EHRA 1CKAA 4RTXA 1OEBA 5ECAA 2DLPA 2I0NA 5IHNA 2LQNA 4RTZA 1G83A 2LMJA 1TG0A 2OJ2A 5I11A 5L23A 1AVZC 5GJWB 2DA9A 4E6RA 2X3XD 2JS0A 2CT3A 1QCFA 1GCPA 4AG2C 3NHNA 2O31A 1HD3A 1WDXA 2P4RA 1JXOA 1EFNA 2MCNA 3REAB 1BBZA 2DVJA 2YUQA 2KRSA 3QWXX 2L0AA 4J9HA 2X3WD 2DMOA 2O2OA 3QWYA 5IXBA 1Z9ZA 3U23A 2OAWA 2CH4A 1PRLC 2EKHA 2FRYA 1ZX6A 2KT8A 4IIMA 4DEYA 3PVLA 1WLPB 2KE9A 1UDLA 4OMLA 1JO8A 1UHFA 4D8KA 2FG0A 2RQWA 4F16A 3H41A 1HSQA 1PWTA 2ROTA 1T3SA 4J9GA 3PE0A 3UF4A 4RTTA 1UGVA 4CC4B 2PNIA 2O9SA 2ESWA 1ABQA 2K9GA 1AD5A 1WFWA 3VS3A 2O9VA 3H0FA 2AK5A 1W1FA 2C0IA 1WX6A 1JQQA 3RBBB 3TVTA 4J9IA 1WA7A 4JZ4A 2GGRA 1K9AA 2DM1A 2YT6A 4OMOA 4Z89A 1M8MA 1K76A 4KRTA 1M3AA 1YCSB 2ENMA 2YUNA 4WCIA 1RUWA 1OPKA 2FRWA 1S1NA 1SRMA 2NUZA 1MV3A 1AZEA 3CQTA 3IQLA 2DL4A 3VS5A 2ABLA 1KFZA 1UHCA 3UA6A 2KRMA 4HVUA 1M27C 2RQRA 2RQVA 2LCSA 1VYTA 1YWOA 4ORZA 3M0TA 3REBB 1SEMA 2K79A 1FMKA 1UFFA 1FYNA 1T0HA 4AFSC 2XMFA 1YN8A 4HCKA 4QT7A 1TUCA 2EYXA 3UATA 1NG2A 1GFDA 2J6OA 1WXUA 4RTYA 3VRZA 1AWWA 4A63B 1Y0MA 2ROLA 2B86A 4AG1C 1SHFA 1X2KA 2HBWA 4RTWA 4Z8AA 4AFUC 2LX7A 3A98A 3VS7A 5IHKA 4M4ZA 1KJWA 1PRMC 1QWFA 1UJYA 1N5ZA 1ABOA 2BZ8A 3EG2A 1AOJA 1XOVA 2BTTA 1ZUUA 2EYZA 3M0SA 1OOTA 2CUDA 2RF0A 3NPFA 1NEBA 2DILA 4JJDA 2CSQA 2M51A 2EYWA 5FWCA 1GBRA 1Y57A 2PZ1A 2KEAA 2GQIA 3EG0A 2YDLA 2JS2A 2DBMA 2RNAA 1X6BA 1GFCA 2CDTA 1PKSA 2RMOA 2RN8A 4EIKA 2K3BA 3EHQA 1AWXA 3M0PA 4AFQC 5GJVB 2LJ1A 2LNHB 2O88A 2H8HA 2NWMA 1ARKA 1ZBJA 2EBPA 2MOXA 2W10A 1T3LA 4HVVA 2FPDA 2JTEA 2BZYA 3THKA 2EGEA 2DYBA 2F2WA 2GNCA 2AKLA 1M30A 3GBQA 1NYGA 1WI7A 1ZSGA 4OMPA 1RLPC 1V1CA 2G6FX 4GBQA 4LNPA 2JW4A 1IO6A 2V1QA 2C0OA 4RTUA 3ULRB 1MV0B 2DJQA 2CT4A 1AEYA 4GLMA 1U3OA 2JMCA 4X1VA 2LJ3A 2F2XA 2LQWA 1W70A 2HDAA 2M0YA 4J9DA 1JXMA 4CC3A 1WXBA 1GRIA 3VS1A 2L2PA 2FPFA 2DF6A 1PKTA 2C0TA 1E7OA 1KIKA 1OV3A 3VS2A 2JXBA 3RNJA 1GL5A 1RLQC 2EPDA 2K2MA 2KGTA 3VRYA 2EW3A 3I5SA 3M0UA 4J9EA 1B3QA 2QDLA 2GBQA 1BU1A 3NMZC 2K6DA 1W6XA 2KXDA 4JPBW 3JV3A 4LUDA 2FPEA 2FO0A 2D0NA 1ZUYA 4FSSA 1VA7A 1X69A 1M3BA 1X6GA 3UA7A 1UUEA 2VWFA 5FWBA 2J05A 1OPLA 2EGAA 1WYXA 2HSPA 1QKWA 2CREA 2PTKA 4Y92A 1H3HA 4LN2A 1AWJA 2CH4W 4CC7A 1I07A 3VS0A 4K11A 2GTOA 2KYMA 1UG1A 1J3TA 1SSHA 1G2BA 3SHWA 1LCKA 4ESRA 1QKXA 1K1ZA 2KROA 1H8KA 1X27A 2YSQA 2BZXA 2KYBA 1M3CA 2E5KA 2YUOA 2LP5A 4F14A 1KSWA 2DBKA 4IIOA 1WXTA 3O5ZA 1YWPA 4JJCA 2AKKA 1K0XA 2JMAA 1CKBA 2DNUA 5FW9A 2J06A 4F17A 2IIMA 4D8DA 2SRCA 2A36A 2VVKA 1BK2A 2J6FA 2RQTA 1ZUKA 3ZL7C 1AWOA 2DX1A 4HXJA 2J7IA 4J9BA 2SEMA 2CSIA 1TUDA 2JM9A 4RTVA 2EYYA 3M0RA 2FEIA 1YNZA 3TSWA 1K0SA 4R0KA 1H92A 1UJ0A 2DE0X 2DL8A 2F2VA 2VKNA 1VYVA 2GTJA 2DL7A 2EGCA 3VS6A 1JU5C 4JZ3A 1QWEA 1CSKA 4OMQA 4J9FA 4OMMA 2A28A 2JM8A 2LJ0A 5IHIA 1BB9A 5IH2A 1SHGA 2YUPA 1X43A 1NYFA 3EGUA 1U5SA 3R6NA 3H0IA 2D8HA 1A0NB 5IXFA 2EVRA 1SRLA 2DL5A 2KBTA 3I35A 1WIEA 2ECZA 1JEGA 1PNJA 3LH5A 4LE9A 2RPNA 4Z88A 2DRKA 1VYUA 3PVQA 1B07A 1E6HA 2ED0A 1UE9A 1GCQC 1AZGB 1UECA 1Z9QA 2W0ZA 1NM7A 3KFVA 2EQIA 3I9QA 2L3QA 5EC7A 2AZSA 1X2QA 4RUGA 1NEGA 2RQUA 2A08A 1K4US 2KXCA 1MUZA 2A37A 2AZVA 2KT1A 4ZNXA 3M0QA 5HCKA 1I1JA 1GCQA 2D8JA 1T0JA
chains in the Genus database with same CATH superfamily
1OU8A 3A1PA 3I5RA 4LDUA 3AT1B 1NLPC 3RERA 1RL2A 3CEYA 3M56A 5GANe 3EG3A 2CUBA 5LJ3e 3CCVQ 5GAOn 1QVFA 1VQ6A 3VS4A 4KULA 1ZLMA 3OYBA 4XTYA 1RI9A 2ED1A 4CI0C 1WJQA 1NLOC 1FMWA 4LDYA 2QQ9A 4C8QA 2OTJA 3EHRA 3OYDA 1CKAA 4O6JA 1OEBA 1SF9A 5ECAA 1QP2A 2LQNA 3HP9A 3CCET 2XK0A 5I11A 2JS0A 1VQOT 1GCPA 3GF5A 2O31A 3M54A 1HD3A 2V8IA 1VQ6Q 1GXIE 1FMVA 7AT1B 4VUBA 2X4XA 2DVJA 2HNIA 1N27A 2F5KA 2KRSA 3QWXX 3JCMd 1KG1A 1TU0B 3R6OA 4PJLA 2LC4A 5J26A 5IXBA 2OTJQ 4C8QF 3U23A 2CH4A 2EKHA 1KQSA 2RHZA 3PVLA 1WLPB 5KYNA 5IT9E 2NUTB 2O4XB 4D8KA 1NZ9A 1DJ7B 1TS9A 3INZA 3P8HA 4F16A 1PWTA 2EFIA 1M1GA 5FRMA 4J9GA 2EAYA 2RD1A 1M1FA 1UGVA 4CC4B 3I56A 3G6EA 3EH1A 3QYHB 4QVZA 3OQ5A 3M4GA 1YITT 1OI1A 2VC8A 2DEUA 1JQQA 3TVTA 2H3EB 1IZ6A 3RKYA 4OMOA 2QA4T 2YUNA 4WCIA 1RUWA 1OPKA 3OYFA 1MMGA 2VV5A 1IHWA 2LT4A 1O75A 5GAN8 1I81A 2QEXT 2NUZA 5J3BA 1AZEA 3A8GB 3CCMT 1Q7YC 1KFZA 3M9QA 5GAMd 4BI3A 3I56Q 3G6EQ 2P0PA 1M27C 3LX7A 1PM3A 3PGGA 2XDBA 2LCSA 3META 4QQ6A 3CBPA 3DB3A 4JJNK 3CPWP 2RI3A 2COYA 1N8RR 3REBB 1SEMA 2K79A 1UFFA 3L1AA 4HCKA 2ZPGB 4PFOA 5GAN3 1BKBA 2QQSA 3H9NA 5CKEA 1GFDA 3VRZA 1D3BA 3JCMc 4MZMA 4ELYC 4A63B 1Y0MA 2ROLA 5GAN2 2HL3A 4RTWA 3M57A 4AFUC 2LX7A 3VS7A 1KD1C 1RAFB 2I2LA 4M4ZA 2LDMA 4E7JA 3L2QA 1PRMC 1K9MR 1Y96B 5GAOq 1M1KC 1BI1A 3UPUA 3JCMJ 2HMAA 2V8JA 3JCMP 1AOJA 1XOVA 3OSVA 4M75F 2RF0A 2OTLQ 4JJDA 2CSQA 2EYWA 2D0QB 2KEAA 1G3SA 3OS0A 3EG0A 4C5HA 2DBMA 1X6BA 1PKSA 5GAMj 9ATCB 1ZA1B 3CD6T 2K3BA 3EHQA 4AFQC 3OYKA 5GJVB 1N8RU 1TTHB 4M77G 2PUOB 1VQ7A 3CXCP 4EMKC 2W10A 2E65A 3WXMB 3G71A 3QZ5B 2BZYA 3THKA 3CCRT 5GAN7 1M30A 5GANd 3OYAA 4M75D 1WNLA 4M78E 4OMPA 4BDZA 2G6FX 3OS5A 4XU1A 5LJ3d 1K9MU 1WQWA 2EQJA 4PLLA 4JS5A 4QW2A 2DTOA 2RO0A 3ULRB 1MV0B 4M77C 2BKDN 3CCUA 1BIBA 4X1VA 1RI0A 3RUXA 1WHMA 4NL3A 2HDAA 1VQ7Q 1M9SA 1GRIA 3VS1A 3G71Q 2JOYA 4BE2A 1Q82C 4FYXB 4GY5A 2MWPA 2DF6A 1E7OA 3E1SA 2CP7A 4M7DE 1WHGA 4M77A 2K2MA 1QVGA 2RI5A 2EW3A 3I5SA 1UB4A 4J9EA 5CKBA 4J8OA 3NMZC 4X9DA 2K6DA 4OMFB 2FPEA 2L5QA 2QYZA 2E6NA 3CCUQ 3T9NA 1VA7A 1SG5A 1UUEA 3JCMg 5FWBA 2J05A 1VQOA 3L2WA 3OW2S 4C92G 2CREA 1M4ZA 1NJIC 5GANj 3I55T 3OY9A 4LDWA 4C0DC 4JRQA 1I5OB 1TXQA 1YIJT 5LJ3j 2EIFA 2EQMA 3SHWA 1LCKA 4ESRA 1QKXA 5FU7C 1H8KA 1X27A 2YSQA 1JJ2P 2BZXA 2YUOA 4L59A 4F14A 3V8LA 4LXCA 4EMKB 1WHHA 2CS7A 2G3RA 1D0XA 2RJEA 1WHJA 4C92C 1TH7A 4DBHA 2IIMA 4D8DA 1VQKT 1BK2A 1VQOQ 4XK8E 4IUUA 3ASKA 3BDLA 1AWOA 1QMCA 2YRDA 2K3XA 3A5ZB 2CSIA 4FU6A 4RTVA 2EYYA 1PG5B 4DQ2A 2FEIA 4M77E 2CYZB 1H92A 3GIBA 4M77B 3VYGA 2EGCA 1QQJA 5CKDA 4C92A 5GAMg 1P92A 2YXYA 2A28A 2EQUA 3RESA 4OB2B 2EJ9A 1WJRA 5IH2A 3O8VA 1SHGA 4C5EA 2RHUA 1WGSA 4FT2A 4F7UG 2D8HA 1A0NB 4IKFA 5IXFA 2EVRA 2A7YA 2MMPA 4D6WA 2KBTA 4HCZA 4KGVB 4XTVA 1ZQ1A 2XKOC 4Z88A 4MDWA 4KBMB 1D1CA 1VQLT 1E6HA 4B6MA 1WHKA 2L3QA 3JRZA 2DK3A 3QIIA 3OBYA 3BY7A 3NTKA 1Q81C 2E4HA 3SWNC 1MHNA 5LJ5e 4DOVA 3CCLT 3JCMe 2V8KA 1W2BS 3CMAT 2AZVA 4OP0A 2KT1A 1R0BG 4M7AC 4ZNXA 3M0QA 5FU7B 2KI7A 2D8JA 1T0JA 1X6OA 5GMKe 1YJNA 4OMNA 5GMKl 4X34A 2K7AA 4LDXA 3KBGA 1K8AR 4F7UA 4PJOD 2J6KA 4V2SA 4C92E 4J9CA 5GANh 4DEXA 2CP3A 4C92B 2DIQA 2X4WA 4ZGEB 2QGGA 4XU3A 1E6GA 4C5IA 3C0CA 5LJ3h 3CC4T 1YJ9A 4M7AA 3OS2A 2KR3A 3S6WA 4J5YA 2PU9B 2HCKA 3MJXA 3CD6A 4KUDK 1S72Q 2K3YA 4HA8A 5GANg 5KYWA 3QHSA 2P0KA 1QVFP 4LDVA 3FJ5A 4E7SA 1YJNQ 5LJ3g 3FC3A 3QDRB 2JT4A 1VIEA 1WHLA 4WF2A 4F7UF 3A8MB 4N0AC 2DLPA 4C0GA 3S3MA 3JB9G 5GAMe 1G83A 2OJ2A 1YJ9Q 5L23A 2RK1A 2DA9A 4YTLA 1QCFA 5DM7R 1WDXA 3EFRA 5CO7A 2ZAEA 3LLRA 1K8AU 1RAEB 1B34B 3ER0A 1MMAA 1V29B 2DYIA 1M2VA 3X24B 4J9HA 2DMOA 2O2OA 3QWYA 1Z9ZA 4FM4B 2DXTA 4ATOA 3EFOB 1PRLC 2FRYA 4FIBA 3SWNB 4DEYA 1QCOA 5D6YA 2KE9A 1UDLA 1JO8A 2CZ6B 2WACA 4MMLA 4M7AE 3H41A 5GAOl 1T3SA 4M7AB 3UF4A 2LCLA 4ZTJA 2O9SA 3M5AA 2DERA 1ABQA 2K9GA 1WFWA 1IHVA 2AK5A 5KYWB 2CP2A 3MKDA 2C0IA 1WX6A 3QG1A 1OZ3A 3CCQT 4J9IA 1WA7A 5GAN4 1BI2A 2LX9A 1KK7A 1YFNA 4N4GA 1M8MA 4KRTA 1UGSB 3M53A 3QSUA 1SRMA 3CQTA 1U1SA 3HRTA 2L3RA 3RKWA 3X28B 3L2ZA 3HRUA 2E5QA 1FWZA 3UA6A 1YJWA 1Q86C 4HVUA 2X35A 3PMIA 2NUTA 2O4XA 4N4IA 2ZGWA 4QKUA 5FROA 1YWOA 4E7ZA 4XU0A 3LGLA 1YHQT 5CK9A 2M1HA 3RKXA 1M2VB 5DLOA 2Y90A 1Q7YR 1N9SA 3WVEB 3CPWS 1TUCA 4XTUA 2ATCB 3FJPA 4FT4A 3C95A 2KQWA 4RTYA 2VUBA 2B86A 3EGXA 1VQ4T 5GAN5 1NPPA 3A98A 5IHKA 1VQNT 4ME7A 2CP5A 1YJWQ 3PMTA 1N5ZA 1ABOA 2BZ8A 3URGA 2FZGB 1M2OA 2VASA 3OBWA 1RAGB 3OYHA 1LPLA 1KD1R 4DOWA 1ZSZC 3RDVA 1M90C 5KYXA 4II1A 3RR6A 3FEOA 2R58A 1M1KR 1IB8A 3HTRA 5C0MA 2GQIA 5LJ5d 3CC7A 2RNAA 3VUBA 1GFCA 3PFSA 2XU8A 4EIKA 3M0PA 1AWXA 4J6YA 1UGRB 2KY9A 4J6WA 2NWMA 1WPYA 1Q7YU 3RIRA 2EBPA 4UC4A 2FPDA 1RADB 4BD3A 3CXCS 1VQ9T 2RK2A 2DYBA 2GNCA 3GBQA 3VYHB 1Y96A 5CCAA 1RLPC 4M78G 2EKOA 3CC7Q 1IO6A 2V1QA 2GQVA 2JVVA 2DAQA 3EGXB 3CMEA 2DJQA 5FU6C 2CT4A 3J81E 2JMCA 4PKCC 3G1JA 3UT1A 1RAAB 3CC4A 1KD1U 2F2XA 3CC2A 2LQWA 3ZBDA 4C8QD 2BIVA 3J7AF 3VKIA 3HPWA 4BACA 1TWBA 3JCMW 1M1KU 1JBMA 4N4HA 3FDRA 2L2PA 4KUIA 3CCST 4M78C 3JCMX 3VS2A 2JXBA 2Y4YA 5KYXB 4M7DG 1GL5A 1R8OB 1RLQC 3VRYA 5LJ5j 3G4SA 3M0UA 1VQMA 3M58A 2LTOA 4KT0E 1W6XA 3MEVA 4JPBW 1Q82R 3L2VA 5L8RE 1QVGP 3BFMA 3CMEQ 2HZYA 2D0NA 3A8HB 1ZUYA 3N5BB 1M5Q1 1W4SA 5GMKj 3UA7A 3CC2Q 4BE1A 2EGAA 1ZSZB 4M78A 2HSPA 2DIGA 1MMDA 2AT1B 2E70A 4M7DC 3V7RA 3VS0A 3L42A 1WJSA 4E7KA 2GTOA 2KYMA 3G4SQ 1VQPA 4O5VA 2KROA 1LNXA 2R5MA 1HK9A 1VQMQ 4A4KA 3PT9A 2KYBA 1NJIR 4IIOA 2QTVA 2X51A 3OYGA 1JJ2S 4JJCA 4M7DA 4J83A 4F17A 2DNUA 1VQ5A 2LNVA 2VVKA 2KDSA 3J80E 4Y28E 2HD0A 3EG9A 2DX1A 3CCJT 2DTHA 4HXJA 2J7IA 4QVDA 1C1AA 2SEMA 1TUDA 2JM9A 3M0RA 3LYIA 1Q82U 1VQ8T 1YNZA 3MEAA 4R0KA 1UJ0A 4XU2A 5FU6B 3PIPA 2DL8A 2VKNA 1I4K1 1VQPQ 3D7SB 2E3HA 1G3TA 2DL7A 1NPRA 3CBOA 1JU5C 1QWEA 1CSKA 2K57A 3BE3A 2JM8A 1BI0A 2LJ0A 4RMOA 3LWHA 1SKUB 5IHIA 2GF7A 1VQ5Q 4RCBA 1X43A 1IRXA 1U5SA 4M78B 2M16A 1LVKA 2RA2A 1SRLA 4EMKA 1H641 1OQKA 2HQXA 1IGQA 3FRNA 1WIEA 3I35A 4JRIA 1NJIU 3HSBA 2LQ8A 3LH5A 1YHQA 3ME9A 2EJGA 2DRKA 2RHYA 2ED0A 1JRIA 1GCQC 1UECA 1Z9QA 1R0CB 2W0ZA 2EQIA 2YRVA 3VUZA 2RM4A 3WVDB 1QW1A 5LJ5h 4E7LA 2HSEB 4RUGA 3JCMh 5A0GA 1NEGA 1VQ4A 2RQUA 2A08A 4M7DB 2KXCA 5A2QE 2E12A 5GMKh 2K5LA 3EG9B 5HCKA 2QGFB 2MAMA 1GCQA 3EGDB 1YI2T 4JJBA 4DA4A 1Q81R 5LJ5g 3CCEA 1OULA 1OZ2A 3H8ZA 8ATCB 3A8OB 4HVWA 3H0HA 4CC2A 1I0CA 4KH0B 3JSCA 4EMGA 3TSZA 5DY9A 5GAOr 3RMQA 3V8KA 1PHTA 2D1XA 3NTIA 5HKCA 4M77F 4J7FA 2L3PA 2KRNA 1SSFA 2MK5A 3P8DA 3SEMA 3NGPA 4FYYB 2QG9B 3E19A 2DL3A 4BY6C 3MP8A 2VGNA 3CCVT 3CCEQ 3EG1A 1QVFS 2LZ6B 1PD0A 1QLYA 2QDYB 2CKKA 1KC8C 5GAMh 4HCCA 3M59A 2L89A 2I0NA 5IHNA 1XTDA 4RTZA 4PJOC 4HT8A 1TG0A 1AVZC 2PVDB 4E6RA 2X3XD 1YITA 3DB4A 2JUFA 3M4YA 3NHNA 2HKQB 2V26A 1Q81U 1JXOA 1EFNA 2MCNA 2GFUA 3REAB 2QA4A 1BBZA 2L0AA 2HAXA 2E10A 3QJ6A 5D6WA 1VQ6T 1BCOA 3OMCA 2QEXA 2YLCA 2HQHA 2OAWA 3CCMA 5KE3A 1Y07A 1BIAA 4NOYA 1ZX6A 2KT8A 4IIMA 3CCSA 4PFZA 4AT1B 2DFUA 2RQWA 2OTJT 4M7AG 4XAXB 1YITQ 3PE0A 4RTTA 3OYEA 4ELZC 1KQSS 2PNIA 1D0YA 2ZPFB 2PQWA 1XQHA 4C92F 2DETA 1AD5A 3VS3A 2O9VA 2QA4Q 5KYYB 3X26B 1AHJB 1W1FA 3JB9J 5EG2A 3RBBB 1IGUA 2QEXQ 4BDYA 2KMTA 4QQDA 2GGRA 3CCMQ 1K9AA 3HFOA 1K76A 4C0DB 1M3AA 1YCSB 3OS1A 4HCBA 3GOXA 1B34A 1S1NA 3LW5E 1TOVA 3L2RA 3IQLA 3EFOA 1FXXA 1UHCA 2VXFA 2BE7D 3OYMA 2XI9A 3SWNA 3M55A 1G3YA 1VUBA 1VYTA 1IREB 1G3WA 4ORZA 3M0TA 3I56T 3G6ET 1FYNA 3SD4A 4PJOE 1T0HA 1OU9A 4OB1B 3MCAB 2COZA 4QT7A 4PJOB 3UATA 1NG2A 1Q86R 2J6OA 1WXUA 1H3ZA 3QBYA 1AWWA 2R5AA 4AG1C 3JB9I 2HBWA 4Z8AA 4MDXA 4C0FA 4EDUA 1KJWA 2DVEA 2DEQA 4OVAA 1QWFA 3CCRA 1UJYA 2ZPBB 4FW1A 3QZ9B 3OB9A 5CQXA 4FSXA 3EG2A 2QQBA 2BTTA 4A4FA 2EYZA 3C12A 2COWA 3M0SA 3NTHA 4M7AF 2CUDA 3NPFA 2DILA 5GMKm 2KK4A 2M51A 3CD6Q 3X25B 2AHJB 1UEBA 2PZ1A 1JB0E 5CKFA 1Q95G 2QQRA 3QKJA 2OTLT 4N0AA 3MP1A 3GP8A 2DJZA 2CDTA 1M90R 2LJ1A 3CCRQ 2LNHB 3UWNA 4CRIA 2BUDA 2O88A 4FCYA 2H8HA 3A8LB 4F04B 1QVPA 1WZOA 6AT1B 1T3LA 2RHIA 2JTEA 1C0MA 1Q86U 1BCMA 3JCMf 2MF2A 2EGEA 2F2WA 2AKLA 1FX7A 4LD9K 5KH6A 1NYGA 1WI7A 3GLXA 3OYJA 1ZSGA 4NS5A 1V1CA 3PTAA 4GBQA 4LNPA 2JW4A 2C0OA 3L2UA 2ZCFB 1AEYA 3ZEHA 1U3OA 3OYLA 2DTIA 5GMKi 3I55A 1W70A 2JTFA 2M0YA 4J9DA 4BUGA 1JXMA 4CC3A 1WXBA 1YIJA 2WSEE 3FLGA 1TSFA 1PKTA 1VQ7T 5HK0A 2LVMA 3KUFA 3RNJA 2LQKA 2EPDA 2EYQA 3G71T 1M90U 3JB9F 1BU1A 1AT1B 2C06A 3OW2A 2X4JA 1VQKA 3JV3A 4LUDA 2FO0A 5GAOm 4FSSA 3ZFJA 2HKNA 2CP0A 3HL8A 1QVGS 5GAMf 1X69A 1M3BA 1X6GA 3I55Q 2JZ2A 1X75C 3G7ZA 3HFNA 4PJJA 5A0LA 1YIJQ 5DLQE 1NE8A 2B8AA 3CCUT 1H3HA 4LN2A 1K73C 1AWJA 4CC7A 2QXFA 4RCCA 4C8QC 4K11A 1N9RA 2E41A 1J3TA 2FL7A 1SSHA 4ZN1A 5AT1B 1K1ZA 4EMHA 2ZZDA 1M3CA 2E5KA 3C94A 2LP5A 1VQKQ 2ZPHB 2DBKA 1NBEB 2DZCA 3JB9D 1WXTA 1YWPA 3MHXA 2AKKA 2KAFA 3P8BB 1K0XA 2JMAA 5FW9A 1O9SA 1N6AA 5D6XA 2OAUA 2SRCA 3CPFA 5HY6A 2CP6A 4A4EA 2QTXA 3F70A 3Q1JA 2J6FA 2RQTA 1ZUKA 8AT1B 4GLKA 3OYNA 3JCMV 1VQLA 1OX8A 2JNGA 4IUTA 2FHDA 2AIRB 3MO8A 1ZSZA 2WSFE 3BW1A 2DD4A 2EJFA 2GTJA 4L5GA 2XICA 3VS6A 4JDSA 4OMQA 4J9FA 4KGZB 4XTZA 4OMMA 3CCLA 1G5VA 3CMAA 1F1BB 2NUPA 2FZKB 1BB9A 1PCXA 2RHXA 2NLUA 3OYCA 4DBQA 1NYFA 4X9CA 2VYTA 4QVCA 1KQ2A 2XDDA 1VQLQ 2DL5A 2BE9B 2F1LA 2QI2A 4M75G 1PNJA 4IUPA 2M9UA 5HK3A 4PNOA 4J7IA 5GANf 3TQ7P 2RPNA 2DD5A 1PC0A 4JRKA 4IUVA 3SB2A 4KH1B 1VYUA 1B07A 1U1TA 2QASA 4PL6A 4P5NA 5LJ3f 1W2BA 3CCLQ 1HXDA 3I9QA 4OB0B 1RABB 3CMAQ 4RKUE 3VJPA 2AZSA 1X2QA 5GAOp 1D1BA 5IAYA 4C8QE 4R56A 3NFCA 4C8QB 2A37A 5C6SA 4M75C 1EZZB 3TU4K 5GAN6 3EFSA 3V7SA 2HEQA 4HKEA 4RG8A 4LUEA 3HRSA 2LCCA 3CBMA 3CC4Q 5I22A 2MYSA 3MEWA 2FVUA 3MPUB 3JB9H 2GFAA 2VGMA 1SPKA 1ZBXA 2MIOA 1GBQA 4PLIA 4PFPA 1U06A 1U8RA 1EX4A 1HJDA 4RG2A 2V1RA 2NUPB 4M75A 4AFZC 2OTLA 3C4SA 2IVWA 3OYYA 2K2VA 1PD1A 2DRMA 1G8XA 2OI3A 4BI4A 1YP5A 1D1AA 5FLXE 1UTIA 2KNBB 5KYUA 2ZPIB 1S72T 1M8VA 2L3SA 5CAIA 2Z0WA 2RJDA 4C5GA 3OSSC 4RTXA 4M78F 4ANJA 3QYGB 2K5IA 1YJNT 3EGDA 1VOMA 2LMJA 1OYXA 1V76A 3BDUA 5GJWB 2CT3A 2D6FA 4AG2C 3CCQA 4ZGDB 2P4RA 1KC8R 2P0QA 1YJ9T 3HHTB 2K5FA 2E1HA 2M02A 3SFMA 2CZ0B 2YUQA 4A53A 2FZCB 2X3WD 3LH0A 2A3LA 4M7DF 3QJYA 3GNGA 4BE0A 3UDCA 4E2FB 4KGXB 4JLIA 4LD6A 4MMKA 1C6VX 2JTMA 4OMLA 4PJMA 1UHFA 4M78D 4MZTA 2F69A 2XIDA 2FG0A 1LJOA 4M75E 1HSQA 2ROTA 4FW2A 4M75B 3TREA 3CCQQ 5CVIA 2ESWA 2EQKA 3E9FA 5IN1A 3H0FA 3DLLA 2RB6A 4C0ZA 4ZGJB 1D3BB 2YRCA 2R57A 3EAEA 4FL6A 5KYUB 3DLMA 4JZ4A 2DM1A 2YT6A 4Z89A 1VQNA 2ENMA 4M7DD 1MMNA 2FRWA 3QDFA 2RJFA 2MWOA 1KC8U 2DXCA 2IG0A 1MV3A 1N8RC 2DL4A 3VS5A 2ABLA 1YHQQ 3X20B 2KRMA 2XHCA 3CPWA 2RQRA 2RQVA 4E7IA 2HL5C 3E9GA 3S3OA 2CZ7B 2QAZA 1FMKA 2L8DA 4R55A 4AFSC 1VQ4Q 4PJOG 1BI3A 2QQAA 2XMFA 1YN8A 1K9MC 3QPHA 1VQNQ 2EYXA 2M0OA 4E7HA 4ZTFA 1B7TA 2IPOB 2MI6A 5KYYA 1TUGB 1Y7XA 1SHFA 1X2KA 2JJ9A 1RAHB 2OX7A 2X4YA 3DKMA 3E2UA 1VQ9A 3QXEB 3PNWC 2CGHA 2E3IA 2FYKA 1ZUUA 3JAME 1OOTA 2E64A 3KXTA 3PIOA 1YJWT 1PSEA 1NEBA 2LT1A 5FWCA 1GBRA 3VV0A 1Y57A 1UGQB 4M77D 2PUKB 5LL6S 2YDLA 4FYWB 2JS2A 4AMCA 4DBFA 5CIUA 2RMOA 3TEEA 2JN0A 2RN8A 2A0FB 3CXCA 5KE2A 3JCMQ 4OB3B 4PJOA 1YBYA 4PJNA 3GNFB 1VQ9Q 3V7CA 1D09B 2YLBA 4BB7A 2RI2A 3JCMb 1Y71A 1ARKA 1XNIA 1ZBJA 1PSFA 1XJWB 4HT9A 2MOXA 2P84A 3QUIA 2FB7A 4HVVA 2Y4XA 2XG8D 4JUVA 2K4YA 2XD0A 1RACB 2H3JA 2D9TA 1OX9A 5AYFA 4E47A 5I2SA 4BI8B 1ZHIA 4OF1A 4ZN3A 4RTUA 4A54A 4GLMA 1MNDA 2HBPA 3MP6A 4PJOF 2P4TA 3LGFA 2LJ3A 2O01E 3CC7T 4MZPA 4Y91A 3CCSQ 1ACMB 4QQGA 2QK0A 1KHIA 3RMSA 5CKHA 2FPFA 4A4HA 3S3NA 2C0TA 4BY6B 1KIKA 1OV3A 2DPPB 3QO3A 4JS4A 1I8FA 2KGTA 2XDPA 5I21A 5M9OA 2RJCA 1S72A 1B3QA 4B9XA 2QDLA 4EPCA 2GBQA 2WSCE 2HQEA 2KXDA 4C92D 2KSSA 3OYIA 4XQ3A 2DKGA 5FRNA 3OMGA 3CCJA 3SDZA 3OW2P 1WQ7A 2VWFA 1OPLA 2E6ZA 1VQ8A 1WYXA 3CMET 5CR2A 5I2MA 1QKWA 2PTKA 4Y92A 1YCYA 2PVGB 2CH4W 1I07A 4L6V5 2ZPEB 3CC2T 1JJ2A 1UG1A 3AHUA 3V8JA 5KCOA 1G2BA 4PK4A 4XTXA 3EH2A 5CQYA 2DXBA 4J6XA 1MGQA 1UGPB 2F5TX 1BYMA 2GCXA 2VB6A 1IXDA 1KSWA 1QP3A 1K73R 3O5ZA 2VXEA 3G4ST 3CCJQ 5D7UA 1VQMT 1CKBA 2J06A 2A36A 1VQ8Q 1EIFA 4NL2A 4JLGA 3FIFA 3ZL7C 3H6ZA 4OGCA 1QCNA 4J9BA 1KHCA 4Z02A 1LOJA 1R77A 3TSWA 1K0SA 3GPLA 2YHTA 2DE0X 2KVQG 2F2VA 5A0DA 1VYVA 2CZ1B 1KQ1A 4OGEA 1MNEA 2MPXC 4JZ3A 5LJ5f 2DXUA 3HKSA 4JRPA 1X01A 1VQPT 5J39A 4Q5WA 4M7AD 2DZ9A 1YI2A 2YUPA 4F7UE 2LRQA 3EGUA 3R6NA 3H0IA 4F7UB 4XTWA 2NYSA 3TCJA 1RAIB 1VQ5T 2YWWA 3MEUA 1KQSP 2PVOB 3OA6A 4A4GA 2ECZA 1JEGA 1K73U 4LE9A 1D0ZA 3PVQA 1I5LA 1UE9A 4TVRA 1AZGB 3KFVA 1NM7A 4DBRA 1HYOA 1ZA2B 5EC7A 4IURA 1W2BP 1YI2Q 4FYVB 2X9HA 3CCVA 1K4US 1K8AC 4C8QG 4WTOB 1MUZA 4IUQA 2DO3A 4B9WA 3LWIA 2EWNA 1VIFA 3VU3C 2RH2A 5KCHA 1I1JA 3FB9A
chains in the Genus database with same CATH topology
2HEQA 4OMNA 4JJBA 4LUEA 3I5RA 5I22A 2K7AA 1NLPC 4HVWA 2J6KA 3H0HA 4J9CA 4CC2A 1I0CA 4DEXA 3TSZA 1SPKA 2MIOA 1GBQA 1U06A 1E6GA 3EG3A 3C0CA 1HJDA 1PHTA 2D1XA 2CUBA 2V1RA 4AFZC 2KR3A 2HCKA 2L3PA 2KRNA 3VS4A 2DRMA 3SEMA 2OI3A 3NGPA 1ZLMA 1YP5A 2DL3A 3FJ5A 1UTIA 1RI9A 2ED1A 2KNBB 2JT4A 3EG1A 2LZ6B 2L3SA 1NLOC 1QLYA 3EHRA 1CKAA 4RTXA 1OEBA 5ECAA 2DLPA 2I0NA 5IHNA 2LQNA 4RTZA 1G83A 2LMJA 1TG0A 2OJ2A 5I11A 5L23A 1AVZC 5GJWB 2DA9A 4E6RA 2X3XD 2JS0A 2CT3A 1QCFA 1GCPA 4AG2C 3NHNA 2O31A 1HD3A 1WDXA 2P4RA 1JXOA 1EFNA 2MCNA 3REAB 1BBZA 2DVJA 2YUQA 2KRSA 3QWXX 2L0AA 4J9HA 2X3WD 2DMOA 2O2OA 3QWYA 5IXBA 1Z9ZA 3U23A 2OAWA 2CH4A 1PRLC 2EKHA 2FRYA 1ZX6A 2KT8A 4IIMA 4DEYA 3PVLA 1WLPB 2KE9A 1UDLA 4OMLA 1JO8A 1UHFA 4D8KA 2FG0A 2RQWA 4F16A 3H41A 1HSQA 1PWTA 2ROTA 1T3SA 4J9GA 3PE0A 3UF4A 4RTTA 1UGVA 4CC4B 2PNIA 2O9SA 2ESWA 1ABQA 2K9GA 1AD5A 1WFWA 3VS3A 2O9VA 3H0FA 2AK5A 1W1FA 2C0IA 1WX6A 1JQQA 3RBBB 3TVTA 4J9IA 1WA7A 4JZ4A 2GGRA 1K9AA 2DM1A 2YT6A 4OMOA 4Z89A 1M8MA 1K76A 4KRTA 1M3AA 1YCSB 2ENMA 2YUNA 4WCIA 1RUWA 1OPKA 2FRWA 1S1NA 1SRMA 2NUZA 1MV3A 1AZEA 3CQTA 3IQLA 2DL4A 3VS5A 2ABLA 1KFZA 1UHCA 3UA6A 2KRMA 4HVUA 1M27C 2RQRA 2RQVA 2LCSA 1VYTA 1YWOA 4ORZA 3M0TA 3REBB 1SEMA 2K79A 1FMKA 1UFFA 1FYNA 1T0HA 4AFSC 2XMFA 1YN8A 4HCKA 4QT7A 1TUCA 2EYXA 3UATA 1NG2A 1GFDA 2J6OA 1WXUA 4RTYA 3VRZA 1AWWA 4A63B 1Y0MA 2ROLA 2B86A 4AG1C 1SHFA 1X2KA 2HBWA 4RTWA 4Z8AA 4AFUC 2LX7A 3A98A 3VS7A 5IHKA 4M4ZA 1KJWA 1PRMC 1QWFA 1UJYA 1N5ZA 1ABOA 2BZ8A 3EG2A 1AOJA 1XOVA 2BTTA 1ZUUA 2EYZA 3M0SA 1OOTA 2CUDA 2RF0A 3NPFA 1NEBA 2DILA 4JJDA 2CSQA 2M51A 2EYWA 5FWCA 1GBRA 1Y57A 2PZ1A 2KEAA 2GQIA 3EG0A 2YDLA 2JS2A 2DBMA 2RNAA 1X6BA 1GFCA 2CDTA 1PKSA 2RMOA 2RN8A 4EIKA 2K3BA 3EHQA 1AWXA 3M0PA 4AFQC 5GJVB 2LJ1A 2LNHB 2O88A 2H8HA 2NWMA 1ARKA 1ZBJA 2EBPA 2MOXA 2W10A 1T3LA 4HVVA 2FPDA 2JTEA 2BZYA 3THKA 2EGEA 2DYBA 2F2WA 2GNCA 2AKLA 1M30A 3GBQA 1NYGA 1WI7A 1ZSGA 4OMPA 1RLPC 1V1CA 2G6FX 4GBQA 4LNPA 2JW4A 1IO6A 2V1QA 2C0OA 4RTUA 3ULRB 1MV0B 2DJQA 2CT4A 1AEYA 4GLMA 1U3OA 2JMCA 4X1VA 2LJ3A 2F2XA 2LQWA 1W70A 2HDAA 2M0YA 4J9DA 1JXMA 4CC3A 1WXBA 1GRIA 3VS1A 2L2PA 2FPFA 2DF6A 1PKTA 2C0TA 1E7OA 1KIKA 1OV3A 3VS2A 2JXBA 3RNJA 1GL5A 1RLQC 2EPDA 2K2MA 2KGTA 3VRYA 2EW3A 3I5SA 3M0UA 4J9EA 1B3QA 2QDLA 2GBQA 1BU1A 3NMZC 2K6DA 1W6XA 2KXDA 4JPBW 3JV3A 4LUDA 2FPEA 2FO0A 2D0NA 1ZUYA 4FSSA 1VA7A 1X69A 1M3BA 1X6GA 3UA7A 1UUEA 2VWFA 5FWBA 2J05A 1OPLA 2EGAA 1WYXA 2HSPA 1QKWA 2CREA 2PTKA 4Y92A 1H3HA 4LN2A 1AWJA 2CH4W 4CC7A 1I07A 3VS0A 4K11A 2GTOA 2KYMA 1UG1A 1J3TA 1SSHA 1G2BA 3SHWA 1LCKA 4ESRA 1QKXA 1K1ZA 2KROA 1H8KA 1X27A 2YSQA 2BZXA 2KYBA 1M3CA 2E5KA 2YUOA 2LP5A 4F14A 1KSWA 2DBKA 4IIOA 1WXTA 3O5ZA 1YWPA 4JJCA 2AKKA 1K0XA 2JMAA 1CKBA 2DNUA 5FW9A 2J06A 4F17A 2IIMA 4D8DA 2SRCA 2A36A 2VVKA 1BK2A 2J6FA 2RQTA 1ZUKA 3ZL7C 1AWOA 2DX1A 4HXJA 2J7IA 4J9BA 2SEMA 2CSIA 1TUDA 2JM9A 4RTVA 2EYYA 3M0RA 2FEIA 1YNZA 3TSWA 1K0SA 4R0KA 1H92A 1UJ0A 2DE0X 2DL8A 2F2VA 2VKNA 1VYVA 2GTJA 2DL7A 2EGCA 3VS6A 1JU5C 4JZ3A 1QWEA 1CSKA 4OMQA 4J9FA 4OMMA 2A28A 2JM8A 2LJ0A 5IHIA 1BB9A 5IH2A 1SHGA 2YUPA 1X43A 1NYFA 3EGUA 1U5SA 3R6NA 3H0IA 2D8HA 1A0NB 5IXFA 2EVRA 1SRLA 2DL5A 2KBTA 3I35A 1WIEA 2ECZA 1JEGA 1PNJA 3LH5A 4LE9A 2RPNA 4Z88A 2DRKA 1VYUA 3PVQA 1B07A 1E6HA 2ED0A 1UE9A 1GCQC 1AZGB 1UECA 1Z9QA 2W0ZA 1NM7A 3KFVA 2EQIA 3I9QA 2L3QA 5EC7A 2AZSA 1X2QA 4RUGA 1NEGA 2RQUA 2A08A 1K4US 2KXCA 1MUZA 2A37A 2AZVA 2KT1A 4ZNXA 3M0QA 5HCKA 1I1JA 1GCQA 2D8JA 1T0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEQ A;  4OMN A;  4JJB A;  4LUE A;  3I5R A;  5I22 A;  2K7A A;  1NLP C;  4HVW A;  2J6K A;  3H0H A;  4J9C A;  4CC2 A;  1I0C A;  4DEX A;  3TSZ A;  1SPK A;  2MIO A;  1GBQ A;  1U06 A;  1E6G A;  3EG3 A;  3C0C A;  1HJD A;  1PHT A;  2D1X A;  2CUB A;  2V1R A;  4AFZ C;  2KR3 A;  2HCK A;  2L3P A;  2KRN A;  3VS4 A;  2DRM A;  3SEM A;  2OI3 A;  3NGP A;  1ZLM A;  1YP5 A;  2DL3 A;  3FJ5 A;  1UTI A;  1RI9 A;  2ED1 A;  2KNB B;  2JT4 A;  3EG1 A;  2LZ6 B;  2L3S A;  1NLO C;  1QLY A;  3EHR A;  1CKA A;  4RTX A;  1OEB A;  5ECA A;  2DLP A;  2I0N A;  5IHN A;  2LQN A;  4RTZ A;  1G83 A;  2LMJ A;  1TG0 A;  2OJ2 A;  5I11 A;  5L23 A;  1AVZ C;  5GJW B;  2DA9 A;  4E6R A;  2X3X D;  2JS0 A;  2CT3 A;  1QCF A;  1GCP A;  4AG2 C;  3NHN A;  2O31 A;  1HD3 A;  1WDX A;  2P4R A;  1JXO A;  1EFN A;  2MCN A;  3REA B;  1BBZ A;  2DVJ A;  2YUQ A;  2KRS A;  3QWX X;  2L0A A;  4J9H A;  2X3W D;  2DMO A;  2O2O A;  3QWY A;  5IXB A;  1Z9Z A;  3U23 A;  2OAW A;  2CH4 A;  1PRL C;  2EKH A;  2FRY A;  1ZX6 A;  2KT8 A;  4IIM A;  4DEY A;  3PVL A;  1WLP B;  2KE9 A;  1UDL A;  4OML A;  1JO8 A;  1UHF A;  4D8K A;  2FG0 A;  2RQW A;  4F16 A;  3H41 A;  1HSQ A;  1PWT A;  2ROT A;  1T3S A;  4J9G A;  3PE0 A;  3UF4 A;  4RTT A;  1UGV A;  4CC4 B;  2PNI A;  2O9S A;  2ESW A;  1ABQ A;  2K9G A;  1AD5 A;  1WFW A;  3VS3 A;  2O9V A;  3H0F A;  2AK5 A;  1W1F A;  2C0I A;  1WX6 A;  1JQQ A;  3RBB B;  3TVT A;  4J9I A;  1WA7 A;  4JZ4 A;  2GGR A;  1K9A A;  2DM1 A;  2YT6 A;  4OMO A;  4Z89 A;  1M8M A;  1K76 A;  4KRT A;  1M3A A;  1YCS B;  2ENM A;  2YUN A;  4WCI A;  1RUW A;  1OPK A;  2FRW A;  1S1N A;  1SRM A;  2NUZ A;  1MV3 A;  1AZE A;  3CQT A;  3IQL A;  2DL4 A;  3VS5 A;  2ABL A;  1KFZ A;  1UHC A;  3UA6 A;  2KRM A;  4HVU A;  1M27 C;  2RQR A;  2RQV A;  2LCS A;  1VYT A;  1YWO A;  4ORZ A;  3M0T A;  3REB B;  1SEM A;  2K79 A;  1FMK A;  1UFF A;  1FYN A;  1T0H A;  4AFS C;  2XMF A;  1YN8 A;  4HCK A;  4QT7 A;  1TUC A;  2EYX A;  3UAT A;  1NG2 A;  1GFD A;  2J6O A;  1WXU A;  4RTY A;  3VRZ A;  1AWW A;  4A63 B;  1Y0M A;  2ROL A;  2B86 A;  4AG1 C;  1SHF A;  1X2K A;  2HBW A;  4RTW A;  4Z8A A;  4AFU C;  2LX7 A;  3A98 A;  3VS7 A;  5IHK A;  4M4Z A;  1KJW A;  1PRM C;  1QWF A;  1UJY A;  1N5Z A;  1ABO A;  2BZ8 A;  3EG2 A;  1AOJ A;  1XOV A;  2BTT A;  1ZUU A;  2EYZ A;  3M0S A;  1OOT A;  2CUD A;  2RF0 A;  3NPF A;  1NEB A;  2DIL A;  4JJD A;  2CSQ A;  2M51 A;  2EYW A;  5FWC A;  1GBR A;  1Y57 A;  2PZ1 A;  2KEA A;  2GQI A;  3EG0 A;  2YDL A;  2JS2 A;  2DBM A;  2RNA A;  1X6B A;  1GFC A;  2CDT A;  1PKS A;  2RMO A;  2RN8 A;  4EIK A;  2K3B A;  3EHQ A;  1AWX A;  3M0P A;  4AFQ C;  5GJV B;  2LJ1 A;  2LNH B;  2O88 A;  2H8H A;  2NWM A;  1ARK A;  1ZBJ A;  2EBP A;  2MOX A;  2W10 A;  1T3L A;  4HVV A;  2FPD A;  2JTE A;  2BZY A;  3THK A;  2EGE A;  2DYB A;  2F2W A;  2GNC A;  2AKL A;  1M30 A;  3GBQ A;  1NYG A;  1WI7 A;  1ZSG A;  4OMP A;  1RLP C;  1V1C A;  2G6F X;  4GBQ A;  4LNP A;  2JW4 A;  1IO6 A;  2V1Q A;  2C0O A;  4RTU A;  3ULR B;  1MV0 B;  2DJQ A;  2CT4 A;  1AEY A;  4GLM A;  1U3O A;  2JMC A;  4X1V A;  2LJ3 A;  2F2X A;  2LQW A;  1W70 A;  2HDA A;  2M0Y A;  4J9D A;  1JXM A;  4CC3 A;  1WXB A;  1GRI A;  3VS1 A;  2L2P A;  2FPF A;  2DF6 A;  1PKT A;  2C0T A;  1E7O A;  1KIK A;  1OV3 A;  3VS2 A;  2JXB A;  3RNJ A;  1GL5 A;  1RLQ C;  2EPD A;  2K2M A;  2KGT A;  3VRY A;  2EW3 A;  3I5S A;  3M0U A;  4J9E A;  1B3Q A;  2QDL A;  2GBQ A;  1BU1 A;  3NMZ C;  2K6D A;  1W6X A;  2KXD A;  4JPB W;  3JV3 A;  4LUD A;  2FPE A;  2FO0 A;  2D0N A;  1ZUY A;  4FSS A;  1VA7 A;  1X69 A;  1M3B A;  1X6G A;  3UA7 A;  1UUE A;  2VWF A;  5FWB A;  2J05 A;  1OPL A;  2EGA A;  1WYX A;  2HSP A;  1QKW A;  2CRE A;  2PTK A;  4Y92 A;  1H3H A;  4LN2 A;  1AWJ A;  2CH4 W;  4CC7 A;  1I07 A;  3VS0 A;  4K11 A;  2GTO A;  2KYM A;  1UG1 A;  1J3T A;  1SSH A;  1G2B A;  3SHW A;  1LCK A;  4ESR A;  1QKX A;  1K1Z A;  2KRO A;  1H8K A;  1X27 A;  2YSQ A;  2BZX A;  2KYB A;  1M3C A;  2E5K A;  2YUO A;  2LP5 A;  4F14 A;  1KSW A;  2DBK A;  4IIO A;  1WXT A;  3O5Z A;  1YWP A;  4JJC A;  2AKK A;  1K0X A;  2JMA A;  1CKB A;  2DNU A;  5FW9 A;  2J06 A;  4F17 A;  2IIM A;  4D8D A;  2SRC A;  2A36 A;  2VVK A;  1BK2 A;  2J6F A;  2RQT A;  1ZUK A;  3ZL7 C;  1AWO A;  2DX1 A;  4HXJ A;  2J7I A;  4J9B A;  2SEM A;  2CSI A;  1TUD A;  2JM9 A;  4RTV A;  2EYY A;  3M0R A;  2FEI A;  1YNZ A;  3TSW A;  1K0S A;  4R0K A;  1H92 A;  1UJ0 A;  2DE0 X;  2DL8 A;  2F2V A;  2VKN A;  1VYV A;  2GTJ A;  2DL7 A;  2EGC A;  3VS6 A;  1JU5 C;  4JZ3 A;  1QWE A;  1CSK A;  4OMQ A;  4J9F A;  4OMM A;  2A28 A;  2JM8 A;  2LJ0 A;  5IHI A;  1BB9 A;  5IH2 A;  1SHG A;  2YUP A;  1X43 A;  1NYF A;  3EGU A;  1U5S A;  3R6N A;  3H0I A;  2D8H A;  1A0N B;  5IXF A;  2EVR A;  1SRL A;  2DL5 A;  2KBT A;  3I35 A;  1WIE A;  2ECZ A;  1JEG A;  1PNJ A;  3LH5 A;  4LE9 A;  2RPN A;  4Z88 A;  2DRK A;  1VYU A;  3PVQ A;  1B07 A;  1E6H A;  2ED0 A;  1UE9 A;  1GCQ C;  1AZG B;  1UEC A;  1Z9Q A;  2W0Z A;  1NM7 A;  3KFV A;  2EQI A;  3I9Q A;  2L3Q A;  5EC7 A;  2AZS A;  1X2Q A;  4RUG A;  1NEG A;  2RQU A;  2A08 A;  1K4U S;  2KXC A;  1MUZ A;  2A37 A;  2AZV A;  2KT1 A;  4ZNX A;  3M0Q A;  5HCK A;  1I1J A;  1GCQ A;  2D8J A;  1T0J A; 
#chains in the Genus database with same CATH topology
 1OU8 A;  3A1P A;  3I5R A;  4LDU A;  3AT1 B;  1NLP C;  3RER A;  1RL2 A;  3CEY A;  3M56 A;  5GAN e;  3EG3 A;  2CUB A;  5LJ3 e;  3CCV Q;  5GAO n;  1QVF A;  1VQ6 A;  3VS4 A;  4KUL A;  1ZLM A;  3OYB A;  4XTY A;  1RI9 A;  2ED1 A;  4CI0 C;  1WJQ A;  1NLO C;  1FMW A;  4LDY A;  2QQ9 A;  4C8Q A;  2OTJ A;  3EHR A;  3OYD A;  1CKA A;  4O6J A;  1OEB A;  1SF9 A;  5ECA A;  1QP2 A;  2LQN A;  3HP9 A;  3CCE T;  2XK0 A;  5I11 A;  2JS0 A;  1VQO T;  1GCP A;  3GF5 A;  2O31 A;  3M54 A;  1HD3 A;  2V8I A;  1VQ6 Q;  1GXI E;  1FMV A;  7AT1 B;  4VUB A;  2X4X A;  2DVJ A;  2HNI A;  1N27 A;  2F5K A;  2KRS A;  3QWX X;  3JCM d;  1KG1 A;  1TU0 B;  3R6O A;  4PJL A;  2LC4 A;  5J26 A;  5IXB A;  2OTJ Q;  4C8Q F;  3U23 A;  2CH4 A;  2EKH A;  1KQS A;  2RHZ A;  3PVL A;  1WLP B;  5KYN A;  5IT9 E;  2NUT B;  2O4X B;  4D8K A;  1NZ9 A;  1DJ7 B;  1TS9 A;  3INZ A;  3P8H A;  4F16 A;  1PWT A;  2EFI A;  1M1G A;  5FRM A;  4J9G A;  2EAY A;  2RD1 A;  1M1F A;  1UGV A;  4CC4 B;  3I56 A;  3G6E A;  3EH1 A;  3QYH B;  4QVZ A;  3OQ5 A;  3M4G A;  1YIT T;  1OI1 A;  2VC8 A;  2DEU A;  1JQQ A;  3TVT A;  2H3E B;  1IZ6 A;  3RKY A;  4OMO A;  2QA4 T;  2YUN A;  4WCI A;  1RUW A;  1OPK A;  3OYF A;  1MMG A;  2VV5 A;  1IHW A;  2LT4 A;  1O75 A;  5GAN 8;  1I81 A;  2QEX T;  2NUZ A;  5J3B A;  1AZE A;  3A8G B;  3CCM T;  1Q7Y C;  1KFZ A;  3M9Q A;  5GAM d;  4BI3 A;  3I56 Q;  3G6E Q;  2P0P A;  1M27 C;  3LX7 A;  1PM3 A;  3PGG A;  2XDB A;  2LCS A;  3MET A;  4QQ6 A;  3CBP A;  3DB3 A;  4JJN K;  3CPW P;  2RI3 A;  2COY A;  1N8R R;  3REB B;  1SEM A;  2K79 A;  1UFF A;  3L1A A;  4HCK A;  2ZPG B;  4PFO A;  5GAN 3;  1BKB A;  2QQS A;  3H9N A;  5CKE A;  1GFD A;  3VRZ A;  1D3B A;  3JCM c;  4MZM A;  4ELY C;  4A63 B;  1Y0M A;  2ROL A;  5GAN 2;  2HL3 A;  4RTW A;  3M57 A;  4AFU C;  2LX7 A;  3VS7 A;  1KD1 C;  1RAF B;  2I2L A;  4M4Z A;  2LDM A;  4E7J A;  3L2Q A;  1PRM C;  1K9M R;  1Y96 B;  5GAO q;  1M1K C;  1BI1 A;  3UPU A;  3JCM J;  2HMA A;  2V8J A;  3JCM P;  1AOJ A;  1XOV A;  3OSV A;  4M75 F;  2RF0 A;  2OTL Q;  4JJD A;  2CSQ A;  2EYW A;  2D0Q B;  2KEA A;  1G3S A;  3OS0 A;  3EG0 A;  4C5H A;  2DBM A;  1X6B A;  1PKS A;  5GAM j;  9ATC B;  1ZA1 B;  3CD6 T;  2K3B A;  3EHQ A;  4AFQ C;  3OYK A;  5GJV B;  1N8R U;  1TTH B;  4M77 G;  2PUO B;  1VQ7 A;  3CXC P;  4EMK C;  2W10 A;  2E65 A;  3WXM B;  3G71 A;  3QZ5 B;  2BZY A;  3THK A;  3CCR T;  5GAN 7;  1M30 A;  5GAN d;  3OYA A;  4M75 D;  1WNL A;  4M78 E;  4OMP A;  4BDZ A;  2G6F X;  3OS5 A;  4XU1 A;  5LJ3 d;  1K9M U;  1WQW A;  2EQJ A;  4PLL A;  4JS5 A;  4QW2 A;  2DTO A;  2RO0 A;  3ULR B;  1MV0 B;  4M77 C;  2BKD N;  3CCU A;  1BIB A;  4X1V A;  1RI0 A;  3RUX A;  1WHM A;  4NL3 A;  2HDA A;  1VQ7 Q;  1M9S A;  1GRI A;  3VS1 A;  3G71 Q;  2JOY A;  4BE2 A;  1Q82 C;  4FYX B;  4GY5 A;  2MWP A;  2DF6 A;  1E7O A;  3E1S A;  2CP7 A;  4M7D E;  1WHG A;  4M77 A;  2K2M A;  1QVG A;  2RI5 A;  2EW3 A;  3I5S A;  1UB4 A;  4J9E A;  5CKB A;  4J8O A;  3NMZ C;  4X9D A;  2K6D A;  4OMF B;  2FPE A;  2L5Q A;  2QYZ A;  2E6N A;  3CCU Q;  3T9N A;  1VA7 A;  1SG5 A;  1UUE A;  3JCM g;  5FWB A;  2J05 A;  1VQO A;  3L2W A;  3OW2 S;  4C92 G;  2CRE A;  1M4Z A;  1NJI C;  5GAN j;  3I55 T;  3OY9 A;  4LDW A;  4C0D C;  4JRQ A;  1I5O B;  1TXQ A;  1YIJ T;  5LJ3 j;  2EIF A;  2EQM A;  3SHW A;  1LCK A;  4ESR A;  1QKX A;  5FU7 C;  1H8K A;  1X27 A;  2YSQ A;  1JJ2 P;  2BZX A;  2YUO A;  4L59 A;  4F14 A;  3V8L A;  4LXC A;  4EMK B;  1WHH A;  2CS7 A;  2G3R A;  1D0X A;  2RJE A;  1WHJ A;  4C92 C;  1TH7 A;  4DBH A;  2IIM A;  4D8D A;  1VQK T;  1BK2 A;  1VQO Q;  4XK8 E;  4IUU A;  3ASK A;  3BDL A;  1AWO A;  1QMC A;  2YRD A;  2K3X A;  3A5Z B;  2CSI A;  4FU6 A;  4RTV A;  2EYY A;  1PG5 B;  4DQ2 A;  2FEI A;  4M77 E;  2CYZ B;  1H92 A;  3GIB A;  4M77 B;  3VYG A;  2EGC A;  1QQJ A;  5CKD A;  4C92 A;  5GAM g;  1P92 A;  2YXY A;  2A28 A;  2EQU A;  3RES A;  4OB2 B;  2EJ9 A;  1WJR A;  5IH2 A;  3O8V A;  1SHG A;  4C5E A;  2RHU A;  1WGS A;  4FT2 A;  4F7U G;  2D8H A;  1A0N B;  4IKF A;  5IXF A;  2EVR A;  2A7Y A;  2MMP A;  4D6W A;  2KBT A;  4HCZ A;  4KGV B;  4XTV A;  1ZQ1 A;  2XKO C;  4Z88 A;  4MDW A;  4KBM B;  1D1C A;  1VQL T;  1E6H A;  4B6M A;  1WHK A;  2L3Q A;  3JRZ A;  2DK3 A;  3QII A;  3OBY A;  3BY7 A;  3NTK A;  1Q81 C;  2E4H A;  3SWN C;  1MHN A;  5LJ5 e;  4DOV A;  3CCL T;  3JCM e;  2V8K A;  1W2B S;  3CMA T;  2AZV A;  4OP0 A;  2KT1 A;  1R0B G;  4M7A C;  4ZNX A;  3M0Q A;  5FU7 B;  2KI7 A;  2D8J A;  1T0J A;  1X6O A;  5GMK e;  1YJN A;  4OMN A;  5GMK l;  4X34 A;  2K7A A;  4LDX A;  3KBG A;  1K8A R;  4F7U A;  4PJO D;  2J6K A;  4V2S A;  4C92 E;  4J9C A;  5GAN h;  4DEX A;  2CP3 A;  4C92 B;  2DIQ A;  2X4W A;  4ZGE B;  2QGG A;  4XU3 A;  1E6G A;  4C5I A;  3C0C A;  5LJ3 h;  3CC4 T;  1YJ9 A;  4M7A A;  3OS2 A;  2KR3 A;  3S6W A;  4J5Y A;  2PU9 B;  2HCK A;  3MJX A;  3CD6 A;  4KUD K;  1S72 Q;  2K3Y A;  4HA8 A;  5GAN g;  5KYW A;  3QHS A;  2P0K A;  1QVF P;  4LDV A;  3FJ5 A;  4E7S A;  1YJN Q;  5LJ3 g;  3FC3 A;  3QDR B;  2JT4 A;  1VIE A;  1WHL A;  4WF2 A;  4F7U F;  3A8M B;  4N0A C;  2DLP A;  4C0G A;  3S3M A;  3JB9 G;  5GAM e;  1G83 A;  2OJ2 A;  1YJ9 Q;  5L23 A;  2RK1 A;  2DA9 A;  4YTL A;  1QCF A;  5DM7 R;  1WDX A;  3EFR A;  5CO7 A;  2ZAE A;  3LLR A;  1K8A U;  1RAE B;  1B34 B;  3ER0 A;  1MMA A;  1V29 B;  2DYI A;  1M2V A;  3X24 B;  4J9H A;  2DMO A;  2O2O A;  3QWY A;  1Z9Z A;  4FM4 B;  2DXT A;  4ATO A;  3EFO B;  1PRL C;  2FRY A;  4FIB A;  3SWN B;  4DEY A;  1QCO A;  5D6Y A;  2KE9 A;  1UDL A;  1JO8 A;  2CZ6 B;  2WAC A;  4MML A;  4M7A E;  3H41 A;  5GAO l;  1T3S A;  4M7A B;  3UF4 A;  2LCL A;  4ZTJ A;  2O9S A;  3M5A A;  2DER A;  1ABQ A;  2K9G A;  1WFW A;  1IHV A;  2AK5 A;  5KYW B;  2CP2 A;  3MKD A;  2C0I A;  1WX6 A;  3QG1 A;  1OZ3 A;  3CCQ T;  4J9I A;  1WA7 A;  5GAN 4;  1BI2 A;  2LX9 A;  1KK7 A;  1YFN A;  4N4G A;  1M8M A;  4KRT A;  1UGS B;  3M53 A;  3QSU A;  1SRM A;  3CQT A;  1U1S A;  3HRT A;  2L3R A;  3RKW A;  3X28 B;  3L2Z A;  3HRU A;  2E5Q A;  1FWZ A;  3UA6 A;  1YJW A;  1Q86 C;  4HVU A;  2X35 A;  3PMI A;  2NUT A;  2O4X A;  4N4I A;  2ZGW A;  4QKU A;  5FRO A;  1YWO A;  4E7Z A;  4XU0 A;  3LGL A;  1YHQ T;  5CK9 A;  2M1H A;  3RKX A;  1M2V B;  5DLO A;  2Y90 A;  1Q7Y R;  1N9S A;  3WVE B;  3CPW S;  1TUC A;  4XTU A;  2ATC B;  3FJP A;  4FT4 A;  3C95 A;  2KQW A;  4RTY A;  2VUB A;  2B86 A;  3EGX A;  1VQ4 T;  5GAN 5;  1NPP A;  3A98 A;  5IHK A;  1VQN T;  4ME7 A;  2CP5 A;  1YJW Q;  3PMT A;  1N5Z A;  1ABO A;  2BZ8 A;  3URG A;  2FZG B;  1M2O A;  2VAS A;  3OBW A;  1RAG B;  3OYH A;  1LPL A;  1KD1 R;  4DOW A;  1ZSZ C;  3RDV A;  1M90 C;  5KYX A;  4II1 A;  3RR6 A;  3FEO A;  2R58 A;  1M1K R;  1IB8 A;  3HTR A;  5C0M A;  2GQI A;  5LJ5 d;  3CC7 A;  2RNA A;  3VUB A;  1GFC A;  3PFS A;  2XU8 A;  4EIK A;  3M0P A;  1AWX A;  4J6Y A;  1UGR B;  2KY9 A;  4J6W A;  2NWM A;  1WPY A;  1Q7Y U;  3RIR A;  2EBP A;  4UC4 A;  2FPD A;  1RAD B;  4BD3 A;  3CXC S;  1VQ9 T;  2RK2 A;  2DYB A;  2GNC A;  3GBQ A;  3VYH B;  1Y96 A;  5CCA A;  1RLP C;  4M78 G;  2EKO A;  3CC7 Q;  1IO6 A;  2V1Q A;  2GQV A;  2JVV A;  2DAQ A;  3EGX B;  3CME A;  2DJQ A;  5FU6 C;  2CT4 A;  3J81 E;  2JMC A;  4PKC C;  3G1J A;  3UT1 A;  1RAA B;  3CC4 A;  1KD1 U;  2F2X A;  3CC2 A;  2LQW A;  3ZBD A;  4C8Q D;  2BIV A;  3J7A F;  3VKI A;  3HPW A;  4BAC A;  1TWB A;  3JCM W;  1M1K U;  1JBM A;  4N4H A;  3FDR A;  2L2P A;  4KUI A;  3CCS T;  4M78 C;  3JCM X;  3VS2 A;  2JXB A;  2Y4Y A;  5KYX B;  4M7D G;  1GL5 A;  1R8O B;  1RLQ C;  3VRY A;  5LJ5 j;  3G4S A;  3M0U A;  1VQM A;  3M58 A;  2LTO A;  4KT0 E;  1W6X A;  3MEV A;  4JPB W;  1Q82 R;  3L2V A;  5L8R E;  1QVG P;  3BFM A;  3CME Q;  2HZY A;  2D0N A;  3A8H B;  1ZUY A;  3N5B B;  1M5Q 1;  1W4S A;  5GMK j;  3UA7 A;  3CC2 Q;  4BE1 A;  2EGA A;  1ZSZ B;  4M78 A;  2HSP A;  2DIG A;  1MMD A;  2AT1 B;  2E70 A;  4M7D C;  3V7R A;  3VS0 A;  3L42 A;  1WJS A;  4E7K A;  2GTO A;  2KYM A;  3G4S Q;  1VQP A;  4O5V A;  2KRO A;  1LNX A;  2R5M A;  1HK9 A;  1VQM Q;  4A4K A;  3PT9 A;  2KYB A;  1NJI R;  4IIO A;  2QTV A;  2X51 A;  3OYG A;  1JJ2 S;  4JJC A;  4M7D A;  4J83 A;  4F17 A;  2DNU A;  1VQ5 A;  2LNV A;  2VVK A;  2KDS A;  3J80 E;  4Y28 E;  2HD0 A;  3EG9 A;  2DX1 A;  3CCJ T;  2DTH A;  4HXJ A;  2J7I A;  4QVD A;  1C1A A;  2SEM A;  1TUD A;  2JM9 A;  3M0R A;  3LYI A;  1Q82 U;  1VQ8 T;  1YNZ A;  3MEA A;  4R0K A;  1UJ0 A;  4XU2 A;  5FU6 B;  3PIP A;  2DL8 A;  2VKN A;  1I4K 1;  1VQP Q;  3D7S B;  2E3H A;  1G3T A;  2DL7 A;  1NPR A;  3CBO A;  1JU5 C;  1QWE A;  1CSK A;  2K57 A;  3BE3 A;  2JM8 A;  1BI0 A;  2LJ0 A;  4RMO A;  3LWH A;  1SKU B;  5IHI A;  2GF7 A;  1VQ5 Q;  4RCB A;  1X43 A;  1IRX A;  1U5S A;  4M78 B;  2M16 A;  1LVK A;  2RA2 A;  1SRL A;  4EMK A;  1H64 1;  1OQK A;  2HQX A;  1IGQ A;  3FRN A;  1WIE A;  3I35 A;  4JRI A;  1NJI U;  3HSB A;  2LQ8 A;  3LH5 A;  1YHQ A;  3ME9 A;  2EJG A;  2DRK A;  2RHY A;  2ED0 A;  1JRI A;  1GCQ C;  1UEC A;  1Z9Q A;  1R0C B;  2W0Z A;  2EQI A;  2YRV A;  3VUZ A;  2RM4 A;  3WVD B;  1QW1 A;  5LJ5 h;  4E7L A;  2HSE B;  4RUG A;  3JCM h;  5A0G A;  1NEG A;  1VQ4 A;  2RQU A;  2A08 A;  4M7D B;  2KXC A;  5A2Q E;  2E12 A;  5GMK h;  2K5L A;  3EG9 B;  5HCK A;  2QGF B;  2MAM A;  1GCQ A;  3EGD B;  1YI2 T;  4JJB A;  4DA4 A;  1Q81 R;  5LJ5 g;  3CCE A;  1OUL A;  1OZ2 A;  3H8Z A;  8ATC B;  3A8O B;  4HVW A;  3H0H A;  4CC2 A;  1I0C A;  4KH0 B;  3JSC A;  4EMG A;  3TSZ A;  5DY9 A;  5GAO r;  3RMQ A;  3V8K A;  1PHT A;  2D1X A;  3NTI A;  5HKC A;  4M77 F;  4J7F A;  2L3P A;  2KRN A;  1SSF A;  2MK5 A;  3P8D A;  3SEM A;  3NGP A;  4FYY B;  2QG9 B;  3E19 A;  2DL3 A;  4BY6 C;  3MP8 A;  2VGN A;  3CCV T;  3CCE Q;  3EG1 A;  1QVF S;  2LZ6 B;  1PD0 A;  1QLY A;  2QDY B;  2CKK A;  1KC8 C;  5GAM h;  4HCC A;  3M59 A;  2L89 A;  2I0N A;  5IHN A;  1XTD A;  4RTZ A;  4PJO C;  4HT8 A;  1TG0 A;  1AVZ C;  2PVD B;  4E6R A;  2X3X D;  1YIT A;  3DB4 A;  2JUF A;  3M4Y A;  3NHN A;  2HKQ B;  2V26 A;  1Q81 U;  1JXO A;  1EFN A;  2MCN A;  2GFU A;  3REA B;  2QA4 A;  1BBZ A;  2L0A A;  2HAX A;  2E10 A;  3QJ6 A;  5D6W A;  1VQ6 T;  1BCO A;  3OMC A;  2QEX A;  2YLC A;  2HQH A;  2OAW A;  3CCM A;  5KE3 A;  1Y07 A;  1BIA A;  4NOY A;  1ZX6 A;  2KT8 A;  4IIM A;  3CCS A;  4PFZ A;  4AT1 B;  2DFU A;  2RQW A;  2OTJ T;  4M7A G;  4XAX B;  1YIT Q;  3PE0 A;  4RTT A;  3OYE A;  4ELZ C;  1KQS S;  2PNI A;  1D0Y A;  2ZPF B;  2PQW A;  1XQH A;  4C92 F;  2DET A;  1AD5 A;  3VS3 A;  2O9V A;  2QA4 Q;  5KYY B;  3X26 B;  1AHJ B;  1W1F A;  3JB9 J;  5EG2 A;  3RBB B;  1IGU A;  2QEX Q;  4BDY A;  2KMT A;  4QQD A;  2GGR A;  3CCM Q;  1K9A A;  3HFO A;  1K76 A;  4C0D B;  1M3A A;  1YCS B;  3OS1 A;  4HCB A;  3GOX A;  1B34 A;  1S1N A;  3LW5 E;  1TOV A;  3L2R A;  3IQL A;  3EFO A;  1FXX A;  1UHC A;  2VXF A;  2BE7 D;  3OYM A;  2XI9 A;  3SWN A;  3M55 A;  1G3Y A;  1VUB A;  1VYT A;  1IRE B;  1G3W A;  4ORZ A;  3M0T A;  3I56 T;  3G6E T;  1FYN A;  3SD4 A;  4PJO E;  1T0H A;  1OU9 A;  4OB1 B;  3MCA B;  2COZ A;  4QT7 A;  4PJO B;  3UAT A;  1NG2 A;  1Q86 R;  2J6O A;  1WXU A;  1H3Z A;  3QBY A;  1AWW A;  2R5A A;  4AG1 C;  3JB9 I;  2HBW A;  4Z8A A;  4MDX A;  4C0F A;  4EDU A;  1KJW A;  2DVE A;  2DEQ A;  4OVA A;  1QWF A;  3CCR A;  1UJY A;  2ZPB B;  4FW1 A;  3QZ9 B;  3OB9 A;  5CQX A;  4FSX A;  3EG2 A;  2QQB A;  2BTT A;  4A4F A;  2EYZ A;  3C12 A;  2COW A;  3M0S A;  3NTH A;  4M7A F;  2CUD A;  3NPF A;  2DIL A;  5GMK m;  2KK4 A;  2M51 A;  3CD6 Q;  3X25 B;  2AHJ B;  1UEB A;  2PZ1 A;  1JB0 E;  5CKF A;  1Q95 G;  2QQR A;  3QKJ A;  2OTL T;  4N0A A;  3MP1 A;  3GP8 A;  2DJZ A;  2CDT A;  1M90 R;  2LJ1 A;  3CCR Q;  2LNH B;  3UWN A;  4CRI A;  2BUD A;  2O88 A;  4FCY A;  2H8H A;  3A8L B;  4F04 B;  1QVP A;  1WZO A;  6AT1 B;  1T3L A;  2RHI A;  2JTE A;  1C0M A;  1Q86 U;  1BCM A;  3JCM f;  2MF2 A;  2EGE A;  2F2W A;  2AKL A;  1FX7 A;  4LD9 K;  5KH6 A;  1NYG A;  1WI7 A;  3GLX A;  3OYJ A;  1ZSG A;  4NS5 A;  1V1C A;  3PTA A;  4GBQ A;  4LNP A;  2JW4 A;  2C0O A;  3L2U A;  2ZCF B;  1AEY A;  3ZEH A;  1U3O A;  3OYL A;  2DTI A;  5GMK i;  3I55 A;  1W70 A;  2JTF A;  2M0Y A;  4J9D A;  4BUG A;  1JXM A;  4CC3 A;  1WXB A;  1YIJ A;  2WSE E;  3FLG A;  1TSF A;  1PKT A;  1VQ7 T;  5HK0 A;  2LVM A;  3KUF A;  3RNJ A;  2LQK A;  2EPD A;  2EYQ A;  3G71 T;  1M90 U;  3JB9 F;  1BU1 A;  1AT1 B;  2C06 A;  3OW2 A;  2X4J A;  1VQK A;  3JV3 A;  4LUD A;  2FO0 A;  5GAO m;  4FSS A;  3ZFJ A;  2HKN A;  2CP0 A;  3HL8 A;  1QVG S;  5GAM f;  1X69 A;  1M3B A;  1X6G A;  3I55 Q;  2JZ2 A;  1X75 C;  3G7Z A;  3HFN A;  4PJJ A;  5A0L A;  1YIJ Q;  5DLQ E;  1NE8 A;  2B8A A;  3CCU T;  1H3H A;  4LN2 A;  1K73 C;  1AWJ A;  4CC7 A;  2QXF A;  4RCC A;  4C8Q C;  4K11 A;  1N9R A;  2E41 A;  1J3T A;  2FL7 A;  1SSH A;  4ZN1 A;  5AT1 B;  1K1Z A;  4EMH A;  2ZZD A;  1M3C A;  2E5K A;  3C94 A;  2LP5 A;  1VQK Q;  2ZPH B;  2DBK A;  1NBE B;  2DZC A;  3JB9 D;  1WXT A;  1YWP A;  3MHX A;  2AKK A;  2KAF A;  3P8B B;  1K0X A;  2JMA A;  5FW9 A;  1O9S A;  1N6A A;  5D6X A;  2OAU A;  2SRC A;  3CPF A;  5HY6 A;  2CP6 A;  4A4E A;  2QTX A;  3F70 A;  3Q1J A;  2J6F A;  2RQT A;  1ZUK A;  8AT1 B;  4GLK A;  3OYN A;  3JCM V;  1VQL A;  1OX8 A;  2JNG A;  4IUT A;  2FHD A;  2AIR B;  3MO8 A;  1ZSZ A;  2WSF E;  3BW1 A;  2DD4 A;  2EJF A;  2GTJ A;  4L5G A;  2XIC A;  3VS6 A;  4JDS A;  4OMQ A;  4J9F A;  4KGZ B;  4XTZ A;  4OMM A;  3CCL A;  1G5V A;  3CMA A;  1F1B B;  2NUP A;  2FZK B;  1BB9 A;  1PCX A;  2RHX A;  2NLU A;  3OYC A;  4DBQ A;  1NYF A;  4X9C A;  2VYT A;  4QVC A;  1KQ2 A;  2XDD A;  1VQL Q;  2DL5 A;  2BE9 B;  2F1L A;  2QI2 A;  4M75 G;  1PNJ A;  4IUP A;  2M9U A;  5HK3 A;  4PNO A;  4J7I A;  5GAN f;  3TQ7 P;  2RPN A;  2DD5 A;  1PC0 A;  4JRK A;  4IUV A;  3SB2 A;  4KH1 B;  1VYU A;  1B07 A;  1U1T A;  2QAS A;  4PL6 A;  4P5N A;  5LJ3 f;  1W2B A;  3CCL Q;  1HXD A;  3I9Q A;  4OB0 B;  1RAB B;  3CMA Q;  4RKU E;  3VJP A;  2AZS A;  1X2Q A;  5GAO p;  1D1B A;  5IAY A;  4C8Q E;  4R56 A;  3NFC A;  4C8Q B;  2A37 A;  5C6S A;  4M75 C;  1EZZ B;  3TU4 K;  5GAN 6;  3EFS A;  3V7S A;  2HEQ A;  4HKE A;  4RG8 A;  4LUE A;  3HRS A;  2LCC A;  3CBM A;  3CC4 Q;  5I22 A;  2MYS A;  3MEW A;  2FVU A;  3MPU B;  3JB9 H;  2GFA A;  2VGM A;  1SPK A;  1ZBX A;  2MIO A;  1GBQ A;  4PLI A;  4PFP A;  1U06 A;  1U8R A;  1EX4 A;  1HJD A;  4RG2 A;  2V1R A;  2NUP B;  4M75 A;  4AFZ C;  2OTL A;  3C4S A;  2IVW A;  3OYY A;  2K2V A;  1PD1 A;  2DRM A;  1G8X A;  2OI3 A;  4BI4 A;  1YP5 A;  1D1A A;  5FLX E;  1UTI A;  2KNB B;  5KYU A;  2ZPI B;  1S72 T;  1M8V A;  2L3S A;  5CAI A;  2Z0W A;  2RJD A;  4C5G A;  3OSS C;  4RTX A;  4M78 F;  4ANJ A;  3QYG B;  2K5I A;  1YJN T;  3EGD A;  1VOM A;  2LMJ A;  1OYX A;  1V76 A;  3BDU A;  5GJW B;  2CT3 A;  2D6F A;  4AG2 C;  3CCQ A;  4ZGD B;  2P4R A;  1KC8 R;  2P0Q A;  1YJ9 T;  3HHT B;  2K5F A;  2E1H A;  2M02 A;  3SFM A;  2CZ0 B;  2YUQ A;  4A53 A;  2FZC B;  2X3W D;  3LH0 A;  2A3L A;  4M7D F;  3QJY A;  3GNG A;  4BE0 A;  3UDC A;  4E2F B;  4KGX B;  4JLI A;  4LD6 A;  4MMK A;  1C6V X;  2JTM A;  4OML A;  4PJM A;  1UHF A;  4M78 D;  4MZT A;  2F69 A;  2XID A;  2FG0 A;  1LJO A;  4M75 E;  1HSQ A;  2ROT A;  4FW2 A;  4M75 B;  3TRE A;  3CCQ Q;  5CVI A;  2ESW A;  2EQK A;  3E9F A;  5IN1 A;  3H0F A;  3DLL A;  2RB6 A;  4C0Z A;  4ZGJ B;  1D3B B;  2YRC A;  2R57 A;  3EAE A;  4FL6 A;  5KYU B;  3DLM A;  4JZ4 A;  2DM1 A;  2YT6 A;  4Z89 A;  1VQN A;  2ENM A;  4M7D D;  1MMN A;  2FRW A;  3QDF A;  2RJF A;  2MWO A;  1KC8 U;  2DXC A;  2IG0 A;  1MV3 A;  1N8R C;  2DL4 A;  3VS5 A;  2ABL A;  1YHQ Q;  3X20 B;  2KRM A;  2XHC A;  3CPW A;  2RQR A;  2RQV A;  4E7I A;  2HL5 C;  3E9G A;  3S3O A;  2CZ7 B;  2QAZ A;  1FMK A;  2L8D A;  4R55 A;  4AFS C;  1VQ4 Q;  4PJO G;  1BI3 A;  2QQA A;  2XMF A;  1YN8 A;  1K9M C;  3QPH A;  1VQN Q;  2EYX A;  2M0O A;  4E7H A;  4ZTF A;  1B7T A;  2IPO B;  2MI6 A;  5KYY A;  1TUG B;  1Y7X A;  1SHF A;  1X2K A;  2JJ9 A;  1RAH B;  2OX7 A;  2X4Y A;  3DKM A;  3E2U A;  1VQ9 A;  3QXE B;  3PNW C;  2CGH A;  2E3I A;  2FYK A;  1ZUU A;  3JAM E;  1OOT A;  2E64 A;  3KXT A;  3PIO A;  1YJW T;  1PSE A;  1NEB A;  2LT1 A;  5FWC A;  1GBR A;  3VV0 A;  1Y57 A;  1UGQ B;  4M77 D;  2PUK B;  5LL6 S;  2YDL A;  4FYW B;  2JS2 A;  4AMC A;  4DBF A;  5CIU A;  2RMO A;  3TEE A;  2JN0 A;  2RN8 A;  2A0F B;  3CXC A;  5KE2 A;  3JCM Q;  4OB3 B;  4PJO A;  1YBY A;  4PJN A;  3GNF B;  1VQ9 Q;  3V7C A;  1D09 B;  2YLB A;  4BB7 A;  2RI2 A;  3JCM b;  1Y71 A;  1ARK A;  1XNI A;  1ZBJ A;  1PSF A;  1XJW B;  4HT9 A;  2MOX A;  2P84 A;  3QUI A;  2FB7 A;  4HVV A;  2Y4X A;  2XG8 D;  4JUV A;  2K4Y A;  2XD0 A;  1RAC B;  2H3J A;  2D9T A;  1OX9 A;  5AYF A;  4E47 A;  5I2S A;  4BI8 B;  1ZHI A;  4OF1 A;  4ZN3 A;  4RTU A;  4A54 A;  4GLM A;  1MND A;  2HBP A;  3MP6 A;  4PJO F;  2P4T A;  3LGF A;  2LJ3 A;  2O01 E;  3CC7 T;  4MZP A;  4Y91 A;  3CCS Q;  1ACM B;  4QQG A;  2QK0 A;  1KHI A;  3RMS A;  5CKH A;  2FPF A;  4A4H A;  3S3N A;  2C0T A;  4BY6 B;  1KIK A;  1OV3 A;  2DPP B;  3QO3 A;  4JS4 A;  1I8F A;  2KGT A;  2XDP A;  5I21 A;  5M9O A;  2RJC A;  1S72 A;  1B3Q A;  4B9X A;  2QDL A;  4EPC A;  2GBQ A;  2WSC E;  2HQE A;  2KXD A;  4C92 D;  2KSS A;  3OYI A;  4XQ3 A;  2DKG A;  5FRN A;  3OMG A;  3CCJ A;  3SDZ A;  3OW2 P;  1WQ7 A;  2VWF A;  1OPL A;  2E6Z A;  1VQ8 A;  1WYX A;  3CME T;  5CR2 A;  5I2M A;  1QKW A;  2PTK A;  4Y92 A;  1YCY A;  2PVG B;  2CH4 W;  1I07 A;  4L6V 5;  2ZPE B;  3CC2 T;  1JJ2 A;  1UG1 A;  3AHU A;  3V8J A;  5KCO A;  1G2B A;  4PK4 A;  4XTX A;  3EH2 A;  5CQY A;  2DXB A;  4J6X A;  1MGQ A;  1UGP B;  2F5T X;  1BYM A;  2GCX A;  2VB6 A;  1IXD A;  1KSW A;  1QP3 A;  1K73 R;  3O5Z A;  2VXE A;  3G4S T;  3CCJ Q;  5D7U A;  1VQM T;  1CKB A;  2J06 A;  2A36 A;  1VQ8 Q;  1EIF A;  4NL2 A;  4JLG A;  3FIF A;  3ZL7 C;  3H6Z A;  4OGC A;  1QCN A;  4J9B A;  1KHC A;  4Z02 A;  1LOJ A;  1R77 A;  3TSW A;  1K0S A;  3GPL A;  2YHT A;  2DE0 X;  2KVQ G;  2F2V A;  5A0D A;  1VYV A;  2CZ1 B;  1KQ1 A;  4OGE A;  1MNE A;  2MPX C;  4JZ3 A;  5LJ5 f;  2DXU A;  3HKS A;  4JRP A;  1X01 A;  1VQP T;  5J39 A;  4Q5W A;  4M7A D;  2DZ9 A;  1YI2 A;  2YUP A;  4F7U E;  2LRQ A;  3EGU A;  3R6N A;  3H0I A;  4F7U B;  4XTW A;  2NYS A;  3TCJ A;  1RAI B;  1VQ5 T;  2YWW A;  3MEU A;  1KQS P;  2PVO B;  3OA6 A;  4A4G A;  2ECZ A;  1JEG A;  1K73 U;  4LE9 A;  1D0Z A;  3PVQ A;  1I5L A;  1UE9 A;  4TVR A;  1AZG B;  3KFV A;  1NM7 A;  4DBR A;  1HYO A;  1ZA2 B;  5EC7 A;  4IUR A;  1W2B P;  1YI2 Q;  4FYV B;  2X9H A;  3CCV A;  1K4U S;  1K8A C;  4C8Q G;  4WTO B;  1MUZ A;  4IUQ A;  2DO3 A;  4B9W A;  3LWI A;  2EWN A;  1VIF A;  3VU3 C;  2RH2 A;  5KCH A;  1I1J A;  3FB9 A; 
#chains in the Genus database with same CATH homology
 2HEQ A;  4OMN A;  4JJB A;  4LUE A;  3I5R A;  5I22 A;  2K7A A;  1NLP C;  4HVW A;  2J6K A;  3H0H A;  4J9C A;  4CC2 A;  1I0C A;  4DEX A;  3TSZ A;  1SPK A;  2MIO A;  1GBQ A;  1U06 A;  1E6G A;  3EG3 A;  3C0C A;  1HJD A;  1PHT A;  2D1X A;  2CUB A;  2V1R A;  4AFZ C;  2KR3 A;  2HCK A;  2L3P A;  2KRN A;  3VS4 A;  2DRM A;  3SEM A;  2OI3 A;  3NGP A;  1ZLM A;  1YP5 A;  2DL3 A;  3FJ5 A;  1UTI A;  1RI9 A;  2ED1 A;  2KNB B;  2JT4 A;  3EG1 A;  2LZ6 B;  2L3S A;  1NLO C;  1QLY A;  3EHR A;  1CKA A;  4RTX A;  1OEB A;  5ECA A;  2DLP A;  2I0N A;  5IHN A;  2LQN A;  4RTZ A;  1G83 A;  2LMJ A;  1TG0 A;  2OJ2 A;  5I11 A;  5L23 A;  1AVZ C;  5GJW B;  2DA9 A;  4E6R A;  2X3X D;  2JS0 A;  2CT3 A;  1QCF A;  1GCP A;  4AG2 C;  3NHN A;  2O31 A;  1HD3 A;  1WDX A;  2P4R A;  1JXO A;  1EFN A;  2MCN A;  3REA B;  1BBZ A;  2DVJ A;  2YUQ A;  2KRS A;  3QWX X;  2L0A A;  4J9H A;  2X3W D;  2DMO A;  2O2O A;  3QWY A;  5IXB A;  1Z9Z A;  3U23 A;  2OAW A;  2CH4 A;  1PRL C;  2EKH A;  2FRY A;  1ZX6 A;  2KT8 A;  4IIM A;  4DEY A;  3PVL A;  1WLP B;  2KE9 A;  1UDL A;  4OML A;  1JO8 A;  1UHF A;  4D8K A;  2FG0 A;  2RQW A;  4F16 A;  3H41 A;  1HSQ A;  1PWT A;  2ROT A;  1T3S A;  4J9G A;  3PE0 A;  3UF4 A;  4RTT A;  1UGV A;  4CC4 B;  2PNI A;  2O9S A;  2ESW A;  1ABQ A;  2K9G A;  1AD5 A;  1WFW A;  3VS3 A;  2O9V A;  3H0F A;  2AK5 A;  1W1F A;  2C0I A;  1WX6 A;  1JQQ A;  3RBB B;  3TVT A;  4J9I A;  1WA7 A;  4JZ4 A;  2GGR A;  1K9A A;  2DM1 A;  2YT6 A;  4OMO A;  4Z89 A;  1M8M A;  1K76 A;  4KRT A;  1M3A A;  1YCS B;  2ENM A;  2YUN A;  4WCI A;  1RUW A;  1OPK A;  2FRW A;  1S1N A;  1SRM A;  2NUZ A;  1MV3 A;  1AZE A;  3CQT A;  3IQL A;  2DL4 A;  3VS5 A;  2ABL A;  1KFZ A;  1UHC A;  3UA6 A;  2KRM A;  4HVU A;  1M27 C;  2RQR A;  2RQV A;  2LCS A;  1VYT A;  1YWO A;  4ORZ A;  3M0T A;  3REB B;  1SEM A;  2K79 A;  1FMK A;  1UFF A;  1FYN A;  1T0H A;  4AFS C;  2XMF A;  1YN8 A;  4HCK A;  4QT7 A;  1TUC A;  2EYX A;  3UAT A;  1NG2 A;  1GFD A;  2J6O A;  1WXU A;  4RTY A;  3VRZ A;  1AWW A;  4A63 B;  1Y0M A;  2ROL A;  2B86 A;  4AG1 C;  1SHF A;  1X2K A;  2HBW A;  4RTW A;  4Z8A A;  4AFU C;  2LX7 A;  3A98 A;  3VS7 A;  5IHK A;  4M4Z A;  1KJW A;  1PRM C;  1QWF A;  1UJY A;  1N5Z A;  1ABO A;  2BZ8 A;  3EG2 A;  1AOJ A;  1XOV A;  2BTT A;  1ZUU A;  2EYZ A;  3M0S A;  1OOT A;  2CUD A;  2RF0 A;  3NPF A;  1NEB A;  2DIL A;  4JJD A;  2CSQ A;  2M51 A;  2EYW A;  5FWC A;  1GBR A;  1Y57 A;  2PZ1 A;  2KEA A;  2GQI A;  3EG0 A;  2YDL A;  2JS2 A;  2DBM A;  2RNA A;  1X6B A;  1GFC A;  2CDT A;  1PKS A;  2RMO A;  2RN8 A;  4EIK A;  2K3B A;  3EHQ A;  1AWX A;  3M0P A;  4AFQ C;  5GJV B;  2LJ1 A;  2LNH B;  2O88 A;  2H8H A;  2NWM A;  1ARK A;  1ZBJ A;  2EBP A;  2MOX A;  2W10 A;  1T3L A;  4HVV A;  2FPD A;  2JTE A;  2BZY A;  3THK A;  2EGE A;  2DYB A;  2F2W A;  2GNC A;  2AKL A;  1M30 A;  3GBQ A;  1NYG A;  1WI7 A;  1ZSG A;  4OMP A;  1RLP C;  1V1C A;  2G6F X;  4GBQ A;  4LNP A;  2JW4 A;  1IO6 A;  2V1Q A;  2C0O A;  4RTU A;  3ULR B;  1MV0 B;  2DJQ A;  2CT4 A;  1AEY A;  4GLM A;  1U3O A;  2JMC A;  4X1V A;  2LJ3 A;  2F2X A;  2LQW A;  1W70 A;  2HDA A;  2M0Y A;  4J9D A;  1JXM A;  4CC3 A;  1WXB A;  1GRI A;  3VS1 A;  2L2P A;  2FPF A;  2DF6 A;  1PKT A;  2C0T A;  1E7O A;  1KIK A;  1OV3 A;  3VS2 A;  2JXB A;  3RNJ A;  1GL5 A;  1RLQ C;  2EPD A;  2K2M A;  2KGT A;  3VRY A;  2EW3 A;  3I5S A;  3M0U A;  4J9E A;  1B3Q A;  2QDL A;  2GBQ A;  1BU1 A;  3NMZ C;  2K6D A;  1W6X A;  2KXD A;  4JPB W;  3JV3 A;  4LUD A;  2FPE A;  2FO0 A;  2D0N A;  1ZUY A;  4FSS A;  1VA7 A;  1X69 A;  1M3B A;  1X6G A;  3UA7 A;  1UUE A;  2VWF A;  5FWB A;  2J05 A;  1OPL A;  2EGA A;  1WYX A;  2HSP A;  1QKW A;  2CRE A;  2PTK A;  4Y92 A;  1H3H A;  4LN2 A;  1AWJ A;  2CH4 W;  4CC7 A;  1I07 A;  3VS0 A;  4K11 A;  2GTO A;  2KYM A;  1UG1 A;  1J3T A;  1SSH A;  1G2B A;  3SHW A;  1LCK A;  4ESR A;  1QKX A;  1K1Z A;  2KRO A;  1H8K A;  1X27 A;  2YSQ A;  2BZX A;  2KYB A;  1M3C A;  2E5K A;  2YUO A;  2LP5 A;  4F14 A;  1KSW A;  2DBK A;  4IIO A;  1WXT A;  3O5Z A;  1YWP A;  4JJC A;  2AKK A;  1K0X A;  2JMA A;  1CKB A;  2DNU A;  5FW9 A;  2J06 A;  4F17 A;  2IIM A;  4D8D A;  2SRC A;  2A36 A;  2VVK A;  1BK2 A;  2J6F A;  2RQT A;  1ZUK A;  3ZL7 C;  1AWO A;  2DX1 A;  4HXJ A;  2J7I A;  4J9B A;  2SEM A;  2CSI A;  1TUD A;  2JM9 A;  4RTV A;  2EYY A;  3M0R A;  2FEI A;  1YNZ A;  3TSW A;  1K0S A;  4R0K A;  1H92 A;  1UJ0 A;  2DE0 X;  2DL8 A;  2F2V A;  2VKN A;  1VYV A;  2GTJ A;  2DL7 A;  2EGC A;  3VS6 A;  1JU5 C;  4JZ3 A;  1QWE A;  1CSK A;  4OMQ A;  4J9F A;  4OMM A;  2A28 A;  2JM8 A;  2LJ0 A;  5IHI A;  1BB9 A;  5IH2 A;  1SHG A;  2YUP A;  1X43 A;  1NYF A;  3EGU A;  1U5S A;  3R6N A;  3H0I A;  2D8H A;  1A0N B;  5IXF A;  2EVR A;  1SRL A;  2DL5 A;  2KBT A;  3I35 A;  1WIE A;  2ECZ A;  1JEG A;  1PNJ A;  3LH5 A;  4LE9 A;  2RPN A;  4Z88 A;  2DRK A;  1VYU A;  3PVQ A;  1B07 A;  1E6H A;  2ED0 A;  1UE9 A;  1GCQ C;  1AZG B;  1UEC A;  1Z9Q A;  2W0Z A;  1NM7 A;  3KFV A;  2EQI A;  3I9Q A;  2L3Q A;  5EC7 A;  2AZS A;  1X2Q A;  4RUG A;  1NEG A;  2RQU A;  2A08 A;  1K4U S;  2KXC A;  1MUZ A;  2A37 A;  2AZV A;  2KT1 A;  4ZNX A;  3M0Q A;  5HCK A;  1I1J A;  1GCQ A;  2D8J A;  1T0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...