2E5KA

Solution structure of sh3 domain in suppressor of t-cell receptor signaling 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
GSSGSSGSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Suppressor of T-cell receptor signaling 1
publication title Solution structure of SH3 domain in Suppressor of T-cell receptor signaling 1
rcsb
source organism Homo sapiens
total genus 7
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2e5kA01
2RQRA 4OMLA 2GBQA 1TG0A 2E5KA 2KEAA 2L3QA 4JJBA 5IH2A 3I5SA 2X3WD 4RTVA 3SHWA 1WX6A 1I07A 1NYFA 2DVJA 4RTTA 4GBQA 2KROA 2PNIA 2MCNA 1PRLC 2F2WA 1Z9QA 4J9IA 1H3HA 1G2BA 2EYWA 3C0CA 3EHQA 3JV3A 2AZVA 2JXBA 2AK5A 1N5ZA 2KT1A 4GLMA 1H8KA 3KFVA 2J6KA 3VS0A 1UTIA 2O88A 2EW3A 4HVUA 5I22A 1AWJA 1U06A 1AWWA 1U3OA 2JMCA 1BK2A 1M3CA 1X6GA 2YUOA 2DMOA 1UUEA 3LH5A 1KIKA 1BBZA 2NUZA 1HJDA 2JW4A 3VS2A 1KSWA 2C0IA 2DL7A 1S1NA 1X43A 4HVVA 2HSPA 2ECZA 3EG1A 1KJWA 1VA7A 4JZ4A 2RQTA 1I0CA 2CSQA 2KNBB 1ARKA 3O5ZA 1X2QA 1JXMA 1W1FA 1FMKA 4CC3A 3GBQA 1NEGA 2RQWA 1NM7A 1TUCA 3REBB 4JJCA 2DA9A 4J9EA 2GQIA 2C0TA 4Z8AA 5L23A 2DE0X 1MV0B 2KYMA 2DJQA 2HBWA 1UE9A 2H8HA 2LJ0A 1VYUA 2OAWA 2FPEA 4JPBW 4LUDA 4JJDA 3ZL7C 3EG2A 2OJ2A 1GBQA 2YUQA 2EQIA 2LCSA 2DL5A 2CH4A 4LN2A 1X6BA 4AFQC 2W0ZA 2HDAA 1CKBA 4DEYA 2KYBA 2PZ1A 4AFZC 1UHFA 2KRNA 3EHRA 1NYGA 3RNJA 2L0AA 3VS5A 1PKSA 2EBPA 2A08A 1GFCA 1OOTA 4IIOA 2K9GA 2BTTA 5I11A 1M30A 1B3QA 4Y92A 1GBRA 1WXBA 1E6HA 1G83A 1K0XA 5GJWB 4RTXA 1YWPA 1IO6A 2D0NA 1QCFA 1JU5C 1OV3A 4JZ3A 2DYBA 4J9HA 1UGVA 2EVRA 5ECAA 1ZUKA 1RLPC 1GCQC 3H0FA 2DL4A 5GJVB 2AKKA 1BU1A 2DRKA 4LNPA 1B07A 4ZNXA 4CC7A 3M0TA 4F17A 3UF4A 1ZUUA 1V1CA 1ZLMA 1YWOA 2DRMA 2RQVA 2VVKA 1AZGB 2D1XA 3FJ5A 4AFSC 2FO0A 1ZSGA 5FWCA 4LUEA 2JS0A 2LMJA 3RBBB 2EPDA 4X1VA 4OMNA 1GCQA 2BZXA 2K7AA 4RTWA 1SHFA 4CC4B 2DBMA 1JO8A 1VYTA 2CREA 2JS2A 2K2MA 1AD5A 1WYXA 3UATA 2PTKA 1NEBA 1Z9ZA 2DX1A 2L3PA 4J9FA 2VWFA 2AKLA 5IXFA 3QWYA 1UJ0A 1MUZA 2LQNA 3VS4A 1PRMC 2I0NA 2JT4A 1YP5A 3R6NA 3SEMA 1T0HA 2LJ3A 1HD3A 2KR3A 1SRLA 2RF0A 2V1RA 2LJ1A 4OMQA 2CH4W 1M27C 3H0HA 2RNAA 1YN8A 1RUWA 2EYZA 3H41A 4AG1C 2DL3A 2KXCA 2KE9A 5EC7A 4HXJA 4M4ZA 2CT3A 4DEXA 5IHIA 2F2VA 2P4RA 2J05A 1W70A 1Y0MA 2O9VA 1JXOA 3VRZA 3VRYA 2KRMA 4F16A 2K79A 4OMMA 2CSIA 3REAB 1E7OA 2KBTA 1WA7A 1UDLA 1Y57A 4WCIA 2YSQA 1K4US 1UHCA 1T3LA 2B86A 2DL8A 1W6XA 2XMFA 4K11A 1M3BA 2J06A 2LX7A 1AEYA 1QLYA 1GL5A 3NMZC 3VS1A 2CUDA 4D8DA 2YT6A 4J9DA 2CDTA 4RTYA 2HEQA 2ROLA 4HVWA 1FYNA 2J6OA 1QWEA 2RQUA 4A63B 1WIEA 3M0QA 2FRYA 1A0NB 2CUBA 3M0SA 2W10A 4QT7A 4OMOA 1PWTA 3QWXX 3UA6A 3H0IA 4D8KA 2GTOA 2ED0A 2DILA 2IIMA 4J9GA 2O31A 2X3XD 4Z89A 1JEGA 1BB9A 1PNJA 2MOXA 2MIOA 3EG0A 3UA7A 1WXTA 1YCSB 2KRSA 2QDLA 3VS7A 1NG2A 2FRWA 1E6GA 1GRIA 2ESWA 2BZ8A 2G6FX 3CQTA 1I1JA 3ULRB 3PVQA 2BZYA 2ED1A 2KGTA 4E6RA 2LZ6B 1PHTA 1ZBJA 4ESRA 5FWBA 4LE9A 1AZEA 1K0SA 1LCKA 2O2OA 3TSWA 2YUNA 2O9SA 4AG2C 1KFZA 2EGCA 2OI3A 2SEMA 2NWMA 4IIMA 1ZUYA 4HCKA 1WDXA 3NGPA 1WI7A 1WXUA 1UG1A 2YUPA 3I5RA 1T0JA 4Z88A 1OEBA 1GCPA 2FEIA 1CSKA 1YNZA 2LP5A 1AWXA 4RTUA 1SHGA 2A28A 2JTEA 2VKNA 2DF6A 1ABQA 1X27A 2F2XA 1AOJA 1AVZC 1U5SA 3I35A 3THKA 3PE0A 2EKHA 2K3BA 1K1ZA 2J7IA 1MV3A 4FSSA 1VYVA 4ORZA 2K6DA 3TSZA 1EFNA 3NPFA 1H92A 3NHNA 1QKXA 2ABLA 2LNHB 1OPKA 1M8MA 2EGAA 2SRCA 1UJYA 1ZX6A 2DBKA 1ABOA 2RN8A 3M0UA 5IHKA 2A37A 4EIKA 3VS6A 2L3SA 1QWFA 2JMAA 1XOVA 3M0RA 2CT4A 3IQLA 1K76A 1NLOC 2JM8A 1CKAA 1WFWA 3TVTA 3VS3A 2DM1A 2D8HA 1RLQC 2YDLA 2D8JA 3U23A 1SPKA 2HCKA 1T3SA 2RPNA 5IXBA 2GNCA 4KRTA 1TUDA 4R0KA 4RUGA 1PKTA 1RI9A 1SEMA 1QKWA 2RMOA 2ROTA 2FPFA 4F14A 2JM9A 2C0OA 1AWOA 1J3TA 1SRMA 2L2PA 5HCKA 3PVLA 4RTZA 2EYXA 3EG3A 1WLPB 4J9CA 2FG0A 2DNUA 2KT8A 2ENMA 5FW9A 1JQQA 2EGEA 1X2KA 1K9AA 1M3AA 2V1QA 2M51A 3M0PA 1GFDA 2KXDA 4J9BA 1SSHA 4OMPA 2A36A 1NLPC 2EYYA 3A98A 2M0YA 2FPDA 2GGRA 5IHNA 2AZSA 4CC2A 1UECA 2DLPA 2LQWA 2J6FA 1HSQA 1X69A 2GTJA 4AFUC 3EGUA 1OPLA 3I9QA 1UFFA
chains in the Genus database with same CATH superfamily
2VASA 3G4SQ 1BI0A 5FU6C 1TUGB 3QYGB 3CC7A 5LJ3e 4ELZC 2AIRB 4FL6A 3EAEA 4M77F 4GBQA 2PNIA 1PRLC 2F2WA 3GIBA 2RJDA 2E3IA 4BI8B 1OI1A 3BDLA 2XI9A 3CMAA 3MJXA 3VS0A 3EG9A 5KYWB 1UTIA 2EW3A 2MF2A 1U06A 4CRIA 1VQ8T 1YHQQ 2YUOA 3S3OA 3CMEA 4QVDA 2NUZA 1KSWA 5LJ5e 3RIRA 3PMTA 3EFSA 1YJWT 3CCQT 2ECZA 3S3NA 2CP2A 2DVEA 3OYEA 4M75B 4PJMA 4LD6A 5KYXB 3OW2P 3CBPA 1W1FA 4DOVA 5KH6A 2DZ9A 1TUCA 1VQ6Q 1G8XA 1KQSP 4JJCA 4J9EA 2GQIA 2C0TA 2FB7A 2RHUA 2RJCA 4Z8AA 2HZYA 1MV0B 1OZ2A 2KYMA 2DJQA 4C5HA 2HQXA 1Q82C 2LT4A 2LTOA 1M1GA 2HBWA 4J7IA 2H8HA 4N0AC 5GAN5 2MPXC 1PD0A 2L89A 4JJDA 4FCYA 1VQLT 2YUQA 4M7DB 1WNLA 2LCSA 2QGGA 4O5VA 3OSSC 1D0ZA 5GMKj 2RA2A 2CGHA 1I8FA 3VS5A 3OYLA 2RI5A 3TEEA 3NTIA 4IIOA 4C92A 1VQ4T 2K9GA 3VKIA 2BTTA 1NPRA 5GANj 1TSFA 1TTHB 2ZCFB 4OMFB 4WF2A 4FW1A 1WXBA 4MZTA 4A4KA 3EFOB 1Q7YU 4FYXB 4FU6A 2D0NA 4P5NA 1QCFA 1OV3A 4MZPA 4ZGEB 1YI2A 4E7JA 1SF9A 1R77A 2EVRA 1JBMA 2WSEE 1ZUKA 1RLPC 1JB0E 3M56A 5GJVB 1BU1A 2RHIA 3L1AA 2DRKA 1B07A 4ZNXA 1YBYA 3CCST 2QQBA 3CPWA 5KYWA 2RQVA 1NZ9A 2D1XA 5FWCA 2LMJA 5GANh 1PD1A 2BIVA 1K9MU 3ZFJA 1WHJA 3JB9J 3CCJA 1GCQA 1QVGP 2YHTA 1JJ2P 3A8LB 4XQ3A 3CCVT 2DXUA 4CC4B 1JO8A 4HT8A 2BKDN 2JS2A 2OTLQ 5KYUB 2PTKA 1KC8C 5GAN4 4C8QD 1QP2A 1W4SA 3CCRA 3L2VA 2F69A 5AYFA 4ATOA 3CD6Q 3JCMX 4F7UA 2QQRA 4R56A 1UJ0A 3M4GA 1VQ5Q 2QASA 3R6NA 3SEMA 3QJ6A 1HD3A 1IXDA 2GQVA 5LJ3j 5GAOl 1YN8A 4M7DA 1RUWA 2DL3A 1JRIA 2KXCA 2KE9A 5EC7A 4PFOA 1VQOA 2YLCA 2RK1A 3PGGA 2VXFA 1BYMA 4DEXA 5IHIA 2CZ0B 1VQMQ 4LD9K 2IVWA 2KQWA 4BUGA 2L8DA 2RH2A 4LDXA 1JXOA 2M9UA 3VRZA 2KRMA 4F16A 2O01E 2K79A 5GANd 4E7LA 1C6VX 2H3JA 2CSIA 1U1SA 3REAB 1E7OA 1KQSA 2KBTA 3G7ZA 4E2FB 2BE7D 4EPCA 3V8KA 2JNGA 1KD1C 4EMGA 4BDYA 1W6XA 1PM3A 2QA4Q 3OY9A 1Q81U 2ZAEA 2J06A 5LJ3h 5LJ5j 4GY5A 4C8QB 1QLYA 3OS1A 1M5Q1 1YJNQ 1KQ2A 2CUDA 4D8DA 2CYZB 2YT6A 2RM4A 4KULA 3OMGA 2CDTA 2OTJQ 2HEQA 2RQUA 9ATCB 3M0QA 2FRYA 1FWZA 3JCMg 2DO3A 4WTOB 4OMOA 2CZ7B 4KBMB 2G3RA 4GLKA 4D8KA 2ED0A 2CP5A 4J9GA 1QVFA 3PNWC 4J6YA 1BB9A 2VV5A 4J8OA 2X4JA 1WQWA 3CEYA 2KRSA 1K73R 2VGMA 2QEXA 4B9WA 4C0DC 5LJ5h 1G5VA 1VQPT 2LZ6B 4ESRA 4VUBA 4PJOB 1K0SA 5A0GA 1LCKA 2HKQB 4M78F 2E70A 2SEMA 3JB9F 1ZUYA 1WDXA 2RD1A 1WXUA 1S72Q 1T0JA 1VIFA 4BE0A 3EGDB 1Q86R 2LP5A 1YJ9T 2XIDA 1WHMA 3M58A 1LVKA 4AT1B 1IGQA 1SHGA 5FU6B 2JTEA 4Y91A 2DF6A 4M78C 1QVGA 1JJ2A 3I35A 8AT1B 4R55A 1MV3A 4M7AF 2M02A 1VYVA 4PFPA 2EQUA 2EQMA 4B9XA 1V29B 3DLLA 2DBKA 3CCEA 2YRCA 4C92E 2RN8A 2JUFA 2K5FA 2L3SA 3M0RA 4M7AC 2CT4A 3JCMJ 3IQLA 1NLOC 2JM8A 3TVTA 1K9MC 2YDLA 1SPKA 2HCKA 2QI2A 1T3SA 5IXBA 1VQKA 2PQWA 4KRTA 4C92G 1RI9A 3JCMV 5LJ5d 1QKWA 2RMOA 3I55T 1AWOA 1J3TA 2X51A 1SRMA 2O4XA 1PG5B 3HFOA 5CR2A 1M90U 1MNDA 4RTZA 4X9DA 3EG3A 1VQ8Q 2KT8A 3VUZA 1YI2Q 1RABB 4C5IA 3HRSA 4MMLA 1BIAA 2RO0A 3M0PA 1NPPA 4ME7A 4C0GA 1GFDA 2KXDA 1D3BB 1RL2A 1D0XA 1NLPC 1YJWQ 2M0YA 3CCQQ 3MHXA 3X25B 3LW5E 1YITT 2KAFA 1FX7A 2GTJA 3CPWS 3OBYA 1NJIC 1SSFA 3I9QA 2RQRA 4M75E 4OMLA 7AT1B 2E5KA 1TOVA 1O75A 2L3QA 1UGSB 4JJBA 5IH2A 3I5SA 3CCMT 2X3WD 2COYA 2ZPBB 4RTVA 4PJOA 2Y90A 1WX6A 1I07A 4F7UE 2DVJA 2QQ9A 4Z02A 2MCNA 2H3EB 1VQLQ 3OYGA 1G2BA 2EYWA 2LCLA 3PIOA 4AMCA 5FRNA 3PMIA 4M75G 3ME9A 1WQ7A 2EKOA 1VQ9T 2J6KA 4M7DE 5GMKe 1AHJB 3M9QA 4F7UG 4HVUA 2HQEA 1Q81C 4FYWB 4HT9A 4OGCA 4EMKA 1VQ4Q 5GAMj 5J39A 1U3OA 1M3CA 3QZ9B 2DMOA 3EG9B 1LPLA 1UUEA 5FLXE 1KIKA 1BBZA 2JW4A 3MPUB 3VS2A 2DL7A 3CC7T 1X43A 4C92D 1EZZB 4M7DG 4IUQA 4L5GA 4OP0A 5J26A 1KJWA 4JZ4A 2EYQA 1I0CA 2CSQA 3G71A 1X2QA 2NLUA 4B6MA 3KBGA 3L2QA 4CC3A 1RAEB 3CMAT 1VQ7A 4C5GA 4OGEA 5L23A 3AT1B 3CCSQ 2LJ0A 4JJNK 1VQNA 3HKSA 1KQSS 3LWHA 4J7FA 5GAMh 2DXCA 4LUDA 3E1SA 1OU9A 3CMET 4PNOA 2R5MA 5A0LA 3MP6A 3CCVQ 2CH4A 1OZ3A 1Q82R 3CBMA 2W0ZA 3RERA 1D3BA 2KYBA 2PZ1A 5KE3A 1RAHB 3OBWA 2E6NA 3HTRA 2KRNA 1IREB 3WXMB 2FHDA 4ZTFA 3RNJA 2D6FA 3NTHA 4N0AA 2EBPA 2DJZA 5I11A 1M30A 3INZA 4DBRA 3GF5A 4J83A 3FC3A 1QVFS 1ZA1B 2K57A 4C92B 1G83A 1K0XA 5GJWB 3RESA 4MZMA 2EJGA 3GPLA 3DB3A 4J9HA 1UGVA 2X35A 3QO3A 4PLIA 4CI0C 3WVDB 2DKGA 2K2VA 2R58A 3OYJA 3CCLA 2RK2A 4EMKC 2X4XA 4LNPA 3EGXB 4ZN3A 3M0TA 2XHCA 1N9RA 3PT9A 2QQSA 3L2RA 1YWOA 2DRMA 2VVKA 1AZGB 1D1BA 3FJ5A 1W2BP 4M7DD 1GXIE 1ZSGA 2JS0A 3FDRA 3CC4A 2QQAA 3ZBDA 4OMNA 4M77C 2BZXA 4IUPA 2HD0A 2E12A 5J3BA 4RTWA 5EG2A 4X9CA 5IT9E 2JTFA 2DBMA 4KH0B 1VYTA 3UDCA 3WVEB 3VYGA 2CREA 2K2MA 1QVGS 1YI2T 3J80E 1AD5A 2IPOB 1JJ2S 3UATA 2R5AA 3CCUA 2HMAA 4A4HA 3QUIA 2L3PA 4RMOA 3MEWA 2VWFA 4UC4A 3BY7A 4C8QE 1WJQA 1KC8R 2VXEA 2LJ3A 4F7UB 2RF0A 2V1RA 2V8IA 2CH4W 3HFNA 3CCJT 3H0HA 1YCYA 5FROA 4FIBA 2EWNA 1G3WA 2P0QA 4PLLA 4C8QG 4RCBA 4M4ZA 2CP6A 2HAXA 1WHGA 3N5BB 4N4GA 4RCCA 2F2VA 1WZOA 3M5AA 3JB9I 2J05A 3C12A 3G6EA 1VQPQ 2O9VA 3CCRT 1D09B 2L5QA 1N8RR 1K8AC 3OYFA 4XU3A 2RJFA 3JCMQ 1UDLA 1RADB 4HA8A 1V76A 1QVFP 4DBFA 3L2ZA 4PJOE 1K4US 1T3LA 2B86A 2DL8A 1YJ9Q 2PVDB 2EJ9A 3NMZC 3QXEB 1XNIA 2GCXA 1HYOA 4LDUA 2KSSA 2K5IA 2HL3A 2X4WA 1UGRB 1Y7XA 2PVGB 4M7AB 1KD1R 2PVOB 1VQOT 3BDUA 4JS5A 4FW2A 2J6OA 1QWEA 2E64A 3EGXA 4BD3A 4XU0A 1M1KR 5GANg 4PJOG 3M0SA 2W10A 1PWTA 3H0IA 4BE2A 5HK3A 2O31A 4Z89A 4N4HA 3L2UA 5GMKh 4FYVB 1C1AA 1PNJA 4BI4A 1OYXA 1YCSB 2YXYA 1KK7A 1Y07A 4LXCA 2LC4A 3VS7A 2ZPIB 3RKYA 1GRIA 2DYIA 5CK9A 2ESWA 2G6FX 1I1JA 3ULRB 2E4HA 2BZYA 4E6RA 2BE9B 3I55Q 5FWBA 1TH7A 1AZEA 3L2WA 2O2OA 2YUNA 2O9SA 1EIFA 2EGCA 3NGPA 1YIJA 2YUPA 2P84A 3I5RA 2JOYA 4PJNA 4XU1A 4QKUA 2FEIA 1W2BA 1CSKA 5LL6S 4BE1A 4RTUA 2A28A 2VKNA 1ZSZC 2RB6A 1X27A 1NBEB 2QEXT 4QW2A 2F2XA 1AOJA 1AVZC 1PC0A 3BFMA 3E9GA 2EKHA 4FSSA 3SFMA 1YITQ 3TU4K 4KH1B 3CC2A 3LLRA 3F70A 4LDWA 2LNHB 2E6ZA 1HK9A 1M8MA 5C6SA 4N4IA 4KUDK 2LVMA 1K73U 5HKCA 3M0UA 4EIKA 1PSEA 3VS6A 2GFAA 3CCMQ 4TVRA 3MCAB 1XOVA 4M78A 4A4EA 2DXBA 2VUBA 4XTZA 3I56A 2CP7A 1QMCA 4HCBA 1CKAA 3FRNA 3VS3A 3OYYA 3QDRB 3DB4A 2MI6A 4J6WA 2RPNA 4PJOD 2XU8A 4JLGA 3JCMf 1X75C 1M2VA 3M54A 1VQ9Q 2ROTA 4F14A 2JM9A 2C0OA 2ZPHB 4XTWA 5DM7R 2NUTB 2LRQA 4M7AA 1U1TA 2EYXA 5CKFA 3QHSA 1Q86U 3M53A 2DNUA 5GAMe 4JLIA 3QBYA 2O4XB 1K9AA 3CCET 2V26A 5FU7C 2M0OA 3MP8A 3CC7Q 2EQKA 4J9BA 3QDFA 2A36A 2EYYA 4BI3A 5IHNA 2K3XA 4E7SA 2AZSA 4KGVB 5GAN7 1Y71A 1VQKT 1HSQA 4Y28E 4AFUC 3E9FA 3CMAQ 3EGUA 1OPLA 1UFFA 3HRUA 1UEBA 2AHJB 4PL6A 3JSCA 3QZ5B 4M75F 2KEAA 3MKDA 3SHWA 5C0MA 2HNIA 3MP1A 2YWWA 4V2SA 2KROA 4JS4A 1TWBA 2DD5A 3CMEQ 1NJIR 2QGFB 4J9IA 4NL2A 2KMTA 2MMPA 3JV3A 4XTXA 5GAN2 2VGNA 4OVAA 2AZVA 2JXBA 2AK5A 1N5ZA 2XDDA 2QYZA 1XQHA 4NOYA 4C0FA 1H8KA 3KFVA 3G4SA 1WPYA 1WHLA 2NYSA 3OYCA 2O88A 2LQKA 1AWJA 3OYKA 1Q7YC 1BK2A 1X6GA 2COWA 2JMCA 4IUTA 5LJ3d 3LH5A 1LJOA 4QVZA 1HJDA 2C0IA 4EMKB 4BB7A 3QJYA 2HSPA 3AHUA 1ZHIA 1VA7A 2M1HA 1IB8A 2RHYA 2KNBB 1ARKA 3OB9A 1JXMA 1N27A 1FMKA 2OAUA 3GBQA 1YHQA 1NEGA 4M77B 2RQWA 5DLOA 2V8KA 3M55A 2DE0X 3GNFB 1VYUA 2OAWA 5CQXA 2NUTA 4JRQA 4E47A 5DLQE 2FPEA 2EIFA 4ELYC 3SD4A 3ZL7C 1GBQA 5CO7A 4IUUA 5M9OA 2DL5A 1X6BA 2WSCE 2HL5C 2HDAA 3E19A 1VQ6A 5DY9A 4DEYA 3CBOA 3PTAA 1PKSA 3G71T 3M57A 2A08A 5CCAA 2Y4XA 3GNGA 4X34A 4Y92A 1VQ7T 1GBRA 4A4GA 5CKBA 3NFCA 1RACB 1E6HA 1D0YA 3VUBA 1MGQA 1VQNT 4RTXA 1YWPA 1IO6A 4JZ3A 1G3SA 1JU5C 4A54A 4F04B 1RI0A 4E7ZA 3CCJQ 3T9NA 2DFUA 1QCOA 5I21A 3X26B 3A8OB 3KXTA 2AKKA 2JZ2A 2PUOB 2B8AA 4ZTJA 3UF4A 4A4FA 5HK0A 1F1BB 2DERA 1ZLMA 4PJLA 4ANJA 4AFSC 3OYMA 3RBBB 2LQ8A 4ZGJB 4FT2A 1Q82U 3CCRQ 2WSFE 1W2BS 2FZCB 1KHIA 2LT1A 3DLMA 4M78E 4RG8A 1WYXA 3LYIA 2PUKB 5GAOm 2QTVA 3TCJA 3CCLT 3GP8A 4M77A 1VQOQ 3QIIA 4C8QF 8ATCB 3VS4A 1PRMC 2I0NA 2JT4A 3HHTB 1D1AA 3JAME 5GAN8 3LGFA 1G3YA 3CC4T 3JB9G 3HP9A 5KCOA 4M7AE 2OTLA 2KR3A 2MYSA 1SRLA 2RI3A 2LJ1A 4XU2A 3A8MB 2RNAA 2RHXA 3S3MA 5GAN3 2KI7A 2E5QA 4KUIA 1H641 4AG1C 3H41A 3VJPA 3CD6A 4HXJA 2KVQG 3SWNC 2CT3A 2ZZDA 1RAAB 5KYYB 1BCOA 2NUPA 2P4RA 4M7AG 2FZGB 1VQ5A 1UB4A 3X20B 1W70A 3NTKA 1Y0MA 3EH1A 3CCUT 3RKWA 5D6YA 4XTUA 3S6WA 1UGQB 3VRYA 2D0QB 1KQ1A 4OMMA 1ZSZB 3EH2A 5CAIA 1WA7A 4WCIA 2YSQA 3OA6A 2ATCB 3JCMW 1UHCA 4PJOF 1Q95G 1N6AA 5KYNA 3URGA 4OB0B 4IKFA 4LDVA 1M3BA 1IRXA 1VQMA 1AEYA 1KG1A 4QQGA 1K8AR 1GL5A 2XKOC 2LDMA 3VS1A 2QEXQ 4FSXA 1R0BG 3H6ZA 2QDYB 3V8LA 1KC8U 4J9DA 2YLBA 2DEQA 5KCHA 2ROLA 3UT1A 1FYNA 2QAZA 1WIEA 2K4YA 2K3YA 2CUBA 4DBHA 4QT7A 3QWXX 3UA6A 2XDPA 4J6XA 3G6ET 1M4ZA 3X28B 3J81E 2JJ9A 5A0DA 2IIMA 4BACA 2X3XD 4BY6C 2QA4A 4XK8E 2MIOA 1B7TA 3UA7A 1WXTA 4QQDA 2Y4YA 1YJNA 3OYDA 2CZ1B 2FRWA 3A1PA 2OTJA 5GAMd 4JRKA 4OF1A 2BZ8A 5CQYA 1OU8A 1QP3A 1PSFA 4M78D 1N8RU 3META 5FU7B 1M90C 3JB9D 2ZPEB 3C94A 1PHTA 1MHNA 4LE9A 3RDVA 2LNVA 1H3ZA 1RAGB 2ZGWA 2AT1B 3C4SA 1MMAA 1RAFB 4IIMA 1UG1A 3RR6A 4HCZA 1GCPA 1BI1A 3CCEQ 2CKKA 4ZGDB 4MMKA 3OYAA 4OB2B 4M7AD 1KD1U 3JCMe 1M1KU 2JTMA 4DA4A 3THKA 4C0DB 2K3BA 2M16A 2K6DA 2VB6A 1VQKQ 3NPFA 1H92A 3FJPA 3LGLA 3RMQA 5KYYA 1S72A 2ABLA 1OPKA 2EGAA 3X24B 2SRCA 1QQJA 1ABOA 1QW1A 1R0CB 2F5TX 4XTVA 5IHKA 2A37A 2QTXA 5D6WA 3H9NA 1ZSZA 1QWFA 2WACA 1YIJT 1K76A 2JN0A 3J7AF 3P8DA 1Y96B 4PKCC 1WFWA 5IAYA 2D8HA 1RLQC 3U23A 4M78B 5GANf 1MMNA 2GNCA 1TUDA 4R0KA 1SEMA 3V7CA 2FPFA 2RHZA 1N9SA 2XDBA 2L2PA 1ZBXA 2IG0A 5HCKA 4IURA 4O6JA 4FYYB 1QVPA 1M2VB 3CC2T 3OSVA 5GMKi 2DXTA 1WLPB 1QCNA 2FG0A 1M9SA 3Q1JA 5FW9A 1XTDA 1JQQA 1M3AA 2M51A 2EFIA 3ZEHA 4OMPA 2CP0A 1SSHA 3HSBA 1MMDA 4DQ2A 1VUBA 2GGRA 2HKNA 3L42A 2FYKA 3I56T 3CXCP 3SDZA 4L6V5 1UECA 1LOJA 2DIQA 2J6FA 5GMKl 3OYIA 1D1CA 1X69A 4PK4A 1VQ8A 4MDWA 4Q5WA 2Z0WA 1P92A 2GBQA 3O8VA 1TG0A 4E7HA 1BI2A 4PJJA 4M77E 3VU3C 1NYFA 1YJWA 3LX7A 4RTTA 3CCQA 3RMSA 3HRTA 4NL3A 1Z9QA 1H3HA 3C0CA 3EHQA 3QYHB 2FZKB 3PIPA 3FLGA 2KT1A 1KHCA 4GLMA 3M59A 3FB9A 4EMHA 2JVVA 2COZA 4E7IA 4M77G 4XAXB 2VYTA 3G71Q 5I22A 3SB2A 5HY6A 2BUDA 1AWWA 1ZQ1A 3V7RA 3C95A 2DTHA 2DTIA 2FVUA 2E41A 1VQ7Q 5LJ3f 1VQLA 2PU9B 1S1NA 4M75A 5KYXA 2YRDA 1VQNQ 4RKUE 4HVVA 4EDUA 5CIUA 3EG1A 3V8JA 4DOWA 1Q7YR 1SKUB 2RQTA 2P0KA 3O5ZA 1Y96A 4II1A 4C92F 1VQ4A 2ZPFB 1NM7A 3REBB 2DA9A 1OULA 3G4ST 2D9TA 5LJ3g 1UE9A 1NJIU 4KT0E 1N8RC 4JUVA 3ER0A 4C92C 4JPBW 3OS2A 2A0FB 1TXQA 3EG2A 2OJ2A 5LJ5f 1U8RA 1YFNA 1UGPB 2EQIA 4LN2A 4AFQC 1K9MR 3OYNA 3OW2A 1G3TA 1CKBA 3JCMP 4AFZC 4QVCA 1UHFA 3EHRA 1NYGA 3CCSA 2L0AA 1OQKA 4LDYA 1GFCA 3EFOA 3MEVA 1OOTA 1WHHA 2VC8A 3CCLQ 4JRPA 1YHQT 1M8VA 1B3QA 1BI3A 4JDSA 2EJFA 1M1KC 3VV0A 1M2OA 2DETA 5LJ5g 1BIBA 3CCVA 1FMWA 2C06A 3SWNB 3CC4Q 2OX7A 1I5OB 4KGXB 2DYBA 2XICA 3DKMA 3OMCA 4M77D 5ECAA 3M4YA 2DPPB 3PFSA 5GAOq 1GCQC 3H0FA 1HXDA 5D7UA 2DL4A 4JRIA 1WGSA 1LNXA 3RUXA 2F5KA 2A7YA 2XG8D 1VQ6T 4F7UF 4CC7A 3QPHA 4F17A 5GAOp 5FRMA 1ZUUA 5IN1A 1V1CA 3CXCA 3P8BB 3CCUQ 2FO0A 2XK0A 4LUEA 4M75C 1C0MA 2CS7A 2EPDA 3E2UA 3JCMh 3GOXA 2MWPA 2DEUA 4X1VA 2GFUA 3KUFA 4C0ZA 4FT4A 1IHWA 5KYUA 2X9HA 2K7AA 4M7DF 1SHFA 5CVIA 2P4TA 1ZA2B 2LCCA 1BCMA 3GLXA 2FL7A 1AT1B 4BDZA 1NEBA 5GAOr 4BY6B 1Z9ZA 2DX1A 3UPUA 2RI2A 3UWNA 3QKJA 4M7DC 1WJRA 4IUVA 1Q81R 1I81A 4J9FA 3VYHB 3MO8A 2AKLA 5IXFA 3QWYA 1IGUA 1MUZA 2LQNA 3OYHA 2YRVA 1YP5A 5AT1B 3G6EQ 1PCXA 1T0HA 4OMQA 1M27C 1X01A 3HPWA 4YTLA 2EYZA 3QSUA 4RG2A 1TU0B 5CKDA 3TQ7P 1VIEA 5CKEA 5I2MA 4XTYA 2DIGA 2DTOA 1NE8A 2MK5A 2E3HA 2ZPGB 2XD0A 3QG1A 3MEAA 3JCMd 2NUPB 4QQ6A 1Y57A 4C8QA 1WHKA 3SWNA 1OX8A 2OTLT 2XMFA 1VOMA 4K11A 2LX7A 1VQPA 4FM4B 5GMKm 3BW1A 4NS5A 3CD6T 2KDSA 4OB3B 4RTYA 4HVWA 4A63B 1K73C 1X6OA 2A3LA 2MAMA 1A0NB 1VQ5T 5CKHA 2GTOA 2DILA 1XJWB 2HSEB 1JEGA 1YJ9A 2E10A 2F1LA 3JCMb 6AT1B 2MOXA 2R57A 3LWIA 3EG0A 2KK4A 4HKEA 1YIJQ 2QDLA 2E1HA 1NG2A 1E6GA 3FIFA 5GAMf 3OS0A 3MEUA 1B34B 3CQTA 3P8HA 1M1FA 1VQMT 2HBPA 4DBQA 3PVQA 2ED1A 2KGTA 3A8GB 1Q86C 5L8RE 1MMGA 1ZBJA 3HL8A 2MWOA 1FXXA 3TSWA 4AG2C 3EGDA 1KFZA 4KGZB 1WJSA 2OI3A 4ZN1A 2QG9B 2NWMA 3CC2Q 4HCKA 1WI7A 2CP3A 3R6OA 2I2LA 4Z88A 1ACMB 1OEBA 1K8AU 1M90R 3JB9H 4PFZA 1YNZA 1AWXA 2QA4T 1R8OB 2EAYA 1EX4A 1MNEA 2L3RA 5GAMg 3D7SB 1ABQA 1DJ7B 3FEOA 5GANe 3I55A 4M78G 5GAN6 1YJNT 3RKXA 1U5SA 3I56Q 3PE0A 1K1ZA 2J7IA 3CPFA 4A53A 2OTJT 3OYBA 4ORZA 3A5ZB 3TSZA 4C5EA 2K5LA 1EFNA 3NHNA 3JCMc 1QKXA 3A8HB 2QK0A 2DD4A 3H8ZA 2EQJA 1I4K1 1UJYA 1ZX6A 2RJEA 4C8QC 1TS9A 2DAQA 1FMVA 3TREA 3G1JA 2JMAA 4OB1B 2E65A 3JRZA 2KY9A 3OW2S 4E7KA 3OS5A 2DM1A 1IHVA 3V7SA 2HQHA 2GF7A 1YITA 2D8JA 4HCCA 2CZ6B 2LX9A 1RAIB 4RUGA 1PKTA 1BKBA 4D6WA 3PVLA 1O9SA 5KE2A 3CCMA 2DK3A 3OQ5A 2P0PA 1S72T 4J9CA 1SG5A 2ENMA 4L59A 3LH0A 2EGEA 2QXFA 1X2KA 2V1QA 1OX9A 1I5LA 4PJOC 3BE3A 3A98A 2FPDA 1VQ9A 3CPWP 2DZCA 5I2SA 2V8JA 4CC2A 5GAOn 4J5YA 5A2QE 4MDXA 2DLPA 2LQWA 4M75D 3ASKA 3EFRA 2X4YA 1IZ6A 3CXCS 1B34A 5D6XA
chains in the Genus database with same CATH topology
2RQRA 4OMLA 2GBQA 1TG0A 2E5KA 2KEAA 2L3QA 4JJBA 5IH2A 3I5SA 2X3WD 4RTVA 3SHWA 1WX6A 1I07A 1NYFA 2DVJA 4RTTA 4GBQA 2KROA 2PNIA 2MCNA 1PRLC 2F2WA 1Z9QA 4J9IA 1H3HA 1G2BA 2EYWA 3C0CA 3EHQA 3JV3A 2AZVA 2JXBA 2AK5A 1N5ZA 2KT1A 4GLMA 1H8KA 3KFVA 2J6KA 3VS0A 1UTIA 2O88A 2EW3A 4HVUA 5I22A 1AWJA 1U06A 1AWWA 1U3OA 2JMCA 1BK2A 1M3CA 1X6GA 2YUOA 2DMOA 1UUEA 3LH5A 1KIKA 1BBZA 2NUZA 1HJDA 2JW4A 3VS2A 1KSWA 2C0IA 2DL7A 1S1NA 1X43A 4HVVA 2HSPA 2ECZA 3EG1A 1KJWA 1VA7A 4JZ4A 2RQTA 1I0CA 2CSQA 2KNBB 1ARKA 3O5ZA 1X2QA 1JXMA 1W1FA 1FMKA 4CC3A 3GBQA 1NEGA 2RQWA 1NM7A 1TUCA 3REBB 4JJCA 2DA9A 4J9EA 2GQIA 2C0TA 4Z8AA 5L23A 2DE0X 1MV0B 2KYMA 2DJQA 2HBWA 1UE9A 2H8HA 2LJ0A 1VYUA 2OAWA 2FPEA 4JPBW 4LUDA 4JJDA 3ZL7C 3EG2A 2OJ2A 1GBQA 2YUQA 2EQIA 2LCSA 2DL5A 2CH4A 4LN2A 1X6BA 4AFQC 2W0ZA 2HDAA 1CKBA 4DEYA 2KYBA 2PZ1A 4AFZC 1UHFA 2KRNA 3EHRA 1NYGA 3RNJA 2L0AA 3VS5A 1PKSA 2EBPA 2A08A 1GFCA 1OOTA 4IIOA 2K9GA 2BTTA 5I11A 1M30A 1B3QA 4Y92A 1GBRA 1WXBA 1E6HA 1G83A 1K0XA 5GJWB 4RTXA 1YWPA 1IO6A 2D0NA 1QCFA 1JU5C 1OV3A 4JZ3A 2DYBA 4J9HA 1UGVA 2EVRA 5ECAA 1ZUKA 1RLPC 1GCQC 3H0FA 2DL4A 5GJVB 2AKKA 1BU1A 2DRKA 4LNPA 1B07A 4ZNXA 4CC7A 3M0TA 4F17A 3UF4A 1ZUUA 1V1CA 1ZLMA 1YWOA 2DRMA 2RQVA 2VVKA 1AZGB 2D1XA 3FJ5A 4AFSC 2FO0A 1ZSGA 5FWCA 4LUEA 2JS0A 2LMJA 3RBBB 2EPDA 4X1VA 4OMNA 1GCQA 2BZXA 2K7AA 4RTWA 1SHFA 4CC4B 2DBMA 1JO8A 1VYTA 2CREA 2JS2A 2K2MA 1AD5A 1WYXA 3UATA 2PTKA 1NEBA 1Z9ZA 2DX1A 2L3PA 4J9FA 2VWFA 2AKLA 5IXFA 3QWYA 1UJ0A 1MUZA 2LQNA 3VS4A 1PRMC 2I0NA 2JT4A 1YP5A 3R6NA 3SEMA 1T0HA 2LJ3A 1HD3A 2KR3A 1SRLA 2RF0A 2V1RA 2LJ1A 4OMQA 2CH4W 1M27C 3H0HA 2RNAA 1YN8A 1RUWA 2EYZA 3H41A 4AG1C 2DL3A 2KXCA 2KE9A 5EC7A 4HXJA 4M4ZA 2CT3A 4DEXA 5IHIA 2F2VA 2P4RA 2J05A 1W70A 1Y0MA 2O9VA 1JXOA 3VRZA 3VRYA 2KRMA 4F16A 2K79A 4OMMA 2CSIA 3REAB 1E7OA 2KBTA 1WA7A 1UDLA 1Y57A 4WCIA 2YSQA 1K4US 1UHCA 1T3LA 2B86A 2DL8A 1W6XA 2XMFA 4K11A 1M3BA 2J06A 2LX7A 1AEYA 1QLYA 1GL5A 3NMZC 3VS1A 2CUDA 4D8DA 2YT6A 4J9DA 2CDTA 4RTYA 2HEQA 2ROLA 4HVWA 1FYNA 2J6OA 1QWEA 2RQUA 4A63B 1WIEA 3M0QA 2FRYA 1A0NB 2CUBA 3M0SA 2W10A 4QT7A 4OMOA 1PWTA 3QWXX 3UA6A 3H0IA 4D8KA 2GTOA 2ED0A 2DILA 2IIMA 4J9GA 2O31A 2X3XD 4Z89A 1JEGA 1BB9A 1PNJA 2MOXA 2MIOA 3EG0A 3UA7A 1WXTA 1YCSB 2KRSA 2QDLA 3VS7A 1NG2A 2FRWA 1E6GA 1GRIA 2ESWA 2BZ8A 2G6FX 3CQTA 1I1JA 3ULRB 3PVQA 2BZYA 2ED1A 2KGTA 4E6RA 2LZ6B 1PHTA 1ZBJA 4ESRA 5FWBA 4LE9A 1AZEA 1K0SA 1LCKA 2O2OA 3TSWA 2YUNA 2O9SA 4AG2C 1KFZA 2EGCA 2OI3A 2SEMA 2NWMA 4IIMA 1ZUYA 4HCKA 1WDXA 3NGPA 1WI7A 1WXUA 1UG1A 2YUPA 3I5RA 1T0JA 4Z88A 1OEBA 1GCPA 2FEIA 1CSKA 1YNZA 2LP5A 1AWXA 4RTUA 1SHGA 2A28A 2JTEA 2VKNA 2DF6A 1ABQA 1X27A 2F2XA 1AOJA 1AVZC 1U5SA 3I35A 3THKA 3PE0A 2EKHA 2K3BA 1K1ZA 2J7IA 1MV3A 4FSSA 1VYVA 4ORZA 2K6DA 3TSZA 1EFNA 3NPFA 1H92A 3NHNA 1QKXA 2ABLA 2LNHB 1OPKA 1M8MA 2EGAA 2SRCA 1UJYA 1ZX6A 2DBKA 1ABOA 2RN8A 3M0UA 5IHKA 2A37A 4EIKA 3VS6A 2L3SA 1QWFA 2JMAA 1XOVA 3M0RA 2CT4A 3IQLA 1K76A 1NLOC 2JM8A 1CKAA 1WFWA 3TVTA 3VS3A 2DM1A 2D8HA 1RLQC 2YDLA 2D8JA 3U23A 1SPKA 2HCKA 1T3SA 2RPNA 5IXBA 2GNCA 4KRTA 1TUDA 4R0KA 4RUGA 1PKTA 1RI9A 1SEMA 1QKWA 2RMOA 2ROTA 2FPFA 4F14A 2JM9A 2C0OA 1AWOA 1J3TA 1SRMA 2L2PA 5HCKA 3PVLA 4RTZA 2EYXA 3EG3A 1WLPB 4J9CA 2FG0A 2DNUA 2KT8A 2ENMA 5FW9A 1JQQA 2EGEA 1X2KA 1K9AA 1M3AA 2V1QA 2M51A 3M0PA 1GFDA 2KXDA 4J9BA 1SSHA 4OMPA 2A36A 1NLPC 2EYYA 3A98A 2M0YA 2FPDA 2GGRA 5IHNA 2AZSA 4CC2A 1UECA 2DLPA 2LQWA 2J6FA 1HSQA 1X69A 2GTJA 4AFUC 3EGUA 1OPLA 3I9QA 1UFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQR A;  4OML A;  2GBQ A;  1TG0 A;  2E5K A;  2KEA A;  2L3Q A;  4JJB A;  5IH2 A;  3I5S A;  2X3W D;  4RTV A;  3SHW A;  1WX6 A;  1I07 A;  1NYF A;  2DVJ A;  4RTT A;  4GBQ A;  2KRO A;  2PNI A;  2MCN A;  1PRL C;  2F2W A;  1Z9Q A;  4J9I A;  1H3H A;  1G2B A;  2EYW A;  3C0C A;  3EHQ A;  3JV3 A;  2AZV A;  2JXB A;  2AK5 A;  1N5Z A;  2KT1 A;  4GLM A;  1H8K A;  3KFV A;  2J6K A;  3VS0 A;  1UTI A;  2O88 A;  2EW3 A;  4HVU A;  5I22 A;  1AWJ A;  1U06 A;  1AWW A;  1U3O A;  2JMC A;  1BK2 A;  1M3C A;  1X6G A;  2YUO A;  2DMO A;  1UUE A;  3LH5 A;  1KIK A;  1BBZ A;  2NUZ A;  1HJD A;  2JW4 A;  3VS2 A;  1KSW A;  2C0I A;  2DL7 A;  1S1N A;  1X43 A;  4HVV A;  2HSP A;  2ECZ A;  3EG1 A;  1KJW A;  1VA7 A;  4JZ4 A;  2RQT A;  1I0C A;  2CSQ A;  2KNB B;  1ARK A;  3O5Z A;  1X2Q A;  1JXM A;  1W1F A;  1FMK A;  4CC3 A;  3GBQ A;  1NEG A;  2RQW A;  1NM7 A;  1TUC A;  3REB B;  4JJC A;  2DA9 A;  4J9E A;  2GQI A;  2C0T A;  4Z8A A;  5L23 A;  2DE0 X;  1MV0 B;  2KYM A;  2DJQ A;  2HBW A;  1UE9 A;  2H8H A;  2LJ0 A;  1VYU A;  2OAW A;  2FPE A;  4JPB W;  4LUD A;  4JJD A;  3ZL7 C;  3EG2 A;  2OJ2 A;  1GBQ A;  2YUQ A;  2EQI A;  2LCS A;  2DL5 A;  2CH4 A;  4LN2 A;  1X6B A;  4AFQ C;  2W0Z A;  2HDA A;  1CKB A;  4DEY A;  2KYB A;  2PZ1 A;  4AFZ C;  1UHF A;  2KRN A;  3EHR A;  1NYG A;  3RNJ A;  2L0A A;  3VS5 A;  1PKS A;  2EBP A;  2A08 A;  1GFC A;  1OOT A;  4IIO A;  2K9G A;  2BTT A;  5I11 A;  1M30 A;  1B3Q A;  4Y92 A;  1GBR A;  1WXB A;  1E6H A;  1G83 A;  1K0X A;  5GJW B;  4RTX A;  1YWP A;  1IO6 A;  2D0N A;  1QCF A;  1JU5 C;  1OV3 A;  4JZ3 A;  2DYB A;  4J9H A;  1UGV A;  2EVR A;  5ECA A;  1ZUK A;  1RLP C;  1GCQ C;  3H0F A;  2DL4 A;  5GJV B;  2AKK A;  1BU1 A;  2DRK A;  4LNP A;  1B07 A;  4ZNX A;  4CC7 A;  3M0T A;  4F17 A;  3UF4 A;  1ZUU A;  1V1C A;  1ZLM A;  1YWO A;  2DRM A;  2RQV A;  2VVK A;  1AZG B;  2D1X A;  3FJ5 A;  4AFS C;  2FO0 A;  1ZSG A;  5FWC A;  4LUE A;  2JS0 A;  2LMJ A;  3RBB B;  2EPD A;  4X1V A;  4OMN A;  1GCQ A;  2BZX A;  2K7A A;  4RTW A;  1SHF A;  4CC4 B;  2DBM A;  1JO8 A;  1VYT A;  2CRE A;  2JS2 A;  2K2M A;  1AD5 A;  1WYX A;  3UAT A;  2PTK A;  1NEB A;  1Z9Z A;  2DX1 A;  2L3P A;  4J9F A;  2VWF A;  2AKL A;  5IXF A;  3QWY A;  1UJ0 A;  1MUZ A;  2LQN A;  3VS4 A;  1PRM C;  2I0N A;  2JT4 A;  1YP5 A;  3R6N A;  3SEM A;  1T0H A;  2LJ3 A;  1HD3 A;  2KR3 A;  1SRL A;  2RF0 A;  2V1R A;  2LJ1 A;  4OMQ A;  2CH4 W;  1M27 C;  3H0H A;  2RNA A;  1YN8 A;  1RUW A;  2EYZ A;  3H41 A;  4AG1 C;  2DL3 A;  2KXC A;  2KE9 A;  5EC7 A;  4HXJ A;  4M4Z A;  2CT3 A;  4DEX A;  5IHI A;  2F2V A;  2P4R A;  2J05 A;  1W70 A;  1Y0M A;  2O9V A;  1JXO A;  3VRZ A;  3VRY A;  2KRM A;  4F16 A;  2K79 A;  4OMM A;  2CSI A;  3REA B;  1E7O A;  2KBT A;  1WA7 A;  1UDL A;  1Y57 A;  4WCI A;  2YSQ A;  1K4U S;  1UHC A;  1T3L A;  2B86 A;  2DL8 A;  1W6X A;  2XMF A;  4K11 A;  1M3B A;  2J06 A;  2LX7 A;  1AEY A;  1QLY A;  1GL5 A;  3NMZ C;  3VS1 A;  2CUD A;  4D8D A;  2YT6 A;  4J9D A;  2CDT A;  4RTY A;  2HEQ A;  2ROL A;  4HVW A;  1FYN A;  2J6O A;  1QWE A;  2RQU A;  4A63 B;  1WIE A;  3M0Q A;  2FRY A;  1A0N B;  2CUB A;  3M0S A;  2W10 A;  4QT7 A;  4OMO A;  1PWT A;  3QWX X;  3UA6 A;  3H0I A;  4D8K A;  2GTO A;  2ED0 A;  2DIL A;  2IIM A;  4J9G A;  2O31 A;  2X3X D;  4Z89 A;  1JEG A;  1BB9 A;  1PNJ A;  2MOX A;  2MIO A;  3EG0 A;  3UA7 A;  1WXT A;  1YCS B;  2KRS A;  2QDL A;  3VS7 A;  1NG2 A;  2FRW A;  1E6G A;  1GRI A;  2ESW A;  2BZ8 A;  2G6F X;  3CQT A;  1I1J A;  3ULR B;  3PVQ A;  2BZY A;  2ED1 A;  2KGT A;  4E6R A;  2LZ6 B;  1PHT A;  1ZBJ A;  4ESR A;  5FWB A;  4LE9 A;  1AZE A;  1K0S A;  1LCK A;  2O2O A;  3TSW A;  2YUN A;  2O9S A;  4AG2 C;  1KFZ A;  2EGC A;  2OI3 A;  2SEM A;  2NWM A;  4IIM A;  1ZUY A;  4HCK A;  1WDX A;  3NGP A;  1WI7 A;  1WXU A;  1UG1 A;  2YUP A;  3I5R A;  1T0J A;  4Z88 A;  1OEB A;  1GCP A;  2FEI A;  1CSK A;  1YNZ A;  2LP5 A;  1AWX A;  4RTU A;  1SHG A;  2A28 A;  2JTE A;  2VKN A;  2DF6 A;  1ABQ A;  1X27 A;  2F2X A;  1AOJ A;  1AVZ C;  1U5S A;  3I35 A;  3THK A;  3PE0 A;  2EKH A;  2K3B A;  1K1Z A;  2J7I A;  1MV3 A;  4FSS A;  1VYV A;  4ORZ A;  2K6D A;  3TSZ A;  1EFN A;  3NPF A;  1H92 A;  3NHN A;  1QKX A;  2ABL A;  2LNH B;  1OPK A;  1M8M A;  2EGA A;  2SRC A;  1UJY A;  1ZX6 A;  2DBK A;  1ABO A;  2RN8 A;  3M0U A;  5IHK A;  2A37 A;  4EIK A;  3VS6 A;  2L3S A;  1QWF A;  2JMA A;  1XOV A;  3M0R A;  2CT4 A;  3IQL A;  1K76 A;  1NLO C;  2JM8 A;  1CKA A;  1WFW A;  3TVT A;  3VS3 A;  2DM1 A;  2D8H A;  1RLQ C;  2YDL A;  2D8J A;  3U23 A;  1SPK A;  2HCK A;  1T3S A;  2RPN A;  5IXB A;  2GNC A;  4KRT A;  1TUD A;  4R0K A;  4RUG A;  1PKT A;  1RI9 A;  1SEM A;  1QKW A;  2RMO A;  2ROT A;  2FPF A;  4F14 A;  2JM9 A;  2C0O A;  1AWO A;  1J3T A;  1SRM A;  2L2P A;  5HCK A;  3PVL A;  4RTZ A;  2EYX A;  3EG3 A;  1WLP B;  4J9C A;  2FG0 A;  2DNU A;  2KT8 A;  2ENM A;  5FW9 A;  1JQQ A;  2EGE A;  1X2K A;  1K9A A;  1M3A A;  2V1Q A;  2M51 A;  3M0P A;  1GFD A;  2KXD A;  4J9B A;  1SSH A;  4OMP A;  2A36 A;  1NLP C;  2EYY A;  3A98 A;  2M0Y A;  2FPD A;  2GGR A;  5IHN A;  2AZS A;  4CC2 A;  1UEC A;  2DLP A;  2LQW A;  2J6F A;  1HSQ A;  1X69 A;  2GTJ A;  4AFU C;  3EGU A;  1OPL A;  3I9Q A;  1UFF A; 
#chains in the Genus database with same CATH topology
 2VAS A;  3G4S Q;  1BI0 A;  5FU6 C;  1TUG B;  3QYG B;  3CC7 A;  5LJ3 e;  4ELZ C;  2AIR B;  4FL6 A;  3EAE A;  4M77 F;  4GBQ A;  2PNI A;  1PRL C;  2F2W A;  3GIB A;  2RJD A;  2E3I A;  4BI8 B;  1OI1 A;  3BDL A;  2XI9 A;  3CMA A;  3MJX A;  3VS0 A;  3EG9 A;  5KYW B;  1UTI A;  2EW3 A;  2MF2 A;  1U06 A;  4CRI A;  1VQ8 T;  1YHQ Q;  2YUO A;  3S3O A;  3CME A;  4QVD A;  2NUZ A;  1KSW A;  5LJ5 e;  3RIR A;  3PMT A;  3EFS A;  1YJW T;  3CCQ T;  2ECZ A;  3S3N A;  2CP2 A;  2DVE A;  3OYE A;  4M75 B;  4PJM A;  4LD6 A;  5KYX B;  3OW2 P;  3CBP A;  1W1F A;  4DOV A;  5KH6 A;  2DZ9 A;  1TUC A;  1VQ6 Q;  1G8X A;  1KQS P;  4JJC A;  4J9E A;  2GQI A;  2C0T A;  2FB7 A;  2RHU A;  2RJC A;  4Z8A A;  2HZY A;  1MV0 B;  1OZ2 A;  2KYM A;  2DJQ A;  4C5H A;  2HQX A;  1Q82 C;  2LT4 A;  2LTO A;  1M1G A;  2HBW A;  4J7I A;  2H8H A;  4N0A C;  5GAN 5;  2MPX C;  1PD0 A;  2L89 A;  4JJD A;  4FCY A;  1VQL T;  2YUQ A;  4M7D B;  1WNL A;  2LCS A;  2QGG A;  4O5V A;  3OSS C;  1D0Z A;  5GMK j;  2RA2 A;  2CGH A;  1I8F A;  3VS5 A;  3OYL A;  2RI5 A;  3TEE A;  3NTI A;  4IIO A;  4C92 A;  1VQ4 T;  2K9G A;  3VKI A;  2BTT A;  1NPR A;  5GAN j;  1TSF A;  1TTH B;  2ZCF B;  4OMF B;  4WF2 A;  4FW1 A;  1WXB A;  4MZT A;  4A4K A;  3EFO B;  1Q7Y U;  4FYX B;  4FU6 A;  2D0N A;  4P5N A;  1QCF A;  1OV3 A;  4MZP A;  4ZGE B;  1YI2 A;  4E7J A;  1SF9 A;  1R77 A;  2EVR A;  1JBM A;  2WSE E;  1ZUK A;  1RLP C;  1JB0 E;  3M56 A;  5GJV B;  1BU1 A;  2RHI A;  3L1A A;  2DRK A;  1B07 A;  4ZNX A;  1YBY A;  3CCS T;  2QQB A;  3CPW A;  5KYW A;  2RQV A;  1NZ9 A;  2D1X A;  5FWC A;  2LMJ A;  5GAN h;  1PD1 A;  2BIV A;  1K9M U;  3ZFJ A;  1WHJ A;  3JB9 J;  3CCJ A;  1GCQ A;  1QVG P;  2YHT A;  1JJ2 P;  3A8L B;  4XQ3 A;  3CCV T;  2DXU A;  4CC4 B;  1JO8 A;  4HT8 A;  2BKD N;  2JS2 A;  2OTL Q;  5KYU B;  2PTK A;  1KC8 C;  5GAN 4;  4C8Q D;  1QP2 A;  1W4S A;  3CCR A;  3L2V A;  2F69 A;  5AYF A;  4ATO A;  3CD6 Q;  3JCM X;  4F7U A;  2QQR A;  4R56 A;  1UJ0 A;  3M4G A;  1VQ5 Q;  2QAS A;  3R6N A;  3SEM A;  3QJ6 A;  1HD3 A;  1IXD A;  2GQV A;  5LJ3 j;  5GAO l;  1YN8 A;  4M7D A;  1RUW A;  2DL3 A;  1JRI A;  2KXC A;  2KE9 A;  5EC7 A;  4PFO A;  1VQO A;  2YLC A;  2RK1 A;  3PGG A;  2VXF A;  1BYM A;  4DEX A;  5IHI A;  2CZ0 B;  1VQM Q;  4LD9 K;  2IVW A;  2KQW A;  4BUG A;  2L8D A;  2RH2 A;  4LDX A;  1JXO A;  2M9U A;  3VRZ A;  2KRM A;  4F16 A;  2O01 E;  2K79 A;  5GAN d;  4E7L A;  1C6V X;  2H3J A;  2CSI A;  1U1S A;  3REA B;  1E7O A;  1KQS A;  2KBT A;  3G7Z A;  4E2F B;  2BE7 D;  4EPC A;  3V8K A;  2JNG A;  1KD1 C;  4EMG A;  4BDY A;  1W6X A;  1PM3 A;  2QA4 Q;  3OY9 A;  1Q81 U;  2ZAE A;  2J06 A;  5LJ3 h;  5LJ5 j;  4GY5 A;  4C8Q B;  1QLY A;  3OS1 A;  1M5Q 1;  1YJN Q;  1KQ2 A;  2CUD A;  4D8D A;  2CYZ B;  2YT6 A;  2RM4 A;  4KUL A;  3OMG A;  2CDT A;  2OTJ Q;  2HEQ A;  2RQU A;  9ATC B;  3M0Q A;  2FRY A;  1FWZ A;  3JCM g;  2DO3 A;  4WTO B;  4OMO A;  2CZ7 B;  4KBM B;  2G3R A;  4GLK A;  4D8K A;  2ED0 A;  2CP5 A;  4J9G A;  1QVF A;  3PNW C;  4J6Y A;  1BB9 A;  2VV5 A;  4J8O A;  2X4J A;  1WQW A;  3CEY A;  2KRS A;  1K73 R;  2VGM A;  2QEX A;  4B9W A;  4C0D C;  5LJ5 h;  1G5V A;  1VQP T;  2LZ6 B;  4ESR A;  4VUB A;  4PJO B;  1K0S A;  5A0G A;  1LCK A;  2HKQ B;  4M78 F;  2E70 A;  2SEM A;  3JB9 F;  1ZUY A;  1WDX A;  2RD1 A;  1WXU A;  1S72 Q;  1T0J A;  1VIF A;  4BE0 A;  3EGD B;  1Q86 R;  2LP5 A;  1YJ9 T;  2XID A;  1WHM A;  3M58 A;  1LVK A;  4AT1 B;  1IGQ A;  1SHG A;  5FU6 B;  2JTE A;  4Y91 A;  2DF6 A;  4M78 C;  1QVG A;  1JJ2 A;  3I35 A;  8AT1 B;  4R55 A;  1MV3 A;  4M7A F;  2M02 A;  1VYV A;  4PFP A;  2EQU A;  2EQM A;  4B9X A;  1V29 B;  3DLL A;  2DBK A;  3CCE A;  2YRC A;  4C92 E;  2RN8 A;  2JUF A;  2K5F A;  2L3S A;  3M0R A;  4M7A C;  2CT4 A;  3JCM J;  3IQL A;  1NLO C;  2JM8 A;  3TVT A;  1K9M C;  2YDL A;  1SPK A;  2HCK A;  2QI2 A;  1T3S A;  5IXB A;  1VQK A;  2PQW A;  4KRT A;  4C92 G;  1RI9 A;  3JCM V;  5LJ5 d;  1QKW A;  2RMO A;  3I55 T;  1AWO A;  1J3T A;  2X51 A;  1SRM A;  2O4X A;  1PG5 B;  3HFO A;  5CR2 A;  1M90 U;  1MND A;  4RTZ A;  4X9D A;  3EG3 A;  1VQ8 Q;  2KT8 A;  3VUZ A;  1YI2 Q;  1RAB B;  4C5I A;  3HRS A;  4MML A;  1BIA A;  2RO0 A;  3M0P A;  1NPP A;  4ME7 A;  4C0G A;  1GFD A;  2KXD A;  1D3B B;  1RL2 A;  1D0X A;  1NLP C;  1YJW Q;  2M0Y A;  3CCQ Q;  3MHX A;  3X25 B;  3LW5 E;  1YIT T;  2KAF A;  1FX7 A;  2GTJ A;  3CPW S;  3OBY A;  1NJI C;  1SSF A;  3I9Q A;  2RQR A;  4M75 E;  4OML A;  7AT1 B;  2E5K A;  1TOV A;  1O75 A;  2L3Q A;  1UGS B;  4JJB A;  5IH2 A;  3I5S A;  3CCM T;  2X3W D;  2COY A;  2ZPB B;  4RTV A;  4PJO A;  2Y90 A;  1WX6 A;  1I07 A;  4F7U E;  2DVJ A;  2QQ9 A;  4Z02 A;  2MCN A;  2H3E B;  1VQL Q;  3OYG A;  1G2B A;  2EYW A;  2LCL A;  3PIO A;  4AMC A;  5FRN A;  3PMI A;  4M75 G;  3ME9 A;  1WQ7 A;  2EKO A;  1VQ9 T;  2J6K A;  4M7D E;  5GMK e;  1AHJ B;  3M9Q A;  4F7U G;  4HVU A;  2HQE A;  1Q81 C;  4FYW B;  4HT9 A;  4OGC A;  4EMK A;  1VQ4 Q;  5GAM j;  5J39 A;  1U3O A;  1M3C A;  3QZ9 B;  2DMO A;  3EG9 B;  1LPL A;  1UUE A;  5FLX E;  1KIK A;  1BBZ A;  2JW4 A;  3MPU B;  3VS2 A;  2DL7 A;  3CC7 T;  1X43 A;  4C92 D;  1EZZ B;  4M7D G;  4IUQ A;  4L5G A;  4OP0 A;  5J26 A;  1KJW A;  4JZ4 A;  2EYQ A;  1I0C A;  2CSQ A;  3G71 A;  1X2Q A;  2NLU A;  4B6M A;  3KBG A;  3L2Q A;  4CC3 A;  1RAE B;  3CMA T;  1VQ7 A;  4C5G A;  4OGE A;  5L23 A;  3AT1 B;  3CCS Q;  2LJ0 A;  4JJN K;  1VQN A;  3HKS A;  1KQS S;  3LWH A;  4J7F A;  5GAM h;  2DXC A;  4LUD A;  3E1S A;  1OU9 A;  3CME T;  4PNO A;  2R5M A;  5A0L A;  3MP6 A;  3CCV Q;  2CH4 A;  1OZ3 A;  1Q82 R;  3CBM A;  2W0Z A;  3RER A;  1D3B A;  2KYB A;  2PZ1 A;  5KE3 A;  1RAH B;  3OBW A;  2E6N A;  3HTR A;  2KRN A;  1IRE B;  3WXM B;  2FHD A;  4ZTF A;  3RNJ A;  2D6F A;  3NTH A;  4N0A A;  2EBP A;  2DJZ A;  5I11 A;  1M30 A;  3INZ A;  4DBR A;  3GF5 A;  4J83 A;  3FC3 A;  1QVF S;  1ZA1 B;  2K57 A;  4C92 B;  1G83 A;  1K0X A;  5GJW B;  3RES A;  4MZM A;  2EJG A;  3GPL A;  3DB3 A;  4J9H A;  1UGV A;  2X35 A;  3QO3 A;  4PLI A;  4CI0 C;  3WVD B;  2DKG A;  2K2V A;  2R58 A;  3OYJ A;  3CCL A;  2RK2 A;  4EMK C;  2X4X A;  4LNP A;  3EGX B;  4ZN3 A;  3M0T A;  2XHC A;  1N9R A;  3PT9 A;  2QQS A;  3L2R A;  1YWO A;  2DRM A;  2VVK A;  1AZG B;  1D1B A;  3FJ5 A;  1W2B P;  4M7D D;  1GXI E;  1ZSG A;  2JS0 A;  3FDR A;  3CC4 A;  2QQA A;  3ZBD A;  4OMN A;  4M77 C;  2BZX A;  4IUP A;  2HD0 A;  2E12 A;  5J3B A;  4RTW A;  5EG2 A;  4X9C A;  5IT9 E;  2JTF A;  2DBM A;  4KH0 B;  1VYT A;  3UDC A;  3WVE B;  3VYG A;  2CRE A;  2K2M A;  1QVG S;  1YI2 T;  3J80 E;  1AD5 A;  2IPO B;  1JJ2 S;  3UAT A;  2R5A A;  3CCU A;  2HMA A;  4A4H A;  3QUI A;  2L3P A;  4RMO A;  3MEW A;  2VWF A;  4UC4 A;  3BY7 A;  4C8Q E;  1WJQ A;  1KC8 R;  2VXE A;  2LJ3 A;  4F7U B;  2RF0 A;  2V1R A;  2V8I A;  2CH4 W;  3HFN A;  3CCJ T;  3H0H A;  1YCY A;  5FRO A;  4FIB A;  2EWN A;  1G3W A;  2P0Q A;  4PLL A;  4C8Q G;  4RCB A;  4M4Z A;  2CP6 A;  2HAX A;  1WHG A;  3N5B B;  4N4G A;  4RCC A;  2F2V A;  1WZO A;  3M5A A;  3JB9 I;  2J05 A;  3C12 A;  3G6E A;  1VQP Q;  2O9V A;  3CCR T;  1D09 B;  2L5Q A;  1N8R R;  1K8A C;  3OYF A;  4XU3 A;  2RJF A;  3JCM Q;  1UDL A;  1RAD B;  4HA8 A;  1V76 A;  1QVF P;  4DBF A;  3L2Z A;  4PJO E;  1K4U S;  1T3L A;  2B86 A;  2DL8 A;  1YJ9 Q;  2PVD B;  2EJ9 A;  3NMZ C;  3QXE B;  1XNI A;  2GCX A;  1HYO A;  4LDU A;  2KSS A;  2K5I A;  2HL3 A;  2X4W A;  1UGR B;  1Y7X A;  2PVG B;  4M7A B;  1KD1 R;  2PVO B;  1VQO T;  3BDU A;  4JS5 A;  4FW2 A;  2J6O A;  1QWE A;  2E64 A;  3EGX A;  4BD3 A;  4XU0 A;  1M1K R;  5GAN g;  4PJO G;  3M0S A;  2W10 A;  1PWT A;  3H0I A;  4BE2 A;  5HK3 A;  2O31 A;  4Z89 A;  4N4H A;  3L2U A;  5GMK h;  4FYV B;  1C1A A;  1PNJ A;  4BI4 A;  1OYX A;  1YCS B;  2YXY A;  1KK7 A;  1Y07 A;  4LXC A;  2LC4 A;  3VS7 A;  2ZPI B;  3RKY A;  1GRI A;  2DYI A;  5CK9 A;  2ESW A;  2G6F X;  1I1J A;  3ULR B;  2E4H A;  2BZY A;  4E6R A;  2BE9 B;  3I55 Q;  5FWB A;  1TH7 A;  1AZE A;  3L2W A;  2O2O A;  2YUN A;  2O9S A;  1EIF A;  2EGC A;  3NGP A;  1YIJ A;  2YUP A;  2P84 A;  3I5R A;  2JOY A;  4PJN A;  4XU1 A;  4QKU A;  2FEI A;  1W2B A;  1CSK A;  5LL6 S;  4BE1 A;  4RTU A;  2A28 A;  2VKN A;  1ZSZ C;  2RB6 A;  1X27 A;  1NBE B;  2QEX T;  4QW2 A;  2F2X A;  1AOJ A;  1AVZ C;  1PC0 A;  3BFM A;  3E9G A;  2EKH A;  4FSS A;  3SFM A;  1YIT Q;  3TU4 K;  4KH1 B;  3CC2 A;  3LLR A;  3F70 A;  4LDW A;  2LNH B;  2E6Z A;  1HK9 A;  1M8M A;  5C6S A;  4N4I A;  4KUD K;  2LVM A;  1K73 U;  5HKC A;  3M0U A;  4EIK A;  1PSE A;  3VS6 A;  2GFA A;  3CCM Q;  4TVR A;  3MCA B;  1XOV A;  4M78 A;  4A4E A;  2DXB A;  2VUB A;  4XTZ A;  3I56 A;  2CP7 A;  1QMC A;  4HCB A;  1CKA A;  3FRN A;  3VS3 A;  3OYY A;  3QDR B;  3DB4 A;  2MI6 A;  4J6W A;  2RPN A;  4PJO D;  2XU8 A;  4JLG A;  3JCM f;  1X75 C;  1M2V A;  3M54 A;  1VQ9 Q;  2ROT A;  4F14 A;  2JM9 A;  2C0O A;  2ZPH B;  4XTW A;  5DM7 R;  2NUT B;  2LRQ A;  4M7A A;  1U1T A;  2EYX A;  5CKF A;  3QHS A;  1Q86 U;  3M53 A;  2DNU A;  5GAM e;  4JLI A;  3QBY A;  2O4X B;  1K9A A;  3CCE T;  2V26 A;  5FU7 C;  2M0O A;  3MP8 A;  3CC7 Q;  2EQK A;  4J9B A;  3QDF A;  2A36 A;  2EYY A;  4BI3 A;  5IHN A;  2K3X A;  4E7S A;  2AZS A;  4KGV B;  5GAN 7;  1Y71 A;  1VQK T;  1HSQ A;  4Y28 E;  4AFU C;  3E9F A;  3CMA Q;  3EGU A;  1OPL A;  1UFF A;  3HRU A;  1UEB A;  2AHJ B;  4PL6 A;  3JSC A;  3QZ5 B;  4M75 F;  2KEA A;  3MKD A;  3SHW A;  5C0M A;  2HNI A;  3MP1 A;  2YWW A;  4V2S A;  2KRO A;  4JS4 A;  1TWB A;  2DD5 A;  3CME Q;  1NJI R;  2QGF B;  4J9I A;  4NL2 A;  2KMT A;  2MMP A;  3JV3 A;  4XTX A;  5GAN 2;  2VGN A;  4OVA A;  2AZV A;  2JXB A;  2AK5 A;  1N5Z A;  2XDD A;  2QYZ A;  1XQH A;  4NOY A;  4C0F A;  1H8K A;  3KFV A;  3G4S A;  1WPY A;  1WHL A;  2NYS A;  3OYC A;  2O88 A;  2LQK A;  1AWJ A;  3OYK A;  1Q7Y C;  1BK2 A;  1X6G A;  2COW A;  2JMC A;  4IUT A;  5LJ3 d;  3LH5 A;  1LJO A;  4QVZ A;  1HJD A;  2C0I A;  4EMK B;  4BB7 A;  3QJY A;  2HSP A;  3AHU A;  1ZHI A;  1VA7 A;  2M1H A;  1IB8 A;  2RHY A;  2KNB B;  1ARK A;  3OB9 A;  1JXM A;  1N27 A;  1FMK A;  2OAU A;  3GBQ A;  1YHQ A;  1NEG A;  4M77 B;  2RQW A;  5DLO A;  2V8K A;  3M55 A;  2DE0 X;  3GNF B;  1VYU A;  2OAW A;  5CQX A;  2NUT A;  4JRQ A;  4E47 A;  5DLQ E;  2FPE A;  2EIF A;  4ELY C;  3SD4 A;  3ZL7 C;  1GBQ A;  5CO7 A;  4IUU A;  5M9O A;  2DL5 A;  1X6B A;  2WSC E;  2HL5 C;  2HDA A;  3E19 A;  1VQ6 A;  5DY9 A;  4DEY A;  3CBO A;  3PTA A;  1PKS A;  3G71 T;  3M57 A;  2A08 A;  5CCA A;  2Y4X A;  3GNG A;  4X34 A;  4Y92 A;  1VQ7 T;  1GBR A;  4A4G A;  5CKB A;  3NFC A;  1RAC B;  1E6H A;  1D0Y A;  3VUB A;  1MGQ A;  1VQN T;  4RTX A;  1YWP A;  1IO6 A;  4JZ3 A;  1G3S A;  1JU5 C;  4A54 A;  4F04 B;  1RI0 A;  4E7Z A;  3CCJ Q;  3T9N A;  2DFU A;  1QCO A;  5I21 A;  3X26 B;  3A8O B;  3KXT A;  2AKK A;  2JZ2 A;  2PUO B;  2B8A A;  4ZTJ A;  3UF4 A;  4A4F A;  5HK0 A;  1F1B B;  2DER A;  1ZLM A;  4PJL A;  4ANJ A;  4AFS C;  3OYM A;  3RBB B;  2LQ8 A;  4ZGJ B;  4FT2 A;  1Q82 U;  3CCR Q;  2WSF E;  1W2B S;  2FZC B;  1KHI A;  2LT1 A;  3DLM A;  4M78 E;  4RG8 A;  1WYX A;  3LYI A;  2PUK B;  5GAO m;  2QTV A;  3TCJ A;  3CCL T;  3GP8 A;  4M77 A;  1VQO Q;  3QII A;  4C8Q F;  8ATC B;  3VS4 A;  1PRM C;  2I0N A;  2JT4 A;  3HHT B;  1D1A A;  3JAM E;  5GAN 8;  3LGF A;  1G3Y A;  3CC4 T;  3JB9 G;  3HP9 A;  5KCO A;  4M7A E;  2OTL A;  2KR3 A;  2MYS A;  1SRL A;  2RI3 A;  2LJ1 A;  4XU2 A;  3A8M B;  2RNA A;  2RHX A;  3S3M A;  5GAN 3;  2KI7 A;  2E5Q A;  4KUI A;  1H64 1;  4AG1 C;  3H41 A;  3VJP A;  3CD6 A;  4HXJ A;  2KVQ G;  3SWN C;  2CT3 A;  2ZZD A;  1RAA B;  5KYY B;  1BCO A;  2NUP A;  2P4R A;  4M7A G;  2FZG B;  1VQ5 A;  1UB4 A;  3X20 B;  1W70 A;  3NTK A;  1Y0M A;  3EH1 A;  3CCU T;  3RKW A;  5D6Y A;  4XTU A;  3S6W A;  1UGQ B;  3VRY A;  2D0Q B;  1KQ1 A;  4OMM A;  1ZSZ B;  3EH2 A;  5CAI A;  1WA7 A;  4WCI A;  2YSQ A;  3OA6 A;  2ATC B;  3JCM W;  1UHC A;  4PJO F;  1Q95 G;  1N6A A;  5KYN A;  3URG A;  4OB0 B;  4IKF A;  4LDV A;  1M3B A;  1IRX A;  1VQM A;  1AEY A;  1KG1 A;  4QQG A;  1K8A R;  1GL5 A;  2XKO C;  2LDM A;  3VS1 A;  2QEX Q;  4FSX A;  1R0B G;  3H6Z A;  2QDY B;  3V8L A;  1KC8 U;  4J9D A;  2YLB A;  2DEQ A;  5KCH A;  2ROL A;  3UT1 A;  1FYN A;  2QAZ A;  1WIE A;  2K4Y A;  2K3Y A;  2CUB A;  4DBH A;  4QT7 A;  3QWX X;  3UA6 A;  2XDP A;  4J6X A;  3G6E T;  1M4Z A;  3X28 B;  3J81 E;  2JJ9 A;  5A0D A;  2IIM A;  4BAC A;  2X3X D;  4BY6 C;  2QA4 A;  4XK8 E;  2MIO A;  1B7T A;  3UA7 A;  1WXT A;  4QQD A;  2Y4Y A;  1YJN A;  3OYD A;  2CZ1 B;  2FRW A;  3A1P A;  2OTJ A;  5GAM d;  4JRK A;  4OF1 A;  2BZ8 A;  5CQY A;  1OU8 A;  1QP3 A;  1PSF A;  4M78 D;  1N8R U;  3MET A;  5FU7 B;  1M90 C;  3JB9 D;  2ZPE B;  3C94 A;  1PHT A;  1MHN A;  4LE9 A;  3RDV A;  2LNV A;  1H3Z A;  1RAG B;  2ZGW A;  2AT1 B;  3C4S A;  1MMA A;  1RAF B;  4IIM A;  1UG1 A;  3RR6 A;  4HCZ A;  1GCP A;  1BI1 A;  3CCE Q;  2CKK A;  4ZGD B;  4MMK A;  3OYA A;  4OB2 B;  4M7A D;  1KD1 U;  3JCM e;  1M1K U;  2JTM A;  4DA4 A;  3THK A;  4C0D B;  2K3B A;  2M16 A;  2K6D A;  2VB6 A;  1VQK Q;  3NPF A;  1H92 A;  3FJP A;  3LGL A;  3RMQ A;  5KYY A;  1S72 A;  2ABL A;  1OPK A;  2EGA A;  3X24 B;  2SRC A;  1QQJ A;  1ABO A;  1QW1 A;  1R0C B;  2F5T X;  4XTV A;  5IHK A;  2A37 A;  2QTX A;  5D6W A;  3H9N A;  1ZSZ A;  1QWF A;  2WAC A;  1YIJ T;  1K76 A;  2JN0 A;  3J7A F;  3P8D A;  1Y96 B;  4PKC C;  1WFW A;  5IAY A;  2D8H A;  1RLQ C;  3U23 A;  4M78 B;  5GAN f;  1MMN A;  2GNC A;  1TUD A;  4R0K A;  1SEM A;  3V7C A;  2FPF A;  2RHZ A;  1N9S A;  2XDB A;  2L2P A;  1ZBX A;  2IG0 A;  5HCK A;  4IUR A;  4O6J A;  4FYY B;  1QVP A;  1M2V B;  3CC2 T;  3OSV A;  5GMK i;  2DXT A;  1WLP B;  1QCN A;  2FG0 A;  1M9S A;  3Q1J A;  5FW9 A;  1XTD A;  1JQQ A;  1M3A A;  2M51 A;  2EFI A;  3ZEH A;  4OMP A;  2CP0 A;  1SSH A;  3HSB A;  1MMD A;  4DQ2 A;  1VUB A;  2GGR A;  2HKN A;  3L42 A;  2FYK A;  3I56 T;  3CXC P;  3SDZ A;  4L6V 5;  1UEC A;  1LOJ A;  2DIQ A;  2J6F A;  5GMK l;  3OYI A;  1D1C A;  1X69 A;  4PK4 A;  1VQ8 A;  4MDW A;  4Q5W A;  2Z0W A;  1P92 A;  2GBQ A;  3O8V A;  1TG0 A;  4E7H A;  1BI2 A;  4PJJ A;  4M77 E;  3VU3 C;  1NYF A;  1YJW A;  3LX7 A;  4RTT A;  3CCQ A;  3RMS A;  3HRT A;  4NL3 A;  1Z9Q A;  1H3H A;  3C0C A;  3EHQ A;  3QYH B;  2FZK B;  3PIP A;  3FLG A;  2KT1 A;  1KHC A;  4GLM A;  3M59 A;  3FB9 A;  4EMH A;  2JVV A;  2COZ A;  4E7I A;  4M77 G;  4XAX B;  2VYT A;  3G71 Q;  5I22 A;  3SB2 A;  5HY6 A;  2BUD A;  1AWW A;  1ZQ1 A;  3V7R A;  3C95 A;  2DTH A;  2DTI A;  2FVU A;  2E41 A;  1VQ7 Q;  5LJ3 f;  1VQL A;  2PU9 B;  1S1N A;  4M75 A;  5KYX A;  2YRD A;  1VQN Q;  4RKU E;  4HVV A;  4EDU A;  5CIU A;  3EG1 A;  3V8J A;  4DOW A;  1Q7Y R;  1SKU B;  2RQT A;  2P0K A;  3O5Z A;  1Y96 A;  4II1 A;  4C92 F;  1VQ4 A;  2ZPF B;  1NM7 A;  3REB B;  2DA9 A;  1OUL A;  3G4S T;  2D9T A;  5LJ3 g;  1UE9 A;  1NJI U;  4KT0 E;  1N8R C;  4JUV A;  3ER0 A;  4C92 C;  4JPB W;  3OS2 A;  2A0F B;  1TXQ A;  3EG2 A;  2OJ2 A;  5LJ5 f;  1U8R A;  1YFN A;  1UGP B;  2EQI A;  4LN2 A;  4AFQ C;  1K9M R;  3OYN A;  3OW2 A;  1G3T A;  1CKB A;  3JCM P;  4AFZ C;  4QVC A;  1UHF A;  3EHR A;  1NYG A;  3CCS A;  2L0A A;  1OQK A;  4LDY A;  1GFC A;  3EFO A;  3MEV A;  1OOT A;  1WHH A;  2VC8 A;  3CCL Q;  4JRP A;  1YHQ T;  1M8V A;  1B3Q A;  1BI3 A;  4JDS A;  2EJF A;  1M1K C;  3VV0 A;  1M2O A;  2DET A;  5LJ5 g;  1BIB A;  3CCV A;  1FMW A;  2C06 A;  3SWN B;  3CC4 Q;  2OX7 A;  1I5O B;  4KGX B;  2DYB A;  2XIC A;  3DKM A;  3OMC A;  4M77 D;  5ECA A;  3M4Y A;  2DPP B;  3PFS A;  5GAO q;  1GCQ C;  3H0F A;  1HXD A;  5D7U A;  2DL4 A;  4JRI A;  1WGS A;  1LNX A;  3RUX A;  2F5K A;  2A7Y A;  2XG8 D;  1VQ6 T;  4F7U F;  4CC7 A;  3QPH A;  4F17 A;  5GAO p;  5FRM A;  1ZUU A;  5IN1 A;  1V1C A;  3CXC A;  3P8B B;  3CCU Q;  2FO0 A;  2XK0 A;  4LUE A;  4M75 C;  1C0M A;  2CS7 A;  2EPD A;  3E2U A;  3JCM h;  3GOX A;  2MWP A;  2DEU A;  4X1V A;  2GFU A;  3KUF A;  4C0Z A;  4FT4 A;  1IHW A;  5KYU A;  2X9H A;  2K7A A;  4M7D F;  1SHF A;  5CVI A;  2P4T A;  1ZA2 B;  2LCC A;  1BCM A;  3GLX A;  2FL7 A;  1AT1 B;  4BDZ A;  1NEB A;  5GAO r;  4BY6 B;  1Z9Z A;  2DX1 A;  3UPU A;  2RI2 A;  3UWN A;  3QKJ A;  4M7D C;  1WJR A;  4IUV A;  1Q81 R;  1I81 A;  4J9F A;  3VYH B;  3MO8 A;  2AKL A;  5IXF A;  3QWY A;  1IGU A;  1MUZ A;  2LQN A;  3OYH A;  2YRV A;  1YP5 A;  5AT1 B;  3G6E Q;  1PCX A;  1T0H A;  4OMQ A;  1M27 C;  1X01 A;  3HPW A;  4YTL A;  2EYZ A;  3QSU A;  4RG2 A;  1TU0 B;  5CKD A;  3TQ7 P;  1VIE A;  5CKE A;  5I2M A;  4XTY A;  2DIG A;  2DTO A;  1NE8 A;  2MK5 A;  2E3H A;  2ZPG B;  2XD0 A;  3QG1 A;  3MEA A;  3JCM d;  2NUP B;  4QQ6 A;  1Y57 A;  4C8Q A;  1WHK A;  3SWN A;  1OX8 A;  2OTL T;  2XMF A;  1VOM A;  4K11 A;  2LX7 A;  1VQP A;  4FM4 B;  5GMK m;  3BW1 A;  4NS5 A;  3CD6 T;  2KDS A;  4OB3 B;  4RTY A;  4HVW A;  4A63 B;  1K73 C;  1X6O A;  2A3L A;  2MAM A;  1A0N B;  1VQ5 T;  5CKH A;  2GTO A;  2DIL A;  1XJW B;  2HSE B;  1JEG A;  1YJ9 A;  2E10 A;  2F1L A;  3JCM b;  6AT1 B;  2MOX A;  2R57 A;  3LWI A;  3EG0 A;  2KK4 A;  4HKE A;  1YIJ Q;  2QDL A;  2E1H A;  1NG2 A;  1E6G A;  3FIF A;  5GAM f;  3OS0 A;  3MEU A;  1B34 B;  3CQT A;  3P8H A;  1M1F A;  1VQM T;  2HBP A;  4DBQ A;  3PVQ A;  2ED1 A;  2KGT A;  3A8G B;  1Q86 C;  5L8R E;  1MMG A;  1ZBJ A;  3HL8 A;  2MWO A;  1FXX A;  3TSW A;  4AG2 C;  3EGD A;  1KFZ A;  4KGZ B;  1WJS A;  2OI3 A;  4ZN1 A;  2QG9 B;  2NWM A;  3CC2 Q;  4HCK A;  1WI7 A;  2CP3 A;  3R6O A;  2I2L A;  4Z88 A;  1ACM B;  1OEB A;  1K8A U;  1M90 R;  3JB9 H;  4PFZ A;  1YNZ A;  1AWX A;  2QA4 T;  1R8O B;  2EAY A;  1EX4 A;  1MNE A;  2L3R A;  5GAM g;  3D7S B;  1ABQ A;  1DJ7 B;  3FEO A;  5GAN e;  3I55 A;  4M78 G;  5GAN 6;  1YJN T;  3RKX A;  1U5S A;  3I56 Q;  3PE0 A;  1K1Z A;  2J7I A;  3CPF A;  4A53 A;  2OTJ T;  3OYB A;  4ORZ A;  3A5Z B;  3TSZ A;  4C5E A;  2K5L A;  1EFN A;  3NHN A;  3JCM c;  1QKX A;  3A8H B;  2QK0 A;  2DD4 A;  3H8Z A;  2EQJ A;  1I4K 1;  1UJY A;  1ZX6 A;  2RJE A;  4C8Q C;  1TS9 A;  2DAQ A;  1FMV A;  3TRE A;  3G1J A;  2JMA A;  4OB1 B;  2E65 A;  3JRZ A;  2KY9 A;  3OW2 S;  4E7K A;  3OS5 A;  2DM1 A;  1IHV A;  3V7S A;  2HQH A;  2GF7 A;  1YIT A;  2D8J A;  4HCC A;  2CZ6 B;  2LX9 A;  1RAI B;  4RUG A;  1PKT A;  1BKB A;  4D6W A;  3PVL A;  1O9S A;  5KE2 A;  3CCM A;  2DK3 A;  3OQ5 A;  2P0P A;  1S72 T;  4J9C A;  1SG5 A;  2ENM A;  4L59 A;  3LH0 A;  2EGE A;  2QXF A;  1X2K A;  2V1Q A;  1OX9 A;  1I5L A;  4PJO C;  3BE3 A;  3A98 A;  2FPD A;  1VQ9 A;  3CPW P;  2DZC A;  5I2S A;  2V8J A;  4CC2 A;  5GAO n;  4J5Y A;  5A2Q E;  4MDX A;  2DLP A;  2LQW A;  4M75 D;  3ASK A;  3EFR A;  2X4Y A;  1IZ6 A;  3CXC S;  1B34 A;  5D6X A; 
#chains in the Genus database with same CATH homology
 2RQR A;  4OML A;  2GBQ A;  1TG0 A;  2E5K A;  2KEA A;  2L3Q A;  4JJB A;  5IH2 A;  3I5S A;  2X3W D;  4RTV A;  3SHW A;  1WX6 A;  1I07 A;  1NYF A;  2DVJ A;  4RTT A;  4GBQ A;  2KRO A;  2PNI A;  2MCN A;  1PRL C;  2F2W A;  1Z9Q A;  4J9I A;  1H3H A;  1G2B A;  2EYW A;  3C0C A;  3EHQ A;  3JV3 A;  2AZV A;  2JXB A;  2AK5 A;  1N5Z A;  2KT1 A;  4GLM A;  1H8K A;  3KFV A;  2J6K A;  3VS0 A;  1UTI A;  2O88 A;  2EW3 A;  4HVU A;  5I22 A;  1AWJ A;  1U06 A;  1AWW A;  1U3O A;  2JMC A;  1BK2 A;  1M3C A;  1X6G A;  2YUO A;  2DMO A;  1UUE A;  3LH5 A;  1KIK A;  1BBZ A;  2NUZ A;  1HJD A;  2JW4 A;  3VS2 A;  1KSW A;  2C0I A;  2DL7 A;  1S1N A;  1X43 A;  4HVV A;  2HSP A;  2ECZ A;  3EG1 A;  1KJW A;  1VA7 A;  4JZ4 A;  2RQT A;  1I0C A;  2CSQ A;  2KNB B;  1ARK A;  3O5Z A;  1X2Q A;  1JXM A;  1W1F A;  1FMK A;  4CC3 A;  3GBQ A;  1NEG A;  2RQW A;  1NM7 A;  1TUC A;  3REB B;  4JJC A;  2DA9 A;  4J9E A;  2GQI A;  2C0T A;  4Z8A A;  5L23 A;  2DE0 X;  1MV0 B;  2KYM A;  2DJQ A;  2HBW A;  1UE9 A;  2H8H A;  2LJ0 A;  1VYU A;  2OAW A;  2FPE A;  4JPB W;  4LUD A;  4JJD A;  3ZL7 C;  3EG2 A;  2OJ2 A;  1GBQ A;  2YUQ A;  2EQI A;  2LCS A;  2DL5 A;  2CH4 A;  4LN2 A;  1X6B A;  4AFQ C;  2W0Z A;  2HDA A;  1CKB A;  4DEY A;  2KYB A;  2PZ1 A;  4AFZ C;  1UHF A;  2KRN A;  3EHR A;  1NYG A;  3RNJ A;  2L0A A;  3VS5 A;  1PKS A;  2EBP A;  2A08 A;  1GFC A;  1OOT A;  4IIO A;  2K9G A;  2BTT A;  5I11 A;  1M30 A;  1B3Q A;  4Y92 A;  1GBR A;  1WXB A;  1E6H A;  1G83 A;  1K0X A;  5GJW B;  4RTX A;  1YWP A;  1IO6 A;  2D0N A;  1QCF A;  1JU5 C;  1OV3 A;  4JZ3 A;  2DYB A;  4J9H A;  1UGV A;  2EVR A;  5ECA A;  1ZUK A;  1RLP C;  1GCQ C;  3H0F A;  2DL4 A;  5GJV B;  2AKK A;  1BU1 A;  2DRK A;  4LNP A;  1B07 A;  4ZNX A;  4CC7 A;  3M0T A;  4F17 A;  3UF4 A;  1ZUU A;  1V1C A;  1ZLM A;  1YWO A;  2DRM A;  2RQV A;  2VVK A;  1AZG B;  2D1X A;  3FJ5 A;  4AFS C;  2FO0 A;  1ZSG A;  5FWC A;  4LUE A;  2JS0 A;  2LMJ A;  3RBB B;  2EPD A;  4X1V A;  4OMN A;  1GCQ A;  2BZX A;  2K7A A;  4RTW A;  1SHF A;  4CC4 B;  2DBM A;  1JO8 A;  1VYT A;  2CRE A;  2JS2 A;  2K2M A;  1AD5 A;  1WYX A;  3UAT A;  2PTK A;  1NEB A;  1Z9Z A;  2DX1 A;  2L3P A;  4J9F A;  2VWF A;  2AKL A;  5IXF A;  3QWY A;  1UJ0 A;  1MUZ A;  2LQN A;  3VS4 A;  1PRM C;  2I0N A;  2JT4 A;  1YP5 A;  3R6N A;  3SEM A;  1T0H A;  2LJ3 A;  1HD3 A;  2KR3 A;  1SRL A;  2RF0 A;  2V1R A;  2LJ1 A;  4OMQ A;  2CH4 W;  1M27 C;  3H0H A;  2RNA A;  1YN8 A;  1RUW A;  2EYZ A;  3H41 A;  4AG1 C;  2DL3 A;  2KXC A;  2KE9 A;  5EC7 A;  4HXJ A;  4M4Z A;  2CT3 A;  4DEX A;  5IHI A;  2F2V A;  2P4R A;  2J05 A;  1W70 A;  1Y0M A;  2O9V A;  1JXO A;  3VRZ A;  3VRY A;  2KRM A;  4F16 A;  2K79 A;  4OMM A;  2CSI A;  3REA B;  1E7O A;  2KBT A;  1WA7 A;  1UDL A;  1Y57 A;  4WCI A;  2YSQ A;  1K4U S;  1UHC A;  1T3L A;  2B86 A;  2DL8 A;  1W6X A;  2XMF A;  4K11 A;  1M3B A;  2J06 A;  2LX7 A;  1AEY A;  1QLY A;  1GL5 A;  3NMZ C;  3VS1 A;  2CUD A;  4D8D A;  2YT6 A;  4J9D A;  2CDT A;  4RTY A;  2HEQ A;  2ROL A;  4HVW A;  1FYN A;  2J6O A;  1QWE A;  2RQU A;  4A63 B;  1WIE A;  3M0Q A;  2FRY A;  1A0N B;  2CUB A;  3M0S A;  2W10 A;  4QT7 A;  4OMO A;  1PWT A;  3QWX X;  3UA6 A;  3H0I A;  4D8K A;  2GTO A;  2ED0 A;  2DIL A;  2IIM A;  4J9G A;  2O31 A;  2X3X D;  4Z89 A;  1JEG A;  1BB9 A;  1PNJ A;  2MOX A;  2MIO A;  3EG0 A;  3UA7 A;  1WXT A;  1YCS B;  2KRS A;  2QDL A;  3VS7 A;  1NG2 A;  2FRW A;  1E6G A;  1GRI A;  2ESW A;  2BZ8 A;  2G6F X;  3CQT A;  1I1J A;  3ULR B;  3PVQ A;  2BZY A;  2ED1 A;  2KGT A;  4E6R A;  2LZ6 B;  1PHT A;  1ZBJ A;  4ESR A;  5FWB A;  4LE9 A;  1AZE A;  1K0S A;  1LCK A;  2O2O A;  3TSW A;  2YUN A;  2O9S A;  4AG2 C;  1KFZ A;  2EGC A;  2OI3 A;  2SEM A;  2NWM A;  4IIM A;  1ZUY A;  4HCK A;  1WDX A;  3NGP A;  1WI7 A;  1WXU A;  1UG1 A;  2YUP A;  3I5R A;  1T0J A;  4Z88 A;  1OEB A;  1GCP A;  2FEI A;  1CSK A;  1YNZ A;  2LP5 A;  1AWX A;  4RTU A;  1SHG A;  2A28 A;  2JTE A;  2VKN A;  2DF6 A;  1ABQ A;  1X27 A;  2F2X A;  1AOJ A;  1AVZ C;  1U5S A;  3I35 A;  3THK A;  3PE0 A;  2EKH A;  2K3B A;  1K1Z A;  2J7I A;  1MV3 A;  4FSS A;  1VYV A;  4ORZ A;  2K6D A;  3TSZ A;  1EFN A;  3NPF A;  1H92 A;  3NHN A;  1QKX A;  2ABL A;  2LNH B;  1OPK A;  1M8M A;  2EGA A;  2SRC A;  1UJY A;  1ZX6 A;  2DBK A;  1ABO A;  2RN8 A;  3M0U A;  5IHK A;  2A37 A;  4EIK A;  3VS6 A;  2L3S A;  1QWF A;  2JMA A;  1XOV A;  3M0R A;  2CT4 A;  3IQL A;  1K76 A;  1NLO C;  2JM8 A;  1CKA A;  1WFW A;  3TVT A;  3VS3 A;  2DM1 A;  2D8H A;  1RLQ C;  2YDL A;  2D8J A;  3U23 A;  1SPK A;  2HCK A;  1T3S A;  2RPN A;  5IXB A;  2GNC A;  4KRT A;  1TUD A;  4R0K A;  4RUG A;  1PKT A;  1RI9 A;  1SEM A;  1QKW A;  2RMO A;  2ROT A;  2FPF A;  4F14 A;  2JM9 A;  2C0O A;  1AWO A;  1J3T A;  1SRM A;  2L2P A;  5HCK A;  3PVL A;  4RTZ A;  2EYX A;  3EG3 A;  1WLP B;  4J9C A;  2FG0 A;  2DNU A;  2KT8 A;  2ENM A;  5FW9 A;  1JQQ A;  2EGE A;  1X2K A;  1K9A A;  1M3A A;  2V1Q A;  2M51 A;  3M0P A;  1GFD A;  2KXD A;  4J9B A;  1SSH A;  4OMP A;  2A36 A;  1NLP C;  2EYY A;  3A98 A;  2M0Y A;  2FPD A;  2GGR A;  5IHN A;  2AZS A;  4CC2 A;  1UEC A;  2DLP A;  2LQW A;  2J6F A;  1HSQ A;  1X69 A;  2GTJ A;  4AFU C;  3EGU A;  1OPL A;  3I9Q A;  1UFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...