2E5KA

Solution structure of sh3 domain in suppressor of t-cell receptor signaling 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
GSSGSSGSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of SH3 domain in Suppressor of T-cell receptor signaling 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Suppressor of T-cell receptor signaling 1
total genus 7
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2e5kA01
4D8DA 1H8KA 2BZXA 2PTKA 2BZYA 2RQTA 5GJVB 2DL4A 1ZX6A 4AFZC 1N5ZA 1Z9QA 2YUQA 5IXFA 1UG1A 1NLPC 2A36A 2LQWA 4J9EA 1AWWA 2LMJA 2DL7A 2VKNA 1UGVA 1PKSA 2RMOA 2IIMA 1M3AA 4HVWA 1BK2A 2KYMA 4JJCA 4RUGA 1M3BA 3PE0A 3VS7A 2P4RA 4OMNA 3REAB 2KBTA 3VS0A 4WCIA 2YUPA 1NYFA 4Z88A 1K9AA 4LNPA 2YDLA 1UTIA 1VA7A 3QWXX 1X6GA 4F17A 1GBQA 5IHKA 3M0RA 2K9GA 1X27A 1G2BA 1UFFA 2H8HA 4DEYA 1VYUA 1PKTA 2L3PA 3I5RA 2CH4W 1Y57A 5I11A 2JTEA 1AVZC 2X3WD 2GTJA 3VS2A 2GQIA 2DYBA 1YCSB 2AKLA 3KFVA 1U3OA 2K79A 1K1ZA 1B07A 1WFWA 4HXJA 1QLYA 2W0ZA 1U06A 4RTTA 3VS5A 2EYZA 2K6DA 4M4ZA 2RNAA 3NMZC 1ZSGA 2KEAA 1KIKA 3RNJA 3UATA 2F2VA 2LZ6B 1K4US 4JZ3A 2LJ1A 3NPFA 1UHCA 1JU5C 1W6XA 2FPFA 1K0XA 3M0UA 1AZGB 2C0IA 1FYNA 2DNUA 3REBB 2LJ3A 1ABOA 3VRZA 4RTYA 2J06A 2KT1A 1X6BA 1LCKA 1AWOA 2EGEA 2LNHB 1PWTA 1GCQA 2ROTA 1JXMA 3M0QA 1OV3A 1QKXA 1JQQA 1BBZA 1GRIA 1NM7A 2DRKA 4Z8AA 3U23A 1AWXA 3O5ZA 2CH4A 1H3HA 1MUZA 3H41A 1ZLMA 2AKKA 3H0HA 2RQVA 4OMQA 4JZ4A 1SPKA 1FMKA 2EGCA 2KRNA 1WXTA 1V1CA 4OMPA 2EYXA 1RLPC 1UE9A 1WI7A 2HDAA 2J6FA 4IIOA 4J9HA 2LJ0A 1GFDA 2O2OA 3UF4A 4E6RA 1AEYA 2D0NA 2EYWA 3NHNA 1VYVA 2W10A 4ZNXA 4QT7A 2RQUA 2GTOA 4DEXA 1YN8A 2DLPA 3THKA 2LCSA 1AOJA 3EG2A 4KRTA 1AWJA 2ENMA 2MCNA 5IHIA 1Z9ZA 1T3SA 2LQNA 4J9BA 4LUDA 1YWPA 2KRSA 4OMMA 2AZSA 2YUOA 2O9VA 1SEMA 2J6OA 2HSPA 2J6KA 1T0HA 1XOVA 3VS4A 2QDLA 1YWOA 2RPNA 1QKWA 3QWYA 3EG1A 2F2WA 1GCQC 2CT3A 3M0TA 4RTZA 3PVLA 3TVTA 2DBKA 1A0NB 2F2XA 2G6FX 2EGAA 2DA9A 2ECZA 4FSSA 2PZ1A 3PVQA 1UECA 1OPLA 2K3BA 1W1FA 5ECAA 1IO6A 2DMOA 3UA7A 4JJDA 2VVKA 2EPDA 2A08A 1OEBA 2DBMA 2KRMA 2RF0A 4K11A 1PRLC 2FRWA 3EGUA 2EQIA 2DX1A 1YP5A 1X69A 1I0CA 1WXBA 4ORZA 4ESRA 3EG0A 2VWFA 2LX7A 2RQWA 4HVUA 1M3CA 1RUWA 4JPBW 2DRMA 1TUCA 2KXDA 1ZUYA 4A63B 1GL5A 2DM1A 1UJ0A 1GFCA 2FPDA 4Y92A 3LH5A 4AG2C 1W70A 4CC3A 2FO0A 3I9QA 2XMFA 1H92A 1SRMA 3FJ5A 1ARKA 2OJ2A 2FG0A 1NEGA 1I1JA 1NYGA 3CQTA 2CSIA 1RI9A 2YT6A 2GBQA 2KROA 2EYYA 1MV0B 1ZUUA 1NG2A 2K2MA 2ED0A 4AG1C 1KSWA 2GGRA 2SRCA 1K0SA 2J7IA 3C0CA 1TG0A 2M0YA 3RBBB 2DE0X 1WA7A 2NUZA 2KNBB 4CC2A 2A28A 1X43A 3TSWA 2V1RA 3A98A 2DL5A 2PNIA 4HCKA 2X3XD 2JT4A 1WDXA 3NGPA 2OAWA 2L2PA 3EHRA 3GBQA 1T3LA 4AFQC 1S1NA 2V1QA 2K7AA 1WIEA 2OI3A 2FPEA 2DF6A 2D8HA 1AZEA 1PRMC 1U5SA 3I35A 2RN8A 3VRYA 2ABLA 5I22A 1CKAA 3SEMA 2CUDA 1SSHA 3EG3A 2MOXA 3IQLA 2KGTA 1T0JA 3H0FA 3VS6A 1QWEA 1B3QA 2CREA 2CSQA 4R0KA 4AFSC 1JEGA 2JM9A 4CC4B 2KYBA 2GNCA 3M0SA 2KE9A 2AK5A 4RTWA 2BZ8A 2C0OA 4HVVA 2KT8A 1J3TA 4J9GA 1M8MA 1I07A 2JS0A 2MIOA 2HBWA 2EKHA 1GCPA 1BU1A 3VS1A 1OOTA 2E5KA 1WYXA 2L3QA 1UHFA 4J9DA 1GBRA 3ULRB 3UA6A 1E6HA 3M0PA 2KXCA 5FW9A 2JXBA 1RLQC 2DL8A 3EHQA 4Z89A 4J9FA 2M51A 2JW4A 1QCFA 2KR3A 3TSZA 2JMAA 2DL3A 4GLMA 1JO8A 1JXOA 1X2QA 2JS2A 2D8JA 5HCKA 2CT4A 1WLPB 2DJQA 1KFZA 1VYTA 5IHNA 1HJDA 1TUDA 2FRYA 1PNJA 1Y0MA 1SRLA 2LP5A 4LE9A 1E7OA 4J9IA 4EIKA 2EVRA 2DILA 2HEQA 1G83A 2C0TA 2YSQA 2D1XA 4CC7A 1UJYA 5L23A 5GJWB 1WXUA 2FEIA 1SHFA 1ABQA 4D8KA 4RTVA 2BTTA 4F16A 1SHGA 1M30A 2L0AA 3H0IA 2O9SA 2SEMA 1ZBJA 1EFNA 3I5SA 3JV3A 1HD3A 2CUBA 4RTUA 1ZUKA 1AD5A 4GBQA 2DVJA 4F14A 3VS3A 2ROLA 5IH2A 2YUNA 5IXBA 2O31A 4X1VA 1WX6A 2O88A 2HCKA 1CKBA 4AFUC 1UDLA 1BB9A 2JMCA 2L3SA 2ESWA 2AZVA 1NLOC 2RQRA 2ED1A 3ZL7C 1CSKA 4RTXA 1UUEA 2A37A 5EC7A 5FWCA 3SHWA 3R6NA 1X2KA 2J05A 1M27C 1HSQA 5FWBA 4LUEA 2EW3A 1YNZA 2NWMA 4IIMA 2B86A 1MV3A 1K76A 2EBPA 1PHTA 1NEBA 1QWFA 1OPKA 1KJWA 4LN2A 4OMLA 4J9CA 2CDTA 2I0NA 4OMOA 1E6GA 2JM8A 4JJBA
chains in the Genus database with same CATH superfamily
5HKCA 2PVGB 4M7AE 5DY9A 1O75A 1VIEA 1KD1R 4JDSA 2YWWA 3M55A 1VQ4T 2QTXA 2MWPA 1UG1A 4PJOB 4XTZA 1K8AC 3E9FA 4DBFA 4M78C 4J9EA 1YJWA 1AWWA 4JLIA 4L59A 2VKNA 1G3YA 2MWOA 2WSFE 2IPOB 1PKSA 1KQ2A 2IIMA 3I55A 4JJCA 4RUGA 5A0GA 4A4KA 1YBYA 2P0QA 3VKIA 1DJ7B 3FJPA 3X24B 1S72A 5GANj 2H3EB 3REAB 2DKGA 2XDDA 2YUPA 1NYFA 4LNPA 1VQ8A 1X6GA 4PNOA 5C0MA 2GCXA 1X27A 2COWA 1D1AA 4C92E 1YJ9T 3VYGA 4DEYA 1PKTA 4QVDA 4M77G 3OW2S 1Y57A 5I11A 4M78A 2X51A 5KYYA 4JRKA 3CCMT 3SWNA 4C0DC 2Y4YA 4PJOG 1WHMA 2GTJA 3P8DA 1EIFA 3CCST 2ZPFB 2DYBA 3KFVA 2ZPGB 2HKQB 2X4WA 2O4XA 1WFWA 3LH0A 2W0ZA 3PTAA 5GAOq 3UDCA 3JB9F 2EYZA 1K9MC 2HQHA 1VQ6A 1M8VA 4PJMA 3P8BB 1Q86C 2QXFA 4M77C 1SKUB 2A3LA 4C92A 3L2UA 1LVKA 1TOVA 1MHNA 4KH1B 2XICA 5GAN2 4RG8A 2PUOB 1FYNA 1D0YA 4ZGDB 1JRIA 4LDWA 3QZ5B 3TQ7P 1X6BA 3V8JA 1AWOA 1PWTA 5J39A 2ROTA 3TU4K 3L42A 1JXMA 2L89A 1QKXA 1JQQA 1BBZA 2LVMA 2EWNA 4M7AC 4Z8AA 3U23A 2O4XB 4F04B 3CCUQ 1K8AU 2CH4A 5LJ3e 2QQRA 3QUIA 4FW2A 3HSBA 3JB9I 3CCSA 1QVFA 1UE9A 2DO3A 1TTHB 1WI7A 5AYFA 4J9HA 5FU6B 4M77F 3OA6A 3UF4A 1AEYA 4IUUA 3MEVA 2CP0A 4C0ZA 2OTJA 4QT7A 1VQ9T 4DEXA 1YN8A 2LCSA 3EG2A 4HKEA 4KRTA 1ZHIA 1QMCA 2MCNA 2B8AA 1VQ7Q 1VQNQ 2KRSA 1VQ7T 4ZGJB 4N4HA 2J6OA 5GAN4 4CRIA 4J7FA 2QDLA 1QKWA 2F2WA 4GLKA 3F70A 2HNIA 1K9MU 1NBEB 1VQKA 4JJNK 1XQHA 4FSSA 1OPLA 2K3BA 1W1FA 5ECAA 1N6AA 2JOYA 3X26B 3OY9A 2RJEA 3H9NA 2EPDA 4B6MA 2DBMA 2RF0A 2EJGA 3C95A 3OS0A 4KBMB 3HP9A 1OU9A 1I0CA 2EQKA 2XK0A 3GIBA 2EAYA 5GAOp 3RMQA 1KHCA 3S3NA 4B9WA 4HVUA 1M3CA 1RUWA 3MEUA 1KK7A 1HXDA 2PQWA 4C8QC 5CAIA 2JN0A 1TUCA 1IZ6A 1N8RU 1GFCA 1VQNT 1UEBA 4CC3A 2P0PA 2FO0A 1RAAB 5CKDA 1SRMA 3FJ5A 1PSEA 3SD4A 1TUGB 2QQBA 4M75E 2OJ2A 3TCJA 2CSIA 4XU0A 2GBQA 2KROA 4BE1A 5HK3A 1NG2A 1Y96B 4XTVA 4DOWA 1KSWA 1YJNQ 2JZ2A 2M9UA 2NUTB 2E5QA 4EMGA 2J7IA 4XTWA 2HQEA 3NFCA 3OYEA 3A8GB 3CMEA 1WA7A 2NUZA 2V1RA 3A98A 2DL5A 3SWNC 2BE7D 1D3BA 2FHDA 4AFQC 1S1NA 3G71T 2QK0A 4EMKC 3CCUT 2CP6A 1RAHB 1YCYA 2D8HA 1U8RA 1UGQB 4E7LA 2E6ZA 3OBYA 1U5SA 3I35A 3LWHA 2K57A 2COZA 3OYJA 2MOXA 3IQLA 1M2VA 4ATOA 3H0FA 3H6ZA 2RHUA 5GMKi 4ELZC 2RJDA 4FSXA 2CSQA 4M77E 4OVAA 5KYXB 1X75C 4CC4B 2GNCA 3ASKA 2AK5A 1BIAA 2C0OA 1YJWT 1J3TA 4J9GA 4FL6A 2P84A 2MIOA 2DETA 2PVDB 1OOTA 4LXCA 2IG0A 4F7UG 3LGLA 3PGGA 3JCMX 2CZ0B 2L3RA 3VUZA 2CP2A 1VQMA 3E2UA 1Y96A 1KQ1A 3ULRB 2DL8A 2JW4A 2DTIA 4BE2A 2ZPEB 1ZSZC 3FRNA 3SFMA 5FRMA 3WVEB 2OTLT 4PL6A 1JO8A 1JXOA 2D8JA 3RKYA 5DLOA 3MHXA 1WHLA 4MZTA 5IHNA 1TUDA 1Y0MA 2XKOC 4F7UA 3QZ9B 2EVRA 3QG1A 1IXDA 3A8LB 2D1XA 2LCCA 4CC7A 3HHTB 1BI1A 1WXUA 4PK4A 1ABQA 4RTVA 4F16A 2L0AA 2K3XA 1ZBJA 1VQ8Q 3JV3A 3OS2A 1HD3A 4FM4B 3HTRA 5GAOm 2QGGA 2ROLA 5A0DA 5IH2A 1TU0B 2HCKA 1CKBA 4PJNA 1QVGA 3ZL7C 1KQSS 1UUEA 5EC7A 3GPLA 3OMGA 3SDZA 3SHWA 5GMKl 3R6NA 4OGEA 5FWBA 4DBHA 3PIPA 2MYSA 4LUEA 3L2VA 3CC4T 2VB6A 1YNZA 4IIMA 2EBPA 3FEOA 1NEBA 1KJWA 2CGHA 4OMOA 1BCOA 1E6GA 3CCQA 1OX9A 3QJ6A 4D8DA 1H8KA 2BZXA 2PTKA 2BZYA 4M78F 3JCMV 2RQTA 4XU3A 1M1KU 3E1SA 2YUQA 2RA2A 1Q81U 5IXFA 1I81A 1NLPC 2A36A 1ZQ1A 3VUBA 1G5VA 1UGVA 1B7TA 1M3AA 1OI1A 4HVWA 5LL6S 2KYMA 2QA4Q 1Y7XA 4M75C 4M77A 3V8LA 3CXCS 4M7AD 4BB7A 4Z88A 1YHQT 1VQOQ 4NL2A 1VQPT 1VA7A 4KGXB 3EGXB 2R5MA 2DD5A 2RI3A 1VQOA 2ATCB 2RHXA 4X9CA 1LJOA 2VUBA 2DEQA 2DTOA 4C0DB 2L3PA 1SG5A 5CKHA 3I5RA 1QVPA 2R57A 3CPWA 3VS2A 4RCCA 1Q81R 1YCSB 4PJOE 2AKLA 4LD6A 3HRSA 1ZA2B 1QLYA 3A8MB 2FB7A 4EMKB 1X01A 3VS5A 3OYDA 2OTLQ 2RO0A 3JCMd 3M5AA 4M7AB 1TS9A 5FU7C 4O6JA 5J26A 1KC8R 5D6YA 2RJCA 1ZSGA 2E10A 2E70A 4P5NA 4J5YA 3OYMA 1RADB 3UATA 1K4US 3CCRQ 2LJ1A 3NPFA 5GAN7 3BW1A 1UHCA 1JU5C 2ZAEA 1PG5B 3JCMh 4M78B 2MAMA 1AZGB 2C0IA 2LRQA 1ABOA 3DB3A 2FZKB 5GANf 2GF7A 2JTMA 2DXBA 3OYLA 1LCKA 2M16A 2EGEA 3E9GA 4C5IA 4LDVA 1GCQA 1VQ5T 1VQ5Q 1OV3A 3FLGA 2DZ9A 4YTLA 1VOMA 4LDYA 3O5ZA 1OZ3A 4DA4A 3HPWA 5LJ3d 1SPKA 2EGCA 1VQNA 2MMPA 3JAME 1YITQ 1RLPC 4PFZA 2DXTA 5GAMd 4IIOA 2LJ0A 3CCJA 4OB2B 3FDRA 4M7DE 2VC8A 4HT8A 3BFMA 2W10A 3CC7A 4KULA 4ZNXA 3CCVA 3QSUA 3RR6A 2E64A 3THKA 1AOJA 3JB9G 1H3ZA 1AWJA 1QP2A 4Z02A 2KQWA 1V76A 5IHIA 1T3SA 4J9BA 4RG2A 1MMGA 1KC8U 4JLGA 1YWPA 3CCRA 2AZSA 3TREA 1M2OA 2HSPA 2J6KA 1NZ9A 2RK1A 1YWOA 2OTJT 1EZZB 3EG1A 4AT1B 2BUDA 5GANe 4ME7A 3OYFA 4JRPA 5GMKm 2EJ9A 2F2XA 2G6FX 4KGVB 1MNEA 2EGAA 2DEUA 4FT4A 2DA9A 2ECZA 2F69A 5I2SA 2E4HA 3PVQA 1JB0E 2RJFA 4E7KA 4M78G 3CXCP 1HYOA 1R0CB 3CCET 3I55T 2ZZDA 4JJDA 3BDLA 1V29B 1M1FA 1W2BA 2YXYA 3MPUB 4QKUA 4OGCA 2FRWA 1YP5A 4DBRA 3EGDA 5GAOr 4QQ6A 1QP3A 1WXBA 4Y28E 3E19A 2LT4A 3GF5A 3DB4A 2RQWA 1PM3A 4LD9K 2RI5A 4L6V5 1VQLA 5IAYA 3CCLA 1PSFA 2KY9A 2KXDA 3JCMc 2LQKA 4A63B 2G3RA 4PFPA 2DM1A 1UJ0A 3QJYA 4Y92A 3UT1A 3CMAQ 3KBGA 3LH5A 3CCMA 4FCYA 1Q82U 1UGSB 1WQ7A 5CK9A 1H92A 5FLXE 1G3WA 4C8QA 2BIVA 4HCZA 3CQTA 4QQDA 3VU3C 2YT6A 1MV0B 2WSCE 3QBYA 4MZMA 2K2MA 4AG1C 5GMKh 4WTOB 3CPWP 3EFOB 4R56A 1S72Q 3QYHB 2M0YA 5CKFA 3RBBB 2DE0X 4II1A 3JB9D 4CC2A 2KNBB 3OYAA 1Y07A 5DLQE 3MP1A 1X43A 4NOYA 1VQ9Q 2ZPIB 2X3XD 2HL3A 2OAWA 1T3LA 2VV5A 3JCMg 2V1QA 1TH7A 1SSFA 2HQXA 1TXQA 2K7AA 3EGXA 4M7DD 3OBWA 2QTVA 4M7DB 2VYTA 1YITT 3CXCA 1JJ2A 3HKSA 2A0FB 2CZ6B 1CKAA 3SEMA 2JNGA 2CUDA 1SSHA 3EG3A 1BKBA 2KGTA 4ELYC 4QVCA 1T0JA 1WJSA 2JJ9A 2XG8D 3VS6A 2X4JA 1O9SA 2DXUA 2YLCA 2KVQG 2JM9A 2KYBA 5LJ3h 2HSEB 3M0SA 5CCAA 4RTWA 2X35A 2BZ8A 3OSSC 3L2WA 5GAN6 3CBPA 2JS0A 3C12A 1M90C 3CC4Q 3VS1A 2JTFA 3CEYA 3QO3A 3CCLQ 2VGMA 3PT9A 5LJ5f 2JVVA 1S72T 1QVFP 2AHJB 1R77A 2WACA 1E6HA 2RHZA 4M78E 5KE2A 4J9FA 2M51A 3S3OA 2KR3A 1IGUA 2JMAA 5KYXA 1YJ9A 4FYYB 4GLMA 1X2QA 1WLPB 2DJQA 1VYTA 4JUVA 2FRYA 5HK0A 1IHVA 1D0ZA 4BD3A 1YITA 2VASA 3EAEA 3EG9B 4FW1A 4Y91A 3C4SA 3N5BB 3R6OA 2C0TA 2V8KA 4C92C 5KCOA 1UJYA 5L23A 3JB9H 2V8IA 1M30A 2L5QA 4PJJA 1D3BB 2C06A 7AT1B 1VQOT 1YHQQ 1YJNT 3OYNA 3X28B 2KI7A 1MMNA 3OYCA 4XTYA 2E6NA 2CUBA 1AD5A 3X25B 2CYZB 4E2FB 3ZBDA 1N9RA 1WX6A 4J6XA 4OMFB 4AFUC 1UDLA 3FC3A 2L3SA 5GANh 4F7UB 2DZCA 1CSKA 1C0MA 3LWIA 2F1LA 2J05A 1WHKA 3KUFA 1H641 2V26A 1QCOA 4PLLA 2VGNA 3GP8A 3HL8A 3OYKA 1WJQA 1MV3A 1K76A 5GAOn 1ZA1B 1WNLA 4LN2A 1M1KR 3I55Q 4JRIA 2RB6A 4E7SA 5KYYB 3UPUA 4JJBA 4OF1A 4C8QF 3JCMW 5LJ5d 4N0AC 2CS7A 2XU8A 4R55A 5GJVB 4OB3B 3ZFJA 2DL4A 4AFZC 2NUPA 3RESA 1ZSZB 2ZPBB 5GANg 5KH6A 1VQ5A 2LQWA 1K73U 4ZGEB 1P92A 3CD6T 3CD6Q 2RMOA 2EYQA 1BK2A 1W2BS 3VV0A 1OZ2A 4RMOA 3CMAT 2OX7A 3PE0A 3VS7A 3NTHA 5D7UA 3URGA 3VJPA 5GAMh 3VS0A 1UGPB 4PKCC 2DPPB 5C6SA 4F17A 1GBQA 1PCXA 3M0RA 2K9GA 1G2BA 1UFFA 3OS5A 1KD1C 3CC4A 4EMKA 4C0FA 2A7YA 4JS5A 4BACA 2H8HA 1VYUA 1K73C 2R5AA 2Y4XA 1PD1A 5FU6C 3AHUA 1W4SA 1G8XA 4C92D 3OYYA 1AVZC 2X3WD 5KYWB 1Q7YU 3ER0A 5CR2A 4XU2A 3RKXA 1U3OA 2EIFA 1B07A 5GMKj 1C6VX 4RTTA 2LC4A 3X20B 2K6DA 5IN1A 3HRTA 2RNAA 3NMZC 1KIKA 2KEAA 3RNJA 2F2VA 2QGFB 4JZ3A 2XIDA 2XD0A 4UC4A 1WGSA 2CP3A 4C92B 3M0UA 1M5Q1 4F7UE 2DAQA 5CIUA 3REBB 2DNUA 3JRZA 2NUTA 3VRZA 2DYIA 2K2VA 3GNFB 2DFUA 1VQ6T 2VXEA 1OU8A 1QCNA 4C5HA 3NTIA 3M56A 3M0QA 4BE0A 3L2ZA 3JSCA 1NM7A 1JJ2S 1AWXA 2QG9B 1H3HA 2LCLA 3H41A 1ZLMA 2LX9A 2AKKA 2RQVA 4OMQA 1FMKA 2KRNA 3CMET 1V1CA 2EQUA 2EYXA 4OMPA 3M58A 2E41A 2GFUA 3MKDA 2HDAA 2J6FA 2LNVA 3CC2A 4O5VA 1GFDA 4E6RA 4HCBA 1YIJT 3PMTA 1YIJQ 1FWZA 3NHNA 1VYVA 1YI2T 3DLMA 2RQUA 2GTOA 3QHSA 2D9TA 3CPFA 1VQKQ 1N27A 4A4GA 1VQKT 2ENMA 3HFNA 2E3HA 3INZA 4N4IA 3RIRA 2LQNA 4QW2A 3CBOA 4LUDA 1M9SA 5M9OA 4XU1A 2YUOA 1QQJA 1IGQA 3I56T 5KE3A 1XOVA 1MNDA 1I5LA 2K4YA 4MZPA 4BI3A 1U1SA 3QWYA 2RHIA 1GCQC 2CT3A 5D6XA 1G3TA 1Q86U 1VQ8T 2XDBA 2DD4A 3J80E 2PZ1A 4KUDK 2FYKA 1UECA 5EG2A 5KYUA 3S3MA 4M75B 3SWNB 3G6EA 3UA7A 4FIBA 5FROA 2QEXT 2VVKA 2KSSA 4FT2A 3CCMQ 4BDYA 1OEBA 1R8OB 4KUIA 5FU7B 2QEXQ 3CMAA 3OMCA 4M7DA 1PRLC 3MEAA 1FX7A 3EGUA 2DX1A 1X69A 1HK9A 3LX7A 4M7DF 3GLXA 4ORZA 2OTLA 1TSFA 3EG0A 2VWFA 2I2LA 3CCVQ 5GAN8 4XAXB 1GL5A 1QVGS 2FPDA 2DIGA 4J83A 1OQKA 4A54A 1QW1A 1W70A 3C94A 3GOXA 3I9QA 2XMFA 2EQJA 1I1JA 1NYGA 3JB9J 2E1HA 4M75D 1C1AA 3BE3A 2EYYA 2HKNA 2DXCA 4C8QG 2ED0A 1YJ9Q 2LTOA 4MDXA 2GGRA 3JCMP 2SRCA 1K0SA 5D6WA 2HZYA 1TG0A 3QKJA 2KDSA 4OB1B 4F7UF 3L1AA 2A28A 3OYHA 4E7IA 3ME9A 4XK8E 2PNIA 3CC2Q 2PVOB 1UGRB 3O8VA 3RUXA 1WDXA 3GBQA 3EHRA 3V7SA 5CVIA 4C5GA 4EDUA 5GANd 1IREB 2KK4A 2MPXC 5CQYA 2OI3A 2FPEA 5LJ3g 3CCQT 4FYXB 1KD1U 3RERA 1PRMC 1N9SA 4FYWB 1NJIC 1OYXA 3VRYA 2ABLA 1XTDA 1PD0A 4M77D 5KYUB 1TWBA 2WSEE 5KCHA 1B3QA 1LOJA 2CREA 2FVUA 3JCMJ 3OSVA 4R0KA 4AFSC 1N8RR 4M75G 1JEGA 3WXMB 4HVVA 1M90U 4IKFA 1M8MA 3CCEQ 4RCBA 1YI2A 2PUKB 3FB9A 1WQWA 2HBWA 4MDWA 3CPWS 1GCPA 5I2MA 2H3JA 1YI2Q 2YRDA 4IUVA 2XDPA 1NJIU 3OYBA 2O01E 2E65A 2HMAA 3V7RA 3MO8A 3CCRT 1Y71A 3UA6A 1RABB 3M0PA 4J6WA 3SB2A 2FZGB 2JXBA 5GAMg 3EHQA 4Z89A 3LW5E 4M75F 4NS5A 3TSZA 3J81E 2P0KA 4BI8B 3AT1B 1RAIB 1WHHA 5IT9E 2M02A 4E7JA 2JS2A 5HCKA 1XJWB 1KFZA 4LDXA 1JJ2P 3GNGA 1B34A 3CCSQ 3EFOA 1KC8C 4J9IA 4EIKA 1LPLA 5GAN3 2QEXA 2QQAA 2HEQA 1G83A 4M78D 2CP7A 3A1PA 5LJ5j 1D0XA 2K5FA 2FEIA 1SHFA 3WVDB 4PJOA 4DQ2A 4B9XA 2OAUA 1SHGA 3H0IA 2SEMA 1YFNA 1KQSP 3CCUA 1ZUKA 2DVJA 3VS3A 3QYGB 4QVZA 2YUNA 3JCMb 5LJ3f 5IXBA 3CCLT 4PJOF 2QQSA 4J8OA 1BB9A 2ESWA 3LLRA 1K73R 2RQRA 4DBQA 2ED1A 5A2QE 3OYIA 1NPRA 2EKOA 2V8JA 4KH0B 1LNXA 1VQ9A 1M27C 1HSQA 1XNIA 4C5EA 3EGDB 2EW3A 2OTJQ 2CZ7B 4OB0B 2B86A 4HA8A 3EH1A 1QWFA 1M1GA 2QA4A 2BKDN 2L8DA 4OMLA 2QQ9A 2KAFA 1K9MR 1VQ7A 2NLUA 4BY6C 3RMSA 3OW2P 2CDTA 2I0NA 3A8HB 4PLIA 1F1BB 1M90R 1KG1A 4NL3A 2JM8A 3CC2T 3ZEHA 4N4GA 3BY7A 3A8OB 3CC7T 1EX4A 1AT1B 1ZX6A 2ZCFB 1N5ZA 1Z9QA 3MCAB 4PFOA 1PC0A 5HY6A 3HFOA 1WJRA 2LDMA 4Q5WA 3EFSA 2LMJA 2DL7A 1G3SA 2XHCA 3META 3T9NA 2RH2A 1D09B 4A4HA 4XTXA 1M3BA 2CP5A 3QIIA 4X34A 2P4RA 3CCQQ 4OMNA 3OB9A 5CO7A 2KBTA 4WCIA 1VQMQ 4BY6B 1VQMT 1K9AA 4FU6A 2YDLA 1UTIA 3QWXX 3M4YA 5IHKA 2NUPB 2RHYA 1Q7YR 1FXXA 4ANJA 3JCMf 3CCEA 4L5GA 2RI2A 1MMAA 3EH2A 4PJOD 2CH4W 2X4YA 4D6WA 1BCMA 2JTEA 1FMWA 2AT1B 4V2SA 2GQIA 2DERA 4C8QE 2K79A 1SF9A 1K1ZA 2RK2A 2HAXA 4HXJA 2IVWA 1BI2A 1U06A 4M4ZA 4C8QB 2LQ8A 5LJ5h 1W2BP 2LZ6B 1RAGB 1YJNA 3V7CA 4J7IA 1RL2A 5CKBA 1W6XA 2AIRB 2FPFA 1VQLT 1K0XA 1N8RC 4M7DC 3G6EQ 3CBMA 2KMTA 2LJ3A 3OQ5A 1M1KC 4RTYA 2J06A 2KT1A 4M7AF 1Q81C 1R0BG 1D1BA 2LNHB 3CCJQ 1RAEB 3CCJT 1FMVA 3G4SA 1GRIA 2E3IA 2DRKA 2CKKA 2DK3A 2F5KA 1MUZA 4QQGA 4AMCA 3H0HA 4JZ4A 3QDRB 3I56Q 4JRQA 1WXTA 4XTUA 2HD0A 2DVEA 1UB4A 2Y90A 2YLBA 2BE9B 2O2OA 1Q82C 1OX8A 2D0NA 2NYSA 4E7HA 1VQPA 2X4XA 1JBMA 2VXFA 2EYWA 4C92F 4RKUE 1KQSA 3MJXA 1ACMB 2DLPA 2F5TX 4E47A 1Z9ZA 3FIFA 5CQXA 4IUTA 2QA4T 4OMMA 1VQLQ 2O9VA 1SEMA 4A4FA 1ZBXA 3Q1JA 1T0HA 1NE8A 2E12A 3VS4A 2RPNA 1BIBA 3LYIA 4M7AA 3M0TA 3QXEB 4RTZA 8ATCB 3PVLA 3TVTA 2DBKA 1A0NB 2FZCB 3P8HA 1IHWA 4JS4A 3CC7Q 6AT1B 1Q82R 2XI9A 4KT0E 3KXTA 1AHJB 3CD6A 4M77B 3L2RA 3A5ZB 1IO6A 2DMOA 2MK5A 3QPHA 2D0QB 2A08A 3EFRA 2KRMA 2CZ1B 2QASA 4E7ZA 4K11A 1I5OB 5GAN5 2EQIA 4C8QD 4ZN1A 5GAMf 3OYGA 3G71Q 3OS1A 3G4ST 4M7DG 1MGQA 1VQ4Q 3G4SQ 3QDFA 4ESRA 4BUGA 2DJZA 2LX7A 4HCCA 4EPCA 3V8KA 4JPBW 2DRMA 2D6FA 1ZUYA 4A4EA 2RD1A 3MEWA 4A53A 5J3BA 5CKEA 4AG2C 1WZOA 3OW2A 2P4TA 3M57A 3LGFA 2M0OA 5AT1B 1MMDA 4C92G 3TEEA 1ARKA 2FG0A 5GMKe 3JCMe 1NEGA 1VQPQ 3MP6A 1X6OA 4KGZB 1WHGA 1RI9A 3M9QA 2MI6A 2QAZA 1ZUUA 2X9HA 1M2VB 2HBPA 2LT1A 4EMHA 3DKMA 3M54A 2ZPHB 3MP8A 3G6ET 3C0CA 4M75A 1Q7YC 4C0GA 3JCMQ 2EQMA 2GFAA 5LJ5g 4PJLA 3TSWA 2K3YA 2EJFA 4HCKA 1OULA 2JT4A 1RI0A 3NGPA 2L2PA 4ZTJA 4N0AA 4X9DA 1WIEA 1YIJA 2Z0WA 2COYA 8AT1B 2DF6A 5L8RE 1QVGP 3CCVT 1AZEA 2YRVA 1RAFB 2RN8A 3G1JA 3I56A 5I22A 1RACB 3G7ZA 4DOVA 1K8AR 2RM4A 5GAMj 3H8ZA 5GAOl 1QWEA 1QVFS 5A0LA 4LDUA 3RDVA 3UWNA 2KE9A 2KT8A 9ATCB 1I07A 4IUPA 2EKHA 1BU1A 3S6WA 2E5KA 1Q86R 4HT9A 1WYXA 3PIOA 2L3QA 3VYHB 1VUBA 4BDZA 1KHIA 1UHFA 3M53A 3EG9A 3HRUA 4J9DA 4XQ3A 5LJ5e 1GBRA 1VIFA 1BYMA 3M59A 3M4GA 2QYZA 2KXCA 5FW9A 2YRCA 1RLQC 5I21A 1M4ZA 1QCFA 4PJOC 2YHTA 4MMKA 1YHQA 1VQ6Q 2DL3A 1VQ4A 2K5LA 3DLLA 2CT4A 1HJDA 5LJ3j 1YJWQ 3PMIA 1PNJA 1SRLA 2LP5A 4LE9A 3NTKA 3CMEQ 1E7OA 4IURA 1D1CA 4CI0C 2DILA 3RKWA 1NPPA 2PU9B 2YSQA 5GJWB 2M1HA 2FL7A 3G71A 4D8KA 1NJIR 2JUFA 5DM7R 2BTTA 4FYVB 1WHJA 2O9SA 1EFNA 1ZSZA 1Q95G 3I5SA 2GQVA 4RTUA 4GBQA 4F14A 2ZGWA 1BI3A 3L2QA 1U1TA 2DIQA 2O31A 4X1VA 2O88A 5KYWA 2MF2A 2QI2A 5GAMe 2JMCA 5KYNA 5FRNA 3J7AF 1B34B 2AZVA 1NLOC 2QDYB 4RTXA 2A37A 4BI4A 5FWCA 2R58A 4OP0A 3PFSA 1X2KA 1IB8A 3D7SB 3PNWC 4WF2A 2DTHA 4ZTFA 1I8FA 4MMLA 4ZN3A 2NWMA 4GY5A 4IUQA 1I4K1 4TVRA 1WPYA 2HL5C 1IRXA 1PHTA 1GXIE 1OPKA 4M7AG 2EFIA 1BI0A 2K5IA 4J9CA 4J6YA 4VUBA 3BDUA
chains in the Genus database with same CATH topology
4D8DA 1H8KA 2BZXA 2PTKA 2BZYA 2RQTA 5GJVB 2DL4A 1ZX6A 4AFZC 1N5ZA 1Z9QA 2YUQA 5IXFA 1UG1A 1NLPC 2A36A 2LQWA 4J9EA 1AWWA 2LMJA 2DL7A 2VKNA 1UGVA 1PKSA 2RMOA 2IIMA 1M3AA 4HVWA 1BK2A 2KYMA 4JJCA 4RUGA 1M3BA 3PE0A 3VS7A 2P4RA 4OMNA 3REAB 2KBTA 3VS0A 4WCIA 2YUPA 1NYFA 4Z88A 1K9AA 4LNPA 2YDLA 1UTIA 1VA7A 3QWXX 1X6GA 4F17A 1GBQA 5IHKA 3M0RA 2K9GA 1X27A 1G2BA 1UFFA 2H8HA 4DEYA 1VYUA 1PKTA 2L3PA 3I5RA 2CH4W 1Y57A 5I11A 2JTEA 1AVZC 2X3WD 2GTJA 3VS2A 2GQIA 2DYBA 1YCSB 2AKLA 3KFVA 1U3OA 2K79A 1K1ZA 1B07A 1WFWA 4HXJA 1QLYA 2W0ZA 1U06A 4RTTA 3VS5A 2EYZA 2K6DA 4M4ZA 2RNAA 3NMZC 1ZSGA 2KEAA 1KIKA 3RNJA 3UATA 2F2VA 2LZ6B 1K4US 4JZ3A 2LJ1A 3NPFA 1UHCA 1JU5C 1W6XA 2FPFA 1K0XA 3M0UA 1AZGB 2C0IA 1FYNA 2DNUA 3REBB 2LJ3A 1ABOA 3VRZA 4RTYA 2J06A 2KT1A 1X6BA 1LCKA 1AWOA 2EGEA 2LNHB 1PWTA 1GCQA 2ROTA 1JXMA 3M0QA 1OV3A 1QKXA 1JQQA 1BBZA 1GRIA 1NM7A 2DRKA 4Z8AA 3U23A 1AWXA 3O5ZA 2CH4A 1H3HA 1MUZA 3H41A 1ZLMA 2AKKA 3H0HA 2RQVA 4OMQA 4JZ4A 1SPKA 1FMKA 2EGCA 2KRNA 1WXTA 1V1CA 4OMPA 2EYXA 1RLPC 1UE9A 1WI7A 2HDAA 2J6FA 4IIOA 4J9HA 2LJ0A 1GFDA 2O2OA 3UF4A 4E6RA 1AEYA 2D0NA 2EYWA 3NHNA 1VYVA 2W10A 4ZNXA 4QT7A 2RQUA 2GTOA 4DEXA 1YN8A 2DLPA 3THKA 2LCSA 1AOJA 3EG2A 4KRTA 1AWJA 2ENMA 2MCNA 5IHIA 1Z9ZA 1T3SA 2LQNA 4J9BA 4LUDA 1YWPA 2KRSA 4OMMA 2AZSA 2YUOA 2O9VA 1SEMA 2J6OA 2HSPA 2J6KA 1T0HA 1XOVA 3VS4A 2QDLA 1YWOA 2RPNA 1QKWA 3QWYA 3EG1A 2F2WA 1GCQC 2CT3A 3M0TA 4RTZA 3PVLA 3TVTA 2DBKA 1A0NB 2F2XA 2G6FX 2EGAA 2DA9A 2ECZA 4FSSA 2PZ1A 3PVQA 1UECA 1OPLA 2K3BA 1W1FA 5ECAA 1IO6A 2DMOA 3UA7A 4JJDA 2VVKA 2EPDA 2A08A 1OEBA 2DBMA 2KRMA 2RF0A 4K11A 1PRLC 2FRWA 3EGUA 2EQIA 2DX1A 1YP5A 1X69A 1I0CA 1WXBA 4ORZA 4ESRA 3EG0A 2VWFA 2LX7A 2RQWA 4HVUA 1M3CA 1RUWA 4JPBW 2DRMA 1TUCA 2KXDA 1ZUYA 4A63B 1GL5A 2DM1A 1UJ0A 1GFCA 2FPDA 4Y92A 3LH5A 4AG2C 1W70A 4CC3A 2FO0A 3I9QA 2XMFA 1H92A 1SRMA 3FJ5A 1ARKA 2OJ2A 2FG0A 1NEGA 1I1JA 1NYGA 3CQTA 2CSIA 1RI9A 2YT6A 2GBQA 2KROA 2EYYA 1MV0B 1ZUUA 1NG2A 2K2MA 2ED0A 4AG1C 1KSWA 2GGRA 2SRCA 1K0SA 2J7IA 3C0CA 1TG0A 2M0YA 3RBBB 2DE0X 1WA7A 2NUZA 2KNBB 4CC2A 2A28A 1X43A 3TSWA 2V1RA 3A98A 2DL5A 2PNIA 4HCKA 2X3XD 2JT4A 1WDXA 3NGPA 2OAWA 2L2PA 3EHRA 3GBQA 1T3LA 4AFQC 1S1NA 2V1QA 2K7AA 1WIEA 2OI3A 2FPEA 2DF6A 2D8HA 1AZEA 1PRMC 1U5SA 3I35A 2RN8A 3VRYA 2ABLA 5I22A 1CKAA 3SEMA 2CUDA 1SSHA 3EG3A 2MOXA 3IQLA 2KGTA 1T0JA 3H0FA 3VS6A 1QWEA 1B3QA 2CREA 2CSQA 4R0KA 4AFSC 1JEGA 2JM9A 4CC4B 2KYBA 2GNCA 3M0SA 2KE9A 2AK5A 4RTWA 2BZ8A 2C0OA 4HVVA 2KT8A 1J3TA 4J9GA 1M8MA 1I07A 2JS0A 2MIOA 2HBWA 2EKHA 1GCPA 1BU1A 3VS1A 1OOTA 2E5KA 1WYXA 2L3QA 1UHFA 4J9DA 1GBRA 3ULRB 3UA6A 1E6HA 3M0PA 2KXCA 5FW9A 2JXBA 1RLQC 2DL8A 3EHQA 4Z89A 4J9FA 2M51A 2JW4A 1QCFA 2KR3A 3TSZA 2JMAA 2DL3A 4GLMA 1JO8A 1JXOA 1X2QA 2JS2A 2D8JA 5HCKA 2CT4A 1WLPB 2DJQA 1KFZA 1VYTA 5IHNA 1HJDA 1TUDA 2FRYA 1PNJA 1Y0MA 1SRLA 2LP5A 4LE9A 1E7OA 4J9IA 4EIKA 2EVRA 2DILA 2HEQA 1G83A 2C0TA 2YSQA 2D1XA 4CC7A 1UJYA 5L23A 5GJWB 1WXUA 2FEIA 1SHFA 1ABQA 4D8KA 4RTVA 2BTTA 4F16A 1SHGA 1M30A 2L0AA 3H0IA 2O9SA 2SEMA 1ZBJA 1EFNA 3I5SA 3JV3A 1HD3A 2CUBA 4RTUA 1ZUKA 1AD5A 4GBQA 2DVJA 4F14A 3VS3A 2ROLA 5IH2A 2YUNA 5IXBA 2O31A 4X1VA 1WX6A 2O88A 2HCKA 1CKBA 4AFUC 1UDLA 1BB9A 2JMCA 2L3SA 2ESWA 2AZVA 1NLOC 2RQRA 2ED1A 3ZL7C 1CSKA 4RTXA 1UUEA 2A37A 5EC7A 5FWCA 3SHWA 3R6NA 1X2KA 2J05A 1M27C 1HSQA 5FWBA 4LUEA 2EW3A 1YNZA 2NWMA 4IIMA 2B86A 1MV3A 1K76A 2EBPA 1PHTA 1NEBA 1QWFA 1OPKA 1KJWA 4LN2A 4OMLA 4J9CA 2CDTA 2I0NA 4OMOA 1E6GA 2JM8A 4JJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8D A;  1H8K A;  2BZX A;  2PTK A;  2BZY A;  2RQT A;  5GJV B;  2DL4 A;  1ZX6 A;  4AFZ C;  1N5Z A;  1Z9Q A;  2YUQ A;  5IXF A;  1UG1 A;  1NLP C;  2A36 A;  2LQW A;  4J9E A;  1AWW A;  2LMJ A;  2DL7 A;  2VKN A;  1UGV A;  1PKS A;  2RMO A;  2IIM A;  1M3A A;  4HVW A;  1BK2 A;  2KYM A;  4JJC A;  4RUG A;  1M3B A;  3PE0 A;  3VS7 A;  2P4R A;  4OMN A;  3REA B;  2KBT A;  3VS0 A;  4WCI A;  2YUP A;  1NYF A;  4Z88 A;  1K9A A;  4LNP A;  2YDL A;  1UTI A;  1VA7 A;  3QWX X;  1X6G A;  4F17 A;  1GBQ A;  5IHK A;  3M0R A;  2K9G A;  1X27 A;  1G2B A;  1UFF A;  2H8H A;  4DEY A;  1VYU A;  1PKT A;  2L3P A;  3I5R A;  2CH4 W;  1Y57 A;  5I11 A;  2JTE A;  1AVZ C;  2X3W D;  2GTJ A;  3VS2 A;  2GQI A;  2DYB A;  1YCS B;  2AKL A;  3KFV A;  1U3O A;  2K79 A;  1K1Z A;  1B07 A;  1WFW A;  4HXJ A;  1QLY A;  2W0Z A;  1U06 A;  4RTT A;  3VS5 A;  2EYZ A;  2K6D A;  4M4Z A;  2RNA A;  3NMZ C;  1ZSG A;  2KEA A;  1KIK A;  3RNJ A;  3UAT A;  2F2V A;  2LZ6 B;  1K4U S;  4JZ3 A;  2LJ1 A;  3NPF A;  1UHC A;  1JU5 C;  1W6X A;  2FPF A;  1K0X A;  3M0U A;  1AZG B;  2C0I A;  1FYN A;  2DNU A;  3REB B;  2LJ3 A;  1ABO A;  3VRZ A;  4RTY A;  2J06 A;  2KT1 A;  1X6B A;  1LCK A;  1AWO A;  2EGE A;  2LNH B;  1PWT A;  1GCQ A;  2ROT A;  1JXM A;  3M0Q A;  1OV3 A;  1QKX A;  1JQQ A;  1BBZ A;  1GRI A;  1NM7 A;  2DRK A;  4Z8A A;  3U23 A;  1AWX A;  3O5Z A;  2CH4 A;  1H3H A;  1MUZ A;  3H41 A;  1ZLM A;  2AKK A;  3H0H A;  2RQV A;  4OMQ A;  4JZ4 A;  1SPK A;  1FMK A;  2EGC A;  2KRN A;  1WXT A;  1V1C A;  4OMP A;  2EYX A;  1RLP C;  1UE9 A;  1WI7 A;  2HDA A;  2J6F A;  4IIO A;  4J9H A;  2LJ0 A;  1GFD A;  2O2O A;  3UF4 A;  4E6R A;  1AEY A;  2D0N A;  2EYW A;  3NHN A;  1VYV A;  2W10 A;  4ZNX A;  4QT7 A;  2RQU A;  2GTO A;  4DEX A;  1YN8 A;  2DLP A;  3THK A;  2LCS A;  1AOJ A;  3EG2 A;  4KRT A;  1AWJ A;  2ENM A;  2MCN A;  5IHI A;  1Z9Z A;  1T3S A;  2LQN A;  4J9B A;  4LUD A;  1YWP A;  2KRS A;  4OMM A;  2AZS A;  2YUO A;  2O9V A;  1SEM A;  2J6O A;  2HSP A;  2J6K A;  1T0H A;  1XOV A;  3VS4 A;  2QDL A;  1YWO A;  2RPN A;  1QKW A;  3QWY A;  3EG1 A;  2F2W A;  1GCQ C;  2CT3 A;  3M0T A;  4RTZ A;  3PVL A;  3TVT A;  2DBK A;  1A0N B;  2F2X A;  2G6F X;  2EGA A;  2DA9 A;  2ECZ A;  4FSS A;  2PZ1 A;  3PVQ A;  1UEC A;  1OPL A;  2K3B A;  1W1F A;  5ECA A;  1IO6 A;  2DMO A;  3UA7 A;  4JJD A;  2VVK A;  2EPD A;  2A08 A;  1OEB A;  2DBM A;  2KRM A;  2RF0 A;  4K11 A;  1PRL C;  2FRW A;  3EGU A;  2EQI A;  2DX1 A;  1YP5 A;  1X69 A;  1I0C A;  1WXB A;  4ORZ A;  4ESR A;  3EG0 A;  2VWF A;  2LX7 A;  2RQW A;  4HVU A;  1M3C A;  1RUW A;  4JPB W;  2DRM A;  1TUC A;  2KXD A;  1ZUY A;  4A63 B;  1GL5 A;  2DM1 A;  1UJ0 A;  1GFC A;  2FPD A;  4Y92 A;  3LH5 A;  4AG2 C;  1W70 A;  4CC3 A;  2FO0 A;  3I9Q A;  2XMF A;  1H92 A;  1SRM A;  3FJ5 A;  1ARK A;  2OJ2 A;  2FG0 A;  1NEG A;  1I1J A;  1NYG A;  3CQT A;  2CSI A;  1RI9 A;  2YT6 A;  2GBQ A;  2KRO A;  2EYY A;  1MV0 B;  1ZUU A;  1NG2 A;  2K2M A;  2ED0 A;  4AG1 C;  1KSW A;  2GGR A;  2SRC A;  1K0S A;  2J7I A;  3C0C A;  1TG0 A;  2M0Y A;  3RBB B;  2DE0 X;  1WA7 A;  2NUZ A;  2KNB B;  4CC2 A;  2A28 A;  1X43 A;  3TSW A;  2V1R A;  3A98 A;  2DL5 A;  2PNI A;  4HCK A;  2X3X D;  2JT4 A;  1WDX A;  3NGP A;  2OAW A;  2L2P A;  3EHR A;  3GBQ A;  1T3L A;  4AFQ C;  1S1N A;  2V1Q A;  2K7A A;  1WIE A;  2OI3 A;  2FPE A;  2DF6 A;  2D8H A;  1AZE A;  1PRM C;  1U5S A;  3I35 A;  2RN8 A;  3VRY A;  2ABL A;  5I22 A;  1CKA A;  3SEM A;  2CUD A;  1SSH A;  3EG3 A;  2MOX A;  3IQL A;  2KGT A;  1T0J A;  3H0F A;  3VS6 A;  1QWE A;  1B3Q A;  2CRE A;  2CSQ A;  4R0K A;  4AFS C;  1JEG A;  2JM9 A;  4CC4 B;  2KYB A;  2GNC A;  3M0S A;  2KE9 A;  2AK5 A;  4RTW A;  2BZ8 A;  2C0O A;  4HVV A;  2KT8 A;  1J3T A;  4J9G A;  1M8M A;  1I07 A;  2JS0 A;  2MIO A;  2HBW A;  2EKH A;  1GCP A;  1BU1 A;  3VS1 A;  1OOT A;  2E5K A;  1WYX A;  2L3Q A;  1UHF A;  4J9D A;  1GBR A;  3ULR B;  3UA6 A;  1E6H A;  3M0P A;  2KXC A;  5FW9 A;  2JXB A;  1RLQ C;  2DL8 A;  3EHQ A;  4Z89 A;  4J9F A;  2M51 A;  2JW4 A;  1QCF A;  2KR3 A;  3TSZ A;  2JMA A;  2DL3 A;  4GLM A;  1JO8 A;  1JXO A;  1X2Q A;  2JS2 A;  2D8J A;  5HCK A;  2CT4 A;  1WLP B;  2DJQ A;  1KFZ A;  1VYT A;  5IHN A;  1HJD A;  1TUD A;  2FRY A;  1PNJ A;  1Y0M A;  1SRL A;  2LP5 A;  4LE9 A;  1E7O A;  4J9I A;  4EIK A;  2EVR A;  2DIL A;  2HEQ A;  1G83 A;  2C0T A;  2YSQ A;  2D1X A;  4CC7 A;  1UJY A;  5L23 A;  5GJW B;  1WXU A;  2FEI A;  1SHF A;  1ABQ A;  4D8K A;  4RTV A;  2BTT A;  4F16 A;  1SHG A;  1M30 A;  2L0A A;  3H0I A;  2O9S A;  2SEM A;  1ZBJ A;  1EFN A;  3I5S A;  3JV3 A;  1HD3 A;  2CUB A;  4RTU A;  1ZUK A;  1AD5 A;  4GBQ A;  2DVJ A;  4F14 A;  3VS3 A;  2ROL A;  5IH2 A;  2YUN A;  5IXB A;  2O31 A;  4X1V A;  1WX6 A;  2O88 A;  2HCK A;  1CKB A;  4AFU C;  1UDL A;  1BB9 A;  2JMC A;  2L3S A;  2ESW A;  2AZV A;  1NLO C;  2RQR A;  2ED1 A;  3ZL7 C;  1CSK A;  4RTX A;  1UUE A;  2A37 A;  5EC7 A;  5FWC A;  3SHW A;  3R6N A;  1X2K A;  2J05 A;  1M27 C;  1HSQ A;  5FWB A;  4LUE A;  2EW3 A;  1YNZ A;  2NWM A;  4IIM A;  2B86 A;  1MV3 A;  1K76 A;  2EBP A;  1PHT A;  1NEB A;  1QWF A;  1OPK A;  1KJW A;  4LN2 A;  4OML A;  4J9C A;  2CDT A;  2I0N A;  4OMO A;  1E6G A;  2JM8 A;  4JJB A; 
#chains in the Genus database with same CATH topology
 5HKC A;  2PVG B;  4M7A E;  5DY9 A;  1O75 A;  1VIE A;  1KD1 R;  4JDS A;  2YWW A;  3M55 A;  1VQ4 T;  2QTX A;  2MWP A;  1UG1 A;  4PJO B;  4XTZ A;  1K8A C;  3E9F A;  4DBF A;  4M78 C;  4J9E A;  1YJW A;  1AWW A;  4JLI A;  4L59 A;  2VKN A;  1G3Y A;  2MWO A;  2WSF E;  2IPO B;  1PKS A;  1KQ2 A;  2IIM A;  3I55 A;  4JJC A;  4RUG A;  5A0G A;  4A4K A;  1YBY A;  2P0Q A;  3VKI A;  1DJ7 B;  3FJP A;  3X24 B;  1S72 A;  5GAN j;  2H3E B;  3REA B;  2DKG A;  2XDD A;  2YUP A;  1NYF A;  4LNP A;  1VQ8 A;  1X6G A;  4PNO A;  5C0M A;  2GCX A;  1X27 A;  2COW A;  1D1A A;  4C92 E;  1YJ9 T;  3VYG A;  4DEY A;  1PKT A;  4QVD A;  4M77 G;  3OW2 S;  1Y57 A;  5I11 A;  4M78 A;  2X51 A;  5KYY A;  4JRK A;  3CCM T;  3SWN A;  4C0D C;  2Y4Y A;  4PJO G;  1WHM A;  2GTJ A;  3P8D A;  1EIF A;  3CCS T;  2ZPF B;  2DYB A;  3KFV A;  2ZPG B;  2HKQ B;  2X4W A;  2O4X A;  1WFW A;  3LH0 A;  2W0Z A;  3PTA A;  5GAO q;  3UDC A;  3JB9 F;  2EYZ A;  1K9M C;  2HQH A;  1VQ6 A;  1M8V A;  4PJM A;  3P8B B;  1Q86 C;  2QXF A;  4M77 C;  1SKU B;  2A3L A;  4C92 A;  3L2U A;  1LVK A;  1TOV A;  1MHN A;  4KH1 B;  2XIC A;  5GAN 2;  4RG8 A;  2PUO B;  1FYN A;  1D0Y A;  4ZGD B;  1JRI A;  4LDW A;  3QZ5 B;  3TQ7 P;  1X6B A;  3V8J A;  1AWO A;  1PWT A;  5J39 A;  2ROT A;  3TU4 K;  3L42 A;  1JXM A;  2L89 A;  1QKX A;  1JQQ A;  1BBZ A;  2LVM A;  2EWN A;  4M7A C;  4Z8A A;  3U23 A;  2O4X B;  4F04 B;  3CCU Q;  1K8A U;  2CH4 A;  5LJ3 e;  2QQR A;  3QUI A;  4FW2 A;  3HSB A;  3JB9 I;  3CCS A;  1QVF A;  1UE9 A;  2DO3 A;  1TTH B;  1WI7 A;  5AYF A;  4J9H A;  5FU6 B;  4M77 F;  3OA6 A;  3UF4 A;  1AEY A;  4IUU A;  3MEV A;  2CP0 A;  4C0Z A;  2OTJ A;  4QT7 A;  1VQ9 T;  4DEX A;  1YN8 A;  2LCS A;  3EG2 A;  4HKE A;  4KRT A;  1ZHI A;  1QMC A;  2MCN A;  2B8A A;  1VQ7 Q;  1VQN Q;  2KRS A;  1VQ7 T;  4ZGJ B;  4N4H A;  2J6O A;  5GAN 4;  4CRI A;  4J7F A;  2QDL A;  1QKW A;  2F2W A;  4GLK A;  3F70 A;  2HNI A;  1K9M U;  1NBE B;  1VQK A;  4JJN K;  1XQH A;  4FSS A;  1OPL A;  2K3B A;  1W1F A;  5ECA A;  1N6A A;  2JOY A;  3X26 B;  3OY9 A;  2RJE A;  3H9N A;  2EPD A;  4B6M A;  2DBM A;  2RF0 A;  2EJG A;  3C95 A;  3OS0 A;  4KBM B;  3HP9 A;  1OU9 A;  1I0C A;  2EQK A;  2XK0 A;  3GIB A;  2EAY A;  5GAO p;  3RMQ A;  1KHC A;  3S3N A;  4B9W A;  4HVU A;  1M3C A;  1RUW A;  3MEU A;  1KK7 A;  1HXD A;  2PQW A;  4C8Q C;  5CAI A;  2JN0 A;  1TUC A;  1IZ6 A;  1N8R U;  1GFC A;  1VQN T;  1UEB A;  4CC3 A;  2P0P A;  2FO0 A;  1RAA B;  5CKD A;  1SRM A;  3FJ5 A;  1PSE A;  3SD4 A;  1TUG B;  2QQB A;  4M75 E;  2OJ2 A;  3TCJ A;  2CSI A;  4XU0 A;  2GBQ A;  2KRO A;  4BE1 A;  5HK3 A;  1NG2 A;  1Y96 B;  4XTV A;  4DOW A;  1KSW A;  1YJN Q;  2JZ2 A;  2M9U A;  2NUT B;  2E5Q A;  4EMG A;  2J7I A;  4XTW A;  2HQE A;  3NFC A;  3OYE A;  3A8G B;  3CME A;  1WA7 A;  2NUZ A;  2V1R A;  3A98 A;  2DL5 A;  3SWN C;  2BE7 D;  1D3B A;  2FHD A;  4AFQ C;  1S1N A;  3G71 T;  2QK0 A;  4EMK C;  3CCU T;  2CP6 A;  1RAH B;  1YCY A;  2D8H A;  1U8R A;  1UGQ B;  4E7L A;  2E6Z A;  3OBY A;  1U5S A;  3I35 A;  3LWH A;  2K57 A;  2COZ A;  3OYJ A;  2MOX A;  3IQL A;  1M2V A;  4ATO A;  3H0F A;  3H6Z A;  2RHU A;  5GMK i;  4ELZ C;  2RJD A;  4FSX A;  2CSQ A;  4M77 E;  4OVA A;  5KYX B;  1X75 C;  4CC4 B;  2GNC A;  3ASK A;  2AK5 A;  1BIA A;  2C0O A;  1YJW T;  1J3T A;  4J9G A;  4FL6 A;  2P84 A;  2MIO A;  2DET A;  2PVD B;  1OOT A;  4LXC A;  2IG0 A;  4F7U G;  3LGL A;  3PGG A;  3JCM X;  2CZ0 B;  2L3R A;  3VUZ A;  2CP2 A;  1VQM A;  3E2U A;  1Y96 A;  1KQ1 A;  3ULR B;  2DL8 A;  2JW4 A;  2DTI A;  4BE2 A;  2ZPE B;  1ZSZ C;  3FRN A;  3SFM A;  5FRM A;  3WVE B;  2OTL T;  4PL6 A;  1JO8 A;  1JXO A;  2D8J A;  3RKY A;  5DLO A;  3MHX A;  1WHL A;  4MZT A;  5IHN A;  1TUD A;  1Y0M A;  2XKO C;  4F7U A;  3QZ9 B;  2EVR A;  3QG1 A;  1IXD A;  3A8L B;  2D1X A;  2LCC A;  4CC7 A;  3HHT B;  1BI1 A;  1WXU A;  4PK4 A;  1ABQ A;  4RTV A;  4F16 A;  2L0A A;  2K3X A;  1ZBJ A;  1VQ8 Q;  3JV3 A;  3OS2 A;  1HD3 A;  4FM4 B;  3HTR A;  5GAO m;  2QGG A;  2ROL A;  5A0D A;  5IH2 A;  1TU0 B;  2HCK A;  1CKB A;  4PJN A;  1QVG A;  3ZL7 C;  1KQS S;  1UUE A;  5EC7 A;  3GPL A;  3OMG A;  3SDZ A;  3SHW A;  5GMK l;  3R6N A;  4OGE A;  5FWB A;  4DBH A;  3PIP A;  2MYS A;  4LUE A;  3L2V A;  3CC4 T;  2VB6 A;  1YNZ A;  4IIM A;  2EBP A;  3FEO A;  1NEB A;  1KJW A;  2CGH A;  4OMO A;  1BCO A;  1E6G A;  3CCQ A;  1OX9 A;  3QJ6 A;  4D8D A;  1H8K A;  2BZX A;  2PTK A;  2BZY A;  4M78 F;  3JCM V;  2RQT A;  4XU3 A;  1M1K U;  3E1S A;  2YUQ A;  2RA2 A;  1Q81 U;  5IXF A;  1I81 A;  1NLP C;  2A36 A;  1ZQ1 A;  3VUB A;  1G5V A;  1UGV A;  1B7T A;  1M3A A;  1OI1 A;  4HVW A;  5LL6 S;  2KYM A;  2QA4 Q;  1Y7X A;  4M75 C;  4M77 A;  3V8L A;  3CXC S;  4M7A D;  4BB7 A;  4Z88 A;  1YHQ T;  1VQO Q;  4NL2 A;  1VQP T;  1VA7 A;  4KGX B;  3EGX B;  2R5M A;  2DD5 A;  2RI3 A;  1VQO A;  2ATC B;  2RHX A;  4X9C A;  1LJO A;  2VUB A;  2DEQ A;  2DTO A;  4C0D B;  2L3P A;  1SG5 A;  5CKH A;  3I5R A;  1QVP A;  2R57 A;  3CPW A;  3VS2 A;  4RCC A;  1Q81 R;  1YCS B;  4PJO E;  2AKL A;  4LD6 A;  3HRS A;  1ZA2 B;  1QLY A;  3A8M B;  2FB7 A;  4EMK B;  1X01 A;  3VS5 A;  3OYD A;  2OTL Q;  2RO0 A;  3JCM d;  3M5A A;  4M7A B;  1TS9 A;  5FU7 C;  4O6J A;  5J26 A;  1KC8 R;  5D6Y A;  2RJC A;  1ZSG A;  2E10 A;  2E70 A;  4P5N A;  4J5Y A;  3OYM A;  1RAD B;  3UAT A;  1K4U S;  3CCR Q;  2LJ1 A;  3NPF A;  5GAN 7;  3BW1 A;  1UHC A;  1JU5 C;  2ZAE A;  1PG5 B;  3JCM h;  4M78 B;  2MAM A;  1AZG B;  2C0I A;  2LRQ A;  1ABO A;  3DB3 A;  2FZK B;  5GAN f;  2GF7 A;  2JTM A;  2DXB A;  3OYL A;  1LCK A;  2M16 A;  2EGE A;  3E9G A;  4C5I A;  4LDV A;  1GCQ A;  1VQ5 T;  1VQ5 Q;  1OV3 A;  3FLG A;  2DZ9 A;  4YTL A;  1VOM A;  4LDY A;  3O5Z A;  1OZ3 A;  4DA4 A;  3HPW A;  5LJ3 d;  1SPK A;  2EGC A;  1VQN A;  2MMP A;  3JAM E;  1YIT Q;  1RLP C;  4PFZ A;  2DXT A;  5GAM d;  4IIO A;  2LJ0 A;  3CCJ A;  4OB2 B;  3FDR A;  4M7D E;  2VC8 A;  4HT8 A;  3BFM A;  2W10 A;  3CC7 A;  4KUL A;  4ZNX A;  3CCV A;  3QSU A;  3RR6 A;  2E64 A;  3THK A;  1AOJ A;  3JB9 G;  1H3Z A;  1AWJ A;  1QP2 A;  4Z02 A;  2KQW A;  1V76 A;  5IHI A;  1T3S A;  4J9B A;  4RG2 A;  1MMG A;  1KC8 U;  4JLG A;  1YWP A;  3CCR A;  2AZS A;  3TRE A;  1M2O A;  2HSP A;  2J6K A;  1NZ9 A;  2RK1 A;  1YWO A;  2OTJ T;  1EZZ B;  3EG1 A;  4AT1 B;  2BUD A;  5GAN e;  4ME7 A;  3OYF A;  4JRP A;  5GMK m;  2EJ9 A;  2F2X A;  2G6F X;  4KGV B;  1MNE A;  2EGA A;  2DEU A;  4FT4 A;  2DA9 A;  2ECZ A;  2F69 A;  5I2S A;  2E4H A;  3PVQ A;  1JB0 E;  2RJF A;  4E7K A;  4M78 G;  3CXC P;  1HYO A;  1R0C B;  3CCE T;  3I55 T;  2ZZD A;  4JJD A;  3BDL A;  1V29 B;  1M1F A;  1W2B A;  2YXY A;  3MPU B;  4QKU A;  4OGC A;  2FRW A;  1YP5 A;  4DBR A;  3EGD A;  5GAO r;  4QQ6 A;  1QP3 A;  1WXB A;  4Y28 E;  3E19 A;  2LT4 A;  3GF5 A;  3DB4 A;  2RQW A;  1PM3 A;  4LD9 K;  2RI5 A;  4L6V 5;  1VQL A;  5IAY A;  3CCL A;  1PSF A;  2KY9 A;  2KXD A;  3JCM c;  2LQK A;  4A63 B;  2G3R A;  4PFP A;  2DM1 A;  1UJ0 A;  3QJY A;  4Y92 A;  3UT1 A;  3CMA Q;  3KBG A;  3LH5 A;  3CCM A;  4FCY A;  1Q82 U;  1UGS B;  1WQ7 A;  5CK9 A;  1H92 A;  5FLX E;  1G3W A;  4C8Q A;  2BIV A;  4HCZ A;  3CQT A;  4QQD A;  3VU3 C;  2YT6 A;  1MV0 B;  2WSC E;  3QBY A;  4MZM A;  2K2M A;  4AG1 C;  5GMK h;  4WTO B;  3CPW P;  3EFO B;  4R56 A;  1S72 Q;  3QYH B;  2M0Y A;  5CKF A;  3RBB B;  2DE0 X;  4II1 A;  3JB9 D;  4CC2 A;  2KNB B;  3OYA A;  1Y07 A;  5DLQ E;  3MP1 A;  1X43 A;  4NOY A;  1VQ9 Q;  2ZPI B;  2X3X D;  2HL3 A;  2OAW A;  1T3L A;  2VV5 A;  3JCM g;  2V1Q A;  1TH7 A;  1SSF A;  2HQX A;  1TXQ A;  2K7A A;  3EGX A;  4M7D D;  3OBW A;  2QTV A;  4M7D B;  2VYT A;  1YIT T;  3CXC A;  1JJ2 A;  3HKS A;  2A0F B;  2CZ6 B;  1CKA A;  3SEM A;  2JNG A;  2CUD A;  1SSH A;  3EG3 A;  1BKB A;  2KGT A;  4ELY C;  4QVC A;  1T0J A;  1WJS A;  2JJ9 A;  2XG8 D;  3VS6 A;  2X4J A;  1O9S A;  2DXU A;  2YLC A;  2KVQ G;  2JM9 A;  2KYB A;  5LJ3 h;  2HSE B;  3M0S A;  5CCA A;  4RTW A;  2X35 A;  2BZ8 A;  3OSS C;  3L2W A;  5GAN 6;  3CBP A;  2JS0 A;  3C12 A;  1M90 C;  3CC4 Q;  3VS1 A;  2JTF A;  3CEY A;  3QO3 A;  3CCL Q;  2VGM A;  3PT9 A;  5LJ5 f;  2JVV A;  1S72 T;  1QVF P;  2AHJ B;  1R77 A;  2WAC A;  1E6H A;  2RHZ A;  4M78 E;  5KE2 A;  4J9F A;  2M51 A;  3S3O A;  2KR3 A;  1IGU A;  2JMA A;  5KYX A;  1YJ9 A;  4FYY B;  4GLM A;  1X2Q A;  1WLP B;  2DJQ A;  1VYT A;  4JUV A;  2FRY A;  5HK0 A;  1IHV A;  1D0Z A;  4BD3 A;  1YIT A;  2VAS A;  3EAE A;  3EG9 B;  4FW1 A;  4Y91 A;  3C4S A;  3N5B B;  3R6O A;  2C0T A;  2V8K A;  4C92 C;  5KCO A;  1UJY A;  5L23 A;  3JB9 H;  2V8I A;  1M30 A;  2L5Q A;  4PJJ A;  1D3B B;  2C06 A;  7AT1 B;  1VQO T;  1YHQ Q;  1YJN T;  3OYN A;  3X28 B;  2KI7 A;  1MMN A;  3OYC A;  4XTY A;  2E6N A;  2CUB A;  1AD5 A;  3X25 B;  2CYZ B;  4E2F B;  3ZBD A;  1N9R A;  1WX6 A;  4J6X A;  4OMF B;  4AFU C;  1UDL A;  3FC3 A;  2L3S A;  5GAN h;  4F7U B;  2DZC A;  1CSK A;  1C0M A;  3LWI A;  2F1L A;  2J05 A;  1WHK A;  3KUF A;  1H64 1;  2V26 A;  1QCO A;  4PLL A;  2VGN A;  3GP8 A;  3HL8 A;  3OYK A;  1WJQ A;  1MV3 A;  1K76 A;  5GAO n;  1ZA1 B;  1WNL A;  4LN2 A;  1M1K R;  3I55 Q;  4JRI A;  2RB6 A;  4E7S A;  5KYY B;  3UPU A;  4JJB A;  4OF1 A;  4C8Q F;  3JCM W;  5LJ5 d;  4N0A C;  2CS7 A;  2XU8 A;  4R55 A;  5GJV B;  4OB3 B;  3ZFJ A;  2DL4 A;  4AFZ C;  2NUP A;  3RES A;  1ZSZ B;  2ZPB B;  5GAN g;  5KH6 A;  1VQ5 A;  2LQW A;  1K73 U;  4ZGE B;  1P92 A;  3CD6 T;  3CD6 Q;  2RMO A;  2EYQ A;  1BK2 A;  1W2B S;  3VV0 A;  1OZ2 A;  4RMO A;  3CMA T;  2OX7 A;  3PE0 A;  3VS7 A;  3NTH A;  5D7U A;  3URG A;  3VJP A;  5GAM h;  3VS0 A;  1UGP B;  4PKC C;  2DPP B;  5C6S A;  4F17 A;  1GBQ A;  1PCX A;  3M0R A;  2K9G A;  1G2B A;  1UFF A;  3OS5 A;  1KD1 C;  3CC4 A;  4EMK A;  4C0F A;  2A7Y A;  4JS5 A;  4BAC A;  2H8H A;  1VYU A;  1K73 C;  2R5A A;  2Y4X A;  1PD1 A;  5FU6 C;  3AHU A;  1W4S A;  1G8X A;  4C92 D;  3OYY A;  1AVZ C;  2X3W D;  5KYW B;  1Q7Y U;  3ER0 A;  5CR2 A;  4XU2 A;  3RKX A;  1U3O A;  2EIF A;  1B07 A;  5GMK j;  1C6V X;  4RTT A;  2LC4 A;  3X20 B;  2K6D A;  5IN1 A;  3HRT A;  2RNA A;  3NMZ C;  1KIK A;  2KEA A;  3RNJ A;  2F2V A;  2QGF B;  4JZ3 A;  2XID A;  2XD0 A;  4UC4 A;  1WGS A;  2CP3 A;  4C92 B;  3M0U A;  1M5Q 1;  4F7U E;  2DAQ A;  5CIU A;  3REB B;  2DNU A;  3JRZ A;  2NUT A;  3VRZ A;  2DYI A;  2K2V A;  3GNF B;  2DFU A;  1VQ6 T;  2VXE A;  1OU8 A;  1QCN A;  4C5H A;  3NTI A;  3M56 A;  3M0Q A;  4BE0 A;  3L2Z A;  3JSC A;  1NM7 A;  1JJ2 S;  1AWX A;  2QG9 B;  1H3H A;  2LCL A;  3H41 A;  1ZLM A;  2LX9 A;  2AKK A;  2RQV A;  4OMQ A;  1FMK A;  2KRN A;  3CME T;  1V1C A;  2EQU A;  2EYX A;  4OMP A;  3M58 A;  2E41 A;  2GFU A;  3MKD A;  2HDA A;  2J6F A;  2LNV A;  3CC2 A;  4O5V A;  1GFD A;  4E6R A;  4HCB A;  1YIJ T;  3PMT A;  1YIJ Q;  1FWZ A;  3NHN A;  1VYV A;  1YI2 T;  3DLM A;  2RQU A;  2GTO A;  3QHS A;  2D9T A;  3CPF A;  1VQK Q;  1N27 A;  4A4G A;  1VQK T;  2ENM A;  3HFN A;  2E3H A;  3INZ A;  4N4I A;  3RIR A;  2LQN A;  4QW2 A;  3CBO A;  4LUD A;  1M9S A;  5M9O A;  4XU1 A;  2YUO A;  1QQJ A;  1IGQ A;  3I56 T;  5KE3 A;  1XOV A;  1MND A;  1I5L A;  2K4Y A;  4MZP A;  4BI3 A;  1U1S A;  3QWY A;  2RHI A;  1GCQ C;  2CT3 A;  5D6X A;  1G3T A;  1Q86 U;  1VQ8 T;  2XDB A;  2DD4 A;  3J80 E;  2PZ1 A;  4KUD K;  2FYK A;  1UEC A;  5EG2 A;  5KYU A;  3S3M A;  4M75 B;  3SWN B;  3G6E A;  3UA7 A;  4FIB A;  5FRO A;  2QEX T;  2VVK A;  2KSS A;  4FT2 A;  3CCM Q;  4BDY A;  1OEB A;  1R8O B;  4KUI A;  5FU7 B;  2QEX Q;  3CMA A;  3OMC A;  4M7D A;  1PRL C;  3MEA A;  1FX7 A;  3EGU A;  2DX1 A;  1X69 A;  1HK9 A;  3LX7 A;  4M7D F;  3GLX A;  4ORZ A;  2OTL A;  1TSF A;  3EG0 A;  2VWF A;  2I2L A;  3CCV Q;  5GAN 8;  4XAX B;  1GL5 A;  1QVG S;  2FPD A;  2DIG A;  4J83 A;  1OQK A;  4A54 A;  1QW1 A;  1W70 A;  3C94 A;  3GOX A;  3I9Q A;  2XMF A;  2EQJ A;  1I1J A;  1NYG A;  3JB9 J;  2E1H A;  4M75 D;  1C1A A;  3BE3 A;  2EYY A;  2HKN A;  2DXC A;  4C8Q G;  2ED0 A;  1YJ9 Q;  2LTO A;  4MDX A;  2GGR A;  3JCM P;  2SRC A;  1K0S A;  5D6W A;  2HZY A;  1TG0 A;  3QKJ A;  2KDS A;  4OB1 B;  4F7U F;  3L1A A;  2A28 A;  3OYH A;  4E7I A;  3ME9 A;  4XK8 E;  2PNI A;  3CC2 Q;  2PVO B;  1UGR B;  3O8V A;  3RUX A;  1WDX A;  3GBQ A;  3EHR A;  3V7S A;  5CVI A;  4C5G A;  4EDU A;  5GAN d;  1IRE B;  2KK4 A;  2MPX C;  5CQY A;  2OI3 A;  2FPE A;  5LJ3 g;  3CCQ T;  4FYX B;  1KD1 U;  3RER A;  1PRM C;  1N9S A;  4FYW B;  1NJI C;  1OYX A;  3VRY A;  2ABL A;  1XTD A;  1PD0 A;  4M77 D;  5KYU B;  1TWB A;  2WSE E;  5KCH A;  1B3Q A;  1LOJ A;  2CRE A;  2FVU A;  3JCM J;  3OSV A;  4R0K A;  4AFS C;  1N8R R;  4M75 G;  1JEG A;  3WXM B;  4HVV A;  1M90 U;  4IKF A;  1M8M A;  3CCE Q;  4RCB A;  1YI2 A;  2PUK B;  3FB9 A;  1WQW A;  2HBW A;  4MDW A;  3CPW S;  1GCP A;  5I2M A;  2H3J A;  1YI2 Q;  2YRD A;  4IUV A;  2XDP A;  1NJI U;  3OYB A;  2O01 E;  2E65 A;  2HMA A;  3V7R A;  3MO8 A;  3CCR T;  1Y71 A;  3UA6 A;  1RAB B;  3M0P A;  4J6W A;  3SB2 A;  2FZG B;  2JXB A;  5GAM g;  3EHQ A;  4Z89 A;  3LW5 E;  4M75 F;  4NS5 A;  3TSZ A;  3J81 E;  2P0K A;  4BI8 B;  3AT1 B;  1RAI B;  1WHH A;  5IT9 E;  2M02 A;  4E7J A;  2JS2 A;  5HCK A;  1XJW B;  1KFZ A;  4LDX A;  1JJ2 P;  3GNG A;  1B34 A;  3CCS Q;  3EFO A;  1KC8 C;  4J9I A;  4EIK A;  1LPL A;  5GAN 3;  2QEX A;  2QQA A;  2HEQ A;  1G83 A;  4M78 D;  2CP7 A;  3A1P A;  5LJ5 j;  1D0X A;  2K5F A;  2FEI A;  1SHF A;  3WVD B;  4PJO A;  4DQ2 A;  4B9X A;  2OAU A;  1SHG A;  3H0I A;  2SEM A;  1YFN A;  1KQS P;  3CCU A;  1ZUK A;  2DVJ A;  3VS3 A;  3QYG B;  4QVZ A;  2YUN A;  3JCM b;  5LJ3 f;  5IXB A;  3CCL T;  4PJO F;  2QQS A;  4J8O A;  1BB9 A;  2ESW A;  3LLR A;  1K73 R;  2RQR A;  4DBQ A;  2ED1 A;  5A2Q E;  3OYI A;  1NPR A;  2EKO A;  2V8J A;  4KH0 B;  1LNX A;  1VQ9 A;  1M27 C;  1HSQ A;  1XNI A;  4C5E A;  3EGD B;  2EW3 A;  2OTJ Q;  2CZ7 B;  4OB0 B;  2B86 A;  4HA8 A;  3EH1 A;  1QWF A;  1M1G A;  2QA4 A;  2BKD N;  2L8D A;  4OML A;  2QQ9 A;  2KAF A;  1K9M R;  1VQ7 A;  2NLU A;  4BY6 C;  3RMS A;  3OW2 P;  2CDT A;  2I0N A;  3A8H B;  4PLI A;  1F1B B;  1M90 R;  1KG1 A;  4NL3 A;  2JM8 A;  3CC2 T;  3ZEH A;  4N4G A;  3BY7 A;  3A8O B;  3CC7 T;  1EX4 A;  1AT1 B;  1ZX6 A;  2ZCF B;  1N5Z A;  1Z9Q A;  3MCA B;  4PFO A;  1PC0 A;  5HY6 A;  3HFO A;  1WJR A;  2LDM A;  4Q5W A;  3EFS A;  2LMJ A;  2DL7 A;  1G3S A;  2XHC A;  3MET A;  3T9N A;  2RH2 A;  1D09 B;  4A4H A;  4XTX A;  1M3B A;  2CP5 A;  3QII A;  4X34 A;  2P4R A;  3CCQ Q;  4OMN A;  3OB9 A;  5CO7 A;  2KBT A;  4WCI A;  1VQM Q;  4BY6 B;  1VQM T;  1K9A A;  4FU6 A;  2YDL A;  1UTI A;  3QWX X;  3M4Y A;  5IHK A;  2NUP B;  2RHY A;  1Q7Y R;  1FXX A;  4ANJ A;  3JCM f;  3CCE A;  4L5G A;  2RI2 A;  1MMA A;  3EH2 A;  4PJO D;  2CH4 W;  2X4Y A;  4D6W A;  1BCM A;  2JTE A;  1FMW A;  2AT1 B;  4V2S A;  2GQI A;  2DER A;  4C8Q E;  2K79 A;  1SF9 A;  1K1Z A;  2RK2 A;  2HAX A;  4HXJ A;  2IVW A;  1BI2 A;  1U06 A;  4M4Z A;  4C8Q B;  2LQ8 A;  5LJ5 h;  1W2B P;  2LZ6 B;  1RAG B;  1YJN A;  3V7C A;  4J7I A;  1RL2 A;  5CKB A;  1W6X A;  2AIR B;  2FPF A;  1VQL T;  1K0X A;  1N8R C;  4M7D C;  3G6E Q;  3CBM A;  2KMT A;  2LJ3 A;  3OQ5 A;  1M1K C;  4RTY A;  2J06 A;  2KT1 A;  4M7A F;  1Q81 C;  1R0B G;  1D1B A;  2LNH B;  3CCJ Q;  1RAE B;  3CCJ T;  1FMV A;  3G4S A;  1GRI A;  2E3I A;  2DRK A;  2CKK A;  2DK3 A;  2F5K A;  1MUZ A;  4QQG A;  4AMC A;  3H0H A;  4JZ4 A;  3QDR B;  3I56 Q;  4JRQ A;  1WXT A;  4XTU A;  2HD0 A;  2DVE A;  1UB4 A;  2Y90 A;  2YLB A;  2BE9 B;  2O2O A;  1Q82 C;  1OX8 A;  2D0N A;  2NYS A;  4E7H A;  1VQP A;  2X4X A;  1JBM A;  2VXF A;  2EYW A;  4C92 F;  4RKU E;  1KQS A;  3MJX A;  1ACM B;  2DLP A;  2F5T X;  4E47 A;  1Z9Z A;  3FIF A;  5CQX A;  4IUT A;  2QA4 T;  4OMM A;  1VQL Q;  2O9V A;  1SEM A;  4A4F A;  1ZBX A;  3Q1J A;  1T0H A;  1NE8 A;  2E12 A;  3VS4 A;  2RPN A;  1BIB A;  3LYI A;  4M7A A;  3M0T A;  3QXE B;  4RTZ A;  8ATC B;  3PVL A;  3TVT A;  2DBK A;  1A0N B;  2FZC B;  3P8H A;  1IHW A;  4JS4 A;  3CC7 Q;  6AT1 B;  1Q82 R;  2XI9 A;  4KT0 E;  3KXT A;  1AHJ B;  3CD6 A;  4M77 B;  3L2R A;  3A5Z B;  1IO6 A;  2DMO A;  2MK5 A;  3QPH A;  2D0Q B;  2A08 A;  3EFR A;  2KRM A;  2CZ1 B;  2QAS A;  4E7Z A;  4K11 A;  1I5O B;  5GAN 5;  2EQI A;  4C8Q D;  4ZN1 A;  5GAM f;  3OYG A;  3G71 Q;  3OS1 A;  3G4S T;  4M7D G;  1MGQ A;  1VQ4 Q;  3G4S Q;  3QDF A;  4ESR A;  4BUG A;  2DJZ A;  2LX7 A;  4HCC A;  4EPC A;  3V8K A;  4JPB W;  2DRM A;  2D6F A;  1ZUY A;  4A4E A;  2RD1 A;  3MEW A;  4A53 A;  5J3B A;  5CKE A;  4AG2 C;  1WZO A;  3OW2 A;  2P4T A;  3M57 A;  3LGF A;  2M0O A;  5AT1 B;  1MMD A;  4C92 G;  3TEE A;  1ARK A;  2FG0 A;  5GMK e;  3JCM e;  1NEG A;  1VQP Q;  3MP6 A;  1X6O A;  4KGZ B;  1WHG A;  1RI9 A;  3M9Q A;  2MI6 A;  2QAZ A;  1ZUU A;  2X9H A;  1M2V B;  2HBP A;  2LT1 A;  4EMH A;  3DKM A;  3M54 A;  2ZPH B;  3MP8 A;  3G6E T;  3C0C A;  4M75 A;  1Q7Y C;  4C0G A;  3JCM Q;  2EQM A;  2GFA A;  5LJ5 g;  4PJL A;  3TSW A;  2K3Y A;  2EJF A;  4HCK A;  1OUL A;  2JT4 A;  1RI0 A;  3NGP A;  2L2P A;  4ZTJ A;  4N0A A;  4X9D A;  1WIE A;  1YIJ A;  2Z0W A;  2COY A;  8AT1 B;  2DF6 A;  5L8R E;  1QVG P;  3CCV T;  1AZE A;  2YRV A;  1RAF B;  2RN8 A;  3G1J A;  3I56 A;  5I22 A;  1RAC B;  3G7Z A;  4DOV A;  1K8A R;  2RM4 A;  5GAM j;  3H8Z A;  5GAO l;  1QWE A;  1QVF S;  5A0L A;  4LDU A;  3RDV A;  3UWN A;  2KE9 A;  2KT8 A;  9ATC B;  1I07 A;  4IUP A;  2EKH A;  1BU1 A;  3S6W A;  2E5K A;  1Q86 R;  4HT9 A;  1WYX A;  3PIO A;  2L3Q A;  3VYH B;  1VUB A;  4BDZ A;  1KHI A;  1UHF A;  3M53 A;  3EG9 A;  3HRU A;  4J9D A;  4XQ3 A;  5LJ5 e;  1GBR A;  1VIF A;  1BYM A;  3M59 A;  3M4G A;  2QYZ A;  2KXC A;  5FW9 A;  2YRC A;  1RLQ C;  5I21 A;  1M4Z A;  1QCF A;  4PJO C;  2YHT A;  4MMK A;  1YHQ A;  1VQ6 Q;  2DL3 A;  1VQ4 A;  2K5L A;  3DLL A;  2CT4 A;  1HJD A;  5LJ3 j;  1YJW Q;  3PMI A;  1PNJ A;  1SRL A;  2LP5 A;  4LE9 A;  3NTK A;  3CME Q;  1E7O A;  4IUR A;  1D1C A;  4CI0 C;  2DIL A;  3RKW A;  1NPP A;  2PU9 B;  2YSQ A;  5GJW B;  2M1H A;  2FL7 A;  3G71 A;  4D8K A;  1NJI R;  2JUF A;  5DM7 R;  2BTT A;  4FYV B;  1WHJ A;  2O9S A;  1EFN A;  1ZSZ A;  1Q95 G;  3I5S A;  2GQV A;  4RTU A;  4GBQ A;  4F14 A;  2ZGW A;  1BI3 A;  3L2Q A;  1U1T A;  2DIQ A;  2O31 A;  4X1V A;  2O88 A;  5KYW A;  2MF2 A;  2QI2 A;  5GAM e;  2JMC A;  5KYN A;  5FRN A;  3J7A F;  1B34 B;  2AZV A;  1NLO C;  2QDY B;  4RTX A;  2A37 A;  4BI4 A;  5FWC A;  2R58 A;  4OP0 A;  3PFS A;  1X2K A;  1IB8 A;  3D7S B;  3PNW C;  4WF2 A;  2DTH A;  4ZTF A;  1I8F A;  4MML A;  4ZN3 A;  2NWM A;  4GY5 A;  4IUQ A;  1I4K 1;  4TVR A;  1WPY A;  2HL5 C;  1IRX A;  1PHT A;  1GXI E;  1OPK A;  4M7A G;  2EFI A;  1BI0 A;  2K5I A;  4J9C A;  4J6Y A;  4VUB A;  3BDU A; 
#chains in the Genus database with same CATH homology
 4D8D A;  1H8K A;  2BZX A;  2PTK A;  2BZY A;  2RQT A;  5GJV B;  2DL4 A;  1ZX6 A;  4AFZ C;  1N5Z A;  1Z9Q A;  2YUQ A;  5IXF A;  1UG1 A;  1NLP C;  2A36 A;  2LQW A;  4J9E A;  1AWW A;  2LMJ A;  2DL7 A;  2VKN A;  1UGV A;  1PKS A;  2RMO A;  2IIM A;  1M3A A;  4HVW A;  1BK2 A;  2KYM A;  4JJC A;  4RUG A;  1M3B A;  3PE0 A;  3VS7 A;  2P4R A;  4OMN A;  3REA B;  2KBT A;  3VS0 A;  4WCI A;  2YUP A;  1NYF A;  4Z88 A;  1K9A A;  4LNP A;  2YDL A;  1UTI A;  1VA7 A;  3QWX X;  1X6G A;  4F17 A;  1GBQ A;  5IHK A;  3M0R A;  2K9G A;  1X27 A;  1G2B A;  1UFF A;  2H8H A;  4DEY A;  1VYU A;  1PKT A;  2L3P A;  3I5R A;  2CH4 W;  1Y57 A;  5I11 A;  2JTE A;  1AVZ C;  2X3W D;  2GTJ A;  3VS2 A;  2GQI A;  2DYB A;  1YCS B;  2AKL A;  3KFV A;  1U3O A;  2K79 A;  1K1Z A;  1B07 A;  1WFW A;  4HXJ A;  1QLY A;  2W0Z A;  1U06 A;  4RTT A;  3VS5 A;  2EYZ A;  2K6D A;  4M4Z A;  2RNA A;  3NMZ C;  1ZSG A;  2KEA A;  1KIK A;  3RNJ A;  3UAT A;  2F2V A;  2LZ6 B;  1K4U S;  4JZ3 A;  2LJ1 A;  3NPF A;  1UHC A;  1JU5 C;  1W6X A;  2FPF A;  1K0X A;  3M0U A;  1AZG B;  2C0I A;  1FYN A;  2DNU A;  3REB B;  2LJ3 A;  1ABO A;  3VRZ A;  4RTY A;  2J06 A;  2KT1 A;  1X6B A;  1LCK A;  1AWO A;  2EGE A;  2LNH B;  1PWT A;  1GCQ A;  2ROT A;  1JXM A;  3M0Q A;  1OV3 A;  1QKX A;  1JQQ A;  1BBZ A;  1GRI A;  1NM7 A;  2DRK A;  4Z8A A;  3U23 A;  1AWX A;  3O5Z A;  2CH4 A;  1H3H A;  1MUZ A;  3H41 A;  1ZLM A;  2AKK A;  3H0H A;  2RQV A;  4OMQ A;  4JZ4 A;  1SPK A;  1FMK A;  2EGC A;  2KRN A;  1WXT A;  1V1C A;  4OMP A;  2EYX A;  1RLP C;  1UE9 A;  1WI7 A;  2HDA A;  2J6F A;  4IIO A;  4J9H A;  2LJ0 A;  1GFD A;  2O2O A;  3UF4 A;  4E6R A;  1AEY A;  2D0N A;  2EYW A;  3NHN A;  1VYV A;  2W10 A;  4ZNX A;  4QT7 A;  2RQU A;  2GTO A;  4DEX A;  1YN8 A;  2DLP A;  3THK A;  2LCS A;  1AOJ A;  3EG2 A;  4KRT A;  1AWJ A;  2ENM A;  2MCN A;  5IHI A;  1Z9Z A;  1T3S A;  2LQN A;  4J9B A;  4LUD A;  1YWP A;  2KRS A;  4OMM A;  2AZS A;  2YUO A;  2O9V A;  1SEM A;  2J6O A;  2HSP A;  2J6K A;  1T0H A;  1XOV A;  3VS4 A;  2QDL A;  1YWO A;  2RPN A;  1QKW A;  3QWY A;  3EG1 A;  2F2W A;  1GCQ C;  2CT3 A;  3M0T A;  4RTZ A;  3PVL A;  3TVT A;  2DBK A;  1A0N B;  2F2X A;  2G6F X;  2EGA A;  2DA9 A;  2ECZ A;  4FSS A;  2PZ1 A;  3PVQ A;  1UEC A;  1OPL A;  2K3B A;  1W1F A;  5ECA A;  1IO6 A;  2DMO A;  3UA7 A;  4JJD A;  2VVK A;  2EPD A;  2A08 A;  1OEB A;  2DBM A;  2KRM A;  2RF0 A;  4K11 A;  1PRL C;  2FRW A;  3EGU A;  2EQI A;  2DX1 A;  1YP5 A;  1X69 A;  1I0C A;  1WXB A;  4ORZ A;  4ESR A;  3EG0 A;  2VWF A;  2LX7 A;  2RQW A;  4HVU A;  1M3C A;  1RUW A;  4JPB W;  2DRM A;  1TUC A;  2KXD A;  1ZUY A;  4A63 B;  1GL5 A;  2DM1 A;  1UJ0 A;  1GFC A;  2FPD A;  4Y92 A;  3LH5 A;  4AG2 C;  1W70 A;  4CC3 A;  2FO0 A;  3I9Q A;  2XMF A;  1H92 A;  1SRM A;  3FJ5 A;  1ARK A;  2OJ2 A;  2FG0 A;  1NEG A;  1I1J A;  1NYG A;  3CQT A;  2CSI A;  1RI9 A;  2YT6 A;  2GBQ A;  2KRO A;  2EYY A;  1MV0 B;  1ZUU A;  1NG2 A;  2K2M A;  2ED0 A;  4AG1 C;  1KSW A;  2GGR A;  2SRC A;  1K0S A;  2J7I A;  3C0C A;  1TG0 A;  2M0Y A;  3RBB B;  2DE0 X;  1WA7 A;  2NUZ A;  2KNB B;  4CC2 A;  2A28 A;  1X43 A;  3TSW A;  2V1R A;  3A98 A;  2DL5 A;  2PNI A;  4HCK A;  2X3X D;  2JT4 A;  1WDX A;  3NGP A;  2OAW A;  2L2P A;  3EHR A;  3GBQ A;  1T3L A;  4AFQ C;  1S1N A;  2V1Q A;  2K7A A;  1WIE A;  2OI3 A;  2FPE A;  2DF6 A;  2D8H A;  1AZE A;  1PRM C;  1U5S A;  3I35 A;  2RN8 A;  3VRY A;  2ABL A;  5I22 A;  1CKA A;  3SEM A;  2CUD A;  1SSH A;  3EG3 A;  2MOX A;  3IQL A;  2KGT A;  1T0J A;  3H0F A;  3VS6 A;  1QWE A;  1B3Q A;  2CRE A;  2CSQ A;  4R0K A;  4AFS C;  1JEG A;  2JM9 A;  4CC4 B;  2KYB A;  2GNC A;  3M0S A;  2KE9 A;  2AK5 A;  4RTW A;  2BZ8 A;  2C0O A;  4HVV A;  2KT8 A;  1J3T A;  4J9G A;  1M8M A;  1I07 A;  2JS0 A;  2MIO A;  2HBW A;  2EKH A;  1GCP A;  1BU1 A;  3VS1 A;  1OOT A;  2E5K A;  1WYX A;  2L3Q A;  1UHF A;  4J9D A;  1GBR A;  3ULR B;  3UA6 A;  1E6H A;  3M0P A;  2KXC A;  5FW9 A;  2JXB A;  1RLQ C;  2DL8 A;  3EHQ A;  4Z89 A;  4J9F A;  2M51 A;  2JW4 A;  1QCF A;  2KR3 A;  3TSZ A;  2JMA A;  2DL3 A;  4GLM A;  1JO8 A;  1JXO A;  1X2Q A;  2JS2 A;  2D8J A;  5HCK A;  2CT4 A;  1WLP B;  2DJQ A;  1KFZ A;  1VYT A;  5IHN A;  1HJD A;  1TUD A;  2FRY A;  1PNJ A;  1Y0M A;  1SRL A;  2LP5 A;  4LE9 A;  1E7O A;  4J9I A;  4EIK A;  2EVR A;  2DIL A;  2HEQ A;  1G83 A;  2C0T A;  2YSQ A;  2D1X A;  4CC7 A;  1UJY A;  5L23 A;  5GJW B;  1WXU A;  2FEI A;  1SHF A;  1ABQ A;  4D8K A;  4RTV A;  2BTT A;  4F16 A;  1SHG A;  1M30 A;  2L0A A;  3H0I A;  2O9S A;  2SEM A;  1ZBJ A;  1EFN A;  3I5S A;  3JV3 A;  1HD3 A;  2CUB A;  4RTU A;  1ZUK A;  1AD5 A;  4GBQ A;  2DVJ A;  4F14 A;  3VS3 A;  2ROL A;  5IH2 A;  2YUN A;  5IXB A;  2O31 A;  4X1V A;  1WX6 A;  2O88 A;  2HCK A;  1CKB A;  4AFU C;  1UDL A;  1BB9 A;  2JMC A;  2L3S A;  2ESW A;  2AZV A;  1NLO C;  2RQR A;  2ED1 A;  3ZL7 C;  1CSK A;  4RTX A;  1UUE A;  2A37 A;  5EC7 A;  5FWC A;  3SHW A;  3R6N A;  1X2K A;  2J05 A;  1M27 C;  1HSQ A;  5FWB A;  4LUE A;  2EW3 A;  1YNZ A;  2NWM A;  4IIM A;  2B86 A;  1MV3 A;  1K76 A;  2EBP A;  1PHT A;  1NEB A;  1QWF A;  1OPK A;  1KJW A;  4LN2 A;  4OML A;  4J9C A;  2CDT A;  2I0N A;  4OMO A;  1E6G A;  2JM8 A;  4JJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...