2E5KA

Solution structure of sh3 domain in suppressor of t-cell receptor signaling 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
GSSGSSGSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of SH3 domain in Suppressor of T-cell receptor signaling 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Suppressor of T-cell receptor signaling 1
total genus 7
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2e5kA01
1NLOC 1ZUKA 1BK2A 3H0HA 5ECAA 2LQNA 3NGPA 2VVKA 4J9CA 2JXBA 3CQTA 4DEXA 1E7OA 1JU5C 2CH4A 2DA9A 3EG3A 1M3BA 1VYVA 3M0RA 1X2KA 1ZX6A 3R6NA 4K11A 5IHIA 1ARKA 1ABQA 1PRMC 1B07A 2DJQA 3M0PA 1B3QA 1HSQA 1KSWA 1HD3A 1RUWA 1AD5A 2KGTA 1RI9A 2ENMA 3SEMA 3GBQA 2ROLA 2JS0A 1UJ0A 3VS7A 3PVLA 1UDLA 3ZL7C 3H0IA 1PRLC 4CC3A 4F14A 1VA7A 3TSZA 1MV3A 1WIEA 2DL4A 2J6OA 4OMMA 2LNHB 1H3HA 1IO6A 1OV3A 1K0SA 2YSQA 2DRKA 2O2OA 2F2VA 1JO8A 2ED0A 2RQTA 4JPBW 1WXBA 2KRSA 2LCSA 1UFFA 2K3BA 4CC7A 4AFZC 1E6GA 2HSPA 2QDLA 1HJDA 1AZEA 4AFUC 1OPKA 2JW4A 4Z88A 3QWYA 2JT4A 2LJ3A 2ESWA 2FPEA 2J05A 2YUPA 2CDTA 1PWTA 2KROA 2K6DA 2PTKA 2LJ0A 1CKBA 1AEYA 2AZVA 2L3PA 2RN8A 2HDAA 2KXCA 2FPFA 1X6GA 4Y92A 1XOVA 1S1NA 5GJWB 1SRMA 5IH2A 2CUDA 2KYBA 2NUZA 1QKWA 2EYZA 4OMOA 2EGCA 1YP5A 3M0UA 1UJYA 1YN8A 2D1XA 2GTJA 4Z89A 1YNZA 3TSWA 3C0CA 1FMKA 1WYXA 1ZBJA 4KRTA 2IIMA 3QWXX 1TUDA 2DYBA 1MV0B 2JTEA 2LZ6B 1M30A 2BZ8A 2FO0A 1M8MA 2H8HA 2B86A 5IXFA 1Y57A 2C0TA 2KYMA 1NLPC 2VKNA 2JS2A 2RMOA 3M0SA 1WA7A 1V1CA 2EVRA 1EFNA 2C0OA 2D8JA 2GBQA 1WXUA 1UUEA 2A08A 3PE0A 1GCQC 1M3AA 2V1RA 1KFZA 4ZNXA 2DNUA 2K79A 3VS1A 4QT7A 1UTIA 2A28A 1X2QA 1M3CA 2X3XD 4GBQA 1VYTA 4LUEA 1K1ZA 2JM8A 1GBRA 1JXOA 1AWJA 4HVVA 2LX7A 1Z9QA 1AVZC 2FRWA 1JEGA 2KEAA 1J3TA 1H92A 3KFVA 1KIKA 2DBMA 3SHWA 2JMCA 2AK5A 3REAB 3THKA 5L23A 1TG0A 1ZUUA 1SEMA 2LMJA 1A0NB 2AKLA 1NEBA 2D0NA 2DILA 3M0TA 1AOJA 1PKSA 2RQRA 2DMOA 2GNCA 2YUNA 4J9EA 4RTVA 2CREA 2EQIA 2LP5A 3EG0A 2KRNA 5IHKA 4RUGA 1K9AA 3EGUA 3UA6A 3VS0A 1T3SA 1SHFA 4IIMA 4J9IA 2ABLA 4AG1C 1OEBA 4E6RA 5FW9A 4HVUA 1NG2A 2V1QA 4RTZA 4OMPA 2DVJA 5FWCA 1T3LA 1UE9A 1W70A 3VS3A 1CKAA 4J9BA 2JMAA 3VRYA 1YCSB 3JV3A 4IIOA 4R0KA 3LH5A 4HCKA 1PKTA 1SHGA 1I0CA 1NM7A 4RTUA 1WI7A 2FG0A 1NYFA 5I11A 4EIKA 3U23A 2EW3A 2DM1A 1X6BA 4OMLA 1U5SA 1ZUYA 3FJ5A 2RPNA 4D8KA 3ULRB 2GQIA 3EHRA 2BZXA 3UA7A 2KXDA 2DL7A 1OPLA 1QWFA 2F2WA 1ZLMA 2KT1A 5IXBA 4LNPA 2DX1A 2DL8A 1WXTA 4JZ3A 1UGVA 2O9VA 2K2MA 2YUQA 2RF0A 2W0ZA 2FEIA 4HXJA 2KBTA 3EHQA 1X69A 1G83A 1JXMA 1X27A 4JJCA 2CSIA 2DF6A 1UHCA 2AKKA 2L3QA 2RQUA 4J9DA 2SEMA 1WFWA 2GTOA 4CC2A 2KNBB 2CSQA 2DL5A 4ORZA 5HCKA 4JJBA 1GRIA 2XMFA 2EGEA 1GFCA 4LUDA 3UATA 2MCNA 2RQWA 1SRLA 1Z9ZA 1T0HA 1RLPC 2J7IA 2J6FA 2MIOA 4AG2C 1UECA 4J9FA 2EYWA 1I1JA 1ZSGA 2DRMA 1RLQC 2FRYA 3RNJA 2M0YA 1AWXA 3TVTA 4AFSC 1GFDA 1UHFA 1FYNA 4D8DA 3VS2A 2A37A 3EG2A 1N5ZA 1I07A 4WCIA 4JZ4A 4RTXA 2L0AA 1ABOA 3H41A 2M51A 2J06A 4RTYA 1KJWA 4RTTA 4JJDA 2YT6A 3REBB 1Y0MA 1PHTA 4OMQA 2BZYA 2P4RA 4DEYA 1VYUA 2L3SA 2X3WD 1K0XA 1AZGB 1CSKA 1AWOA 2A36A 2JM9A 4A63B 2G6FX 3IQLA 3EG1A 2K9GA 1JQQA 4OMNA 4AFQC 2MOXA 2E5KA 2L2PA 3UF4A 1K4US 2J6KA 3I5RA 2YUOA 3NMZC 2KR3A 1LCKA 1NEGA 2BTTA 4J9GA 1W6XA 1U3OA 3I9QA 1WDXA 2HCKA 5IHNA 3RBBB 1G2BA 2DBKA 3I5SA 3H0FA 3VS6A 2D8HA 2EBPA 4F17A 1AWWA 4F16A 3O5ZA 1TUCA 4RTWA 1U06A 2CH4W 2O31A 2DLPA 3VS4A 2EPDA 2KRMA 2GGRA 3M0QA 4CC4B 1H8KA 1BU1A 2DE0X 1W1FA 1E6HA 1QKXA 2AZSA 3VS5A 2C0IA 3VRZA 4HVWA 1BBZA 1QWEA 2DL3A 2ED1A 1UG1A 1GCPA 1QCFA 1GL5A 4ESRA 2CT3A 2EYXA 2OI3A 2VWFA 4GLMA 4J9HA 2RNAA 2YDLA 2EGAA 1K76A 1YWOA 2NWMA 3PVQA 4M4ZA 1GCQA 2PNIA 4FSSA 4X1VA 2O9SA 5FWBA 2I0NA 2ECZA 2OAWA 2HBWA 5I22A 2ROTA 1WX6A 2CUBA 2SRCA 1MUZA 4LE9A 2HEQA 2CT4A 1GBQA 1T0JA 1SSHA 4LN2A 1M27C 2EKHA 2F2XA 2RQVA 3A98A 2W10A 1SPKA 2LJ1A 1OOTA 2FPDA 4Z8AA 1YWPA 2LQWA 2O88A 2OJ2A 1PNJA 5EC7A 3NHNA 1WLPB 1QLYA 1NYGA 2EYYA 5GJVB 2KE9A 2K7AA 2KT8A 3I35A 1X43A 2PZ1A 3NPFA 1BB9A
chains in the Genus database with same CATH superfamily
2DD4A 3C12A 1Q86C 4MZMA 3CC2A 2CZ7B 4E7IA 3CXCA 2LVMA 2M9UA 3CQTA 2CH4A 3KBGA 3CCEQ 3M0RA 1ZHIA 3CCMT 2LNVA 5CO7A 3CCLA 1ZX6A 5IHIA 1ARKA 2VGNA 1JBMA 1ABQA 1D0YA 4KULA 1N8RR 4C8QC 3SWNC 3M0PA 1B3QA 2RHIA 1AD5A 3GBQA 1EX4A 2GF7A 2MWOA 2P4TA 3LGLA 1MNDA 1Q7YU 1NJIC 2JS0A 3M54A 4DBQA 5DM7R 2CGHA 5LJ5h 3INZA 4RCBA 5IAYA 3LX7A 4MZTA 1UDLA 3ZL7C 1WNLA 2DL4A 2LCLA 3G7ZA 3EH2A 1K0SA 3RIRA 3JRZA 1D1CA 4IUTA 3CC2T 2RM4A 2ED0A 4EMKB 1ZSZA 2WSFE 3VYHB 4B9XA 4FW2A 4AFUC 2E64A 1VOMA 1OPKA 2JW4A 2QDYB 3QWYA 2LJ3A 4O5VA 1YIJQ 3QZ5B 2FB7A 2CDTA 3GNFB 1BCMA 1PWTA 1M2VA 4TVRA 1M5Q1 2LJ0A 3CCVA 2RA2A 4J5YA 2AHJB 4HCBA 4UC4A 1PC0A 4N4IA 1Q7YC 1NJIU 2ZPGB 4Y92A 5GJWB 2KYBA 2M0OA 1QVGA 5CK9A 2EYZA 1VQNA 1YN8A 4F7UA 1VQOQ 4KH0B 1WYXA 3EGXB 3MJXA 2JTEA 3MCAB 1QCOA 4KGZB 4LDVA 4DBHA 2NUTB 2H8HA 1YJNA 4ZGDB 3L2QA 4F7UE 1Y57A 2HKQB 3OQ5A 5KYWA 2DXUA 1NLPC 2DAQA 4F04B 2BIVA 2JS2A 1WA7A 5I21A 1EFNA 1M1KC 2CP6A 1VQ5T 2GBQA 2ZGWA 4QVDA 4OB0B 4ZGJB 1GCQC 3QYGB 5GANg 3PMTA 2DNUA 1D1BA 4ZN3A 2HD0A 1KK7A 4M75A 1X2QA 4R56A 2DPPB 4LUEA 3RDVA 4D6WA 3JB9I 1OU9A 2JM8A 1YI2A 5KYUB 1VIEA 2P0PA 1SSFA 1G3YA 3C4SA 4HVVA 3TREA 2LX7A 1AVZC 3CEYA 1Q95G 1WHJA 4E2FB 4KH1B 1JB0E 3OYEA 2BE7D 1H92A 5A2QE 4FU6A 3OS1A 1S72T 3CCEA 4E7SA 2V8IA 3REAB 3THKA 3J80E 1SEMA 1QVFS 5HK3A 4M7DD 2LMJA 2AKLA 1NEBA 1AHJB 3S6WA 1QP2A 2RQRA 2VUBA 4LDUA 2KVQG 2D6FA 3PFSA 1NE8A 3CD6A 2CREA 4C8QE 5GAMh 2NLUA 1K8AC 2E3HA 2K5IA 3QJYA 4KGVB 1YJWT 3EGUA 2NUPA 1FWZA 1G3WA 1S72Q 4AG1C 1OEBA 5FU6C 1BKBA 1UGRB 4E6RA 5FW9A 4C8QA 2Y4XA 1SKUB 3TCJA 5KYYA 1W70A 4JJNK 4J9BA 3JAME 1IHVA 3VRYA 1KD1U 3QYHB 4JRKA 1SHGA 1TSFA 1NM7A 1WI7A 3CC4T 4N0AC 1KQSS 3FIFA 1YJWQ 3G4SA 3RKWA 4PJNA 1ZUYA 3FJ5A 2DYIA 2GQIA 3EHRA 2BZXA 3CCRA 4N4GA 4L59A 1OQKA 4IUQA 2KXDA 5LJ5g 3MEAA 3M58A 2AT1B 2DX1A 2CZ1B 1WXTA 4M7DF 1YITT 4RKUE 2YHTA 2X35A 3CC4Q 1X69A 1Y71A 1X27A 3WVEB 2DF6A 2AKKA 4J9DA 2LRQA 5I2SA 2KDSA 3FB9A 2KNBB 4F7UF 2CSQA 1IRXA 3QKJA 4ORZA 5HCKA 4JJBA 1QVPA 1W2BA 1N9SA 3GPLA 3L2UA 1VQ9A 2RO0A 4GY5A 4M78D 2YRCA 3VUZA 3JCMe 5GAN3 4AT1B 1ZSGA 3OYMA 3RNJA 2CP3A 4AFSC 4NL3A 2JVVA 1UHFA 1FYNA 2G3RA 3VS2A 2A37A 4BY6C 4FIBA 1YHQA 1YITA 2L0AA 4BE0A 2M1HA 2J06A 4RTYA 4RTTA 3S3NA 1PHTA 4LDXA 1SG5A 2P4RA 2L3SA 4DOVA 2MI6A 3HFNA 1AZGB 1RAGB 4M78A 1BIBA 1VQ5A 2ZPBB 5LJ3g 1OULA 2XDPA 4L6V5 2DERA 2IVWA 4AFQC 4QVZA 2QEXQ 2GCXA 2YUOA 3NMZC 4EMGA 3JB9J 2X4XA 2D0QB 5GANh 2LCCA 4BDYA 3SD4A 2IPOB 3O5ZA 3CCQT 2X9HA 3GF5A 2DXTA 2O31A 4HT9A 2QQSA 2KRMA 2GGRA 4E7ZA 3RKYA 3KXTA 2AZSA 1TH7A 2RJDA 4ATOA 3P8BB 1OYXA 1GCPA 3O8VA 4RMOA 4M75B 2CT3A 3A1PA 1D3BA 4J7IA 2EYXA 2QYZA 1QP3A 3G4SQ 1X01A 1EIFA 5LJ5e 1ZSZC 4LDWA 2RNAA 3DB3A 4PJLA 1WHMA 2DEUA 1QVFP 2COZA 1KHCA 5GAMe 4M4ZA 2HAXA 2EQMA 3LH0A 2PNIA 4X1VA 5FU6B 3JCMd 1IB8A 2CZ6B 2ECZA 1I4K1 2BUDA 1WZOA 2HBWA 4LDYA 1K9MC 1TUGB 3EFOB 1WX6A 1K73R 2HL5C 2SRCA 3T9NA 5M9OA 3MO8A 2P0QA 1BI3A 2CT4A 8AT1B 1I5OB 2VV5A 2F2XA 1SPKA 4M77C 2FPDA 2CP5A 5GAOn 4HA8A 3OYKA 3CPWA 1WLPB 4HCCA 1Q81C 3GLXA 2EYYA 4J7FA 2K7AA 2K4YA 1X43A 2PZ1A 3BDUA 1G8XA 1BCOA 5KYYB 1NLOC 1YIJT 2EQJA 3H0HA 4QQ6A 2EAYA 3NGPA 3H6ZA 2OTJT 3I56Q 2JJ9A 3A5ZB 4DEXA 1BI1A 1JU5C 3EG3A 1M3BA 1YHQQ 2RI3A 3R6NA 1G3TA 2FYKA 3BDLA 2DJQA 1Y96A 4M78B 1HD3A 4F7UG 4MDXA 1MMAA 2KGTA 1RI9A 2ENMA 3SEMA 1KD1C 4AMCA 1PCXA 1VQPQ 3PNWC 4M7DC 1R0CB 4M7DG 2ZPHB 3QXEB 5I2MA 1MNEA 2XK0A 2IG0A 1VQKA 3A8GB 3HRTA 4XTWA 3JCMh 4XU2A 1VA7A 3I55Q 1MV3A 1QMCA 4Z02A 2J6OA 3MEVA 4OMMA 1QVGP 1H3HA 1JO8A 1LVKA 3LGFA 2K3BA 4CC7A 1E6GA 3CCMA 1JJ2S 2QDLA 2L3RA 4JUVA 1N8RC 2O4XA 4C92G 2JT4A 1QW1A 3MHXA 5L8RE 4XU0A 2J05A 1BI0A 1N9RA 1KG1A 3X20B 4JRPA 5LJ3h 1VQ7Q 4FSXA 1NJIR 2AIRB 3CMAT 2AZVA 2WACA 4NS5A 2H3EB 3MP8A 1JJ2P 1XOVA 4C92B 4PFZA 5FU7B 3OW2S 1SRMA 5FRMA 2CP0A 4M78C 2HZYA 3OY9A 3QPHA 2HKNA 2EGCA 3QBYA 3M0UA 2D1XA 4A4HA 4Z89A 4QQDA 5GANe 1ZBJA 4KRTA 4M78E 1KQSA 3CCSQ 4C92F 4A4EA 2FO0A 2B86A 3MEWA 3AHUA 3QZ9B 2C0TA 2KYMA 2C06A 7AT1B 2HSEB 3M0SA 5A0GA 2EVRA 2JTFA 2C0OA 5FROA 2FL7A 3L2ZA 1UUEA 2RJFA 3SWNB 2A08A 5C0MA 2ZCFB 3PE0A 5CKDA 5DY9A 2K5FA 5GAMj 5J3BA 1WHHA 2BE9B 4GBQA 1VYTA 1P92A 4ELZC 1JXOA 1M2OA 1JEGA 2KEAA 2NYSA 1KIKA 2JMCA 1X75C 2AK5A 1VQ6A 3CPWS 1YJNT 4Q5WA 3NTKA 1TG0A 2E70A 4PL6A 4BD3A 2RI5A 2DILA 2YRVA 4EMHA 1PKSA 2YUNA 4RTVA 1VQMT 1KC8C 1TOVA 2LP5A 1VQPA 5IHKA 2V8JA 4OGEA 1WJQA 5FU7C 1T3SA 1SHFA 4IIMA 1D09B 1D0XA 1IREB 5EG2A 1VQMA 5CVIA 1Q82R 2ZPEB 4CI0C 1K8AU 2PUKB 1T3LA 1UE9A 4MMLA 2WSEE 5KCOA 2H3JA 4R0KA 3JV3A 5GAOr 1PKTA 4HKEA 3CCET 2OTLA 4EIKA 1MMDA 4OB2B 1YJ9A 2EW3A 1M2VB 5LJ5d 2DM1A 2FVUA 2QK0A 4XK8E 3X26B 4D8KA 1KQ2A 1M8VA 1Y07A 2RI2A 2KK4A 5GAOq 2E41A 3DLMA 3HHTB 2OTLT 1OPLA 3CCLQ 2F2WA 3FEOA 1TS9A 2KT1A 5IXBA 3JCMg 2M16A 1UGVA 2X51A 2K2MA 1OU8A 2RF0A 4HXJA 1JJ2A 2MK5A 4JJCA 2MAMA 2E5QA 3M59A 3EFSA 4CC2A 1VQ9Q 2DL5A 4J6YA 5D6XA 1VQLA 3EFRA 2QA4Q 1M90R 1GRIA 2LQ8A 2XICA 2XMFA 4PKCC 3V7SA 1YI2Q 1M90U 1ZSZB 5GAMd 3N5BB 1Z9ZA 1XTDA 3QSUA 1RLPC 4GLKA 2J7IA 2OX7A 5LL6S 2EYWA 1I1JA 3M55A 4FYXB 2DRMA 5KH6A 5CR2A 4JS4A 3TVTA 1KQ1A 4M77F 4J8OA 5LJ3e 3EG2A 4BE1A 1ZBXA 2KI7A 4E7HA 4JZ4A 1BYMA 5GANj 1ABOA 3M56A 1MMNA 4B6MA 5FLXE 4M7AG 4QVCA 2OAUA 3G4ST 2Y4YA 3CCVQ 3CXCS 1Y0MA 2RJCA 3ZBDA 4OMQA 4BI4A 4DEYA 1VYUA 1BIAA 4DBFA 4M77G 1CSKA 1R77A 4A63B 2G6FX 3EG1A 3JCMW 1RAAB 4OMFB 4OMNA 1VQ8A 4BI8B 2MOXA 1VQOA 2E5KA 1K4US 2VGMA 2J6KA 4X9CA 3HTRA 3FLGA 1OX9A 1HK9A 2A3LA 1ZA2B 5LJ3d 3I9QA 4RCCA 1WDXA 4EMKC 5IHNA 3CCVT 4A4GA 1G2BA 2WSCE 2COWA 2DBKA 1LOJA 2QQ9A 3VS6A 1KC8R 3FDRA 4F17A 1G5VA 3DKMA 3MP1A 1XNIA 4M7DE 3CBPA 2CKKA 4Y28E 4M7DA 3VS4A 1VQ4T 3S3MA 1H8KA 1BU1A 3HSBA 2DE0X 1W1FA 2RB6A 1MGQA 4PJOF 3VS5A 1WHGA 1XQHA 3FRNA 3E1SA 4HVWA 2OTJQ 5CKEA 3H9NA 3FC3A 1VQ4A 2LX9A 4JRIA 1GL5A 4ESRA 2R57A 2I2LA 1VQOT 1F1BB 3RERA 2R5MA 2YDLA 1K76A 1IZ6A 1UEBA 4XTVA 5GAOp 2ZPFB 2I0NA 1IXDA 5LJ5f 5I22A 1FXXA 1PSFA 1Y7XA 2CUBA 1Q7YR 4LE9A 1YJ9T 2X4JA 3GIBA 2B8AA 5A0DA 1UGQB 1U1TA 4M7AD 2EKHA 3PIPA 3A98A 3CCJQ 2LJ1A 1OOTA 1WHKA 1YWPA 3OS5A 4XTUA 1RL2A 1PNJA 2VXEA 3NHNA 4M7AA 2DKGA 1QLYA 2A7YA 4FYVB 2KE9A 5DLQE 3RMQA 1YCYA 2VYTA 2KRNA 1BB9A 2RK2A 1ZUKA 1PD0A 1BK2A 5ECAA 5CQYA 4WF2A 2VVKA 4J9CA 2JXBA 4C0GA 1D1AA 1E7OA 2EQUA 2DA9A 4C0ZA 1M9SA 5KYUA 1VYVA 2DZ9A 5HK0A 3RKXA 3CCRQ 5AYFA 3BE3A 2DZCA 1PRMC 4KUIA 5KCHA 2QGFB 3CMEQ 1N27A 1KSWA 2YWWA 1SF9A 5FRNA 3G71Q 3JCMJ 4RG8A 2EIFA 1PG5B 2GFUA 3CC7T 4ZTFA 3PVLA 5HY6A 3H0IA 5GMKj 1PRLC 4CC3A 2XIDA 1WJRA 3TSZA 1WIEA 2D9TA 3HKSA 2KQWA 1ZQ1A 5KE3A 2LNHB 2E12A 1IO6A 2DRKA 2O2OA 1IGQA 3OSVA 1Q86R 1DJ7B 4VUBA 1WXBA 3V8KA 2KRSA 3JCMV 5GAN4 1UFFA 4N0AA 4AFZC 2YXYA 3S3OA 1C6VX 1K8AR 1AZEA 2Y90A 1W2BP 3NTHA 2FPEA 2YUPA 2KY9A 4IKFA 4BE2A 4XTYA 4C5IA 1CKBA 1NBEB 1AEYA 2L3PA 3SDZA 1EZZB 2VB6A 3RR6A 1RAEB 2KXCA 2O01E 2FPFA 4JRQA 1MHNA 2EJ9A 1LPLA 1ZA1B 5HKCA 2QQBA 5IH2A 2CUDA 3OBYA 4OB3B 4OVAA 3CBOA 1YP5A 1Q81U 2LT1A 5D6YA 2GTJA 1YNZA 2VC8A 3C0CA 2CS7A 1Q81R 3X25B 3RESA 2DYBA 1MV0B 1M30A 2BZ8A 1M8MA 2F5KA 1QVFA 5IXFA 3CCQQ 4QQGA 3G6EQ 1N8RU 3PMIA 2HL3A 2RMOA 3E19A 1V1CA 1RAIB 2DIGA 1RI0A 1WXUA 2K57A 3CCJA 4M78G 4BUGA 2DTOA 2K79A 3VS1A 2RHZA 3OYDA 4LD6A 2A28A 2DK3A 1M3CA 3V7CA 1K1ZA 3JCMc 4EDUA 1GBRA 3OW2A 1QQJA 2DJZA 3G1JA 1Z9QA 3BY7A 4E47A 3JCMX 2DBMA 5GMKl 3L2RA 3CCLT 1HYOA 5IN1A 5L23A 3H8ZA 3LW5E 5GAN7 3ASKA 3VJPA 1A0NB 3M53A 2D0NA 1AOJA 2DMOA 2JUFA 3UWNA 4J9EA 3CCMQ 2QQAA 4MMKA 4N4HA 5D6WA 2CP2A 4M78F 3EG0A 3EH1A 3A8OB 2XKOC 3Q1JA 1M1GA 4PJOD 2HQEA 1Q86U 1K9AA 1N6AA 3VS0A 3UDCA 3V7RA 2HQXA 2QTVA 4KT0E 2ABLA 3EGDB 3R6OA 3CMAA 3MPUB 3PT9A 1B34B 4M7AC 4HVUA 3L2VA 2GFAA 5AT1B 1NG2A 2V1QA 4RTZA 4PJOB 4OMPA 3VYGA 2DVJA 4C92D 5FWCA 1I8FA 3JSCA 3VS3A 1CKAA 4C8QG 5GAN5 3LLRA 4NL2A 3UPUA 3I56T 4HCKA 4O6JA 1I0CA 4RTUA 4M7AB 3CC2Q 5I11A 2V8KA 3V8LA 4C92A 3U23A 2HNIA 1X6BA 4OMLA 1U5SA 3CCSA 3SB2A 5LJ3f 2EWNA 2E65A 1G3SA 2YLBA 3L42A 4M7AF 1ZLMA 5KYXA 4FM4B 4LNPA 4M75E 2DL8A 2XU8A 3OYYA 2O9VA 1GXIE 2P84A 1IHWA 4XAXB 4F7UB 2K3XA 2FEIA 2KBTA 1U8RA 1JXMA 5GMKe 1VQNT 2CSIA 2L3QA 1UHCA 4DOWA 2P0KA 4V2SA 1Q82C 1WFWA 4PFPA 1B7TA 3EAEA 4ZGEB 1LNXA 3OSSC 1GFCA 4LUDA 3UATA 2E3IA 2MCNA 2RQWA 1SRLA 2F69A 2BKDN 1HXDA 2MIOA 5CKFA 4AG2C 2CP7A 5LJ3j 2DEQA 1RLQC 2FRYA 3P8DA 1NPPA 2M0YA 2PU9B 1VQNQ 4PLIA 1OZ3A 3EG9B 1GFDA 2DETA 1YIJA 4D8DA 1K73C 4J6XA 1N5ZA 5IT9E 4WCIA 1VQKQ 5GMKm 4RTXA 2FZKB 2KAFA 4ZTJA 2XDDA 2V26A 2M51A 1QVGS 3PIOA 3HRUA 2XD0A 3FJPA 4DQ2A 1KJWA 1VQPT 3QDFA 3MKDA 2RK1A 2PUOB 3A8MB 3REBB 1H3ZA 2QTXA 2LTOA 3MP6A 2KMTA 1RAHB 1U1SA 3HRSA 3PGGA 4C5HA 1K0XA 3EGXA 1AWOA 4B9WA 2A36A 3IQLA 1TWBA 3HFOA 2L2PA 4QKUA 3CD6T 3CXCP 4JDSA 1WJSA 3LWIA 1LCKA 1YJ9Q 2RJEA 4HT8A 3META 3VU3C 3QDRB 3RBBB 2HCKA 3QHSA 3I5SA 2EKOA 1B34A 2D8HA 2Z0WA 1K9MU 1AWWA 1JRIA 1KD1R 1TUCA 2CH4W 2JN0A 2XI9A 4OGCA 3BW1A 3CMAQ 1VQ7T 4WTOB 4CC4B 1KHIA 4E7JA 1E6HA 1QKXA 2E6ZA 3CD6Q 2C0IA 2A0FB 2E1HA 3VRZA 1FMWA 2JZ2A 1BBZA 2F1LA 4IUVA 1QWEA 2JOYA 2DL3A 2ED1A 4JLIA 4FYWB 2QAZA 3OA6A 3JB9H 1FX7A 1QCFA 4A53A 3TQ7P 3ZEHA 3JB9D 1OX8A 1QCNA 3CCRT 1RACB 2VWFA 1WHLA 4GLMA 4J9HA 3RMSA 4ANJA 4FYYB 2EGAA 4QW2A 5J26A 1YBYA 1YWOA 2DXCA 1VQ6Q 2E6NA 2CYZB 4IUUA 4ZN1A 1V76A 2LC4A 1NPRA 1BI2A 1X6OA 2ROTA 3CC7Q 3JCMP 3JCMb 2COYA 1UGPB 1MUZA 2HEQA 2M02A 5GAOl 5GANf 1GBQA 3QG1A 4LN2A 2RQVA 5CIUA 4RG2A 3ZFJA 4Z8AA 3E2UA 1VQ6T 2LQWA 5GMKi 3F70A 1WQ7A 1NYGA 4FT2A 5GJVB 3OYBA 4C8QB 1PSEA 2KT8A 5KYWB 1OZ2A 4E7LA 4C92C 4PJOA 5C6SA 1YJNQ 2OTLQ 2LQNA 2RHYA 3AT1B 1H641 4PJMA 3LWHA 4C0FA 1VUBA 4PK4A 6AT1B 2R58A 2YRDA 1X2KA 3OYAA 4K11A 1D0ZA 3A8HB 1B07A 2DD5A 5LJ5j 1HSQA 1RUWA 3E9FA 3M5AA 4BB7A 2PVDB 4R55A 2QGGA 2QA4T 4C8QD 2QG9B 2ROLA 3CBMA 3OS0A 1UJ0A 1YI2T 3VS7A 3M4GA 1YITQ 2L8DA 4C92E 4F14A 1VQLQ 3MEUA 3G6ET 1W2BS 4M75G 1OV3A 2YSQA 3JB9F 4BY6B 2F2VA 2RQTA 4JPBW 4M7DB 2LCSA 3E9GA 2HSPA 2NUPB 3JCMf 1HJDA 4XTZA 2HMAA 4Z88A 2EJFA 3CPFA 3EGDA 2ESWA 4E7KA 3OB9A 3OBWA 2K5LA 2QEXA 1VQLT 4A54A 1M1KR 2L89A 2QA4A 2KROA 2MWPA 2K6DA 3OMGA 1S72A 2PTKA 3OYCA 1TXQA 5GANd 3KUFA 3WVDB 2RN8A 2HBPA 2HDAA 3DB4A 4M75D 3M57A 1X6GA 1S1NA 1C1AA 5CKHA 2NUZA 3J81E 1QKWA 4OMOA 1I81A 1UJYA 3OYIA 1K73U 3VKIA 2LT4A 2R5AA 3TSWA 1YJWA 1FMKA 1R8OB 3TU4K 2IIMA 2QI2A 3A8LB 2DIQA 3QWXX 5GAN8 3OW2P 1TUDA 2LZ6B 4KGXB 1V29B 4BI3A 4PJOG 3CC7A 3OYLA 2FHDA 2VKNA 4ELYC 2QEXT 1AT1B 2X4WA 3GP8A 3RUXA 2QASA 2K3YA 4LD9K 2D8JA 3JB9G 4BACA 3CC4A 4M77A 1M3AA 2V1RA 2PVGB 2MF2A 1Q82U 4ZNXA 1KFZA 2ZZDA 4QT7A 1UTIA 1VQ8Q 2X3XD 5CKBA 4EPCA 3LYIA 4J83A 1AWJA 4FT4A 5CCAA 2FRWA 1J3TA 3KFVA 5KE2A 3SHWA 4FCYA 4HCZA 3D7SB 1ZUUA 3J7AF 4C5EA 1C0MA 3M0TA 2VXFA 2GNCA 1VQ8T 4MDWA 4PJOC 1YHQT 2XG8D 2VASA 3CPWP 1MMGA 4EMKA 2EQIA 2EJGA 2F5TX 3HL8A 4M75F 3M9QA 2MPXC 2OTJA 1VQ4Q 4RUGA 3UA6A 1RAFB 4J9IA 5DLOA 1YFNA 2O4XB 4LXCA 5CAIA 1O75A 1TTHB 1VQ5Q 4XQ3A 1ACMB 2JMAA 1M90C 4CRIA 1M1KU 1YCSB 4IIOA 3LH5A 3GNGA 2EYQA 1NYFA 2FG0A 1M4ZA 1VQKT 4OF1A 3EG9A 4M77E 4C5GA 2PQWA 2RPNA 3ULRB 1O9SA 4XU1A 1M1FA 1WGSA 3C95A 3UA7A 1UGSB 1D3BB 1RADB 2DL7A 3CCQA 2PVOB 4MZPA 3G6EA 1QWFA 5GMKh 3G71T 5A0LA 3VV0A 3CCUA 5GAOm 2GQVA 4J6WA 4JZ3A 2YUQA 3PTAA 2LQKA 2W0ZA 3CMEA 2DTIA 3EHQA 3CCJT 1G83A 2RQUA 3L1AA 4IUPA 2SEMA 2GTOA 3I55A 3TEEA 2K2VA 3EFOA 4PLLA 2EGEA 4YTLA 9ATCB 3BFMA 1T0HA 2J6FA 3I55T 4IURA 4C0DB 1UECA 4J9FA 3CCST 4M7AE 3SWNA 2JTMA 4PJJA 1AWXA 3G71A 3X28B 4OB1B 1RABB 1I07A 5GAMf 4P5NA 3OMCA 4JLGA 3CMET 4PNOA 5GAN2 3H41A 2RH2A 4X9DA 3OS2A 5CQXA 3OYHA 2E10A 2QQRA 2YT6A 4JJDA 2XDBA 1KQSP 4NOYA 1R0BG 2BZYA 1NZ9A 3OYJA 3GOXA 1Y96B 5GAN6 2DXBA 2X3WD 8ATCB 4OP0A 4KBMB 2JM9A 3QJ6A 4KUDK 1OI1A 2K9GA 2ZAEA 5D7UA 1JQQA 4C8QF 3I56A 2MMPA 2DVEA 3UF4A 3I5RA 4L5GA 3NFCA 1I5LA 2KR3A 3ER0A 1NEGA 2BTTA 4J9GA 4XU3A 3QO3A 1W6XA 3OYFA 1U3OA 3WXMB 2RHXA 3HP9A 3HPWA 4Y91A 3H0FA 1PD1A 2EBPA 2DO3A 4F16A 1WQWA 4A4KA 4C0DC 4RTWA 1U06A 1K9MR 2KSSA 2DLPA 3UT1A 5KYNA 2EPDA 2EFIA 3JCMQ 2E4HA 4X34A 3M0QA 2JNGA 4M77D 3P8HA 3VUBA 1FMVA 4PJOE 4JS5A 2YLCA 2FZGB 3OYNA 2XHCA 1UG1A 3QIIA 4DA4A 4II1A 3NTIA 2X4YA 1PM3A 2OI3A 3M4YA 2CZ0B 4A4FA 5KYXB 1UB4A 2RHUA 1LJOA 2EQKA 2NWMA 4BDZA 3PVQA 2QXFA 3URGA 1GCQA 4FSSA 2O9SA 5FWBA 3CCUQ 4DBRA 2RD1A 4ME7A 1WPYA 2OAWA 2LDMA 4M75C 1TU0B 1KC8U 3C94A 4PFOA 3SFMA 4XTXA 1VQ7A 2L5QA 1IGUA 2FZCB 3X24B 1T0JA 1SSHA 1W4SA 1M27C 1VQMQ 3L2WA 2ATCB 2W10A 5J39A 4FL6A 1XJWB 2O88A 3ME9A 4FW1A 1VQ9T 2MYSA 2OJ2A 3V8JA 5GAMg 3DLLA 5EC7A 2NUTA 2HQHA 3CCUT 2ZPIB 1VIFA 2DTHA 2DFUA 4M77B 3I35A 3QUIA 3OYGA 3NPFA
chains in the Genus database with same CATH topology
1NLOC 1ZUKA 1BK2A 3H0HA 5ECAA 2LQNA 3NGPA 2VVKA 4J9CA 2JXBA 3CQTA 4DEXA 1E7OA 1JU5C 2CH4A 2DA9A 3EG3A 1M3BA 1VYVA 3M0RA 1X2KA 1ZX6A 3R6NA 4K11A 5IHIA 1ARKA 1ABQA 1PRMC 1B07A 2DJQA 3M0PA 1B3QA 1HSQA 1KSWA 1HD3A 1RUWA 1AD5A 2KGTA 1RI9A 2ENMA 3SEMA 3GBQA 2ROLA 2JS0A 1UJ0A 3VS7A 3PVLA 1UDLA 3ZL7C 3H0IA 1PRLC 4CC3A 4F14A 1VA7A 3TSZA 1MV3A 1WIEA 2DL4A 2J6OA 4OMMA 2LNHB 1H3HA 1IO6A 1OV3A 1K0SA 2YSQA 2DRKA 2O2OA 2F2VA 1JO8A 2ED0A 2RQTA 4JPBW 1WXBA 2KRSA 2LCSA 1UFFA 2K3BA 4CC7A 4AFZC 1E6GA 2HSPA 2QDLA 1HJDA 1AZEA 4AFUC 1OPKA 2JW4A 4Z88A 3QWYA 2JT4A 2LJ3A 2ESWA 2FPEA 2J05A 2YUPA 2CDTA 1PWTA 2KROA 2K6DA 2PTKA 2LJ0A 1CKBA 1AEYA 2AZVA 2L3PA 2RN8A 2HDAA 2KXCA 2FPFA 1X6GA 4Y92A 1XOVA 1S1NA 5GJWB 1SRMA 5IH2A 2CUDA 2KYBA 2NUZA 1QKWA 2EYZA 4OMOA 2EGCA 1YP5A 3M0UA 1UJYA 1YN8A 2D1XA 2GTJA 4Z89A 1YNZA 3TSWA 3C0CA 1FMKA 1WYXA 1ZBJA 4KRTA 2IIMA 3QWXX 1TUDA 2DYBA 1MV0B 2JTEA 2LZ6B 1M30A 2BZ8A 2FO0A 1M8MA 2H8HA 2B86A 5IXFA 1Y57A 2C0TA 2KYMA 1NLPC 2VKNA 2JS2A 2RMOA 3M0SA 1WA7A 1V1CA 2EVRA 1EFNA 2C0OA 2D8JA 2GBQA 1WXUA 1UUEA 2A08A 3PE0A 1GCQC 1M3AA 2V1RA 1KFZA 4ZNXA 2DNUA 2K79A 3VS1A 4QT7A 1UTIA 2A28A 1X2QA 1M3CA 2X3XD 4GBQA 1VYTA 4LUEA 1K1ZA 2JM8A 1GBRA 1JXOA 1AWJA 4HVVA 2LX7A 1Z9QA 1AVZC 2FRWA 1JEGA 2KEAA 1J3TA 1H92A 3KFVA 1KIKA 2DBMA 3SHWA 2JMCA 2AK5A 3REAB 3THKA 5L23A 1TG0A 1ZUUA 1SEMA 2LMJA 1A0NB 2AKLA 1NEBA 2D0NA 2DILA 3M0TA 1AOJA 1PKSA 2RQRA 2DMOA 2GNCA 2YUNA 4J9EA 4RTVA 2CREA 2EQIA 2LP5A 3EG0A 2KRNA 5IHKA 4RUGA 1K9AA 3EGUA 3UA6A 3VS0A 1T3SA 1SHFA 4IIMA 4J9IA 2ABLA 4AG1C 1OEBA 4E6RA 5FW9A 4HVUA 1NG2A 2V1QA 4RTZA 4OMPA 2DVJA 5FWCA 1T3LA 1UE9A 1W70A 3VS3A 1CKAA 4J9BA 2JMAA 3VRYA 1YCSB 3JV3A 4IIOA 4R0KA 3LH5A 4HCKA 1PKTA 1SHGA 1I0CA 1NM7A 4RTUA 1WI7A 2FG0A 1NYFA 5I11A 4EIKA 3U23A 2EW3A 2DM1A 1X6BA 4OMLA 1U5SA 1ZUYA 3FJ5A 2RPNA 4D8KA 3ULRB 2GQIA 3EHRA 2BZXA 3UA7A 2KXDA 2DL7A 1OPLA 1QWFA 2F2WA 1ZLMA 2KT1A 5IXBA 4LNPA 2DX1A 2DL8A 1WXTA 4JZ3A 1UGVA 2O9VA 2K2MA 2YUQA 2RF0A 2W0ZA 2FEIA 4HXJA 2KBTA 3EHQA 1X69A 1G83A 1JXMA 1X27A 4JJCA 2CSIA 2DF6A 1UHCA 2AKKA 2L3QA 2RQUA 4J9DA 2SEMA 1WFWA 2GTOA 4CC2A 2KNBB 2CSQA 2DL5A 4ORZA 5HCKA 4JJBA 1GRIA 2XMFA 2EGEA 1GFCA 4LUDA 3UATA 2MCNA 2RQWA 1SRLA 1Z9ZA 1T0HA 1RLPC 2J7IA 2J6FA 2MIOA 4AG2C 1UECA 4J9FA 2EYWA 1I1JA 1ZSGA 2DRMA 1RLQC 2FRYA 3RNJA 2M0YA 1AWXA 3TVTA 4AFSC 1GFDA 1UHFA 1FYNA 4D8DA 3VS2A 2A37A 3EG2A 1N5ZA 1I07A 4WCIA 4JZ4A 4RTXA 2L0AA 1ABOA 3H41A 2M51A 2J06A 4RTYA 1KJWA 4RTTA 4JJDA 2YT6A 3REBB 1Y0MA 1PHTA 4OMQA 2BZYA 2P4RA 4DEYA 1VYUA 2L3SA 2X3WD 1K0XA 1AZGB 1CSKA 1AWOA 2A36A 2JM9A 4A63B 2G6FX 3IQLA 3EG1A 2K9GA 1JQQA 4OMNA 4AFQC 2MOXA 2E5KA 2L2PA 3UF4A 1K4US 2J6KA 3I5RA 2YUOA 3NMZC 2KR3A 1LCKA 1NEGA 2BTTA 4J9GA 1W6XA 1U3OA 3I9QA 1WDXA 2HCKA 5IHNA 3RBBB 1G2BA 2DBKA 3I5SA 3H0FA 3VS6A 2D8HA 2EBPA 4F17A 1AWWA 4F16A 3O5ZA 1TUCA 4RTWA 1U06A 2CH4W 2O31A 2DLPA 3VS4A 2EPDA 2KRMA 2GGRA 3M0QA 4CC4B 1H8KA 1BU1A 2DE0X 1W1FA 1E6HA 1QKXA 2AZSA 3VS5A 2C0IA 3VRZA 4HVWA 1BBZA 1QWEA 2DL3A 2ED1A 1UG1A 1GCPA 1QCFA 1GL5A 4ESRA 2CT3A 2EYXA 2OI3A 2VWFA 4GLMA 4J9HA 2RNAA 2YDLA 2EGAA 1K76A 1YWOA 2NWMA 3PVQA 4M4ZA 1GCQA 2PNIA 4FSSA 4X1VA 2O9SA 5FWBA 2I0NA 2ECZA 2OAWA 2HBWA 5I22A 2ROTA 1WX6A 2CUBA 2SRCA 1MUZA 4LE9A 2HEQA 2CT4A 1GBQA 1T0JA 1SSHA 4LN2A 1M27C 2EKHA 2F2XA 2RQVA 3A98A 2W10A 1SPKA 2LJ1A 1OOTA 2FPDA 4Z8AA 1YWPA 2LQWA 2O88A 2OJ2A 1PNJA 5EC7A 3NHNA 1WLPB 1QLYA 1NYGA 2EYYA 5GJVB 2KE9A 2K7AA 2KT8A 3I35A 1X43A 2PZ1A 3NPFA 1BB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLO C;  1ZUK A;  1BK2 A;  3H0H A;  5ECA A;  2LQN A;  3NGP A;  2VVK A;  4J9C A;  2JXB A;  3CQT A;  4DEX A;  1E7O A;  1JU5 C;  2CH4 A;  2DA9 A;  3EG3 A;  1M3B A;  1VYV A;  3M0R A;  1X2K A;  1ZX6 A;  3R6N A;  4K11 A;  5IHI A;  1ARK A;  1ABQ A;  1PRM C;  1B07 A;  2DJQ A;  3M0P A;  1B3Q A;  1HSQ A;  1KSW A;  1HD3 A;  1RUW A;  1AD5 A;  2KGT A;  1RI9 A;  2ENM A;  3SEM A;  3GBQ A;  2ROL A;  2JS0 A;  1UJ0 A;  3VS7 A;  3PVL A;  1UDL A;  3ZL7 C;  3H0I A;  1PRL C;  4CC3 A;  4F14 A;  1VA7 A;  3TSZ A;  1MV3 A;  1WIE A;  2DL4 A;  2J6O A;  4OMM A;  2LNH B;  1H3H A;  1IO6 A;  1OV3 A;  1K0S A;  2YSQ A;  2DRK A;  2O2O A;  2F2V A;  1JO8 A;  2ED0 A;  2RQT A;  4JPB W;  1WXB A;  2KRS A;  2LCS A;  1UFF A;  2K3B A;  4CC7 A;  4AFZ C;  1E6G A;  2HSP A;  2QDL A;  1HJD A;  1AZE A;  4AFU C;  1OPK A;  2JW4 A;  4Z88 A;  3QWY A;  2JT4 A;  2LJ3 A;  2ESW A;  2FPE A;  2J05 A;  2YUP A;  2CDT A;  1PWT A;  2KRO A;  2K6D A;  2PTK A;  2LJ0 A;  1CKB A;  1AEY A;  2AZV A;  2L3P A;  2RN8 A;  2HDA A;  2KXC A;  2FPF A;  1X6G A;  4Y92 A;  1XOV A;  1S1N A;  5GJW B;  1SRM A;  5IH2 A;  2CUD A;  2KYB A;  2NUZ A;  1QKW A;  2EYZ A;  4OMO A;  2EGC A;  1YP5 A;  3M0U A;  1UJY A;  1YN8 A;  2D1X A;  2GTJ A;  4Z89 A;  1YNZ A;  3TSW A;  3C0C A;  1FMK A;  1WYX A;  1ZBJ A;  4KRT A;  2IIM A;  3QWX X;  1TUD A;  2DYB A;  1MV0 B;  2JTE A;  2LZ6 B;  1M30 A;  2BZ8 A;  2FO0 A;  1M8M A;  2H8H A;  2B86 A;  5IXF A;  1Y57 A;  2C0T A;  2KYM A;  1NLP C;  2VKN A;  2JS2 A;  2RMO A;  3M0S A;  1WA7 A;  1V1C A;  2EVR A;  1EFN A;  2C0O A;  2D8J A;  2GBQ A;  1WXU A;  1UUE A;  2A08 A;  3PE0 A;  1GCQ C;  1M3A A;  2V1R A;  1KFZ A;  4ZNX A;  2DNU A;  2K79 A;  3VS1 A;  4QT7 A;  1UTI A;  2A28 A;  1X2Q A;  1M3C A;  2X3X D;  4GBQ A;  1VYT A;  4LUE A;  1K1Z A;  2JM8 A;  1GBR A;  1JXO A;  1AWJ A;  4HVV A;  2LX7 A;  1Z9Q A;  1AVZ C;  2FRW A;  1JEG A;  2KEA A;  1J3T A;  1H92 A;  3KFV A;  1KIK A;  2DBM A;  3SHW A;  2JMC A;  2AK5 A;  3REA B;  3THK A;  5L23 A;  1TG0 A;  1ZUU A;  1SEM A;  2LMJ A;  1A0N B;  2AKL A;  1NEB A;  2D0N A;  2DIL A;  3M0T A;  1AOJ A;  1PKS A;  2RQR A;  2DMO A;  2GNC A;  2YUN A;  4J9E A;  4RTV A;  2CRE A;  2EQI A;  2LP5 A;  3EG0 A;  2KRN A;  5IHK A;  4RUG A;  1K9A A;  3EGU A;  3UA6 A;  3VS0 A;  1T3S A;  1SHF A;  4IIM A;  4J9I A;  2ABL A;  4AG1 C;  1OEB A;  4E6R A;  5FW9 A;  4HVU A;  1NG2 A;  2V1Q A;  4RTZ A;  4OMP A;  2DVJ A;  5FWC A;  1T3L A;  1UE9 A;  1W70 A;  3VS3 A;  1CKA A;  4J9B A;  2JMA A;  3VRY A;  1YCS B;  3JV3 A;  4IIO A;  4R0K A;  3LH5 A;  4HCK A;  1PKT A;  1SHG A;  1I0C A;  1NM7 A;  4RTU A;  1WI7 A;  2FG0 A;  1NYF A;  5I11 A;  4EIK A;  3U23 A;  2EW3 A;  2DM1 A;  1X6B A;  4OML A;  1U5S A;  1ZUY A;  3FJ5 A;  2RPN A;  4D8K A;  3ULR B;  2GQI A;  3EHR A;  2BZX A;  3UA7 A;  2KXD A;  2DL7 A;  1OPL A;  1QWF A;  2F2W A;  1ZLM A;  2KT1 A;  5IXB A;  4LNP A;  2DX1 A;  2DL8 A;  1WXT A;  4JZ3 A;  1UGV A;  2O9V A;  2K2M A;  2YUQ A;  2RF0 A;  2W0Z A;  2FEI A;  4HXJ A;  2KBT A;  3EHQ A;  1X69 A;  1G83 A;  1JXM A;  1X27 A;  4JJC A;  2CSI A;  2DF6 A;  1UHC A;  2AKK A;  2L3Q A;  2RQU A;  4J9D A;  2SEM A;  1WFW A;  2GTO A;  4CC2 A;  2KNB B;  2CSQ A;  2DL5 A;  4ORZ A;  5HCK A;  4JJB A;  1GRI A;  2XMF A;  2EGE A;  1GFC A;  4LUD A;  3UAT A;  2MCN A;  2RQW A;  1SRL A;  1Z9Z A;  1T0H A;  1RLP C;  2J7I A;  2J6F A;  2MIO A;  4AG2 C;  1UEC A;  4J9F A;  2EYW A;  1I1J A;  1ZSG A;  2DRM A;  1RLQ C;  2FRY A;  3RNJ A;  2M0Y A;  1AWX A;  3TVT A;  4AFS C;  1GFD A;  1UHF A;  1FYN A;  4D8D A;  3VS2 A;  2A37 A;  3EG2 A;  1N5Z A;  1I07 A;  4WCI A;  4JZ4 A;  4RTX A;  2L0A A;  1ABO A;  3H41 A;  2M51 A;  2J06 A;  4RTY A;  1KJW A;  4RTT A;  4JJD A;  2YT6 A;  3REB B;  1Y0M A;  1PHT A;  4OMQ A;  2BZY A;  2P4R A;  4DEY A;  1VYU A;  2L3S A;  2X3W D;  1K0X A;  1AZG B;  1CSK A;  1AWO A;  2A36 A;  2JM9 A;  4A63 B;  2G6F X;  3IQL A;  3EG1 A;  2K9G A;  1JQQ A;  4OMN A;  4AFQ C;  2MOX A;  2E5K A;  2L2P A;  3UF4 A;  1K4U S;  2J6K A;  3I5R A;  2YUO A;  3NMZ C;  2KR3 A;  1LCK A;  1NEG A;  2BTT A;  4J9G A;  1W6X A;  1U3O A;  3I9Q A;  1WDX A;  2HCK A;  5IHN A;  3RBB B;  1G2B A;  2DBK A;  3I5S A;  3H0F A;  3VS6 A;  2D8H A;  2EBP A;  4F17 A;  1AWW A;  4F16 A;  3O5Z A;  1TUC A;  4RTW A;  1U06 A;  2CH4 W;  2O31 A;  2DLP A;  3VS4 A;  2EPD A;  2KRM A;  2GGR A;  3M0Q A;  4CC4 B;  1H8K A;  1BU1 A;  2DE0 X;  1W1F A;  1E6H A;  1QKX A;  2AZS A;  3VS5 A;  2C0I A;  3VRZ A;  4HVW A;  1BBZ A;  1QWE A;  2DL3 A;  2ED1 A;  1UG1 A;  1GCP A;  1QCF A;  1GL5 A;  4ESR A;  2CT3 A;  2EYX A;  2OI3 A;  2VWF A;  4GLM A;  4J9H A;  2RNA A;  2YDL A;  2EGA A;  1K76 A;  1YWO A;  2NWM A;  3PVQ A;  4M4Z A;  1GCQ A;  2PNI A;  4FSS A;  4X1V A;  2O9S A;  5FWB A;  2I0N A;  2ECZ A;  2OAW A;  2HBW A;  5I22 A;  2ROT A;  1WX6 A;  2CUB A;  2SRC A;  1MUZ A;  4LE9 A;  2HEQ A;  2CT4 A;  1GBQ A;  1T0J A;  1SSH A;  4LN2 A;  1M27 C;  2EKH A;  2F2X A;  2RQV A;  3A98 A;  2W10 A;  1SPK A;  2LJ1 A;  1OOT A;  2FPD A;  4Z8A A;  1YWP A;  2LQW A;  2O88 A;  2OJ2 A;  1PNJ A;  5EC7 A;  3NHN A;  1WLP B;  1QLY A;  1NYG A;  2EYY A;  5GJV B;  2KE9 A;  2K7A A;  2KT8 A;  3I35 A;  1X43 A;  2PZ1 A;  3NPF A;  1BB9 A; 
#chains in the Genus database with same CATH topology
 2DD4 A;  3C12 A;  1Q86 C;  4MZM A;  3CC2 A;  2CZ7 B;  4E7I A;  3CXC A;  2LVM A;  2M9U A;  3CQT A;  2CH4 A;  3KBG A;  3CCE Q;  3M0R A;  1ZHI A;  3CCM T;  2LNV A;  5CO7 A;  3CCL A;  1ZX6 A;  5IHI A;  1ARK A;  2VGN A;  1JBM A;  1ABQ A;  1D0Y A;  4KUL A;  1N8R R;  4C8Q C;  3SWN C;  3M0P A;  1B3Q A;  2RHI A;  1AD5 A;  3GBQ A;  1EX4 A;  2GF7 A;  2MWO A;  2P4T A;  3LGL A;  1MND A;  1Q7Y U;  1NJI C;  2JS0 A;  3M54 A;  4DBQ A;  5DM7 R;  2CGH A;  5LJ5 h;  3INZ A;  4RCB A;  5IAY A;  3LX7 A;  4MZT A;  1UDL A;  3ZL7 C;  1WNL A;  2DL4 A;  2LCL A;  3G7Z A;  3EH2 A;  1K0S A;  3RIR A;  3JRZ A;  1D1C A;  4IUT A;  3CC2 T;  2RM4 A;  2ED0 A;  4EMK B;  1ZSZ A;  2WSF E;  3VYH B;  4B9X A;  4FW2 A;  4AFU C;  2E64 A;  1VOM A;  1OPK A;  2JW4 A;  2QDY B;  3QWY A;  2LJ3 A;  4O5V A;  1YIJ Q;  3QZ5 B;  2FB7 A;  2CDT A;  3GNF B;  1BCM A;  1PWT A;  1M2V A;  4TVR A;  1M5Q 1;  2LJ0 A;  3CCV A;  2RA2 A;  4J5Y A;  2AHJ B;  4HCB A;  4UC4 A;  1PC0 A;  4N4I A;  1Q7Y C;  1NJI U;  2ZPG B;  4Y92 A;  5GJW B;  2KYB A;  2M0O A;  1QVG A;  5CK9 A;  2EYZ A;  1VQN A;  1YN8 A;  4F7U A;  1VQO Q;  4KH0 B;  1WYX A;  3EGX B;  3MJX A;  2JTE A;  3MCA B;  1QCO A;  4KGZ B;  4LDV A;  4DBH A;  2NUT B;  2H8H A;  1YJN A;  4ZGD B;  3L2Q A;  4F7U E;  1Y57 A;  2HKQ B;  3OQ5 A;  5KYW A;  2DXU A;  1NLP C;  2DAQ A;  4F04 B;  2BIV A;  2JS2 A;  1WA7 A;  5I21 A;  1EFN A;  1M1K C;  2CP6 A;  1VQ5 T;  2GBQ A;  2ZGW A;  4QVD A;  4OB0 B;  4ZGJ B;  1GCQ C;  3QYG B;  5GAN g;  3PMT A;  2DNU A;  1D1B A;  4ZN3 A;  2HD0 A;  1KK7 A;  4M75 A;  1X2Q A;  4R56 A;  2DPP B;  4LUE A;  3RDV A;  4D6W A;  3JB9 I;  1OU9 A;  2JM8 A;  1YI2 A;  5KYU B;  1VIE A;  2P0P A;  1SSF A;  1G3Y A;  3C4S A;  4HVV A;  3TRE A;  2LX7 A;  1AVZ C;  3CEY A;  1Q95 G;  1WHJ A;  4E2F B;  4KH1 B;  1JB0 E;  3OYE A;  2BE7 D;  1H92 A;  5A2Q E;  4FU6 A;  3OS1 A;  1S72 T;  3CCE A;  4E7S A;  2V8I A;  3REA B;  3THK A;  3J80 E;  1SEM A;  1QVF S;  5HK3 A;  4M7D D;  2LMJ A;  2AKL A;  1NEB A;  1AHJ B;  3S6W A;  1QP2 A;  2RQR A;  2VUB A;  4LDU A;  2KVQ G;  2D6F A;  3PFS A;  1NE8 A;  3CD6 A;  2CRE A;  4C8Q E;  5GAM h;  2NLU A;  1K8A C;  2E3H A;  2K5I A;  3QJY A;  4KGV B;  1YJW T;  3EGU A;  2NUP A;  1FWZ A;  1G3W A;  1S72 Q;  4AG1 C;  1OEB A;  5FU6 C;  1BKB A;  1UGR B;  4E6R A;  5FW9 A;  4C8Q A;  2Y4X A;  1SKU B;  3TCJ A;  5KYY A;  1W70 A;  4JJN K;  4J9B A;  3JAM E;  1IHV A;  3VRY A;  1KD1 U;  3QYH B;  4JRK A;  1SHG A;  1TSF A;  1NM7 A;  1WI7 A;  3CC4 T;  4N0A C;  1KQS S;  3FIF A;  1YJW Q;  3G4S A;  3RKW A;  4PJN A;  1ZUY A;  3FJ5 A;  2DYI A;  2GQI A;  3EHR A;  2BZX A;  3CCR A;  4N4G A;  4L59 A;  1OQK A;  4IUQ A;  2KXD A;  5LJ5 g;  3MEA A;  3M58 A;  2AT1 B;  2DX1 A;  2CZ1 B;  1WXT A;  4M7D F;  1YIT T;  4RKU E;  2YHT A;  2X35 A;  3CC4 Q;  1X69 A;  1Y71 A;  1X27 A;  3WVE B;  2DF6 A;  2AKK A;  4J9D A;  2LRQ A;  5I2S A;  2KDS A;  3FB9 A;  2KNB B;  4F7U F;  2CSQ A;  1IRX A;  3QKJ A;  4ORZ A;  5HCK A;  4JJB A;  1QVP A;  1W2B A;  1N9S A;  3GPL A;  3L2U A;  1VQ9 A;  2RO0 A;  4GY5 A;  4M78 D;  2YRC A;  3VUZ A;  3JCM e;  5GAN 3;  4AT1 B;  1ZSG A;  3OYM A;  3RNJ A;  2CP3 A;  4AFS C;  4NL3 A;  2JVV A;  1UHF A;  1FYN A;  2G3R A;  3VS2 A;  2A37 A;  4BY6 C;  4FIB A;  1YHQ A;  1YIT A;  2L0A A;  4BE0 A;  2M1H A;  2J06 A;  4RTY A;  4RTT A;  3S3N A;  1PHT A;  4LDX A;  1SG5 A;  2P4R A;  2L3S A;  4DOV A;  2MI6 A;  3HFN A;  1AZG B;  1RAG B;  4M78 A;  1BIB A;  1VQ5 A;  2ZPB B;  5LJ3 g;  1OUL A;  2XDP A;  4L6V 5;  2DER A;  2IVW A;  4AFQ C;  4QVZ A;  2QEX Q;  2GCX A;  2YUO A;  3NMZ C;  4EMG A;  3JB9 J;  2X4X A;  2D0Q B;  5GAN h;  2LCC A;  4BDY A;  3SD4 A;  2IPO B;  3O5Z A;  3CCQ T;  2X9H A;  3GF5 A;  2DXT A;  2O31 A;  4HT9 A;  2QQS A;  2KRM A;  2GGR A;  4E7Z A;  3RKY A;  3KXT A;  2AZS A;  1TH7 A;  2RJD A;  4ATO A;  3P8B B;  1OYX A;  1GCP A;  3O8V A;  4RMO A;  4M75 B;  2CT3 A;  3A1P A;  1D3B A;  4J7I A;  2EYX A;  2QYZ A;  1QP3 A;  3G4S Q;  1X01 A;  1EIF A;  5LJ5 e;  1ZSZ C;  4LDW A;  2RNA A;  3DB3 A;  4PJL A;  1WHM A;  2DEU A;  1QVF P;  2COZ A;  1KHC A;  5GAM e;  4M4Z A;  2HAX A;  2EQM A;  3LH0 A;  2PNI A;  4X1V A;  5FU6 B;  3JCM d;  1IB8 A;  2CZ6 B;  2ECZ A;  1I4K 1;  2BUD A;  1WZO A;  2HBW A;  4LDY A;  1K9M C;  1TUG B;  3EFO B;  1WX6 A;  1K73 R;  2HL5 C;  2SRC A;  3T9N A;  5M9O A;  3MO8 A;  2P0Q A;  1BI3 A;  2CT4 A;  8AT1 B;  1I5O B;  2VV5 A;  2F2X A;  1SPK A;  4M77 C;  2FPD A;  2CP5 A;  5GAO n;  4HA8 A;  3OYK A;  3CPW A;  1WLP B;  4HCC A;  1Q81 C;  3GLX A;  2EYY A;  4J7F A;  2K7A A;  2K4Y A;  1X43 A;  2PZ1 A;  3BDU A;  1G8X A;  1BCO A;  5KYY B;  1NLO C;  1YIJ T;  2EQJ A;  3H0H A;  4QQ6 A;  2EAY A;  3NGP A;  3H6Z A;  2OTJ T;  3I56 Q;  2JJ9 A;  3A5Z B;  4DEX A;  1BI1 A;  1JU5 C;  3EG3 A;  1M3B A;  1YHQ Q;  2RI3 A;  3R6N A;  1G3T A;  2FYK A;  3BDL A;  2DJQ A;  1Y96 A;  4M78 B;  1HD3 A;  4F7U G;  4MDX A;  1MMA A;  2KGT A;  1RI9 A;  2ENM A;  3SEM A;  1KD1 C;  4AMC A;  1PCX A;  1VQP Q;  3PNW C;  4M7D C;  1R0C B;  4M7D G;  2ZPH B;  3QXE B;  5I2M A;  1MNE A;  2XK0 A;  2IG0 A;  1VQK A;  3A8G B;  3HRT A;  4XTW A;  3JCM h;  4XU2 A;  1VA7 A;  3I55 Q;  1MV3 A;  1QMC A;  4Z02 A;  2J6O A;  3MEV A;  4OMM A;  1QVG P;  1H3H A;  1JO8 A;  1LVK A;  3LGF A;  2K3B A;  4CC7 A;  1E6G A;  3CCM A;  1JJ2 S;  2QDL A;  2L3R A;  4JUV A;  1N8R C;  2O4X A;  4C92 G;  2JT4 A;  1QW1 A;  3MHX A;  5L8R E;  4XU0 A;  2J05 A;  1BI0 A;  1N9R A;  1KG1 A;  3X20 B;  4JRP A;  5LJ3 h;  1VQ7 Q;  4FSX A;  1NJI R;  2AIR B;  3CMA T;  2AZV A;  2WAC A;  4NS5 A;  2H3E B;  3MP8 A;  1JJ2 P;  1XOV A;  4C92 B;  4PFZ A;  5FU7 B;  3OW2 S;  1SRM A;  5FRM A;  2CP0 A;  4M78 C;  2HZY A;  3OY9 A;  3QPH A;  2HKN A;  2EGC A;  3QBY A;  3M0U A;  2D1X A;  4A4H A;  4Z89 A;  4QQD A;  5GAN e;  1ZBJ A;  4KRT A;  4M78 E;  1KQS A;  3CCS Q;  4C92 F;  4A4E A;  2FO0 A;  2B86 A;  3MEW A;  3AHU A;  3QZ9 B;  2C0T A;  2KYM A;  2C06 A;  7AT1 B;  2HSE B;  3M0S A;  5A0G A;  2EVR A;  2JTF A;  2C0O A;  5FRO A;  2FL7 A;  3L2Z A;  1UUE A;  2RJF A;  3SWN B;  2A08 A;  5C0M A;  2ZCF B;  3PE0 A;  5CKD A;  5DY9 A;  2K5F A;  5GAM j;  5J3B A;  1WHH A;  2BE9 B;  4GBQ A;  1VYT A;  1P92 A;  4ELZ C;  1JXO A;  1M2O A;  1JEG A;  2KEA A;  2NYS A;  1KIK A;  2JMC A;  1X75 C;  2AK5 A;  1VQ6 A;  3CPW S;  1YJN T;  4Q5W A;  3NTK A;  1TG0 A;  2E70 A;  4PL6 A;  4BD3 A;  2RI5 A;  2DIL A;  2YRV A;  4EMH A;  1PKS A;  2YUN A;  4RTV A;  1VQM T;  1KC8 C;  1TOV A;  2LP5 A;  1VQP A;  5IHK A;  2V8J A;  4OGE A;  1WJQ A;  5FU7 C;  1T3S A;  1SHF A;  4IIM A;  1D09 B;  1D0X A;  1IRE B;  5EG2 A;  1VQM A;  5CVI A;  1Q82 R;  2ZPE B;  4CI0 C;  1K8A U;  2PUK B;  1T3L A;  1UE9 A;  4MML A;  2WSE E;  5KCO A;  2H3J A;  4R0K A;  3JV3 A;  5GAO r;  1PKT A;  4HKE A;  3CCE T;  2OTL A;  4EIK A;  1MMD A;  4OB2 B;  1YJ9 A;  2EW3 A;  1M2V B;  5LJ5 d;  2DM1 A;  2FVU A;  2QK0 A;  4XK8 E;  3X26 B;  4D8K A;  1KQ2 A;  1M8V A;  1Y07 A;  2RI2 A;  2KK4 A;  5GAO q;  2E41 A;  3DLM A;  3HHT B;  2OTL T;  1OPL A;  3CCL Q;  2F2W A;  3FEO A;  1TS9 A;  2KT1 A;  5IXB A;  3JCM g;  2M16 A;  1UGV A;  2X51 A;  2K2M A;  1OU8 A;  2RF0 A;  4HXJ A;  1JJ2 A;  2MK5 A;  4JJC A;  2MAM A;  2E5Q A;  3M59 A;  3EFS A;  4CC2 A;  1VQ9 Q;  2DL5 A;  4J6Y A;  5D6X A;  1VQL A;  3EFR A;  2QA4 Q;  1M90 R;  1GRI A;  2LQ8 A;  2XIC A;  2XMF A;  4PKC C;  3V7S A;  1YI2 Q;  1M90 U;  1ZSZ B;  5GAM d;  3N5B B;  1Z9Z A;  1XTD A;  3QSU A;  1RLP C;  4GLK A;  2J7I A;  2OX7 A;  5LL6 S;  2EYW A;  1I1J A;  3M55 A;  4FYX B;  2DRM A;  5KH6 A;  5CR2 A;  4JS4 A;  3TVT A;  1KQ1 A;  4M77 F;  4J8O A;  5LJ3 e;  3EG2 A;  4BE1 A;  1ZBX A;  2KI7 A;  4E7H A;  4JZ4 A;  1BYM A;  5GAN j;  1ABO A;  3M56 A;  1MMN A;  4B6M A;  5FLX E;  4M7A G;  4QVC A;  2OAU A;  3G4S T;  2Y4Y A;  3CCV Q;  3CXC S;  1Y0M A;  2RJC A;  3ZBD A;  4OMQ A;  4BI4 A;  4DEY A;  1VYU A;  1BIA A;  4DBF A;  4M77 G;  1CSK A;  1R77 A;  4A63 B;  2G6F X;  3EG1 A;  3JCM W;  1RAA B;  4OMF B;  4OMN A;  1VQ8 A;  4BI8 B;  2MOX A;  1VQO A;  2E5K A;  1K4U S;  2VGM A;  2J6K A;  4X9C A;  3HTR A;  3FLG A;  1OX9 A;  1HK9 A;  2A3L A;  1ZA2 B;  5LJ3 d;  3I9Q A;  4RCC A;  1WDX A;  4EMK C;  5IHN A;  3CCV T;  4A4G A;  1G2B A;  2WSC E;  2COW A;  2DBK A;  1LOJ A;  2QQ9 A;  3VS6 A;  1KC8 R;  3FDR A;  4F17 A;  1G5V A;  3DKM A;  3MP1 A;  1XNI A;  4M7D E;  3CBP A;  2CKK A;  4Y28 E;  4M7D A;  3VS4 A;  1VQ4 T;  3S3M A;  1H8K A;  1BU1 A;  3HSB A;  2DE0 X;  1W1F A;  2RB6 A;  1MGQ A;  4PJO F;  3VS5 A;  1WHG A;  1XQH A;  3FRN A;  3E1S A;  4HVW A;  2OTJ Q;  5CKE A;  3H9N A;  3FC3 A;  1VQ4 A;  2LX9 A;  4JRI A;  1GL5 A;  4ESR A;  2R57 A;  2I2L A;  1VQO T;  1F1B B;  3RER A;  2R5M A;  2YDL A;  1K76 A;  1IZ6 A;  1UEB A;  4XTV A;  5GAO p;  2ZPF B;  2I0N A;  1IXD A;  5LJ5 f;  5I22 A;  1FXX A;  1PSF A;  1Y7X A;  2CUB A;  1Q7Y R;  4LE9 A;  1YJ9 T;  2X4J A;  3GIB A;  2B8A A;  5A0D A;  1UGQ B;  1U1T A;  4M7A D;  2EKH A;  3PIP A;  3A98 A;  3CCJ Q;  2LJ1 A;  1OOT A;  1WHK A;  1YWP A;  3OS5 A;  4XTU A;  1RL2 A;  1PNJ A;  2VXE A;  3NHN A;  4M7A A;  2DKG A;  1QLY A;  2A7Y A;  4FYV B;  2KE9 A;  5DLQ E;  3RMQ A;  1YCY A;  2VYT A;  2KRN A;  1BB9 A;  2RK2 A;  1ZUK A;  1PD0 A;  1BK2 A;  5ECA A;  5CQY A;  4WF2 A;  2VVK A;  4J9C A;  2JXB A;  4C0G A;  1D1A A;  1E7O A;  2EQU A;  2DA9 A;  4C0Z A;  1M9S A;  5KYU A;  1VYV A;  2DZ9 A;  5HK0 A;  3RKX A;  3CCR Q;  5AYF A;  3BE3 A;  2DZC A;  1PRM C;  4KUI A;  5KCH A;  2QGF B;  3CME Q;  1N27 A;  1KSW A;  2YWW A;  1SF9 A;  5FRN A;  3G71 Q;  3JCM J;  4RG8 A;  2EIF A;  1PG5 B;  2GFU A;  3CC7 T;  4ZTF A;  3PVL A;  5HY6 A;  3H0I A;  5GMK j;  1PRL C;  4CC3 A;  2XID A;  1WJR A;  3TSZ A;  1WIE A;  2D9T A;  3HKS A;  2KQW A;  1ZQ1 A;  5KE3 A;  2LNH B;  2E12 A;  1IO6 A;  2DRK A;  2O2O A;  1IGQ A;  3OSV A;  1Q86 R;  1DJ7 B;  4VUB A;  1WXB A;  3V8K A;  2KRS A;  3JCM V;  5GAN 4;  1UFF A;  4N0A A;  4AFZ C;  2YXY A;  3S3O A;  1C6V X;  1K8A R;  1AZE A;  2Y90 A;  1W2B P;  3NTH A;  2FPE A;  2YUP A;  2KY9 A;  4IKF A;  4BE2 A;  4XTY A;  4C5I A;  1CKB A;  1NBE B;  1AEY A;  2L3P A;  3SDZ A;  1EZZ B;  2VB6 A;  3RR6 A;  1RAE B;  2KXC A;  2O01 E;  2FPF A;  4JRQ A;  1MHN A;  2EJ9 A;  1LPL A;  1ZA1 B;  5HKC A;  2QQB A;  5IH2 A;  2CUD A;  3OBY A;  4OB3 B;  4OVA A;  3CBO A;  1YP5 A;  1Q81 U;  2LT1 A;  5D6Y A;  2GTJ A;  1YNZ A;  2VC8 A;  3C0C A;  2CS7 A;  1Q81 R;  3X25 B;  3RES A;  2DYB A;  1MV0 B;  1M30 A;  2BZ8 A;  1M8M A;  2F5K A;  1QVF A;  5IXF A;  3CCQ Q;  4QQG A;  3G6E Q;  1N8R U;  3PMI A;  2HL3 A;  2RMO A;  3E19 A;  1V1C A;  1RAI B;  2DIG A;  1RI0 A;  1WXU A;  2K57 A;  3CCJ A;  4M78 G;  4BUG A;  2DTO A;  2K79 A;  3VS1 A;  2RHZ A;  3OYD A;  4LD6 A;  2A28 A;  2DK3 A;  1M3C A;  3V7C A;  1K1Z A;  3JCM c;  4EDU A;  1GBR A;  3OW2 A;  1QQJ A;  2DJZ A;  3G1J A;  1Z9Q A;  3BY7 A;  4E47 A;  3JCM X;  2DBM A;  5GMK l;  3L2R A;  3CCL T;  1HYO A;  5IN1 A;  5L23 A;  3H8Z A;  3LW5 E;  5GAN 7;  3ASK A;  3VJP A;  1A0N B;  3M53 A;  2D0N A;  1AOJ A;  2DMO A;  2JUF A;  3UWN A;  4J9E A;  3CCM Q;  2QQA A;  4MMK A;  4N4H A;  5D6W A;  2CP2 A;  4M78 F;  3EG0 A;  3EH1 A;  3A8O B;  2XKO C;  3Q1J A;  1M1G A;  4PJO D;  2HQE A;  1Q86 U;  1K9A A;  1N6A A;  3VS0 A;  3UDC A;  3V7R A;  2HQX A;  2QTV A;  4KT0 E;  2ABL A;  3EGD B;  3R6O A;  3CMA A;  3MPU B;  3PT9 A;  1B34 B;  4M7A C;  4HVU A;  3L2V A;  2GFA A;  5AT1 B;  1NG2 A;  2V1Q A;  4RTZ A;  4PJO B;  4OMP A;  3VYG A;  2DVJ A;  4C92 D;  5FWC A;  1I8F A;  3JSC A;  3VS3 A;  1CKA A;  4C8Q G;  5GAN 5;  3LLR A;  4NL2 A;  3UPU A;  3I56 T;  4HCK A;  4O6J A;  1I0C A;  4RTU A;  4M7A B;  3CC2 Q;  5I11 A;  2V8K A;  3V8L A;  4C92 A;  3U23 A;  2HNI A;  1X6B A;  4OML A;  1U5S A;  3CCS A;  3SB2 A;  5LJ3 f;  2EWN A;  2E65 A;  1G3S A;  2YLB A;  3L42 A;  4M7A F;  1ZLM A;  5KYX A;  4FM4 B;  4LNP A;  4M75 E;  2DL8 A;  2XU8 A;  3OYY A;  2O9V A;  1GXI E;  2P84 A;  1IHW A;  4XAX B;  4F7U B;  2K3X A;  2FEI A;  2KBT A;  1U8R A;  1JXM A;  5GMK e;  1VQN T;  2CSI A;  2L3Q A;  1UHC A;  4DOW A;  2P0K A;  4V2S A;  1Q82 C;  1WFW A;  4PFP A;  1B7T A;  3EAE A;  4ZGE B;  1LNX A;  3OSS C;  1GFC A;  4LUD A;  3UAT A;  2E3I A;  2MCN A;  2RQW A;  1SRL A;  2F69 A;  2BKD N;  1HXD A;  2MIO A;  5CKF A;  4AG2 C;  2CP7 A;  5LJ3 j;  2DEQ A;  1RLQ C;  2FRY A;  3P8D A;  1NPP A;  2M0Y A;  2PU9 B;  1VQN Q;  4PLI A;  1OZ3 A;  3EG9 B;  1GFD A;  2DET A;  1YIJ A;  4D8D A;  1K73 C;  4J6X A;  1N5Z A;  5IT9 E;  4WCI A;  1VQK Q;  5GMK m;  4RTX A;  2FZK B;  2KAF A;  4ZTJ A;  2XDD A;  2V26 A;  2M51 A;  1QVG S;  3PIO A;  3HRU A;  2XD0 A;  3FJP A;  4DQ2 A;  1KJW A;  1VQP T;  3QDF A;  3MKD A;  2RK1 A;  2PUO B;  3A8M B;  3REB B;  1H3Z A;  2QTX A;  2LTO A;  3MP6 A;  2KMT A;  1RAH B;  1U1S A;  3HRS A;  3PGG A;  4C5H A;  1K0X A;  3EGX A;  1AWO A;  4B9W A;  2A36 A;  3IQL A;  1TWB A;  3HFO A;  2L2P A;  4QKU A;  3CD6 T;  3CXC P;  4JDS A;  1WJS A;  3LWI A;  1LCK A;  1YJ9 Q;  2RJE A;  4HT8 A;  3MET A;  3VU3 C;  3QDR B;  3RBB B;  2HCK A;  3QHS A;  3I5S A;  2EKO A;  1B34 A;  2D8H A;  2Z0W A;  1K9M U;  1AWW A;  1JRI A;  1KD1 R;  1TUC A;  2CH4 W;  2JN0 A;  2XI9 A;  4OGC A;  3BW1 A;  3CMA Q;  1VQ7 T;  4WTO B;  4CC4 B;  1KHI A;  4E7J A;  1E6H A;  1QKX A;  2E6Z A;  3CD6 Q;  2C0I A;  2A0F B;  2E1H A;  3VRZ A;  1FMW A;  2JZ2 A;  1BBZ A;  2F1L A;  4IUV A;  1QWE A;  2JOY A;  2DL3 A;  2ED1 A;  4JLI A;  4FYW B;  2QAZ A;  3OA6 A;  3JB9 H;  1FX7 A;  1QCF A;  4A53 A;  3TQ7 P;  3ZEH A;  3JB9 D;  1OX8 A;  1QCN A;  3CCR T;  1RAC B;  2VWF A;  1WHL A;  4GLM A;  4J9H A;  3RMS A;  4ANJ A;  4FYY B;  2EGA A;  4QW2 A;  5J26 A;  1YBY A;  1YWO A;  2DXC A;  1VQ6 Q;  2E6N A;  2CYZ B;  4IUU A;  4ZN1 A;  1V76 A;  2LC4 A;  1NPR A;  1BI2 A;  1X6O A;  2ROT A;  3CC7 Q;  3JCM P;  3JCM b;  2COY A;  1UGP B;  1MUZ A;  2HEQ A;  2M02 A;  5GAO l;  5GAN f;  1GBQ A;  3QG1 A;  4LN2 A;  2RQV A;  5CIU A;  4RG2 A;  3ZFJ A;  4Z8A A;  3E2U A;  1VQ6 T;  2LQW A;  5GMK i;  3F70 A;  1WQ7 A;  1NYG A;  4FT2 A;  5GJV B;  3OYB A;  4C8Q B;  1PSE A;  2KT8 A;  5KYW B;  1OZ2 A;  4E7L A;  4C92 C;  4PJO A;  5C6S A;  1YJN Q;  2OTL Q;  2LQN A;  2RHY A;  3AT1 B;  1H64 1;  4PJM A;  3LWH A;  4C0F A;  1VUB A;  4PK4 A;  6AT1 B;  2R58 A;  2YRD A;  1X2K A;  3OYA A;  4K11 A;  1D0Z A;  3A8H B;  1B07 A;  2DD5 A;  5LJ5 j;  1HSQ A;  1RUW A;  3E9F A;  3M5A A;  4BB7 A;  2PVD B;  4R55 A;  2QGG A;  2QA4 T;  4C8Q D;  2QG9 B;  2ROL A;  3CBM A;  3OS0 A;  1UJ0 A;  1YI2 T;  3VS7 A;  3M4G A;  1YIT Q;  2L8D A;  4C92 E;  4F14 A;  1VQL Q;  3MEU A;  3G6E T;  1W2B S;  4M75 G;  1OV3 A;  2YSQ A;  3JB9 F;  4BY6 B;  2F2V A;  2RQT A;  4JPB W;  4M7D B;  2LCS A;  3E9G A;  2HSP A;  2NUP B;  3JCM f;  1HJD A;  4XTZ A;  2HMA A;  4Z88 A;  2EJF A;  3CPF A;  3EGD A;  2ESW A;  4E7K A;  3OB9 A;  3OBW A;  2K5L A;  2QEX A;  1VQL T;  4A54 A;  1M1K R;  2L89 A;  2QA4 A;  2KRO A;  2MWP A;  2K6D A;  3OMG A;  1S72 A;  2PTK A;  3OYC A;  1TXQ A;  5GAN d;  3KUF A;  3WVD B;  2RN8 A;  2HBP A;  2HDA A;  3DB4 A;  4M75 D;  3M57 A;  1X6G A;  1S1N A;  1C1A A;  5CKH A;  2NUZ A;  3J81 E;  1QKW A;  4OMO A;  1I81 A;  1UJY A;  3OYI A;  1K73 U;  3VKI A;  2LT4 A;  2R5A A;  3TSW A;  1YJW A;  1FMK A;  1R8O B;  3TU4 K;  2IIM A;  2QI2 A;  3A8L B;  2DIQ A;  3QWX X;  5GAN 8;  3OW2 P;  1TUD A;  2LZ6 B;  4KGX B;  1V29 B;  4BI3 A;  4PJO G;  3CC7 A;  3OYL A;  2FHD A;  2VKN A;  4ELY C;  2QEX T;  1AT1 B;  2X4W A;  3GP8 A;  3RUX A;  2QAS A;  2K3Y A;  4LD9 K;  2D8J A;  3JB9 G;  4BAC A;  3CC4 A;  4M77 A;  1M3A A;  2V1R A;  2PVG B;  2MF2 A;  1Q82 U;  4ZNX A;  1KFZ A;  2ZZD A;  4QT7 A;  1UTI A;  1VQ8 Q;  2X3X D;  5CKB A;  4EPC A;  3LYI A;  4J83 A;  1AWJ A;  4FT4 A;  5CCA A;  2FRW A;  1J3T A;  3KFV A;  5KE2 A;  3SHW A;  4FCY A;  4HCZ A;  3D7S B;  1ZUU A;  3J7A F;  4C5E A;  1C0M A;  3M0T A;  2VXF A;  2GNC A;  1VQ8 T;  4MDW A;  4PJO C;  1YHQ T;  2XG8 D;  2VAS A;  3CPW P;  1MMG A;  4EMK A;  2EQI A;  2EJG A;  2F5T X;  3HL8 A;  4M75 F;  3M9Q A;  2MPX C;  2OTJ A;  1VQ4 Q;  4RUG A;  3UA6 A;  1RAF B;  4J9I A;  5DLO A;  1YFN A;  2O4X B;  4LXC A;  5CAI A;  1O75 A;  1TTH B;  1VQ5 Q;  4XQ3 A;  1ACM B;  2JMA A;  1M90 C;  4CRI A;  1M1K U;  1YCS B;  4IIO A;  3LH5 A;  3GNG A;  2EYQ A;  1NYF A;  2FG0 A;  1M4Z A;  1VQK T;  4OF1 A;  3EG9 A;  4M77 E;  4C5G A;  2PQW A;  2RPN A;  3ULR B;  1O9S A;  4XU1 A;  1M1F A;  1WGS A;  3C95 A;  3UA7 A;  1UGS B;  1D3B B;  1RAD B;  2DL7 A;  3CCQ A;  2PVO B;  4MZP A;  3G6E A;  1QWF A;  5GMK h;  3G71 T;  5A0L A;  3VV0 A;  3CCU A;  5GAO m;  2GQV A;  4J6W A;  4JZ3 A;  2YUQ A;  3PTA A;  2LQK A;  2W0Z A;  3CME A;  2DTI A;  3EHQ A;  3CCJ T;  1G83 A;  2RQU A;  3L1A A;  4IUP A;  2SEM A;  2GTO A;  3I55 A;  3TEE A;  2K2V A;  3EFO A;  4PLL A;  2EGE A;  4YTL A;  9ATC B;  3BFM A;  1T0H A;  2J6F A;  3I55 T;  4IUR A;  4C0D B;  1UEC A;  4J9F A;  3CCS T;  4M7A E;  3SWN A;  2JTM A;  4PJJ A;  1AWX A;  3G71 A;  3X28 B;  4OB1 B;  1RAB B;  1I07 A;  5GAM f;  4P5N A;  3OMC A;  4JLG A;  3CME T;  4PNO A;  5GAN 2;  3H41 A;  2RH2 A;  4X9D A;  3OS2 A;  5CQX A;  3OYH A;  2E10 A;  2QQR A;  2YT6 A;  4JJD A;  2XDB A;  1KQS P;  4NOY A;  1R0B G;  2BZY A;  1NZ9 A;  3OYJ A;  3GOX A;  1Y96 B;  5GAN 6;  2DXB A;  2X3W D;  8ATC B;  4OP0 A;  4KBM B;  2JM9 A;  3QJ6 A;  4KUD K;  1OI1 A;  2K9G A;  2ZAE A;  5D7U A;  1JQQ A;  4C8Q F;  3I56 A;  2MMP A;  2DVE A;  3UF4 A;  3I5R A;  4L5G A;  3NFC A;  1I5L A;  2KR3 A;  3ER0 A;  1NEG A;  2BTT A;  4J9G A;  4XU3 A;  3QO3 A;  1W6X A;  3OYF A;  1U3O A;  3WXM B;  2RHX A;  3HP9 A;  3HPW A;  4Y91 A;  3H0F A;  1PD1 A;  2EBP A;  2DO3 A;  4F16 A;  1WQW A;  4A4K A;  4C0D C;  4RTW A;  1U06 A;  1K9M R;  2KSS A;  2DLP A;  3UT1 A;  5KYN A;  2EPD A;  2EFI A;  3JCM Q;  2E4H A;  4X34 A;  3M0Q A;  2JNG A;  4M77 D;  3P8H A;  3VUB A;  1FMV A;  4PJO E;  4JS5 A;  2YLC A;  2FZG B;  3OYN A;  2XHC A;  1UG1 A;  3QII A;  4DA4 A;  4II1 A;  3NTI A;  2X4Y A;  1PM3 A;  2OI3 A;  3M4Y A;  2CZ0 B;  4A4F A;  5KYX B;  1UB4 A;  2RHU A;  1LJO A;  2EQK A;  2NWM A;  4BDZ A;  3PVQ A;  2QXF A;  3URG A;  1GCQ A;  4FSS A;  2O9S A;  5FWB A;  3CCU Q;  4DBR A;  2RD1 A;  4ME7 A;  1WPY A;  2OAW A;  2LDM A;  4M75 C;  1TU0 B;  1KC8 U;  3C94 A;  4PFO A;  3SFM A;  4XTX A;  1VQ7 A;  2L5Q A;  1IGU A;  2FZC B;  3X24 B;  1T0J A;  1SSH A;  1W4S A;  1M27 C;  1VQM Q;  3L2W A;  2ATC B;  2W10 A;  5J39 A;  4FL6 A;  1XJW B;  2O88 A;  3ME9 A;  4FW1 A;  1VQ9 T;  2MYS A;  2OJ2 A;  3V8J A;  5GAM g;  3DLL A;  5EC7 A;  2NUT A;  2HQH A;  3CCU T;  2ZPI B;  1VIF A;  2DTH A;  2DFU A;  4M77 B;  3I35 A;  3QUI A;  3OYG A;  3NPF A; 
#chains in the Genus database with same CATH homology
 1NLO C;  1ZUK A;  1BK2 A;  3H0H A;  5ECA A;  2LQN A;  3NGP A;  2VVK A;  4J9C A;  2JXB A;  3CQT A;  4DEX A;  1E7O A;  1JU5 C;  2CH4 A;  2DA9 A;  3EG3 A;  1M3B A;  1VYV A;  3M0R A;  1X2K A;  1ZX6 A;  3R6N A;  4K11 A;  5IHI A;  1ARK A;  1ABQ A;  1PRM C;  1B07 A;  2DJQ A;  3M0P A;  1B3Q A;  1HSQ A;  1KSW A;  1HD3 A;  1RUW A;  1AD5 A;  2KGT A;  1RI9 A;  2ENM A;  3SEM A;  3GBQ A;  2ROL A;  2JS0 A;  1UJ0 A;  3VS7 A;  3PVL A;  1UDL A;  3ZL7 C;  3H0I A;  1PRL C;  4CC3 A;  4F14 A;  1VA7 A;  3TSZ A;  1MV3 A;  1WIE A;  2DL4 A;  2J6O A;  4OMM A;  2LNH B;  1H3H A;  1IO6 A;  1OV3 A;  1K0S A;  2YSQ A;  2DRK A;  2O2O A;  2F2V A;  1JO8 A;  2ED0 A;  2RQT A;  4JPB W;  1WXB A;  2KRS A;  2LCS A;  1UFF A;  2K3B A;  4CC7 A;  4AFZ C;  1E6G A;  2HSP A;  2QDL A;  1HJD A;  1AZE A;  4AFU C;  1OPK A;  2JW4 A;  4Z88 A;  3QWY A;  2JT4 A;  2LJ3 A;  2ESW A;  2FPE A;  2J05 A;  2YUP A;  2CDT A;  1PWT A;  2KRO A;  2K6D A;  2PTK A;  2LJ0 A;  1CKB A;  1AEY A;  2AZV A;  2L3P A;  2RN8 A;  2HDA A;  2KXC A;  2FPF A;  1X6G A;  4Y92 A;  1XOV A;  1S1N A;  5GJW B;  1SRM A;  5IH2 A;  2CUD A;  2KYB A;  2NUZ A;  1QKW A;  2EYZ A;  4OMO A;  2EGC A;  1YP5 A;  3M0U A;  1UJY A;  1YN8 A;  2D1X A;  2GTJ A;  4Z89 A;  1YNZ A;  3TSW A;  3C0C A;  1FMK A;  1WYX A;  1ZBJ A;  4KRT A;  2IIM A;  3QWX X;  1TUD A;  2DYB A;  1MV0 B;  2JTE A;  2LZ6 B;  1M30 A;  2BZ8 A;  2FO0 A;  1M8M A;  2H8H A;  2B86 A;  5IXF A;  1Y57 A;  2C0T A;  2KYM A;  1NLP C;  2VKN A;  2JS2 A;  2RMO A;  3M0S A;  1WA7 A;  1V1C A;  2EVR A;  1EFN A;  2C0O A;  2D8J A;  2GBQ A;  1WXU A;  1UUE A;  2A08 A;  3PE0 A;  1GCQ C;  1M3A A;  2V1R A;  1KFZ A;  4ZNX A;  2DNU A;  2K79 A;  3VS1 A;  4QT7 A;  1UTI A;  2A28 A;  1X2Q A;  1M3C A;  2X3X D;  4GBQ A;  1VYT A;  4LUE A;  1K1Z A;  2JM8 A;  1GBR A;  1JXO A;  1AWJ A;  4HVV A;  2LX7 A;  1Z9Q A;  1AVZ C;  2FRW A;  1JEG A;  2KEA A;  1J3T A;  1H92 A;  3KFV A;  1KIK A;  2DBM A;  3SHW A;  2JMC A;  2AK5 A;  3REA B;  3THK A;  5L23 A;  1TG0 A;  1ZUU A;  1SEM A;  2LMJ A;  1A0N B;  2AKL A;  1NEB A;  2D0N A;  2DIL A;  3M0T A;  1AOJ A;  1PKS A;  2RQR A;  2DMO A;  2GNC A;  2YUN A;  4J9E A;  4RTV A;  2CRE A;  2EQI A;  2LP5 A;  3EG0 A;  2KRN A;  5IHK A;  4RUG A;  1K9A A;  3EGU A;  3UA6 A;  3VS0 A;  1T3S A;  1SHF A;  4IIM A;  4J9I A;  2ABL A;  4AG1 C;  1OEB A;  4E6R A;  5FW9 A;  4HVU A;  1NG2 A;  2V1Q A;  4RTZ A;  4OMP A;  2DVJ A;  5FWC A;  1T3L A;  1UE9 A;  1W70 A;  3VS3 A;  1CKA A;  4J9B A;  2JMA A;  3VRY A;  1YCS B;  3JV3 A;  4IIO A;  4R0K A;  3LH5 A;  4HCK A;  1PKT A;  1SHG A;  1I0C A;  1NM7 A;  4RTU A;  1WI7 A;  2FG0 A;  1NYF A;  5I11 A;  4EIK A;  3U23 A;  2EW3 A;  2DM1 A;  1X6B A;  4OML A;  1U5S A;  1ZUY A;  3FJ5 A;  2RPN A;  4D8K A;  3ULR B;  2GQI A;  3EHR A;  2BZX A;  3UA7 A;  2KXD A;  2DL7 A;  1OPL A;  1QWF A;  2F2W A;  1ZLM A;  2KT1 A;  5IXB A;  4LNP A;  2DX1 A;  2DL8 A;  1WXT A;  4JZ3 A;  1UGV A;  2O9V A;  2K2M A;  2YUQ A;  2RF0 A;  2W0Z A;  2FEI A;  4HXJ A;  2KBT A;  3EHQ A;  1X69 A;  1G83 A;  1JXM A;  1X27 A;  4JJC A;  2CSI A;  2DF6 A;  1UHC A;  2AKK A;  2L3Q A;  2RQU A;  4J9D A;  2SEM A;  1WFW A;  2GTO A;  4CC2 A;  2KNB B;  2CSQ A;  2DL5 A;  4ORZ A;  5HCK A;  4JJB A;  1GRI A;  2XMF A;  2EGE A;  1GFC A;  4LUD A;  3UAT A;  2MCN A;  2RQW A;  1SRL A;  1Z9Z A;  1T0H A;  1RLP C;  2J7I A;  2J6F A;  2MIO A;  4AG2 C;  1UEC A;  4J9F A;  2EYW A;  1I1J A;  1ZSG A;  2DRM A;  1RLQ C;  2FRY A;  3RNJ A;  2M0Y A;  1AWX A;  3TVT A;  4AFS C;  1GFD A;  1UHF A;  1FYN A;  4D8D A;  3VS2 A;  2A37 A;  3EG2 A;  1N5Z A;  1I07 A;  4WCI A;  4JZ4 A;  4RTX A;  2L0A A;  1ABO A;  3H41 A;  2M51 A;  2J06 A;  4RTY A;  1KJW A;  4RTT A;  4JJD A;  2YT6 A;  3REB B;  1Y0M A;  1PHT A;  4OMQ A;  2BZY A;  2P4R A;  4DEY A;  1VYU A;  2L3S A;  2X3W D;  1K0X A;  1AZG B;  1CSK A;  1AWO A;  2A36 A;  2JM9 A;  4A63 B;  2G6F X;  3IQL A;  3EG1 A;  2K9G A;  1JQQ A;  4OMN A;  4AFQ C;  2MOX A;  2E5K A;  2L2P A;  3UF4 A;  1K4U S;  2J6K A;  3I5R A;  2YUO A;  3NMZ C;  2KR3 A;  1LCK A;  1NEG A;  2BTT A;  4J9G A;  1W6X A;  1U3O A;  3I9Q A;  1WDX A;  2HCK A;  5IHN A;  3RBB B;  1G2B A;  2DBK A;  3I5S A;  3H0F A;  3VS6 A;  2D8H A;  2EBP A;  4F17 A;  1AWW A;  4F16 A;  3O5Z A;  1TUC A;  4RTW A;  1U06 A;  2CH4 W;  2O31 A;  2DLP A;  3VS4 A;  2EPD A;  2KRM A;  2GGR A;  3M0Q A;  4CC4 B;  1H8K A;  1BU1 A;  2DE0 X;  1W1F A;  1E6H A;  1QKX A;  2AZS A;  3VS5 A;  2C0I A;  3VRZ A;  4HVW A;  1BBZ A;  1QWE A;  2DL3 A;  2ED1 A;  1UG1 A;  1GCP A;  1QCF A;  1GL5 A;  4ESR A;  2CT3 A;  2EYX A;  2OI3 A;  2VWF A;  4GLM A;  4J9H A;  2RNA A;  2YDL A;  2EGA A;  1K76 A;  1YWO A;  2NWM A;  3PVQ A;  4M4Z A;  1GCQ A;  2PNI A;  4FSS A;  4X1V A;  2O9S A;  5FWB A;  2I0N A;  2ECZ A;  2OAW A;  2HBW A;  5I22 A;  2ROT A;  1WX6 A;  2CUB A;  2SRC A;  1MUZ A;  4LE9 A;  2HEQ A;  2CT4 A;  1GBQ A;  1T0J A;  1SSH A;  4LN2 A;  1M27 C;  2EKH A;  2F2X A;  2RQV A;  3A98 A;  2W10 A;  1SPK A;  2LJ1 A;  1OOT A;  2FPD A;  4Z8A A;  1YWP A;  2LQW A;  2O88 A;  2OJ2 A;  1PNJ A;  5EC7 A;  3NHN A;  1WLP B;  1QLY A;  1NYG A;  2EYY A;  5GJV B;  2KE9 A;  2K7A A;  2KT8 A;  3I35 A;  1X43 A;  2PZ1 A;  3NPF A;  1BB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...