2E5KA

Solution structure of sh3 domain in suppressor of t-cell receptor signaling 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor of T-cell receptor signaling 1
molecule tags Protein binding
source organism Homo sapiens
publication title Solution structure of SH3 domain in Suppressor of T-cell receptor signaling 1
rcsb
total genus 7
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2e5kA01
1ABQA 1X27A 2EGAA 2K7AA 4RTVA 2KYBA 1QWEA 3CQTA 1BU1A 2RQVA 1GCPA 2K9GA 1NEGA 4RTZA 1OEBA 2D1XA 2DRKA 4JJDA 4F17A 1YWPA 1I1JA 3NGPA 4J9BA 1GCQC 1NEBA 2EYWA 1I07A 1UFFA 1M27C 2KRNA 3QWXX 3VS0A 4AG1C 1GBQA 2RMOA 4LUDA 1CKAA 2FRWA 1Z9ZA 3SHWA 3M0UA 2O2OA 2RF0A 2ROTA 2YSQA 1BB9A 1ABOA 4AFSC 2FPEA 1TUDA 2ROLA 4R0KA 1VA7A 2LCSA 1QLYA 3NMZC 2KE9A 2A08A 5FWBA 2OJ2A 2LZ6B 1SHFA 1ZUUA 2F2VA 2CDTA 2ECZA 2BTTA 1HSQA 3LH5A 1HJDA 2FPDA 1E6HA 2CH4A 2DA9A 2CT3A 2AK5A 3UA6A 2CUDA 2YDLA 2CREA 1PRMC 4J9FA 2F2WA 2DM1A 4X1VA 1WLPB 2HDAA 2VKNA 2I0NA 3H41A 1AEYA 1W1FA 2JMAA 4OMQA 2K79A 2ESWA 1YNZA 4HVWA 1T3SA 4J9GA 1M3BA 1N5ZA 1UGVA 2KRSA 1RLQC 2DMOA 1UG1A 3M0QA 2LQNA 4GLMA 3VRZA 4Z89A 2AZVA 2CH4W 1T0HA 2M0YA 2DVJA 3ULRB 3REAB 1FMKA 1JXMA 2L0AA 2EYZA 2YT6A 1ZBJA 2DL4A 2HCKA 2JS0A 2LP5A 2LX7A 4D8DA 2JM9A 4J9CA 1K76A 1AWWA 1PHTA 1MV0B 2F2XA 4Z88A 1SSHA 2FRYA 3JV3A 1GFCA 3REBB 3VS7A 2RQTA 5I11A 1W70A 2CUBA 2D0NA 1UTIA 2OI3A 1QKXA 3UA7A 2DL5A 2MOXA 2A37A 1JQQA 3PVQA 4JJCA 4RTYA 5IXBA 3I9QA 2P4RA 4OMLA 1G2BA 2DL8A 1SRLA 2DLPA 1UDLA 4OMPA 4ZNXA 5L23A 2M51A 2KT1A 1SRMA 1TG0A 2J6FA 1AZGB 2X3XD 4CC3A 1VYVA 2XMFA 2DBMA 3IQLA 2EGEA 5HCKA 5I22A 1OPLA 1AWJA 5GJVB 4EIKA 1Y0MA 2QDLA 1AVZC 2W10A 3C0CA 2CT4A 1JXOA 1CKBA 1HD3A 2ENMA 1B07A 1GRIA 1K0XA 3U23A 1PKSA 1U3OA 2RN8A 1GL5A 1ZSGA 5EC7A 3EG0A 1W6XA 2YUOA 1ZX6A 3VS4A 2SRCA 3QWYA 1M30A 2EGCA 3R6NA 1AWOA 4QT7A 5IHKA 1Y57A 4JZ3A 2A36A 2BZXA 2LJ3A 1WXUA 4GBQA 4HXJA 1B3QA 3I5SA 2BZYA 1Z9QA 2LJ1A 2VWFA 1WI7A 1MV3A 4RTTA 1OOTA 1NLPC 4RTXA 1NG2A 1WFWA 1BBZA 1M3CA 2DILA 1I0CA 2GQIA 5IHIA 2O88A 1H8KA 1UECA 1V1CA 3I35A 1MUZA 5IXFA 2KNBB 1X6GA 2L3QA 4K11A 1UUEA 1VYUA 3TSZA 1X2QA 2AKLA 2PNIA 4JJBA 2FO0A 3GBQA 2O9SA 1JEGA 2E5KA 2RPNA 1UJ0A 2KEAA 5IHNA 2KXCA 4Y92A 2D8JA 2EKHA 1LCKA 3SEMA 2JMCA 3TVTA 2KR3A 4HVVA 4OMNA 4AG2C 2EW3A 4M4ZA 4LE9A 1UE9A 4J9EA 2J6KA 1JU5C 2DBKA 2JXBA 1WIEA 1ARKA 2J7IA 3EGUA 1X6BA 3PE0A 3VS1A 3M0PA 4F14A 1GBRA 4DEYA 2RNAA 2FG0A 2EYYA 5FWCA 4AFZC 1PWTA 4LNPA 1NM7A 3I5RA 5ECAA 2YUQA 3EG2A 2IIMA 2KBTA 4CC7A 4AFUC 3VRYA 4DEXA 2RQWA 2GTJA 2DE0X 2A28A 3M0SA 1QCFA 1M3AA 2MIOA 3M0RA 3VS2A 1S1NA 1AD5A 3VS6A 1H3HA 1CSKA 5FW9A 2JM8A 1AZEA 1U5SA 3H0FA 2DYBA 2C0IA 2FEIA 4ORZA 2C0TA 2L2PA 1T0JA 1K9AA 2GGRA 4LN2A 4HVUA 3FJ5A 4RTWA 2H8HA 4JPBW 1KIKA 1M8MA 2DL7A 2EYXA 1E7OA 1WXBA 1FYNA 1KFZA 2LQWA 4E6RA 3KFVA 2HEQA 3RBBB 1AOJA 3NHNA 2DRMA 2VVKA 4FSSA 3EHQA 2DL3A 2EQIA 2KROA 2AZSA 2JW4A 4J9HA 2LJ0A 3O5ZA 2K2MA 1RLPC 2GTOA 2ED1A 4CC2A 3NPFA 1NYFA 2YUPA 2LMJA 2YUNA 1X2KA 2AKKA 2JTEA 3TSWA 3VS5A 1K0SA 1YCSB 1WYXA 1G83A 2L3PA 4RUGA 4D8KA 1XOVA 2KRMA 4KRTA 1UHFA 2ABLA 1SHGA 2KGTA 2L3SA 1ZUKA 2NUZA 4JZ4A 2JS2A 2J06A 2DF6A 1X69A 1ZUYA 1AWXA 2PTKA 2J6OA 1UHCA 1VYTA 1GFDA 4A63B 2EBPA 1ZLMA 3A98A 2X3WD 1K4US 1RUWA 4Z8AA 2GBQA 1BK2A 1QKWA 3PVLA 1WX6A 4F16A 2EVRA 2K3BA 2W0ZA 3H0IA 2OAWA 4OMMA 1A0NB 2NWMA 1T3LA 1WA7A 4J9IA 1QWFA 1SPKA 1YWOA 2PZ1A 3H0HA 1E6GA 3THKA 2V1RA 1OV3A 1JO8A 1WXTA 2J05A 4RTUA 2C0OA 4IIMA 1UJYA 2CSIA 4AFQC 4IIOA 3UF4A 2DJQA 1H92A 1IO6A 4HCKA 1TUCA 1PRLC 1EFNA 2RQUA 2V1QA 2HBWA 2SEMA 3RNJA 3VS3A 3EG1A 2DNUA 1NLOC 1KJWA 1SEMA 2BZ8A 1NYGA 1PKTA 1YP5A 4WCIA 2KT8A 2JT4A 1WDXA 4J9DA 1X43A 2K6DA 5GJWB 3UATA 3M0TA 4CC4B 4ESRA 3EHRA 1KSWA 4LUEA 1U06A 2MCNA 2O9VA 1YN8A 3EG3A 2O31A 2B86A 2GNCA 2KYMA 1GCQA 3ZL7C 2DX1A 1RI9A 2CSQA 1K1ZA 2G6FX 2ED0A 2D8HA 2LNHB 1OPKA 1J3TA 2EPDA 5IH2A 4OMOA 2KXDA 2HSPA 1PNJA 2RQRA 2FPFA
chains in the Genus database with same CATH superfamily
4HT8A 1RI0A 1ABQA 1X27A 2EGAA 2K7AA 3QKJA 1QVFS 1FX7A 1QWEA 3CQTA 1BU1A 4CRIA 3TEEA 2KAFA 4NL3A 3EFRA 4J9BA 1UFFA 2KRNA 3VS0A 3JCMP 2CS7A 2RMOA 4LUDA 1CKAA 2JUFA 4BI8B 2HQEA 5C0MA 4LDXA 4M77C 3VU3C 3A8GB 3CCQT 4OB1B 1PM3A 4A54A 4FW1A 4PJMA 2ROLA 5FU7B 4Y28E 3OS1A 2LCSA 4O6JA 3NMZC 2KE9A 4JS4A 1NBEB 1KC8U 2OJ2A 4KGZB 1SHFA 1ZUUA 5AYFA 1VOMA 4IUPA 1MMGA 1E6HA 2CH4A 2K3YA 1IREB 2YDLA 4M7DA 2ZPBB 4XTXA 1MMNA 1VQPT 1TS9A 1D1CA 3EAEA 3CC2A 1IB8A 4IKFA 1S72Q 2LT1A 2VYTA 4J9GA 1M1FA 3A8MB 1QCOA 2EWNA 1KK7A 1RLQC 2MMPA 1IGQA 5EG2A 4M78B 1YJWQ 4Z89A 2AZVA 4NL2A 5M9OA 4HT9A 2CZ7B 3DLMA 4N4IA 5GMKh 2P0PA 1ZBJA 1MNDA 1Q81R 5GMKj 4ZGJB 2P0KA 3CC7A 1VQ5T 2JM9A 4J9CA 1K76A 1WPYA 2QA4T 1D3BB 4EMKB 1U1SA 4J7FA 1V29B 2EQUA 2KDSA 5FU6B 1GFCA 4N0AC 2RQTA 2VXFA 5I11A 5KYWB 2D0NA 2JJ9A 1Q86R 1RAFB 2A37A 3P8HA 1LNXA 2XDPA 4RKUE 3HL8A 4A4FA 2DLPA 1MGQA 1X6OA 4XTWA 1UDLA 2DFUA 2K57A 2YRDA 3OW2S 5DLQE 1SRMA 2X3XD 3BFMA 1ZA1B 3FIFA 2DBMA 4IUUA 1Q95G 2EGEA 3H6ZA 5A0LA 3OYDA 2CP5A 5GJVB 1D1AA 1K73R 2B8AA 2RJFA 3G71A 1CKBA 1Q81U 1D3BA 1K0XA 3CCSA 1QVGS 5GAN5 4IUVA 5EC7A 3VS4A 1M1KU 3LWIA 3JCMW 1AWOA 4XTUA 1QCNA 1Y57A 4JZ3A 2A36A 1WXUA 1Z9QA 2LJ1A 4J7IA 3CMAQ 4BUGA 5KCOA 1ZSZC 3RKWA 3SDZA 4RTTA 1NLPC 1BBZA 3OMCA 1M3CA 1QMCA 3QJYA 1Q82U 2FZKB 2ATCB 5IHIA 5KYUB 4Q5WA 1HYOA 3HFNA 4DBHA 4DOWA 4F04B 2H3JA 1Y7XA 2L3QA 3CBMA 1JJ2P 1UUEA 1VYUA 3TSZA 1C6VX 2HBPA 4RG2A 4JJBA 2FO0A 1PD1A 4C0DC 2XD0A 2E10A 1EZZB 3OBYA 2G3RA 3H8ZA 1VIFA 4M78F 2D8JA 3QPHA 1IXDA 1N9RA 2RJEA 2DEUA 2EW3A 4M4ZA 2ZZDA 4N4GA 2COYA 2J6KA 2RHXA 3CMAT 3LWHA 2QQ9A 2HQXA 4NOYA 1N8RR 3M0PA 4F14A 3CD6A 4FL6A 2FG0A 5FWCA 3ZEHA 4LNPA 3N5BB 2DD4A 3EG2A 2IIMA 3M53A 3OQ5A 1VQ5A 2A28A 1QCFA 2RJDA 3VS2A 1S1NA 5LJ5f 1AD5A 2MF2A 5KYYA 1CSKA 3M9QA 2BIVA 2QQBA 2XI9A 3CCUT 2JM8A 3PIPA 1QP3A 4QVDA 4M77F 4M75C 3H0FA 4PJNA 1OYXA 2AIRB 5D6XA 3NFCA 2L2PA 8AT1B 1ZQ1A 1T0JA 4CI0C 2Z0WA 2QG9B 3OW2P 3A8OB 4J6XA 2EYXA 1ZSZB 2ZGWA 5KYXB 2KK4A 1N8RU 1MMDA 1RAIB 2LQWA 4E6RA 4M7AF 3RR6A 3CC4Q 1KHIA 3JAME 4A53A 3M4GA 3EGXA 3EHQA 5L8RE 2NUPB 3OSVA 2JW4A 3JCMV 4J6YA 1N6AA 2X4XA 2LJ0A 3O5ZA 1RLPC 4OB2B 2GTOA 1G8XA 3RKYA 2YUPA 2QQSA 4DOVA 2YUNA 5KYWA 4PJOB 2WSEE 1RADB 5KE2A 2JTEA 3VS5A 4PNOA 4M7AD 2RJCA 4KRTA 3TU4K 2PVOB 4M7AE 2JS2A 3DKMA 3CCLT 3NTIA 2H3EB 3O8VA 2KMTA 5IAYA 4MZMA 2J6OA 3VYHB 4FCYA 5CVIA 1YCYA 5FLXE 2V8IA 3ME9A 3OBWA 2KSSA 1RABB 4Z8AA 3Q1JA 2M1HA 3OA6A 3I55T 3PVLA 1WX6A 1YJ9T 2W0ZA 4RMOA 4C5GA 3V8KA 5GAMd 1PD0A 1YJNQ 3CC7Q 4EPCA 2PZ1A 3VV0A 3THKA 2V1RA 4JS5A 1KD1C 1JO8A 2O01E 4O5VA 2QEXQ 4L59A 1NPPA 3QG1A 2VGNA 2RHZA 3NTKA 4IIOA 2DJQA 3LX7A 4IURA 3I56Q 1IO6A 4HCKA 1TUCA 1JJ2A 1KHCA 3RNJA 4BY6C 3CCEA 1NLOC 4JDSA 1KJWA 1SEMA 1TUGB 1OU9A 4M77E 3D7SB 3CCJT 3CCVQ 2LDMA 4J9DA 4C92E 5A0DA 3M55A 2HAXA 2MCNA 2O9VA 4JRKA 4DA4A 3S3MA 2QTVA 4FYWB 1FMVA 4UC4A 3G4ST 1GCQA 4PK4A 3ZL7C 5GANf 5GMKi 3EGDB 2EYQA 5I21A 4PKCC 2CP3A 3M54A 4BDYA 2KQWA 5KYYB 5IH2A 3CCVA 4OMOA 4ZGDB 4QQ6A 1EX4A 3G6EQ 2QGGA 5GAOq 4LXCA 5CCAA 3X24B 2V26A 4RTVA 1Q7YU 2KYBA 2RQVA 2K9GA 3BY7A 2D1XA 4F17A 1I1JA 2Y4YA 1QVGA 2EYWA 3HTRA 3SB2A 3X20B 2V8KA 1W2BA 4OF1A 3QWXX 3HSBA 1Z9ZA 1R0BG 3EH1A 2GF7A 2RF0A 2EIFA 1IRXA 3I55A 1ABOA 2QA4Q 3EG9B 3FRNA 4R0KA 1OZ3A 1VA7A 2RHYA 1R8OB 2A08A 2RO0A 5FWBA 2LZ6B 1YFNA 1ZSZA 4FT4A 2ECZA 3OYJA 1HJDA 3LH5A 4NS5A 2FPDA 2K5FA 1YJNA 3J7AF 2CT3A 2AK5A 3UA6A 2P0QA 1VQ6A 2LRQA 2DM1A 1TU0B 4X1VA 4KBMB 3QZ9B 1WLPB 2HDAA 2LCLA 1MHNA 2EJFA 1W1FA 5D7UA 5FU6C 2JMAA 4LD6A 1QVFP 4PFOA 1VQLQ 4DBRA 4BD3A 4WF2A 3S3NA 3SWNB 1N5ZA 4N0AA 3CCRA 1G3WA 1WHKA 5GAN8 3CMEA 2MWOA 4GLMA 3CCST 3QBYA 1P92A 4FYYB 3VRZA 1YIJA 2CH4W 1T0HA 4M75F 2M0YA 1JXMA 4WTOB 1KQSS 4PJOD 2EYZA 4B9XA 3QO3A 3OYMA 5LJ5e 1UGSB 3C95A 4ANJA 3BDUA 1PHTA 1RAEB 3MEVA 1UB4A 3VJPA 3VS7A 3G6EA 1W4SA 3GOXA 2MPXC 4M7AG 2CP7A 1UTIA 2LQ8A 2CP6A 3BDLA 4C8QD 3OYBA 1QKXA 4L5GA 4XTYA 3OB9A 4JRQA 3PVQA 5CAIA 4RTYA 5IXBA 3LW5E 2P4RA 2YLBA 3OSSC 3T9NA 2IG0A 2DL8A 1SRLA 4M75G 1B34A 3CC2T 1YBYA 3MO8A 1ZA2B 2M51A 4FU6A 2VV5A 2DXTA 3JB9D 1VQPA 4YTLA 1TG0A 2J6FA 1OX9A 1M90C 3GLXA 1I8FA 5GAN2 2XIDA 1OPLA 4PFPA 2E6NA 2YXYA 2QQRA 2QDLA 2HKQB 3OYFA 4XK8E 1Q86U 3VUBA 4E7JA 3URGA 1H641 4E7SA 5KYNA 3OYKA 3G4SA 1B07A 4HCCA 2RN8A 1GL5A 3F70A 3E9FA 2YUOA 2VUBA 1ZX6A 3PTAA 2DO3A 1M30A 2RI3A 5GANg 2RHUA 3PMIA 5IHKA 2LJ3A 3GNGA 4GBQA 5I2MA 1B3QA 2R58A 3I5SA 5HKCA 3P8BB 3CCRT 2QDYB 4M75D 1UGPB 2K4YA 1U1TA 1VQMA 1WJQA 4M75B 3X28B 3JB9G 1OOTA 4RTXA 1H8KA 1KQSP 1V1CA 3I35A 5LJ3d 2VGMA 2X9HA 3OY9A 1M1KC 2PNIA 5HY6A 2YWWA 2O9SA 5DM7R 3TQ7P 1VQMQ 1LJOA 1YITT 8ATCB 9ATCB 1VQMT 2DIQA 4M78A 1QVGP 1KQ1A 3OYLA 2KI7A 3LLRA 4LE9A 2K5LA 2DBKA 2JXBA 2ZPHB 3CCRQ 2E64A 3JCMQ 4BE1A 5LJ3h 2D9TA 3VS1A 1GBRA 3I56T 3UDCA 2M9UA 2NUTA 5LJ5h 3L2WA 5ECAA 2ZCFB 2QEXT 1S72A 4AFUC 3VRYA 2RQWA 2XK0A 1XJWB 1VQ9Q 1BYMA 2MIOA 4ELZC 1H3HA 3CPWS 3E19A 1VIEA 4M7DD 2OX7A 4PJOF 1U5SA 4EMKA 5CR2A 2C0IA 2JTFA 4ORZA 3HKSA 3MEAA 3JCMh 5KE3A 2XDBA 4KT0E 3SWNA 1S72T 1NJIC 4PJJA 4P5NA 4OGEA 4E47A 2H8HA 3J80E 1Q86C 2L5QA 3CCMQ 2RHIA 4XU3A 2DL7A 1SG5A 3META 4C92B 1E7OA 2O4XA 2PVGB 4C92D 2NUTB 2VVKA 4XU1A 2DL3A 4J9HA 4E7HA 2R57A 4M78D 3JCMg 3CCET 2ED1A 3G4SQ 4J83A 3LGFA 3HRSA 4XTZA 2MAMA 5GAMh 2L8DA 1WJSA 1YCSB 4C8QG 4QQGA 2L3PA 3MPUB 1PCXA 5D6WA 2E5QA 3CEYA 4KULA 2JTMA 2DIGA 2L3SA 4X9DA 2NUZA 2J06A 1VQNT 1WHHA 3LGLA 3ER0A 4MDXA 5CO7A 1VYTA 2O4XB 2EBPA 2WSFE 2MYSA 1K4US 5GAMg 1MMAA 5FU7C 1ZHIA 3QJ6A 5GAOm 3RMQA 3GPLA 1PSFA 1BK2A 4B6MA 3X25B 4F16A 3H0IA 1VQOT 3PMTA 1T3LA 1WA7A 3CD6T 1WHMA 3SFMA 5I2SA 2VASA 5CKHA 3VKIA 2NYSA 5GMKm 5GAMf 1I4K1 3EGDA 5AT1B 2CSIA 1RAHB 4AFQC 2YRCA 4PFZA 3OYGA 4JJNK 1EFNA 2LCCA 2RQUA 2V1QA 3VS3A 2EQJA 2P84A 1YIJT 2X4JA 1NYGA 1PKTA 4WCIA 4C92A 2RM4A 3S3OA 2EAYA 3CCLA 2LQKA 5GJWB 4KH0B 3OYAA 3INZA 1YIJQ 2FZCB 1YJWA 1YN8A 1K9MU 2GNCA 2JVVA 3X26B 1D09B 1JBMA 4F7UA 2DX1A 1RI9A 1XNIA 3TCJA 4C8QA 1VQ9A 1ZBXA 3M59A 1M2VB 1J3TA 1R77A 4C0FA 1W2BS 4J8OA 3E9GA 2KXDA 2HSPA 1PNJA 3C94A 4ZGEB 2RQRA 2FPFA 4MMKA 4ATOA 1VQ8T 4PJLA 1GCPA 4JLGA 1NEGA 3DB3A 4PJOA 4RTZA 5CQYA 5GAOl 2DRKA 1YWPA 1MNEA 5J26A 1NEBA 1WJRA 1NZ9A 2ZPEB 3FEOA 1GBQA 4A4HA 4HCBA 2RB6A 5CQXA 3A5ZB 1BB9A 2BE7D 4AFSC 1O75A 3FDRA 3FJPA 3QZ5B 1QLYA 2F5TX 4BE2A 4MZTA 3KBGA 4BI4A 2BTTA 1HSQA 1KC8C 2DA9A 1Q82R 2CUDA 3CCSQ 3E1SA 3EFSA 3JRZA 2QEXA 3HRUA 2VKNA 2EQKA 1YI2Q 2K5IA 2I0NA 3H41A 2MK5A 2LVMA 2FL7A 2CYZB 2PQWA 4N4HA 2DAQA 2K79A 2PUKB 3L2VA 1T3SA 4OGCA 2M16A 1EIFA 1UGVA 2RI2A 2I2LA 2OTLQ 1VQKT 1UG1A 4C0DB 1K8AR 3CD6Q 3JCMX 2LC4A 4FYVB 4LDWA 2DVJA 3ULRB 4LD9K 3REAB 4BDZA 1FMKA 1I5LA 4RCCA 5CKDA 2DD5A 2HCKA 2QI2A 2JS0A 2QQAA 1BIAA 2LP5A 3V7RA 1G5VA 2HSEB 1SF9A 2LTOA 1AWWA 2GFUA 4FIBA 4M77A 1F1BB 1RACB 1SSHA 1KQ2A 2EFIA 2MWPA 1VQOA 2FRYA 2E12A 3CMEQ 1W70A 1WHLA 1BKBA 2CUBA 2GCXA 2OI3A 3GIBA 5GANd 3UT1A 4LDYA 1BI2A 1C1AA 1JQQA 3HRTA 4JJCA 4C92C 5FROA 4ZTJA 4QVCA 3I9QA 1N8RC 4OMLA 1V76A 1VQ6T 3MJXA 2DZ9A 5L23A 4IUTA 2KT1A 3M58A 1M2OA 4CC3A 1VYVA 2QA4A 2XMFA 1YITA 5I22A 2FYKA 4F7UE 1OI1A 4AT1B 4B9WA 4EDUA 2W10A 3C0CA 1AHJB 1JXOA 1VUBA 1YJ9Q 4XU0A 2E41A 2ENMA 1DJ7B 1VQ6Q 2K3XA 3HHTB 2QTXA 1PKSA 1U3OA 3SD4A 5GANh 5GAOp 1ZSGA 4FT2A 1W6XA 1VQ8A 1Q7YR 3QWYA 2EGCA 4X34A 3R6NA 2DXUA 4QT7A 3RIRA 2DERA 2BZXA 3HP9A 4HXJA 1UGQB 1BI1A 2BZYA 2R5MA 1M1GA 2HQHA 2VWFA 1NPRA 4C92G 3MEUA 3KUFA 1TSFA 1NG2A 2DILA 1I0CA 2GQIA 1VQ7Q 5DY9A 4A4GA 1X6GA 1PSEA 1YJWT 2DETA 4K11A 4L6V5 1Y71A 1VQKQ 3ZFJA 4M7AA 3CBOA 2PU9B 3GBQA 2M0OA 4M78C 1JEGA 2E5KA 3V8JA 4MMLA 5IT9E 3G7ZA 2KEAA 5IHNA 3KXTA 2KXCA 4BB7A 4Y92A 3JCMe 4DBQA 3CC2Q 5KYUA 2EKHA 1C0MA 1VQ7A 1LCKA 3SEMA 2JMCA 3FB9A 2KR3A 3OMGA 5D6YA 3TVTA 4DBFA 1YHQA 3L2QA 5FRMA 3A8LB 3OS0A 1Y07A 1WIEA 1ARKA 1IZ6A 3EGUA 5LJ5j 2CGHA 2RNAA 4DEYA 1BCMA 4ZN1A 2EYYA 1LOJA 3OYIA 1NJIR 4AFZC 4X9CA 1NM7A 2YUQA 1OX8A 2D6FA 3V8LA 2KBTA 4CC7A 2HZYA 4M78E 2DXCA 4EMHA 2DE0X 3CCMA 4RCBA 1YJ9A 5KH6A 4JRIA 3ASKA 3L2RA 1VQOQ 4KGXB 2OTLA 1Y96A 3MHXA 1TOVA 1VQ8Q 2ZAEA 2XG8D 2FEIA 5J39A 1M2VA 2QYZA 5DLOA 2C0TA 4PJOC 3M5AA 3DB4A 5C6SA 3OYHA 1VQ5Q 2GGRA 3JCMJ 2VC8A 4LN2A 2CZ1B 4HVUA 3FJ5A 4RTWA 5GAOr 1KIKA 1N9SA 1K73U 4E7ZA 4GLKA 3KFVA 2HEQA 2COZA 3RBBB 3NHNA 1I81A 4ME7A 2D0QB 2XHCA 1XQHA 2EQIA 2E70A 3PIOA 5GAN4 4R56A 3JCMb 1JRIA 4JLIA 3OW2A 3NPFA 2E65A 2F1LA 4PLIA 2PUOB 3JCMc 3G71T 2EQMA 1VQ7T 3TSWA 1K0SA 4RUGA 4D8KA 1XOVA 4M77G 3EGXB 3CPWP 2OTJQ 1M90R 2L3RA 2BUDA 1WZOA 2DF6A 1X69A 1ZUYA 1AWXA 2PTKA 4ZTFA 4LDUA 5GANe 1UHCA 4FM4B 1GFDA 4A63B 1ZLMA 1RAGB 4ELYC 1WQWA 4AMCA 2X3WD 4KGVB 2A0FB 4M75A 1ACMB 4KH1B 1OU8A 3PFSA 2VXEA 4M7DB 4FSXA 2NWMA 4J9IA 1RAAB 2WSCE 4HCZA 1YWOA 3QYGB 1E6GA 2DPPB 1OV3A 1WXTA 2LX9A 2J05A 4VUBA 1UGRB 3HPWA 5IN1A 3VUZA 2A3LA 4C8QE 3CCUQ 2JZ2A 2JOYA 3UF4A 2DVEA 2ZPFB 3QXEB 1H92A 3E2UA 1PRLC 2A7YA 1VQLA 2HBWA 2L89A 2DNUA 3L2UA 2E1HA 3OYCA 2OAUA 3P8DA 1M90U 2KT8A 2JT4A 2RK1A 3SWNC 1N27A 1I5OB 3CCVT 3UPUA 1FMWA 2K6DA 2E3IA 3M0TA 4ESRA 3JB9J 3RUXA 1KSWA 3L42A 4EMKC 3CC4A 2O31A 2B86A 2DTIA 4MZPA 1VQNA 2KYMA 2X4YA 2JNGA 3MP6A 3QDRB 1AT1B 2KY9A 3EH2A 2EPDA 3CCMT 4M7DF 5KCHA 3CXCP 1M1KR 4KUIA 2HD0A 3OS5A 2OTLT 1KC8R 3RESA 1LVKA 1OEBA 3S6WA 4JJDA 1VQKA 2DXBA 3GP8A 1VQ4Q 1O9SA 3NGPA 1FWZA 1GCQC 4E7KA 2BE9B 4XTVA 1I07A 4AG1C 1M27C 1G3SA 4OP0A 4MDWA 4ZN3A 2FRWA 4BI3A 2DTHA 3SHWA 3M0UA 2V8JA 2O2OA 2YLCA 2ROTA 2YSQA 4A4EA 2M02A 2BKDN 3V7SA 2FPEA 1TUDA 2C06A 3OYEA 1NE8A 2E3HA 1G3YA 1YHQQ 2Y4XA 2CDTA 2F2VA 4C8QF 3G71Q 1KQSA 1D0XA 2EJ9A 4PLLA 2CREA 1PRMC 4J9FA 2F2WA 1VQ4T 2ZPIB 5LJ3j 3CCQQ 3H9NA 4TVRA 4C5HA 5HK0A 1Q81C 1AEYA 3RERA 2P4TA 2E6ZA 4OMQA 2ESWA 3OYNA 1YNZA 4HVWA 2DYIA 1W2BP 2DJZA 3PGGA 5CIUA 1M3BA 3GNFB 2KRSA 2DMOA 1H3ZA 1SSFA 2RK2A 4LDVA 1QQJA 3M0QA 4C5IA 1QW1A 2LQNA 1KG1A 3FC3A 5FRNA 5CKFA 3PNWC 2DKGA 1VQNQ 2L0AA 2YT6A 2DL4A 1Q82C 2RD1A 3QYHB 3LYIA 4C5EA 2LX7A 4D8DA 1MV0B 3CCJQ 2F2XA 1WQ7A 3CPFA 4Z88A 1X75C 1LPLA 2JN0A 3CMET 3JV3A 3REBB 4C8QB 2NLUA 4KUDK 1TH7A 3MP8A 1BI3A 4HA8A 3UA7A 2DL5A 2F5KA 2MOXA 1G3TA 2LNVA 2RI5A 2PVDB 2KVQG 2LT4A 2QGFB 1VQ9T 1G2BA 3A8HB 5GAMj 1IHWA 2CKKA 5CKBA 4OMPA 3JCMd 5A0GA 4J5YA 2CZ6B 4ZNXA 5LL6S 1TTHB 1HK9A 1AZGB 3QUIA 4OVAA 3I55Q 1D1BA 3JCMf 3IQLA 5HCKA 1M9SA 3I56A 1AWJA 4EIKA 1XTDA 1Y0MA 4C0GA 5CK9A 1AVZC 2CT4A 3BW1A 2XU8A 1NJIU 4J6WA 5J3BA 5LJ3f 4D6WA 1HD3A 5HK3A 2RA2A 1GRIA 3QDFA 3U23A 3CCLQ 1YHQT 4DQ2A 1M8VA 3CCQA 4XU2A 3EG0A 3BE3A 3JSCA 3CXCA 1K73C 2HNIA 4QKUA 2SRCA 3FLGA 2DTOA 1QVFA 1QP2A 2AT1B 2CZ0B 2CP2A 2E4HA 4RG8A 2K2VA 1JJ2S 1BIBA 4Z02A 1WI7A 7AT1B 1MV3A 3A1PA 3JB9F 5GAN7 3AT1B 1WFWA 2NUPA 1B7TA 2FB7A 3CCUA 2O88A 4M78G 1RL2A 3MP1A 1UECA 4M7AC 3L2ZA 3RMSA 1MUZA 5IXFA 2KNBB 2QXFA 3MCAB 4FYXB 4QW2A 3CCEQ 1KD1U 3J81E 1X2QA 1BI0A 2AKLA 4QQDA 4JUVA 1WGSA 1M5Q1 3JB9I 2RPNA 1FXXA 1UJ0A 2EKOA 1YJNT 4M77D 4OB0B 1YI2A 2HKNA 3QHSA 2WACA 2HMAA 4M77B 1OQKA 2YHTA 4HVVA 2QK0A 4OMNA 4C92F 2OTJA 4AG2C 3G1JA 3CC7T 3TREA 1UE9A 4J9EA 1K8AC 3QSUA 1JU5C 3HFOA 3EG9A 1X01A 2J7IA 1X6BA 3PE0A 2GQVA 4HKEA 5GMKe 4II1A 2FZGB 4R55A 1PWTA 3M56A 1WNLA 2EJGA 3I5RA 4M7DE 2MI6A 4DEXA 2GTJA 3M0SA 1M3AA 3M0RA 3CCJA 2OTJT 3VS6A 1UEBA 1Q7YC 3DLLA 5FW9A 1WHGA 5GMKl 3ZBDA 1K9MR 5LJ3e 3MEWA 2XKOC 3JB9H 1PC0A 2RH2A 1AZEA 4V2SA 1KD1R 2QASA 1TWBA 2DYBA 3C4SA 2DZCA 4XAXB 2XICA 3CXCS 4E7IA 4F7UG 2VB6A 1K9AA 4JPBW 2CP0A 3OS2A 1M8MA 1VQPQ 1WXBA 1FYNA 1KFZA 1JB0E 1BCOA 3WXMB 1D0ZA 2Y90A 1AOJA 2DRMA 4QVZA 1YITQ 4FSSA 4EMGA 2KROA 2AZSA 1IHVA 4PJOE 1B34B 4E7LA 2K2MA 1K9MC 2X35A 4CC2A 1VQLT 1NYFA 3L1AA 2LMJA 3R6OA 1M4ZA 4IUQA 2ZPGB 4F7UF 3EFOA 1X2KA 1HXDA 2AKKA 1WYXA 1G83A 4XQ3A 2KRMA 3CC4T 1UHFA 2ABLA 3M57A 1SHGA 2KGTA 2HL5C 3VYGA 1SKUB 1ZUKA 4F7UB 4M7DC 5LJ3g 4JZ4A 2IVWA 1PG5B 1OZ2A 4OB3B 3UWNA 3CPWA 1D0YA 5GAMe 1U8RA 4FW2A 5LJ5g 2GFAA 2YRVA 4BACA 1WHJA 5GAN3 3A98A 5GANj 1RUWA 5GAOn 1GXIE 3AHUA 2GBQA 1K8AU 1QKWA 4OMFB 2FVUA 3OYYA 2EVRA 2K3BA 2COWA 2OAWA 4OMMA 1A0NB 2X4WA 3M4YA 3MKDA 4C8QC 4JRPA 5CKEA 1QWFA 1SPKA 3CMAA 2F69A 3WVDB 3H0HA 2R5AA 4PL6A 4PJOG 6AT1B 1TXQA 3EFOB 4GY5A 2XDDA 3RDVA 4RTUA 2C0OA 4IIMA 1UJYA 2FHDA 5KYXA 3LH0A 2SEMA 3EG1A 1YI2T 2BZ8A 1YP5A 4A4KA 2QAZA 1WDXA 2DEQA 5LJ5d 1X43A 2IPOB 3UATA 3CBPA 4CC4B 4BE0A 1OULA 3EHRA 4LUEA 1U06A 3EG3A 1Y96B 4Y91A 5A2QE 4BY6B 4M7DG 5GAN6 3G6ET 1IGUA 1VQ4A 2CSQA 1R0CB 3V7CA 1K1ZA 2G6FX 3WVEB 3GF5A 2ED0A 3QIIA 2D8HA 2LNHB 4C0ZA 2AHJB 1OPKA 3RKXA 2DK3A 1QVPA 4M75E 3PT9A 2HL3A 3C12A 4E2FB 3NTHA 4M7AB 2X51A
chains in the Genus database with same CATH topology
1ABQA 1X27A 2EGAA 2K7AA 4RTVA 2KYBA 1QWEA 3CQTA 1BU1A 2RQVA 1GCPA 2K9GA 1NEGA 4RTZA 1OEBA 2D1XA 2DRKA 4JJDA 4F17A 1YWPA 1I1JA 3NGPA 4J9BA 1GCQC 1NEBA 2EYWA 1I07A 1UFFA 1M27C 2KRNA 3QWXX 3VS0A 4AG1C 1GBQA 2RMOA 4LUDA 1CKAA 2FRWA 1Z9ZA 3SHWA 3M0UA 2O2OA 2RF0A 2ROTA 2YSQA 1BB9A 1ABOA 4AFSC 2FPEA 1TUDA 2ROLA 4R0KA 1VA7A 2LCSA 1QLYA 3NMZC 2KE9A 2A08A 5FWBA 2OJ2A 2LZ6B 1SHFA 1ZUUA 2F2VA 2CDTA 2ECZA 2BTTA 1HSQA 3LH5A 1HJDA 2FPDA 1E6HA 2CH4A 2DA9A 2CT3A 2AK5A 3UA6A 2CUDA 2YDLA 2CREA 1PRMC 4J9FA 2F2WA 2DM1A 4X1VA 1WLPB 2HDAA 2VKNA 2I0NA 3H41A 1AEYA 1W1FA 2JMAA 4OMQA 2K79A 2ESWA 1YNZA 4HVWA 1T3SA 4J9GA 1M3BA 1N5ZA 1UGVA 2KRSA 1RLQC 2DMOA 1UG1A 3M0QA 2LQNA 4GLMA 3VRZA 4Z89A 2AZVA 2CH4W 1T0HA 2M0YA 2DVJA 3ULRB 3REAB 1FMKA 1JXMA 2L0AA 2EYZA 2YT6A 1ZBJA 2DL4A 2HCKA 2JS0A 2LP5A 2LX7A 4D8DA 2JM9A 4J9CA 1K76A 1AWWA 1PHTA 1MV0B 2F2XA 4Z88A 1SSHA 2FRYA 3JV3A 1GFCA 3REBB 3VS7A 2RQTA 5I11A 1W70A 2CUBA 2D0NA 1UTIA 2OI3A 1QKXA 3UA7A 2DL5A 2MOXA 2A37A 1JQQA 3PVQA 4JJCA 4RTYA 5IXBA 3I9QA 2P4RA 4OMLA 1G2BA 2DL8A 1SRLA 2DLPA 1UDLA 4OMPA 4ZNXA 5L23A 2M51A 2KT1A 1SRMA 1TG0A 2J6FA 1AZGB 2X3XD 4CC3A 1VYVA 2XMFA 2DBMA 3IQLA 2EGEA 5HCKA 5I22A 1OPLA 1AWJA 5GJVB 4EIKA 1Y0MA 2QDLA 1AVZC 2W10A 3C0CA 2CT4A 1JXOA 1CKBA 1HD3A 2ENMA 1B07A 1GRIA 1K0XA 3U23A 1PKSA 1U3OA 2RN8A 1GL5A 1ZSGA 5EC7A 3EG0A 1W6XA 2YUOA 1ZX6A 3VS4A 2SRCA 3QWYA 1M30A 2EGCA 3R6NA 1AWOA 4QT7A 5IHKA 1Y57A 4JZ3A 2A36A 2BZXA 2LJ3A 1WXUA 4GBQA 4HXJA 1B3QA 3I5SA 2BZYA 1Z9QA 2LJ1A 2VWFA 1WI7A 1MV3A 4RTTA 1OOTA 1NLPC 4RTXA 1NG2A 1WFWA 1BBZA 1M3CA 2DILA 1I0CA 2GQIA 5IHIA 2O88A 1H8KA 1UECA 1V1CA 3I35A 1MUZA 5IXFA 2KNBB 1X6GA 2L3QA 4K11A 1UUEA 1VYUA 3TSZA 1X2QA 2AKLA 2PNIA 4JJBA 2FO0A 3GBQA 2O9SA 1JEGA 2E5KA 2RPNA 1UJ0A 2KEAA 5IHNA 2KXCA 4Y92A 2D8JA 2EKHA 1LCKA 3SEMA 2JMCA 3TVTA 2KR3A 4HVVA 4OMNA 4AG2C 2EW3A 4M4ZA 4LE9A 1UE9A 4J9EA 2J6KA 1JU5C 2DBKA 2JXBA 1WIEA 1ARKA 2J7IA 3EGUA 1X6BA 3PE0A 3VS1A 3M0PA 4F14A 1GBRA 4DEYA 2RNAA 2FG0A 2EYYA 5FWCA 4AFZC 1PWTA 4LNPA 1NM7A 3I5RA 5ECAA 2YUQA 3EG2A 2IIMA 2KBTA 4CC7A 4AFUC 3VRYA 4DEXA 2RQWA 2GTJA 2DE0X 2A28A 3M0SA 1QCFA 1M3AA 2MIOA 3M0RA 3VS2A 1S1NA 1AD5A 3VS6A 1H3HA 1CSKA 5FW9A 2JM8A 1AZEA 1U5SA 3H0FA 2DYBA 2C0IA 2FEIA 4ORZA 2C0TA 2L2PA 1T0JA 1K9AA 2GGRA 4LN2A 4HVUA 3FJ5A 4RTWA 2H8HA 4JPBW 1KIKA 1M8MA 2DL7A 2EYXA 1E7OA 1WXBA 1FYNA 1KFZA 2LQWA 4E6RA 3KFVA 2HEQA 3RBBB 1AOJA 3NHNA 2DRMA 2VVKA 4FSSA 3EHQA 2DL3A 2EQIA 2KROA 2AZSA 2JW4A 4J9HA 2LJ0A 3O5ZA 2K2MA 1RLPC 2GTOA 2ED1A 4CC2A 3NPFA 1NYFA 2YUPA 2LMJA 2YUNA 1X2KA 2AKKA 2JTEA 3TSWA 3VS5A 1K0SA 1YCSB 1WYXA 1G83A 2L3PA 4RUGA 4D8KA 1XOVA 2KRMA 4KRTA 1UHFA 2ABLA 1SHGA 2KGTA 2L3SA 1ZUKA 2NUZA 4JZ4A 2JS2A 2J06A 2DF6A 1X69A 1ZUYA 1AWXA 2PTKA 2J6OA 1UHCA 1VYTA 1GFDA 4A63B 2EBPA 1ZLMA 3A98A 2X3WD 1K4US 1RUWA 4Z8AA 2GBQA 1BK2A 1QKWA 3PVLA 1WX6A 4F16A 2EVRA 2K3BA 2W0ZA 3H0IA 2OAWA 4OMMA 1A0NB 2NWMA 1T3LA 1WA7A 4J9IA 1QWFA 1SPKA 1YWOA 2PZ1A 3H0HA 1E6GA 3THKA 2V1RA 1OV3A 1JO8A 1WXTA 2J05A 4RTUA 2C0OA 4IIMA 1UJYA 2CSIA 4AFQC 4IIOA 3UF4A 2DJQA 1H92A 1IO6A 4HCKA 1TUCA 1PRLC 1EFNA 2RQUA 2V1QA 2HBWA 2SEMA 3RNJA 3VS3A 3EG1A 2DNUA 1NLOC 1KJWA 1SEMA 2BZ8A 1NYGA 1PKTA 1YP5A 4WCIA 2KT8A 2JT4A 1WDXA 4J9DA 1X43A 2K6DA 5GJWB 3UATA 3M0TA 4CC4B 4ESRA 3EHRA 1KSWA 4LUEA 1U06A 2MCNA 2O9VA 1YN8A 3EG3A 2O31A 2B86A 2GNCA 2KYMA 1GCQA 3ZL7C 2DX1A 1RI9A 2CSQA 1K1ZA 2G6FX 2ED0A 2D8HA 2LNHB 1OPKA 1J3TA 2EPDA 5IH2A 4OMOA 2KXDA 2HSPA 1PNJA 2RQRA 2FPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABQ A;  1X27 A;  2EGA A;  2K7A A;  4RTV A;  2KYB A;  1QWE A;  3CQT A;  1BU1 A;  2RQV A;  1GCP A;  2K9G A;  1NEG A;  4RTZ A;  1OEB A;  2D1X A;  2DRK A;  4JJD A;  4F17 A;  1YWP A;  1I1J A;  3NGP A;  4J9B A;  1GCQ C;  1NEB A;  2EYW A;  1I07 A;  1UFF A;  1M27 C;  2KRN A;  3QWX X;  3VS0 A;  4AG1 C;  1GBQ A;  2RMO A;  4LUD A;  1CKA A;  2FRW A;  1Z9Z A;  3SHW A;  3M0U A;  2O2O A;  2RF0 A;  2ROT A;  2YSQ A;  1BB9 A;  1ABO A;  4AFS C;  2FPE A;  1TUD A;  2ROL A;  4R0K A;  1VA7 A;  2LCS A;  1QLY A;  3NMZ C;  2KE9 A;  2A08 A;  5FWB A;  2OJ2 A;  2LZ6 B;  1SHF A;  1ZUU A;  2F2V A;  2CDT A;  2ECZ A;  2BTT A;  1HSQ A;  3LH5 A;  1HJD A;  2FPD A;  1E6H A;  2CH4 A;  2DA9 A;  2CT3 A;  2AK5 A;  3UA6 A;  2CUD A;  2YDL A;  2CRE A;  1PRM C;  4J9F A;  2F2W A;  2DM1 A;  4X1V A;  1WLP B;  2HDA A;  2VKN A;  2I0N A;  3H41 A;  1AEY A;  1W1F A;  2JMA A;  4OMQ A;  2K79 A;  2ESW A;  1YNZ A;  4HVW A;  1T3S A;  4J9G A;  1M3B A;  1N5Z A;  1UGV A;  2KRS A;  1RLQ C;  2DMO A;  1UG1 A;  3M0Q A;  2LQN A;  4GLM A;  3VRZ A;  4Z89 A;  2AZV A;  2CH4 W;  1T0H A;  2M0Y A;  2DVJ A;  3ULR B;  3REA B;  1FMK A;  1JXM A;  2L0A A;  2EYZ A;  2YT6 A;  1ZBJ A;  2DL4 A;  2HCK A;  2JS0 A;  2LP5 A;  2LX7 A;  4D8D A;  2JM9 A;  4J9C A;  1K76 A;  1AWW A;  1PHT A;  1MV0 B;  2F2X A;  4Z88 A;  1SSH A;  2FRY A;  3JV3 A;  1GFC A;  3REB B;  3VS7 A;  2RQT A;  5I11 A;  1W70 A;  2CUB A;  2D0N A;  1UTI A;  2OI3 A;  1QKX A;  3UA7 A;  2DL5 A;  2MOX A;  2A37 A;  1JQQ A;  3PVQ A;  4JJC A;  4RTY A;  5IXB A;  3I9Q A;  2P4R A;  4OML A;  1G2B A;  2DL8 A;  1SRL A;  2DLP A;  1UDL A;  4OMP A;  4ZNX A;  5L23 A;  2M51 A;  2KT1 A;  1SRM A;  1TG0 A;  2J6F A;  1AZG B;  2X3X D;  4CC3 A;  1VYV A;  2XMF A;  2DBM A;  3IQL A;  2EGE A;  5HCK A;  5I22 A;  1OPL A;  1AWJ A;  5GJV B;  4EIK A;  1Y0M A;  2QDL A;  1AVZ C;  2W10 A;  3C0C A;  2CT4 A;  1JXO A;  1CKB A;  1HD3 A;  2ENM A;  1B07 A;  1GRI A;  1K0X A;  3U23 A;  1PKS A;  1U3O A;  2RN8 A;  1GL5 A;  1ZSG A;  5EC7 A;  3EG0 A;  1W6X A;  2YUO A;  1ZX6 A;  3VS4 A;  2SRC A;  3QWY A;  1M30 A;  2EGC A;  3R6N A;  1AWO A;  4QT7 A;  5IHK A;  1Y57 A;  4JZ3 A;  2A36 A;  2BZX A;  2LJ3 A;  1WXU A;  4GBQ A;  4HXJ A;  1B3Q A;  3I5S A;  2BZY A;  1Z9Q A;  2LJ1 A;  2VWF A;  1WI7 A;  1MV3 A;  4RTT A;  1OOT A;  1NLP C;  4RTX A;  1NG2 A;  1WFW A;  1BBZ A;  1M3C A;  2DIL A;  1I0C A;  2GQI A;  5IHI A;  2O88 A;  1H8K A;  1UEC A;  1V1C A;  3I35 A;  1MUZ A;  5IXF A;  2KNB B;  1X6G A;  2L3Q A;  4K11 A;  1UUE A;  1VYU A;  3TSZ A;  1X2Q A;  2AKL A;  2PNI A;  4JJB A;  2FO0 A;  3GBQ A;  2O9S A;  1JEG A;  2E5K A;  2RPN A;  1UJ0 A;  2KEA A;  5IHN A;  2KXC A;  4Y92 A;  2D8J A;  2EKH A;  1LCK A;  3SEM A;  2JMC A;  3TVT A;  2KR3 A;  4HVV A;  4OMN A;  4AG2 C;  2EW3 A;  4M4Z A;  4LE9 A;  1UE9 A;  4J9E A;  2J6K A;  1JU5 C;  2DBK A;  2JXB A;  1WIE A;  1ARK A;  2J7I A;  3EGU A;  1X6B A;  3PE0 A;  3VS1 A;  3M0P A;  4F14 A;  1GBR A;  4DEY A;  2RNA A;  2FG0 A;  2EYY A;  5FWC A;  4AFZ C;  1PWT A;  4LNP A;  1NM7 A;  3I5R A;  5ECA A;  2YUQ A;  3EG2 A;  2IIM A;  2KBT A;  4CC7 A;  4AFU C;  3VRY A;  4DEX A;  2RQW A;  2GTJ A;  2DE0 X;  2A28 A;  3M0S A;  1QCF A;  1M3A A;  2MIO A;  3M0R A;  3VS2 A;  1S1N A;  1AD5 A;  3VS6 A;  1H3H A;  1CSK A;  5FW9 A;  2JM8 A;  1AZE A;  1U5S A;  3H0F A;  2DYB A;  2C0I A;  2FEI A;  4ORZ A;  2C0T A;  2L2P A;  1T0J A;  1K9A A;  2GGR A;  4LN2 A;  4HVU A;  3FJ5 A;  4RTW A;  2H8H A;  4JPB W;  1KIK A;  1M8M A;  2DL7 A;  2EYX A;  1E7O A;  1WXB A;  1FYN A;  1KFZ A;  2LQW A;  4E6R A;  3KFV A;  2HEQ A;  3RBB B;  1AOJ A;  3NHN A;  2DRM A;  2VVK A;  4FSS A;  3EHQ A;  2DL3 A;  2EQI A;  2KRO A;  2AZS A;  2JW4 A;  4J9H A;  2LJ0 A;  3O5Z A;  2K2M A;  1RLP C;  2GTO A;  2ED1 A;  4CC2 A;  3NPF A;  1NYF A;  2YUP A;  2LMJ A;  2YUN A;  1X2K A;  2AKK A;  2JTE A;  3TSW A;  3VS5 A;  1K0S A;  1YCS B;  1WYX A;  1G83 A;  2L3P A;  4RUG A;  4D8K A;  1XOV A;  2KRM A;  4KRT A;  1UHF A;  2ABL A;  1SHG A;  2KGT A;  2L3S A;  1ZUK A;  2NUZ A;  4JZ4 A;  2JS2 A;  2J06 A;  2DF6 A;  1X69 A;  1ZUY A;  1AWX A;  2PTK A;  2J6O A;  1UHC A;  1VYT A;  1GFD A;  4A63 B;  2EBP A;  1ZLM A;  3A98 A;  2X3W D;  1K4U S;  1RUW A;  4Z8A A;  2GBQ A;  1BK2 A;  1QKW A;  3PVL A;  1WX6 A;  4F16 A;  2EVR A;  2K3B A;  2W0Z A;  3H0I A;  2OAW A;  4OMM A;  1A0N B;  2NWM A;  1T3L A;  1WA7 A;  4J9I A;  1QWF A;  1SPK A;  1YWO A;  2PZ1 A;  3H0H A;  1E6G A;  3THK A;  2V1R A;  1OV3 A;  1JO8 A;  1WXT A;  2J05 A;  4RTU A;  2C0O A;  4IIM A;  1UJY A;  2CSI A;  4AFQ C;  4IIO A;  3UF4 A;  2DJQ A;  1H92 A;  1IO6 A;  4HCK A;  1TUC A;  1PRL C;  1EFN A;  2RQU A;  2V1Q A;  2HBW A;  2SEM A;  3RNJ A;  3VS3 A;  3EG1 A;  2DNU A;  1NLO C;  1KJW A;  1SEM A;  2BZ8 A;  1NYG A;  1PKT A;  1YP5 A;  4WCI A;  2KT8 A;  2JT4 A;  1WDX A;  4J9D A;  1X43 A;  2K6D A;  5GJW B;  3UAT A;  3M0T A;  4CC4 B;  4ESR A;  3EHR A;  1KSW A;  4LUE A;  1U06 A;  2MCN A;  2O9V A;  1YN8 A;  3EG3 A;  2O31 A;  2B86 A;  2GNC A;  2KYM A;  1GCQ A;  3ZL7 C;  2DX1 A;  1RI9 A;  2CSQ A;  1K1Z A;  2G6F X;  2ED0 A;  2D8H A;  2LNH B;  1OPK A;  1J3T A;  2EPD A;  5IH2 A;  4OMO A;  2KXD A;  2HSP A;  1PNJ A;  2RQR A;  2FPF A; 
#chains in the Genus database with same CATH topology
 4HT8 A;  1RI0 A;  1ABQ A;  1X27 A;  2EGA A;  2K7A A;  3QKJ A;  1QVF S;  1FX7 A;  1QWE A;  3CQT A;  1BU1 A;  4CRI A;  3TEE A;  2KAF A;  4NL3 A;  3EFR A;  4J9B A;  1UFF A;  2KRN A;  3VS0 A;  3JCM P;  2CS7 A;  2RMO A;  4LUD A;  1CKA A;  2JUF A;  4BI8 B;  2HQE A;  5C0M A;  4LDX A;  4M77 C;  3VU3 C;  3A8G B;  3CCQ T;  4OB1 B;  1PM3 A;  4A54 A;  4FW1 A;  4PJM A;  2ROL A;  5FU7 B;  4Y28 E;  3OS1 A;  2LCS A;  4O6J A;  3NMZ C;  2KE9 A;  4JS4 A;  1NBE B;  1KC8 U;  2OJ2 A;  4KGZ B;  1SHF A;  1ZUU A;  5AYF A;  1VOM A;  4IUP A;  1MMG A;  1E6H A;  2CH4 A;  2K3Y A;  1IRE B;  2YDL A;  4M7D A;  2ZPB B;  4XTX A;  1MMN A;  1VQP T;  1TS9 A;  1D1C A;  3EAE A;  3CC2 A;  1IB8 A;  4IKF A;  1S72 Q;  2LT1 A;  2VYT A;  4J9G A;  1M1F A;  3A8M B;  1QCO A;  2EWN A;  1KK7 A;  1RLQ C;  2MMP A;  1IGQ A;  5EG2 A;  4M78 B;  1YJW Q;  4Z89 A;  2AZV A;  4NL2 A;  5M9O A;  4HT9 A;  2CZ7 B;  3DLM A;  4N4I A;  5GMK h;  2P0P A;  1ZBJ A;  1MND A;  1Q81 R;  5GMK j;  4ZGJ B;  2P0K A;  3CC7 A;  1VQ5 T;  2JM9 A;  4J9C A;  1K76 A;  1WPY A;  2QA4 T;  1D3B B;  4EMK B;  1U1S A;  4J7F A;  1V29 B;  2EQU A;  2KDS A;  5FU6 B;  1GFC A;  4N0A C;  2RQT A;  2VXF A;  5I11 A;  5KYW B;  2D0N A;  2JJ9 A;  1Q86 R;  1RAF B;  2A37 A;  3P8H A;  1LNX A;  2XDP A;  4RKU E;  3HL8 A;  4A4F A;  2DLP A;  1MGQ A;  1X6O A;  4XTW A;  1UDL A;  2DFU A;  2K57 A;  2YRD A;  3OW2 S;  5DLQ E;  1SRM A;  2X3X D;  3BFM A;  1ZA1 B;  3FIF A;  2DBM A;  4IUU A;  1Q95 G;  2EGE A;  3H6Z A;  5A0L A;  3OYD A;  2CP5 A;  5GJV B;  1D1A A;  1K73 R;  2B8A A;  2RJF A;  3G71 A;  1CKB A;  1Q81 U;  1D3B A;  1K0X A;  3CCS A;  1QVG S;  5GAN 5;  4IUV A;  5EC7 A;  3VS4 A;  1M1K U;  3LWI A;  3JCM W;  1AWO A;  4XTU A;  1QCN A;  1Y57 A;  4JZ3 A;  2A36 A;  1WXU A;  1Z9Q A;  2LJ1 A;  4J7I A;  3CMA Q;  4BUG A;  5KCO A;  1ZSZ C;  3RKW A;  3SDZ A;  4RTT A;  1NLP C;  1BBZ A;  3OMC A;  1M3C A;  1QMC A;  3QJY A;  1Q82 U;  2FZK B;  2ATC B;  5IHI A;  5KYU B;  4Q5W A;  1HYO A;  3HFN A;  4DBH A;  4DOW A;  4F04 B;  2H3J A;  1Y7X A;  2L3Q A;  3CBM A;  1JJ2 P;  1UUE A;  1VYU A;  3TSZ A;  1C6V X;  2HBP A;  4RG2 A;  4JJB A;  2FO0 A;  1PD1 A;  4C0D C;  2XD0 A;  2E10 A;  1EZZ B;  3OBY A;  2G3R A;  3H8Z A;  1VIF A;  4M78 F;  2D8J A;  3QPH A;  1IXD A;  1N9R A;  2RJE A;  2DEU A;  2EW3 A;  4M4Z A;  2ZZD A;  4N4G A;  2COY A;  2J6K A;  2RHX A;  3CMA T;  3LWH A;  2QQ9 A;  2HQX A;  4NOY A;  1N8R R;  3M0P A;  4F14 A;  3CD6 A;  4FL6 A;  2FG0 A;  5FWC A;  3ZEH A;  4LNP A;  3N5B B;  2DD4 A;  3EG2 A;  2IIM A;  3M53 A;  3OQ5 A;  1VQ5 A;  2A28 A;  1QCF A;  2RJD A;  3VS2 A;  1S1N A;  5LJ5 f;  1AD5 A;  2MF2 A;  5KYY A;  1CSK A;  3M9Q A;  2BIV A;  2QQB A;  2XI9 A;  3CCU T;  2JM8 A;  3PIP A;  1QP3 A;  4QVD A;  4M77 F;  4M75 C;  3H0F A;  4PJN A;  1OYX A;  2AIR B;  5D6X A;  3NFC A;  2L2P A;  8AT1 B;  1ZQ1 A;  1T0J A;  4CI0 C;  2Z0W A;  2QG9 B;  3OW2 P;  3A8O B;  4J6X A;  2EYX A;  1ZSZ B;  2ZGW A;  5KYX B;  2KK4 A;  1N8R U;  1MMD A;  1RAI B;  2LQW A;  4E6R A;  4M7A F;  3RR6 A;  3CC4 Q;  1KHI A;  3JAM E;  4A53 A;  3M4G A;  3EGX A;  3EHQ A;  5L8R E;  2NUP B;  3OSV A;  2JW4 A;  3JCM V;  4J6Y A;  1N6A A;  2X4X A;  2LJ0 A;  3O5Z A;  1RLP C;  4OB2 B;  2GTO A;  1G8X A;  3RKY A;  2YUP A;  2QQS A;  4DOV A;  2YUN A;  5KYW A;  4PJO B;  2WSE E;  1RAD B;  5KE2 A;  2JTE A;  3VS5 A;  4PNO A;  4M7A D;  2RJC A;  4KRT A;  3TU4 K;  2PVO B;  4M7A E;  2JS2 A;  3DKM A;  3CCL T;  3NTI A;  2H3E B;  3O8V A;  2KMT A;  5IAY A;  4MZM A;  2J6O A;  3VYH B;  4FCY A;  5CVI A;  1YCY A;  5FLX E;  2V8I A;  3ME9 A;  3OBW A;  2KSS A;  1RAB B;  4Z8A A;  3Q1J A;  2M1H A;  3OA6 A;  3I55 T;  3PVL A;  1WX6 A;  1YJ9 T;  2W0Z A;  4RMO A;  4C5G A;  3V8K A;  5GAM d;  1PD0 A;  1YJN Q;  3CC7 Q;  4EPC A;  2PZ1 A;  3VV0 A;  3THK A;  2V1R A;  4JS5 A;  1KD1 C;  1JO8 A;  2O01 E;  4O5V A;  2QEX Q;  4L59 A;  1NPP A;  3QG1 A;  2VGN A;  2RHZ A;  3NTK A;  4IIO A;  2DJQ A;  3LX7 A;  4IUR A;  3I56 Q;  1IO6 A;  4HCK A;  1TUC A;  1JJ2 A;  1KHC A;  3RNJ A;  4BY6 C;  3CCE A;  1NLO C;  4JDS A;  1KJW A;  1SEM A;  1TUG B;  1OU9 A;  4M77 E;  3D7S B;  3CCJ T;  3CCV Q;  2LDM A;  4J9D A;  4C92 E;  5A0D A;  3M55 A;  2HAX A;  2MCN A;  2O9V A;  4JRK A;  4DA4 A;  3S3M A;  2QTV A;  4FYW B;  1FMV A;  4UC4 A;  3G4S T;  1GCQ A;  4PK4 A;  3ZL7 C;  5GAN f;  5GMK i;  3EGD B;  2EYQ A;  5I21 A;  4PKC C;  2CP3 A;  3M54 A;  4BDY A;  2KQW A;  5KYY B;  5IH2 A;  3CCV A;  4OMO A;  4ZGD B;  4QQ6 A;  1EX4 A;  3G6E Q;  2QGG A;  5GAO q;  4LXC A;  5CCA A;  3X24 B;  2V26 A;  4RTV A;  1Q7Y U;  2KYB A;  2RQV A;  2K9G A;  3BY7 A;  2D1X A;  4F17 A;  1I1J A;  2Y4Y A;  1QVG A;  2EYW A;  3HTR A;  3SB2 A;  3X20 B;  2V8K A;  1W2B A;  4OF1 A;  3QWX X;  3HSB A;  1Z9Z A;  1R0B G;  3EH1 A;  2GF7 A;  2RF0 A;  2EIF A;  1IRX A;  3I55 A;  1ABO A;  2QA4 Q;  3EG9 B;  3FRN A;  4R0K A;  1OZ3 A;  1VA7 A;  2RHY A;  1R8O B;  2A08 A;  2RO0 A;  5FWB A;  2LZ6 B;  1YFN A;  1ZSZ A;  4FT4 A;  2ECZ A;  3OYJ A;  1HJD A;  3LH5 A;  4NS5 A;  2FPD A;  2K5F A;  1YJN A;  3J7A F;  2CT3 A;  2AK5 A;  3UA6 A;  2P0Q A;  1VQ6 A;  2LRQ A;  2DM1 A;  1TU0 B;  4X1V A;  4KBM B;  3QZ9 B;  1WLP B;  2HDA A;  2LCL A;  1MHN A;  2EJF A;  1W1F A;  5D7U A;  5FU6 C;  2JMA A;  4LD6 A;  1QVF P;  4PFO A;  1VQL Q;  4DBR A;  4BD3 A;  4WF2 A;  3S3N A;  3SWN B;  1N5Z A;  4N0A A;  3CCR A;  1G3W A;  1WHK A;  5GAN 8;  3CME A;  2MWO A;  4GLM A;  3CCS T;  3QBY A;  1P92 A;  4FYY B;  3VRZ A;  1YIJ A;  2CH4 W;  1T0H A;  4M75 F;  2M0Y A;  1JXM A;  4WTO B;  1KQS S;  4PJO D;  2EYZ A;  4B9X A;  3QO3 A;  3OYM A;  5LJ5 e;  1UGS B;  3C95 A;  4ANJ A;  3BDU A;  1PHT A;  1RAE B;  3MEV A;  1UB4 A;  3VJP A;  3VS7 A;  3G6E A;  1W4S A;  3GOX A;  2MPX C;  4M7A G;  2CP7 A;  1UTI A;  2LQ8 A;  2CP6 A;  3BDL A;  4C8Q D;  3OYB A;  1QKX A;  4L5G A;  4XTY A;  3OB9 A;  4JRQ A;  3PVQ A;  5CAI A;  4RTY A;  5IXB A;  3LW5 E;  2P4R A;  2YLB A;  3OSS C;  3T9N A;  2IG0 A;  2DL8 A;  1SRL A;  4M75 G;  1B34 A;  3CC2 T;  1YBY A;  3MO8 A;  1ZA2 B;  2M51 A;  4FU6 A;  2VV5 A;  2DXT A;  3JB9 D;  1VQP A;  4YTL A;  1TG0 A;  2J6F A;  1OX9 A;  1M90 C;  3GLX A;  1I8F A;  5GAN 2;  2XID A;  1OPL A;  4PFP A;  2E6N A;  2YXY A;  2QQR A;  2QDL A;  2HKQ B;  3OYF A;  4XK8 E;  1Q86 U;  3VUB A;  4E7J A;  3URG A;  1H64 1;  4E7S A;  5KYN A;  3OYK A;  3G4S A;  1B07 A;  4HCC A;  2RN8 A;  1GL5 A;  3F70 A;  3E9F A;  2YUO A;  2VUB A;  1ZX6 A;  3PTA A;  2DO3 A;  1M30 A;  2RI3 A;  5GAN g;  2RHU A;  3PMI A;  5IHK A;  2LJ3 A;  3GNG A;  4GBQ A;  5I2M A;  1B3Q A;  2R58 A;  3I5S A;  5HKC A;  3P8B B;  3CCR T;  2QDY B;  4M75 D;  1UGP B;  2K4Y A;  1U1T A;  1VQM A;  1WJQ A;  4M75 B;  3X28 B;  3JB9 G;  1OOT A;  4RTX A;  1H8K A;  1KQS P;  1V1C A;  3I35 A;  5LJ3 d;  2VGM A;  2X9H A;  3OY9 A;  1M1K C;  2PNI A;  5HY6 A;  2YWW A;  2O9S A;  5DM7 R;  3TQ7 P;  1VQM Q;  1LJO A;  1YIT T;  8ATC B;  9ATC B;  1VQM T;  2DIQ A;  4M78 A;  1QVG P;  1KQ1 A;  3OYL A;  2KI7 A;  3LLR A;  4LE9 A;  2K5L A;  2DBK A;  2JXB A;  2ZPH B;  3CCR Q;  2E64 A;  3JCM Q;  4BE1 A;  5LJ3 h;  2D9T A;  3VS1 A;  1GBR A;  3I56 T;  3UDC A;  2M9U A;  2NUT A;  5LJ5 h;  3L2W A;  5ECA A;  2ZCF B;  2QEX T;  1S72 A;  4AFU C;  3VRY A;  2RQW A;  2XK0 A;  1XJW B;  1VQ9 Q;  1BYM A;  2MIO A;  4ELZ C;  1H3H A;  3CPW S;  3E19 A;  1VIE A;  4M7D D;  2OX7 A;  4PJO F;  1U5S A;  4EMK A;  5CR2 A;  2C0I A;  2JTF A;  4ORZ A;  3HKS A;  3MEA A;  3JCM h;  5KE3 A;  2XDB A;  4KT0 E;  3SWN A;  1S72 T;  1NJI C;  4PJJ A;  4P5N A;  4OGE A;  4E47 A;  2H8H A;  3J80 E;  1Q86 C;  2L5Q A;  3CCM Q;  2RHI A;  4XU3 A;  2DL7 A;  1SG5 A;  3MET A;  4C92 B;  1E7O A;  2O4X A;  2PVG B;  4C92 D;  2NUT B;  2VVK A;  4XU1 A;  2DL3 A;  4J9H A;  4E7H A;  2R57 A;  4M78 D;  3JCM g;  3CCE T;  2ED1 A;  3G4S Q;  4J83 A;  3LGF A;  3HRS A;  4XTZ A;  2MAM A;  5GAM h;  2L8D A;  1WJS A;  1YCS B;  4C8Q G;  4QQG A;  2L3P A;  3MPU B;  1PCX A;  5D6W A;  2E5Q A;  3CEY A;  4KUL A;  2JTM A;  2DIG A;  2L3S A;  4X9D A;  2NUZ A;  2J06 A;  1VQN T;  1WHH A;  3LGL A;  3ER0 A;  4MDX A;  5CO7 A;  1VYT A;  2O4X B;  2EBP A;  2WSF E;  2MYS A;  1K4U S;  5GAM g;  1MMA A;  5FU7 C;  1ZHI A;  3QJ6 A;  5GAO m;  3RMQ A;  3GPL A;  1PSF A;  1BK2 A;  4B6M A;  3X25 B;  4F16 A;  3H0I A;  1VQO T;  3PMT A;  1T3L A;  1WA7 A;  3CD6 T;  1WHM A;  3SFM A;  5I2S A;  2VAS A;  5CKH A;  3VKI A;  2NYS A;  5GMK m;  5GAM f;  1I4K 1;  3EGD A;  5AT1 B;  2CSI A;  1RAH B;  4AFQ C;  2YRC A;  4PFZ A;  3OYG A;  4JJN K;  1EFN A;  2LCC A;  2RQU A;  2V1Q A;  3VS3 A;  2EQJ A;  2P84 A;  1YIJ T;  2X4J A;  1NYG A;  1PKT A;  4WCI A;  4C92 A;  2RM4 A;  3S3O A;  2EAY A;  3CCL A;  2LQK A;  5GJW B;  4KH0 B;  3OYA A;  3INZ A;  1YIJ Q;  2FZC B;  1YJW A;  1YN8 A;  1K9M U;  2GNC A;  2JVV A;  3X26 B;  1D09 B;  1JBM A;  4F7U A;  2DX1 A;  1RI9 A;  1XNI A;  3TCJ A;  4C8Q A;  1VQ9 A;  1ZBX A;  3M59 A;  1M2V B;  1J3T A;  1R77 A;  4C0F A;  1W2B S;  4J8O A;  3E9G A;  2KXD A;  2HSP A;  1PNJ A;  3C94 A;  4ZGE B;  2RQR A;  2FPF A;  4MMK A;  4ATO A;  1VQ8 T;  4PJL A;  1GCP A;  4JLG A;  1NEG A;  3DB3 A;  4PJO A;  4RTZ A;  5CQY A;  5GAO l;  2DRK A;  1YWP A;  1MNE A;  5J26 A;  1NEB A;  1WJR A;  1NZ9 A;  2ZPE B;  3FEO A;  1GBQ A;  4A4H A;  4HCB A;  2RB6 A;  5CQX A;  3A5Z B;  1BB9 A;  2BE7 D;  4AFS C;  1O75 A;  3FDR A;  3FJP A;  3QZ5 B;  1QLY A;  2F5T X;  4BE2 A;  4MZT A;  3KBG A;  4BI4 A;  2BTT A;  1HSQ A;  1KC8 C;  2DA9 A;  1Q82 R;  2CUD A;  3CCS Q;  3E1S A;  3EFS A;  3JRZ A;  2QEX A;  3HRU A;  2VKN A;  2EQK A;  1YI2 Q;  2K5I A;  2I0N A;  3H41 A;  2MK5 A;  2LVM A;  2FL7 A;  2CYZ B;  2PQW A;  4N4H A;  2DAQ A;  2K79 A;  2PUK B;  3L2V A;  1T3S A;  4OGC A;  2M16 A;  1EIF A;  1UGV A;  2RI2 A;  2I2L A;  2OTL Q;  1VQK T;  1UG1 A;  4C0D B;  1K8A R;  3CD6 Q;  3JCM X;  2LC4 A;  4FYV B;  4LDW A;  2DVJ A;  3ULR B;  4LD9 K;  3REA B;  4BDZ A;  1FMK A;  1I5L A;  4RCC A;  5CKD A;  2DD5 A;  2HCK A;  2QI2 A;  2JS0 A;  2QQA A;  1BIA A;  2LP5 A;  3V7R A;  1G5V A;  2HSE B;  1SF9 A;  2LTO A;  1AWW A;  2GFU A;  4FIB A;  4M77 A;  1F1B B;  1RAC B;  1SSH A;  1KQ2 A;  2EFI A;  2MWP A;  1VQO A;  2FRY A;  2E12 A;  3CME Q;  1W70 A;  1WHL A;  1BKB A;  2CUB A;  2GCX A;  2OI3 A;  3GIB A;  5GAN d;  3UT1 A;  4LDY A;  1BI2 A;  1C1A A;  1JQQ A;  3HRT A;  4JJC A;  4C92 C;  5FRO A;  4ZTJ A;  4QVC A;  3I9Q A;  1N8R C;  4OML A;  1V76 A;  1VQ6 T;  3MJX A;  2DZ9 A;  5L23 A;  4IUT A;  2KT1 A;  3M58 A;  1M2O A;  4CC3 A;  1VYV A;  2QA4 A;  2XMF A;  1YIT A;  5I22 A;  2FYK A;  4F7U E;  1OI1 A;  4AT1 B;  4B9W A;  4EDU A;  2W10 A;  3C0C A;  1AHJ B;  1JXO A;  1VUB A;  1YJ9 Q;  4XU0 A;  2E41 A;  2ENM A;  1DJ7 B;  1VQ6 Q;  2K3X A;  3HHT B;  2QTX A;  1PKS A;  1U3O A;  3SD4 A;  5GAN h;  5GAO p;  1ZSG A;  4FT2 A;  1W6X A;  1VQ8 A;  1Q7Y R;  3QWY A;  2EGC A;  4X34 A;  3R6N A;  2DXU A;  4QT7 A;  3RIR A;  2DER A;  2BZX A;  3HP9 A;  4HXJ A;  1UGQ B;  1BI1 A;  2BZY A;  2R5M A;  1M1G A;  2HQH A;  2VWF A;  1NPR A;  4C92 G;  3MEU A;  3KUF A;  1TSF A;  1NG2 A;  2DIL A;  1I0C A;  2GQI A;  1VQ7 Q;  5DY9 A;  4A4G A;  1X6G A;  1PSE A;  1YJW T;  2DET A;  4K11 A;  4L6V 5;  1Y71 A;  1VQK Q;  3ZFJ A;  4M7A A;  3CBO A;  2PU9 B;  3GBQ A;  2M0O A;  4M78 C;  1JEG A;  2E5K A;  3V8J A;  4MML A;  5IT9 E;  3G7Z A;  2KEA A;  5IHN A;  3KXT A;  2KXC A;  4BB7 A;  4Y92 A;  3JCM e;  4DBQ A;  3CC2 Q;  5KYU A;  2EKH A;  1C0M A;  1VQ7 A;  1LCK A;  3SEM A;  2JMC A;  3FB9 A;  2KR3 A;  3OMG A;  5D6Y A;  3TVT A;  4DBF A;  1YHQ A;  3L2Q A;  5FRM A;  3A8L B;  3OS0 A;  1Y07 A;  1WIE A;  1ARK A;  1IZ6 A;  3EGU A;  5LJ5 j;  2CGH A;  2RNA A;  4DEY A;  1BCM A;  4ZN1 A;  2EYY A;  1LOJ A;  3OYI A;  1NJI R;  4AFZ C;  4X9C A;  1NM7 A;  2YUQ A;  1OX8 A;  2D6F A;  3V8L A;  2KBT A;  4CC7 A;  2HZY A;  4M78 E;  2DXC A;  4EMH A;  2DE0 X;  3CCM A;  4RCB A;  1YJ9 A;  5KH6 A;  4JRI A;  3ASK A;  3L2R A;  1VQO Q;  4KGX B;  2OTL A;  1Y96 A;  3MHX A;  1TOV A;  1VQ8 Q;  2ZAE A;  2XG8 D;  2FEI A;  5J39 A;  1M2V A;  2QYZ A;  5DLO A;  2C0T A;  4PJO C;  3M5A A;  3DB4 A;  5C6S A;  3OYH A;  1VQ5 Q;  2GGR A;  3JCM J;  2VC8 A;  4LN2 A;  2CZ1 B;  4HVU A;  3FJ5 A;  4RTW A;  5GAO r;  1KIK A;  1N9S A;  1K73 U;  4E7Z A;  4GLK A;  3KFV A;  2HEQ A;  2COZ A;  3RBB B;  3NHN A;  1I81 A;  4ME7 A;  2D0Q B;  2XHC A;  1XQH A;  2EQI A;  2E70 A;  3PIO A;  5GAN 4;  4R56 A;  3JCM b;  1JRI A;  4JLI A;  3OW2 A;  3NPF A;  2E65 A;  2F1L A;  4PLI A;  2PUO B;  3JCM c;  3G71 T;  2EQM A;  1VQ7 T;  3TSW A;  1K0S A;  4RUG A;  4D8K A;  1XOV A;  4M77 G;  3EGX B;  3CPW P;  2OTJ Q;  1M90 R;  2L3R A;  2BUD A;  1WZO A;  2DF6 A;  1X69 A;  1ZUY A;  1AWX A;  2PTK A;  4ZTF A;  4LDU A;  5GAN e;  1UHC A;  4FM4 B;  1GFD A;  4A63 B;  1ZLM A;  1RAG B;  4ELY C;  1WQW A;  4AMC A;  2X3W D;  4KGV B;  2A0F B;  4M75 A;  1ACM B;  4KH1 B;  1OU8 A;  3PFS A;  2VXE A;  4M7D B;  4FSX A;  2NWM A;  4J9I A;  1RAA B;  2WSC E;  4HCZ A;  1YWO A;  3QYG B;  1E6G A;  2DPP B;  1OV3 A;  1WXT A;  2LX9 A;  2J05 A;  4VUB A;  1UGR B;  3HPW A;  5IN1 A;  3VUZ A;  2A3L A;  4C8Q E;  3CCU Q;  2JZ2 A;  2JOY A;  3UF4 A;  2DVE A;  2ZPF B;  3QXE B;  1H92 A;  3E2U A;  1PRL C;  2A7Y A;  1VQL A;  2HBW A;  2L89 A;  2DNU A;  3L2U A;  2E1H A;  3OYC A;  2OAU A;  3P8D A;  1M90 U;  2KT8 A;  2JT4 A;  2RK1 A;  3SWN C;  1N27 A;  1I5O B;  3CCV T;  3UPU A;  1FMW A;  2K6D A;  2E3I A;  3M0T A;  4ESR A;  3JB9 J;  3RUX A;  1KSW A;  3L42 A;  4EMK C;  3CC4 A;  2O31 A;  2B86 A;  2DTI A;  4MZP A;  1VQN A;  2KYM A;  2X4Y A;  2JNG A;  3MP6 A;  3QDR B;  1AT1 B;  2KY9 A;  3EH2 A;  2EPD A;  3CCM T;  4M7D F;  5KCH A;  3CXC P;  1M1K R;  4KUI A;  2HD0 A;  3OS5 A;  2OTL T;  1KC8 R;  3RES A;  1LVK A;  1OEB A;  3S6W A;  4JJD A;  1VQK A;  2DXB A;  3GP8 A;  1VQ4 Q;  1O9S A;  3NGP A;  1FWZ A;  1GCQ C;  4E7K A;  2BE9 B;  4XTV A;  1I07 A;  4AG1 C;  1M27 C;  1G3S A;  4OP0 A;  4MDW A;  4ZN3 A;  2FRW A;  4BI3 A;  2DTH A;  3SHW A;  3M0U A;  2V8J A;  2O2O A;  2YLC A;  2ROT A;  2YSQ A;  4A4E A;  2M02 A;  2BKD N;  3V7S A;  2FPE A;  1TUD A;  2C06 A;  3OYE A;  1NE8 A;  2E3H A;  1G3Y A;  1YHQ Q;  2Y4X A;  2CDT A;  2F2V A;  4C8Q F;  3G71 Q;  1KQS A;  1D0X A;  2EJ9 A;  4PLL A;  2CRE A;  1PRM C;  4J9F A;  2F2W A;  1VQ4 T;  2ZPI B;  5LJ3 j;  3CCQ Q;  3H9N A;  4TVR A;  4C5H A;  5HK0 A;  1Q81 C;  1AEY A;  3RER A;  2P4T A;  2E6Z A;  4OMQ A;  2ESW A;  3OYN A;  1YNZ A;  4HVW A;  2DYI A;  1W2B P;  2DJZ A;  3PGG A;  5CIU A;  1M3B A;  3GNF B;  2KRS A;  2DMO A;  1H3Z A;  1SSF A;  2RK2 A;  4LDV A;  1QQJ A;  3M0Q A;  4C5I A;  1QW1 A;  2LQN A;  1KG1 A;  3FC3 A;  5FRN A;  5CKF A;  3PNW C;  2DKG A;  1VQN Q;  2L0A A;  2YT6 A;  2DL4 A;  1Q82 C;  2RD1 A;  3QYH B;  3LYI A;  4C5E A;  2LX7 A;  4D8D A;  1MV0 B;  3CCJ Q;  2F2X A;  1WQ7 A;  3CPF A;  4Z88 A;  1X75 C;  1LPL A;  2JN0 A;  3CME T;  3JV3 A;  3REB B;  4C8Q B;  2NLU A;  4KUD K;  1TH7 A;  3MP8 A;  1BI3 A;  4HA8 A;  3UA7 A;  2DL5 A;  2F5K A;  2MOX A;  1G3T A;  2LNV A;  2RI5 A;  2PVD B;  2KVQ G;  2LT4 A;  2QGF B;  1VQ9 T;  1G2B A;  3A8H B;  5GAM j;  1IHW A;  2CKK A;  5CKB A;  4OMP A;  3JCM d;  5A0G A;  4J5Y A;  2CZ6 B;  4ZNX A;  5LL6 S;  1TTH B;  1HK9 A;  1AZG B;  3QUI A;  4OVA A;  3I55 Q;  1D1B A;  3JCM f;  3IQL A;  5HCK A;  1M9S A;  3I56 A;  1AWJ A;  4EIK A;  1XTD A;  1Y0M A;  4C0G A;  5CK9 A;  1AVZ C;  2CT4 A;  3BW1 A;  2XU8 A;  1NJI U;  4J6W A;  5J3B A;  5LJ3 f;  4D6W A;  1HD3 A;  5HK3 A;  2RA2 A;  1GRI A;  3QDF A;  3U23 A;  3CCL Q;  1YHQ T;  4DQ2 A;  1M8V A;  3CCQ A;  4XU2 A;  3EG0 A;  3BE3 A;  3JSC A;  3CXC A;  1K73 C;  2HNI A;  4QKU A;  2SRC A;  3FLG A;  2DTO A;  1QVF A;  1QP2 A;  2AT1 B;  2CZ0 B;  2CP2 A;  2E4H A;  4RG8 A;  2K2V A;  1JJ2 S;  1BIB A;  4Z02 A;  1WI7 A;  7AT1 B;  1MV3 A;  3A1P A;  3JB9 F;  5GAN 7;  3AT1 B;  1WFW A;  2NUP A;  1B7T A;  2FB7 A;  3CCU A;  2O88 A;  4M78 G;  1RL2 A;  3MP1 A;  1UEC A;  4M7A C;  3L2Z A;  3RMS A;  1MUZ A;  5IXF A;  2KNB B;  2QXF A;  3MCA B;  4FYX B;  4QW2 A;  3CCE Q;  1KD1 U;  3J81 E;  1X2Q A;  1BI0 A;  2AKL A;  4QQD A;  4JUV A;  1WGS A;  1M5Q 1;  3JB9 I;  2RPN A;  1FXX A;  1UJ0 A;  2EKO A;  1YJN T;  4M77 D;  4OB0 B;  1YI2 A;  2HKN A;  3QHS A;  2WAC A;  2HMA A;  4M77 B;  1OQK A;  2YHT A;  4HVV A;  2QK0 A;  4OMN A;  4C92 F;  2OTJ A;  4AG2 C;  3G1J A;  3CC7 T;  3TRE A;  1UE9 A;  4J9E A;  1K8A C;  3QSU A;  1JU5 C;  3HFO A;  3EG9 A;  1X01 A;  2J7I A;  1X6B A;  3PE0 A;  2GQV A;  4HKE A;  5GMK e;  4II1 A;  2FZG B;  4R55 A;  1PWT A;  3M56 A;  1WNL A;  2EJG A;  3I5R A;  4M7D E;  2MI6 A;  4DEX A;  2GTJ A;  3M0S A;  1M3A A;  3M0R A;  3CCJ A;  2OTJ T;  3VS6 A;  1UEB A;  1Q7Y C;  3DLL A;  5FW9 A;  1WHG A;  5GMK l;  3ZBD A;  1K9M R;  5LJ3 e;  3MEW A;  2XKO C;  3JB9 H;  1PC0 A;  2RH2 A;  1AZE A;  4V2S A;  1KD1 R;  2QAS A;  1TWB A;  2DYB A;  3C4S A;  2DZC A;  4XAX B;  2XIC A;  3CXC S;  4E7I A;  4F7U G;  2VB6 A;  1K9A A;  4JPB W;  2CP0 A;  3OS2 A;  1M8M A;  1VQP Q;  1WXB A;  1FYN A;  1KFZ A;  1JB0 E;  1BCO A;  3WXM B;  1D0Z A;  2Y90 A;  1AOJ A;  2DRM A;  4QVZ A;  1YIT Q;  4FSS A;  4EMG A;  2KRO A;  2AZS A;  1IHV A;  4PJO E;  1B34 B;  4E7L A;  2K2M A;  1K9M C;  2X35 A;  4CC2 A;  1VQL T;  1NYF A;  3L1A A;  2LMJ A;  3R6O A;  1M4Z A;  4IUQ A;  2ZPG B;  4F7U F;  3EFO A;  1X2K A;  1HXD A;  2AKK A;  1WYX A;  1G83 A;  4XQ3 A;  2KRM A;  3CC4 T;  1UHF A;  2ABL A;  3M57 A;  1SHG A;  2KGT A;  2HL5 C;  3VYG A;  1SKU B;  1ZUK A;  4F7U B;  4M7D C;  5LJ3 g;  4JZ4 A;  2IVW A;  1PG5 B;  1OZ2 A;  4OB3 B;  3UWN A;  3CPW A;  1D0Y A;  5GAM e;  1U8R A;  4FW2 A;  5LJ5 g;  2GFA A;  2YRV A;  4BAC A;  1WHJ A;  5GAN 3;  3A98 A;  5GAN j;  1RUW A;  5GAO n;  1GXI E;  3AHU A;  2GBQ A;  1K8A U;  1QKW A;  4OMF B;  2FVU A;  3OYY A;  2EVR A;  2K3B A;  2COW A;  2OAW A;  4OMM A;  1A0N B;  2X4W A;  3M4Y A;  3MKD A;  4C8Q C;  4JRP A;  5CKE A;  1QWF A;  1SPK A;  3CMA A;  2F69 A;  3WVD B;  3H0H A;  2R5A A;  4PL6 A;  4PJO G;  6AT1 B;  1TXQ A;  3EFO B;  4GY5 A;  2XDD A;  3RDV A;  4RTU A;  2C0O A;  4IIM A;  1UJY A;  2FHD A;  5KYX A;  3LH0 A;  2SEM A;  3EG1 A;  1YI2 T;  2BZ8 A;  1YP5 A;  4A4K A;  2QAZ A;  1WDX A;  2DEQ A;  5LJ5 d;  1X43 A;  2IPO B;  3UAT A;  3CBP A;  4CC4 B;  4BE0 A;  1OUL A;  3EHR A;  4LUE A;  1U06 A;  3EG3 A;  1Y96 B;  4Y91 A;  5A2Q E;  4BY6 B;  4M7D G;  5GAN 6;  3G6E T;  1IGU A;  1VQ4 A;  2CSQ A;  1R0C B;  3V7C A;  1K1Z A;  2G6F X;  3WVE B;  3GF5 A;  2ED0 A;  3QII A;  2D8H A;  2LNH B;  4C0Z A;  2AHJ B;  1OPK A;  3RKX A;  2DK3 A;  1QVP A;  4M75 E;  3PT9 A;  2HL3 A;  3C12 A;  4E2F B;  3NTH A;  4M7A B;  2X51 A; 
#chains in the Genus database with same CATH homology
 1ABQ A;  1X27 A;  2EGA A;  2K7A A;  4RTV A;  2KYB A;  1QWE A;  3CQT A;  1BU1 A;  2RQV A;  1GCP A;  2K9G A;  1NEG A;  4RTZ A;  1OEB A;  2D1X A;  2DRK A;  4JJD A;  4F17 A;  1YWP A;  1I1J A;  3NGP A;  4J9B A;  1GCQ C;  1NEB A;  2EYW A;  1I07 A;  1UFF A;  1M27 C;  2KRN A;  3QWX X;  3VS0 A;  4AG1 C;  1GBQ A;  2RMO A;  4LUD A;  1CKA A;  2FRW A;  1Z9Z A;  3SHW A;  3M0U A;  2O2O A;  2RF0 A;  2ROT A;  2YSQ A;  1BB9 A;  1ABO A;  4AFS C;  2FPE A;  1TUD A;  2ROL A;  4R0K A;  1VA7 A;  2LCS A;  1QLY A;  3NMZ C;  2KE9 A;  2A08 A;  5FWB A;  2OJ2 A;  2LZ6 B;  1SHF A;  1ZUU A;  2F2V A;  2CDT A;  2ECZ A;  2BTT A;  1HSQ A;  3LH5 A;  1HJD A;  2FPD A;  1E6H A;  2CH4 A;  2DA9 A;  2CT3 A;  2AK5 A;  3UA6 A;  2CUD A;  2YDL A;  2CRE A;  1PRM C;  4J9F A;  2F2W A;  2DM1 A;  4X1V A;  1WLP B;  2HDA A;  2VKN A;  2I0N A;  3H41 A;  1AEY A;  1W1F A;  2JMA A;  4OMQ A;  2K79 A;  2ESW A;  1YNZ A;  4HVW A;  1T3S A;  4J9G A;  1M3B A;  1N5Z A;  1UGV A;  2KRS A;  1RLQ C;  2DMO A;  1UG1 A;  3M0Q A;  2LQN A;  4GLM A;  3VRZ A;  4Z89 A;  2AZV A;  2CH4 W;  1T0H A;  2M0Y A;  2DVJ A;  3ULR B;  3REA B;  1FMK A;  1JXM A;  2L0A A;  2EYZ A;  2YT6 A;  1ZBJ A;  2DL4 A;  2HCK A;  2JS0 A;  2LP5 A;  2LX7 A;  4D8D A;  2JM9 A;  4J9C A;  1K76 A;  1AWW A;  1PHT A;  1MV0 B;  2F2X A;  4Z88 A;  1SSH A;  2FRY A;  3JV3 A;  1GFC A;  3REB B;  3VS7 A;  2RQT A;  5I11 A;  1W70 A;  2CUB A;  2D0N A;  1UTI A;  2OI3 A;  1QKX A;  3UA7 A;  2DL5 A;  2MOX A;  2A37 A;  1JQQ A;  3PVQ A;  4JJC A;  4RTY A;  5IXB A;  3I9Q A;  2P4R A;  4OML A;  1G2B A;  2DL8 A;  1SRL A;  2DLP A;  1UDL A;  4OMP A;  4ZNX A;  5L23 A;  2M51 A;  2KT1 A;  1SRM A;  1TG0 A;  2J6F A;  1AZG B;  2X3X D;  4CC3 A;  1VYV A;  2XMF A;  2DBM A;  3IQL A;  2EGE A;  5HCK A;  5I22 A;  1OPL A;  1AWJ A;  5GJV B;  4EIK A;  1Y0M A;  2QDL A;  1AVZ C;  2W10 A;  3C0C A;  2CT4 A;  1JXO A;  1CKB A;  1HD3 A;  2ENM A;  1B07 A;  1GRI A;  1K0X A;  3U23 A;  1PKS A;  1U3O A;  2RN8 A;  1GL5 A;  1ZSG A;  5EC7 A;  3EG0 A;  1W6X A;  2YUO A;  1ZX6 A;  3VS4 A;  2SRC A;  3QWY A;  1M30 A;  2EGC A;  3R6N A;  1AWO A;  4QT7 A;  5IHK A;  1Y57 A;  4JZ3 A;  2A36 A;  2BZX A;  2LJ3 A;  1WXU A;  4GBQ A;  4HXJ A;  1B3Q A;  3I5S A;  2BZY A;  1Z9Q A;  2LJ1 A;  2VWF A;  1WI7 A;  1MV3 A;  4RTT A;  1OOT A;  1NLP C;  4RTX A;  1NG2 A;  1WFW A;  1BBZ A;  1M3C A;  2DIL A;  1I0C A;  2GQI A;  5IHI A;  2O88 A;  1H8K A;  1UEC A;  1V1C A;  3I35 A;  1MUZ A;  5IXF A;  2KNB B;  1X6G A;  2L3Q A;  4K11 A;  1UUE A;  1VYU A;  3TSZ A;  1X2Q A;  2AKL A;  2PNI A;  4JJB A;  2FO0 A;  3GBQ A;  2O9S A;  1JEG A;  2E5K A;  2RPN A;  1UJ0 A;  2KEA A;  5IHN A;  2KXC A;  4Y92 A;  2D8J A;  2EKH A;  1LCK A;  3SEM A;  2JMC A;  3TVT A;  2KR3 A;  4HVV A;  4OMN A;  4AG2 C;  2EW3 A;  4M4Z A;  4LE9 A;  1UE9 A;  4J9E A;  2J6K A;  1JU5 C;  2DBK A;  2JXB A;  1WIE A;  1ARK A;  2J7I A;  3EGU A;  1X6B A;  3PE0 A;  3VS1 A;  3M0P A;  4F14 A;  1GBR A;  4DEY A;  2RNA A;  2FG0 A;  2EYY A;  5FWC A;  4AFZ C;  1PWT A;  4LNP A;  1NM7 A;  3I5R A;  5ECA A;  2YUQ A;  3EG2 A;  2IIM A;  2KBT A;  4CC7 A;  4AFU C;  3VRY A;  4DEX A;  2RQW A;  2GTJ A;  2DE0 X;  2A28 A;  3M0S A;  1QCF A;  1M3A A;  2MIO A;  3M0R A;  3VS2 A;  1S1N A;  1AD5 A;  3VS6 A;  1H3H A;  1CSK A;  5FW9 A;  2JM8 A;  1AZE A;  1U5S A;  3H0F A;  2DYB A;  2C0I A;  2FEI A;  4ORZ A;  2C0T A;  2L2P A;  1T0J A;  1K9A A;  2GGR A;  4LN2 A;  4HVU A;  3FJ5 A;  4RTW A;  2H8H A;  4JPB W;  1KIK A;  1M8M A;  2DL7 A;  2EYX A;  1E7O A;  1WXB A;  1FYN A;  1KFZ A;  2LQW A;  4E6R A;  3KFV A;  2HEQ A;  3RBB B;  1AOJ A;  3NHN A;  2DRM A;  2VVK A;  4FSS A;  3EHQ A;  2DL3 A;  2EQI A;  2KRO A;  2AZS A;  2JW4 A;  4J9H A;  2LJ0 A;  3O5Z A;  2K2M A;  1RLP C;  2GTO A;  2ED1 A;  4CC2 A;  3NPF A;  1NYF A;  2YUP A;  2LMJ A;  2YUN A;  1X2K A;  2AKK A;  2JTE A;  3TSW A;  3VS5 A;  1K0S A;  1YCS B;  1WYX A;  1G83 A;  2L3P A;  4RUG A;  4D8K A;  1XOV A;  2KRM A;  4KRT A;  1UHF A;  2ABL A;  1SHG A;  2KGT A;  2L3S A;  1ZUK A;  2NUZ A;  4JZ4 A;  2JS2 A;  2J06 A;  2DF6 A;  1X69 A;  1ZUY A;  1AWX A;  2PTK A;  2J6O A;  1UHC A;  1VYT A;  1GFD A;  4A63 B;  2EBP A;  1ZLM A;  3A98 A;  2X3W D;  1K4U S;  1RUW A;  4Z8A A;  2GBQ A;  1BK2 A;  1QKW A;  3PVL A;  1WX6 A;  4F16 A;  2EVR A;  2K3B A;  2W0Z A;  3H0I A;  2OAW A;  4OMM A;  1A0N B;  2NWM A;  1T3L A;  1WA7 A;  4J9I A;  1QWF A;  1SPK A;  1YWO A;  2PZ1 A;  3H0H A;  1E6G A;  3THK A;  2V1R A;  1OV3 A;  1JO8 A;  1WXT A;  2J05 A;  4RTU A;  2C0O A;  4IIM A;  1UJY A;  2CSI A;  4AFQ C;  4IIO A;  3UF4 A;  2DJQ A;  1H92 A;  1IO6 A;  4HCK A;  1TUC A;  1PRL C;  1EFN A;  2RQU A;  2V1Q A;  2HBW A;  2SEM A;  3RNJ A;  3VS3 A;  3EG1 A;  2DNU A;  1NLO C;  1KJW A;  1SEM A;  2BZ8 A;  1NYG A;  1PKT A;  1YP5 A;  4WCI A;  2KT8 A;  2JT4 A;  1WDX A;  4J9D A;  1X43 A;  2K6D A;  5GJW B;  3UAT A;  3M0T A;  4CC4 B;  4ESR A;  3EHR A;  1KSW A;  4LUE A;  1U06 A;  2MCN A;  2O9V A;  1YN8 A;  3EG3 A;  2O31 A;  2B86 A;  2GNC A;  2KYM A;  1GCQ A;  3ZL7 C;  2DX1 A;  1RI9 A;  2CSQ A;  1K1Z A;  2G6F X;  2ED0 A;  2D8H A;  2LNH B;  1OPK A;  1J3T A;  2EPD A;  5IH2 A;  4OMO A;  2KXD A;  2HSP A;  1PNJ A;  2RQR A;  2FPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...