2E5KA

Solution structure of sh3 domain in suppressor of t-cell receptor signaling 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor of T-cell receptor signaling 1
publication title Solution structure of SH3 domain in Suppressor of T-cell receptor signaling 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2e5kA01
1E7OA 1PKSA 2MIOA 2FPEA 1VYVA 3QWYA 1X43A 3THKA 4ZNXA 2DMOA 4J9CA 2VKNA 1M8MA 1B3QA 3UF4A 2CSIA 4D8KA 1NEGA 1VYUA 1X6BA 1RI9A 2CSQA 2F2VA 2F2XA 2K7AA 2JS2A 3SEMA 1BB9A 3ULRB 4Z8AA 5I11A 2J6OA 2BZYA 2KR3A 2E5KA 1FYNA 1H92A 1NYFA 1WFWA 2KT8A 3NGPA 5FWBA 4A63B 3SHWA 1U5SA 4CC7A 2KNBB 1GRIA 1RLQC 2FPDA 1OPKA 2JT4A 4OMQA 2CH4A 1I1JA 2HCKA 3VS7A 4CC2A 3VS0A 4OMPA 2JM8A 3VS1A 3IQLA 4D8DA 3CQTA 3ZL7C 2L2PA 1V1CA 4OMLA 2RPNA 1QKWA 2C0IA 2FO0A 2K6DA 1SEMA 1GFDA 2C0TA 1I0CA 4J9EA 4J9BA 2DL3A 1UHCA 4JZ3A 2HEQA 4J9IA 3UA6A 1TG0A 2BZXA 5GJVB 2LMJA 2ROLA 4K11A 5ECAA 1GCQA 2AKKA 2ED1A 1M3CA 2OJ2A 4RTWA 2DRMA 2DA9A 3JV3A 2VVKA 1T0JA 1K0XA 1GCPA 3FJ5A 1K9AA 1OOTA 2DL4A 1AWXA 1PKTA 1QCFA 3TSZA 2EVRA 2CT4A 4AFSC 1UECA 1X69A 5GJWB 1N5ZA 2K3BA 1GCQC 1JO8A 1JQQA 1FMKA 2X3WD 4DEXA 1WI7A 2ECZA 2J05A 1AVZC 1KSWA 1ZSGA 2A08A 1KIKA 2VWFA 2SEMA 1Y57A 1WIEA 3TSWA 2F2WA 1YWOA 1M30A 2GTJA 1BBZA 4RTYA 1NM7A 3GBQA 1ZLMA 4LE9A 2KE9A 1K1ZA 2H8HA 1S1NA 2EPDA 5IHIA 2ESWA 2ED0A 2XMFA 3EG3A 3TVTA 2JM9A 2M51A 4AG1C 1JXMA 1W1FA 1YN8A 4Y92A 4GLMA 4RTVA 2GGRA 1JXOA 3QWXX 3UA7A 1HSQA 1OPLA 2GQIA 1T0HA 2KEAA 1X2KA 4WCIA 1BK2A 2EYWA 2JMCA 3EGUA 4J9FA 3M0PA 5L23A 1HD3A 1TUCA 2FEIA 1UFFA 2V1QA 2RF0A 4QT7A 5IH2A 1WYXA 1WA7A 2KRMA 1GBQA 3R6NA 2JMAA 1BU1A 1PWTA 4F17A 2LX7A 3M0RA 2YUOA 1UGVA 1AWJA 2L3SA 4M4ZA 2BTTA 2YUPA 3KFVA 1GBRA 5IHKA 2G6FX 1Z9ZA 1WXUA 2HBWA 2JS0A 1EFNA 1X6GA 2EYYA 4LUEA 4JJBA 2EGEA 1NEBA 1UE9A 1VYTA 1E6HA 2V1RA 1RLPC 3M0TA 2GTOA 1G2BA 2KT1A 1CSKA 1AEYA 1ABQA 3UATA 1CKBA 2RMOA 1AOJA 2KBTA 2LCSA 1W70A 2W0ZA 3H41A 4ORZA 1U06A 4IIMA 2YDLA 2DF6A 1ZX6A 4RTXA 2EGAA 2X3XD 2DLPA 2I0NA 2MCNA 4AG2C 1E6GA 1MUZA 2JTEA 2CREA 4HVVA 3M0SA 1WLPB 2SRCA 2DBMA 1WX6A 1SHFA 2KYMA 2NWMA 1MV3A 3EG1A 1ZBJA 4J9HA 3VS4A 4AFZC 1UTIA 2PTKA 1HJDA 2YT6A 2NUZA 1PRLC 1M3AA 1X2QA 1T3SA 1YP5A 2OI3A 2RQRA 2EBPA 2LQWA 2RQVA 4Z89A 3I35A 2DVJA 2AZSA 5HCKA 4X1VA 1AWWA 4F16A 2ROTA 1SRMA 1PRMC 1Z9QA 3RNJA 3VRZA 2FG0A 1UDLA 1A0NB 2OAWA 2EKHA 4J9DA 3PE0A 2QDLA 1AD5A 2EGCA 2IIMA 4RTTA 3VS2A 1Y0MA 2A36A 2FRWA 1WXBA 2J6KA 4RTZA 1OV3A 1ZUUA 2RQUA 1GFCA 1M27C 4AFUC 2DJQA 1KJWA 3O5ZA 2EW3A 2KXCA 3LH5A 2J06A 4HXJA 2KRNA 2YUQA 3M0QA 1SHGA 1QWEA 1CKAA 1AZEA 3EG2A 1W6XA 2KGTA 4GBQA 1SSHA 2DL7A 2CDTA 2DYBA 2L3PA 1K4US 3VRYA 2D8HA 2LP5A 4JPBW 3REAB 2FRYA 2L3QA 2LNHB 1JEGA 2HSPA 2DNUA 2LJ0A 3PVQA 1JU5C 2RN8A 2EQIA 4RUGA 4J9GA 1SPKA 5EC7A 3I9QA 2KXDA 4EIKA 2EYZA 4HVWA 2A37A 5FWCA 1OEBA 1X27A 1WXTA 2RNAA 4HCKA 4AFQC 2P4RA 1NLPC 4Z88A 2DL5A 2HDAA 3H0FA 2GBQA 1B07A 1T3LA 2KYBA 1MV0B 1ZUKA 4E6RA 2BZ8A 2C0OA 1K76A 4OMOA 2O88A 2B86A 2K79A 3NMZC 2J6FA 2FPFA 1KFZA 4ESRA 1PHTA 1VA7A 1NLOC 1WDXA 2CUBA 1LCKA 1UHFA 4OMNA 1J3TA 2DM1A 2AZVA 2DRKA 2O9VA 1M3BA 5I22A 2O2OA 2K2MA 2M0YA 2EYXA 2O31A 2DBKA 2D8JA 5FW9A 2DL8A 5IXBA 2PNIA 3PVLA 1U3OA 2W10A 2ENMA 2D0NA 3VS3A 4FSSA 3EHRA 3NPFA 1ZUYA 4JJDA 2DILA 2YSQA 3H0IA 3I5RA 1UUEA 2DE0X 1QLYA 4IIOA 1QKXA 2LQNA 1NYGA 2L0AA 1I07A 3VS6A 1H3HA 2O9SA 2CH4W 1ABOA 2LJ3A 1UJYA 2GNCA 4CC4B 3M0UA 4CC3A 1UJ0A 2K9GA 1QWFA 1YNZA 1UG1A 4HVUA 3C0CA 4OMMA 2MOXA 2CUDA 4R0KA 2LJ1A 4LUDA 2DX1A 2PZ1A 1YCSB 1GL5A 1RUWA 2CT3A 1SRLA 4LNPA 2A28A 1AZGB 1YWPA 5IXFA 3U23A 3RBBB 3I5SA 2KROA 1PNJA 3EHQA 1G83A 2YUNA 1NG2A 2LZ6B 4LN2A 4KRTA 2JW4A 3NHNA 1ARKA 2AK5A 1IO6A 2RQWA 1K0SA 2AKLA 3H0HA 3EG0A 2D1XA 2KRSA 3REBB 1AWOA 1TUDA 2J7IA 4DEYA 2JXBA 4F14A 3VS5A 4RTUA 1H8KA 1XOVA 2ABLA 4JJCA 5IHNA 4JZ4A 2RQTA 3A98A
chains in the Genus database with same CATH superfamily
3FLGA 5A0LA 1G5VA 4ZNXA 2DMOA 2GFAA 3OW2A 4C8QE 2E10A 1YJ9Q 1NEGA 1X6BA 3CMAQ 5IAYA 5GAMj 2F2VA 2K7AA 2YLCA 2CGHA 2JS2A 1IHWA 3ULRB 1WJRA 1YITA 4Z8AA 1QMCA 2JOYA 4C8QD 5LL6S 4IUUA 2K5FA 2PQWA 2YRDA 3DLLA 5DLOA 4FSXA 3TREA 3EFSA 2LVMA 4BDYA 4MDWA 3SHWA 3ZBDA 2KNBB 3S3OA 4C5EA 1GRIA 1RLQC 1Y96A 3L2WA 2JT4A 1EZZB 1I1JA 2B8AA 3VS7A 1AT1B 3M58A 5I2MA 2L2PA 1KK7A 2GF7A 4R55A 4BI8B 1OZ2A 2EJGA 2FO0A 1I0CA 3UT1A 1UHCA 2AIRB 4J9IA 5GJVB 4K11A 3X28B 4M7AG 2KMTA 2ED1A 4J5YA 2JNGA 4F04B 4PJOG 3JV3A 1X01A 1TS9A 2VVKA 3HL8A 1GCPA 3FJ5A 2PVDB 1HK9A 2DL4A 1WHJA 4PK4A 3RMQA 2PU9B 4GLKA 5CQXA 3RDVA 1W2BA 4J6XA 4E2FB 1JB0E 3JB9D 2MMPA 3P8BB 1JQQA 2X3WD 1C6VX 2E12A 1D3BA 3G71A 2YHTA 4E7HA 4ZGJB 1KSWA 1ZSGA 3OBWA 2SEMA 1Y57A 1VQ6Q 3TSWA 3CC2A 4MZPA 2D0QB 2DXCA 3CCVT 4O6JA 1NM7A 1OU8A 1LJOA 2IG0A 1ZLMA 5GMKl 4HCBA 2FZGB 5FU7C 2ED0A 1NJIR 1N8RU 2WSFE 3TVTA 3G4SA 1VQ4A 1VQMA 3CCSA 4AT1B 2YRVA 2E41A 1JXOA 5KYUB 2OTLQ 1Q82U 1HSQA 1VIEA 1NE8A 2DPPB 5IT9E 3KBGA 4WCIA 1YIJT 1K9MC 1BK2A 4OGCA 3MEAA 4J9FA 3QZ5B 3NTIA 3HRSA 1JJ2A 3N5BB 1I8FA 2HMAA 4F17A 2LX7A 3M0RA 1K8AU 3ER0A 1AWJA 1VQ8Q 1LPLA 2YUPA 3A8LB 3KFVA 5D6XA 1WXUA 2HBWA 1WHKA 1EFNA 2JTFA 3QYHB 3HSBA 1NZ9A 2EYYA 5A0DA 2ZGWA 2JJ9A 2MF2A 1E6HA 1FMVA 3L2RA 2AT1B 2KT1A 3CC7T 3CC4T 1ABQA 3OYAA 3CCJA 2O4XB 1BI0A 1YHQT 2CP7A 5CVIA 2LQKA 2QEXT 2VGMA 3JCMb 1VQ5A 3H41A 3PT9A 4BE2A 4IIMA 4M7AE 3RUXA 3OB9A 1VQPT 3GPLA 4PJOE 2RHIA 4E7JA 1Q95G 2I0NA 2K3XA 2MCNA 4OB0B 1MUZA 1RAGB 4M7AD 1S72Q 1WX6A 1SHFA 3CCEQ 3WVEB 4A4FA 4PJOD 1UTIA 1IHVA 5C6SA 5KYWB 1HJDA 5GMKh 2X35A 1PRLC 1M3AA 3L2ZA 2BKDN 5GAN5 2WSEE 2EBPA 3HPWA 4DBQA 3I35A 2DVJA 2AZSA 3OMGA 1QW1A 3LGFA 3V8KA 2ZZDA 2MYSA 1PRMC 1Z9QA 3L2VA 2G3RA 4M78G 5L8RE 1UDLA 5LJ5e 2E6ZA 2XDPA 5GAOl 3J80E 1A0NB 4KH0B 1AD5A 1KHCA 3BE3A 5CO7A 5LJ3g 1OV3A 1ZUUA 4AFUC 5GAN3 2QXFA 2KXCA 4FL6A 3LH5A 1M1KU 3OYMA 3QBYA 1SHGA 4D6WA 1IRXA 4MMKA 3WVDB 4DOVA 1TWBA 4B9WA 3EG2A 1W6XA 1SSHA 2CDTA 4EMKC 5J26A 3P8HA 1FX7A 3EGDB 2O4XA 3X25B 2JZ2A 4JPBW 3REAB 2L3QA 3PVQA 2LJ0A 4F7UB 3H8ZA 2RN8A 3V8LA 2EQIA 4RUGA 3LW5E 1SPKA 3QIIA 3QXEB 1G3YA 4M75C 5KH6A 3CCUT 1OEBA 1R8OB 5GAMd 2RNAA 1YI2T 3BDUA 2QDYB 1KG1A 2RI3A 3MCAB 9ATCB 5KYWA 3LH0A 1XJWB 5GAMf 3INZA 2GBQA 2KYBA 1M90R 3CCVA 1MV0B 1TUGB 3GOXA 4LDVA 4OMOA 2O88A 5FU6B 2K79A 4C0DC 3NMZC 1VOMA 3URGA 1KFZA 4M75F 2PVOB 1PHTA 4XTVA 1VUBA 1NLOC 5GAOn 3SB2A 2DTIA 3F70A 4FU6A 2E64A 4C0ZA 2AZVA 1B34A 1PCXA 2O9VA 2YLBA 1PD1A 3JCMg 4FYXB 2M0YA 1YIJA 2CP0A 3JCMW 3OBYA 1QQJA 1U3OA 1YJNA 1OX8A 4C92B 3S3MA 4C5HA 2VASA 3EHRA 4FW2A 3H0IA 3I5RA 2DE0X 5GAN7 1I07A 2O9SA 2QGGA 3QG1A 3CBOA 2VUBA 2HQXA 4OVAA 1N9SA 3CPFA 4XU0A 2GCXA 3EGDA 3HHTB 4LDYA 4AMCA 1LNXA 1UG1A 4HVUA 1TSFA 4OMMA 2MOXA 1ACMB 2DX1A 3HRTA 3CXCS 1MMGA 3QDRB 4F7UA 3C94A 4L5GA 3CMEA 4XU3A 2DVEA 1YWPA 2H3JA 2DZCA 2XICA 5AT1B 3CC4A 2KROA 3MPUB 5LJ3h 1YHQA 2QK0A 1G83A 4KULA 4ZN1A 2QEXA 1UEBA 3CPWS 2LZ6B 4LN2A 2JW4A 5GANh 3MEWA 2AK5A 3CD6T 5J39A 1WQWA 4QQDA 2AKLA 4B6MA 1VQPA 2I2LA 4DBHA 3BFMA 3EG9A 1BYMA 1AWOA 2EQJA 2J7IA 2JXBA 4F14A 4A54A 4RTUA 4M77C 4E7LA 4MZMA 3SWNB 5IHNA 2IPOB 4D8DA 4FT2A 3A98A 4BDZA 4FIBA 3QWYA 3THKA 1X43A 2P0QA 4NS5A 1NPRA 1FXXA 3UF4A 4D8KA 1QVGA 5EG2A 2F2XA 1Y71A 3UDCA 4NL3A 1R77A 5FU6C 1PSEA 1IZ6A 4C92A 3A1PA 3E9GA 4M77F 5I11A 4N4HA 1VQOT 2E5KA 5IN1A 2CKKA 1H92A 4M78F 4M7DA 5J3BA 2KT8A 4HCZA 3RR6A 5FWBA 1PG5B 1UB4A 1XNIA 2M1HA 1X75C 1QVGP 2E65A 1BCMA 2COZA 4C92C 4A4HA 3M4YA 2BIVA 2CH4A 2HCKA 4M7DC 4A53A 4CC2A 3I55A 4OMPA 4ANJA 3I56Q 2JM8A 1K73U 1TXQA 2RHXA 2RPNA 4PNOA 2C0IA 2K6DA 5CAIA 2HEQA 4E7SA 2ROLA 3C95A 3J7AF 5CK9A 2DAQA 5ECAA 4HA8A 1D1BA 1M3CA 4PFOA 2EJ9A 4M7DF 2DA9A 4YTLA 3CCUA 1T0JA 1YI2A 5LJ5h 1K9AA 4E7KA 2GQVA 1OOTA 3SWNA 2HD0A 4BI4A 1PKTA 1C1AA 1DJ7B 2PVGB 1YITQ 3CCQT 4AFSC 1Q7YC 2WSCE 1RADB 3O8VA 1RABB 1JO8A 4QVDA 1KC8U 1H641 1WI7A 2BUDA 1AVZC 2A08A 2VWFA 4PFZA 1YWOA 1N9RA 1ZSZB 4EMHA 2Z0WA 3SWNC 2GTJA 3SDZA 2KQWA 4LE9A 1K1ZA 1VQNT 2QQAA 4OP0A 1S1NA 5HY6A 3FRNA 1OX9A 2JM9A 2E3HA 2RHUA 3PNWC 3L2QA 3UA7A 1KQSS 1OPLA 1T0HA 2QAZA 3LGLA 4KUDK 2A3LA 1OYXA 2EKOA 3OS2A 5GAMe 4RMOA 1TUCA 2XG8D 1UFFA 2RF0A 4QT7A 1Q82R 1VQ9A 5IH2A 2OTLT 1WYXA 1WA7A 2LX9A 3QUIA 3GNGA 2JMAA 5CIUA 1QVFS 1BCOA 2XDDA 3PFSA 1BI2A 1HYOA 1G3WA 1P92A 3M59A 1GBRA 2X9HA 3CCMA 1YCYA 2G6FX 4QKUA 2ZAEA 1K8AR 1SG5A 5I21A 3G71Q 3OW2P 1NEBA 3CC2Q 1D1CA 3CD6A 1RLPC 3M0TA 1G2BA 4JS5A 3L2UA 2OTJA 1AEYA 4BE0A 1PC0A 2LCSA 2RMOA 5FROA 3EH1A 3NTHA 1W70A 4C8QA 3G4SQ 1VQ4Q 2YDLA 1VQMQ 3CCSQ 2DLPA 3OYKA 1WQ7A 1M1GA 2DXTA 1LVKA 2JTEA 3P8DA 1JRIA 2CREA 4BD3A 1IREB 2QA4T 3EG1A 2DBMA 2NWMA 1MV3A 4AFZC 4IUPA 2PTKA 2M16A 4C8QC 1MMDA 2L8DA 2KDSA 1YP5A 1UGRB 1VQOA 1YJWT 2LQWA 1OQKA 2RA2A 3GP8A 1Q86R 3CCET 3LWHA 1VQ7T 2DKGA 5HCKA 1VQLT 2ROTA 4FW1A 3RNJA 2FG0A 2QQSA 1WJSA 4NOYA 2OAWA 2EKHA 2NLUA 5FLXE 2QDLA 3A8MB 5CKDA 3PIOA 2IIMA 2Y4XA 4RTTA 2DYIA 1Y0MA 3OYCA 1M27C 2DJQA 4M75G 3O5ZA 4E7ZA 3CCRQ 1I81A 1W2BP 4N4GA 4HXJA 1PSFA 2PUKB 1VQ5Q 2COYA 2K3YA 2LRQA 2DL7A 1D09B 3A8GB 8AT1B 4BY6B 3VRYA 5KYXB 2H3EB 2HBPA 2LP5A 3BW1A 1GXIE 5KE2A 1JEGA 2DNUA 2DXBA 3RMSA 1JU5C 4M7AB 5CKFA 4KBMB 4L59A 2E3IA 4J9GA 3CCQA 5DY9A 4OMFB 5EC7A 3I9QA 4PJOB 1WHHA 2EYZA 3RKWA 2A37A 1NBEB 1Q86C 3AT1B 1X27A 3OQ5A 1M2VB 4XTYA 4AFQC 2LNVA 1FMWA 4Z88A 3VYGA 4DOWA 4KGXB 3H0FA 1JJ2P 1T3LA 2QGFB 1ZUKA 2C0OA 2MK5A 2EQUA 2HQHA 2B86A 4PFPA 1VQNA 1EIFA 2J6FA 4ZGDB 2FPFA 1O75A 1NJIC 1VA7A 1EX4A 4Q5WA 4DA4A 1WDXA 4CRIA 1UGQB 2QYZA 2NUTB 3JCMc 1VQKT 2ZPGB 1UHFA 3H6ZA 1WJQA 3OY9A 3FDRA 3G6ET 2DRKA 2KK4A 5I22A 2O2OA 2K2MA 1K9MU 3TQ7P 3MHXA 2D8JA 5FW9A 2DXUA 2DL8A 2PNIA 4J7FA 5GAN4 2W10A 3JSCA 2ENMA 2OTLA 2HKQB 1TH7A 2M02A 3NPFA 4JJDA 4ZGEB 3C4SA 3OYNA 2FYKA 2A0FB 2JTMA 2MI6A 5KYUA 2RHYA 2XD0A 1NYGA 3HKSA 3HRUA 2LJ3A 2NYSA 2GNCA 3M0UA 1U1SA 4B9XA 4M77G 2CUDA 4R0KA 4JJNK 1PM3A 4LD6A 5CCAA 3JB9I 4M75E 1YCSB 2LC4A 3HFOA 1GL5A 1RUWA 4JLGA 2A28A 5IXFA 3CCVQ 2Y90A 3EH2A 3ZEHA 1KD1R 4PJOA 3I5SA 1PNJA 4M75D 4KT0E 3TU4K 5GANg 1NG2A 2D6FA 3CEYA 4PLLA 4HCCA 3NFCA 1M2VA 3NHNA 5KE3A 1K0SA 2CZ1B 2EJFA 2WACA 2ZCFB 5GAMh 2KRSA 3REBB 5HKCA 3GNFB 3UPUA 2LCCA 1KQSA 4PJOC 1YIJQ 2QA4A 1H8KA 3JCMV 4JJCA 1YJNQ 3OSVA 4CI0C 4JZ4A 3EGXB 1E7OA 1YBYA 2FPEA 1D0XA 2KY9A 3TEEA 4M7DG 2X4XA 4J9CA 2VKNA 3M4GA 1YJWA 1QVFA 1B3QA 3CCEA 1VQ7A 2CSIA 1RI9A 1VQLA 2CSQA 3DKMA 4RKUE 4XTUA 1RAHB 2HAXA 2J6OA 3E19A 4J6WA 3OS1A 1NYFA 1WFWA 4HKEA 4J83A 3CMEQ 3NGPA 1WZOA 3CC4Q 3MP6A 1TOVA 4M78B 1KD1C 1U5SA 3X24B 2V26A 1YHQQ 2QEXQ 1PD0A 5CR2A 1MNEA 3A5ZB 4R56A 1OZ3A 2FPDA 1OPKA 2RH2A 2K5LA 4OMQA 3S3NA 4LDXA 1Q81R 1VQPQ 2VXFA 1OU9A 2K5IA 4KGVB 3VS0A 2FL7A 3VS1A 3WXMB 3JCMP 1KQ1A 2FZCB 4UC4A 1GFDA 2C0TA 4J9EA 4J9BA 2DL3A 4JZ3A 4JUVA 3UA6A 1WPYA 4L6V5 1TG0A 2BZXA 4M77E 3I56T 1RAFB 1K73R 4M78E 4J7IA 2OJ2A 3OS0A 4RTWA 4FYWB 2DRMA 4QQGA 3QZ9B 4RCBA 2E5QA 5LJ5g 2QQBA 4II1A 1MMAA 4M77D 2E6NA 1AWXA 3TSZA 4M78D 4XTXA 2EVRA 2CT4A 4IUQA 1UECA 1X69A 4PJJA 4XU1A 1N5ZA 3CC7A 2K3BA 1M90C 3OS5A 1FMKA 3FJPA 3OA6A 2M0OA 1M2OA 2J05A 3MP8A 2DD5A 3E1SA 1KIKA 5KCHA 2DJZA 4GY5A 2F2WA 3S6WA 3QKJA 1M30A 1BBZA 4RTYA 4KH1B 3GBQA 1VQKA 3G6EA 1KC8R 3VYHB 2KE9A 3RKYA 5IHIA 1BI3A 1Q81C 3I55Q 2XMFA 3G7ZA 1M5Q1 1JXMA 2RJDA 4Y92A 2EYQA 4M7DE 3ASKA 2QG9B 4GLMA 4X34A 4QW2A 1QP3A 2L3RA 2KEAA 5KYYB 1X2KA 1WHGA 1SF9A 3CCLT 2EYWA 5L23A 4M7DD 4F7UF 2FEIA 2V1QA 3TCJA 1SKUB 2KRMA 3CCUQ 2LT1A 1BU1A 1YI2Q 2DTHA 2E4HA 1UGVA 1IXDA 1OULA 1YJ9T 3CMAT 2BE7D 2M9UA 2QQRA 5IHKA 3RESA 1G3SA 2IVWA 4XAXB 4DBRA 2EGEA 2JUFA 2X4JA 4C8QG 1UE9A 1R0BG 2V1RA 4ME7A 2XI9A 3M57A 1I5LA 3EFOB 2GTOA 4BI3A 1C0MA 4EMGA 1CSKA 1D1AA 2P0KA 1NPPA 4OGEA 2KI7A 2NUPB 2KBTA 4ORZA 1U06A 1Y07A 1FWZA 2DF6A 1ZX6A 4RTXA 3PTAA 3JCMX 2RHZA 2HL5C 2KVQG 4IUVA 5GAN2 2YXYA 4C92F 2MPXC 4AG2C 3GF5A 4HVVA 1MNDA 2SRCA 3QDFA 3G4ST 1RL2A 1Y7XA 1VQ9Q 4ELZC 3PIPA 3LYIA 2COWA 2OI3A 3LLRA 3DB4A 4Z89A 3RERA 5KYYA 2OX7A 2DIQA 4X1VA 3CCMQ 4E7IA 5GAN8 1AWWA 4IURA 1HXDA 4PKCC 2EFIA 3JCMd 4P5NA 2AHJB 5DM7R 2DFUA 5GMKj 3OYHA 3JCMf 3FIFA 3QYGB 3VS2A 2A36A 1WXBA 3CD6Q 2J6KA 4RTZA 2RQUA 1QCOA 2RK1A 1GFCA 2OTJQ 1KJWA 2EQMA 4WTOB 5GMKm 1VQ6T 2EW3A 4PJMA 2RJCA 5AYFA 3M0QA 3OYJA 1CKAA 2DIGA 3DLMA 3J81E 3SD4A 3VU3C 3M55A 1N8RR 2FHDA 3I56A 3CCRT 3MEUA 2DYBA 4PL6A 2RD1A 3OYFA 2HQEA 2L3PA 5M9OA 1K4US 1WNLA 1WGSA 2D8HA 3OYIA 2FVUA 2NUPA 4PJNA 2ZPBB 1V76A 2HSPA 4RCCA 5GAOp 4C0FA 5FU7B 1Q7YU 1VQOQ 1D3BB 5GAOr 4HVWA 5FWCA 3T9NA 2L89A 1WXTA 4HT9A 3R6OA 1I4K1 1VQ8T 1I5OB 3FB9A 4LDUA 1U1TA 1B07A 5FRNA 2LDMA 4Z02A 2EWNA 4OB1B 2CZ7B 4OF1A 3VUBA 1ZA1B 2XK0A 3A8OB 4N0AA 5D6WA 2ZPFB 1X6OA 2QI2A 4OMNA 4JLIA 1ZSZA 1M3BA 3QJYA 4TVRA 3X26B 2R57A 3GLXA 2ZPHB 3CCLA 1N8RC 2O31A 3PVLA 4N0AC 1Q82C 4ZTFA 2EAYA 2L5QA 1K9MR 1UUEA 1QLYA 4C5IA 4IIOA 1QKXA 4QQ6A 1ZSZC 2L0AA 1S72T 1YJ9A 1ABOA 3CMAA 3CCQQ 3CXCA 4CC4B 4CC3A 1UJ0A 2K9GA 2PUOB 1YNZA 3C0CA 4OB3B 1K8AC 2P0PA 2X4YA 2F1LA 3V7SA 3OSSC 2DERA 2CT3A 1UGPB 4C8QF 3CPWA 2RJFA 5GAOm 3RKXA 3U23A 2EQKA 3CCJQ 2DD4A 1JBMA 1VQNQ 2HZYA 2YUNA 3CXCP 4ATOA 2K4YA 1TTHB 2JVVA 1IO6A 2RQWA 2HL3A 5GAMg 4DQ2A 4XK8E 2D1XA 3L1AA 1M1KR 3CPWP 3RIRA 4LD9K 5LJ3e 3QO3A 5LJ3j 2RQTA 5GMKi 5GANe 1PKSA 2MIOA 1ZQ1A 4A4GA 5CQYA 5GANj 5KYNA 1VYVA 4JRQA 2K57A 1M8MA 4A4KA 1VYUA 1YJNT 5CKEA 3PMTA 3PGGA 3SFMA 3SEMA 1BB9A 1BI1A 2FB7A 4ELYC 3E9FA 4EMKB 2C06A 2LTOA 1QVGS 2BZYA 2KR3A 1FYNA 2V8KA 2GFUA 3OYLA 2RM4A 7AT1B 4A63B 3JB9F 4MZTA 3HTRA 2LT4A 1N6AA 1VQ6A 4CC7A 3M53A 2R58A 2VC8A 2VV5A 4ZN3A 3CMET 2RI2A 1OI1A 4KGZB 4JS4A 4M75B 3MKDA 2EIFA 4HT8A 3LX7A 3A8HB 3CCRA 3IQLA 3OYEA 3CQTA 4J6YA 3ZL7C 1RAIB 1D0YA 1V1CA 2HKNA 1M1KC 4OMLA 2YWWA 2QA4Q 1QKWA 4E47A 1QVPA 2VXEA 4QVZA 3OYDA 1SEMA 3L42A 2DTOA 3M56A 4F7UG 2DEUA 2LMJA 4C0DB 1W4SA 4FT4A 4FYVB 3H9NA 1B7TA 1GCQA 5HK3A 2AKKA 1YJWQ 4FYYB 2V8JA 3JCMe 1Q86U 1VQ7Q 4ZTJA 4RG8A 5D7UA 5KYXA 2XDBA 1K0XA 1VQLQ 2RB6A 3BDLA 1QCFA 5A0GA 1VQ8A 3QJ6A 4XTZA 4M7AA 3QPHA 5GJWB 5A2QE 3EFRA 3FEOA 1GCQC 3VUZA 4FM4B 1WHMA 2QQ9A 4DEXA 3GIBA 3JCMQ 2ECZA 5FRMA 4BY6C 2P4TA 3X20B 1WIEA 1NJIU 4XU2A 5GAOq 1KHIA 1B34B 2CYZB 4EMKA 2LCLA 5LJ5j 4M7AC 3KXTA 2H8HA 2MWPA 2EPDA 2ESWA 4BE1A 3EG3A 2M51A 4AG1C 3CBPA 1W1FA 1YN8A 4EPCA 2XIDA 4RTVA 2GGRA 1M9SA 3QWXX 4C92G 2GQIA 3M54A 2NUTA 3I55T 1LOJA 1MHNA 2JMCA 1S72A 4M75A 1D0ZA 3EGUA 3M0PA 2BE9B 1HD3A 3JB9J 1MMNA 4M7AF 2DETA 1GBQA 4PJOF 3HP9A 3R6NA 3QHSA 1KQSP 1PWTA 3CBMA 3OW2S 1QCNA 2YUOA 2L3SA 4M4ZA 1ZA2B 1BKBA 2BTTA 4BUGA 2XKOC 3MEVA 4M77B 2YRCA 1Z9ZA 2F5TX 4IUTA 3CC7Q 5GAN6 2JS0A 3EAEA 8ATCB 1QVFP 1X6GA 4LUEA 4JJBA 1VYTA 3V7RA 3EG9B 4V2SA 2QTXA 2XHCA 1VQKQ 3G6EQ 3UATA 1AHJB 2VB6A 1CKBA 1AOJA 4KUIA 4F7UE 2W0ZA 4J8OA 2D9TA 3D7SB 3C12A 3LWIA 2EGAA 2X3XD 3VV0A 2X4WA 3AHUA 4MMLA 2KSSA 4NL2A 1RACB 3META 1E6GA 3ZFJA 1U8RA 2DZ9A 1MGQA 3KUFA 3M0SA 1WLPB 2KYMA 1ZBJA 4J9HA 4WF2A 3VS4A 2YT6A 2NUZA 1X2QA 5HK0A 4DBFA 4X9CA 4M7DB 4JRKA 3EGXA 1T3SA 2RQRA 2E70A 3JRZA 2RQVA 1ZBXA 4Y28E 1XQHA 1VQ9T 5CKBA 3ME9A 4C5GA 6AT1B 4F16A 1SRMA 1IGQA 5C0MA 2VYTA 1YITT 1KD1U 3VRZA 4X9DA 1W2BS 3E2UA 4J9DA 3PE0A 1QP2A 2EGCA 2ZPIB 3CCMT 2FRWA 2DO3A 2RO0A 3BY7A 1H3ZA 2RI5A 3MO8A 4C92E 4M77A 1TU0B 2J06A 3DB3A 3JB9H 2KRNA 4M78A 2YUQA 2HNIA 1QWEA 2MAMA 2K2VA 1AZEA 2CP5A 2KGTA 4C92D 4GBQA 5CKHA 2OTJT 1RAEB 3NTKA 2VGNA 4XQ3A 1K73C 5D6YA 2RJEA 4MDXA 5LJ3d 2FRYA 2LNHB 4M78C 2LQ8A 1SSFA 4PJLA 5GANd 1JJ2S 3Q1JA 5LJ3f 2KXDA 4EIKA 1G3TA 2X51A 1R0CB 2CS7A 1RI0A 1M90U 5GANf 1V29B 2ZPEB 2F5KA 4HCKA 1BIAA 2P4RA 1NLPC 4C0GA 2DL5A 4O5VA 1Q7YR 2HDAA 3MJXA 4JDSA 2Y4YA 1F1BB 4E6RA 2R5AA 2BZ8A 1BIBA 1K76A 1RAAB 2P84A 1UGSB 2RK2A 4N4IA 3G71T 2CP2A 1KC8C 4JRPA 1Q81U 4OB2B 1M4ZA 4ESRA 3CC2T 2CP3A 3JCMJ 4QVCA 1YFNA 1XTDA 2CUBA 1M1FA 3OYGA 1LCKA 1J3TA 2DM1A 2CP6A 3HFNA 1M8VA 2EYXA 3JCMh 2DBKA 2R5MA 2JN0A 3M5AA 2E1HA 1VQ4T 5IXBA 1VQMT 1IGUA 3CCST 1N27A 2D0NA 3VS3A 4A4EA 3VJPA 4FSSA 5I2SA 1ZUYA 2MWOA 2DILA 2CZ6B 2YSQA 1IB8A 2LQNA 3VS6A 1H3HA 2CH4W 5KCOA 3PMIA 3OYYA 1UJYA 3VKIA 2A7YA 1QWFA 1ZHIA 2ATCB 4PLIA 4BB7A 1Y96B 5GMKe 2LJ1A 1G8XA 4LUDA 2PZ1A 2QTVA 1WHLA 4Y91A 4EDUA 1SRLA 3QSUA 4LNPA 2KAFA 2V8IA 3JB9G 1AZGB 2HSEB 4VUBA 3V7CA 2QASA 3G1JA 3RBBB 3V8JA 3M9QA 4BACA 3EHQA 4C8QB 4LDWA 4RG2A 2DK3A 4KRTA 3JAME 1KQ2A 4FCYA 1ARKA 3OYBA 2O01E 5LJ5d 3UWNA 3FC3A 3H0HA 4LXCA 3CCJT 3EG0A 4XTWA 2XU8A 5DLQE 3EFOA 3OMCA 1TUDA 3MP1A 4DEYA 5LJ5f 3VS5A 1O9SA 3CCLQ 1VQ5T 1XOVA 2ABLA 2FZKB 2DEQA 1VIFA 4IKFA 2OAUA 2F69A 4JRIA 2CZ0B
chains in the Genus database with same CATH topology
1E7OA 1PKSA 2MIOA 2FPEA 1VYVA 3QWYA 1X43A 3THKA 4ZNXA 2DMOA 4J9CA 2VKNA 1M8MA 1B3QA 3UF4A 2CSIA 4D8KA 1NEGA 1VYUA 1X6BA 1RI9A 2CSQA 2F2VA 2F2XA 2K7AA 2JS2A 3SEMA 1BB9A 3ULRB 4Z8AA 5I11A 2J6OA 2BZYA 2KR3A 2E5KA 1FYNA 1H92A 1NYFA 1WFWA 2KT8A 3NGPA 5FWBA 4A63B 3SHWA 1U5SA 4CC7A 2KNBB 1GRIA 1RLQC 2FPDA 1OPKA 2JT4A 4OMQA 2CH4A 1I1JA 2HCKA 3VS7A 4CC2A 3VS0A 4OMPA 2JM8A 3VS1A 3IQLA 4D8DA 3CQTA 3ZL7C 2L2PA 1V1CA 4OMLA 2RPNA 1QKWA 2C0IA 2FO0A 2K6DA 1SEMA 1GFDA 2C0TA 1I0CA 4J9EA 4J9BA 2DL3A 1UHCA 4JZ3A 2HEQA 4J9IA 3UA6A 1TG0A 2BZXA 5GJVB 2LMJA 2ROLA 4K11A 5ECAA 1GCQA 2AKKA 2ED1A 1M3CA 2OJ2A 4RTWA 2DRMA 2DA9A 3JV3A 2VVKA 1T0JA 1K0XA 1GCPA 3FJ5A 1K9AA 1OOTA 2DL4A 1AWXA 1PKTA 1QCFA 3TSZA 2EVRA 2CT4A 4AFSC 1UECA 1X69A 5GJWB 1N5ZA 2K3BA 1GCQC 1JO8A 1JQQA 1FMKA 2X3WD 4DEXA 1WI7A 2ECZA 2J05A 1AVZC 1KSWA 1ZSGA 2A08A 1KIKA 2VWFA 2SEMA 1Y57A 1WIEA 3TSWA 2F2WA 1YWOA 1M30A 2GTJA 1BBZA 4RTYA 1NM7A 3GBQA 1ZLMA 4LE9A 2KE9A 1K1ZA 2H8HA 1S1NA 2EPDA 5IHIA 2ESWA 2ED0A 2XMFA 3EG3A 3TVTA 2JM9A 2M51A 4AG1C 1JXMA 1W1FA 1YN8A 4Y92A 4GLMA 4RTVA 2GGRA 1JXOA 3QWXX 3UA7A 1HSQA 1OPLA 2GQIA 1T0HA 2KEAA 1X2KA 4WCIA 1BK2A 2EYWA 2JMCA 3EGUA 4J9FA 3M0PA 5L23A 1HD3A 1TUCA 2FEIA 1UFFA 2V1QA 2RF0A 4QT7A 5IH2A 1WYXA 1WA7A 2KRMA 1GBQA 3R6NA 2JMAA 1BU1A 1PWTA 4F17A 2LX7A 3M0RA 2YUOA 1UGVA 1AWJA 2L3SA 4M4ZA 2BTTA 2YUPA 3KFVA 1GBRA 5IHKA 2G6FX 1Z9ZA 1WXUA 2HBWA 2JS0A 1EFNA 1X6GA 2EYYA 4LUEA 4JJBA 2EGEA 1NEBA 1UE9A 1VYTA 1E6HA 2V1RA 1RLPC 3M0TA 2GTOA 1G2BA 2KT1A 1CSKA 1AEYA 1ABQA 3UATA 1CKBA 2RMOA 1AOJA 2KBTA 2LCSA 1W70A 2W0ZA 3H41A 4ORZA 1U06A 4IIMA 2YDLA 2DF6A 1ZX6A 4RTXA 2EGAA 2X3XD 2DLPA 2I0NA 2MCNA 4AG2C 1E6GA 1MUZA 2JTEA 2CREA 4HVVA 3M0SA 1WLPB 2SRCA 2DBMA 1WX6A 1SHFA 2KYMA 2NWMA 1MV3A 3EG1A 1ZBJA 4J9HA 3VS4A 4AFZC 1UTIA 2PTKA 1HJDA 2YT6A 2NUZA 1PRLC 1M3AA 1X2QA 1T3SA 1YP5A 2OI3A 2RQRA 2EBPA 2LQWA 2RQVA 4Z89A 3I35A 2DVJA 2AZSA 5HCKA 4X1VA 1AWWA 4F16A 2ROTA 1SRMA 1PRMC 1Z9QA 3RNJA 3VRZA 2FG0A 1UDLA 1A0NB 2OAWA 2EKHA 4J9DA 3PE0A 2QDLA 1AD5A 2EGCA 2IIMA 4RTTA 3VS2A 1Y0MA 2A36A 2FRWA 1WXBA 2J6KA 4RTZA 1OV3A 1ZUUA 2RQUA 1GFCA 1M27C 4AFUC 2DJQA 1KJWA 3O5ZA 2EW3A 2KXCA 3LH5A 2J06A 4HXJA 2KRNA 2YUQA 3M0QA 1SHGA 1QWEA 1CKAA 1AZEA 3EG2A 1W6XA 2KGTA 4GBQA 1SSHA 2DL7A 2CDTA 2DYBA 2L3PA 1K4US 3VRYA 2D8HA 2LP5A 4JPBW 3REAB 2FRYA 2L3QA 2LNHB 1JEGA 2HSPA 2DNUA 2LJ0A 3PVQA 1JU5C 2RN8A 2EQIA 4RUGA 4J9GA 1SPKA 5EC7A 3I9QA 2KXDA 4EIKA 2EYZA 4HVWA 2A37A 5FWCA 1OEBA 1X27A 1WXTA 2RNAA 4HCKA 4AFQC 2P4RA 1NLPC 4Z88A 2DL5A 2HDAA 3H0FA 2GBQA 1B07A 1T3LA 2KYBA 1MV0B 1ZUKA 4E6RA 2BZ8A 2C0OA 1K76A 4OMOA 2O88A 2B86A 2K79A 3NMZC 2J6FA 2FPFA 1KFZA 4ESRA 1PHTA 1VA7A 1NLOC 1WDXA 2CUBA 1LCKA 1UHFA 4OMNA 1J3TA 2DM1A 2AZVA 2DRKA 2O9VA 1M3BA 5I22A 2O2OA 2K2MA 2M0YA 2EYXA 2O31A 2DBKA 2D8JA 5FW9A 2DL8A 5IXBA 2PNIA 3PVLA 1U3OA 2W10A 2ENMA 2D0NA 3VS3A 4FSSA 3EHRA 3NPFA 1ZUYA 4JJDA 2DILA 2YSQA 3H0IA 3I5RA 1UUEA 2DE0X 1QLYA 4IIOA 1QKXA 2LQNA 1NYGA 2L0AA 1I07A 3VS6A 1H3HA 2O9SA 2CH4W 1ABOA 2LJ3A 1UJYA 2GNCA 4CC4B 3M0UA 4CC3A 1UJ0A 2K9GA 1QWFA 1YNZA 1UG1A 4HVUA 3C0CA 4OMMA 2MOXA 2CUDA 4R0KA 2LJ1A 4LUDA 2DX1A 2PZ1A 1YCSB 1GL5A 1RUWA 2CT3A 1SRLA 4LNPA 2A28A 1AZGB 1YWPA 5IXFA 3U23A 3RBBB 3I5SA 2KROA 1PNJA 3EHQA 1G83A 2YUNA 1NG2A 2LZ6B 4LN2A 4KRTA 2JW4A 3NHNA 1ARKA 2AK5A 1IO6A 2RQWA 1K0SA 2AKLA 3H0HA 3EG0A 2D1XA 2KRSA 3REBB 1AWOA 1TUDA 2J7IA 4DEYA 2JXBA 4F14A 3VS5A 4RTUA 1H8KA 1XOVA 2ABLA 4JJCA 5IHNA 4JZ4A 2RQTA 3A98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7O A;  1PKS A;  2MIO A;  2FPE A;  1VYV A;  3QWY A;  1X43 A;  3THK A;  4ZNX A;  2DMO A;  4J9C A;  2VKN A;  1M8M A;  1B3Q A;  3UF4 A;  2CSI A;  4D8K A;  1NEG A;  1VYU A;  1X6B A;  1RI9 A;  2CSQ A;  2F2V A;  2F2X A;  2K7A A;  2JS2 A;  3SEM A;  1BB9 A;  3ULR B;  4Z8A A;  5I11 A;  2J6O A;  2BZY A;  2KR3 A;  2E5K A;  1FYN A;  1H92 A;  1NYF A;  1WFW A;  2KT8 A;  3NGP A;  5FWB A;  4A63 B;  3SHW A;  1U5S A;  4CC7 A;  2KNB B;  1GRI A;  1RLQ C;  2FPD A;  1OPK A;  2JT4 A;  4OMQ A;  2CH4 A;  1I1J A;  2HCK A;  3VS7 A;  4CC2 A;  3VS0 A;  4OMP A;  2JM8 A;  3VS1 A;  3IQL A;  4D8D A;  3CQT A;  3ZL7 C;  2L2P A;  1V1C A;  4OML A;  2RPN A;  1QKW A;  2C0I A;  2FO0 A;  2K6D A;  1SEM A;  1GFD A;  2C0T A;  1I0C A;  4J9E A;  4J9B A;  2DL3 A;  1UHC A;  4JZ3 A;  2HEQ A;  4J9I A;  3UA6 A;  1TG0 A;  2BZX A;  5GJV B;  2LMJ A;  2ROL A;  4K11 A;  5ECA A;  1GCQ A;  2AKK A;  2ED1 A;  1M3C A;  2OJ2 A;  4RTW A;  2DRM A;  2DA9 A;  3JV3 A;  2VVK A;  1T0J A;  1K0X A;  1GCP A;  3FJ5 A;  1K9A A;  1OOT A;  2DL4 A;  1AWX A;  1PKT A;  1QCF A;  3TSZ A;  2EVR A;  2CT4 A;  4AFS C;  1UEC A;  1X69 A;  5GJW B;  1N5Z A;  2K3B A;  1GCQ C;  1JO8 A;  1JQQ A;  1FMK A;  2X3W D;  4DEX A;  1WI7 A;  2ECZ A;  2J05 A;  1AVZ C;  1KSW A;  1ZSG A;  2A08 A;  1KIK A;  2VWF A;  2SEM A;  1Y57 A;  1WIE A;  3TSW A;  2F2W A;  1YWO A;  1M30 A;  2GTJ A;  1BBZ A;  4RTY A;  1NM7 A;  3GBQ A;  1ZLM A;  4LE9 A;  2KE9 A;  1K1Z A;  2H8H A;  1S1N A;  2EPD A;  5IHI A;  2ESW A;  2ED0 A;  2XMF A;  3EG3 A;  3TVT A;  2JM9 A;  2M51 A;  4AG1 C;  1JXM A;  1W1F A;  1YN8 A;  4Y92 A;  4GLM A;  4RTV A;  2GGR A;  1JXO A;  3QWX X;  3UA7 A;  1HSQ A;  1OPL A;  2GQI A;  1T0H A;  2KEA A;  1X2K A;  4WCI A;  1BK2 A;  2EYW A;  2JMC A;  3EGU A;  4J9F A;  3M0P A;  5L23 A;  1HD3 A;  1TUC A;  2FEI A;  1UFF A;  2V1Q A;  2RF0 A;  4QT7 A;  5IH2 A;  1WYX A;  1WA7 A;  2KRM A;  1GBQ A;  3R6N A;  2JMA A;  1BU1 A;  1PWT A;  4F17 A;  2LX7 A;  3M0R A;  2YUO A;  1UGV A;  1AWJ A;  2L3S A;  4M4Z A;  2BTT A;  2YUP A;  3KFV A;  1GBR A;  5IHK A;  2G6F X;  1Z9Z A;  1WXU A;  2HBW A;  2JS0 A;  1EFN A;  1X6G A;  2EYY A;  4LUE A;  4JJB A;  2EGE A;  1NEB A;  1UE9 A;  1VYT A;  1E6H A;  2V1R A;  1RLP C;  3M0T A;  2GTO A;  1G2B A;  2KT1 A;  1CSK A;  1AEY A;  1ABQ A;  3UAT A;  1CKB A;  2RMO A;  1AOJ A;  2KBT A;  2LCS A;  1W70 A;  2W0Z A;  3H41 A;  4ORZ A;  1U06 A;  4IIM A;  2YDL A;  2DF6 A;  1ZX6 A;  4RTX A;  2EGA A;  2X3X D;  2DLP A;  2I0N A;  2MCN A;  4AG2 C;  1E6G A;  1MUZ A;  2JTE A;  2CRE A;  4HVV A;  3M0S A;  1WLP B;  2SRC A;  2DBM A;  1WX6 A;  1SHF A;  2KYM A;  2NWM A;  1MV3 A;  3EG1 A;  1ZBJ A;  4J9H A;  3VS4 A;  4AFZ C;  1UTI A;  2PTK A;  1HJD A;  2YT6 A;  2NUZ A;  1PRL C;  1M3A A;  1X2Q A;  1T3S A;  1YP5 A;  2OI3 A;  2RQR A;  2EBP A;  2LQW A;  2RQV A;  4Z89 A;  3I35 A;  2DVJ A;  2AZS A;  5HCK A;  4X1V A;  1AWW A;  4F16 A;  2ROT A;  1SRM A;  1PRM C;  1Z9Q A;  3RNJ A;  3VRZ A;  2FG0 A;  1UDL A;  1A0N B;  2OAW A;  2EKH A;  4J9D A;  3PE0 A;  2QDL A;  1AD5 A;  2EGC A;  2IIM A;  4RTT A;  3VS2 A;  1Y0M A;  2A36 A;  2FRW A;  1WXB A;  2J6K A;  4RTZ A;  1OV3 A;  1ZUU A;  2RQU A;  1GFC A;  1M27 C;  4AFU C;  2DJQ A;  1KJW A;  3O5Z A;  2EW3 A;  2KXC A;  3LH5 A;  2J06 A;  4HXJ A;  2KRN A;  2YUQ A;  3M0Q A;  1SHG A;  1QWE A;  1CKA A;  1AZE A;  3EG2 A;  1W6X A;  2KGT A;  4GBQ A;  1SSH A;  2DL7 A;  2CDT A;  2DYB A;  2L3P A;  1K4U S;  3VRY A;  2D8H A;  2LP5 A;  4JPB W;  3REA B;  2FRY A;  2L3Q A;  2LNH B;  1JEG A;  2HSP A;  2DNU A;  2LJ0 A;  3PVQ A;  1JU5 C;  2RN8 A;  2EQI A;  4RUG A;  4J9G A;  1SPK A;  5EC7 A;  3I9Q A;  2KXD A;  4EIK A;  2EYZ A;  4HVW A;  2A37 A;  5FWC A;  1OEB A;  1X27 A;  1WXT A;  2RNA A;  4HCK A;  4AFQ C;  2P4R A;  1NLP C;  4Z88 A;  2DL5 A;  2HDA A;  3H0F A;  2GBQ A;  1B07 A;  1T3L A;  2KYB A;  1MV0 B;  1ZUK A;  4E6R A;  2BZ8 A;  2C0O A;  1K76 A;  4OMO A;  2O88 A;  2B86 A;  2K79 A;  3NMZ C;  2J6F A;  2FPF A;  1KFZ A;  4ESR A;  1PHT A;  1VA7 A;  1NLO C;  1WDX A;  2CUB A;  1LCK A;  1UHF A;  4OMN A;  1J3T A;  2DM1 A;  2AZV A;  2DRK A;  2O9V A;  1M3B A;  5I22 A;  2O2O A;  2K2M A;  2M0Y A;  2EYX A;  2O31 A;  2DBK A;  2D8J A;  5FW9 A;  2DL8 A;  5IXB A;  2PNI A;  3PVL A;  1U3O A;  2W10 A;  2ENM A;  2D0N A;  3VS3 A;  4FSS A;  3EHR A;  3NPF A;  1ZUY A;  4JJD A;  2DIL A;  2YSQ A;  3H0I A;  3I5R A;  1UUE A;  2DE0 X;  1QLY A;  4IIO A;  1QKX A;  2LQN A;  1NYG A;  2L0A A;  1I07 A;  3VS6 A;  1H3H A;  2O9S A;  2CH4 W;  1ABO A;  2LJ3 A;  1UJY A;  2GNC A;  4CC4 B;  3M0U A;  4CC3 A;  1UJ0 A;  2K9G A;  1QWF A;  1YNZ A;  1UG1 A;  4HVU A;  3C0C A;  4OMM A;  2MOX A;  2CUD A;  4R0K A;  2LJ1 A;  4LUD A;  2DX1 A;  2PZ1 A;  1YCS B;  1GL5 A;  1RUW A;  2CT3 A;  1SRL A;  4LNP A;  2A28 A;  1AZG B;  1YWP A;  5IXF A;  3U23 A;  3RBB B;  3I5S A;  2KRO A;  1PNJ A;  3EHQ A;  1G83 A;  2YUN A;  1NG2 A;  2LZ6 B;  4LN2 A;  4KRT A;  2JW4 A;  3NHN A;  1ARK A;  2AK5 A;  1IO6 A;  2RQW A;  1K0S A;  2AKL A;  3H0H A;  3EG0 A;  2D1X A;  2KRS A;  3REB B;  1AWO A;  1TUD A;  2J7I A;  4DEY A;  2JXB A;  4F14 A;  3VS5 A;  4RTU A;  1H8K A;  1XOV A;  2ABL A;  4JJC A;  5IHN A;  4JZ4 A;  2RQT A;  3A98 A; 
#chains in the Genus database with same CATH topology
 3FLG A;  5A0L A;  1G5V A;  4ZNX A;  2DMO A;  2GFA A;  3OW2 A;  4C8Q E;  2E10 A;  1YJ9 Q;  1NEG A;  1X6B A;  3CMA Q;  5IAY A;  5GAM j;  2F2V A;  2K7A A;  2YLC A;  2CGH A;  2JS2 A;  1IHW A;  3ULR B;  1WJR A;  1YIT A;  4Z8A A;  1QMC A;  2JOY A;  4C8Q D;  5LL6 S;  4IUU A;  2K5F A;  2PQW A;  2YRD A;  3DLL A;  5DLO A;  4FSX A;  3TRE A;  3EFS A;  2LVM A;  4BDY A;  4MDW A;  3SHW A;  3ZBD A;  2KNB B;  3S3O A;  4C5E A;  1GRI A;  1RLQ C;  1Y96 A;  3L2W A;  2JT4 A;  1EZZ B;  1I1J A;  2B8A A;  3VS7 A;  1AT1 B;  3M58 A;  5I2M A;  2L2P A;  1KK7 A;  2GF7 A;  4R55 A;  4BI8 B;  1OZ2 A;  2EJG A;  2FO0 A;  1I0C A;  3UT1 A;  1UHC A;  2AIR B;  4J9I A;  5GJV B;  4K11 A;  3X28 B;  4M7A G;  2KMT A;  2ED1 A;  4J5Y A;  2JNG A;  4F04 B;  4PJO G;  3JV3 A;  1X01 A;  1TS9 A;  2VVK A;  3HL8 A;  1GCP A;  3FJ5 A;  2PVD B;  1HK9 A;  2DL4 A;  1WHJ A;  4PK4 A;  3RMQ A;  2PU9 B;  4GLK A;  5CQX A;  3RDV A;  1W2B A;  4J6X A;  4E2F B;  1JB0 E;  3JB9 D;  2MMP A;  3P8B B;  1JQQ A;  2X3W D;  1C6V X;  2E12 A;  1D3B A;  3G71 A;  2YHT A;  4E7H A;  4ZGJ B;  1KSW A;  1ZSG A;  3OBW A;  2SEM A;  1Y57 A;  1VQ6 Q;  3TSW A;  3CC2 A;  4MZP A;  2D0Q B;  2DXC A;  3CCV T;  4O6J A;  1NM7 A;  1OU8 A;  1LJO A;  2IG0 A;  1ZLM A;  5GMK l;  4HCB A;  2FZG B;  5FU7 C;  2ED0 A;  1NJI R;  1N8R U;  2WSF E;  3TVT A;  3G4S A;  1VQ4 A;  1VQM A;  3CCS A;  4AT1 B;  2YRV A;  2E41 A;  1JXO A;  5KYU B;  2OTL Q;  1Q82 U;  1HSQ A;  1VIE A;  1NE8 A;  2DPP B;  5IT9 E;  3KBG A;  4WCI A;  1YIJ T;  1K9M C;  1BK2 A;  4OGC A;  3MEA A;  4J9F A;  3QZ5 B;  3NTI A;  3HRS A;  1JJ2 A;  3N5B B;  1I8F A;  2HMA A;  4F17 A;  2LX7 A;  3M0R A;  1K8A U;  3ER0 A;  1AWJ A;  1VQ8 Q;  1LPL A;  2YUP A;  3A8L B;  3KFV A;  5D6X A;  1WXU A;  2HBW A;  1WHK A;  1EFN A;  2JTF A;  3QYH B;  3HSB A;  1NZ9 A;  2EYY A;  5A0D A;  2ZGW A;  2JJ9 A;  2MF2 A;  1E6H A;  1FMV A;  3L2R A;  2AT1 B;  2KT1 A;  3CC7 T;  3CC4 T;  1ABQ A;  3OYA A;  3CCJ A;  2O4X B;  1BI0 A;  1YHQ T;  2CP7 A;  5CVI A;  2LQK A;  2QEX T;  2VGM A;  3JCM b;  1VQ5 A;  3H41 A;  3PT9 A;  4BE2 A;  4IIM A;  4M7A E;  3RUX A;  3OB9 A;  1VQP T;  3GPL A;  4PJO E;  2RHI A;  4E7J A;  1Q95 G;  2I0N A;  2K3X A;  2MCN A;  4OB0 B;  1MUZ A;  1RAG B;  4M7A D;  1S72 Q;  1WX6 A;  1SHF A;  3CCE Q;  3WVE B;  4A4F A;  4PJO D;  1UTI A;  1IHV A;  5C6S A;  5KYW B;  1HJD A;  5GMK h;  2X35 A;  1PRL C;  1M3A A;  3L2Z A;  2BKD N;  5GAN 5;  2WSE E;  2EBP A;  3HPW A;  4DBQ A;  3I35 A;  2DVJ A;  2AZS A;  3OMG A;  1QW1 A;  3LGF A;  3V8K A;  2ZZD A;  2MYS A;  1PRM C;  1Z9Q A;  3L2V A;  2G3R A;  4M78 G;  5L8R E;  1UDL A;  5LJ5 e;  2E6Z A;  2XDP A;  5GAO l;  3J80 E;  1A0N B;  4KH0 B;  1AD5 A;  1KHC A;  3BE3 A;  5CO7 A;  5LJ3 g;  1OV3 A;  1ZUU A;  4AFU C;  5GAN 3;  2QXF A;  2KXC A;  4FL6 A;  3LH5 A;  1M1K U;  3OYM A;  3QBY A;  1SHG A;  4D6W A;  1IRX A;  4MMK A;  3WVD B;  4DOV A;  1TWB A;  4B9W A;  3EG2 A;  1W6X A;  1SSH A;  2CDT A;  4EMK C;  5J26 A;  3P8H A;  1FX7 A;  3EGD B;  2O4X A;  3X25 B;  2JZ2 A;  4JPB W;  3REA B;  2L3Q A;  3PVQ A;  2LJ0 A;  4F7U B;  3H8Z A;  2RN8 A;  3V8L A;  2EQI A;  4RUG A;  3LW5 E;  1SPK A;  3QII A;  3QXE B;  1G3Y A;  4M75 C;  5KH6 A;  3CCU T;  1OEB A;  1R8O B;  5GAM d;  2RNA A;  1YI2 T;  3BDU A;  2QDY B;  1KG1 A;  2RI3 A;  3MCA B;  9ATC B;  5KYW A;  3LH0 A;  1XJW B;  5GAM f;  3INZ A;  2GBQ A;  2KYB A;  1M90 R;  3CCV A;  1MV0 B;  1TUG B;  3GOX A;  4LDV A;  4OMO A;  2O88 A;  5FU6 B;  2K79 A;  4C0D C;  3NMZ C;  1VOM A;  3URG A;  1KFZ A;  4M75 F;  2PVO B;  1PHT A;  4XTV A;  1VUB A;  1NLO C;  5GAO n;  3SB2 A;  2DTI A;  3F70 A;  4FU6 A;  2E64 A;  4C0Z A;  2AZV A;  1B34 A;  1PCX A;  2O9V A;  2YLB A;  1PD1 A;  3JCM g;  4FYX B;  2M0Y A;  1YIJ A;  2CP0 A;  3JCM W;  3OBY A;  1QQJ A;  1U3O A;  1YJN A;  1OX8 A;  4C92 B;  3S3M A;  4C5H A;  2VAS A;  3EHR A;  4FW2 A;  3H0I A;  3I5R A;  2DE0 X;  5GAN 7;  1I07 A;  2O9S A;  2QGG A;  3QG1 A;  3CBO A;  2VUB A;  2HQX A;  4OVA A;  1N9S A;  3CPF A;  4XU0 A;  2GCX A;  3EGD A;  3HHT B;  4LDY A;  4AMC A;  1LNX A;  1UG1 A;  4HVU A;  1TSF A;  4OMM A;  2MOX A;  1ACM B;  2DX1 A;  3HRT A;  3CXC S;  1MMG A;  3QDR B;  4F7U A;  3C94 A;  4L5G A;  3CME A;  4XU3 A;  2DVE A;  1YWP A;  2H3J A;  2DZC A;  2XIC A;  5AT1 B;  3CC4 A;  2KRO A;  3MPU B;  5LJ3 h;  1YHQ A;  2QK0 A;  1G83 A;  4KUL A;  4ZN1 A;  2QEX A;  1UEB A;  3CPW S;  2LZ6 B;  4LN2 A;  2JW4 A;  5GAN h;  3MEW A;  2AK5 A;  3CD6 T;  5J39 A;  1WQW A;  4QQD A;  2AKL A;  4B6M A;  1VQP A;  2I2L A;  4DBH A;  3BFM A;  3EG9 A;  1BYM A;  1AWO A;  2EQJ A;  2J7I A;  2JXB A;  4F14 A;  4A54 A;  4RTU A;  4M77 C;  4E7L A;  4MZM A;  3SWN B;  5IHN A;  2IPO B;  4D8D A;  4FT2 A;  3A98 A;  4BDZ A;  4FIB A;  3QWY A;  3THK A;  1X43 A;  2P0Q A;  4NS5 A;  1NPR A;  1FXX A;  3UF4 A;  4D8K A;  1QVG A;  5EG2 A;  2F2X A;  1Y71 A;  3UDC A;  4NL3 A;  1R77 A;  5FU6 C;  1PSE A;  1IZ6 A;  4C92 A;  3A1P A;  3E9G A;  4M77 F;  5I11 A;  4N4H A;  1VQO T;  2E5K A;  5IN1 A;  2CKK A;  1H92 A;  4M78 F;  4M7D A;  5J3B A;  2KT8 A;  4HCZ A;  3RR6 A;  5FWB A;  1PG5 B;  1UB4 A;  1XNI A;  2M1H A;  1X75 C;  1QVG P;  2E65 A;  1BCM A;  2COZ A;  4C92 C;  4A4H A;  3M4Y A;  2BIV A;  2CH4 A;  2HCK A;  4M7D C;  4A53 A;  4CC2 A;  3I55 A;  4OMP A;  4ANJ A;  3I56 Q;  2JM8 A;  1K73 U;  1TXQ A;  2RHX A;  2RPN A;  4PNO A;  2C0I A;  2K6D A;  5CAI A;  2HEQ A;  4E7S A;  2ROL A;  3C95 A;  3J7A F;  5CK9 A;  2DAQ A;  5ECA A;  4HA8 A;  1D1B A;  1M3C A;  4PFO A;  2EJ9 A;  4M7D F;  2DA9 A;  4YTL A;  3CCU A;  1T0J A;  1YI2 A;  5LJ5 h;  1K9A A;  4E7K A;  2GQV A;  1OOT A;  3SWN A;  2HD0 A;  4BI4 A;  1PKT A;  1C1A A;  1DJ7 B;  2PVG B;  1YIT Q;  3CCQ T;  4AFS C;  1Q7Y C;  2WSC E;  1RAD B;  3O8V A;  1RAB B;  1JO8 A;  4QVD A;  1KC8 U;  1H64 1;  1WI7 A;  2BUD A;  1AVZ C;  2A08 A;  2VWF A;  4PFZ A;  1YWO A;  1N9R A;  1ZSZ B;  4EMH A;  2Z0W A;  3SWN C;  2GTJ A;  3SDZ A;  2KQW A;  4LE9 A;  1K1Z A;  1VQN T;  2QQA A;  4OP0 A;  1S1N A;  5HY6 A;  3FRN A;  1OX9 A;  2JM9 A;  2E3H A;  2RHU A;  3PNW C;  3L2Q A;  3UA7 A;  1KQS S;  1OPL A;  1T0H A;  2QAZ A;  3LGL A;  4KUD K;  2A3L A;  1OYX A;  2EKO A;  3OS2 A;  5GAM e;  4RMO A;  1TUC A;  2XG8 D;  1UFF A;  2RF0 A;  4QT7 A;  1Q82 R;  1VQ9 A;  5IH2 A;  2OTL T;  1WYX A;  1WA7 A;  2LX9 A;  3QUI A;  3GNG A;  2JMA A;  5CIU A;  1QVF S;  1BCO A;  2XDD A;  3PFS A;  1BI2 A;  1HYO A;  1G3W A;  1P92 A;  3M59 A;  1GBR A;  2X9H A;  3CCM A;  1YCY A;  2G6F X;  4QKU A;  2ZAE A;  1K8A R;  1SG5 A;  5I21 A;  3G71 Q;  3OW2 P;  1NEB A;  3CC2 Q;  1D1C A;  3CD6 A;  1RLP C;  3M0T A;  1G2B A;  4JS5 A;  3L2U A;  2OTJ A;  1AEY A;  4BE0 A;  1PC0 A;  2LCS A;  2RMO A;  5FRO A;  3EH1 A;  3NTH A;  1W70 A;  4C8Q A;  3G4S Q;  1VQ4 Q;  2YDL A;  1VQM Q;  3CCS Q;  2DLP A;  3OYK A;  1WQ7 A;  1M1G A;  2DXT A;  1LVK A;  2JTE A;  3P8D A;  1JRI A;  2CRE A;  4BD3 A;  1IRE B;  2QA4 T;  3EG1 A;  2DBM A;  2NWM A;  1MV3 A;  4AFZ C;  4IUP A;  2PTK A;  2M16 A;  4C8Q C;  1MMD A;  2L8D A;  2KDS A;  1YP5 A;  1UGR B;  1VQO A;  1YJW T;  2LQW A;  1OQK A;  2RA2 A;  3GP8 A;  1Q86 R;  3CCE T;  3LWH A;  1VQ7 T;  2DKG A;  5HCK A;  1VQL T;  2ROT A;  4FW1 A;  3RNJ A;  2FG0 A;  2QQS A;  1WJS A;  4NOY A;  2OAW A;  2EKH A;  2NLU A;  5FLX E;  2QDL A;  3A8M B;  5CKD A;  3PIO A;  2IIM A;  2Y4X A;  4RTT A;  2DYI A;  1Y0M A;  3OYC A;  1M27 C;  2DJQ A;  4M75 G;  3O5Z A;  4E7Z A;  3CCR Q;  1I81 A;  1W2B P;  4N4G A;  4HXJ A;  1PSF A;  2PUK B;  1VQ5 Q;  2COY A;  2K3Y A;  2LRQ A;  2DL7 A;  1D09 B;  3A8G B;  8AT1 B;  4BY6 B;  3VRY A;  5KYX B;  2H3E B;  2HBP A;  2LP5 A;  3BW1 A;  1GXI E;  5KE2 A;  1JEG A;  2DNU A;  2DXB A;  3RMS A;  1JU5 C;  4M7A B;  5CKF A;  4KBM B;  4L59 A;  2E3I A;  4J9G A;  3CCQ A;  5DY9 A;  4OMF B;  5EC7 A;  3I9Q A;  4PJO B;  1WHH A;  2EYZ A;  3RKW A;  2A37 A;  1NBE B;  1Q86 C;  3AT1 B;  1X27 A;  3OQ5 A;  1M2V B;  4XTY A;  4AFQ C;  2LNV A;  1FMW A;  4Z88 A;  3VYG A;  4DOW A;  4KGX B;  3H0F A;  1JJ2 P;  1T3L A;  2QGF B;  1ZUK A;  2C0O A;  2MK5 A;  2EQU A;  2HQH A;  2B86 A;  4PFP A;  1VQN A;  1EIF A;  2J6F A;  4ZGD B;  2FPF A;  1O75 A;  1NJI C;  1VA7 A;  1EX4 A;  4Q5W A;  4DA4 A;  1WDX A;  4CRI A;  1UGQ B;  2QYZ A;  2NUT B;  3JCM c;  1VQK T;  2ZPG B;  1UHF A;  3H6Z A;  1WJQ A;  3OY9 A;  3FDR A;  3G6E T;  2DRK A;  2KK4 A;  5I22 A;  2O2O A;  2K2M A;  1K9M U;  3TQ7 P;  3MHX A;  2D8J A;  5FW9 A;  2DXU A;  2DL8 A;  2PNI A;  4J7F A;  5GAN 4;  2W10 A;  3JSC A;  2ENM A;  2OTL A;  2HKQ B;  1TH7 A;  2M02 A;  3NPF A;  4JJD A;  4ZGE B;  3C4S A;  3OYN A;  2FYK A;  2A0F B;  2JTM A;  2MI6 A;  5KYU A;  2RHY A;  2XD0 A;  1NYG A;  3HKS A;  3HRU A;  2LJ3 A;  2NYS A;  2GNC A;  3M0U A;  1U1S A;  4B9X A;  4M77 G;  2CUD A;  4R0K A;  4JJN K;  1PM3 A;  4LD6 A;  5CCA A;  3JB9 I;  4M75 E;  1YCS B;  2LC4 A;  3HFO A;  1GL5 A;  1RUW A;  4JLG A;  2A28 A;  5IXF A;  3CCV Q;  2Y90 A;  3EH2 A;  3ZEH A;  1KD1 R;  4PJO A;  3I5S A;  1PNJ A;  4M75 D;  4KT0 E;  3TU4 K;  5GAN g;  1NG2 A;  2D6F A;  3CEY A;  4PLL A;  4HCC A;  3NFC A;  1M2V A;  3NHN A;  5KE3 A;  1K0S A;  2CZ1 B;  2EJF A;  2WAC A;  2ZCF B;  5GAM h;  2KRS A;  3REB B;  5HKC A;  3GNF B;  3UPU A;  2LCC A;  1KQS A;  4PJO C;  1YIJ Q;  2QA4 A;  1H8K A;  3JCM V;  4JJC A;  1YJN Q;  3OSV A;  4CI0 C;  4JZ4 A;  3EGX B;  1E7O A;  1YBY A;  2FPE A;  1D0X A;  2KY9 A;  3TEE A;  4M7D G;  2X4X A;  4J9C A;  2VKN A;  3M4G A;  1YJW A;  1QVF A;  1B3Q A;  3CCE A;  1VQ7 A;  2CSI A;  1RI9 A;  1VQL A;  2CSQ A;  3DKM A;  4RKU E;  4XTU A;  1RAH B;  2HAX A;  2J6O A;  3E19 A;  4J6W A;  3OS1 A;  1NYF A;  1WFW A;  4HKE A;  4J83 A;  3CME Q;  3NGP A;  1WZO A;  3CC4 Q;  3MP6 A;  1TOV A;  4M78 B;  1KD1 C;  1U5S A;  3X24 B;  2V26 A;  1YHQ Q;  2QEX Q;  1PD0 A;  5CR2 A;  1MNE A;  3A5Z B;  4R56 A;  1OZ3 A;  2FPD A;  1OPK A;  2RH2 A;  2K5L A;  4OMQ A;  3S3N A;  4LDX A;  1Q81 R;  1VQP Q;  2VXF A;  1OU9 A;  2K5I A;  4KGV B;  3VS0 A;  2FL7 A;  3VS1 A;  3WXM B;  3JCM P;  1KQ1 A;  2FZC B;  4UC4 A;  1GFD A;  2C0T A;  4J9E A;  4J9B A;  2DL3 A;  4JZ3 A;  4JUV A;  3UA6 A;  1WPY A;  4L6V 5;  1TG0 A;  2BZX A;  4M77 E;  3I56 T;  1RAF B;  1K73 R;  4M78 E;  4J7I A;  2OJ2 A;  3OS0 A;  4RTW A;  4FYW B;  2DRM A;  4QQG A;  3QZ9 B;  4RCB A;  2E5Q A;  5LJ5 g;  2QQB A;  4II1 A;  1MMA A;  4M77 D;  2E6N A;  1AWX A;  3TSZ A;  4M78 D;  4XTX A;  2EVR A;  2CT4 A;  4IUQ A;  1UEC A;  1X69 A;  4PJJ A;  4XU1 A;  1N5Z A;  3CC7 A;  2K3B A;  1M90 C;  3OS5 A;  1FMK A;  3FJP A;  3OA6 A;  2M0O A;  1M2O A;  2J05 A;  3MP8 A;  2DD5 A;  3E1S A;  1KIK A;  5KCH A;  2DJZ A;  4GY5 A;  2F2W A;  3S6W A;  3QKJ A;  1M30 A;  1BBZ A;  4RTY A;  4KH1 B;  3GBQ A;  1VQK A;  3G6E A;  1KC8 R;  3VYH B;  2KE9 A;  3RKY A;  5IHI A;  1BI3 A;  1Q81 C;  3I55 Q;  2XMF A;  3G7Z A;  1M5Q 1;  1JXM A;  2RJD A;  4Y92 A;  2EYQ A;  4M7D E;  3ASK A;  2QG9 B;  4GLM A;  4X34 A;  4QW2 A;  1QP3 A;  2L3R A;  2KEA A;  5KYY B;  1X2K A;  1WHG A;  1SF9 A;  3CCL T;  2EYW A;  5L23 A;  4M7D D;  4F7U F;  2FEI A;  2V1Q A;  3TCJ A;  1SKU B;  2KRM A;  3CCU Q;  2LT1 A;  1BU1 A;  1YI2 Q;  2DTH A;  2E4H A;  1UGV A;  1IXD A;  1OUL A;  1YJ9 T;  3CMA T;  2BE7 D;  2M9U A;  2QQR A;  5IHK A;  3RES A;  1G3S A;  2IVW A;  4XAX B;  4DBR A;  2EGE A;  2JUF A;  2X4J A;  4C8Q G;  1UE9 A;  1R0B G;  2V1R A;  4ME7 A;  2XI9 A;  3M57 A;  1I5L A;  3EFO B;  2GTO A;  4BI3 A;  1C0M A;  4EMG A;  1CSK A;  1D1A A;  2P0K A;  1NPP A;  4OGE A;  2KI7 A;  2NUP B;  2KBT A;  4ORZ A;  1U06 A;  1Y07 A;  1FWZ A;  2DF6 A;  1ZX6 A;  4RTX A;  3PTA A;  3JCM X;  2RHZ A;  2HL5 C;  2KVQ G;  4IUV A;  5GAN 2;  2YXY A;  4C92 F;  2MPX C;  4AG2 C;  3GF5 A;  4HVV A;  1MND A;  2SRC A;  3QDF A;  3G4S T;  1RL2 A;  1Y7X A;  1VQ9 Q;  4ELZ C;  3PIP A;  3LYI A;  2COW A;  2OI3 A;  3LLR A;  3DB4 A;  4Z89 A;  3RER A;  5KYY A;  2OX7 A;  2DIQ A;  4X1V A;  3CCM Q;  4E7I A;  5GAN 8;  1AWW A;  4IUR A;  1HXD A;  4PKC C;  2EFI A;  3JCM d;  4P5N A;  2AHJ B;  5DM7 R;  2DFU A;  5GMK j;  3OYH A;  3JCM f;  3FIF A;  3QYG B;  3VS2 A;  2A36 A;  1WXB A;  3CD6 Q;  2J6K A;  4RTZ A;  2RQU A;  1QCO A;  2RK1 A;  1GFC A;  2OTJ Q;  1KJW A;  2EQM A;  4WTO B;  5GMK m;  1VQ6 T;  2EW3 A;  4PJM A;  2RJC A;  5AYF A;  3M0Q A;  3OYJ A;  1CKA A;  2DIG A;  3DLM A;  3J81 E;  3SD4 A;  3VU3 C;  3M55 A;  1N8R R;  2FHD A;  3I56 A;  3CCR T;  3MEU A;  2DYB A;  4PL6 A;  2RD1 A;  3OYF A;  2HQE A;  2L3P A;  5M9O A;  1K4U S;  1WNL A;  1WGS A;  2D8H A;  3OYI A;  2FVU A;  2NUP A;  4PJN A;  2ZPB B;  1V76 A;  2HSP A;  4RCC A;  5GAO p;  4C0F A;  5FU7 B;  1Q7Y U;  1VQO Q;  1D3B B;  5GAO r;  4HVW A;  5FWC A;  3T9N A;  2L89 A;  1WXT A;  4HT9 A;  3R6O A;  1I4K 1;  1VQ8 T;  1I5O B;  3FB9 A;  4LDU A;  1U1T A;  1B07 A;  5FRN A;  2LDM A;  4Z02 A;  2EWN A;  4OB1 B;  2CZ7 B;  4OF1 A;  3VUB A;  1ZA1 B;  2XK0 A;  3A8O B;  4N0A A;  5D6W A;  2ZPF B;  1X6O A;  2QI2 A;  4OMN A;  4JLI A;  1ZSZ A;  1M3B A;  3QJY A;  4TVR A;  3X26 B;  2R57 A;  3GLX A;  2ZPH B;  3CCL A;  1N8R C;  2O31 A;  3PVL A;  4N0A C;  1Q82 C;  4ZTF A;  2EAY A;  2L5Q A;  1K9M R;  1UUE A;  1QLY A;  4C5I A;  4IIO A;  1QKX A;  4QQ6 A;  1ZSZ C;  2L0A A;  1S72 T;  1YJ9 A;  1ABO A;  3CMA A;  3CCQ Q;  3CXC A;  4CC4 B;  4CC3 A;  1UJ0 A;  2K9G A;  2PUO B;  1YNZ A;  3C0C A;  4OB3 B;  1K8A C;  2P0P A;  2X4Y A;  2F1L A;  3V7S A;  3OSS C;  2DER A;  2CT3 A;  1UGP B;  4C8Q F;  3CPW A;  2RJF A;  5GAO m;  3RKX A;  3U23 A;  2EQK A;  3CCJ Q;  2DD4 A;  1JBM A;  1VQN Q;  2HZY A;  2YUN A;  3CXC P;  4ATO A;  2K4Y A;  1TTH B;  2JVV A;  1IO6 A;  2RQW A;  2HL3 A;  5GAM g;  4DQ2 A;  4XK8 E;  2D1X A;  3L1A A;  1M1K R;  3CPW P;  3RIR A;  4LD9 K;  5LJ3 e;  3QO3 A;  5LJ3 j;  2RQT A;  5GMK i;  5GAN e;  1PKS A;  2MIO A;  1ZQ1 A;  4A4G A;  5CQY A;  5GAN j;  5KYN A;  1VYV A;  4JRQ A;  2K57 A;  1M8M A;  4A4K A;  1VYU A;  1YJN T;  5CKE A;  3PMT A;  3PGG A;  3SFM A;  3SEM A;  1BB9 A;  1BI1 A;  2FB7 A;  4ELY C;  3E9F A;  4EMK B;  2C06 A;  2LTO A;  1QVG S;  2BZY A;  2KR3 A;  1FYN A;  2V8K A;  2GFU A;  3OYL A;  2RM4 A;  7AT1 B;  4A63 B;  3JB9 F;  4MZT A;  3HTR A;  2LT4 A;  1N6A A;  1VQ6 A;  4CC7 A;  3M53 A;  2R58 A;  2VC8 A;  2VV5 A;  4ZN3 A;  3CME T;  2RI2 A;  1OI1 A;  4KGZ B;  4JS4 A;  4M75 B;  3MKD A;  2EIF A;  4HT8 A;  3LX7 A;  3A8H B;  3CCR A;  3IQL A;  3OYE A;  3CQT A;  4J6Y A;  3ZL7 C;  1RAI B;  1D0Y A;  1V1C A;  2HKN A;  1M1K C;  4OML A;  2YWW A;  2QA4 Q;  1QKW A;  4E47 A;  1QVP A;  2VXE A;  4QVZ A;  3OYD A;  1SEM A;  3L42 A;  2DTO A;  3M56 A;  4F7U G;  2DEU A;  2LMJ A;  4C0D B;  1W4S A;  4FT4 A;  4FYV B;  3H9N A;  1B7T A;  1GCQ A;  5HK3 A;  2AKK A;  1YJW Q;  4FYY B;  2V8J A;  3JCM e;  1Q86 U;  1VQ7 Q;  4ZTJ A;  4RG8 A;  5D7U A;  5KYX A;  2XDB A;  1K0X A;  1VQL Q;  2RB6 A;  3BDL A;  1QCF A;  5A0G A;  1VQ8 A;  3QJ6 A;  4XTZ A;  4M7A A;  3QPH A;  5GJW B;  5A2Q E;  3EFR A;  3FEO A;  1GCQ C;  3VUZ A;  4FM4 B;  1WHM A;  2QQ9 A;  4DEX A;  3GIB A;  3JCM Q;  2ECZ A;  5FRM A;  4BY6 C;  2P4T A;  3X20 B;  1WIE A;  1NJI U;  4XU2 A;  5GAO q;  1KHI A;  1B34 B;  2CYZ B;  4EMK A;  2LCL A;  5LJ5 j;  4M7A C;  3KXT A;  2H8H A;  2MWP A;  2EPD A;  2ESW A;  4BE1 A;  3EG3 A;  2M51 A;  4AG1 C;  3CBP A;  1W1F A;  1YN8 A;  4EPC A;  2XID A;  4RTV A;  2GGR A;  1M9S A;  3QWX X;  4C92 G;  2GQI A;  3M54 A;  2NUT A;  3I55 T;  1LOJ A;  1MHN A;  2JMC A;  1S72 A;  4M75 A;  1D0Z A;  3EGU A;  3M0P A;  2BE9 B;  1HD3 A;  3JB9 J;  1MMN A;  4M7A F;  2DET A;  1GBQ A;  4PJO F;  3HP9 A;  3R6N A;  3QHS A;  1KQS P;  1PWT A;  3CBM A;  3OW2 S;  1QCN A;  2YUO A;  2L3S A;  4M4Z A;  1ZA2 B;  1BKB A;  2BTT A;  4BUG A;  2XKO C;  3MEV A;  4M77 B;  2YRC A;  1Z9Z A;  2F5T X;  4IUT A;  3CC7 Q;  5GAN 6;  2JS0 A;  3EAE A;  8ATC B;  1QVF P;  1X6G A;  4LUE A;  4JJB A;  1VYT A;  3V7R A;  3EG9 B;  4V2S A;  2QTX A;  2XHC A;  1VQK Q;  3G6E Q;  3UAT A;  1AHJ B;  2VB6 A;  1CKB A;  1AOJ A;  4KUI A;  4F7U E;  2W0Z A;  4J8O A;  2D9T A;  3D7S B;  3C12 A;  3LWI A;  2EGA A;  2X3X D;  3VV0 A;  2X4W A;  3AHU A;  4MML A;  2KSS A;  4NL2 A;  1RAC B;  3MET A;  1E6G A;  3ZFJ A;  1U8R A;  2DZ9 A;  1MGQ A;  3KUF A;  3M0S A;  1WLP B;  2KYM A;  1ZBJ A;  4J9H A;  4WF2 A;  3VS4 A;  2YT6 A;  2NUZ A;  1X2Q A;  5HK0 A;  4DBF A;  4X9C A;  4M7D B;  4JRK A;  3EGX A;  1T3S A;  2RQR A;  2E70 A;  3JRZ A;  2RQV A;  1ZBX A;  4Y28 E;  1XQH A;  1VQ9 T;  5CKB A;  3ME9 A;  4C5G A;  6AT1 B;  4F16 A;  1SRM A;  1IGQ A;  5C0M A;  2VYT A;  1YIT T;  1KD1 U;  3VRZ A;  4X9D A;  1W2B S;  3E2U A;  4J9D A;  3PE0 A;  1QP2 A;  2EGC A;  2ZPI B;  3CCM T;  2FRW A;  2DO3 A;  2RO0 A;  3BY7 A;  1H3Z A;  2RI5 A;  3MO8 A;  4C92 E;  4M77 A;  1TU0 B;  2J06 A;  3DB3 A;  3JB9 H;  2KRN A;  4M78 A;  2YUQ A;  2HNI A;  1QWE A;  2MAM A;  2K2V A;  1AZE A;  2CP5 A;  2KGT A;  4C92 D;  4GBQ A;  5CKH A;  2OTJ T;  1RAE B;  3NTK A;  2VGN A;  4XQ3 A;  1K73 C;  5D6Y A;  2RJE A;  4MDX A;  5LJ3 d;  2FRY A;  2LNH B;  4M78 C;  2LQ8 A;  1SSF A;  4PJL A;  5GAN d;  1JJ2 S;  3Q1J A;  5LJ3 f;  2KXD A;  4EIK A;  1G3T A;  2X51 A;  1R0C B;  2CS7 A;  1RI0 A;  1M90 U;  5GAN f;  1V29 B;  2ZPE B;  2F5K A;  4HCK A;  1BIA A;  2P4R A;  1NLP C;  4C0G A;  2DL5 A;  4O5V A;  1Q7Y R;  2HDA A;  3MJX A;  4JDS A;  2Y4Y A;  1F1B B;  4E6R A;  2R5A A;  2BZ8 A;  1BIB A;  1K76 A;  1RAA B;  2P84 A;  1UGS B;  2RK2 A;  4N4I A;  3G71 T;  2CP2 A;  1KC8 C;  4JRP A;  1Q81 U;  4OB2 B;  1M4Z A;  4ESR A;  3CC2 T;  2CP3 A;  3JCM J;  4QVC A;  1YFN A;  1XTD A;  2CUB A;  1M1F A;  3OYG A;  1LCK A;  1J3T A;  2DM1 A;  2CP6 A;  3HFN A;  1M8V A;  2EYX A;  3JCM h;  2DBK A;  2R5M A;  2JN0 A;  3M5A A;  2E1H A;  1VQ4 T;  5IXB A;  1VQM T;  1IGU A;  3CCS T;  1N27 A;  2D0N A;  3VS3 A;  4A4E A;  3VJP A;  4FSS A;  5I2S A;  1ZUY A;  2MWO A;  2DIL A;  2CZ6 B;  2YSQ A;  1IB8 A;  2LQN A;  3VS6 A;  1H3H A;  2CH4 W;  5KCO A;  3PMI A;  3OYY A;  1UJY A;  3VKI A;  2A7Y A;  1QWF A;  1ZHI A;  2ATC B;  4PLI A;  4BB7 A;  1Y96 B;  5GMK e;  2LJ1 A;  1G8X A;  4LUD A;  2PZ1 A;  2QTV A;  1WHL A;  4Y91 A;  4EDU A;  1SRL A;  3QSU A;  4LNP A;  2KAF A;  2V8I A;  3JB9 G;  1AZG B;  2HSE B;  4VUB A;  3V7C A;  2QAS A;  3G1J A;  3RBB B;  3V8J A;  3M9Q A;  4BAC A;  3EHQ A;  4C8Q B;  4LDW A;  4RG2 A;  2DK3 A;  4KRT A;  3JAM E;  1KQ2 A;  4FCY A;  1ARK A;  3OYB A;  2O01 E;  5LJ5 d;  3UWN A;  3FC3 A;  3H0H A;  4LXC A;  3CCJ T;  3EG0 A;  4XTW A;  2XU8 A;  5DLQ E;  3EFO A;  3OMC A;  1TUD A;  3MP1 A;  4DEY A;  5LJ5 f;  3VS5 A;  1O9S A;  3CCL Q;  1VQ5 T;  1XOV A;  2ABL A;  2FZK B;  2DEQ A;  1VIF A;  4IKF A;  2OAU A;  2F69 A;  4JRI A;  2CZ0 B; 
#chains in the Genus database with same CATH homology
 1E7O A;  1PKS A;  2MIO A;  2FPE A;  1VYV A;  3QWY A;  1X43 A;  3THK A;  4ZNX A;  2DMO A;  4J9C A;  2VKN A;  1M8M A;  1B3Q A;  3UF4 A;  2CSI A;  4D8K A;  1NEG A;  1VYU A;  1X6B A;  1RI9 A;  2CSQ A;  2F2V A;  2F2X A;  2K7A A;  2JS2 A;  3SEM A;  1BB9 A;  3ULR B;  4Z8A A;  5I11 A;  2J6O A;  2BZY A;  2KR3 A;  2E5K A;  1FYN A;  1H92 A;  1NYF A;  1WFW A;  2KT8 A;  3NGP A;  5FWB A;  4A63 B;  3SHW A;  1U5S A;  4CC7 A;  2KNB B;  1GRI A;  1RLQ C;  2FPD A;  1OPK A;  2JT4 A;  4OMQ A;  2CH4 A;  1I1J A;  2HCK A;  3VS7 A;  4CC2 A;  3VS0 A;  4OMP A;  2JM8 A;  3VS1 A;  3IQL A;  4D8D A;  3CQT A;  3ZL7 C;  2L2P A;  1V1C A;  4OML A;  2RPN A;  1QKW A;  2C0I A;  2FO0 A;  2K6D A;  1SEM A;  1GFD A;  2C0T A;  1I0C A;  4J9E A;  4J9B A;  2DL3 A;  1UHC A;  4JZ3 A;  2HEQ A;  4J9I A;  3UA6 A;  1TG0 A;  2BZX A;  5GJV B;  2LMJ A;  2ROL A;  4K11 A;  5ECA A;  1GCQ A;  2AKK A;  2ED1 A;  1M3C A;  2OJ2 A;  4RTW A;  2DRM A;  2DA9 A;  3JV3 A;  2VVK A;  1T0J A;  1K0X A;  1GCP A;  3FJ5 A;  1K9A A;  1OOT A;  2DL4 A;  1AWX A;  1PKT A;  1QCF A;  3TSZ A;  2EVR A;  2CT4 A;  4AFS C;  1UEC A;  1X69 A;  5GJW B;  1N5Z A;  2K3B A;  1GCQ C;  1JO8 A;  1JQQ A;  1FMK A;  2X3W D;  4DEX A;  1WI7 A;  2ECZ A;  2J05 A;  1AVZ C;  1KSW A;  1ZSG A;  2A08 A;  1KIK A;  2VWF A;  2SEM A;  1Y57 A;  1WIE A;  3TSW A;  2F2W A;  1YWO A;  1M30 A;  2GTJ A;  1BBZ A;  4RTY A;  1NM7 A;  3GBQ A;  1ZLM A;  4LE9 A;  2KE9 A;  1K1Z A;  2H8H A;  1S1N A;  2EPD A;  5IHI A;  2ESW A;  2ED0 A;  2XMF A;  3EG3 A;  3TVT A;  2JM9 A;  2M51 A;  4AG1 C;  1JXM A;  1W1F A;  1YN8 A;  4Y92 A;  4GLM A;  4RTV A;  2GGR A;  1JXO A;  3QWX X;  3UA7 A;  1HSQ A;  1OPL A;  2GQI A;  1T0H A;  2KEA A;  1X2K A;  4WCI A;  1BK2 A;  2EYW A;  2JMC A;  3EGU A;  4J9F A;  3M0P A;  5L23 A;  1HD3 A;  1TUC A;  2FEI A;  1UFF A;  2V1Q A;  2RF0 A;  4QT7 A;  5IH2 A;  1WYX A;  1WA7 A;  2KRM A;  1GBQ A;  3R6N A;  2JMA A;  1BU1 A;  1PWT A;  4F17 A;  2LX7 A;  3M0R A;  2YUO A;  1UGV A;  1AWJ A;  2L3S A;  4M4Z A;  2BTT A;  2YUP A;  3KFV A;  1GBR A;  5IHK A;  2G6F X;  1Z9Z A;  1WXU A;  2HBW A;  2JS0 A;  1EFN A;  1X6G A;  2EYY A;  4LUE A;  4JJB A;  2EGE A;  1NEB A;  1UE9 A;  1VYT A;  1E6H A;  2V1R A;  1RLP C;  3M0T A;  2GTO A;  1G2B A;  2KT1 A;  1CSK A;  1AEY A;  1ABQ A;  3UAT A;  1CKB A;  2RMO A;  1AOJ A;  2KBT A;  2LCS A;  1W70 A;  2W0Z A;  3H41 A;  4ORZ A;  1U06 A;  4IIM A;  2YDL A;  2DF6 A;  1ZX6 A;  4RTX A;  2EGA A;  2X3X D;  2DLP A;  2I0N A;  2MCN A;  4AG2 C;  1E6G A;  1MUZ A;  2JTE A;  2CRE A;  4HVV A;  3M0S A;  1WLP B;  2SRC A;  2DBM A;  1WX6 A;  1SHF A;  2KYM A;  2NWM A;  1MV3 A;  3EG1 A;  1ZBJ A;  4J9H A;  3VS4 A;  4AFZ C;  1UTI A;  2PTK A;  1HJD A;  2YT6 A;  2NUZ A;  1PRL C;  1M3A A;  1X2Q A;  1T3S A;  1YP5 A;  2OI3 A;  2RQR A;  2EBP A;  2LQW A;  2RQV A;  4Z89 A;  3I35 A;  2DVJ A;  2AZS A;  5HCK A;  4X1V A;  1AWW A;  4F16 A;  2ROT A;  1SRM A;  1PRM C;  1Z9Q A;  3RNJ A;  3VRZ A;  2FG0 A;  1UDL A;  1A0N B;  2OAW A;  2EKH A;  4J9D A;  3PE0 A;  2QDL A;  1AD5 A;  2EGC A;  2IIM A;  4RTT A;  3VS2 A;  1Y0M A;  2A36 A;  2FRW A;  1WXB A;  2J6K A;  4RTZ A;  1OV3 A;  1ZUU A;  2RQU A;  1GFC A;  1M27 C;  4AFU C;  2DJQ A;  1KJW A;  3O5Z A;  2EW3 A;  2KXC A;  3LH5 A;  2J06 A;  4HXJ A;  2KRN A;  2YUQ A;  3M0Q A;  1SHG A;  1QWE A;  1CKA A;  1AZE A;  3EG2 A;  1W6X A;  2KGT A;  4GBQ A;  1SSH A;  2DL7 A;  2CDT A;  2DYB A;  2L3P A;  1K4U S;  3VRY A;  2D8H A;  2LP5 A;  4JPB W;  3REA B;  2FRY A;  2L3Q A;  2LNH B;  1JEG A;  2HSP A;  2DNU A;  2LJ0 A;  3PVQ A;  1JU5 C;  2RN8 A;  2EQI A;  4RUG A;  4J9G A;  1SPK A;  5EC7 A;  3I9Q A;  2KXD A;  4EIK A;  2EYZ A;  4HVW A;  2A37 A;  5FWC A;  1OEB A;  1X27 A;  1WXT A;  2RNA A;  4HCK A;  4AFQ C;  2P4R A;  1NLP C;  4Z88 A;  2DL5 A;  2HDA A;  3H0F A;  2GBQ A;  1B07 A;  1T3L A;  2KYB A;  1MV0 B;  1ZUK A;  4E6R A;  2BZ8 A;  2C0O A;  1K76 A;  4OMO A;  2O88 A;  2B86 A;  2K79 A;  3NMZ C;  2J6F A;  2FPF A;  1KFZ A;  4ESR A;  1PHT A;  1VA7 A;  1NLO C;  1WDX A;  2CUB A;  1LCK A;  1UHF A;  4OMN A;  1J3T A;  2DM1 A;  2AZV A;  2DRK A;  2O9V A;  1M3B A;  5I22 A;  2O2O A;  2K2M A;  2M0Y A;  2EYX A;  2O31 A;  2DBK A;  2D8J A;  5FW9 A;  2DL8 A;  5IXB A;  2PNI A;  3PVL A;  1U3O A;  2W10 A;  2ENM A;  2D0N A;  3VS3 A;  4FSS A;  3EHR A;  3NPF A;  1ZUY A;  4JJD A;  2DIL A;  2YSQ A;  3H0I A;  3I5R A;  1UUE A;  2DE0 X;  1QLY A;  4IIO A;  1QKX A;  2LQN A;  1NYG A;  2L0A A;  1I07 A;  3VS6 A;  1H3H A;  2O9S A;  2CH4 W;  1ABO A;  2LJ3 A;  1UJY A;  2GNC A;  4CC4 B;  3M0U A;  4CC3 A;  1UJ0 A;  2K9G A;  1QWF A;  1YNZ A;  1UG1 A;  4HVU A;  3C0C A;  4OMM A;  2MOX A;  2CUD A;  4R0K A;  2LJ1 A;  4LUD A;  2DX1 A;  2PZ1 A;  1YCS B;  1GL5 A;  1RUW A;  2CT3 A;  1SRL A;  4LNP A;  2A28 A;  1AZG B;  1YWP A;  5IXF A;  3U23 A;  3RBB B;  3I5S A;  2KRO A;  1PNJ A;  3EHQ A;  1G83 A;  2YUN A;  1NG2 A;  2LZ6 B;  4LN2 A;  4KRT A;  2JW4 A;  3NHN A;  1ARK A;  2AK5 A;  1IO6 A;  2RQW A;  1K0S A;  2AKL A;  3H0H A;  3EG0 A;  2D1X A;  2KRS A;  3REB B;  1AWO A;  1TUD A;  2J7I A;  4DEY A;  2JXB A;  4F14 A;  3VS5 A;  4RTU A;  1H8K A;  1XOV A;  2ABL A;  4JJC A;  5IHN A;  4JZ4 A;  2RQT A;  3A98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...