2H3JA

Solution nmr structure of protein pa4359 from pseudomonas aeruginosa: northeast structural genomics consortium target pat89
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
b'MSALQPSRSYRITGYSPAISNGYRQRLFSMGLLPGAALRVVRIAPLGDPIQVETRQTSLALRRKDLALLTLVPLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PA4359
publication title Solution Structure of Hypothetical protein PA4359: Northest Structural Genomics Target PaT89
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2h3jA01
1BI1A 3MHXA 2QQAA 1FX7A 2K5LA 1BYMA 2GCXA 1G3YA 1BI3A 1BI2A 1QVPA 2K4YA 1QW1A 3HRUA 1G3WA 5CVIA 3E19A 4O5VA 1BI0A 1FWZA 3GLXA 1U8RA 3HRSA 4O6JA 2QQBA 2H3JA 1G3TA 1G3SA 2K5FA 2K5IA 1P92A 3HRTA 2QQ9A 2LX9A
chains in the Genus database with same CATH superfamily
1VQNA 4M77G 2X3WD 2LNHB 4LUDA 2RHXA 4ORZA 4X34A 1NEBA 2KRSA 5J3BA 1I0CA 2RHUA 4M7DD 3KFVA 3CCJQ 1TU0B 1YWOA 3MP8A 1AOJA 4C0DC 3QWYA 4N4HA 1I81A 1OOTA 2Y4XA 2QQBA 4ZGEB 2PNIA 1UFFA 3JCMc 4BE0A 1EFNA 5C0MA 1BIBA 4M7AD 3HSBA 3M59A 1MV0B 2GCXA 4DBQA 4CC7A 1M1GA 2F5KA 2NUTA 3OW2S 1HYOA 2RH2A 2VB6A 1WHHA 1PCXA 2DL3A 4J9DA 3DKMA 4QW2A 5KYNA 1OX9A 1VQ8A 2M9UA 2C0IA 2IIMA 1FMVA 3G6ET 3OB9A 2PZ1A 1WYXA 4OMLA 3OYJA 1MHNA 1OV3A 3OYLA 2F2XA 5KYYA 5I11A 4IKFA 2JS2A 1W70A 4E7LA 1W4SA 2DVEA 2CUDA 2EYQA 3UA7A 3GBQA 2VXFA 4TVRA 2E6ZA 2CSIA 3ZL7C 2QQ9A 3G6EQ 3CCUT 1YJNT 5AYFA 2COZA 3MEAA 5GANe 5GAN5 1QVFA 3M55A 4HT9A 3A8LB 4J9IA 1UGRB 3MP6A 1GCPA 1XJWB 5HK3A 4OMOA 5LJ5f 1UGQB 3LGLA 2DZ9A 1PSFA 2CZ1B 4BD3A 1AD5A 3CCUQ 2HL5C 3CCMQ 1LNXA 2EFIA 4IUVA 3OY9A 2EYYA 1UUEA 4FL6A 3OS5A 4OF1A 2HSEB 3BDUA 3RKYA 2COYA 2ZPFB 1UJYA 2EGEA 4OB0B 3LH5A 3INZA 1BK2A 3OQ5A 2EGCA 4FCYA 2JOYA 4CC4B 3G7ZA 2C06A 2KXDA 5IHIA 2RQWA 1Q82R 1AWWA 3TQ7P 4IUQA 4CRIA 2QQAA 3CCMA 3VRYA 3OA6A 1OEBA 3UT1A 1QKXA 4NL2A 2KE9A 2LVMA 2GNCA 3TEEA 1VQMT 4M7AE 3S3MA 3L42A 2WSCE 2RM4A 4QQGA 1EX4A 4KBMB 2CP0A 3G71T 1OQKA 4J9CA 2NUPA 4ELZC 1QVGA 4C0ZA 3BDLA 3UDCA 2JNGA 3CCQA 4EMKC 1VQMQ 5GAN7 2D1XA 3OSVA 2FPDA 4A4KA 1YJ9T 1K73C 3LX7A 2O01E 1UGPB 1J3TA 1VQ6A 1WHJA 4HVUA 5D6XA 2GBQA 1N9SA 1AVZC 3H6ZA 2J6FA 2DX1A 4OB1B 1YJ9Q 2DBKA 2Y90A 3H0IA 3TSZA 3FB9A 3JRZA 3QDRB 4PJOB 4FYWB 4NOYA 2KNBB 1U1SA 3RERA 4M75F 4M7DG 2L3QA 2QEXT 2LQ8A 2DTOA 1IXDA 4A54A 3PTAA 4AFSC 4XTXA 3AT1B 4Z02A 3G4ST 4M75C 4E7HA 2YUNA 5GAN4 5J26A 1S72T 3P8BB 2DTHA 2XD0A 4M77B 4M78A 2L3SA 4M7AG 2BZXA 4GLKA 5ECAA 5I2MA 3JCMh 2HQEA 2YUOA 2YLBA 1X75C 2VWFA 2Y4YA 1RACB 3AHUA 1S72Q 1OULA 1Q7YC 4C8QB 4EIKA 3A8GB 2OTLQ 3FJPA 4C92A 2R5MA 3PVLA 3SEMA 3RKWA 2P84A 1V29B 1RAGB 4EMGA 4FYVB 1KJWA 3S3NA 2NUZA 1WQ7A 2SRCA 4F17A 2LCCA 3VS6A 3QJ6A 2XKOC 2KGTA 2K3XA 3QPHA 3EFSA 1C1AA 6AT1B 1W6XA 2QQSA 3JV3A 3ULRB 1VQLT 3CCVT 2P4TA 4RG8A 1IB8A 1H3HA 2CSQA 1QVFP 3EG1A 3HKSA 1UEBA 3LH0A 3I56T 2E70A 4F7UA 2P4RA 1TTHB 1X6BA 2J7IA 5GMKh 2JTEA 1K73U 1UHFA 1X6GA 2F5TX 4LD6A 2R58A 2KI7A 2R5AA 3J80E 4JDSA 1BB9A 1I5LA 5IXBA 2LCSA 1WGSA 1NG2A 3ZFJA 1B34A 3I56Q 5IH2A 4XU2A 2AKLA 2RHZA 2A0FB 1YCSB 2LTOA 3CCET 1JEGA 1GFDA 1YFNA 4FT2A 2EKHA 3LYIA 1QMCA 3QXEB 5FRNA 1QLYA 3VS0A 3QUIA 2K3BA 2MAMA 2G6FX 2OAUA 3OYHA 1UHCA 4J9BA 2A3LA 2BIVA 4ZN1A 3CCEQ 1NJIC 3I35A 5A2QE 3OYMA 3LWIA 4MDWA 2CP6A 2C0TA 3EAEA 2IVWA 4FU6A 2KDSA 4AG1C 2DJZA 3LLRA 3EG0A 3HFNA 3KUFA 5LJ3f 2AK5A 4RCCA 3MCAB 1Q7YU 5LJ5g 1QVGP 1QW1A 4OGCA 4E47A 2CP7A 3HRSA 2HBWA 1EZZB 2E5QA 1D3BB 1E6HA 4PJMA 1VQ7A 5CCAA 5FWBA 2X51A 2YRCA 1WFWA 2RK2A 2E64A 2DIGA 3CC4Q 1ZBJA 2OTJQ 2JVVA 4XTVA 2J6OA 2RB6A 2X4XA 2CYZB 5CR2A 1WHGA 5FROA 3NHNA 2DTIA 5GAOp 5GMKj 1SRMA 1CSKA 2OX7A 4J9EA 4RTUA 1ZA2B 3I5SA 3SWNB 4HCZA 1AWOA 3CBMA 3V8LA 2X35A 1VOMA 2KEAA 2F2VA 3X25B 4KGZB 2KT8A 4QQDA 4MZTA 1PWTA 1IGQA 1AEYA 1PKTA 3ME9A 3FEOA 1AWXA 1K4US 2JM8A 2V8KA 2MPXC 3CC4A 1NYGA 3E9FA 4C8QD 2OTJA 3OS2A 3JAME 1B7TA 3UF4A 4KULA 4N4GA 1NPPA 1YNZA 3O8VA 1SSFA 2MYSA 3D7SB 5GAMf 4C0FA 2LNVA 2DYIA 4M78F 1YJWT 4AFQC 1SG5A 2CDTA 2HEQA 2KRMA 3A8OB 4KT0E 4M78C 5LJ5d 4M7AB 3JB9J 2QGFB 3TU4K 1FXXA 4IIMA 3BW1A 5LJ5j 1NJIU 4RTXA 1YITQ 2E3IA 4LDVA 2NWMA 2EQIA 5CKEA 2X9HA 2DEUA 1SHGA 1VA7A 3CMAA 1D1BA 2QTVA 4R56A 2XDPA 3OYKA 1XQHA 2DO3A 3VUZA 2K2MA 3EFOA 4Z89A 2AHJB 1E6GA 2X3XD 2ED0A 4O6JA 3WVDB 3L2RA 4BY6B 5FU6B 1IO6A 3FIFA 1LPLA 3HTRA 4D8KA 5GANg 5GAN8 1SRLA 1UG1A 3THKA 2XI9A 2O31A 3NMZC 3META 1G83A 2YWWA 2RF0A 3PNWC 2FG0A 2KXCA 3NPFA 4HT8A 2DLPA 4F7UF 4PFPA 2CZ6B 2RI3A 2H8HA 2H3JA 2XDBA 3PGGA 1UJ0A 5GMKe 3WXMB 3OYDA 3CPWS 1YI2A 3E9GA 4JRIA 1UB4A 2JZ2A 2HQXA 4Y28E 1VQKA 3M4GA 1RAFB 1N27A 2LC4A 4XAXB 3RNJA 1D0ZA 3OYCA 1KD1C 4IUUA 4BDYA 3JB9D 1VQOT 3VV0A 2HMAA 3OBYA 1VQ4Q 2J6KA 2QTXA 1VQNT 1VQ5Q 1PD1A 2BE9B 2JS0A 3M9QA 2RI5A 2LMJA 1WXUA 1TH7A 4J6XA 4D8DA 2FZCB 2VKNA 4JRPA 3QWXX 1ZBXA 4RTTA 3LW5E 2L5QA 3ASKA 5CK9A 1M30A 3M5AA 1KSWA 2E10A 2K9GA 2FYKA 3PT9A 4J9GA 2KT1A 5GANd 3DLLA 3JCMf 5GANj 2RJCA 3BE3A 4CC3A 3IQLA 4DBRA 2V1QA 2CP3A 3CCJT 4ME7A 1VQ8T 2X4YA 3VS5A 4FYYB 1N8RC 1T0JA 5LJ3h 2EGAA 5GJVB 1K9MC 3EGDA 2RN8A 1RAIB 2LJ3A 4XU1A 1GBRA 1NBEB 3E19A 1VQ8Q 4KUDK 2PVDB 1I5OB 4C8QG 3E1SA 1M2VB 2QK0A 2DNUA 2NUTB 1MMNA 4PLIA 1BU1A 2HBPA 3VS1A 2EIFA 2DIQA 2O9SA 4E7JA 4RTWA 3CMEA 4ELYC 2L0AA 3QYHB 1H8KA 2GFAA 3G1JA 1QCFA 4DQ2A 1KD1U 2G3RA 4AT1B 3V8KA 3E2UA 1NJIR 5KYYB 4CC2A 2ZPBB 3OYEA 3VS7A 1ZSGA 3JCMX 2DD5A 2RA2A 3RR6A 1AWJA 1PKSA 1ZLMA 2VUBA 5I21A 2EKOA 2F69A 5IHKA 2LT4A 4E7KA 3P8HA 2RHIA 4J9FA 2DYBA 2XDDA 2LJ0A 1KQSA 3HRTA 2GQVA 3OMCA 4M7DF 2FRWA 5GAMh 3CCMT 4J7IA 1ZX6A 2HAXA 2KVQG 3RIRA 1YCYA 4JS4A 3C12A 1O9SA 4DOVA 4M7DC 4A4EA 2KYMA 3JCMV 5HK0A 1NM7A 1D09B 3TVTA 1XTDA 1TUCA 4BE2A 8AT1B 2FL7A 5FRMA 2E12A 1T0HA 1LJOA 4ZGDB 1K8AC 5KYWB 2H3EB 2RMOA 1N8RU 1ZSZC 4RMOA 4J7FA 2QDYB 3JB9G 1QP2A 2HSPA 1ZQ1A 1K9MU 1VQ6T 3M4YA 2GTJA 1VQ9A 3CCQQ 1QVFS 1R0CB 4B6MA 3TSWA 1Q81C 3EFRA 4PFOA 4PFZA 3QSUA 4XK8E 2QA4A 2JMCA 2NUPB 3OMGA 1VQ6Q 4FW1A 3UATA 4CI0C 3GIBA 2JJ9A 2O4XA 1BI2A 3X20B 4B9WA 1KG1A 2SEMA 1M90C 1W2BP 2E65A 2MWOA 1GFCA 5FW9A 5CAIA 4E7ZA 2KSSA 4ZGJB 1E7OA 1KC8C 4LUEA 4BI3A 2GF7A 1PHTA 2L3PA 2FEIA 4DBFA 1NLPC 1Y96A 3KXTA 1RABB 4QVDA 1PM3A 1OX8A 1ZUKA 1TOVA 2CKKA 2FPFA 2L8DA 1NEGA 3M0UA 3HFOA 2A36A 4J6WA 4UC4A 2VXEA 4AMCA 7AT1B 1QCOA 1U1TA 1QVGS 1K9AA 4PJNA 3EGXB 4XTUA 2K3YA 9ATCB 5GAOq 2OI3A 4FM4B 3CBOA 1G3WA 3NTIA 2W0ZA 2AKKA 5DM7R 2EJ9A 4Y92A 5LJ3e 1WXBA 4BE1A 2M16A 1YIJA 1BBZA 2OTLT 4OMNA 5GAOl 3PFSA 5CQXA 4L5GA 1PD0A 2WSFE 1VIFA 3NFCA 4X9CA 2XICA 2EBPA 3A1PA 1K8AU 2DA9A 1PRLC 2PU9B 3JCMg 4JPBW 4KRTA 1KD1R 4R55A 2K79A 4YTLA 4XTWA 2KBTA 3ZEHA 3G71A 4PJOA 2EVRA 4K11A 4AFZC 2XU8A 5GAOn 4HVWA 3PMIA 1Q81U 5DY9A 1KFZA 2YRVA 3RESA 1IGUA 1Y0MA 1U5SA 4II1A 5CKBA 3R6OA 2ECZA 1H641 4VUBA 1KQSP 1ACMB 4M77A 1M8VA 3DLMA 2AZSA 5A0DA 1JO8A 2VVKA 3VRZA 5LL6S 3I9QA 1M90U 3GOXA 4M75E 1R0BG 1TUDA 1K1ZA 1ZA1B 2L2PA 1KC8U 3RDVA 1VYUA 5KH6A 2MMPA 1KQ2A 3J7AF 1DJ7B 2ZPGB 2DAQA 3EH1A 3OSSC 2EYWA 1WA7A 2L89A 2ZCFB 3M0QA 4JJDA 3OYFA 4MZMA 3G4SA 5GAMe 1W1FA 1GBQA 1BI0A 1PNJA 4PJLA 4JJCA 2DL5A 2JXBA 3M0TA 2RQVA 3EG2A 3HP9A 3PIPA 3V7RA 1T3LA 1VQ7T 2LCLA 3QZ5B 3C94A 2O9VA 2DVJA 4EDUA 1K9MR 2VGMA 1RI0A 1FYNA 2LQWA 4JLGA 3JCMd 1G5VA 1WIEA 5KCHA 2GQIA 2F2WA 4BDZA 3Q1JA 1VQ7Q 1TXQA 4ANJA 3CC7Q 2J05A 4FYXB 5M9OA 2EPDA 2LX7A 1I07A 2DXCA 3H0HA 2YDLA 4KGXB 5AT1B 1JJ2A 5IT9E 1WJQA 3OYIA 4OGEA 1YWPA 1PC0A 1IHVA 2Z0WA 4M75G 5J39A 4MDXA 4LDYA 4IUPA 2DFUA 4RTYA 3RKXA 1VQLA 3CCVA 1TSFA 1I1JA 3P8DA 2KMTA 3VS3A 3CC4T 4ZNXA 1SSHA 2OTJT 3VJPA 2E5KA 3FDRA 1UGSB 4QVCA 3VS2A 2B86A 4ZTJA 1N5ZA 4C0DB 1V1CA 1WZOA 5DLQE 3CC7A 2ROTA 1HK9A 3CCRQ 2M1HA 4JRQA 1D0XA 3QBYA 4MZPA 2EW3A 5CKDA 1AZGB 3BFMA 5IHNA 4KH1B 2LT1A 2EAYA 2P0QA 3TCJA 2I2LA 3CC2Q 3LGFA 2CP2A 3F70A 1WLPB 3CCLA 1BI1A 3CMAT 2CS7A 3JCMP 1X27A 2XIDA 5KYXB 2M0OA 3X28B 1O75A 4WTOB 4C92D 1IZ6A 3EG9B 1YBYA 2KQWA 2EQKA 1D3BA 4L59A 3CCRA 2D9TA 2VC8A 3CMAQ 4JZ4A 1WXTA 1VUBA 4ESRA 2YSQA 2LDMA 2ZAEA 3CD6Q 1YITT 2D0QB 1OI1A 3CC2A 5GJWB 3LWHA 1GCQC 2ESWA 2D0NA 1LOJA 4AG2C 5CO7A 3JCMe 4QT7A 1G3SA 3SWNA 1YI2T 4GY5A 4KH0B 2RJEA 4LN2A 3MEVA 4HCKA 4PJOF 1VQKT 3JSCA 2COWA 5CKFA 3I55A 5KCOA 3L2WA 1G3YA 2E41A 3MJXA 1M8MA 4PJOC 2PUOB 1YI2Q 4E2FB 1M90R 3GP8A 3CCSA 2V8IA 2YUPA 3CD6A 4M7DA 2NLUA 4XTYA 1VQKQ 2A7YA 1Q95G 1KC8R 1Y57A 4M77F 4ATOA 1PG5B 2RQTA 5I22A 1X69A 1K73R 1WNLA 4FSXA 4DBHA 8ATCB 2HKQB 4M77C 3R6NA 2P0PA 4C8QF 4M7AA 5FU7B 3L2UA 4WCIA 1ZSZA 1LCKA 2E3HA 1JQQA 3X26B 2QXFA 4C8QC 4M78E 1Z9ZA 1X01A 1OYXA 5KYUB 4PJJA 1S1NA 3MHXA 1VQ4T 2ABLA 3PVQA 1UGVA 1QQJA 5KE3A 1Y7XA 1VQ5T 1JBMA 4EMKB 2ATCB 3RUXA 4BUGA 1YHQQ 4C92E 1JJ2P 1JRIA 1P92A 2DETA 3O5ZA 1RADB 1M9SA 4HCCA 1M1KC 5HKCA 2RHYA 1Q7YR 2MF2A 3HRUA 2LQNA 2RO0A 1SHFA 1WJSA 4FIBA 2CH4W 3A98A 3L2ZA 4JLIA 2D8HA 2X4JA 3GNFB 1T3SA 1W2BA 1M3AA 1MMDA 4M75B 1YHQA 4P5NA 4F7UE 2DBMA 3CXCA 5GAOr 1KIKA 2QGGA 3M54A 2K7AA 3EH2A 4OB3B 2PTKA 2DEQA 5CVIA 4PK4A 1ZUYA 2BTTA 1OPLA 1G3TA 1VQPA 1I4K1 3M0PA 4RTVA 3CMEQ 2QDLA 2E1HA 4RKUE 3SHWA 5I2SA 1QCNA 4XTZA 4R0KA 4JJBA 3DB3A 4C92G 3GPLA 2CH4A 4C5HA 2EJFA 2WACA 2YT6A 5LJ3g 1C0MA 2DPPB 4L6V5 3VUBA 4Q5WA 1VQOA 2FHDA 1MMGA 4QQ6A 2LZ6B 2P0KA 1RLQC 1WI7A 2PVGB 4OP0A 3C95A 1U06A 2MOXA 3OW2A 2LP5A 2HDAA 4QKUA 4EPCA 5GAOm 2DKGA 2R57A 1MUZA 2MIOA 4PLLA 3REAB 1N6AA 1Z9QA 4F14A 2V26A 4F7UG 1MMAA 2FVUA 2KK4A 2CT3A 3A8HB 2K5FA 1NPRA 5A0GA 1OPKA 5CQYA 1ARKA 1TG0A 2CZ0B 2YLCA 3ER0A 1UE9A 1ZUUA 2RQRA 3C4SA 2FZGB 1D1CA 5GAN6 2O2OA 3CEYA 4DOWA 1M1KU 1M2VA 5A0LA 4JJNK 2BUDA 3SWNC 1VQ9T 3HL8A 4O5VA 2QQRA 4RG2A 4J8OA 3A5ZB 3OYBA 1HSQA 4Y91A 3CCJA 4DEYA 1KK7A 2B8AA 2QA4T 1QWFA 2ROLA 4LNPA 2D6FA 1ZHIA 3CPWP 2FPEA 1VQ9Q 4AFUC 5GAMg 2DL8A 4DEXA 1H92A 2YUQA 2HL3A 2K4YA 3FLGA 1R77A 2RK1A 3CQTA 3QYGB 5LJ3d 1KHCA 3GLXA 1AHJB 4Z88A 2QA4Q 2MK5A 4M7AF 4E6RA 5LJ3j 1CKAA 1OU8A 5GMKm 3I5RA 3CCQT 4HVVA 5GMKi 1CKBA 4M7AC 2W10A 1KQSS 2KAFA 3S6WA 1WDXA 4KGVB 1HXDA 2RQUA 5D6WA 2DD4A 1BI3A 4OMQA 4C5GA 1Q86C 1Y07A 3VYGA 1UTIA 2JMAA 2DERA 1YJNQ 2O4XB 3ZBDA 3WVEB 2RPNA 1TUGB 1M1FA 1MV3A 1WHMA 3VS4A 2K57A 3C0CA 2DL7A 2BZ8A 2XK0A 2HCKA 4BY6C 5FU6C 2LJ1A 2YXYA 4V2SA 2RJDA 2XMFA 3CPFA 3G6EA 3KBGA 4HXJA 1SEMA 2DF6A 4A4HA 1Y96B 4M75D 4M7DE 4XQ3A 4IUTA 3M56A 2MCNA 1YIJT 2K5IA 5FU7C 5KYWA 3CXCP 3EHQA 2OAWA 4LD9K 5IN1A 3L2QA 1A0NB 3CCUA 1YJNA 3H9NA 2ED1A 3JCMW 1MNEA 1D0YA 3JCMQ 3M53A 1QP3A 4HA8A 4J5YA 1YIJQ 5GAMd 1OU9A 2NYSA 1SPKA 3H41A 4X1VA 3HPWA 2EQJA 5GAMj 2BZYA 2KR3A 2DZCA 2FZKB 1GRIA 4EMHA 1K76A 2DK3A 1FX7A 4M78B 3G71Q 4OMFB 4LXCA 2HD0A 3SD4A 3OYYA 2GFUA 2QG9B 4N0AA 5L23A 3OW2P 1GCQA 3FC3A 4C92B 1YP5A 1G2BA 2QYZA 4NS5A 1QWEA 2RD1A 3NTKA 2EYZA 2E4HA 3MEWA 1RAHB 2DILA 1VQMA 1Q86U 4N4IA 1BKBA 1OZ3A 5IXFA 2AIRB 2LQKA 3JCMb 3UWNA 2FO0A 2QEXQ 3EGXA 5GANf 2CREA 2DJQA 2C0OA 3G4SQ 1H3ZA 1M1KR 1YJ9A 3H0FA 3REBB 4F7UB 1N9RA 3FJ5A 2XHCA 4GLMA 1FMKA 2PUKB 4MMLA 1RAEB 1V76A 5CKHA 4IURA 2FRYA 1B34B 2CP5A 2X4WA 4C8QA 3PIOA 1RUWA 1Y71A 2EQMA 3QZ9B 2QEXA 1K0SA 5L8RE 3JCMJ 4IIOA 5D6YA 5GMKl 4OMMA 4A63B 2RJFA 1S72A 3QKJA 2K6DA 2OTLA 2JT4A 3QDFA 1RL2A 1XNIA 2VGNA 3BY7A 2GTOA 1XOVA 1N8RR 3CC7T 1BIAA 1X43A 2I0NA 2KYBA 2L3RA 1VQLQ 3CCVQ 1EIFA 4QVZA 5FWCA 4C0GA 3CBPA 2EWNA 1M4ZA 3RMQA 2RNAA 2M51A 2JUFA 2ZZDA 1MNDA 4JUVA 5KE2A 5GAN2 2QI2A 3CCLT 2DM1A 4OB2B 1VYVA 1M3CA 3OS0A 2JM9A 1WQWA 3QO3A 3VKIA 2DRMA 4JS5A 2DE0X 1TWBA 2O88A 4XU3A 2EJGA 3EG3A 3A8MB 2CT4A 2A37A 4PKCC 3UPUA 1JXOA 1WJRA 4A53A 4RTZA 3CCRT 3CCLQ 3VU3C 1B07A 2PQWA 4JRKA 4NL3A 1ABQA 2A28A 3T9NA 3I56A 4X9DA 2KY9A 2ZPIB 5LJ5h 2M0YA 2MI6A 2CGHA 3CC2T 2XG8D 1RAAB 3S3OA 1D1AA 1JJ2S 1JXMA 4OMPA 2JTMA 2YHTA 3VYHB 3EGUA 2F1LA 4M78D 2QASA 2HNIA 1WX6A 1QKWA 2IG0A 3I55T 3CCEA 3TREA 2VASA 1WHKA 4BACA 5EC7A 4E7SA 1X2QA 3QHSA 4LE9A 2YRDA 3OBWA 4OVAA 2RI2A 4PJOD 1G8XA 1AT1B 3CCST 2ZGWA 3CD6T 2V8JA 1TS9A 1VIEA 2DXUA 4WF2A 3I55Q 4JZ3A 3RMSA 2J06A 3X24B 3NGPA 1SKUB 2LRQA 5D7UA 4C5IA 2D8JA 4PL6A 3OYNA 1K8AR 2DL4A 4FW2A 2K5LA 3CCSQ 2WSEE 3GF5A 4M77D 1Q86R 4BI8B 4N0AC 3SDZA 1IREB 1U8RA 5DLOA 4B9XA 3L2VA 1WHLA 3EFOB 1Q81R 1Q82C 2BE7D 4M7DB 1MGQA 1BCOA 2CUBA 1M27C 1GXIE 5KYXA 1JU5C 1U3OA 1I8FA 4RUGA 3EG9A 1PRMC 2KRNA 3MP1A 2IPOB 4Z8AA 3PMTA 3V8JA 1SF9A 5HCKA 4E7IA 1LVKA 1FMWA 3SB2A 2K2VA 3DB4A 1F1BB 3FRNA 5FLXE 3OS1A 3JB9I 2HKNA 1ZSZB 1KHIA 3L1AA 1YJWQ 1IHWA 2LX9A 4C92F 2M02A 3H8ZA 2ZPHB 2HQHA 4HCBA 4C92C 3URGA 3CPWA 2GGRA 4BI4A 5HY6A 1FWZA 1UECA 4F16A 1K0XA 1UDLA 5GANh 2KROA 4RCBA 4LDXA 3V7CA 4PNOA 4LDUA 2JTFA 1YHQT 3M57A 3QJYA 4KUIA 4BB7A 1YJWA 3M58A 3N5BB 1YITA 1HJDA 3OYAA 2ENMA 2E6NA 4C5EA 1YN8A 1BCMA 4A4GA 2FB7A 2EYXA 1VQPT 4PJOE 1JB0E 4DA4A 2VV5A 2DXBA 2JW4A 2V1RA 2EQUA 4J9HA 2DXTA 2OJ2A 1B3QA 3GNGA 3UA6A 1RI9A 1BYMA 4A4FA 3HHTB 3M0SA 1VQPQ 4M4ZA 3SFMA 2AT1B 3U23A 1KQ1A 4M77E 2CZ7B 5KYUA 1WPYA 4LDWA 1M5Q1 1OZ2A 5C6SA 4D6WA 2HZYA 3J81E 4XU0A 1X6OA 1Q82U 4ZN3A 1VYTA 4C8QE 4FSSA 1NYFA 1PSEA 3CMET 1M2OA 4EMKA 1VQOQ 4HKEA 1ABOA 2BKDN 2AZVA 3NTHA 4M78G 3QG1A 1VQNQ 3MKDA 3EGDB 5CIUA 1R8OB 1AZEA 3V7SA 3JB9H 5EG2A 5LJ5e 5GAN3 3OYGA 1NZ9A 3PE0A 2MWPA 1NLOC 3QIIA 2PVOB 4J6YA 2DRKA 2A08A 4ZTFA 3JB9F 1RLPC 2VYTA 1VQ4A 4PJOG 4F04B 1IRXA 1X2KA 1C6VX 1NE8A 4GBQA 1W2BS 1QVPA 2DMOA 2JN0A 1VQ5A 1M3BA 3MEUA 3MPUB 3CXCS 2QAZA 3M0RA 3RBBB 3EHRA 4MMKA 4M75A 4FT4A 2ZPEB 5IAYA 1HD3A 1GL5A 4J83A 3MO8A
chains in the Genus database with same CATH topology
4LDVA 3CCUA 3HP9A 3PIPA 1YJNA 3V7RA 1VQNA 1VQ7T 2LCLA 3QZ5B 3C94A 4M77G 5CKEA 3JCMW 3CMAA 4EDUA 3JCMQ 2RHXA 2VGMA 3M53A 1RI0A 2XDPA 4X34A 4R56A 1QP3A 4HA8A 4J5YA 1XQHA 2DO3A 5J3BA 2RHUA 3OYKA 3VUZA 4M7DD 4JLGA 5GAMd 3JCMd 2AHJB 3MP8A 4C0DC 1G5VA 3HPWA 4N4HA 5KCHA 1I81A 2EQJA 4O6JA 2Y4XA 2QQBA 3WVDB 4BY6B 5GAMj 3L2RA 5FU6B 4ZGEB 3Q1JA 4BDZA 5M9OA 2DZCA 3FIFA 3JCMc 4BE0A 2DXCA 5GANg 5GAN8 1VQ5T 4EMHA 5C0MA 1BIBA 1JJ2A 5IT9E 1WJQA 2DK3A 2XI9A 1FX7A 3HSBA 4M7AD 3OYIA 3M59A 3META 4M78B 4OGEA 2GCXA 4M75G 3PNWC 5J39A 4MDXA 4OMFB 4HT8A 2HD0A 3SD4A 4F7UF 1M1GA 2F5KA 4LDYA 3OYYA 4IUPA 2CZ6B 2GFUA 3OW2S 2RI3A 3RKXA 1VQLA 2RH2A 2H3JA 4N0AA 3CCVA 3P8DA 2XDBA 2KMTA 3PGGA 3CC4T 5GMKe 3WXMB 3OYDA 3CPWS 1YI2A 2OTJT 3E9GA 3DKMA 3VJPA 4JRIA 1UB4A 4QW2A 1VQ8A 2JZ2A 3FC3A 2HQXA 4C92B 3FDRA 2M9UA 1UGSB 4Y28E 4QVCA 4NS5A 1VQKA 4ZTJA 4C0DB 3M4GA 5DLQE 3CC7A 2RD1A 3G6ET 1HK9A 3NTKA 3OB9A 1N27A 2M1HA 4JRQA 3OYJA 3QBYA 4MZPA 1MHNA 2LC4A 4XAXB 3MEWA 3OYLA 3OYCA 5CKDA 1VQMA 1Q86U 1KD1C 3BFMA 4IUUA 4BDYA 3JB9D 4IKFA 4N4IA 1BKBA 4E7LA 2LT1A 1W4SA 2DVEA 1OZ3A 3VV0A 1VQOT 2EYQA 2EAYA 2LQKA 2VXFA 4TVRA 3JCMb 2E6ZA 2P0QA 3OBYA 3UWNA 3TCJA 2I2LA 2QQ9A 5GANf 3LGFA 2QTXA 3CCUT 1YJNT 1VQNT 5AYFA 3F70A 3CCLA 1BI1A 3MEAA 3CMAT 2CS7A 1H3ZA 1YJ9A 5GANe 3JCMP 5GAN5 1QVFA 3M55A 2XIDA 4HT9A 3A8LB 2M0OA 3X28B 1UGRB 3MP6A 1O75A 3M9QA 1N9RA 2RI5A 4C92D 1IZ6A 4F7UB 5HK3A 5LJ5f 1UGQB 1TH7A 4J6XA 2KQWA 1YBYA 3LGLA 2DZ9A 1PSFA 2CZ1B 2EQKA 2XHCA 4BD3A 1D3BA 4JRPA 1ZBXA 2PUKB 4L59A 4MMLA 3CCRA 1LNXA 2D9TA 2EFIA 2VC8A 4IUVA 3OY9A 5CKHA 3LW5E 4IURA 2L5QA 4FL6A 3ASKA 3OS5A 4OF1A 5CK9A 1VUBA 3M5AA 2E10A 3BDUA 2FYKA 1B34B 3PT9A 2LDMA 2X4WA 2ZPFB 3RKYA 4C8QA 5GANd 3PIOA 4OB0B 1Y71A 2EQMA 3INZA 3QZ9B 2QEXA 3DLLA 3JCMf 3OQ5A 2D0QB 1OI1A 5L8RE 5GANj 2RJCA 1YITT 3CC2A 2JOYA 3JCMJ 3G7ZA 3LWHA 5D6YA 5GMKl 2C06A 1LOJA 5CO7A 3JCMe 2RJFA 1S72A 1G3SA 3SWNA 3CCJT 1YI2T 4GY5A 3QKJA 4ME7A 1Q7YU 1VQ8T 2RJEA 2OTLA 2X4YA 4IUQA 4CRIA 1RL2A 3MEVA 1XNIA 4PJOF 1VQKT 3JSCA 2VGNA 3BY7A 1XOVA 2QQAA 3CCMA 1N8RC 5CKFA 5LJ3h 3OA6A 3I55A 3CC7T 5KCOA 1BIAA 3L2WA 2L3RA 3UT1A 1G3YA 2E41A 1K9MC 4NL2A 1EIFA 4QVZA 2LVMA 4XU1A 3TEEA 4C0GA 1VQMT 4M7AE 2PUOB 3CBPA 4PJOC 2EWNA 1M4ZA 3RMQA 3L42A 3S3MA 2WSCE 2RM4A 3E19A 4QQGA 4KBMB 2V8IA 3GP8A 2PVDB 3CCSA 4KUDK 4C8QG 3CD6A 4M7DA 3E1SA 3G71T 2NLUA 4XTYA 2JUFA 2ZZDA 4JUVA 4PLIA 2A7YA 4ELZC 1QVGA 5KE2A 5GAN2 4C0ZA 3BDLA 2HBPA 4M77F 3UDCA 2JNGA 2EIFA 2QI2A 4ATOA 3CCLT 3CCQA 4OB2B 4EMKC 2DIQA 3OS0A 1WQWA 3QO3A 3VKIA 5GAN7 4A4KA 3OSVA 4JS5A 4E7JA 1YJ9T 1K73C 3LX7A 1WNLA 2O01E 4FSXA 1UGPB 4XU3A 4ELYC 3CMEA 2EJGA 4M77C 2P0PA 4C8QF 3QYHB 3A8MB 5FU7B 4M7AA 4PKCC 3L2UA 1VQ6A 2GFAA 3UPUA 1WJRA 4A53A 5D6XA 4DQ2A 3CCRT 1KD1U 3VU3C 2G3RA 3V8KA 1N9SA 3H6ZA 3X26B 2QXFA 4C8QC 4OB1B 2PQWA 4JRKA 2Y90A 3FB9A 3JRZA 3QDRB 2ZPBB 4M78E 3OYEA 4NL3A 3JCMX 1X01A 4PJOB 1OYXA 2DD5A 4NOYA 3MHXA 2RA2A 1U1SA 3T9NA 3RERA 4M75F 3I56A 4X9DA 4M7DG 2KY9A 1VQ4T 2ZPIB 5LJ5h 2MI6A 2CGHA 2QEXT 2LQ8A 3CC2T 2XG8D 2DTOA 4A54A 3PTAA 3S3OA 2VUBA 4XTXA 5I21A 1JJ2S 5KE3A 4Z02A 3G4ST 1Y7XA 2EKOA 2F69A 2LT4A 2JTMA 2YHTA 1JBMA 4M75C 3P8HA 3VYHB 4EMKB 4E7HA 4E7KA 3RUXA 5GAN4 5J26A 1S72T 3P8BB 2DTHA 4BUGA 2RHIA 4M78D 4C92E 2XD0A 1JRIA 1P92A 2XDDA 1KQSA 3HRTA 4M77B 2GQVA 2HNIA 4M78A 1M9SA 3OMCA 4M7AG 4M7DF 5GAMh 4GLKA 5I2MA 2IG0A 4J7IA 3JCMh 3CCMT 3I55T 2HQEA 4HCCA 2HAXA 2KVQG 3RIRA 3CCEA 1YCYA 3TREA 3C12A 2YLBA 1X75C 4JS4A 4BACA 2Y4YA 1M1KC 1O9SA 3QHSA 4DOVA 5HKCA 4M7DC 4A4EA 3AHUA 3OBWA 2RHYA 4OVAA 2RI2A 4C8QB 1Q7YC 3A8GB 4PJOD 2MF2A 3JCMV 3HRUA 5HK0A 2ZGWA 3CCST 2RO0A 3CD6T 3FJPA 2V8JA 1VIEA 1WJSA 2DXUA 4C92A 4FIBA 2R5MA 4WF2A 3RMSA 3RKWA 1XTDA 3L2ZA 4JLIA 3X24B 4BE2A 1V29B 2FL7A 2LRQA 5FRMA 2E12A 2X4JA 3GNFB 4C5IA 4PL6A 4EMGA 1W2BA 3OYNA 1LJOA 4ZGDB 3S3NA 1K8AC 4M75B 1WQ7A 1YHQA 4P5NA 4F7UE 3CXCA 5GAOr 2K5LA 1N8RU 2LCCA 2WSEE 4RMOA 3M54A 3QJ6A 3GF5A 2XKOC 2QDYB 4J7FA 4M77D 3JB9G 1QP2A 2K3XA 1ZQ1A 3QPHA 4BI8B 3EFSA 4N0AC 4OB3B 1K9MU 1VQ6T 3M4YA 2DEQA 1VQ9A 5CVIA 3SDZA 1IREB 2QQSA 1U8RA 5DLOA 4B9XA 1QVFS 3L2VA 1VQLT 3CCVT 2P4TA 1G3TA 4RG8A 1I4K1 1VQPA 1Q81C 1Q82C 3EFRA 2E1HA 4M7DB 1MGQA 3QSUA 4RKUE 4XK8E 5I2SA 3HKSA 2QA4A 1GXIE 1UEBA 3OMGA 1I8FA 3LH0A 3I56T 2E70A 4F7UA 4XTZA 3DB3A 4C92G 3GPLA 4CI0C 5GMKh 4C5HA 1K73U 3GIBA 3MP1A 2EJFA 2F5TX 2WACA 4LD6A 2R58A 2O4XA 2R5AA 3PMTA 1BI2A 3V8JA 3X20B 4JDSA 4B9WA 5LJ3g 3J80E 1KG1A 4E7IA 2DPPB 1I5LA 4L6V5 1WGSA 4Q5WA 3VUBA 1M90C 3SB2A 2K2VA 1VQOA 2E65A 2FHDA 2MWOA 3DB4A 3FRNA 5FLXE 3OS1A 4QQ6A 5CAIA 3ZFJA 1B34A 3JB9I 2KSSA 2P0KA 4ZGJB 1KC8C 1KHIA 2PVGB 3L1AA 4OP0A 4XU2A 2LX9A 4C92F 2RHZA 3C95A 4BI3A 2GF7A 2LTOA 3CCET 3H8ZA 2ZPHB 4FT2A 3OW2A 3LYIA 4EPCA 3QXEB 4HCBA 1Y96A 5GAOm 3KXTA 2DKGA 2R57A 4QVDA 5FRNA 4C92C 4PLLA 3URGA 3L2QA 3QUIA 3CPWA 4BI4A 2MAMA 1N6AA 2OAUA 5HY6A 3OYHA 1FWZA 4F7UG 2FVUA 2KK4A 5GANh 2A3LA 2BIVA 4ZN1A 3A8HB 2CKKA 2K5FA 1NPRA 4RCBA 1NJIC 4LDXA 2L8DA 5A0GA 5A2QE 5CQYA 3OYMA 3V7CA 4MDWA 4PNOA 3LWIA 3EAEA 4LDUA 2CZ0B 2IVWA 2YLCA 3ER0A 3HFOA 4FU6A 2JTFA 4J6WA 4UC4A 2VXEA 1YHQT 2KDSA 1U1TA 3C4SA 3M57A 1QVGS 3QJYA 4XTUA 4KUIA 5GAN6 3CEYA 4BB7A 2DJZA 1YJWA 3M58A 3LLRA 3N5BB 2K3YA 3HFNA 5LJ3f 3KUFA 4DOWA 5A0LA 1YITA 5GAOq 1M1KU 4RCCA 3OYAA 4JJNK 3MCAB 2E6NA 2BUDA 4FM4B 3SWNC 1QW1A 4C5EA 3CBOA 5LJ5g 1G3WA 4OGCA 3NTIA 1VQ9T 4E47A 3HL8A 4O5VA 2QQRA 4RG2A 3HRSA 4A4GA 2FB7A 5DM7R 4J8OA 2EJ9A 3A5ZB 1VQPT 5LJ3e 3OYBA 4PJOE 4BE1A 4Y91A 2M16A 1JB0E 1YIJA 3CCJA 4DA4A 2VV5A 2DXBA 2E5QA 2OTLT 2B8AA 5GAOl 2QA4T 1D3BB 3PFSA 5CQXA 2EQUA 4L5GA 2DXTA 2D6FA 1ZHIA 2WSFE 3GNGA 1VQ7A 5CCAA 1VIFA 3NFCA 4X9CA 2XICA 1K8AU 1BYMA 5GAMg 4A4FA 2PU9B 2RK2A 3HHTB 3JCMg 2E64A 2DIGA 3SFMA 2K4YA 2JVVA 3FLGA 4R55A 4XTVA 2RB6A 2RK1A 2X4XA 3QYGB 4YTLA 1KQ1A 4M77E 5LJ3d 2CYZB 1KHCA 3GLXA 1AHJB 4XTWA 2CZ7B 3ZEHA 3G71A 5CR2A 4PJOA 5FROA 4M7AF 2DTIA 1WPYA 4LDWA 1M5Q1 1OZ2A 5C6SA 5GAOp 2XU8A 5LJ3j 4D6WA 5GAOn 5GMKj 3PMIA 5GMKm 3J81E 4XU0A 1X6OA 5DY9A 3CCQT 1Q82U 1Q81U 2YRVA 5GMKi 3RESA 3SWNB 4HCZA 4ZN3A 3CBMA 3V8LA 4C8QE 4M7AC 4II1A 1KQSS 2KAFA 3S6WA 5CKBA 1PSEA 3CMET 3R6OA 1HXDA 4EMKA 4HKEA 5D6WA 4C5GA 2DD4A 1BI3A 2X35A 1Q86C 1Y07A 1H641 2BKDN 3NTHA 4VUBA 4QQDA 3X25B 4M78G 4MZTA 3VYGA 4M77A 3QG1A 1M8VA 3DLMA 5CIUA 2O4XB 3ZBDA 5A0DA 1R8OB 5LL6S 3V7SA 3ME9A 3WVEB 3FEOA 5EG2A 1M90U 3JB9H 5LJ5e 5GAN3 2V8KA 3OYGA 3GOXA 4M75E 3CC4A 1M1FA 1NZ9A 3E9FA 4C8QD 2OTJA 3OS2A 2MWPA 2K57A 3JAME 2PVOB 3QIIA 1KC8U 2XK0A 4J6YA 4KULA 4N4GA 2MMPA 5KH6A 1NPPA 4BY6C 4ZTFA 1KQ2A 5FU6C 3J7AF 3JB9F 1DJ7B 2VYTA 2ZPGB 1SSFA 2DAQA 3O8VA 1VQ4A 4V2SA 5GAMf 4PJOG 4C0FA 2RJDA 2LNVA 4M78F 3CPFA 1YJWT 3OSSC 3G6EA 3KBGA 1NE8A 1W2BS 2L89A 2ZCFB 1QVPA 3OYFA 4MZMA 3A8OB 3G4SA 2JN0A 4A4HA 5GAMe 3MEUA 3CXCS 1Y96B 1VQ5A 1BI0A 4M75D 4M7DE 4KT0E 4XQ3A 4M78C 5LJ5d 4IUTA 3M56A 1YIJT 4M7AB 3JB9J 4MMKA 2K5IA 5FU7C 4M75A 4FT4A 2ZPEB 5IAYA 3TU4K 1FXXA 3BW1A 4J83A 5LJ5j 1NJIU 4LD9K 3MO8A 5IN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI1 A;  3MHX A;  2QQA A;  1FX7 A;  2K5L A;  1BYM A;  2GCX A;  1G3Y A;  1BI3 A;  1BI2 A;  1QVP A;  2K4Y A;  1QW1 A;  3HRU A;  1G3W A;  5CVI A;  3E19 A;  4O5V A;  1BI0 A;  1FWZ A;  3GLX A;  1U8R A;  3HRS A;  4O6J A;  2QQB A;  2H3J A;  1G3T A;  1G3S A;  2K5F A;  2K5I A;  1P92 A;  3HRT A;  2QQ9 A;  2LX9 A; 
#chains in the Genus database with same CATH topology
 1VQN A;  4M77 G;  2X3W D;  2LNH B;  4LUD A;  2RHX A;  4ORZ A;  4X34 A;  1NEB A;  2KRS A;  5J3B A;  1I0C A;  2RHU A;  4M7D D;  3KFV A;  3CCJ Q;  1TU0 B;  1YWO A;  3MP8 A;  1AOJ A;  4C0D C;  3QWY A;  4N4H A;  1I81 A;  1OOT A;  2Y4X A;  2QQB A;  4ZGE B;  2PNI A;  1UFF A;  3JCM c;  4BE0 A;  1EFN A;  5C0M A;  1BIB A;  4M7A D;  3HSB A;  3M59 A;  1MV0 B;  2GCX A;  4DBQ A;  4CC7 A;  1M1G A;  2F5K A;  2NUT A;  3OW2 S;  1HYO A;  2RH2 A;  2VB6 A;  1WHH A;  1PCX A;  2DL3 A;  4J9D A;  3DKM A;  4QW2 A;  5KYN A;  1OX9 A;  1VQ8 A;  2M9U A;  2C0I A;  2IIM A;  1FMV A;  3G6E T;  3OB9 A;  2PZ1 A;  1WYX A;  4OML A;  3OYJ A;  1MHN A;  1OV3 A;  3OYL A;  2F2X A;  5KYY A;  5I11 A;  4IKF A;  2JS2 A;  1W70 A;  4E7L A;  1W4S A;  2DVE A;  2CUD A;  2EYQ A;  3UA7 A;  3GBQ A;  2VXF A;  4TVR A;  2E6Z A;  2CSI A;  3ZL7 C;  2QQ9 A;  3G6E Q;  3CCU T;  1YJN T;  5AYF A;  2COZ A;  3MEA A;  5GAN e;  5GAN 5;  1QVF A;  3M55 A;  4HT9 A;  3A8L B;  4J9I A;  1UGR B;  3MP6 A;  1GCP A;  1XJW B;  5HK3 A;  4OMO A;  5LJ5 f;  1UGQ B;  3LGL A;  2DZ9 A;  1PSF A;  2CZ1 B;  4BD3 A;  1AD5 A;  3CCU Q;  2HL5 C;  3CCM Q;  1LNX A;  2EFI A;  4IUV A;  3OY9 A;  2EYY A;  1UUE A;  4FL6 A;  3OS5 A;  4OF1 A;  2HSE B;  3BDU A;  3RKY A;  2COY A;  2ZPF B;  1UJY A;  2EGE A;  4OB0 B;  3LH5 A;  3INZ A;  1BK2 A;  3OQ5 A;  2EGC A;  4FCY A;  2JOY A;  4CC4 B;  3G7Z A;  2C06 A;  2KXD A;  5IHI A;  2RQW A;  1Q82 R;  1AWW A;  3TQ7 P;  4IUQ A;  4CRI A;  2QQA A;  3CCM A;  3VRY A;  3OA6 A;  1OEB A;  3UT1 A;  1QKX A;  4NL2 A;  2KE9 A;  2LVM A;  2GNC A;  3TEE A;  1VQM T;  4M7A E;  3S3M A;  3L42 A;  2WSC E;  2RM4 A;  4QQG A;  1EX4 A;  4KBM B;  2CP0 A;  3G71 T;  1OQK A;  4J9C A;  2NUP A;  4ELZ C;  1QVG A;  4C0Z A;  3BDL A;  3UDC A;  2JNG A;  3CCQ A;  4EMK C;  1VQM Q;  5GAN 7;  2D1X A;  3OSV A;  2FPD A;  4A4K A;  1YJ9 T;  1K73 C;  3LX7 A;  2O01 E;  1UGP B;  1J3T A;  1VQ6 A;  1WHJ A;  4HVU A;  5D6X A;  2GBQ A;  1N9S A;  1AVZ C;  3H6Z A;  2J6F A;  2DX1 A;  4OB1 B;  1YJ9 Q;  2DBK A;  2Y90 A;  3H0I A;  3TSZ A;  3FB9 A;  3JRZ A;  3QDR B;  4PJO B;  4FYW B;  4NOY A;  2KNB B;  1U1S A;  3RER A;  4M75 F;  4M7D G;  2L3Q A;  2QEX T;  2LQ8 A;  2DTO A;  1IXD A;  4A54 A;  3PTA A;  4AFS C;  4XTX A;  3AT1 B;  4Z02 A;  3G4S T;  4M75 C;  4E7H A;  2YUN A;  5GAN 4;  5J26 A;  1S72 T;  3P8B B;  2DTH A;  2XD0 A;  4M77 B;  4M78 A;  2L3S A;  4M7A G;  2BZX A;  4GLK A;  5ECA A;  5I2M A;  3JCM h;  2HQE A;  2YUO A;  2YLB A;  1X75 C;  2VWF A;  2Y4Y A;  1RAC B;  3AHU A;  1S72 Q;  1OUL A;  1Q7Y C;  4C8Q B;  4EIK A;  3A8G B;  2OTL Q;  3FJP A;  4C92 A;  2R5M A;  3PVL A;  3SEM A;  3RKW A;  2P84 A;  1V29 B;  1RAG B;  4EMG A;  4FYV B;  1KJW A;  3S3N A;  2NUZ A;  1WQ7 A;  2SRC A;  4F17 A;  2LCC A;  3VS6 A;  3QJ6 A;  2XKO C;  2KGT A;  2K3X A;  3QPH A;  3EFS A;  1C1A A;  6AT1 B;  1W6X A;  2QQS A;  3JV3 A;  3ULR B;  1VQL T;  3CCV T;  2P4T A;  4RG8 A;  1IB8 A;  1H3H A;  2CSQ A;  1QVF P;  3EG1 A;  3HKS A;  1UEB A;  3LH0 A;  3I56 T;  2E70 A;  4F7U A;  2P4R A;  1TTH B;  1X6B A;  2J7I A;  5GMK h;  2JTE A;  1K73 U;  1UHF A;  1X6G A;  2F5T X;  4LD6 A;  2R58 A;  2KI7 A;  2R5A A;  3J80 E;  4JDS A;  1BB9 A;  1I5L A;  5IXB A;  2LCS A;  1WGS A;  1NG2 A;  3ZFJ A;  1B34 A;  3I56 Q;  5IH2 A;  4XU2 A;  2AKL A;  2RHZ A;  2A0F B;  1YCS B;  2LTO A;  3CCE T;  1JEG A;  1GFD A;  1YFN A;  4FT2 A;  2EKH A;  3LYI A;  1QMC A;  3QXE B;  5FRN A;  1QLY A;  3VS0 A;  3QUI A;  2K3B A;  2MAM A;  2G6F X;  2OAU A;  3OYH A;  1UHC A;  4J9B A;  2A3L A;  2BIV A;  4ZN1 A;  3CCE Q;  1NJI C;  3I35 A;  5A2Q E;  3OYM A;  3LWI A;  4MDW A;  2CP6 A;  2C0T A;  3EAE A;  2IVW A;  4FU6 A;  2KDS A;  4AG1 C;  2DJZ A;  3LLR A;  3EG0 A;  3HFN A;  3KUF A;  5LJ3 f;  2AK5 A;  4RCC A;  3MCA B;  1Q7Y U;  5LJ5 g;  1QVG P;  1QW1 A;  4OGC A;  4E47 A;  2CP7 A;  3HRS A;  2HBW A;  1EZZ B;  2E5Q A;  1D3B B;  1E6H A;  4PJM A;  1VQ7 A;  5CCA A;  5FWB A;  2X51 A;  2YRC A;  1WFW A;  2RK2 A;  2E64 A;  2DIG A;  3CC4 Q;  1ZBJ A;  2OTJ Q;  2JVV A;  4XTV A;  2J6O A;  2RB6 A;  2X4X A;  2CYZ B;  5CR2 A;  1WHG A;  5FRO A;  3NHN A;  2DTI A;  5GAO p;  5GMK j;  1SRM A;  1CSK A;  2OX7 A;  4J9E A;  4RTU A;  1ZA2 B;  3I5S A;  3SWN B;  4HCZ A;  1AWO A;  3CBM A;  3V8L A;  2X35 A;  1VOM A;  2KEA A;  2F2V A;  3X25 B;  4KGZ B;  2KT8 A;  4QQD A;  4MZT A;  1PWT A;  1IGQ A;  1AEY A;  1PKT A;  3ME9 A;  3FEO A;  1AWX A;  1K4U S;  2JM8 A;  2V8K A;  2MPX C;  3CC4 A;  1NYG A;  3E9F A;  4C8Q D;  2OTJ A;  3OS2 A;  3JAM E;  1B7T A;  3UF4 A;  4KUL A;  4N4G A;  1NPP A;  1YNZ A;  3O8V A;  1SSF A;  2MYS A;  3D7S B;  5GAM f;  4C0F A;  2LNV A;  2DYI A;  4M78 F;  1YJW T;  4AFQ C;  1SG5 A;  2CDT A;  2HEQ A;  2KRM A;  3A8O B;  4KT0 E;  4M78 C;  5LJ5 d;  4M7A B;  3JB9 J;  2QGF B;  3TU4 K;  1FXX A;  4IIM A;  3BW1 A;  5LJ5 j;  1NJI U;  4RTX A;  1YIT Q;  2E3I A;  4LDV A;  2NWM A;  2EQI A;  5CKE A;  2X9H A;  2DEU A;  1SHG A;  1VA7 A;  3CMA A;  1D1B A;  2QTV A;  4R56 A;  2XDP A;  3OYK A;  1XQH A;  2DO3 A;  3VUZ A;  2K2M A;  3EFO A;  4Z89 A;  2AHJ B;  1E6G A;  2X3X D;  2ED0 A;  4O6J A;  3WVD B;  3L2R A;  4BY6 B;  5FU6 B;  1IO6 A;  3FIF A;  1LPL A;  3HTR A;  4D8K A;  5GAN g;  5GAN 8;  1SRL A;  1UG1 A;  3THK A;  2XI9 A;  2O31 A;  3NMZ C;  3MET A;  1G83 A;  2YWW A;  2RF0 A;  3PNW C;  2FG0 A;  2KXC A;  3NPF A;  4HT8 A;  2DLP A;  4F7U F;  4PFP A;  2CZ6 B;  2RI3 A;  2H8H A;  2H3J A;  2XDB A;  3PGG A;  1UJ0 A;  5GMK e;  3WXM B;  3OYD A;  3CPW S;  1YI2 A;  3E9G A;  4JRI A;  1UB4 A;  2JZ2 A;  2HQX A;  4Y28 E;  1VQK A;  3M4G A;  1RAF B;  1N27 A;  2LC4 A;  4XAX B;  3RNJ A;  1D0Z A;  3OYC A;  1KD1 C;  4IUU A;  4BDY A;  3JB9 D;  1VQO T;  3VV0 A;  2HMA A;  3OBY A;  1VQ4 Q;  2J6K A;  2QTX A;  1VQN T;  1VQ5 Q;  1PD1 A;  2BE9 B;  2JS0 A;  3M9Q A;  2RI5 A;  2LMJ A;  1WXU A;  1TH7 A;  4J6X A;  4D8D A;  2FZC B;  2VKN A;  4JRP A;  3QWX X;  1ZBX A;  4RTT A;  3LW5 E;  2L5Q A;  3ASK A;  5CK9 A;  1M30 A;  3M5A A;  1KSW A;  2E10 A;  2K9G A;  2FYK A;  3PT9 A;  4J9G A;  2KT1 A;  5GAN d;  3DLL A;  3JCM f;  5GAN j;  2RJC A;  3BE3 A;  4CC3 A;  3IQL A;  4DBR A;  2V1Q A;  2CP3 A;  3CCJ T;  4ME7 A;  1VQ8 T;  2X4Y A;  3VS5 A;  4FYY B;  1N8R C;  1T0J A;  5LJ3 h;  2EGA A;  5GJV B;  1K9M C;  3EGD A;  2RN8 A;  1RAI B;  2LJ3 A;  4XU1 A;  1GBR A;  1NBE B;  3E19 A;  1VQ8 Q;  4KUD K;  2PVD B;  1I5O B;  4C8Q G;  3E1S A;  1M2V B;  2QK0 A;  2DNU A;  2NUT B;  1MMN A;  4PLI A;  1BU1 A;  2HBP A;  3VS1 A;  2EIF A;  2DIQ A;  2O9S A;  4E7J A;  4RTW A;  3CME A;  4ELY C;  2L0A A;  3QYH B;  1H8K A;  2GFA A;  3G1J A;  1QCF A;  4DQ2 A;  1KD1 U;  2G3R A;  4AT1 B;  3V8K A;  3E2U A;  1NJI R;  5KYY B;  4CC2 A;  2ZPB B;  3OYE A;  3VS7 A;  1ZSG A;  3JCM X;  2DD5 A;  2RA2 A;  3RR6 A;  1AWJ A;  1PKS A;  1ZLM A;  2VUB A;  5I21 A;  2EKO A;  2F69 A;  5IHK A;  2LT4 A;  4E7K A;  3P8H A;  2RHI A;  4J9F A;  2DYB A;  2XDD A;  2LJ0 A;  1KQS A;  3HRT A;  2GQV A;  3OMC A;  4M7D F;  2FRW A;  5GAM h;  3CCM T;  4J7I A;  1ZX6 A;  2HAX A;  2KVQ G;  3RIR A;  1YCY A;  4JS4 A;  3C12 A;  1O9S A;  4DOV A;  4M7D C;  4A4E A;  2KYM A;  3JCM V;  5HK0 A;  1NM7 A;  1D09 B;  3TVT A;  1XTD A;  1TUC A;  4BE2 A;  8AT1 B;  2FL7 A;  5FRM A;  2E12 A;  1T0H A;  1LJO A;  4ZGD B;  1K8A C;  5KYW B;  2H3E B;  2RMO A;  1N8R U;  1ZSZ C;  4RMO A;  4J7F A;  2QDY B;  3JB9 G;  1QP2 A;  2HSP A;  1ZQ1 A;  1K9M U;  1VQ6 T;  3M4Y A;  2GTJ A;  1VQ9 A;  3CCQ Q;  1QVF S;  1R0C B;  4B6M A;  3TSW A;  1Q81 C;  3EFR A;  4PFO A;  4PFZ A;  3QSU A;  4XK8 E;  2QA4 A;  2JMC A;  2NUP B;  3OMG A;  1VQ6 Q;  4FW1 A;  3UAT A;  4CI0 C;  3GIB A;  2JJ9 A;  2O4X A;  1BI2 A;  3X20 B;  4B9W A;  1KG1 A;  2SEM A;  1M90 C;  1W2B P;  2E65 A;  2MWO A;  1GFC A;  5FW9 A;  5CAI A;  4E7Z A;  2KSS A;  4ZGJ B;  1E7O A;  1KC8 C;  4LUE A;  4BI3 A;  2GF7 A;  1PHT A;  2L3P A;  2FEI A;  4DBF A;  1NLP C;  1Y96 A;  3KXT A;  1RAB B;  4QVD A;  1PM3 A;  1OX8 A;  1ZUK A;  1TOV A;  2CKK A;  2FPF A;  2L8D A;  1NEG A;  3M0U A;  3HFO A;  2A36 A;  4J6W A;  4UC4 A;  2VXE A;  4AMC A;  7AT1 B;  1QCO A;  1U1T A;  1QVG S;  1K9A A;  4PJN A;  3EGX B;  4XTU A;  2K3Y A;  9ATC B;  5GAO q;  2OI3 A;  4FM4 B;  3CBO A;  1G3W A;  3NTI A;  2W0Z A;  2AKK A;  5DM7 R;  2EJ9 A;  4Y92 A;  5LJ3 e;  1WXB A;  4BE1 A;  2M16 A;  1YIJ A;  1BBZ A;  2OTL T;  4OMN A;  5GAO l;  3PFS A;  5CQX A;  4L5G A;  1PD0 A;  2WSF E;  1VIF A;  3NFC A;  4X9C A;  2XIC A;  2EBP A;  3A1P A;  1K8A U;  2DA9 A;  1PRL C;  2PU9 B;  3JCM g;  4JPB W;  4KRT A;  1KD1 R;  4R55 A;  2K79 A;  4YTL A;  4XTW A;  2KBT A;  3ZEH A;  3G71 A;  4PJO A;  2EVR A;  4K11 A;  4AFZ C;  2XU8 A;  5GAO n;  4HVW A;  3PMI A;  1Q81 U;  5DY9 A;  1KFZ A;  2YRV A;  3RES A;  1IGU A;  1Y0M A;  1U5S A;  4II1 A;  5CKB A;  3R6O A;  2ECZ A;  1H64 1;  4VUB A;  1KQS P;  1ACM B;  4M77 A;  1M8V A;  3DLM A;  2AZS A;  5A0D A;  1JO8 A;  2VVK A;  3VRZ A;  5LL6 S;  3I9Q A;  1M90 U;  3GOX A;  4M75 E;  1R0B G;  1TUD A;  1K1Z A;  1ZA1 B;  2L2P A;  1KC8 U;  3RDV A;  1VYU A;  5KH6 A;  2MMP A;  1KQ2 A;  3J7A F;  1DJ7 B;  2ZPG B;  2DAQ A;  3EH1 A;  3OSS C;  2EYW A;  1WA7 A;  2L89 A;  2ZCF B;  3M0Q A;  4JJD A;  3OYF A;  4MZM A;  3G4S A;  5GAM e;  1W1F A;  1GBQ A;  1BI0 A;  1PNJ A;  4PJL A;  4JJC A;  2DL5 A;  2JXB A;  3M0T A;  2RQV A;  3EG2 A;  3HP9 A;  3PIP A;  3V7R A;  1T3L A;  1VQ7 T;  2LCL A;  3QZ5 B;  3C94 A;  2O9V A;  2DVJ A;  4EDU A;  1K9M R;  2VGM A;  1RI0 A;  1FYN A;  2LQW A;  4JLG A;  3JCM d;  1G5V A;  1WIE A;  5KCH A;  2GQI A;  2F2W A;  4BDZ A;  3Q1J A;  1VQ7 Q;  1TXQ A;  4ANJ A;  3CC7 Q;  2J05 A;  4FYX B;  5M9O A;  2EPD A;  2LX7 A;  1I07 A;  2DXC A;  3H0H A;  2YDL A;  4KGX B;  5AT1 B;  1JJ2 A;  5IT9 E;  1WJQ A;  3OYI A;  4OGE A;  1YWP A;  1PC0 A;  1IHV A;  2Z0W A;  4M75 G;  5J39 A;  4MDX A;  4LDY A;  4IUP A;  2DFU A;  4RTY A;  3RKX A;  1VQL A;  3CCV A;  1TSF A;  1I1J A;  3P8D A;  2KMT A;  3VS3 A;  3CC4 T;  4ZNX A;  1SSH A;  2OTJ T;  3VJP A;  2E5K A;  3FDR A;  1UGS B;  4QVC A;  3VS2 A;  2B86 A;  4ZTJ A;  1N5Z A;  4C0D B;  1V1C A;  1WZO A;  5DLQ E;  3CC7 A;  2ROT A;  1HK9 A;  3CCR Q;  2M1H A;  4JRQ A;  1D0X A;  3QBY A;  4MZP A;  2EW3 A;  5CKD A;  1AZG B;  3BFM A;  5IHN A;  4KH1 B;  2LT1 A;  2EAY A;  2P0Q A;  3TCJ A;  2I2L A;  3CC2 Q;  3LGF A;  2CP2 A;  3F70 A;  1WLP B;  3CCL A;  1BI1 A;  3CMA T;  2CS7 A;  3JCM P;  1X27 A;  2XID A;  5KYX B;  2M0O A;  3X28 B;  1O75 A;  4WTO B;  4C92 D;  1IZ6 A;  3EG9 B;  1YBY A;  2KQW A;  2EQK A;  1D3B A;  4L59 A;  3CCR A;  2D9T A;  2VC8 A;  3CMA Q;  4JZ4 A;  1WXT A;  1VUB A;  4ESR A;  2YSQ A;  2LDM A;  2ZAE A;  3CD6 Q;  1YIT T;  2D0Q B;  1OI1 A;  3CC2 A;  5GJW B;  3LWH A;  1GCQ C;  2ESW A;  2D0N A;  1LOJ A;  4AG2 C;  5CO7 A;  3JCM e;  4QT7 A;  1G3S A;  3SWN A;  1YI2 T;  4GY5 A;  4KH0 B;  2RJE A;  4LN2 A;  3MEV A;  4HCK A;  4PJO F;  1VQK T;  3JSC A;  2COW A;  5CKF A;  3I55 A;  5KCO A;  3L2W A;  1G3Y A;  2E41 A;  3MJX A;  1M8M A;  4PJO C;  2PUO B;  1YI2 Q;  4E2F B;  1M90 R;  3GP8 A;  3CCS A;  2V8I A;  2YUP A;  3CD6 A;  4M7D A;  2NLU A;  4XTY A;  1VQK Q;  2A7Y A;  1Q95 G;  1KC8 R;  1Y57 A;  4M77 F;  4ATO A;  1PG5 B;  2RQT A;  5I22 A;  1X69 A;  1K73 R;  1WNL A;  4FSX A;  4DBH A;  8ATC B;  2HKQ B;  4M77 C;  3R6N A;  2P0P A;  4C8Q F;  4M7A A;  5FU7 B;  3L2U A;  4WCI A;  1ZSZ A;  1LCK A;  2E3H A;  1JQQ A;  3X26 B;  2QXF A;  4C8Q C;  4M78 E;  1Z9Z A;  1X01 A;  1OYX A;  5KYU B;  4PJJ A;  1S1N A;  3MHX A;  1VQ4 T;  2ABL A;  3PVQ A;  1UGV A;  1QQJ A;  5KE3 A;  1Y7X A;  1VQ5 T;  1JBM A;  4EMK B;  2ATC B;  3RUX A;  4BUG A;  1YHQ Q;  4C92 E;  1JJ2 P;  1JRI A;  1P92 A;  2DET A;  3O5Z A;  1RAD B;  1M9S A;  4HCC A;  1M1K C;  5HKC A;  2RHY A;  1Q7Y R;  2MF2 A;  3HRU A;  2LQN A;  2RO0 A;  1SHF A;  1WJS A;  4FIB A;  2CH4 W;  3A98 A;  3L2Z A;  4JLI A;  2D8H A;  2X4J A;  3GNF B;  1T3S A;  1W2B A;  1M3A A;  1MMD A;  4M75 B;  1YHQ A;  4P5N A;  4F7U E;  2DBM A;  3CXC A;  5GAO r;  1KIK A;  2QGG A;  3M54 A;  2K7A A;  3EH2 A;  4OB3 B;  2PTK A;  2DEQ A;  5CVI A;  4PK4 A;  1ZUY A;  2BTT A;  1OPL A;  1G3T A;  1VQP A;  1I4K 1;  3M0P A;  4RTV A;  3CME Q;  2QDL A;  2E1H A;  4RKU E;  3SHW A;  5I2S A;  1QCN A;  4XTZ A;  4R0K A;  4JJB A;  3DB3 A;  4C92 G;  3GPL A;  2CH4 A;  4C5H A;  2EJF A;  2WAC A;  2YT6 A;  5LJ3 g;  1C0M A;  2DPP B;  4L6V 5;  3VUB A;  4Q5W A;  1VQO A;  2FHD A;  1MMG A;  4QQ6 A;  2LZ6 B;  2P0K A;  1RLQ C;  1WI7 A;  2PVG B;  4OP0 A;  3C95 A;  1U06 A;  2MOX A;  3OW2 A;  2LP5 A;  2HDA A;  4QKU A;  4EPC A;  5GAO m;  2DKG A;  2R57 A;  1MUZ A;  2MIO A;  4PLL A;  3REA B;  1N6A A;  1Z9Q A;  4F14 A;  2V26 A;  4F7U G;  1MMA A;  2FVU A;  2KK4 A;  2CT3 A;  3A8H B;  2K5F A;  1NPR A;  5A0G A;  1OPK A;  5CQY A;  1ARK A;  1TG0 A;  2CZ0 B;  2YLC A;  3ER0 A;  1UE9 A;  1ZUU A;  2RQR A;  3C4S A;  2FZG B;  1D1C A;  5GAN 6;  2O2O A;  3CEY A;  4DOW A;  1M1K U;  1M2V A;  5A0L A;  4JJN K;  2BUD A;  3SWN C;  1VQ9 T;  3HL8 A;  4O5V A;  2QQR A;  4RG2 A;  4J8O A;  3A5Z B;  3OYB A;  1HSQ A;  4Y91 A;  3CCJ A;  4DEY A;  1KK7 A;  2B8A A;  2QA4 T;  1QWF A;  2ROL A;  4LNP A;  2D6F A;  1ZHI A;  3CPW P;  2FPE A;  1VQ9 Q;  4AFU C;  5GAM g;  2DL8 A;  4DEX A;  1H92 A;  2YUQ A;  2HL3 A;  2K4Y A;  3FLG A;  1R77 A;  2RK1 A;  3CQT A;  3QYG B;  5LJ3 d;  1KHC A;  3GLX A;  1AHJ B;  4Z88 A;  2QA4 Q;  2MK5 A;  4M7A F;  4E6R A;  5LJ3 j;  1CKA A;  1OU8 A;  5GMK m;  3I5R A;  3CCQ T;  4HVV A;  5GMK i;  1CKB A;  4M7A C;  2W10 A;  1KQS S;  2KAF A;  3S6W A;  1WDX A;  4KGV B;  1HXD A;  2RQU A;  5D6W A;  2DD4 A;  1BI3 A;  4OMQ A;  4C5G A;  1Q86 C;  1Y07 A;  3VYG A;  1UTI A;  2JMA A;  2DER A;  1YJN Q;  2O4X B;  3ZBD A;  3WVE B;  2RPN A;  1TUG B;  1M1F A;  1MV3 A;  1WHM A;  3VS4 A;  2K57 A;  3C0C A;  2DL7 A;  2BZ8 A;  2XK0 A;  2HCK A;  4BY6 C;  5FU6 C;  2LJ1 A;  2YXY A;  4V2S A;  2RJD A;  2XMF A;  3CPF A;  3G6E A;  3KBG A;  4HXJ A;  1SEM A;  2DF6 A;  4A4H A;  1Y96 B;  4M75 D;  4M7D E;  4XQ3 A;  4IUT A;  3M56 A;  2MCN A;  1YIJ T;  2K5I A;  5FU7 C;  5KYW A;  3CXC P;  3EHQ A;  2OAW A;  4LD9 K;  5IN1 A;  3L2Q A;  1A0N B;  3CCU A;  1YJN A;  3H9N A;  2ED1 A;  3JCM W;  1MNE A;  1D0Y A;  3JCM Q;  3M53 A;  1QP3 A;  4HA8 A;  4J5Y A;  1YIJ Q;  5GAM d;  1OU9 A;  2NYS A;  1SPK A;  3H41 A;  4X1V A;  3HPW A;  2EQJ A;  5GAM j;  2BZY A;  2KR3 A;  2DZC A;  2FZK B;  1GRI A;  4EMH A;  1K76 A;  2DK3 A;  1FX7 A;  4M78 B;  3G71 Q;  4OMF B;  4LXC A;  2HD0 A;  3SD4 A;  3OYY A;  2GFU A;  2QG9 B;  4N0A A;  5L23 A;  3OW2 P;  1GCQ A;  3FC3 A;  4C92 B;  1YP5 A;  1G2B A;  2QYZ A;  4NS5 A;  1QWE A;  2RD1 A;  3NTK A;  2EYZ A;  2E4H A;  3MEW A;  1RAH B;  2DIL A;  1VQM A;  1Q86 U;  4N4I A;  1BKB A;  1OZ3 A;  5IXF A;  2AIR B;  2LQK A;  3JCM b;  3UWN A;  2FO0 A;  2QEX Q;  3EGX A;  5GAN f;  2CRE A;  2DJQ A;  2C0O A;  3G4S Q;  1H3Z A;  1M1K R;  1YJ9 A;  3H0F A;  3REB B;  4F7U B;  1N9R A;  3FJ5 A;  2XHC A;  4GLM A;  1FMK A;  2PUK B;  4MML A;  1RAE B;  1V76 A;  5CKH A;  4IUR A;  2FRY A;  1B34 B;  2CP5 A;  2X4W A;  4C8Q A;  3PIO A;  1RUW A;  1Y71 A;  2EQM A;  3QZ9 B;  2QEX A;  1K0S A;  5L8R E;  3JCM J;  4IIO A;  5D6Y A;  5GMK l;  4OMM A;  4A63 B;  2RJF A;  1S72 A;  3QKJ A;  2K6D A;  2OTL A;  2JT4 A;  3QDF A;  1RL2 A;  1XNI A;  2VGN A;  3BY7 A;  2GTO A;  1XOV A;  1N8R R;  3CC7 T;  1BIA A;  1X43 A;  2I0N A;  2KYB A;  2L3R A;  1VQL Q;  3CCV Q;  1EIF A;  4QVZ A;  5FWC A;  4C0G A;  3CBP A;  2EWN A;  1M4Z A;  3RMQ A;  2RNA A;  2M51 A;  2JUF A;  2ZZD A;  1MND A;  4JUV A;  5KE2 A;  5GAN 2;  2QI2 A;  3CCL T;  2DM1 A;  4OB2 B;  1VYV A;  1M3C A;  3OS0 A;  2JM9 A;  1WQW A;  3QO3 A;  3VKI A;  2DRM A;  4JS5 A;  2DE0 X;  1TWB A;  2O88 A;  4XU3 A;  2EJG A;  3EG3 A;  3A8M B;  2CT4 A;  2A37 A;  4PKC C;  3UPU A;  1JXO A;  1WJR A;  4A53 A;  4RTZ A;  3CCR T;  3CCL Q;  3VU3 C;  1B07 A;  2PQW A;  4JRK A;  4NL3 A;  1ABQ A;  2A28 A;  3T9N A;  3I56 A;  4X9D A;  2KY9 A;  2ZPI B;  5LJ5 h;  2M0Y A;  2MI6 A;  2CGH A;  3CC2 T;  2XG8 D;  1RAA B;  3S3O A;  1D1A A;  1JJ2 S;  1JXM A;  4OMP A;  2JTM A;  2YHT A;  3VYH B;  3EGU A;  2F1L A;  4M78 D;  2QAS A;  2HNI A;  1WX6 A;  1QKW A;  2IG0 A;  3I55 T;  3CCE A;  3TRE A;  2VAS A;  1WHK A;  4BAC A;  5EC7 A;  4E7S A;  1X2Q A;  3QHS A;  4LE9 A;  2YRD A;  3OBW A;  4OVA A;  2RI2 A;  4PJO D;  1G8X A;  1AT1 B;  3CCS T;  2ZGW A;  3CD6 T;  2V8J A;  1TS9 A;  1VIE A;  2DXU A;  4WF2 A;  3I55 Q;  4JZ3 A;  3RMS A;  2J06 A;  3X24 B;  3NGP A;  1SKU B;  2LRQ A;  5D7U A;  4C5I A;  2D8J A;  4PL6 A;  3OYN A;  1K8A R;  2DL4 A;  4FW2 A;  2K5L A;  3CCS Q;  2WSE E;  3GF5 A;  4M77 D;  1Q86 R;  4BI8 B;  4N0A C;  3SDZ A;  1IRE B;  1U8R A;  5DLO A;  4B9X A;  3L2V A;  1WHL A;  3EFO B;  1Q81 R;  1Q82 C;  2BE7 D;  4M7D B;  1MGQ A;  1BCO A;  2CUB A;  1M27 C;  1GXI E;  5KYX A;  1JU5 C;  1U3O A;  1I8F A;  4RUG A;  3EG9 A;  1PRM C;  2KRN A;  3MP1 A;  2IPO B;  4Z8A A;  3PMT A;  3V8J A;  1SF9 A;  5HCK A;  4E7I A;  1LVK A;  1FMW A;  3SB2 A;  2K2V A;  3DB4 A;  1F1B B;  3FRN A;  5FLX E;  3OS1 A;  3JB9 I;  2HKN A;  1ZSZ B;  1KHI A;  3L1A A;  1YJW Q;  1IHW A;  2LX9 A;  4C92 F;  2M02 A;  3H8Z A;  2ZPH B;  2HQH A;  4HCB A;  4C92 C;  3URG A;  3CPW A;  2GGR A;  4BI4 A;  5HY6 A;  1FWZ A;  1UEC A;  4F16 A;  1K0X A;  1UDL A;  5GAN h;  2KRO A;  4RCB A;  4LDX A;  3V7C A;  4PNO A;  4LDU A;  2JTF A;  1YHQ T;  3M57 A;  3QJY A;  4KUI A;  4BB7 A;  1YJW A;  3M58 A;  3N5B B;  1YIT A;  1HJD A;  3OYA A;  2ENM A;  2E6N A;  4C5E A;  1YN8 A;  1BCM A;  4A4G A;  2FB7 A;  2EYX A;  1VQP T;  4PJO E;  1JB0 E;  4DA4 A;  2VV5 A;  2DXB A;  2JW4 A;  2V1R A;  2EQU A;  4J9H A;  2DXT A;  2OJ2 A;  1B3Q A;  3GNG A;  3UA6 A;  1RI9 A;  1BYM A;  4A4F A;  3HHT B;  3M0S A;  1VQP Q;  4M4Z A;  3SFM A;  2AT1 B;  3U23 A;  1KQ1 A;  4M77 E;  2CZ7 B;  5KYU A;  1WPY A;  4LDW A;  1M5Q 1;  1OZ2 A;  5C6S A;  4D6W A;  2HZY A;  3J81 E;  4XU0 A;  1X6O A;  1Q82 U;  4ZN3 A;  1VYT A;  4C8Q E;  4FSS A;  1NYF A;  1PSE A;  3CME T;  1M2O A;  4EMK A;  1VQO Q;  4HKE A;  1ABO A;  2BKD N;  2AZV A;  3NTH A;  4M78 G;  3QG1 A;  1VQN Q;  3MKD A;  3EGD B;  5CIU A;  1R8O B;  1AZE A;  3V7S A;  3JB9 H;  5EG2 A;  5LJ5 e;  5GAN 3;  3OYG A;  1NZ9 A;  3PE0 A;  2MWP A;  1NLO C;  3QII A;  2PVO B;  4J6Y A;  2DRK A;  2A08 A;  4ZTF A;  3JB9 F;  1RLP C;  2VYT A;  1VQ4 A;  4PJO G;  4F04 B;  1IRX A;  1X2K A;  1C6V X;  1NE8 A;  4GBQ A;  1W2B S;  1QVP A;  2DMO A;  2JN0 A;  1VQ5 A;  1M3B A;  3MEU A;  3MPU B;  3CXC S;  2QAZ A;  3M0R A;  3RBB B;  3EHR A;  4MMK A;  4M75 A;  4FT4 A;  2ZPE B;  5IAY A;  1HD3 A;  1GL5 A;  4J83 A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 4LDV A;  3CCU A;  3HP9 A;  3PIP A;  1YJN A;  3V7R A;  1VQN A;  1VQ7 T;  2LCL A;  3QZ5 B;  3C94 A;  4M77 G;  5CKE A;  3JCM W;  3CMA A;  4EDU A;  3JCM Q;  2RHX A;  2VGM A;  3M53 A;  1RI0 A;  2XDP A;  4X34 A;  4R56 A;  1QP3 A;  4HA8 A;  4J5Y A;  1XQH A;  2DO3 A;  5J3B A;  2RHU A;  3OYK A;  3VUZ A;  4M7D D;  4JLG A;  5GAM d;  3JCM d;  2AHJ B;  3MP8 A;  4C0D C;  1G5V A;  3HPW A;  4N4H A;  5KCH A;  1I81 A;  2EQJ A;  4O6J A;  2Y4X A;  2QQB A;  3WVD B;  4BY6 B;  5GAM j;  3L2R A;  5FU6 B;  4ZGE B;  3Q1J A;  4BDZ A;  5M9O A;  2DZC A;  3FIF A;  3JCM c;  4BE0 A;  2DXC A;  5GAN g;  5GAN 8;  1VQ5 T;  4EMH A;  5C0M A;  1BIB A;  1JJ2 A;  5IT9 E;  1WJQ A;  2DK3 A;  2XI9 A;  1FX7 A;  3HSB A;  4M7A D;  3OYI A;  3M59 A;  3MET A;  4M78 B;  4OGE A;  2GCX A;  4M75 G;  3PNW C;  5J39 A;  4MDX A;  4OMF B;  4HT8 A;  2HD0 A;  3SD4 A;  4F7U F;  1M1G A;  2F5K A;  4LDY A;  3OYY A;  4IUP A;  2CZ6 B;  2GFU A;  3OW2 S;  2RI3 A;  3RKX A;  1VQL A;  2RH2 A;  2H3J A;  4N0A A;  3CCV A;  3P8D A;  2XDB A;  2KMT A;  3PGG A;  3CC4 T;  5GMK e;  3WXM B;  3OYD A;  3CPW S;  1YI2 A;  2OTJ T;  3E9G A;  3DKM A;  3VJP A;  4JRI A;  1UB4 A;  4QW2 A;  1VQ8 A;  2JZ2 A;  3FC3 A;  2HQX A;  4C92 B;  3FDR A;  2M9U A;  1UGS B;  4Y28 E;  4QVC A;  4NS5 A;  1VQK A;  4ZTJ A;  4C0D B;  3M4G A;  5DLQ E;  3CC7 A;  2RD1 A;  3G6E T;  1HK9 A;  3NTK A;  3OB9 A;  1N27 A;  2M1H A;  4JRQ A;  3OYJ A;  3QBY A;  4MZP A;  1MHN A;  2LC4 A;  4XAX B;  3MEW A;  3OYL A;  3OYC A;  5CKD A;  1VQM A;  1Q86 U;  1KD1 C;  3BFM A;  4IUU A;  4BDY A;  3JB9 D;  4IKF A;  4N4I A;  1BKB A;  4E7L A;  2LT1 A;  1W4S A;  2DVE A;  1OZ3 A;  3VV0 A;  1VQO T;  2EYQ A;  2EAY A;  2LQK A;  2VXF A;  4TVR A;  3JCM b;  2E6Z A;  2P0Q A;  3OBY A;  3UWN A;  3TCJ A;  2I2L A;  2QQ9 A;  5GAN f;  3LGF A;  2QTX A;  3CCU T;  1YJN T;  1VQN T;  5AYF A;  3F70 A;  3CCL A;  1BI1 A;  3MEA A;  3CMA T;  2CS7 A;  1H3Z A;  1YJ9 A;  5GAN e;  3JCM P;  5GAN 5;  1QVF A;  3M55 A;  2XID A;  4HT9 A;  3A8L B;  2M0O A;  3X28 B;  1UGR B;  3MP6 A;  1O75 A;  3M9Q A;  1N9R A;  2RI5 A;  4C92 D;  1IZ6 A;  4F7U B;  5HK3 A;  5LJ5 f;  1UGQ B;  1TH7 A;  4J6X A;  2KQW A;  1YBY A;  3LGL A;  2DZ9 A;  1PSF A;  2CZ1 B;  2EQK A;  2XHC A;  4BD3 A;  1D3B A;  4JRP A;  1ZBX A;  2PUK B;  4L59 A;  4MML A;  3CCR A;  1LNX A;  2D9T A;  2EFI A;  2VC8 A;  4IUV A;  3OY9 A;  5CKH A;  3LW5 E;  4IUR A;  2L5Q A;  4FL6 A;  3ASK A;  3OS5 A;  4OF1 A;  5CK9 A;  1VUB A;  3M5A A;  2E10 A;  3BDU A;  2FYK A;  1B34 B;  3PT9 A;  2LDM A;  2X4W A;  2ZPF B;  3RKY A;  4C8Q A;  5GAN d;  3PIO A;  4OB0 B;  1Y71 A;  2EQM A;  3INZ A;  3QZ9 B;  2QEX A;  3DLL A;  3JCM f;  3OQ5 A;  2D0Q B;  1OI1 A;  5L8R E;  5GAN j;  2RJC A;  1YIT T;  3CC2 A;  2JOY A;  3JCM J;  3G7Z A;  3LWH A;  5D6Y A;  5GMK l;  2C06 A;  1LOJ A;  5CO7 A;  3JCM e;  2RJF A;  1S72 A;  1G3S A;  3SWN A;  3CCJ T;  1YI2 T;  4GY5 A;  3QKJ A;  4ME7 A;  1Q7Y U;  1VQ8 T;  2RJE A;  2OTL A;  2X4Y A;  4IUQ A;  4CRI A;  1RL2 A;  3MEV A;  1XNI A;  4PJO F;  1VQK T;  3JSC A;  2VGN A;  3BY7 A;  1XOV A;  2QQA A;  3CCM A;  1N8R C;  5CKF A;  5LJ3 h;  3OA6 A;  3I55 A;  3CC7 T;  5KCO A;  1BIA A;  3L2W A;  2L3R A;  3UT1 A;  1G3Y A;  2E41 A;  1K9M C;  4NL2 A;  1EIF A;  4QVZ A;  2LVM A;  4XU1 A;  3TEE A;  4C0G A;  1VQM T;  4M7A E;  2PUO B;  3CBP A;  4PJO C;  2EWN A;  1M4Z A;  3RMQ A;  3L42 A;  3S3M A;  2WSC E;  2RM4 A;  3E19 A;  4QQG A;  4KBM B;  2V8I A;  3GP8 A;  2PVD B;  3CCS A;  4KUD K;  4C8Q G;  3CD6 A;  4M7D A;  3E1S A;  3G71 T;  2NLU A;  4XTY A;  2JUF A;  2ZZD A;  4JUV A;  4PLI A;  2A7Y A;  4ELZ C;  1QVG A;  5KE2 A;  5GAN 2;  4C0Z A;  3BDL A;  2HBP A;  4M77 F;  3UDC A;  2JNG A;  2EIF A;  2QI2 A;  4ATO A;  3CCL T;  3CCQ A;  4OB2 B;  4EMK C;  2DIQ A;  3OS0 A;  1WQW A;  3QO3 A;  3VKI A;  5GAN 7;  4A4K A;  3OSV A;  4JS5 A;  4E7J A;  1YJ9 T;  1K73 C;  3LX7 A;  1WNL A;  2O01 E;  4FSX A;  1UGP B;  4XU3 A;  4ELY C;  3CME A;  2EJG A;  4M77 C;  2P0P A;  4C8Q F;  3QYH B;  3A8M B;  5FU7 B;  4M7A A;  4PKC C;  3L2U A;  1VQ6 A;  2GFA A;  3UPU A;  1WJR A;  4A53 A;  5D6X A;  4DQ2 A;  3CCR T;  1KD1 U;  3VU3 C;  2G3R A;  3V8K A;  1N9S A;  3H6Z A;  3X26 B;  2QXF A;  4C8Q C;  4OB1 B;  2PQW A;  4JRK A;  2Y90 A;  3FB9 A;  3JRZ A;  3QDR B;  2ZPB B;  4M78 E;  3OYE A;  4NL3 A;  3JCM X;  1X01 A;  4PJO B;  1OYX A;  2DD5 A;  4NOY A;  3MHX A;  2RA2 A;  1U1S A;  3T9N A;  3RER A;  4M75 F;  3I56 A;  4X9D A;  4M7D G;  2KY9 A;  1VQ4 T;  2ZPI B;  5LJ5 h;  2MI6 A;  2CGH A;  2QEX T;  2LQ8 A;  3CC2 T;  2XG8 D;  2DTO A;  4A54 A;  3PTA A;  3S3O A;  2VUB A;  4XTX A;  5I21 A;  1JJ2 S;  5KE3 A;  4Z02 A;  3G4S T;  1Y7X A;  2EKO A;  2F69 A;  2LT4 A;  2JTM A;  2YHT A;  1JBM A;  4M75 C;  3P8H A;  3VYH B;  4EMK B;  4E7H A;  4E7K A;  3RUX A;  5GAN 4;  5J26 A;  1S72 T;  3P8B B;  2DTH A;  4BUG A;  2RHI A;  4M78 D;  4C92 E;  2XD0 A;  1JRI A;  1P92 A;  2XDD A;  1KQS A;  3HRT A;  4M77 B;  2GQV A;  2HNI A;  4M78 A;  1M9S A;  3OMC A;  4M7A G;  4M7D F;  5GAM h;  4GLK A;  5I2M A;  2IG0 A;  4J7I A;  3JCM h;  3CCM T;  3I55 T;  2HQE A;  4HCC A;  2HAX A;  2KVQ G;  3RIR A;  3CCE A;  1YCY A;  3TRE A;  3C12 A;  2YLB A;  1X75 C;  4JS4 A;  4BAC A;  2Y4Y A;  1M1K C;  1O9S A;  3QHS A;  4DOV A;  5HKC A;  4M7D C;  4A4E A;  3AHU A;  3OBW A;  2RHY A;  4OVA A;  2RI2 A;  4C8Q B;  1Q7Y C;  3A8G B;  4PJO D;  2MF2 A;  3JCM V;  3HRU A;  5HK0 A;  2ZGW A;  3CCS T;  2RO0 A;  3CD6 T;  3FJP A;  2V8J A;  1VIE A;  1WJS A;  2DXU A;  4C92 A;  4FIB A;  2R5M A;  4WF2 A;  3RMS A;  3RKW A;  1XTD A;  3L2Z A;  4JLI A;  3X24 B;  4BE2 A;  1V29 B;  2FL7 A;  2LRQ A;  5FRM A;  2E12 A;  2X4J A;  3GNF B;  4C5I A;  4PL6 A;  4EMG A;  1W2B A;  3OYN A;  1LJO A;  4ZGD B;  3S3N A;  1K8A C;  4M75 B;  1WQ7 A;  1YHQ A;  4P5N A;  4F7U E;  3CXC A;  5GAO r;  2K5L A;  1N8R U;  2LCC A;  2WSE E;  4RMO A;  3M54 A;  3QJ6 A;  3GF5 A;  2XKO C;  2QDY B;  4J7F A;  4M77 D;  3JB9 G;  1QP2 A;  2K3X A;  1ZQ1 A;  3QPH A;  4BI8 B;  3EFS A;  4N0A C;  4OB3 B;  1K9M U;  1VQ6 T;  3M4Y A;  2DEQ A;  1VQ9 A;  5CVI A;  3SDZ A;  1IRE B;  2QQS A;  1U8R A;  5DLO A;  4B9X A;  1QVF S;  3L2V A;  1VQL T;  3CCV T;  2P4T A;  1G3T A;  4RG8 A;  1I4K 1;  1VQP A;  1Q81 C;  1Q82 C;  3EFR A;  2E1H A;  4M7D B;  1MGQ A;  3QSU A;  4RKU E;  4XK8 E;  5I2S A;  3HKS A;  2QA4 A;  1GXI E;  1UEB A;  3OMG A;  1I8F A;  3LH0 A;  3I56 T;  2E70 A;  4F7U A;  4XTZ A;  3DB3 A;  4C92 G;  3GPL A;  4CI0 C;  5GMK h;  4C5H A;  1K73 U;  3GIB A;  3MP1 A;  2EJF A;  2F5T X;  2WAC A;  4LD6 A;  2R58 A;  2O4X A;  2R5A A;  3PMT A;  1BI2 A;  3V8J A;  3X20 B;  4JDS A;  4B9W A;  5LJ3 g;  3J80 E;  1KG1 A;  4E7I A;  2DPP B;  1I5L A;  4L6V 5;  1WGS A;  4Q5W A;  3VUB A;  1M90 C;  3SB2 A;  2K2V A;  1VQO A;  2E65 A;  2FHD A;  2MWO A;  3DB4 A;  3FRN A;  5FLX E;  3OS1 A;  4QQ6 A;  5CAI A;  3ZFJ A;  1B34 A;  3JB9 I;  2KSS A;  2P0K A;  4ZGJ B;  1KC8 C;  1KHI A;  2PVG B;  3L1A A;  4OP0 A;  4XU2 A;  2LX9 A;  4C92 F;  2RHZ A;  3C95 A;  4BI3 A;  2GF7 A;  2LTO A;  3CCE T;  3H8Z A;  2ZPH B;  4FT2 A;  3OW2 A;  3LYI A;  4EPC A;  3QXE B;  4HCB A;  1Y96 A;  5GAO m;  3KXT A;  2DKG A;  2R57 A;  4QVD A;  5FRN A;  4C92 C;  4PLL A;  3URG A;  3L2Q A;  3QUI A;  3CPW A;  4BI4 A;  2MAM A;  1N6A A;  2OAU A;  5HY6 A;  3OYH A;  1FWZ A;  4F7U G;  2FVU A;  2KK4 A;  5GAN h;  2A3L A;  2BIV A;  4ZN1 A;  3A8H B;  2CKK A;  2K5F A;  1NPR A;  4RCB A;  1NJI C;  4LDX A;  2L8D A;  5A0G A;  5A2Q E;  5CQY A;  3OYM A;  3V7C A;  4MDW A;  4PNO A;  3LWI A;  3EAE A;  4LDU A;  2CZ0 B;  2IVW A;  2YLC A;  3ER0 A;  3HFO A;  4FU6 A;  2JTF A;  4J6W A;  4UC4 A;  2VXE A;  1YHQ T;  2KDS A;  1U1T A;  3C4S A;  3M57 A;  1QVG S;  3QJY A;  4XTU A;  4KUI A;  5GAN 6;  3CEY A;  4BB7 A;  2DJZ A;  1YJW A;  3M58 A;  3LLR A;  3N5B B;  2K3Y A;  3HFN A;  5LJ3 f;  3KUF A;  4DOW A;  5A0L A;  1YIT A;  5GAO q;  1M1K U;  4RCC A;  3OYA A;  4JJN K;  3MCA B;  2E6N A;  2BUD A;  4FM4 B;  3SWN C;  1QW1 A;  4C5E A;  3CBO A;  5LJ5 g;  1G3W A;  4OGC A;  3NTI A;  1VQ9 T;  4E47 A;  3HL8 A;  4O5V A;  2QQR A;  4RG2 A;  3HRS A;  4A4G A;  2FB7 A;  5DM7 R;  4J8O A;  2EJ9 A;  3A5Z B;  1VQP T;  5LJ3 e;  3OYB A;  4PJO E;  4BE1 A;  4Y91 A;  2M16 A;  1JB0 E;  1YIJ A;  3CCJ A;  4DA4 A;  2VV5 A;  2DXB A;  2E5Q A;  2OTL T;  2B8A A;  5GAO l;  2QA4 T;  1D3B B;  3PFS A;  5CQX A;  2EQU A;  4L5G A;  2DXT A;  2D6F A;  1ZHI A;  2WSF E;  3GNG A;  1VQ7 A;  5CCA A;  1VIF A;  3NFC A;  4X9C A;  2XIC A;  1K8A U;  1BYM A;  5GAM g;  4A4F A;  2PU9 B;  2RK2 A;  3HHT B;  3JCM g;  2E64 A;  2DIG A;  3SFM A;  2K4Y A;  2JVV A;  3FLG A;  4R55 A;  4XTV A;  2RB6 A;  2RK1 A;  2X4X A;  3QYG B;  4YTL A;  1KQ1 A;  4M77 E;  5LJ3 d;  2CYZ B;  1KHC A;  3GLX A;  1AHJ B;  4XTW A;  2CZ7 B;  3ZEH A;  3G71 A;  5CR2 A;  4PJO A;  5FRO A;  4M7A F;  2DTI A;  1WPY A;  4LDW A;  1M5Q 1;  1OZ2 A;  5C6S A;  5GAO p;  2XU8 A;  5LJ3 j;  4D6W A;  5GAO n;  5GMK j;  3PMI A;  5GMK m;  3J81 E;  4XU0 A;  1X6O A;  5DY9 A;  3CCQ T;  1Q82 U;  1Q81 U;  2YRV A;  5GMK i;  3RES A;  3SWN B;  4HCZ A;  4ZN3 A;  3CBM A;  3V8L A;  4C8Q E;  4M7A C;  4II1 A;  1KQS S;  2KAF A;  3S6W A;  5CKB A;  1PSE A;  3CME T;  3R6O A;  1HXD A;  4EMK A;  4HKE A;  5D6W A;  4C5G A;  2DD4 A;  1BI3 A;  2X35 A;  1Q86 C;  1Y07 A;  1H64 1;  2BKD N;  3NTH A;  4VUB A;  4QQD A;  3X25 B;  4M78 G;  4MZT A;  3VYG A;  4M77 A;  3QG1 A;  1M8V A;  3DLM A;  5CIU A;  2O4X B;  3ZBD A;  5A0D A;  1R8O B;  5LL6 S;  3V7S A;  3ME9 A;  3WVE B;  3FEO A;  5EG2 A;  1M90 U;  3JB9 H;  5LJ5 e;  5GAN 3;  2V8K A;  3OYG A;  3GOX A;  4M75 E;  3CC4 A;  1M1F A;  1NZ9 A;  3E9F A;  4C8Q D;  2OTJ A;  3OS2 A;  2MWP A;  2K57 A;  3JAM E;  2PVO B;  3QII A;  1KC8 U;  2XK0 A;  4J6Y A;  4KUL A;  4N4G A;  2MMP A;  5KH6 A;  1NPP A;  4BY6 C;  4ZTF A;  1KQ2 A;  5FU6 C;  3J7A F;  3JB9 F;  1DJ7 B;  2VYT A;  2ZPG B;  1SSF A;  2DAQ A;  3O8V A;  1VQ4 A;  4V2S A;  5GAM f;  4PJO G;  4C0F A;  2RJD A;  2LNV A;  4M78 F;  3CPF A;  1YJW T;  3OSS C;  3G6E A;  3KBG A;  1NE8 A;  1W2B S;  2L89 A;  2ZCF B;  1QVP A;  3OYF A;  4MZM A;  3A8O B;  3G4S A;  2JN0 A;  4A4H A;  5GAM e;  3MEU A;  3CXC S;  1Y96 B;  1VQ5 A;  1BI0 A;  4M75 D;  4M7D E;  4KT0 E;  4XQ3 A;  4M78 C;  5LJ5 d;  4IUT A;  3M56 A;  1YIJ T;  4M7A B;  3JB9 J;  4MMK A;  2K5I A;  5FU7 C;  4M75 A;  4FT4 A;  2ZPE B;  5IAY A;  3TU4 K;  1FXX A;  3BW1 A;  4J83 A;  5LJ5 j;  1NJI U;  4LD9 K;  3MO8 A;  5IN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...