2H3JA

Solution nmr structure of protein pa4359 from pseudomonas aeruginosa: northeast structural genomics consortium target pat89
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
MSALQPSRSYRITGYSPAISNGYRQRLFSMGLLPGAALRVVRIAPLGDPIQVETRQTSLALRRKDLALLTLVPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PA4359
publication title Solution Structure of Hypothetical protein PA4359: Northest Structural Genomics Target PaT89
rcsb
source organism Pseudomonas aeruginosa
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2h3jA01
3GLXA 3E19A 4O5VA 2QQ9A 2K5FA 1G3YA 2GCXA 2LX9A 2QQBA 1BI0A 1QW1A 2K5IA 1BYMA 3HRTA 1FWZA 2QQAA 1BI3A 1BI2A 2K4YA 3HRSA 5CVIA 3HRUA 2H3JA 1P92A 1G3TA 1G3SA 1U8RA 1BI1A 3MHXA 1FX7A 1QVPA 2K5LA 1G3WA 4O6JA
chains in the Genus database with same CATH superfamily
1K73R 2VYTA 2HQXA 2KAFA 2EPDA 5FW9A 3CPWS 1AOJA 4QQDA 1OU8A 2ROTA 2PUKB 4XQ3A 1B34A 5DY9A 4E7IA 1ABOA 1MNEA 2E1HA 1UE9A 2KMTA 1ZHIA 2P0PA 5ECAA 5HCKA 1I1JA 1WI7A 4C5EA 3CCLT 3I9QA 4J7FA 4M75D 2DTOA 3RKWA 3H6ZA 4AMCA 4KRTA 4J9CA 2VGNA 2JW4A 4PFZA 3JCMQ 2RI5A 2QEXA 4PLLA 2O4XA 4B9WA 3G71A 4J9BA 4FCYA 1QCNA 4F14A 3CCUQ 5CKBA 1YJWA 2E12A 1YHQT 3MP8A 4E7LA 3H0FA 4M7DA 2HEQA 5LJ5h 1RADB 4A4EA 3CD6Q 2RB6A 3CMAT 3V7SA 4CC2A 2M0OA 1OULA 3M0TA 1WXBA 1QVFP 2EBPA 2V26A 4C92D 4HXJA 2FPFA 2EFIA 2LQWA 4FYVB 4GBQA 2CP6A 2X4WA 1O75A 2OX7A 4ZGJB 4HVWA 2QQSA 3MEVA 1Z9QA 1Q86R 2RHYA 1NM7A 4F7UA 5FLXE 1RACB 1XQHA 2DJZA 1IRXA 2CP2A 4M75E 4MMLA 2PU9B 2ZAEA 5GJVB 4LDWA 3BDLA 1UUEA 4CC7A 3JCMe 1K8AC 1M1KC 4FYWB 2E70A 3HHTB 4M75G 2DFUA 3SWNB 1N6AA 1E6HA 2OAWA 1G3YA 2L5QA 3VYGA 1K8AR 1UEBA 1M1KR 4M78B 1QVGP 4PL6A 3JB9H 3LH5A 2R5MA 1Y96B 2E5KA 4JJCA 1W2BS 3TQ7P 2XD0A 3CCEA 3JB9G 4P5NA 1JEGA 1Q7YU 1ARKA 1R77A 2HZYA 1VQ6T 3CCRT 1FYNA 2KRNA 1U1SA 3CCLA 1K1ZA 3E19A 5CKHA 2K57A 2LX9A 1KHCA 5FU6B 1YJ9T 1SF9A 4PJOF 4JS5A 3JCMd 4C92E 5A0LA 2J7IA 4C92G 1X2QA 4QKUA 2JNGA 1YHQA 3VS1A 3NTKA 4M77G 3EG9A 2JJ9A 2X4XA 1M30A 3H0IA 1RL2A 2KT8A 4J9EA 2DZ9A 3FJ5A 2M1HA 2HD0A 3C4SA 3CMAA 1BI0A 1YFNA 1FWZA 4EMGA 3I56Q 2VXEA 3FIFA 3RKXA 2OTJQ 2CSQA 1JRIA 5AYFA 3DB4A 3M55A 2HDAA 3OQ5A 1T0JA 3HFNA 1WNLA 1YP5A 2L8DA 2JS2A 2JVVA 1I5LA 2EQUA 1WJSA 5IN1A 2EIFA 1H3HA 2AK5A 1R0BG 2DL4A 2JOYA 4J9GA 5CVIA 3OYNA 3HRUA 1KJWA 3CEYA 1QWEA 2RQWA 1R0CB 1N27A 2VKNA 2EKHA 1TU0B 2QQRA 1UB4A 2J06A 1YITT 2L3SA 2M16A 3HPWA 2Y4XA 1WYXA 4BB7A 3VS4A 4A54A 1KK7A 1K9MR 1MMGA 3OMGA 1TS9A 4GY5A 1VQLQ 2K4YA 1GCQC 3EG2A 4OB1B 1VQ6A 3CCRA 3FC3A 5FU7B 3MEUA 4RMOA 1NYFA 1VQ7Q 1HYOA 2O4XB 3CBMA 2BTTA 2RK1A 4J5YA 1YJ9A 1QWFA 1G2BA 4AFUC 4JZ3A 3GNGA 1OX8A 2PVOB 5LJ3j 4PJMA 1JJ2S 4PJOB 1M1FA 2EWNA 2JTMA 1BCOA 3CCJQ 3CMEQ 5GAOr 3LLRA 1BKBA 3A8HB 2GFUA 3ZBDA 2JS0A 3S3NA 2O2OA 3GIBA 2W10A 1ACMB 2PVGB 1OU9A 2KNBB 3SWNC 4O5VA 3ULRB 2FEIA 2D0QB 3CCMT 2I2LA 1M9SA 4QW2A 2LCCA 2QGFB 4RG8A 1G83A 2R57A 4XAXB 5GAOl 3UF4A 5LJ5e 4E6RA 3QDRB 3O5ZA 3OYCA 1LVKA 5J39A 3BY7A 3L2ZA 4AFQC 3KXTA 1S72T 1SKUB 4M7AF 4MZTA 3M56A 4KH0B 3V8LA 2DEQA 3CBPA 2LJ1A 3CCSQ 2EYYA 2C06A 1X43A 5FU6C 3RR6A 2WSCE 4E7SA 2VB6A 4JRIA 3WVDB 2KR3A 2Z0WA 1SPKA 2D0NA 4QVCA 3QBYA 5GAN2 2G6FX 1RLPC 1U8RA 3S3MA 1BI1A 2V8JA 5LJ5d 2BZXA 1YITA 3HFOA 2AZSA 5CKDA 4FT2A 1LNXA 4LXCA 1VQ5T 2FRYA 5GAOm 4DBHA 3OYGA 3ZFJA 1VOMA 4KT0E 5GAN6 2YUNA 1K76A 2E41A 4NS5A 3UWNA 4LDVA 5J3BA 3QUIA 3CCVQ 1W2BA 5CAIA 2KT1A 2J05A 4V2SA 2MMPA 3OYHA 1UJ0A 3SFMA 3OYFA 2DK3A 2F5KA 4IUVA 5DLOA 1VQMQ 1GFDA 1EFNA 1VYUA 3PT9A 2QASA 3RMQA 5KE2A 1VQKT 4AG2C 5I2SA 4C5HA 1YIJT 4JRPA 2MOXA 1N5ZA 2QK0A 4KULA 2DF6A 3ZEHA 3JCMg 1AWOA 1AHJB 4J6YA 3CCMA 1M90R 2YRVA 5IH2A 5KYUB 2MWOA 4F16A 5FRMA 1GBQA 3AHUA 2YUOA 1Y71A 1MGQA 2QDYB 5D6XA 4M7DE 1YI2Q 1S72A 5FU7C 1KC8U 4M7DG 2K2VA 2P0KA 4M7AB 1NPRA 4D6WA 5HK0A 1TG0A 2R5AA 4EDUA 2ZZDA 2CH4A 1Q7YC 1M2VB 3GBQA 2HL3A 1ZBJA 1UECA 4OB0B 1KHIA 1OPKA 1WHKA 2MYSA 2K6DA 4LUDA 4ELYC 2HKNA 4PJOC 2QXFA 1QKWA 5GAN7 2DKGA 4XTXA 4F7UE 2KRSA 1GCQA 1PWTA 1VQPT 1VQ5A 3CBOA 1G5VA 4F7UG 2LTOA 2CS7A 3LH0A 1OEBA 1YCSB 2O9SA 1GRIA 2EQIA 4CC3A 2YXYA 4BI8B 4M75F 1VQOT 1GL5A 2RHIA 5CKEA 1VYTA 2FVUA 2RJDA 3D7SB 1XTDA 5CR2A 1VQ9A 1FMKA 3EG3A 2LQKA 3DB3A 1VQNQ 1YJNA 2QAZA 3MEWA 5IHIA 2SEMA 8ATCB 2DILA 4IUQA 2K9GA 2LC4A 5EG2A 2O01E 1Y0MA 3SWNA 4BDYA 1BI2A 3GF5A 1JJ2A 2J6KA 5GMKj 2M9UA 4J6WA 3VS0A 1S1NA 3CC4Q 3X25B 3I55Q 1Y96A 4MMKA 3VU3C 4C92F 2E5QA 4WCIA 3JB9I 1KQSA 3C94A 4OGCA 2NYSA 3LW5E 1FXXA 4JRKA 1J3TA 1K0XA 2SRCA 1MNDA 3G4SA 1WHGA 3OBWA 1C1AA 2C0IA 2LT4A 5I21A 4FT4A 1M3BA 2RJFA 2DRKA 4DOWA 3PFSA 1PRMC 4LDYA 3TSWA 4C8QD 3E2UA 5KYXB 4A53A 2KQWA 4OMLA 4PFPA 4LUEA 5GMKi 5KYWA 2CP3A 4PFOA 1ZSZB 1ZSGA 5GAN4 5IAYA 4RCCA 2HCKA 2LCSA 1D09B 1Q81U 3UATA 1AWJA 4HCKA 2KK4A 3KUFA 1VQPA 1JXMA 1X6BA 2QG9B 3M4YA 2ZPFB 1EX4A 2HMAA 4L6V5 1M4ZA 2ED1A 1VQOA 5GANf 1PD1A 2RJEA 5GMKh 5LJ5g 3CXCA 3HKSA 1BCMA 5LJ3e 3QJYA 1UDLA 2K5LA 2KE9A 4RCBA 4XTWA 5GAN8 4M7AC 3I5SA 1PG5B 4Z89A 3M54A 5LJ5f 4E7KA 1AEYA 2AKKA 3J7AF 3I5RA 3NMZC 5A0GA 3A98A 4JZ4A 2A08A 4X34A 4C8QE 5C6SA 3ER0A 3WVEB 2DIGA 2A3LA 2HBWA 4C8QG 2V1RA 2YDLA 1NBEB 1SSFA 2RO0A 2V1QA 5LJ3d 2KXCA 4YTLA 4C92B 1WA7A 4RTVA 1WFWA 3LGFA 3U23A 1X69A 2XI9A 1QP2A 5IXBA 2C0TA 2LNVA 4N4GA 4OGEA 3JB9D 1X27A 3PIPA 2HQHA 5DLQE 3M0PA 3PMTA 3V7RA 2XKOC 1U5SA 2QEXQ 2CUBA 4PJOA 2CT3A 5AT1B 4HT8A 1JQQA 3G71Q 1Y7XA 2FYKA 1NPPA 1RAAB 2L0AA 1YJWQ 1B3QA 4XTUA 1T0HA 3O8VA 4M4ZA 3HRTA 4IKFA 1DJ7B 2F1LA 2VUBA 1VQ4T 1LJOA 3UDCA 4C0FA 2DYIA 4FYXB 5GMKl 1N9RA 4D8KA 4RTYA 1QVGS 2MF2A 4LDXA 4M77D 3BFMA 1M2OA 3RUXA 7AT1B 5D6WA 2RNAA 4IUPA 1RUWA 2M0YA 2P4TA 2ZPBB 4NL3A 4PJNA 1TSFA 1BYMA 1D1CA 2QQAA 1BI3A 4K11A 2CSIA 3BE3A 2CP0A 3MHXA 3EFOB 4FW1A 1PD0A 2ATCB 3FRNA 8AT1B 2F2WA 1MHNA 2R58A 4JJNK 2KGTA 2LX7A 1CKAA 1KQ2A 1I4K1 2JMCA 3EAEA 2XDPA 5A0DA 2EQKA 4QQ6A 1KC8C 3JSCA 1WZOA 2DTHA 1ZSZC 5GMKm 2GQVA 1WLPB 2D1XA 2DMOA 4Y91A 2H3JA 1KC8R 1G3TA 2GQIA 1OZ2A 2WACA 3JV3A 1ZUKA 2DETA 4E47A 2FPEA 2RH2A 3OSSC 3CCEQ 1X6GA 2YUQA 2JM8A 4OMOA 4A4HA 2DXCA 3MPUB 1VQ7T 4RTUA 3JCMV 3CCLQ 3OW2S 1NJIC 5IT9E 4M77E 2COWA 4M75C 1OI1A 2ESWA 4IUUA 3Q1JA 2JTEA 2BE7D 1LCKA 2VXFA 1RI9A 5KYWB 3V8JA 3CCJT 2XICA 3A8GB 3OYEA 2DXTA 4LD6A 2EQJA 5GAMj 1YHQQ 2X51A 1BBZA 1VQ4A 3GNFB 3OYBA 2KI7A 4M78D 5KYUA 4BUGA 1N8RU 3C12A 3CMAQ 2ZPHB 2BUDA 3VKIA 1TUCA 3L2QA 4LDUA 4QT7A 1AZGB 3DKMA 1FMWA 3BW1A 2ED0A 2RHZA 1V76A 3L2VA 3SB2A 2KEAA 1IGUA 2RQUA 4C92C 2K5IA 3RERA 2HSPA 4M7AA 3QIIA 1M3CA 2VVKA 4C0DC 1M2VA 4JRQA 1FX7A 1RLQC 2RN8A 4JS4A 1WX6A 1MUZA 3PGGA 1ABQA 2EJ9A 5GMKe 3AT1B 5HK3A 4MZMA 2H3EB 1WJQA 1D3BB 1PCXA 2BIVA 1H8KA 2KYMA 3CPWA 1QCOA 3A8OB 3VS7A 2FHDA 3R6NA 1AWXA 1YBYA 1W1FA 3M4GA 1K0SA 3LWIA 3J80E 1KSWA 2J6FA 5GAMh 4JPBW 1WDXA 3QYHB 5KH6A 1VQ6Q 3PVQA 2YLCA 3CCRQ 4LE9A 4M78E 1JO8A 4IURA 1Q81C 1K9AA 1WQ7A 4WF2A 5CKFA 1GBRA 4ATOA 3QKJA 4M78G 4BE0A 2DXUA 1YJ9Q 2GNCA 2DO3A 3NTIA 1IHWA 1WIEA 4ZNXA 1ZBXA 5LJ3g 1R8OB 1C6VX 3OS5A 5KCHA 1RABB 1IGQA 2ABLA 1UJYA 4F04B 2L3RA 3NGPA 1D1BA 3N5BB 2DIQA 1HK9A 2MCNA 1QW1A 1CKBA 4BY6C 1F1BB 3VYHB 3PE0A 4DBRA 2V8KA 1D0YA 1AVZC 4FL6A 2DL8A 3M58A 2DERA 1UGPB 2LDMA 4FM4B 3JRZA 1X6OA 4JJBA 4QQGA 3VUZA 2K2MA 5GAN5 4J83A 1VQ8T 4PJLA 1K4US 1TUDA 3C95A 1CSKA 3PMIA 2I0NA 4OB3B 1M27C 5KYXA 4R55A 1H3ZA 4XU0A 1PHTA 2RPNA 1MMDA 2CT4A 2QA4T 1W4SA 3X28B 1JJ2P 3QSUA 4OF1A 1ZSZA 4M7DD 3SHWA 4RG2A 2GTJA 2NUTB 1VIEA 2RA2A 3A1PA 1JXOA 1LOJA 3SEMA 4E7ZA 1KQSP 2MAMA 3RIRA 2XIDA 5LJ3h 1YITQ 2IVWA 4N4IA 2X4JA 2KY9A 3META 2DEUA 1I0CA 4HCBA 3X24B 1RI0A 4GLMA 2RMOA 5CCAA 3CCQT 2RF0A 3MEAA 4M75A 2QQ9A 1TH7A 2RK2A 3PNWC 2LP5A 4C8QF 1T3SA 3FJPA 4C0GA 4BI3A 2JXBA 2JZ2A 2WSEE 1NG2A 4CRIA 1BIBA 3OYKA 4PKCC 2EJGA 1JU5C 3OW2A 2P0QA 2E10A 1KFZA 1PKTA 2X4YA 1QVPA 3EHQA 1X2KA 1WHMA 1OZ3A 2OJ2A 4OMMA 2NLUA 2AT1B 4ZTFA 1I8FA 1TWBA 2RQRA 4QVDA 3L2UA 3M0RA 3CC2T 4BDZA 2XG8D 1SEMA 3EGXB 1U1TA 2LJ0A 3MP6A 3OYIA 3JCMf 3EH2A 3CCMQ 1G3SA 4C92A 3JCMW 3OS1A 3S6WA 2BE9B 3CXCP 1VQ8A 2CZ6B 4MDXA 2PTKA 4HVUA 2GBQA 3QWYA 1D1AA 1EZZB 3A5ZB 3QJ6A 1S72Q 3G6ET 2OTLT 1Q7YR 1AWWA 2E3HA 3INZA 4DEYA 5I22A 2L3QA 2EYZA 4LN2A 2QA4A 3MJXA 1U3OA 2P4RA 3DLMA 3SDZA 2X3WD 4NL2A 1NJIU 3GP8A 3EFSA 5L23A 1WHLA 4JLGA 5KYNA 4BI4A 4BD3A 1JBMA 1X75C 2HQEA 1VIFA 4JLIA 2D8HA 2D6FA 4PNOA 4Z02A 2LZ6B 1VQ5Q 3EH1A 2P84A 2DZCA 2DTIA 3CCQA 1ZUYA 3CC7T 4BE2A 2QYZA 3FB9A 3JB9F 2AIRB 1HD3A 3OMCA 4OP0A 3EGDA 1N8RC 3EFOA 3GPLA 1VQKA 4NOYA 1YIJA 4J7IA 1VQ9Q 4XTYA 2JM9A 1N8RR 2DPPB 5GAMe 1MMNA 1ZUUA 1YJNQ 2KBTA 3HTRA 1KG1A 4ANJA 2W0ZA 1VA7A 4J6XA 4OB2B 3L42A 3TREA 4M77F 4Z88A 3CC2A 1XJWB 4DQ2A 3R6OA 3M0UA 5IXFA 1JB0E 2EW3A 3VS2A 3H8ZA 1GFCA 2Y90A 2DL3A 3UT1A 5M9OA 4ZTJA 5GAMd 2EGAA 4Z8AA 3CCUT 3G4SQ 1TXQA 3VV0A 2YRDA 4C5GA 4L59A 2FRWA 1IB8A 1K9MU 2EQMA 3G6EA 2OTLA 1IHVA 4FU6A 4JJDA 3P8BB 4HT9A 1RAFB 2DAQA 1P92A 1B7TA 2EAYA 2DNUA 1PRLC 4KGZB 1PSFA 3G1JA 4DEXA 2YT6A 3CD6T 1M8MA 3OY9A 1BK2A 3QHSA 1EIFA 1X01A 5GAN3 2O9VA 2YSQA 2HNIA 2MI6A 5GANj 2HAXA 3EG1A 2K7AA 3M0SA 4WTOB 2PNIA 1VQPQ 2CP7A 4M75B 3M53A 2AZVA 2PVDB 2X9HA 3CC7A 3RKYA 2CUDA 2JMAA 1SRLA 2GFAA 1VQOQ 1YN8A 4N0AC 5I2MA 3VS5A 4IIOA 2RHXA 2ROLA 2LRQA 2H8HA 2KRMA 5FWBA 1RAIB 3QYGB 3F70A 5KYYB 2COYA 2QGGA 2X35A 2DE0X 4ESRA 2NUZA 4J9FA 1D3BA 2GGRA 4M78F 2DL5A 1MV0B 1KIKA 2ZPGB 1QVFS 4FYYB 2KDSA 1Q95G 4X9DA 3H0HA 4EPCA 4MZPA 2EJFA 4VUBA 1SRMA 3GOXA 4AT1B 4EMKB 4QVZA 4M77B 3CCET 1WXTA 4C0DB 1M5Q1 4EIKA 3URGA 2DD4A 1OV3A 2OAUA 3VJPA 2VC8A 4KBMB 1VYVA 4PK4A 2BZ8A 4PJJA 3CCUA 3SD4A 3JB9J 2LQNA 1Y57A 5GANh 5A2QE 1ZX6A 2A37A 2MWPA 4N4HA 5LL6S 1YNZA 4C8QC 2EYQA 4B6MA 1M8VA 3CD6A 4RTZA 5DM7R 3CPWP 2F2VA 2L89A 2PUOB 2E65A 1NLPC 2CZ1B 3I56T 2DVJA 3LGLA 2IG0A 3ASKA 4AG1C 2OTJT 4L5GA 1MV3A 2Y4YA 4RKUE 4BACA 1YWPA 2DX1A 2K3YA 3ME9A 2XK0A 2BKDN 3PTAA 3LWHA 2JN0A 3JAME 2VGMA 2XDBA 1UGSB 2LMJA 2RI3A 3EGDB 1Q86C 4OMPA 1A0NB 1M90U 2AKLA 3FEOA 2K3BA 4IIMA 4BY6B 2IIMA 1WGSA 1OYXA 9ATCB 2A7YA 2NUTA 4Y92A 2JT4A 3OYMA 3P8DA 4DOVA 2KVQG 2V8IA 2YUPA 4FW2A 1UGRB 4EMHA 1I07A 1WPYA 1IZ6A 1VQLT 3T9NA 2CKKA 4KUDK 2YHTA 1KD1U 2WSFE 4UC4A 3VRYA 3MCAB 5GAOp 1ZA2B 1N9SA 4AFSC 4ELZC 1QP3A 2EYWA 3M9QA 3HSBA 3OA6A 2DBMA 4JUVA 4ME7A 4RTWA 4BE1A 1AZEA 1NJIR 2VWFA 1UG1A 2NUPB 3GLXA 3A8LB 1M3AA 4ORZA 4ZGEB 3CMET 1QLYA 1D0XA 2DA9A 2A36A 3OB9A 2HKQB 1O9SA 4M7DF 2D8JA 5CIUA 4HCZA 3I35A 5FROA 4KGXB 3TVTA 3HRSA 1NYGA 4LD9K 1AD5A 4TVRA 5GAMg 2EGCA 2HSEB 2ECZA 1WJRA 3I56A 2MIOA 4O6JA 1W2BP 4HA8A 3EGXA 2OTJA 3RBBB 1VQ4Q 4HKEA 5CQYA 4KH1B 3REAB 1UGVA 5GAOn 5GAMf 4N0AA 3CCST 4EMKC 4DA4A 4M77C 2RQTA 4FIBA 3CQTA 2GTOA 2YRCA 3WXMB 1I81A 4F7UF 1G8XA 2LJ3A 3JCMc 3OW2P 1C0MA 1QMCA 1TOVA 2DYBA 3EFRA 4LNPA 1OQKA 3M5AA 5FRNA 2CH4W 3RDVA 2L3PA 1FMVA 2E64A 1PM3A 1IO6A 3TEEA 1IXDA 3VRZA 4R56A 2C0OA 2CGHA 1HSQA 3JCMb 3S3OA 4X1VA 2DL7A 2CZ0B 1VQLA 2OI3A 1Z9ZA 1K9MC 3CCVT 1Q82U 5IHKA 1B34B 3E9FA 3QZ5B 1QVFA 3RMSA 2ZGWA 4OVAA 1VQ7A 4FSXA 1W70A 3G7ZA 4F17A 1WHHA 1VQMT 1Q81R 1OOTA 1PKSA 3E1SA 2A28A 2J6OA 1UHCA 2O31A 4C8QA 3CCJA 3CMEA 2XDDA 2HBPA 2GCXA 5L8RE 3V8KA 3THKA 1NZ9A 1MMAA 2KROA 3BDUA 1UGQB 5CK9A 2FB7A 2B86A 2IPOB 4M7DB 5LJ3f 5GJWB 1M1GA 3UA6A 3KFVA 4IUTA 5GANe 1UFFA 4XU1A 2CYZB 1KQSS 2KSSA 4A4GA 1QVGA 3LX7A 3JCMJ 1K73U 1YI2T 2DXBA 3QXEB 4M78C 2FPDA 1TUGB 3M59A 3UPUA 3FLGA 1AT1B 3P8HA 3EHRA 4RTTA 3CCSA 3OYDA 2HL5C 2QI2A 3QPHA 1QQJA 3X26B 2PQWA 3RESA 4KUIA 2QDLA 5CO7A 2CP5A 5CQXA 4PJOD 3QZ9B 3TU4K 4F7UB 1B07A 5GANd 2X3XD 5IHNA 1LPLA 4J9HA 4XK8E 1PC0A 1VUBA 1NLOC 3L2WA 4ZN3A 2DJQA 2M02A 1RAEB 2LT1A 3PIOA 2RJCA 3C0CA 1PNJA 3MO8A 1WQWA 1HJDA 2DLPA 3IQLA 3VS3A 3UA7A 4HVVA 3CCVA 2K5FA 3QWXX 5FWCA 2YWWA 3MP1A 1GCPA 2XMFA 1WXUA 5HY6A 6AT1B 2K79A 3CXCS 2QTXA 3EG0A 1QCFA 3M57A 1VQMA 1VQNT 2EKOA 2CZ7B 2AHJB 2NWMA 3L2RA 1U06A 4II1A 2ZCFB 4C0ZA 1VQ9T 1TTHB 1NEGA 5KYYA 5KCOA 1SSHA 3ZL7C 3MKDA 4GLKA 1YJNT 2QQBA 2VASA 2E6NA 2FO0A 3CC4T 1YCYA 3I55T 1Q86U 3EG9B 1Y07A 2XHCA 2G3RA 2JTFA 5C0MA 4PJOE 2EVRA 2MK5A 3DLLA 5D6YA 1BU1A 1M90C 2ENMA 4PJOG 2XU8A 1XOVA 4EMKA 5HKCA 4M77A 1W6XA 1UTIA 4D8DA 1YWOA 1YI2A 2E4HA 1GXIE 2RD1A 4PLIA 4MDWA 1H641 1K8AU 4XU3A 1M1KU 4J9DA 4RUGA 4OMNA 3G4ST 3M0QA 1VQ8Q 2LNHB 3OYLA 2GF7A 2ZPEB 2RQVA 1KD1C 3TSZA 3OS2A 2FL7A 3OYAA 4ZN1A 3H9NA 1HXDA 1ZA1B 1KD1R 2VV5A 2MPXC 2F5TX 3NFCA 4E7JA 2QA4Q 3OS0A 2FZKB 3E9GA 1BB9A 1NEBA 1SHFA 4M7DC 2EYXA 2B8AA 3J81E 1RAHB 2F2XA 3QO3A 3JCMX 4CI0C 2DBKA 3JCMP 4HCCA 5J26A 3HP9A 1D0ZA 4J9IA 2D9TA 3CCQQ 3JCMh 4M7AD 1UHFA 3V7CA 1VQNA 3REBB 1NE8A 3OSVA 4C8QB 1OX9A 4AFZC 2ZPIB 3H41A 3X20B 2LVMA 1VQKQ 1G3WA 3NHNA 2DRMA 4RTXA 4A4FA 1YIJQ 1T3LA 3CC4A 1ZLMA 2LQ8A 4E2FB 3I55A 5D7UA 5I11A 4OMQA 5KE3A 4XTVA 2O88A 1E6GA 2A0FB 1SG5A 2E3IA 3QG1A 2RM4A 3L1AA 4KGVB 1XNIA 4M78A 3HL8A 3PVLA 4DBQA 4E7HA 3A8MB 3CC2Q 3RNJA 1WHJA 4FSSA 1V29B 2LCLA 2CDTA 4ZGDB 2QEXT 2NUPA 5EC7A 1KQ1A 2YLBA 5GAOq 3G71T 2M51A 2KYBA 1YJWT 1Q82C 2DVEA 4X9CA 4Y28E 2CREA 1SHGA 4J8OA 4R0KA 2COZA 4OMFB 1Q82R 3G6EQ 4CC4B 2OTLQ 3NPFA 4M7AE 4XTZA 1RAGB 2FG0A 1PSEA 2FZCB 4JDSA 4Q5WA 1ZQ1A 4DBFA 1OPLA 3FDRA 2BZYA 2PZ1A 4M7AG 2E6ZA 4A63B 2JUFA 1H92A 2EGEA 3VS6A 2KXDA 1I5OB 3OYYA 5GANg 2DM1A 2QTVA 1IREB 4B9XA 2RHUA 5LJ5j 2RI2A 3VUBA 4C5IA 2DD5A 3CPFA 3OYJA 2F69A 1QKXA 3TCJA 1BIAA 3CC7Q 3KBGA 1V1CA 1E7OA 3LYIA 4A4KA 3NTHA 3EGUA 3OBYA 1K73C 3QDFA 2K3XA 4XU2A 2FZGB 2L2PA
chains in the Genus database with same CATH topology
5GAN5 3GLXA 3A8LB 4J83A 2VYTA 1VQ8T 2HQXA 4ZGEB 1VQPT 1VQ5A 2KAFA 3CBOA 3CMET 1G5VA 3C95A 3OB9A 3PMIA 4F7UG 2LTOA 2CS7A 3LH0A 4M7DF 1O9SA 4OB3B 3CPWS 4BI8B 4M75F 5CIUA 4HCZA 4QQDA 5FROA 1VQOT 4R55A 1H3ZA 4XU0A 2RHIA 2PUKB 3HRSA 4XQ3A 1B34A 5DY9A 5CKEA 4E7IA 2FVUA 2RJDA 4LD9K 2E1HA 2KMTA 2QA4T 4TVRA 5GAMg 1XTDA 1ZHIA 1W4SA 2P0PA 5CR2A 1WJRA 3X28B 3I56A 3QSUA 4O6JA 4OF1A 1VQ9A 4HA8A 4M7DD 4C5EA 3CCLT 2OTJA 4J7FA 4M75D 2LQKA 4RG2A 3DB3A 2DTOA 4HKEA 5CQYA 1VIEA 3RKWA 2RA2A 1YJNA 3H6ZA 1LOJA 2VGNA 3MEWA 5GAOn 3JCMQ 2RI5A 2QEXA 4PLLA 2MAMA 3RIRA 5GAMf 4IUQA 2O4XA 2XIDA 4N0AA 2LC4A 5EG2A 2O01E 5LJ3h 4B9WA 3SWNA 2IVWA 4EMKC 3G71A 3CCST 4M77C 4N4IA 4BDYA 1BI2A 3GF5A 4DA4A 2X4JA 4FIBA 2KY9A 5CKBA 3META 1YJWA 1JJ2A 3WXMB 4F7UF 1I81A 5GMKj 2M9UA 4HCBA 4J6WA 3X24B 2E12A 3X25B 1YHQT 1RI0A 3JCMc 3MP8A 1Y96A 4MMKA 5CCAA 3CCQT 4E7LA 3VU3C 4C92F 3EFRA 3M5AA 4M7DA 2E5QA 5LJ5h 3MEAA 3JB9I 4M75A 1KQSA 2QQ9A 1TH7A 5FRNA 2RK2A 3C94A 3PNWC 4OGCA 4A4EA 2RB6A 3LW5E 3CMAT 4C8QF 1FXXA 3V7SA 3FJPA 2E64A 4JRKA 4BI3A 4C0GA 2JZ2A 2M0OA 2WSEE 4CRIA 1BIBA 3TEEA 3G4SA 3OYKA 3OBWA 2LT4A 5I21A 4PKCC 4R56A 2EJGA 4FT4A 4C92D 3OW2A 1M8VA 2RJFA 2CGHA 2P0QA 2EFIA 4DOWA 3JCMb 2E10A 3PFSA 3S3OA 2X4YA 1QVPA 2CZ0B 4LDYA 1VQLA 4C8QD 1OZ3A 2X4WA 1K9MC 1O75A 4A53A 4ZGJB 3CCVT 1Q82U 1B34B 2QQSA 3E9FA 3QZ5B 2NLUA 3MEVA 4ZTFA 2RHYA 1QVFA 3RMSA 2KQWA 2ZGWA 1I8FA 4OVAA 4QVDA 3L2UA 5GMKi 3CC2T 1VQ7A 4F7UA 4BDZA 2XG8D 4FSXA 5FLXE 3G7ZA 1XQHA 5GAN4 1U1TA 2DJZA 3MP6A 3OYIA 5IAYA 1VQMT 4RCCA 3JCMf 1G3SA 4C92A 4M75E 4MMLA 3JCMW 3OS1A 1Q81U 2PU9B 3S6WA 4LDWA 3BDLA 3E1SA 3JCMe 1K8AC 1M1KC 2KK4A 2E70A 3HHTB 4M75G 3KUFA 4C8QA 3CCJA 1VQ8A 2CZ6B 3SWNB 1N6AA 1VQPA 3CMEA 2XDDA 4MDXA 2HBPA 1G3YA 2GCXA 2L5QA 5L8RE 3M4YA 3V8KA 2ZPFB 3A5ZB 3QJ6A 3VYGA 1UEBA 1NZ9A 4M78B 4L6V5 1M4ZA 4PL6A 3JB9H 2R5MA 1VQOA 1Y96B 1W2BS 3BDUA 5GANf 3G6ET 1UGQB 5CK9A 2FB7A 3CCEA 2OTLT 3JB9G 2XD0A 4M7DB 2RJEA 4P5NA 5LJ3f 1Q7YU 3INZA 1M1GA 5GMKh 5LJ5g 5GANe 4IUTA 3CXCA 2QA4A 1VQ6T 3CCRT 3HKSA 4XU1A 5LJ3e 3QJYA 2CYZB 1KQSS 2K5LA 3DLMA 2KSSA 1U1SA 3SDZA 4RCBA 4NL2A 1NJIU 3CCLA 4XTWA 3GP8A 5GAN8 4A4GA 3E19A 3EFSA 1QVGA 4M7AC 5CKHA 3LX7A 2K57A 4JLGA 2LX9A 1KHCA 5FU6B 3JCMJ 4BI4A 1YI2T 4PJOF 4JS5A 1YJ9T 3M54A 5LJ5f 3JCMd 2DXBA 3QXEB 4M78C 4E7KA 4BD3A 1JBMA 1X75C 3M59A 3J7AF 2HQEA 3FLGA 1VIFA 3P8HA 4C92E 3UPUA 5A0LA 3CCSA 5A0GA 3OYDA 2QI2A 4JLIA 3QPHA 3X26B 2PQWA 2D6FA 3RESA 4PNOA 4Z02A 4C92G 4X34A 4C8QE 5C6SA 4KUIA 5CO7A 3ER0A 1YHQA 2JNGA 3WVEB 3NTKA 4M77G 2X4XA 2DIGA 5CQXA 1RL2A 2A3LA 2DZCA 2DTIA 3CCQA 3QZ9B 4C8QG 3TU4K 2DZ9A 4F7UB 4BE2A 3CC7T 3FB9A 4PJOD 3JB9F 2M1HA 5GANd 1SSFA 2HD0A 3C4SA 2RO0A 3OMCA 4XK8E 3CMAA 5LJ3d 1BI0A 4OP0A 1VUBA 3L2WA 4YTLA 4C92B 4ZN3A 1N8RC 3GPLA 1VQKA 1FWZA 4EMGA 3LGFA 4NOYA 1YIJA 2XI9A 4J7IA 4XTYA 2VXEA 1QP2A 2LT1A 3FIFA 3RKXA 2DPPB 3PIOA 2RJCA 5GAMe 2LNVA 4N4GA 4OGEA 3JB9D 3PIPA 1JRIA 5DLQE 3VUZA 3MO8A 5AYFA 1WQWA 3PMTA 3V7RA 2XKOC 3DB4A 3M55A 1KG1A 3OQ5A 4PJOA 4HT8A 3HFNA 1WNLA 1Y7XA 3CCVA 2FYKA 2L8DA 2JVVA 2K5FA 1NPPA 4J6XA 1I5LA 4OB2B 3L42A 3TREA 4M77F 2EQUA 1WJSA 3MP1A 5IN1A 2EIFA 4XTUA 3O8VA 3CC2A 4DQ2A 3HRTA 4IKFA 5HY6A 1DJ7B 3R6OA 2VUBA 1JB0E 3CXCS 2QTXA 2JOYA 1VQ4T 3H8ZA 1LJOA 3M57A 5CVIA 3OYNA 1K73U 1VQMA 3HRUA 2Y90A 1VQNT 3CEYA 3UDCA 4C0FA 2EKOA 3UT1A 5M9OA 2CZ7B 5GMKl 1N9RA 1N27A 2AHJB 4ZTJA 1QVGS 3L2RA 2MF2A 2QQRA 4II1A 2ZCFB 4M77D 1UB4A 4C0ZA 4LDXA 1VQ9T 3BFMA 5GAMd 3RUXA 1YITT 5KCOA 3CCUT 5D6WA 4IUPA 2M16A 4GLKA 1YJNT 2QQBA 3HPWA 2P4TA 3VV0A 2E6NA 2Y4XA 2ZPBB 4L59A 4C5GA 4NL3A 4BB7A 3CC4T 1YCYA 4A54A 3I55T 1Q86U 1BYMA 3OMGA 1Y07A 1K9MU 2QQAA 2EQMA 4GY5A 3G6EA 2XHCA 2OTLA 2G3RA 1BI3A 4FU6A 2JTFA 2K4YA 5C0MA 4PJOE 3P8BB 4HT9A 4OB1B 3DLLA 2DAQA 1P92A 2EAYA 5D6YA 1VQ6A 3CD6T 3CCRA 1PSFA 3FC3A 5FU7B 3MHXA 1M90C 4PJOG 3OY9A 2XU8A 1XOVA 3MEUA 4EMKA 4RMOA 5HKCA 4M77A 3FRNA 2O4XB 3CBMA 3QHSA 1EIFA 2RK1A 4J5YA 1YI2A 1YJ9A 1MHNA 2R58A 1X01A 5GAN3 4JJNK 1GXIE 2HNIA 2RD1A 2MI6A 4PLIA 1I4K1 4MDWA 5GANj 1KQ2A 2HAXA 1H641 3EAEA 3GNGA 2XDPA 1K8AU 4XU3A 1M1KU 5A0DA 2EQKA 2PVOB 4QQ6A 5LJ3j 1KC8C 3JSCA 1JJ2S 2DTHA 4PJOB 3G4ST 1M1FA 5GMKm 2GQVA 2EWNA 2JTMA 3OYLA 2GF7A 2ZPEB 5GAOr 3LLRA 1BKBA 2H3JA 4Y91A 3A8HB 1G3TA 2GFUA 1OZ2A 2WACA 4M75B 3M53A 3ZBDA 1KD1C 3S3NA 2PVDB 3GIBA 3CC7A 3OS2A 2PVGB 3RKYA 2FL7A 3OYAA 2GFAA 4E47A 4ZN1A 2RH2A 4N0AC 1HXDA 3OSSC 5I2MA 4O5VA 3SWNC 2VV5A 2F5TX 3NFCA 2D0QB 2RHXA 3CCMT 4E7JA 2I2LA 4A4HA 1M9SA 3OS0A 3E9GA 2DXCA 4QW2A 2LRQA 2LCCA 4RG8A 1VQ7T 2R57A 4XAXB 5GAOl 3JCMV 3QYGB 3F70A 5LJ5e 3OW2S 1NJIC 5IT9E 4M77E 2X35A 3QDRB 4M7DC 4M75C 3OYCA 2B8AA 5J39A 3BY7A 3L2ZA 1OI1A 4IUUA 3J81E 3KXTA 1S72T 4M7AF 1D3BA 4MZTA 3M56A 3Q1JA 3QO3A 3V8LA 3JCMX 2DEQA 3CBPA 4M78F 4CI0C 2VXFA 3JCMP 3V8JA 3CCJT 2XICA 4HCCA 3A8GB 3OYEA 5J26A 3HP9A 2ZPGB 2C06A 2DXTA 1QVFS 4LD6A 5FU6C 2EQJA 5GAMj 4X9DA 2KDSA 2WSCE 4EPCA 4MZPA 2EJFA 4VUBA 2D9TA 3GOXA 3JCMh 4EMKB 4M7AD 1VQ4A 4JRIA 4M77B 4QVZA 3WVDB 3V7CA 1VQNA 3CCET 3GNFB 1NE8A 3OSVA 4QVCA 4C8QB 3OYBA 4M78D 2ZPIB 4C0DB 1M5Q1 3QBYA 4BUGA 5GAN2 1N8RU 3URGA 2DD4A 3C12A 3X20B 2ZPHB 1U8RA 3S3MA 1BI1A 2LVMA 2V8JA 2OAUA 2BUDA 3VJPA 3VKIA 2VC8A 5LJ5d 4LDUA 3L2QA 4KBMB 1G3WA 1YITA 3DKMA 3HFOA 3CCUA 4A4FA 3SD4A 3BW1A 3JB9J 5CKDA 4FT2A 2RHZA 3L2VA 1LNXA 1VQ5T 3SB2A 5GAOm 3CC4A 5GANh 5A2QE 3ZFJA 2LQ8A 3OYGA 4KT0E 4C92C 5GAN6 3I55A 2K5IA 5KE3A 4XTVA 2E41A 4NS5A 3RERA 4M7AA 3UWNA 4LDVA 3QIIA 2MWPA 4N4HA 3QUIA 5J3BA 5LL6S 4C8QC 3QG1A 2EYQA 4C0DC 1W2BA 2RM4A 3L1AA 5CAIA 4M78A 1XNIA 3CD6A 4V2SA 4JRQA 2MMPA 5DM7R 3OYHA 3HL8A 1FX7A 2L89A 2PUOB 3A8MB 2E65A 4E7HA 3SFMA 3OYFA 2CZ1B 3I56T 4JS4A 2DK3A 2F5KA 3PGGA 3LGLA 4IUVA 1V29B 2IG0A 3ASKA 2EJ9A 2OTJT 2LCLA 4L5GA 5GMKe 5DLOA 3PT9A 5HK3A 3RMQA 4MZMA 5KE2A 2Y4YA 4ZGDB 4RKUE 1WJQA 1VQKT 1D3BB 4C5HA 5I2SA 4BACA 2QEXT 2BIVA 1YIJT 1KQ1A 2K3YA 3ME9A 4JRPA 2XK0A 2YLBA 2BKDN 5GAOq 3LWHA 3PTAA 3A8OB 3G71T 3CPWA 2JN0A 3JAME 2FHDA 1YJWT 1Q82C 2DVEA 4X9CA 1YBYA 4Y28E 2VGMA 4KULA 3M4GA 3ZEHA 2XDBA 1UGSB 2RI3A 4J8OA 1Q86C 4OMFB 3LWIA 3J80E 3JCMg 1AHJB 4M7AE 4J6YA 4XTZA 3CCMA 2YRVA 5GAMh 1PSEA 1M90U 4JDSA 4Q5WA 1ZQ1A 2MWOA 3FEOA 3QYHB 5KH6A 2YLCA 4M78E 3FDRA 5FRMA 4IURA 3AHUA 4BY6B 1Q81C 4M7AG 2E6ZA 1WQ7A 1Y71A 4WF2A 1MGQA 5CKFA 2JUFA 1WGSA 2QDYB 1OYXA 2A7YA 4ATOA 3QKJA 4M78G 5D6XA 4M7DE 4BE0A 3OYMA 3P8DA 2DXUA 4DOVA 1S72A 2DO3A 2KVQG 2V8IA 3NTIA 1UGRB 5FU7C 3OYYA 1KC8U 4EMHA 5GANg 4M7DG 1WPYA 2K2VA 1IZ6A 1ZBXA 1VQLT 1IREB 4B9XA 5LJ3g 1R8OB 3OS5A 5KCHA 2P0KA 3T9NA 4M7AB 1NPRA 4D6WA 2CKKA 2RHUA 5HK0A 5LJ5j 2RI2A 3VUBA 4KUDK 2YHTA 2R5AA 4EDUA 1KD1U 4C5IA 2ZZDA 2WSFE 2DD5A 2L3RA 3CPFA 1Q7YC 3N5BB 2DIQA 3OYJA 1HK9A 2F69A 1QW1A 4UC4A 4OB0B 3MCAB 4BY6C 5GAOp 1KHIA 1BIAA 3TCJA 3KBGA 1N9SA 3VYHB 4ELZC 1QP3A 3M9QA 4ELYC 4PJOC 3LYIA 4A4KA 3NTHA 2V8KA 2QXFA 4FL6A 3HSBA 5GAN7 3M58A 2DKGA 3OBYA 1UGPB 3OA6A 1K73C 4ME7A 2K3XA 2LDMA 4JUVA 4XU2A 4XTXA 4BE1A 4FM4B 3JRZA 1X6OA 4QQGA 4F7UE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLX A;  3E19 A;  4O5V A;  2QQ9 A;  2K5F A;  1G3Y A;  2GCX A;  2LX9 A;  2QQB A;  1BI0 A;  1QW1 A;  2K5I A;  1BYM A;  3HRT A;  1FWZ A;  2QQA A;  1BI3 A;  1BI2 A;  2K4Y A;  3HRS A;  5CVI A;  3HRU A;  2H3J A;  1P92 A;  1G3T A;  1G3S A;  1U8R A;  1BI1 A;  3MHX A;  1FX7 A;  1QVP A;  2K5L A;  1G3W A;  4O6J A; 
#chains in the Genus database with same CATH topology
 1K73 R;  2VYT A;  2HQX A;  2KAF A;  2EPD A;  5FW9 A;  3CPW S;  1AOJ A;  4QQD A;  1OU8 A;  2ROT A;  2PUK B;  4XQ3 A;  1B34 A;  5DY9 A;  4E7I A;  1ABO A;  1MNE A;  2E1H A;  1UE9 A;  2KMT A;  1ZHI A;  2P0P A;  5ECA A;  5HCK A;  1I1J A;  1WI7 A;  4C5E A;  3CCL T;  3I9Q A;  4J7F A;  4M75 D;  2DTO A;  3RKW A;  3H6Z A;  4AMC A;  4KRT A;  4J9C A;  2VGN A;  2JW4 A;  4PFZ A;  3JCM Q;  2RI5 A;  2QEX A;  4PLL A;  2O4X A;  4B9W A;  3G71 A;  4J9B A;  4FCY A;  1QCN A;  4F14 A;  3CCU Q;  5CKB A;  1YJW A;  2E12 A;  1YHQ T;  3MP8 A;  4E7L A;  3H0F A;  4M7D A;  2HEQ A;  5LJ5 h;  1RAD B;  4A4E A;  3CD6 Q;  2RB6 A;  3CMA T;  3V7S A;  4CC2 A;  2M0O A;  1OUL A;  3M0T A;  1WXB A;  1QVF P;  2EBP A;  2V26 A;  4C92 D;  4HXJ A;  2FPF A;  2EFI A;  2LQW A;  4FYV B;  4GBQ A;  2CP6 A;  2X4W A;  1O75 A;  2OX7 A;  4ZGJ B;  4HVW A;  2QQS A;  3MEV A;  1Z9Q A;  1Q86 R;  2RHY A;  1NM7 A;  4F7U A;  5FLX E;  1RAC B;  1XQH A;  2DJZ A;  1IRX A;  2CP2 A;  4M75 E;  4MML A;  2PU9 B;  2ZAE A;  5GJV B;  4LDW A;  3BDL A;  1UUE A;  4CC7 A;  3JCM e;  1K8A C;  1M1K C;  4FYW B;  2E70 A;  3HHT B;  4M75 G;  2DFU A;  3SWN B;  1N6A A;  1E6H A;  2OAW A;  1G3Y A;  2L5Q A;  3VYG A;  1K8A R;  1UEB A;  1M1K R;  4M78 B;  1QVG P;  4PL6 A;  3JB9 H;  3LH5 A;  2R5M A;  1Y96 B;  2E5K A;  4JJC A;  1W2B S;  3TQ7 P;  2XD0 A;  3CCE A;  3JB9 G;  4P5N A;  1JEG A;  1Q7Y U;  1ARK A;  1R77 A;  2HZY A;  1VQ6 T;  3CCR T;  1FYN A;  2KRN A;  1U1S A;  3CCL A;  1K1Z A;  3E19 A;  5CKH A;  2K57 A;  2LX9 A;  1KHC A;  5FU6 B;  1YJ9 T;  1SF9 A;  4PJO F;  4JS5 A;  3JCM d;  4C92 E;  5A0L A;  2J7I A;  4C92 G;  1X2Q A;  4QKU A;  2JNG A;  1YHQ A;  3VS1 A;  3NTK A;  4M77 G;  3EG9 A;  2JJ9 A;  2X4X A;  1M30 A;  3H0I A;  1RL2 A;  2KT8 A;  4J9E A;  2DZ9 A;  3FJ5 A;  2M1H A;  2HD0 A;  3C4S A;  3CMA A;  1BI0 A;  1YFN A;  1FWZ A;  4EMG A;  3I56 Q;  2VXE A;  3FIF A;  3RKX A;  2OTJ Q;  2CSQ A;  1JRI A;  5AYF A;  3DB4 A;  3M55 A;  2HDA A;  3OQ5 A;  1T0J A;  3HFN A;  1WNL A;  1YP5 A;  2L8D A;  2JS2 A;  2JVV A;  1I5L A;  2EQU A;  1WJS A;  5IN1 A;  2EIF A;  1H3H A;  2AK5 A;  1R0B G;  2DL4 A;  2JOY A;  4J9G A;  5CVI A;  3OYN A;  3HRU A;  1KJW A;  3CEY A;  1QWE A;  2RQW A;  1R0C B;  1N27 A;  2VKN A;  2EKH A;  1TU0 B;  2QQR A;  1UB4 A;  2J06 A;  1YIT T;  2L3S A;  2M16 A;  3HPW A;  2Y4X A;  1WYX A;  4BB7 A;  3VS4 A;  4A54 A;  1KK7 A;  1K9M R;  1MMG A;  3OMG A;  1TS9 A;  4GY5 A;  1VQL Q;  2K4Y A;  1GCQ C;  3EG2 A;  4OB1 B;  1VQ6 A;  3CCR A;  3FC3 A;  5FU7 B;  3MEU A;  4RMO A;  1NYF A;  1VQ7 Q;  1HYO A;  2O4X B;  3CBM A;  2BTT A;  2RK1 A;  4J5Y A;  1YJ9 A;  1QWF A;  1G2B A;  4AFU C;  4JZ3 A;  3GNG A;  1OX8 A;  2PVO B;  5LJ3 j;  4PJM A;  1JJ2 S;  4PJO B;  1M1F A;  2EWN A;  2JTM A;  1BCO A;  3CCJ Q;  3CME Q;  5GAO r;  3LLR A;  1BKB A;  3A8H B;  2GFU A;  3ZBD A;  2JS0 A;  3S3N A;  2O2O A;  3GIB A;  2W10 A;  1ACM B;  2PVG B;  1OU9 A;  2KNB B;  3SWN C;  4O5V A;  3ULR B;  2FEI A;  2D0Q B;  3CCM T;  2I2L A;  1M9S A;  4QW2 A;  2LCC A;  2QGF B;  4RG8 A;  1G83 A;  2R57 A;  4XAX B;  5GAO l;  3UF4 A;  5LJ5 e;  4E6R A;  3QDR B;  3O5Z A;  3OYC A;  1LVK A;  5J39 A;  3BY7 A;  3L2Z A;  4AFQ C;  3KXT A;  1S72 T;  1SKU B;  4M7A F;  4MZT A;  3M56 A;  4KH0 B;  3V8L A;  2DEQ A;  3CBP A;  2LJ1 A;  3CCS Q;  2EYY A;  2C06 A;  1X43 A;  5FU6 C;  3RR6 A;  2WSC E;  4E7S A;  2VB6 A;  4JRI A;  3WVD B;  2KR3 A;  2Z0W A;  1SPK A;  2D0N A;  4QVC A;  3QBY A;  5GAN 2;  2G6F X;  1RLP C;  1U8R A;  3S3M A;  1BI1 A;  2V8J A;  5LJ5 d;  2BZX A;  1YIT A;  3HFO A;  2AZS A;  5CKD A;  4FT2 A;  1LNX A;  4LXC A;  1VQ5 T;  2FRY A;  5GAO m;  4DBH A;  3OYG A;  3ZFJ A;  1VOM A;  4KT0 E;  5GAN 6;  2YUN A;  1K76 A;  2E41 A;  4NS5 A;  3UWN A;  4LDV A;  5J3B A;  3QUI A;  3CCV Q;  1W2B A;  5CAI A;  2KT1 A;  2J05 A;  4V2S A;  2MMP A;  3OYH A;  1UJ0 A;  3SFM A;  3OYF A;  2DK3 A;  2F5K A;  4IUV A;  5DLO A;  1VQM Q;  1GFD A;  1EFN A;  1VYU A;  3PT9 A;  2QAS A;  3RMQ A;  5KE2 A;  1VQK T;  4AG2 C;  5I2S A;  4C5H A;  1YIJ T;  4JRP A;  2MOX A;  1N5Z A;  2QK0 A;  4KUL A;  2DF6 A;  3ZEH A;  3JCM g;  1AWO A;  1AHJ B;  4J6Y A;  3CCM A;  1M90 R;  2YRV A;  5IH2 A;  5KYU B;  2MWO A;  4F16 A;  5FRM A;  1GBQ A;  3AHU A;  2YUO A;  1Y71 A;  1MGQ A;  2QDY B;  5D6X A;  4M7D E;  1YI2 Q;  1S72 A;  5FU7 C;  1KC8 U;  4M7D G;  2K2V A;  2P0K A;  4M7A B;  1NPR A;  4D6W A;  5HK0 A;  1TG0 A;  2R5A A;  4EDU A;  2ZZD A;  2CH4 A;  1Q7Y C;  1M2V B;  3GBQ A;  2HL3 A;  1ZBJ A;  1UEC A;  4OB0 B;  1KHI A;  1OPK A;  1WHK A;  2MYS A;  2K6D A;  4LUD A;  4ELY C;  2HKN A;  4PJO C;  2QXF A;  1QKW A;  5GAN 7;  2DKG A;  4XTX A;  4F7U E;  2KRS A;  1GCQ A;  1PWT A;  1VQP T;  1VQ5 A;  3CBO A;  1G5V A;  4F7U G;  2LTO A;  2CS7 A;  3LH0 A;  1OEB A;  1YCS B;  2O9S A;  1GRI A;  2EQI A;  4CC3 A;  2YXY A;  4BI8 B;  4M75 F;  1VQO T;  1GL5 A;  2RHI A;  5CKE A;  1VYT A;  2FVU A;  2RJD A;  3D7S B;  1XTD A;  5CR2 A;  1VQ9 A;  1FMK A;  3EG3 A;  2LQK A;  3DB3 A;  1VQN Q;  1YJN A;  2QAZ A;  3MEW A;  5IHI A;  2SEM A;  8ATC B;  2DIL A;  4IUQ A;  2K9G A;  2LC4 A;  5EG2 A;  2O01 E;  1Y0M A;  3SWN A;  4BDY A;  1BI2 A;  3GF5 A;  1JJ2 A;  2J6K A;  5GMK j;  2M9U A;  4J6W A;  3VS0 A;  1S1N A;  3CC4 Q;  3X25 B;  3I55 Q;  1Y96 A;  4MMK A;  3VU3 C;  4C92 F;  2E5Q A;  4WCI A;  3JB9 I;  1KQS A;  3C94 A;  4OGC A;  2NYS A;  3LW5 E;  1FXX A;  4JRK A;  1J3T A;  1K0X A;  2SRC A;  1MND A;  3G4S A;  1WHG A;  3OBW A;  1C1A A;  2C0I A;  2LT4 A;  5I21 A;  4FT4 A;  1M3B A;  2RJF A;  2DRK A;  4DOW A;  3PFS A;  1PRM C;  4LDY A;  3TSW A;  4C8Q D;  3E2U A;  5KYX B;  4A53 A;  2KQW A;  4OML A;  4PFP A;  4LUE A;  5GMK i;  5KYW A;  2CP3 A;  4PFO A;  1ZSZ B;  1ZSG A;  5GAN 4;  5IAY A;  4RCC A;  2HCK A;  2LCS A;  1D09 B;  1Q81 U;  3UAT A;  1AWJ A;  4HCK A;  2KK4 A;  3KUF A;  1VQP A;  1JXM A;  1X6B A;  2QG9 B;  3M4Y A;  2ZPF B;  1EX4 A;  2HMA A;  4L6V 5;  1M4Z A;  2ED1 A;  1VQO A;  5GAN f;  1PD1 A;  2RJE A;  5GMK h;  5LJ5 g;  3CXC A;  3HKS A;  1BCM A;  5LJ3 e;  3QJY A;  1UDL A;  2K5L A;  2KE9 A;  4RCB A;  4XTW A;  5GAN 8;  4M7A C;  3I5S A;  1PG5 B;  4Z89 A;  3M54 A;  5LJ5 f;  4E7K A;  1AEY A;  2AKK A;  3J7A F;  3I5R A;  3NMZ C;  5A0G A;  3A98 A;  4JZ4 A;  2A08 A;  4X34 A;  4C8Q E;  5C6S A;  3ER0 A;  3WVE B;  2DIG A;  2A3L A;  2HBW A;  4C8Q G;  2V1R A;  2YDL A;  1NBE B;  1SSF A;  2RO0 A;  2V1Q A;  5LJ3 d;  2KXC A;  4YTL A;  4C92 B;  1WA7 A;  4RTV A;  1WFW A;  3LGF A;  3U23 A;  1X69 A;  2XI9 A;  1QP2 A;  5IXB A;  2C0T A;  2LNV A;  4N4G A;  4OGE A;  3JB9 D;  1X27 A;  3PIP A;  2HQH A;  5DLQ E;  3M0P A;  3PMT A;  3V7R A;  2XKO C;  1U5S A;  2QEX Q;  2CUB A;  4PJO A;  2CT3 A;  5AT1 B;  4HT8 A;  1JQQ A;  3G71 Q;  1Y7X A;  2FYK A;  1NPP A;  1RAA B;  2L0A A;  1YJW Q;  1B3Q A;  4XTU A;  1T0H A;  3O8V A;  4M4Z A;  3HRT A;  4IKF A;  1DJ7 B;  2F1L A;  2VUB A;  1VQ4 T;  1LJO A;  3UDC A;  4C0F A;  2DYI A;  4FYX B;  5GMK l;  1N9R A;  4D8K A;  4RTY A;  1QVG S;  2MF2 A;  4LDX A;  4M77 D;  3BFM A;  1M2O A;  3RUX A;  7AT1 B;  5D6W A;  2RNA A;  4IUP A;  1RUW A;  2M0Y A;  2P4T A;  2ZPB B;  4NL3 A;  4PJN A;  1TSF A;  1BYM A;  1D1C A;  2QQA A;  1BI3 A;  4K11 A;  2CSI A;  3BE3 A;  2CP0 A;  3MHX A;  3EFO B;  4FW1 A;  1PD0 A;  2ATC B;  3FRN A;  8AT1 B;  2F2W A;  1MHN A;  2R58 A;  4JJN K;  2KGT A;  2LX7 A;  1CKA A;  1KQ2 A;  1I4K 1;  2JMC A;  3EAE A;  2XDP A;  5A0D A;  2EQK A;  4QQ6 A;  1KC8 C;  3JSC A;  1WZO A;  2DTH A;  1ZSZ C;  5GMK m;  2GQV A;  1WLP B;  2D1X A;  2DMO A;  4Y91 A;  2H3J A;  1KC8 R;  1G3T A;  2GQI A;  1OZ2 A;  2WAC A;  3JV3 A;  1ZUK A;  2DET A;  4E47 A;  2FPE A;  2RH2 A;  3OSS C;  3CCE Q;  1X6G A;  2YUQ A;  2JM8 A;  4OMO A;  4A4H A;  2DXC A;  3MPU B;  1VQ7 T;  4RTU A;  3JCM V;  3CCL Q;  3OW2 S;  1NJI C;  5IT9 E;  4M77 E;  2COW A;  4M75 C;  1OI1 A;  2ESW A;  4IUU A;  3Q1J A;  2JTE A;  2BE7 D;  1LCK A;  2VXF A;  1RI9 A;  5KYW B;  3V8J A;  3CCJ T;  2XIC A;  3A8G B;  3OYE A;  2DXT A;  4LD6 A;  2EQJ A;  5GAM j;  1YHQ Q;  2X51 A;  1BBZ A;  1VQ4 A;  3GNF B;  3OYB A;  2KI7 A;  4M78 D;  5KYU A;  4BUG A;  1N8R U;  3C12 A;  3CMA Q;  2ZPH B;  2BUD A;  3VKI A;  1TUC A;  3L2Q A;  4LDU A;  4QT7 A;  1AZG B;  3DKM A;  1FMW A;  3BW1 A;  2ED0 A;  2RHZ A;  1V76 A;  3L2V A;  3SB2 A;  2KEA A;  1IGU A;  2RQU A;  4C92 C;  2K5I A;  3RER A;  2HSP A;  4M7A A;  3QII A;  1M3C A;  2VVK A;  4C0D C;  1M2V A;  4JRQ A;  1FX7 A;  1RLQ C;  2RN8 A;  4JS4 A;  1WX6 A;  1MUZ A;  3PGG A;  1ABQ A;  2EJ9 A;  5GMK e;  3AT1 B;  5HK3 A;  4MZM A;  2H3E B;  1WJQ A;  1D3B B;  1PCX A;  2BIV A;  1H8K A;  2KYM A;  3CPW A;  1QCO A;  3A8O B;  3VS7 A;  2FHD A;  3R6N A;  1AWX A;  1YBY A;  1W1F A;  3M4G A;  1K0S A;  3LWI A;  3J80 E;  1KSW A;  2J6F A;  5GAM h;  4JPB W;  1WDX A;  3QYH B;  5KH6 A;  1VQ6 Q;  3PVQ A;  2YLC A;  3CCR Q;  4LE9 A;  4M78 E;  1JO8 A;  4IUR A;  1Q81 C;  1K9A A;  1WQ7 A;  4WF2 A;  5CKF A;  1GBR A;  4ATO A;  3QKJ A;  4M78 G;  4BE0 A;  2DXU A;  1YJ9 Q;  2GNC A;  2DO3 A;  3NTI A;  1IHW A;  1WIE A;  4ZNX A;  1ZBX A;  5LJ3 g;  1R8O B;  1C6V X;  3OS5 A;  5KCH A;  1RAB B;  1IGQ A;  2ABL A;  1UJY A;  4F04 B;  2L3R A;  3NGP A;  1D1B A;  3N5B B;  2DIQ A;  1HK9 A;  2MCN A;  1QW1 A;  1CKB A;  4BY6 C;  1F1B B;  3VYH B;  3PE0 A;  4DBR A;  2V8K A;  1D0Y A;  1AVZ C;  4FL6 A;  2DL8 A;  3M58 A;  2DER A;  1UGP B;  2LDM A;  4FM4 B;  3JRZ A;  1X6O A;  4JJB A;  4QQG A;  3VUZ A;  2K2M A;  5GAN 5;  4J83 A;  1VQ8 T;  4PJL A;  1K4U S;  1TUD A;  3C95 A;  1CSK A;  3PMI A;  2I0N A;  4OB3 B;  1M27 C;  5KYX A;  4R55 A;  1H3Z A;  4XU0 A;  1PHT A;  2RPN A;  1MMD A;  2CT4 A;  2QA4 T;  1W4S A;  3X28 B;  1JJ2 P;  3QSU A;  4OF1 A;  1ZSZ A;  4M7D D;  3SHW A;  4RG2 A;  2GTJ A;  2NUT B;  1VIE A;  2RA2 A;  3A1P A;  1JXO A;  1LOJ A;  3SEM A;  4E7Z A;  1KQS P;  2MAM A;  3RIR A;  2XID A;  5LJ3 h;  1YIT Q;  2IVW A;  4N4I A;  2X4J A;  2KY9 A;  3MET A;  2DEU A;  1I0C A;  4HCB A;  3X24 B;  1RI0 A;  4GLM A;  2RMO A;  5CCA A;  3CCQ T;  2RF0 A;  3MEA A;  4M75 A;  2QQ9 A;  1TH7 A;  2RK2 A;  3PNW C;  2LP5 A;  4C8Q F;  1T3S A;  3FJP A;  4C0G A;  4BI3 A;  2JXB A;  2JZ2 A;  2WSE E;  1NG2 A;  4CRI A;  1BIB A;  3OYK A;  4PKC C;  2EJG A;  1JU5 C;  3OW2 A;  2P0Q A;  2E10 A;  1KFZ A;  1PKT A;  2X4Y A;  1QVP A;  3EHQ A;  1X2K A;  1WHM A;  1OZ3 A;  2OJ2 A;  4OMM A;  2NLU A;  2AT1 B;  4ZTF A;  1I8F A;  1TWB A;  2RQR A;  4QVD A;  3L2U A;  3M0R A;  3CC2 T;  4BDZ A;  2XG8 D;  1SEM A;  3EGX B;  1U1T A;  2LJ0 A;  3MP6 A;  3OYI A;  3JCM f;  3EH2 A;  3CCM Q;  1G3S A;  4C92 A;  3JCM W;  3OS1 A;  3S6W A;  2BE9 B;  3CXC P;  1VQ8 A;  2CZ6 B;  4MDX A;  2PTK A;  4HVU A;  2GBQ A;  3QWY A;  1D1A A;  1EZZ B;  3A5Z B;  3QJ6 A;  1S72 Q;  3G6E T;  2OTL T;  1Q7Y R;  1AWW A;  2E3H A;  3INZ A;  4DEY A;  5I22 A;  2L3Q A;  2EYZ A;  4LN2 A;  2QA4 A;  3MJX A;  1U3O A;  2P4R A;  3DLM A;  3SDZ A;  2X3W D;  4NL2 A;  1NJI U;  3GP8 A;  3EFS A;  5L23 A;  1WHL A;  4JLG A;  5KYN A;  4BI4 A;  4BD3 A;  1JBM A;  1X75 C;  2HQE A;  1VIF A;  4JLI A;  2D8H A;  2D6F A;  4PNO A;  4Z02 A;  2LZ6 B;  1VQ5 Q;  3EH1 A;  2P84 A;  2DZC A;  2DTI A;  3CCQ A;  1ZUY A;  3CC7 T;  4BE2 A;  2QYZ A;  3FB9 A;  3JB9 F;  2AIR B;  1HD3 A;  3OMC A;  4OP0 A;  3EGD A;  1N8R C;  3EFO A;  3GPL A;  1VQK A;  4NOY A;  1YIJ A;  4J7I A;  1VQ9 Q;  4XTY A;  2JM9 A;  1N8R R;  2DPP B;  5GAM e;  1MMN A;  1ZUU A;  1YJN Q;  2KBT A;  3HTR A;  1KG1 A;  4ANJ A;  2W0Z A;  1VA7 A;  4J6X A;  4OB2 B;  3L42 A;  3TRE A;  4M77 F;  4Z88 A;  3CC2 A;  1XJW B;  4DQ2 A;  3R6O A;  3M0U A;  5IXF A;  1JB0 E;  2EW3 A;  3VS2 A;  3H8Z A;  1GFC A;  2Y90 A;  2DL3 A;  3UT1 A;  5M9O A;  4ZTJ A;  5GAM d;  2EGA A;  4Z8A A;  3CCU T;  3G4S Q;  1TXQ A;  3VV0 A;  2YRD A;  4C5G A;  4L59 A;  2FRW A;  1IB8 A;  1K9M U;  2EQM A;  3G6E A;  2OTL A;  1IHV A;  4FU6 A;  4JJD A;  3P8B B;  4HT9 A;  1RAF B;  2DAQ A;  1P92 A;  1B7T A;  2EAY A;  2DNU A;  1PRL C;  4KGZ B;  1PSF A;  3G1J A;  4DEX A;  2YT6 A;  3CD6 T;  1M8M A;  3OY9 A;  1BK2 A;  3QHS A;  1EIF A;  1X01 A;  5GAN 3;  2O9V A;  2YSQ A;  2HNI A;  2MI6 A;  5GAN j;  2HAX A;  3EG1 A;  2K7A A;  3M0S A;  4WTO B;  2PNI A;  1VQP Q;  2CP7 A;  4M75 B;  3M53 A;  2AZV A;  2PVD B;  2X9H A;  3CC7 A;  3RKY A;  2CUD A;  2JMA A;  1SRL A;  2GFA A;  1VQO Q;  1YN8 A;  4N0A C;  5I2M A;  3VS5 A;  4IIO A;  2RHX A;  2ROL A;  2LRQ A;  2H8H A;  2KRM A;  5FWB A;  1RAI B;  3QYG B;  3F70 A;  5KYY B;  2COY A;  2QGG A;  2X35 A;  2DE0 X;  4ESR A;  2NUZ A;  4J9F A;  1D3B A;  2GGR A;  4M78 F;  2DL5 A;  1MV0 B;  1KIK A;  2ZPG B;  1QVF S;  4FYY B;  2KDS A;  1Q95 G;  4X9D A;  3H0H A;  4EPC A;  4MZP A;  2EJF A;  4VUB A;  1SRM A;  3GOX A;  4AT1 B;  4EMK B;  4QVZ A;  4M77 B;  3CCE T;  1WXT A;  4C0D B;  1M5Q 1;  4EIK A;  3URG A;  2DD4 A;  1OV3 A;  2OAU A;  3VJP A;  2VC8 A;  4KBM B;  1VYV A;  4PK4 A;  2BZ8 A;  4PJJ A;  3CCU A;  3SD4 A;  3JB9 J;  2LQN A;  1Y57 A;  5GAN h;  5A2Q E;  1ZX6 A;  2A37 A;  2MWP A;  4N4H A;  5LL6 S;  1YNZ A;  4C8Q C;  2EYQ A;  4B6M A;  1M8V A;  3CD6 A;  4RTZ A;  5DM7 R;  3CPW P;  2F2V A;  2L89 A;  2PUO B;  2E65 A;  1NLP C;  2CZ1 B;  3I56 T;  2DVJ A;  3LGL A;  2IG0 A;  3ASK A;  4AG1 C;  2OTJ T;  4L5G A;  1MV3 A;  2Y4Y A;  4RKU E;  4BAC A;  1YWP A;  2DX1 A;  2K3Y A;  3ME9 A;  2XK0 A;  2BKD N;  3PTA A;  3LWH A;  2JN0 A;  3JAM E;  2VGM A;  2XDB A;  1UGS B;  2LMJ A;  2RI3 A;  3EGD B;  1Q86 C;  4OMP A;  1A0N B;  1M90 U;  2AKL A;  3FEO A;  2K3B A;  4IIM A;  4BY6 B;  2IIM A;  1WGS A;  1OYX A;  9ATC B;  2A7Y A;  2NUT A;  4Y92 A;  2JT4 A;  3OYM A;  3P8D A;  4DOV A;  2KVQ G;  2V8I A;  2YUP A;  4FW2 A;  1UGR B;  4EMH A;  1I07 A;  1WPY A;  1IZ6 A;  1VQL T;  3T9N A;  2CKK A;  4KUD K;  2YHT A;  1KD1 U;  2WSF E;  4UC4 A;  3VRY A;  3MCA B;  5GAO p;  1ZA2 B;  1N9S A;  4AFS C;  4ELZ C;  1QP3 A;  2EYW A;  3M9Q A;  3HSB A;  3OA6 A;  2DBM A;  4JUV A;  4ME7 A;  4RTW A;  4BE1 A;  1AZE A;  1NJI R;  2VWF A;  1UG1 A;  2NUP B;  3GLX A;  3A8L B;  1M3A A;  4ORZ A;  4ZGE B;  3CME T;  1QLY A;  1D0X A;  2DA9 A;  2A36 A;  3OB9 A;  2HKQ B;  1O9S A;  4M7D F;  2D8J A;  5CIU A;  4HCZ A;  3I35 A;  5FRO A;  4KGX B;  3TVT A;  3HRS A;  1NYG A;  4LD9 K;  1AD5 A;  4TVR A;  5GAM g;  2EGC A;  2HSE B;  2ECZ A;  1WJR A;  3I56 A;  2MIO A;  4O6J A;  1W2B P;  4HA8 A;  3EGX A;  2OTJ A;  3RBB B;  1VQ4 Q;  4HKE A;  5CQY A;  4KH1 B;  3REA B;  1UGV A;  5GAO n;  5GAM f;  4N0A A;  3CCS T;  4EMK C;  4DA4 A;  4M77 C;  2RQT A;  4FIB A;  3CQT A;  2GTO A;  2YRC A;  3WXM B;  1I81 A;  4F7U F;  1G8X A;  2LJ3 A;  3JCM c;  3OW2 P;  1C0M A;  1QMC A;  1TOV A;  2DYB A;  3EFR A;  4LNP A;  1OQK A;  3M5A A;  5FRN A;  2CH4 W;  3RDV A;  2L3P A;  1FMV A;  2E64 A;  1PM3 A;  1IO6 A;  3TEE A;  1IXD A;  3VRZ A;  4R56 A;  2C0O A;  2CGH A;  1HSQ A;  3JCM b;  3S3O A;  4X1V A;  2DL7 A;  2CZ0 B;  1VQL A;  2OI3 A;  1Z9Z A;  1K9M C;  3CCV T;  1Q82 U;  5IHK A;  1B34 B;  3E9F A;  3QZ5 B;  1QVF A;  3RMS A;  2ZGW A;  4OVA A;  1VQ7 A;  4FSX A;  1W70 A;  3G7Z A;  4F17 A;  1WHH A;  1VQM T;  1Q81 R;  1OOT A;  1PKS A;  3E1S A;  2A28 A;  2J6O A;  1UHC A;  2O31 A;  4C8Q A;  3CCJ A;  3CME A;  2XDD A;  2HBP A;  2GCX A;  5L8R E;  3V8K A;  3THK A;  1NZ9 A;  1MMA A;  2KRO A;  3BDU A;  1UGQ B;  5CK9 A;  2FB7 A;  2B86 A;  2IPO B;  4M7D B;  5LJ3 f;  5GJW B;  1M1G A;  3UA6 A;  3KFV A;  4IUT A;  5GAN e;  1UFF A;  4XU1 A;  2CYZ B;  1KQS S;  2KSS A;  4A4G A;  1QVG A;  3LX7 A;  3JCM J;  1K73 U;  1YI2 T;  2DXB A;  3QXE B;  4M78 C;  2FPD A;  1TUG B;  3M59 A;  3UPU A;  3FLG A;  1AT1 B;  3P8H A;  3EHR A;  4RTT A;  3CCS A;  3OYD A;  2HL5 C;  2QI2 A;  3QPH A;  1QQJ A;  3X26 B;  2PQW A;  3RES A;  4KUI A;  2QDL A;  5CO7 A;  2CP5 A;  5CQX A;  4PJO D;  3QZ9 B;  3TU4 K;  4F7U B;  1B07 A;  5GAN d;  2X3X D;  5IHN A;  1LPL A;  4J9H A;  4XK8 E;  1PC0 A;  1VUB A;  1NLO C;  3L2W A;  4ZN3 A;  2DJQ A;  2M02 A;  1RAE B;  2LT1 A;  3PIO A;  2RJC A;  3C0C A;  1PNJ A;  3MO8 A;  1WQW A;  1HJD A;  2DLP A;  3IQL A;  3VS3 A;  3UA7 A;  4HVV A;  3CCV A;  2K5F A;  3QWX X;  5FWC A;  2YWW A;  3MP1 A;  1GCP A;  2XMF A;  1WXU A;  5HY6 A;  6AT1 B;  2K79 A;  3CXC S;  2QTX A;  3EG0 A;  1QCF A;  3M57 A;  1VQM A;  1VQN T;  2EKO A;  2CZ7 B;  2AHJ B;  2NWM A;  3L2R A;  1U06 A;  4II1 A;  2ZCF B;  4C0Z A;  1VQ9 T;  1TTH B;  1NEG A;  5KYY A;  5KCO A;  1SSH A;  3ZL7 C;  3MKD A;  4GLK A;  1YJN T;  2QQB A;  2VAS A;  2E6N A;  2FO0 A;  3CC4 T;  1YCY A;  3I55 T;  1Q86 U;  3EG9 B;  1Y07 A;  2XHC A;  2G3R A;  2JTF A;  5C0M A;  4PJO E;  2EVR A;  2MK5 A;  3DLL A;  5D6Y A;  1BU1 A;  1M90 C;  2ENM A;  4PJO G;  2XU8 A;  1XOV A;  4EMK A;  5HKC A;  4M77 A;  1W6X A;  1UTI A;  4D8D A;  1YWO A;  1YI2 A;  2E4H A;  1GXI E;  2RD1 A;  4PLI A;  4MDW A;  1H64 1;  1K8A U;  4XU3 A;  1M1K U;  4J9D A;  4RUG A;  4OMN A;  3G4S T;  3M0Q A;  1VQ8 Q;  2LNH B;  3OYL A;  2GF7 A;  2ZPE B;  2RQV A;  1KD1 C;  3TSZ A;  3OS2 A;  2FL7 A;  3OYA A;  4ZN1 A;  3H9N A;  1HXD A;  1ZA1 B;  1KD1 R;  2VV5 A;  2MPX C;  2F5T X;  3NFC A;  4E7J A;  2QA4 Q;  3OS0 A;  2FZK B;  3E9G A;  1BB9 A;  1NEB A;  1SHF A;  4M7D C;  2EYX A;  2B8A A;  3J81 E;  1RAH B;  2F2X A;  3QO3 A;  3JCM X;  4CI0 C;  2DBK A;  3JCM P;  4HCC A;  5J26 A;  3HP9 A;  1D0Z A;  4J9I A;  2D9T A;  3CCQ Q;  3JCM h;  4M7A D;  1UHF A;  3V7C A;  1VQN A;  3REB B;  1NE8 A;  3OSV A;  4C8Q B;  1OX9 A;  4AFZ C;  2ZPI B;  3H41 A;  3X20 B;  2LVM A;  1VQK Q;  1G3W A;  3NHN A;  2DRM A;  4RTX A;  4A4F A;  1YIJ Q;  1T3L A;  3CC4 A;  1ZLM A;  2LQ8 A;  4E2F B;  3I55 A;  5D7U A;  5I11 A;  4OMQ A;  5KE3 A;  4XTV A;  2O88 A;  1E6G A;  2A0F B;  1SG5 A;  2E3I A;  3QG1 A;  2RM4 A;  3L1A A;  4KGV B;  1XNI A;  4M78 A;  3HL8 A;  3PVL A;  4DBQ A;  4E7H A;  3A8M B;  3CC2 Q;  3RNJ A;  1WHJ A;  4FSS A;  1V29 B;  2LCL A;  2CDT A;  4ZGD B;  2QEX T;  2NUP A;  5EC7 A;  1KQ1 A;  2YLB A;  5GAO q;  3G71 T;  2M51 A;  2KYB A;  1YJW T;  1Q82 C;  2DVE A;  4X9C A;  4Y28 E;  2CRE A;  1SHG A;  4J8O A;  4R0K A;  2COZ A;  4OMF B;  1Q82 R;  3G6E Q;  4CC4 B;  2OTL Q;  3NPF A;  4M7A E;  4XTZ A;  1RAG B;  2FG0 A;  1PSE A;  2FZC B;  4JDS A;  4Q5W A;  1ZQ1 A;  4DBF A;  1OPL A;  3FDR A;  2BZY A;  2PZ1 A;  4M7A G;  2E6Z A;  4A63 B;  2JUF A;  1H92 A;  2EGE A;  3VS6 A;  2KXD A;  1I5O B;  3OYY A;  5GAN g;  2DM1 A;  2QTV A;  1IRE B;  4B9X A;  2RHU A;  5LJ5 j;  2RI2 A;  3VUB A;  4C5I A;  2DD5 A;  3CPF A;  3OYJ A;  2F69 A;  1QKX A;  3TCJ A;  1BIA A;  3CC7 Q;  3KBG A;  1V1C A;  1E7O A;  3LYI A;  4A4K A;  3NTH A;  3EGU A;  3OBY A;  1K73 C;  3QDF A;  2K3X A;  4XU2 A;  2FZG B;  2L2P A; 
#chains in the Genus database with same CATH homology
 5GAN 5;  3GLX A;  3A8L B;  4J83 A;  2VYT A;  1VQ8 T;  2HQX A;  4ZGE B;  1VQP T;  1VQ5 A;  2KAF A;  3CBO A;  3CME T;  1G5V A;  3C95 A;  3OB9 A;  3PMI A;  4F7U G;  2LTO A;  2CS7 A;  3LH0 A;  4M7D F;  1O9S A;  4OB3 B;  3CPW S;  4BI8 B;  4M75 F;  5CIU A;  4HCZ A;  4QQD A;  5FRO A;  1VQO T;  4R55 A;  1H3Z A;  4XU0 A;  2RHI A;  2PUK B;  3HRS A;  4XQ3 A;  1B34 A;  5DY9 A;  5CKE A;  4E7I A;  2FVU A;  2RJD A;  4LD9 K;  2E1H A;  2KMT A;  2QA4 T;  4TVR A;  5GAM g;  1XTD A;  1ZHI A;  1W4S A;  2P0P A;  5CR2 A;  1WJR A;  3X28 B;  3I56 A;  3QSU A;  4O6J A;  4OF1 A;  1VQ9 A;  4HA8 A;  4M7D D;  4C5E A;  3CCL T;  2OTJ A;  4J7F A;  4M75 D;  2LQK A;  4RG2 A;  3DB3 A;  2DTO A;  4HKE A;  5CQY A;  1VIE A;  3RKW A;  2RA2 A;  1YJN A;  3H6Z A;  1LOJ A;  2VGN A;  3MEW A;  5GAO n;  3JCM Q;  2RI5 A;  2QEX A;  4PLL A;  2MAM A;  3RIR A;  5GAM f;  4IUQ A;  2O4X A;  2XID A;  4N0A A;  2LC4 A;  5EG2 A;  2O01 E;  5LJ3 h;  4B9W A;  3SWN A;  2IVW A;  4EMK C;  3G71 A;  3CCS T;  4M77 C;  4N4I A;  4BDY A;  1BI2 A;  3GF5 A;  4DA4 A;  2X4J A;  4FIB A;  2KY9 A;  5CKB A;  3MET A;  1YJW A;  1JJ2 A;  3WXM B;  4F7U F;  1I81 A;  5GMK j;  2M9U A;  4HCB A;  4J6W A;  3X24 B;  2E12 A;  3X25 B;  1YHQ T;  1RI0 A;  3JCM c;  3MP8 A;  1Y96 A;  4MMK A;  5CCA A;  3CCQ T;  4E7L A;  3VU3 C;  4C92 F;  3EFR A;  3M5A A;  4M7D A;  2E5Q A;  5LJ5 h;  3MEA A;  3JB9 I;  4M75 A;  1KQS A;  2QQ9 A;  1TH7 A;  5FRN A;  2RK2 A;  3C94 A;  3PNW C;  4OGC A;  4A4E A;  2RB6 A;  3LW5 E;  3CMA T;  4C8Q F;  1FXX A;  3V7S A;  3FJP A;  2E64 A;  4JRK A;  4BI3 A;  4C0G A;  2JZ2 A;  2M0O A;  2WSE E;  4CRI A;  1BIB A;  3TEE A;  3G4S A;  3OYK A;  3OBW A;  2LT4 A;  5I21 A;  4PKC C;  4R56 A;  2EJG A;  4FT4 A;  4C92 D;  3OW2 A;  1M8V A;  2RJF A;  2CGH A;  2P0Q A;  2EFI A;  4DOW A;  3JCM b;  2E10 A;  3PFS A;  3S3O A;  2X4Y A;  1QVP A;  2CZ0 B;  4LDY A;  1VQL A;  4C8Q D;  1OZ3 A;  2X4W A;  1K9M C;  1O75 A;  4A53 A;  4ZGJ B;  3CCV T;  1Q82 U;  1B34 B;  2QQS A;  3E9F A;  3QZ5 B;  2NLU A;  3MEV A;  4ZTF A;  2RHY A;  1QVF A;  3RMS A;  2KQW A;  2ZGW A;  1I8F A;  4OVA A;  4QVD A;  3L2U A;  5GMK i;  3CC2 T;  1VQ7 A;  4F7U A;  4BDZ A;  2XG8 D;  4FSX A;  5FLX E;  3G7Z A;  1XQH A;  5GAN 4;  1U1T A;  2DJZ A;  3MP6 A;  3OYI A;  5IAY A;  1VQM T;  4RCC A;  3JCM f;  1G3S A;  4C92 A;  4M75 E;  4MML A;  3JCM W;  3OS1 A;  1Q81 U;  2PU9 B;  3S6W A;  4LDW A;  3BDL A;  3E1S A;  3JCM e;  1K8A C;  1M1K C;  2KK4 A;  2E70 A;  3HHT B;  4M75 G;  3KUF A;  4C8Q A;  3CCJ A;  1VQ8 A;  2CZ6 B;  3SWN B;  1N6A A;  1VQP A;  3CME A;  2XDD A;  4MDX A;  2HBP A;  1G3Y A;  2GCX A;  2L5Q A;  5L8R E;  3M4Y A;  3V8K A;  2ZPF B;  3A5Z B;  3QJ6 A;  3VYG A;  1UEB A;  1NZ9 A;  4M78 B;  4L6V 5;  1M4Z A;  4PL6 A;  3JB9 H;  2R5M A;  1VQO A;  1Y96 B;  1W2B S;  3BDU A;  5GAN f;  3G6E T;  1UGQ B;  5CK9 A;  2FB7 A;  3CCE A;  2OTL T;  3JB9 G;  2XD0 A;  4M7D B;  2RJE A;  4P5N A;  5LJ3 f;  1Q7Y U;  3INZ A;  1M1G A;  5GMK h;  5LJ5 g;  5GAN e;  4IUT A;  3CXC A;  2QA4 A;  1VQ6 T;  3CCR T;  3HKS A;  4XU1 A;  5LJ3 e;  3QJY A;  2CYZ B;  1KQS S;  2K5L A;  3DLM A;  2KSS A;  1U1S A;  3SDZ A;  4RCB A;  4NL2 A;  1NJI U;  3CCL A;  4XTW A;  3GP8 A;  5GAN 8;  4A4G A;  3E19 A;  3EFS A;  1QVG A;  4M7A C;  5CKH A;  3LX7 A;  2K57 A;  4JLG A;  2LX9 A;  1KHC A;  5FU6 B;  3JCM J;  4BI4 A;  1YI2 T;  4PJO F;  4JS5 A;  1YJ9 T;  3M54 A;  5LJ5 f;  3JCM d;  2DXB A;  3QXE B;  4M78 C;  4E7K A;  4BD3 A;  1JBM A;  1X75 C;  3M59 A;  3J7A F;  2HQE A;  3FLG A;  1VIF A;  3P8H A;  4C92 E;  3UPU A;  5A0L A;  3CCS A;  5A0G A;  3OYD A;  2QI2 A;  4JLI A;  3QPH A;  3X26 B;  2PQW A;  2D6F A;  3RES A;  4PNO A;  4Z02 A;  4C92 G;  4X34 A;  4C8Q E;  5C6S A;  4KUI A;  5CO7 A;  3ER0 A;  1YHQ A;  2JNG A;  3WVE B;  3NTK A;  4M77 G;  2X4X A;  2DIG A;  5CQX A;  1RL2 A;  2A3L A;  2DZC A;  2DTI A;  3CCQ A;  3QZ9 B;  4C8Q G;  3TU4 K;  2DZ9 A;  4F7U B;  4BE2 A;  3CC7 T;  3FB9 A;  4PJO D;  3JB9 F;  2M1H A;  5GAN d;  1SSF A;  2HD0 A;  3C4S A;  2RO0 A;  3OMC A;  4XK8 E;  3CMA A;  5LJ3 d;  1BI0 A;  4OP0 A;  1VUB A;  3L2W A;  4YTL A;  4C92 B;  4ZN3 A;  1N8R C;  3GPL A;  1VQK A;  1FWZ A;  4EMG A;  3LGF A;  4NOY A;  1YIJ A;  2XI9 A;  4J7I A;  4XTY A;  2VXE A;  1QP2 A;  2LT1 A;  3FIF A;  3RKX A;  2DPP B;  3PIO A;  2RJC A;  5GAM e;  2LNV A;  4N4G A;  4OGE A;  3JB9 D;  3PIP A;  1JRI A;  5DLQ E;  3VUZ A;  3MO8 A;  5AYF A;  1WQW A;  3PMT A;  3V7R A;  2XKO C;  3DB4 A;  3M55 A;  1KG1 A;  3OQ5 A;  4PJO A;  4HT8 A;  3HFN A;  1WNL A;  1Y7X A;  3CCV A;  2FYK A;  2L8D A;  2JVV A;  2K5F A;  1NPP A;  4J6X A;  1I5L A;  4OB2 B;  3L42 A;  3TRE A;  4M77 F;  2EQU A;  1WJS A;  3MP1 A;  5IN1 A;  2EIF A;  4XTU A;  3O8V A;  3CC2 A;  4DQ2 A;  3HRT A;  4IKF A;  5HY6 A;  1DJ7 B;  3R6O A;  2VUB A;  1JB0 E;  3CXC S;  2QTX A;  2JOY A;  1VQ4 T;  3H8Z A;  1LJO A;  3M57 A;  5CVI A;  3OYN A;  1K73 U;  1VQM A;  3HRU A;  2Y90 A;  1VQN T;  3CEY A;  3UDC A;  4C0F A;  2EKO A;  3UT1 A;  5M9O A;  2CZ7 B;  5GMK l;  1N9R A;  1N27 A;  2AHJ B;  4ZTJ A;  1QVG S;  3L2R A;  2MF2 A;  2QQR A;  4II1 A;  2ZCF B;  4M77 D;  1UB4 A;  4C0Z A;  4LDX A;  1VQ9 T;  3BFM A;  5GAM d;  3RUX A;  1YIT T;  5KCO A;  3CCU T;  5D6W A;  4IUP A;  2M16 A;  4GLK A;  1YJN T;  2QQB A;  3HPW A;  2P4T A;  3VV0 A;  2E6N A;  2Y4X A;  2ZPB B;  4L59 A;  4C5G A;  4NL3 A;  4BB7 A;  3CC4 T;  1YCY A;  4A54 A;  3I55 T;  1Q86 U;  1BYM A;  3OMG A;  1Y07 A;  1K9M U;  2QQA A;  2EQM A;  4GY5 A;  3G6E A;  2XHC A;  2OTL A;  2G3R A;  1BI3 A;  4FU6 A;  2JTF A;  2K4Y A;  5C0M A;  4PJO E;  3P8B B;  4HT9 A;  4OB1 B;  3DLL A;  2DAQ A;  1P92 A;  2EAY A;  5D6Y A;  1VQ6 A;  3CD6 T;  3CCR A;  1PSF A;  3FC3 A;  5FU7 B;  3MHX A;  1M90 C;  4PJO G;  3OY9 A;  2XU8 A;  1XOV A;  3MEU A;  4EMK A;  4RMO A;  5HKC A;  4M77 A;  3FRN A;  2O4X B;  3CBM A;  3QHS A;  1EIF A;  2RK1 A;  4J5Y A;  1YI2 A;  1YJ9 A;  1MHN A;  2R58 A;  1X01 A;  5GAN 3;  4JJN K;  1GXI E;  2HNI A;  2RD1 A;  2MI6 A;  4PLI A;  1I4K 1;  4MDW A;  5GAN j;  1KQ2 A;  2HAX A;  1H64 1;  3EAE A;  3GNG A;  2XDP A;  1K8A U;  4XU3 A;  1M1K U;  5A0D A;  2EQK A;  2PVO B;  4QQ6 A;  5LJ3 j;  1KC8 C;  3JSC A;  1JJ2 S;  2DTH A;  4PJO B;  3G4S T;  1M1F A;  5GMK m;  2GQV A;  2EWN A;  2JTM A;  3OYL A;  2GF7 A;  2ZPE B;  5GAO r;  3LLR A;  1BKB A;  2H3J A;  4Y91 A;  3A8H B;  1G3T A;  2GFU A;  1OZ2 A;  2WAC A;  4M75 B;  3M53 A;  3ZBD A;  1KD1 C;  3S3N A;  2PVD B;  3GIB A;  3CC7 A;  3OS2 A;  2PVG B;  3RKY A;  2FL7 A;  3OYA A;  2GFA A;  4E47 A;  4ZN1 A;  2RH2 A;  4N0A C;  1HXD A;  3OSS C;  5I2M A;  4O5V A;  3SWN C;  2VV5 A;  2F5T X;  3NFC A;  2D0Q B;  2RHX A;  3CCM T;  4E7J A;  2I2L A;  4A4H A;  1M9S A;  3OS0 A;  3E9G A;  2DXC A;  4QW2 A;  2LRQ A;  2LCC A;  4RG8 A;  1VQ7 T;  2R57 A;  4XAX B;  5GAO l;  3JCM V;  3QYG B;  3F70 A;  5LJ5 e;  3OW2 S;  1NJI C;  5IT9 E;  4M77 E;  2X35 A;  3QDR B;  4M7D C;  4M75 C;  3OYC A;  2B8A A;  5J39 A;  3BY7 A;  3L2Z A;  1OI1 A;  4IUU A;  3J81 E;  3KXT A;  1S72 T;  4M7A F;  1D3B A;  4MZT A;  3M56 A;  3Q1J A;  3QO3 A;  3V8L A;  3JCM X;  2DEQ A;  3CBP A;  4M78 F;  4CI0 C;  2VXF A;  3JCM P;  3V8J A;  3CCJ T;  2XIC A;  4HCC A;  3A8G B;  3OYE A;  5J26 A;  3HP9 A;  2ZPG B;  2C06 A;  2DXT A;  1QVF S;  4LD6 A;  5FU6 C;  2EQJ A;  5GAM j;  4X9D A;  2KDS A;  2WSC E;  4EPC A;  4MZP A;  2EJF A;  4VUB A;  2D9T A;  3GOX A;  3JCM h;  4EMK B;  4M7A D;  1VQ4 A;  4JRI A;  4M77 B;  4QVZ A;  3WVD B;  3V7C A;  1VQN A;  3CCE T;  3GNF B;  1NE8 A;  3OSV A;  4QVC A;  4C8Q B;  3OYB A;  4M78 D;  2ZPI B;  4C0D B;  1M5Q 1;  3QBY A;  4BUG A;  5GAN 2;  1N8R U;  3URG A;  2DD4 A;  3C12 A;  3X20 B;  2ZPH B;  1U8R A;  3S3M A;  1BI1 A;  2LVM A;  2V8J A;  2OAU A;  2BUD A;  3VJP A;  3VKI A;  2VC8 A;  5LJ5 d;  4LDU A;  3L2Q A;  4KBM B;  1G3W A;  1YIT A;  3DKM A;  3HFO A;  3CCU A;  4A4F A;  3SD4 A;  3BW1 A;  3JB9 J;  5CKD A;  4FT2 A;  2RHZ A;  3L2V A;  1LNX A;  1VQ5 T;  3SB2 A;  5GAO m;  3CC4 A;  5GAN h;  5A2Q E;  3ZFJ A;  2LQ8 A;  3OYG A;  4KT0 E;  4C92 C;  5GAN 6;  3I55 A;  2K5I A;  5KE3 A;  4XTV A;  2E41 A;  4NS5 A;  3RER A;  4M7A A;  3UWN A;  4LDV A;  3QII A;  2MWP A;  4N4H A;  3QUI A;  5J3B A;  5LL6 S;  4C8Q C;  3QG1 A;  2EYQ A;  4C0D C;  1W2B A;  2RM4 A;  3L1A A;  5CAI A;  4M78 A;  1XNI A;  3CD6 A;  4V2S A;  4JRQ A;  2MMP A;  5DM7 R;  3OYH A;  3HL8 A;  1FX7 A;  2L89 A;  2PUO B;  3A8M B;  2E65 A;  4E7H A;  3SFM A;  3OYF A;  2CZ1 B;  3I56 T;  4JS4 A;  2DK3 A;  2F5K A;  3PGG A;  3LGL A;  4IUV A;  1V29 B;  2IG0 A;  3ASK A;  2EJ9 A;  2OTJ T;  2LCL A;  4L5G A;  5GMK e;  5DLO A;  3PT9 A;  5HK3 A;  3RMQ A;  4MZM A;  5KE2 A;  2Y4Y A;  4ZGD B;  4RKU E;  1WJQ A;  1VQK T;  1D3B B;  4C5H A;  5I2S A;  4BAC A;  2QEX T;  2BIV A;  1YIJ T;  1KQ1 A;  2K3Y A;  3ME9 A;  4JRP A;  2XK0 A;  2YLB A;  2BKD N;  5GAO q;  3LWH A;  3PTA A;  3A8O B;  3G71 T;  3CPW A;  2JN0 A;  3JAM E;  2FHD A;  1YJW T;  1Q82 C;  2DVE A;  4X9C A;  1YBY A;  4Y28 E;  2VGM A;  4KUL A;  3M4G A;  3ZEH A;  2XDB A;  1UGS B;  2RI3 A;  4J8O A;  1Q86 C;  4OMF B;  3LWI A;  3J80 E;  3JCM g;  1AHJ B;  4M7A E;  4J6Y A;  4XTZ A;  3CCM A;  2YRV A;  5GAM h;  1PSE A;  1M90 U;  4JDS A;  4Q5W A;  1ZQ1 A;  2MWO A;  3FEO A;  3QYH B;  5KH6 A;  2YLC A;  4M78 E;  3FDR A;  5FRM A;  4IUR A;  3AHU A;  4BY6 B;  1Q81 C;  4M7A G;  2E6Z A;  1WQ7 A;  1Y71 A;  4WF2 A;  1MGQ A;  5CKF A;  2JUF A;  1WGS A;  2QDY B;  1OYX A;  2A7Y A;  4ATO A;  3QKJ A;  4M78 G;  5D6X A;  4M7D E;  4BE0 A;  3OYM A;  3P8D A;  2DXU A;  4DOV A;  1S72 A;  2DO3 A;  2KVQ G;  2V8I A;  3NTI A;  1UGR B;  5FU7 C;  3OYY A;  1KC8 U;  4EMH A;  5GAN g;  4M7D G;  1WPY A;  2K2V A;  1IZ6 A;  1ZBX A;  1VQL T;  1IRE B;  4B9X A;  5LJ3 g;  1R8O B;  3OS5 A;  5KCH A;  2P0K A;  3T9N A;  4M7A B;  1NPR A;  4D6W A;  2CKK A;  2RHU A;  5HK0 A;  5LJ5 j;  2RI2 A;  3VUB A;  4KUD K;  2YHT A;  2R5A A;  4EDU A;  1KD1 U;  4C5I A;  2ZZD A;  2WSF E;  2DD5 A;  2L3R A;  3CPF A;  1Q7Y C;  3N5B B;  2DIQ A;  3OYJ A;  1HK9 A;  2F69 A;  1QW1 A;  4UC4 A;  4OB0 B;  3MCA B;  4BY6 C;  5GAO p;  1KHI A;  1BIA A;  3TCJ A;  3KBG A;  1N9S A;  3VYH B;  4ELZ C;  1QP3 A;  3M9Q A;  4ELY C;  4PJO C;  3LYI A;  4A4K A;  3NTH A;  2V8K A;  2QXF A;  4FL6 A;  3HSB A;  5GAN 7;  3M58 A;  2DKG A;  3OBY A;  1UGP B;  3OA6 A;  1K73 C;  4ME7 A;  2K3X A;  2LDM A;  4JUV A;  4XU2 A;  4XTX A;  4BE1 A;  4FM4 B;  3JRZ A;  1X6O A;  4QQG A;  4F7U E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...