5KE2A

Crystal structure of setdb1 tudor domain in complex with inhibitor xst06472a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
207
Chain Sequence
ENLYFQGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETDB1
publication title Crystal structure of SETDB1 Tudor domain in complex with inhibitor xst06472a
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 58
structure length 207
sequence length 211
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18358 Tudor_4 Histone methyltransferase Tudor domain
A PF18359 TUDOR_5 Histone methyltransferase Tudor domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A03
2PQWA 3MEWA 4N4GA 2EQMA 3PMTA 2X4XA 1SSFA 3ASKA 2P0KA 3P8HA 2VYTA 3LGLA 2F5KA 2GFAA 4E7KA 3MEAA 2X4YA 3KUFA 2HQXA 4IUPA 3OA6A 4ZTJA 4E7LA 5C0MA 1OYXA 2K3YA 3L2UA 3H8ZA 4B9XA 3S6WA 3OYMA 3OYGA 4BE0A 4A4FA 1WJQA 4L59A 2O4XB 4Q5WA 3MO8A 2RJCA 3LX7A 2IG0A 2RI5A 3MP8A 3Q1JA 2R5MA 2RHXA 2R5AA 1KHCA 2LRQA 3PMIA 5D6YA 3SD4A 2L8DA 2M16A 3OYKA 4E7JA 3LLRA 2BUDA 1WJRA 3EAEA 4QQDA 3OYLA 5KCHA 2CKKA 2YRVA 4BE1A 2RHYA 4HCZA 5KCOA 3MP6A 3FC3A 4IUUA 3NTKA 3NTIA 5M9OA 3C4SA 3ME9A 3S3OA 2FHDA 4QW2A 5FRMA 1G5VA 3H6ZA 3UT1A 3NTHA 3UWNA 2RHUA 4BACA 5KE2A 4E7HA 5C6SA 4QQ6A 2EQJA 4PLLA 4A4EA 3OYFA 4C5GA 5FRNA 4N4HA 2JTFA 2LCCA 2LVMA 2MWPA 3QKJA 5J39A 4UC4A 3OYJA 2D9TA 3OYEA 5FROA 2E5QA 5KH6A 3S3MA 4IUQA 3FDRA 2R57A 3OYHA 4QQGA 4BD3A 4QVZA 4FL6A 2O4XA 2G3RA 1WGSA 4IUTA 3OS2A 3L2WA 3QIIA 3L2VA 2EQUA 2DIQA 2EFIA 2LTOA 2QQSA 2X35A 3MEUA 4PL6A 3OYIA 3CEYA 2M1HA 3OMGA 5J26A 3OY9A 3BDLA 2JZ2A 2GF7A 5IAYA 3S3NA 2QQRA 2EQKA 4GY5A 3DB3A 3OS0A 4Z02A 2WACA 4C5EA 1OZ3A 3L2QA 4C5HA 3MEVA 4II1A 1N27A 5D6XA 3LH0A 2RJFA 2E6NA 3GOXA 2B8AA 3META 2XK0A 2HQEA 2EKOA 4EDUA 3P8DA 4E7IA 3QBYA 5CIUA 2GFUA 2DIGA 3E9GA 3PNWC 4A4GA 5D6WA 3L2RA 2RI3A 2BIVA 3DB4A 2RJEA 3LYIA 3E9FA 3F70A 3LGFA 4LD6A 3OYNA 4FU6A 4BDZA 3PFSA 4BDYA 2RJDA 1XNIA 4X34A 4IKFA 4OVAA 4IUVA 1RI0A 4BE2A 2MWOA 4NS5A 4PLIA 1H3ZA 2NLUA 2M0OA 2LDMA 1OI1A 2BKDN 2RO0A 2L3RA 2XDPA 3OYBA 5KE3A 3OYDA 3M9QA 3ZEHA 4A4HA 4C5IA 2RHZA 3OB9A 4N4IA 2RI2A 3O8VA 3OYCA 2X4WA 3QJ6A 4IURA 3DLMA 1OZ2A 3OYAA 2K3XA 4CRIA 3MP1A 2DAQA 3L42A 2L89A 1MHNA 2RHIA 3OMCA 3OQ5A 5IN1A 3FLGA 4B9WA 4ZTFA 3OS1A 1WJSA 4RG2A 2R58A 3FEOA
chains in the Genus database with same CATH superfamily
2PQWA 1QMCA 1W2BA 1N6AA 2XG8D 1BB9A 5GAOm 2KY9A 2X4YA 4IUPA 1QCNA 1W6XA 1QCFA 2C0TA 3CMET 4J9BA 1WA7A 2DXUA 1ZUKA 2O01E 5KYXA 1UTIA 3WVDB 2QASA 2SRCA 1C6VX 3CPWA 1UUEA 1NEGA 1VQNA 3I35A 2KBTA 1RAFB 3LW5E 2COZA 4M7DF 2VB6A 4KH0B 4BE1A 2O88A 4PJOF 3EGUA 2DJZA 2VGMA 4F04B 1JXMA 2HZYA 4M7AC 1I4K1 1QVGA 1UE9A 2KT8A 1N8RR 3RNJA 3OBWA 3M59A 2AIRB 2WSEE 4ZGDB 5CKEA 2QA4A 4M4ZA 5KYYA 2D9TA 2E5QA 1W2BS 3V7SA 4BI3A 5L23A 3HL8A 3CCSA 5CQXA 3ZFJA 4JDSA 4C92F 4M7DC 4N0AC 3M58A 3V8JA 2QQSA 2A37A 4A53A 4PJOC 2MYSA 3HFOA 4MMKA 5CKDA 2J6OA 2DM1A 3OS0A 3L2QA 2PZ1A 3CCEA 1NJIU 3A8GB 1M5Q1 3CCSQ 4QVDA 3BY7A 1BIBA 2EKOA 3CCLQ 3REBB 2EQIA 4XTVA 2ABLA 4J9FA 2PU9B 1QVGS 1LCKA 2LP5A 4LN2A 4C92C 2EYQA 2NLUA 1OI1A 2RO0A 1C0MA 2L3RA 2HL3A 4N4IA 2FPEA 5EG2A 2JM8A 1E6GA 1NPPA 4C8QC 1K73U 1X2KA 4F14A 2OAWA 2DTHA 5A2QE 5IHIA 3A98A 1SRLA 2XMFA 1SSFA 1IXDA 2VYTA 1VQ6T 5GANd 1AWXA 1CKBA 2EJGA 1YI2T 2QI2A 3OYMA 2RQWA 4J7FA 2RK1A 1K0XA 1WLPB 1ZA2B 4Q5WA 3Q1JA 2D6FA 1KHCA 2LRQA 2XICA 5LL6S 3EFOB 2XKOC 4DBFA 3OYLA 2DXTA 4LUEA 1YP5A 5GAN7 3FC3A 3N5BB 1V29B 5I2SA 4NL3A 4FYVB 4J9IA 2HQHA 1WZOA 2J6FA 3H41A 1N8RC 1Y0MA 1VA7A 4PLLA 4CC3A 2H3JA 3KXTA 2ATCB 2JUFA 2GTJA 2R57A 3G71Q 2RQUA 1UECA 4RUGA 1KQ2A 2IVWA 2EQUA 1M2VA 1NEBA 2E65A 1VYTA 2JZ2A 1ZUYA 3BDUA 2H8HA 1KC8C 4KUIA 2Y4YA 1OX9A 2F2XA 3VS0A 4FIBA 2A7YA 1W1FA 3CXCA 3CCUT 3M53A 1YIJA 3CCVQ 1K1ZA 1RADB 1Y71A 1RUWA 1M1KU 4BI4A 4FM4B 4M75A 3F70A 3QSUA 2NUTB 2RPNA 1VQMA 2AZVA 4AFUC 4OVAA 1RI0A 3QZ5B 2RD1A 4PLIA 2PVGB 1OU9A 4E7SA 2K9GA 2NUPA 3DKMA 3VYGA 2X4WA 1BK2A 5DY9A 4LNPA 1UGPB 4EMKC 4PJLA 4C8QE 1MV0B 2ZPGB 4L5GA 2FRYA 3EHRA 3JCMd 2FZKB 3CC4Q 3LGLA 2HSEB 4E7KA 4F16A 2CSIA 5GAMd 2YUNA 3CXCS 1TOVA 2LNHB 1I0CA 4J9DA 4PFPA 1X2QA 3CCJA 3FRNA 2R5AA 1VQ5T 5D6YA 1K9MU 5GANg 1D1BA 3CD6A 1HSQA 1VQ4A 4JRIA 1QP2A 2LQWA 1ZSGA 3UATA 2BZYA 1S72A 1H8KA 3CCJQ 4FYYB 2LCCA 2LZ6B 5LJ5e 2HAXA 1Z9ZA 1JEGA 2YLBA 3OYHA 3TU4K 4C8QD 2VXFA 3UA7A 1S72Q 1FMKA 1JJ2S 4KGXB 4OMLA 1RL2A 4P5NA 4M75G 4Z02A 2OJ2A 2LJ0A 3UDCA 5IT9E 1TWBA 3CCRT 2EJFA 3LYIA 4OGCA 1B34B 3ZEHA 1VQ7T 2ZZDA 4XTUA 3O8VA 4M77B 4C0DC 2DTOA 3M4GA 2RM4A 3MP1A 2ED0A 1IHWA 2JXBA 3C95A 2KEAA 3QZ9B 2MAMA 3QPHA 4XAXB 1KFZA 2KE9A 3L1AA 4XQ3A 4HT9A 1GCQC 3UA6A 2K3YA 1O75A 5FU6C 2V26A 3G6EA 4M75F 3TREA 4OMFB 4M78F 4HXJA 4OF1A 2RJCA 5LJ3d 2M0YA 4A4KA 3M0RA 2QTVA 3JCMg 2M16A 2CS7A 1VQ9T 2HBPA 2RHYA 5GAMg 2AT1B 4IUUA 1LJOA 3BE3A 5M9OA 4ME7A 3JCMP 3SWNC 1K73C 2FHDA 3G6EQ 3CC2Q 1LNXA 3PE0A 3V8LA 1AWOA 1ZLMA 1ZSZC 4Z8AA 2EW3A 1NBEB 5FRNA 3RBBB 4IIOA 3CPFA 4M78C 2DD5A 4QVZA 2ED1A 2KYMA 4IUTA 2JNGA 1Z9QA 2LTOA 2RF0A 3CEYA 3OMGA 3ZL7C 3PIPA 2GF7A 1VQOA 1ZBXA 1VQ8A 1MNDA 4NL2A 4ANJA 4J9HA 2KRMA 2QXFA 2XK0A 1TUCA 2DNUA 2DX1A 2KAFA 5GANh 2BE7D 1VQOQ 2HEQA 1VQ8Q 4IUVA 1BIAA 3I9QA 3EGXB 2DZCA 5KYYB 3OB9A 4M7AA 3R6OA 2DTIA 4MMLA 1FMVA 4R0KA 4DBHA 3DLMA 4AFZC 2RQRA 2X51A 2JMAA 5CK9A 1MHNA 2GNCA 2ZPFB 4XU0A 1NE8A 1M27C 2E41A 4D8DA 3OS5A 2HQXA 2YXYA 1RLQC 4M7DA 4N0AA 5FWBA 3RKWA 4PJOA 4LDUA 2QEXA 2C0OA 2LJ1A 4L6V5 1YCSB 3PMIA 2HMAA 3ULRB 1UDLA 3GF5A 2DLPA 1HYOA 3ER0A 2KRSA 3NTKA 1MMNA 5FU7B 4X9DA 3VS3A 4CC7A 4F7UB 3A8LB 3RERA 1AT1B 5LJ3g 2RHUA 2FO0A 1SSHA 3GIBA 4C92A 4QQ6A 5EC7A 1AZEA 1UGQB 5GAN8 2LVMA 3E1SA 4BB7A 1UGRB 1O9SA 3OYJA 1W2BP 1KQSA 4RTZA 1X69A 5FROA 5KH6A 4AFSC 3AHUA 4M78E 2FPDA 4FL6A 1OX8A 4PKCC 4C8QA 1HD3A 3HKSA 2XHCA 2KSSA 2OTJA 3CPWP 3BDLA 2DA9A 3CCQT 5IHNA 3PIOA 1B07A 1QVFS 2PNIA 3EH2A 2OTLT 2EBPA 1WXUA 4ZGJB 1OULA 2JS2A 3LH0A 2B8AA 4JRQA 3OSSC 2XIDA 1ABQA 2DZ9A 3JCMh 1QVGP 3QWYA 2JT4A 1QVPA 2RJEA 4M7AG 1PRMC 1T0JA 1XNIA 2GGRA 2RK2A 4RTXA 5GAMh 4BE2A 2DD4A 2COWA 1G3SA 1I1JA 1T3LA 1WNLA 4XTYA 2LC4A 1UJ0A 1V1CA 2RHZA 2RI2A 4MDXA 3OYCA 4C0FA 1YJWT 1RAAB 1KQSS 1BCOA 2DL8A 2EGEA 4CRIA 2YHTA 1M2VB 2FVUA 2EVRA 1WIEA 4ELZC 2DEUA 5IN1A 4M7DG 2ZAEA 1NLOC 4M78D 3MHXA 2PUOB 4PJOG 3NPFA 1VIFA 1KSWA 1YJNA 2GFAA 3EH1A 2PTKA 3MEAA 3OA6A 3HRTA 3L2UA 3D7SB 2CT4A 4HCKA 3CC7T 1WJQA 4CC4B 3FIFA 1MNEA 5LJ3f 2RI5A 2XDDA 1U06A 2EYYA 1H3HA 4LDWA 1WXTA 2D8JA 1SHFA 2A3LA 1YJNQ 3CMAA 2I2LA 4C92G 1AEYA 4XTWA 8AT1B 2I0NA 2OX7A 2O2OA 1KG1A 2HCKA 4FT2A 3JCMW 2KYBA 1G5VA 1YHQT 5GMKj 3CCMT 1YBYA 2VC8A 4BY6B 3OYFA 4C8QG 1M3AA 1AD5A 2X4JA 3CMAQ 1YITA 1E7OA 4JJNK 3X25B 3CCUQ 4IUQA 3VS2A 1WDXA 2A36A 3I56T 3JCMX 3VJPA 2V8KA 5GMKl 4EMKA 1EFNA 1JQQA 2HL5C 3M55A 5I22A 1OEBA 5GAN2 1K8AR 1YITQ 4LDYA 2RNAA 2X9HA 2V8IA 1I5LA 3HRUA 3PVLA 2QTXA 3HP9A 2CREA 1PD0A 1SHGA 3L2ZA 2V1QA 3FJ5A 5CIUA 1YN8A 1U1TA 3OYNA 3NFCA 2GTOA 3VS7A 3CCLA 2K5FA 1H3ZA 1R77A 4J6YA 1E6HA 4JRKA 2XDPA 1BKBA 2DBMA 3GPLA 4C5IA 2WSFE 4K11A 2HBWA 5LJ3h 3X24B 1WI7A 2QDLA 1GFDA 2DBKA 4C8QF 1OZ2A 1WQ7A 2KNBB 2LQKA 1IGQA 2BZXA 2DETA 2ZCFB 1YJ9T 2VUBA 2KRNA 4LUDA 3H0IA 1VQKT 3P8BB 3TQ7P 4RG2A 2EWNA 2F1LA 1PRLC 2EIFA 2EQMA 3CXCP 3SFMA 2IIMA 5GMKi 2K57A 2DKGA 1M3CA 5IH2A 3V8KA 3OYGA 2JN0A 3A8OB 1Y7XA 4QKUA 5GANj 4J9CA 1I8FA 3EFRA 1I07A 2RHXA 3VUBA 2E6ZA 3FJPA 1UJYA 1WJRA 1H641 5KCHA 5IXBA 3JCMV 2CP0A 3G4SA 5DLOA 4RCBA 5DLQE 1EZZB 5A0GA 3BFMA 1Q7YU 3RMSA 4AG1C 4BI8B 4Y91A 2E5KA 5C6SA 3H0HA 1K4US 2M02A 1MMAA 4N4HA 3QUIA 1UB4A 3G4SQ 2F5TX 3CCRQ 4CI0C 4RG8A 3QWXX 1M8VA 1U8RA 2BE9B 2DL4A 3G71A 4DA4A 2CZ6B 3AT1B 1AOJA 2EQKA 3LWIA 1VQLT 2VXEA 3JRZA 4M77C 1GCQA 4II1A 2V1RA 2YUOA 1K9AA 3GLXA 1VQ7Q 1KIKA 4V2SA 4E7IA 4A63B 1WHKA 4OB2B 3CCVA 2OAUA 1T3SA 4FYXB 1K76A 1PSFA 1XQHA 3VS4A 2FZCB 2CP3A 3EGDB 1BI3A 1Q95G 2ZPIB 2W10A 3ZBDA 1RABB 3SWNA 2CT3A 2RQVA 1C1AA 1TUGB 3JV3A 3M54A 1ZSZA 2EAYA 2R58A 3CBMA 4M78A 5GJWB 2E3IA 2MMPA 1VQ9Q 3WXMB 2L5QA 1W70A 3CC4A 4ZN1A 2JW4A 5A0LA 1T0HA 5GAMj 5J26A 4MZPA 2F2VA 3U23A 3JB9I 1VYVA 4JLIA 1FXXA 3X20B 1ZUUA 4M7AB 1VQNT 5GAOr 2RA2A 4JRPA 2JJ9A 1Q81R 2COYA 3M0TA 3ME9A 3MCAB 4MZTA 1EX4A 5KYNA 2MI6A 1JJ2A 2CP7A 1FYNA 1AHJB 1WHGA 3QXEB 2K2VA 4BACA 1RI9A 1NG2A 2HKQB 3NGPA 4C5GA 3EFSA 1PG5B 3QYGB 4Y28E 4Y92A 1OOTA 3OYEA 2DVEA 4QQGA 4BD3A 4M7DB 2P84A 1AWJA 4PJOB 2QA4T 2X35A 3NHNA 4PL6A 1N9RA 1TTHB 3CCST 4XK8E 2GBQA 5CCAA 2WACA 2L3SA 1Q7YR 3EG9A 1IRXA 3MEVA 4M77E 5J3BA 2YRDA 4EDUA 1Q86R 2K4YA 3O5ZA 3QBYA 3CCET 2BIVA 2AK5A 1VQPA 3PFSA 4F7UF 4C92B 4IKFA 4FW1A 3RESA 1ZBJA 1SF9A 2J05A 2LX9A 1GRIA 4ORZA 5I21A 2LMJA 4BUGA 4M78G 2ROLA 1VUBA 2DAQA 1VQPQ 3JB9F 2BTTA 1M90R 4B9WA 1UHFA 3CBPA 3OS1A 2CH4W 2JTMA 3FEOA 2NUZA 3MEWA 4RTUA 3P8HA 3THKA 2DYBA 3A8HB 3REAB 2FYKA 1UEBA 1OYXA 1PCXA 1RAIB 5HCKA 1IHVA 4A4FA 4L59A 2O4XB 1TXQA 3I55A 2J7IA 2J06A 3S3NA 2KVQG 4M77D 2YLCA 2DEQA 2HKNA 1X6BA 5GMKh 2FL7A 5LJ3j 2FEIA 2QQAA 4XU2A 4FYWB 1Q81C 1RACB 2KQWA 2ZPBB 5GANf 3I55Q 3NTHA 3VKIA 5CQYA 1FWZA 1SKUB 4AFQC 3VRZA 4A4EA 3CC2A 2HDAA 2A28A 2E1HA 2PVOB 5LJ5d 2OTLQ 1Y07A 4PFOA 2MCNA 4OB1B 2QQ9A 3OSVA 1P92A 5IHKA 3HSBA 4PJNA 2VKNA 3KFVA 2PVDB 4GBQA 1MUZA 2CDTA 1QW1A 1OQKA 4KGZB 2P4RA 1YFNA 2X3XD 4FCYA 3GBQA 1Y57A 1Q7YC 4O5VA 1D3BA 3SEMA 1Q86C 1MMGA 1PKSA 4RTWA 1YIJT 1ZHIA 2NWMA 2ZPHB 1ZX6A 2DK3A 5HK0A 5KYXB 1S1NA 5KYUA 2Y90A 2ZGWA 4AT1B 1TS9A 5KE3A 3OYDA 3M9QA 1KQSP 1VQMT 2AKKA 1JXOA 4EMKB 3CC7Q 1KK7A 2E4HA 2K6DA 4DEYA 4AG2C 1M90C 1GL5A 1A0NB 1D09B 3A1PA 2KXCA 3CMEA 1WX6A 4VUBA 5C0MA 4F7UE 1AZGB 4B9XA 2NUTA 1NLPC 1QKWA 4Z88A 4BY6C 3X26B 2CYZB 2CZ7B 1MV3A 1YHQQ 2A08A 3JCMJ 3CQTA 3CMEQ 3CCMQ 2BUDA 2ESWA 4HVWA 2LT4A 3A8MB 3VU3C 1KHIA 2HD0A 3CCJT 1WHJA 1U1SA 2ZPEB 2KMTA 4JJCA 5FLXE 1J3TA 4PFZA 3VS5A 3JCMf 2YUPA 3CD6T 1QP3A 2YWWA 2LCLA 5FRMA 3UT1A 1VQ4T 3UWNA 3DLLA 5GAMf 1ZA1B 2MPXC 4HCBA 1QVFA 1UHCA 2LQNA 2JTFA 1NYFA 3GNGA 1S72T 3RDVA 2KGTA 1IREB 4LDVA 2G3RA 2DO3A 1K8AU 3QHSA 1IZ6A 2DJQA 3V7RA 5KYWA 3NMZC 5HKCA 3URGA 2QQRA 5LJ5g 2P0QA 4EMHA 1BI2A 1BU1A 1ABOA 1TG0A 3MPUB 2BZ8A 3E9GA 2QYZA 3DB4A 3MJXA 3JB9D 4FSXA 3EG1A 3JCMQ 6AT1B 2M0OA 1VQKQ 1GBQA 4C0DB 1QKXA 2NYSA 2QG9B 4J7IA 2DILA 2F69A 3HRSA 1TU0B 3JCMb 2GQVA 1VQ6A 2Z0WA 3OQ5A 3UPUA 1YI2A 3SB2A 1Q82U 3X28B 5GMKm 3G7ZA 2KT1A 5AT1B 4E6RA 5FU6B 4E7LA 2QQBA 3LH5A 1NZ9A 1VQ6Q 3JB9H 5CKHA 3EHQA 3QDFA 1YI2Q 3G6ET 4M77A 2CKKA 3CBOA 2DRKA 4J9GA 4KT0E 4WCIA 5GMKe 3MP6A 1SPKA 3SWNB 5GJVB 3NTIA 1D1CA 2DF6A 1WXBA 3H0FA 4QW2A 3G1JA 3PGGA 4C0GA 1PD1A 5KE2A 3M56A 1N9SA 3JSCA 5HY6A 2CUDA 4M75B 2XDBA 2CZ0B 3QKJA 5J39A 3C12A 1VQLQ 2PUKB 4OMQA 3FDRA 4GLKA 3SHWA 1JRIA 2NUPB 2DIQA 2GCXA 3CCUA 3PT9A 5IAYA 3OW2A 1IO6A 3DB3A 1M3BA 1ZQ1A 1PNJA 1R0CB 1FX7A 1N27A 3GOXA 1VQOT 1VQ8T 2FPFA 2DIGA 1DJ7B 3L2RA 1YWPA 1JBMA 1M4ZA 4FU6A 4OB3B 2EKHA 2JS0A 4OMPA 1TH7A 4J6WA 2EYXA 2O31A 2BKDN 2K3BA 1UGSB 3TCJA 1WQWA 1OPLA 1QCOA 4ATOA 5GAN6 2YDLA 1SG5A 4ZTFA 1WJSA 4DBQA 2ECZA 2LJ3A 3PMTA 2X4XA 3EG9B 3OW2S 2KXDA 2J6KA 3I5SA 1UGVA 4PJJA 2QK0A 5GANe 1BI0A 3J7AF 1VQNQ 2DL7A 4M77G 1VQ5A 2DFUA 3RIRA 1XJWB 4ZNXA 5LJ5h 4BE0A 2EYWA 1LVKA 3EGXA 3TSZA 2CP2A 1YNZA 5GAN3 1Q81U 1GCPA 3LLRA 2QEXT 4PK4A 4J5YA 2AKLA 1VQ5Q 2KROA 4B6MA 1KC8R 4A54A 4TVRA 3H6ZA 4X9CA 2VASA 3HFNA 4D8KA 3CPWS 1Q82R 2FZGB 2QA4Q 3JAME 1F1BB 1MGQA 4JJBA 3JB9J 3QO3A 2XI9A 1U5SA 2WSCE 2ROTA 3S3MA 5L8RE 1NM7A 2EGAA 4LXCA 1WGSA 1LPLA 2JMCA 2FB7A 5GAN4 2D0NA 4E2FB 1WHHA 3CCEQ 5GAOl 3C94A 2F2WA 2M1HA 2QAZA 3CCRA 1G3TA 5GAOn 2P4TA 1OZ3A 4M77F 4KRTA 2OTJT 1Q86U 4F7UA 1PSEA 5D6XA 2RJFA 4ELYC 4FT4A 5IXFA 4A4GA 3T9NA 3RKYA 4ZGEB 1JJ2P 4XTXA 4DEXA 1VQ7A 4BDYA 1D0XA 3VS6A 3WVEB 1UG1A 2RH2A 4A4HA 1BYMA 1X75C 4OB0B 1K8AC 1CKAA 1JB0E 3LWHA 1M90U 3VUZA 1Y96A 4PNOA 2RHIA 4J83A 3FLGA 4J8OA 2GQIA 1M2OA 1X6OA 4LDXA 4NOYA 2K5LA 5AYFA 2ENMA 4RTYA 3JCMe 3MKDA 2F5KA 4M7AE 1D3BB 1D1AA 5GAMe 1GBRA 2H3EB 3J81E 1EIFA 3S6WA 2FRWA 1X43A 1VQ9A 4MZMA 1YJNT 2YUQA 1R8OB 4O6JA 1XOVA 4JZ3A 3LX7A 3MP8A 2R5MA 5A0DA 3SD4A 5KYUB 4RMOA 4WTOB 1HJDA 2L8DA 4KULA 2EJ9A 1QWEA 2JOYA 4LE9A 1I81A 3H9NA 1KQ1A 5CR2A 2CH4A 2DE0X 2XD0A 5CO7A 2IPOB 4M7DE 1HXDA 4PJOE 3CMAT 4HA8A 1OU8A 3RUXA 2DXBA 2DL3A 1Q82C 4E7HA 4KGVB 2AHJB 3M0UA 4C0ZA 2D0QB 1H92A 1XTDA 2CP6A 2CGHA 2E10A 5GAN5 4F7UG 1YITT 1G83A 3L2VA 1M1FA 1PKTA 2VV5A 1RAGB 3KBGA 4M7AD 4C92E 1YIJQ 2KK4A 4KBMB 4J6XA 3QDRB 4JJDA 4C5HA 4ESRA 4IIMA 3JB9G 1VQMQ 1NJIR 1GFCA 1BCMA 2GFUA 4EIKA 3PNWC 4JS5A 3VYHB 3LGFA 2C0IA 2KR3A 2B86A 2RJDA 3TSWA 1LOJA 1WFWA 2W0ZA 4M7DD 5FW9A 4PJOD 2P0PA 2Y4XA 3CCLT 2CSQA 2DMOA 3EG3A 1WPYA 5KYWB 2AZSA 4RTTA 2MK5A 3OMCA 2M9UA 1MMDA 4EMGA 3QJ6A 2DERA 4N4GA 1K73R 3INZA 2X3WD 4C92D 5CKBA 2EPDA 1KD1U 1UFFA 1BBZA 4Z89A 1N5ZA 3HPWA 4RCCA 3CD6Q 5LJ3e 2OI3A 4C8QB 1VQ4Q 1SRMA 4HVVA 4DOWA 1BI1A 3VS1A 3VRYA 4AMCA 2A0FB 1ARKA 2LX7A 1X27A 4CC2A 5FU7C 5CVIA 2C06A 4E7ZA 1RAHB 3QYHB 4JUVA 3J80E 1JO8A 2DRMA 2L3QA 5DM7R 3G4ST 2JTEA 7AT1B 4GLMA 2MWPA 2L0AA 4UC4A 1RLPC 3CCQA 1PC0A 2CP5A 5LJ5j 2OTLA 3QIIA 2EFIA 2M51A 3RKXA 3UF4A 4R56A 3OYIA 2VWFA 3OY9A 4GY5A 2VVKA 2DPPB 3G71T 1G3WA 3CCQQ 3QG1A 3META 2YRCA 1NJIC 1RAEB 2MIOA 3TVTA 1QQJA 2RB6A 5CAIA 1AWWA 1M1KR 1R0BG 1VOMA 1PWTA 1YJWA 1QVFP 4JPBW 2LDMA 3EFOA 4DOVA 3FB9A 3VV0A 2EGCA 3CCVT 3OYBA 1X01A 4XU1A 3HHTB 4ZN3A 3QJYA 4RKUE 1G2BA 2RQTA 4IURA 2K2MA 3OYAA 3IQLA 4OMOA 3PTAA 2L89A 5GAOq 2FG0A 1YJWQ 4EPCA 4HT8A 3CC7A 2MOXA 2K5IA 3ASKA 2K79A 4MDWA 2L3PA 1V76A 1WHMA 5HK3A 2MF2A 1IB8A 1X6GA 1OV3A 2LT1A 1VIEA 4M75C 3EGDA 3MO8A 5ECAA 1AVZC 3CC4T 3EAEA 1PHTA 9ATCB 4QQDA 4WF2A 1WHLA 1QWFA 4YTLA 4HCZA 1YHQA 4D6WA 1K9MR 3CCMA 5GAOp 3M57A 1D0ZA 2CZ1B 1VYUA 1JU5C 2E64A 1B3QA 4OGEA 3I56A 4QVCA 1KD1R 1U3OA 2E3HA 4OMNA 2LCSA 4KH1B 2RMOA 3OS2A 3L2WA 4R55A 2KI7A 3MEUA 3RR6A 2XU8A 4LD9K 3I56Q 4OP0A 1M30A 3HTRA 4C5EA 2EYZA 2V8JA 2E12A 1NYGA 1YCYA 2JM9A 2E6NA 2L2PA 4RTVA 1TUDA 2QGGA 3P8DA 4X1VA 2LNVA 1M9SA 2QDYB 3E9FA 2LQ8A 2K7AA 1M1GA 4BDZA 3I5RA 2O9VA 1D0YA 2CUBA 1K0SA 2MWOA 2YSQA 1M1KC 2O9SA 5I11A 2DVJA 1VQPT 1WYXA 1YJ9A 2KDSA 8ATCB 1VQKA 2YT6A 3R6NA 4FSSA 1QLYA 2G6FX 2RN8A 5FWCA 3OBYA 3OW2P 1N8RU 4JLGA 1M8MA 2P0KA 3M0QA 1YJ9Q 2QEXQ 3KUFA 2E70A 4ZTJA 3H8ZA 1ACMB 2IG0A 3OYKA 3RMQA 4M75E 4E7JA 3V7CA 4JS4A 1HK9A 4XTZA 2D1XA 5D7UA 2YRVA 5I2MA 1KC8U 1TSFA 3I55T 4FW2A 5KCOA 2QGFB 3EG2A 1GXIE 3C4SA 1K9MC 2DYIA 3S3OA 1Y96B 1KJWA 4HVUA 4HCCA 3JCMc 1CSKA 4JZ4A 2EQJA 2HNIA 2VGNA 4DQ2A 4QT7A 3OYYA 3GP8A 1KD1C 1SEMA 1B34A 2OTJQ 3M0SA 4KUDK 3CC2T 3A5ZB 2O4XA 1VQLA 1FMWA 4PJMA 3EG0A 4OMMA 4HKEA 1YWOA 1PM3A 1G3YA 4E47A 1ZSZB 2SEMA 1B7TA 4XU3A 3M4YA 4DBRA 1G8XA 4M78B 3PVQA 4M75D 1I5OB 2HQEA 5LJ5f 1IGUA 5CKFA 5D6WA 2RI3A 2JVVA 3C0CA 4LD6A 3BW1A 3E2UA 4X34A 2DL5A 1W4SA 4NS5A 4F17A 2HSPA 3GNFB 3M5AA 3E19A 2D8HA 2K3XA 3TEEA 4J9EA 3SDZA 3L42A 3M0PA 2DXCA 1NPRA 1OPKA 4M7AF
chains in the Genus database with same CATH topology
2PQWA 3MEWA 1W2BA 3JCMe 1N6AA 3P8HA 2XG8D 1NE8A 5GAOm 2E41A 2F5KA 3A8HB 2KY9A 4M7AE 1D3BB 2X4YA 3OS5A 2FYKA 2HQXA 4IUPA 5GAMe 1UEBA 1OYXA 3J81E 4M7DA 1EIFA 3CMET 4N0AA 2DXUA 3S6WA 2O01E 3RKWA 4PJOA 4A4FA 4LDUA 4MZMA 3WVDB 1YJNT 1VQ9A 1R8OB 4L59A 2QEXA 3CPWA 2O4XB 4O6JA 3I55A 4L6V5 1XOVA 1VQNA 3LX7A 3MP8A 3S3NA 2KVQG 4M77D 2R5MA 5A0DA 2YLCA 3SD4A 2DEQA 3PMIA 4RMOA 2L8DA 3LW5E 4KULA 2EJ9A 2JOYA 5GMKh 4M7DF 3GF5A 4BE1A 1I81A 2FL7A 3ER0A 5LJ3j 4PJOF 1KQ1A 2DJZA 5CR2A 3NTKA 2VGMA 2QQAA 4XU2A 4X9DA 5CO7A 5FU7B 1Q81C 4F7UB 2XD0A 3A8LB 1I4K1 4M7AC 4M7DE 1HXDA 1QVGA 3RERA 2KQWA 4PJOE 2ZPBB 4HA8A 5LJ3g 5GANf 3CMAT 3RUXA 3NTHA 2RHUA 2DXBA 3VKIA 5CQYA 1FWZA 1Q82C 3OBWA 4E7HA 3GIBA 4C92A 3M59A 4QQ6A 4A4EA 2AHJB 3CC2A 1UGQB 2WSEE 5GAN8 2E1HA 2PVOB 4ZGDB 2LVMA 3E1SA 4BB7A 5CKEA 4C0ZA 5LJ5d 1UGRB 1O9SA 2D0QB 3OYJA 2QA4A 1KQSA 1Y07A 2D9TA 5FROA 2E5QA 5KH6A 1XTDA 2CGHA 1W2BS 3V7SA 4OB1B 2QQ9A 4M78E 3HL8A 4BI3A 2E10A 3OSVA 1P92A 4FL6A 5CQXA 4JDSA 3ZFJA 5GAN5 3CCSA 4C92F 4F7UG 1YITT 4M7DC 4PKCC 4C8QA 3HKSA 4N0AC 2XHCA 2KSSA 1M1FA 3M58A 2VV5A 3V8JA 2QQSA 3L2VA 4A53A 3HSBA 4PJOC 4MMKA 3HFOA 3KBGA 5CKDA 4M7AD 3BDLA 3CCQT 4C92E 2PVDB 3PIOA 1QVFS 3OS0A 2KK4A 1QW1A 3L2QA 2OTLT 4KBMB 4J6XA 3CCEA 1NJIU 3A8GB 3QDRB 4ZGJB 1Q7YC 4C5HA 1M5Q1 4O5VA 3LH0A 1D3BA 2B8AA 4JRQA 4QVDA 3BY7A 3JB9G 1BIBA 3OSSC 2EKOA 2XIDA 2DZ9A 1Q86C 2GFUA 3PNWC 4XTVA 3JCMh 4JS5A 3VYHB 1QVPA 2RJEA 4M7AG 3LGFA 1YIJT 1ZHIA 2ZPHB 2DK3A 2PU9B 2RJDA 1XNIA 5HK0A 1QVGS 5GAMh 2RK2A 1LOJA 2DD4A 4BE2A 4C92C 4M7DD 2EYQA 2Y90A 2ZGWA 1G3SA 2NLUA 1WNLA 1OI1A 4XTYA 2RO0A 4PJOD 2P0PA 2LC4A 2L3RA 4NOYA 5KE3A 3OYDA 3M9QA 2RHZA 2Y4XA 4N4IA 2RI2A 1VQMT 4MDXA 3OYCA 4C0FA 3CCLT 5EG2A 1YJWT 1KQSS 1WPYA 4CRIA 2YHTA 1NPPA 2FVUA 4C8QC 4EMKB 1K73U 4ELZC 3OMCA 2M9UA 5IN1A 4M7DG 4EMGA 2DTHA 4M78D 5A2QE 3MHXA 1M90C 2PUOB 4PJOG 3QJ6A 3CMEA 3AHUA 1VIFA 4N4GA 1SSFA 2VYTA 3INZA 1YJNA 1VQ6T 5GANd 2GFAA 3MEAA 4VUBA 3OA6A 3HRTA 4C92D 5CKBA 2EJGA 5C0MA 4F7UE 3L2UA 1YI2T 1KD1U 4B9XA 3CC7T 3HPWA 2QI2A 3OYMA 4RCCA 4J7FA 2RK1A 1WJQA 4BY6C 4Q5WA 3X26B 5LJ3e 2CYZB 2CZ7B 3FIFA 5LJ3f 4C8QB 2RI5A 3Q1JA 2XDDA 2D6FA 1KHCA 2LRQA 3JCMJ 2XICA 2BUDA 4LDWA 5LL6S 2LT4A 2XKOC 3A8MB 4DOWA 2A3LA 1BI1A 2DXTA 3OYLA 3CMAA 3VU3C 1KHIA 5GAN7 2I2LA 4C92G 2HD0A 3CCJT 3FC3A 1U1SA 2ZPEB 2KMTA 5FLXE 3N5BB 4XTWA 3JCMf 1V29B 1KG1A 5FU7C 5I2SA 3CD6T 1QP3A 5CVIA 4FT2A 2LCLA 4NL3A 2C06A 3JCMW 5FRMA 3UT1A 1G5VA 1VQ4T 3QYHB 4JUVA 3UWNA 5GAMf 5GMKj 3J80E 3DLLA 1YHQT 1N8RC 5DM7R 3G4ST 3CCMT 1YBYA 2VC8A 4PLLA 4BY6B 3OYFA 4C8QG 2H3JA 3KXTA 4HCBA 1QVFA 2JTFA 2X4JA 3GNGA 2MWPA 1YITA 1S72T 4UC4A 4JJNK 3X25B 2JUFA 4IUQA 2R57A 1IREB 3CCQA 4LDVA 2G3RA 3JCMX 2DO3A 3I56T 1K8AU 5LJ5j 3QHSA 2OTLA 3QIIA 1KQ2A 1IZ6A 2EQUA 2IVWA 2EFIA 3V7RA 3VJPA 2V8KA 3RKXA 4EMKA 5GMKl 4R56A 3OYIA 2E65A 5HKCA 3OY9A 2JZ2A 3BDUA 3M55A 3URGA 5GAN2 1KC8C 2QQRA 4KUIA 4GY5A 5LJ5g 2P0QA 2Y4YA 4LDYA 4EMHA 4FIBA 2A7YA 3CCUT 3CXCA 1BI2A 2DPPB 2V8IA 1I5LA 3HRUA 3M53A 3G71T 2QTXA 1G3WA 1YIJA 3HP9A 3QG1A 1Y71A 3META 3L2ZA 1NJIC 1M1KU 5CIUA 3E9GA 4FM4B 4BI4A 4M75A 3DB4A 1U1TA 3F70A 3OYNA 3NFCA 2RB6A 3QSUA 1VQMA 5CAIA 3JB9D 4FSXA 4OVAA 1RI0A 3CCLA 3QZ5B 2K5FA 2RD1A 3JCMQ 4PLIA 1YJWA 1H3ZA 2M0OA 2LDMA 4DOVA 2PVGB 3FB9A 3VV0A 4J6YA 4JRKA 3OYBA 2XDPA 1BKBA 1X01A 4C0DB 4C5IA 3GPLA 4XU1A 3HHTB 2WSFE 3DKMA 5LJ3h 3X24B 3VYGA 4ZN3A 3QJYA 4RKUE 2X4WA 4IURA 5DY9A 4J7IA 4C8QF 1OZ2A 1WQ7A 3OYAA 2LQKA 2F69A 3PTAA 2ZCFB 2L89A 3HRSA 3JCMb 2GQVA 1UGPB 2VUBA 5GAOq 1YJ9T 1VQ6A 3OQ5A 4EMKC 4C8QE 3UPUA 1VQKT 3P8BB 2ZPGB 4EPCA 4L5GA 2EWNA 4RG2A 1YI2A 3SB2A 1Q82U 2EIFA 4HT8A 2EQMA 3CC7A 3ASKA 2K5IA 3JCMd 4MDWA 3X28B 5GMKm 3LGLA 3CCVT 4E7KA 3SFMA 3G7ZA 5GAMd 5FU6B 5GMKi 4E7LA 3CXCS 2QQBA 2K57A 2DKGA 5HK3A 2MF2A 3V8KA 3OYGA 1NZ9A 2JN0A 3A8OB 1Y7XA 2LT1A 5GANj 3JB9H 1VIEA 4M75C 3MO8A 1I8FA 3EFRA 5CKHA 3FRNA 3CCJA 2RHXA 2R5AA 3VUBA 1VQ5T 2E6ZA 3FJPA 5D6YA 1K9MU 3CC4T 1WJRA 3EAEA 3G6ET 4M77A 4QQDA 1H641 4WF2A 5KCHA 5GANg 3CD6A 2CKKA 3CBOA 4KT0E 4YTLA 4HCZA 1VQ4A 5GMKe 3MP6A 4JRIA 4D6WA 1YHQA 3SWNB 1QP2A 3JCMV 3G4SA 3NTIA 4RCBA 5DLQE 5DLOA 5GAOp 3CCMA 5A0GA 3BFMA 1Q7YU 3M57A 3RMSA 4QW2A 2CZ1B 3PGGA 1S72A 4C0GA 4BI8B 5KE2A 3M56A 1N9SA 2E64A 4Y91A 3JSCA 5HY6A 5C6SA 4M75B 2XDBA 4N4HA 2LCCA 4OGEA 2CZ0B 3QKJA 3I56A 5J39A 3C12A 4QVCA 3QUIA 5LJ5e 1UB4A 2HAXA 2PUKB 2YLBA 3FDRA 3OYHA 4GLKA 4C8QD 3TU4K 2F5TX 2VXFA 4CI0C 4RG8A 1JRIA 3OS2A 3L2WA 4R55A 1JJ2S 1M8VA 1U8RA 2DIQA 2GCXA 3CCUA 3MEUA 3G71A 3PT9A 4DA4A 2CZ6B 2XU8A 5IAYA 4LD9K 3OW2A 1RL2A 2EQKA 4P5NA 3DB3A 3LWIA 1VQLT 2VXEA 4M75G 4OP0A 4Z02A 4C5EA 3JRZA 3UDCA 5IT9E 1ZQ1A 4M77C 1FX7A 2V8JA 2E12A 4II1A 1N27A 1YCYA 2E6NA 3GLXA 3CCRT 3GOXA 1VQOT 1VQ8T 4V2SA 3P8DA 4E7IA 2LNVA 1M9SA 2DIGA 1DJ7B 2QDYB 3L2RA 4OB2B 3CCVA 2EJFA 3LYIA 3E9FA 1JBMA 2OAUA 2LQ8A 1M4ZA 4FU6A 1M1GA 4BDZA 4OGCA 4OB3B 1PSFA 1TH7A 4J6WA 1XQHA 2MWOA 1M1KC 2BKDN 1UGSB 3TCJA 1B34B 3ZEHA 1BI3A 2ZPIB 1VQPT 1VQ7T 2ZZDA 4XTUA 1WQWA 3O8VA 2KDSA 3ZBDA 1YJ9A 4M77B 3SWNA 4C0DC 4ATOA 2DTOA 3M4GA 1VQKA 5GAN6 2RM4A 3MP1A 3M54A 3C95A 2EAYA 3QZ9B 2MAMA 4ZTFA 1WJSA 3OBYA 2R58A 1N8RU 3QPHA 4JLGA 3CBMA 3PMTA 4M78A 2X4XA 4XAXB 2P0KA 3L1AA 3OW2S 2MMPA 4XQ3A 5GANe 4HT9A 1BI0A 3KUFA 3WXMB 2E70A 3J7AF 4ZTJA 2L5QA 2K3YA 4M77G 1VQ5A 3H8ZA 1O75A 5FU6C 3CC4A 3G6EA 4M75F 3RIRA 4ZN1A 5LJ5h 4BE0A 3TREA 4OMFB 5A0LA 4M78F 4OF1A 2RJCA 5LJ3d 5GAMj 2IG0A 5J26A 4MZPA 4A4KA 3RMQA 4M75E 3JCMg 3OYKA 5GAN3 4E7JA 2M16A 1Q81U 3V7CA 2CS7A 3LLRA 4JS4A 3JB9I 1VQ9T 1HK9A 4XTZA 2HBPA 2QEXT 2YRVA 5I2MA 1KC8U 2RHYA 4J5YA 4JLIA 1FXXA 3X20B 5GAMg 3I55T 5KCOA 4M7AB 1VQNT 5GAOr 4IUUA 2OTJA 2RA2A 4JRPA 1GXIE 1LJOA 3C4SA 5M9OA 4ME7A 1K9MC 3ME9A 3SWNC 3JCMP 3S3OA 1K73C 2FHDA 1Y96B 3MCAB 4MZTA 4A54A 1JJ2A 2MI6A 4HCCA 4TVRA 3H6ZA 4X9CA 1LNXA 3HFNA 1AHJB 3JCMc 3QXEB 3CPWS 2K2VA 4BACA 3V8LA 3JAME 1MGQA 2EQJA 2HNIA 2VGNA 4C5GA 3JB9J 3EFSA 4DQ2A 3QO3A 2XI9A 5FRNA 3OYYA 3QYGB 4Y28E 3GP8A 3CPFA 1KD1C 2WSCE 4M78C 3OYEA 1B34A 3S3MA 5L8RE 2DVEA 4QQGA 4KUDK 4BD3A 2DD5A 3CC2T 4QVZA 4M7DB 3A5ZB 2O4XA 1WGSA 4IUTA 1VQLA 4PJOB 2QA4T 2JNGA 2FB7A 5GAN4 2LTOA 2X35A 5GAOl 3C94A 4HKEA 3CEYA 2M1HA 3OMGA 4PL6A 1N9RA 3PIPA 2GF7A 3CCST 3CCRA 1G3TA 5GAOn 1VQOA 1G3YA 1ZBXA 4XK8E 4E47A 5CCAA 1VQ8A 2P4TA 2WACA 1OZ3A 4M77F 2OTJT 1Q86U 4F7UA 4NL2A 4XU3A 3MEVA 1PSEA 3M4YA 5D6XA 2RJFA 4M77E 4ELYC 4M78B 4FT4A 2QXFA 5J3BA 4M75D 2XK0A 2HQEA 4EDUA 5LJ5f 5CKFA 2K4YA 3QBYA 4A4GA 3CCET 3T9NA 3RKYA 5D6WA 4ZGEB 2RI3A 2BIVA 2JVVA 2KAFA 4XTXA 4LD6A 5GANh 1VQPA 3BW1A 3PFSA 4F7UF 4C92B 4X34A 4BDYA 1VQ7A 4IKFA 1W4SA 4IUVA 3RESA 4NS5A 1BIAA 3WVEB 2K5LA 2DZCA 3GNFB 2RH2A 4A4HA 1BYMA 1X75C 2LX9A 3OB9A 4OB0B 1K8AC 4M7AA 3M5AA 5AYFA 3R6OA 3E19A 2DTIA 4MMLA 5I21A 1JB0E 4BUGA 4M78G 3LWHA 1M90U 3VUZA 1VUBA 3DLMA 1Y96A 2K3XA 4PNOA 3TEEA 3SDZA 2DAQA 3L42A 5CK9A 3JB9F 1MHNA 2RHIA 4J83A 2ZPFB 2DXCA 3FLGA 4J8OA 4B9WA 1NPRA 1X6OA 3CBPA 3OS1A 4LDXA 4M7AF 2JTMA 3FEOA 4XU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQW A;  3MEW A;  4N4G A;  2EQM A;  3PMT A;  2X4X A;  1SSF A;  3ASK A;  2P0K A;  3P8H A;  2VYT A;  3LGL A;  2F5K A;  2GFA A;  4E7K A;  3MEA A;  2X4Y A;  3KUF A;  2HQX A;  4IUP A;  3OA6 A;  4ZTJ A;  4E7L A;  5C0M A;  1OYX A;  2K3Y A;  3L2U A;  3H8Z A;  4B9X A;  3S6W A;  3OYM A;  3OYG A;  4BE0 A;  4A4F A;  1WJQ A;  4L59 A;  2O4X B;  4Q5W A;  3MO8 A;  2RJC A;  3LX7 A;  2IG0 A;  2RI5 A;  3MP8 A;  3Q1J A;  2R5M A;  2RHX A;  2R5A A;  1KHC A;  2LRQ A;  3PMI A;  5D6Y A;  3SD4 A;  2L8D A;  2M16 A;  3OYK A;  4E7J A;  3LLR A;  2BUD A;  1WJR A;  3EAE A;  4QQD A;  3OYL A;  5KCH A;  2CKK A;  2YRV A;  4BE1 A;  2RHY A;  4HCZ A;  5KCO A;  3MP6 A;  3FC3 A;  4IUU A;  3NTK A;  3NTI A;  5M9O A;  3C4S A;  3ME9 A;  3S3O A;  2FHD A;  4QW2 A;  5FRM A;  1G5V A;  3H6Z A;  3UT1 A;  3NTH A;  3UWN A;  2RHU A;  4BAC A;  5KE2 A;  4E7H A;  5C6S A;  4QQ6 A;  2EQJ A;  4PLL A;  4A4E A;  3OYF A;  4C5G A;  5FRN A;  4N4H A;  2JTF A;  2LCC A;  2LVM A;  2MWP A;  3QKJ A;  5J39 A;  4UC4 A;  3OYJ A;  2D9T A;  3OYE A;  5FRO A;  2E5Q A;  5KH6 A;  3S3M A;  4IUQ A;  3FDR A;  2R57 A;  3OYH A;  4QQG A;  4BD3 A;  4QVZ A;  4FL6 A;  2O4X A;  2G3R A;  1WGS A;  4IUT A;  3OS2 A;  3L2W A;  3QII A;  3L2V A;  2EQU A;  2DIQ A;  2EFI A;  2LTO A;  2QQS A;  2X35 A;  3MEU A;  4PL6 A;  3OYI A;  3CEY A;  2M1H A;  3OMG A;  5J26 A;  3OY9 A;  3BDL A;  2JZ2 A;  2GF7 A;  5IAY A;  3S3N A;  2QQR A;  2EQK A;  4GY5 A;  3DB3 A;  3OS0 A;  4Z02 A;  2WAC A;  4C5E A;  1OZ3 A;  3L2Q A;  4C5H A;  3MEV A;  4II1 A;  1N27 A;  5D6X A;  3LH0 A;  2RJF A;  2E6N A;  3GOX A;  2B8A A;  3MET A;  2XK0 A;  2HQE A;  2EKO A;  4EDU A;  3P8D A;  4E7I A;  3QBY A;  5CIU A;  2GFU A;  2DIG A;  3E9G A;  3PNW C;  4A4G A;  5D6W A;  3L2R A;  2RI3 A;  2BIV A;  3DB4 A;  2RJE A;  3LYI A;  3E9F A;  3F70 A;  3LGF A;  4LD6 A;  3OYN A;  4FU6 A;  4BDZ A;  3PFS A;  4BDY A;  2RJD A;  1XNI A;  4X34 A;  4IKF A;  4OVA A;  4IUV A;  1RI0 A;  4BE2 A;  2MWO A;  4NS5 A;  4PLI A;  1H3Z A;  2NLU A;  2M0O A;  2LDM A;  1OI1 A;  2BKD N;  2RO0 A;  2L3R A;  2XDP A;  3OYB A;  5KE3 A;  3OYD A;  3M9Q A;  3ZEH A;  4A4H A;  4C5I A;  2RHZ A;  3OB9 A;  4N4I A;  2RI2 A;  3O8V A;  3OYC A;  2X4W A;  3QJ6 A;  4IUR A;  3DLM A;  1OZ2 A;  3OYA A;  2K3X A;  4CRI A;  3MP1 A;  2DAQ A;  3L42 A;  2L89 A;  1MHN A;  2RHI A;  3OMC A;  3OQ5 A;  5IN1 A;  3FLG A;  4B9W A;  4ZTF A;  3OS1 A;  1WJS A;  4RG2 A;  2R58 A;  3FEO A; 
#chains in the Genus database with same CATH topology
 2PQW A;  1QMC A;  1W2B A;  1N6A A;  2XG8 D;  1BB9 A;  5GAO m;  2KY9 A;  2X4Y A;  4IUP A;  1QCN A;  1W6X A;  1QCF A;  2C0T A;  3CME T;  4J9B A;  1WA7 A;  2DXU A;  1ZUK A;  2O01 E;  5KYX A;  1UTI A;  3WVD B;  2QAS A;  2SRC A;  1C6V X;  3CPW A;  1UUE A;  1NEG A;  1VQN A;  3I35 A;  2KBT A;  1RAF B;  3LW5 E;  2COZ A;  4M7D F;  2VB6 A;  4KH0 B;  4BE1 A;  2O88 A;  4PJO F;  3EGU A;  2DJZ A;  2VGM A;  4F04 B;  1JXM A;  2HZY A;  4M7A C;  1I4K 1;  1QVG A;  1UE9 A;  2KT8 A;  1N8R R;  3RNJ A;  3OBW A;  3M59 A;  2AIR B;  2WSE E;  4ZGD B;  5CKE A;  2QA4 A;  4M4Z A;  5KYY A;  2D9T A;  2E5Q A;  1W2B S;  3V7S A;  4BI3 A;  5L23 A;  3HL8 A;  3CCS A;  5CQX A;  3ZFJ A;  4JDS A;  4C92 F;  4M7D C;  4N0A C;  3M58 A;  3V8J A;  2QQS A;  2A37 A;  4A53 A;  4PJO C;  2MYS A;  3HFO A;  4MMK A;  5CKD A;  2J6O A;  2DM1 A;  3OS0 A;  3L2Q A;  2PZ1 A;  3CCE A;  1NJI U;  3A8G B;  1M5Q 1;  3CCS Q;  4QVD A;  3BY7 A;  1BIB A;  2EKO A;  3CCL Q;  3REB B;  2EQI A;  4XTV A;  2ABL A;  4J9F A;  2PU9 B;  1QVG S;  1LCK A;  2LP5 A;  4LN2 A;  4C92 C;  2EYQ A;  2NLU A;  1OI1 A;  2RO0 A;  1C0M A;  2L3R A;  2HL3 A;  4N4I A;  2FPE A;  5EG2 A;  2JM8 A;  1E6G A;  1NPP A;  4C8Q C;  1K73 U;  1X2K A;  4F14 A;  2OAW A;  2DTH A;  5A2Q E;  5IHI A;  3A98 A;  1SRL A;  2XMF A;  1SSF A;  1IXD A;  2VYT A;  1VQ6 T;  5GAN d;  1AWX A;  1CKB A;  2EJG A;  1YI2 T;  2QI2 A;  3OYM A;  2RQW A;  4J7F A;  2RK1 A;  1K0X A;  1WLP B;  1ZA2 B;  4Q5W A;  3Q1J A;  2D6F A;  1KHC A;  2LRQ A;  2XIC A;  5LL6 S;  3EFO B;  2XKO C;  4DBF A;  3OYL A;  2DXT A;  4LUE A;  1YP5 A;  5GAN 7;  3FC3 A;  3N5B B;  1V29 B;  5I2S A;  4NL3 A;  4FYV B;  4J9I A;  2HQH A;  1WZO A;  2J6F A;  3H41 A;  1N8R C;  1Y0M A;  1VA7 A;  4PLL A;  4CC3 A;  2H3J A;  3KXT A;  2ATC B;  2JUF A;  2GTJ A;  2R57 A;  3G71 Q;  2RQU A;  1UEC A;  4RUG A;  1KQ2 A;  2IVW A;  2EQU A;  1M2V A;  1NEB A;  2E65 A;  1VYT A;  2JZ2 A;  1ZUY A;  3BDU A;  2H8H A;  1KC8 C;  4KUI A;  2Y4Y A;  1OX9 A;  2F2X A;  3VS0 A;  4FIB A;  2A7Y A;  1W1F A;  3CXC A;  3CCU T;  3M53 A;  1YIJ A;  3CCV Q;  1K1Z A;  1RAD B;  1Y71 A;  1RUW A;  1M1K U;  4BI4 A;  4FM4 B;  4M75 A;  3F70 A;  3QSU A;  2NUT B;  2RPN A;  1VQM A;  2AZV A;  4AFU C;  4OVA A;  1RI0 A;  3QZ5 B;  2RD1 A;  4PLI A;  2PVG B;  1OU9 A;  4E7S A;  2K9G A;  2NUP A;  3DKM A;  3VYG A;  2X4W A;  1BK2 A;  5DY9 A;  4LNP A;  1UGP B;  4EMK C;  4PJL A;  4C8Q E;  1MV0 B;  2ZPG B;  4L5G A;  2FRY A;  3EHR A;  3JCM d;  2FZK B;  3CC4 Q;  3LGL A;  2HSE B;  4E7K A;  4F16 A;  2CSI A;  5GAM d;  2YUN A;  3CXC S;  1TOV A;  2LNH B;  1I0C A;  4J9D A;  4PFP A;  1X2Q A;  3CCJ A;  3FRN A;  2R5A A;  1VQ5 T;  5D6Y A;  1K9M U;  5GAN g;  1D1B A;  3CD6 A;  1HSQ A;  1VQ4 A;  4JRI A;  1QP2 A;  2LQW A;  1ZSG A;  3UAT A;  2BZY A;  1S72 A;  1H8K A;  3CCJ Q;  4FYY B;  2LCC A;  2LZ6 B;  5LJ5 e;  2HAX A;  1Z9Z A;  1JEG A;  2YLB A;  3OYH A;  3TU4 K;  4C8Q D;  2VXF A;  3UA7 A;  1S72 Q;  1FMK A;  1JJ2 S;  4KGX B;  4OML A;  1RL2 A;  4P5N A;  4M75 G;  4Z02 A;  2OJ2 A;  2LJ0 A;  3UDC A;  5IT9 E;  1TWB A;  3CCR T;  2EJF A;  3LYI A;  4OGC A;  1B34 B;  3ZEH A;  1VQ7 T;  2ZZD A;  4XTU A;  3O8V A;  4M77 B;  4C0D C;  2DTO A;  3M4G A;  2RM4 A;  3MP1 A;  2ED0 A;  1IHW A;  2JXB A;  3C95 A;  2KEA A;  3QZ9 B;  2MAM A;  3QPH A;  4XAX B;  1KFZ A;  2KE9 A;  3L1A A;  4XQ3 A;  4HT9 A;  1GCQ C;  3UA6 A;  2K3Y A;  1O75 A;  5FU6 C;  2V26 A;  3G6E A;  4M75 F;  3TRE A;  4OMF B;  4M78 F;  4HXJ A;  4OF1 A;  2RJC A;  5LJ3 d;  2M0Y A;  4A4K A;  3M0R A;  2QTV A;  3JCM g;  2M16 A;  2CS7 A;  1VQ9 T;  2HBP A;  2RHY A;  5GAM g;  2AT1 B;  4IUU A;  1LJO A;  3BE3 A;  5M9O A;  4ME7 A;  3JCM P;  3SWN C;  1K73 C;  2FHD A;  3G6E Q;  3CC2 Q;  1LNX A;  3PE0 A;  3V8L A;  1AWO A;  1ZLM A;  1ZSZ C;  4Z8A A;  2EW3 A;  1NBE B;  5FRN A;  3RBB B;  4IIO A;  3CPF A;  4M78 C;  2DD5 A;  4QVZ A;  2ED1 A;  2KYM A;  4IUT A;  2JNG A;  1Z9Q A;  2LTO A;  2RF0 A;  3CEY A;  3OMG A;  3ZL7 C;  3PIP A;  2GF7 A;  1VQO A;  1ZBX A;  1VQ8 A;  1MND A;  4NL2 A;  4ANJ A;  4J9H A;  2KRM A;  2QXF A;  2XK0 A;  1TUC A;  2DNU A;  2DX1 A;  2KAF A;  5GAN h;  2BE7 D;  1VQO Q;  2HEQ A;  1VQ8 Q;  4IUV A;  1BIA A;  3I9Q A;  3EGX B;  2DZC A;  5KYY B;  3OB9 A;  4M7A A;  3R6O A;  2DTI A;  4MML A;  1FMV A;  4R0K A;  4DBH A;  3DLM A;  4AFZ C;  2RQR A;  2X51 A;  2JMA A;  5CK9 A;  1MHN A;  2GNC A;  2ZPF B;  4XU0 A;  1NE8 A;  1M27 C;  2E41 A;  4D8D A;  3OS5 A;  2HQX A;  2YXY A;  1RLQ C;  4M7D A;  4N0A A;  5FWB A;  3RKW A;  4PJO A;  4LDU A;  2QEX A;  2C0O A;  2LJ1 A;  4L6V 5;  1YCS B;  3PMI A;  2HMA A;  3ULR B;  1UDL A;  3GF5 A;  2DLP A;  1HYO A;  3ER0 A;  2KRS A;  3NTK A;  1MMN A;  5FU7 B;  4X9D A;  3VS3 A;  4CC7 A;  4F7U B;  3A8L B;  3RER A;  1AT1 B;  5LJ3 g;  2RHU A;  2FO0 A;  1SSH A;  3GIB A;  4C92 A;  4QQ6 A;  5EC7 A;  1AZE A;  1UGQ B;  5GAN 8;  2LVM A;  3E1S A;  4BB7 A;  1UGR B;  1O9S A;  3OYJ A;  1W2B P;  1KQS A;  4RTZ A;  1X69 A;  5FRO A;  5KH6 A;  4AFS C;  3AHU A;  4M78 E;  2FPD A;  4FL6 A;  1OX8 A;  4PKC C;  4C8Q A;  1HD3 A;  3HKS A;  2XHC A;  2KSS A;  2OTJ A;  3CPW P;  3BDL A;  2DA9 A;  3CCQ T;  5IHN A;  3PIO A;  1B07 A;  1QVF S;  2PNI A;  3EH2 A;  2OTL T;  2EBP A;  1WXU A;  4ZGJ B;  1OUL A;  2JS2 A;  3LH0 A;  2B8A A;  4JRQ A;  3OSS C;  2XID A;  1ABQ A;  2DZ9 A;  3JCM h;  1QVG P;  3QWY A;  2JT4 A;  1QVP A;  2RJE A;  4M7A G;  1PRM C;  1T0J A;  1XNI A;  2GGR A;  2RK2 A;  4RTX A;  5GAM h;  4BE2 A;  2DD4 A;  2COW A;  1G3S A;  1I1J A;  1T3L A;  1WNL A;  4XTY A;  2LC4 A;  1UJ0 A;  1V1C A;  2RHZ A;  2RI2 A;  4MDX A;  3OYC A;  4C0F A;  1YJW T;  1RAA B;  1KQS S;  1BCO A;  2DL8 A;  2EGE A;  4CRI A;  2YHT A;  1M2V B;  2FVU A;  2EVR A;  1WIE A;  4ELZ C;  2DEU A;  5IN1 A;  4M7D G;  2ZAE A;  1NLO C;  4M78 D;  3MHX A;  2PUO B;  4PJO G;  3NPF A;  1VIF A;  1KSW A;  1YJN A;  2GFA A;  3EH1 A;  2PTK A;  3MEA A;  3OA6 A;  3HRT A;  3L2U A;  3D7S B;  2CT4 A;  4HCK A;  3CC7 T;  1WJQ A;  4CC4 B;  3FIF A;  1MNE A;  5LJ3 f;  2RI5 A;  2XDD A;  1U06 A;  2EYY A;  1H3H A;  4LDW A;  1WXT A;  2D8J A;  1SHF A;  2A3L A;  1YJN Q;  3CMA A;  2I2L A;  4C92 G;  1AEY A;  4XTW A;  8AT1 B;  2I0N A;  2OX7 A;  2O2O A;  1KG1 A;  2HCK A;  4FT2 A;  3JCM W;  2KYB A;  1G5V A;  1YHQ T;  5GMK j;  3CCM T;  1YBY A;  2VC8 A;  4BY6 B;  3OYF A;  4C8Q G;  1M3A A;  1AD5 A;  2X4J A;  3CMA Q;  1YIT A;  1E7O A;  4JJN K;  3X25 B;  3CCU Q;  4IUQ A;  3VS2 A;  1WDX A;  2A36 A;  3I56 T;  3JCM X;  3VJP A;  2V8K A;  5GMK l;  4EMK A;  1EFN A;  1JQQ A;  2HL5 C;  3M55 A;  5I22 A;  1OEB A;  5GAN 2;  1K8A R;  1YIT Q;  4LDY A;  2RNA A;  2X9H A;  2V8I A;  1I5L A;  3HRU A;  3PVL A;  2QTX A;  3HP9 A;  2CRE A;  1PD0 A;  1SHG A;  3L2Z A;  2V1Q A;  3FJ5 A;  5CIU A;  1YN8 A;  1U1T A;  3OYN A;  3NFC A;  2GTO A;  3VS7 A;  3CCL A;  2K5F A;  1H3Z A;  1R77 A;  4J6Y A;  1E6H A;  4JRK A;  2XDP A;  1BKB A;  2DBM A;  3GPL A;  4C5I A;  2WSF E;  4K11 A;  2HBW A;  5LJ3 h;  3X24 B;  1WI7 A;  2QDL A;  1GFD A;  2DBK A;  4C8Q F;  1OZ2 A;  1WQ7 A;  2KNB B;  2LQK A;  1IGQ A;  2BZX A;  2DET A;  2ZCF B;  1YJ9 T;  2VUB A;  2KRN A;  4LUD A;  3H0I A;  1VQK T;  3P8B B;  3TQ7 P;  4RG2 A;  2EWN A;  2F1L A;  1PRL C;  2EIF A;  2EQM A;  3CXC P;  3SFM A;  2IIM A;  5GMK i;  2K57 A;  2DKG A;  1M3C A;  5IH2 A;  3V8K A;  3OYG A;  2JN0 A;  3A8O B;  1Y7X A;  4QKU A;  5GAN j;  4J9C A;  1I8F A;  3EFR A;  1I07 A;  2RHX A;  3VUB A;  2E6Z A;  3FJP A;  1UJY A;  1WJR A;  1H64 1;  5KCH A;  5IXB A;  3JCM V;  2CP0 A;  3G4S A;  5DLO A;  4RCB A;  5DLQ E;  1EZZ B;  5A0G A;  3BFM A;  1Q7Y U;  3RMS A;  4AG1 C;  4BI8 B;  4Y91 A;  2E5K A;  5C6S A;  3H0H A;  1K4U S;  2M02 A;  1MMA A;  4N4H A;  3QUI A;  1UB4 A;  3G4S Q;  2F5T X;  3CCR Q;  4CI0 C;  4RG8 A;  3QWX X;  1M8V A;  1U8R A;  2BE9 B;  2DL4 A;  3G71 A;  4DA4 A;  2CZ6 B;  3AT1 B;  1AOJ A;  2EQK A;  3LWI A;  1VQL T;  2VXE A;  3JRZ A;  4M77 C;  1GCQ A;  4II1 A;  2V1R A;  2YUO A;  1K9A A;  3GLX A;  1VQ7 Q;  1KIK A;  4V2S A;  4E7I A;  4A63 B;  1WHK A;  4OB2 B;  3CCV A;  2OAU A;  1T3S A;  4FYX B;  1K76 A;  1PSF A;  1XQH A;  3VS4 A;  2FZC B;  2CP3 A;  3EGD B;  1BI3 A;  1Q95 G;  2ZPI B;  2W10 A;  3ZBD A;  1RAB B;  3SWN A;  2CT3 A;  2RQV A;  1C1A A;  1TUG B;  3JV3 A;  3M54 A;  1ZSZ A;  2EAY A;  2R58 A;  3CBM A;  4M78 A;  5GJW B;  2E3I A;  2MMP A;  1VQ9 Q;  3WXM B;  2L5Q A;  1W70 A;  3CC4 A;  4ZN1 A;  2JW4 A;  5A0L A;  1T0H A;  5GAM j;  5J26 A;  4MZP A;  2F2V A;  3U23 A;  3JB9 I;  1VYV A;  4JLI A;  1FXX A;  3X20 B;  1ZUU A;  4M7A B;  1VQN T;  5GAO r;  2RA2 A;  4JRP A;  2JJ9 A;  1Q81 R;  2COY A;  3M0T A;  3ME9 A;  3MCA B;  4MZT A;  1EX4 A;  5KYN A;  2MI6 A;  1JJ2 A;  2CP7 A;  1FYN A;  1AHJ B;  1WHG A;  3QXE B;  2K2V A;  4BAC A;  1RI9 A;  1NG2 A;  2HKQ B;  3NGP A;  4C5G A;  3EFS A;  1PG5 B;  3QYG B;  4Y28 E;  4Y92 A;  1OOT A;  3OYE A;  2DVE A;  4QQG A;  4BD3 A;  4M7D B;  2P84 A;  1AWJ A;  4PJO B;  2QA4 T;  2X35 A;  3NHN A;  4PL6 A;  1N9R A;  1TTH B;  3CCS T;  4XK8 E;  2GBQ A;  5CCA A;  2WAC A;  2L3S A;  1Q7Y R;  3EG9 A;  1IRX A;  3MEV A;  4M77 E;  5J3B A;  2YRD A;  4EDU A;  1Q86 R;  2K4Y A;  3O5Z A;  3QBY A;  3CCE T;  2BIV A;  2AK5 A;  1VQP A;  3PFS A;  4F7U F;  4C92 B;  4IKF A;  4FW1 A;  3RES A;  1ZBJ A;  1SF9 A;  2J05 A;  2LX9 A;  1GRI A;  4ORZ A;  5I21 A;  2LMJ A;  4BUG A;  4M78 G;  2ROL A;  1VUB A;  2DAQ A;  1VQP Q;  3JB9 F;  2BTT A;  1M90 R;  4B9W A;  1UHF A;  3CBP A;  3OS1 A;  2CH4 W;  2JTM A;  3FEO A;  2NUZ A;  3MEW A;  4RTU A;  3P8H A;  3THK A;  2DYB A;  3A8H B;  3REA B;  2FYK A;  1UEB A;  1OYX A;  1PCX A;  1RAI B;  5HCK A;  1IHV A;  4A4F A;  4L59 A;  2O4X B;  1TXQ A;  3I55 A;  2J7I A;  2J06 A;  3S3N A;  2KVQ G;  4M77 D;  2YLC A;  2DEQ A;  2HKN A;  1X6B A;  5GMK h;  2FL7 A;  5LJ3 j;  2FEI A;  2QQA A;  4XU2 A;  4FYW B;  1Q81 C;  1RAC B;  2KQW A;  2ZPB B;  5GAN f;  3I55 Q;  3NTH A;  3VKI A;  5CQY A;  1FWZ A;  1SKU B;  4AFQ C;  3VRZ A;  4A4E A;  3CC2 A;  2HDA A;  2A28 A;  2E1H A;  2PVO B;  5LJ5 d;  2OTL Q;  1Y07 A;  4PFO A;  2MCN A;  4OB1 B;  2QQ9 A;  3OSV A;  1P92 A;  5IHK A;  3HSB A;  4PJN A;  2VKN A;  3KFV A;  2PVD B;  4GBQ A;  1MUZ A;  2CDT A;  1QW1 A;  1OQK A;  4KGZ B;  2P4R A;  1YFN A;  2X3X D;  4FCY A;  3GBQ A;  1Y57 A;  1Q7Y C;  4O5V A;  1D3B A;  3SEM A;  1Q86 C;  1MMG A;  1PKS A;  4RTW A;  1YIJ T;  1ZHI A;  2NWM A;  2ZPH B;  1ZX6 A;  2DK3 A;  5HK0 A;  5KYX B;  1S1N A;  5KYU A;  2Y90 A;  2ZGW A;  4AT1 B;  1TS9 A;  5KE3 A;  3OYD A;  3M9Q A;  1KQS P;  1VQM T;  2AKK A;  1JXO A;  4EMK B;  3CC7 Q;  1KK7 A;  2E4H A;  2K6D A;  4DEY A;  4AG2 C;  1M90 C;  1GL5 A;  1A0N B;  1D09 B;  3A1P A;  2KXC A;  3CME A;  1WX6 A;  4VUB A;  5C0M A;  4F7U E;  1AZG B;  4B9X A;  2NUT A;  1NLP C;  1QKW A;  4Z88 A;  4BY6 C;  3X26 B;  2CYZ B;  2CZ7 B;  1MV3 A;  1YHQ Q;  2A08 A;  3JCM J;  3CQT A;  3CME Q;  3CCM Q;  2BUD A;  2ESW A;  4HVW A;  2LT4 A;  3A8M B;  3VU3 C;  1KHI A;  2HD0 A;  3CCJ T;  1WHJ A;  1U1S A;  2ZPE B;  2KMT A;  4JJC A;  5FLX E;  1J3T A;  4PFZ A;  3VS5 A;  3JCM f;  2YUP A;  3CD6 T;  1QP3 A;  2YWW A;  2LCL A;  5FRM A;  3UT1 A;  1VQ4 T;  3UWN A;  3DLL A;  5GAM f;  1ZA1 B;  2MPX C;  4HCB A;  1QVF A;  1UHC A;  2LQN A;  2JTF A;  1NYF A;  3GNG A;  1S72 T;  3RDV A;  2KGT A;  1IRE B;  4LDV A;  2G3R A;  2DO3 A;  1K8A U;  3QHS A;  1IZ6 A;  2DJQ A;  3V7R A;  5KYW A;  3NMZ C;  5HKC A;  3URG A;  2QQR A;  5LJ5 g;  2P0Q A;  4EMH A;  1BI2 A;  1BU1 A;  1ABO A;  1TG0 A;  3MPU B;  2BZ8 A;  3E9G A;  2QYZ A;  3DB4 A;  3MJX A;  3JB9 D;  4FSX A;  3EG1 A;  3JCM Q;  6AT1 B;  2M0O A;  1VQK Q;  1GBQ A;  4C0D B;  1QKX A;  2NYS A;  2QG9 B;  4J7I A;  2DIL A;  2F69 A;  3HRS A;  1TU0 B;  3JCM b;  2GQV A;  1VQ6 A;  2Z0W A;  3OQ5 A;  3UPU A;  1YI2 A;  3SB2 A;  1Q82 U;  3X28 B;  5GMK m;  3G7Z A;  2KT1 A;  5AT1 B;  4E6R A;  5FU6 B;  4E7L A;  2QQB A;  3LH5 A;  1NZ9 A;  1VQ6 Q;  3JB9 H;  5CKH A;  3EHQ A;  3QDF A;  1YI2 Q;  3G6E T;  4M77 A;  2CKK A;  3CBO A;  2DRK A;  4J9G A;  4KT0 E;  4WCI A;  5GMK e;  3MP6 A;  1SPK A;  3SWN B;  5GJV B;  3NTI A;  1D1C A;  2DF6 A;  1WXB A;  3H0F A;  4QW2 A;  3G1J A;  3PGG A;  4C0G A;  1PD1 A;  5KE2 A;  3M56 A;  1N9S A;  3JSC A;  5HY6 A;  2CUD A;  4M75 B;  2XDB A;  2CZ0 B;  3QKJ A;  5J39 A;  3C12 A;  1VQL Q;  2PUK B;  4OMQ A;  3FDR A;  4GLK A;  3SHW A;  1JRI A;  2NUP B;  2DIQ A;  2GCX A;  3CCU A;  3PT9 A;  5IAY A;  3OW2 A;  1IO6 A;  3DB3 A;  1M3B A;  1ZQ1 A;  1PNJ A;  1R0C B;  1FX7 A;  1N27 A;  3GOX A;  1VQO T;  1VQ8 T;  2FPF A;  2DIG A;  1DJ7 B;  3L2R A;  1YWP A;  1JBM A;  1M4Z A;  4FU6 A;  4OB3 B;  2EKH A;  2JS0 A;  4OMP A;  1TH7 A;  4J6W A;  2EYX A;  2O31 A;  2BKD N;  2K3B A;  1UGS B;  3TCJ A;  1WQW A;  1OPL A;  1QCO A;  4ATO A;  5GAN 6;  2YDL A;  1SG5 A;  4ZTF A;  1WJS A;  4DBQ A;  2ECZ A;  2LJ3 A;  3PMT A;  2X4X A;  3EG9 B;  3OW2 S;  2KXD A;  2J6K A;  3I5S A;  1UGV A;  4PJJ A;  2QK0 A;  5GAN e;  1BI0 A;  3J7A F;  1VQN Q;  2DL7 A;  4M77 G;  1VQ5 A;  2DFU A;  3RIR A;  1XJW B;  4ZNX A;  5LJ5 h;  4BE0 A;  2EYW A;  1LVK A;  3EGX A;  3TSZ A;  2CP2 A;  1YNZ A;  5GAN 3;  1Q81 U;  1GCP A;  3LLR A;  2QEX T;  4PK4 A;  4J5Y A;  2AKL A;  1VQ5 Q;  2KRO A;  4B6M A;  1KC8 R;  4A54 A;  4TVR A;  3H6Z A;  4X9C A;  2VAS A;  3HFN A;  4D8K A;  3CPW S;  1Q82 R;  2FZG B;  2QA4 Q;  3JAM E;  1F1B B;  1MGQ A;  4JJB A;  3JB9 J;  3QO3 A;  2XI9 A;  1U5S A;  2WSC E;  2ROT A;  3S3M A;  5L8R E;  1NM7 A;  2EGA A;  4LXC A;  1WGS A;  1LPL A;  2JMC A;  2FB7 A;  5GAN 4;  2D0N A;  4E2F B;  1WHH A;  3CCE Q;  5GAO l;  3C94 A;  2F2W A;  2M1H A;  2QAZ A;  3CCR A;  1G3T A;  5GAO n;  2P4T A;  1OZ3 A;  4M77 F;  4KRT A;  2OTJ T;  1Q86 U;  4F7U A;  1PSE A;  5D6X A;  2RJF A;  4ELY C;  4FT4 A;  5IXF A;  4A4G A;  3T9N A;  3RKY A;  4ZGE B;  1JJ2 P;  4XTX A;  4DEX A;  1VQ7 A;  4BDY A;  1D0X A;  3VS6 A;  3WVE B;  1UG1 A;  2RH2 A;  4A4H A;  1BYM A;  1X75 C;  4OB0 B;  1K8A C;  1CKA A;  1JB0 E;  3LWH A;  1M90 U;  3VUZ A;  1Y96 A;  4PNO A;  2RHI A;  4J83 A;  3FLG A;  4J8O A;  2GQI A;  1M2O A;  1X6O A;  4LDX A;  4NOY A;  2K5L A;  5AYF A;  2ENM A;  4RTY A;  3JCM e;  3MKD A;  2F5K A;  4M7A E;  1D3B B;  1D1A A;  5GAM e;  1GBR A;  2H3E B;  3J81 E;  1EIF A;  3S6W A;  2FRW A;  1X43 A;  1VQ9 A;  4MZM A;  1YJN T;  2YUQ A;  1R8O B;  4O6J A;  1XOV A;  4JZ3 A;  3LX7 A;  3MP8 A;  2R5M A;  5A0D A;  3SD4 A;  5KYU B;  4RMO A;  4WTO B;  1HJD A;  2L8D A;  4KUL A;  2EJ9 A;  1QWE A;  2JOY A;  4LE9 A;  1I81 A;  3H9N A;  1KQ1 A;  5CR2 A;  2CH4 A;  2DE0 X;  2XD0 A;  5CO7 A;  2IPO B;  4M7D E;  1HXD A;  4PJO E;  3CMA T;  4HA8 A;  1OU8 A;  3RUX A;  2DXB A;  2DL3 A;  1Q82 C;  4E7H A;  4KGV B;  2AHJ B;  3M0U A;  4C0Z A;  2D0Q B;  1H92 A;  1XTD A;  2CP6 A;  2CGH A;  2E10 A;  5GAN 5;  4F7U G;  1YIT T;  1G83 A;  3L2V A;  1M1F A;  1PKT A;  2VV5 A;  1RAG B;  3KBG A;  4M7A D;  4C92 E;  1YIJ Q;  2KK4 A;  4KBM B;  4J6X A;  3QDR B;  4JJD A;  4C5H A;  4ESR A;  4IIM A;  3JB9 G;  1VQM Q;  1NJI R;  1GFC A;  1BCM A;  2GFU A;  4EIK A;  3PNW C;  4JS5 A;  3VYH B;  3LGF A;  2C0I A;  2KR3 A;  2B86 A;  2RJD A;  3TSW A;  1LOJ A;  1WFW A;  2W0Z A;  4M7D D;  5FW9 A;  4PJO D;  2P0P A;  2Y4X A;  3CCL T;  2CSQ A;  2DMO A;  3EG3 A;  1WPY A;  5KYW B;  2AZS A;  4RTT A;  2MK5 A;  3OMC A;  2M9U A;  1MMD A;  4EMG A;  3QJ6 A;  2DER A;  4N4G A;  1K73 R;  3INZ A;  2X3W D;  4C92 D;  5CKB A;  2EPD A;  1KD1 U;  1UFF A;  1BBZ A;  4Z89 A;  1N5Z A;  3HPW A;  4RCC A;  3CD6 Q;  5LJ3 e;  2OI3 A;  4C8Q B;  1VQ4 Q;  1SRM A;  4HVV A;  4DOW A;  1BI1 A;  3VS1 A;  3VRY A;  4AMC A;  2A0F B;  1ARK A;  2LX7 A;  1X27 A;  4CC2 A;  5FU7 C;  5CVI A;  2C06 A;  4E7Z A;  1RAH B;  3QYH B;  4JUV A;  3J80 E;  1JO8 A;  2DRM A;  2L3Q A;  5DM7 R;  3G4S T;  2JTE A;  7AT1 B;  4GLM A;  2MWP A;  2L0A A;  4UC4 A;  1RLP C;  3CCQ A;  1PC0 A;  2CP5 A;  5LJ5 j;  2OTL A;  3QII A;  2EFI A;  2M51 A;  3RKX A;  3UF4 A;  4R56 A;  3OYI A;  2VWF A;  3OY9 A;  4GY5 A;  2VVK A;  2DPP B;  3G71 T;  1G3W A;  3CCQ Q;  3QG1 A;  3MET A;  2YRC A;  1NJI C;  1RAE B;  2MIO A;  3TVT A;  1QQJ A;  2RB6 A;  5CAI A;  1AWW A;  1M1K R;  1R0B G;  1VOM A;  1PWT A;  1YJW A;  1QVF P;  4JPB W;  2LDM A;  3EFO A;  4DOV A;  3FB9 A;  3VV0 A;  2EGC A;  3CCV T;  3OYB A;  1X01 A;  4XU1 A;  3HHT B;  4ZN3 A;  3QJY A;  4RKU E;  1G2B A;  2RQT A;  4IUR A;  2K2M A;  3OYA A;  3IQL A;  4OMO A;  3PTA A;  2L89 A;  5GAO q;  2FG0 A;  1YJW Q;  4EPC A;  4HT8 A;  3CC7 A;  2MOX A;  2K5I A;  3ASK A;  2K79 A;  4MDW A;  2L3P A;  1V76 A;  1WHM A;  5HK3 A;  2MF2 A;  1IB8 A;  1X6G A;  1OV3 A;  2LT1 A;  1VIE A;  4M75 C;  3EGD A;  3MO8 A;  5ECA A;  1AVZ C;  3CC4 T;  3EAE A;  1PHT A;  9ATC B;  4QQD A;  4WF2 A;  1WHL A;  1QWF A;  4YTL A;  4HCZ A;  1YHQ A;  4D6W A;  1K9M R;  3CCM A;  5GAO p;  3M57 A;  1D0Z A;  2CZ1 B;  1VYU A;  1JU5 C;  2E64 A;  1B3Q A;  4OGE A;  3I56 A;  4QVC A;  1KD1 R;  1U3O A;  2E3H A;  4OMN A;  2LCS A;  4KH1 B;  2RMO A;  3OS2 A;  3L2W A;  4R55 A;  2KI7 A;  3MEU A;  3RR6 A;  2XU8 A;  4LD9 K;  3I56 Q;  4OP0 A;  1M30 A;  3HTR A;  4C5E A;  2EYZ A;  2V8J A;  2E12 A;  1NYG A;  1YCY A;  2JM9 A;  2E6N A;  2L2P A;  4RTV A;  1TUD A;  2QGG A;  3P8D A;  4X1V A;  2LNV A;  1M9S A;  2QDY B;  3E9F A;  2LQ8 A;  2K7A A;  1M1G A;  4BDZ A;  3I5R A;  2O9V A;  1D0Y A;  2CUB A;  1K0S A;  2MWO A;  2YSQ A;  1M1K C;  2O9S A;  5I11 A;  2DVJ A;  1VQP T;  1WYX A;  1YJ9 A;  2KDS A;  8ATC B;  1VQK A;  2YT6 A;  3R6N A;  4FSS A;  1QLY A;  2G6F X;  2RN8 A;  5FWC A;  3OBY A;  3OW2 P;  1N8R U;  4JLG A;  1M8M A;  2P0K A;  3M0Q A;  1YJ9 Q;  2QEX Q;  3KUF A;  2E70 A;  4ZTJ A;  3H8Z A;  1ACM B;  2IG0 A;  3OYK A;  3RMQ A;  4M75 E;  4E7J A;  3V7C A;  4JS4 A;  1HK9 A;  4XTZ A;  2D1X A;  5D7U A;  2YRV A;  5I2M A;  1KC8 U;  1TSF A;  3I55 T;  4FW2 A;  5KCO A;  2QGF B;  3EG2 A;  1GXI E;  3C4S A;  1K9M C;  2DYI A;  3S3O A;  1Y96 B;  1KJW A;  4HVU A;  4HCC A;  3JCM c;  1CSK A;  4JZ4 A;  2EQJ A;  2HNI A;  2VGN A;  4DQ2 A;  4QT7 A;  3OYY A;  3GP8 A;  1KD1 C;  1SEM A;  1B34 A;  2OTJ Q;  3M0S A;  4KUD K;  3CC2 T;  3A5Z B;  2O4X A;  1VQL A;  1FMW A;  4PJM A;  3EG0 A;  4OMM A;  4HKE A;  1YWO A;  1PM3 A;  1G3Y A;  4E47 A;  1ZSZ B;  2SEM A;  1B7T A;  4XU3 A;  3M4Y A;  4DBR A;  1G8X A;  4M78 B;  3PVQ A;  4M75 D;  1I5O B;  2HQE A;  5LJ5 f;  1IGU A;  5CKF A;  5D6W A;  2RI3 A;  2JVV A;  3C0C A;  4LD6 A;  3BW1 A;  3E2U A;  4X34 A;  2DL5 A;  1W4S A;  4NS5 A;  4F17 A;  2HSP A;  3GNF B;  3M5A A;  3E19 A;  2D8H A;  2K3X A;  3TEE A;  4J9E A;  3SDZ A;  3L42 A;  3M0P A;  2DXC A;  1NPR A;  1OPK A;  4M7A F; 
#chains in the Genus database with same CATH homology
 2PQW A;  3MEW A;  1W2B A;  3JCM e;  1N6A A;  3P8H A;  2XG8 D;  1NE8 A;  5GAO m;  2E41 A;  2F5K A;  3A8H B;  2KY9 A;  4M7A E;  1D3B B;  2X4Y A;  3OS5 A;  2FYK A;  2HQX A;  4IUP A;  5GAM e;  1UEB A;  1OYX A;  3J81 E;  4M7D A;  1EIF A;  3CME T;  4N0A A;  2DXU A;  3S6W A;  2O01 E;  3RKW A;  4PJO A;  4A4F A;  4LDU A;  4MZM A;  3WVD B;  1YJN T;  1VQ9 A;  1R8O B;  4L59 A;  2QEX A;  3CPW A;  2O4X B;  4O6J A;  3I55 A;  4L6V 5;  1XOV A;  1VQN A;  3LX7 A;  3MP8 A;  3S3N A;  2KVQ G;  4M77 D;  2R5M A;  5A0D A;  2YLC A;  3SD4 A;  2DEQ A;  3PMI A;  4RMO A;  2L8D A;  3LW5 E;  4KUL A;  2EJ9 A;  2JOY A;  5GMK h;  4M7D F;  3GF5 A;  4BE1 A;  1I81 A;  2FL7 A;  3ER0 A;  5LJ3 j;  4PJO F;  1KQ1 A;  2DJZ A;  5CR2 A;  3NTK A;  2VGM A;  2QQA A;  4XU2 A;  4X9D A;  5CO7 A;  5FU7 B;  1Q81 C;  4F7U B;  2XD0 A;  3A8L B;  1I4K 1;  4M7A C;  4M7D E;  1HXD A;  1QVG A;  3RER A;  2KQW A;  4PJO E;  2ZPB B;  4HA8 A;  5LJ3 g;  5GAN f;  3CMA T;  3RUX A;  3NTH A;  2RHU A;  2DXB A;  3VKI A;  5CQY A;  1FWZ A;  1Q82 C;  3OBW A;  4E7H A;  3GIB A;  4C92 A;  3M59 A;  4QQ6 A;  4A4E A;  2AHJ B;  3CC2 A;  1UGQ B;  2WSE E;  5GAN 8;  2E1H A;  2PVO B;  4ZGD B;  2LVM A;  3E1S A;  4BB7 A;  5CKE A;  4C0Z A;  5LJ5 d;  1UGR B;  1O9S A;  2D0Q B;  3OYJ A;  2QA4 A;  1KQS A;  1Y07 A;  2D9T A;  5FRO A;  2E5Q A;  5KH6 A;  1XTD A;  2CGH A;  1W2B S;  3V7S A;  4OB1 B;  2QQ9 A;  4M78 E;  3HL8 A;  4BI3 A;  2E10 A;  3OSV A;  1P92 A;  4FL6 A;  5CQX A;  4JDS A;  3ZFJ A;  5GAN 5;  3CCS A;  4C92 F;  4F7U G;  1YIT T;  4M7D C;  4PKC C;  4C8Q A;  3HKS A;  4N0A C;  2XHC A;  2KSS A;  1M1F A;  3M58 A;  2VV5 A;  3V8J A;  2QQS A;  3L2V A;  4A53 A;  3HSB A;  4PJO C;  4MMK A;  3HFO A;  3KBG A;  5CKD A;  4M7A D;  3BDL A;  3CCQ T;  4C92 E;  2PVD B;  3PIO A;  1QVF S;  3OS0 A;  2KK4 A;  1QW1 A;  3L2Q A;  2OTL T;  4KBM B;  4J6X A;  3CCE A;  1NJI U;  3A8G B;  3QDR B;  4ZGJ B;  1Q7Y C;  4C5H A;  1M5Q 1;  4O5V A;  3LH0 A;  1D3B A;  2B8A A;  4JRQ A;  4QVD A;  3BY7 A;  3JB9 G;  1BIB A;  3OSS C;  2EKO A;  2XID A;  2DZ9 A;  1Q86 C;  2GFU A;  3PNW C;  4XTV A;  3JCM h;  4JS5 A;  3VYH B;  1QVP A;  2RJE A;  4M7A G;  3LGF A;  1YIJ T;  1ZHI A;  2ZPH B;  2DK3 A;  2PU9 B;  2RJD A;  1XNI A;  5HK0 A;  1QVG S;  5GAM h;  2RK2 A;  1LOJ A;  2DD4 A;  4BE2 A;  4C92 C;  4M7D D;  2EYQ A;  2Y90 A;  2ZGW A;  1G3S A;  2NLU A;  1WNL A;  1OI1 A;  4XTY A;  2RO0 A;  4PJO D;  2P0P A;  2LC4 A;  2L3R A;  4NOY A;  5KE3 A;  3OYD A;  3M9Q A;  2RHZ A;  2Y4X A;  4N4I A;  2RI2 A;  1VQM T;  4MDX A;  3OYC A;  4C0F A;  3CCL T;  5EG2 A;  1YJW T;  1KQS S;  1WPY A;  4CRI A;  2YHT A;  1NPP A;  2FVU A;  4C8Q C;  4EMK B;  1K73 U;  4ELZ C;  3OMC A;  2M9U A;  5IN1 A;  4M7D G;  4EMG A;  2DTH A;  4M78 D;  5A2Q E;  3MHX A;  1M90 C;  2PUO B;  4PJO G;  3QJ6 A;  3CME A;  3AHU A;  1VIF A;  4N4G A;  1SSF A;  2VYT A;  3INZ A;  1YJN A;  1VQ6 T;  5GAN d;  2GFA A;  3MEA A;  4VUB A;  3OA6 A;  3HRT A;  4C92 D;  5CKB A;  2EJG A;  5C0M A;  4F7U E;  3L2U A;  1YI2 T;  1KD1 U;  4B9X A;  3CC7 T;  3HPW A;  2QI2 A;  3OYM A;  4RCC A;  4J7F A;  2RK1 A;  1WJQ A;  4BY6 C;  4Q5W A;  3X26 B;  5LJ3 e;  2CYZ B;  2CZ7 B;  3FIF A;  5LJ3 f;  4C8Q B;  2RI5 A;  3Q1J A;  2XDD A;  2D6F A;  1KHC A;  2LRQ A;  3JCM J;  2XIC A;  2BUD A;  4LDW A;  5LL6 S;  2LT4 A;  2XKO C;  3A8M B;  4DOW A;  2A3L A;  1BI1 A;  2DXT A;  3OYL A;  3CMA A;  3VU3 C;  1KHI A;  5GAN 7;  2I2L A;  4C92 G;  2HD0 A;  3CCJ T;  3FC3 A;  1U1S A;  2ZPE B;  2KMT A;  5FLX E;  3N5B B;  4XTW A;  3JCM f;  1V29 B;  1KG1 A;  5FU7 C;  5I2S A;  3CD6 T;  1QP3 A;  5CVI A;  4FT2 A;  2LCL A;  4NL3 A;  2C06 A;  3JCM W;  5FRM A;  3UT1 A;  1G5V A;  1VQ4 T;  3QYH B;  4JUV A;  3UWN A;  5GAM f;  5GMK j;  3J80 E;  3DLL A;  1YHQ T;  1N8R C;  5DM7 R;  3G4S T;  3CCM T;  1YBY A;  2VC8 A;  4PLL A;  4BY6 B;  3OYF A;  4C8Q G;  2H3J A;  3KXT A;  4HCB A;  1QVF A;  2JTF A;  2X4J A;  3GNG A;  2MWP A;  1YIT A;  1S72 T;  4UC4 A;  4JJN K;  3X25 B;  2JUF A;  4IUQ A;  2R57 A;  1IRE B;  3CCQ A;  4LDV A;  2G3R A;  3JCM X;  2DO3 A;  3I56 T;  1K8A U;  5LJ5 j;  3QHS A;  2OTL A;  3QII A;  1KQ2 A;  1IZ6 A;  2EQU A;  2IVW A;  2EFI A;  3V7R A;  3VJP A;  2V8K A;  3RKX A;  4EMK A;  5GMK l;  4R56 A;  3OYI A;  2E65 A;  5HKC A;  3OY9 A;  2JZ2 A;  3BDU A;  3M55 A;  3URG A;  5GAN 2;  1KC8 C;  2QQR A;  4KUI A;  4GY5 A;  5LJ5 g;  2P0Q A;  2Y4Y A;  4LDY A;  4EMH A;  4FIB A;  2A7Y A;  3CCU T;  3CXC A;  1BI2 A;  2DPP B;  2V8I A;  1I5L A;  3HRU A;  3M53 A;  3G71 T;  2QTX A;  1G3W A;  1YIJ A;  3HP9 A;  3QG1 A;  1Y71 A;  3MET A;  3L2Z A;  1NJI C;  1M1K U;  5CIU A;  3E9G A;  4FM4 B;  4BI4 A;  4M75 A;  3DB4 A;  1U1T A;  3F70 A;  3OYN A;  3NFC A;  2RB6 A;  3QSU A;  1VQM A;  5CAI A;  3JB9 D;  4FSX A;  4OVA A;  1RI0 A;  3CCL A;  3QZ5 B;  2K5F A;  2RD1 A;  3JCM Q;  4PLI A;  1YJW A;  1H3Z A;  2M0O A;  2LDM A;  4DOV A;  2PVG B;  3FB9 A;  3VV0 A;  4J6Y A;  4JRK A;  3OYB A;  2XDP A;  1BKB A;  1X01 A;  4C0D B;  4C5I A;  3GPL A;  4XU1 A;  3HHT B;  2WSF E;  3DKM A;  5LJ3 h;  3X24 B;  3VYG A;  4ZN3 A;  3QJY A;  4RKU E;  2X4W A;  4IUR A;  5DY9 A;  4J7I A;  4C8Q F;  1OZ2 A;  1WQ7 A;  3OYA A;  2LQK A;  2F69 A;  3PTA A;  2ZCF B;  2L89 A;  3HRS A;  3JCM b;  2GQV A;  1UGP B;  2VUB A;  5GAO q;  1YJ9 T;  1VQ6 A;  3OQ5 A;  4EMK C;  4C8Q E;  3UPU A;  1VQK T;  3P8B B;  2ZPG B;  4EPC A;  4L5G A;  2EWN A;  4RG2 A;  1YI2 A;  3SB2 A;  1Q82 U;  2EIF A;  4HT8 A;  2EQM A;  3CC7 A;  3ASK A;  2K5I A;  3JCM d;  4MDW A;  3X28 B;  5GMK m;  3LGL A;  3CCV T;  4E7K A;  3SFM A;  3G7Z A;  5GAM d;  5FU6 B;  5GMK i;  4E7L A;  3CXC S;  2QQB A;  2K57 A;  2DKG A;  5HK3 A;  2MF2 A;  3V8K A;  3OYG A;  1NZ9 A;  2JN0 A;  3A8O B;  1Y7X A;  2LT1 A;  5GAN j;  3JB9 H;  1VIE A;  4M75 C;  3MO8 A;  1I8F A;  3EFR A;  5CKH A;  3FRN A;  3CCJ A;  2RHX A;  2R5A A;  3VUB A;  1VQ5 T;  2E6Z A;  3FJP A;  5D6Y A;  1K9M U;  3CC4 T;  1WJR A;  3EAE A;  3G6E T;  4M77 A;  4QQD A;  1H64 1;  4WF2 A;  5KCH A;  5GAN g;  3CD6 A;  2CKK A;  3CBO A;  4KT0 E;  4YTL A;  4HCZ A;  1VQ4 A;  5GMK e;  3MP6 A;  4JRI A;  4D6W A;  1YHQ A;  3SWN B;  1QP2 A;  3JCM V;  3G4S A;  3NTI A;  4RCB A;  5DLQ E;  5DLO A;  5GAO p;  3CCM A;  5A0G A;  3BFM A;  1Q7Y U;  3M57 A;  3RMS A;  4QW2 A;  2CZ1 B;  3PGG A;  1S72 A;  4C0G A;  4BI8 B;  5KE2 A;  3M56 A;  1N9S A;  2E64 A;  4Y91 A;  3JSC A;  5HY6 A;  5C6S A;  4M75 B;  2XDB A;  4N4H A;  2LCC A;  4OGE A;  2CZ0 B;  3QKJ A;  3I56 A;  5J39 A;  3C12 A;  4QVC A;  3QUI A;  5LJ5 e;  1UB4 A;  2HAX A;  2PUK B;  2YLB A;  3FDR A;  3OYH A;  4GLK A;  4C8Q D;  3TU4 K;  2F5T X;  2VXF A;  4CI0 C;  4RG8 A;  1JRI A;  3OS2 A;  3L2W A;  4R55 A;  1JJ2 S;  1M8V A;  1U8R A;  2DIQ A;  2GCX A;  3CCU A;  3MEU A;  3G71 A;  3PT9 A;  4DA4 A;  2CZ6 B;  2XU8 A;  5IAY A;  4LD9 K;  3OW2 A;  1RL2 A;  2EQK A;  4P5N A;  3DB3 A;  3LWI A;  1VQL T;  2VXE A;  4M75 G;  4OP0 A;  4Z02 A;  4C5E A;  3JRZ A;  3UDC A;  5IT9 E;  1ZQ1 A;  4M77 C;  1FX7 A;  2V8J A;  2E12 A;  4II1 A;  1N27 A;  1YCY A;  2E6N A;  3GLX A;  3CCR T;  3GOX A;  1VQO T;  1VQ8 T;  4V2S A;  3P8D A;  4E7I A;  2LNV A;  1M9S A;  2DIG A;  1DJ7 B;  2QDY B;  3L2R A;  4OB2 B;  3CCV A;  2EJF A;  3LYI A;  3E9F A;  1JBM A;  2OAU A;  2LQ8 A;  1M4Z A;  4FU6 A;  1M1G A;  4BDZ A;  4OGC A;  4OB3 B;  1PSF A;  1TH7 A;  4J6W A;  1XQH A;  2MWO A;  1M1K C;  2BKD N;  1UGS B;  3TCJ A;  1B34 B;  3ZEH A;  1BI3 A;  2ZPI B;  1VQP T;  1VQ7 T;  2ZZD A;  4XTU A;  1WQW A;  3O8V A;  2KDS A;  3ZBD A;  1YJ9 A;  4M77 B;  3SWN A;  4C0D C;  4ATO A;  2DTO A;  3M4G A;  1VQK A;  5GAN 6;  2RM4 A;  3MP1 A;  3M54 A;  3C95 A;  2EAY A;  3QZ9 B;  2MAM A;  4ZTF A;  1WJS A;  3OBY A;  2R58 A;  1N8R U;  3QPH A;  4JLG A;  3CBM A;  3PMT A;  4M78 A;  2X4X A;  4XAX B;  2P0K A;  3L1A A;  3OW2 S;  2MMP A;  4XQ3 A;  5GAN e;  4HT9 A;  1BI0 A;  3KUF A;  3WXM B;  2E70 A;  3J7A F;  4ZTJ A;  2L5Q A;  2K3Y A;  4M77 G;  1VQ5 A;  3H8Z A;  1O75 A;  5FU6 C;  3CC4 A;  3G6E A;  4M75 F;  3RIR A;  4ZN1 A;  5LJ5 h;  4BE0 A;  3TRE A;  4OMF B;  5A0L A;  4M78 F;  4OF1 A;  2RJC A;  5LJ3 d;  5GAM j;  2IG0 A;  5J26 A;  4MZP A;  4A4K A;  3RMQ A;  4M75 E;  3JCM g;  3OYK A;  5GAN 3;  4E7J A;  2M16 A;  1Q81 U;  3V7C A;  2CS7 A;  3LLR A;  4JS4 A;  3JB9 I;  1VQ9 T;  1HK9 A;  4XTZ A;  2HBP A;  2QEX T;  2YRV A;  5I2M A;  1KC8 U;  2RHY A;  4J5Y A;  4JLI A;  1FXX A;  3X20 B;  5GAM g;  3I55 T;  5KCO A;  4M7A B;  1VQN T;  5GAO r;  4IUU A;  2OTJ A;  2RA2 A;  4JRP A;  1GXI E;  1LJO A;  3C4S A;  5M9O A;  4ME7 A;  1K9M C;  3ME9 A;  3SWN C;  3JCM P;  3S3O A;  1K73 C;  2FHD A;  1Y96 B;  3MCA B;  4MZT A;  4A54 A;  1JJ2 A;  2MI6 A;  4HCC A;  4TVR A;  3H6Z A;  4X9C A;  1LNX A;  3HFN A;  1AHJ B;  3JCM c;  3QXE B;  3CPW S;  2K2V A;  4BAC A;  3V8L A;  3JAM E;  1MGQ A;  2EQJ A;  2HNI A;  2VGN A;  4C5G A;  3JB9 J;  3EFS A;  4DQ2 A;  3QO3 A;  2XI9 A;  5FRN A;  3OYY A;  3QYG B;  4Y28 E;  3GP8 A;  3CPF A;  1KD1 C;  2WSC E;  4M78 C;  3OYE A;  1B34 A;  3S3M A;  5L8R E;  2DVE A;  4QQG A;  4KUD K;  4BD3 A;  2DD5 A;  3CC2 T;  4QVZ A;  4M7D B;  3A5Z B;  2O4X A;  1WGS A;  4IUT A;  1VQL A;  4PJO B;  2QA4 T;  2JNG A;  2FB7 A;  5GAN 4;  2LTO A;  2X35 A;  5GAO l;  3C94 A;  4HKE A;  3CEY A;  2M1H A;  3OMG A;  4PL6 A;  1N9R A;  3PIP A;  2GF7 A;  3CCS T;  3CCR A;  1G3T A;  5GAO n;  1VQO A;  1G3Y A;  1ZBX A;  4XK8 E;  4E47 A;  5CCA A;  1VQ8 A;  2P4T A;  2WAC A;  1OZ3 A;  4M77 F;  2OTJ T;  1Q86 U;  4F7U A;  4NL2 A;  4XU3 A;  3MEV A;  1PSE A;  3M4Y A;  5D6X A;  2RJF A;  4M77 E;  4ELY C;  4M78 B;  4FT4 A;  2QXF A;  5J3B A;  4M75 D;  2XK0 A;  2HQE A;  4EDU A;  5LJ5 f;  5CKF A;  2K4Y A;  3QBY A;  4A4G A;  3CCE T;  3T9N A;  3RKY A;  5D6W A;  4ZGE B;  2RI3 A;  2BIV A;  2JVV A;  2KAF A;  4XTX A;  4LD6 A;  5GAN h;  1VQP A;  3BW1 A;  3PFS A;  4F7U F;  4C92 B;  4X34 A;  4BDY A;  1VQ7 A;  4IKF A;  1W4S A;  4IUV A;  3RES A;  4NS5 A;  1BIA A;  3WVE B;  2K5L A;  2DZC A;  3GNF B;  2RH2 A;  4A4H A;  1BYM A;  1X75 C;  2LX9 A;  3OB9 A;  4OB0 B;  1K8A C;  4M7A A;  3M5A A;  5AYF A;  3R6O A;  3E19 A;  2DTI A;  4MML A;  5I21 A;  1JB0 E;  4BUG A;  4M78 G;  3LWH A;  1M90 U;  3VUZ A;  1VUB A;  3DLM A;  1Y96 A;  2K3X A;  4PNO A;  3TEE A;  3SDZ A;  2DAQ A;  3L42 A;  5CK9 A;  3JB9 F;  1MHN A;  2RHI A;  4J83 A;  2ZPF B;  2DXC A;  3FLG A;  4J8O A;  4B9W A;  1NPR A;  1X6O A;  3CBP A;  3OS1 A;  4LDX A;  4M7A F;  2JTM A;  3FEO A;  4XU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...