5KE2A

Crystal structure of setdb1 tudor domain in complex with inhibitor xst06472a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
207
Chain Sequence
ENLYFQGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETDB1
publication title Crystal structure of SETDB1 Tudor domain in complex with inhibitor xst06472a
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 58
structure length 207
sequence length 211
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18358 Tudor_4 Histone methyltransferase Tudor domain
A PF18359 TUDOR_5 Histone methyltransferase Tudor domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A03
4FU6A 3OYMA 4QQDA 2NLUA 3MP8A 3OYAA 2MWOA 4ZTJA 3MP6A 4IUVA 4HCZA 1RI0A 2B8AA 4IUPA 3OYKA 3OYNA 4BE0A 2K3XA 2R58A 2RHUA 2XDPA 3ME9A 4IUQA 2X4YA 4A4GA 5KCOA 2JZ2A 3S3NA 3QBYA 5J26A 3UT1A 2DAQA 3DB4A 5FRNA 3OYFA 2RI2A 3L2VA 2EFIA 3L2WA 4BD3A 5C6SA 5FRMA 5IAYA 2RJFA 3CEYA 2BKDN 3OYBA 3S6WA 2G3RA 2LVMA 2EQKA 5J39A 3H6ZA 3PFSA 4II1A 3FC3A 2BIVA 2M0OA 5CIUA 3M9QA 5IN1A 4L59A 4X34A 4Z02A 2F5KA 1H3ZA 2K3YA 3LGFA 4A4EA 2R57A 3LYIA 4C5EA 3GOXA 4UC4A 2CKKA 4BDYA 4BDZA 2RHZA 3L2RA 2LTOA 4QQ6A 1OYXA 3UWNA 1G5VA 4N4IA 1WJQA 4IURA 2X4WA 5D6XA 5D6WA 4E7HA 3FDRA 3OYJA 3QJ6A 3P8DA 4GY5A 3S3OA 2RHYA 1MHNA 1OZ2A 2M16A 2D9TA 3LLRA 2YRVA 3OS1A 2GF7A 2E6NA 3OMGA 2EQUA 3Q1JA 3MEWA 4QQGA 3P8HA 3META 4BACA 3MEUA 3OA6A 3ASKA 3NTKA 4Q5WA 3KUFA 3LH0A 1N27A 1OZ3A 2R5MA 3FLGA 3SD4A 3LGLA 2EQMA 4C5GA 2JTFA 4E7LA 3FEOA 2EKOA 3OMCA 3PMIA 4EDUA 2RHXA 5KE3A 2RHIA 3ZEHA 5C0MA 3EAEA 3QKJA 1WJRA 3PMTA 3E9FA 5KCHA 3OS2A 2L89A 4N4HA 3MEAA 2R5AA 3QIIA 2RJDA 4CRIA 3S3MA 2MWPA 4QW2A 4A4FA 2O4XA 3OYIA 2VYTA 3OYHA 3OYLA 3OS0A 1SSFA 2M1HA 2RI5A 3L42A 3OYGA 2LCCA 3L2UA 3C4SA 3H8ZA 3MEVA 4LD6A 3DLMA 2HQXA 4IUTA 5KH6A 4ZTFA 3F70A 3OB9A 5FROA 2RI3A 2IG0A 2RJCA 4FL6A 4N4GA 3LX7A 1OI1A 2FHDA 2P0KA 3OYCA 2XK0A 2QQSA 4PLLA 4QVZA 5M9OA 2QQRA 2LRQA 2L8DA 4RG2A 4OVAA 2HQEA 4A4HA 3OY9A 3BDLA 2RO0A 4C5HA 4PLIA 2WACA 2LDMA 2X35A 2BUDA 4E7IA 2E5QA 3MO8A 5KE2A 3OYDA 2X4XA 4NS5A 4IKFA 1KHCA 4BE1A 3O8VA 3OYEA 2GFUA 4PL6A 4E7KA 5D6YA 4B9WA 1XNIA 2DIGA 1WJSA 3NTHA 4IUUA 3E9GA 4B9XA 2EQJA 1WGSA 2L3RA 3NTIA 4BE2A 2PQWA 3PNWC 3OQ5A 2O4XB 3L2QA 4E7JA 3DB3A 2RJEA 2DIQA 4C5IA 2GFAA 3MP1A
chains in the Genus database with same CATH superfamily
3H0HA 2MWOA 4M7DE 1UGQB 3SWNC 4JJNK 4LUDA 1H3HA 2DERA 1RUWA 5C6SA 1IZ6A 3S6WA 5L23A 4X9CA 2EQKA 1WNLA 1VQOT 3E19A 1NPPA 4F7UB 1RLQC 1K76A 2K5FA 4A4EA 2JXBA 3GOXA 4BDYA 2CT4A 2PVOB 3I55T 2AK5A 1M1GA 1YI2Q 3PVLA 1YNZA 1H8KA 3P8DA 3CC7T 3S3OA 2EQUA 1YN8A 3P8HA 3HP9A 3CXCP 1O9SA 1KFZA 3CCLT 3I56T 1PWTA 1VQMQ 1KC8C 4A53A 4RG8A 4JJBA 3A8MB 3THKA 5A0GA 4PJOD 1NG2A 1N8RU 2EJ9A 5IHIA 2PU9B 3TVTA 2OAWA 3QSUA 4QW2A 2RA2A 3CPWS 2KGTA 1PSEA 4JZ4A 2CP2A 3DLMA 2OI3A 2JS2A 1YBYA 4Z8AA 4HVUA 3LX7A 4QVZA 4PNOA 4M7AB 5GAN3 5GJVB 1OU9A 4NS5A 2EPDA 3EGDB 5CKBA 1Y57A 1YHQT 2LNVA 1C0MA 2K5IA 2YUOA 2ZAEA 4A54A 4ZGJB 4EIKA 1UHCA 3M59A 2HKNA 4BE2A 1U3OA 1Q86C 2EGCA 2DL3A 4HVWA 1M4ZA 3DB3A 2KY9A 2E10A 4QQDA 1N6AA 4XU0A 1RI0A 1LVKA 1OU8A 3OYKA 2XD0A 2CUBA 2DZCA 5CKDA 2ZPHB 4DA4A 2DK3A 3UT1A 2J06A 3OYFA 1RI9A 5GANf 2KR3A 4ESRA 1X27A 4JRKA 3C0CA 4R0KA 4J9GA 4JRPA 1ABQA 3CMAT 1UGRB 2R57A 1D0ZA 2RHZA 2L0AA 3L2RA 5GAN6 1G5VA 2DL5A 1S72Q 1B07A 4IURA 3NPFA 1ZA2B 4GY5A 4F17A 2GF7A 3VS3A 2QTXA 1YJ9A 3META 4WF2A 4C92B 3M0TA 3DLLA 3X28B 4LDXA 4FM4B 2Z0WA 1VQ5T 1YHQQ 4HCBA 2GGRA 1LOJA 1X75C 4M75D 1YIJT 5GMKl 1ZSZB 2LJ1A 3VV0A 3WVEB 4JPBW 1KSWA 2BE7D 2JT4A 2LQKA 4C92F 3VS4A 2QQBA 1PM3A 4O5VA 1VIEA 2D1XA 2NUTA 3OYGA 1SSHA 4LD6A 5GANg 4LXCA 3F70A 4MDXA 3QG1A 2RD1A 4ME7A 4OF1A 1VQ4T 1VQLT 2DF6A 1M5Q1 2HQEA 4ZGEB 2SEMA 4C0FA 1PD0A 1H641 3M55A 1U1TA 3CCUT 4M77G 4J6YA 1KQSP 2GQVA 4FSSA 1YI2A 3A5ZB 2L2PA 4CC4B 4PJOG 3L2QA 3GNFB 1UE9A 1WFWA 4E6RA 4PJNA 3LWIA 2EWNA 1TG0A 3QDRB 4DOWA 3CPWA 1G83A 1EZZB 1I5LA 3NFCA 1QMCA 4HCZA 2DTHA 1SHFA 2DVJA 4C92A 1YCSB 4J9CA 1Q81U 1VQMA 3CEYA 3OYBA 1ZSZA 4OB0B 2BIVA 2HBPA 3EFRA 4IIOA 3GBQA 2LP5A 1X6GA 3GF5A 2P4RA 2KE9A 1NLPC 1KD1R 2F1LA 3OYJA 3OS5A 4J9DA 4OGCA 2E6NA 5GMKi 1I0CA 3MEWA 3EG9B 1JB0E 1X01A 2XDBA 1HYOA 5KYUB 1WDXA 3HRSA 3CCUQ 4ZNXA 4E7LA 3VKIA 2CP3A 1BI0A 2V1QA 1M3BA 1OULA 4E7ZA 3CC4A 1WJRA 1G3YA 4JRQA 2MI6A 5A0LA 1GL5A 1X6OA 2O2OA 2RQTA 1IXDA 2M02A 2DETA 1Z9ZA 4PFOA 3H8ZA 2E41A 1VQ7Q 1U5SA 1M9SA 3VYGA 4C0ZA 3CQTA 2Y90A 2FHDA 4MMKA 2HL3A 2XK0A 1K8AU 4PLLA 5I2MA 2IIMA 4BI4A 1QKWA 2E12A 2RO0A 4JLGA 2LDMA 3CXCA 4WTOB 3OYDA 1RABB 1WJSA 4CC3A 2CT3A 3E9GA 4OB2B 2K57A 4M78F 3J80E 1Q82U 2A36A 4M75G 1VQ6Q 1LPLA 1WI7A 2DIQA 3MP1A 1AWWA 2XHCA 4FU6A 2KRSA 2J6KA 3MP8A 4M7DF 5CR2A 1MMGA 2KDSA 3EG9A 2XDPA 1W4SA 3QBYA 2LNHB 2FPEA 3CCJA 1JJ2P 4FW1A 2LVMA 5GAN5 3H6ZA 1BI1A 4C8QB 2YRCA 4C92C 2ZPBB 3VS7A 2ROTA 1O75A 2QYZA 1GXIE 1MV3A 5IT9E 1ZSZC 1D3BB 1MNEA 2OTJQ 2QA4T 4M78A 4FT4A 4BACA 3OA6A 3JB9D 3CCRQ 4EPCA 4M7DA 3PMIA 4FYXB 3VRZA 2MYSA 1JQQA 3CBMA 2DX1A 2ROLA 1IHVA 1K9MC 4N4HA 4HA8A 4J7FA 3UATA 3L2ZA 4C0GA 2KT8A 1XTDA 2V8IA 2L3QA 1P92A 3CCMA 5FROA 1WXTA 1NYFA 2M0YA 1AEYA 4JLIA 2QQRA 2JMCA 4XTUA 2CUDA 2E1HA 2V8KA 2FPDA 5GMKj 3BW1A 3X25B 2LZ6B 2E5QA 2IPOB 5I21A 1E7OA 3LWHA 3V8LA 1UHFA 1WQ7A 2BE9B 2MF2A 3VS6A 2RH2A 2VC8A 1XNIA 2DXBA 1ACMB 2QEXT 4XU3A 1SKUB 5LJ3j 3UA7A 2EYQA 5CK9A 3OYMA 1BKBA 3I35A 2J7IA 5CCAA 3JCMW 1TS9A 5FU7B 5EC7A 1MUZA 3M0RA 1I5OB 4M77E 2OAUA 1SPKA 1VYTA 4BD3A 5FRMA 5IAYA 3TU4K 3CCVA 1BBZA 4Z89A 2HQHA 2VGNA 3G6EA 2O01E 1WLPB 5KYWA 4II1A 3FC3A 2B86A 2ZPFB 1Q7YU 1KQSA 1QWEA 1VYUA 2DLPA 2X4WA 2F2XA 1VQ7A 2HD0A 3JCMf 2BZYA 2XG8D 5GAMe 2KXDA 2K2MA 1WHLA 1FX7A 2HKQB 4QKUA 2F5TX 1E6GA 4PJMA 4Q5WA 2DMOA 1C1AA 1YJ9T 1N27A 4M4ZA 3FLGA 3GP8A 1M1KC 2AHJB 2LMJA 1N8RR 2JTFA 3PTAA 2D8JA 1MMDA 2W0ZA 2CZ0B 3PMTA 3HSBA 2P0PA 5HK3A 1VQ6A 1KG1A 3QYHB 3CCEA 4FYVB 1RL2A 3PE0A 2DVEA 3MEVA 4D8DA 2HQXA 4IUTA 4ZTFA 1WXUA 5KYXA 2FVUA 2ED0A 2P0KA 1JXOA 1YWOA 2QQSA 1GFCA 4JJDA 2L8DA 4KUIA 2YT6A 4PK4A 2H3JA 2EGEA 4Y91A 3RESA 2ED1A 4IKFA 1D1CA 4BE1A 1KQ2A 2GFUA 2RQUA 2KXCA 2ZPIB 3CPWP 3JB9G 1WGSA 3JCMg 2L3RA 1UFFA 2EIFA 4ATOA 4BUGA 1YI2T 4R55A 2DAQA 2DNUA 1AWOA 2OTJA 1Y7XA 3C94A 2RQWA 4KH0B 4IUPA 3VS2A 3ME9A 4AFSC 5KCOA 1K4US 3LH5A 3CCRA 1IREB 3KBGA 1BIAA 3G1JA 2P0QA 2EFIA 4J7IA 1VQKQ 1VQMT 1T3SA 5GAN2 4M75E 4GLMA 4LDYA 1SRMA 1YITQ 3QZ9B 1WQWA 4XAXB 2KK4A 1R0BG 2F69A 4X34A 1PRLC 1KC8U 1H3ZA 3CD6A 2LX7A 1GCQA 3FJ5A 2RF0A 1V76A 4QQ6A 5CQXA 4PJJA 3J81E 1M3AA 4N4IA 3TSWA 5D6XA 2DYBA 3JCMJ 2KRMA 4OMFB 2WSCE 5HY6A 2QXFA 2FL7A 3INZA 3A1PA 3JCMV 4HT8A 1K73C 4ELZC 4RTTA 3ZFJA 4DEXA 3PT9A 1NYGA 2EQMA 4ORZA 2DJQA 2JM9A 2V8JA 2KVQG 3FEOA 5AYFA 5GAMh 4PFZA 2CP7A 1IB8A 1JJ2A 1M8MA 2EYXA 3SHWA 2QDYB 2D0QB 3JCMX 4A4FA 2KQWA 1M90C 1VQ9Q 1B3QA 3L2UA 2PNIA 1Q86U 5GMKm 4XTXA 4C92D 1QVPA 3J7AF 3M4YA 5GAMd 1QP2A 3MO8A 3M58A 1V29B 1ZA1B 1VUBA 4OMNA 5FU7C 2XIDA 1PHTA 1HSQA 2DIGA 5FLXE 1YCYA 2E6ZA 3QO3A 4KGXB 1KHIA 1Y96A 4DEYA 2A28A 3E2UA 2KNBB 4F7UG 1S72T 2CSQA 1QVFA 1W6XA 2NWMA 4CC7A 1I81A 1Q81R 3R6OA 1RAFB 2DL8A 4RTWA 2DXCA 1MGQA 1Q95G 3DB4A 2RI2A 1YWPA 2Y4YA 1VYVA 1QVGS 2K3BA 1R8OB 3HL8A 1M2VA 1I8FA 2E5KA 4RCCA 3CC4Q 5LJ3f 3OBWA 2NYSA 2NUTB 3LYIA 4BDZA 2E65A 2CP6A 4J9BA 2K4YA 2FPFA 3LLRA 1TOVA 2ZZDA 1Y0MA 1I07A 3NTKA 3KUFA 5D7UA 4M7AG 1IRXA 4XK8E 4C5GA 3CCSQ 3CMEA 2I2LA 4DOVA 1WA7A 2RHIA 2M51A 2BZ8A 3E9FA 2DXUA 1IO6A 4LDUA 1NJIC 3QJYA 2GNCA 5HKCA 4F16A 5CQYA 1K8AR 4HCKA 2AT1B 1BU1A 4N4GA 2ECZA 1MNDA 3WVDB 5LJ3g 1XQHA 3CCJQ 4OVAA 2VB6A 1VQKA 4RTZA 3E1SA 1AWXA 2V26A 1YITA 5GAOl 4IIMA 1Q82R 2KI7A 3O5ZA 1X43A 4F04B 3JB9J 2EAYA 4B9XA 1CSKA 2E3HA 2HSEB 4XTWA 3EFOB 3V7CA 3JCMb 2DYIA 3MP6A 4M77F 2A0FB 3VUBA 3RERA 3FRNA 2K5LA 1SF9A 2JZ2A 3C95A 7AT1B 2A7YA 2ABLA 1LNXA 2JVVA 4PJOF 2FZGB 4B6MA 1SG5A 2O9SA 1GBRA 1BI3A 3G71Q 3M9QA 4L59A 1ABOA 1OQKA 2O31A 2RPNA 1VQ9A 3CC2Q 2YUNA 5CAIA 3HTRA 3CCMQ 1MHNA 2YLBA 1OZ2A 1VQ7T 2M16A 3OW2S 5GAN4 2QG9B 4AFQC 4FYYB 1GCPA 2DZ9A 2PVGB 4MMLA 2R5MA 1ZBJA 2A37A 1AHJB 2RQVA 1OOTA 3SDZA 4M77A 1UGPB 4KGVB 4C8QD 2NUPA 3QKJA 4R56A 4EMKA 2AKKA 3EFOA 3RDVA 1T0JA 1VQ6T 4PJOA 4A63B 2CP0A 2QQAA 1PC0A 2VYTA 2LCCA 3RUXA 2MMPA 2HDAA 2IG0A 1DJ7B 4OB1B 4AT1B 5DY9A 2NUZA 4HXJA 5AT1B 1TWBA 2P4TA 5L8RE 1ZUUA 3CCVQ 4PLIA 1SHGA 2X35A 3PGGA 2BUDA 3X20B 3G6EQ 3VS1A 2VWFA 2RK2A 2COYA 3O8VA 5HK0A 2DILA 3M0UA 1M1KR 1GFDA 1VQOA 3AHUA 1JRIA 5A0DA 1M8VA 3JB9H 5GAMf 1U06A 4M78B 2RM4A 3UA6A 2OTJT 3CC7A 4BE0A 2JUFA 3M57A 4A4GA 1TXQA 4M7DB 4M75F 3CCSA 4J9FA 3ZBDA 3CCRT 2KRNA 2FYKA 4CC2A 3I56A 1Q7YR 4O6JA 4F7UE 2FRYA 1NEBA 1B34B 3PFSA 2C06A 4FW2A 3CCEQ 2C0OA 3CD6T 1TUGB 1K9MU 4OP0A 3M0QA 5CKHA 3KFVA 2K79A 1Z9QA 4N0AA 1KQ1A 5CKEA 2YRVA 3JRZA 1FXXA 4D6WA 1KK7A 1JBMA 4BY6B 1CKBA 5A2QE 1XOVA 1PKSA 3TREA 4XTZA 4EDUA 5GAMg 1VQPQ 2K9GA 3EAEA 3QUIA 1AOJA 4OMPA 3REBB 4V2SA 4JS5A 2RJDA 3EG2A 4M75A 2ZPGB 2W10A 2YHTA 4D8KA 4M77C 1AZEA 1V1CA 3C4SA 5LJ5e 4M7AE 4EMKC 2DJZA 4XTVA 3EHQA 4VUBA 4AG2C 2DBKA 3CCQQ 1F1BB 2QTVA 1UGSB 4QVCA 2LCSA 3BDLA 4RTYA 2DKGA 5KYWB 1W2BS 3RKXA 1QVFP 1KHCA 3G7ZA 1B34A 3G71A 4RTXA 4PFPA 4MDWA 3CD6Q 4LN2A 1YP5A 2DD4A 2EBPA 3CC2A 3CMAA 4YTLA 2ENMA 4C8QG 2RJEA 1R77A 2GFAA 2NLUA 2SRCA 2GTJA 1G3TA 3CPFA 1VIFA 9ATCB 3QHSA 1H92A 2RHUA 1VA7A 2L5QA 1WHMA 3M54A 2MOXA 4F14A 3L2VA 1Y07A 2VGMA 1UTIA 2ZPEB 4J9IA 3M0PA 2XDDA 1KC8R 2C0IA 2EVRA 5LL6S 1RADB 1M1KU 1RAGB 1D0XA 1RAIB 1A0NB 2QI2A 2FEIA 4C5EA 2DRKA 2LTOA 1OYXA 5KYXB 4J6WA 1WJQA 3IQLA 3QJ6A 3Q1JA 1FMKA 2CZ6B 4EMGA 4RCBA 5GANh 4X1VA 4PJOE 3EG1A 1OZ3A 3SEMA 3EG0A 2KAFA 2YXYA 2RMOA 2Y4XA 3VS5A 2EKOA 2YSQA 4FYWB 1M30A 3H0FA 5CKFA 1IGUA 1WZOA 3H0IA 3JB9I 1PNJA 2E64A 2R5AA 1JO8A 4DBRA 1Q86R 1KD1C 2RI5A 4JRIA 2CH4W 2VXFA 1QW1A 3GLXA 3D7SB 4BI8B 5KYYA 2JJ9A 3OB9A 2K7AA 4J9HA 3V8JA 3HKSA 1NM7A 3JAME 1GBQA 4RG2A 2LJ3A 4M78C 4XU1A 1WHKA 1VQKT 1YITT 2X51A 4RMOA 5LJ5h 4E47A 3EH1A 4M7DC 3NTIA 4LNPA 1QLYA 1LCKA 2KROA 2X3XD 2YDLA 3MJXA 5GAOp 3VJPA 2QASA 1JEGA 4XU2A 3M0SA 2KBTA 3SB2A 4OGEA 3JB9F 2COZA 2EQIA 1OX9A 4KRTA 4LE9A 1OPLA 3EGXA 1WHHA 3M56A 1YJWQ 5ECAA 4OMOA 2YWWA 2E4HA 3CMEQ 5LJ5d 2YUPA 1YJNQ 1VQPA 1K73U 1PD1A 1IHWA 4PJLA 3FB9A 5GAN8 5IN1A 3EHRA 4BY6C 4Y92A 2LT1A 4ZGDB 4OMLA 3RMSA 3BDUA 2J6FA 2DTIA 3UWNA 1EIFA 1VQ9T 4BI3A 4NL2A 2E3IA 3H9NA 4LDWA 3UDCA 2D9TA 2J6OA 3PIPA 5I2SA 1M90U 3CCQA 2EYWA 4JZ3A 3V7RA 1GRIA 3OMCA 2DRMA 3I9QA 5KYNA 4L6V5 2RQRA 4NOYA 4HCCA 1Y96B 2BZXA 1PG5B 5KCHA 3OS2A 1RACB 3MEAA 3QIIA 2PTKA 2JNGA 1MMNA 2FB7A 3P8BB 2M1HA 5EG2A 1AZGB 1ZQ1A 1X69A 4JS4A 5I11A 3G4SQ 1MV0B 4FL6A 3I5SA 2K6DA 1PSFA 2X4JA 3TEEA 3N5BB 1WPYA 1M2VB 3HFOA 1X2KA 4A4HA 3JV3A 3OY9A 3RNJA 1QWFA 2WACA 3CC4T 3OSSC 1W70A 2ESWA 3VU3C 1M1FA 1N9SA 2DEQA 4KGZB 2KT1A 3U23A 4JJCA 2VXEA 1WHGA 2DD5A 3M53A 2HSPA 2O4XB 4MZMA 5CVIA 3EG3A 2F2WA 4C5IA 1VQ8Q 2ZGWA 3ZL7C 5GAMj 1D1BA 2A08A 4ZTJA 5GAOm 1WXBA 1QCNA 2DXTA 3OYNA 2K3XA 2O9VA 3AT1B 2QA4A 4TVRA 2LT4A 4J6XA 1VQNQ 3VS0A 3QWYA 4F7UF 2ZCFB 2OTLQ 3CCST 2RK1A 4M77D 4C8QE 4KH1B 3BE3A 5CIUA 1JXMA 2F5KA 4P5NA 2XI9A 3A8LB 2PUOB 1VOMA 4C0DB 4JUVA 3QYGB 3A8OB 1SEMA 3FDRA 1BIBA 2MCNA 2LC4A 2QGGA 1NJIU 5CO7A 3VYHB 2YUQA 3OS1A 4QQGA 2EJFA 4FIBA 2EKHA 3ULRB 3CCJT 4A4KA 3JCMe 4RTUA 1QQJA 5KE3A 2COWA 3ZEHA 1VQOQ 2AIRB 1ZLMA 1BB9A 2QEXA 3I55Q 2O4XA 3OW2P 2EYYA 4F7UA 3OYLA 4M7AF 1BYMA 1GCQC 3CC7Q 2RN8A 1G3SA 1EFNA 2RI3A 3GNGA 2MIOA 3JCMc 4DBFA 1I4K1 4MZPA 1YJWA 3MCAB 1YJNA 1ZHIA 3CCLQ 1IGQA 4KT0E 3I56Q 1N8RC 4E2FB 1KJWA 2KYMA 2DFUA 2MK5A 1X2QA 1FWZA 4E7KA 3OYEA 3M5AA 2LQNA 3JCMP 4B9WA 5DLQE 2F2VA 3NTHA 2EQJA 1UJ0A 1WX6A 3G71T 1D0YA 2X3WD 3CC2T 2OJ2A 6AT1B 3OQ5A 1NZ9A 2JMAA 1WHJA 3CCMT 1K1ZA 4GBQA 3X24B 4LDVA 1NEGA 3MHXA 2HMAA 3EFSA 3HPWA 4Y28E 3URGA 2PVDB 4LD9K 4M77B 1BI2A 2CP5A 4M7AA 2NUPB 2BTTA 1K9AA 1NLOC 3CXCS 2FO0A 5FWBA 4EMKB 1PKTA 5J39A 4ZN3A 2QQ9A 1BCOA 4PJOB 3EGUA 4Z02A 1K9MR 3EGDA 1UJYA 5FWCA 4M78D 5LJ5f 2EJGA 1UG1A 5FW9A 5IXBA 2LQWA 1CKAA 3G4SA 4RKUE 4J9EA 2C0TA 1N5ZA 1OV3A 4M7DD 4JDSA 4C92G 3KXTA 1N9RA 3CCVT 4FT2A 3LGLA 3T9NA 2AZSA 4OMMA 2KEAA 3G6ET 4AFUC 2RHXA 1G3WA 1LJOA 5GAOq 1AT1B 3SFMA 3CMAQ 2LQ8A 1FYNA 2V1RA 2GCXA 1UB4A 1VQ8A 3JCMQ 3JCMh 1W1FA 3PVQA 3HFNA 1AD5A 4AMCA 2EGAA 4HKEA 1UGVA 2M9UA 2VASA 1TU0B 2LRQA 1VQNA 2RB6A 4NL3A 2OX7A 2G6FX 4C5HA 1JU5C 2OTLA 1QVGA 1VQ5Q 1B7TA 2GBQA 4X9DA 3RR6A 2L3SA 5KE2A 2CDTA 2JOYA 1YIJQ 5LJ5g 2RNAA 2DM1A 2KMTA 5IHNA 3CCET 1K0XA 3JCMd 2PQWA 3PNWC 3JSCA 2GQIA 4E7JA 2XICA 2JTEA 2DPPB 4IUUA 8AT1B 3ER0A 4XTYA 2B8AA 1VQLQ 1VQ4Q 2R58A 4C0DC 4IUQA 1W2BP 1MMAA 3A8GB 2CSIA 5GMKe 4AFZC 1HK9A 3L2WA 1S1NA 2L3PA 3OBYA 1R0CB 2D6FA 2G3RA 2XKOC 2HZYA 1VQPT 4RTVA 4M75B 1QCFA 3I55A 3LGFA 4QT7A 1C6VX 4UC4A 2WSEE 4M7AC 2JN0A 2K2VA 5D6WA 1RAHB 2CS7A 4E7HA 1FMWA 5LJ3e 1BCMA 3NMZC 2RHYA 5GAOn 4KBMB 1Y71A 2LX9A 1UECA 1Q81C 3OMGA 3V8KA 5GAN7 3CCQT 1UEBA 3CCLA 4L5GA 1AVZC 2O88A 2D8HA 3CBPA 2CGHA 5GANe 5C0MA 2H3EB 3MKDA 3EH2A 2QGFB 2L89A 4CRIA 1OPKA 3NGPA 2PUKB 1KQSS 3OS0A 2EYZA 4QVDA 1S72A 5KH6A 5J3BA 4J5YA 4M78G 2IVWA 3OYCA 2HL5C 5M9OA 4ELYC 2LCLA 4BB7A 4KUDK 4LUEA 1G8XA 2CYZB 5KYUA 4M7DG 3R6NA 1YHQA 1E6HA 1UDLA 3RKWA 1FMVA 2MAMA 1NE8A 4CI0C 5DM7R 2FRWA 4PKCC 1K8AC 2CZ1B 3OW2A 4PJOC 2P84A 5IXFA 1PCXA 2X4YA 3OSVA 3GIBA 2HBWA 3BY7A 5J26A 1OEBA 1K73R 4C8QF 2VV5A 1ZUYA 4FSXA 2RJFA 3C12A 4RUGA 3UF4A 1Q82C 5I22A 3QPHA 1NBEB 5FU6B 1ZBXA 2JW4A 1TH7A 2VUBA 1PRMC 2K3YA 2HEQA 4EMHA 2QK0A 3HHTB 5GMKh 3SWNB 2DEUA 5KYYB 1M90R 3FIFA 1M2OA 3V7SA 1YFNA 1KD1U 3RIRA 2KSSA 3MEUA 3ASKA 2DBMA 4ANJA 2YRDA 1VQ5A 1X6BA 4OMQA 4DBQA 3OYYA 2MPXC 2JTMA 1YIJA 2HCKA 5LJ3h 2X9HA 1T3LA 2DO3A 2FG0A 2JM8A 3M4GA 1NPRA 3RKYA 1BK2A 2DE0X 2CH4A 4ZN1A 3TSZA 4C8QA 1J3TA 1SSFA 3L42A 4C92E 1QKXA 4E7SA 1HJDA 4DBHA 1AWJA 3H41A 1VQLA 1VQ4A 3EGXB 2QA4Q 3MPUB 4N0AC 1QCOA 1OX8A 3HRUA 1QP3A 1D3BA 1T0HA 5GJWB 4Z88A 5LJ3d 5GAOr 1U1SA 1YJWT 1XJWB 1I1JA 3CMET 3VUZA 2JS0A 3X26B 1YJNT 1HXDA 4K11A 3CCUA 2X4XA 3A8HB 3BFMA 3A98A 1D09B 5IHKA 2I0NA 1JJ2S 1HD3A 5GANj 3QZ5B 2QDLA 3CBOA 2FZKB 3TQ7P 2DA9A 3SWNA 1SRLA 5GANd 2LJ0A 4HVVA 5IH2A 3HRTA 1TUCA 2H8HA 4HT9A 4M75C 2J05A 3OYAA 2XMFA 4IUVA 4J8OA 3TCJA 3S3NA 1TUDA 4J83A 2VKNA 2YLCA 3REAB 3WXMB 5FRNA 2E70A 2A3LA 1D1AA 3PIOA 2VVKA 3FJPA 2BKDN 1WIEA 4XQ3A 2ATCB 2M0OA 2KYBA 2QEXQ 2DL7A 2CKKA 1EX4A 1NJIR 3NHNA 1RAEB 1QVFS 3RBBB 2EW3A 5LJ5j 1UUEA 1K0SA 3DKMA 3G4ST 3VRYA 2HAXA 1M27C 4KULA 4FCYA 1ARKA 3LH0A 2HNIA 1RLPC 3SD4A 4AG1C 1W2BA 2WSFE 1ZSGA 2D0NA 1Q7YC 5HCKA 4WCIA 2CREA 3L1AA 3QDFA 8ATCB 1ZUKA 1ZX6A 3GPLA 4OB3B 1G2BA 2XU8A 3S3MA 1TTHB 2MWPA 4MZTA 3OYIA 2AKLA 3OYHA 1WYXA 2FZCB 1M3CA 3RMQA 1VQ8T 1QVGP 1U8RA 3LW5E 2CZ7B 2RJCA 1OI1A 2GTOA 4C8QC 4DQ2A 1YJ9Q 1RAAB 3UPUA 4M7AD 1VQNT 4E7IA 5DLOA 1KIKA 3I5RA 2OTLT 3QWXX 1TSFA 4PL6A 5D6YA 2AZVA 3QXEB 4GLKA 2DL4A 2DTOA 4M78E 2QAZA 2PZ1A 5FU6C
chains in the Genus database with same CATH topology
3OYMA 2RM4A 2MWOA 1BKBA 2OTJT 3X24B 3CC7A 4LDVA 5CCAA 4BE0A 3MHXA 2JUFA 3M57A 3EFSA 5FU7B 3JCMW 4M7DE 1UGQB 3HPWA 4A4GA 4Y28E 4M77E 3SWNC 3URGA 4JJNK 2PVDB 2OAUA 4M7DB 4M75F 4LD9K 3CCSA 4M77B 3ZBDA 1BI2A 3CCRT 4M7AA 4BD3A 5C6SA 5FRMA 5IAYA 3TU4K 1IZ6A 3CCVA 2FYKA 3CXCS 3S6WA 3I56A 2VGNA 4X9CA 4EMKB 2EQKA 3G6EA 1WNLA 2O01E 4O6JA 5J39A 4F7UE 1VQOT 1B34B 2QQ9A 3PFSA 4II1A 4ZN3A 3FC3A 4PJOB 3E19A 1NPPA 2C06A 4Z02A 2ZPFB 4F7UB 1Q7YU 2K5FA 4A4EA 3GOXA 4BDYA 2PVOB 3I55T 1KQSA 3CD6T 4M78D 5LJ5f 2EJGA 1M1GA 1K9MU 4OP0A 5CKHA 2X4WA 1VQ7A 4N0AA 3P8DA 2HD0A 3JCMf 4RKUE 3G4SA 3S3OA 3CC7T 2XG8D 5GAMe 1KQ1A 5CKEA 2YRVA 3JRZA 1FX7A 1FXXA 2EQUA 4D6WA 2F5TX 3P8HA 3HP9A 4M7DD 4JDSA 1JBMA 4C92G 4Q5WA 4BY6B 1O9SA 1YJ9T 5A2QE 1N27A 3KXTA 1N9RA 3CCVT 3CCLT 3FLGA 4FT2A 3GP8A 3LGLA 3I56T 3T9NA 1XOVA 2AHJB 1M1KC 3G6ET 2JTFA 3PTAA 1KC8C 3TREA 4A53A 4RG8A 1VQ7T 4XTZA 4EDUA 2RHXA 1G3WA 2CZ0B 3A8MB 5GAMg 5A0GA 4PJOD 1LJOA 5GAOq 3EAEA 3SFMA 3QUIA 3PMTA 2EJ9A 1N8RU 3HSBA 2P0PA 2LQ8A 2PU9B 5HK3A 4V2SA 1VQ6A 4JS5A 3QSUA 1KG1A 2GCXA 2RJDA 4M75A 3QYHB 4QW2A 3CCEA 1UB4A 1VQ8A 2RA2A 3CPWS 3JCMQ 1PSEA 2ZPGB 3JCMh 2YHTA 1RL2A 4M77C 2DVEA 3C4SA 3MEVA 3HFNA 3DLMA 2HQXA 4IUTA 4ZTFA 5LJ5e 1YBYA 2FVUA 4HKEA 4M7AE 4EMKC 2DJZA 3LX7A 4XTVA 2M9UA 2P0KA 4VUBA 2QQSA 4PNOA 4QVZA 4M7AB 5GAN3 2LRQA 2L8DA 1VQNA 2RB6A 1UGSB 4KUIA 4NL3A 4QVCA 1K8AU 3BDLA 4C5HA 2H3JA 2OTLA 2DKGA 1QVGA 4X9DA 1W2BS 4Y91A 3RKXA 5KE2A 3RESA 2JOYA 4NS5A 4IKFA 5LJ5g 1KHCA 3G7ZA 1B34A 3G71A 2GFUA 4BE1A 1KQ2A 5CKBA 2KMTA 4MDWA 2ZPIB 1YHQT 3JB9G 2LNVA 4ZGJB 2K5IA 2DD4A 1WGSA 4A54A 3JCMg 3CC2A 2L3RA 3CCET 2EIFA 3JCMd 3CMAA 3M59A 4ATOA 4YTLA 4BE2A 2PQWA 3PNWC 1Q86C 3JSCA 1M4ZA 4BUGA 4C8QG 4E7JA 2XICA 3DB3A 1VQNT 2KY9A 1YI2T 2DPPB 2RJEA 4R55A 2GFAA 2DAQA 2E10A 4IUUA 2OTJA 1Y7XA 3ER0A 4QQDA 2NLUA 3C94A 1N6AA 1G3TA 3CPFA 4XTYA 1VIFA 1RI0A 4XU0A 3QHSA 2B8AA 4IUPA 3OYKA 2XD0A 2R58A 2RHUA 3ME9A 4IUQA 2DZCA 4C0DC 5KCOA 5CKDA 2L5QA 2ZPHB 4DA4A 2DK3A 3UT1A 3A8GB 3M54A 3CCRA 1IREB 3OYFA 3KBGA 1BIAA 5GMKe 1HK9A 2P0QA 2EFIA 4J7IA 1Y07A 2VGMA 5GANf 3L2VA 3L2WA 1VQMT 2ZPEB 3OBYA 4JRKA 5GAN2 4M75E 2XDDA 2D6FA 2G3RA 2XKOC 4LDYA 3QZ9B 1VQPT 1WQWA 4XAXB 2KK4A 4M75B 5LL6S 4JRPA 1M1KU 3CMAT 2F69A 4X34A 1KC8U 1H3ZA 3I55A 1UGRB 3LGFA 2QI2A 3CD6A 2R57A 4C5EA 4UC4A 2WSEE 4M7AC 2RHZA 3L2RA 2LTOA 5GAN6 4QQ6A 1OYXA 5CQXA 2JN0A 1G5VA 3J81E 4J6WA 4N4IA 1WJQA 2K2VA 4IURA 2CS7A 5D6XA 5D6WA 4E7HA 5LJ3e 3JCMJ 3QJ6A 4GY5A 2RHYA 5GAOn 4KBMB 4OMFB 1Y71A 2LX9A 1Q81C 2GF7A 2WSCE 3OMGA 3Q1JA 5HY6A 2QXFA 2FL7A 2QTXA 3V8KA 3INZA 1YJ9A 3META 4WF2A 4EMGA 5GAN7 4RCBA 5GANh 3JCMV 1UEBA 3CCQT 4C92B 1K73C 4ELZC 3X28B 3DLLA 3CCLA 4HT8A 4LDXA 4PJOE 3ZFJA 4FM4B 1OZ3A 4L5GA 2KAFA 3PT9A 1VQ5T 4HCBA 2EQMA 2Y4XA 1LOJA 1X75C 2EKOA 2KVQG 2V8JA 3CBPA 3FEOA 5AYFA 2CGHA 4M75D 5GANe 5GMKl 5GAMh 1YIJT 5CKFA 5C0MA 3VV0A 3WVEB 3JB9I 1JJ2A 2E64A 2L89A 2LQKA 2QDYB 2R5AA 2D0QB 4C92F 4CRIA 2QQBA 3JCMX 4A4FA 2KQWA 4O5VA 1M90C 1KD1C 1KQSS 2PUKB 1VIEA 3OS0A 2RI5A 3OYGA 3L2UA 4JRIA 4QVDA 2VXFA 1QW1A 4LD6A 3GLXA 5GANg 1S72A 1Q86U 5KH6A 4BI8B 1VQLT 3F70A 3OB9A 5J3BA 4MDXA 4J5YA 3V8JA 3QG1A 2RD1A 4ME7A 4M78G 4OF1A 3HKSA 4XTXA 2IVWA 5GMKm 4C92D 3OYCA 1VQ4T 3JAME 5M9OA 1QVPA 1M5Q1 3J7AF 4ELYC 2LCLA 4RG2A 4BB7A 2HQEA 4KUDK 4ZGEB 4M78C 3M4YA 5GAMd 4C0FA 4XU1A 1QP2A 1VQKT 3MO8A 1H641 3M55A 1V29B 2CYZB 3M58A 1VUBA 1U1TA 1YHQA 1YITT 4RMOA 4M7DG 5FU7C 2XIDA 4M77G 5LJ5h 3CCUT 4E47A 3RKWA 2DIGA 5FLXE 4J6YA 1YCYA 2GQVA 2MAMA 2E6ZA 3QO3A 4M7DC 1NE8A 3NTIA 1KHIA 1Y96A 4CI0C 3A5ZB 1YI2A 5DM7R 4PJOG 3L2QA 3GNFB 4F7UG 1S72T 4PKCC 3LWIA 5GAOp 1QVFA 1K8AC 2EWNA 3VJPA 2CZ1B 3QDRB 4DOWA 4XU2A 3CPWA 3OW2A 1I5LA 4PJOC 3SB2A 4OGEA 3NFCA 1I81A 4HCZA 3R6OA 3JB9F 2DTHA 2X4YA 3OSVA 2DXCA 3GIBA 4C92A 3BY7A 5J26A 1MGQA 3M56A 3DB4A 1Q81U 2RI2A 1VQMA 2Y4YA 4C8QF 2VV5A 5LJ5d 1QVGS 3HL8A 1R8OB 4FSXA 2RJFA 3C12A 3CEYA 1I8FA 1VQPA 3OYBA 4RCCA 1Q82C 1K73U 3QPHA 5FU6B 5LJ3f 1ZBXA 3FB9A 4OB0B 2BIVA 1TH7A 3OBWA 5GAN8 5IN1A 4BY6C 2HBPA 3EFRA 2VUBA 2LT1A 4ZGDB 2K3YA 4EMHA 3GF5A 3LYIA 4BDZA 3RMSA 3BDUA 3HHTB 5GMKh 2E65A 2DTIA 3SWNB 3UWNA 1EIFA 1VQ9T 3FIFA 4BI3A 4NL2A 3OYJA 2K4YA 3V7SA 4LDWA 3UDCA 2D9TA 3PIPA 3LLRA 3OS5A 5I2SA 4OGCA 2E6NA 5GMKi 1KD1U 3CCQA 3RIRA 3MEWA 2ZZDA 1JB0E 1X01A 2KSSA 3MEUA 2XDBA 3ASKA 3NTKA 3KUFA 1VQ5A 3V7RA 3HRSA 3OYYA 4M7AG 2JTMA 4XK8E 3VKIA 4C5GA 4E7LA 1YIJA 5LJ3h 3CMEA 3OMCA 2I2LA 1BI0A 4L6V5 4DOVA 2DO3A 4NOYA 2RHIA 3CC4A 3M4GA 4HCCA 1WJRA 1Y96B 1NPRA 3E9FA 2DXUA 3RKYA 5KCHA 3OS2A 1G3YA 4JRQA 2MI6A 5A0LA 3MEAA 3QIIA 2JNGA 4LDUA 1X6OA 2FB7A 4ZN1A 3P8BB 4C8QA 1NJIC 3QJYA 5HKCA 1SSFA 2M1HA 3L42A 5EG2A 4C92E 1ZQ1A 5CQYA 3H8ZA 4JS4A 1M90U 2E41A 1VQLA 1VQ4A 1M9SA 3VYGA 4C0ZA 4FL6A 4N4GA 3WVDB 1PSFA 2Y90A 2FHDA 4MMKA 2X4JA 2XK0A 3HRUA 4N0AC 4PLLA 1QP3A 1WPYA 3N5BB 1D3BA 3TEEA 1XQHA 5I2MA 5LJ3g 3JCMP 3HFOA 5LJ3d 4OVAA 4A4HA 4BI4A 5GAOr 1U1SA 1VQKA 3OY9A 1YJWT 2E12A 2RO0A 3E1SA 4JLGA 2WACA 2LDMA 3VUZA 3CMET 3X26B 1YJNT 3CXCA 1YITA 1HXDA 3CCUA 3OYDA 3CC4T 5GAOl 2X4XA 3OSSC 3A8HB 3BFMA 3VU3C 3JB9J 1M1FA 1N9SA 2DEQA 2EAYA 1WJSA 4OB2B 3E9GA 4B9XA 2K57A 4M78F 1JJ2S 3J80E 5GANj 2VXEA 3QZ5B 1Q82U 3CBOA 4XTWA 4M75G 3SWNA 2DD5A 5GANd 3M53A 4MZMA 2O4XB 3V7CA 5CVIA 3JCMb 3HRTA 2DIQA 4C5IA 3MP1A 2ZGWA 2XHCA 4FU6A 4M75C 4HT9A 5GAMj 3MP8A 3OYAA 4M7DF 4ZTJA 3MP6A 4IUVA 4M77F 3VUBA 4J8OA 5CR2A 5GAOm 2KDSA 3FRNA 3RERA 3TCJA 2DXTA 3OYNA 2K3XA 2K5LA 3S3NA 2XDPA 2QA4A 1W4SA 2JZ2A 4TVRA 4J83A 3C95A 3QBYA 2A7YA 2LT4A 2YLCA 3WXMB 1LNXA 4J6XA 5FRNA 2JVVA 2E70A 2A3LA 4PJOF 3PIOA 3CCJA 4F7UF 3FJPA 2ZCFB 2BKDN 3CCST 2RK1A 4M77D 4C8QE 2LVMA 5GAN5 3H6ZA 1BI1A 4XQ3A 1BI3A 2M0OA 5CIUA 4C8QB 3M9QA 4C92C 4L59A 2F5KA 4P5NA 2ZPBB 2XI9A 3A8LB 2PUOB 1VQ9A 2CKKA 4C0DB 1O75A 5CAIA 4JUVA 1GXIE 3QYGB 3A8OB 5IT9E 3FDRA 1QVFS 1BIBA 1MHNA 2YLBA 1OZ2A 5LJ5j 2M16A 3OW2S 1D3BB 2LC4A 3DKMA 1NJIU 5CO7A 3VYHB 2QA4T 3OS1A 3G4ST 4M78A 2HAXA 4QQGA 5GAN4 2EJFA 4FIBA 4KULA 4FT4A 4BACA 3OA6A 3CCJT 2DZ9A 3LH0A 2PVGB 4MMLA 3JB9D 4A4KA 2HNIA 2R5MA 3SD4A 3JCMe 1W2BA 1AHJB 2WSFE 4EPCA 1Q7YC 4M7DA 3PMIA 3SDZA 4M77A 5KE3A 1UGPB 4C8QD 3L1AA 3ZEHA 3CBMA 3QKJA 1K9MC 4R56A 3GPLA 4EMKA 4N4HA 4OB3B 4HA8A 4J7FA 2XU8A 3S3MA 2QEXA 3L2ZA 2MWPA 1VQ6T 4PJOA 2O4XA 4MZTA 2QQAA 2VYTA 4C0GA 4F7UA 3OYHA 3OYIA 3OYLA 1XTDA 4M7AF 1BYMA 2LCCA 3RMQA 1VQ8T 3RUXA 2V8IA 2MMPA 1U8RA 1G3SA 1P92A 3CCMA 5FROA 3LW5E 2RI3A 3GNGA 2CZ7B 2IG0A 2RJCA 3JCMc 1OI1A 1I4K1 4MZPA 1DJ7B 4OB1B 4JLIA 2QQRA 3MCAB 4XTUA 4C8QC 5DY9A 4DQ2A 2E1HA 1YJWA 2V8KA 5GMKj 1YJNA 3UPUA 4M7AD 1ZHIA 2P4TA 3BW1A 5L8RE 4KT0E 4PLIA 2X35A 3PGGA 2BUDA 3X20B 3X25B 2E5QA 5DLOA 4E7IA 5I21A 1N8RC 3CCMT 3LWHA 2OTLT 3V8LA 1WQ7A 1FWZA 2MF2A 2RK2A 3O8VA 3OYEA 4E7KA 2RH2A 2VC8A 3M5AA 4PL6A 5D6YA 1XNIA 2DXBA 3NTHA 3QXEB 5DLQE 4B9WA 5HK0A 2EQJA 4GLKA 3G71T 2QEXT 1VQOA 3AHUA 1JRIA 5A0DA 1M8VA 4XU3A 3JB9H 3CC2T 2DTOA 4M78E 3OQ5A 5GAMf 1NZ9A 2CZ6B 5LJ3j 5FU6C 4M78B 2EYQA 5CK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FU6 A;  3OYM A;  4QQD A;  2NLU A;  3MP8 A;  3OYA A;  2MWO A;  4ZTJ A;  3MP6 A;  4IUV A;  4HCZ A;  1RI0 A;  2B8A A;  4IUP A;  3OYK A;  3OYN A;  4BE0 A;  2K3X A;  2R58 A;  2RHU A;  2XDP A;  3ME9 A;  4IUQ A;  2X4Y A;  4A4G A;  5KCO A;  2JZ2 A;  3S3N A;  3QBY A;  5J26 A;  3UT1 A;  2DAQ A;  3DB4 A;  5FRN A;  3OYF A;  2RI2 A;  3L2V A;  2EFI A;  3L2W A;  4BD3 A;  5C6S A;  5FRM A;  5IAY A;  2RJF A;  3CEY A;  2BKD N;  3OYB A;  3S6W A;  2G3R A;  2LVM A;  2EQK A;  5J39 A;  3H6Z A;  3PFS A;  4II1 A;  3FC3 A;  2BIV A;  2M0O A;  5CIU A;  3M9Q A;  5IN1 A;  4L59 A;  4X34 A;  4Z02 A;  2F5K A;  1H3Z A;  2K3Y A;  3LGF A;  4A4E A;  2R57 A;  3LYI A;  4C5E A;  3GOX A;  4UC4 A;  2CKK A;  4BDY A;  4BDZ A;  2RHZ A;  3L2R A;  2LTO A;  4QQ6 A;  1OYX A;  3UWN A;  1G5V A;  4N4I A;  1WJQ A;  4IUR A;  2X4W A;  5D6X A;  5D6W A;  4E7H A;  3FDR A;  3OYJ A;  3QJ6 A;  3P8D A;  4GY5 A;  3S3O A;  2RHY A;  1MHN A;  1OZ2 A;  2M16 A;  2D9T A;  3LLR A;  2YRV A;  3OS1 A;  2GF7 A;  2E6N A;  3OMG A;  2EQU A;  3Q1J A;  3MEW A;  4QQG A;  3P8H A;  3MET A;  4BAC A;  3MEU A;  3OA6 A;  3ASK A;  3NTK A;  4Q5W A;  3KUF A;  3LH0 A;  1N27 A;  1OZ3 A;  2R5M A;  3FLG A;  3SD4 A;  3LGL A;  2EQM A;  4C5G A;  2JTF A;  4E7L A;  3FEO A;  2EKO A;  3OMC A;  3PMI A;  4EDU A;  2RHX A;  5KE3 A;  2RHI A;  3ZEH A;  5C0M A;  3EAE A;  3QKJ A;  1WJR A;  3PMT A;  3E9F A;  5KCH A;  3OS2 A;  2L89 A;  4N4H A;  3MEA A;  2R5A A;  3QII A;  2RJD A;  4CRI A;  3S3M A;  2MWP A;  4QW2 A;  4A4F A;  2O4X A;  3OYI A;  2VYT A;  3OYH A;  3OYL A;  3OS0 A;  1SSF A;  2M1H A;  2RI5 A;  3L42 A;  3OYG A;  2LCC A;  3L2U A;  3C4S A;  3H8Z A;  3MEV A;  4LD6 A;  3DLM A;  2HQX A;  4IUT A;  5KH6 A;  4ZTF A;  3F70 A;  3OB9 A;  5FRO A;  2RI3 A;  2IG0 A;  2RJC A;  4FL6 A;  4N4G A;  3LX7 A;  1OI1 A;  2FHD A;  2P0K A;  3OYC A;  2XK0 A;  2QQS A;  4PLL A;  4QVZ A;  5M9O A;  2QQR A;  2LRQ A;  2L8D A;  4RG2 A;  4OVA A;  2HQE A;  4A4H A;  3OY9 A;  3BDL A;  2RO0 A;  4C5H A;  4PLI A;  2WAC A;  2LDM A;  2X35 A;  2BUD A;  4E7I A;  2E5Q A;  3MO8 A;  5KE2 A;  3OYD A;  2X4X A;  4NS5 A;  4IKF A;  1KHC A;  4BE1 A;  3O8V A;  3OYE A;  2GFU A;  4PL6 A;  4E7K A;  5D6Y A;  4B9W A;  1XNI A;  2DIG A;  1WJS A;  3NTH A;  4IUU A;  3E9G A;  4B9X A;  2EQJ A;  1WGS A;  2L3R A;  3NTI A;  4BE2 A;  2PQW A;  3PNW C;  3OQ5 A;  2O4X B;  3L2Q A;  4E7J A;  3DB3 A;  2RJE A;  2DIQ A;  4C5I A;  2GFA A;  3MP1 A; 
#chains in the Genus database with same CATH topology
 3H0H A;  2MWO A;  4M7D E;  1UGQ B;  3SWN C;  4JJN K;  4LUD A;  1H3H A;  2DER A;  1RUW A;  5C6S A;  1IZ6 A;  3S6W A;  5L23 A;  4X9C A;  2EQK A;  1WNL A;  1VQO T;  3E19 A;  1NPP A;  4F7U B;  1RLQ C;  1K76 A;  2K5F A;  4A4E A;  2JXB A;  3GOX A;  4BDY A;  2CT4 A;  2PVO B;  3I55 T;  2AK5 A;  1M1G A;  1YI2 Q;  3PVL A;  1YNZ A;  1H8K A;  3P8D A;  3CC7 T;  3S3O A;  2EQU A;  1YN8 A;  3P8H A;  3HP9 A;  3CXC P;  1O9S A;  1KFZ A;  3CCL T;  3I56 T;  1PWT A;  1VQM Q;  1KC8 C;  4A53 A;  4RG8 A;  4JJB A;  3A8M B;  3THK A;  5A0G A;  4PJO D;  1NG2 A;  1N8R U;  2EJ9 A;  5IHI A;  2PU9 B;  3TVT A;  2OAW A;  3QSU A;  4QW2 A;  2RA2 A;  3CPW S;  2KGT A;  1PSE A;  4JZ4 A;  2CP2 A;  3DLM A;  2OI3 A;  2JS2 A;  1YBY A;  4Z8A A;  4HVU A;  3LX7 A;  4QVZ A;  4PNO A;  4M7A B;  5GAN 3;  5GJV B;  1OU9 A;  4NS5 A;  2EPD A;  3EGD B;  5CKB A;  1Y57 A;  1YHQ T;  2LNV A;  1C0M A;  2K5I A;  2YUO A;  2ZAE A;  4A54 A;  4ZGJ B;  4EIK A;  1UHC A;  3M59 A;  2HKN A;  4BE2 A;  1U3O A;  1Q86 C;  2EGC A;  2DL3 A;  4HVW A;  1M4Z A;  3DB3 A;  2KY9 A;  2E10 A;  4QQD A;  1N6A A;  4XU0 A;  1RI0 A;  1LVK A;  1OU8 A;  3OYK A;  2XD0 A;  2CUB A;  2DZC A;  5CKD A;  2ZPH B;  4DA4 A;  2DK3 A;  3UT1 A;  2J06 A;  3OYF A;  1RI9 A;  5GAN f;  2KR3 A;  4ESR A;  1X27 A;  4JRK A;  3C0C A;  4R0K A;  4J9G A;  4JRP A;  1ABQ A;  3CMA T;  1UGR B;  2R57 A;  1D0Z A;  2RHZ A;  2L0A A;  3L2R A;  5GAN 6;  1G5V A;  2DL5 A;  1S72 Q;  1B07 A;  4IUR A;  3NPF A;  1ZA2 B;  4GY5 A;  4F17 A;  2GF7 A;  3VS3 A;  2QTX A;  1YJ9 A;  3MET A;  4WF2 A;  4C92 B;  3M0T A;  3DLL A;  3X28 B;  4LDX A;  4FM4 B;  2Z0W A;  1VQ5 T;  1YHQ Q;  4HCB A;  2GGR A;  1LOJ A;  1X75 C;  4M75 D;  1YIJ T;  5GMK l;  1ZSZ B;  2LJ1 A;  3VV0 A;  3WVE B;  4JPB W;  1KSW A;  2BE7 D;  2JT4 A;  2LQK A;  4C92 F;  3VS4 A;  2QQB A;  1PM3 A;  4O5V A;  1VIE A;  2D1X A;  2NUT A;  3OYG A;  1SSH A;  4LD6 A;  5GAN g;  4LXC A;  3F70 A;  4MDX A;  3QG1 A;  2RD1 A;  4ME7 A;  4OF1 A;  1VQ4 T;  1VQL T;  2DF6 A;  1M5Q 1;  2HQE A;  4ZGE B;  2SEM A;  4C0F A;  1PD0 A;  1H64 1;  3M55 A;  1U1T A;  3CCU T;  4M77 G;  4J6Y A;  1KQS P;  2GQV A;  4FSS A;  1YI2 A;  3A5Z B;  2L2P A;  4CC4 B;  4PJO G;  3L2Q A;  3GNF B;  1UE9 A;  1WFW A;  4E6R A;  4PJN A;  3LWI A;  2EWN A;  1TG0 A;  3QDR B;  4DOW A;  3CPW A;  1G83 A;  1EZZ B;  1I5L A;  3NFC A;  1QMC A;  4HCZ A;  2DTH A;  1SHF A;  2DVJ A;  4C92 A;  1YCS B;  4J9C A;  1Q81 U;  1VQM A;  3CEY A;  3OYB A;  1ZSZ A;  4OB0 B;  2BIV A;  2HBP A;  3EFR A;  4IIO A;  3GBQ A;  2LP5 A;  1X6G A;  3GF5 A;  2P4R A;  2KE9 A;  1NLP C;  1KD1 R;  2F1L A;  3OYJ A;  3OS5 A;  4J9D A;  4OGC A;  2E6N A;  5GMK i;  1I0C A;  3MEW A;  3EG9 B;  1JB0 E;  1X01 A;  2XDB A;  1HYO A;  5KYU B;  1WDX A;  3HRS A;  3CCU Q;  4ZNX A;  4E7L A;  3VKI A;  2CP3 A;  1BI0 A;  2V1Q A;  1M3B A;  1OUL A;  4E7Z A;  3CC4 A;  1WJR A;  1G3Y A;  4JRQ A;  2MI6 A;  5A0L A;  1GL5 A;  1X6O A;  2O2O A;  2RQT A;  1IXD A;  2M02 A;  2DET A;  1Z9Z A;  4PFO A;  3H8Z A;  2E41 A;  1VQ7 Q;  1U5S A;  1M9S A;  3VYG A;  4C0Z A;  3CQT A;  2Y90 A;  2FHD A;  4MMK A;  2HL3 A;  2XK0 A;  1K8A U;  4PLL A;  5I2M A;  2IIM A;  4BI4 A;  1QKW A;  2E12 A;  2RO0 A;  4JLG A;  2LDM A;  3CXC A;  4WTO B;  3OYD A;  1RAB B;  1WJS A;  4CC3 A;  2CT3 A;  3E9G A;  4OB2 B;  2K57 A;  4M78 F;  3J80 E;  1Q82 U;  2A36 A;  4M75 G;  1VQ6 Q;  1LPL A;  1WI7 A;  2DIQ A;  3MP1 A;  1AWW A;  2XHC A;  4FU6 A;  2KRS A;  2J6K A;  3MP8 A;  4M7D F;  5CR2 A;  1MMG A;  2KDS A;  3EG9 A;  2XDP A;  1W4S A;  3QBY A;  2LNH B;  2FPE A;  3CCJ A;  1JJ2 P;  4FW1 A;  2LVM A;  5GAN 5;  3H6Z A;  1BI1 A;  4C8Q B;  2YRC A;  4C92 C;  2ZPB B;  3VS7 A;  2ROT A;  1O75 A;  2QYZ A;  1GXI E;  1MV3 A;  5IT9 E;  1ZSZ C;  1D3B B;  1MNE A;  2OTJ Q;  2QA4 T;  4M78 A;  4FT4 A;  4BAC A;  3OA6 A;  3JB9 D;  3CCR Q;  4EPC A;  4M7D A;  3PMI A;  4FYX B;  3VRZ A;  2MYS A;  1JQQ A;  3CBM A;  2DX1 A;  2ROL A;  1IHV A;  1K9M C;  4N4H A;  4HA8 A;  4J7F A;  3UAT A;  3L2Z A;  4C0G A;  2KT8 A;  1XTD A;  2V8I A;  2L3Q A;  1P92 A;  3CCM A;  5FRO A;  1WXT A;  1NYF A;  2M0Y A;  1AEY A;  4JLI A;  2QQR A;  2JMC A;  4XTU A;  2CUD A;  2E1H A;  2V8K A;  2FPD A;  5GMK j;  3BW1 A;  3X25 B;  2LZ6 B;  2E5Q A;  2IPO B;  5I21 A;  1E7O A;  3LWH A;  3V8L A;  1UHF A;  1WQ7 A;  2BE9 B;  2MF2 A;  3VS6 A;  2RH2 A;  2VC8 A;  1XNI A;  2DXB A;  1ACM B;  2QEX T;  4XU3 A;  1SKU B;  5LJ3 j;  3UA7 A;  2EYQ A;  5CK9 A;  3OYM A;  1BKB A;  3I35 A;  2J7I A;  5CCA A;  3JCM W;  1TS9 A;  5FU7 B;  5EC7 A;  1MUZ A;  3M0R A;  1I5O B;  4M77 E;  2OAU A;  1SPK A;  1VYT A;  4BD3 A;  5FRM A;  5IAY A;  3TU4 K;  3CCV A;  1BBZ A;  4Z89 A;  2HQH A;  2VGN A;  3G6E A;  2O01 E;  1WLP B;  5KYW A;  4II1 A;  3FC3 A;  2B86 A;  2ZPF B;  1Q7Y U;  1KQS A;  1QWE A;  1VYU A;  2DLP A;  2X4W A;  2F2X A;  1VQ7 A;  2HD0 A;  3JCM f;  2BZY A;  2XG8 D;  5GAM e;  2KXD A;  2K2M A;  1WHL A;  1FX7 A;  2HKQ B;  4QKU A;  2F5T X;  1E6G A;  4PJM A;  4Q5W A;  2DMO A;  1C1A A;  1YJ9 T;  1N27 A;  4M4Z A;  3FLG A;  3GP8 A;  1M1K C;  2AHJ B;  2LMJ A;  1N8R R;  2JTF A;  3PTA A;  2D8J A;  1MMD A;  2W0Z A;  2CZ0 B;  3PMT A;  3HSB A;  2P0P A;  5HK3 A;  1VQ6 A;  1KG1 A;  3QYH B;  3CCE A;  4FYV B;  1RL2 A;  3PE0 A;  2DVE A;  3MEV A;  4D8D A;  2HQX A;  4IUT A;  4ZTF A;  1WXU A;  5KYX A;  2FVU A;  2ED0 A;  2P0K A;  1JXO A;  1YWO A;  2QQS A;  1GFC A;  4JJD A;  2L8D A;  4KUI A;  2YT6 A;  4PK4 A;  2H3J A;  2EGE A;  4Y91 A;  3RES A;  2ED1 A;  4IKF A;  1D1C A;  4BE1 A;  1KQ2 A;  2GFU A;  2RQU A;  2KXC A;  2ZPI B;  3CPW P;  3JB9 G;  1WGS A;  3JCM g;  2L3R A;  1UFF A;  2EIF A;  4ATO A;  4BUG A;  1YI2 T;  4R55 A;  2DAQ A;  2DNU A;  1AWO A;  2OTJ A;  1Y7X A;  3C94 A;  2RQW A;  4KH0 B;  4IUP A;  3VS2 A;  3ME9 A;  4AFS C;  5KCO A;  1K4U S;  3LH5 A;  3CCR A;  1IRE B;  3KBG A;  1BIA A;  3G1J A;  2P0Q A;  2EFI A;  4J7I A;  1VQK Q;  1VQM T;  1T3S A;  5GAN 2;  4M75 E;  4GLM A;  4LDY A;  1SRM A;  1YIT Q;  3QZ9 B;  1WQW A;  4XAX B;  2KK4 A;  1R0B G;  2F69 A;  4X34 A;  1PRL C;  1KC8 U;  1H3Z A;  3CD6 A;  2LX7 A;  1GCQ A;  3FJ5 A;  2RF0 A;  1V76 A;  4QQ6 A;  5CQX A;  4PJJ A;  3J81 E;  1M3A A;  4N4I A;  3TSW A;  5D6X A;  2DYB A;  3JCM J;  2KRM A;  4OMF B;  2WSC E;  5HY6 A;  2QXF A;  2FL7 A;  3INZ A;  3A1P A;  3JCM V;  4HT8 A;  1K73 C;  4ELZ C;  4RTT A;  3ZFJ A;  4DEX A;  3PT9 A;  1NYG A;  2EQM A;  4ORZ A;  2DJQ A;  2JM9 A;  2V8J A;  2KVQ G;  3FEO A;  5AYF A;  5GAM h;  4PFZ A;  2CP7 A;  1IB8 A;  1JJ2 A;  1M8M A;  2EYX A;  3SHW A;  2QDY B;  2D0Q B;  3JCM X;  4A4F A;  2KQW A;  1M90 C;  1VQ9 Q;  1B3Q A;  3L2U A;  2PNI A;  1Q86 U;  5GMK m;  4XTX A;  4C92 D;  1QVP A;  3J7A F;  3M4Y A;  5GAM d;  1QP2 A;  3MO8 A;  3M58 A;  1V29 B;  1ZA1 B;  1VUB A;  4OMN A;  5FU7 C;  2XID A;  1PHT A;  1HSQ A;  2DIG A;  5FLX E;  1YCY A;  2E6Z A;  3QO3 A;  4KGX B;  1KHI A;  1Y96 A;  4DEY A;  2A28 A;  3E2U A;  2KNB B;  4F7U G;  1S72 T;  2CSQ A;  1QVF A;  1W6X A;  2NWM A;  4CC7 A;  1I81 A;  1Q81 R;  3R6O A;  1RAF B;  2DL8 A;  4RTW A;  2DXC A;  1MGQ A;  1Q95 G;  3DB4 A;  2RI2 A;  1YWP A;  2Y4Y A;  1VYV A;  1QVG S;  2K3B A;  1R8O B;  3HL8 A;  1M2V A;  1I8F A;  2E5K A;  4RCC A;  3CC4 Q;  5LJ3 f;  3OBW A;  2NYS A;  2NUT B;  3LYI A;  4BDZ A;  2E65 A;  2CP6 A;  4J9B A;  2K4Y A;  2FPF A;  3LLR A;  1TOV A;  2ZZD A;  1Y0M A;  1I07 A;  3NTK A;  3KUF A;  5D7U A;  4M7A G;  1IRX A;  4XK8 E;  4C5G A;  3CCS Q;  3CME A;  2I2L A;  4DOV A;  1WA7 A;  2RHI A;  2M51 A;  2BZ8 A;  3E9F A;  2DXU A;  1IO6 A;  4LDU A;  1NJI C;  3QJY A;  2GNC A;  5HKC A;  4F16 A;  5CQY A;  1K8A R;  4HCK A;  2AT1 B;  1BU1 A;  4N4G A;  2ECZ A;  1MND A;  3WVD B;  5LJ3 g;  1XQH A;  3CCJ Q;  4OVA A;  2VB6 A;  1VQK A;  4RTZ A;  3E1S A;  1AWX A;  2V26 A;  1YIT A;  5GAO l;  4IIM A;  1Q82 R;  2KI7 A;  3O5Z A;  1X43 A;  4F04 B;  3JB9 J;  2EAY A;  4B9X A;  1CSK A;  2E3H A;  2HSE B;  4XTW A;  3EFO B;  3V7C A;  3JCM b;  2DYI A;  3MP6 A;  4M77 F;  2A0F B;  3VUB A;  3RER A;  3FRN A;  2K5L A;  1SF9 A;  2JZ2 A;  3C95 A;  7AT1 B;  2A7Y A;  2ABL A;  1LNX A;  2JVV A;  4PJO F;  2FZG B;  4B6M A;  1SG5 A;  2O9S A;  1GBR A;  1BI3 A;  3G71 Q;  3M9Q A;  4L59 A;  1ABO A;  1OQK A;  2O31 A;  2RPN A;  1VQ9 A;  3CC2 Q;  2YUN A;  5CAI A;  3HTR A;  3CCM Q;  1MHN A;  2YLB A;  1OZ2 A;  1VQ7 T;  2M16 A;  3OW2 S;  5GAN 4;  2QG9 B;  4AFQ C;  4FYY B;  1GCP A;  2DZ9 A;  2PVG B;  4MML A;  2R5M A;  1ZBJ A;  2A37 A;  1AHJ B;  2RQV A;  1OOT A;  3SDZ A;  4M77 A;  1UGP B;  4KGV B;  4C8Q D;  2NUP A;  3QKJ A;  4R56 A;  4EMK A;  2AKK A;  3EFO A;  3RDV A;  1T0J A;  1VQ6 T;  4PJO A;  4A63 B;  2CP0 A;  2QQA A;  1PC0 A;  2VYT A;  2LCC A;  3RUX A;  2MMP A;  2HDA A;  2IG0 A;  1DJ7 B;  4OB1 B;  4AT1 B;  5DY9 A;  2NUZ A;  4HXJ A;  5AT1 B;  1TWB A;  2P4T A;  5L8R E;  1ZUU A;  3CCV Q;  4PLI A;  1SHG A;  2X35 A;  3PGG A;  2BUD A;  3X20 B;  3G6E Q;  3VS1 A;  2VWF A;  2RK2 A;  2COY A;  3O8V A;  5HK0 A;  2DIL A;  3M0U A;  1M1K R;  1GFD A;  1VQO A;  3AHU A;  1JRI A;  5A0D A;  1M8V A;  3JB9 H;  5GAM f;  1U06 A;  4M78 B;  2RM4 A;  3UA6 A;  2OTJ T;  3CC7 A;  4BE0 A;  2JUF A;  3M57 A;  4A4G A;  1TXQ A;  4M7D B;  4M75 F;  3CCS A;  4J9F A;  3ZBD A;  3CCR T;  2KRN A;  2FYK A;  4CC2 A;  3I56 A;  1Q7Y R;  4O6J A;  4F7U E;  2FRY A;  1NEB A;  1B34 B;  3PFS A;  2C06 A;  4FW2 A;  3CCE Q;  2C0O A;  3CD6 T;  1TUG B;  1K9M U;  4OP0 A;  3M0Q A;  5CKH A;  3KFV A;  2K79 A;  1Z9Q A;  4N0A A;  1KQ1 A;  5CKE A;  2YRV A;  3JRZ A;  1FXX A;  4D6W A;  1KK7 A;  1JBM A;  4BY6 B;  1CKB A;  5A2Q E;  1XOV A;  1PKS A;  3TRE A;  4XTZ A;  4EDU A;  5GAM g;  1VQP Q;  2K9G A;  3EAE A;  3QUI A;  1AOJ A;  4OMP A;  3REB B;  4V2S A;  4JS5 A;  2RJD A;  3EG2 A;  4M75 A;  2ZPG B;  2W10 A;  2YHT A;  4D8K A;  4M77 C;  1AZE A;  1V1C A;  3C4S A;  5LJ5 e;  4M7A E;  4EMK C;  2DJZ A;  4XTV A;  3EHQ A;  4VUB A;  4AG2 C;  2DBK A;  3CCQ Q;  1F1B B;  2QTV A;  1UGS B;  4QVC A;  2LCS A;  3BDL A;  4RTY A;  2DKG A;  5KYW B;  1W2B S;  3RKX A;  1QVF P;  1KHC A;  3G7Z A;  1B34 A;  3G71 A;  4RTX A;  4PFP A;  4MDW A;  3CD6 Q;  4LN2 A;  1YP5 A;  2DD4 A;  2EBP A;  3CC2 A;  3CMA A;  4YTL A;  2ENM A;  4C8Q G;  2RJE A;  1R77 A;  2GFA A;  2NLU A;  2SRC A;  2GTJ A;  1G3T A;  3CPF A;  1VIF A;  9ATC B;  3QHS A;  1H92 A;  2RHU A;  1VA7 A;  2L5Q A;  1WHM A;  3M54 A;  2MOX A;  4F14 A;  3L2V A;  1Y07 A;  2VGM A;  1UTI A;  2ZPE B;  4J9I A;  3M0P A;  2XDD A;  1KC8 R;  2C0I A;  2EVR A;  5LL6 S;  1RAD B;  1M1K U;  1RAG B;  1D0X A;  1RAI B;  1A0N B;  2QI2 A;  2FEI A;  4C5E A;  2DRK A;  2LTO A;  1OYX A;  5KYX B;  4J6W A;  1WJQ A;  3IQL A;  3QJ6 A;  3Q1J A;  1FMK A;  2CZ6 B;  4EMG A;  4RCB A;  5GAN h;  4X1V A;  4PJO E;  3EG1 A;  1OZ3 A;  3SEM A;  3EG0 A;  2KAF A;  2YXY A;  2RMO A;  2Y4X A;  3VS5 A;  2EKO A;  2YSQ A;  4FYW B;  1M30 A;  3H0F A;  5CKF A;  1IGU A;  1WZO A;  3H0I A;  3JB9 I;  1PNJ A;  2E64 A;  2R5A A;  1JO8 A;  4DBR A;  1Q86 R;  1KD1 C;  2RI5 A;  4JRI A;  2CH4 W;  2VXF A;  1QW1 A;  3GLX A;  3D7S B;  4BI8 B;  5KYY A;  2JJ9 A;  3OB9 A;  2K7A A;  4J9H A;  3V8J A;  3HKS A;  1NM7 A;  3JAM E;  1GBQ A;  4RG2 A;  2LJ3 A;  4M78 C;  4XU1 A;  1WHK A;  1VQK T;  1YIT T;  2X51 A;  4RMO A;  5LJ5 h;  4E47 A;  3EH1 A;  4M7D C;  3NTI A;  4LNP A;  1QLY A;  1LCK A;  2KRO A;  2X3X D;  2YDL A;  3MJX A;  5GAO p;  3VJP A;  2QAS A;  1JEG A;  4XU2 A;  3M0S A;  2KBT A;  3SB2 A;  4OGE A;  3JB9 F;  2COZ A;  2EQI A;  1OX9 A;  4KRT A;  4LE9 A;  1OPL A;  3EGX A;  1WHH A;  3M56 A;  1YJW Q;  5ECA A;  4OMO A;  2YWW A;  2E4H A;  3CME Q;  5LJ5 d;  2YUP A;  1YJN Q;  1VQP A;  1K73 U;  1PD1 A;  1IHW A;  4PJL A;  3FB9 A;  5GAN 8;  5IN1 A;  3EHR A;  4BY6 C;  4Y92 A;  2LT1 A;  4ZGD B;  4OML A;  3RMS A;  3BDU A;  2J6F A;  2DTI A;  3UWN A;  1EIF A;  1VQ9 T;  4BI3 A;  4NL2 A;  2E3I A;  3H9N A;  4LDW A;  3UDC A;  2D9T A;  2J6O A;  3PIP A;  5I2S A;  1M90 U;  3CCQ A;  2EYW A;  4JZ3 A;  3V7R A;  1GRI A;  3OMC A;  2DRM A;  3I9Q A;  5KYN A;  4L6V 5;  2RQR A;  4NOY A;  4HCC A;  1Y96 B;  2BZX A;  1PG5 B;  5KCH A;  3OS2 A;  1RAC B;  3MEA A;  3QII A;  2PTK A;  2JNG A;  1MMN A;  2FB7 A;  3P8B B;  2M1H A;  5EG2 A;  1AZG B;  1ZQ1 A;  1X69 A;  4JS4 A;  5I11 A;  3G4S Q;  1MV0 B;  4FL6 A;  3I5S A;  2K6D A;  1PSF A;  2X4J A;  3TEE A;  3N5B B;  1WPY A;  1M2V B;  3HFO A;  1X2K A;  4A4H A;  3JV3 A;  3OY9 A;  3RNJ A;  1QWF A;  2WAC A;  3CC4 T;  3OSS C;  1W70 A;  2ESW A;  3VU3 C;  1M1F A;  1N9S A;  2DEQ A;  4KGZ B;  2KT1 A;  3U23 A;  4JJC A;  2VXE A;  1WHG A;  2DD5 A;  3M53 A;  2HSP A;  2O4X B;  4MZM A;  5CVI A;  3EG3 A;  2F2W A;  4C5I A;  1VQ8 Q;  2ZGW A;  3ZL7 C;  5GAM j;  1D1B A;  2A08 A;  4ZTJ A;  5GAO m;  1WXB A;  1QCN A;  2DXT A;  3OYN A;  2K3X A;  2O9V A;  3AT1 B;  2QA4 A;  4TVR A;  2LT4 A;  4J6X A;  1VQN Q;  3VS0 A;  3QWY A;  4F7U F;  2ZCF B;  2OTL Q;  3CCS T;  2RK1 A;  4M77 D;  4C8Q E;  4KH1 B;  3BE3 A;  5CIU A;  1JXM A;  2F5K A;  4P5N A;  2XI9 A;  3A8L B;  2PUO B;  1VOM A;  4C0D B;  4JUV A;  3QYG B;  3A8O B;  1SEM A;  3FDR A;  1BIB A;  2MCN A;  2LC4 A;  2QGG A;  1NJI U;  5CO7 A;  3VYH B;  2YUQ A;  3OS1 A;  4QQG A;  2EJF A;  4FIB A;  2EKH A;  3ULR B;  3CCJ T;  4A4K A;  3JCM e;  4RTU A;  1QQJ A;  5KE3 A;  2COW A;  3ZEH A;  1VQO Q;  2AIR B;  1ZLM A;  1BB9 A;  2QEX A;  3I55 Q;  2O4X A;  3OW2 P;  2EYY A;  4F7U A;  3OYL A;  4M7A F;  1BYM A;  1GCQ C;  3CC7 Q;  2RN8 A;  1G3S A;  1EFN A;  2RI3 A;  3GNG A;  2MIO A;  3JCM c;  4DBF A;  1I4K 1;  4MZP A;  1YJW A;  3MCA B;  1YJN A;  1ZHI A;  3CCL Q;  1IGQ A;  4KT0 E;  3I56 Q;  1N8R C;  4E2F B;  1KJW A;  2KYM A;  2DFU A;  2MK5 A;  1X2Q A;  1FWZ A;  4E7K A;  3OYE A;  3M5A A;  2LQN A;  3JCM P;  4B9W A;  5DLQ E;  2F2V A;  3NTH A;  2EQJ A;  1UJ0 A;  1WX6 A;  3G71 T;  1D0Y A;  2X3W D;  3CC2 T;  2OJ2 A;  6AT1 B;  3OQ5 A;  1NZ9 A;  2JMA A;  1WHJ A;  3CCM T;  1K1Z A;  4GBQ A;  3X24 B;  4LDV A;  1NEG A;  3MHX A;  2HMA A;  3EFS A;  3HPW A;  4Y28 E;  3URG A;  2PVD B;  4LD9 K;  4M77 B;  1BI2 A;  2CP5 A;  4M7A A;  2NUP B;  2BTT A;  1K9A A;  1NLO C;  3CXC S;  2FO0 A;  5FWB A;  4EMK B;  1PKT A;  5J39 A;  4ZN3 A;  2QQ9 A;  1BCO A;  4PJO B;  3EGU A;  4Z02 A;  1K9M R;  3EGD A;  1UJY A;  5FWC A;  4M78 D;  5LJ5 f;  2EJG A;  1UG1 A;  5FW9 A;  5IXB A;  2LQW A;  1CKA A;  3G4S A;  4RKU E;  4J9E A;  2C0T A;  1N5Z A;  1OV3 A;  4M7D D;  4JDS A;  4C92 G;  3KXT A;  1N9R A;  3CCV T;  4FT2 A;  3LGL A;  3T9N A;  2AZS A;  4OMM A;  2KEA A;  3G6E T;  4AFU C;  2RHX A;  1G3W A;  1LJO A;  5GAO q;  1AT1 B;  3SFM A;  3CMA Q;  2LQ8 A;  1FYN A;  2V1R A;  2GCX A;  1UB4 A;  1VQ8 A;  3JCM Q;  3JCM h;  1W1F A;  3PVQ A;  3HFN A;  1AD5 A;  4AMC A;  2EGA A;  4HKE A;  1UGV A;  2M9U A;  2VAS A;  1TU0 B;  2LRQ A;  1VQN A;  2RB6 A;  4NL3 A;  2OX7 A;  2G6F X;  4C5H A;  1JU5 C;  2OTL A;  1QVG A;  1VQ5 Q;  1B7T A;  2GBQ A;  4X9D A;  3RR6 A;  2L3S A;  5KE2 A;  2CDT A;  2JOY A;  1YIJ Q;  5LJ5 g;  2RNA A;  2DM1 A;  2KMT A;  5IHN A;  3CCE T;  1K0X A;  3JCM d;  2PQW A;  3PNW C;  3JSC A;  2GQI A;  4E7J A;  2XIC A;  2JTE A;  2DPP B;  4IUU A;  8AT1 B;  3ER0 A;  4XTY A;  2B8A A;  1VQL Q;  1VQ4 Q;  2R58 A;  4C0D C;  4IUQ A;  1W2B P;  1MMA A;  3A8G B;  2CSI A;  5GMK e;  4AFZ C;  1HK9 A;  3L2W A;  1S1N A;  2L3P A;  3OBY A;  1R0C B;  2D6F A;  2G3R A;  2XKO C;  2HZY A;  1VQP T;  4RTV A;  4M75 B;  1QCF A;  3I55 A;  3LGF A;  4QT7 A;  1C6V X;  4UC4 A;  2WSE E;  4M7A C;  2JN0 A;  2K2V A;  5D6W A;  1RAH B;  2CS7 A;  4E7H A;  1FMW A;  5LJ3 e;  1BCM A;  3NMZ C;  2RHY A;  5GAO n;  4KBM B;  1Y71 A;  2LX9 A;  1UEC A;  1Q81 C;  3OMG A;  3V8K A;  5GAN 7;  3CCQ T;  1UEB A;  3CCL A;  4L5G A;  1AVZ C;  2O88 A;  2D8H A;  3CBP A;  2CGH A;  5GAN e;  5C0M A;  2H3E B;  3MKD A;  3EH2 A;  2QGF B;  2L89 A;  4CRI A;  1OPK A;  3NGP A;  2PUK B;  1KQS S;  3OS0 A;  2EYZ A;  4QVD A;  1S72 A;  5KH6 A;  5J3B A;  4J5Y A;  4M78 G;  2IVW A;  3OYC A;  2HL5 C;  5M9O A;  4ELY C;  2LCL A;  4BB7 A;  4KUD K;  4LUE A;  1G8X A;  2CYZ B;  5KYU A;  4M7D G;  3R6N A;  1YHQ A;  1E6H A;  1UDL A;  3RKW A;  1FMV A;  2MAM A;  1NE8 A;  4CI0 C;  5DM7 R;  2FRW A;  4PKC C;  1K8A C;  2CZ1 B;  3OW2 A;  4PJO C;  2P84 A;  5IXF A;  1PCX A;  2X4Y A;  3OSV A;  3GIB A;  2HBW A;  3BY7 A;  5J26 A;  1OEB A;  1K73 R;  4C8Q F;  2VV5 A;  1ZUY A;  4FSX A;  2RJF A;  3C12 A;  4RUG A;  3UF4 A;  1Q82 C;  5I22 A;  3QPH A;  1NBE B;  5FU6 B;  1ZBX A;  2JW4 A;  1TH7 A;  2VUB A;  1PRM C;  2K3Y A;  2HEQ A;  4EMH A;  2QK0 A;  3HHT B;  5GMK h;  3SWN B;  2DEU A;  5KYY B;  1M90 R;  3FIF A;  1M2O A;  3V7S A;  1YFN A;  1KD1 U;  3RIR A;  2KSS A;  3MEU A;  3ASK A;  2DBM A;  4ANJ A;  2YRD A;  1VQ5 A;  1X6B A;  4OMQ A;  4DBQ A;  3OYY A;  2MPX C;  2JTM A;  1YIJ A;  2HCK A;  5LJ3 h;  2X9H A;  1T3L A;  2DO3 A;  2FG0 A;  2JM8 A;  3M4G A;  1NPR A;  3RKY A;  1BK2 A;  2DE0 X;  2CH4 A;  4ZN1 A;  3TSZ A;  4C8Q A;  1J3T A;  1SSF A;  3L42 A;  4C92 E;  1QKX A;  4E7S A;  1HJD A;  4DBH A;  1AWJ A;  3H41 A;  1VQL A;  1VQ4 A;  3EGX B;  2QA4 Q;  3MPU B;  4N0A C;  1QCO A;  1OX8 A;  3HRU A;  1QP3 A;  1D3B A;  1T0H A;  5GJW B;  4Z88 A;  5LJ3 d;  5GAO r;  1U1S A;  1YJW T;  1XJW B;  1I1J A;  3CME T;  3VUZ A;  2JS0 A;  3X26 B;  1YJN T;  1HXD A;  4K11 A;  3CCU A;  2X4X A;  3A8H B;  3BFM A;  3A98 A;  1D09 B;  5IHK A;  2I0N A;  1JJ2 S;  1HD3 A;  5GAN j;  3QZ5 B;  2QDL A;  3CBO A;  2FZK B;  3TQ7 P;  2DA9 A;  3SWN A;  1SRL A;  5GAN d;  2LJ0 A;  4HVV A;  5IH2 A;  3HRT A;  1TUC A;  2H8H A;  4HT9 A;  4M75 C;  2J05 A;  3OYA A;  2XMF A;  4IUV A;  4J8O A;  3TCJ A;  3S3N A;  1TUD A;  4J83 A;  2VKN A;  2YLC A;  3REA B;  3WXM B;  5FRN A;  2E70 A;  2A3L A;  1D1A A;  3PIO A;  2VVK A;  3FJP A;  2BKD N;  1WIE A;  4XQ3 A;  2ATC B;  2M0O A;  2KYB A;  2QEX Q;  2DL7 A;  2CKK A;  1EX4 A;  1NJI R;  3NHN A;  1RAE B;  1QVF S;  3RBB B;  2EW3 A;  5LJ5 j;  1UUE A;  1K0S A;  3DKM A;  3G4S T;  3VRY A;  2HAX A;  1M27 C;  4KUL A;  4FCY A;  1ARK A;  3LH0 A;  2HNI A;  1RLP C;  3SD4 A;  4AG1 C;  1W2B A;  2WSF E;  1ZSG A;  2D0N A;  1Q7Y C;  5HCK A;  4WCI A;  2CRE A;  3L1A A;  3QDF A;  8ATC B;  1ZUK A;  1ZX6 A;  3GPL A;  4OB3 B;  1G2B A;  2XU8 A;  3S3M A;  1TTH B;  2MWP A;  4MZT A;  3OYI A;  2AKL A;  3OYH A;  1WYX A;  2FZC B;  1M3C A;  3RMQ A;  1VQ8 T;  1QVG P;  1U8R A;  3LW5 E;  2CZ7 B;  2RJC A;  1OI1 A;  2GTO A;  4C8Q C;  4DQ2 A;  1YJ9 Q;  1RAA B;  3UPU A;  4M7A D;  1VQN T;  4E7I A;  5DLO A;  1KIK A;  3I5R A;  2OTL T;  3QWX X;  1TSF A;  4PL6 A;  5D6Y A;  2AZV A;  3QXE B;  4GLK A;  2DL4 A;  2DTO A;  4M78 E;  2QAZ A;  2PZ1 A;  5FU6 C; 
#chains in the Genus database with same CATH homology
 3OYM A;  2RM4 A;  2MWO A;  1BKB A;  2OTJ T;  3X24 B;  3CC7 A;  4LDV A;  5CCA A;  4BE0 A;  3MHX A;  2JUF A;  3M57 A;  3EFS A;  5FU7 B;  3JCM W;  4M7D E;  1UGQ B;  3HPW A;  4A4G A;  4Y28 E;  4M77 E;  3SWN C;  3URG A;  4JJN K;  2PVD B;  2OAU A;  4M7D B;  4M75 F;  4LD9 K;  3CCS A;  4M77 B;  3ZBD A;  1BI2 A;  3CCR T;  4M7A A;  4BD3 A;  5C6S A;  5FRM A;  5IAY A;  3TU4 K;  1IZ6 A;  3CCV A;  2FYK A;  3CXC S;  3S6W A;  3I56 A;  2VGN A;  4X9C A;  4EMK B;  2EQK A;  3G6E A;  1WNL A;  2O01 E;  4O6J A;  5J39 A;  4F7U E;  1VQO T;  1B34 B;  2QQ9 A;  3PFS A;  4II1 A;  4ZN3 A;  3FC3 A;  4PJO B;  3E19 A;  1NPP A;  2C06 A;  4Z02 A;  2ZPF B;  4F7U B;  1Q7Y U;  2K5F A;  4A4E A;  3GOX A;  4BDY A;  2PVO B;  3I55 T;  1KQS A;  3CD6 T;  4M78 D;  5LJ5 f;  2EJG A;  1M1G A;  1K9M U;  4OP0 A;  5CKH A;  2X4W A;  1VQ7 A;  4N0A A;  3P8D A;  2HD0 A;  3JCM f;  4RKU E;  3G4S A;  3S3O A;  3CC7 T;  2XG8 D;  5GAM e;  1KQ1 A;  5CKE A;  2YRV A;  3JRZ A;  1FX7 A;  1FXX A;  2EQU A;  4D6W A;  2F5T X;  3P8H A;  3HP9 A;  4M7D D;  4JDS A;  1JBM A;  4C92 G;  4Q5W A;  4BY6 B;  1O9S A;  1YJ9 T;  5A2Q E;  1N27 A;  3KXT A;  1N9R A;  3CCV T;  3CCL T;  3FLG A;  4FT2 A;  3GP8 A;  3LGL A;  3I56 T;  3T9N A;  1XOV A;  2AHJ B;  1M1K C;  3G6E T;  2JTF A;  3PTA A;  1KC8 C;  3TRE A;  4A53 A;  4RG8 A;  1VQ7 T;  4XTZ A;  4EDU A;  2RHX A;  1G3W A;  2CZ0 B;  3A8M B;  5GAM g;  5A0G A;  4PJO D;  1LJO A;  5GAO q;  3EAE A;  3SFM A;  3QUI A;  3PMT A;  2EJ9 A;  1N8R U;  3HSB A;  2P0P A;  2LQ8 A;  2PU9 B;  5HK3 A;  4V2S A;  1VQ6 A;  4JS5 A;  3QSU A;  1KG1 A;  2GCX A;  2RJD A;  4M75 A;  3QYH B;  4QW2 A;  3CCE A;  1UB4 A;  1VQ8 A;  2RA2 A;  3CPW S;  3JCM Q;  1PSE A;  2ZPG B;  3JCM h;  2YHT A;  1RL2 A;  4M77 C;  2DVE A;  3C4S A;  3MEV A;  3HFN A;  3DLM A;  2HQX A;  4IUT A;  4ZTF A;  5LJ5 e;  1YBY A;  2FVU A;  4HKE A;  4M7A E;  4EMK C;  2DJZ A;  3LX7 A;  4XTV A;  2M9U A;  2P0K A;  4VUB A;  2QQS A;  4PNO A;  4QVZ A;  4M7A B;  5GAN 3;  2LRQ A;  2L8D A;  1VQN A;  2RB6 A;  1UGS B;  4KUI A;  4NL3 A;  4QVC A;  1K8A U;  3BDL A;  4C5H A;  2H3J A;  2OTL A;  2DKG A;  1QVG A;  4X9D A;  1W2B S;  4Y91 A;  3RKX A;  5KE2 A;  3RES A;  2JOY A;  4NS5 A;  4IKF A;  5LJ5 g;  1KHC A;  3G7Z A;  1B34 A;  3G71 A;  2GFU A;  4BE1 A;  1KQ2 A;  5CKB A;  2KMT A;  4MDW A;  2ZPI B;  1YHQ T;  3JB9 G;  2LNV A;  4ZGJ B;  2K5I A;  2DD4 A;  1WGS A;  4A54 A;  3JCM g;  3CC2 A;  2L3R A;  3CCE T;  2EIF A;  3JCM d;  3CMA A;  3M59 A;  4ATO A;  4YTL A;  4BE2 A;  2PQW A;  3PNW C;  1Q86 C;  3JSC A;  1M4Z A;  4BUG A;  4C8Q G;  4E7J A;  2XIC A;  3DB3 A;  1VQN T;  2KY9 A;  1YI2 T;  2DPP B;  2RJE A;  4R55 A;  2GFA A;  2DAQ A;  2E10 A;  4IUU A;  2OTJ A;  1Y7X A;  3ER0 A;  4QQD A;  2NLU A;  3C94 A;  1N6A A;  1G3T A;  3CPF A;  4XTY A;  1VIF A;  1RI0 A;  4XU0 A;  3QHS A;  2B8A A;  4IUP A;  3OYK A;  2XD0 A;  2R58 A;  2RHU A;  3ME9 A;  4IUQ A;  2DZC A;  4C0D C;  5KCO A;  5CKD A;  2L5Q A;  2ZPH B;  4DA4 A;  2DK3 A;  3UT1 A;  3A8G B;  3M54 A;  3CCR A;  1IRE B;  3OYF A;  3KBG A;  1BIA A;  5GMK e;  1HK9 A;  2P0Q A;  2EFI A;  4J7I A;  1Y07 A;  2VGM A;  5GAN f;  3L2V A;  3L2W A;  1VQM T;  2ZPE B;  3OBY A;  4JRK A;  5GAN 2;  4M75 E;  2XDD A;  2D6F A;  2G3R A;  2XKO C;  4LDY A;  3QZ9 B;  1VQP T;  1WQW A;  4XAX B;  2KK4 A;  4M75 B;  5LL6 S;  4JRP A;  1M1K U;  3CMA T;  2F69 A;  4X34 A;  1KC8 U;  1H3Z A;  3I55 A;  1UGR B;  3LGF A;  2QI2 A;  3CD6 A;  2R57 A;  4C5E A;  4UC4 A;  2WSE E;  4M7A C;  2RHZ A;  3L2R A;  2LTO A;  5GAN 6;  4QQ6 A;  1OYX A;  5CQX A;  2JN0 A;  1G5V A;  3J81 E;  4J6W A;  4N4I A;  1WJQ A;  2K2V A;  4IUR A;  2CS7 A;  5D6X A;  5D6W A;  4E7H A;  5LJ3 e;  3JCM J;  3QJ6 A;  4GY5 A;  2RHY A;  5GAO n;  4KBM B;  4OMF B;  1Y71 A;  2LX9 A;  1Q81 C;  2GF7 A;  2WSC E;  3OMG A;  3Q1J A;  5HY6 A;  2QXF A;  2FL7 A;  2QTX A;  3V8K A;  3INZ A;  1YJ9 A;  3MET A;  4WF2 A;  4EMG A;  5GAN 7;  4RCB A;  5GAN h;  3JCM V;  1UEB A;  3CCQ T;  4C92 B;  1K73 C;  4ELZ C;  3X28 B;  3DLL A;  3CCL A;  4HT8 A;  4LDX A;  4PJO E;  3ZFJ A;  4FM4 B;  1OZ3 A;  4L5G A;  2KAF A;  3PT9 A;  1VQ5 T;  4HCB A;  2EQM A;  2Y4X A;  1LOJ A;  1X75 C;  2EKO A;  2KVQ G;  2V8J A;  3CBP A;  3FEO A;  5AYF A;  2CGH A;  4M75 D;  5GAN e;  5GMK l;  5GAM h;  1YIJ T;  5CKF A;  5C0M A;  3VV0 A;  3WVE B;  3JB9 I;  1JJ2 A;  2E64 A;  2L89 A;  2LQK A;  2QDY B;  2R5A A;  2D0Q B;  4C92 F;  4CRI A;  2QQB A;  3JCM X;  4A4F A;  2KQW A;  4O5V A;  1M90 C;  1KD1 C;  1KQS S;  2PUK B;  1VIE A;  3OS0 A;  2RI5 A;  3OYG A;  3L2U A;  4JRI A;  4QVD A;  2VXF A;  1QW1 A;  4LD6 A;  3GLX A;  5GAN g;  1S72 A;  1Q86 U;  5KH6 A;  4BI8 B;  1VQL T;  3F70 A;  3OB9 A;  5J3B A;  4MDX A;  4J5Y A;  3V8J A;  3QG1 A;  2RD1 A;  4ME7 A;  4M78 G;  4OF1 A;  3HKS A;  4XTX A;  2IVW A;  5GMK m;  4C92 D;  3OYC A;  1VQ4 T;  3JAM E;  5M9O A;  1QVP A;  1M5Q 1;  3J7A F;  4ELY C;  2LCL A;  4RG2 A;  4BB7 A;  2HQE A;  4KUD K;  4ZGE B;  4M78 C;  3M4Y A;  5GAM d;  4C0F A;  4XU1 A;  1QP2 A;  1VQK T;  3MO8 A;  1H64 1;  3M55 A;  1V29 B;  2CYZ B;  3M58 A;  1VUB A;  1U1T A;  1YHQ A;  1YIT T;  4RMO A;  4M7D G;  5FU7 C;  2XID A;  4M77 G;  5LJ5 h;  3CCU T;  4E47 A;  3RKW A;  2DIG A;  5FLX E;  4J6Y A;  1YCY A;  2GQV A;  2MAM A;  2E6Z A;  3QO3 A;  4M7D C;  1NE8 A;  3NTI A;  1KHI A;  1Y96 A;  4CI0 C;  3A5Z B;  1YI2 A;  5DM7 R;  4PJO G;  3L2Q A;  3GNF B;  4F7U G;  1S72 T;  4PKC C;  3LWI A;  5GAO p;  1QVF A;  1K8A C;  2EWN A;  3VJP A;  2CZ1 B;  3QDR B;  4DOW A;  4XU2 A;  3CPW A;  3OW2 A;  1I5L A;  4PJO C;  3SB2 A;  4OGE A;  3NFC A;  1I81 A;  4HCZ A;  3R6O A;  3JB9 F;  2DTH A;  2X4Y A;  3OSV A;  2DXC A;  3GIB A;  4C92 A;  3BY7 A;  5J26 A;  1MGQ A;  3M56 A;  3DB4 A;  1Q81 U;  2RI2 A;  1VQM A;  2Y4Y A;  4C8Q F;  2VV5 A;  5LJ5 d;  1QVG S;  3HL8 A;  1R8O B;  4FSX A;  2RJF A;  3C12 A;  3CEY A;  1I8F A;  1VQP A;  3OYB A;  4RCC A;  1Q82 C;  1K73 U;  3QPH A;  5FU6 B;  5LJ3 f;  1ZBX A;  3FB9 A;  4OB0 B;  2BIV A;  1TH7 A;  3OBW A;  5GAN 8;  5IN1 A;  4BY6 C;  2HBP A;  3EFR A;  2VUB A;  2LT1 A;  4ZGD B;  2K3Y A;  4EMH A;  3GF5 A;  3LYI A;  4BDZ A;  3RMS A;  3BDU A;  3HHT B;  5GMK h;  2E65 A;  2DTI A;  3SWN B;  3UWN A;  1EIF A;  1VQ9 T;  3FIF A;  4BI3 A;  4NL2 A;  3OYJ A;  2K4Y A;  3V7S A;  4LDW A;  3UDC A;  2D9T A;  3PIP A;  3LLR A;  3OS5 A;  5I2S A;  4OGC A;  2E6N A;  5GMK i;  1KD1 U;  3CCQ A;  3RIR A;  3MEW A;  2ZZD A;  1JB0 E;  1X01 A;  2KSS A;  3MEU A;  2XDB A;  3ASK A;  3NTK A;  3KUF A;  1VQ5 A;  3V7R A;  3HRS A;  3OYY A;  4M7A G;  2JTM A;  4XK8 E;  3VKI A;  4C5G A;  4E7L A;  1YIJ A;  5LJ3 h;  3CME A;  3OMC A;  2I2L A;  1BI0 A;  4L6V 5;  4DOV A;  2DO3 A;  4NOY A;  2RHI A;  3CC4 A;  3M4G A;  4HCC A;  1WJR A;  1Y96 B;  1NPR A;  3E9F A;  2DXU A;  3RKY A;  5KCH A;  3OS2 A;  1G3Y A;  4JRQ A;  2MI6 A;  5A0L A;  3MEA A;  3QII A;  2JNG A;  4LDU A;  1X6O A;  2FB7 A;  4ZN1 A;  3P8B B;  4C8Q A;  1NJI C;  3QJY A;  5HKC A;  1SSF A;  2M1H A;  3L42 A;  5EG2 A;  4C92 E;  1ZQ1 A;  5CQY A;  3H8Z A;  4JS4 A;  1M90 U;  2E41 A;  1VQL A;  1VQ4 A;  1M9S A;  3VYG A;  4C0Z A;  4FL6 A;  4N4G A;  3WVD B;  1PSF A;  2Y90 A;  2FHD A;  4MMK A;  2X4J A;  2XK0 A;  3HRU A;  4N0A C;  4PLL A;  1QP3 A;  1WPY A;  3N5B B;  1D3B A;  3TEE A;  1XQH A;  5I2M A;  5LJ3 g;  3JCM P;  3HFO A;  5LJ3 d;  4OVA A;  4A4H A;  4BI4 A;  5GAO r;  1U1S A;  1VQK A;  3OY9 A;  1YJW T;  2E12 A;  2RO0 A;  3E1S A;  4JLG A;  2WAC A;  2LDM A;  3VUZ A;  3CME T;  3X26 B;  1YJN T;  3CXC A;  1YIT A;  1HXD A;  3CCU A;  3OYD A;  3CC4 T;  5GAO l;  2X4X A;  3OSS C;  3A8H B;  3BFM A;  3VU3 C;  3JB9 J;  1M1F A;  1N9S A;  2DEQ A;  2EAY A;  1WJS A;  4OB2 B;  3E9G A;  4B9X A;  2K57 A;  4M78 F;  1JJ2 S;  3J80 E;  5GAN j;  2VXE A;  3QZ5 B;  1Q82 U;  3CBO A;  4XTW A;  4M75 G;  3SWN A;  2DD5 A;  5GAN d;  3M53 A;  4MZM A;  2O4X B;  3V7C A;  5CVI A;  3JCM b;  3HRT A;  2DIQ A;  4C5I A;  3MP1 A;  2ZGW A;  2XHC A;  4FU6 A;  4M75 C;  4HT9 A;  5GAM j;  3MP8 A;  3OYA A;  4M7D F;  4ZTJ A;  3MP6 A;  4IUV A;  4M77 F;  3VUB A;  4J8O A;  5CR2 A;  5GAO m;  2KDS A;  3FRN A;  3RER A;  3TCJ A;  2DXT A;  3OYN A;  2K3X A;  2K5L A;  3S3N A;  2XDP A;  2QA4 A;  1W4S A;  2JZ2 A;  4TVR A;  4J83 A;  3C95 A;  3QBY A;  2A7Y A;  2LT4 A;  2YLC A;  3WXM B;  1LNX A;  4J6X A;  5FRN A;  2JVV A;  2E70 A;  2A3L A;  4PJO F;  3PIO A;  3CCJ A;  4F7U F;  3FJP A;  2ZCF B;  2BKD N;  3CCS T;  2RK1 A;  4M77 D;  4C8Q E;  2LVM A;  5GAN 5;  3H6Z A;  1BI1 A;  4XQ3 A;  1BI3 A;  2M0O A;  5CIU A;  4C8Q B;  3M9Q A;  4C92 C;  4L59 A;  2F5K A;  4P5N A;  2ZPB B;  2XI9 A;  3A8L B;  2PUO B;  1VQ9 A;  2CKK A;  4C0D B;  1O75 A;  5CAI A;  4JUV A;  1GXI E;  3QYG B;  3A8O B;  5IT9 E;  3FDR A;  1QVF S;  1BIB A;  1MHN A;  2YLB A;  1OZ2 A;  5LJ5 j;  2M16 A;  3OW2 S;  1D3B B;  2LC4 A;  3DKM A;  1NJI U;  5CO7 A;  3VYH B;  2QA4 T;  3OS1 A;  3G4S T;  4M78 A;  2HAX A;  4QQG A;  5GAN 4;  2EJF A;  4FIB A;  4KUL A;  4FT4 A;  4BAC A;  3OA6 A;  3CCJ T;  2DZ9 A;  3LH0 A;  2PVG B;  4MML A;  3JB9 D;  4A4K A;  2HNI A;  2R5M A;  3SD4 A;  3JCM e;  1W2B A;  1AHJ B;  2WSF E;  4EPC A;  1Q7Y C;  4M7D A;  3PMI A;  3SDZ A;  4M77 A;  5KE3 A;  1UGP B;  4C8Q D;  3L1A A;  3ZEH A;  3CBM A;  3QKJ A;  1K9M C;  4R56 A;  3GPL A;  4EMK A;  4N4H A;  4OB3 B;  4HA8 A;  4J7F A;  2XU8 A;  3S3M A;  2QEX A;  3L2Z A;  2MWP A;  1VQ6 T;  4PJO A;  2O4X A;  4MZT A;  2QQA A;  2VYT A;  4C0G A;  4F7U A;  3OYH A;  3OYI A;  3OYL A;  1XTD A;  4M7A F;  1BYM A;  2LCC A;  3RMQ A;  1VQ8 T;  3RUX A;  2V8I A;  2MMP A;  1U8R A;  1G3S A;  1P92 A;  3CCM A;  5FRO A;  3LW5 E;  2RI3 A;  3GNG A;  2CZ7 B;  2IG0 A;  2RJC A;  3JCM c;  1OI1 A;  1I4K 1;  4MZP A;  1DJ7 B;  4OB1 B;  4JLI A;  2QQR A;  3MCA B;  4XTU A;  4C8Q C;  5DY9 A;  4DQ2 A;  2E1H A;  1YJW A;  2V8K A;  5GMK j;  1YJN A;  3UPU A;  4M7A D;  1ZHI A;  2P4T A;  3BW1 A;  5L8R E;  4KT0 E;  4PLI A;  2X35 A;  3PGG A;  2BUD A;  3X20 B;  3X25 B;  2E5Q A;  5DLO A;  4E7I A;  5I21 A;  1N8R C;  3CCM T;  3LWH A;  2OTL T;  3V8L A;  1WQ7 A;  1FWZ A;  2MF2 A;  2RK2 A;  3O8V A;  3OYE A;  4E7K A;  2RH2 A;  2VC8 A;  3M5A A;  4PL6 A;  5D6Y A;  1XNI A;  2DXB A;  3NTH A;  3QXE B;  5DLQ E;  4B9W A;  5HK0 A;  2EQJ A;  4GLK A;  3G71 T;  2QEX T;  1VQO A;  3AHU A;  1JRI A;  5A0D A;  1M8V A;  4XU3 A;  3JB9 H;  3CC2 T;  2DTO A;  4M78 E;  3OQ5 A;  5GAM f;  1NZ9 A;  2CZ6 B;  5LJ3 j;  5FU6 C;  4M78 B;  2EYQ A;  5CK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...