5KE2A

Crystal structure of setdb1 tudor domain in complex with inhibitor xst06472a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
207
Chain Sequence
b'ENLYFQGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETDB1
publication title Crystal structure of SETDB1 Tudor domain in complex with inhibitor xst06472a
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 58
structure length 207
sequence length 211
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18358 Tudor_4 Histone methyltransferase Tudor domain
A PF18359 TUDOR_5 Histone methyltransferase Tudor domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A03
3OYGA 4B9WA 1SSFA 3L2UA 2EQUA 3OYHA 4A4HA 4QQGA 2LVMA 3FLGA 4A4FA 1WJSA 3BDLA 3L42A 2JTFA 2JZ2A 3C4SA 3FEOA 3LYIA 4RG2A 4Z02A 3OS2A 3OYIA 2HQXA 3MEUA 4N4IA 1RI0A 2E5QA 4IKFA 4QVZA 1WJQA 2YRVA 1KHCA 3QJ6A 3OYLA 2RHIA 5D6YA 1H3ZA 1WGSA 3ME9A 3QBYA 2EQJA 4II1A 3OMCA 3NTHA 2GF7A 1XNIA 2MWOA 2WACA 4C5IA 2DAQA 3DB4A 4QW2A 3QKJA 4GY5A 2X35A 4FU6A 3S3OA 3M9QA 3UWNA 4IUQA 3OYEA 5FRMA 3PNWC 2E6NA 3SD4A 3EAEA 2X4WA 3O8VA 3OYAA 3OYJA 3NTIA 4PLLA 3OS1A 4BACA 5KCOA 5CIUA 2RJFA 3FC3A 2CKKA 3OMGA 4IURA 2O4XA 4N4HA 3FDRA 3S3NA 3QIIA 2M16A 3H6ZA 3DB3A 3LH0A 2LTOA 2RHYA 2R58A 3LLRA 2L89A 3MEVA 2X4YA 5KE3A 2XK0A 3LGLA 2FHDA 2O4XB 2D9TA 4IUUA 4NS5A 4E7JA 3PMTA 1MHNA 2GFAA 2RJEA 4HCZA 3L2RA 4N4GA 4BE0A 5FROA 2MWPA 2EQMA 4UC4A 2EQKA 4CRIA 2R5AA 2LCCA 3S6WA 3S3MA 4IUTA 5C6SA 3PMIA 2RI5A 4EDUA 4BE2A 2B8AA 4BDYA 2HQEA 3E9FA 2DIGA 3META 4QQ6A 2X4XA 3OYMA 5D6XA 3OYDA 4E7IA 3MEAA 3OB9A 3OYNA 2LRQA 3MP1A 3NTKA 3P8HA 3ZEHA 2EKOA 2VYTA 2DIQA 3PFSA 3P8DA 2P0KA 4C5GA 3LGFA 1N27A 2IG0A 2RI3A 2R5MA 3E9GA 2K3XA 3MO8A 4FL6A 1OZ3A 2R57A 2QQRA 3H8ZA 4OVAA 4A4GA 4BD3A 4C5HA 2K3YA 5KCHA 3OA6A 4E7LA 3L2QA 4ZTFA 2RO0A 3L2VA 2BIVA 4L59A 4ZTJA 2XDPA 4PL6A 2L8DA 3OS0A 4A4EA 2QQSA 5C0MA 4IUPA 4X34A 3MP8A 3OYKA 4E7KA 5D6WA 2EFIA 3GOXA 2L3RA 3F70A 1OYXA 4E7HA 4LD6A 2M1HA 2RHXA 3OQ5A 3UT1A 5KE2A 5FRNA 3OYBA 4IUVA 5M9OA 3OY9A 2RJDA 5IAYA 2PQWA 4QQDA 4BDZA 5J26A 2LDMA 3OYCA 2RHUA 4BE1A 4C5EA 2GFUA 2F5KA 3ASKA 3L2WA 1OI1A 2G3RA 2NLUA 2RJCA 5IN1A 5KH6A 3MP6A 3Q1JA 4B9XA 3LX7A 2BKDN 4Q5WA 2M0OA 3MEWA 3DLMA 3KUFA 4PLIA 3OYFA 1WJRA 1G5VA 2RI2A 2RHZA 5J39A 1OZ2A 3CEYA 2BUDA
chains in the Genus database with same CATH superfamily
1BB9A 2F1LA 3L2UA 3CXCA 1QVFA 3JB9J 4YTLA 3TU4K 2KROA 2QA4A 2YHTA 1YI2A 3M56A 2FEIA 4PJNA 5KYUA 4ELZC 5AT1B 1GL5A 3RUXA 2QGFB 4J9GA 2HKNA 2XHCA 1VQNT 2D8HA 5CR2A 4HCCA 1QVFS 4WF2A 3CC4T 1GCQC 1M8MA 1SKUB 4PLLA 4ZGDB 1OPLA 4RUGA 4CC7A 2LT4A 3VU3C 1UGRB 5LJ3f 3QZ5B 1VQLT 1K9MC 2KY9A 3BFMA 4PFPA 3KXTA 1OQKA 4M75A 1VUBA 1UGPB 2RJEA 2K9GA 1Q95G 1TUGB 2E70A 3J80E 3I56Q 1JRIA 3E9FA 5GMKi 1W4SA 4J9CA 3OYNA 3MP1A 3J7AF 1AWWA 2E3HA 3QUIA 1YWOA 2AZVA 9ATCB 2CP7A 1DJ7B 2RD1A 3MO8A 4FL6A 4OMMA 2K3YA 3CMAQ 5CKBA 4L59A 1MNEA 2JN0A 4IUPA 5CQXA 3CCQT 3PIPA 4P5NA 4AG1C 2DBKA 2RHXA 2YRDA 3TQ7P 3A98A 5L23A 4DBHA 4IIOA 4C5EA 3RERA 4F7UA 2HBWA 5CKFA 3GBQA 5IN1A 1U1TA 3HFNA 3RDVA 5DY9A 1RAEB 3X25B 4NOYA 4HCKA 2VWFA 5GAMd 3QJYA 2K4YA 4RG2A 3EGXA 1EIFA 2D1XA 1IO6A 1YJWA 2CDTA 3MEUA 4AFZC 1OX9A 1Q86U 1PD1A 2O31A 2LT1A 1NLPC 3WVEB 1SHGA 1GFDA 2COYA 2K57A 2HCKA 4RMOA 3SFMA 1U8RA 1XQHA 1EFNA 3SB2A 1JQQA 1N8RU 4C0ZA 1AOJA 3OYAA 3FJPA 2CKKA 1D0XA 4IURA 4N4HA 3CMEQ 2M16A 2AK5A 3PTAA 2RQWA 4FIBA 2EAYA 2XK0A 2KRSA 3HP9A 4QKUA 1RAHB 2OX7A 3CCEA 3QG1A 2L0AA 1YHQA 2YXYA 3EH2A 1UG1A 1KD1R 4C8QF 4ZGJB 1RUWA 2JW4A 4HVWA 3CCMA 2GNCA 1VIFA 3HHTB 4M78A 3CC7T 2OJ2A 3REAB 4D8DA 5CO7A 2JOYA 1YWPA 3CBMA 4XU0A 1Y7XA 4WTOB 2JTEA 1BU1A 4C92F 4M75C 1D3BB 1UTIA 1NBEB 1D0YA 2ZPEB 4GBQA 1TS9A 1BIBA 3HFOA 1X01A 3NGPA 4EMKA 4JRIA 4BB7A 3MKDA 2HEQA 3OYBA 1TWBA 3RNJA 2DL3A 1X6OA 3M0UA 2NLUA 1G3WA 4B9XA 3LX7A 1MV3A 4EIKA 4OB0B 4RTYA 5KYUB 1QWEA 3OYGA 1Q7YR 1Q81U 3CCJT 2V8JA 1YJ9T 1VQMA 2J06A 1VQPQ 3G4ST 1VIEA 2DNUA 3L42A 1WHGA 5LJ5g 4PJOG 1RI0A 1BI1A 1BKBA 1WGSA 5CCAA 1D1AA 5GMKl 2CP6A 2VXFA 3OMCA 3LW5E 1I5LA 3V7SA 3HTRA 2YDLA 3HL8A 3EFOB 4F17A 3A8HB 2FRYA 1KC8R 4M75B 5GAN7 2JTMA 1UJ0A 1KJWA 4K11A 1WHMA 4ZNXA 5I11A 3OYJA 5IH2A 2A28A 2QEXQ 1H92A 1BK2A 3QO3A 4KH0B 3CCVQ 1IGQA 5LJ5e 1V1CA 2M51A 4CC3A 2GQVA 3JCMf 5GMKe 1IXDA 3VS6A 3LGLA 3BDUA 2DXCA 5KYYA 1VQ9A 3OW2S 1MHNA 4KGXB 2KXDA 4JJBA 4Y92A 4BE0A 2BZ8A 2M0YA 1VQ7T 4BY6C 4V2SA 2KQWA 3TCJA 1QMCA 1JJ2P 1YITT 1WHLA 4BE2A 1QLYA 4RCCA 1BI3A 3OYMA 3OB9A 3BE3A 2YRCA 2IPOB 3D7SB 3LH5A 3VS7A 2EWNA 2IG0A 2RI3A 2OTJQ 3JCMW 1VQNA 3I5RA 1RLPC 4MDXA 4F7UB 3H9NA 3CC4A 1B3QA 3A8LB 1BIAA 4DBRA 3REBB 4PL6A 2RK1A 5LJ3g 2YT6A 2ROTA 3AT1B 2EYXA 1Q82U 3OY9A 3NPFA 3R6OA 3RBBB 5FWCA 2NUPB 1PRMC 5GANd 4KUIA 3EGXB 2RJCA 1KD1C 2LC4A 1IHVA 2OTLT 3JCMQ 3OYFA 1NEBA 2ZCFB 5J39A 2W10A 4PJOA 4M7AE 1WLPB 2MF2A 4M77E 2XI9A 4BI4A 1SSFA 4C8QG 4FYWB 4BY6B 2W0ZA 3JV3A 1KK7A 1I1JA 3QJ6A 4M7AD 4M77D 1H3ZA 1PD0A 1WZOA 3CCRQ 3CMAT 2LMJA 1VQ8Q 4II1A 5GAMe 1SRLA 4C92G 2A7YA 4M75F 1OOTA 3CCQA 1QVGP 1EX4A 4DOVA 2E6NA 2A08A 2DBMA 2O88A 1EZZB 1M1GA 3HPWA 1K0SA 3QWYA 2COWA 3DB3A 2J6FA 1YNZA 2LTOA 2L89A 3JB9D 1VQ4Q 2XKOC 4OB2B 2FZKB 5KE3A 2E12A 1Q7YC 4TVRA 3PMTA 4HKEA 3A8MB 2ESWA 4J7IA 3EG9A 2DK3A 3HSBA 4KH1B 2HL3A 1Y96A 2DE0X 4IUTA 5CVIA 2RI5A 2E1HA 1D09B 2K7AA 3PVQA 1NM7A 4IIMA 4HXJA 2OAUA 3NTKA 2HNIA 1O9SA 3NMZC 1WDXA 5EC7A 1O75A 2LJ1A 1X27A 3PGGA 1KC8C 1K8AU 2QQRA 1T3SA 2DTOA 4F7UF 1M90R 1E6HA 3G7ZA 2ZPBB 3EH1A 4J8OA 2L8DA 3CMET 5D6WA 2L3RA 4E7HA 4LD6A 1M1KU 4Z88A 2RJDA 3M0RA 5KH6A 5KYWA 2DL8A 3THKA 4Q5WA 3DLMA 1OV3A 1YJNQ 2DF6A 2RI2A 3A8OB 1N6AA 2QGGA 3L1AA 2LZ6B 3CC7A 2LVMA 3JCMc 1WJSA 1WHHA 1T0HA 2CZ6B 2JTFA 1X2KA 1SEMA 4PJLA 4N4IA 1OEBA 2AIRB 2AKLA 3U23A 4OMFB 3CCLQ 1Z9QA 2MAMA 3EFRA 1V76A 1I8FA 3NTHA 5CKHA 2RQRA 1M4ZA 2G6FX 2A3LA 4J6XA 3CD6Q 1OPKA 3PIOA 3QKJA 1KQSS 2LCSA 5GAMj 3BY7A 2X3WD 4PJOC 2DXBA 3O8VA 4LXCA 1TXQA 2KAFA 1KIKA 2MK5A 4DOWA 4AFUC 1B7TA 3FDRA 1BCMA 1MUZA 2GGRA 4A53A 1ZBXA 2RHYA 1BI2A 3LLRA 4J6YA 2EYYA 1HYOA 1I5OB 2HD0A 2A36A 2XG8D 1MMAA 4M78F 4EMGA 4JS5A 4HA8A 2MYSA 1N9RA 1C1AA 2LNVA 4C0DC 4XU2A 1YJ9A 3EGDA 3G4SA 1VQPT 5FROA 2O9VA 3S6WA 2ZZDA 4OB1B 1VQ5T 3C95A 1OULA 2RK2A 4D8KA 1S1NA 2CSQA 2HQEA 2DIGA 3META 4DQ2A 5LL6S 2CUBA 2YLBA 3WXMB 4C5GA 4XTZA 5A0GA 2K3XA 2EJ9A 1RAAB 2RM4A 2DX1A 4OMQA 2CZ1B 2QEXT 4M75G 4RG8A 3MP8A 3TSZA 4RKUE 4E7KA 2EFIA 3F70A 4PJOB 2PZ1A 3JCMg 3EFSA 1ACMB 2GQIA 3OYCA 1VQOT 2G3RA 2HQHA 1IB8A 3HKSA 3UATA 1VQ7A 4VUBA 1BBZA 2DD4A 2C0OA 3OSVA 2Z0WA 2FG0A 1YITA 4C0DB 4GLKA 3OBWA 3I55Q 4M7DG 2DZCA 3LYIA 4M77A 5GANe 1T3LA 4OGCA 3JCMe 1G8XA 2YUQA 4RTXA 1M90C 3PT9A 2C0TA 2DERA 3VS2A 3CCSQ 3VYHB 3QYHB 4RCBA 4F7UG 1SHFA 4FW1A 2CP5A 1WXUA 1JXOA 4FYYB 3PNWC 1ZUUA 1ABOA 3EG9B 5I2MA 2P4RA 2A37A 1Y96B 1IGUA 3SHWA 2DA9A 2OTLA 4LD9K 1VQKQ 3NFCA 2FHDA 4F16A 4J9EA 5CQYA 3MCAB 4BUGA 4C92C 2KGTA 1B07A 1JJ2A 3CBPA 3X28B 1S72Q 2DLPA 3CXCS 3V8JA 4A4KA 3GP8A 2E10A 2HKQB 2JMAA 3VS1A 1TOVA 5HK3A 1W2BP 4E7IA 2IVWA 3MEAA 2KMTA 2KRMA 1WXBA 3P8HA 2CH4A 1Q86R 2DMOA 5GAMf 2GCXA 3VYGA 2ED1A 1BCOA 2RO0A 3M4YA 4ANJA 1NPRA 5KYWB 2VKNA 4C8QB 2DTIA 5CK9A 4X34A 2AKKA 2PVDB 4PJOF 2J7IA 1OYXA 3UA6A 1Z9ZA 3OQ5A 2QASA 1VQ4T 1X69A 2O2OA 1N8RR 1FMWA 5FRNA 2LCLA 1CSKA 4PFZA 1WXTA 2F5KA 3L2WA 3I35A 1PWTA 4DA4A 1AD5A 2QA4Q 4M78G 1VYTA 5GAN4 4M7DA 1D1CA 1YI2Q 4C92B 5I21A 3X24B 4E7ZA 3SWNA 2RH2A 1PCXA 1LNXA 1TG0A 2VB6A 4A4HA 1K73R 1X6BA 2XICA 1YCSB 4XTYA 4FT2A 2DPPB 5I22A 3UA7A 2H8HA 2PTKA 1QQJA 5GANj 5FLXE 2WACA 1QVGA 1R8OB 1RAGB 8ATCB 1VQ6A 1QKXA 3DB4A 3N5BB 3QDFA 1M2VA 4J9IA 3JCMb 3CMEA 3OS5A 2KR3A 4LDWA 3OYEA 5CAIA 4Y91A 1XTDA 8AT1B 5GAOn 1VA7A 3EAEA 4BACA 3EGDB 2YLCA 3FJ5A 3CC2Q 2FVUA 1FYNA 2I0NA 2JS2A 4KT0E 1YBYA 1NE8A 2ABLA 3RIRA 5GAOp 1QVGS 1KQ2A 2ZPGB 1YP5A 1KHIA 3OSSC 1BYMA 2MOXA 5C6SA 5HK0A 4X1VA 4EDUA 3LWHA 1ZA2B 1I07A 3H0FA 1Q81R 3OYYA 2K5IA 3H41A 3A5ZB 3CPWP 2P0KA 2KE9A 3CD6T 1GRIA 3BW1A 2QAZA 1K73U 4O5VA 4OB3B 3M5AA 2SRCA 5GAOq 1MNDA 1W70A 2PUOB 5HCKA 4E6RA 1PC0A 1AWXA 2QTXA 2LX7A 2FO0A 2QG9B 4CI0C 2P0QA 3MP6A 1VQPA 2EQIA 4C0GA 1G5VA 3NHNA 1VQ5A 2QQAA 2HAXA 4Z89A 2XU8A 5GAOm 5A2QE 1FMKA 1RL2A 5FW9A 2DEUA 2QXFA 1SF9A 1D0ZA 3GIBA 2RMOA 4XTUA 2NUTA 1N9SA 1Q86C 3VRYA 1JEGA 1AEYA 1UUEA 2HDAA 2KYBA 2F2XA 2QEXA 4C5IA 4JZ3A 2X9HA 1N8RC 4M7DC 4C0FA 3SD4A 3CCEQ 3SWNC 2RPNA 4XQ3A 2BZYA 1R0CB 1WHJA 2J05A 2O4XA 1VQOA 1H3HA 2E6ZA 2DL5A 4C8QE 4J9FA 2EYZA 1M5Q1 1E7OA 1Q82R 4J5YA 1MMGA 4IUUA 1NG2A 3HRSA 2FZCB 1NLOC 3V7RA 5D7UA 1K73C 4KGVB 2JM9A 4MZTA 2DM1A 4C8QD 3I55T 1W1FA 2LCCA 3CCUT 3ZFJA 1V29B 4DEXA 2KVQG 5D6XA 5GANf 3ZEHA 4XU1A 3M57A 1JXMA 1NYFA 4BD3A 4JRQA 1X75C 3VUZA 2CZ0B 2F69A 1K76A 4NL2A 1QKWA 2QQSA 1ZSZA 2X51A 2EKHA 4M7DB 1FX7A 3M58A 4R56A 3SWNB 1YFNA 4OMLA 3JCMJ 2CT4A 4BDZA 1VQMQ 2RHUA 3QZ9B 4M77F 3ASKA 1OI1A 2B86A 3JB9I 1C6VX 2PUKB 2K2MA 4LN2A 4PLIA 2HMAA 4JDSA 2VUBA 1M2OA 1SSHA 1Q81C 3GNFB 1WPYA 1M2VB 4R55A 5A0DA 1VQLA 2HQXA 3GNGA 4L6V5 1KHCA 3IQLA 2RHIA 4M78C 5GAMg 2H3EB 2EQJA 2MWOA 2EPDA 2HBPA 2DL4A 4QW2A 3SEMA 3PVLA 3I56T 1F1BB 4J83A 1K8AR 5FRMA 1VQ9Q 1TTHB 1VQ4A 3M0TA 2ZPIB 1ZQ1A 2HL5C 2FPFA 3JSCA 2XDDA 3QIIA 4EMKC 1M3AA 1NJIU 3MEVA 1XJWB 2LP5A 4RTZA 4ME7A 1M1KR 5LJ3h 1PSFA 1I0CA 3EG3A 5AYFA 4UC4A 2NUZA 1W2BA 1K1ZA 3VS4A 1VQNQ 3V8KA 1FWZA 2V1QA 4AMCA 3CC4Q 3UDCA 2PU9B 1CKBA 2K3BA 2DETA 1G3SA 2DL7A 1A0NB 2JT4A 2JS0A 4M78B 3H8ZA 5KCHA 4LDXA 4LDVA 3C0CA 4QT7A 1QWFA 1W2BS 4GLMA 2V8IA 2XDPA 2L3SA 3VJPA 3CC2T 2KEAA 4M7DF 2JM8A 4QVCA 1Q82C 2FPEA 2EGEA 5KE2A 2RA2A 3JCMX 3AHUA 1UGSB 4OF1A 2GFUA 2J6OA 2YSQA 2M9UA 4EMKB 2LJ0A 2K6DA 3MEWA 4Y28E 1TUCA 2VGMA 2DRKA 4WCIA 2BUDA 2E5KA 4B9WA 1HSQA 2EQUA 4A4FA 3EHRA 3C4SA 3OYIA 1ZSZC 2EGCA 2LQ8A 3A1PA 4M75E 4PKCC 1NJIC 3CD6A 1WJQA 4NL3A 5D6YA 4ZN3A 3H0IA 4JS4A 2L2PA 4LDYA 3TEEA 3G71Q 1WI7A 3ER0A 1TUDA 1FXXA 4M75D 4GY5A 1UEBA 1ZUKA 2JJ9A 4R0KA 3OBYA 3JRZA 2X4WA 5CIUA 2E41A 3S3NA 2P0PA 4JPBW 3VUBA 3VS0A 4M7AG 4M77G 3JCMV 5GAN5 5GAN6 2ZPHB 4DEYA 4J9DA 4CRIA 4XK8E 2QTVA 3VRZA 4RTVA 1OU8A 5KYYB 1M8VA 3PMIA 1AVZC 1CKAA 3CPWA 4RTTA 4F7UE 1KG1A 1JU5C 1ZSZB 2VYTA 2V8KA 1NZ9A 3P8DA 2CP3A 4FW2A 1N27A 2E4HA 3JB9G 3J81E 2R5MA 1GFCA 1K8AC 2YUOA 3GLXA 4AFSC 3FIFA 3OA6A 2DVJA 1HXDA 3CCJA 2QI2A 3P8BB 1NYGA 5CKEA 4BI8B 3CPWS 4ESRA 3PE0A 2D6FA 1ARKA 1LOJA 2ATCB 2M1HA 3UT1A 4EMHA 1M1KC 2ZGWA 3X20B 5J26A 2YWWA 1LJOA 2K5LA 1MGQA 2QDLA 3I9QA 3Q1JA 3I55A 4CC2A 1ZX6A 1WJRA 1NEGA 5ECAA 3CCUA 1OZ2A 3EG0A 3OW2P 1RADB 2MI6A 5GANg 1UE9A 3UF4A 3CCVT 2I2LA 4KUDK 1UGQB 4Z02A 2PNIA 2CSIA 2CS7A 2KI7A 3JCMP 1QW1A 2A0FB 2DAQA 4MMKA 5GAN3 4FU6A 1QP3A 1UECA 2VC8A 3M4GA 1H8KA 5L8RE 1YJ9Q 2JVVA 4M7AA 2MMPA 5KYXA 3C12A 2X3XD 2C06A 1K9MU 2OTJT 1X43A 2D9TA 4NS5A 4ZN1A 2M02A 3V8LA 1ZUYA 3QSUA 3VKIA 3MJXA 3TVTA 2COZA 4FT4A 3QXEB 2CGHA 1P92A 1U06A 2EKOA 2DIQA 1RACB 1PSEA 3LGFA 1MV0B 1AWOA 2DJZA 3G6EQ 3I56A 1JO8A 2RNAA 5IHNA 2Y4XA 1X6GA 1VQ7Q 1AHJB 1SG5A 2LX9A 1T0JA 2CYZB 5IHKA 1VYVA 3GOXA 1ZBJA 2O01E 3O5ZA 7AT1B 1YITQ 1W6XA 2EGAA 3CCRT 3CMAA 1YIJQ 2LDMA 2X4JA 1LPLA 1VQ8T 3QWXX 1GCPA 1WQWA 5LJ5d 2BKDN 5EG2A 1JJ2S 2F2WA 1WFWA 4OMNA 1MMDA 4J9BA 2FZGB 1ZHIA 4Z8AA 2Y4YA 3GF5A 2RB6A 2E5QA 3EFOA 2YRVA 3RKWA 1VYUA 2DXTA 3CPFA 3M0PA 2EYWA 2CH4W 3X26B 4J9HA 1OX8A 4FYXB 2OTLQ 3CC2A 3VS5A 1PHTA 3EG2A 5GAOr 1IREB 2DO3A 4O6JA 4FM4B 2JUFA 4AFQC 4RTWA 2DTHA 2ROLA 3FC3A 3WVDB 3JB9H 2HZYA 2MIOA 3LH0A 4MZMA 1G83A 4FSXA 1I81A 2KK4A 3ULRB 2LJ3A 1G3YA 5FU6C 2XD0A 3L2RA 4N4GA 4N0AA 5IXBA 3RESA 1U1SA 4QQ6A 4HVVA 4QVDA 5FU7C 3G1JA 4M7AC 4LE9A 1RLQC 4JLGA 4M77C 4DBFA 3PFSA 3G71T 1PNJA 2F2VA 5LJ3d 4PJOE 1YJNT 1HJDA 4BI3A 3L2QA 2KDSA 2XDBA 2BIVA 4OP0A 5DM7R 4JLIA 2NUPA 1UGVA 4JJNK 4PJOD 3QYGB 1UDLA 1WIEA 1K0XA 1KQSP 2CZ7B 4XTVA 3CCLT 2PQWA 1BI0A 2Y90A 4PJJA 1Y71A 3DKMA 2CT3A 3KUFA 2O9SA 2QQ9A 3QDRB 3FRNA 5FU6B 3QPHA 1GXIE 2KBTA 1UFFA 2K79A 1TH7A 1VQ6Q 3BDLA 5IXFA 3OS2A 2VXEA 1JB0E 2XIDA 3DLLA 4OMOA 2KNBB 4IKFA 1QCNA 1ZSGA 5FU7B 4M7AB 4M77B 5KYXB 3M53A 1YJWQ 2GF7A 1XNIA 1Y0MA 4J6WA 4JJCA 4E7SA 3S3OA 3UWNA 2KYMA 4IUQA 1PRLC 2EVRA 1JBMA 5GAOl 3LWIA 1Y07A 1ABQA 2QQBA 4B6MA 2R58A 2JNGA 2VV5A 3E1SA 1K4US 1LCKA 2GFAA 4HCZA 3MHXA 1PKSA 1WA7A 2EQMA 3CCVA 2DKGA 2QDYB 2VVKA 3S3MA 4ELYC 1YHQQ 4BDYA 3H0HA 2WSEE 4KULA 3URGA 4RTUA 2LRQA 1YN8A 1GBQA 1RAIB 2EBPA 4X9CA 4KRTA 2OAWA 3I5SA 1UHCA 1WNLA 1UB4A 1KQ1A 2FPDA 2WSFE 3CCMQ 2IIMA 2L3PA 2CUDA 2HSPA 4PJMA 3HRTA 1VOMA 4J7FA 4MMLA 4N0AC 5C0MA 2EW3A 1HK9A 4FSSA 3ZBDA 4C92E 1VQ5Q 5HY6A 2OTJA 2VGNA 1J3TA 2HSEB 4A63B 5GMKm 2ED0A 4BE1A 5J3BA 2AZSA 1H641 3SDZA 1KD1U 2AT1B 5IT9E 3CCST 5LJ5h 1IRXA 1NJIR 3OW2A 4C92D 2EIFA 5GMKh 3TSWA 3EG1A 4L5GA 4M4ZA 3OYHA 4QQGA 1KSWA 1MMNA 4PNOA 5DLQE 4MDWA 1LVKA 2FYKA 3M0QA 3CXCP 2BTTA 3EHQA 3L2ZA 1VQKT 1QVFP 5GAN2 4HT8A 1AT1B 1M27C 2KSSA 4M7AF 1WX6A 3G6ET 2DFUA 4HT9A 1VQOQ 1S72T 3R6NA 4HCBA 2BE9B 4JRKA 1B34A 1RABB 2KT8A 4ATOA 3OS1A 3CCRA 1YIJT 2ZPFB 1VQ8A 3OMGA 4FCYA 2PVOB 4ORZA 1ZA1B 2X4YA 3JB9F 3V7CA 2ECZA 3ZL7C 3JAME 4LUEA 2DXUA 3UPUA 1Q7YU 3KBGA 4E7JA 2DYIA 3VV0A 1X2QA 2EYQA 2CP0A 4HVUA 1UHFA 2R5AA 3CBOA 4LUDA 1YCYA 2KRNA 2LQKA 4E2FB 2DEQA 2QA4T 5GJVB 1KC8U 2RQTA 3JCMd 1YI2T 1OZ3A 2R57A 4A4GA 1U5SA 4FYVB 3INZA 3MPUB 2XMFA 4E7LA 2V1RA 2DZ9A 4F14A 5GAMh 2E64A 4A4EA 3OYKA 2RF0A 2C0IA 1GBRA 5LJ3e 3CQTA 5DLOA 6AT1B 3FB9A 2GBQA 1VQLQ 2ENMA 3RR6A 2DVEA 4X9DA 2KT1A 3CEYA 1AZGB 1E6GA 2OI3A 3FEOA 4EPCA 3G71A 1OU9A 1D1BA 4QVZA 1AZEA 1YJNA 4PK4A 1PM3A 3OYLA 5CKDA 5LJ5j 1M3BA 5GMKj 2NUTB 3VS3A 2DRMA 5GAN8 4XTWA 3M9QA 3RKYA 2F5TX 4CC4B 3CCLA 1QCOA 3NTIA 2RJFA 1C0MA 3H6ZA 3CCQQ 1K9AA 1R0BG 2P4TA 2D0NA 1M9SA 1Y57A 2O4XB 4JZ4A 2FRWA 2EJFA 1NPPA 4ZGEB 2MWPA 1IZ6A 2EQKA 2JMCA 1VQ6T 2EJGA 2SEMA 1TU0B 2X4XA 3OYDA 2NWMA 2E3IA 4XU3A 3M54A 1YJWT 4M7DE 2K5FA 3E9GA 4C8QA 3E19A 1QP2A 2DILA 5KYNA 2QK0A 4AT1B 2E65A 2RQVA 4D6WA 4ZTJA 1KQSA 4M7DD 2ZAEA 4AG2C 2P84A 4XTXA 1WYXA 5M9OA 4QQDA 1PG5B 1U3OA 4C92A 1M1FA 2LNHB 2FL7A 2CP2A 5LJ3j 2M0OA 2YUPA 2RQUA 3GPLA 2JXBA 3RMSA 1K9MR 2WSCE 2RHZA 3TREA 2RN8A 3KFVA 1GCQA 2KXCA 4E47A 1YHQT 2K2VA 3CCET 3M55A 3FLGA 1UJYA 1ZLMA 2JZ2A 1RI9A 1SRMA 4F04B 5A0LA 4KBMB 1B34B 4MZPA 1HD3A 2QYZA 1IHWA 2L3QA 3CCMT 3CC7Q 2CREA 1M90U 1SPKA 3ME9A 3QBYA 4OGEA 1R77A 5IHIA 2BZXA 2LQNA 2X35A 1AWJA 2D0QB 5HKCA 2DYBA 1WQ7A 5KCOA 3RMQA 4JRPA 1G3TA 2VASA 3CCSA 2MCNA 3E2UA 1FMVA 5FWBA 2LQWA 3M0SA 2PVGB 1TSFA 1QCFA 4JJDA 1XOVA 3T9NA 1M30A 1QVPA 4M78E 2NYSA 2DD5A 2V26A 1VQKA 2B8AA 1I4K1 3CCJQ 1PKTA 1VQMT 5GJWB 2FB7A 3G4SQ 3G6EA 5LJ5f 3RKXA 1WHKA 3C94A 4KGZB 5GANh 1S72A 3QHSA 4M78D 2GTOA 1N5ZA 4XAXB 4C5HA 2J6KA 2D8JA 4OVAA 3JCMh 4ZTFA 3EGUA 3L2VA 1KFZA 3A8GB 2BE7D 1YIJA 4LNPA 3OS0A 1RAFB 4PFOA 2DJQA 5I2SA 3HRUA 3CCUQ 1M3CA 4IUVA 4DBQA 2AHJB 5IAYA 2YUNA 1G2BA 1D3BA 2MPXC 2L5QA 3M59A 2GTJA 4JUVA 4A54A 4OMPA 4LDUA 4C8QC 2H3JA 1VQ9T
chains in the Genus database with same CATH topology
1Q81C 3L2UA 3L1AA 3CXCA 3GNFB 1TH7A 3CC7A 2LVMA 3JCMc 1QVFA 1WJSA 3BDLA 3JB9J 2JTFA 1WPYA 2CZ6B 2VXEA 4YTLA 1JB0E 5A0DA 4R55A 3OS2A 2HQXA 2XIDA 4N4IA 3DLLA 3TU4K 1VQLA 2QA4A 3GNGA 4IKFA 4L6V5 1KHCA 4OMFB 5FU7B 2RHIA 2YHTA 1YI2A 3M56A 2MAMA 4M7AB 4ELZC 4M78C 3EFRA 5GAMg 4M77B 3M53A 2EQJA 1I8FA 3NTHA 2GF7A 3RUXA 1XNIA 2MWOA 5CKHA 1M4ZA 4J6WA 2A3LA 4J6XA 2HBPA 4QW2A 3PIOA 2XHCA 3QKJA 1VQNT 4PJOB 5CR2A 3I56T 3S3OA 1KQSS 3UWNA 4J83A 4IUQA 5FRMA 5GAMj 4HCCA 1QVFS 1VQ4A 3BY7A 4WF2A 3CC4T 4PJOC 2ZPIB 2DXBA 1ZQ1A 3O8VA 4PLLA 2KAFA 3JSCA 4ZGDB 4DOWA 1JBMA 5GAOl 2XDDA 1Y07A 3LWIA 3FDRA 2QQBA 3QIIA 4EMKC 2LT4A 3VU3C 1UGRB 5LJ3f 4A53A 3QZ5B 1ZBXA 2R58A 1BI2A 2RHYA 3LLRA 3MEVA 4J6YA 1NJIU 2JNGA 2KY9A 1K9MC 2HD0A 2XG8D 2VV5A 3BFMA 3E1SA 4M78F 4ME7A 3KXTA 4EMGA 4M75A 5LJ3h 1VUBA 4JS5A 1UGPB 4HA8A 1N9RA 2LNVA 1PSFA 5AYFA 2GFAA 2RJEA 4C0DC 4XU2A 4HCZA 3MHXA 1YJ9A 3G4SA 1VQPT 5FROA 2EQMA 4UC4A 2E70A 3CCVA 1W2BA 2DKGA 2QDYB 3S6WA 3S3MA 2ZZDA 3V8KA 1FWZA 4OB1B 3J80E 3C95A 1VQ5T 2RK2A 4ELYC 1JRIA 4BDYA 2HQEA 3E9FA 2DIGA 3META 3UDCA 5GMKi 1W4SA 2WSEE 3OYNA 2PU9B 4KULA 3URGA 2LRQA 3MP1A 3J7AF 4DQ2A 3QUIA 5LL6S 2YLBA 3WXMB 4C5GA 4X9CA 1DJ7B 4XTZA 1G3SA 1WNLA 5A0GA 1UB4A 1KQ1A 2RD1A 2K3XA 3MO8A 4FL6A 2WSFE 4M78B 5KCHA 3H8ZA 2EJ9A 4LDXA 4LDVA 2K3YA 2RM4A 5CKBA 1W2BS 3HRTA 2V8IA 4L59A 2CZ1B 4J7FA 4MMLA 2QEXT 2XDPA 2JN0A 4M75G 4RG8A 3VJPA 4N0AC 5C0MA 3CC2T 4M7DF 4IUPA 3MP8A 5CQXA 3CCQT 3PIPA 4RKUE 4E7KA 2EFIA 1HK9A 4P5NA 3ZBDA 3F70A 4C92E 5HY6A 4QVCA 1Q82C 2RHXA 3JCMg 5KE2A 2VGNA 2RA2A 3EFSA 2OTJA 3JCMX 5GMKm 3AHUA 1UGSB 3OYCA 4OF1A 4BE1A 4C5EA 2GFUA 5J3BA 4EMKB 2M9UA 4F7UA 1H641 5CKFA 3SDZA 1VQOT 3RERA 2G3RA 5IN1A 1KD1U 1U1TA 3HFNA 5IT9E 3HKSA 3CCST 5DY9A 3MEWA 5LJ5h 3OW2A 4Y28E 1VQ7A 2VGMA 4VUBA 2EIFA 2DD4A 4C92D 3X25B 5GMKh 4NOYA 3OSVA 4L5GA 1YITA 2BUDA 4C0DB 4GLKA 4B9WA 5GAMd 2EQUA 3OBWA 3QJYA 3OYHA 4QQGA 4PNOA 2K4YA 5DLQE 4M7DG 4A4FA 4MDWA 2DZCA 3LYIA 4M77A 1EIFA 3C4SA 4RG2A 2FYKA 3OYIA 5GANe 1YJWA 3MEUA 2LQ8A 4M75E 4PKCC 1Q86U 1NJIC 3L2ZA 1VQKT 3CD6A 1WJQA 4OGCA 4NL3A 5GAN2 4HT8A 2KSSA 2LT1A 5D6YA 3JCMe 4M7AF 3G6ET 1M90C 3PT9A 3WVEB 4ZN3A 4JS4A 4LDYA 3TEEA 4HT9A 3ER0A 1S72T 2K57A 1FXXA 4HCBA 3VYHB 4RMOA 3QYHB 4RCBA 3SFMA 1U8RA 1XQHA 4F7UG 4M75D 4GY5A 4JRKA 1UEBA 3SB2A 1N8RU 1B34A 3PNWC 4C0ZA 3OBYA 3JRZA 2X4WA 3OYAA 5I2MA 3FJPA 3OS1A 4ATOA 3CCRA 1YIJT 5CIUA 2E41A 2ZPFB 2CKKA 1VQ8A 3OMGA 4IURA 4N4HA 2PVOB 3S3NA 1Y96B 2M16A 2P0PA 3VUBA 3PTAA 4FIBA 2OTLA 2X4YA 2EAYA 4LD9K 3JB9F 3V7CA 4M7AG 2XK0A 3NFCA 4M77G 3HP9A 2FHDA 3JCMV 5GAN5 3JAME 5CQYA 3UPUA 2DXUA 3MCAB 5GAN6 3KBGA 4BUGA 4C92C 2ZPHB 1Q7YU 3CCEA 3QG1A 4E7JA 1YHQA 3VV0A 2EYQA 1JJ2A 3CBPA 3X28B 4C8QF 4CRIA 2R5AA 3CBOA 3CXCS 3V8JA 4XK8E 4A4KA 4ZGJB 3GP8A 1M8VA 2E10A 1YCYA 3PMIA 3CPWA 4F7UE 5HK3A 1KG1A 4E7IA 2IVWA 3CCMA 3MEAA 3HHTB 1VIFA 2KMTA 4M78A 3CC7T 3P8HA 2LQKA 2VYTA 2DEQA 2V8KA 5CO7A 1NZ9A 3P8DA 3JB9G 1N27A 2JOYA 2QA4T 3CBMA 3J81E 1KC8U 4XU0A 2R5MA 1Y7XA 1K8AC 3JCMd 1YI2T 1OZ3A 2R57A 4A4GA 3GLXA 4C92F 3FIFA 5GAMf 3OA6A 2GCXA 3VYGA 1HXDA 3INZA 4M75C 4E7LA 1D3BB 3CCJA 2DZ9A 2RO0A 3M4YA 2QI2A 1NPRA 2ZPEB 3P8BB 5CKEA 4C8QB 2DTIA 5GAMh 2E64A 4A4EA 4BI8B 5CK9A 3CPWS 2D6FA 1BIBA 3HFOA 1X01A 4X34A 4EMKA 2PVDB 1LOJA 4PJOF 3OYKA 4JRIA 4BB7A 1OYXA 1VQ4T 2M1HA 3OQ5A 3UT1A 4EMHA 5FRNA 3OYBA 2LCLA 5LJ3e 1M1KC 2ZGWA 3X20B 5DLOA 5J26A 1LJOA 1X6OA 2K5LA 2F5KA 3L2WA 1MGQA 2NLUA 3FB9A 1G3WA 4DA4A 3Q1JA 4B9XA 3LX7A 3I55A 4M78G 1WJRA 2DVEA 4X9DA 5GAN4 4M7DA 4OB0B 4C92B 5I21A 3X24B 3CCUA 1OZ2A 3SWNA 2RH2A 3CEYA 3OYGA 1Q81U 3CCJT 2V8JA 1YJ9T 1LNXA 2MI6A 4A4HA 3G4ST 1VQMA 5GANg 1VIEA 2XICA 3CCVT 2I2LA 3L42A 3FEOA 5LJ5g 1UGQB 4Z02A 4PJOG 4EPCA 3G71A 4XTYA 4KUDK 1RI0A 4FT2A 2DPPB 4QVZA 2CS7A 1YJNA 1BI1A 1BKBA 3OYLA 1WGSA 5GANj 5CCAA 5FLXE 5CKDA 3JCMP 1QW1A 5LJ5j 5GMKl 2VXFA 3OMCA 3LW5E 1I5LA 3V7SA 5GMKj 2WACA 1QVGA 3HL8A 1R8OB 5GAN8 1VQ6A 3A8HB 2DAQA 3DB4A 3N5BB 4MMKA 4XTWA 4FU6A 3JCMb 3OS5A 3M9QA 5GAN3 3RKYA 3CMEA 4LDWA 4M75B 5GAN7 3OYEA 1QP3A 2VC8A 4Y91A 5CAIA 1XTDA 2JTMA 5GAOn 2F5TX 3CCLA 3M4GA 3EAEA 5L8RE 3OYJA 3NTIA 4BACA 2JVVA 2RJFA 4M7AA 2YLCA 2MMPA 2FVUA 3QO3A 3C12A 3H6ZA 5LJ5e 2C06A 2GQVA 3JCMf 5GMKe 1K9MU 2OTJT 2P4TA 4KT0E 1YBYA 3LGLA 1M9SA 1NE8A 3BDUA 3RIRA 2DXCA 5GAOp 2O4XB 1QVGS 2D9TA 3OW2S 4NS5A 1VQ9A 1KQ2A 2ZPGB 1MHNA 4ZN1A 1KHIA 2EJFA 1NPPA 3V8LA 4ZGEB 4BE0A 3OSSC 2MWPA 1IZ6A 2EQKA 1VQ7T 1VQ6T 3QSUA 2EJGA 1BYMA 4BY6C 4V2SA 3VKIA 2KQWA 5C6SA 3TCJA 5HK0A 4EDUA 3LWHA 1YITT 4BE2A 4RCCA 1BI3A 2X4XA 3OYMA 3OYDA 4FT4A 3OB9A 3QXEB 2CGHA 1P92A 2K5IA 2EKOA 3OYYA 3A5ZB 2DIQA 4XU3A 3M54A 1YJWT 2P0KA 4M7DE 1PSEA 2EWNA 3LGFA 2IG0A 3CD6T 2RI3A 2K5FA 3E9GA 4C8QA 2DJZA 3JCMW 1VQNA 3E19A 3I56A 4MDXA 1QP2A 3BW1A 4F7UB 1K73U 4O5VA 3CC4A 4OB3B 3M5AA 2E65A 4D6WA 5GAOq 3A8LB 4ZTJA 1KQSA 1BIAA 4PL6A 2Y4XA 4M7DD 1AHJB 2LX9A 2RK1A 2PUOB 2CYZB 1VQLT 5LJ3g 4XTXA 3GOXA 2O01E 1Q82U 2QTXA 5M9OA 3OY9A 4QQDA 3R6OA 3CCRT 3CMAA 2LDMA 2X4JA 4CI0C 1VQ8T 2P0QA 1M1FA 4C92A 2FL7A 5GANd 4KUIA 1WQWA 2RJCA 2LC4A 1KD1C 5LJ5d 3MP6A 5LJ3j 1VQPA 2OTLT 3JCMQ 2BKDN 2M0OA 3OYFA 3GPLA 5EG2A 4C0GA 3RMSA 1G5VA 2WSCE 2ZCFB 1JJ2S 2RHZA 1VQ5A 3TREA 2QQAA 5J39A 4PJOA 2HAXA 4M7AE 2MF2A 3CCET 4M77E 2XI9A 4BI4A 2K2VA 4E47A 1SSFA 2XU8A 4C8QG 5GAOm 1YHQT 5A2QE 1RL2A 3M55A 3FLGA 2QXFA 4BY6B 1ZHIA 2JZ2A 5A0LA 3GIBA 2Y4YA 3GF5A 4XTUA 4KBMB 1B34B 4MZPA 2RB6A 1N9SA 1Q86C 2E5QA 2YRVA 3RKWA 3QJ6A 4M7AD 2DXTA 3CPFA 4M77D 3CCMT 1H3ZA 3CMAT 1M90U 3ME9A 3QBYA 4OGEA 4II1A 5GAMe 3X26B 2QEXA 4C5IA 3CC2A 4C92G 2A7YA 4M75F 2X35A 5GAOr 3CCQA 1IREB 2DO3A 1N8RC 4O6JA 4M7DC 4FM4B 2JUFA 2D0QB 4C0FA 4DOVA 2DTHA 2E6NA 3SD4A 3SWNC 5HKCA 1M1GA 1WQ7A 4XQ3A 5KCOA 3FC3A 3WVDB 3JB9H 3RMQA 3HPWA 4JRPA 2O4XA 1VQOA 1G3TA 2E6ZA 4C8QE 3DB3A 3LH0A 2LTOA 2L89A 3JB9D 1M5Q1 4MZMA 2XKOC 3CCSA 4FSXA 4OB2B 1I81A 5KE3A 2KK4A 2E12A 4J5YA 1G3YA 4IUUA 1Q7YC 4TVRA 2PVGB 3HRSA 3PMTA 3V7RA 4HKEA 3A8MB 5FU6C 4J7IA 1K73C 4MZTA 2DK3A 2XD0A 3L2RA 4N4GA 4N0AA 1XOVA 4C8QD 3I55T 3HSBA 3T9NA 2LCCA 1Y96A 1QVPA 4IUTA 5CVIA 4M78E 3RESA 2RI5A 3CCUT 2DD5A 2E1HA 3ZFJA 1V29B 1U1SA 1I4K1 2B8AA 2KVQG 1VQKA 4QQ6A 4QVDA 1VQMT 5D6XA 2FB7A 5FU7C 5GANf 3G6EA 2OAUA 3NTKA 3ZEHA 2HNIA 1O9SA 5LJ5f 4M7AC 4JLGA 4M77C 3RKXA 3PFSA 3G71T 3C94A 4XU1A 1O75A 1S72A 5GANh 3M57A 3QHSA 3PGGA 5LJ3d 4M78D 1YJNT 1KC8C 4BI3A 4PJOE 1K8AU 4XAXB 4C5HA 4BD3A 2QQRA 4OVAA 2DTOA 4F7UF 4JRQA 1X75C 3JCMh 3VUZA 3L2QA 2CZ0B 4ZTFA 2KDSA 2F69A 2XDBA 3G7ZA 3L2VA 2BIVA 4OP0A 2ZPBB 3A8GB 4J8OA 5DM7R 1YIJA 4JLIA 4NL2A 2L8DA 3OS0A 2QQSA 4JJNK 5I2SA 4M7DB 3CMET 1FX7A 3HRUA 3M58A 4PJOD 3QYGB 5D6WA 2L3RA 4R56A 4E7HA 2CZ7B 4LD6A 3SWNB 4XTVA 3CCLT 4IUVA 1M1KU 2AHJB 3JCMJ 2RJDA 5IAYA 2PQWA 4BDZA 1BI0A 2RHUA 3QZ9B 4M77F 2Y90A 3ASKA 1D3BA 1OI1A 2L5QA 3M59A 1Y71A 3DKMA 5KH6A 3JB9I 2PUKB 4Q5WA 3DLMA 3KUFA 4PLIA 4JUVA 2QQ9A 3QDRB 4JDSA 3FRNA 2VUBA 4A54A 4LDUA 4C8QC 2H3JA 2RI2A 1VQ9T 5FU6B 3A8OB 3QPHA 1GXIE 1N6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYG A;  4B9W A;  1SSF A;  3L2U A;  2EQU A;  3OYH A;  4A4H A;  4QQG A;  2LVM A;  3FLG A;  4A4F A;  1WJS A;  3BDL A;  3L42 A;  2JTF A;  2JZ2 A;  3C4S A;  3FEO A;  3LYI A;  4RG2 A;  4Z02 A;  3OS2 A;  3OYI A;  2HQX A;  3MEU A;  4N4I A;  1RI0 A;  2E5Q A;  4IKF A;  4QVZ A;  1WJQ A;  2YRV A;  1KHC A;  3QJ6 A;  3OYL A;  2RHI A;  5D6Y A;  1H3Z A;  1WGS A;  3ME9 A;  3QBY A;  2EQJ A;  4II1 A;  3OMC A;  3NTH A;  2GF7 A;  1XNI A;  2MWO A;  2WAC A;  4C5I A;  2DAQ A;  3DB4 A;  4QW2 A;  3QKJ A;  4GY5 A;  2X35 A;  4FU6 A;  3S3O A;  3M9Q A;  3UWN A;  4IUQ A;  3OYE A;  5FRM A;  3PNW C;  2E6N A;  3SD4 A;  3EAE A;  2X4W A;  3O8V A;  3OYA A;  3OYJ A;  3NTI A;  4PLL A;  3OS1 A;  4BAC A;  5KCO A;  5CIU A;  2RJF A;  3FC3 A;  2CKK A;  3OMG A;  4IUR A;  2O4X A;  4N4H A;  3FDR A;  3S3N A;  3QII A;  2M16 A;  3H6Z A;  3DB3 A;  3LH0 A;  2LTO A;  2RHY A;  2R58 A;  3LLR A;  2L89 A;  3MEV A;  2X4Y A;  5KE3 A;  2XK0 A;  3LGL A;  2FHD A;  2O4X B;  2D9T A;  4IUU A;  4NS5 A;  4E7J A;  3PMT A;  1MHN A;  2GFA A;  2RJE A;  4HCZ A;  3L2R A;  4N4G A;  4BE0 A;  5FRO A;  2MWP A;  2EQM A;  4UC4 A;  2EQK A;  4CRI A;  2R5A A;  2LCC A;  3S6W A;  3S3M A;  4IUT A;  5C6S A;  3PMI A;  2RI5 A;  4EDU A;  4BE2 A;  2B8A A;  4BDY A;  2HQE A;  3E9F A;  2DIG A;  3MET A;  4QQ6 A;  2X4X A;  3OYM A;  5D6X A;  3OYD A;  4E7I A;  3MEA A;  3OB9 A;  3OYN A;  2LRQ A;  3MP1 A;  3NTK A;  3P8H A;  3ZEH A;  2EKO A;  2VYT A;  2DIQ A;  3PFS A;  3P8D A;  2P0K A;  4C5G A;  3LGF A;  1N27 A;  2IG0 A;  2RI3 A;  2R5M A;  3E9G A;  2K3X A;  3MO8 A;  4FL6 A;  1OZ3 A;  2R57 A;  2QQR A;  3H8Z A;  4OVA A;  4A4G A;  4BD3 A;  4C5H A;  2K3Y A;  5KCH A;  3OA6 A;  4E7L A;  3L2Q A;  4ZTF A;  2RO0 A;  3L2V A;  2BIV A;  4L59 A;  4ZTJ A;  2XDP A;  4PL6 A;  2L8D A;  3OS0 A;  4A4E A;  2QQS A;  5C0M A;  4IUP A;  4X34 A;  3MP8 A;  3OYK A;  4E7K A;  5D6W A;  2EFI A;  3GOX A;  2L3R A;  3F70 A;  1OYX A;  4E7H A;  4LD6 A;  2M1H A;  2RHX A;  3OQ5 A;  3UT1 A;  5KE2 A;  5FRN A;  3OYB A;  4IUV A;  5M9O A;  3OY9 A;  2RJD A;  5IAY A;  2PQW A;  4QQD A;  4BDZ A;  5J26 A;  2LDM A;  3OYC A;  2RHU A;  4BE1 A;  4C5E A;  2GFU A;  2F5K A;  3ASK A;  3L2W A;  1OI1 A;  2G3R A;  2NLU A;  2RJC A;  5IN1 A;  5KH6 A;  3MP6 A;  3Q1J A;  4B9X A;  3LX7 A;  2BKD N;  4Q5W A;  2M0O A;  3MEW A;  3DLM A;  3KUF A;  4PLI A;  3OYF A;  1WJR A;  1G5V A;  2RI2 A;  2RHZ A;  5J39 A;  1OZ2 A;  3CEY A;  2BUD A; 
#chains in the Genus database with same CATH topology
 1BB9 A;  2F1L A;  3L2U A;  3CXC A;  1QVF A;  3JB9 J;  4YTL A;  3TU4 K;  2KRO A;  2QA4 A;  2YHT A;  1YI2 A;  3M56 A;  2FEI A;  4PJN A;  5KYU A;  4ELZ C;  5AT1 B;  1GL5 A;  3RUX A;  2QGF B;  4J9G A;  2HKN A;  2XHC A;  1VQN T;  2D8H A;  5CR2 A;  4HCC A;  1QVF S;  4WF2 A;  3CC4 T;  1GCQ C;  1M8M A;  1SKU B;  4PLL A;  4ZGD B;  1OPL A;  4RUG A;  4CC7 A;  2LT4 A;  3VU3 C;  1UGR B;  5LJ3 f;  3QZ5 B;  1VQL T;  1K9M C;  2KY9 A;  3BFM A;  4PFP A;  3KXT A;  1OQK A;  4M75 A;  1VUB A;  1UGP B;  2RJE A;  2K9G A;  1Q95 G;  1TUG B;  2E70 A;  3J80 E;  3I56 Q;  1JRI A;  3E9F A;  5GMK i;  1W4S A;  4J9C A;  3OYN A;  3MP1 A;  3J7A F;  1AWW A;  2E3H A;  3QUI A;  1YWO A;  2AZV A;  9ATC B;  2CP7 A;  1DJ7 B;  2RD1 A;  3MO8 A;  4FL6 A;  4OMM A;  2K3Y A;  3CMA Q;  5CKB A;  4L59 A;  1MNE A;  2JN0 A;  4IUP A;  5CQX A;  3CCQ T;  3PIP A;  4P5N A;  4AG1 C;  2DBK A;  2RHX A;  2YRD A;  3TQ7 P;  3A98 A;  5L23 A;  4DBH A;  4IIO A;  4C5E A;  3RER A;  4F7U A;  2HBW A;  5CKF A;  3GBQ A;  5IN1 A;  1U1T A;  3HFN A;  3RDV A;  5DY9 A;  1RAE B;  3X25 B;  4NOY A;  4HCK A;  2VWF A;  5GAM d;  3QJY A;  2K4Y A;  4RG2 A;  3EGX A;  1EIF A;  2D1X A;  1IO6 A;  1YJW A;  2CDT A;  3MEU A;  4AFZ C;  1OX9 A;  1Q86 U;  1PD1 A;  2O31 A;  2LT1 A;  1NLP C;  3WVE B;  1SHG A;  1GFD A;  2COY A;  2K57 A;  2HCK A;  4RMO A;  3SFM A;  1U8R A;  1XQH A;  1EFN A;  3SB2 A;  1JQQ A;  1N8R U;  4C0Z A;  1AOJ A;  3OYA A;  3FJP A;  2CKK A;  1D0X A;  4IUR A;  4N4H A;  3CME Q;  2M16 A;  2AK5 A;  3PTA A;  2RQW A;  4FIB A;  2EAY A;  2XK0 A;  2KRS A;  3HP9 A;  4QKU A;  1RAH B;  2OX7 A;  3CCE A;  3QG1 A;  2L0A A;  1YHQ A;  2YXY A;  3EH2 A;  1UG1 A;  1KD1 R;  4C8Q F;  4ZGJ B;  1RUW A;  2JW4 A;  4HVW A;  3CCM A;  2GNC A;  1VIF A;  3HHT B;  4M78 A;  3CC7 T;  2OJ2 A;  3REA B;  4D8D A;  5CO7 A;  2JOY A;  1YWP A;  3CBM A;  4XU0 A;  1Y7X A;  4WTO B;  2JTE A;  1BU1 A;  4C92 F;  4M75 C;  1D3B B;  1UTI A;  1NBE B;  1D0Y A;  2ZPE B;  4GBQ A;  1TS9 A;  1BIB A;  3HFO A;  1X01 A;  3NGP A;  4EMK A;  4JRI A;  4BB7 A;  3MKD A;  2HEQ A;  3OYB A;  1TWB A;  3RNJ A;  2DL3 A;  1X6O A;  3M0U A;  2NLU A;  1G3W A;  4B9X A;  3LX7 A;  1MV3 A;  4EIK A;  4OB0 B;  4RTY A;  5KYU B;  1QWE A;  3OYG A;  1Q7Y R;  1Q81 U;  3CCJ T;  2V8J A;  1YJ9 T;  1VQM A;  2J06 A;  1VQP Q;  3G4S T;  1VIE A;  2DNU A;  3L42 A;  1WHG A;  5LJ5 g;  4PJO G;  1RI0 A;  1BI1 A;  1BKB A;  1WGS A;  5CCA A;  1D1A A;  5GMK l;  2CP6 A;  2VXF A;  3OMC A;  3LW5 E;  1I5L A;  3V7S A;  3HTR A;  2YDL A;  3HL8 A;  3EFO B;  4F17 A;  3A8H B;  2FRY A;  1KC8 R;  4M75 B;  5GAN 7;  2JTM A;  1UJ0 A;  1KJW A;  4K11 A;  1WHM A;  4ZNX A;  5I11 A;  3OYJ A;  5IH2 A;  2A28 A;  2QEX Q;  1H92 A;  1BK2 A;  3QO3 A;  4KH0 B;  3CCV Q;  1IGQ A;  5LJ5 e;  1V1C A;  2M51 A;  4CC3 A;  2GQV A;  3JCM f;  5GMK e;  1IXD A;  3VS6 A;  3LGL A;  3BDU A;  2DXC A;  5KYY A;  1VQ9 A;  3OW2 S;  1MHN A;  4KGX B;  2KXD A;  4JJB A;  4Y92 A;  4BE0 A;  2BZ8 A;  2M0Y A;  1VQ7 T;  4BY6 C;  4V2S A;  2KQW A;  3TCJ A;  1QMC A;  1JJ2 P;  1YIT T;  1WHL A;  4BE2 A;  1QLY A;  4RCC A;  1BI3 A;  3OYM A;  3OB9 A;  3BE3 A;  2YRC A;  2IPO B;  3D7S B;  3LH5 A;  3VS7 A;  2EWN A;  2IG0 A;  2RI3 A;  2OTJ Q;  3JCM W;  1VQN A;  3I5R A;  1RLP C;  4MDX A;  4F7U B;  3H9N A;  3CC4 A;  1B3Q A;  3A8L B;  1BIA A;  4DBR A;  3REB B;  4PL6 A;  2RK1 A;  5LJ3 g;  2YT6 A;  2ROT A;  3AT1 B;  2EYX A;  1Q82 U;  3OY9 A;  3NPF A;  3R6O A;  3RBB B;  5FWC A;  2NUP B;  1PRM C;  5GAN d;  4KUI A;  3EGX B;  2RJC A;  1KD1 C;  2LC4 A;  1IHV A;  2OTL T;  3JCM Q;  3OYF A;  1NEB A;  2ZCF B;  5J39 A;  2W10 A;  4PJO A;  4M7A E;  1WLP B;  2MF2 A;  4M77 E;  2XI9 A;  4BI4 A;  1SSF A;  4C8Q G;  4FYW B;  4BY6 B;  2W0Z A;  3JV3 A;  1KK7 A;  1I1J A;  3QJ6 A;  4M7A D;  4M77 D;  1H3Z A;  1PD0 A;  1WZO A;  3CCR Q;  3CMA T;  2LMJ A;  1VQ8 Q;  4II1 A;  5GAM e;  1SRL A;  4C92 G;  2A7Y A;  4M75 F;  1OOT A;  3CCQ A;  1QVG P;  1EX4 A;  4DOV A;  2E6N A;  2A08 A;  2DBM A;  2O88 A;  1EZZ B;  1M1G A;  3HPW A;  1K0S A;  3QWY A;  2COW A;  3DB3 A;  2J6F A;  1YNZ A;  2LTO A;  2L89 A;  3JB9 D;  1VQ4 Q;  2XKO C;  4OB2 B;  2FZK B;  5KE3 A;  2E12 A;  1Q7Y C;  4TVR A;  3PMT A;  4HKE A;  3A8M B;  2ESW A;  4J7I A;  3EG9 A;  2DK3 A;  3HSB A;  4KH1 B;  2HL3 A;  1Y96 A;  2DE0 X;  4IUT A;  5CVI A;  2RI5 A;  2E1H A;  1D09 B;  2K7A A;  3PVQ A;  1NM7 A;  4IIM A;  4HXJ A;  2OAU A;  3NTK A;  2HNI A;  1O9S A;  3NMZ C;  1WDX A;  5EC7 A;  1O75 A;  2LJ1 A;  1X27 A;  3PGG A;  1KC8 C;  1K8A U;  2QQR A;  1T3S A;  2DTO A;  4F7U F;  1M90 R;  1E6H A;  3G7Z A;  2ZPB B;  3EH1 A;  4J8O A;  2L8D A;  3CME T;  5D6W A;  2L3R A;  4E7H A;  4LD6 A;  1M1K U;  4Z88 A;  2RJD A;  3M0R A;  5KH6 A;  5KYW A;  2DL8 A;  3THK A;  4Q5W A;  3DLM A;  1OV3 A;  1YJN Q;  2DF6 A;  2RI2 A;  3A8O B;  1N6A A;  2QGG A;  3L1A A;  2LZ6 B;  3CC7 A;  2LVM A;  3JCM c;  1WJS A;  1WHH A;  1T0H A;  2CZ6 B;  2JTF A;  1X2K A;  1SEM A;  4PJL A;  4N4I A;  1OEB A;  2AIR B;  2AKL A;  3U23 A;  4OMF B;  3CCL Q;  1Z9Q A;  2MAM A;  3EFR A;  1V76 A;  1I8F A;  3NTH A;  5CKH A;  2RQR A;  1M4Z A;  2G6F X;  2A3L A;  4J6X A;  3CD6 Q;  1OPK A;  3PIO A;  3QKJ A;  1KQS S;  2LCS A;  5GAM j;  3BY7 A;  2X3W D;  4PJO C;  2DXB A;  3O8V A;  4LXC A;  1TXQ A;  2KAF A;  1KIK A;  2MK5 A;  4DOW A;  4AFU C;  1B7T A;  3FDR A;  1BCM A;  1MUZ A;  2GGR A;  4A53 A;  1ZBX A;  2RHY A;  1BI2 A;  3LLR A;  4J6Y A;  2EYY A;  1HYO A;  1I5O B;  2HD0 A;  2A36 A;  2XG8 D;  1MMA A;  4M78 F;  4EMG A;  4JS5 A;  4HA8 A;  2MYS A;  1N9R A;  1C1A A;  2LNV A;  4C0D C;  4XU2 A;  1YJ9 A;  3EGD A;  3G4S A;  1VQP T;  5FRO A;  2O9V A;  3S6W A;  2ZZD A;  4OB1 B;  1VQ5 T;  3C95 A;  1OUL A;  2RK2 A;  4D8K A;  1S1N A;  2CSQ A;  2HQE A;  2DIG A;  3MET A;  4DQ2 A;  5LL6 S;  2CUB A;  2YLB A;  3WXM B;  4C5G A;  4XTZ A;  5A0G A;  2K3X A;  2EJ9 A;  1RAA B;  2RM4 A;  2DX1 A;  4OMQ A;  2CZ1 B;  2QEX T;  4M75 G;  4RG8 A;  3MP8 A;  3TSZ A;  4RKU E;  4E7K A;  2EFI A;  3F70 A;  4PJO B;  2PZ1 A;  3JCM g;  3EFS A;  1ACM B;  2GQI A;  3OYC A;  1VQO T;  2G3R A;  2HQH A;  1IB8 A;  3HKS A;  3UAT A;  1VQ7 A;  4VUB A;  1BBZ A;  2DD4 A;  2C0O A;  3OSV A;  2Z0W A;  2FG0 A;  1YIT A;  4C0D B;  4GLK A;  3OBW A;  3I55 Q;  4M7D G;  2DZC A;  3LYI A;  4M77 A;  5GAN e;  1T3L A;  4OGC A;  3JCM e;  1G8X A;  2YUQ A;  4RTX A;  1M90 C;  3PT9 A;  2C0T A;  2DER A;  3VS2 A;  3CCS Q;  3VYH B;  3QYH B;  4RCB A;  4F7U G;  1SHF A;  4FW1 A;  2CP5 A;  1WXU A;  1JXO A;  4FYY B;  3PNW C;  1ZUU A;  1ABO A;  3EG9 B;  5I2M A;  2P4R A;  2A37 A;  1Y96 B;  1IGU A;  3SHW A;  2DA9 A;  2OTL A;  4LD9 K;  1VQK Q;  3NFC A;  2FHD A;  4F16 A;  4J9E A;  5CQY A;  3MCA B;  4BUG A;  4C92 C;  2KGT A;  1B07 A;  1JJ2 A;  3CBP A;  3X28 B;  1S72 Q;  2DLP A;  3CXC S;  3V8J A;  4A4K A;  3GP8 A;  2E10 A;  2HKQ B;  2JMA A;  3VS1 A;  1TOV A;  5HK3 A;  1W2B P;  4E7I A;  2IVW A;  3MEA A;  2KMT A;  2KRM A;  1WXB A;  3P8H A;  2CH4 A;  1Q86 R;  2DMO A;  5GAM f;  2GCX A;  3VYG A;  2ED1 A;  1BCO A;  2RO0 A;  3M4Y A;  4ANJ A;  1NPR A;  5KYW B;  2VKN A;  4C8Q B;  2DTI A;  5CK9 A;  4X34 A;  2AKK A;  2PVD B;  4PJO F;  2J7I A;  1OYX A;  3UA6 A;  1Z9Z A;  3OQ5 A;  2QAS A;  1VQ4 T;  1X69 A;  2O2O A;  1N8R R;  1FMW A;  5FRN A;  2LCL A;  1CSK A;  4PFZ A;  1WXT A;  2F5K A;  3L2W A;  3I35 A;  1PWT A;  4DA4 A;  1AD5 A;  2QA4 Q;  4M78 G;  1VYT A;  5GAN 4;  4M7D A;  1D1C A;  1YI2 Q;  4C92 B;  5I21 A;  3X24 B;  4E7Z A;  3SWN A;  2RH2 A;  1PCX A;  1LNX A;  1TG0 A;  2VB6 A;  4A4H A;  1K73 R;  1X6B A;  2XIC A;  1YCS B;  4XTY A;  4FT2 A;  2DPP B;  5I22 A;  3UA7 A;  2H8H A;  2PTK A;  1QQJ A;  5GAN j;  5FLX E;  2WAC A;  1QVG A;  1R8O B;  1RAG B;  8ATC B;  1VQ6 A;  1QKX A;  3DB4 A;  3N5B B;  3QDF A;  1M2V A;  4J9I A;  3JCM b;  3CME A;  3OS5 A;  2KR3 A;  4LDW A;  3OYE A;  5CAI A;  4Y91 A;  1XTD A;  8AT1 B;  5GAO n;  1VA7 A;  3EAE A;  4BAC A;  3EGD B;  2YLC A;  3FJ5 A;  3CC2 Q;  2FVU A;  1FYN A;  2I0N A;  2JS2 A;  4KT0 E;  1YBY A;  1NE8 A;  2ABL A;  3RIR A;  5GAO p;  1QVG S;  1KQ2 A;  2ZPG B;  1YP5 A;  1KHI A;  3OSS C;  1BYM A;  2MOX A;  5C6S A;  5HK0 A;  4X1V A;  4EDU A;  3LWH A;  1ZA2 B;  1I07 A;  3H0F A;  1Q81 R;  3OYY A;  2K5I A;  3H41 A;  3A5Z B;  3CPW P;  2P0K A;  2KE9 A;  3CD6 T;  1GRI A;  3BW1 A;  2QAZ A;  1K73 U;  4O5V A;  4OB3 B;  3M5A A;  2SRC A;  5GAO q;  1MND A;  1W70 A;  2PUO B;  5HCK A;  4E6R A;  1PC0 A;  1AWX A;  2QTX A;  2LX7 A;  2FO0 A;  2QG9 B;  4CI0 C;  2P0Q A;  3MP6 A;  1VQP A;  2EQI A;  4C0G A;  1G5V A;  3NHN A;  1VQ5 A;  2QQA A;  2HAX A;  4Z89 A;  2XU8 A;  5GAO m;  5A2Q E;  1FMK A;  1RL2 A;  5FW9 A;  2DEU A;  2QXF A;  1SF9 A;  1D0Z A;  3GIB A;  2RMO A;  4XTU A;  2NUT A;  1N9S A;  1Q86 C;  3VRY A;  1JEG A;  1AEY A;  1UUE A;  2HDA A;  2KYB A;  2F2X A;  2QEX A;  4C5I A;  4JZ3 A;  2X9H A;  1N8R C;  4M7D C;  4C0F A;  3SD4 A;  3CCE Q;  3SWN C;  2RPN A;  4XQ3 A;  2BZY A;  1R0C B;  1WHJ A;  2J05 A;  2O4X A;  1VQO A;  1H3H A;  2E6Z A;  2DL5 A;  4C8Q E;  4J9F A;  2EYZ A;  1M5Q 1;  1E7O A;  1Q82 R;  4J5Y A;  1MMG A;  4IUU A;  1NG2 A;  3HRS A;  2FZC B;  1NLO C;  3V7R A;  5D7U A;  1K73 C;  4KGV B;  2JM9 A;  4MZT A;  2DM1 A;  4C8Q D;  3I55 T;  1W1F A;  2LCC A;  3CCU T;  3ZFJ A;  1V29 B;  4DEX A;  2KVQ G;  5D6X A;  5GAN f;  3ZEH A;  4XU1 A;  3M57 A;  1JXM A;  1NYF A;  4BD3 A;  4JRQ A;  1X75 C;  3VUZ A;  2CZ0 B;  2F69 A;  1K76 A;  4NL2 A;  1QKW A;  2QQS A;  1ZSZ A;  2X51 A;  2EKH A;  4M7D B;  1FX7 A;  3M58 A;  4R56 A;  3SWN B;  1YFN A;  4OML A;  3JCM J;  2CT4 A;  4BDZ A;  1VQM Q;  2RHU A;  3QZ9 B;  4M77 F;  3ASK A;  1OI1 A;  2B86 A;  3JB9 I;  1C6V X;  2PUK B;  2K2M A;  4LN2 A;  4PLI A;  2HMA A;  4JDS A;  2VUB A;  1M2O A;  1SSH A;  1Q81 C;  3GNF B;  1WPY A;  1M2V B;  4R55 A;  5A0D A;  1VQL A;  2HQX A;  3GNG A;  4L6V 5;  1KHC A;  3IQL A;  2RHI A;  4M78 C;  5GAM g;  2H3E B;  2EQJ A;  2MWO A;  2EPD A;  2HBP A;  2DL4 A;  4QW2 A;  3SEM A;  3PVL A;  3I56 T;  1F1B B;  4J83 A;  1K8A R;  5FRM A;  1VQ9 Q;  1TTH B;  1VQ4 A;  3M0T A;  2ZPI B;  1ZQ1 A;  2HL5 C;  2FPF A;  3JSC A;  2XDD A;  3QII A;  4EMK C;  1M3A A;  1NJI U;  3MEV A;  1XJW B;  2LP5 A;  4RTZ A;  4ME7 A;  1M1K R;  5LJ3 h;  1PSF A;  1I0C A;  3EG3 A;  5AYF A;  4UC4 A;  2NUZ A;  1W2B A;  1K1Z A;  3VS4 A;  1VQN Q;  3V8K A;  1FWZ A;  2V1Q A;  4AMC A;  3CC4 Q;  3UDC A;  2PU9 B;  1CKB A;  2K3B A;  2DET A;  1G3S A;  2DL7 A;  1A0N B;  2JT4 A;  2JS0 A;  4M78 B;  3H8Z A;  5KCH A;  4LDX A;  4LDV A;  3C0C A;  4QT7 A;  1QWF A;  1W2B S;  4GLM A;  2V8I A;  2XDP A;  2L3S A;  3VJP A;  3CC2 T;  2KEA A;  4M7D F;  2JM8 A;  4QVC A;  1Q82 C;  2FPE A;  2EGE A;  5KE2 A;  2RA2 A;  3JCM X;  3AHU A;  1UGS B;  4OF1 A;  2GFU A;  2J6O A;  2YSQ A;  2M9U A;  4EMK B;  2LJ0 A;  2K6D A;  3MEW A;  4Y28 E;  1TUC A;  2VGM A;  2DRK A;  4WCI A;  2BUD A;  2E5K A;  4B9W A;  1HSQ A;  2EQU A;  4A4F A;  3EHR A;  3C4S A;  3OYI A;  1ZSZ C;  2EGC A;  2LQ8 A;  3A1P A;  4M75 E;  4PKC C;  1NJI C;  3CD6 A;  1WJQ A;  4NL3 A;  5D6Y A;  4ZN3 A;  3H0I A;  4JS4 A;  2L2P A;  4LDY A;  3TEE A;  3G71 Q;  1WI7 A;  3ER0 A;  1TUD A;  1FXX A;  4M75 D;  4GY5 A;  1UEB A;  1ZUK A;  2JJ9 A;  4R0K A;  3OBY A;  3JRZ A;  2X4W A;  5CIU A;  2E41 A;  3S3N A;  2P0P A;  4JPB W;  3VUB A;  3VS0 A;  4M7A G;  4M77 G;  3JCM V;  5GAN 5;  5GAN 6;  2ZPH B;  4DEY A;  4J9D A;  4CRI A;  4XK8 E;  2QTV A;  3VRZ A;  4RTV A;  1OU8 A;  5KYY B;  1M8V A;  3PMI A;  1AVZ C;  1CKA A;  3CPW A;  4RTT A;  4F7U E;  1KG1 A;  1JU5 C;  1ZSZ B;  2VYT A;  2V8K A;  1NZ9 A;  3P8D A;  2CP3 A;  4FW2 A;  1N27 A;  2E4H A;  3JB9 G;  3J81 E;  2R5M A;  1GFC A;  1K8A C;  2YUO A;  3GLX A;  4AFS C;  3FIF A;  3OA6 A;  2DVJ A;  1HXD A;  3CCJ A;  2QI2 A;  3P8B B;  1NYG A;  5CKE A;  4BI8 B;  3CPW S;  4ESR A;  3PE0 A;  2D6F A;  1ARK A;  1LOJ A;  2ATC B;  2M1H A;  3UT1 A;  4EMH A;  1M1K C;  2ZGW A;  3X20 B;  5J26 A;  2YWW A;  1LJO A;  2K5L A;  1MGQ A;  2QDL A;  3I9Q A;  3Q1J A;  3I55 A;  4CC2 A;  1ZX6 A;  1WJR A;  1NEG A;  5ECA A;  3CCU A;  1OZ2 A;  3EG0 A;  3OW2 P;  1RAD B;  2MI6 A;  5GAN g;  1UE9 A;  3UF4 A;  3CCV T;  2I2L A;  4KUD K;  1UGQ B;  4Z02 A;  2PNI A;  2CSI A;  2CS7 A;  2KI7 A;  3JCM P;  1QW1 A;  2A0F B;  2DAQ A;  4MMK A;  5GAN 3;  4FU6 A;  1QP3 A;  1UEC A;  2VC8 A;  3M4G A;  1H8K A;  5L8R E;  1YJ9 Q;  2JVV A;  4M7A A;  2MMP A;  5KYX A;  3C12 A;  2X3X D;  2C06 A;  1K9M U;  2OTJ T;  1X43 A;  2D9T A;  4NS5 A;  4ZN1 A;  2M02 A;  3V8L A;  1ZUY A;  3QSU A;  3VKI A;  3MJX A;  3TVT A;  2COZ A;  4FT4 A;  3QXE B;  2CGH A;  1P92 A;  1U06 A;  2EKO A;  2DIQ A;  1RAC B;  1PSE A;  3LGF A;  1MV0 B;  1AWO A;  2DJZ A;  3G6E Q;  3I56 A;  1JO8 A;  2RNA A;  5IHN A;  2Y4X A;  1X6G A;  1VQ7 Q;  1AHJ B;  1SG5 A;  2LX9 A;  1T0J A;  2CYZ B;  5IHK A;  1VYV A;  3GOX A;  1ZBJ A;  2O01 E;  3O5Z A;  7AT1 B;  1YIT Q;  1W6X A;  2EGA A;  3CCR T;  3CMA A;  1YIJ Q;  2LDM A;  2X4J A;  1LPL A;  1VQ8 T;  3QWX X;  1GCP A;  1WQW A;  5LJ5 d;  2BKD N;  5EG2 A;  1JJ2 S;  2F2W A;  1WFW A;  4OMN A;  1MMD A;  4J9B A;  2FZG B;  1ZHI A;  4Z8A A;  2Y4Y A;  3GF5 A;  2RB6 A;  2E5Q A;  3EFO A;  2YRV A;  3RKW A;  1VYU A;  2DXT A;  3CPF A;  3M0P A;  2EYW A;  2CH4 W;  3X26 B;  4J9H A;  1OX8 A;  4FYX B;  2OTL Q;  3CC2 A;  3VS5 A;  1PHT A;  3EG2 A;  5GAO r;  1IRE B;  2DO3 A;  4O6J A;  4FM4 B;  2JUF A;  4AFQ C;  4RTW A;  2DTH A;  2ROL A;  3FC3 A;  3WVD B;  3JB9 H;  2HZY A;  2MIO A;  3LH0 A;  4MZM A;  1G83 A;  4FSX A;  1I81 A;  2KK4 A;  3ULR B;  2LJ3 A;  1G3Y A;  5FU6 C;  2XD0 A;  3L2R A;  4N4G A;  4N0A A;  5IXB A;  3RES A;  1U1S A;  4QQ6 A;  4HVV A;  4QVD A;  5FU7 C;  3G1J A;  4M7A C;  4LE9 A;  1RLQ C;  4JLG A;  4M77 C;  4DBF A;  3PFS A;  3G71 T;  1PNJ A;  2F2V A;  5LJ3 d;  4PJO E;  1YJN T;  1HJD A;  4BI3 A;  3L2Q A;  2KDS A;  2XDB A;  2BIV A;  4OP0 A;  5DM7 R;  4JLI A;  2NUP A;  1UGV A;  4JJN K;  4PJO D;  3QYG B;  1UDL A;  1WIE A;  1K0X A;  1KQS P;  2CZ7 B;  4XTV A;  3CCL T;  2PQW A;  1BI0 A;  2Y90 A;  4PJJ A;  1Y71 A;  3DKM A;  2CT3 A;  3KUF A;  2O9S A;  2QQ9 A;  3QDR B;  3FRN A;  5FU6 B;  3QPH A;  1GXI E;  2KBT A;  1UFF A;  2K79 A;  1TH7 A;  1VQ6 Q;  3BDL A;  5IXF A;  3OS2 A;  2VXE A;  1JB0 E;  2XID A;  3DLL A;  4OMO A;  2KNB B;  4IKF A;  1QCN A;  1ZSG A;  5FU7 B;  4M7A B;  4M77 B;  5KYX B;  3M53 A;  1YJW Q;  2GF7 A;  1XNI A;  1Y0M A;  4J6W A;  4JJC A;  4E7S A;  3S3O A;  3UWN A;  2KYM A;  4IUQ A;  1PRL C;  2EVR A;  1JBM A;  5GAO l;  3LWI A;  1Y07 A;  1ABQ A;  2QQB A;  4B6M A;  2R58 A;  2JNG A;  2VV5 A;  3E1S A;  1K4U S;  1LCK A;  2GFA A;  4HCZ A;  3MHX A;  1PKS A;  1WA7 A;  2EQM A;  3CCV A;  2DKG A;  2QDY B;  2VVK A;  3S3M A;  4ELY C;  1YHQ Q;  4BDY A;  3H0H A;  2WSE E;  4KUL A;  3URG A;  4RTU A;  2LRQ A;  1YN8 A;  1GBQ A;  1RAI B;  2EBP A;  4X9C A;  4KRT A;  2OAW A;  3I5S A;  1UHC A;  1WNL A;  1UB4 A;  1KQ1 A;  2FPD A;  2WSF E;  3CCM Q;  2IIM A;  2L3P A;  2CUD A;  2HSP A;  4PJM A;  3HRT A;  1VOM A;  4J7F A;  4MML A;  4N0A C;  5C0M A;  2EW3 A;  1HK9 A;  4FSS A;  3ZBD A;  4C92 E;  1VQ5 Q;  5HY6 A;  2OTJ A;  2VGN A;  1J3T A;  2HSE B;  4A63 B;  5GMK m;  2ED0 A;  4BE1 A;  5J3B A;  2AZS A;  1H64 1;  3SDZ A;  1KD1 U;  2AT1 B;  5IT9 E;  3CCS T;  5LJ5 h;  1IRX A;  1NJI R;  3OW2 A;  4C92 D;  2EIF A;  5GMK h;  3TSW A;  3EG1 A;  4L5G A;  4M4Z A;  3OYH A;  4QQG A;  1KSW A;  1MMN A;  4PNO A;  5DLQ E;  4MDW A;  1LVK A;  2FYK A;  3M0Q A;  3CXC P;  2BTT A;  3EHQ A;  3L2Z A;  1VQK T;  1QVF P;  5GAN 2;  4HT8 A;  1AT1 B;  1M27 C;  2KSS A;  4M7A F;  1WX6 A;  3G6E T;  2DFU A;  4HT9 A;  1VQO Q;  1S72 T;  3R6N A;  4HCB A;  2BE9 B;  4JRK A;  1B34 A;  1RAB B;  2KT8 A;  4ATO A;  3OS1 A;  3CCR A;  1YIJ T;  2ZPF B;  1VQ8 A;  3OMG A;  4FCY A;  2PVO B;  4ORZ A;  1ZA1 B;  2X4Y A;  3JB9 F;  3V7C A;  2ECZ A;  3ZL7 C;  3JAM E;  4LUE A;  2DXU A;  3UPU A;  1Q7Y U;  3KBG A;  4E7J A;  2DYI A;  3VV0 A;  1X2Q A;  2EYQ A;  2CP0 A;  4HVU A;  1UHF A;  2R5A A;  3CBO A;  4LUD A;  1YCY A;  2KRN A;  2LQK A;  4E2F B;  2DEQ A;  2QA4 T;  5GJV B;  1KC8 U;  2RQT A;  3JCM d;  1YI2 T;  1OZ3 A;  2R57 A;  4A4G A;  1U5S A;  4FYV B;  3INZ A;  3MPU B;  2XMF A;  4E7L A;  2V1R A;  2DZ9 A;  4F14 A;  5GAM h;  2E64 A;  4A4E A;  3OYK A;  2RF0 A;  2C0I A;  1GBR A;  5LJ3 e;  3CQT A;  5DLO A;  6AT1 B;  3FB9 A;  2GBQ A;  1VQL Q;  2ENM A;  3RR6 A;  2DVE A;  4X9D A;  2KT1 A;  3CEY A;  1AZG B;  1E6G A;  2OI3 A;  3FEO A;  4EPC A;  3G71 A;  1OU9 A;  1D1B A;  4QVZ A;  1AZE A;  1YJN A;  4PK4 A;  1PM3 A;  3OYL A;  5CKD A;  5LJ5 j;  1M3B A;  5GMK j;  2NUT B;  3VS3 A;  2DRM A;  5GAN 8;  4XTW A;  3M9Q A;  3RKY A;  2F5T X;  4CC4 B;  3CCL A;  1QCO A;  3NTI A;  2RJF A;  1C0M A;  3H6Z A;  3CCQ Q;  1K9A A;  1R0B G;  2P4T A;  2D0N A;  1M9S A;  1Y57 A;  2O4X B;  4JZ4 A;  2FRW A;  2EJF A;  1NPP A;  4ZGE B;  2MWP A;  1IZ6 A;  2EQK A;  2JMC A;  1VQ6 T;  2EJG A;  2SEM A;  1TU0 B;  2X4X A;  3OYD A;  2NWM A;  2E3I A;  4XU3 A;  3M54 A;  1YJW T;  4M7D E;  2K5F A;  3E9G A;  4C8Q A;  3E19 A;  1QP2 A;  2DIL A;  5KYN A;  2QK0 A;  4AT1 B;  2E65 A;  2RQV A;  4D6W A;  4ZTJ A;  1KQS A;  4M7D D;  2ZAE A;  4AG2 C;  2P84 A;  4XTX A;  1WYX A;  5M9O A;  4QQD A;  1PG5 B;  1U3O A;  4C92 A;  1M1F A;  2LNH B;  2FL7 A;  2CP2 A;  5LJ3 j;  2M0O A;  2YUP A;  2RQU A;  3GPL A;  2JXB A;  3RMS A;  1K9M R;  2WSC E;  2RHZ A;  3TRE A;  2RN8 A;  3KFV A;  1GCQ A;  2KXC A;  4E47 A;  1YHQ T;  2K2V A;  3CCE T;  3M55 A;  3FLG A;  1UJY A;  1ZLM A;  2JZ2 A;  1RI9 A;  1SRM A;  4F04 B;  5A0L A;  4KBM B;  1B34 B;  4MZP A;  1HD3 A;  2QYZ A;  1IHW A;  2L3Q A;  3CCM T;  3CC7 Q;  2CRE A;  1M90 U;  1SPK A;  3ME9 A;  3QBY A;  4OGE A;  1R77 A;  5IHI A;  2BZX A;  2LQN A;  2X35 A;  1AWJ A;  2D0Q B;  5HKC A;  2DYB A;  1WQ7 A;  5KCO A;  3RMQ A;  4JRP A;  1G3T A;  2VAS A;  3CCS A;  2MCN A;  3E2U A;  1FMV A;  5FWB A;  2LQW A;  3M0S A;  2PVG B;  1TSF A;  1QCF A;  4JJD A;  1XOV A;  3T9N A;  1M30 A;  1QVP A;  4M78 E;  2NYS A;  2DD5 A;  2V26 A;  1VQK A;  2B8A A;  1I4K 1;  3CCJ Q;  1PKT A;  1VQM T;  5GJW B;  2FB7 A;  3G4S Q;  3G6E A;  5LJ5 f;  3RKX A;  1WHK A;  3C94 A;  4KGZ B;  5GAN h;  1S72 A;  3QHS A;  4M78 D;  2GTO A;  1N5Z A;  4XAX B;  4C5H A;  2J6K A;  2D8J A;  4OVA A;  3JCM h;  4ZTF A;  3EGU A;  3L2V A;  1KFZ A;  3A8G B;  2BE7 D;  1YIJ A;  4LNP A;  3OS0 A;  1RAF B;  4PFO A;  2DJQ A;  5I2S A;  3HRU A;  3CCU Q;  1M3C A;  4IUV A;  4DBQ A;  2AHJ B;  5IAY A;  2YUN A;  1G2B A;  1D3B A;  2MPX C;  2L5Q A;  3M59 A;  2GTJ A;  4JUV A;  4A54 A;  4OMP A;  4LDU A;  4C8Q C;  2H3J A;  1VQ9 T; 
#chains in the Genus database with same CATH homology
 1Q81 C;  3L2U A;  3L1A A;  3CXC A;  3GNF B;  1TH7 A;  3CC7 A;  2LVM A;  3JCM c;  1QVF A;  1WJS A;  3BDL A;  3JB9 J;  2JTF A;  1WPY A;  2CZ6 B;  2VXE A;  4YTL A;  1JB0 E;  5A0D A;  4R55 A;  3OS2 A;  2HQX A;  2XID A;  4N4I A;  3DLL A;  3TU4 K;  1VQL A;  2QA4 A;  3GNG A;  4IKF A;  4L6V 5;  1KHC A;  4OMF B;  5FU7 B;  2RHI A;  2YHT A;  1YI2 A;  3M56 A;  2MAM A;  4M7A B;  4ELZ C;  4M78 C;  3EFR A;  5GAM g;  4M77 B;  3M53 A;  2EQJ A;  1I8F A;  3NTH A;  2GF7 A;  3RUX A;  1XNI A;  2MWO A;  5CKH A;  1M4Z A;  4J6W A;  2A3L A;  4J6X A;  2HBP A;  4QW2 A;  3PIO A;  2XHC A;  3QKJ A;  1VQN T;  4PJO B;  5CR2 A;  3I56 T;  3S3O A;  1KQS S;  3UWN A;  4J83 A;  4IUQ A;  5FRM A;  5GAM j;  4HCC A;  1QVF S;  1VQ4 A;  3BY7 A;  4WF2 A;  3CC4 T;  4PJO C;  2ZPI B;  2DXB A;  1ZQ1 A;  3O8V A;  4PLL A;  2KAF A;  3JSC A;  4ZGD B;  4DOW A;  1JBM A;  5GAO l;  2XDD A;  1Y07 A;  3LWI A;  3FDR A;  2QQB A;  3QII A;  4EMK C;  2LT4 A;  3VU3 C;  1UGR B;  5LJ3 f;  4A53 A;  3QZ5 B;  1ZBX A;  2R58 A;  1BI2 A;  2RHY A;  3LLR A;  3MEV A;  4J6Y A;  1NJI U;  2JNG A;  2KY9 A;  1K9M C;  2HD0 A;  2XG8 D;  2VV5 A;  3BFM A;  3E1S A;  4M78 F;  4ME7 A;  3KXT A;  4EMG A;  4M75 A;  5LJ3 h;  1VUB A;  4JS5 A;  1UGP B;  4HA8 A;  1N9R A;  2LNV A;  1PSF A;  5AYF A;  2GFA A;  2RJE A;  4C0D C;  4XU2 A;  4HCZ A;  3MHX A;  1YJ9 A;  3G4S A;  1VQP T;  5FRO A;  2EQM A;  4UC4 A;  2E70 A;  3CCV A;  1W2B A;  2DKG A;  2QDY B;  3S6W A;  3S3M A;  2ZZD A;  3V8K A;  1FWZ A;  4OB1 B;  3J80 E;  3C95 A;  1VQ5 T;  2RK2 A;  4ELY C;  1JRI A;  4BDY A;  2HQE A;  3E9F A;  2DIG A;  3MET A;  3UDC A;  5GMK i;  1W4S A;  2WSE E;  3OYN A;  2PU9 B;  4KUL A;  3URG A;  2LRQ A;  3MP1 A;  3J7A F;  4DQ2 A;  3QUI A;  5LL6 S;  2YLB A;  3WXM B;  4C5G A;  4X9C A;  1DJ7 B;  4XTZ A;  1G3S A;  1WNL A;  5A0G A;  1UB4 A;  1KQ1 A;  2RD1 A;  2K3X A;  3MO8 A;  4FL6 A;  2WSF E;  4M78 B;  5KCH A;  3H8Z A;  2EJ9 A;  4LDX A;  4LDV A;  2K3Y A;  2RM4 A;  5CKB A;  1W2B S;  3HRT A;  2V8I A;  4L59 A;  2CZ1 B;  4J7F A;  4MML A;  2QEX T;  2XDP A;  2JN0 A;  4M75 G;  4RG8 A;  3VJP A;  4N0A C;  5C0M A;  3CC2 T;  4M7D F;  4IUP A;  3MP8 A;  5CQX A;  3CCQ T;  3PIP A;  4RKU E;  4E7K A;  2EFI A;  1HK9 A;  4P5N A;  3ZBD A;  3F70 A;  4C92 E;  5HY6 A;  4QVC A;  1Q82 C;  2RHX A;  3JCM g;  5KE2 A;  2VGN A;  2RA2 A;  3EFS A;  2OTJ A;  3JCM X;  5GMK m;  3AHU A;  1UGS B;  3OYC A;  4OF1 A;  4BE1 A;  4C5E A;  2GFU A;  5J3B A;  4EMK B;  2M9U A;  4F7U A;  1H64 1;  5CKF A;  3SDZ A;  1VQO T;  3RER A;  2G3R A;  5IN1 A;  1KD1 U;  1U1T A;  3HFN A;  5IT9 E;  3HKS A;  3CCS T;  5DY9 A;  3MEW A;  5LJ5 h;  3OW2 A;  4Y28 E;  1VQ7 A;  2VGM A;  4VUB A;  2EIF A;  2DD4 A;  4C92 D;  3X25 B;  5GMK h;  4NOY A;  3OSV A;  4L5G A;  1YIT A;  2BUD A;  4C0D B;  4GLK A;  4B9W A;  5GAM d;  2EQU A;  3OBW A;  3QJY A;  3OYH A;  4QQG A;  4PNO A;  2K4Y A;  5DLQ E;  4M7D G;  4A4F A;  4MDW A;  2DZC A;  3LYI A;  4M77 A;  1EIF A;  3C4S A;  4RG2 A;  2FYK A;  3OYI A;  5GAN e;  1YJW A;  3MEU A;  2LQ8 A;  4M75 E;  4PKC C;  1Q86 U;  1NJI C;  3L2Z A;  1VQK T;  3CD6 A;  1WJQ A;  4OGC A;  4NL3 A;  5GAN 2;  4HT8 A;  2KSS A;  2LT1 A;  5D6Y A;  3JCM e;  4M7A F;  3G6E T;  1M90 C;  3PT9 A;  3WVE B;  4ZN3 A;  4JS4 A;  4LDY A;  3TEE A;  4HT9 A;  3ER0 A;  1S72 T;  2K57 A;  1FXX A;  4HCB A;  3VYH B;  4RMO A;  3QYH B;  4RCB A;  3SFM A;  1U8R A;  1XQH A;  4F7U G;  4M75 D;  4GY5 A;  4JRK A;  1UEB A;  3SB2 A;  1N8R U;  1B34 A;  3PNW C;  4C0Z A;  3OBY A;  3JRZ A;  2X4W A;  3OYA A;  5I2M A;  3FJP A;  3OS1 A;  4ATO A;  3CCR A;  1YIJ T;  5CIU A;  2E41 A;  2ZPF B;  2CKK A;  1VQ8 A;  3OMG A;  4IUR A;  4N4H A;  2PVO B;  3S3N A;  1Y96 B;  2M16 A;  2P0P A;  3VUB A;  3PTA A;  4FIB A;  2OTL A;  2X4Y A;  2EAY A;  4LD9 K;  3JB9 F;  3V7C A;  4M7A G;  2XK0 A;  3NFC A;  4M77 G;  3HP9 A;  2FHD A;  3JCM V;  5GAN 5;  3JAM E;  5CQY A;  3UPU A;  2DXU A;  3MCA B;  5GAN 6;  3KBG A;  4BUG A;  4C92 C;  2ZPH B;  1Q7Y U;  3CCE A;  3QG1 A;  4E7J A;  1YHQ A;  3VV0 A;  2EYQ A;  1JJ2 A;  3CBP A;  3X28 B;  4C8Q F;  4CRI A;  2R5A A;  3CBO A;  3CXC S;  3V8J A;  4XK8 E;  4A4K A;  4ZGJ B;  3GP8 A;  1M8V A;  2E10 A;  1YCY A;  3PMI A;  3CPW A;  4F7U E;  5HK3 A;  1KG1 A;  4E7I A;  2IVW A;  3CCM A;  3MEA A;  3HHT B;  1VIF A;  2KMT A;  4M78 A;  3CC7 T;  3P8H A;  2LQK A;  2VYT A;  2DEQ A;  2V8K A;  5CO7 A;  1NZ9 A;  3P8D A;  3JB9 G;  1N27 A;  2JOY A;  2QA4 T;  3CBM A;  3J81 E;  1KC8 U;  4XU0 A;  2R5M A;  1Y7X A;  1K8A C;  3JCM d;  1YI2 T;  1OZ3 A;  2R57 A;  4A4G A;  3GLX A;  4C92 F;  3FIF A;  5GAM f;  3OA6 A;  2GCX A;  3VYG A;  1HXD A;  3INZ A;  4M75 C;  4E7L A;  1D3B B;  3CCJ A;  2DZ9 A;  2RO0 A;  3M4Y A;  2QI2 A;  1NPR A;  2ZPE B;  3P8B B;  5CKE A;  4C8Q B;  2DTI A;  5GAM h;  2E64 A;  4A4E A;  4BI8 B;  5CK9 A;  3CPW S;  2D6F A;  1BIB A;  3HFO A;  1X01 A;  4X34 A;  4EMK A;  2PVD B;  1LOJ A;  4PJO F;  3OYK A;  4JRI A;  4BB7 A;  1OYX A;  1VQ4 T;  2M1H A;  3OQ5 A;  3UT1 A;  4EMH A;  5FRN A;  3OYB A;  2LCL A;  5LJ3 e;  1M1K C;  2ZGW A;  3X20 B;  5DLO A;  5J26 A;  1LJO A;  1X6O A;  2K5L A;  2F5K A;  3L2W A;  1MGQ A;  2NLU A;  3FB9 A;  1G3W A;  4DA4 A;  3Q1J A;  4B9X A;  3LX7 A;  3I55 A;  4M78 G;  1WJR A;  2DVE A;  4X9D A;  5GAN 4;  4M7D A;  4OB0 B;  4C92 B;  5I21 A;  3X24 B;  3CCU A;  1OZ2 A;  3SWN A;  2RH2 A;  3CEY A;  3OYG A;  1Q81 U;  3CCJ T;  2V8J A;  1YJ9 T;  1LNX A;  2MI6 A;  4A4H A;  3G4S T;  1VQM A;  5GAN g;  1VIE A;  2XIC A;  3CCV T;  2I2L A;  3L42 A;  3FEO A;  5LJ5 g;  1UGQ B;  4Z02 A;  4PJO G;  4EPC A;  3G71 A;  4XTY A;  4KUD K;  1RI0 A;  4FT2 A;  2DPP B;  4QVZ A;  2CS7 A;  1YJN A;  1BI1 A;  1BKB A;  3OYL A;  1WGS A;  5GAN j;  5CCA A;  5FLX E;  5CKD A;  3JCM P;  1QW1 A;  5LJ5 j;  5GMK l;  2VXF A;  3OMC A;  3LW5 E;  1I5L A;  3V7S A;  5GMK j;  2WAC A;  1QVG A;  3HL8 A;  1R8O B;  5GAN 8;  1VQ6 A;  3A8H B;  2DAQ A;  3DB4 A;  3N5B B;  4MMK A;  4XTW A;  4FU6 A;  3JCM b;  3OS5 A;  3M9Q A;  5GAN 3;  3RKY A;  3CME A;  4LDW A;  4M75 B;  5GAN 7;  3OYE A;  1QP3 A;  2VC8 A;  4Y91 A;  5CAI A;  1XTD A;  2JTM A;  5GAO n;  2F5T X;  3CCL A;  3M4G A;  3EAE A;  5L8R E;  3OYJ A;  3NTI A;  4BAC A;  2JVV A;  2RJF A;  4M7A A;  2YLC A;  2MMP A;  2FVU A;  3QO3 A;  3C12 A;  3H6Z A;  5LJ5 e;  2C06 A;  2GQV A;  3JCM f;  5GMK e;  1K9M U;  2OTJ T;  2P4T A;  4KT0 E;  1YBY A;  3LGL A;  1M9S A;  1NE8 A;  3BDU A;  3RIR A;  2DXC A;  5GAO p;  2O4X B;  1QVG S;  2D9T A;  3OW2 S;  4NS5 A;  1VQ9 A;  1KQ2 A;  2ZPG B;  1MHN A;  4ZN1 A;  1KHI A;  2EJF A;  1NPP A;  3V8L A;  4ZGE B;  4BE0 A;  3OSS C;  2MWP A;  1IZ6 A;  2EQK A;  1VQ7 T;  1VQ6 T;  3QSU A;  2EJG A;  1BYM A;  4BY6 C;  4V2S A;  3VKI A;  2KQW A;  5C6S A;  3TCJ A;  5HK0 A;  4EDU A;  3LWH A;  1YIT T;  4BE2 A;  4RCC A;  1BI3 A;  2X4X A;  3OYM A;  3OYD A;  4FT4 A;  3OB9 A;  3QXE B;  2CGH A;  1P92 A;  2K5I A;  2EKO A;  3OYY A;  3A5Z B;  2DIQ A;  4XU3 A;  3M54 A;  1YJW T;  2P0K A;  4M7D E;  1PSE A;  2EWN A;  3LGF A;  2IG0 A;  3CD6 T;  2RI3 A;  2K5F A;  3E9G A;  4C8Q A;  2DJZ A;  3JCM W;  1VQN A;  3E19 A;  3I56 A;  4MDX A;  1QP2 A;  3BW1 A;  4F7U B;  1K73 U;  4O5V A;  3CC4 A;  4OB3 B;  3M5A A;  2E65 A;  4D6W A;  5GAO q;  3A8L B;  4ZTJ A;  1KQS A;  1BIA A;  4PL6 A;  2Y4X A;  4M7D D;  1AHJ B;  2LX9 A;  2RK1 A;  2PUO B;  2CYZ B;  1VQL T;  5LJ3 g;  4XTX A;  3GOX A;  2O01 E;  1Q82 U;  2QTX A;  5M9O A;  3OY9 A;  4QQD A;  3R6O A;  3CCR T;  3CMA A;  2LDM A;  2X4J A;  4CI0 C;  1VQ8 T;  2P0Q A;  1M1F A;  4C92 A;  2FL7 A;  5GAN d;  4KUI A;  1WQW A;  2RJC A;  2LC4 A;  1KD1 C;  5LJ5 d;  3MP6 A;  5LJ3 j;  1VQP A;  2OTL T;  3JCM Q;  2BKD N;  2M0O A;  3OYF A;  3GPL A;  5EG2 A;  4C0G A;  3RMS A;  1G5V A;  2WSC E;  2ZCF B;  1JJ2 S;  2RHZ A;  1VQ5 A;  3TRE A;  2QQA A;  5J39 A;  4PJO A;  2HAX A;  4M7A E;  2MF2 A;  3CCE T;  4M77 E;  2XI9 A;  4BI4 A;  2K2V A;  4E47 A;  1SSF A;  2XU8 A;  4C8Q G;  5GAO m;  1YHQ T;  5A2Q E;  1RL2 A;  3M55 A;  3FLG A;  2QXF A;  4BY6 B;  1ZHI A;  2JZ2 A;  5A0L A;  3GIB A;  2Y4Y A;  3GF5 A;  4XTU A;  4KBM B;  1B34 B;  4MZP A;  2RB6 A;  1N9S A;  1Q86 C;  2E5Q A;  2YRV A;  3RKW A;  3QJ6 A;  4M7A D;  2DXT A;  3CPF A;  4M77 D;  3CCM T;  1H3Z A;  3CMA T;  1M90 U;  3ME9 A;  3QBY A;  4OGE A;  4II1 A;  5GAM e;  3X26 B;  2QEX A;  4C5I A;  3CC2 A;  4C92 G;  2A7Y A;  4M75 F;  2X35 A;  5GAO r;  3CCQ A;  1IRE B;  2DO3 A;  1N8R C;  4O6J A;  4M7D C;  4FM4 B;  2JUF A;  2D0Q B;  4C0F A;  4DOV A;  2DTH A;  2E6N A;  3SD4 A;  3SWN C;  5HKC A;  1M1G A;  1WQ7 A;  4XQ3 A;  5KCO A;  3FC3 A;  3WVD B;  3JB9 H;  3RMQ A;  3HPW A;  4JRP A;  2O4X A;  1VQO A;  1G3T A;  2E6Z A;  4C8Q E;  3DB3 A;  3LH0 A;  2LTO A;  2L89 A;  3JB9 D;  1M5Q 1;  4MZM A;  2XKO C;  3CCS A;  4FSX A;  4OB2 B;  1I81 A;  5KE3 A;  2KK4 A;  2E12 A;  4J5Y A;  1G3Y A;  4IUU A;  1Q7Y C;  4TVR A;  2PVG B;  3HRS A;  3PMT A;  3V7R A;  4HKE A;  3A8M B;  5FU6 C;  4J7I A;  1K73 C;  4MZT A;  2DK3 A;  2XD0 A;  3L2R A;  4N4G A;  4N0A A;  1XOV A;  4C8Q D;  3I55 T;  3HSB A;  3T9N A;  2LCC A;  1Y96 A;  1QVP A;  4IUT A;  5CVI A;  4M78 E;  3RES A;  2RI5 A;  3CCU T;  2DD5 A;  2E1H A;  3ZFJ A;  1V29 B;  1U1S A;  1I4K 1;  2B8A A;  2KVQ G;  1VQK A;  4QQ6 A;  4QVD A;  1VQM T;  5D6X A;  2FB7 A;  5FU7 C;  5GAN f;  3G6E A;  2OAU A;  3NTK A;  3ZEH A;  2HNI A;  1O9S A;  5LJ5 f;  4M7A C;  4JLG A;  4M77 C;  3RKX A;  3PFS A;  3G71 T;  3C94 A;  4XU1 A;  1O75 A;  1S72 A;  5GAN h;  3M57 A;  3QHS A;  3PGG A;  5LJ3 d;  4M78 D;  1YJN T;  1KC8 C;  4BI3 A;  4PJO E;  1K8A U;  4XAX B;  4C5H A;  4BD3 A;  2QQR A;  4OVA A;  2DTO A;  4F7U F;  4JRQ A;  1X75 C;  3JCM h;  3VUZ A;  3L2Q A;  2CZ0 B;  4ZTF A;  2KDS A;  2F69 A;  2XDB A;  3G7Z A;  3L2V A;  2BIV A;  4OP0 A;  2ZPB B;  3A8G B;  4J8O A;  5DM7 R;  1YIJ A;  4JLI A;  4NL2 A;  2L8D A;  3OS0 A;  2QQS A;  4JJN K;  5I2S A;  4M7D B;  3CME T;  1FX7 A;  3HRU A;  3M58 A;  4PJO D;  3QYG B;  5D6W A;  2L3R A;  4R56 A;  4E7H A;  2CZ7 B;  4LD6 A;  3SWN B;  4XTV A;  3CCL T;  4IUV A;  1M1K U;  2AHJ B;  3JCM J;  2RJD A;  5IAY A;  2PQW A;  4BDZ A;  1BI0 A;  2RHU A;  3QZ9 B;  4M77 F;  2Y90 A;  3ASK A;  1D3B A;  1OI1 A;  2L5Q A;  3M59 A;  1Y71 A;  3DKM A;  5KH6 A;  3JB9 I;  2PUK B;  4Q5W A;  3DLM A;  3KUF A;  4PLI A;  4JUV A;  2QQ9 A;  3QDR B;  4JDS A;  3FRN A;  2VUB A;  4A54 A;  4LDU A;  4C8Q C;  2H3J A;  2RI2 A;  1VQ9 T;  5FU6 B;  3A8O B;  3QPH A;  1GXI E;  1N6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...