5KE2A

Crystal structure of setdb1 tudor domain in complex with inhibitor xst06472a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
207
Chain Sequence
ENLYFQGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SETDB1 Tudor domain in complex with inhibitor xst06472a
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Histone-lysine N-methyltransferase SETDB1
total genus 58
structure length 207
sequence length 211
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18358 Tudor_4 Histone methyltransferase Tudor domain
A PF18359 TUDOR_5 Histone methyltransferase Tudor domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A03
3P8DA 3QJ6A 5M9OA 4Z02A 2WACA 4CRIA 2BIVA 3H8ZA 3QBYA 3FLGA 3OY9A 2RJCA 2RHYA 2LRQA 4QQDA 5KCHA 3GOXA 4B9WA 3QKJA 1N27A 3OYHA 1RI0A 2RI3A 4BDZA 3UWNA 3MEAA 4C5IA 5IAYA 2K3XA 2MWPA 4N4HA 3CEYA 2FHDA 3LGLA 4GY5A 2X4XA 3S3NA 2VYTA 1WGSA 4NS5A 3OYKA 3S3OA 2RHXA 2DIQA 3OYMA 2QQSA 3UT1A 2K3YA 3O8VA 2NLUA 3ME9A 4BE0A 5KE2A 3NTIA 3LYIA 1MHNA 4E7KA 5J39A 2R5MA 2M0OA 4LD6A 2R5AA 3MP8A 5KCOA 1H3ZA 3OS0A 1OI1A 3OQ5A 3LX7A 4N4IA 3EAEA 2CKKA 2L89A 3LLRA 2IG0A 2XK0A 3FEOA 3OMGA 4BDYA 4E7HA 5D6WA 2L8DA 5KE3A 3DLMA 3MP6A 4A4FA 4C5GA 4BE1A 1OYXA 5C6SA 3OYLA 3OYGA 4E7JA 2RI2A 4QQGA 4IKFA 2GFUA 2QQRA 3OB9A 2HQXA 3ZEHA 4N4GA 4IUPA 4QQ6A 3L2RA 5CIUA 5IN1A 2JZ2A 2RJFA 3NTHA 4II1A 4BACA 4QVZA 4BD3A 4OVAA 4ZTJA 3PNWC 2LCCA 4UC4A 2HQEA 3LGFA 4QW2A 3E9GA 3S6WA 2O4XA 3SD4A 3OYNA 3OYFA 5FRNA 3L42A 2B8AA 2RI5A 1KHCA 2M16A 2LDMA 3OYBA 2GF7A 3NTKA 2BKDN 3OMCA 4C5EA 2RO0A 2F5KA 5D6YA 4IUTA 2X35A 3C4SA 4E7IA 5D6XA 3E9FA 2RHUA 1OZ2A 3BDLA 2EQKA 5FRMA 3OS1A 3PMTA 2EFIA 1WJQA 4PLIA 5FROA 4IUUA 4FL6A 3MP1A 3OYEA 3FDRA 2RJDA 5C0MA 4PLLA 2RHIA 2GFAA 3QIIA 3DB4A 2LVMA 2X4YA 3H6ZA 3L2VA 2EKOA 3META 4IURA 3ASKA 4PL6A 3OS2A 2LTOA 4A4HA 2JTFA 4IUVA 3L2QA 2P0KA 3OYDA 3PMIA 4E7LA 3LH0A 3OYCA 2RJEA 2XDPA 4FU6A 4HCZA 1XNIA 4RG2A 1WJRA 2BUDA 4EDUA 2G3RA 3MEVA 3S3MA 2EQJA 3OYAA 4A4GA 4BE2A 2PQWA 3OA6A 1SSFA 4Q5WA 3F70A 2EQUA 1G5VA 2O4XB 3KUFA 2R57A 1OZ3A 5J26A 1WJSA 3L2WA 4B9XA 3FC3A 3MO8A 3L2UA 3M9QA 3MEWA 2X4WA 2DIGA 4A4EA 2RHZA 2DAQA 2YRVA 5KH6A 4ZTFA 3DB3A 2M1HA 3PFSA 2MWOA 2R58A 2D9TA 4L59A 4C5HA 3OYJA 3MEUA 2E6NA 3OYIA 2L3RA 2EQMA 2E5QA 4IUQA 4X34A 3Q1JA 3P8HA
chains in the Genus database with same CATH superfamily
3UPUA 3CCVT 2VB6A 2WACA 3H8ZA 3G6EQ 2PTKA 5KCHA 2OTLT 5GAN2 1HYOA 4PJMA 1ZUKA 5AT1B 3HSBA 3X26B 2VYTA 1YJWQ 4WF2A 1TUDA 1VQMA 4XU3A 1YHQT 2LT1A 1CKAA 2LP5A 2M0OA 3ZBDA 1CKBA 1XQHA 3CCRT 3OS0A 3RESA 4N4IA 3N5BB 1YJ9A 5KYNA 4ZN3A 2JTMA 4Z88A 1V1CA 3HTRA 1KG1A 1IO6A 1T0JA 2LJ0A 1BIBA 2NUPA 2CUDA 2DLPA 3OB9A 5CKEA 1X27A 1EX4A 2DVJA 1QP3A 4OB2B 1H92A 4UC4A 1H3HA 5FRNA 3M53A 3HP9A 4JJDA 2F5TX 4D8KA 1PG5B 3C4SA 4DEXA 3D7SB 2O9VA 5CO7A 1UEBA 4IUUA 1Q7YU 2X4YA 2EKOA 2YT6A 4AMCA 2DX1A 1W6XA 2OX7A 2M02A 4IUVA 4E7LA 2FEIA 3VS6A 1UGQB 1OPLA 3P8BB 2KAFA 4BE2A 4XQ3A 1VQ6T 2PNIA 4FT4A 1Q82U 1GXIE 3I55Q 2AHJB 3GBQA 3J80E 5HKCA 1TSFA 1KQSA 2JUFA 2HL3A 2FRWA 2M0YA 3CCMT 2E6NA 1K9MC 1RAIB 2E5QA 3E19A 5GANh 5M9OA 4WCIA 5CKDA 2XMFA 2KSSA 1QCOA 2NYSA 2V8IA 4E7SA 2J6FA 1NJIC 4C0GA 2RH2A 4BDZA 3UWNA 4RCCA 1WHLA 4M77B 3CMAQ 5FU7C 2O9SA 2JW4A 1U8RA 2FPEA 4EPCA 1I81A 2ROTA 3LH5A 4DBHA 4FCYA 1LCKA 2JN0A 2C0OA 3RERA 3PTAA 1VQ7A 3FEOA 5L8RE 3KXTA 1VQ6Q 3H0HA 2FZKB 3G6ET 3OYLA 1M2OA 2JVVA 1WLPB 1GBQA 2CGHA 2KXCA 1M2VA 3OW2S 4OMPA 3I55A 2ZPIB 5LJ5g 1KJWA 3OYBA 1R0BG 2BZ8A 3I9QA 4LNPA 4GLMA 5GAMj 4PJLA 1BKBA 4J6WA 1WFWA 3M56A 5IH2A 3ZL7C 3G7ZA 3I55T 2CYZB 1YJ9Q 1D1CA 2CP7A 2KYBA 1B34B 2LQKA 1Q82R 3OYDA 3CCUA 4M77G 4RKUE 3GP8A 1WQWA 3LWHA 2DD4A 2K5IA 3EH2A 1M9SA 2E41A 1OPKA 1RACB 4ZGEB 2EQUA 2OTLA 1K0XA 3JCMb 5J26A 3URGA 3EHQA 3FC3A 5HY6A 4XTXA 3M58A 4PJOB 3CC4Q 4L59A 1TUGB 4XAXB 3UA6A 4ME7A 3V7CA 4RG8A 3EFSA 1Q86R 2BIVA 3JV3A 5GAMg 2J6KA 2GQVA 5GAOm 1MMNA 3O5ZA 1VQ9Q 5FWCA 4OB3B 2RK2A 2K4YA 1Y71A 3S3OA 1AZEA 4E2FB 1KK7A 2CUBA 2K3YA 2DXCA 4EMKB 1S1NA 4M77F 2E6ZA 5KYUB 1MGQA 3M0UA 6AT1B 2CP3A 4M7DA 2DEQA 2DO3A 3VS4A 3CCST 3MP6A 4BE1A 3EG9B 4AFZC 2RI2A 4OGCA 1YITT 2GNCA 2A37A 4RTXA 2RQVA 4O6JA 4ESRA 3CC4T 1QQJA 5HCKA 2PZ1A 3JCMe 1BI1A 4F7UE 3CMEA 4EMHA 2HNIA 3BDLA 2EQKA 1C0MA 1UHCA 1UHFA 3FJPA 5C0MA 5DLQE 3CCSA 2DBKA 3AHUA 3NHNA 3JCMV 3FB9A 5L23A 2L5QA 4M75F 4LUEA 3L1AA 2DL3A 3S3MA 3OYAA 3EGUA 1W2BS 1N8RC 4GBQA 2EJGA 1NPPA 1VQNA 2R57A 5GANj 2DFUA 3JCMW 3L2WA 1J3TA 2GGRA 2W0ZA 3G4SQ 1C1AA 1LOJA 3QG1A 3MEWA 8ATCB 3M59A 2CP5A 2LT4A 2MOXA 1UDLA 4PJOG 3CCLQ 1RAGB 2XKOC 4IUQA 1UGPB 2LJ1A 1P92A 3V7RA 4M77E 2LRQA 3VS3A 2YXYA 1UG1A 3GOXA 5GAMd 4AT1B 2K7AA 5GAMe 4E7ZA 4C8QC 2CSQA 2KK4A 1Q7YC 2DJZA 3OYMA 1ZSZC 1M90C 3NTIA 4E7KA 1QCNA 3A8OB 2X3XD 5GMKj 2HDAA 2VV5A 2BZXA 2O2OA 1JBMA 1IGQA 4J6YA 1K8AC 2EWNA 3A98A 4DOVA 5C6SA 2FPDA 4ZN1A 1AWXA 1W2BP 1YCSB 2JZ2A 1VQNQ 1JRIA 2KE9A 3I5SA 3L42A 3SWNA 4LE9A 2M16A 1Q81C 2QGGA 1VQOQ 2JNGA 2MCNA 3CXCS 2FL7A 4E7IA 1ARKA 3M0TA 2RHUA 1G3SA 4M7AG 1NEBA 2V8JA 2DK3A 1MMAA 2XHCA 3HHTB 3KBGA 2NWMA 4PL6A 1D1AA 1SPKA 3PMIA 1TH7A 5FLXE 1UFFA 4A4KA 4HVWA 2COZA 1FMKA 3RMQA 1SEMA 4J9BA 5LJ5h 1NG2A 4M78C 4BUGA 2E3HA 3SFMA 4BI4A 3JAME 4XU1A 5DM7R 2D1XA 3CCLT 4C92D 4RMOA 4R0KA 2DMOA 2MWOA 1NPRA 1K73U 1I8FA 3CBPA 4AG2C 1BB9A 3Q1JA 1W4SA 2K3BA 5IHIA 4VUBA 3KFVA 5A0GA 1NBEB 2A28A 3AT1B 2LCSA 3CC2T 3QYHB 1VYTA 1K4US 4Y91A 1X43A 2XG8D 4KUIA 2O88A 1N9RA 1WHHA 1VQOA 2QQAA 3O8VA 1MNDA 2AKKA 2QEXQ 2EPDA 5J39A 1FMVA 3A8GB 1Q81R 1IXDA 3MP8A 2EJ9A 2JJ9A 3PT9A 2DYBA 2DXTA 5CKHA 2CKKA 1K73R 1M4ZA 3MPUB 2AZSA 3MHXA 4AFSC 1K9MR 1RLPC 4DBQA 4A4FA 4J9FA 1M2VB 2CT4A 3H0IA 4N4GA 2YUQA 4QQ6A 3L2RA 3CCJQ 4II1A 1JB0E 1IGUA 1VQLQ 2LCCA 3CCQA 1H641 1KHCA 1BYMA 1JQQA 2RO0A 4E47A 3H0FA 2EFIA 2E3IA 3EGXA 1W70A 3T9NA 4PNOA 1EZZB 4FL6A 4PKCC 2OJ2A 3M54A 7AT1B 1T3LA 4Y28E 3G71Q 1SF9A 3M0RA 3ASKA 4PJOF 3CC4A 3OS2A 1PWTA 4RCBA 3OYCA 1UGSB 2KYMA 4EDUA 2GTOA 3A8MB 1JJ2S 3CCQT 1JU5C 2A0FB 3F70A 4Q5WA 4A54A 5GMKi 3X20B 1ABOA 4J9HA 1VQPT 1QKXA 5GAMf 4M7AE 2DPPB 2QTVA 3MKDA 1OQKA 1E6HA 2L3RA 2EQMA 2QGFB 4JZ4A 5GJWB 3QO3A 1WNLA 3CD6T 2K57A 1SRLA 3UDCA 2ATCB 1ZA1B 1VQOT 2FYKA 2ESWA 2DVEA 3OYKA 4M7AA 2KRNA 2EGAA 5KE2A 1M8MA 1VIFA 1R0CB 4V2SA 1YN8A 1OX9A 1TTHB 1QW1A 1PKTA 3GNGA 2ED0A 2JMCA 4DBRA 2OTJQ 5CQYA 5KE3A 2LQ8A 1VQLA 1K8AR 4J9GA 1VQMT 4E7JA 4IIOA 2OAWA 2CSIA 3M5AA 3HKSA 1G2BA 4IUPA 5IN1A 2QEXA 2P84A 2AIRB 3LGFA 5GANe 3S6WA 1IHWA 3OYNA 1UB4A 2PUOB 1B3QA 2X35A 4J8OA 2AKLA 3E9FA 2P4RA 4CC4B 2KEAA 1D3BA 2XDDA 2PVDB 3OYEA 2PVOB 4LDWA 1M3BA 3EH1A 4L6V5 3VKIA 1KQSS 1PD1A 4HXJA 1KQSP 3CCET 1M30A 5IHKA 2VWFA 3FIFA 2V1QA 2J06A 2JS0A 3OA6A 4OMFB 1PD0A 2GTJA 3TU4K 4L5GA 2HAXA 1VQ5A 3KUFA 3QPHA 2L2PA 1GFDA 2P0PA 3QXEB 3LWIA 2RK1A 2ZPBB 4HA8A 5IT9E 4X9DA 3TSWA 3JCMd 2L3SA 2CZ7B 4ZTFA 4HT9A 5A2QE 1YFNA 5GJVB 4ZGJB 2LX9A 4KH0B 4HCCA 3BFMA 4NOYA 1G3WA 2G6FX 4M7AC 3CCJT 5CKBA 1AWWA 1D3BB 1YJWT 2KGTA 2RD1A 1YWOA 4M77D 4MMLA 3CCMA 3TREA 2DILA 1GCPA 5LJ5d 1I5OB 2QYZA 2R5MA 4ELZC 1H3ZA 1Q81U 5CKFA 4KULA 1VUBA 2MYSA 1N5ZA 2CH4A 4D6WA 4EIKA 2XIDA 3I56A 1TOVA 5DY9A 2LNHB 4M75G 1M3AA 2RQUA 4JRKA 4J7FA 1ZHIA 5GAOn 3TEEA 1M3CA 4DBFA 3BW1A 3ZFJA 3E9GA 3QWXX 2L3PA 2ED1A 2C0TA 4M7AF 1Y7XA 1OOTA 1WA7A 3SEMA 5HK0A 3PGGA 3M0QA 1OZ2A 4J9EA 1KHIA 2VVKA 1M90U 4PJOC 4A63B 2RJDA 1X2QA 4M75D 2E10A 2V8KA 5KYXA 4JUVA 4AG1C 3M4YA 4KT0E 2WSCE 1NLPC 2X4JA 1G3TA 2JTFA 4FYYB 4Y92A 4YTLA 4JJNK 3V7SA 4MZTA 1QVGP 4MMKA 4KH1B 4RTVA 1VQNT 3EGXB 4QT7A 5KYUA 3FJ5A 1HJDA 4DEYA 1WHMA 2ROLA 1PRMC 1WPYA 1AWJA 4MDWA 1WHGA 1X6OA 3BDUA 2Y90A 1VQPA 4J6XA 1SKUB 3PFSA 2FG0A 3HL8A 3C94A 2EGEA 4OMLA 3VRZA 3LGLA 1ZUUA 2MPXC 3CMAA 3HRUA 1QVFP 2Z0WA 4D8DA 4C92F 3CCVA 2DL7A 3ULRB 1QVPA 1I1JA 2RI3A 4JJCA 2K3XA 2RQRA 3JCMJ 1YCYA 2DZ9A 4FYWB 4RTWA 4ELYC 1S72T 2QQSA 1WHJA 4O5VA 2NLUA 1SHGA 3R6NA 4B6MA 2CREA 2EKHA 1MV0B 3OW2P 3MCAB 1G83A 2YUNA 1PRLC 3PVLA 4LD6A 2XU8A 5A0LA 1X01A 2KQWA 4ATOA 4DA4A 2DJQA 1SSHA 3CCUQ 1TU0B 4HCBA 2QXFA 2JS2A 2KI7A 2JMAA 2EYXA 2GFUA 3ZEHA 2ZPEB 2RJFA 4BACA 1RAAB 2QAZA 2W10A 4RTTA 4PFZA 3QDFA 1MUZA 1T3SA 4EMGA 2VXEA 3U23A 2VGNA 3HFNA 2K5LA 3SWNC 3VS0A 1VQPQ 1KQ2A 2A08A 2DF6A 4KGZB 3OSSC 3OS1A 1Q82C 9ATCB 5AYFA 4XTYA 5FROA 1Q7YR 2BE9B 2RHIA 1B34A 2F2WA 3QUIA 2KVQG 4IURA 2DXUA 1M5Q1 3QSUA 4A4HA 3CBMA 1B07A 2IIMA 2YWWA 4M75E 1S72Q 2K5FA 4C0FA 2QA4T 4C0ZA 2QDLA 3EHRA 3M0SA 4KRTA 2G3RA 3PIPA 1JO8A 2IPOB 1SSFA 1N6AA 4M75A 4Z8AA 1VQ5Q 2WSFE 4OMOA 2XI9A 3CC2Q 2DKGA 4C0DC 1KC8C 1YHQA 3RIRA 1U3OA 2RM4A 3OYJA 8AT1B 3JCMh 1NYFA 2EVRA 1JJ2A 1EIFA 2E64A 4BE0A 4M7AD 1N8RU 1ZBJA 3QBYA 1WIEA 2M9UA 3H41A 1UTIA 4B9WA 1N27A 4XTZA 3RDVA 2FHDA 3EG2A 4QVDA 3UT1A 1AOJA 1X6BA 5GMKh 2AT1B 1MHNA 1LPLA 5KYXB 1QVFA 2PU9B 5EC7A 1D1BA 5GANf 1WQ7A 4BDYA 1QWEA 4C92B 1RAFB 2LCLA 3M0PA 3G4ST 4C5GA 3CXCA 3WVEB 2E5KA 3CMEQ 2CZ6B 3CCEQ 1WZOA 1VQKT 3V8KA 1GFCA 4R56A 4BD3A 2CDTA 4M75B 2J7IA 2HQEA 1VQ4T 2HBWA 4FYVB 4J9DA 2JM9A 3CCEA 3BE3A 4LDUA 5CQXA 1M90R 1I07A 5GANd 4PLIA 1ZBXA 3A1PA 3G4SA 2IVWA 2YRCA 2BTTA 3JB9H 1SRMA 2VUBA 4OMNA 2ZAEA 4JLGA 3LH0A 3PE0A 2E70A 4RG2A 1WJRA 4J7IA 4X1VA 2D0QB 3V8JA 1RL2A 5CAIA 3QJYA 2LQWA 1TUCA 1VQ9A 1GCQA 2EAYA 4C92E 1IHVA 4HVUA 4HKEA 4M7DF 4KBMB 2RN8A 5KH6A 3A8HB 5FU7B 2PVGB 3TQ7P 2MAMA 3OYIA 2L0AA 1QVGS 3QJ6A 1TWBA 1ZQ1A 1VQ9T 4BI3A 1QCFA 2KDSA 1M8VA 1HK9A 2RJCA 1OEBA 3QKJA 4M7DB 2BE7D 3EGDB 2WSEE 3I56T 2DRKA 1UJ0A 2P0QA 2YUPA 3LW5E 1QVGA 2D8HA 2GQIA 2QASA 1S72A 2MIOA 1WHKA 1K9AA 2LX7A 1BCMA 2O31A 4LD9K 1R8OB 4C8QG 1YHQQ 3HFOA 1X69A 1YBYA 4ANJA 1IB8A 2A36A 1H8KA 1RABB 3JB9D 1U5SA 1VQ4A 5GAN8 2HBPA 1VQKA 4AFQC 1T0HA 4M77A 2DRMA 1ZX6A 3OYFA 2O4XA 1O9SA 5CR2A 1NJIU 2PUKB 3RBBB 1KFZA 1MV3A 4QKUA 1XJWB 2F5KA 4MZPA 2NUPB 3OS5A 4P5NA 1UUEA 2GCXA 1YIJT 4FYXB 2KR3A 5IHNA 1PKSA 1TS9A 3MP1A 4E6RA 3OW2A 3DB4A 1K0SA 5LJ3e 3RKWA 2KBTA 4JRQA 4C92C 2KT8A 3CMAT 4PJOA 2QA4Q 3WXMB 2EQJA 1K76A 1MMDA 2PQWA 3EFRA 5GAN6 2DNUA 1WJSA 3HRTA 1VQ5T 2NUTA 3VV0A 5KYWA 1ZUYA 2KMTA 2VC8A 5GMKm 2D9TA 1Y07A 1SHFA 1OU9A 3RUXA 1A0NB 2ZPGB 2QQ9A 3ER0A 1IREB 2EQIA 1BBZA 2YLCA 3CC7A 3OYHA 3I56Q 2C06A 1KIKA 1G8XA 4J5YA 5LJ3j 3CC2A 1PSEA 3JB9I 4QVCA 3OBWA 1WGSA 1ZSGA 1YWPA 2HCKA 5IXFA 1K1ZA 3VYHB 2OTJA 3MJXA 4OF1A 1YJ9T 2J05A 1X6GA 2KT1A 3JCMg 1OX8A 2F2XA 2IG0A 2XK0A 1Y57A 2XICA 1BI0A 1V76A 2RA2A 4M77C 3GF5A 1IRXA 3L2ZA 2FB7A 1WXBA 1FMWA 3VUBA 4FM4B 3GNFB 5J3BA 1DJ7B 4DQ2A 3NPFA 4XTWA 5HK3A 1K73C 4ZNXA 2A7YA 1RI9A 3VYGA 2J6OA 1VA7A 2LDMA 3NTKA 3VS5A 1VQMQ 1NZ9A 3G71T 2FRYA 4JS4A 3CBOA 1WJQA 1QLYA 4F7UA 4JZ3A 4BI8B 1KQ1A 1D09B 1RAHB 2LVMA 4LDYA 1X75C 2FO0A 3VS2A 1KD1U 1VQKQ 3CMET 2D6FA 4FU6A 1XNIA 2K2VA 4OB1B 1YI2T 3HPWA 4FW2A 2HMAA 1G5VA 1X2KA 2K79A 2LJ3A 1U06A 1G3YA 1VOMA 2K6DA 1VQ8A 1D0YA 3JB9F 2DERA 3V8LA 3IQLA 3OYYA 4JPBW 4M7DD 2R58A 1N9SA 2RNAA 3SWNB 1W1FA 1ACMB 1GCQC 1W2BA 1E6GA 3P8DA 1ZA2B 4OGEA 3RKYA 2CP2A 3FLGA 5LJ5e 4PFPA 2RHYA 1D0ZA 1RI0A 2YLBA 2QI2A 4C5IA 5GAOl 2HZYA 1AT1B 4PK4A 5DLOA 2X4XA 4NS5A 2HL5C 2DIQA 1AHJB 1FWZA 1YNZA 2DETA 1FYNA 4LDXA 1UGVA 1BIAA 2R5AA 1U1SA 3NGPA 3VJPA 4XU2A 1QWFA 1F1BB 2CS7A 2MMPA 3OMGA 1VQ7Q 2H3JA 1C6VX 4F17A 2EBPA 3JB9J 1OYXA 1CSKA 1Q86U 3JSCA 1M1KR 1VQLT 4KGXB 4IKFA 2C0IA 2RB6A 2L3QA 4QVZA 4ZTJA 2QDYB 2JXBA 3SD4A 2GF7A 4C5EA 2KROA 1V29B 5D6YA 4IUTA 3SB2A 1Q86C 4F7UG 5GAOp 2D0NA 3M4GA 1ZLMA 3RNJA 3L2VA 3PIOA 3SDZA 5FU6B 1R77A 2XDBA 1GBRA 2RJEA 2XDPA 1VQ8Q 2BUDA 3MEVA 2QA4A 1Y96A 3CPFA 2QQBA 5FWBA 2X51A 4BY6B 3E2UA 4RTYA 1I4K1 5GAN5 4B9XA 3M9QA 3HRSA 1YIJQ 1LJOA 1JJ2P 4JS5A 5I11A 1JEGA 2VASA 4M78F 2NUZA 3QYGB 2P4TA 4M7DE 1PC0A 1YJNQ 1AVZC 4Z02A 3EFOA 2DYIA 2AZVA 2HD0A 2CT3A 3QWYA 4ORZA 3FRNA 1YI2Q 4KUDK 2DL8A 3JCMf 4EMKC 5IAYA 2MWPA 1WXTA 2MF2A 2K2MA 3J7AF 2YHTA 3REBB 3OBYA 5GAN4 3CC7Q 2FVUA 2NUTB 2QK0A 2KRMA 5KCOA 4K11A 1UECA 1NYGA 4LDVA 2LZ6B 1QKWA 2L8DA 4XK8E 3SHWA 1EFNA 3X28B 3VS7A 2MI6A 1VIEA 4QQGA 4M7DC 2DBMA 2HQXA 2ENMA 4Z89A 2YUOA 2F2VA 2QEXT 2E12A 3I35A 2LMJA 3CCUT 2BKDN 3G71A 1BK2A 3UA7A 3G6EA 4XU0A 2DD5A 4C0DB 5FRMA 3PMTA 1MMGA 3JCMc 4J9IA 2B86A 4TVRA 1MNEA 4PJJA 2VGMA 4LXCA 4XTUA 3VU3C 4C92A 2H8HA 2LC4A 4PJOE 1PM3A 4M7AB 1VQ6A 4ZGDB 5KYWB 4FT2A 1UE9A 3CCSQ 1KC8U 2DIGA 2JTEA 1AWOA 2DAQA 2CH4W 4CC7A 2OTJT 3CCVQ 1AEYA 2YRVA 1M1KC 4JDSA 4M4ZA 1Z9ZA 4C5HA 2HKNA 1SG5A 1RUWA 4MZMA 3C12A 1QVFS 1YJWA 2AK5A 3NFCA 4M75C 3CCJA 4PJOD 2E1HA 1IZ6A 1GL5A 3S3NA 3VUZA 3OSVA 2RHXA 3CCRQ 2V26A 2EIFA 4M78G 5LJ3h 1I5LA 4F04B 2HQHA 4WTOB 1FX7A 2ZPHB 3J81E 2RF0A 2LNVA 3RMSA 2Y4YA 3OQ5A 3LX7A 4HVVA 4E7HA 1NE8A 2YSQA 1OULA 5I21A 5GAOq 5D6WA 1BI2A 3JB9G 1HXDA 1YITA 2E4HA 2EGCA 3CQTA 3INZA 4C92G 2RQTA 2QQRA 2DXBA 5GMKl 4M78D 1K9MU 5KYYB 4HT8A 3CD6Q 4C8QF 5LJ5f 4OVAA 2SEMA 4OB0B 2Y4XA 1BI3A 4OMQA 3X24B 4F16A 3OMCA 4RTZA 1M1FA 4F7UF 1KD1R 1B7TA 3EG3A 1M1KU 2RMOA 5LJ5j 3H6ZA 4F7UB 2CP0A 3GPLA 5LJ3f 1QP2A 1WI7A 3M57A 4FW1A 2D8JA 1JXOA 1NJIR 2V1RA 2XD0A 4BY6C 4HCZA 2FPFA 2DTOA 2EYWA 2KXDA 2X3WD 4CI0C 1U1TA 5GAN3 4C8QE 1PNJA 4M7DG 1NM7A 3REAB 1XTDA 3DKMA 1WYXA 2X4WA 4A4EA 1M1GA 3A8LB 3EG9A 1WX6A 3JCMQ 1PSFA 2H3EB 2HSEB 3UATA 4JJBA 3H9NA 3CCLA 4F14A 3JCMX 2ECZA 3EG1A 4X34A 2ZZDA 3P8HA 1AZGB 1OV3A 4X9CA 4NL3A 1VYUA 3CC7T 1XOVA 2COWA 3OY9A 3TVTA 4QQDA 3CD6A 2YDLA 2HKQB 2DL5A 2ZCFB 1VYVA 5CCAA 3MEAA 1VQ7T 4C8QD 1LNXA 1YJNA 3WVDB 4JRIA 2CP6A 2FZCB 1PCXA 2DTIA 3ME9A 1ZSZA 3LYIA 1UGRB 4A53A 2DA9A 1E7OA 2GBQA 4RUGA 4J83A 1K8AU 1M27C 5I22A 5D7UA 3CCMQ 1FXXA 5EG2A 2X9HA 4JLIA 1I0CA 3THKA 2DM1A 1RAEB 5I2SA 4HCKA 5FU6C 3TSZA 1WXUA 5ECAA 4CC3A 2I2LA 5CIUA 2DTHA 1ABQA 2DZCA 3BY7A 4PJNA 4KGVB 4JRPA 2KRSA 4M78E 4QW2A 4IIMA 2B8AA 2RI5A 2O01E 3CCRA 2ZPFB 4DOWA 2EYZA 3GIBA 4M78A 2ZGWA 3EFOB 3CPWP 5LJ3d 5GAN7 3PVQA 4FSSA 1Q95G 2DE0X 4R55A 3QIIA 2OAUA 5GMKe 3META 4XTVA 5GANg 1YP5A 4PFOA 1QMCA 2LQNA 1KC8R 2CZ1B 2A3LA 3CPWS 2P0KA 2F69A 1RLQC 3QZ9B 3RKXA 4BB7A 4LUDA 2VKNA 3JRZA 4GLKA 1OZ3A 1YI2A 3C0CA 2JOYA 1JXMA 4N0AC 2ABLA 2RPNA 1ZSZB 2SRCA 3MO8A 5CK9A 3TCJA 3CCQQ 1Z9QA 3CPWA 1N8RR 3UF4A 2VXFA 1D0XA 2M1HA 4RTUA 1TG0A 2EYQA 3R6OA 3MEUA 3I5RA 3X25B 2QG9B 2CZ0B 5KYYA 3QZ5B 1TXQA 4CRIA 2K9GA 2EJFA 3E1SA 1KD1C 1LVKA 1HSQA 1YJNT 3QHSA 3CEYA 4N4HA 4GY5A 4EMKA 4LN2A 4OMMA 3A5ZB 1UJYA 4AFUC 3DLLA 1RADB 3C95A 3M55A 1GRIA 4FIBA 1AD5A 3EG0A 4M78B 1NLOC 1OI1A 2YRDA 3EAEA 3LLRA 2L89A 2EYYA 1BCOA 1Y0MA 3DLMA 2F1LA 3NMZC 2I0NA 3OYGA 3RR6A 2BZYA 4J9CA 2MK5A 1VQ4Q 2KNBB 1NEGA 2E65A 3NTHA 5LJ3g 1KSWA 4C8QA 3PNWC 2HEQA 3G1JA 4OP0A 2OTLQ 5D6XA 5A0DA 1Y96B 3FDRA 5CVIA 2KY9A 1YIJA 4PLLA 2DL4A 2GFAA 3VRYA 5IXBA 2LTOA 3QDRB 3L2QA 1YITQ 2JM8A 3VS1A 3JCMP 2EW3A 1BU1A 1PHTA 2FZGB 5GAMh 4NL2A 4A4GA 2OI3A 3EGDA 1WDXA 4N0AA 2O4XB 1HD3A 2COYA 2QTXA 2JT4A 2DEUA 4FSXA 3L2UA 4CC2A 1OU8A 2RHZA 5I2MA 5GAOr 3CXCP 5FW9A 1O75A 4C8QB 5LL6S 1VQ8T 3DB3A 2RQWA 3GLXA 4MDXA 2HSPA 2M51A
chains in the Genus database with same CATH topology
3UPUA 1W4SA 4M7DE 4VUBA 3CCVT 5A0GA 4Z02A 2WACA 3H8ZA 3QBYA 2HD0A 2M9UA 5KCHA 3CC2T 4B9WA 1N27A 3QYHB 4XTZA 3FRNA 4KUDK 4Y91A 2OTLT 3JCMf 4EMKC 5GAN2 5IAYA 2MWPA 3HSBA 2FHDA 3X26B 2XG8D 2VYTA 4KUIA 4QVDA 2MF2A 1N9RA 3UT1A 1VQOA 2YHTA 3J7AF 2QQAA 3O8VA 4WF2A 1VQMA 4XU3A 5GMKh 1YHQT 2LT1A 1MHNA 5GAN4 3OBYA 2FVUA 1QVFA 5J39A 2M0OA 2PU9B 3A8GB 3ZBDA 3MP8A 1XQHA 3CCRT 5KCOA 3OS0A 2EJ9A 3RESA 4N4IA 3PT9A 5GANf 3N5BB 2DXTA 4LDVA 5CKHA 1WQ7A 2CKKA 4BDYA 1YJ9A 4C92B 4ZN3A 2JTMA 1M4ZA 3MHXA 2L8DA 4XK8E 2LCLA 1KG1A 3G4ST 4C5GA 4A4FA 3CXCA 3X28B 3WVEB 2MI6A 1BIBA 1VIEA 4QQGA 2CZ6B 4M7DC 3OB9A 5CKEA 1VQKT 2HQXA 3V8KA 4N4GA 3L2RA 4QQ6A 1QP3A 4OB2B 4II1A 1JB0E 4R56A 4BD3A 4M75B 2QEXT 2LCCA 2E12A 2HQEA 4UC4A 1VQ4T 5FRNA 3CCQA 1H641 1KHCA 3M53A 3HP9A 3CCEA 3CCUT 1BYMA 2BKDN 3G71A 2F5TX 2RO0A 4LDUA 3G6EA 3C4SA 5CQXA 4XU0A 4E47A 2DD5A 5CO7A 4C0DB 5FRMA 3PMTA 5GANd 2EFIA 1UEBA 1ZBXA 4PLIA 3T9NA 4PNOA 4IUUA 4FL6A 3JCMc 4PKCC 3M54A 3G4SA 2IVWA 1Q7YU 4Y28E 2X4YA 2EKOA 4TVRA 3ASKA 4PJOF 3CC4A 3OS2A 3JB9H 2VUBA 4M7AD 4RCBA 4IUVA 4E7LA 2VGMA 4JLGA 3LH0A 3OYCA 1UGSB 1UGQB 2E70A 4RG2A 1WJRA 4J7IA 4EDUA 4XTUA 4C92A 3VU3C 3P8BB 2KAFA 2LC4A 2D0QB 4PJOE 3V8JA 3A8MB 4BE2A 1JJ2S 4XQ3A 3CCQT 1VQ6T 1RL2A 4Q5WA 3F70A 5CAIA 1Q82U 3QJYA 4FT4A 4A54A 1GXIE 5GMKi 4M7AB 1VQ6A 3X20B 4ZGDB 1VQ9A 2EAYA 2AHJB 4C92E 3J80E 4HKEA 4FT2A 1VQPT 1KC8U 2DIGA 4M7DF 5HKCA 4KBMB 1KQSA 2DAQA 5GAMf 2OTJT 2JUFA 2YRVA 4M7AE 1M1KC 4JDSA 2DPPB 5KH6A 3A8HB 5FU7B 4C5HA 3CCMT 2E6NA 2PVGB 3OYIA 2MAMA 1K9MC 2L3RA 2EQMA 2E5QA 3E19A 4MZMA 5GANh 1QVGS 3QJ6A 5CKDA 3C12A 5M9OA 2KSSA 1ZQ1A 3QO3A 4BI3A 1VQ9T 1QVFS 1WNLA 1YJWA 3CD6T 2K57A 2KDSA 2V8IA 1HK9A 2RJCA 1NJIC 3NFCA 4M75C 1M8VA 4C0GA 3CCJA 3UDCA 3QKJA 2RH2A 4BDZA 4PJOD 3UWNA 4M7DB 2E1HA 1IZ6A 4RCCA 2WSEE 1VQOT 2FYKA 3S3NA 3VUZA 4M77B 3OSVA 2DVEA 3OYKA 2RHXA 5FU7C 3I56T 4M7AA 2EIFA 2P0QA 4M78G 5LJ3h 1U8RA 3LW5E 1QVGA 5KE2A 4EPCA 1I5LA 1VIFA 1S72A 4V2SA 1FX7A 1I81A 2ZPHB 3J81E 2JN0A 2LNVA 4LD9K 3RMSA 1R8OB 4C8QG 2Y4YA 3OQ5A 3RERA 3PTAA 3LX7A 1QW1A 4E7HA 1NE8A 5GAOq 3GNGA 3FEOA 5I21A 1VQ7A 5D6WA 1BI2A 5L8RE 3JB9G 3KXTA 1HXDA 5CQYA 5KE3A 1YITA 2LQ8A 1VQLA 3HFOA 1YBYA 3G6ET 3OYLA 1VQMT 3INZA 4E7JA 2JVVA 4C92G 2QQRA 2DXBA 3M5AA 3HKSA 2CGHA 4M78D 5GMKl 1K9MU 4HT8A 4IUPA 3JB9D 1VQ4A 5GAN8 2HBPA 5IN1A 4C8QF 2QEXA 3OW2S 1VQKA 3I55A 4M77A 5LJ5f 4OVAA 2ZPIB 4OB0B 3OYFA 3LGFA 2Y4XA 1BI3A 3S6WA 2O4XA 1O9SA 3X24B 1UB4A 5GANe 5LJ5g 2PUKB 5CR2A 3OYNA 1NJIU 3OYBA 3OMCA 2PUOB 2F5KA 1M1FA 4F7UF 2X35A 4MZPA 4J8OA 3OS5A 3E9FA 4P5NA 5GAMj 2GCXA 1YIJT 1BKBA 1D3BA 4J6WA 2XDDA 2PVDB 3MP1A 3OYEA 3M56A 2PVOB 4LDWA 3OW2A 1M1KU 3DB4A 5LJ5j 3G7ZA 3I55T 2CYZB 3H6ZA 4F7UB 3GPLA 5LJ3f 1QP2A 1B34B 2LQKA 4L6V5 3M57A 3RKWA 5LJ3e 3VKIA 1KQSS 2XD0A 4JRQA 3OYDA 3CCUA 3CCET 4C92C 3CMAT 4M77G 4RKUE 3FIFA 1WQWA 4BY6C 3LWHA 4HCZA 3GP8A 2DD4A 4PJOA 2K5IA 2DTOA 3WXMB 2EQJA 1M9SA 4CI0C 2PQWA 1U1TA 2E41A 4OMFB 5GAN3 4ZGEB 3OA6A 2EQUA 3TU4K 4L5GA 2OTLA 4C8QE 3EFRA 1VQ5A 2HAXA 4M7DG 3KUFA 5GAN6 3JCMb 3QPHA 5J26A 3HRTA 1WJSA 3URGA 1VQ5T 2P0PA 3QXEB 1XTDA 3FC3A 3DKMA 3LWIA 2RK1A 5HY6A 2X4WA 4A4EA 1M1GA 3A8LB 2ZPBB 4HA8A 4XTXA 3VV0A 4X9DA 3M58A 3JCMd 5IT9E 3JCMQ 4PJOB 1PSFA 2CZ7B 2KMTA 4ZTFA 2VC8A 5GMKm 4HT9A 4L59A 2D9TA 5A2QE 1Y07A 4XAXB 4ZGJB 2LX9A 3CCLA 3JCMX 4ME7A 3V7CA 3BFMA 4NOYA 4X34A 4HCCA 1G3WA 3RUXA 2ZZDA 3P8HA 4RG8A 4X9CA 3EFSA 2ZPGB 4NL3A 3CC7T 2QQ9A 3ER0A 4M7AC 1XOVA 1IREB 3CCJT 2BIVA 5CKBA 3OY9A 2YLCA 5GAMg 1D3BB 4QQDA 2GQVA 1YJWT 5GAOm 3CD6A 3CC7A 3OYHA 2C06A 2ZCFB 5CCAA 3MEAA 4J5YA 5LJ3j 3CC2A 1VQ7T 1PSEA 4OB3B 2RK2A 2K4YA 2RD1A 3JB9I 4M77D 4QVCA 1Y71A 3OBWA 4C8QD 1LNXA 3S3OA 1WGSA 1YJNA 4MMLA 3CCMA 3TREA 3WVDB 5LJ5d 4JRIA 2K3YA 2DXCA 2DTIA 3ME9A 3VYHB 4EMKB 2OTJA 3LYIA 1UGRB 4A53A 4M77F 1K8AU 4J83A 2E6ZA 2R5MA 4ELZC 1MGQA 4OF1A 1YJ9T 1H3ZA 1Q81U 3JCMg 4M7DA 1FXXA 5EG2A 5CKFA 4KULA 1VUBA 2IG0A 2DEQA 2XK0A 4D6WA 2DO3A 2XICA 2XIDA 1BI0A 4JLIA 2RA2A 3I56A 4M77C 3GF5A 3CCST 3MP6A 4BE1A 5I2SA 3L2ZA 2FB7A 5DY9A 3VUBA 4FM4B 4M75G 2RI2A 3GNFB 4OGCA 5FU6C 5J3BA 1YITT 1DJ7B 4DQ2A 4XTWA 4JRKA 5HK3A 4J7FA 2I2LA 1ZHIA 5GAOn 5CIUA 2DTHA 1K73C 3BY7A 2DZCA 4O6JA 3TEEA 4JRPA 3BW1A 2A7YA 4M78E 4QW2A 3ZFJA 3CC4T 3E9GA 3VYGA 2B8AA 2RI5A 3JCMe 2LDMA 1BI1A 2O01E 3NTKA 4F7UE 3CMEA 4M7AF 1Y7XA 3CCRA 2ZPFB 4DOWA 4EMHA 5HK0A 1NZ9A 2HNIA 3PGGA 3G71T 3GIBA 4M78A 2ZGWA 4JS4A 1OZ2A 3BDLA 2EQKA 5LJ3d 3CBOA 1KHIA 1WJQA 5GAN7 4F7UA 1M90U 4PJOC 3FJPA 2RJDA 5DLQE 4BI8B 1KQ1A 5C0MA 4R55A 3CCSA 3QIIA 3AHUA 2LVMA 2E10A 4M75D 3JCMV 4LDYA 2OAUA 2V8KA 4JUVA 5GMKe 2E64A 3META 4XTVA 3M4YA 4KT0E 5GANg 1X75C 2WSCE 2X4JA 3FB9A 1KD1U 2CZ1B 1G3TA 2A3LA 2JTFA 3CPWS 4YTLA 2P0KA 3CMET 4JJNK 2D6FA 2F69A 4FU6A 3V7SA 2L5QA 4M75F 1XNIA 4MZTA 3L1AA 2K2VA 4MMKA 3S3MA 3QZ9B 3RKXA 4OB1B 3OYAA 1VQNT 4BB7A 1W2BS 1YI2T 1N8RC 3HPWA 3JRZA 2EJGA 4GLKA 1NPPA 1G5VA 1VQNA 2R57A 5GANj 1OZ3A 1G3YA 3JCMW 1YI2A 3L2WA 2JOYA 4N0AC 1WPYA 1VQ8A 5CK9A 3MO8A 4MDWA 3TCJA 1LOJA 3QG1A 3MEWA 3M59A 3CPWA 3JB9F 3V8LA 1X6OA 2VXFA 3BDUA 2Y90A 3OYYA 1VQPA 2LT4A 4J6XA 4M7DD 2M1HA 3PFSA 2R58A 4PJOG 1N9SA 3HL8A 2EYQA 3C94A 3MEUA 3R6OA 3SWNB 2XKOC 3X25B 1W2BA 2CZ0B 3LGLA 4IUQA 1UGPB 3P8DA 3CMAA 3QZ5B 4OGEA 3RKYA 3HRUA 4CRIA 1P92A 3FLGA 3V7RA 4C92F 3CCVA 4M77E 5LJ5e 2RHYA 2EJFA 2LRQA 3E1SA 3GOXA 1QVPA 1RI0A 2RI3A 1KD1C 2YLBA 2QI2A 4C5IA 5GAMd 5GAOl 1YJNT 2K3XA 5GAMe 3QHSA 3CEYA 4N4HA 3JCMJ 1YCYA 2DZ9A 4C8QC 4GY5A 5DLOA 2X4XA 2KK4A 4NS5A 4EMKA 1Q7YC 4ELYC 2DIQA 2DJZA 3OYMA 1AHJB 2QQSA 1FWZA 1S72T 4O5VA 1M90C 2NLUA 3A5ZB 3NTIA 4E7KA 3MCAB 3DLLA 3A8OB 3C95A 3M55A 4LDXA 4FIBA 4LD6A 1BIAA 2R5AA 1U1SA 4M78B 5GMKj 3VJPA 2VV5A 1OI1A 2XU8A 4XU2A 5A0LA 1JBMA 1X01A 2CS7A 2KQWA 2L89A 3EAEA 2MMPA 3LLRA 3OMGA 4DA4A 4ATOA 2H3JA 4J6YA 1K8AC 2EWNA 3DLMA 4HCBA 3JB9J 2QXFA 1OYXA 4DOVA 5C6SA 1Q86U 3JSCA 3OYGA 1VQLT 4ZN1A 4IKFA 2GFUA 3ZEHA 2ZPEB 2RB6A 2JZ2A 2E65A 2RJFA 3NTHA 4BACA 4QVZA 1JRIA 5LJ3g 4C8QA 4ZTJA 2QDYB 3PNWC 4OP0A 3SD4A 4EMGA 2VXEA 3L42A 3SWNA 2M16A 1Q81C 2VGNA 2GF7A 3HFNA 4C5EA 2JNGA 1V29B 2K5LA 5D6YA 3SWNC 4IUTA 3CXCS 1KQ2A 2FL7A 3SB2A 4E7IA 1Q86C 5D6XA 2RHUA 4F7UG 3OSSC 1G3SA 5GAOp 5A0DA 3OS1A 1Q82C 4M7AG 1Y96B 3M4GA 5AYFA 4XTYA 2V8JA 5FROA 3FDRA 5CVIA 2KY9A 1YIJA 4PLLA 2RHIA 1B34A 2GFAA 2DK3A 2XHCA 3HHTB 3L2VA 3KBGA 3PIOA 3QUIA 3SDZA 2KVQG 4IURA 2DXUA 4PL6A 1M5Q1 3QSUA 2LTOA 4A4HA 3CBMA 5FU6B 2XDBA 3QDRB 3L2QA 4M75E 3PMIA 1TH7A 2K5FA 4C0FA 2QA4T 4C0ZA 2RJEA 2XDPA 5FLXE 3JCMP 5GAMh 2BUDA 4NL2A 2G3RA 3MEVA 4A4KA 3PIPA 2QA4A 1Y96A 4A4GA 3CPFA 3RMQA 1SSFA 1N6AA 2QQBA 4M75A 5LJ5h 4BY6B 4N0AA 1I4K1 2O4XB 2WSFE 4M78C 4BUGA 2QTXA 3SFMA 2XI9A 5GAN5 4B9XA 4BI4A 4FSXA 3JAME 3M9QA 2DKGA 3HRSA 4XU1A 4C0DC 5DM7R 3L2UA 2RHZA 1KC8C 5I2MA 3CCLT 1YHQA 3RIRA 1LJOA 4C92D 5GAOr 4RMOA 4JS5A 2RM4A 1O75A 4C8QB 5LL6S 1VQ8T 3DB3A 3GLXA 2MWOA 3OYJA 1NPRA 4MDXA 1K73U 4M78F 1I8FA 3CBPA 3QYGB 3JCMh 1JJ2A 1EIFA 4BE0A 3Q1JA 1N8RU 2P4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8D A;  3QJ6 A;  5M9O A;  4Z02 A;  2WAC A;  4CRI A;  2BIV A;  3H8Z A;  3QBY A;  3FLG A;  3OY9 A;  2RJC A;  2RHY A;  2LRQ A;  4QQD A;  5KCH A;  3GOX A;  4B9W A;  3QKJ A;  1N27 A;  3OYH A;  1RI0 A;  2RI3 A;  4BDZ A;  3UWN A;  3MEA A;  4C5I A;  5IAY A;  2K3X A;  2MWP A;  4N4H A;  3CEY A;  2FHD A;  3LGL A;  4GY5 A;  2X4X A;  3S3N A;  2VYT A;  1WGS A;  4NS5 A;  3OYK A;  3S3O A;  2RHX A;  2DIQ A;  3OYM A;  2QQS A;  3UT1 A;  2K3Y A;  3O8V A;  2NLU A;  3ME9 A;  4BE0 A;  5KE2 A;  3NTI A;  3LYI A;  1MHN A;  4E7K A;  5J39 A;  2R5M A;  2M0O A;  4LD6 A;  2R5A A;  3MP8 A;  5KCO A;  1H3Z A;  3OS0 A;  1OI1 A;  3OQ5 A;  3LX7 A;  4N4I A;  3EAE A;  2CKK A;  2L89 A;  3LLR A;  2IG0 A;  2XK0 A;  3FEO A;  3OMG A;  4BDY A;  4E7H A;  5D6W A;  2L8D A;  5KE3 A;  3DLM A;  3MP6 A;  4A4F A;  4C5G A;  4BE1 A;  1OYX A;  5C6S A;  3OYL A;  3OYG A;  4E7J A;  2RI2 A;  4QQG A;  4IKF A;  2GFU A;  2QQR A;  3OB9 A;  2HQX A;  3ZEH A;  4N4G A;  4IUP A;  4QQ6 A;  3L2R A;  5CIU A;  5IN1 A;  2JZ2 A;  2RJF A;  3NTH A;  4II1 A;  4BAC A;  4QVZ A;  4BD3 A;  4OVA A;  4ZTJ A;  3PNW C;  2LCC A;  4UC4 A;  2HQE A;  3LGF A;  4QW2 A;  3E9G A;  3S6W A;  2O4X A;  3SD4 A;  3OYN A;  3OYF A;  5FRN A;  3L42 A;  2B8A A;  2RI5 A;  1KHC A;  2M16 A;  2LDM A;  3OYB A;  2GF7 A;  3NTK A;  2BKD N;  3OMC A;  4C5E A;  2RO0 A;  2F5K A;  5D6Y A;  4IUT A;  2X35 A;  3C4S A;  4E7I A;  5D6X A;  3E9F A;  2RHU A;  1OZ2 A;  3BDL A;  2EQK A;  5FRM A;  3OS1 A;  3PMT A;  2EFI A;  1WJQ A;  4PLI A;  5FRO A;  4IUU A;  4FL6 A;  3MP1 A;  3OYE A;  3FDR A;  2RJD A;  5C0M A;  4PLL A;  2RHI A;  2GFA A;  3QII A;  3DB4 A;  2LVM A;  2X4Y A;  3H6Z A;  3L2V A;  2EKO A;  3MET A;  4IUR A;  3ASK A;  4PL6 A;  3OS2 A;  2LTO A;  4A4H A;  2JTF A;  4IUV A;  3L2Q A;  2P0K A;  3OYD A;  3PMI A;  4E7L A;  3LH0 A;  3OYC A;  2RJE A;  2XDP A;  4FU6 A;  4HCZ A;  1XNI A;  4RG2 A;  1WJR A;  2BUD A;  4EDU A;  2G3R A;  3MEV A;  3S3M A;  2EQJ A;  3OYA A;  4A4G A;  4BE2 A;  2PQW A;  3OA6 A;  1SSF A;  4Q5W A;  3F70 A;  2EQU A;  1G5V A;  2O4X B;  3KUF A;  2R57 A;  1OZ3 A;  5J26 A;  1WJS A;  3L2W A;  4B9X A;  3FC3 A;  3MO8 A;  3L2U A;  3M9Q A;  3MEW A;  2X4W A;  2DIG A;  4A4E A;  2RHZ A;  2DAQ A;  2YRV A;  5KH6 A;  4ZTF A;  3DB3 A;  2M1H A;  3PFS A;  2MWO A;  2R58 A;  2D9T A;  4L59 A;  4C5H A;  3OYJ A;  3MEU A;  2E6N A;  3OYI A;  2L3R A;  2EQM A;  2E5Q A;  4IUQ A;  4X34 A;  3Q1J A;  3P8H A; 
#chains in the Genus database with same CATH topology
 3UPU A;  3CCV T;  2VB6 A;  2WAC A;  3H8Z A;  3G6E Q;  2PTK A;  5KCH A;  2OTL T;  5GAN 2;  1HYO A;  4PJM A;  1ZUK A;  5AT1 B;  3HSB A;  3X26 B;  2VYT A;  1YJW Q;  4WF2 A;  1TUD A;  1VQM A;  4XU3 A;  1YHQ T;  2LT1 A;  1CKA A;  2LP5 A;  2M0O A;  3ZBD A;  1CKB A;  1XQH A;  3CCR T;  3OS0 A;  3RES A;  4N4I A;  3N5B B;  1YJ9 A;  5KYN A;  4ZN3 A;  2JTM A;  4Z88 A;  1V1C A;  3HTR A;  1KG1 A;  1IO6 A;  1T0J A;  2LJ0 A;  1BIB A;  2NUP A;  2CUD A;  2DLP A;  3OB9 A;  5CKE A;  1X27 A;  1EX4 A;  2DVJ A;  1QP3 A;  4OB2 B;  1H92 A;  4UC4 A;  1H3H A;  5FRN A;  3M53 A;  3HP9 A;  4JJD A;  2F5T X;  4D8K A;  1PG5 B;  3C4S A;  4DEX A;  3D7S B;  2O9V A;  5CO7 A;  1UEB A;  4IUU A;  1Q7Y U;  2X4Y A;  2EKO A;  2YT6 A;  4AMC A;  2DX1 A;  1W6X A;  2OX7 A;  2M02 A;  4IUV A;  4E7L A;  2FEI A;  3VS6 A;  1UGQ B;  1OPL A;  3P8B B;  2KAF A;  4BE2 A;  4XQ3 A;  1VQ6 T;  2PNI A;  4FT4 A;  1Q82 U;  1GXI E;  3I55 Q;  2AHJ B;  3GBQ A;  3J80 E;  5HKC A;  1TSF A;  1KQS A;  2JUF A;  2HL3 A;  2FRW A;  2M0Y A;  3CCM T;  2E6N A;  1K9M C;  1RAI B;  2E5Q A;  3E19 A;  5GAN h;  5M9O A;  4WCI A;  5CKD A;  2XMF A;  2KSS A;  1QCO A;  2NYS A;  2V8I A;  4E7S A;  2J6F A;  1NJI C;  4C0G A;  2RH2 A;  4BDZ A;  3UWN A;  4RCC A;  1WHL A;  4M77 B;  3CMA Q;  5FU7 C;  2O9S A;  2JW4 A;  1U8R A;  2FPE A;  4EPC A;  1I81 A;  2ROT A;  3LH5 A;  4DBH A;  4FCY A;  1LCK A;  2JN0 A;  2C0O A;  3RER A;  3PTA A;  1VQ7 A;  3FEO A;  5L8R E;  3KXT A;  1VQ6 Q;  3H0H A;  2FZK B;  3G6E T;  3OYL A;  1M2O A;  2JVV A;  1WLP B;  1GBQ A;  2CGH A;  2KXC A;  1M2V A;  3OW2 S;  4OMP A;  3I55 A;  2ZPI B;  5LJ5 g;  1KJW A;  3OYB A;  1R0B G;  2BZ8 A;  3I9Q A;  4LNP A;  4GLM A;  5GAM j;  4PJL A;  1BKB A;  4J6W A;  1WFW A;  3M56 A;  5IH2 A;  3ZL7 C;  3G7Z A;  3I55 T;  2CYZ B;  1YJ9 Q;  1D1C A;  2CP7 A;  2KYB A;  1B34 B;  2LQK A;  1Q82 R;  3OYD A;  3CCU A;  4M77 G;  4RKU E;  3GP8 A;  1WQW A;  3LWH A;  2DD4 A;  2K5I A;  3EH2 A;  1M9S A;  2E41 A;  1OPK A;  1RAC B;  4ZGE B;  2EQU A;  2OTL A;  1K0X A;  3JCM b;  5J26 A;  3URG A;  3EHQ A;  3FC3 A;  5HY6 A;  4XTX A;  3M58 A;  4PJO B;  3CC4 Q;  4L59 A;  1TUG B;  4XAX B;  3UA6 A;  4ME7 A;  3V7C A;  4RG8 A;  3EFS A;  1Q86 R;  2BIV A;  3JV3 A;  5GAM g;  2J6K A;  2GQV A;  5GAO m;  1MMN A;  3O5Z A;  1VQ9 Q;  5FWC A;  4OB3 B;  2RK2 A;  2K4Y A;  1Y71 A;  3S3O A;  1AZE A;  4E2F B;  1KK7 A;  2CUB A;  2K3Y A;  2DXC A;  4EMK B;  1S1N A;  4M77 F;  2E6Z A;  5KYU B;  1MGQ A;  3M0U A;  6AT1 B;  2CP3 A;  4M7D A;  2DEQ A;  2DO3 A;  3VS4 A;  3CCS T;  3MP6 A;  4BE1 A;  3EG9 B;  4AFZ C;  2RI2 A;  4OGC A;  1YIT T;  2GNC A;  2A37 A;  4RTX A;  2RQV A;  4O6J A;  4ESR A;  3CC4 T;  1QQJ A;  5HCK A;  2PZ1 A;  3JCM e;  1BI1 A;  4F7U E;  3CME A;  4EMH A;  2HNI A;  3BDL A;  2EQK A;  1C0M A;  1UHC A;  1UHF A;  3FJP A;  5C0M A;  5DLQ E;  3CCS A;  2DBK A;  3AHU A;  3NHN A;  3JCM V;  3FB9 A;  5L23 A;  2L5Q A;  4M75 F;  4LUE A;  3L1A A;  2DL3 A;  3S3M A;  3OYA A;  3EGU A;  1W2B S;  1N8R C;  4GBQ A;  2EJG A;  1NPP A;  1VQN A;  2R57 A;  5GAN j;  2DFU A;  3JCM W;  3L2W A;  1J3T A;  2GGR A;  2W0Z A;  3G4S Q;  1C1A A;  1LOJ A;  3QG1 A;  3MEW A;  8ATC B;  3M59 A;  2CP5 A;  2LT4 A;  2MOX A;  1UDL A;  4PJO G;  3CCL Q;  1RAG B;  2XKO C;  4IUQ A;  1UGP B;  2LJ1 A;  1P92 A;  3V7R A;  4M77 E;  2LRQ A;  3VS3 A;  2YXY A;  1UG1 A;  3GOX A;  5GAM d;  4AT1 B;  2K7A A;  5GAM e;  4E7Z A;  4C8Q C;  2CSQ A;  2KK4 A;  1Q7Y C;  2DJZ A;  3OYM A;  1ZSZ C;  1M90 C;  3NTI A;  4E7K A;  1QCN A;  3A8O B;  2X3X D;  5GMK j;  2HDA A;  2VV5 A;  2BZX A;  2O2O A;  1JBM A;  1IGQ A;  4J6Y A;  1K8A C;  2EWN A;  3A98 A;  4DOV A;  5C6S A;  2FPD A;  4ZN1 A;  1AWX A;  1W2B P;  1YCS B;  2JZ2 A;  1VQN Q;  1JRI A;  2KE9 A;  3I5S A;  3L42 A;  3SWN A;  4LE9 A;  2M16 A;  1Q81 C;  2QGG A;  1VQO Q;  2JNG A;  2MCN A;  3CXC S;  2FL7 A;  4E7I A;  1ARK A;  3M0T A;  2RHU A;  1G3S A;  4M7A G;  1NEB A;  2V8J A;  2DK3 A;  1MMA A;  2XHC A;  3HHT B;  3KBG A;  2NWM A;  4PL6 A;  1D1A A;  1SPK A;  3PMI A;  1TH7 A;  5FLX E;  1UFF A;  4A4K A;  4HVW A;  2COZ A;  1FMK A;  3RMQ A;  1SEM A;  4J9B A;  5LJ5 h;  1NG2 A;  4M78 C;  4BUG A;  2E3H A;  3SFM A;  4BI4 A;  3JAM E;  4XU1 A;  5DM7 R;  2D1X A;  3CCL T;  4C92 D;  4RMO A;  4R0K A;  2DMO A;  2MWO A;  1NPR A;  1K73 U;  1I8F A;  3CBP A;  4AG2 C;  1BB9 A;  3Q1J A;  1W4S A;  2K3B A;  5IHI A;  4VUB A;  3KFV A;  5A0G A;  1NBE B;  2A28 A;  3AT1 B;  2LCS A;  3CC2 T;  3QYH B;  1VYT A;  1K4U S;  4Y91 A;  1X43 A;  2XG8 D;  4KUI A;  2O88 A;  1N9R A;  1WHH A;  1VQO A;  2QQA A;  3O8V A;  1MND A;  2AKK A;  2QEX Q;  2EPD A;  5J39 A;  1FMV A;  3A8G B;  1Q81 R;  1IXD A;  3MP8 A;  2EJ9 A;  2JJ9 A;  3PT9 A;  2DYB A;  2DXT A;  5CKH A;  2CKK A;  1K73 R;  1M4Z A;  3MPU B;  2AZS A;  3MHX A;  4AFS C;  1K9M R;  1RLP C;  4DBQ A;  4A4F A;  4J9F A;  1M2V B;  2CT4 A;  3H0I A;  4N4G A;  2YUQ A;  4QQ6 A;  3L2R A;  3CCJ Q;  4II1 A;  1JB0 E;  1IGU A;  1VQL Q;  2LCC A;  3CCQ A;  1H64 1;  1KHC A;  1BYM A;  1JQQ A;  2RO0 A;  4E47 A;  3H0F A;  2EFI A;  2E3I A;  3EGX A;  1W70 A;  3T9N A;  4PNO A;  1EZZ B;  4FL6 A;  4PKC C;  2OJ2 A;  3M54 A;  7AT1 B;  1T3L A;  4Y28 E;  3G71 Q;  1SF9 A;  3M0R A;  3ASK A;  4PJO F;  3CC4 A;  3OS2 A;  1PWT A;  4RCB A;  3OYC A;  1UGS B;  2KYM A;  4EDU A;  2GTO A;  3A8M B;  1JJ2 S;  3CCQ T;  1JU5 C;  2A0F B;  3F70 A;  4Q5W A;  4A54 A;  5GMK i;  3X20 B;  1ABO A;  4J9H A;  1VQP T;  1QKX A;  5GAM f;  4M7A E;  2DPP B;  2QTV A;  3MKD A;  1OQK A;  1E6H A;  2L3R A;  2EQM A;  2QGF B;  4JZ4 A;  5GJW B;  3QO3 A;  1WNL A;  3CD6 T;  2K57 A;  1SRL A;  3UDC A;  2ATC B;  1ZA1 B;  1VQO T;  2FYK A;  2ESW A;  2DVE A;  3OYK A;  4M7A A;  2KRN A;  2EGA A;  5KE2 A;  1M8M A;  1VIF A;  1R0C B;  4V2S A;  1YN8 A;  1OX9 A;  1TTH B;  1QW1 A;  1PKT A;  3GNG A;  2ED0 A;  2JMC A;  4DBR A;  2OTJ Q;  5CQY A;  5KE3 A;  2LQ8 A;  1VQL A;  1K8A R;  4J9G A;  1VQM T;  4E7J A;  4IIO A;  2OAW A;  2CSI A;  3M5A A;  3HKS A;  1G2B A;  4IUP A;  5IN1 A;  2QEX A;  2P84 A;  2AIR B;  3LGF A;  5GAN e;  3S6W A;  1IHW A;  3OYN A;  1UB4 A;  2PUO B;  1B3Q A;  2X35 A;  4J8O A;  2AKL A;  3E9F A;  2P4R A;  4CC4 B;  2KEA A;  1D3B A;  2XDD A;  2PVD B;  3OYE A;  2PVO B;  4LDW A;  1M3B A;  3EH1 A;  4L6V 5;  3VKI A;  1KQS S;  1PD1 A;  4HXJ A;  1KQS P;  3CCE T;  1M30 A;  5IHK A;  2VWF A;  3FIF A;  2V1Q A;  2J06 A;  2JS0 A;  3OA6 A;  4OMF B;  1PD0 A;  2GTJ A;  3TU4 K;  4L5G A;  2HAX A;  1VQ5 A;  3KUF A;  3QPH A;  2L2P A;  1GFD A;  2P0P A;  3QXE B;  3LWI A;  2RK1 A;  2ZPB B;  4HA8 A;  5IT9 E;  4X9D A;  3TSW A;  3JCM d;  2L3S A;  2CZ7 B;  4ZTF A;  4HT9 A;  5A2Q E;  1YFN A;  5GJV B;  4ZGJ B;  2LX9 A;  4KH0 B;  4HCC A;  3BFM A;  4NOY A;  1G3W A;  2G6F X;  4M7A C;  3CCJ T;  5CKB A;  1AWW A;  1D3B B;  1YJW T;  2KGT A;  2RD1 A;  1YWO A;  4M77 D;  4MML A;  3CCM A;  3TRE A;  2DIL A;  1GCP A;  5LJ5 d;  1I5O B;  2QYZ A;  2R5M A;  4ELZ C;  1H3Z A;  1Q81 U;  5CKF A;  4KUL A;  1VUB A;  2MYS A;  1N5Z A;  2CH4 A;  4D6W A;  4EIK A;  2XID A;  3I56 A;  1TOV A;  5DY9 A;  2LNH B;  4M75 G;  1M3A A;  2RQU A;  4JRK A;  4J7F A;  1ZHI A;  5GAO n;  3TEE A;  1M3C A;  4DBF A;  3BW1 A;  3ZFJ A;  3E9G A;  3QWX X;  2L3P A;  2ED1 A;  2C0T A;  4M7A F;  1Y7X A;  1OOT A;  1WA7 A;  3SEM A;  5HK0 A;  3PGG A;  3M0Q A;  1OZ2 A;  4J9E A;  1KHI A;  2VVK A;  1M90 U;  4PJO C;  4A63 B;  2RJD A;  1X2Q A;  4M75 D;  2E10 A;  2V8K A;  5KYX A;  4JUV A;  4AG1 C;  3M4Y A;  4KT0 E;  2WSC E;  1NLP C;  2X4J A;  1G3T A;  2JTF A;  4FYY B;  4Y92 A;  4YTL A;  4JJN K;  3V7S A;  4MZT A;  1QVG P;  4MMK A;  4KH1 B;  4RTV A;  1VQN T;  3EGX B;  4QT7 A;  5KYU A;  3FJ5 A;  1HJD A;  4DEY A;  1WHM A;  2ROL A;  1PRM C;  1WPY A;  1AWJ A;  4MDW A;  1WHG A;  1X6O A;  3BDU A;  2Y90 A;  1VQP A;  4J6X A;  1SKU B;  3PFS A;  2FG0 A;  3HL8 A;  3C94 A;  2EGE A;  4OML A;  3VRZ A;  3LGL A;  1ZUU A;  2MPX C;  3CMA A;  3HRU A;  1QVF P;  2Z0W A;  4D8D A;  4C92 F;  3CCV A;  2DL7 A;  3ULR B;  1QVP A;  1I1J A;  2RI3 A;  4JJC A;  2K3X A;  2RQR A;  3JCM J;  1YCY A;  2DZ9 A;  4FYW B;  4RTW A;  4ELY C;  1S72 T;  2QQS A;  1WHJ A;  4O5V A;  2NLU A;  1SHG A;  3R6N A;  4B6M A;  2CRE A;  2EKH A;  1MV0 B;  3OW2 P;  3MCA B;  1G83 A;  2YUN A;  1PRL C;  3PVL A;  4LD6 A;  2XU8 A;  5A0L A;  1X01 A;  2KQW A;  4ATO A;  4DA4 A;  2DJQ A;  1SSH A;  3CCU Q;  1TU0 B;  4HCB A;  2QXF A;  2JS2 A;  2KI7 A;  2JMA A;  2EYX A;  2GFU A;  3ZEH A;  2ZPE B;  2RJF A;  4BAC A;  1RAA B;  2QAZ A;  2W10 A;  4RTT A;  4PFZ A;  3QDF A;  1MUZ A;  1T3S A;  4EMG A;  2VXE A;  3U23 A;  2VGN A;  3HFN A;  2K5L A;  3SWN C;  3VS0 A;  1VQP Q;  1KQ2 A;  2A08 A;  2DF6 A;  4KGZ B;  3OSS C;  3OS1 A;  1Q82 C;  9ATC B;  5AYF A;  4XTY A;  5FRO A;  1Q7Y R;  2BE9 B;  2RHI A;  1B34 A;  2F2W A;  3QUI A;  2KVQ G;  4IUR A;  2DXU A;  1M5Q 1;  3QSU A;  4A4H A;  3CBM A;  1B07 A;  2IIM A;  2YWW A;  4M75 E;  1S72 Q;  2K5F A;  4C0F A;  2QA4 T;  4C0Z A;  2QDL A;  3EHR A;  3M0S A;  4KRT A;  2G3R A;  3PIP A;  1JO8 A;  2IPO B;  1SSF A;  1N6A A;  4M75 A;  4Z8A A;  1VQ5 Q;  2WSF E;  4OMO A;  2XI9 A;  3CC2 Q;  2DKG A;  4C0D C;  1KC8 C;  1YHQ A;  3RIR A;  1U3O A;  2RM4 A;  3OYJ A;  8AT1 B;  3JCM h;  1NYF A;  2EVR A;  1JJ2 A;  1EIF A;  2E64 A;  4BE0 A;  4M7A D;  1N8R U;  1ZBJ A;  3QBY A;  1WIE A;  2M9U A;  3H41 A;  1UTI A;  4B9W A;  1N27 A;  4XTZ A;  3RDV A;  2FHD A;  3EG2 A;  4QVD A;  3UT1 A;  1AOJ A;  1X6B A;  5GMK h;  2AT1 B;  1MHN A;  1LPL A;  5KYX B;  1QVF A;  2PU9 B;  5EC7 A;  1D1B A;  5GAN f;  1WQ7 A;  4BDY A;  1QWE A;  4C92 B;  1RAF B;  2LCL A;  3M0P A;  3G4S T;  4C5G A;  3CXC A;  3WVE B;  2E5K A;  3CME Q;  2CZ6 B;  3CCE Q;  1WZO A;  1VQK T;  3V8K A;  1GFC A;  4R56 A;  4BD3 A;  2CDT A;  4M75 B;  2J7I A;  2HQE A;  1VQ4 T;  2HBW A;  4FYV B;  4J9D A;  2JM9 A;  3CCE A;  3BE3 A;  4LDU A;  5CQX A;  1M90 R;  1I07 A;  5GAN d;  4PLI A;  1ZBX A;  3A1P A;  3G4S A;  2IVW A;  2YRC A;  2BTT A;  3JB9 H;  1SRM A;  2VUB A;  4OMN A;  2ZAE A;  4JLG A;  3LH0 A;  3PE0 A;  2E70 A;  4RG2 A;  1WJR A;  4J7I A;  4X1V A;  2D0Q B;  3V8J A;  1RL2 A;  5CAI A;  3QJY A;  2LQW A;  1TUC A;  1VQ9 A;  1GCQ A;  2EAY A;  4C92 E;  1IHV A;  4HVU A;  4HKE A;  4M7D F;  4KBM B;  2RN8 A;  5KH6 A;  3A8H B;  5FU7 B;  2PVG B;  3TQ7 P;  2MAM A;  3OYI A;  2L0A A;  1QVG S;  3QJ6 A;  1TWB A;  1ZQ1 A;  1VQ9 T;  4BI3 A;  1QCF A;  2KDS A;  1M8V A;  1HK9 A;  2RJC A;  1OEB A;  3QKJ A;  4M7D B;  2BE7 D;  3EGD B;  2WSE E;  3I56 T;  2DRK A;  1UJ0 A;  2P0Q A;  2YUP A;  3LW5 E;  1QVG A;  2D8H A;  2GQI A;  2QAS A;  1S72 A;  2MIO A;  1WHK A;  1K9A A;  2LX7 A;  1BCM A;  2O31 A;  4LD9 K;  1R8O B;  4C8Q G;  1YHQ Q;  3HFO A;  1X69 A;  1YBY A;  4ANJ A;  1IB8 A;  2A36 A;  1H8K A;  1RAB B;  3JB9 D;  1U5S A;  1VQ4 A;  5GAN 8;  2HBP A;  1VQK A;  4AFQ C;  1T0H A;  4M77 A;  2DRM A;  1ZX6 A;  3OYF A;  2O4X A;  1O9S A;  5CR2 A;  1NJI U;  2PUK B;  3RBB B;  1KFZ A;  1MV3 A;  4QKU A;  1XJW B;  2F5K A;  4MZP A;  2NUP B;  3OS5 A;  4P5N A;  1UUE A;  2GCX A;  1YIJ T;  4FYX B;  2KR3 A;  5IHN A;  1PKS A;  1TS9 A;  3MP1 A;  4E6R A;  3OW2 A;  3DB4 A;  1K0S A;  5LJ3 e;  3RKW A;  2KBT A;  4JRQ A;  4C92 C;  2KT8 A;  3CMA T;  4PJO A;  2QA4 Q;  3WXM B;  2EQJ A;  1K76 A;  1MMD A;  2PQW A;  3EFR A;  5GAN 6;  2DNU A;  1WJS A;  3HRT A;  1VQ5 T;  2NUT A;  3VV0 A;  5KYW A;  1ZUY A;  2KMT A;  2VC8 A;  5GMK m;  2D9T A;  1Y07 A;  1SHF A;  1OU9 A;  3RUX A;  1A0N B;  2ZPG B;  2QQ9 A;  3ER0 A;  1IRE B;  2EQI A;  1BBZ A;  2YLC A;  3CC7 A;  3OYH A;  3I56 Q;  2C06 A;  1KIK A;  1G8X A;  4J5Y A;  5LJ3 j;  3CC2 A;  1PSE A;  3JB9 I;  4QVC A;  3OBW A;  1WGS A;  1ZSG A;  1YWP A;  2HCK A;  5IXF A;  1K1Z A;  3VYH B;  2OTJ A;  3MJX A;  4OF1 A;  1YJ9 T;  2J05 A;  1X6G A;  2KT1 A;  3JCM g;  1OX8 A;  2F2X A;  2IG0 A;  2XK0 A;  1Y57 A;  2XIC A;  1BI0 A;  1V76 A;  2RA2 A;  4M77 C;  3GF5 A;  1IRX A;  3L2Z A;  2FB7 A;  1WXB A;  1FMW A;  3VUB A;  4FM4 B;  3GNF B;  5J3B A;  1DJ7 B;  4DQ2 A;  3NPF A;  4XTW A;  5HK3 A;  1K73 C;  4ZNX A;  2A7Y A;  1RI9 A;  3VYG A;  2J6O A;  1VA7 A;  2LDM A;  3NTK A;  3VS5 A;  1VQM Q;  1NZ9 A;  3G71 T;  2FRY A;  4JS4 A;  3CBO A;  1WJQ A;  1QLY A;  4F7U A;  4JZ3 A;  4BI8 B;  1KQ1 A;  1D09 B;  1RAH B;  2LVM A;  4LDY A;  1X75 C;  2FO0 A;  3VS2 A;  1KD1 U;  1VQK Q;  3CME T;  2D6F A;  4FU6 A;  1XNI A;  2K2V A;  4OB1 B;  1YI2 T;  3HPW A;  4FW2 A;  2HMA A;  1G5V A;  1X2K A;  2K79 A;  2LJ3 A;  1U06 A;  1G3Y A;  1VOM A;  2K6D A;  1VQ8 A;  1D0Y A;  3JB9 F;  2DER A;  3V8L A;  3IQL A;  3OYY A;  4JPB W;  4M7D D;  2R58 A;  1N9S A;  2RNA A;  3SWN B;  1W1F A;  1ACM B;  1GCQ C;  1W2B A;  1E6G A;  3P8D A;  1ZA2 B;  4OGE A;  3RKY A;  2CP2 A;  3FLG A;  5LJ5 e;  4PFP A;  2RHY A;  1D0Z A;  1RI0 A;  2YLB A;  2QI2 A;  4C5I A;  5GAO l;  2HZY A;  1AT1 B;  4PK4 A;  5DLO A;  2X4X A;  4NS5 A;  2HL5 C;  2DIQ A;  1AHJ B;  1FWZ A;  1YNZ A;  2DET A;  1FYN A;  4LDX A;  1UGV A;  1BIA A;  2R5A A;  1U1S A;  3NGP A;  3VJP A;  4XU2 A;  1QWF A;  1F1B B;  2CS7 A;  2MMP A;  3OMG A;  1VQ7 Q;  2H3J A;  1C6V X;  4F17 A;  2EBP A;  3JB9 J;  1OYX A;  1CSK A;  1Q86 U;  3JSC A;  1M1K R;  1VQL T;  4KGX B;  4IKF A;  2C0I A;  2RB6 A;  2L3Q A;  4QVZ A;  4ZTJ A;  2QDY B;  2JXB A;  3SD4 A;  2GF7 A;  4C5E A;  2KRO A;  1V29 B;  5D6Y A;  4IUT A;  3SB2 A;  1Q86 C;  4F7U G;  5GAO p;  2D0N A;  3M4G A;  1ZLM A;  3RNJ A;  3L2V A;  3PIO A;  3SDZ A;  5FU6 B;  1R77 A;  2XDB A;  1GBR A;  2RJE A;  2XDP A;  1VQ8 Q;  2BUD A;  3MEV A;  2QA4 A;  1Y96 A;  3CPF A;  2QQB A;  5FWB A;  2X51 A;  4BY6 B;  3E2U A;  4RTY A;  1I4K 1;  5GAN 5;  4B9X A;  3M9Q A;  3HRS A;  1YIJ Q;  1LJO A;  1JJ2 P;  4JS5 A;  5I11 A;  1JEG A;  2VAS A;  4M78 F;  2NUZ A;  3QYG B;  2P4T A;  4M7D E;  1PC0 A;  1YJN Q;  1AVZ C;  4Z02 A;  3EFO A;  2DYI A;  2AZV A;  2HD0 A;  2CT3 A;  3QWY A;  4ORZ A;  3FRN A;  1YI2 Q;  4KUD K;  2DL8 A;  3JCM f;  4EMK C;  5IAY A;  2MWP A;  1WXT A;  2MF2 A;  2K2M A;  3J7A F;  2YHT A;  3REB B;  3OBY A;  5GAN 4;  3CC7 Q;  2FVU A;  2NUT B;  2QK0 A;  2KRM A;  5KCO A;  4K11 A;  1UEC A;  1NYG A;  4LDV A;  2LZ6 B;  1QKW A;  2L8D A;  4XK8 E;  3SHW A;  1EFN A;  3X28 B;  3VS7 A;  2MI6 A;  1VIE A;  4QQG A;  4M7D C;  2DBM A;  2HQX A;  2ENM A;  4Z89 A;  2YUO A;  2F2V A;  2QEX T;  2E12 A;  3I35 A;  2LMJ A;  3CCU T;  2BKD N;  3G71 A;  1BK2 A;  3UA7 A;  3G6E A;  4XU0 A;  2DD5 A;  4C0D B;  5FRM A;  3PMT A;  1MMG A;  3JCM c;  4J9I A;  2B86 A;  4TVR A;  1MNE A;  4PJJ A;  2VGM A;  4LXC A;  4XTU A;  3VU3 C;  4C92 A;  2H8H A;  2LC4 A;  4PJO E;  1PM3 A;  4M7A B;  1VQ6 A;  4ZGD B;  5KYW B;  4FT2 A;  1UE9 A;  3CCS Q;  1KC8 U;  2DIG A;  2JTE A;  1AWO A;  2DAQ A;  2CH4 W;  4CC7 A;  2OTJ T;  3CCV Q;  1AEY A;  2YRV A;  1M1K C;  4JDS A;  4M4Z A;  1Z9Z A;  4C5H A;  2HKN A;  1SG5 A;  1RUW A;  4MZM A;  3C12 A;  1QVF S;  1YJW A;  2AK5 A;  3NFC A;  4M75 C;  3CCJ A;  4PJO D;  2E1H A;  1IZ6 A;  1GL5 A;  3S3N A;  3VUZ A;  3OSV A;  2RHX A;  3CCR Q;  2V26 A;  2EIF A;  4M78 G;  5LJ3 h;  1I5L A;  4F04 B;  2HQH A;  4WTO B;  1FX7 A;  2ZPH B;  3J81 E;  2RF0 A;  2LNV A;  3RMS A;  2Y4Y A;  3OQ5 A;  3LX7 A;  4HVV A;  4E7H A;  1NE8 A;  2YSQ A;  1OUL A;  5I21 A;  5GAO q;  5D6W A;  1BI2 A;  3JB9 G;  1HXD A;  1YIT A;  2E4H A;  2EGC A;  3CQT A;  3INZ A;  4C92 G;  2RQT A;  2QQR A;  2DXB A;  5GMK l;  4M78 D;  1K9M U;  5KYY B;  4HT8 A;  3CD6 Q;  4C8Q F;  5LJ5 f;  4OVA A;  2SEM A;  4OB0 B;  2Y4X A;  1BI3 A;  4OMQ A;  3X24 B;  4F16 A;  3OMC A;  4RTZ A;  1M1F A;  4F7U F;  1KD1 R;  1B7T A;  3EG3 A;  1M1K U;  2RMO A;  5LJ5 j;  3H6Z A;  4F7U B;  2CP0 A;  3GPL A;  5LJ3 f;  1QP2 A;  1WI7 A;  3M57 A;  4FW1 A;  2D8J A;  1JXO A;  1NJI R;  2V1R A;  2XD0 A;  4BY6 C;  4HCZ A;  2FPF A;  2DTO A;  2EYW A;  2KXD A;  2X3W D;  4CI0 C;  1U1T A;  5GAN 3;  4C8Q E;  1PNJ A;  4M7D G;  1NM7 A;  3REA B;  1XTD A;  3DKM A;  1WYX A;  2X4W A;  4A4E A;  1M1G A;  3A8L B;  3EG9 A;  1WX6 A;  3JCM Q;  1PSF A;  2H3E B;  2HSE B;  3UAT A;  4JJB A;  3H9N A;  3CCL A;  4F14 A;  3JCM X;  2ECZ A;  3EG1 A;  4X34 A;  2ZZD A;  3P8H A;  1AZG B;  1OV3 A;  4X9C A;  4NL3 A;  1VYU A;  3CC7 T;  1XOV A;  2COW A;  3OY9 A;  3TVT A;  4QQD A;  3CD6 A;  2YDL A;  2HKQ B;  2DL5 A;  2ZCF B;  1VYV A;  5CCA A;  3MEA A;  1VQ7 T;  4C8Q D;  1LNX A;  1YJN A;  3WVD B;  4JRI A;  2CP6 A;  2FZC B;  1PCX A;  2DTI A;  3ME9 A;  1ZSZ A;  3LYI A;  1UGR B;  4A53 A;  2DA9 A;  1E7O A;  2GBQ A;  4RUG A;  4J83 A;  1K8A U;  1M27 C;  5I22 A;  5D7U A;  3CCM Q;  1FXX A;  5EG2 A;  2X9H A;  4JLI A;  1I0C A;  3THK A;  2DM1 A;  1RAE B;  5I2S A;  4HCK A;  5FU6 C;  3TSZ A;  1WXU A;  5ECA A;  4CC3 A;  2I2L A;  5CIU A;  2DTH A;  1ABQ A;  2DZC A;  3BY7 A;  4PJN A;  4KGV B;  4JRP A;  2KRS A;  4M78 E;  4QW2 A;  4IIM A;  2B8A A;  2RI5 A;  2O01 E;  3CCR A;  2ZPF B;  4DOW A;  2EYZ A;  3GIB A;  4M78 A;  2ZGW A;  3EFO B;  3CPW P;  5LJ3 d;  5GAN 7;  3PVQ A;  4FSS A;  1Q95 G;  2DE0 X;  4R55 A;  3QII A;  2OAU A;  5GMK e;  3MET A;  4XTV A;  5GAN g;  1YP5 A;  4PFO A;  1QMC A;  2LQN A;  1KC8 R;  2CZ1 B;  2A3L A;  3CPW S;  2P0K A;  2F69 A;  1RLQ C;  3QZ9 B;  3RKX A;  4BB7 A;  4LUD A;  2VKN A;  3JRZ A;  4GLK A;  1OZ3 A;  1YI2 A;  3C0C A;  2JOY A;  1JXM A;  4N0A C;  2ABL A;  2RPN A;  1ZSZ B;  2SRC A;  3MO8 A;  5CK9 A;  3TCJ A;  3CCQ Q;  1Z9Q A;  3CPW A;  1N8R R;  3UF4 A;  2VXF A;  1D0X A;  2M1H A;  4RTU A;  1TG0 A;  2EYQ A;  3R6O A;  3MEU A;  3I5R A;  3X25 B;  2QG9 B;  2CZ0 B;  5KYY A;  3QZ5 B;  1TXQ A;  4CRI A;  2K9G A;  2EJF A;  3E1S A;  1KD1 C;  1LVK A;  1HSQ A;  1YJN T;  3QHS A;  3CEY A;  4N4H A;  4GY5 A;  4EMK A;  4LN2 A;  4OMM A;  3A5Z B;  1UJY A;  4AFU C;  3DLL A;  1RAD B;  3C95 A;  3M55 A;  1GRI A;  4FIB A;  1AD5 A;  3EG0 A;  4M78 B;  1NLO C;  1OI1 A;  2YRD A;  3EAE A;  3LLR A;  2L89 A;  2EYY A;  1BCO A;  1Y0M A;  3DLM A;  2F1L A;  3NMZ C;  2I0N A;  3OYG A;  3RR6 A;  2BZY A;  4J9C A;  2MK5 A;  1VQ4 Q;  2KNB B;  1NEG A;  2E65 A;  3NTH A;  5LJ3 g;  1KSW A;  4C8Q A;  3PNW C;  2HEQ A;  3G1J A;  4OP0 A;  2OTL Q;  5D6X A;  5A0D A;  1Y96 B;  3FDR A;  5CVI A;  2KY9 A;  1YIJ A;  4PLL A;  2DL4 A;  2GFA A;  3VRY A;  5IXB A;  2LTO A;  3QDR B;  3L2Q A;  1YIT Q;  2JM8 A;  3VS1 A;  3JCM P;  2EW3 A;  1BU1 A;  1PHT A;  2FZG B;  5GAM h;  4NL2 A;  4A4G A;  2OI3 A;  3EGD A;  1WDX A;  4N0A A;  2O4X B;  1HD3 A;  2COY A;  2QTX A;  2JT4 A;  2DEU A;  4FSX A;  3L2U A;  4CC2 A;  1OU8 A;  2RHZ A;  5I2M A;  5GAO r;  3CXC P;  5FW9 A;  1O75 A;  4C8Q B;  5LL6 S;  1VQ8 T;  3DB3 A;  2RQW A;  3GLX A;  4MDX A;  2HSP A;  2M51 A; 
#chains in the Genus database with same CATH homology
 3UPU A;  1W4S A;  4M7D E;  4VUB A;  3CCV T;  5A0G A;  4Z02 A;  2WAC A;  3H8Z A;  3QBY A;  2HD0 A;  2M9U A;  5KCH A;  3CC2 T;  4B9W A;  1N27 A;  3QYH B;  4XTZ A;  3FRN A;  4KUD K;  4Y91 A;  2OTL T;  3JCM f;  4EMK C;  5GAN 2;  5IAY A;  2MWP A;  3HSB A;  2FHD A;  3X26 B;  2XG8 D;  2VYT A;  4KUI A;  4QVD A;  2MF2 A;  1N9R A;  3UT1 A;  1VQO A;  2YHT A;  3J7A F;  2QQA A;  3O8V A;  4WF2 A;  1VQM A;  4XU3 A;  5GMK h;  1YHQ T;  2LT1 A;  1MHN A;  5GAN 4;  3OBY A;  2FVU A;  1QVF A;  5J39 A;  2M0O A;  2PU9 B;  3A8G B;  3ZBD A;  3MP8 A;  1XQH A;  3CCR T;  5KCO A;  3OS0 A;  2EJ9 A;  3RES A;  4N4I A;  3PT9 A;  5GAN f;  3N5B B;  2DXT A;  4LDV A;  5CKH A;  1WQ7 A;  2CKK A;  4BDY A;  1YJ9 A;  4C92 B;  4ZN3 A;  2JTM A;  1M4Z A;  3MHX A;  2L8D A;  4XK8 E;  2LCL A;  1KG1 A;  3G4S T;  4C5G A;  4A4F A;  3CXC A;  3X28 B;  3WVE B;  2MI6 A;  1BIB A;  1VIE A;  4QQG A;  2CZ6 B;  4M7D C;  3OB9 A;  5CKE A;  1VQK T;  2HQX A;  3V8K A;  4N4G A;  3L2R A;  4QQ6 A;  1QP3 A;  4OB2 B;  4II1 A;  1JB0 E;  4R56 A;  4BD3 A;  4M75 B;  2QEX T;  2LCC A;  2E12 A;  2HQE A;  4UC4 A;  1VQ4 T;  5FRN A;  3CCQ A;  1H64 1;  1KHC A;  3M53 A;  3HP9 A;  3CCE A;  3CCU T;  1BYM A;  2BKD N;  3G71 A;  2F5T X;  2RO0 A;  4LDU A;  3G6E A;  3C4S A;  5CQX A;  4XU0 A;  4E47 A;  2DD5 A;  5CO7 A;  4C0D B;  5FRM A;  3PMT A;  5GAN d;  2EFI A;  1UEB A;  1ZBX A;  4PLI A;  3T9N A;  4PNO A;  4IUU A;  4FL6 A;  3JCM c;  4PKC C;  3M54 A;  3G4S A;  2IVW A;  1Q7Y U;  4Y28 E;  2X4Y A;  2EKO A;  4TVR A;  3ASK A;  4PJO F;  3CC4 A;  3OS2 A;  3JB9 H;  2VUB A;  4M7A D;  4RCB A;  4IUV A;  4E7L A;  2VGM A;  4JLG A;  3LH0 A;  3OYC A;  1UGS B;  1UGQ B;  2E70 A;  4RG2 A;  1WJR A;  4J7I A;  4EDU A;  4XTU A;  4C92 A;  3VU3 C;  3P8B B;  2KAF A;  2LC4 A;  2D0Q B;  4PJO E;  3V8J A;  3A8M B;  4BE2 A;  1JJ2 S;  4XQ3 A;  3CCQ T;  1VQ6 T;  1RL2 A;  4Q5W A;  3F70 A;  5CAI A;  1Q82 U;  3QJY A;  4FT4 A;  4A54 A;  1GXI E;  5GMK i;  4M7A B;  1VQ6 A;  3X20 B;  4ZGD B;  1VQ9 A;  2EAY A;  2AHJ B;  4C92 E;  3J80 E;  4HKE A;  4FT2 A;  1VQP T;  1KC8 U;  2DIG A;  4M7D F;  5HKC A;  4KBM B;  1KQS A;  2DAQ A;  5GAM f;  2OTJ T;  2JUF A;  2YRV A;  4M7A E;  1M1K C;  4JDS A;  2DPP B;  5KH6 A;  3A8H B;  5FU7 B;  4C5H A;  3CCM T;  2E6N A;  2PVG B;  3OYI A;  2MAM A;  1K9M C;  2L3R A;  2EQM A;  2E5Q A;  3E19 A;  4MZM A;  5GAN h;  1QVG S;  3QJ6 A;  5CKD A;  3C12 A;  5M9O A;  2KSS A;  1ZQ1 A;  3QO3 A;  4BI3 A;  1VQ9 T;  1QVF S;  1WNL A;  1YJW A;  3CD6 T;  2K57 A;  2KDS A;  2V8I A;  1HK9 A;  2RJC A;  1NJI C;  3NFC A;  4M75 C;  1M8V A;  4C0G A;  3CCJ A;  3UDC A;  3QKJ A;  2RH2 A;  4BDZ A;  4PJO D;  3UWN A;  4M7D B;  2E1H A;  1IZ6 A;  4RCC A;  2WSE E;  1VQO T;  2FYK A;  3S3N A;  3VUZ A;  4M77 B;  3OSV A;  2DVE A;  3OYK A;  2RHX A;  5FU7 C;  3I56 T;  4M7A A;  2EIF A;  2P0Q A;  4M78 G;  5LJ3 h;  1U8R A;  3LW5 E;  1QVG A;  5KE2 A;  4EPC A;  1I5L A;  1VIF A;  1S72 A;  4V2S A;  1FX7 A;  1I81 A;  2ZPH B;  3J81 E;  2JN0 A;  2LNV A;  4LD9 K;  3RMS A;  1R8O B;  4C8Q G;  2Y4Y A;  3OQ5 A;  3RER A;  3PTA A;  3LX7 A;  1QW1 A;  4E7H A;  1NE8 A;  5GAO q;  3GNG A;  3FEO A;  5I21 A;  1VQ7 A;  5D6W A;  1BI2 A;  5L8R E;  3JB9 G;  3KXT A;  1HXD A;  5CQY A;  5KE3 A;  1YIT A;  2LQ8 A;  1VQL A;  3HFO A;  1YBY A;  3G6E T;  3OYL A;  1VQM T;  3INZ A;  4E7J A;  2JVV A;  4C92 G;  2QQR A;  2DXB A;  3M5A A;  3HKS A;  2CGH A;  4M78 D;  5GMK l;  1K9M U;  4HT8 A;  4IUP A;  3JB9 D;  1VQ4 A;  5GAN 8;  2HBP A;  5IN1 A;  4C8Q F;  2QEX A;  3OW2 S;  1VQK A;  3I55 A;  4M77 A;  5LJ5 f;  4OVA A;  2ZPI B;  4OB0 B;  3OYF A;  3LGF A;  2Y4X A;  1BI3 A;  3S6W A;  2O4X A;  1O9S A;  3X24 B;  1UB4 A;  5GAN e;  5LJ5 g;  2PUK B;  5CR2 A;  3OYN A;  1NJI U;  3OYB A;  3OMC A;  2PUO B;  2F5K A;  1M1F A;  4F7U F;  2X35 A;  4MZP A;  4J8O A;  3OS5 A;  3E9F A;  4P5N A;  5GAM j;  2GCX A;  1YIJ T;  1BKB A;  1D3B A;  4J6W A;  2XDD A;  2PVD B;  3MP1 A;  3OYE A;  3M56 A;  2PVO B;  4LDW A;  3OW2 A;  1M1K U;  3DB4 A;  5LJ5 j;  3G7Z A;  3I55 T;  2CYZ B;  3H6Z A;  4F7U B;  3GPL A;  5LJ3 f;  1QP2 A;  1B34 B;  2LQK A;  4L6V 5;  3M57 A;  3RKW A;  5LJ3 e;  3VKI A;  1KQS S;  2XD0 A;  4JRQ A;  3OYD A;  3CCU A;  3CCE T;  4C92 C;  3CMA T;  4M77 G;  4RKU E;  3FIF A;  1WQW A;  4BY6 C;  3LWH A;  4HCZ A;  3GP8 A;  2DD4 A;  4PJO A;  2K5I A;  2DTO A;  3WXM B;  2EQJ A;  1M9S A;  4CI0 C;  2PQW A;  1U1T A;  2E41 A;  4OMF B;  5GAN 3;  4ZGE B;  3OA6 A;  2EQU A;  3TU4 K;  4L5G A;  2OTL A;  4C8Q E;  3EFR A;  1VQ5 A;  2HAX A;  4M7D G;  3KUF A;  5GAN 6;  3JCM b;  3QPH A;  5J26 A;  3HRT A;  1WJS A;  3URG A;  1VQ5 T;  2P0P A;  3QXE B;  1XTD A;  3FC3 A;  3DKM A;  3LWI A;  2RK1 A;  5HY6 A;  2X4W A;  4A4E A;  1M1G A;  3A8L B;  2ZPB B;  4HA8 A;  4XTX A;  3VV0 A;  4X9D A;  3M58 A;  3JCM d;  5IT9 E;  3JCM Q;  4PJO B;  1PSF A;  2CZ7 B;  2KMT A;  4ZTF A;  2VC8 A;  5GMK m;  4HT9 A;  4L59 A;  2D9T A;  5A2Q E;  1Y07 A;  4XAX B;  4ZGJ B;  2LX9 A;  3CCL A;  3JCM X;  4ME7 A;  3V7C A;  3BFM A;  4NOY A;  4X34 A;  4HCC A;  1G3W A;  3RUX A;  2ZZD A;  3P8H A;  4RG8 A;  4X9C A;  3EFS A;  2ZPG B;  4NL3 A;  3CC7 T;  2QQ9 A;  3ER0 A;  4M7A C;  1XOV A;  1IRE B;  3CCJ T;  2BIV A;  5CKB A;  3OY9 A;  2YLC A;  5GAM g;  1D3B B;  4QQD A;  2GQV A;  1YJW T;  5GAO m;  3CD6 A;  3CC7 A;  3OYH A;  2C06 A;  2ZCF B;  5CCA A;  3MEA A;  4J5Y A;  5LJ3 j;  3CC2 A;  1VQ7 T;  1PSE A;  4OB3 B;  2RK2 A;  2K4Y A;  2RD1 A;  3JB9 I;  4M77 D;  4QVC A;  1Y71 A;  3OBW A;  4C8Q D;  1LNX A;  3S3O A;  1WGS A;  1YJN A;  4MML A;  3CCM A;  3TRE A;  3WVD B;  5LJ5 d;  4JRI A;  2K3Y A;  2DXC A;  2DTI A;  3ME9 A;  3VYH B;  4EMK B;  2OTJ A;  3LYI A;  1UGR B;  4A53 A;  4M77 F;  1K8A U;  4J83 A;  2E6Z A;  2R5M A;  4ELZ C;  1MGQ A;  4OF1 A;  1YJ9 T;  1H3Z A;  1Q81 U;  3JCM g;  4M7D A;  1FXX A;  5EG2 A;  5CKF A;  4KUL A;  1VUB A;  2IG0 A;  2DEQ A;  2XK0 A;  4D6W A;  2DO3 A;  2XIC A;  2XID A;  1BI0 A;  4JLI A;  2RA2 A;  3I56 A;  4M77 C;  3GF5 A;  3CCS T;  3MP6 A;  4BE1 A;  5I2S A;  3L2Z A;  2FB7 A;  5DY9 A;  3VUB A;  4FM4 B;  4M75 G;  2RI2 A;  3GNF B;  4OGC A;  5FU6 C;  5J3B A;  1YIT T;  1DJ7 B;  4DQ2 A;  4XTW A;  4JRK A;  5HK3 A;  4J7F A;  2I2L A;  1ZHI A;  5GAO n;  5CIU A;  2DTH A;  1K73 C;  3BY7 A;  2DZC A;  4O6J A;  3TEE A;  4JRP A;  3BW1 A;  2A7Y A;  4M78 E;  4QW2 A;  3ZFJ A;  3CC4 T;  3E9G A;  3VYG A;  2B8A A;  2RI5 A;  3JCM e;  2LDM A;  1BI1 A;  2O01 E;  3NTK A;  4F7U E;  3CME A;  4M7A F;  1Y7X A;  3CCR A;  2ZPF B;  4DOW A;  4EMH A;  5HK0 A;  1NZ9 A;  2HNI A;  3PGG A;  3G71 T;  3GIB A;  4M78 A;  2ZGW A;  4JS4 A;  1OZ2 A;  3BDL A;  2EQK A;  5LJ3 d;  3CBO A;  1KHI A;  1WJQ A;  5GAN 7;  4F7U A;  1M90 U;  4PJO C;  3FJP A;  2RJD A;  5DLQ E;  4BI8 B;  1KQ1 A;  5C0M A;  4R55 A;  3CCS A;  3QII A;  3AHU A;  2LVM A;  2E10 A;  4M75 D;  3JCM V;  4LDY A;  2OAU A;  2V8K A;  4JUV A;  5GMK e;  2E64 A;  3MET A;  4XTV A;  3M4Y A;  4KT0 E;  5GAN g;  1X75 C;  2WSC E;  2X4J A;  3FB9 A;  1KD1 U;  2CZ1 B;  1G3T A;  2A3L A;  2JTF A;  3CPW S;  4YTL A;  2P0K A;  3CME T;  4JJN K;  2D6F A;  2F69 A;  4FU6 A;  3V7S A;  2L5Q A;  4M75 F;  1XNI A;  4MZT A;  3L1A A;  2K2V A;  4MMK A;  3S3M A;  3QZ9 B;  3RKX A;  4OB1 B;  3OYA A;  1VQN T;  4BB7 A;  1W2B S;  1YI2 T;  1N8R C;  3HPW A;  3JRZ A;  2EJG A;  4GLK A;  1NPP A;  1G5V A;  1VQN A;  2R57 A;  5GAN j;  1OZ3 A;  1G3Y A;  3JCM W;  1YI2 A;  3L2W A;  2JOY A;  4N0A C;  1WPY A;  1VQ8 A;  5CK9 A;  3MO8 A;  4MDW A;  3TCJ A;  1LOJ A;  3QG1 A;  3MEW A;  3M59 A;  3CPW A;  3JB9 F;  3V8L A;  1X6O A;  2VXF A;  3BDU A;  2Y90 A;  3OYY A;  1VQP A;  2LT4 A;  4J6X A;  4M7D D;  2M1H A;  3PFS A;  2R58 A;  4PJO G;  1N9S A;  3HL8 A;  2EYQ A;  3C94 A;  3MEU A;  3R6O A;  3SWN B;  2XKO C;  3X25 B;  1W2B A;  2CZ0 B;  3LGL A;  4IUQ A;  1UGP B;  3P8D A;  3CMA A;  3QZ5 B;  4OGE A;  3RKY A;  3HRU A;  4CRI A;  1P92 A;  3FLG A;  3V7R A;  4C92 F;  3CCV A;  4M77 E;  5LJ5 e;  2RHY A;  2EJF A;  2LRQ A;  3E1S A;  3GOX A;  1QVP A;  1RI0 A;  2RI3 A;  1KD1 C;  2YLB A;  2QI2 A;  4C5I A;  5GAM d;  5GAO l;  1YJN T;  2K3X A;  5GAM e;  3QHS A;  3CEY A;  4N4H A;  3JCM J;  1YCY A;  2DZ9 A;  4C8Q C;  4GY5 A;  5DLO A;  2X4X A;  2KK4 A;  4NS5 A;  4EMK A;  1Q7Y C;  4ELY C;  2DIQ A;  2DJZ A;  3OYM A;  1AHJ B;  2QQS A;  1FWZ A;  1S72 T;  4O5V A;  1M90 C;  2NLU A;  3A5Z B;  3NTI A;  4E7K A;  3MCA B;  3DLL A;  3A8O B;  3C95 A;  3M55 A;  4LDX A;  4FIB A;  4LD6 A;  1BIA A;  2R5A A;  1U1S A;  4M78 B;  5GMK j;  3VJP A;  2VV5 A;  1OI1 A;  2XU8 A;  4XU2 A;  5A0L A;  1JBM A;  1X01 A;  2CS7 A;  2KQW A;  2L89 A;  3EAE A;  2MMP A;  3LLR A;  3OMG A;  4DA4 A;  4ATO A;  2H3J A;  4J6Y A;  1K8A C;  2EWN A;  3DLM A;  4HCB A;  3JB9 J;  2QXF A;  1OYX A;  4DOV A;  5C6S A;  1Q86 U;  3JSC A;  3OYG A;  1VQL T;  4ZN1 A;  4IKF A;  2GFU A;  3ZEH A;  2ZPE B;  2RB6 A;  2JZ2 A;  2E65 A;  2RJF A;  3NTH A;  4BAC A;  4QVZ A;  1JRI A;  5LJ3 g;  4C8Q A;  4ZTJ A;  2QDY B;  3PNW C;  4OP0 A;  3SD4 A;  4EMG A;  2VXE A;  3L42 A;  3SWN A;  2M16 A;  1Q81 C;  2VGN A;  2GF7 A;  3HFN A;  4C5E A;  2JNG A;  1V29 B;  2K5L A;  5D6Y A;  3SWN C;  4IUT A;  3CXC S;  1KQ2 A;  2FL7 A;  3SB2 A;  4E7I A;  1Q86 C;  5D6X A;  2RHU A;  4F7U G;  3OSS C;  1G3S A;  5GAO p;  5A0D A;  3OS1 A;  1Q82 C;  4M7A G;  1Y96 B;  3M4G A;  5AYF A;  4XTY A;  2V8J A;  5FRO A;  3FDR A;  5CVI A;  2KY9 A;  1YIJ A;  4PLL A;  2RHI A;  1B34 A;  2GFA A;  2DK3 A;  2XHC A;  3HHT B;  3L2V A;  3KBG A;  3PIO A;  3QUI A;  3SDZ A;  2KVQ G;  4IUR A;  2DXU A;  4PL6 A;  1M5Q 1;  3QSU A;  2LTO A;  4A4H A;  3CBM A;  5FU6 B;  2XDB A;  3QDR B;  3L2Q A;  4M75 E;  3PMI A;  1TH7 A;  2K5F A;  4C0F A;  2QA4 T;  4C0Z A;  2RJE A;  2XDP A;  5FLX E;  3JCM P;  5GAM h;  2BUD A;  4NL2 A;  2G3R A;  3MEV A;  4A4K A;  3PIP A;  2QA4 A;  1Y96 A;  4A4G A;  3CPF A;  3RMQ A;  1SSF A;  1N6A A;  2QQB A;  4M75 A;  5LJ5 h;  4BY6 B;  4N0A A;  1I4K 1;  2O4X B;  2WSF E;  4M78 C;  4BUG A;  2QTX A;  3SFM A;  2XI9 A;  5GAN 5;  4B9X A;  4BI4 A;  4FSX A;  3JAM E;  3M9Q A;  2DKG A;  3HRS A;  4XU1 A;  4C0D C;  5DM7 R;  3L2U A;  2RHZ A;  1KC8 C;  5I2M A;  3CCL T;  1YHQ A;  3RIR A;  1LJO A;  4C92 D;  5GAO r;  4RMO A;  4JS5 A;  2RM4 A;  1O75 A;  4C8Q B;  5LL6 S;  1VQ8 T;  3DB3 A;  3GLX A;  2MWO A;  3OYJ A;  1NPR A;  4MDX A;  1K73 U;  4M78 F;  1I8F A;  3CBP A;  3QYG B;  3JCM h;  1JJ2 A;  1EIF A;  4BE0 A;  3Q1J A;  1N8R U;  2P4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...