5KE2A

Crystal structure of setdb1 tudor domain in complex with inhibitor xst06472a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
207
Chain Sequence
ENLYFQGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Histone-lysine N-methyltransferase SETDB1
publication title Crystal structure of SETDB1 Tudor domain in complex with inhibitor xst06472a
rcsb
source organism Homo sapiens
total genus 58
structure length 207
sequence length 211
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18358 Tudor_4 Histone methyltransferase Tudor domain
A PF18359 TUDOR_5 Histone methyltransferase Tudor domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke2A03
4BD3A 2BUDA 3QIIA 2QQRA 3H8ZA 3GOXA 3OYGA 2GFUA 3QKJA 3MP1A 2K3YA 1OI1A 4QQGA 2NLUA 3OYAA 2RHYA 4IUTA 4RG2A 3NTKA 3ZEHA 3OYHA 2QQSA 1KHCA 3OYLA 1WJSA 2EKOA 4BACA 2JTFA 4UC4A 2R57A 4N4IA 4IUVA 3META 2DIGA 4PL6A 2JZ2A 3OA6A 3FC3A 3FDRA 5M9OA 3QBYA 2D9TA 3L2QA 4C5IA 1MHNA 3L42A 3PMTA 4BE2A 4C5GA 3DB3A 2L3RA 4A4HA 3LLRA 3OYJA 5FROA 3MEWA 3SD4A 5C0MA 2R58A 3Q1JA 5KE3A 4X34A 4C5EA 4BE0A 2MWPA 4IURA 5KH6A 2LRQA 2LVMA 4OVAA 3S3MA 1SSFA 5D6YA 2LTOA 2BIVA 3LH0A 1WGSA 2CKKA 2M0OA 3NTHA 2EFIA 3OS0A 2F5KA 3S3NA 4IUUA 4N4HA 3UT1A 3KUFA 3ME9A 3MP8A 3LX7A 2DIQA 4II1A 3ASKA 4FU6A 2PQWA 2DAQA 2GF7A 2M16A 3OYKA 3L2RA 2XDPA 4L59A 1G5VA 4E7JA 3MEUA 1OYXA 3P8HA 4E7HA 3OQ5A 5C6SA 3F70A 4A4GA 3MO8A 2RHIA 4E7LA 4E7IA 3S3OA 5IN1A 5FRNA 5D6WA 2XK0A 3O8VA 3DLMA 3MEVA 5FRMA 3MEAA 3LYIA 3OYFA 1WJQA 2R5AA 2RJFA 2HQXA 4IUPA 4B9XA 4C5HA 5KE2A 2HQEA 4BDYA 3QJ6A 2IG0A 1OZ2A 3BDLA 3PNWC 1RI0A 4N4GA 4ZTJA 2LDMA 1N27A 4LD6A 4BE1A 3L2VA 3OB9A 4IKFA 3H6ZA 1WJRA 2RHUA 2LCCA 2EQUA 2WACA 3LGLA 2FHDA 2L89A 5D6XA 2EQKA 4IUQA 2YRVA 4QQ6A 2O4XA 2RI2A 2E5QA 3OMCA 3OYDA 1OZ3A 3OMGA 4A4FA 4CRIA 4HCZA 2RI5A 2RI3A 3FLGA 2M1HA 3OYCA 3L2WA 2E6NA 2X4XA 5J39A 5IAYA 3OYEA 2EQJA 2RHXA 2VYTA 2X4WA 3OS2A 4Z02A 3C4SA 3PMIA 4QVZA 3M9QA 3OYMA 2P0KA 4EDUA 1XNIA 4B9WA 2RHZA 4FL6A 2BKDN 4QQDA 5CIUA 4ZTFA 2GFAA 2L8DA 3S6WA 3FEOA 3OYBA 3CEYA 4PLLA 2X4YA 3OS1A 2G3RA 2MWOA 2RJDA 2X35A 3OYIA 3L2UA 4E7KA 2EQMA 3E9GA 2R5MA 2RJCA 2B8AA 5KCHA 4BDZA 3PFSA 1H3ZA 3UWNA 3OY9A 2RO0A 2O4XB 4A4EA 3OYNA 3DB4A 5KCOA 3E9FA 3LGFA 5J26A 4Q5WA 3P8DA 3NTIA 4QW2A 4GY5A 3EAEA 4NS5A 4PLIA 3MP6A 2RJEA 2K3XA
chains in the Genus database with same CATH superfamily
4J8OA 4BD3A 2HSPA 2J6FA 1YI2A 2OAWA 5LJ5f 3EGXB 2BZXA 4NL3A 2RHYA 1ZX6A 1D1CA 1S72A 2CP3A 5DY9A 4J9HA 3JB9H 3BY7A 3G71A 1QW1A 4OMNA 4JRPA 2DERA 1MHNA 4RTWA 4M7DA 3CCUQ 3MEWA 1OPLA 1ZQ1A 5CK9A 3EGDB 2DL5A 3WVDB 5IHNA 1I8FA 1YP5A 1ZLMA 4GBQA 4EPCA 1VQNA 2O31A 2EFIA 2AK5A 4E7SA 1G3SA 1LCKA 2G6FX 4KBMB 3M54A 3THKA 1ZSZB 5I2SA 4JJCA 1Q7YR 3A8OB 1PKTA 1FMWA 3PNWC 2AIRB 4JJDA 3CC4A 5CVIA 2RPNA 4LD6A 1AHJB 2DJQA 4BI3A 3JCMX 4M7AF 4J5YA 1KD1U 2NUPB 3OMCA 1X2QA 3OMGA 5D7UA 3FLGA 2JJ9A 1Q82U 2RQUA 4Z02A 1IHWA 2BZ8A 2LCSA 3HRTA 5A0GA 3ER0A 4MDXA 2DYBA 2GQIA 5LJ3e 1YJ9T 2X4YA 2G3RA 5ECAA 1KC8U 1W2BP 3PIOA 2IVWA 4M7DF 2EW3A 4DOVA 1JO8A 3REBB 4C8QE 1BK2A 1MUZA 1UEBA 2XG8D 2XDBA 2KXCA 2RD1A 4DBQA 5GAMg 2KVQG 4MMKA 1WNLA 2X9HA 2MF2A 1GXIE 4F7UE 1D1AA 4BY6C 2DL4A 2OTJQ 2PNIA 2ESWA 2KAFA 1VUBA 3I56A 3RMSA 2QGGA 2RQTA 4HCKA 3CCMT 2ZPEB 2KT1A 2OJ2A 3OYJA 3E1SA 1D0ZA 5GAMd 1VQ5A 2KEAA 2YUPA 1YIJQ 5LJ3f 4X9CA 2R58A 3X25B 1SRLA 2XIDA 1FX7A 4X34A 3N5BB 2QYZA 2SRCA 2DXUA 3NTHA 2L0AA 1MMGA 1MV0B 3QZ5B 1PD1A 1M27C 2Y4YA 3L2RA 2E10A 3QXEB 2Y90A 3A8GB 3G71Q 1OV3A 3VS7A 2VV5A 3MEAA 3VYGA 1VQ8A 2YUOA 4J83A 3NPFA 2CP0A 1NBEB 2XICA 3HP9A 5CKEA 3LGLA 5D6XA 2FO0A 2RI2A 1R77A 1I07A 3VS4A 3VKIA 1LOJA 2M9UA 2F1LA 5LJ3h 2E6NA 1WHHA 2LNVA 4C8QB 2X4WA 4XAXB 2DLPA 4RTVA 1M1GA 3CCLT 1M90U 3JB9D 1U3OA 2FB7A 1JXMA 4ORZA 4Z88A 2RF0A 2K5LA 2QQAA 4F7UB 3OYYA 5CCAA 3UWNA 3EHRA 4FCYA 2RNAA 2Y4XA 1ARKA 3CC4Q 1M4ZA 3NTIA 2CREA 2CZ7B 2ZPHB 4RG8A 2K79A 2KK4A 4XTUA 1OPKA 1YJWT 4B6MA 3EG2A 3ZBDA 1FWZA 3JCMe 4BACA 2HZYA 4O6JA 3RKWA 1KK7A 1Q95G 2E70A 5GAN8 4BE2A 1WQWA 3BE3A 1ZA1B 3MKDA 1AOJA 1X43A 5C0MA 2ZPBB 1QCNA 2Z0WA 1K9MU 2QI2A 2DTHA 3EFRA 4QKUA 3M0TA 2OX7A 5FWCA 3KUFA 3ME9A 2HEQA 2CSIA 4E2FB 4EMKC 2GF7A 2M16A 1Y96A 4M75G 1VQLT 4E7HA 2QK0A 2VASA 5C6SA 2P0PA 5IN1A 3I56Q 2MI6A 4EIKA 2ECZA 2K5FA 5GAMj 3MCAB 1WJQA 2RJFA 2DEUA 3JCMf 2AKLA 2CT3A 1MV3A 3ULRB 5KYWA 3TEEA 1TWBA 1NLPC 1UECA 2CUBA 2LCCA 3GLXA 2ZCFB 1X6BA 2EQKA 4M7DE 1NYGA 2NYSA 3CCJT 1NG2A 2LCLA 4Z8AA 2CT4A 2X4XA 3JB9F 1Z9QA 2RHXA 3EFOA 4QVZA 4XTXA 9ATCB 1G3YA 2P0KA 1HK9A 4EMHA 2A0FB 5CIUA 4HVWA 2O2OA 2EYQA 4DBHA 2L3QA 3QDRB 2DVEA 1VYVA 2K2VA 2X35A 1YJ9A 2HL3A 5J3BA 2KY9A 1C0MA 1AD5A 2XKOC 1VQ8Q 4A4EA 3DB4A 3CC7Q 2GGRA 1JU5C 4M77G 3RNJA 4OMPA 2VGMA 5GMKj 1NJIR 2JS2A 2DPPB 2QQRA 2COYA 3JCMh 1GFCA 1B7TA 4L5GA 4QQGA 4RG2A 2XI9A 2KSSA 3GP8A 1IGQA 4XK8E 2DKGA 4LDVA 4JZ4A 1BIBA 3META 2DIGA 3I35A 4M7AB 3M4YA 2EYWA 3CCMA 4C92A 3LLRA 1T3LA 3G6EQ 4D6WA 3CCQT 4KULA 4PJMA 4KUIA 1A0NB 3A8MB 1Y57A 1S72T 2PVOB 3SB2A 3WVEB 2E12A 4XTYA 4KH0B 3CQTA 5GMKl 4M78A 2LZ6B 4FM4B 1RI9A 1WYXA 4A53A 2CDTA 4AFZC 4WTOB 2C0TA 5GAOn 1KG1A 2E4HA 4M7DB 2WSEE 4E7LA 3M55A 4Y91A 1I1JA 3CMAQ 3DLMA 3UDCA 1K0SA 4FT4A 4C8QD 1VQNT 1Q7YU 1M3BA 2J6KA 1F1BB 3BDLA 2L3PA 2CUDA 2I2LA 4BE1A 2DTOA 2WACA 1PRLC 1G3TA 4FSXA 4M75C 1G8XA 4F17A 1PG5B 1Q81C 1Q86C 1YBYA 3HFNA 3QUIA 1SEMA 4CI0C 2L8DA 3G4ST 3CCLA 2MWOA 4JJBA 4HKEA 1N5ZA 2JNGA 2FPEA 1XJWB 4C92F 1SRMA 1U06A 4PK4A 1M1KR 1M2OA 3OW2S 2LJ0A 5CKHA 2HNIA 3QJYA 1HSQA 4AG1C 2RN8A 1FYNA 2MCNA 1G3WA 2X51A 2EGEA 4HXJA 4WCIA 3RIRA 3J81E 1IRXA 4C0DB 2QQSA 2FRYA 4E7ZA 1UUEA 4M78F 3H0FA 4PKCC 1YJWA 2EJGA 2ABLA 2DXCA 5GMKm 2JZ2A 5M9OA 1U1SA 3HPWA 2D9TA 3L2QA 2YLCA 2DBKA 4X9DA 1UGQB 4M77C 1IZ6A 3SD4A 5GAN7 1D0XA 5CKFA 1U5SA 3OW2A 5DLOA 2B86A 3CD6Q 1B34A 1AWXA 4BB7A 2D8JA 4FU6A 2YWWA 4GLMA 2KNBB 4K11A 1IO6A 2M51A 3CC2A 1N8RR 4A4GA 2D6FA 3VV0A 3BFMA 1VQLA 2CP2A 4MZMA 1I81A 3TU4K 1WXBA 2EAYA 4LUEA 2O88A 2R5AA 1G2BA 4C5HA 1NLOC 1C1AA 2XMFA 1ZBJA 2DJZA 3SFMA 3CCMQ 2KDSA 2K5IA 2NUTA 2F2XA 2RHUA 2EBPA 3UATA 1QLYA 2VKNA 1WA7A 2MK5A 1LPLA 2JW4A 2HAXA 1E6HA 1I0CA 1VYTA 4CRIA 2EGAA 2E64A 5KYNA 3X20B 2RI3A 3CCJA 4F04B 3VS5A 3CCRT 3A8HB 2YLBA 1PSFA 2CS7A 2GFAA 2FL7A 3CMET 2QQ9A 5IHKA 3CEYA 3WXMB 2LQ8A 4JRIA 4LDYA 2CZ6B 2QDYB 3L2UA 2XU8A 5GMKi 1K76A 3CCET 1W2BS 2VB6A 2KR3A 2JUFA 1WX6A 3E2UA 4M7AD 3T9NA 4HT9A 5AYFA 3VS3A 3CCVT 2QEXQ 1PSEA 1KIKA 2LJ1A 4XTWA 3TCJA 1Y7XA 3OYHA 1VIEA 2AKKA 2A28A 2VXEA 4J9BA 4N4IA 1JXOA 2DF6A 2DL8A 1QP3A 2PVGB 4FW1A 4JLIA 1BIAA 3CPFA 3CCLQ 4LE9A 4RUGA 1VIFA 4A54A 4M7DD 3SDZA 2COWA 1X69A 4PJNA 1W2BA 4C5EA 5KH6A 2LRQA 3CCQA 3QDFA 2CGHA 1WHLA 1Q81R 4AMCA 3FRNA 1GCQA 1KHIA 1TG0A 3NHNA 1GBQA 4N4HA 3VUBA 4ZN3A 5FU6B 1H8KA 2VVKA 3FIFA 4XU3A 2FZGB 2GTJA 3MEUA 2QG9B 2LC4A 4ATOA 2LNHB 3QWXX 2RHIA 2VWFA 4E7IA 1RAEB 5IXFA 2DTIA 1VQOQ 2KXDA 1ZSZC 1VQ6Q 3VU3C 1N27A 4C8QG 3EGUA 3JCMg 2MAMA 3RDVA 2EYZA 3EG1A 2FHDA 2L89A 1Y96B 4J9CA 2O4XA 5IHIA 4C92E 4RTTA 3O5ZA 4F7UG 5J39A 5IAYA 2ED1A 3JAME 5LJ5h 3PMIA 1WFWA 2CYZB 2LP5A 2P0QA 5KYWB 2GCXA 3JCMd 1FMKA 2D8HA 2AHJB 3OYBA 1YHQA 5CKBA 4M78E 1VQLQ 1VQMT 2RJDA 2FYKA 1VQ4A 1YWOA 3CBMA 3G4SA 2RA2A 3HTRA 4PNOA 1FXXA 1CKBA 1CKAA 3P8BB 4PJOA 4M4ZA 2QA4T 5FLXE 2V8KA 2DD5A 1NJIU 4D8DA 2GFUA 3EFOB 5CO7A 2RMOA 3EHQA 3M5AA 4M75A 5HKCA 1JB0E 3DLLA 1OQKA 4AG2C 2JTFA 3H0HA 2R57A 6AT1B 4IIMA 2FZCB 2OAUA 3QBYA 2KMTA 2DZCA 4DBFA 3PMTA 5GAOp 3M4GA 4C5GA 1N6AA 3V8LA 5IXBA 4D8KA 2AT1B 2DEQA 3INZA 5KE3A 4IURA 2MWPA 2LT4A 4N0AC 1BCMA 1QQJA 1WGSA 2CKKA 2M0OA 3QG1A 4JRQA 1BI0A 3KBGA 4Y92A 2C0IA 2ZPGB 2W10A 3JCMV 3S3OA 4C92B 2VXFA 2ROTA 3O8VA 3TVTA 1QWFA 1VQ9T 3M0PA 2JS0A 3REAB 4M77A 2DD4A 4N4GA 4DOWA 1MNEA 4M78B 5KYYA 2FRWA 1UG1A 4MMLA 4PJOF 1YI2Q 2D0NA 2PUKB 1TU0B 3CCQQ 1OZ3A 1I5OB 1MMAA 1X6GA 4HCZA 1S72Q 3VS0A 2P4TA 3OYMA 1YITT 1Q82C 3CCRA 1NE8A 1UB4A 4LNPA 3V7SA 3CMEA 1ZHIA 4C8QC 4OB3B 1V76A 3BW1A 1R0CB 3ZL7C 3CCEA 1KC8C 2P84A 5CAIA 1VQNQ 1P92A 4NL2A 4HA8A 1WHJA 2E1HA 1M1KU 2MYSA 2K3YA 2YXYA 2NLUA 5CQYA 1UJYA 3NMZC 2DRKA 3CCVA 1VQPA 2DZ9A 4IUVA 1RABB 1AVZC 5EC7A 4V2SA 5A2QE 1BBZA 3QYGB 3SWNA 4E47A 2E3HA 3CCSA 1R8OB 3G4SQ 1U1TA 4GLKA 4M7DG 1RAGB 2LTOA 1PHTA 4HVUA 1UGSB 2LMJA 2OI3A 1TUCA 4RTYA 5FWBA 3LX7A 4R56A 3OYKA 1QVPA 2BTTA 2EIFA 2QQBA 3F70A 3LWIA 4J9IA 5KYXA 1K73C 2CH4A 2FZKB 2A3LA 1N8RU 2KYBA 3QWYA 1OEBA 2A37A 1O9SA 1AWWA 2CH4W 4RTZA 1OZ2A 4IKFA 3CPWP 4HVVA 1B34B 3QPHA 1UFFA 1TUGB 3CC2T 4M7AE 3RR6A 2KBTA 1TUDA 4R55A 4PFOA 2M02A 3J80E 5HCKA 2DETA 2RK1A 3VJPA 4ZNXA 2F2WA 5IH2A 4KRTA 1UHCA 2BKDN 2KRSA 3MPUB 2LQKA 1JJ2P 1YCSB 1D1BA 4HT8A 3FB9A 2NUZA 2NUTB 3UA6A 1M90C 1VQ5Q 4KGZB 2YSQA 3PFSA 8ATCB 1VQKT 1VQMA 2RM4A 1ZSZA 2E3IA 1K4US 2QGFB 3P8DA 5GJVB 1QVFP 1OULA 1B07A 4E6RA 3GF5A 2QA4A 3OYGA 3MP1A 3V7CA 2F69A 3EG0A 2DBMA 1TTHB 1M9SA 1YWPA 4FYWB 1UTIA 3MHXA 4OMQA 4EMGA 2V1RA 3VS2A 3TREA 3QZ9B 1QVGP 1ZUUA 1U8RA 1BU1A 3J7AF 2L3RA 1YCYA 4ZGJB 3CMEQ 1WPYA 1VA7A 4C92D 5L8RE 2DILA 5GAMe 3Q1JA 4J6XA 4ESRA 1WLPB 3CCEQ 4AFUC 5CQXA 2EJFA 3A98A 3I5RA 1K9MC 2SEMA 2DM1A 5LJ5g 3JB9I 1XQHA 2DIQA 3QYHB 1WHGA 1Q81U 4PJOE 2XDPA 1RAIB 4M78D 5FU7B 1NPPA 3V8KA 3MO8A 5I22A 3PE0A 3IQLA 3OBWA 3CBPA 4QT7A 4IUPA 5LJ5d 2DE0X 4BDYA 2YDLA 3HRUA 3A1PA 2GNCA 3GIBA 2XHCA 4M7DC 4ZTJA 1M8VA 1VQ9A 1JEGA 3L2VA 2EQUA 1TH7A 3RMQA 4N0AA 2V8IA 4CC7A 1NYFA 1YNZA 2OTLT 2BE9B 4A4FA 1UGVA 2JVVA 2QXFA 2ZPIB 1D09B 5GMKe 3OYCA 1XTDA 5IT9E 3C94A 4KT0E 4LDUA 2BE7D 4PLLA 1E7OA 1YITA 3OYIA 1YJNT 2B8AA 4XU2A 2MIOA 1H3ZA 1Y07A 2O4XB 2CSQA 5J26A 1M3CA 4QW2A 1K1ZA 4PLIA 3BDUA 2DL3A 2RJEA 4DBRA 1GL5A 3QIIA 1JRIA 1YHQT 1OOTA 2EYYA 2YT6A 4OMLA 2RQVA 3CBOA 1VQ4T 2A7YA 2EYXA 3DKMA 3JCMP 4DQ2A 5A0LA 2ATCB 4OMOA 3TSWA 3JB9G 1KQSP 4FYXB 4JPBW 1IB8A 4PJOB 1AEYA 1WQ7A 1G83A 2QDLA 1VQMQ 4M75B 2KE9A 1SSFA 2BIVA 4PFPA 3OS0A 3S3NA 3UT1A 2QA4Q 1OX8A 2JM9A 3OSSC 3KFVA 1T3SA 4OP0A 1EFNA 2HKQB 1H3HA 3TSZA 2FPFA 3JCMc 1YJ9Q 4ELZC 2HCKA 5EG2A 5KE2A 1CSKA 1BI2A 1B3QA 1ZUYA 5LJ3g 4FSSA 2DMOA 5GMKh 4J9FA 1BYMA 2YRVA 2E5QA 1X75C 4RKUE 3VS6A 1QMCA 2RI5A 3OYEA 3OS2A 5HK3A 2KT8A 1BI3A 5LJ3d 1MMDA 2EVRA 4OF1A 5LJ5j 4M77B 3RUXA 3HRSA 5KYYB 2DXBA 3HSBA 2PTKA 3HKSA 1J3TA 3RKYA 1WIEA 2RO0A 1M2VA 3GNGA 2C06A 1VQKA 5GAOr 3PVLA 5GAOl 3MP6A 1K8AC 1RUWA 2K3XA 3CXCP 4EMKA 3VS1A 1S1NA 3JCMJ 2A08A 4WF2A 2COZA 3ZEHA 5DLQE 1VOMA 4RMOA 5AT1B 3EG3A 2KGTA 3R6OA 1SSHA 2FEIA 1RLPC 1PKSA 5GANe 1AWOA 2QTVA 4JJNK 4BE0A 3S3MA 2ZPFB 2LVMA 4OVAA 2AZSA 1VQPT 4C92G 3L2ZA 4JLGA 3QHSA 3KXTA 4JS4A 4BI4A 4FT2A 2J7IA 2YUNA 3SWNB 3CCST 1Y0MA 4M78G 2OTJA 1NEGA 2DX1A 4LDXA 1ZBXA 2ROLA 3MEVA 5FU6C 3OYFA 2HKNA 4PJLA 1AZEA 5HK0A 3UF4A 1MNDA 3RKXA 1O75A 2LQNA 1PNJA 2K57A 2X3XD 3OB9A 1YIJA 4QVDA 1MGQA 1WJRA 1UGPB 1Q86R 5GANf 3OS5A 2LJ3A 3H9NA 2WSCE 2QTXA 4KGXB 4OGCA 4ME7A 3M56A 1N9RA 5KYXB 3PGGA 1YJWQ 2OTLA 4YTLA 5GAOm 2D0QB 3HFOA 4AFQC 1XNIA 4LDWA 1SKUB 3CMAT 1UHFA 5GAN2 3FEOA 1JQQA 2X3WD 3OS1A 3HHTB 4CC2A 3C95A 1VYUA 3HL8A 1YJNA 1RAFB 4PFZA 5CR2A 4Q5WA 1OX9A 3I55T 2K2MA 3M0UA 4NS5A 4PJOD 2JTEA 2DYIA 2BUDA 3M53A 1BKBA 3QKJA 4IIOA 2IIMA 2O01E 5LJ3j 1OU9A 3AT1B 3CC2Q 1ABOA 4M75D 1NM7A 1WJSA 5GANh 2F5TX 1NEBA 4PL6A 2O9VA 3OA6A 4OMMA 2RK2A 1WXTA 2VUBA 2ENMA 2VC8A 5I2MA 1BB9A 2EQIA 5KYUA 1H92A 1VQKQ 2EWNA 1AZGB 4ZGEB 3URGA 1TOVA 2KROA 4J9EA 3CCJQ 4OB0B 4XU1A 1D0YA 2PQWA 1I5LA 1M8MA 2EJ9A 2WSFE 4E7JA 1OYXA 1GFDA 4DEYA 2MPXC 2K7AA 3A5ZB 3X26B 3X28B 2PVDB 1RLQC 2JMCA 4MZTA 3L1AA 4RTUA 1KSWA 4BUGA 2HQXA 4BI8B 2KRMA 4OMFB 2LX7A 1X01A 1BCOA 1PD0A 2DRMA 3X24B 1K8AR 4C92C 2JT4A 3H6ZA 1AWJA 4M77D 2E65A 3CPWS 2PUOB 1QCFA 1WHKA 1M5Q1 2RQRA 3SHWA 3CD6T 2F2VA 2DVJA 2V1QA 4MZPA 4M78C 1Z9ZA 2V8JA 2W0ZA 4ZTFA 2MOXA 1VQ7T 3GPLA 3C12A 1JJ2S 2R5MA 4BDZA 2GBQA 1M30A 1QKXA 1IHVA 2DFUA 2YHTA 4RTXA 4BY6B 3EAEA 3OSVA 1QVFS 2PZ1A 2ED0A 1D3BA 1KD1C 3H8ZA 3CPWA 4M75F 1C6VX 1M3AA 3NTKA 2CZ1B 1PC0A 1KHCA 1NJIC 3EG9A 3MJXA 2EKOA 2OTLQ 4NOYA 1OU8A 1K73U 3RESA 4TVRA 3FDRA 1WXUA 2DL7A 1WZOA 1PCXA 1QVGS 1W4SA 1YN8A 3DB3A 1UGRB 1JJ2A 3H41A 2HL5C 5GAOq 1AT1B 4QVCA 2M0YA 3CC7A 1YJNQ 4M7AG 2C0OA 5D6YA 4KUDK 2QEXT 1QVFA 1RL2A 3I5SA 2DAQA 2HMAA 1YHQQ 4XTZA 1WHMA 1K0XA 5FRNA 5D6WA 2FPDA 1VQ4Q 4A4KA 4M77F 4AFSC 2IG0A 3M0QA 1SHGA 1QVGA 2LDMA 1I4K1 3V8JA 4F16A 3G6EA 2IPOB 3ZFJA 3H0IA 1NPRA 3UPUA 3JV3A 5DM7R 4IUQA 3JCMb 5GAN6 1PM3A 2HSEB 3JRZA 3JSCA 1QP2A 2M1HA 2HBWA 2VYTA 3M9QA 4ZN1A 3EGXA 4OB1B 5GAN5 4R0KA 4J6YA 3CCUT 4QQDA 1VQOT 3S6WA 1EIFA 1T0JA 2CP5A 1DJ7B 2GTOA 3QSUA 2EQMA 3E9GA 3CMAA 1HYOA 2J6OA 1VQ6T 2J05A 5KCOA 3E9FA 4JRKA 3I55A 4XU0A 5A0DA 3EGDA 3LH5A 1OI1A 4PJOG 1BI1A 4C0GA 3OYAA 4IUTA 1M1KC 4FYYB 3TQ7P 2HD0A 2RB6A 3G7ZA 1NZ9A 4OGEA 1SF9A 4XTVA 1M2VB 1KQSS 2MMPA 4P5NA 3NGPA 5GAN3 1E6GA 4J9DA 5FROA 2V26A 1QKWA 3D7SB 1W1FA 5HY6A 4EMKB 4ZGDB 5L23A 1RACB 1M1FA 4L6V5 3LH0A 2HBPA 2KYMA 4LUDA 4II1A 2ZZDA 1SPKA 3PTAA 4L59A 1H641 1ZUKA 2NUPA 4A63B 3NFCA 3P8HA 3OQ5A 4ANJA 3CCRQ 2O9SA 4JZ3A 2XK0A 7AT1B 2DO3A 2JOYA 3OBYA 1X2KA 4C0ZA 4J7IA 4B9XA 1KQSA 2HQEA 5FU7C 3JCMW 1N8RC 4M7AC 2EGCA 1X27A 4Z89A 2KI7A 2E5KA 1KD1R 2NWMA 3FJ5A 3EH2A 2AZVA 1KQ1A 3M0SA 3OYDA 1Q86U 2OTJT 1LNXA 1WDXA 3VYHB 1Q82R 3CCVQ 3LWHA 5GANg 2D1XA 1VQPQ 3CD6A 1GCQC 4KGVB 5I11A 4M75E 4CC4B 4EDUA 4PJJA 2JMAA 1YIJT 4FW2A 3C0CA 1WI7A 1KC8R 1ABQA 3PT9A 5KCHA 3CCSQ 1VQ7A 5GANd 4RCCA 3OYNA 2DNUA 1YI2T 5GAMf 4HCBA 2KRNA 3RBBB 4Y28E 1RAHB 3CXCS 3QO3A 3G71T 1PWTA 2HQHA 3A8LB 4LN2A 1SG5A 4CC3A 2E41A 3L42A 4FIBA 3U23A 2P4RA 2LT1A 1UJ0A 2L2PA 1UDLA 2QAZA 2YRCA 3LW5E 3RERA 1Y71A 2FVUA 4M77E 4PJOC 1V29B 5I21A 1ZSGA 4C0FA 1K73R 2F5KA 1GRIA 3I55Q 2FG0A 4ELYC 2QEXA 1N9SA 1X6OA 3CXCA 1UE9A 3SEMA 3G1JA 1G5VA 4JS5A 2PU9B 5GAMh 2CP7A 2JN0A 1HJDA 2BZYA 3GNFB 3I9QA 1RADB 4C0DC 1V1CA 4C8QA 2HDAA 1QWEA 5FRMA 3LYIA 3CC4T 3QJ6A 4MDWA 5KYUB 3JB9J 1FMVA 4JUVA 2RQWA 2ZAEA 1GBRA 4F7UA 2ZGWA 2GQVA 1IGUA 3R6NA 1K8AU 4F14A 4QQ6A 4JDSA 2DK3A 2EPDA 3EFSA 1W6XA 4RCBA 4FYVB 2H3EB 2EQJA 1M90R 4DA4A 4O5VA 1LVKA 1IREB 3FJPA 2RHZA 3E19A 4B9WA 3V7RA 1HD3A 2XDDA 2JTMA 3CCUA 1RAAB 3VRZA 4E7KA 3JCMQ 1VQOA 1EZZB 2RJCA 5CKDA 1KFZA 1Q7YC 2H3JA 2QASA 4KH1B 3OY9A 1ACMB 1QCOA 1MMNA 3LGFA 1VQ6A 4GY5A 3UA7A 5GAN4 3GOXA 4J7FA 2JM8A 2K4YA 3I56T 3OYLA 2K9GA 4DEXA 5GJWB 5FW9A 4UC4A 4J9GA 1LJOA 4VUBA 1IXDA 3FC3A 3EH1A 1TXQA 4C5IA 5GANj 4OB2B 1VQ5T 1KQ2A 4A4HA 4C8QF 1VQ9Q 1K9MR 4LD9K 2J06A 3M59A 1D3BB 4XQ3A 1VQ7Q 2DXTA 2K6DA 4J6WA 1YFNA 4F7UF 3EG9B 2CP6A 3PIPA 1TS9A 2K3BA 4IUUA 3VUZA 3MP8A 1EX4A 3ASKA 1T0HA 2LX9A 1GCPA 3M0RA 1PRMC 2H8HA 3GBQA 4AT1B 1VQ8T 1TSFA 2RH2A 1YITQ 5LL6S 2E6ZA 3CC7T 4X1VA 2LQWA 1JBMA 2DA9A 1HXDA 1XOVA 1RI0A 5LJ5e 3AHUA 3SWNC 2XD0A 2X4JA 3M58A 2KQWA 3VRYA 2I0NA 4HCCA 3L2WA 2EKHA 2JXBA 2CZ0B 3C4SA 2YRDA 4FL6A 3G6ET 1ZA2B 1W70A 3M57A 2YUQA 1R0BG 2VGNA 2L5QA 3PVQA 1SHFA 4M7AA 3OW2P 4LXCA 1K9AA 8AT1B 2A36A 1KJWA 2L3SA
chains in the Genus database with same CATH topology
4J8OA 1G3WA 4BD3A 1D3BA 1KD1C 3H8ZA 3CPWA 2QA4A 3OYGA 1YI2A 5LJ5f 4M75F 3MP1A 3V7CA 3RIRA 4NL3A 2F69A 3J81E 2RHYA 3NTKA 2CZ1B 1S72A 4C0DB 2QQSA 1M9SA 1KHCA 4M78F 1NJIC 2EKOA 4PKCC 5DY9A 1YJWA 2EJGA 4NOYA 3JB9H 3BY7A 3G71A 3MHXA 1K73U 1QW1A 2DXCA 4EMGA 3RESA 2JZ2A 5GMKm 4TVRA 4JRPA 3TREA 3QZ9B 3FDRA 5M9OA 1U1SA 3HPWA 2D9TA 3L2QA 1MHNA 2YLCA 1QVGS 4X9DA 1W4SA 1U8RA 3DB3A 3J7AF 4M7DA 1UGQB 2L3RA 1YCYA 4ZGJB 1UGRB 4M77C 1JJ2A 3MEWA 1IZ6A 3SD4A 1WPYA 1ZQ1A 5GAN7 4C92D 5L8RE 5GAMe 5GAOq 3Q1JA 4J6XA 5CK9A 4QVCA 3WVDB 1I8FA 3CC7A 4M7AG 5D6YA 4KUDK 5CKFA 4EPCA 3OW2A 1VQNA 5CQXA 2QEXT 2EJFA 2EFIA 1QVFA 1K9MC 5DLOA 1RL2A 5LJ5g 3JB9I 1B34A 1XQHA 4BB7A 1G3SA 2DIQA 3QYHB 4FU6A 4KBMB 1Q81U 2DAQA 4PJOE 2XDPA 4M78D 5FU7B 1NPPA 3M54A 3V8KA 3CC2A 4A4GA 3MO8A 5I2SA 2D6FA 4XTZA 3VV0A 3BFMA 1VQLA 5FRNA 5D6WA 4MZMA 3OBWA 1I81A 3TU4K 2EAYA 3CBPA 3A8OB 2R5AA 4IUPA 4C5HA 5LJ5d 4BDYA 4A4KA 4M77F 2DJZA 2IG0A 3HRUA 3SFMA 3PNWC 1QVGA 3GIBA 2XHCA 3CC4A 2KDSA 2LDMA 1I4K1 5CVIA 3V8JA 2K5IA 4LD6A 3G6EA 4ZTJA 1VQ9A 3L2VA 3ZFJA 1AHJB 2RHUA 2EQUA 4BI3A 1NPRA 3UPUA 1TH7A 3RMQA 3JCMX 4M7AF 4N0AA 2V8IA 5DM7R 4IUQA 4J5YA 3JCMb 1KD1U 2HAXA 5GAN6 3OMCA 2OTLT 3OMGA 4A4FA 4CRIA 2E64A 2JVVA 2QXFA 3JRZA 3JSCA 3X20B 2RI3A 2ZPIB 3FLGA 1QP2A 2M1HA 5GMKe 3OYCA 1Q82U 3CCJA 1M1KC 2VYTA 4Z02A 3M9QA 3CCRT 4ZN1A 4OB1B 1XTDA 5IT9E 5GAN5 4J6YA 3CCUT 3A8HB 5A0GA 2YLBA 3HRTA 3ER0A 1PSFA 4QQDA 5LJ3e 2CS7A 2GFAA 3C94A 2FL7A 3CMET 4KT0E 1EIFA 2QQ9A 3S6WA 1YJ9T 3CEYA 4LDUA 3WXMB 4PLLA 2LQ8A 2X4YA 4JRIA 2G3RA 4LDYA 1YITA 2CZ6B 1DJ7B 2QDYB 3OYIA 2EQMA 2XU8A 3E9GA 3L2UA 3CMAA 5GMKi 2B8AA 1YJNT 4XU2A 1KC8U 3PIOA 1H3ZA 1VQ6T 3CCET 2IVWA 1W2BS 1Y07A 2O4XB 4M7DF 5KCOA 3E9FA 1VQOT 5J26A 4DOVA 2JUFA 4QW2A 4C8QE 4JRKA 4M7AD 4PLIA 3BDUA 2RJEA 3T9NA 1UEBA 3I55A 2XG8D 3QIIA 4XU0A 2XDBA 5A0DA 5AYFA 4HT9A 3CCVT 2RD1A 1JRIA 4C0GA 1OI1A 1PSEA 1BI1A 4PJOG 3OYAA 1YHQT 5GAMg 2KVQG 4IUTA 4XTWA 4MMKA 1WNLA 3CBOA 3TCJA 1Y7XA 2A7YA 3OYHA 2MF2A 1VQ4T 1VIEA 3DKMA 1GXIE 4F7UE 3JCMP 4DQ2A 4BY6C 5A0LA 2VXEA 3I56A 2KAFA 1VUBA 2HD0A 3RMSA 4N4IA 3JB9G 2RB6A 3G7ZA 1NZ9A 4OGEA 3CCMT 4XTVA 1KQSS 4PJOB 1QP3A 2PVGB 2ZPEB 2MMPA 4JLIA 1BIAA 4P5NA 3CPFA 5GAN3 3OYJA 1WQ7A 3E1SA 5FROA 5GAMd 1VIFA 1VQ5A 4A54A 4M7DD 5LJ3f 5HY6A 3SDZA 4X9CA 2R58A 3X25B 4EMKB 2XIDA 4ZGDB 1FX7A 4X34A 1W2BA 3N5BB 4C5EA 5KH6A 2LRQA 4M75B 3CCQA 1SSFA 1M1FA 2BIVA 3LH0A 4L6V5 2CGHA 2HBPA 2DXUA 3NTHA 3OS0A 3FRNA 3S3NA 1KHIA 4N4HA 3UT1A 4ZN3A 3VUBA 3QZ5B 3RERA 4II1A 5FU6B 2ZZDA 3FIFA 2Y4YA 3L2RA 4XU3A 3PTAA 1H641 4L59A 3OSSC 3NFCA 4OP0A 3MEUA 3P8HA 2LC4A 3OQ5A 2E10A 4ATOA 3QXEB 2RHIA 4E7IA 2DTIA 3JCMc 2Y90A 2XK0A 3A8GB 4ELZC 2DO3A 2JOYA 2VV5A 3MEAA 3OBYA 5EG2A 3VYGA 4J83A 4C0ZA 4J7IA 5KE2A 4B9XA 1VQ8A 1KQSA 2HQEA 5FU7C 3JCMW 1BI2A 1N8RC 2XICA 3HP9A 5CKEA 4M7AC 3VU3C 1N27A 5LJ3g 4C8QG 3JCMg 2MAMA 5GMKh 3LGLA 5D6XA 2FHDA 2L89A 1BYMA 1Y96B 2YRVA 2O4XA 2RI2A 1KQ1A 2E5QA 4C92E 3OYDA 1Q86U 1X75C 2OTJT 1LNXA 3VYHB 3VKIA 1LOJA 2M9UA 4RKUE 3LWHA 2RI5A 5LJ3h 5GANg 4F7UG 2E6NA 5J39A 3OYEA 5IAYA 3JAME 3CD6A 2LNVA 4C8QB 2X4WA 4XAXB 5HK3A 5LJ5h 3OS2A 3PMIA 1BI3A 4M75E 2CYZB 5LJ3d 1M1GA 2P0QA 4EDUA 3CCLT 3JB9D 1M90U 2GCXA 3JCMd 4OF1A 1YIJT 5LJ5j 2AHJB 2FB7A 3OYBA 4M77B 1YHQA 5CKBA 4M78E 1VQMT 2RJDA 2FYKA 1VQ4A 2K5LA 3RUXA 2QQAA 3PT9A 3HRSA 4F7UB 5KCHA 2DXBA 3OYYA 3CBMA 3HSBA 3HKSA 3G4SA 1VQ7A 2RA2A 3RKYA 4PNOA 3UWNA 1FXXA 5CCAA 5GANd 3P8BB 2RO0A 3GNGA 4RCCA 3OYNA 4PJOA 2Y4XA 2C06A 1VQKA 1M4ZA 3NTIA 2QA4T 1YI2T 5GAOr 5GAMf 5GAOl 2CZ7B 3MP6A 5FLXE 1K8AC 2ZPHB 2V8KA 2DD5A 2K3XA 4RG8A 4HCBA 4Y28E 4EMKA 3CXCS 2GFUA 2KK4A 5CO7A 1NJIU 4XTUA 3M5AA 3QO3A 4M75A 3JCMJ 5HKCA 1YJWT 1JB0E 3DLLA 4WF2A 3ZEHA 5DLQE 3G71T 3ZBDA 1FWZA 3A8LB 3JCMe 4BACA 2JTFA 2R57A 4O6JA 4RMOA 3RKWA 2E70A 3R6OA 2E41A 2OAUA 5GAN8 3QBYA 2KMTA 2DZCA 4BE2A 3L42A 3PMTA 4FIBA 5GAOp 1WQWA 3M4GA 4C5GA 1N6AA 3V8LA 5GANe 2LT1A 4JJNK 5C0MA 2ZPBB 2DEQA 3LW5E 3INZA 5KE3A 1K9MU 4BE0A 3S3MA 1Y71A 2MWPA 2DTHA 2LT4A 2LVMA 2QI2A 2ZPFB 3EFRA 4IURA 4N0AC 2FVUA 4M77E 4OVAA 1VQPT 4PJOC 4C92G 3L2ZA 1WGSA 1V29B 2CKKA 4JLGA 2M0OA 5I21A 3QG1A 4C0FA 3QHSA 2F5KA 4JRQA 1BI0A 3KBGA 3KUFA 3ME9A 4ELYC 2QEXA 1N9SA 1X6OA 3KXTA 3CXCA 4EMKC 2GF7A 2M16A 1Y96A 4JS4A 4M75G 4BI4A 2ZPGB 4JS5A 2PU9B 1VQLT 1G5VA 4FT2A 5GAMh 4E7HA 2JN0A 3JCMV 5C6SA 3GNFB 3SWNB 3CCST 2P0PA 4C92B 3S3OA 5IN1A 4M78G 4C0DC 2OTJA 2VXFA 4C8QA 2MI6A 1ZBXA 4LDXA 3O8VA 2K5FA 5GAMj 3MEVA 5FRMA 3MCAB 5FU6C 3LYIA 3OYFA 1WJQA 2RJFA 3CC4T 3JCMf 1VQ9T 5HK0A 3QJ6A 3TEEA 4MDWA 3RKXA 1O75A 3JB9J 4JUVA 4M77A 2DD4A 2K57A 4N4GA 4DOWA 3OB9A 1YIJA 4QVDA 1MGQA 1WJRA 1UGPB 4F7UA 2LCCA 2ZGWA 3GLXA 4M78B 2ZCFB 2GQVA 4MMLA 4PJOF 5GANf 3OS5A 1K8AU 2PUKB 2EQKA 4QQ6A 4JDSA 2WSCE 4M7DE 2DK3A 2QTXA 1OZ3A 3EFSA 4OGCA 3CCJT 4ME7A 2LCLA 3M56A 4HCZA 4RCBA 1N9RA 2X4XA 3PGGA 3JB9F 2OTLA 2EQJA 2RHXA 4YTLA 5GAOm 4DA4A 2D0QB 3HFOA 2P4TA 3OYMA 4QVZA 4O5VA 4XTXA 1G3YA 2P0KA 1IREB 1HK9A 1XNIA 2RHZA 3E19A 3FJPA 5CIUA 4LDWA 3V7RA 4B9WA 4EMHA 1YITT 1Q82C 3CMAT 5GAN2 3FEOA 3CCRA 1NE8A 2EYQA 2XDDA 2JTMA 1UB4A 3CCUA 3QDRB 2DVEA 3OS1A 3JCMQ 2K2VA 2X35A 3V7SA 4E7KA 1VQOA 1YJ9A 2RJCA 5J3BA 2KY9A 5CKDA 3CMEA 1ZHIA 4C8QC 3HHTB 1Q7YC 2H3JA 2XKOC 4OB3B 3C95A 3OY9A 3BW1A 3HL8A 4A4EA 1YJNA 3DB4A 5CR2A 3LGFA 4Q5WA 4M77G 3I55T 1VQ6A 3CCEA 1KC8C 5CAIA 5GMKj 1P92A 2VGMA 4GY5A 4NL2A 4HA8A 4NS5A 5GAN4 2E1HA 4PJOD 1M1KU 2BUDA 2DPPB 2QQRA 4J7FA 3M53A 3JCMh 3GOXA 1BKBA 2K4YA 3QKJA 4L5GA 2K3YA 4QQGA 2NLUA 2O01E 5LJ3j 5CQYA 4RG2A 2XI9A 2KSSA 3I56T 3GP8A 3CCVA 3OYLA 4M75D 1WJSA 1VQPA 4XK8E 5GANh 2DKGA 4LDVA 4UC4A 2DZ9A 1BIBA 2F5TX 3META 2DIGA 1LJOA 4IUVA 4VUBA 4PL6A 3OA6A 3FC3A 4V2SA 4C5IA 4M7AB 5A2QE 4OB2B 5GANj 1VQ5T 2RK2A 3M4YA 1KQ2A 1M8VA 3QYGB 3CCMA 3SWNA 4A4HA 4C8QF 3LLRA 4C92A 4E47A 3QSUA 4LD9K 4D6WA 3CCQT 2VUBA 3M59A 4KULA 1R8OB 1D3BB 4XQ3A 3CCSA 1U1TA 2DXTA 2VC8A 4GLKA 4KUIA 5I2MA 3A8MB 4J6WA 1S72T 2PVOB 4M7DG 3SB2A 2LTOA 3WVEB 2EWNA 4F7UF 2E12A 4ZGEB 3URGA 1UGSB 4XTYA 3PIPA 4IUUA 5GMKl 4M78A 3VUZA 4FM4B 4OB0B 3MP8A 3LX7A 4XU1A 3ASKA 2PQWA 4R56A 4A53A 3OYKA 1I5LA 1QVPA 2EIFA 2EJ9A 2WSFE 2LX9A 2QQBA 4E7JA 5GAOn 1OYXA 1KG1A 4M7DB 3F70A 3A5ZB 3X26B 3X28B 2WSEE 3LWIA 2PVDB 4E7LA 1K73C 3M55A 1VQ8T 2RH2A 4Y91A 2A3LA 5LL6S 1N8RU 2E6ZA 4MZTA 3CC7T 3DLMA 3L1AA 3UDCA 1JBMA 4BUGA 2HQXA 4FT4A 1O9SA 4BI8B 4C8QD 1Q7YU 1VQNT 4MDXA 4OMFB 1HXDA 1XOVA 1X01A 1OZ2A 3BDLA 1RI0A 5LJ5e 2I2LA 3AHUA 3X24B 3SWNC 4BE1A 4C92C 2DTOA 2X4JA 4IKFA 3H6ZA 2XD0A 4M77D 1B34B 2E65A 3QPHA 2PUOB 3CPWS 2WACA 3CC2T 4M7AE 1M5Q1 1G3TA 4FSXA 3M58A 2KQWA 4R55A 3CD6T 4M75C 4M7DC 3J80E 4HCCA 3L2WA 1Q81C 2CZ0B 4MZPA 2RK1A 3VJPA 4M78C 1Q86C 3C4SA 1YBYA 3HFNA 2V8JA 3QUIA 4ZTFA 4FL6A 2BKDN 3G6ET 4CI0C 2L8DA 3M57A 2LQKA 3G4ST 1VQ7T 3GPLA 3CCLA 4HT8A 3C12A 3FB9A 2MWOA 1JJ2S 4HKEA 1M90C 2R5MA 2VGNA 4BDZA 2L5QA 3PFSA 2JNGA 1VQKT 1VQMA 2RM4A 4M7AA 4C92F 2YHTA 3P8DA 3OW2S 5CKHA 2HNIA 4BY6B 3EAEA 3OSVA 3QJYA 1QVFS 3GF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD3 A;  2BUD A;  3QII A;  2QQR A;  3H8Z A;  3GOX A;  3OYG A;  2GFU A;  3QKJ A;  3MP1 A;  2K3Y A;  1OI1 A;  4QQG A;  2NLU A;  3OYA A;  2RHY A;  4IUT A;  4RG2 A;  3NTK A;  3ZEH A;  3OYH A;  2QQS A;  1KHC A;  3OYL A;  1WJS A;  2EKO A;  4BAC A;  2JTF A;  4UC4 A;  2R57 A;  4N4I A;  4IUV A;  3MET A;  2DIG A;  4PL6 A;  2JZ2 A;  3OA6 A;  3FC3 A;  3FDR A;  5M9O A;  3QBY A;  2D9T A;  3L2Q A;  4C5I A;  1MHN A;  3L42 A;  3PMT A;  4BE2 A;  4C5G A;  3DB3 A;  2L3R A;  4A4H A;  3LLR A;  3OYJ A;  5FRO A;  3MEW A;  3SD4 A;  5C0M A;  2R58 A;  3Q1J A;  5KE3 A;  4X34 A;  4C5E A;  4BE0 A;  2MWP A;  4IUR A;  5KH6 A;  2LRQ A;  2LVM A;  4OVA A;  3S3M A;  1SSF A;  5D6Y A;  2LTO A;  2BIV A;  3LH0 A;  1WGS A;  2CKK A;  2M0O A;  3NTH A;  2EFI A;  3OS0 A;  2F5K A;  3S3N A;  4IUU A;  4N4H A;  3UT1 A;  3KUF A;  3ME9 A;  3MP8 A;  3LX7 A;  2DIQ A;  4II1 A;  3ASK A;  4FU6 A;  2PQW A;  2DAQ A;  2GF7 A;  2M16 A;  3OYK A;  3L2R A;  2XDP A;  4L59 A;  1G5V A;  4E7J A;  3MEU A;  1OYX A;  3P8H A;  4E7H A;  3OQ5 A;  5C6S A;  3F70 A;  4A4G A;  3MO8 A;  2RHI A;  4E7L A;  4E7I A;  3S3O A;  5IN1 A;  5FRN A;  5D6W A;  2XK0 A;  3O8V A;  3DLM A;  3MEV A;  5FRM A;  3MEA A;  3LYI A;  3OYF A;  1WJQ A;  2R5A A;  2RJF A;  2HQX A;  4IUP A;  4B9X A;  4C5H A;  5KE2 A;  2HQE A;  4BDY A;  3QJ6 A;  2IG0 A;  1OZ2 A;  3BDL A;  3PNW C;  1RI0 A;  4N4G A;  4ZTJ A;  2LDM A;  1N27 A;  4LD6 A;  4BE1 A;  3L2V A;  3OB9 A;  4IKF A;  3H6Z A;  1WJR A;  2RHU A;  2LCC A;  2EQU A;  2WAC A;  3LGL A;  2FHD A;  2L89 A;  5D6X A;  2EQK A;  4IUQ A;  2YRV A;  4QQ6 A;  2O4X A;  2RI2 A;  2E5Q A;  3OMC A;  3OYD A;  1OZ3 A;  3OMG A;  4A4F A;  4CRI A;  4HCZ A;  2RI5 A;  2RI3 A;  3FLG A;  2M1H A;  3OYC A;  3L2W A;  2E6N A;  2X4X A;  5J39 A;  5IAY A;  3OYE A;  2EQJ A;  2RHX A;  2VYT A;  2X4W A;  3OS2 A;  4Z02 A;  3C4S A;  3PMI A;  4QVZ A;  3M9Q A;  3OYM A;  2P0K A;  4EDU A;  1XNI A;  4B9W A;  2RHZ A;  4FL6 A;  2BKD N;  4QQD A;  5CIU A;  4ZTF A;  2GFA A;  2L8D A;  3S6W A;  3FEO A;  3OYB A;  3CEY A;  4PLL A;  2X4Y A;  3OS1 A;  2G3R A;  2MWO A;  2RJD A;  2X35 A;  3OYI A;  3L2U A;  4E7K A;  2EQM A;  3E9G A;  2R5M A;  2RJC A;  2B8A A;  5KCH A;  4BDZ A;  3PFS A;  1H3Z A;  3UWN A;  3OY9 A;  2RO0 A;  2O4X B;  4A4E A;  3OYN A;  3DB4 A;  5KCO A;  3E9F A;  3LGF A;  5J26 A;  4Q5W A;  3P8D A;  3NTI A;  4QW2 A;  4GY5 A;  3EAE A;  4NS5 A;  4PLI A;  3MP6 A;  2RJE A;  2K3X A; 
#chains in the Genus database with same CATH topology
 4J8O A;  4BD3 A;  2HSP A;  2J6F A;  1YI2 A;  2OAW A;  5LJ5 f;  3EGX B;  2BZX A;  4NL3 A;  2RHY A;  1ZX6 A;  1D1C A;  1S72 A;  2CP3 A;  5DY9 A;  4J9H A;  3JB9 H;  3BY7 A;  3G71 A;  1QW1 A;  4OMN A;  4JRP A;  2DER A;  1MHN A;  4RTW A;  4M7D A;  3CCU Q;  3MEW A;  1OPL A;  1ZQ1 A;  5CK9 A;  3EGD B;  2DL5 A;  3WVD B;  5IHN A;  1I8F A;  1YP5 A;  1ZLM A;  4GBQ A;  4EPC A;  1VQN A;  2O31 A;  2EFI A;  2AK5 A;  4E7S A;  1G3S A;  1LCK A;  2G6F X;  4KBM B;  3M54 A;  3THK A;  1ZSZ B;  5I2S A;  4JJC A;  1Q7Y R;  3A8O B;  1PKT A;  1FMW A;  3PNW C;  2AIR B;  4JJD A;  3CC4 A;  5CVI A;  2RPN A;  4LD6 A;  1AHJ B;  2DJQ A;  4BI3 A;  3JCM X;  4M7A F;  4J5Y A;  1KD1 U;  2NUP B;  3OMC A;  1X2Q A;  3OMG A;  5D7U A;  3FLG A;  2JJ9 A;  1Q82 U;  2RQU A;  4Z02 A;  1IHW A;  2BZ8 A;  2LCS A;  3HRT A;  5A0G A;  3ER0 A;  4MDX A;  2DYB A;  2GQI A;  5LJ3 e;  1YJ9 T;  2X4Y A;  2G3R A;  5ECA A;  1KC8 U;  1W2B P;  3PIO A;  2IVW A;  4M7D F;  2EW3 A;  4DOV A;  1JO8 A;  3REB B;  4C8Q E;  1BK2 A;  1MUZ A;  1UEB A;  2XG8 D;  2XDB A;  2KXC A;  2RD1 A;  4DBQ A;  5GAM g;  2KVQ G;  4MMK A;  1WNL A;  2X9H A;  2MF2 A;  1GXI E;  4F7U E;  1D1A A;  4BY6 C;  2DL4 A;  2OTJ Q;  2PNI A;  2ESW A;  2KAF A;  1VUB A;  3I56 A;  3RMS A;  2QGG A;  2RQT A;  4HCK A;  3CCM T;  2ZPE B;  2KT1 A;  2OJ2 A;  3OYJ A;  3E1S A;  1D0Z A;  5GAM d;  1VQ5 A;  2KEA A;  2YUP A;  1YIJ Q;  5LJ3 f;  4X9C A;  2R58 A;  3X25 B;  1SRL A;  2XID A;  1FX7 A;  4X34 A;  3N5B B;  2QYZ A;  2SRC A;  2DXU A;  3NTH A;  2L0A A;  1MMG A;  1MV0 B;  3QZ5 B;  1PD1 A;  1M27 C;  2Y4Y A;  3L2R A;  2E10 A;  3QXE B;  2Y90 A;  3A8G B;  3G71 Q;  1OV3 A;  3VS7 A;  2VV5 A;  3MEA A;  3VYG A;  1VQ8 A;  2YUO A;  4J83 A;  3NPF A;  2CP0 A;  1NBE B;  2XIC A;  3HP9 A;  5CKE A;  3LGL A;  5D6X A;  2FO0 A;  2RI2 A;  1R77 A;  1I07 A;  3VS4 A;  3VKI A;  1LOJ A;  2M9U A;  2F1L A;  5LJ3 h;  2E6N A;  1WHH A;  2LNV A;  4C8Q B;  2X4W A;  4XAX B;  2DLP A;  4RTV A;  1M1G A;  3CCL T;  1M90 U;  3JB9 D;  1U3O A;  2FB7 A;  1JXM A;  4ORZ A;  4Z88 A;  2RF0 A;  2K5L A;  2QQA A;  4F7U B;  3OYY A;  5CCA A;  3UWN A;  3EHR A;  4FCY A;  2RNA A;  2Y4X A;  1ARK A;  3CC4 Q;  1M4Z A;  3NTI A;  2CRE A;  2CZ7 B;  2ZPH B;  4RG8 A;  2K79 A;  2KK4 A;  4XTU A;  1OPK A;  1YJW T;  4B6M A;  3EG2 A;  3ZBD A;  1FWZ A;  3JCM e;  4BAC A;  2HZY A;  4O6J A;  3RKW A;  1KK7 A;  1Q95 G;  2E70 A;  5GAN 8;  4BE2 A;  1WQW A;  3BE3 A;  1ZA1 B;  3MKD A;  1AOJ A;  1X43 A;  5C0M A;  2ZPB B;  1QCN A;  2Z0W A;  1K9M U;  2QI2 A;  2DTH A;  3EFR A;  4QKU A;  3M0T A;  2OX7 A;  5FWC A;  3KUF A;  3ME9 A;  2HEQ A;  2CSI A;  4E2F B;  4EMK C;  2GF7 A;  2M16 A;  1Y96 A;  4M75 G;  1VQL T;  4E7H A;  2QK0 A;  2VAS A;  5C6S A;  2P0P A;  5IN1 A;  3I56 Q;  2MI6 A;  4EIK A;  2ECZ A;  2K5F A;  5GAM j;  3MCA B;  1WJQ A;  2RJF A;  2DEU A;  3JCM f;  2AKL A;  2CT3 A;  1MV3 A;  3ULR B;  5KYW A;  3TEE A;  1TWB A;  1NLP C;  1UEC A;  2CUB A;  2LCC A;  3GLX A;  2ZCF B;  1X6B A;  2EQK A;  4M7D E;  1NYG A;  2NYS A;  3CCJ T;  1NG2 A;  2LCL A;  4Z8A A;  2CT4 A;  2X4X A;  3JB9 F;  1Z9Q A;  2RHX A;  3EFO A;  4QVZ A;  4XTX A;  9ATC B;  1G3Y A;  2P0K A;  1HK9 A;  4EMH A;  2A0F B;  5CIU A;  4HVW A;  2O2O A;  2EYQ A;  4DBH A;  2L3Q A;  3QDR B;  2DVE A;  1VYV A;  2K2V A;  2X35 A;  1YJ9 A;  2HL3 A;  5J3B A;  2KY9 A;  1C0M A;  1AD5 A;  2XKO C;  1VQ8 Q;  4A4E A;  3DB4 A;  3CC7 Q;  2GGR A;  1JU5 C;  4M77 G;  3RNJ A;  4OMP A;  2VGM A;  5GMK j;  1NJI R;  2JS2 A;  2DPP B;  2QQR A;  2COY A;  3JCM h;  1GFC A;  1B7T A;  4L5G A;  4QQG A;  4RG2 A;  2XI9 A;  2KSS A;  3GP8 A;  1IGQ A;  4XK8 E;  2DKG A;  4LDV A;  4JZ4 A;  1BIB A;  3MET A;  2DIG A;  3I35 A;  4M7A B;  3M4Y A;  2EYW A;  3CCM A;  4C92 A;  3LLR A;  1T3L A;  3G6E Q;  4D6W A;  3CCQ T;  4KUL A;  4PJM A;  4KUI A;  1A0N B;  3A8M B;  1Y57 A;  1S72 T;  2PVO B;  3SB2 A;  3WVE B;  2E12 A;  4XTY A;  4KH0 B;  3CQT A;  5GMK l;  4M78 A;  2LZ6 B;  4FM4 B;  1RI9 A;  1WYX A;  4A53 A;  2CDT A;  4AFZ C;  4WTO B;  2C0T A;  5GAO n;  1KG1 A;  2E4H A;  4M7D B;  2WSE E;  4E7L A;  3M55 A;  4Y91 A;  1I1J A;  3CMA Q;  3DLM A;  3UDC A;  1K0S A;  4FT4 A;  4C8Q D;  1VQN T;  1Q7Y U;  1M3B A;  2J6K A;  1F1B B;  3BDL A;  2L3P A;  2CUD A;  2I2L A;  4BE1 A;  2DTO A;  2WAC A;  1PRL C;  1G3T A;  4FSX A;  4M75 C;  1G8X A;  4F17 A;  1PG5 B;  1Q81 C;  1Q86 C;  1YBY A;  3HFN A;  3QUI A;  1SEM A;  4CI0 C;  2L8D A;  3G4S T;  3CCL A;  2MWO A;  4JJB A;  4HKE A;  1N5Z A;  2JNG A;  2FPE A;  1XJW B;  4C92 F;  1SRM A;  1U06 A;  4PK4 A;  1M1K R;  1M2O A;  3OW2 S;  2LJ0 A;  5CKH A;  2HNI A;  3QJY A;  1HSQ A;  4AG1 C;  2RN8 A;  1FYN A;  2MCN A;  1G3W A;  2X51 A;  2EGE A;  4HXJ A;  4WCI A;  3RIR A;  3J81 E;  1IRX A;  4C0D B;  2QQS A;  2FRY A;  4E7Z A;  1UUE A;  4M78 F;  3H0F A;  4PKC C;  1YJW A;  2EJG A;  2ABL A;  2DXC A;  5GMK m;  2JZ2 A;  5M9O A;  1U1S A;  3HPW A;  2D9T A;  3L2Q A;  2YLC A;  2DBK A;  4X9D A;  1UGQ B;  4M77 C;  1IZ6 A;  3SD4 A;  5GAN 7;  1D0X A;  5CKF A;  1U5S A;  3OW2 A;  5DLO A;  2B86 A;  3CD6 Q;  1B34 A;  1AWX A;  4BB7 A;  2D8J A;  4FU6 A;  2YWW A;  4GLM A;  2KNB B;  4K11 A;  1IO6 A;  2M51 A;  3CC2 A;  1N8R R;  4A4G A;  2D6F A;  3VV0 A;  3BFM A;  1VQL A;  2CP2 A;  4MZM A;  1I81 A;  3TU4 K;  1WXB A;  2EAY A;  4LUE A;  2O88 A;  2R5A A;  1G2B A;  4C5H A;  1NLO C;  1C1A A;  2XMF A;  1ZBJ A;  2DJZ A;  3SFM A;  3CCM Q;  2KDS A;  2K5I A;  2NUT A;  2F2X A;  2RHU A;  2EBP A;  3UAT A;  1QLY A;  2VKN A;  1WA7 A;  2MK5 A;  1LPL A;  2JW4 A;  2HAX A;  1E6H A;  1I0C A;  1VYT A;  4CRI A;  2EGA A;  2E64 A;  5KYN A;  3X20 B;  2RI3 A;  3CCJ A;  4F04 B;  3VS5 A;  3CCR T;  3A8H B;  2YLB A;  1PSF A;  2CS7 A;  2GFA A;  2FL7 A;  3CME T;  2QQ9 A;  5IHK A;  3CEY A;  3WXM B;  2LQ8 A;  4JRI A;  4LDY A;  2CZ6 B;  2QDY B;  3L2U A;  2XU8 A;  5GMK i;  1K76 A;  3CCE T;  1W2B S;  2VB6 A;  2KR3 A;  2JUF A;  1WX6 A;  3E2U A;  4M7A D;  3T9N A;  4HT9 A;  5AYF A;  3VS3 A;  3CCV T;  2QEX Q;  1PSE A;  1KIK A;  2LJ1 A;  4XTW A;  3TCJ A;  1Y7X A;  3OYH A;  1VIE A;  2AKK A;  2A28 A;  2VXE A;  4J9B A;  4N4I A;  1JXO A;  2DF6 A;  2DL8 A;  1QP3 A;  2PVG B;  4FW1 A;  4JLI A;  1BIA A;  3CPF A;  3CCL Q;  4LE9 A;  4RUG A;  1VIF A;  4A54 A;  4M7D D;  3SDZ A;  2COW A;  1X69 A;  4PJN A;  1W2B A;  4C5E A;  5KH6 A;  2LRQ A;  3CCQ A;  3QDF A;  2CGH A;  1WHL A;  1Q81 R;  4AMC A;  3FRN A;  1GCQ A;  1KHI A;  1TG0 A;  3NHN A;  1GBQ A;  4N4H A;  3VUB A;  4ZN3 A;  5FU6 B;  1H8K A;  2VVK A;  3FIF A;  4XU3 A;  2FZG B;  2GTJ A;  3MEU A;  2QG9 B;  2LC4 A;  4ATO A;  2LNH B;  3QWX X;  2RHI A;  2VWF A;  4E7I A;  1RAE B;  5IXF A;  2DTI A;  1VQO Q;  2KXD A;  1ZSZ C;  1VQ6 Q;  3VU3 C;  1N27 A;  4C8Q G;  3EGU A;  3JCM g;  2MAM A;  3RDV A;  2EYZ A;  3EG1 A;  2FHD A;  2L89 A;  1Y96 B;  4J9C A;  2O4X A;  5IHI A;  4C92 E;  4RTT A;  3O5Z A;  4F7U G;  5J39 A;  5IAY A;  2ED1 A;  3JAM E;  5LJ5 h;  3PMI A;  1WFW A;  2CYZ B;  2LP5 A;  2P0Q A;  5KYW B;  2GCX A;  3JCM d;  1FMK A;  2D8H A;  2AHJ B;  3OYB A;  1YHQ A;  5CKB A;  4M78 E;  1VQL Q;  1VQM T;  2RJD A;  2FYK A;  1VQ4 A;  1YWO A;  3CBM A;  3G4S A;  2RA2 A;  3HTR A;  4PNO A;  1FXX A;  1CKB A;  1CKA A;  3P8B B;  4PJO A;  4M4Z A;  2QA4 T;  5FLX E;  2V8K A;  2DD5 A;  1NJI U;  4D8D A;  2GFU A;  3EFO B;  5CO7 A;  2RMO A;  3EHQ A;  3M5A A;  4M75 A;  5HKC A;  1JB0 E;  3DLL A;  1OQK A;  4AG2 C;  2JTF A;  3H0H A;  2R57 A;  6AT1 B;  4IIM A;  2FZC B;  2OAU A;  3QBY A;  2KMT A;  2DZC A;  4DBF A;  3PMT A;  5GAO p;  3M4G A;  4C5G A;  1N6A A;  3V8L A;  5IXB A;  4D8K A;  2AT1 B;  2DEQ A;  3INZ A;  5KE3 A;  4IUR A;  2MWP A;  2LT4 A;  4N0A C;  1BCM A;  1QQJ A;  1WGS A;  2CKK A;  2M0O A;  3QG1 A;  4JRQ A;  1BI0 A;  3KBG A;  4Y92 A;  2C0I A;  2ZPG B;  2W10 A;  3JCM V;  3S3O A;  4C92 B;  2VXF A;  2ROT A;  3O8V A;  3TVT A;  1QWF A;  1VQ9 T;  3M0P A;  2JS0 A;  3REA B;  4M77 A;  2DD4 A;  4N4G A;  4DOW A;  1MNE A;  4M78 B;  5KYY A;  2FRW A;  1UG1 A;  4MML A;  4PJO F;  1YI2 Q;  2D0N A;  2PUK B;  1TU0 B;  3CCQ Q;  1OZ3 A;  1I5O B;  1MMA A;  1X6G A;  4HCZ A;  1S72 Q;  3VS0 A;  2P4T A;  3OYM A;  1YIT T;  1Q82 C;  3CCR A;  1NE8 A;  1UB4 A;  4LNP A;  3V7S A;  3CME A;  1ZHI A;  4C8Q C;  4OB3 B;  1V76 A;  3BW1 A;  1R0C B;  3ZL7 C;  3CCE A;  1KC8 C;  2P84 A;  5CAI A;  1VQN Q;  1P92 A;  4NL2 A;  4HA8 A;  1WHJ A;  2E1H A;  1M1K U;  2MYS A;  2K3Y A;  2YXY A;  2NLU A;  5CQY A;  1UJY A;  3NMZ C;  2DRK A;  3CCV A;  1VQP A;  2DZ9 A;  4IUV A;  1RAB B;  1AVZ C;  5EC7 A;  4V2S A;  5A2Q E;  1BBZ A;  3QYG B;  3SWN A;  4E47 A;  2E3H A;  3CCS A;  1R8O B;  3G4S Q;  1U1T A;  4GLK A;  4M7D G;  1RAG B;  2LTO A;  1PHT A;  4HVU A;  1UGS B;  2LMJ A;  2OI3 A;  1TUC A;  4RTY A;  5FWB A;  3LX7 A;  4R56 A;  3OYK A;  1QVP A;  2BTT A;  2EIF A;  2QQB A;  3F70 A;  3LWI A;  4J9I A;  5KYX A;  1K73 C;  2CH4 A;  2FZK B;  2A3L A;  1N8R U;  2KYB A;  3QWY A;  1OEB A;  2A37 A;  1O9S A;  1AWW A;  2CH4 W;  4RTZ A;  1OZ2 A;  4IKF A;  3CPW P;  4HVV A;  1B34 B;  3QPH A;  1UFF A;  1TUG B;  3CC2 T;  4M7A E;  3RR6 A;  2KBT A;  1TUD A;  4R55 A;  4PFO A;  2M02 A;  3J80 E;  5HCK A;  2DET A;  2RK1 A;  3VJP A;  4ZNX A;  2F2W A;  5IH2 A;  4KRT A;  1UHC A;  2BKD N;  2KRS A;  3MPU B;  2LQK A;  1JJ2 P;  1YCS B;  1D1B A;  4HT8 A;  3FB9 A;  2NUZ A;  2NUT B;  3UA6 A;  1M90 C;  1VQ5 Q;  4KGZ B;  2YSQ A;  3PFS A;  8ATC B;  1VQK T;  1VQM A;  2RM4 A;  1ZSZ A;  2E3I A;  1K4U S;  2QGF B;  3P8D A;  5GJV B;  1QVF P;  1OUL A;  1B07 A;  4E6R A;  3GF5 A;  2QA4 A;  3OYG A;  3MP1 A;  3V7C A;  2F69 A;  3EG0 A;  2DBM A;  1TTH B;  1M9S A;  1YWP A;  4FYW B;  1UTI A;  3MHX A;  4OMQ A;  4EMG A;  2V1R A;  3VS2 A;  3TRE A;  3QZ9 B;  1QVG P;  1ZUU A;  1U8R A;  1BU1 A;  3J7A F;  2L3R A;  1YCY A;  4ZGJ B;  3CME Q;  1WPY A;  1VA7 A;  4C92 D;  5L8R E;  2DIL A;  5GAM e;  3Q1J A;  4J6X A;  4ESR A;  1WLP B;  3CCE Q;  4AFU C;  5CQX A;  2EJF A;  3A98 A;  3I5R A;  1K9M C;  2SEM A;  2DM1 A;  5LJ5 g;  3JB9 I;  1XQH A;  2DIQ A;  3QYH B;  1WHG A;  1Q81 U;  4PJO E;  2XDP A;  1RAI B;  4M78 D;  5FU7 B;  1NPP A;  3V8K A;  3MO8 A;  5I22 A;  3PE0 A;  3IQL A;  3OBW A;  3CBP A;  4QT7 A;  4IUP A;  5LJ5 d;  2DE0 X;  4BDY A;  2YDL A;  3HRU A;  3A1P A;  2GNC A;  3GIB A;  2XHC A;  4M7D C;  4ZTJ A;  1M8V A;  1VQ9 A;  1JEG A;  3L2V A;  2EQU A;  1TH7 A;  3RMQ A;  4N0A A;  2V8I A;  4CC7 A;  1NYF A;  1YNZ A;  2OTL T;  2BE9 B;  4A4F A;  1UGV A;  2JVV A;  2QXF A;  2ZPI B;  1D09 B;  5GMK e;  3OYC A;  1XTD A;  5IT9 E;  3C94 A;  4KT0 E;  4LDU A;  2BE7 D;  4PLL A;  1E7O A;  1YIT A;  3OYI A;  1YJN T;  2B8A A;  4XU2 A;  2MIO A;  1H3Z A;  1Y07 A;  2O4X B;  2CSQ A;  5J26 A;  1M3C A;  4QW2 A;  1K1Z A;  4PLI A;  3BDU A;  2DL3 A;  2RJE A;  4DBR A;  1GL5 A;  3QII A;  1JRI A;  1YHQ T;  1OOT A;  2EYY A;  2YT6 A;  4OML A;  2RQV A;  3CBO A;  1VQ4 T;  2A7Y A;  2EYX A;  3DKM A;  3JCM P;  4DQ2 A;  5A0L A;  2ATC B;  4OMO A;  3TSW A;  3JB9 G;  1KQS P;  4FYX B;  4JPB W;  1IB8 A;  4PJO B;  1AEY A;  1WQ7 A;  1G83 A;  2QDL A;  1VQM Q;  4M75 B;  2KE9 A;  1SSF A;  2BIV A;  4PFP A;  3OS0 A;  3S3N A;  3UT1 A;  2QA4 Q;  1OX8 A;  2JM9 A;  3OSS C;  3KFV A;  1T3S A;  4OP0 A;  1EFN A;  2HKQ B;  1H3H A;  3TSZ A;  2FPF A;  3JCM c;  1YJ9 Q;  4ELZ C;  2HCK A;  5EG2 A;  5KE2 A;  1CSK A;  1BI2 A;  1B3Q A;  1ZUY A;  5LJ3 g;  4FSS A;  2DMO A;  5GMK h;  4J9F A;  1BYM A;  2YRV A;  2E5Q A;  1X75 C;  4RKU E;  3VS6 A;  1QMC A;  2RI5 A;  3OYE A;  3OS2 A;  5HK3 A;  2KT8 A;  1BI3 A;  5LJ3 d;  1MMD A;  2EVR A;  4OF1 A;  5LJ5 j;  4M77 B;  3RUX A;  3HRS A;  5KYY B;  2DXB A;  3HSB A;  2PTK A;  3HKS A;  1J3T A;  3RKY A;  1WIE A;  2RO0 A;  1M2V A;  3GNG A;  2C06 A;  1VQK A;  5GAO r;  3PVL A;  5GAO l;  3MP6 A;  1K8A C;  1RUW A;  2K3X A;  3CXC P;  4EMK A;  3VS1 A;  1S1N A;  3JCM J;  2A08 A;  4WF2 A;  2COZ A;  3ZEH A;  5DLQ E;  1VOM A;  4RMO A;  5AT1 B;  3EG3 A;  2KGT A;  3R6O A;  1SSH A;  2FEI A;  1RLP C;  1PKS A;  5GAN e;  1AWO A;  2QTV A;  4JJN K;  4BE0 A;  3S3M A;  2ZPF B;  2LVM A;  4OVA A;  2AZS A;  1VQP T;  4C92 G;  3L2Z A;  4JLG A;  3QHS A;  3KXT A;  4JS4 A;  4BI4 A;  4FT2 A;  2J7I A;  2YUN A;  3SWN B;  3CCS T;  1Y0M A;  4M78 G;  2OTJ A;  1NEG A;  2DX1 A;  4LDX A;  1ZBX A;  2ROL A;  3MEV A;  5FU6 C;  3OYF A;  2HKN A;  4PJL A;  1AZE A;  5HK0 A;  3UF4 A;  1MND A;  3RKX A;  1O75 A;  2LQN A;  1PNJ A;  2K57 A;  2X3X D;  3OB9 A;  1YIJ A;  4QVD A;  1MGQ A;  1WJR A;  1UGP B;  1Q86 R;  5GAN f;  3OS5 A;  2LJ3 A;  3H9N A;  2WSC E;  2QTX A;  4KGX B;  4OGC A;  4ME7 A;  3M56 A;  1N9R A;  5KYX B;  3PGG A;  1YJW Q;  2OTL A;  4YTL A;  5GAO m;  2D0Q B;  3HFO A;  4AFQ C;  1XNI A;  4LDW A;  1SKU B;  3CMA T;  1UHF A;  5GAN 2;  3FEO A;  1JQQ A;  2X3W D;  3OS1 A;  3HHT B;  4CC2 A;  3C95 A;  1VYU A;  3HL8 A;  1YJN A;  1RAF B;  4PFZ A;  5CR2 A;  4Q5W A;  1OX9 A;  3I55 T;  2K2M A;  3M0U A;  4NS5 A;  4PJO D;  2JTE A;  2DYI A;  2BUD A;  3M53 A;  1BKB A;  3QKJ A;  4IIO A;  2IIM A;  2O01 E;  5LJ3 j;  1OU9 A;  3AT1 B;  3CC2 Q;  1ABO A;  4M75 D;  1NM7 A;  1WJS A;  5GAN h;  2F5T X;  1NEB A;  4PL6 A;  2O9V A;  3OA6 A;  4OMM A;  2RK2 A;  1WXT A;  2VUB A;  2ENM A;  2VC8 A;  5I2M A;  1BB9 A;  2EQI A;  5KYU A;  1H92 A;  1VQK Q;  2EWN A;  1AZG B;  4ZGE B;  3URG A;  1TOV A;  2KRO A;  4J9E A;  3CCJ Q;  4OB0 B;  4XU1 A;  1D0Y A;  2PQW A;  1I5L A;  1M8M A;  2EJ9 A;  2WSF E;  4E7J A;  1OYX A;  1GFD A;  4DEY A;  2MPX C;  2K7A A;  3A5Z B;  3X26 B;  3X28 B;  2PVD B;  1RLQ C;  2JMC A;  4MZT A;  3L1A A;  4RTU A;  1KSW A;  4BUG A;  2HQX A;  4BI8 B;  2KRM A;  4OMF B;  2LX7 A;  1X01 A;  1BCO A;  1PD0 A;  2DRM A;  3X24 B;  1K8A R;  4C92 C;  2JT4 A;  3H6Z A;  1AWJ A;  4M77 D;  2E65 A;  3CPW S;  2PUO B;  1QCF A;  1WHK A;  1M5Q 1;  2RQR A;  3SHW A;  3CD6 T;  2F2V A;  2DVJ A;  2V1Q A;  4MZP A;  4M78 C;  1Z9Z A;  2V8J A;  2W0Z A;  4ZTF A;  2MOX A;  1VQ7 T;  3GPL A;  3C12 A;  1JJ2 S;  2R5M A;  4BDZ A;  2GBQ A;  1M30 A;  1QKX A;  1IHV A;  2DFU A;  2YHT A;  4RTX A;  4BY6 B;  3EAE A;  3OSV A;  1QVF S;  2PZ1 A;  2ED0 A;  1D3B A;  1KD1 C;  3H8Z A;  3CPW A;  4M75 F;  1C6V X;  1M3A A;  3NTK A;  2CZ1 B;  1PC0 A;  1KHC A;  1NJI C;  3EG9 A;  3MJX A;  2EKO A;  2OTL Q;  4NOY A;  1OU8 A;  1K73 U;  3RES A;  4TVR A;  3FDR A;  1WXU A;  2DL7 A;  1WZO A;  1PCX A;  1QVG S;  1W4S A;  1YN8 A;  3DB3 A;  1UGR B;  1JJ2 A;  3H41 A;  2HL5 C;  5GAO q;  1AT1 B;  4QVC A;  2M0Y A;  3CC7 A;  1YJN Q;  4M7A G;  2C0O A;  5D6Y A;  4KUD K;  2QEX T;  1QVF A;  1RL2 A;  3I5S A;  2DAQ A;  2HMA A;  1YHQ Q;  4XTZ A;  1WHM A;  1K0X A;  5FRN A;  5D6W A;  2FPD A;  1VQ4 Q;  4A4K A;  4M77 F;  4AFS C;  2IG0 A;  3M0Q A;  1SHG A;  1QVG A;  2LDM A;  1I4K 1;  3V8J A;  4F16 A;  3G6E A;  2IPO B;  3ZFJ A;  3H0I A;  1NPR A;  3UPU A;  3JV3 A;  5DM7 R;  4IUQ A;  3JCM b;  5GAN 6;  1PM3 A;  2HSE B;  3JRZ A;  3JSC A;  1QP2 A;  2M1H A;  2HBW A;  2VYT A;  3M9Q A;  4ZN1 A;  3EGX A;  4OB1 B;  5GAN 5;  4R0K A;  4J6Y A;  3CCU T;  4QQD A;  1VQO T;  3S6W A;  1EIF A;  1T0J A;  2CP5 A;  1DJ7 B;  2GTO A;  3QSU A;  2EQM A;  3E9G A;  3CMA A;  1HYO A;  2J6O A;  1VQ6 T;  2J05 A;  5KCO A;  3E9F A;  4JRK A;  3I55 A;  4XU0 A;  5A0D A;  3EGD A;  3LH5 A;  1OI1 A;  4PJO G;  1BI1 A;  4C0G A;  3OYA A;  4IUT A;  1M1K C;  4FYY B;  3TQ7 P;  2HD0 A;  2RB6 A;  3G7Z A;  1NZ9 A;  4OGE A;  1SF9 A;  4XTV A;  1M2V B;  1KQS S;  2MMP A;  4P5N A;  3NGP A;  5GAN 3;  1E6G A;  4J9D A;  5FRO A;  2V26 A;  1QKW A;  3D7S B;  1W1F A;  5HY6 A;  4EMK B;  4ZGD B;  5L23 A;  1RAC B;  1M1F A;  4L6V 5;  3LH0 A;  2HBP A;  2KYM A;  4LUD A;  4II1 A;  2ZZD A;  1SPK A;  3PTA A;  4L59 A;  1H64 1;  1ZUK A;  2NUP A;  4A63 B;  3NFC A;  3P8H A;  3OQ5 A;  4ANJ A;  3CCR Q;  2O9S A;  4JZ3 A;  2XK0 A;  7AT1 B;  2DO3 A;  2JOY A;  3OBY A;  1X2K A;  4C0Z A;  4J7I A;  4B9X A;  1KQS A;  2HQE A;  5FU7 C;  3JCM W;  1N8R C;  4M7A C;  2EGC A;  1X27 A;  4Z89 A;  2KI7 A;  2E5K A;  1KD1 R;  2NWM A;  3FJ5 A;  3EH2 A;  2AZV A;  1KQ1 A;  3M0S A;  3OYD A;  1Q86 U;  2OTJ T;  1LNX A;  1WDX A;  3VYH B;  1Q82 R;  3CCV Q;  3LWH A;  5GAN g;  2D1X A;  1VQP Q;  3CD6 A;  1GCQ C;  4KGV B;  5I11 A;  4M75 E;  4CC4 B;  4EDU A;  4PJJ A;  2JMA A;  1YIJ T;  4FW2 A;  3C0C A;  1WI7 A;  1KC8 R;  1ABQ A;  3PT9 A;  5KCH A;  3CCS Q;  1VQ7 A;  5GAN d;  4RCC A;  3OYN A;  2DNU A;  1YI2 T;  5GAM f;  4HCB A;  2KRN A;  3RBB B;  4Y28 E;  1RAH B;  3CXC S;  3QO3 A;  3G71 T;  1PWT A;  2HQH A;  3A8L B;  4LN2 A;  1SG5 A;  4CC3 A;  2E41 A;  3L42 A;  4FIB A;  3U23 A;  2P4R A;  2LT1 A;  1UJ0 A;  2L2P A;  1UDL A;  2QAZ A;  2YRC A;  3LW5 E;  3RER A;  1Y71 A;  2FVU A;  4M77 E;  4PJO C;  1V29 B;  5I21 A;  1ZSG A;  4C0F A;  1K73 R;  2F5K A;  1GRI A;  3I55 Q;  2FG0 A;  4ELY C;  2QEX A;  1N9S A;  1X6O A;  3CXC A;  1UE9 A;  3SEM A;  3G1J A;  1G5V A;  4JS5 A;  2PU9 B;  5GAM h;  2CP7 A;  2JN0 A;  1HJD A;  2BZY A;  3GNF B;  3I9Q A;  1RAD B;  4C0D C;  1V1C A;  4C8Q A;  2HDA A;  1QWE A;  5FRM A;  3LYI A;  3CC4 T;  3QJ6 A;  4MDW A;  5KYU B;  3JB9 J;  1FMV A;  4JUV A;  2RQW A;  2ZAE A;  1GBR A;  4F7U A;  2ZGW A;  2GQV A;  1IGU A;  3R6N A;  1K8A U;  4F14 A;  4QQ6 A;  4JDS A;  2DK3 A;  2EPD A;  3EFS A;  1W6X A;  4RCB A;  4FYV B;  2H3E B;  2EQJ A;  1M90 R;  4DA4 A;  4O5V A;  1LVK A;  1IRE B;  3FJP A;  2RHZ A;  3E19 A;  4B9W A;  3V7R A;  1HD3 A;  2XDD A;  2JTM A;  3CCU A;  1RAA B;  3VRZ A;  4E7K A;  3JCM Q;  1VQO A;  1EZZ B;  2RJC A;  5CKD A;  1KFZ A;  1Q7Y C;  2H3J A;  2QAS A;  4KH1 B;  3OY9 A;  1ACM B;  1QCO A;  1MMN A;  3LGF A;  1VQ6 A;  4GY5 A;  3UA7 A;  5GAN 4;  3GOX A;  4J7F A;  2JM8 A;  2K4Y A;  3I56 T;  3OYL A;  2K9G A;  4DEX A;  5GJW B;  5FW9 A;  4UC4 A;  4J9G A;  1LJO A;  4VUB A;  1IXD A;  3FC3 A;  3EH1 A;  1TXQ A;  4C5I A;  5GAN j;  4OB2 B;  1VQ5 T;  1KQ2 A;  4A4H A;  4C8Q F;  1VQ9 Q;  1K9M R;  4LD9 K;  2J06 A;  3M59 A;  1D3B B;  4XQ3 A;  1VQ7 Q;  2DXT A;  2K6D A;  4J6W A;  1YFN A;  4F7U F;  3EG9 B;  2CP6 A;  3PIP A;  1TS9 A;  2K3B A;  4IUU A;  3VUZ A;  3MP8 A;  1EX4 A;  3ASK A;  1T0H A;  2LX9 A;  1GCP A;  3M0R A;  1PRM C;  2H8H A;  3GBQ A;  4AT1 B;  1VQ8 T;  1TSF A;  2RH2 A;  1YIT Q;  5LL6 S;  2E6Z A;  3CC7 T;  4X1V A;  2LQW A;  1JBM A;  2DA9 A;  1HXD A;  1XOV A;  1RI0 A;  5LJ5 e;  3AHU A;  3SWN C;  2XD0 A;  2X4J A;  3M58 A;  2KQW A;  3VRY A;  2I0N A;  4HCC A;  3L2W A;  2EKH A;  2JXB A;  2CZ0 B;  3C4S A;  2YRD A;  4FL6 A;  3G6E T;  1ZA2 B;  1W70 A;  3M57 A;  2YUQ A;  1R0B G;  2VGN A;  2L5Q A;  3PVQ A;  1SHF A;  4M7A A;  3OW2 P;  4LXC A;  1K9A A;  8AT1 B;  2A36 A;  1KJW A;  2L3S A; 
#chains in the Genus database with same CATH homology
 4J8O A;  1G3W A;  4BD3 A;  1D3B A;  1KD1 C;  3H8Z A;  3CPW A;  2QA4 A;  3OYG A;  1YI2 A;  5LJ5 f;  4M75 F;  3MP1 A;  3V7C A;  3RIR A;  4NL3 A;  2F69 A;  3J81 E;  2RHY A;  3NTK A;  2CZ1 B;  1S72 A;  4C0D B;  2QQS A;  1M9S A;  1KHC A;  4M78 F;  1NJI C;  2EKO A;  4PKC C;  5DY9 A;  1YJW A;  2EJG A;  4NOY A;  3JB9 H;  3BY7 A;  3G71 A;  3MHX A;  1K73 U;  1QW1 A;  2DXC A;  4EMG A;  3RES A;  2JZ2 A;  5GMK m;  4TVR A;  4JRP A;  3TRE A;  3QZ9 B;  3FDR A;  5M9O A;  1U1S A;  3HPW A;  2D9T A;  3L2Q A;  1MHN A;  2YLC A;  1QVG S;  4X9D A;  1W4S A;  1U8R A;  3DB3 A;  3J7A F;  4M7D A;  1UGQ B;  2L3R A;  1YCY A;  4ZGJ B;  1UGR B;  4M77 C;  1JJ2 A;  3MEW A;  1IZ6 A;  3SD4 A;  1WPY A;  1ZQ1 A;  5GAN 7;  4C92 D;  5L8R E;  5GAM e;  5GAO q;  3Q1J A;  4J6X A;  5CK9 A;  4QVC A;  3WVD B;  1I8F A;  3CC7 A;  4M7A G;  5D6Y A;  4KUD K;  5CKF A;  4EPC A;  3OW2 A;  1VQN A;  5CQX A;  2QEX T;  2EJF A;  2EFI A;  1QVF A;  1K9M C;  5DLO A;  1RL2 A;  5LJ5 g;  3JB9 I;  1B34 A;  1XQH A;  4BB7 A;  1G3S A;  2DIQ A;  3QYH B;  4FU6 A;  4KBM B;  1Q81 U;  2DAQ A;  4PJO E;  2XDP A;  4M78 D;  5FU7 B;  1NPP A;  3M54 A;  3V8K A;  3CC2 A;  4A4G A;  3MO8 A;  5I2S A;  2D6F A;  4XTZ A;  3VV0 A;  3BFM A;  1VQL A;  5FRN A;  5D6W A;  4MZM A;  3OBW A;  1I81 A;  3TU4 K;  2EAY A;  3CBP A;  3A8O B;  2R5A A;  4IUP A;  4C5H A;  5LJ5 d;  4BDY A;  4A4K A;  4M77 F;  2DJZ A;  2IG0 A;  3HRU A;  3SFM A;  3PNW C;  1QVG A;  3GIB A;  2XHC A;  3CC4 A;  2KDS A;  2LDM A;  1I4K 1;  5CVI A;  3V8J A;  2K5I A;  4LD6 A;  3G6E A;  4ZTJ A;  1VQ9 A;  3L2V A;  3ZFJ A;  1AHJ B;  2RHU A;  2EQU A;  4BI3 A;  1NPR A;  3UPU A;  1TH7 A;  3RMQ A;  3JCM X;  4M7A F;  4N0A A;  2V8I A;  5DM7 R;  4IUQ A;  4J5Y A;  3JCM b;  1KD1 U;  2HAX A;  5GAN 6;  3OMC A;  2OTL T;  3OMG A;  4A4F A;  4CRI A;  2E64 A;  2JVV A;  2QXF A;  3JRZ A;  3JSC A;  3X20 B;  2RI3 A;  2ZPI B;  3FLG A;  1QP2 A;  2M1H A;  5GMK e;  3OYC A;  1Q82 U;  3CCJ A;  1M1K C;  2VYT A;  4Z02 A;  3M9Q A;  3CCR T;  4ZN1 A;  4OB1 B;  1XTD A;  5IT9 E;  5GAN 5;  4J6Y A;  3CCU T;  3A8H B;  5A0G A;  2YLB A;  3HRT A;  3ER0 A;  1PSF A;  4QQD A;  5LJ3 e;  2CS7 A;  2GFA A;  3C94 A;  2FL7 A;  3CME T;  4KT0 E;  1EIF A;  2QQ9 A;  3S6W A;  1YJ9 T;  3CEY A;  4LDU A;  3WXM B;  4PLL A;  2LQ8 A;  2X4Y A;  4JRI A;  2G3R A;  4LDY A;  1YIT A;  2CZ6 B;  1DJ7 B;  2QDY B;  3OYI A;  2EQM A;  2XU8 A;  3E9G A;  3L2U A;  3CMA A;  5GMK i;  2B8A A;  1YJN T;  4XU2 A;  1KC8 U;  3PIO A;  1H3Z A;  1VQ6 T;  3CCE T;  2IVW A;  1W2B S;  1Y07 A;  2O4X B;  4M7D F;  5KCO A;  3E9F A;  1VQO T;  5J26 A;  4DOV A;  2JUF A;  4QW2 A;  4C8Q E;  4JRK A;  4M7A D;  4PLI A;  3BDU A;  2RJE A;  3T9N A;  1UEB A;  3I55 A;  2XG8 D;  3QII A;  4XU0 A;  2XDB A;  5A0D A;  5AYF A;  4HT9 A;  3CCV T;  2RD1 A;  1JRI A;  4C0G A;  1OI1 A;  1PSE A;  1BI1 A;  4PJO G;  3OYA A;  1YHQ T;  5GAM g;  2KVQ G;  4IUT A;  4XTW A;  4MMK A;  1WNL A;  3CBO A;  3TCJ A;  1Y7X A;  2A7Y A;  3OYH A;  2MF2 A;  1VQ4 T;  1VIE A;  3DKM A;  1GXI E;  4F7U E;  3JCM P;  4DQ2 A;  4BY6 C;  5A0L A;  2VXE A;  3I56 A;  2KAF A;  1VUB A;  2HD0 A;  3RMS A;  4N4I A;  3JB9 G;  2RB6 A;  3G7Z A;  1NZ9 A;  4OGE A;  3CCM T;  4XTV A;  1KQS S;  4PJO B;  1QP3 A;  2PVG B;  2ZPE B;  2MMP A;  4JLI A;  1BIA A;  4P5N A;  3CPF A;  5GAN 3;  3OYJ A;  1WQ7 A;  3E1S A;  5FRO A;  5GAM d;  1VIF A;  1VQ5 A;  4A54 A;  4M7D D;  5LJ3 f;  5HY6 A;  3SDZ A;  4X9C A;  2R58 A;  3X25 B;  4EMK B;  2XID A;  4ZGD B;  1FX7 A;  4X34 A;  1W2B A;  3N5B B;  4C5E A;  5KH6 A;  2LRQ A;  4M75 B;  3CCQ A;  1SSF A;  1M1F A;  2BIV A;  3LH0 A;  4L6V 5;  2CGH A;  2HBP A;  2DXU A;  3NTH A;  3OS0 A;  3FRN A;  3S3N A;  1KHI A;  4N4H A;  3UT1 A;  4ZN3 A;  3VUB A;  3QZ5 B;  3RER A;  4II1 A;  5FU6 B;  2ZZD A;  3FIF A;  2Y4Y A;  3L2R A;  4XU3 A;  3PTA A;  1H64 1;  4L59 A;  3OSS C;  3NFC A;  4OP0 A;  3MEU A;  3P8H A;  2LC4 A;  3OQ5 A;  2E10 A;  4ATO A;  3QXE B;  2RHI A;  4E7I A;  2DTI A;  3JCM c;  2Y90 A;  2XK0 A;  3A8G B;  4ELZ C;  2DO3 A;  2JOY A;  2VV5 A;  3MEA A;  3OBY A;  5EG2 A;  3VYG A;  4J83 A;  4C0Z A;  4J7I A;  5KE2 A;  4B9X A;  1VQ8 A;  1KQS A;  2HQE A;  5FU7 C;  3JCM W;  1BI2 A;  1N8R C;  2XIC A;  3HP9 A;  5CKE A;  4M7A C;  3VU3 C;  1N27 A;  5LJ3 g;  4C8Q G;  3JCM g;  2MAM A;  5GMK h;  3LGL A;  5D6X A;  2FHD A;  2L89 A;  1BYM A;  1Y96 B;  2YRV A;  2O4X A;  2RI2 A;  1KQ1 A;  2E5Q A;  4C92 E;  3OYD A;  1Q86 U;  1X75 C;  2OTJ T;  1LNX A;  3VYH B;  3VKI A;  1LOJ A;  2M9U A;  4RKU E;  3LWH A;  2RI5 A;  5LJ3 h;  5GAN g;  4F7U G;  2E6N A;  5J39 A;  3OYE A;  5IAY A;  3JAM E;  3CD6 A;  2LNV A;  4C8Q B;  2X4W A;  4XAX B;  5HK3 A;  5LJ5 h;  3OS2 A;  3PMI A;  1BI3 A;  4M75 E;  2CYZ B;  5LJ3 d;  1M1G A;  2P0Q A;  4EDU A;  3CCL T;  3JB9 D;  1M90 U;  2GCX A;  3JCM d;  4OF1 A;  1YIJ T;  5LJ5 j;  2AHJ B;  2FB7 A;  3OYB A;  4M77 B;  1YHQ A;  5CKB A;  4M78 E;  1VQM T;  2RJD A;  2FYK A;  1VQ4 A;  2K5L A;  3RUX A;  2QQA A;  3PT9 A;  3HRS A;  4F7U B;  5KCH A;  2DXB A;  3OYY A;  3CBM A;  3HSB A;  3HKS A;  3G4S A;  1VQ7 A;  2RA2 A;  3RKY A;  4PNO A;  3UWN A;  1FXX A;  5CCA A;  5GAN d;  3P8B B;  2RO0 A;  3GNG A;  4RCC A;  3OYN A;  4PJO A;  2Y4X A;  2C06 A;  1VQK A;  1M4Z A;  3NTI A;  2QA4 T;  1YI2 T;  5GAO r;  5GAM f;  5GAO l;  2CZ7 B;  3MP6 A;  5FLX E;  1K8A C;  2ZPH B;  2V8K A;  2DD5 A;  2K3X A;  4RG8 A;  4HCB A;  4Y28 E;  4EMK A;  3CXC S;  2GFU A;  2KK4 A;  5CO7 A;  1NJI U;  4XTU A;  3M5A A;  3QO3 A;  4M75 A;  3JCM J;  5HKC A;  1YJW T;  1JB0 E;  3DLL A;  4WF2 A;  3ZEH A;  5DLQ E;  3G71 T;  3ZBD A;  1FWZ A;  3A8L B;  3JCM e;  4BAC A;  2JTF A;  2R57 A;  4O6J A;  4RMO A;  3RKW A;  2E70 A;  3R6O A;  2E41 A;  2OAU A;  5GAN 8;  3QBY A;  2KMT A;  2DZC A;  4BE2 A;  3L42 A;  3PMT A;  4FIB A;  5GAO p;  1WQW A;  3M4G A;  4C5G A;  1N6A A;  3V8L A;  5GAN e;  2LT1 A;  4JJN K;  5C0M A;  2ZPB B;  2DEQ A;  3LW5 E;  3INZ A;  5KE3 A;  1K9M U;  4BE0 A;  3S3M A;  1Y71 A;  2MWP A;  2DTH A;  2LT4 A;  2LVM A;  2QI2 A;  2ZPF B;  3EFR A;  4IUR A;  4N0A C;  2FVU A;  4M77 E;  4OVA A;  1VQP T;  4PJO C;  4C92 G;  3L2Z A;  1WGS A;  1V29 B;  2CKK A;  4JLG A;  2M0O A;  5I21 A;  3QG1 A;  4C0F A;  3QHS A;  2F5K A;  4JRQ A;  1BI0 A;  3KBG A;  3KUF A;  3ME9 A;  4ELY C;  2QEX A;  1N9S A;  1X6O A;  3KXT A;  3CXC A;  4EMK C;  2GF7 A;  2M16 A;  1Y96 A;  4JS4 A;  4M75 G;  4BI4 A;  2ZPG B;  4JS5 A;  2PU9 B;  1VQL T;  1G5V A;  4FT2 A;  5GAM h;  4E7H A;  2JN0 A;  3JCM V;  5C6S A;  3GNF B;  3SWN B;  3CCS T;  2P0P A;  4C92 B;  3S3O A;  5IN1 A;  4M78 G;  4C0D C;  2OTJ A;  2VXF A;  4C8Q A;  2MI6 A;  1ZBX A;  4LDX A;  3O8V A;  2K5F A;  5GAM j;  3MEV A;  5FRM A;  3MCA B;  5FU6 C;  3LYI A;  3OYF A;  1WJQ A;  2RJF A;  3CC4 T;  3JCM f;  1VQ9 T;  5HK0 A;  3QJ6 A;  3TEE A;  4MDW A;  3RKX A;  1O75 A;  3JB9 J;  4JUV A;  4M77 A;  2DD4 A;  2K57 A;  4N4G A;  4DOW A;  3OB9 A;  1YIJ A;  4QVD A;  1MGQ A;  1WJR A;  1UGP B;  4F7U A;  2LCC A;  2ZGW A;  3GLX A;  4M78 B;  2ZCF B;  2GQV A;  4MML A;  4PJO F;  5GAN f;  3OS5 A;  1K8A U;  2PUK B;  2EQK A;  4QQ6 A;  4JDS A;  2WSC E;  4M7D E;  2DK3 A;  2QTX A;  1OZ3 A;  3EFS A;  4OGC A;  3CCJ T;  4ME7 A;  2LCL A;  3M56 A;  4HCZ A;  4RCB A;  1N9R A;  2X4X A;  3PGG A;  3JB9 F;  2OTL A;  2EQJ A;  2RHX A;  4YTL A;  5GAO m;  4DA4 A;  2D0Q B;  3HFO A;  2P4T A;  3OYM A;  4QVZ A;  4O5V A;  4XTX A;  1G3Y A;  2P0K A;  1IRE B;  1HK9 A;  1XNI A;  2RHZ A;  3E19 A;  3FJP A;  5CIU A;  4LDW A;  3V7R A;  4B9W A;  4EMH A;  1YIT T;  1Q82 C;  3CMA T;  5GAN 2;  3FEO A;  3CCR A;  1NE8 A;  2EYQ A;  2XDD A;  2JTM A;  1UB4 A;  3CCU A;  3QDR B;  2DVE A;  3OS1 A;  3JCM Q;  2K2V A;  2X35 A;  3V7S A;  4E7K A;  1VQO A;  1YJ9 A;  2RJC A;  5J3B A;  2KY9 A;  5CKD A;  3CME A;  1ZHI A;  4C8Q C;  3HHT B;  1Q7Y C;  2H3J A;  2XKO C;  4OB3 B;  3C95 A;  3OY9 A;  3BW1 A;  3HL8 A;  4A4E A;  1YJN A;  3DB4 A;  5CR2 A;  3LGF A;  4Q5W A;  4M77 G;  3I55 T;  1VQ6 A;  3CCE A;  1KC8 C;  5CAI A;  5GMK j;  1P92 A;  2VGM A;  4GY5 A;  4NL2 A;  4HA8 A;  4NS5 A;  5GAN 4;  2E1H A;  4PJO D;  1M1K U;  2BUD A;  2DPP B;  2QQR A;  4J7F A;  3M53 A;  3JCM h;  3GOX A;  1BKB A;  2K4Y A;  3QKJ A;  4L5G A;  2K3Y A;  4QQG A;  2NLU A;  2O01 E;  5LJ3 j;  5CQY A;  4RG2 A;  2XI9 A;  2KSS A;  3I56 T;  3GP8 A;  3CCV A;  3OYL A;  4M75 D;  1WJS A;  1VQP A;  4XK8 E;  5GAN h;  2DKG A;  4LDV A;  4UC4 A;  2DZ9 A;  1BIB A;  2F5T X;  3MET A;  2DIG A;  1LJO A;  4IUV A;  4VUB A;  4PL6 A;  3OA6 A;  3FC3 A;  4V2S A;  4C5I A;  4M7A B;  5A2Q E;  4OB2 B;  5GAN j;  1VQ5 T;  2RK2 A;  3M4Y A;  1KQ2 A;  1M8V A;  3QYG B;  3CCM A;  3SWN A;  4A4H A;  4C8Q F;  3LLR A;  4C92 A;  4E47 A;  3QSU A;  4LD9 K;  4D6W A;  3CCQ T;  2VUB A;  3M59 A;  4KUL A;  1R8O B;  1D3B B;  4XQ3 A;  3CCS A;  1U1T A;  2DXT A;  2VC8 A;  4GLK A;  4KUI A;  5I2M A;  3A8M B;  4J6W A;  1S72 T;  2PVO B;  4M7D G;  3SB2 A;  2LTO A;  3WVE B;  2EWN A;  4F7U F;  2E12 A;  4ZGE B;  3URG A;  1UGS B;  4XTY A;  3PIP A;  4IUU A;  5GMK l;  4M78 A;  3VUZ A;  4FM4 B;  4OB0 B;  3MP8 A;  3LX7 A;  4XU1 A;  3ASK A;  2PQW A;  4R56 A;  4A53 A;  3OYK A;  1I5L A;  1QVP A;  2EIF A;  2EJ9 A;  2WSF E;  2LX9 A;  2QQB A;  4E7J A;  5GAO n;  1OYX A;  1KG1 A;  4M7D B;  3F70 A;  3A5Z B;  3X26 B;  3X28 B;  2WSE E;  3LWI A;  2PVD B;  4E7L A;  1K73 C;  3M55 A;  1VQ8 T;  2RH2 A;  4Y91 A;  2A3L A;  5LL6 S;  1N8R U;  2E6Z A;  4MZT A;  3CC7 T;  3DLM A;  3L1A A;  3UDC A;  1JBM A;  4BUG A;  2HQX A;  4FT4 A;  1O9S A;  4BI8 B;  4C8Q D;  1Q7Y U;  1VQN T;  4MDX A;  4OMF B;  1HXD A;  1XOV A;  1X01 A;  1OZ2 A;  3BDL A;  1RI0 A;  5LJ5 e;  2I2L A;  3AHU A;  3X24 B;  3SWN C;  4BE1 A;  4C92 C;  2DTO A;  2X4J A;  4IKF A;  3H6Z A;  2XD0 A;  4M77 D;  1B34 B;  2E65 A;  3QPH A;  2PUO B;  3CPW S;  2WAC A;  3CC2 T;  4M7A E;  1M5Q 1;  1G3T A;  4FSX A;  3M58 A;  2KQW A;  4R55 A;  3CD6 T;  4M75 C;  4M7D C;  3J80 E;  4HCC A;  3L2W A;  1Q81 C;  2CZ0 B;  4MZP A;  2RK1 A;  3VJP A;  4M78 C;  1Q86 C;  3C4S A;  1YBY A;  3HFN A;  2V8J A;  3QUI A;  4ZTF A;  4FL6 A;  2BKD N;  3G6E T;  4CI0 C;  2L8D A;  3M57 A;  2LQK A;  3G4S T;  1VQ7 T;  3GPL A;  3CCL A;  4HT8 A;  3C12 A;  3FB9 A;  2MWO A;  1JJ2 S;  4HKE A;  1M90 C;  2R5M A;  2VGN A;  4BDZ A;  2L5Q A;  3PFS A;  2JNG A;  1VQK T;  1VQM A;  2RM4 A;  4M7A A;  4C92 F;  2YHT A;  3P8D A;  3OW2 S;  5CKH A;  2HNI A;  4BY6 B;  3EAE A;  3OSV A;  3QJY A;  1QVF S;  3GF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...