4PJOF

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, f, t
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoF00
3JCMf 4C92A 4EMGA 4PNOA 2DZCA 1BIAA 2CGHA 4M75B 5LJ3d 1TH7A 5LJ3j 2DKGA 3SWNB 2EJ9A 3AHUA 1X01A 3QO3A 3JB9G 1B34B 1MGQA 4RCCA 3JB9I 4NOYA 4OP0A 1LJOA 2I2LA 4M77F 3JB9H 4XTYA 4XQ3A 3JCMQ 4M7DC 4M75G 1I5LA 3EFSA 5GAN8 2VXEA 4PJOE 5GMKe 3JCMc 4M77E 3RKWA 5LJ5f 1JRIA 4Y91A 5GANf 2VC8A 3FIFA 1I8FA 2RB6A 3RKXA 2ZGWA 5GAN3 5GAMf 5GAN4 3JB9J 4HT9A 5LJ5g 4XTVA 5GAOn 4JRKA 5GAOm 1I81A 1H641 2DXUA 4M75E 3RUXA 5LJ3g 4HA8A 3V7RA 2DTHA 2E64A 5GMKm 4J6XA 4X9CA 3JCMb 4M7AG 3JCMg 1KQ1A 1U1TA 2YLBA 5GAOp 2QTXA 4NL2A 5GAMj 4M7AA 3BW1A 4M77D 3JCMW 3V8JA 5I21A 4M78C 3V7CA 4C92D 5GMKh 4J6YA 4F7UE 4M77B 3JCMP 5LJ5d 1WPYA 3INZA 4A54A 4DQ2A 2RM4A 3QUIA 5LJ3e 5LJ3h 5LJ5e 4XTWA 2FB7A 4PJOG 4XTXA 2E10A 1HK9A 5GAN2 3L2ZA 3V8KA 5GAOl 4C92C 4X9DA 5GANd 4C8QE 4PJOA 4JRIA 4F7UF 2EJGA 3M4GA 4XTZA 5GANj 4V2SA 4M7AC 3JB9F 4M7AE 1I4K1 4EMKC 4M7DE 4C8QG 4M7DB 4EMKB 1KQ2A 1WNLA 4F7UA 4M78G 2RA2A 3QSUA 1YCYA 4N0AC 2E41A 4M7AB 4JLIA 4XU2A 1N9SA 3QHSA 1U1SA 1D3BA 2K57A 4MMKA 3SWNA 3V7SA 2HNIA 4M7AD 4JUVA 4F7UB 3HFOA 4M7DF 4M7AF 4M75F 2YHTA 5LJ5j 3V8LA 1HXDA 1M5Q1 2FYKA 4M77G 2EJFA 4XU0A 4J6WA 4C92G 4WF2A 2YLCA 3RKYA 3RESA 3VU3C 2DEQA 2E65A 3SB2A 2DZ9A 1BIBA 5GMKj 5CAIA 5GAMd 4M78E 4EMHA 1JBMA 2DVEA 3FB9A 5GAMh 5LJ3f 4HT8A 5DY9A 4M75C 3HSBA 4M7DG 1WQ7A 3BDUA 2Y90A 5GAMg 1LOJA 3JCMe 1N9RA 4PJOD 4EMKA 4PJOF 1Y96B 1WQWA 4M78D 3JCMV 5GAN6 5GAN5 4M7DA 3JCMJ 3JCMd 5GANg 3JB9D 2DTIA 3JCMh 4C8QB 3SWNC 1D3BB 2JN0A 3BY7A 4M77C 4XU3A 4XU1A 4C92B 4C8QC 4QVDA 4NL3A 4C8QD 4C92E 3PGGA 4MMLA 4C8QA 5LJ5h 4M75D 2EAYA 4M78F 3RIRA 4F7UG 3RERA 1LNXA 4RCBA 2DTOA 3HFNA 5GAMe 4QVCA 5GAOr 5GAN7 1B34A 4C8QF 3JCMX 5GAOq 4PJOC 3BFMA 2E1HA 4M78A 2DJZA 2VXFA 4XTUA 2DXTA 3L1AA 1Y96A 5GANe 4C92F 5GANh 4PJOB 4M78B 3GIBA 5GMKl 4M75A 2RD1A 4N0AA 5GMKi 4M77A 3EFRA 1M8VA 2EWNA 3FJPA 4M7DD 4A53A 4J5YA
chains in the Genus database with same CATH superfamily
3I56T 5CR2A 5ECAA 2HSPA 2KXCA 1B34B 1Q86C 1VQ4A 1NZ9A 1FMKA 3ZBDA 4IUVA 3BE3A 4M77F 5I11A 2J6KA 5CQYA 4AFUC 2JNGA 2O9VA 2DF6A 2YUOA 3T9NA 3CCVQ 2QGGA 2HEQA 2KROA 3EFOA 3CPWA 5CO7A 2H3EB 1H641 1UE9A 3DKMA 2A28A 4M75E 2ED0A 4LD6A 2YUNA 4KULA 1Q7YC 5KE3A 1P92A 1WHKA 4K11A 3JCMW 5I21A 2QAZA 2GQIA 3M5AA 3QXEB 4OGEA 2M51A 4FT2A 3QUIA 3A8HB 2J05A 5LJ5e 1UTIA 3UPUA 4PJOG 4IUQA 1WXUA 4FL6A 2VGNA 1M1KU 1KK7A 1YBYA 4ZGEB 4LDUA 1WDXA 1AHJB 4YTLA 1KD1U 4M7AE 1UGQB 4M7DE 4C5EA 2P84A 2RK2A 4RTXA 2E41A 3DLMA 1N9SA 3PIPA 2JS2A 2CP2A 1N8RR 5FW9A 1LPLA 2PQWA 2JMAA 4KGVB 1NEGA 1GXIE 2YLCA 2R58A 1VA7A 3CCRQ 3U23A 4EMHA 1UGVA 2F2WA 2LP5A 2ROLA 3CC4Q 3OS5A 1MV3A 4LE9A 4OMPA 5GANg 1IRXA 3C0CA 1NEBA 1M2VB 1G3YA 1BCMA 2KAFA 3LX7A 2RJFA 2PU9B 2BE9B 5GAMe 1QKXA 4C0DC 2L0AA 3G1JA 3FC3A 5GANh 4PJOB 4JDSA 2NUTA 2LQWA 1KHIA 1ZX6A 4J83A 3ME9A 2OAWA 3CMAT 2MWPA 4A53A 2RMOA 5J3BA 4HVWA 2CDTA 2WSFE 2MOXA 1VQNT 3MEUA 4J8OA 1X2QA 2KRNA 1YIJA 4F14A 2IPOB 3I5RA 2DA9A 2LT1A 5GANf 1ZLMA 1SEMA 2HDAA 3EFOB 5GAMf 3QZ9B 3OYBA 2LJ3A 3CXCS 1W4SA 2O31A 1Q86R 3A98A 1V76A 3LYIA 1Q7YR 1T3SA 1SRLA 2RQWA 1KC8U 5LJ5d 1WPYA 1R0CB 3QBYA 1B7TA 1Q82U 3DB4A 4AMCA 4HCCA 2L5QA 2EGEA 1SHGA 3OSVA 2OTJT 1K9MC 4RTWA 3CBOA 6AT1B 2HKQB 3CC7A 2L3RA 4Z02A 3C94A 2LJ1A 3TSZA 2HNIA 1VQ5Q 1G3WA 2QEXQ 3PIOA 1UECA 2DXCA 3FLGA 2CZ0B 1PKSA 2V1QA 4ATOA 4A4KA 2WSEE 1D0XA 4HXJA 5CKBA 5HKCA 3CMAA 2DRMA 2DTIA 3MKDA 2LNVA 4QW2A 2VASA 1ARKA 1RAIB 3CCVT 4M4ZA 4MMLA 4II1A 3QJYA 3HPWA 4PLLA 2KBTA 2XIDA 2D1XA 1R0BG 2GGRA 3VS6A 2GFAA 2M16A 1YHQA 1VQLT 3REBB 1N6AA 1K8AC 4C92A 2ZPGB 2DE0X 2LNHB 4ME7A 2X3WD 2CT3A 2VGMA 3JB9I 3CCUT 2KT8A 4JRPA 5FWBA 4X1VA 1QVFA 3CD6A 4M75G 2OAUA 1A0NB 4QKUA 1RAFB 4ZTFA 1VQKQ 1VQOQ 2KY9A 4P5NA 1X27A 4HA8A 5GMKm 3I55T 2LX7A 4M7AA 4QQGA 4M78C 2E12A 3HP9A 3VS2A 2LJ0A 3A8OB 5M9OA 1AWWA 2FB7A 1JXMA 5GAN2 2RJCA 1VQ9T 2GTJA 3MCAB 5GANd 4C8QE 2ROTA 3HKSA 1ZHIA 5CCAA 1W2BP 4BI3A 2KQWA 1M9SA 4M78G 1NJIC 4RTTA 5D6YA 2LT4A 2YSQA 2AK5A 4TVRA 1E7OA 2EFIA 4J6WA 1ZA2B 3META 3G71Q 2EQIA 1WJRA 5LJ3f 3BDUA 4C5GA 3MPUB 2EKOA 3I35A 2QG9B 4PJOD 3CD6Q 2KDSA 3X24B 5IN1A 2BKDN 3LGFA 1VQPQ 4C8QD 1IHWA 2FZGB 1WHMA 2XDDA 3PVLA 1SRMA 1X43A 4LDVA 2VXFA 2DXTA 2JUFA 1VQLA 4IIMA 3UATA 1X75C 3EFRA 2CGHA 3OYCA 4M75B 1VQ7Q 1TH7A 4RKUE 3LH0A 3J81E 2XICA 4X34A 3S3MA 2ENMA 4NOYA 4J9FA 3P8BB 3JCMQ 1EZZB 4A4EA 2FG0A 1K0SA 2JXBA 4PJOE 3M0QA 3JCMc 4MZMA 3L2WA 2CZ7B 3H0IA 2NUPB 3EG1A 1MNEA 1YN8A 1WHJA 1I81A 2P0PA 3SDZA 1AWXA 1YJ9T 3FRNA 3CMEA 1Z9QA 3VS4A 3MP8A 5KYWA 2A08A 1JJ2P 1IXDA 1KFZA 1M27C 1VQPA 3OYEA 1OULA 4XTWA 2E10A 1HK9A 2P4RA 3P8DA 2BZXA 1M1GA 2VUBA 2NUTB 5GANj 4V2SA 1KJWA 2CP0A 3CPWS 4M7AB 3KXTA 2C06A 2E5QA 4ORZA 3URGA 3CCQA 3QPHA 1YWOA 3QDFA 2DIQA 4JLGA 2FHDA 4L6V5 4JJDA 4BY6B 2MF2A 3VU3C 1B07A 1NM7A 3NTHA 2X4JA 3OYLA 1KD1C 3A5ZB 2HAXA 1K9AA 1JQQA 4M78D 4J7IA 2J6FA 4BE2A 1ZSGA 5CKFA 4C92E 1M1FA 4OVAA 2WACA 1EX4A 3ZFJA 2HZYA 4F7UG 1GBRA 3CCJA 2WSCE 4N4HA 1YI2T 1OZ3A 1AZEA 1LVKA 3L1AA 3ZL7C 3CC7Q 4JPBW 1OPKA 4VUBA 1Y71A 1GCPA 1EFNA 4LDYA 2DZCA 3RDVA 5LJ3d 1YJWQ 4Z8AA 1M1KR 2L89A 4OMOA 2V8IA 1OZ2A 1HD3A 1ZSZA 3I56A 2DRKA 2OI3A 1PKTA 1MGQA 4Y28E 2HQEA 5DM7R 3EG9A 1ZUYA 5I2SA 2YRDA 4XQ3A 2KMTA 3TVTA 1N8RU 1KHCA 4LDXA 5GAN8 3QDRB 2AZVA 2V1RA 1OPLA 4PFOA 3CCQQ 4LDWA 3HRUA 2DXBA 1OX9A 1Q81U 2RI3A 1MV0B 2QYZA 1NPRA 1QCFA 4IKFA 3CCMT 4HKEA 4J9GA 4PJJA 5HY6A 4FU6A 1WFWA 3VRYA 4DBHA 3MP1A 4J6YA 4PL6A 2RM4A 3S3NA 2F5TX 1WJSA 2X4WA 3L2ZA 3MEWA 1VOMA 1M1KC 2DJQA 2K79A 1VYUA 1M3CA 2EKHA 4MDXA 2RA2A 3EH1A 2EQKA 4L5GA 5CKEA 1G2BA 1TG0A 2K57A 1YJWA 2QQ9A 3VS0A 3M58A 1WHHA 3MEVA 1M30A 4D8KA 3TEEA 4D6WA 3VKIA 3M4YA 1NPPA 3E2UA 3FDRA 3J7AF 3SEMA 2R5AA 1K1ZA 4KGXB 4M77C 1NJIR 4NL3A 5HK0A 3CXCA 1GCQC 1YI2A 3VUBA 1UGRB 2COYA 1XTDA 1OV3A 4HCKA 1D0ZA 1VQMQ 1F1BB 5CQXA 1VQ6A 4E7HA 3LWHA 2ABLA 4DOVA 4J5YA 2KK4A 4EMGA 1XJWB 1RACB 3I55A 1QW1A 2QA4T 2KE9A 3LH5A 4FW1A 2PVDB 2JMCA 5KYXB 1YITQ 2O2OA 3F70A 2A7YA 2D0NA 4BUGA 3M0RA 1I5LA 2HL3A 3EG2A 5GMKe 2CYZB 2F5KA 2M0OA 1K73U 2V8JA 2FEIA 4IUTA 4KH0B 1K0XA 4DBRA 1VUBA 1RI0A 3G4SA 4E7SA 2DTHA 1T0JA 1UHCA 1SSFA 3CCQT 3VJPA 3JCMg 1U1TA 1YJ9A 2EBPA 3V8JA 4C92D 1AVZC 5KYUB 1RAGB 1VQNQ 3JV3A 2MWOA 2DL5A 4DEXA 4OB2B 3VS1A 1V1CA 4M7DB 3QG1A 1WHLA 1G3SA 2QA4Q 2BZ8A 1G83A 1HXDA 2FYKA 4WF2A 2L3SA 1GL5A 5DY9A 4M7DG 5GAMg 1LOJA 2GTOA 1UDLA 2ZAEA 4EMKA 3QWXX 3M0SA 1OI1A 3ZEHA 4A63B 2NUPA 3BY7A 3NMZC 4C8QA 2D8HA 3RIRA 5FRMA 3G4SQ 1VQ8Q 3CCMQ 4RTYA 1VIEA 4KUIA 3CCEQ 4C0ZA 1KQSP 5GMKl 3PTAA 1OX8A 3CCST 3JCMf 2XU8A 2EIFA 3LLRA 4LUEA 3WVDB 5IXBA 2YXYA 4JJNK 2K3XA 2LQ8A 5KCOA 2EQJA 4RCCA 4BACA 5A0LA 4R55A 4L59A 3RBBB 3VV0A 3OS1A 4A4FA 2RHYA 4BI4A 4Y91A 4FM4B 3L2QA 4KT0E 4OB3B 3WVEB 1Q82C 2LCSA 1BCOA 4JRKA 3CCRA 3CCJQ 1U8RA 3V7RA 3O8VA 4X9CA 1WZOA 1AWOA 1KQ1A 2RQRA 3P8HA 4M77D 1Q95G 2KSSA 5KYUA 2QASA 2DBMA 4OB1B 3TQ7P 3R6NA 3CCUQ 4PJMA 3GP8A 3EH2A 4GLMA 4PJOA 3D7SB 3CCSQ 4ZGDB 2K4YA 3TREA 2DL7A 2K3BA 1WNLA 2XK0A 4F7UA 3QHSA 2OTLQ 1H3HA 5CIUA 5LJ5j 5J26A 3OMCA 4M77G 2LC4A 3OQ5A 5GJWB 2E4HA 3M59A 4CC2A 1YNZA 3QJ6A 4ELYC 2KRMA 2EYYA 2KEAA 1XQHA 3H8ZA 3OYIA 2BUDA 3SWNC 5LJ5g 3OYYA 2RI5A 4RUGA 2V26A 5HK3A 1ABQA 2HQXA 2P0QA 4ZTJA 3BFMA 2DJZA 1UJ0A 8AT1B 1K76A 2JS0A 2OX7A 5FU6B 2DEUA 4J9HA 5A2QE 1NYGA 4E7LA 1QWFA 1M90C 2E5KA 2RF0A 3GNFB 2R5MA 2RHIA 2XHCA 4BY6C 3S6WA 2Z0WA 4Q5WA 7AT1B 5KCHA 2KNBB 2KT1A 1CKBA 1ZQ1A 2JTMA 4OMMA 2M9UA 1JO8A 5IAYA 4RTVA 3RR6A 5GAN3 3NFCA 4O5VA 1WJQA 1U5SA 3EGDA 1VQ4T 1TU0B 2PVOB 4RTZA 3O5ZA 4FSSA 3G6EQ 2BTTA 1JU5C 3VS5A 2FVUA 2J6OA 2J06A 3CCET 4EIKA 2YUQA 4LD9K 4QT7A 2LZ6B 4IUPA 4KH1B 1ZBJA 2ZZDA 2AT1B 5KH6A 4X9DA 4CRIA 4F7UF 1YITA 1N5ZA 1PRLC 1I4K1 1UFFA 3A8GB 3QSUA 3DB3A 1V29B 3OYGA 4M7AF 3CC2T 3X28B 1K9MU 2E65A 1KC8R 2JM9A 2DVEA 1KD1R 4MDWA 3HSBA 1Q82R 3JCMe 2FO0A 5IT9E 1M90R 1QP2A 2H8HA 2A3LA 2VWFA 1UGPB 5FU6C 3JCMd 2EPDA 2X51A 2KYBA 1TXQA 5GJVB 1AD5A 2CP3A 2W10A 4OMFB 1VQKA 3RERA 1VYTA 3E9GA 4RCBA 2DTOA 2NYSA 3HFNA 5GAN7 1VQOT 1S72Q 1BYMA 4M78B 1WGSA 1QQJA 1BI1A 3MJXA 1JRIA 1KSWA 2O01E 1H92A 2DBKA 2QEXT 2HCKA 1PD0A 1IO6A 3J80E 3M0UA 5LJ3j 1D1CA 2EW3A 1GFCA 3KBGA 4R56A 2KVQG 2XD0A 3NTIA 3MO8A 4E7KA 1N8RC 4OF1A 3CBMA 2G6FX 3RKWA 3RKXA 2ZGWA 1MUZA 4RG2A 4AG2C 2DXUA 2MCNA 2OJ2A 1DJ7B 3UWNA 1RADB 3C95A 1T0HA 2QTXA 2LRQA 4AFQC 4KRTA 2CH4W 3JRZA 3HRSA 4ZN1A 1KQSA 2FL7A 4F7UE 3JCMP 1S1NA 2K9GA 3M57A 1KC8C 1WXTA 1M3BA 1YCSB 2JOYA 1SF9A 1WIEA 2HKNA 2HBWA 1ACMB 3OB9A 2JVVA 4JRIA 3EGXB 4C8QG 2K3YA 1WA7A 5FU7C 1YITT 1VQ7A 1QKWA 4OMNA 2DL8A 2KI7A 2XKOC 4LNPA 2BZYA 3PFSA 2ATCB 4PJNA 1WX6A 1SHFA 1VQ7T 5GAMd 2HQHA 3Q1JA 4ELZC 2CKKA 1PM3A 4FIBA 4GY5A 2YRVA 3I5SA 3QKJA 2O4XB 4E6RA 2D0QB 1MNDA 3OMGA 2L3QA 2QDLA 1VQ8T 2LX9A 4XU1A 1ZBXA 3HHTB 3QIIA 2W0ZA 3SHWA 3QYGB 4DA4A 3HTRA 1B34A 2XMFA 3JCMX 2DX1A 2E1HA 4M78A 2K7AA 4CC3A 2GF7A 5IHIA 3CCSA 2MIOA 5KE2A 2GNCA 2QGFB 1I5OB 2YUPA 2OTLA 1BIAA 3OYFA 2NUZA 2XDPA 3GNGA 3SWNB 1FXXA 4RMOA 2ECZA 1BU1A 1QP3A 1X6BA 2PNIA 2EYXA 2L3PA 1AOJA 3JB9H 2KXDA 4RTUA 4J7FA 1QWEA 4DBQA 4M7DC 2A36A 2FPEA 1K4US 2K5LA 3CMAQ 3WXMB 3GF5A 3JB9J 1JB0E 2E3HA 1H3ZA 1ZSZB 1GFDA 5GAOm 3M9QA 3RUXA 4PJLA 3JCMb 4N4GA 2Y4XA 3CC4A 2YWWA 3OYAA 2RJEA 1YWPA 5GAOp 1YHQQ 2AKKA 3V7CA 4ANJA 2QQRA 2F69A 1OQKA 5I2MA 3NGPA 5J39A 4PFPA 3H9NA 2COWA 2ZPFB 3V8KA 3JAME 2CUDA 4BD3A 3L2VA 1QVGA 1K8AR 1PNJA 1ABOA 5IHKA 5KYWB 4HCZA 2FPFA 1QCNA 1C0MA 1NJIU 1U1SA 1D3BA 4JZ3A 2L2PA 3V8LA 3E19A 3I56Q 2FZKB 2SRCA 2KR3A 2KRSA 3RKYA 3RESA 2GQVA 2RNAA 2DZ9A 2BIVA 4A4HA 3G6ET 2CREA 8ATCB 4F04B 1RI9A 2X9HA 2Y4YA 1VQ6T 1U3OA 3JCMh 1VQ9Q 2RHXA 3PGGA 1UG1A 5IH2A 4QVCA 1IGQA 3KFVA 2SEMA 3OSSC 1KIKA 2EGCA 1Y96A 2C0TA 3CC2A 1SSHA 2EYWA 1QVFS 1QVGS 2RD1A 3X20B 2HMAA 1TUCA 2EJ9A 4FYVB 3C4SA 1BK2A 1W70A 4OP0A 2X35A 2I2LA 2HD0A 1FMVA 5HCKA 3EFSA 2P4TA 1AT1B 4PKCC 2OTJQ 3LWIA 1ZUKA 2DILA 2B8AA 3G7ZA 3H6ZA 4HT9A 4LUDA 4UC4A 1D09B 1OU8A 2EVRA 1PSFA 4IUUA 3CCRT 1VQLQ 3M55A 1C1AA 4NL2A 3ASKA 1WYXA 2DETA 3BW1A 2ZPBB 4A54A 4R0KA 1Y07A 3EGDB 5LJ3e 2C0OA 4AT1B 2O88A 1RAEB 4WTOB 1TWBA 2DFUA 4ESRA 2YRCA 3CC2Q 1OYXA 3M56A 1W2BS 2CS7A 3OS0A 1PG5B 4XU2A 3SWNA 4FCYA 1TUGB 3CCVA 3EAEA 3OYNA 2F1LA 1XOVA 1BIBA 4FSXA 1JBMA 3FB9A 3GOXA 4BE1A 1NLPC 2I0NA 2Y90A 3GBQA 4M7DA 3VYGA 3OY9A 2D9TA 4C92B 4C8QC 1PD1A 2EAYA 3OW2P 1VQOA 1G5VA 2ESWA 2RK1A 4QQDA 4PJOC 3RMQA 5A0GA 1NG2A 2ZPHB 3FJ5A 1YJ9Q 1U06A 2AZSA 1RUWA 4N0AA 4A4GA 4Z89A 2DAQA 2A0FB 4XAXB 1M2VA 4PNOA 2JT4A 4AFSC 5AYFA 1O75A 1X69A 3X26B 2DKGA 3HL8A 3AHUA 4E2FB 1LJOA 4E7ZA 3THKA 5CKHA 3SFMA 2FRYA 2PZ1A 1I0CA 1M8MA 2R57A 2DD5A 1TOVA 4M77E 5LJ5f 3A1PA 2CZ6B 3FIFA 2RB6A 2JM8A 1S72T 4J9BA 4LXCA 5GAOn 1IB8A 5C6SA 2DM1A 2CUBA 2QDYB 4IIOA 1I07A 1NYFA 1VYVA 5GMKh 1I1JA 3CMET 3PVQA 1YJNA 2HBPA 4M77B 1YIJT 4J9CA 5IXFA 4MZPA 2NLUA 3H41A 1VQ8A 1PCXA 2KYMA 4DEYA 4FYWB 2E6NA 1IHVA 4O6JA 1KQ2A 1FWZA 2A37A 4JLIA 4DOWA 4AG1C 1Q81R 5EG2A 2YT6A 3UA7A 2DNUA 2GCXA 1M5Q1 1LCKA 1NBEB 1BI3A 2PTKA 3CQTA 4C92G 3OYJA 2X3XD 5DLQE 5CAIA 4M78E 4PLIA 2RO0A 1R8OB 1HYOA 1SG5A 3CBPA 1N9RA 2L8DA 4PJOF 1WQWA 1MMDA 3MHXA 3EGUA 2O9SA 2H3JA 2GFUA 2C0IA 2EYQA 1TSFA 1TTHB 2HL5C 5EC7A 4DBFA 1X6OA 3HRTA 1MMAA 1ZSZC 1Q81C 1HJDA 1LNXA 2XG8D 4HVVA 2MK5A 1PHTA 3EG3A 3ER0A 5FWCA 5GAOq 3N5BB 1BI0A 3MP6A 3CMEQ 4JJBA 2QQAA 2DYIA 5GANe 2K5IA 4JRQA 1RLQC 1VQ5T 4JZ4A 2LQNA 2PUKB 4NS5A 3DLLA 1K8AU 3OA6A 3CPFA 1AZGB 2E3IA 1JEGA 5LL6S 1VQ5A 5A0DA 1M4ZA 1UJYA 3VS3A 2QEXA 3CCUA 1X01A 1BI2A 3QZ5B 1KG1A 2EQMA 1G8XA 1Y7XA 1Q86U 2AIRB 1Q7YU 4OGCA 1WHGA 3EHQA 3EG0A 1PSEA 2IVWA 2IIMA 2MAMA 1M2OA 3CCLA 3PMTA 1GRIA 1VQ9A 5I22A 2MMPA 1H8KA 5GAN4 3L42A 2LTOA 1YI2Q 1K9MR 4BI8B 4KBMB 2HSEB 5DLOA 1SKUB 2ZPIB 2RJDA 1PC0A 4M7AG 2YLBA 5D6XA 1AWJA 1SPKA 1B3QA 4AFZC 1FX7A 3TSWA 2YDLA 4J9DA 1GCQA 2DLPA 1J3TA 4XTXA 2E6ZA 3E1SA 2B86A 5L8RE 2RQVA 1G3TA 2RHZA 4XTZA 2JTEA 5KYYA 4B9WA 1HSQA 2QK0A 1K73R 2LMJA 2ED1A 4N0AC 1UGSB 3KUFA 4MMKA 1WLPB 5D7UA 4F7UB 4RG8A 4M7DF 3GLXA 1OU9A 2QTVA 4B6MA 3SB2A 2MPXC 1VQMT 4E7IA 2D6FA 1O9SA 3SD4A 4WCIA 5CVIA 3JCMV 2RN8A 4CC7A 3JSCA 3CCLQ 4LN2A 3JB9D 4XU3A 3VRZA 2GBQA 1KQSS 2MYSA 4D8DA 5LJ5h 1QVFP 3ULRB 3RMSA 1E6GA 5GAOr 1R77A 4C8QF 3G6EA 4N4IA 3OYHA 3S3OA 1W1FA 1IZ6A 4BDZA 3GIBA 3H0HA 4JS4A 1E6HA 1UEBA 2EWNA 3FJPA 4M7DD 3UF4A 5FROA 1AEYA 3G71T 1Z9ZA 3QYHB 4J9EA 3G71A 1W2BA 1EIFA 2K5FA 2M02A 1YP5A 1YHQT 2VXEA 1W6XA 3MEAA 2LDMA 2VC8A 2VV5A 3RNJA 4F17A 2DD4A 4FYXB 3OYMA 3CC4T 4E47A 3PMIA 4EDUA 3CCEA 1X2KA 5FLXE 2JW4A 5GAMj 3OW2S 2RQUA 5CKDA 2DK3A 3M0TA 3I9QA 2JTFA 1BBZA 2EQUA 2QQSA 1QCOA 1PWTA 3UT1A 4C5HA 2BE7D 2CSQA 3A8LB 5KYYB 2CZ1B 4F16A 1C6VX 5GAOl 1BKBA 1S72A 2EJGA 1RL2A 3H0FA 1UB4A 1VQMA 4M7AC 3FEOA 1VQ6Q 2AHJB 4EMKC 3CC7T 4GBQA 2JZ2A 1GBQA 4KUDK 2AKLA 4JUVA 5AT1B 3IQLA 2VYTA 4HCBA 2DEQA 5D6WA 3VUZA 5GMKj 3M53A 4B9XA 1Y57A 3EGXA 2X4XA 4PK4A 1YJNQ 4C0DB 5GMKi 4J9IA 4M78F 2LVMA 1D0YA 2M1HA 3M0PA 3BDLA 3CCLT 1TUDA 3CCJT 2VVKA 4XTUA 3OW2A 2DL3A 3CEYA 3R6OA 4M77A 2VKNA 3AT1B 4M75D 1UHFA 2EYZA 1UUEA 3X25B 2EGAA 1M90U 1VQNA 2QXFA 3OS2A 3JB9G 3TU4K 3E9FA 2RH2A 1ZA1B 1ZUUA 4XTYA 2LQKA 2ZCFB 2CP5A 5FU7B 3OYKA 2V8KA 1I8FA 5C0MA 5KYNA 2PVGB 3LGLA 4OMLA 1RLPC 4GLKA 2F2VA 3G4ST 1JXOA 4XTVA 2RHUA 3EG9B 4C5IA 2NWMA 2CP7A 4BDYA 5IHNA 4E7JA 2E64A 1FMWA 3OBYA 4J6XA 1VIFA 2D8JA 1YJNT 3VS7A 2PUOB 4JS5A 2RPNA 4C0GA 2K2MA 2MI6A 1CSKA 3L2RA 3VYHB 1WI7A 4OMQA 2F2XA 3CCMA 3PT9A 1IREB 2O4XA 4FYYB 4XK8E 4CC4B 2X4YA 4FT4A 1D1AA 1YCYA 1BB9A 1N27A 2KGTA 1M8VA 3EHRA 4M7AD 2QQBA 2K6DA 2YHTA 3C12A 3GPLA 4XU0A 4BE0A 4C0FA 2CT4A 5L23A 1T3LA 4Y92A 2DL4A 3UDCA 1YIJQ 5GAN6 1PRMC 3CXCP 3JCMJ 1VQKT 4EPCA 1D3BB 2JN0A 4FW2A 3PE0A 2COZA 4IURA 2J7IA 1XNIA 1NE8A 1YFNA 2DPPB 1RABB 2ZPEB 1MMNA 2FZCB 4C92F 2RI2A 2OTLT 2K2VA 4OB0B 2CP6A 3M54A 2DO3A 1QLYA 3QO3A 1X6GA 3LW5E 1OOTA 1MMGA 2DERA 3PNWC 2P0KA 2M0YA 3NPFA 4QVZA 1M3AA 3REAB 2FRWA 3QWYA 5LJ3g 1CKAA 1QVPA 1MHNA 1TS9A 1VQPT 1OEBA 1FYNA 1JJ2S 2LCLA 3NTKA 3INZA 4DQ2A 5FRNA 4MZTA 4ZNXA 3I55Q 9ATCB 5LJ3h 3CD6T 2XI9A 4HVUA 2DVJA 1VQ4Q 2JJ9A 2FPDA 1D1BA 3UA6A 2VB6A 3M4GA 2XDBA 3JB9F 2DMOA 4EMKB 3CPWP 1IGUA 3A8MB 3V7SA 3HFOA 1RAHB 4M75F 5CK9A 2DIGA 1YJWT 1Y0MA 2EJFA 5GAMh 4HT8A 3NHNA 3OBWA 4M75C 1WQ7A 4ZGJB 3L2UA 4PFZA 2CH4A 2QI2A 1Y96B 4BB7A 5GAN5 2DYBA 2OTJA 1RAAB 4C8QB 4C92C 1K73C 4QVDA 2CSIA 3TCJA 1JJ2A 1NLOC 2IG0A 2LCCA 4KGZB 5KYXA 1QMCA 4JJCA 4CI0C 4ZN3A 1QVGP 4M75A 3OYDA 2G3RA 1WXBA 4QQ6A 2E70A 2RQTA 4Z88A 2QA4A
chains in the Genus database with same CATH topology
3CPFA 3I56T 2QEXT 4LDYA 2DZCA 5LL6S 5LJ3d 3J80E 1VQ5A 5CR2A 5LJ3j 5A0DA 2L89A 1M4ZA 2V8IA 1OZ2A 3I56A 2QEXA 3KBGA 3CCUA 1X01A 4R56A 2KVQG 1B34B 1MGQA 1BI2A 2HQEA 3QZ5B 2EQMA 3MO8A 1NZ9A 1Y7XA 3NTIA 5I2SA 5DM7R 4E7KA 1Q86U 3ZBDA 4IUVA 4M77F 1Q7YU 4OGCA 4OF1A 1N8RC 4XQ3A 2KMTA 3CBMA 1N8RU 1KHCA 1PSEA 2IVWA 4LDXA 5CQYA 5GAN8 3QDRB 2MAMA 2JNGA 3RKWA 3CCLA 3PMTA 1VQ9A 3RKXA 2ZGWA 2MMPA 4LDWA 3T9NA 5GAN4 4RG2A 3HRUA 2DXBA 3L42A 5LJ5g 2LTOA 1Q81U 2RI3A 4BI8B 3CPWA 5CO7A 4KBMB 1H641 1NPRA 3DKMA 2DXUA 4IKFA 4M75E 5DLOA 4HKEA 3CCMT 2ZPIB 5HY6A 2RJDA 4FU6A 1DJ7B 4LD6A 3UWNA 3C95A 1Q7YC 4KULA 4M7AG 5KE3A 1P92A 2YLBA 2QTXA 2LRQA 3MP1A 5D6XA 3JCMW 3JRZA 5I21A 3OY9A 3HRSA 4ZN1A 1KQSA 2FL7A 3M5AA 3QXEB 4J6YA 4F7UE 1FX7A 4PL6A 4OGEA 3JCMP 3M57A 1KC8C 4FT2A 2RM4A 3QUIA 1VQ4A 3A8HB 3S3NA 2F5TX 5LJ5e 1WJSA 2JOYA 2X4WA 3UPUA 4PJOG 4XTXA 2E6ZA 4IUQA 3E1SA 3L2ZA 3OB9A 4FL6A 5L8RE 2VGNA 1M1KU 1G3TA 2JVVA 2RHZA 3MEWA 4JRIA 1YBYA 4ZGEB 4Y28E 4XTZA 1M1KC 4LDUA 4B9WA 1AHJB 4YTLA 1KD1U 4M7AE 1UGQB 4C8QG 4C5EA 4M7DE 2RK2A 2K3YA 4MDXA 2RA2A 5FU7C 4N0AC 2EQKA 1UGSB 2E41A 3KUFA 3DLMA 4L5GA 5CKEA 1N9SA 4MMKA 2K57A 3PIPA 1YJWA 1VQ7A 2QQ9A 4F7UB 4RG8A 2XKOC 4M7DF 3GLXA 2PQWA 3M58A 3PFSA 1GXIE 2YLCA 1VQ7T 5GAMd 3Q1JA 3MEVA 2R58A 3SB2A 4ELZC 2XD0A 2CKKA 4FIBA 4GY5A 3TEEA 4D6WA 4EMHA 2YRVA 3QKJA 2O4XB 1VQMT 4E7IA 2D6FA 1O9SA 2D0QB 3SD4A 3VKIA 3M4YA 3OMGA 3OS5A 5CVIA 3JCMV 1VQ8T 1NPPA 3FDRA 3J7AF 3JSCA 2R5AA 5GANg 3JB9D 2LX9A 4XU1A 4XU3A 4M77C 1ZBXA 4NL3A 5HK0A 3HHTB 1G3YA 3QIIA 3CXCA 1KQSS 2KAFA 5LJ5h 3LX7A 1YI2A 2RJFA 1UGRB 2PU9B 3RMSA 3VUBA 5GAMe 5GAOr 3QYGB 1XTDA 4DA4A 1B34A 4C8QF 3JCMX 1Q86C 3G6EA 4N4IA 2E1HA 4M78A 3OYHA 4C0DC 3S3OA 2GF7A 1IZ6A 3CCSA 3FC3A 5GANh 4PJOB 5CQXA 4JDSA 4BDZA 1VQ6A 4E7HA 3GIBA 1KHIA 3LWHA 4JS4A 5KE2A 4J83A 1UEBA 3ME9A 2EWNA 3CMAT 2MWPA 3FJPA 4A53A 4DOVA 4J5YA 4M7DD 2KK4A 4EMGA 2OTLA 1BIAA 5FROA 3OYFA 2XDPA 3G71T 5J3BA 3QYHB 3GNGA 3I55A 3SWNB 1FXXA 1QW1A 4RMOA 2QA4T 2WSFE 1VQNT 3G71A 1W2BA 1QP3A 2PVDB 1EIFA 3MEUA 2K5FA 4J8OA 3F70A 3JB9H 1YIJA 2A7YA 4J7FA 4BUGA 1YHQT 4M7DC 1I5LA 2VXEA 3MEAA 5GMKe 2K5LA 2LT1A 2CYZB 2LDMA 3WXMB 2F5KA 5GANf 2M0OA 2VC8A 1K73U 2V8JA 3GF5A 2VV5A 5GAMf 3JB9J 3QZ9B 3OYBA 1JB0E 1H3ZA 4IUTA 2DD4A 3CXCS 5GAOm 3OYMA 3CC4T 1VUBA 1RI0A 3G4SA 3M9QA 1W4SA 3RUXA 2DTHA 1SSFA 4E47A 3PMIA 3JCMb 4N4GA 3VJPA 4EDUA 3CCQT 3LYIA 2Y4XA 3JCMg 3CCEA 3CC4A 1U1TA 3OYAA 1YJ9A 2RJEA 5GAOp 5FLXE 5GAMj 3OW2S 3V8JA 5CKDA 3V7CA 2DK3A 4C92D 2QQRA 2F69A 2JTFA 5LJ5d 1WPYA 1KC8U 2EQUA 2QQSA 3QBYA 5I2MA 1Q82U 3UT1A 3DB4A 4C5HA 3A8LB 5J39A 2MWOA 4HCCA 2L5QA 2ZPFB 4OB2B 3OSVA 2CZ1B 1K9MC 3V8KA 5GAOl 4BD3A 3JAME 1BKBA 3L2VA 3CBOA 1S72A 1QVGA 2EJGA 1RL2A 1VQMA 1UB4A 3CC7A 2L3RA 4M7AC 3FEOA 4Z02A 2AHJB 4EMKC 4M7DB 4HCZA 3C94A 3QG1A 1G3SA 3CC7T 1NJIU 1U1SA 1D3BA 2JZ2A 4KUDK 2HNIA 4JUVA 1G3WA 3V8LA 1HXDA 3E19A 2FYKA 2VYTA 4HCBA 3PIOA 4WF2A 3RKYA 3RESA 2DEQA 2GQVA 5D6WA 2DZ9A 3VUZA 5GMKj 2DXCA 2BIVA 3FLGA 3M53A 4A4HA 4B9XA 2CZ0B 5DY9A 3G6ET 4M7DG 5GAMg 1LOJA 4ATOA 4A4KA 4EMKA 2X4XA 2Y4YA 1VQ6T 2WSEE 1OI1A 5CKBA 3ZEHA 5HKCA 3CMAA 2DTIA 3JCMh 4C0DB 5GMKi 2LNVA 3BY7A 4QW2A 2RHXA 3PGGA 3CCVT 4MMLA 4C8QA 4II1A 4M78F 3QJYA 3RIRA 2LVMA 5FRMA 3HPWA 4QVCA 4PLLA 2XIDA 2M1HA 3OSSC 3BDLA 3CCLT 3CCJT 1VIEA 4XTUA 2GFAA 4KUIA 3OW2A 1Y96A 2M16A 4C0ZA 3CC2A 3CEYA 3R6OA 5GMKl 1QVFS 1YHQA 1QVGS 2RD1A 1VQLT 3PTAA 4M77A 3X20B 4M75D 1K8AC 1N6AA 3CCST 3JCMf 3X25B 4C92A 2XU8A 2EIFA 2ZPGB 3LLRA 1M90U 3WVDB 4ME7A 1VQNA 4JJNK 2QXFA 2EJ9A 2K3XA 2LQ8A 3OS2A 5KCOA 3JB9G 2EQJA 3C4SA 2VGMA 3TU4K 4RCCA 3JB9I 3E9FA 2RH2A 4OP0A 3CCUT 4JRPA 4BACA 2X35A 2I2LA 2HD0A 4XTYA 2LQKA 5A0LA 2ZCFB 5FU7B 4R55A 1QVFA 4L59A 3CD6A 4M75G 3EFSA 2OAUA 2P4TA 4PKCC 3OYKA 3VV0A 3OS1A 4A4FA 3LWIA 2RHYA 4BI4A 4Y91A 2V8KA 4FM4B 3L2QA 1I8FA 2B8AA 3G7ZA 4KT0E 4OB3B 3WVEB 2PVGB 3LGLA 5C0MA 4ZTFA 1Q82C 3H6ZA 4HT9A 4GLKA 3G4ST 4UC4A 4XTVA 2RHUA 2KY9A 4JRKA 4P5NA 4C5IA 3CCRA 1U8RA 4BDYA 4HA8A 3V7RA 1PSFA 4E7JA 2E64A 4IUUA 3OBYA 3O8VA 4J6XA 4X9CA 5GMKm 1VIFA 3I55T 1YJNT 3CCRT 1KQ1A 2PUOB 4JS5A 3M55A 4NL2A 3ASKA 3P8HA 4C0GA 3BW1A 4M77D 4M7AA 2KSSA 4QQGA 4M78C 2E12A 2ZPBB 2MI6A 3HP9A 4A54A 1Y07A 4OB1B 3A8OB 5M9OA 5LJ3e 3L2RA 3VYHB 2FB7A 2QA4A 5GAN2 2RJCA 3GP8A 3CCMA 1VQ9T 3MCAB 5GANd 3PT9A 3HKSA 4C8QE 4PJOA 1ZHIA 1IREB 2O4XA 4XK8E 4ZGDB 4VUBA 2X4YA 2K4YA 4FT4A 3TREA 5CCAA 2OTJT 4BI3A 2KQWA 1OYXA 3M56A 1W2BS 2CS7A 1M9SA 3OS0A 1WNLA 2XK0A 4M78G 4F7UA 1NJIC 1YCYA 5D6YA 2LT4A 4XU2A 1N27A 3QHSA 1M8VA 3SWNA 4M7AD 5CIUA 2QQBA 4TVRA 2YHTA 5J26A 5LJ5j 3CCVA 3EAEA 3C12A 3OMCA 4M77G 4XU0A 2EFIA 3OYNA 3GPLA 2LC4A 3OQ5A 4J6WA 4C0FA 4BE0A 1XOVA 3META 1BIBA 4FSXA 3M59A 1JBMA 1WJRA 3FB9A 5LJ3f 3QJ6A 3GOXA 3BDUA 3UDCA 2Y90A 4C5GA 4ELYC 4BE1A 2EKOA 4PJOD 5GAN6 1XQHA 3H8ZA 2KDSA 3OYIA 4M7DA 3JCMJ 1VQKT 2BUDA 3VYGA 3X24B 4EPCA 3SWNC 1D3BB 2JN0A 2RI5A 2BKDN 2D9TA 3OYYA 5IN1A 2HQXA 3LGFA 4C92B 4C8QD 4C8QC 5HK3A 2XDDA 2EAYA 4IURA 1VQOA 1G5VA 2RK1A 4LDVA 4QQDA 2P0QA 4PJOC 3RMQA 3BFMA 4ZTJA 1NE8A 1XNIA 2DJZA 5A0GA 2ZPHB 2VXFA 2DPPB 2DXTA 2JUFA 1VQLA 2ZPEB 5FU6B 4C92F 2RI2A 5A2QE 4N0AA 2OTLT 1X75C 3EFRA 4A4GA 2DAQA 2CGHA 2K2VA 4XAXB 3OYCA 4E7LA 1M90C 4PNOA 4M75B 4OB0B 5AYFA 1O75A 1TH7A 3GNFB 3M54A 3LH0A 4RKUE 2R5MA 2DKGA 3X26B 2XICA 3J81E 2RHIA 2DO3A 2XHCA 3HL8A 4BY6C 3AHUA 3QO3A 4X34A 3S3MA 3LW5E 3S6WA 4NOYA 4Q5WA 5KCHA 3P8BB 3PNWC 1LJOA 5CKHA 3SFMA 3JCMQ 4A4EA 1ZQ1A 2JTMA 2M9UA 2R57A 2DD5A 4PJOE 2P0KA 3JCMc 4M77E 5IAYA 5LJ5f 4MZMA 2CZ6B 3L2WA 3FIFA 2CZ7B 2RB6A 4QVZA 5GAN3 1S72T 3NFCA 4O5VA 1WJQA 5GAOn 1VQ4T 5C6SA 1I81A 2PVOB 2P0PA 3SDZA 5LJ3g 1QVPA 1YJ9T 3FRNA 3CMEA 1MHNA 2QDYB 2FVUA 1VQPT 3MP8A 3CCET 1JJ2S 5GMKh 3CMET 2LCLA 1YJNA 2HBPA 3NTKA 4M77B 4LD9K 3INZA 4DQ2A 1VQPA 1YIJT 5FRNA 4MZTA 4IUPA 5LJ3h 3CD6T 2XI9A 3OYEA 4XTWA 4MZPA 2NLUA 2E10A 1HK9A 1VQ8A 2ZZDA 3P8DA 5KH6A 1M1GA 4X9DA 2VUBA 4CRIA 4F7UF 3M4GA 1YITA 2XDBA 5GANj 4V2SA 3JB9F 1I4K1 2E6NA 3CPWS 4O6JA 3A8GB 1FWZA 4EMKB 1KQ2A 3QSUA 4M7AB 3KXTA 2C06A 4JLIA 2E5QA 3URGA 3DB3A 4DOWA 3A8MB 3V7SA 3QPHA 1V29B 5EG2A 3OYGA 3CCQA 3HFOA 4M7AF 4M75F 5CK9A 2DIQA 2DIGA 2GCXA 4JLGA 2FHDA 1YJWT 4L6V5 1M5Q1 2EJFA 4BY6B 3CC2T 1BI3A 4C92G 2MF2A 3X28B 3VU3C 3OYJA 1K9MU 2E65A 5DLQE 1YITT 5CAIA 4M78E 5GAMh 2DVEA 4PLIA 3NTHA 4HT8A 2RO0A 4MDWA 1R8OB 2X4JA 3OBWA 4M75C 3A5ZB 3OYLA 1KD1C 1WQ7A 3HSBA 4ZGJB 2HAXA 3JCMe 3CBPA 1N9RA 3L2UA 5IT9E 2L8DA 2QI2A 1Y96B 1QP2A 1WQWA 2A3LA 3MHXA 4J7IA 4M78D 4PJOF 4BB7A 5GAN5 2H3JA 1UGPB 5FU6C 2GFUA 3JCMd 4BE2A 2OTJA 2EYQA 4C8QB 4C92C 1KG1A 5CKFA 1K73C 4QVDA 1X6OA 4C92E 3HRTA 4OMFB 1VQKA 1M1FA 3TCJA 4OVAA 2WACA 1JJ2A 3RERA 3ZFJA 4F7UG 1Q81C 1LNXA 2XG8D 3E9GA 4RCBA 2DTOA 2IG0A 2LCCA 2WSCE 3HFNA 4N4HA 3CCJA 3ER0A 5GAN7 1YI2T 5GAOq 1OZ3A 3N5BB 1BI0A 3MP6A 1VQOT 3L1AA 2QQAA 1BYMA 4CI0C 4ZN3A 5GANe 2K5IA 4JRQA 4M78B 1VQ5T 4M75A 2PUKB 3OYDA 2G3RA 1WGSA 4NS5A 4QQ6A 3DLLA 1Y71A 1K8AU 1BI1A 2E70A 1JRIA 3OA6A 2O01E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM f;  4C92 A;  4EMG A;  4PNO A;  2DZC A;  1BIA A;  2CGH A;  4M75 B;  5LJ3 d;  1TH7 A;  5LJ3 j;  2DKG A;  3SWN B;  2EJ9 A;  3AHU A;  1X01 A;  3QO3 A;  3JB9 G;  1B34 B;  1MGQ A;  4RCC A;  3JB9 I;  4NOY A;  4OP0 A;  1LJO A;  2I2L A;  4M77 F;  3JB9 H;  4XTY A;  4XQ3 A;  3JCM Q;  4M7D C;  4M75 G;  1I5L A;  3EFS A;  5GAN 8;  2VXE A;  4PJO E;  5GMK e;  3JCM c;  4M77 E;  3RKW A;  5LJ5 f;  1JRI A;  4Y91 A;  5GAN f;  2VC8 A;  3FIF A;  1I8F A;  2RB6 A;  3RKX A;  2ZGW A;  5GAN 3;  5GAM f;  5GAN 4;  3JB9 J;  4HT9 A;  5LJ5 g;  4XTV A;  5GAO n;  4JRK A;  5GAO m;  1I81 A;  1H64 1;  2DXU A;  4M75 E;  3RUX A;  5LJ3 g;  4HA8 A;  3V7R A;  2DTH A;  2E64 A;  5GMK m;  4J6X A;  4X9C A;  3JCM b;  4M7A G;  3JCM g;  1KQ1 A;  1U1T A;  2YLB A;  5GAO p;  2QTX A;  4NL2 A;  5GAM j;  4M7A A;  3BW1 A;  4M77 D;  3JCM W;  3V8J A;  5I21 A;  4M78 C;  3V7C A;  4C92 D;  5GMK h;  4J6Y A;  4F7U E;  4M77 B;  3JCM P;  5LJ5 d;  1WPY A;  3INZ A;  4A54 A;  4DQ2 A;  2RM4 A;  3QUI A;  5LJ3 e;  5LJ3 h;  5LJ5 e;  4XTW A;  2FB7 A;  4PJO G;  4XTX A;  2E10 A;  1HK9 A;  5GAN 2;  3L2Z A;  3V8K A;  5GAO l;  4C92 C;  4X9D A;  5GAN d;  4C8Q E;  4PJO A;  4JRI A;  4F7U F;  2EJG A;  3M4G A;  4XTZ A;  5GAN j;  4V2S A;  4M7A C;  3JB9 F;  4M7A E;  1I4K 1;  4EMK C;  4M7D E;  4C8Q G;  4M7D B;  4EMK B;  1KQ2 A;  1WNL A;  4F7U A;  4M78 G;  2RA2 A;  3QSU A;  1YCY A;  4N0A C;  2E41 A;  4M7A B;  4JLI A;  4XU2 A;  1N9S A;  3QHS A;  1U1S A;  1D3B A;  2K57 A;  4MMK A;  3SWN A;  3V7S A;  2HNI A;  4M7A D;  4JUV A;  4F7U B;  3HFO A;  4M7D F;  4M7A F;  4M75 F;  2YHT A;  5LJ5 j;  3V8L A;  1HXD A;  1M5Q 1;  2FYK A;  4M77 G;  2EJF A;  4XU0 A;  4J6W A;  4C92 G;  4WF2 A;  2YLC A;  3RKY A;  3RES A;  3VU3 C;  2DEQ A;  2E65 A;  3SB2 A;  2DZ9 A;  1BIB A;  5GMK j;  5CAI A;  5GAM d;  4M78 E;  4EMH A;  1JBM A;  2DVE A;  3FB9 A;  5GAM h;  5LJ3 f;  4HT8 A;  5DY9 A;  4M75 C;  3HSB A;  4M7D G;  1WQ7 A;  3BDU A;  2Y90 A;  5GAM g;  1LOJ A;  3JCM e;  1N9R A;  4PJO D;  4EMK A;  4PJO F;  1Y96 B;  1WQW A;  4M78 D;  3JCM V;  5GAN 6;  5GAN 5;  4M7D A;  3JCM J;  3JCM d;  5GAN g;  3JB9 D;  2DTI A;  3JCM h;  4C8Q B;  3SWN C;  1D3B B;  2JN0 A;  3BY7 A;  4M77 C;  4XU3 A;  4XU1 A;  4C92 B;  4C8Q C;  4QVD A;  4NL3 A;  4C8Q D;  4C92 E;  3PGG A;  4MML A;  4C8Q A;  5LJ5 h;  4M75 D;  2EAY A;  4M78 F;  3RIR A;  4F7U G;  3RER A;  1LNX A;  4RCB A;  2DTO A;  3HFN A;  5GAM e;  4QVC A;  5GAO r;  5GAN 7;  1B34 A;  4C8Q F;  3JCM X;  5GAO q;  4PJO C;  3BFM A;  2E1H A;  4M78 A;  2DJZ A;  2VXF A;  4XTU A;  2DXT A;  3L1A A;  1Y96 A;  5GAN e;  4C92 F;  5GAN h;  4PJO B;  4M78 B;  3GIB A;  5GMK l;  4M75 A;  2RD1 A;  4N0A A;  5GMK i;  4M77 A;  3EFR A;  1M8V A;  2EWN A;  3FJP A;  4M7D D;  4A53 A;  4J5Y A; 
#chains in the Genus database with same CATH topology
 3I56 T;  5CR2 A;  5ECA A;  2HSP A;  2KXC A;  1B34 B;  1Q86 C;  1VQ4 A;  1NZ9 A;  1FMK A;  3ZBD A;  4IUV A;  3BE3 A;  4M77 F;  5I11 A;  2J6K A;  5CQY A;  4AFU C;  2JNG A;  2O9V A;  2DF6 A;  2YUO A;  3T9N A;  3CCV Q;  2QGG A;  2HEQ A;  2KRO A;  3EFO A;  3CPW A;  5CO7 A;  2H3E B;  1H64 1;  1UE9 A;  3DKM A;  2A28 A;  4M75 E;  2ED0 A;  4LD6 A;  2YUN A;  4KUL A;  1Q7Y C;  5KE3 A;  1P92 A;  1WHK A;  4K11 A;  3JCM W;  5I21 A;  2QAZ A;  2GQI A;  3M5A A;  3QXE B;  4OGE A;  2M51 A;  4FT2 A;  3QUI A;  3A8H B;  2J05 A;  5LJ5 e;  1UTI A;  3UPU A;  4PJO G;  4IUQ A;  1WXU A;  4FL6 A;  2VGN A;  1M1K U;  1KK7 A;  1YBY A;  4ZGE B;  4LDU A;  1WDX A;  1AHJ B;  4YTL A;  1KD1 U;  4M7A E;  1UGQ B;  4M7D E;  4C5E A;  2P84 A;  2RK2 A;  4RTX A;  2E41 A;  3DLM A;  1N9S A;  3PIP A;  2JS2 A;  2CP2 A;  1N8R R;  5FW9 A;  1LPL A;  2PQW A;  2JMA A;  4KGV B;  1NEG A;  1GXI E;  2YLC A;  2R58 A;  1VA7 A;  3CCR Q;  3U23 A;  4EMH A;  1UGV A;  2F2W A;  2LP5 A;  2ROL A;  3CC4 Q;  3OS5 A;  1MV3 A;  4LE9 A;  4OMP A;  5GAN g;  1IRX A;  3C0C A;  1NEB A;  1M2V B;  1G3Y A;  1BCM A;  2KAF A;  3LX7 A;  2RJF A;  2PU9 B;  2BE9 B;  5GAM e;  1QKX A;  4C0D C;  2L0A A;  3G1J A;  3FC3 A;  5GAN h;  4PJO B;  4JDS A;  2NUT A;  2LQW A;  1KHI A;  1ZX6 A;  4J83 A;  3ME9 A;  2OAW A;  3CMA T;  2MWP A;  4A53 A;  2RMO A;  5J3B A;  4HVW A;  2CDT A;  2WSF E;  2MOX A;  1VQN T;  3MEU A;  4J8O A;  1X2Q A;  2KRN A;  1YIJ A;  4F14 A;  2IPO B;  3I5R A;  2DA9 A;  2LT1 A;  5GAN f;  1ZLM A;  1SEM A;  2HDA A;  3EFO B;  5GAM f;  3QZ9 B;  3OYB A;  2LJ3 A;  3CXC S;  1W4S A;  2O31 A;  1Q86 R;  3A98 A;  1V76 A;  3LYI A;  1Q7Y R;  1T3S A;  1SRL A;  2RQW A;  1KC8 U;  5LJ5 d;  1WPY A;  1R0C B;  3QBY A;  1B7T A;  1Q82 U;  3DB4 A;  4AMC A;  4HCC A;  2L5Q A;  2EGE A;  1SHG A;  3OSV A;  2OTJ T;  1K9M C;  4RTW A;  3CBO A;  6AT1 B;  2HKQ B;  3CC7 A;  2L3R A;  4Z02 A;  3C94 A;  2LJ1 A;  3TSZ A;  2HNI A;  1VQ5 Q;  1G3W A;  2QEX Q;  3PIO A;  1UEC A;  2DXC A;  3FLG A;  2CZ0 B;  1PKS A;  2V1Q A;  4ATO A;  4A4K A;  2WSE E;  1D0X A;  4HXJ A;  5CKB A;  5HKC A;  3CMA A;  2DRM A;  2DTI A;  3MKD A;  2LNV A;  4QW2 A;  2VAS A;  1ARK A;  1RAI B;  3CCV T;  4M4Z A;  4MML A;  4II1 A;  3QJY A;  3HPW A;  4PLL A;  2KBT A;  2XID A;  2D1X A;  1R0B G;  2GGR A;  3VS6 A;  2GFA A;  2M16 A;  1YHQ A;  1VQL T;  3REB B;  1N6A A;  1K8A C;  4C92 A;  2ZPG B;  2DE0 X;  2LNH B;  4ME7 A;  2X3W D;  2CT3 A;  2VGM A;  3JB9 I;  3CCU T;  2KT8 A;  4JRP A;  5FWB A;  4X1V A;  1QVF A;  3CD6 A;  4M75 G;  2OAU A;  1A0N B;  4QKU A;  1RAF B;  4ZTF A;  1VQK Q;  1VQO Q;  2KY9 A;  4P5N A;  1X27 A;  4HA8 A;  5GMK m;  3I55 T;  2LX7 A;  4M7A A;  4QQG A;  4M78 C;  2E12 A;  3HP9 A;  3VS2 A;  2LJ0 A;  3A8O B;  5M9O A;  1AWW A;  2FB7 A;  1JXM A;  5GAN 2;  2RJC A;  1VQ9 T;  2GTJ A;  3MCA B;  5GAN d;  4C8Q E;  2ROT A;  3HKS A;  1ZHI A;  5CCA A;  1W2B P;  4BI3 A;  2KQW A;  1M9S A;  4M78 G;  1NJI C;  4RTT A;  5D6Y A;  2LT4 A;  2YSQ A;  2AK5 A;  4TVR A;  1E7O A;  2EFI A;  4J6W A;  1ZA2 B;  3MET A;  3G71 Q;  2EQI A;  1WJR A;  5LJ3 f;  3BDU A;  4C5G A;  3MPU B;  2EKO A;  3I35 A;  2QG9 B;  4PJO D;  3CD6 Q;  2KDS A;  3X24 B;  5IN1 A;  2BKD N;  3LGF A;  1VQP Q;  4C8Q D;  1IHW A;  2FZG B;  1WHM A;  2XDD A;  3PVL A;  1SRM A;  1X43 A;  4LDV A;  2VXF A;  2DXT A;  2JUF A;  1VQL A;  4IIM A;  3UAT A;  1X75 C;  3EFR A;  2CGH A;  3OYC A;  4M75 B;  1VQ7 Q;  1TH7 A;  4RKU E;  3LH0 A;  3J81 E;  2XIC A;  4X34 A;  3S3M A;  2ENM A;  4NOY A;  4J9F A;  3P8B B;  3JCM Q;  1EZZ B;  4A4E A;  2FG0 A;  1K0S A;  2JXB A;  4PJO E;  3M0Q A;  3JCM c;  4MZM A;  3L2W A;  2CZ7 B;  3H0I A;  2NUP B;  3EG1 A;  1MNE A;  1YN8 A;  1WHJ A;  1I81 A;  2P0P A;  3SDZ A;  1AWX A;  1YJ9 T;  3FRN A;  3CME A;  1Z9Q A;  3VS4 A;  3MP8 A;  5KYW A;  2A08 A;  1JJ2 P;  1IXD A;  1KFZ A;  1M27 C;  1VQP A;  3OYE A;  1OUL A;  4XTW A;  2E10 A;  1HK9 A;  2P4R A;  3P8D A;  2BZX A;  1M1G A;  2VUB A;  2NUT B;  5GAN j;  4V2S A;  1KJW A;  2CP0 A;  3CPW S;  4M7A B;  3KXT A;  2C06 A;  2E5Q A;  4ORZ A;  3URG A;  3CCQ A;  3QPH A;  1YWO A;  3QDF A;  2DIQ A;  4JLG A;  2FHD A;  4L6V 5;  4JJD A;  4BY6 B;  2MF2 A;  3VU3 C;  1B07 A;  1NM7 A;  3NTH A;  2X4J A;  3OYL A;  1KD1 C;  3A5Z B;  2HAX A;  1K9A A;  1JQQ A;  4M78 D;  4J7I A;  2J6F A;  4BE2 A;  1ZSG A;  5CKF A;  4C92 E;  1M1F A;  4OVA A;  2WAC A;  1EX4 A;  3ZFJ A;  2HZY A;  4F7U G;  1GBR A;  3CCJ A;  2WSC E;  4N4H A;  1YI2 T;  1OZ3 A;  1AZE A;  1LVK A;  3L1A A;  3ZL7 C;  3CC7 Q;  4JPB W;  1OPK A;  4VUB A;  1Y71 A;  1GCP A;  1EFN A;  4LDY A;  2DZC A;  3RDV A;  5LJ3 d;  1YJW Q;  4Z8A A;  1M1K R;  2L89 A;  4OMO A;  2V8I A;  1OZ2 A;  1HD3 A;  1ZSZ A;  3I56 A;  2DRK A;  2OI3 A;  1PKT A;  1MGQ A;  4Y28 E;  2HQE A;  5DM7 R;  3EG9 A;  1ZUY A;  5I2S A;  2YRD A;  4XQ3 A;  2KMT A;  3TVT A;  1N8R U;  1KHC A;  4LDX A;  5GAN 8;  3QDR B;  2AZV A;  2V1R A;  1OPL A;  4PFO A;  3CCQ Q;  4LDW A;  3HRU A;  2DXB A;  1OX9 A;  1Q81 U;  2RI3 A;  1MV0 B;  2QYZ A;  1NPR A;  1QCF A;  4IKF A;  3CCM T;  4HKE A;  4J9G A;  4PJJ A;  5HY6 A;  4FU6 A;  1WFW A;  3VRY A;  4DBH A;  3MP1 A;  4J6Y A;  4PL6 A;  2RM4 A;  3S3N A;  2F5T X;  1WJS A;  2X4W A;  3L2Z A;  3MEW A;  1VOM A;  1M1K C;  2DJQ A;  2K79 A;  1VYU A;  1M3C A;  2EKH A;  4MDX A;  2RA2 A;  3EH1 A;  2EQK A;  4L5G A;  5CKE A;  1G2B A;  1TG0 A;  2K57 A;  1YJW A;  2QQ9 A;  3VS0 A;  3M58 A;  1WHH A;  3MEV A;  1M30 A;  4D8K A;  3TEE A;  4D6W A;  3VKI A;  3M4Y A;  1NPP A;  3E2U A;  3FDR A;  3J7A F;  3SEM A;  2R5A A;  1K1Z A;  4KGX B;  4M77 C;  1NJI R;  4NL3 A;  5HK0 A;  3CXC A;  1GCQ C;  1YI2 A;  3VUB A;  1UGR B;  2COY A;  1XTD A;  1OV3 A;  4HCK A;  1D0Z A;  1VQM Q;  1F1B B;  5CQX A;  1VQ6 A;  4E7H A;  3LWH A;  2ABL A;  4DOV A;  4J5Y A;  2KK4 A;  4EMG A;  1XJW B;  1RAC B;  3I55 A;  1QW1 A;  2QA4 T;  2KE9 A;  3LH5 A;  4FW1 A;  2PVD B;  2JMC A;  5KYX B;  1YIT Q;  2O2O A;  3F70 A;  2A7Y A;  2D0N A;  4BUG A;  3M0R A;  1I5L A;  2HL3 A;  3EG2 A;  5GMK e;  2CYZ B;  2F5K A;  2M0O A;  1K73 U;  2V8J A;  2FEI A;  4IUT A;  4KH0 B;  1K0X A;  4DBR A;  1VUB A;  1RI0 A;  3G4S A;  4E7S A;  2DTH A;  1T0J A;  1UHC A;  1SSF A;  3CCQ T;  3VJP A;  3JCM g;  1U1T A;  1YJ9 A;  2EBP A;  3V8J A;  4C92 D;  1AVZ C;  5KYU B;  1RAG B;  1VQN Q;  3JV3 A;  2MWO A;  2DL5 A;  4DEX A;  4OB2 B;  3VS1 A;  1V1C A;  4M7D B;  3QG1 A;  1WHL A;  1G3S A;  2QA4 Q;  2BZ8 A;  1G83 A;  1HXD A;  2FYK A;  4WF2 A;  2L3S A;  1GL5 A;  5DY9 A;  4M7D G;  5GAM g;  1LOJ A;  2GTO A;  1UDL A;  2ZAE A;  4EMK A;  3QWX X;  3M0S A;  1OI1 A;  3ZEH A;  4A63 B;  2NUP A;  3BY7 A;  3NMZ C;  4C8Q A;  2D8H A;  3RIR A;  5FRM A;  3G4S Q;  1VQ8 Q;  3CCM Q;  4RTY A;  1VIE A;  4KUI A;  3CCE Q;  4C0Z A;  1KQS P;  5GMK l;  3PTA A;  1OX8 A;  3CCS T;  3JCM f;  2XU8 A;  2EIF A;  3LLR A;  4LUE A;  3WVD B;  5IXB A;  2YXY A;  4JJN K;  2K3X A;  2LQ8 A;  5KCO A;  2EQJ A;  4RCC A;  4BAC A;  5A0L A;  4R55 A;  4L59 A;  3RBB B;  3VV0 A;  3OS1 A;  4A4F A;  2RHY A;  4BI4 A;  4Y91 A;  4FM4 B;  3L2Q A;  4KT0 E;  4OB3 B;  3WVE B;  1Q82 C;  2LCS A;  1BCO A;  4JRK A;  3CCR A;  3CCJ Q;  1U8R A;  3V7R A;  3O8V A;  4X9C A;  1WZO A;  1AWO A;  1KQ1 A;  2RQR A;  3P8H A;  4M77 D;  1Q95 G;  2KSS A;  5KYU A;  2QAS A;  2DBM A;  4OB1 B;  3TQ7 P;  3R6N A;  3CCU Q;  4PJM A;  3GP8 A;  3EH2 A;  4GLM A;  4PJO A;  3D7S B;  3CCS Q;  4ZGD B;  2K4Y A;  3TRE A;  2DL7 A;  2K3B A;  1WNL A;  2XK0 A;  4F7U A;  3QHS A;  2OTL Q;  1H3H A;  5CIU A;  5LJ5 j;  5J26 A;  3OMC A;  4M77 G;  2LC4 A;  3OQ5 A;  5GJW B;  2E4H A;  3M59 A;  4CC2 A;  1YNZ A;  3QJ6 A;  4ELY C;  2KRM A;  2EYY A;  2KEA A;  1XQH A;  3H8Z A;  3OYI A;  2BUD A;  3SWN C;  5LJ5 g;  3OYY A;  2RI5 A;  4RUG A;  2V26 A;  5HK3 A;  1ABQ A;  2HQX A;  2P0Q A;  4ZTJ A;  3BFM A;  2DJZ A;  1UJ0 A;  8AT1 B;  1K76 A;  2JS0 A;  2OX7 A;  5FU6 B;  2DEU A;  4J9H A;  5A2Q E;  1NYG A;  4E7L A;  1QWF A;  1M90 C;  2E5K A;  2RF0 A;  3GNF B;  2R5M A;  2RHI A;  2XHC A;  4BY6 C;  3S6W A;  2Z0W A;  4Q5W A;  7AT1 B;  5KCH A;  2KNB B;  2KT1 A;  1CKB A;  1ZQ1 A;  2JTM A;  4OMM A;  2M9U A;  1JO8 A;  5IAY A;  4RTV A;  3RR6 A;  5GAN 3;  3NFC A;  4O5V A;  1WJQ A;  1U5S A;  3EGD A;  1VQ4 T;  1TU0 B;  2PVO B;  4RTZ A;  3O5Z A;  4FSS A;  3G6E Q;  2BTT A;  1JU5 C;  3VS5 A;  2FVU A;  2J6O A;  2J06 A;  3CCE T;  4EIK A;  2YUQ A;  4LD9 K;  4QT7 A;  2LZ6 B;  4IUP A;  4KH1 B;  1ZBJ A;  2ZZD A;  2AT1 B;  5KH6 A;  4X9D A;  4CRI A;  4F7U F;  1YIT A;  1N5Z A;  1PRL C;  1I4K 1;  1UFF A;  3A8G B;  3QSU A;  3DB3 A;  1V29 B;  3OYG A;  4M7A F;  3CC2 T;  3X28 B;  1K9M U;  2E65 A;  1KC8 R;  2JM9 A;  2DVE A;  1KD1 R;  4MDW A;  3HSB A;  1Q82 R;  3JCM e;  2FO0 A;  5IT9 E;  1M90 R;  1QP2 A;  2H8H A;  2A3L A;  2VWF A;  1UGP B;  5FU6 C;  3JCM d;  2EPD A;  2X51 A;  2KYB A;  1TXQ A;  5GJV B;  1AD5 A;  2CP3 A;  2W10 A;  4OMF B;  1VQK A;  3RER A;  1VYT A;  3E9G A;  4RCB A;  2DTO A;  2NYS A;  3HFN A;  5GAN 7;  1VQO T;  1S72 Q;  1BYM A;  4M78 B;  1WGS A;  1QQJ A;  1BI1 A;  3MJX A;  1JRI A;  1KSW A;  2O01 E;  1H92 A;  2DBK A;  2QEX T;  2HCK A;  1PD0 A;  1IO6 A;  3J80 E;  3M0U A;  5LJ3 j;  1D1C A;  2EW3 A;  1GFC A;  3KBG A;  4R56 A;  2KVQ G;  2XD0 A;  3NTI A;  3MO8 A;  4E7K A;  1N8R C;  4OF1 A;  3CBM A;  2G6F X;  3RKW A;  3RKX A;  2ZGW A;  1MUZ A;  4RG2 A;  4AG2 C;  2DXU A;  2MCN A;  2OJ2 A;  1DJ7 B;  3UWN A;  1RAD B;  3C95 A;  1T0H A;  2QTX A;  2LRQ A;  4AFQ C;  4KRT A;  2CH4 W;  3JRZ A;  3HRS A;  4ZN1 A;  1KQS A;  2FL7 A;  4F7U E;  3JCM P;  1S1N A;  2K9G A;  3M57 A;  1KC8 C;  1WXT A;  1M3B A;  1YCS B;  2JOY A;  1SF9 A;  1WIE A;  2HKN A;  2HBW A;  1ACM B;  3OB9 A;  2JVV A;  4JRI A;  3EGX B;  4C8Q G;  2K3Y A;  1WA7 A;  5FU7 C;  1YIT T;  1VQ7 A;  1QKW A;  4OMN A;  2DL8 A;  2KI7 A;  2XKO C;  4LNP A;  2BZY A;  3PFS A;  2ATC B;  4PJN A;  1WX6 A;  1SHF A;  1VQ7 T;  5GAM d;  2HQH A;  3Q1J A;  4ELZ C;  2CKK A;  1PM3 A;  4FIB A;  4GY5 A;  2YRV A;  3I5S A;  3QKJ A;  2O4X B;  4E6R A;  2D0Q B;  1MND A;  3OMG A;  2L3Q A;  2QDL A;  1VQ8 T;  2LX9 A;  4XU1 A;  1ZBX A;  3HHT B;  3QII A;  2W0Z A;  3SHW A;  3QYG B;  4DA4 A;  3HTR A;  1B34 A;  2XMF A;  3JCM X;  2DX1 A;  2E1H A;  4M78 A;  2K7A A;  4CC3 A;  2GF7 A;  5IHI A;  3CCS A;  2MIO A;  5KE2 A;  2GNC A;  2QGF B;  1I5O B;  2YUP A;  2OTL A;  1BIA A;  3OYF A;  2NUZ A;  2XDP A;  3GNG A;  3SWN B;  1FXX A;  4RMO A;  2ECZ A;  1BU1 A;  1QP3 A;  1X6B A;  2PNI A;  2EYX A;  2L3P A;  1AOJ A;  3JB9 H;  2KXD A;  4RTU A;  4J7F A;  1QWE A;  4DBQ A;  4M7D C;  2A36 A;  2FPE A;  1K4U S;  2K5L A;  3CMA Q;  3WXM B;  3GF5 A;  3JB9 J;  1JB0 E;  2E3H A;  1H3Z A;  1ZSZ B;  1GFD A;  5GAO m;  3M9Q A;  3RUX A;  4PJL A;  3JCM b;  4N4G A;  2Y4X A;  3CC4 A;  2YWW A;  3OYA A;  2RJE A;  1YWP A;  5GAO p;  1YHQ Q;  2AKK A;  3V7C A;  4ANJ A;  2QQR A;  2F69 A;  1OQK A;  5I2M A;  3NGP A;  5J39 A;  4PFP A;  3H9N A;  2COW A;  2ZPF B;  3V8K A;  3JAM E;  2CUD A;  4BD3 A;  3L2V A;  1QVG A;  1K8A R;  1PNJ A;  1ABO A;  5IHK A;  5KYW B;  4HCZ A;  2FPF A;  1QCN A;  1C0M A;  1NJI U;  1U1S A;  1D3B A;  4JZ3 A;  2L2P A;  3V8L A;  3E19 A;  3I56 Q;  2FZK B;  2SRC A;  2KR3 A;  2KRS A;  3RKY A;  3RES A;  2GQV A;  2RNA A;  2DZ9 A;  2BIV A;  4A4H A;  3G6E T;  2CRE A;  8ATC B;  4F04 B;  1RI9 A;  2X9H A;  2Y4Y A;  1VQ6 T;  1U3O A;  3JCM h;  1VQ9 Q;  2RHX A;  3PGG A;  1UG1 A;  5IH2 A;  4QVC A;  1IGQ A;  3KFV A;  2SEM A;  3OSS C;  1KIK A;  2EGC A;  1Y96 A;  2C0T A;  3CC2 A;  1SSH A;  2EYW A;  1QVF S;  1QVG S;  2RD1 A;  3X20 B;  2HMA A;  1TUC A;  2EJ9 A;  4FYV B;  3C4S A;  1BK2 A;  1W70 A;  4OP0 A;  2X35 A;  2I2L A;  2HD0 A;  1FMV A;  5HCK A;  3EFS A;  2P4T A;  1AT1 B;  4PKC C;  2OTJ Q;  3LWI A;  1ZUK A;  2DIL A;  2B8A A;  3G7Z A;  3H6Z A;  4HT9 A;  4LUD A;  4UC4 A;  1D09 B;  1OU8 A;  2EVR A;  1PSF A;  4IUU A;  3CCR T;  1VQL Q;  3M55 A;  1C1A A;  4NL2 A;  3ASK A;  1WYX A;  2DET A;  3BW1 A;  2ZPB B;  4A54 A;  4R0K A;  1Y07 A;  3EGD B;  5LJ3 e;  2C0O A;  4AT1 B;  2O88 A;  1RAE B;  4WTO B;  1TWB A;  2DFU A;  4ESR A;  2YRC A;  3CC2 Q;  1OYX A;  3M56 A;  1W2B S;  2CS7 A;  3OS0 A;  1PG5 B;  4XU2 A;  3SWN A;  4FCY A;  1TUG B;  3CCV A;  3EAE A;  3OYN A;  2F1L A;  1XOV A;  1BIB A;  4FSX A;  1JBM A;  3FB9 A;  3GOX A;  4BE1 A;  1NLP C;  2I0N A;  2Y90 A;  3GBQ A;  4M7D A;  3VYG A;  3OY9 A;  2D9T A;  4C92 B;  4C8Q C;  1PD1 A;  2EAY A;  3OW2 P;  1VQO A;  1G5V A;  2ESW A;  2RK1 A;  4QQD A;  4PJO C;  3RMQ A;  5A0G A;  1NG2 A;  2ZPH B;  3FJ5 A;  1YJ9 Q;  1U06 A;  2AZS A;  1RUW A;  4N0A A;  4A4G A;  4Z89 A;  2DAQ A;  2A0F B;  4XAX B;  1M2V A;  4PNO A;  2JT4 A;  4AFS C;  5AYF A;  1O75 A;  1X69 A;  3X26 B;  2DKG A;  3HL8 A;  3AHU A;  4E2F B;  1LJO A;  4E7Z A;  3THK A;  5CKH A;  3SFM A;  2FRY A;  2PZ1 A;  1I0C A;  1M8M A;  2R57 A;  2DD5 A;  1TOV A;  4M77 E;  5LJ5 f;  3A1P A;  2CZ6 B;  3FIF A;  2RB6 A;  2JM8 A;  1S72 T;  4J9B A;  4LXC A;  5GAO n;  1IB8 A;  5C6S A;  2DM1 A;  2CUB A;  2QDY B;  4IIO A;  1I07 A;  1NYF A;  1VYV A;  5GMK h;  1I1J A;  3CME T;  3PVQ A;  1YJN A;  2HBP A;  4M77 B;  1YIJ T;  4J9C A;  5IXF A;  4MZP A;  2NLU A;  3H41 A;  1VQ8 A;  1PCX A;  2KYM A;  4DEY A;  4FYW B;  2E6N A;  1IHV A;  4O6J A;  1KQ2 A;  1FWZ A;  2A37 A;  4JLI A;  4DOW A;  4AG1 C;  1Q81 R;  5EG2 A;  2YT6 A;  3UA7 A;  2DNU A;  2GCX A;  1M5Q 1;  1LCK A;  1NBE B;  1BI3 A;  2PTK A;  3CQT A;  4C92 G;  3OYJ A;  2X3X D;  5DLQ E;  5CAI A;  4M78 E;  4PLI A;  2RO0 A;  1R8O B;  1HYO A;  1SG5 A;  3CBP A;  1N9R A;  2L8D A;  4PJO F;  1WQW A;  1MMD A;  3MHX A;  3EGU A;  2O9S A;  2H3J A;  2GFU A;  2C0I A;  2EYQ A;  1TSF A;  1TTH B;  2HL5 C;  5EC7 A;  4DBF A;  1X6O A;  3HRT A;  1MMA A;  1ZSZ C;  1Q81 C;  1HJD A;  1LNX A;  2XG8 D;  4HVV A;  2MK5 A;  1PHT A;  3EG3 A;  3ER0 A;  5FWC A;  5GAO q;  3N5B B;  1BI0 A;  3MP6 A;  3CME Q;  4JJB A;  2QQA A;  2DYI A;  5GAN e;  2K5I A;  4JRQ A;  1RLQ C;  1VQ5 T;  4JZ4 A;  2LQN A;  2PUK B;  4NS5 A;  3DLL A;  1K8A U;  3OA6 A;  3CPF A;  1AZG B;  2E3I A;  1JEG A;  5LL6 S;  1VQ5 A;  5A0D A;  1M4Z A;  1UJY A;  3VS3 A;  2QEX A;  3CCU A;  1X01 A;  1BI2 A;  3QZ5 B;  1KG1 A;  2EQM A;  1G8X A;  1Y7X A;  1Q86 U;  2AIR B;  1Q7Y U;  4OGC A;  1WHG A;  3EHQ A;  3EG0 A;  1PSE A;  2IVW A;  2IIM A;  2MAM A;  1M2O A;  3CCL A;  3PMT A;  1GRI A;  1VQ9 A;  5I22 A;  2MMP A;  1H8K A;  5GAN 4;  3L42 A;  2LTO A;  1YI2 Q;  1K9M R;  4BI8 B;  4KBM B;  2HSE B;  5DLO A;  1SKU B;  2ZPI B;  2RJD A;  1PC0 A;  4M7A G;  2YLB A;  5D6X A;  1AWJ A;  1SPK A;  1B3Q A;  4AFZ C;  1FX7 A;  3TSW A;  2YDL A;  4J9D A;  1GCQ A;  2DLP A;  1J3T A;  4XTX A;  2E6Z A;  3E1S A;  2B86 A;  5L8R E;  2RQV A;  1G3T A;  2RHZ A;  4XTZ A;  2JTE A;  5KYY A;  4B9W A;  1HSQ A;  2QK0 A;  1K73 R;  2LMJ A;  2ED1 A;  4N0A C;  1UGS B;  3KUF A;  4MMK A;  1WLP B;  5D7U A;  4F7U B;  4RG8 A;  4M7D F;  3GLX A;  1OU9 A;  2QTV A;  4B6M A;  3SB2 A;  2MPX C;  1VQM T;  4E7I A;  2D6F A;  1O9S A;  3SD4 A;  4WCI A;  5CVI A;  3JCM V;  2RN8 A;  4CC7 A;  3JSC A;  3CCL Q;  4LN2 A;  3JB9 D;  4XU3 A;  3VRZ A;  2GBQ A;  1KQS S;  2MYS A;  4D8D A;  5LJ5 h;  1QVF P;  3ULR B;  3RMS A;  1E6G A;  5GAO r;  1R77 A;  4C8Q F;  3G6E A;  4N4I A;  3OYH A;  3S3O A;  1W1F A;  1IZ6 A;  4BDZ A;  3GIB A;  3H0H A;  4JS4 A;  1E6H A;  1UEB A;  2EWN A;  3FJP A;  4M7D D;  3UF4 A;  5FRO A;  1AEY A;  3G71 T;  1Z9Z A;  3QYH B;  4J9E A;  3G71 A;  1W2B A;  1EIF A;  2K5F A;  2M02 A;  1YP5 A;  1YHQ T;  2VXE A;  1W6X A;  3MEA A;  2LDM A;  2VC8 A;  2VV5 A;  3RNJ A;  4F17 A;  2DD4 A;  4FYX B;  3OYM A;  3CC4 T;  4E47 A;  3PMI A;  4EDU A;  3CCE A;  1X2K A;  5FLX E;  2JW4 A;  5GAM j;  3OW2 S;  2RQU A;  5CKD A;  2DK3 A;  3M0T A;  3I9Q A;  2JTF A;  1BBZ A;  2EQU A;  2QQS A;  1QCO A;  1PWT A;  3UT1 A;  4C5H A;  2BE7 D;  2CSQ A;  3A8L B;  5KYY B;  2CZ1 B;  4F16 A;  1C6V X;  5GAO l;  1BKB A;  1S72 A;  2EJG A;  1RL2 A;  3H0F A;  1UB4 A;  1VQM A;  4M7A C;  3FEO A;  1VQ6 Q;  2AHJ B;  4EMK C;  3CC7 T;  4GBQ A;  2JZ2 A;  1GBQ A;  4KUD K;  2AKL A;  4JUV A;  5AT1 B;  3IQL A;  2VYT A;  4HCB A;  2DEQ A;  5D6W A;  3VUZ A;  5GMK j;  3M53 A;  4B9X A;  1Y57 A;  3EGX A;  2X4X A;  4PK4 A;  1YJN Q;  4C0D B;  5GMK i;  4J9I A;  4M78 F;  2LVM A;  1D0Y A;  2M1H A;  3M0P A;  3BDL A;  3CCL T;  1TUD A;  3CCJ T;  2VVK A;  4XTU A;  3OW2 A;  2DL3 A;  3CEY A;  3R6O A;  4M77 A;  2VKN A;  3AT1 B;  4M75 D;  1UHF A;  2EYZ A;  1UUE A;  3X25 B;  2EGA A;  1M90 U;  1VQN A;  2QXF A;  3OS2 A;  3JB9 G;  3TU4 K;  3E9F A;  2RH2 A;  1ZA1 B;  1ZUU A;  4XTY A;  2LQK A;  2ZCF B;  2CP5 A;  5FU7 B;  3OYK A;  2V8K A;  1I8F A;  5C0M A;  5KYN A;  2PVG B;  3LGL A;  4OML A;  1RLP C;  4GLK A;  2F2V A;  3G4S T;  1JXO A;  4XTV A;  2RHU A;  3EG9 B;  4C5I A;  2NWM A;  2CP7 A;  4BDY A;  5IHN A;  4E7J A;  2E64 A;  1FMW A;  3OBY A;  4J6X A;  1VIF A;  2D8J A;  1YJN T;  3VS7 A;  2PUO B;  4JS5 A;  2RPN A;  4C0G A;  2K2M A;  2MI6 A;  1CSK A;  3L2R A;  3VYH B;  1WI7 A;  4OMQ A;  2F2X A;  3CCM A;  3PT9 A;  1IRE B;  2O4X A;  4FYY B;  4XK8 E;  4CC4 B;  2X4Y A;  4FT4 A;  1D1A A;  1YCY A;  1BB9 A;  1N27 A;  2KGT A;  1M8V A;  3EHR A;  4M7A D;  2QQB A;  2K6D A;  2YHT A;  3C12 A;  3GPL A;  4XU0 A;  4BE0 A;  4C0F A;  2CT4 A;  5L23 A;  1T3L A;  4Y92 A;  2DL4 A;  3UDC A;  1YIJ Q;  5GAN 6;  1PRM C;  3CXC P;  3JCM J;  1VQK T;  4EPC A;  1D3B B;  2JN0 A;  4FW2 A;  3PE0 A;  2COZ A;  4IUR A;  2J7I A;  1XNI A;  1NE8 A;  1YFN A;  2DPP B;  1RAB B;  2ZPE B;  1MMN A;  2FZC B;  4C92 F;  2RI2 A;  2OTL T;  2K2V A;  4OB0 B;  2CP6 A;  3M54 A;  2DO3 A;  1QLY A;  3QO3 A;  1X6G A;  3LW5 E;  1OOT A;  1MMG A;  2DER A;  3PNW C;  2P0K A;  2M0Y A;  3NPF A;  4QVZ A;  1M3A A;  3REA B;  2FRW A;  3QWY A;  5LJ3 g;  1CKA A;  1QVP A;  1MHN A;  1TS9 A;  1VQP T;  1OEB A;  1FYN A;  1JJ2 S;  2LCL A;  3NTK A;  3INZ A;  4DQ2 A;  5FRN A;  4MZT A;  4ZNX A;  3I55 Q;  9ATC B;  5LJ3 h;  3CD6 T;  2XI9 A;  4HVU A;  2DVJ A;  1VQ4 Q;  2JJ9 A;  2FPD A;  1D1B A;  3UA6 A;  2VB6 A;  3M4G A;  2XDB A;  3JB9 F;  2DMO A;  4EMK B;  3CPW P;  1IGU A;  3A8M B;  3V7S A;  3HFO A;  1RAH B;  4M75 F;  5CK9 A;  2DIG A;  1YJW T;  1Y0M A;  2EJF A;  5GAM h;  4HT8 A;  3NHN A;  3OBW A;  4M75 C;  1WQ7 A;  4ZGJ B;  3L2U A;  4PFZ A;  2CH4 A;  2QI2 A;  1Y96 B;  4BB7 A;  5GAN 5;  2DYB A;  2OTJ A;  1RAA B;  4C8Q B;  4C92 C;  1K73 C;  4QVD A;  2CSI A;  3TCJ A;  1JJ2 A;  1NLO C;  2IG0 A;  2LCC A;  4KGZ B;  5KYX A;  1QMC A;  4JJC A;  4CI0 C;  4ZN3 A;  1QVG P;  4M75 A;  3OYD A;  2G3R A;  1WXB A;  4QQ6 A;  2E70 A;  2RQT A;  4Z88 A;  2QA4 A; 
#chains in the Genus database with same CATH homology
 3CPF A;  3I56 T;  2QEX T;  4LDY A;  2DZC A;  5LL6 S;  5LJ3 d;  3J80 E;  1VQ5 A;  5CR2 A;  5LJ3 j;  5A0D A;  2L89 A;  1M4Z A;  2V8I A;  1OZ2 A;  3I56 A;  2QEX A;  3KBG A;  3CCU A;  1X01 A;  4R56 A;  2KVQ G;  1B34 B;  1MGQ A;  1BI2 A;  2HQE A;  3QZ5 B;  2EQM A;  3MO8 A;  1NZ9 A;  1Y7X A;  3NTI A;  5I2S A;  5DM7 R;  4E7K A;  1Q86 U;  3ZBD A;  4IUV A;  4M77 F;  1Q7Y U;  4OGC A;  4OF1 A;  1N8R C;  4XQ3 A;  2KMT A;  3CBM A;  1N8R U;  1KHC A;  1PSE A;  2IVW A;  4LDX A;  5CQY A;  5GAN 8;  3QDR B;  2MAM A;  2JNG A;  3RKW A;  3CCL A;  3PMT A;  1VQ9 A;  3RKX A;  2ZGW A;  2MMP A;  4LDW A;  3T9N A;  5GAN 4;  4RG2 A;  3HRU A;  2DXB A;  3L42 A;  5LJ5 g;  2LTO A;  1Q81 U;  2RI3 A;  4BI8 B;  3CPW A;  5CO7 A;  4KBM B;  1H64 1;  1NPR A;  3DKM A;  2DXU A;  4IKF A;  4M75 E;  5DLO A;  4HKE A;  3CCM T;  2ZPI B;  5HY6 A;  2RJD A;  4FU6 A;  1DJ7 B;  4LD6 A;  3UWN A;  3C95 A;  1Q7Y C;  4KUL A;  4M7A G;  5KE3 A;  1P92 A;  2YLB A;  2QTX A;  2LRQ A;  3MP1 A;  5D6X A;  3JCM W;  3JRZ A;  5I21 A;  3OY9 A;  3HRS A;  4ZN1 A;  1KQS A;  2FL7 A;  3M5A A;  3QXE B;  4J6Y A;  4F7U E;  1FX7 A;  4PL6 A;  4OGE A;  3JCM P;  3M57 A;  1KC8 C;  4FT2 A;  2RM4 A;  3QUI A;  1VQ4 A;  3A8H B;  3S3N A;  2F5T X;  5LJ5 e;  1WJS A;  2JOY A;  2X4W A;  3UPU A;  4PJO G;  4XTX A;  2E6Z A;  4IUQ A;  3E1S A;  3L2Z A;  3OB9 A;  4FL6 A;  5L8R E;  2VGN A;  1M1K U;  1G3T A;  2JVV A;  2RHZ A;  3MEW A;  4JRI A;  1YBY A;  4ZGE B;  4Y28 E;  4XTZ A;  1M1K C;  4LDU A;  4B9W A;  1AHJ B;  4YTL A;  1KD1 U;  4M7A E;  1UGQ B;  4C8Q G;  4C5E A;  4M7D E;  2RK2 A;  2K3Y A;  4MDX A;  2RA2 A;  5FU7 C;  4N0A C;  2EQK A;  1UGS B;  2E41 A;  3KUF A;  3DLM A;  4L5G A;  5CKE A;  1N9S A;  4MMK A;  2K57 A;  3PIP A;  1YJW A;  1VQ7 A;  2QQ9 A;  4F7U B;  4RG8 A;  2XKO C;  4M7D F;  3GLX A;  2PQW A;  3M58 A;  3PFS A;  1GXI E;  2YLC A;  1VQ7 T;  5GAM d;  3Q1J A;  3MEV A;  2R58 A;  3SB2 A;  4ELZ C;  2XD0 A;  2CKK A;  4FIB A;  4GY5 A;  3TEE A;  4D6W A;  4EMH A;  2YRV A;  3QKJ A;  2O4X B;  1VQM T;  4E7I A;  2D6F A;  1O9S A;  2D0Q B;  3SD4 A;  3VKI A;  3M4Y A;  3OMG A;  3OS5 A;  5CVI A;  3JCM V;  1VQ8 T;  1NPP A;  3FDR A;  3J7A F;  3JSC A;  2R5A A;  5GAN g;  3JB9 D;  2LX9 A;  4XU1 A;  4XU3 A;  4M77 C;  1ZBX A;  4NL3 A;  5HK0 A;  3HHT B;  1G3Y A;  3QII A;  3CXC A;  1KQS S;  2KAF A;  5LJ5 h;  3LX7 A;  1YI2 A;  2RJF A;  1UGR B;  2PU9 B;  3RMS A;  3VUB A;  5GAM e;  5GAO r;  3QYG B;  1XTD A;  4DA4 A;  1B34 A;  4C8Q F;  3JCM X;  1Q86 C;  3G6E A;  4N4I A;  2E1H A;  4M78 A;  3OYH A;  4C0D C;  3S3O A;  2GF7 A;  1IZ6 A;  3CCS A;  3FC3 A;  5GAN h;  4PJO B;  5CQX A;  4JDS A;  4BDZ A;  1VQ6 A;  4E7H A;  3GIB A;  1KHI A;  3LWH A;  4JS4 A;  5KE2 A;  4J83 A;  1UEB A;  3ME9 A;  2EWN A;  3CMA T;  2MWP A;  3FJP A;  4A53 A;  4DOV A;  4J5Y A;  4M7D D;  2KK4 A;  4EMG A;  2OTL A;  1BIA A;  5FRO A;  3OYF A;  2XDP A;  3G71 T;  5J3B A;  3QYH B;  3GNG A;  3I55 A;  3SWN B;  1FXX A;  1QW1 A;  4RMO A;  2QA4 T;  2WSF E;  1VQN T;  3G71 A;  1W2B A;  1QP3 A;  2PVD B;  1EIF A;  3MEU A;  2K5F A;  4J8O A;  3F70 A;  3JB9 H;  1YIJ A;  2A7Y A;  4J7F A;  4BUG A;  1YHQ T;  4M7D C;  1I5L A;  2VXE A;  3MEA A;  5GMK e;  2K5L A;  2LT1 A;  2CYZ B;  2LDM A;  3WXM B;  2F5K A;  5GAN f;  2M0O A;  2VC8 A;  1K73 U;  2V8J A;  3GF5 A;  2VV5 A;  5GAM f;  3JB9 J;  3QZ9 B;  3OYB A;  1JB0 E;  1H3Z A;  4IUT A;  2DD4 A;  3CXC S;  5GAO m;  3OYM A;  3CC4 T;  1VUB A;  1RI0 A;  3G4S A;  3M9Q A;  1W4S A;  3RUX A;  2DTH A;  1SSF A;  4E47 A;  3PMI A;  3JCM b;  4N4G A;  3VJP A;  4EDU A;  3CCQ T;  3LYI A;  2Y4X A;  3JCM g;  3CCE A;  3CC4 A;  1U1T A;  3OYA A;  1YJ9 A;  2RJE A;  5GAO p;  5FLX E;  5GAM j;  3OW2 S;  3V8J A;  5CKD A;  3V7C A;  2DK3 A;  4C92 D;  2QQR A;  2F69 A;  2JTF A;  5LJ5 d;  1WPY A;  1KC8 U;  2EQU A;  2QQS A;  3QBY A;  5I2M A;  1Q82 U;  3UT1 A;  3DB4 A;  4C5H A;  3A8L B;  5J39 A;  2MWO A;  4HCC A;  2L5Q A;  2ZPF B;  4OB2 B;  3OSV A;  2CZ1 B;  1K9M C;  3V8K A;  5GAO l;  4BD3 A;  3JAM E;  1BKB A;  3L2V A;  3CBO A;  1S72 A;  1QVG A;  2EJG A;  1RL2 A;  1VQM A;  1UB4 A;  3CC7 A;  2L3R A;  4M7A C;  3FEO A;  4Z02 A;  2AHJ B;  4EMK C;  4M7D B;  4HCZ A;  3C94 A;  3QG1 A;  1G3S A;  3CC7 T;  1NJI U;  1U1S A;  1D3B A;  2JZ2 A;  4KUD K;  2HNI A;  4JUV A;  1G3W A;  3V8L A;  1HXD A;  3E19 A;  2FYK A;  2VYT A;  4HCB A;  3PIO A;  4WF2 A;  3RKY A;  3RES A;  2DEQ A;  2GQV A;  5D6W A;  2DZ9 A;  3VUZ A;  5GMK j;  2DXC A;  2BIV A;  3FLG A;  3M53 A;  4A4H A;  4B9X A;  2CZ0 B;  5DY9 A;  3G6E T;  4M7D G;  5GAM g;  1LOJ A;  4ATO A;  4A4K A;  4EMK A;  2X4X A;  2Y4Y A;  1VQ6 T;  2WSE E;  1OI1 A;  5CKB A;  3ZEH A;  5HKC A;  3CMA A;  2DTI A;  3JCM h;  4C0D B;  5GMK i;  2LNV A;  3BY7 A;  4QW2 A;  2RHX A;  3PGG A;  3CCV T;  4MML A;  4C8Q A;  4II1 A;  4M78 F;  3QJY A;  3RIR A;  2LVM A;  5FRM A;  3HPW A;  4QVC A;  4PLL A;  2XID A;  2M1H A;  3OSS C;  3BDL A;  3CCL T;  3CCJ T;  1VIE A;  4XTU A;  2GFA A;  4KUI A;  3OW2 A;  1Y96 A;  2M16 A;  4C0Z A;  3CC2 A;  3CEY A;  3R6O A;  5GMK l;  1QVF S;  1YHQ A;  1QVG S;  2RD1 A;  1VQL T;  3PTA A;  4M77 A;  3X20 B;  4M75 D;  1K8A C;  1N6A A;  3CCS T;  3JCM f;  3X25 B;  4C92 A;  2XU8 A;  2EIF A;  2ZPG B;  3LLR A;  1M90 U;  3WVD B;  4ME7 A;  1VQN A;  4JJN K;  2QXF A;  2EJ9 A;  2K3X A;  2LQ8 A;  3OS2 A;  5KCO A;  3JB9 G;  2EQJ A;  3C4S A;  2VGM A;  3TU4 K;  4RCC A;  3JB9 I;  3E9F A;  2RH2 A;  4OP0 A;  3CCU T;  4JRP A;  4BAC A;  2X35 A;  2I2L A;  2HD0 A;  4XTY A;  2LQK A;  5A0L A;  2ZCF B;  5FU7 B;  4R55 A;  1QVF A;  4L59 A;  3CD6 A;  4M75 G;  3EFS A;  2OAU A;  2P4T A;  4PKC C;  3OYK A;  3VV0 A;  3OS1 A;  4A4F A;  3LWI A;  2RHY A;  4BI4 A;  4Y91 A;  2V8K A;  4FM4 B;  3L2Q A;  1I8F A;  2B8A A;  3G7Z A;  4KT0 E;  4OB3 B;  3WVE B;  2PVG B;  3LGL A;  5C0M A;  4ZTF A;  1Q82 C;  3H6Z A;  4HT9 A;  4GLK A;  3G4S T;  4UC4 A;  4XTV A;  2RHU A;  2KY9 A;  4JRK A;  4P5N A;  4C5I A;  3CCR A;  1U8R A;  4BDY A;  4HA8 A;  3V7R A;  1PSF A;  4E7J A;  2E64 A;  4IUU A;  3OBY A;  3O8V A;  4J6X A;  4X9C A;  5GMK m;  1VIF A;  3I55 T;  1YJN T;  3CCR T;  1KQ1 A;  2PUO B;  4JS5 A;  3M55 A;  4NL2 A;  3ASK A;  3P8H A;  4C0G A;  3BW1 A;  4M77 D;  4M7A A;  2KSS A;  4QQG A;  4M78 C;  2E12 A;  2ZPB B;  2MI6 A;  3HP9 A;  4A54 A;  1Y07 A;  4OB1 B;  3A8O B;  5M9O A;  5LJ3 e;  3L2R A;  3VYH B;  2FB7 A;  2QA4 A;  5GAN 2;  2RJC A;  3GP8 A;  3CCM A;  1VQ9 T;  3MCA B;  5GAN d;  3PT9 A;  3HKS A;  4C8Q E;  4PJO A;  1ZHI A;  1IRE B;  2O4X A;  4XK8 E;  4ZGD B;  4VUB A;  2X4Y A;  2K4Y A;  4FT4 A;  3TRE A;  5CCA A;  2OTJ T;  4BI3 A;  2KQW A;  1OYX A;  3M56 A;  1W2B S;  2CS7 A;  1M9S A;  3OS0 A;  1WNL A;  2XK0 A;  4M78 G;  4F7U A;  1NJI C;  1YCY A;  5D6Y A;  2LT4 A;  4XU2 A;  1N27 A;  3QHS A;  1M8V A;  3SWN A;  4M7A D;  5CIU A;  2QQB A;  4TVR A;  2YHT A;  5J26 A;  5LJ5 j;  3CCV A;  3EAE A;  3C12 A;  3OMC A;  4M77 G;  4XU0 A;  2EFI A;  3OYN A;  3GPL A;  2LC4 A;  3OQ5 A;  4J6W A;  4C0F A;  4BE0 A;  1XOV A;  3MET A;  1BIB A;  4FSX A;  3M59 A;  1JBM A;  1WJR A;  3FB9 A;  5LJ3 f;  3QJ6 A;  3GOX A;  3BDU A;  3UDC A;  2Y90 A;  4C5G A;  4ELY C;  4BE1 A;  2EKO A;  4PJO D;  5GAN 6;  1XQH A;  3H8Z A;  2KDS A;  3OYI A;  4M7D A;  3JCM J;  1VQK T;  2BUD A;  3VYG A;  3X24 B;  4EPC A;  3SWN C;  1D3B B;  2JN0 A;  2RI5 A;  2BKD N;  2D9T A;  3OYY A;  5IN1 A;  2HQX A;  3LGF A;  4C92 B;  4C8Q D;  4C8Q C;  5HK3 A;  2XDD A;  2EAY A;  4IUR A;  1VQO A;  1G5V A;  2RK1 A;  4LDV A;  4QQD A;  2P0Q A;  4PJO C;  3RMQ A;  3BFM A;  4ZTJ A;  1NE8 A;  1XNI A;  2DJZ A;  5A0G A;  2ZPH B;  2VXF A;  2DPP B;  2DXT A;  2JUF A;  1VQL A;  2ZPE B;  5FU6 B;  4C92 F;  2RI2 A;  5A2Q E;  4N0A A;  2OTL T;  1X75 C;  3EFR A;  4A4G A;  2DAQ A;  2CGH A;  2K2V A;  4XAX B;  3OYC A;  4E7L A;  1M90 C;  4PNO A;  4M75 B;  4OB0 B;  5AYF A;  1O75 A;  1TH7 A;  3GNF B;  3M54 A;  3LH0 A;  4RKU E;  2R5M A;  2DKG A;  3X26 B;  2XIC A;  3J81 E;  2RHI A;  2DO3 A;  2XHC A;  3HL8 A;  4BY6 C;  3AHU A;  3QO3 A;  4X34 A;  3S3M A;  3LW5 E;  3S6W A;  4NOY A;  4Q5W A;  5KCH A;  3P8B B;  3PNW C;  1LJO A;  5CKH A;  3SFM A;  3JCM Q;  4A4E A;  1ZQ1 A;  2JTM A;  2M9U A;  2R57 A;  2DD5 A;  4PJO E;  2P0K A;  3JCM c;  4M77 E;  5IAY A;  5LJ5 f;  4MZM A;  2CZ6 B;  3L2W A;  3FIF A;  2CZ7 B;  2RB6 A;  4QVZ A;  5GAN 3;  1S72 T;  3NFC A;  4O5V A;  1WJQ A;  5GAO n;  1VQ4 T;  5C6S A;  1I81 A;  2PVO B;  2P0P A;  3SDZ A;  5LJ3 g;  1QVP A;  1YJ9 T;  3FRN A;  3CME A;  1MHN A;  2QDY B;  2FVU A;  1VQP T;  3MP8 A;  3CCE T;  1JJ2 S;  5GMK h;  3CME T;  2LCL A;  1YJN A;  2HBP A;  3NTK A;  4M77 B;  4LD9 K;  3INZ A;  4DQ2 A;  1VQP A;  1YIJ T;  5FRN A;  4MZT A;  4IUP A;  5LJ3 h;  3CD6 T;  2XI9 A;  3OYE A;  4XTW A;  4MZP A;  2NLU A;  2E10 A;  1HK9 A;  1VQ8 A;  2ZZD A;  3P8D A;  5KH6 A;  1M1G A;  4X9D A;  2VUB A;  4CRI A;  4F7U F;  3M4G A;  1YIT A;  2XDB A;  5GAN j;  4V2S A;  3JB9 F;  1I4K 1;  2E6N A;  3CPW S;  4O6J A;  3A8G B;  1FWZ A;  4EMK B;  1KQ2 A;  3QSU A;  4M7A B;  3KXT A;  2C06 A;  4JLI A;  2E5Q A;  3URG A;  3DB3 A;  4DOW A;  3A8M B;  3V7S A;  3QPH A;  1V29 B;  5EG2 A;  3OYG A;  3CCQ A;  3HFO A;  4M7A F;  4M75 F;  5CK9 A;  2DIQ A;  2DIG A;  2GCX A;  4JLG A;  2FHD A;  1YJW T;  4L6V 5;  1M5Q 1;  2EJF A;  4BY6 B;  3CC2 T;  1BI3 A;  4C92 G;  2MF2 A;  3X28 B;  3VU3 C;  3OYJ A;  1K9M U;  2E65 A;  5DLQ E;  1YIT T;  5CAI A;  4M78 E;  5GAM h;  2DVE A;  4PLI A;  3NTH A;  4HT8 A;  2RO0 A;  4MDW A;  1R8O B;  2X4J A;  3OBW A;  4M75 C;  3A5Z B;  3OYL A;  1KD1 C;  1WQ7 A;  3HSB A;  4ZGJ B;  2HAX A;  3JCM e;  3CBP A;  1N9R A;  3L2U A;  5IT9 E;  2L8D A;  2QI2 A;  1Y96 B;  1QP2 A;  1WQW A;  2A3L A;  3MHX A;  4J7I A;  4M78 D;  4PJO F;  4BB7 A;  5GAN 5;  2H3J A;  1UGP B;  5FU6 C;  2GFU A;  3JCM d;  4BE2 A;  2OTJ A;  2EYQ A;  4C8Q B;  4C92 C;  1KG1 A;  5CKF A;  1K73 C;  4QVD A;  1X6O A;  4C92 E;  3HRT A;  4OMF B;  1VQK A;  1M1F A;  3TCJ A;  4OVA A;  2WAC A;  1JJ2 A;  3RER A;  3ZFJ A;  4F7U G;  1Q81 C;  1LNX A;  2XG8 D;  3E9G A;  4RCB A;  2DTO A;  2IG0 A;  2LCC A;  2WSC E;  3HFN A;  4N4H A;  3CCJ A;  3ER0 A;  5GAN 7;  1YI2 T;  5GAO q;  1OZ3 A;  3N5B B;  1BI0 A;  3MP6 A;  1VQO T;  3L1A A;  2QQA A;  1BYM A;  4CI0 C;  4ZN3 A;  5GAN e;  2K5I A;  4JRQ A;  4M78 B;  1VQ5 T;  4M75 A;  2PUK B;  3OYD A;  2G3R A;  1WGS A;  4NS5 A;  4QQ6 A;  3DLL A;  1Y71 A;  1K8A U;  1BI1 A;  2E70 A;  1JRI A;  3OA6 A;  2O01 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...