4PJOF

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, f, t
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoF00
2VXEA 3V7SA 1LOJA 3QSUA 3HFOA 3FB9A 4M78C 3JB9G 4C92B 4EMKC 4C8QF 4X9DA 4XTUA 4JUVA 3JCMV 5GMKm 5GAN2 4M7DC 3JCMQ 1WPYA 2E41A 5GAMd 3SWNB 1JBMA 3V7CA 4PJOG 4M78F 3V8LA 5LJ3d 2FYKA 1BIAA 2DXTA 1M8VA 4M7DF 3JB9I 3JCMX 4N0AA 4M7AE 4XTZA 1WQ7A 4M77A 3L2ZA 4M75D 5GAN7 4MMLA 4PJOB 4V2SA 3JCMh 2RM4A 3SWNA 3JCMf 3V8JA 3BDUA 3JCMb 4JRIA 4RCBA 3V7RA 4JLIA 4A54A 4C92E 3EFRA 4XTVA 4C8QD 2DZ9A 1JRIA 4EMGA 1I4K1 5I21A 2DTHA 4PJOA 4M77G 2EJGA 3FIFA 3QO3A 1U1TA 3RKXA 4M78D 4M7AC 3RUXA 5GAN5 5GAOn 5GAMh 4J6YA 3HFNA 5GAMf 5GAMj 3JCMJ 4M7DD 1B34A 1WQWA 4JRKA 4NL2A 2E64A 4M75G 5LJ3h 5LJ3f 5LJ3j 4M7AF 4M77B 4J5YA 3INZA 2DTOA 4C92C 3VU3C 3AHUA 4XU3A 3BFMA 1HK9A 4HT9A 3QUIA 2E10A 1YCYA 3JB9H 4C92F 3JCMe 5GAOq 1Y96A 3V8KA 4PNOA 1TH7A 4M78G 5GMKj 5GAOp 5GAN8 3JCMg 3JB9F 4M7DG 2HNIA 2DEQA 4WF2A 1LJOA 5CAIA 1B34B 4M75A 5GMKl 5LJ5f 2DKGA 4M77E 5LJ5j 4HT8A 1H641 1U1SA 4M7AD 5GAMe 4XQ3A 5GAN6 4QVDA 2VC8A 4M7DB 5LJ5d 1D3BA 1I81A 1MGQA 3L1AA 3RKYA 5LJ3e 5GANh 2YHTA 5GANf 5GANj 3RIRA 4C8QA 3JB9J 2EJ9A 5GAMg 2DZCA 4C92D 2RA2A 4PJOE 1Y96B 3RERA 4M78A 5LJ3g 5GANd 4EMKA 4N0AC 5LJ5g 4F7UG 2E1HA 4M7DA 4M77C 1KQ1A 3JB9D 3SB2A 4J6XA 3SWNC 4J6WA 4M75B 3JCMW 4C8QG 4DQ2A 4M7AG 4XTXA 4M77F 5GAOr 4F7UB 2QTXA 4XU0A 3BY7A 5GMKh 1D3BB 5DY9A 1I8FA 5GMKi 2E65A 4PJOC 4XTWA 2RB6A 2CGHA 4M7AB 4C8QB 4EMHA 5LJ5h 4XTYA 3M4GA 4RCCA 4M78B 4PJOF 4EMKB 1N9RA 4F7UA 4XU2A 4NL3A 1HXDA 3RESA 2VXFA 3JCMc 4M75E 3PGGA 2DVEA 5GANg 5GAOm 4M7AA 2EJFA 4OP0A 1N9SA 4NOYA 4F7UE 1KQ2A 2DJZA 4M77D 4MMKA 3BW1A 3EFSA 1M5Q1 1LNXA 4C8QE 2ZGWA 1X01A 2YLCA 4C92A 3HSBA 1WNLA 2I2LA 2DXUA 2K57A 4HA8A 4Y91A 4X9CA 2YLBA 3JCMP 5GMKe 2EWNA 4M78E 1BIBA 3QHSA 3GIBA 4M75C 3RKWA 2EAYA 4A53A 4M7DE 4PJOD 2JN0A 5LJ5e 5GAOl 4QVCA 2RD1A 3JCMd 5GAN4 2Y90A 2DTIA 4XU1A 2FB7A 1I5LA 3FJPA 4M75F 4C92G 4C8QC 4F7UF 5GAN3 5GANe
chains in the Genus database with same CATH superfamily
3EGXA 1LOJA 3FB9A 4PJJA 3JSCA 3PIPA 4EMKC 1Q86U 4X9DA 4XTUA 3EAEA 5CKBA 1JBMA 3V7CA 1VQOA 2DXTA 5KE3A 1M1GA 1YI2A 3CPWA 2NUPB 2LQWA 1VQLT 2K3YA 3L2ZA 4BDZA 2RM4A 3META 3JCMb 3V7RA 4C92E 3CBOA 4E2FB 4OB0B 2DZ9A 2COZA 3EGDB 3RMSA 3FIFA 5CKHA 3MEWA 1YJNQ 4II1A 1GCQC 1D1AA 1VQ8T 1X27A 3PE0A 3VRYA 2CZ0B 3VU3C 4BD3A 2RI5A 1KIKA 1YN8A 1ZSZC 1I1JA 2HL5C 5CK9A 4WCIA 3JCMg 2AZVA 2L5QA 2KYMA 1VQ4T 2LJ0A 5GMKl 1F1BB 4J9CA 4MZTA 4QVDA 2KXCA 3RKYA 1BI2A 1QWEA 2LCCA 5GANh 3OYAA 2F2XA 3JB9J 4BE2A 2MMPA 5AT1B 1ZX6A 4J6WA 3M0RA 2K79A 1OQKA 3MKDA 1M2VB 5KCHA 1PKTA 1I8FA 1RI9A 5D6XA 2CGHA 2BE7D 2QDLA 2BIVA 1KK7A 2XG8D 3G71Q 2X35A 4P5NA 5IH2A 2A36A 2O01E 3PGGA 2QXFA 1K0SA 3X28B 4C0DB 1VQ8A 5D6YA 1G8XA 1YHQT 2M02A 4OMLA 4E47A 1I07A 1M3BA 4M75C 3CCUT 2PUKB 1ARKA 2RD1A 4OB2B 3L2VA 2E3IA 2AT1B 1JJ2P 1PSFA 1P92A 2DL3A 2X4XA 1YJWA 3DLMA 1RAIB 2J6FA 3OYDA 3O5ZA 3C4SA 2RJDA 2KVQG 1G2BA 5LJ3d 2HEQA 1SEMA 2HSPA 4NS5A 4N0AA 3OYIA 2KI7A 1G3YA 2DAQA 1NEGA 5DLOA 1K76A 4BE1A 1NM7A 2V8KA 4HVVA 1W2BS 2A08A 1WXTA 3CCJQ 2E3HA 3NFCA 1D0ZA 5LJ3j 4M7AF 3OSVA 1EFNA 1HD3A 2VWFA 1T3LA 1K8AC 3OQ5A 1QCOA 4QKUA 1ZSGA 3CCUA 3VYHB 1M1KU 2RHZA 5A0LA 1WI7A 5C0MA 3PMTA 1QW1A 2DBKA 3HL8A 3A8GB 2MCNA 3TU4K 2KEAA 4HVUA 2KGTA 1ZUUA 4M77C 4BE0A 1OI1A 3VS1A 2YRCA 2XMFA 2OX7A 3REAB 1PRLC 2WSEE 5IHIA 4OMFB 2I0NA 2RB6A 4XTWA 1G83A 4A4HA 4XTYA 2DD5A 2V8JA 1VQ6Q 2ZCFB 4FL6A 2RQVA 2EYWA 3EG9A 3HPWA 1V29B 1BI0A 4JRPA 3FC3A 1YJNA 1QKXA 2FHDA 2R5AA 1K9MR 1VQNQ 1ABOA 2FZKB 2J06A 3LX7A 2B86A 2Y90A 3REBB 2FB7A 4D6WA 3FJPA 1YCSB 2CUBA 1Q95G 1X2QA 3QSUA 1QQJA 2P0KA 2DL7A 2JM8A 2MK5A 1MUZA 1JO8A 4QW2A 1M8VA 3JCMX 2E12A 2XICA 2HDAA 4E7ZA 3A5ZB 1LCKA 5CQXA 3BDUA 3CBPA 4OF1A 5DLQE 2QI2A 5KYXB 4C8QD 2DBMA 1T3SA 2XIDA 1E7OA 2MF2A 4J6YA 4C0FA 5GAMf 3OW2P 2XK0A 3QZ9B 1WQWA 4GY5A 1JB0E 4C92C 2M9UA 2F69A 3BFMA 4XU3A 1Y0MA 4BY6C 3G71A 3JB9H 3OYGA 2EQUA 1KD1C 4RTTA 1WJQA 4J9FA 4F14A 4Q5WA 3OS5A 1PD1A 1GXIE 4CRIA 3HHTB 2PQWA 3M0SA 2NLUA 1WLPB 2EGAA 1NZ9A 1EIFA 5GANj 4C8QA 1RACB 2YSQA 1KQSS 3OB9A 3VS0A 1NLPC 2JUFA 2EYXA 4IUPA 3CMEQ 4C8QG 2ZPHB 4DQ2A 4ZNXA 5GMKh 2HZYA 5GMKi 2E65A 2F2VA 5FWBA 1SRMA 3PIOA 4AFSC 1MNDA 3CXCA 3R6OA 1EX4A 1N9RA 1NPRA 1UHCA 1AWXA 4PFOA 2PTKA 2H3JA 4NOYA 5GJVB 3TSWA 4ZGJB 4FW1A 3E1SA 3CCJA 2D8JA 2EWNA 4M78E 1FMWA 4E7IA 2ZPFB 1OZ2A 2MPXC 1M1FA 2FPFA 1VQNT 3LW5E 2KROA 3JCMV 5IHNA 5GMKm 4EDUA 2CREA 4LDYA 2FPEA 3CCEQ 4HCKA 4M4ZA 5GAN7 4F16A 1ZBXA 5CKEA 3CCQQ 2CZ7B 2QEXT 1B3QA 5L8RE 3DKMA 1N8RC 1U5SA 1MMDA 3RUXA 2IIMA 2DEUA 3WVDB 2FZGB 1B34A 5C6SA 2SEMA 3BE3A 2HQXA 2RMOA 4O5VA 4EIKA 3LWHA 3GPLA 2LZ6B 2ZPEB 3CC7Q 2QDYB 1VQ6A 4MDXA 2HAXA 2XI9A 2ESWA 1IREB 4M7DG 1LJOA 2X4WA 2OTJQ 3I5SA 2LNHB 1KC8R 1D3BA 5LJ3e 4D8KA 4RUGA 1VQNA 2RQUA 2RA2A 2D1XA 2K2MA 1Q86R 3QWXX 1R77A 4F7UB 4XU0A 3BY7A 3SHWA 3H0IA 4CC4B 3CCLQ 1WHHA 4ZGEB 1YIJQ 4RG2A 3DLLA 3VUZA 4EMKB 4RTZA 1RLQC 2DPPB 3CC4Q 1T0HA 1X75C 2RQTA 2FL7A 4MZPA 1K8AU 4HA8A 4KUDK 3EG3A 3FLGA 1U8RA 3MP6A 2RF0A 2PVOB 4A53A 3RKWA 4J9EA 2YDLA 5GAOl 1PRMC 4XU1A 2MAMA 3UATA 1DJ7B 1U3OA 3QKJA 3V7SA 3OMGA 3MHXA 4JUVA 4N4HA 5D7UA 4JLGA 2LT4A 1MV0B 2YWWA 4PJOG 3VJPA 3JAME 1MHNA 4FYWB 1BIAA 1ZSZB 5I2SA 2FVUA 2JM9A 4XAXB 4RMOA 1OX9A 2EVRA 2ENMA 1WDXA 4O6JA 4L5GA 3CCET 4IUUA 5CKFA 2K3XA 2GBQA 3OYCA 1ZBJA 3CMEA 4WTOB 2KE9A 5FRMA 2W10A 4X1VA 3C95A 4FYYB 1VQLQ 5FROA 4JS5A 1Q81C 2BKDN 1AZGB 4C5HA 1ZUKA 5A0DA 3A8HB 1WJSA 5KYWA 3OW2S 2CP2A 3M9QA 4RG8A 2AHJB 4M7AD 3E9FA 2VC8A 5IXFA 5GAMg 4IKFA 2L2PA 1WYXA 2O2OA 2JS2A 1E6GA 4OMPA 3SB2A 1AD5A 4OGCA 1VQ4Q 4M75B 1UGSB 2CUDA 4IUTA 2E70A 2X51A 3SD4A 3CQTA 3J7AF 3S3MA 2OTLQ 3PVLA 1WHKA 2QYZA 4EMHA 2DM1A 3CD6T 2WSCE 3CCEA 3ASKA 2YUQA 2AZSA 4OMMA 4FT4A 5IN1A 4BUGA 3QDRB 1TTHB 2VXFA 3CCQA 3M56A 4M7AA 4JZ4A 1MMAA 2HBPA 4FSXA 3CCLT 3EFOB 1YIJT 1M90C 1OYXA 1WHLA 1WJRA 2VGMA 2NUZA 1OU8A 4RTVA 2NUTA 1SSHA 2O9VA 1KD1U 3NGPA 1GFCA 1TG0A 4QVCA 5CVIA 4LDXA 3GLXA 3CMAT 2KQWA 5LJ5g 2O4XA 4LD9K 1YHQQ 1VQ9Q 3CC7A 1V76A 4M78C 2NWMA 2RO0A 1M1KR 2EW3A 4BI4A 1IO6A 4Z89A 1IHVA 2H8HA 2FYKA 1G3WA 2OJ2A 2QAZA 4M7DF 3THKA 1GBQA 4AFUC 3QYHB 2A37A 4AG1C 2P0QA 2JTMA 4K11A 5A2QE 4FYXB 1SHFA 2YXYA 1U1TA 2IG0A 3CCVT 4E7LA 2COYA 3OA6A 4YTLA 1K1ZA 4M77B 3CCLA 1YIJA 4KRTA 1OU9A 4UC4A 1MNEA 3URGA 1XJWB 3CC4A 2FG0A 4DBFA 5GAN8 2BZYA 2HQEA 5CO7A 1BYMA 3I5RA 2QA4Q 1WXBA 2K5IA 4HT8A 5L23A 2EKOA 3CPWS 1UE9A 1OOTA 3EH2A 1M2OA 2MOXA 4L59A 3M0QA 1MMNA 2HSEB 4PL6A 2QQBA 3EGUA 2E6ZA 3I56T 1W6XA 4J6XA 4TVRA 2DL8A 3LGLA 1KSWA 1KQSP 2RHIA 2DD4A 3R6NA 4PJOF 1N8RU 1D09B 4PLIA 2OTLT 2ROTA 1N9SA 1J3TA 3QZ5B 1M8MA 4C8QE 2DXBA 2YLCA 3S3OA 2O9SA 1WNLA 3E9GA 4N4IA 4J7FA 3T9NA 1VQLA 1TXQA 1SPKA 3CXCP 5FU7C 2K4YA 1VQ5T 1Q7YC 2MI6A 2MWOA 1ZA1B 1KFZA 5I11A 3ER0A 2A3LA 4C92B 1GCPA 3RBBB 4BY6B 2EFIA 4RTYA 1I0CA 4HXJA 1VQ9T 3CPFA 3JCMh 3WVEB 1VQ7T 4C0ZA 1ZA2B 1K73U 1YFNA 2KK4A 4PJLA 2QGFB 2B8AA 1VQ4A 3M5AA 3RKXA 4ZN3A 3A8MB 3UDCA 2JNGA 4N4GA 1KHIA 4M75G 2OTLA 1M3AA 1TUCA 1HK9A 2ZZDA 3QUIA 1K4US 1N6AA 1SRLA 2FEIA 3L2QA 2BZ8A 4A4EA 2GNCA 3TQ7P 5FU6C 2DEQA 3MP1A 4F04B 4J9GA 1BBZA 5EG2A 2V1RA 1LVKA 1WHGA 3DB3A 2QA4T 1QVPA 3H41A 4N0AC 3GNGA 3KBGA 3E2UA 2HD0A 2QASA 1W2BA 3PFSA 3OYEA 1YHQA 1VQ9A 1NEBA 1IZ6A 1H92A 4R56A 2PNIA 4C5GA 1AWOA 3H9NA 1VQ7A 4Y92A 3FRNA 5CQYA 2DX1A 1VYVA 3VRZA 2D8HA 1NE8A 4QQGA 2I2LA 1WHJA 1TS9A 1Q81U 4LUEA 5GMKe 4DA4A 2NYSA 2EAYA 2JMAA 4AFZC 2JN0A 2K7AA 2NUPA 3EG0A 3GOXA 1X69A 4DBHA 2EPDA 1ABQA 3M57A 4F7UF 1QWFA 2VGNA 2XDBA 5GAN2 3EGDA 2EYZA 2QA4A 1RAHB 3V8LA 3CCRT 4HCCA 2PZ1A 3JB9I 5KYUA 5J39A 3A8OB 2JVVA 4MMLA 3SWNA 3MEAA 4KGXB 4OGEA 2COWA 2A28A 2LJ3A 2QGGA 1SG5A 2D0NA 4BB7A 1D1CA 2ZPIB 4R0KA 1M27C 2A0FB 2C0TA 2AKKA 1UHFA 2M51A 3MP8A 4NL2A 2F1LA 2AIRB 5LJ3f 3VS2A 4ELYC 1M90U 2YRVA 2QEXQ 5HKCA 1YCYA 2F5TX 4JPBW 5GAOq 3I35A 2CP3A 5KYYA 3LH0A 3M0UA 2DERA 5J3BA 5LJ5j 1K8AR 1E6HA 1H641 2JS0A 5GAN6 4FT2A 1M2VA 3VYGA 3VKIA 4IUVA 2EYYA 1SKUB 2Y4YA 2BUDA 1Y96B 3RERA 3VS5A 4IIOA 5GANd 3OYBA 5I2MA 3M0TA 1IHWA 2HKNA 4D8DA 4KGZB 2RK2A 1W4SA 3S6WA 1FYNA 4DEYA 2JXBA 2KDSA 3MCAB 4OMQA 2BTTA 1Y07A 2EJFA 1IB8A 1BKBA 2K5LA 2DXCA 2F5KA 1M5Q1 4CC2A 4HCZA 3QBYA 2P0PA 2V1QA 3JCMd 3F70A 3SFMA 2DILA 1G3SA 4M75F 5KH6A 1VQPQ 4C8QC 2WACA 2FRWA 1QVFA 1OPLA 2CP7A 3JCMQ 4RTXA 1QKWA 1SSFA 3L2WA 2GF7A 3CXCS 2VB6A 4M7AE 2M0OA 3D7SB 2PVDB 2X4YA 1AVZC 1T0JA 3V8JA 4JRIA 4RCBA 3EFRA 4JJBA 4OMOA 1BCOA 3G1JA 2WSFE 3VS6A 2DRMA 1PHTA 4AT1B 2HMAA 1WGSA 4M7DD 2L3QA 4X34A 3AT1B 4J83A 1OULA 2D6FA 4HT9A 3Q1JA 2LJ1A 1WFWA 2CH4W 2DIQA 2HNIA 4KGVB 5HCKA 1PNJA 5HK0A 4MDWA 3H0HA 4KBMB 2RQWA 1XQHA 1Q7YU 1JJ2A 1KD1R 1YITQ 5GANf 3RIRA 1X6GA 3H0FA 1I5OB 3G4ST 3CPWP 4M7DA 1PD0A 4M77F 3QPHA 2L8DA 2P84A 2KBTA 4M7AB 1RAEB 2D0QB 4M78B 3RESA 3KFVA 4PJMA 1UGQB 2Y4XA 4JJNK 4OP0A 1UJYA 1KQ2A 2DJZA 2FO0A 1KJWA 1LNXA 1UJ0A 3CC2Q 2RJEA 1QVGA 3CD6Q 4E7KA 2O4XB 3QG1A 4PJOD 4C5IA 1C6VX 4HKEA 2X9HA 1I5LA 2QEXA 1CSKA 2JTFA 4NL3A 2CS7A 4JJDA 2LCSA 3QXEB 1PG5B 1VQPT 3P8DA 4QQDA 2OAWA 1WQ7A 3CMAQ 4V2SA 1NYFA 1PWTA 3EGXB 4A54A 3G6EQ 4JLIA 1AZEA 1WX6A 2KRMA 2X3WD 4PJOA 2Z0WA 2EJGA 3QO3A 3QYGB 4JRQA 2EKHA 2JMCA 4LE9A 1X6OA 1OEBA 2CZ6B 3INZA 2DTOA 4LUDA 1Q82C 3VUBA 2CP6A 1N8RR 2DNUA 4C92F 1U06A 4J9BA 1VUBA 1TUDA 3JB9F 3CCVQ 1A0NB 5CR2A 2DKGA 2DETA 3LH5A 2DL4A 5FRNA 3MEUA 1FWZA 3L1AA 2CP0A 1VQKT 4QQ6A 4OB1B 2KMTA 2DZCA 2HCKA 1RI0A 1S72Q 1NJIC 5LJ3g 4E6RA 1VQPA 1YITT 2LRQA 2G6FX 2YUNA 3I9QA 2C0OA 1O9SA 2HBWA 3O8VA 4FYVB 4ORZA 2XKOC 5FU7B 3OSSC 4DOWA 2VVKA 3OS0A 1GRIA 4XU2A 3JCMc 3I56Q 2MWPA 4B6MA 1K73R 3RNJA 3HRTA 4ZGDB 2ED0A 3IQLA 2CSQA 2CP5A 1VIFA 3BW1A 5CIUA 4B9XA 1BIBA 2VV5A 2GQIA 1FMVA 4LXCA 2L3PA 2LX9A 3CC2T 4LDUA 3ME9A 2KY9A 5GAN3 1LPLA 2KT1A 5GANe 2YUPA 4HVWA 4DBRA 5M9OA 1K9AA 1WPYA 2E41A 7AT1B 2LQKA 8AT1B 2JZ2A 1M30A 3SDZA 4ESRA 1VQMT 1VQ5Q 1YITA 5FU6B 4LDVA 1Y7XA 3EG1A 1MMGA 3DB4A 1ZHIA 4CC3A 4EMGA 1I4K1 4BDYA 2DTHA 2CDTA 4M7AC 5GAOn 5GAMh 3G6ET 1AHJB 4J7IA 1VQOT 2E64A 3HTRA 1YI2T 3N5BB 4PFZA 1YNZA 1VQ7Q 2EQIA 3E19A 3JCMe 2EQMA 1OPKA 1WXUA 2K6DA 1ACMB 3OBWA 3ZEHA 4PNOA 4M78G 2CZ1B 2GFAA 3NPFA 4BI8B 1GL5A 1YWPA 4WF2A 5CAIA 1VYTA 2LQNA 1HSQA 1Q81R 3CC2A 3CD6A 1QLYA 2L3SA 3PVQA 1VOMA 1RAAB 4FM4B 3OYKA 1RADB 4PFPA 3M53A 4EMKA 3I55Q 4F7UG 1ZLMA 2J7IA 2E1HA 1UB4A 3UPUA 5I22A 2CT4A 1G3TA 2VKNA 1D0YA 4A4FA 1S72T 1RLPC 3CBMA 3OMCA 5IAYA 5LJ5h 3TREA 1R8OB 2VYTA 2KNBB 3OYLA 3CMAA 3CCMQ 1UGRB 2LTOA 1X2KA 5EC7A 2DLPA 5GANg 1UTIA 3G6EA 2L0AA 1GCQA 1H3HA 4FU6A 2J05A 2V26A 3OYFA 3L2RA 2DXUA 2K57A 4X9CA 4DBQA 3RDVA 2DIGA 2DYIA 3NMZC 1ZSZA 2XDDA 3KXTA 1M90R 2L3RA 2DTIA 1Y57A 3MJXA 3QIIA 5CKDA 3QJYA 3EG9B 4PLLA 1AWJA 5KYUB 3M54A 3CCVA 3SWNB 4JDSA 2EYQA 2ZPGB 2DA9A 4M75D 1M4ZA 1S72A 1KG1A 4IIMA 4A4GA 4PJNA 1YJWT 1QVFP 3CCRQ 4J9IA 3M55A 3BDLA 3NHNA 3RMQA 2ROLA 1TUGB 5KYYB 4J5YA 2CSIA 4ATOA 2PVGB 5D6WA 1PKSA 2GTJA 3UWNA 3A98A 2H3EB 3I56A 2R57A 5GAOp 3NTKA 4J8OA 5IXBA 2KT8A 3OS1A 1Z9QA 3X26B 4M75A 2AK5A 3OYNA 5FWCA 1UUEA 1UFFA 3PNWC 4QT7A 2DK3A 2GCXA 2J6OA 1H8KA 2FZCB 2LMJA 3EFOA 4XTXA 4Z02A 2QTXA 3OY9A 2P4TA 2HKQB 1ZUYA 2RK1A 3I55T 4ELZC 1TOVA 3TEEA 3OS2A 2O88A 4C8QB 1BCMA 3C94A 1AEYA 1QP2A 4RCCA 1VQ5A 1AOJA 3LGFA 1K9MC 1WHMA 2BZXA 5GAOm 5FLXE 4XK8E 2K5FA 2KSSA 4M77D 5KYNA 1X01A 3CCMT 1Q82U 1PSEA 4GBQA 2E6NA 3QHSA 4M7DE 4F17A 4AG2C 2C0IA 3ZBDA 6AT1B 3ZL7C 4ZN1A 3KUFA 5GAMd 4IURA 2ED1A 3L42A 4M78F 1YJNT 1TU0B 1QVGP 1NJIU 1Q7YR 2PUOB 4XTZA 4JZ3A 3JV3A 1M3CA 3X24B 4M77A 3CCSQ 1FMKA 3NTIA 4C0GA 3X20B 5CCAA 3CEYA 3I55A 1NG2A 4Y28E 4OVAA 3QJ6A 4M77G 2ATCB 2MYSA 4RTUA 3ULRB 4FCYA 5GAMj 1GFDA 2CKKA 2K2VA 2JOYA 2E4HA 4JS4A 2DL5A 1WZOA 2RQRA 1M9SA 2DE0X 3NTHA 3TSZA 4BI3A 3AHUA 2EQJA 3EG2A 1PCXA 1JU5C 1R0CB 2DRKA 3EHRA 3CCMA 1RUWA 2VASA 2EIFA 4FSSA 1TSFA 2RH2A 2XDPA 1B34B 4VUBA 4XQ3A 4M7DB 3VV0A 5LJ5d 3FEOA 2EJ9A 4ME7A 4C92D 3OYHA 4PJOE 3G71T 2X4JA 4KUIA 3VS7A 1KQ1A 3JB9D 3SWNC 3HKSA 2ZAEA 1RL2A 1ZQ1A 4AMCA 1BB9A 2JW4A 1D3BB 5DY9A 5GJWB 3P8BB 4C5EA 2CYZB 3ZFJA 1XTDA 9ATCB 3G4SQ 3SEMA 1VYUA 4LDWA 2JTEA 3EFSA 2LCLA 4KULA 4C92A 3CCRA 5IT9E 4DOVA 2YRDA 1C1AA 3JCMP 3GIBA 2EGCA 1R0BG 1UECA 2P4RA 3PTAA 1NPPA 1GBRA 2LC4A 2DJQA 1VIEA 3PT9A 2D9TA 4C92G 4QVZA 1W70A 2IVWA 1BU1A 1UGPB 2SRCA 2DYBA 2VXEA 3HFOA 1PM3A 3JB9G 1BI3A 4KT0E 1CKBA 4FIBA 3CCJT 3QWYA 4C0DC 1C0MA 2LX7A 4PJOB 1X43A 2RPNA 1OX8A 2LNVA 3OYYA 2CH4A 3X25B 1CKAA 1KQSA 2R58A 1W1FA 1NYGA 3H8ZA 4J9DA 4DEXA 3CCST 3JCMJ 2F2WA 2KXDA 5A0GA 3HP9A 3H6ZA 2QTVA 2RN8A 1KC8C 2YT6A 1QVFS 3V8KA 1TH7A 4PKCC 2RNAA 1UG1A 2LQ8A 1B7TA 5LJ5f 2EGEA 2LVMA 2CT3A 1IGUA 1RAFB 3L2UA 3C12A 3J81E 1SF9A 1MGQA 1Q86C 2YHTA 3LYIA 4J9HA 3MO8A 1UDLA 3M0PA 1V1CA 3HRSA 2XD0A 5KYWB 4L6V5 2EBPA 1VQ6T 1QP3A 5GAOr 4Z8AA 4IUQA 3OBYA 3GF5A 1VQKQ 2G3RA 1YJ9Q 1XOVA 1S1NA 2RI3A 1D1BA 2JT4A 3A8LB 3LLRA 2QG9B 2E5KA 3P8HA 3CCSA 2DVEA 2RHUA 3WXMB 2BE9B 4F7UE 1H3ZA 4FW2A 3FJ5A 3GP8A 3UT1A 1RABB 5J26A 3HSBA 1JJ2S 1AT1B 4Y91A 1AWWA 5KE2A 2LP5A 3JRZA 1MV3A 2DF6A 5DM7R 5GAN4 1IRXA 4GLMA 2W0ZA 2OI3A 1FX7A 1N5ZA 1G5VA 4OB3B 2QQRA 2LDMA 4M7DC 3U23A 2NUTB 3S3NA 3UF4A 2XHCA 1BI1A 4OMNA 1O75A 3M58A 3JCMf 2YUOA 4A63B 4JJCA 4XTVA 3PMIA 5AYFA 1JRIA 1QVGS 2E5QA 2K9GA 4PK4A 5KYXA 5IHKA 2A7YA 1K9MU 2RJCA 1VQMQ 2DMOA 1HJDA 1SHGA 2FPDA 3G4SA 4LNPA 2RHXA 2PU9B 1Y96A 1B07A 1K73C 2RJFA 2ZPBB 2XU8A 2X3XD 2K3BA 3UA7A 2GGRA 3CMET 1VQOQ 5GAMe 1YI2Q 2DFUA 2DVJA 1I81A 2ECZA 3MEVA 2QQAA 3C0CA 4ZTFA 4EPCA 1JEGA 3UA6A 3GNFB 3M4YA 2R5MA 2L89A 4E7SA 1XNIA 5ECAA 1Z9ZA 4RTWA 3VS4A 2GFUA 4PJOC 2JJ9A 2MIOA 2KAFA 2KRNA 1PC0A 1VA7A 1JQQA 2OAUA 4M75E 3MPUB 1YJ9T 2ABLA 4E7JA 1OZ3A 4KH0B 1IXDA 2ZGWA 1OV3A 3GBQA 1IGQA 1QCFA 4HCBA 1M1KC 5LJ5e 3OYJA 4LD6A 3CCQT 1BK2A 2KR3A 2O31A 4C8QF 3OW2A 4LN2A 4KH1B 1W2BP 3TVTA 5LL6S 3G7ZA 2FRYA 5KCOA 2IPOB 1YP5A 4CC7A 1Y71A 5FW9A 1VQ8Q 8ATCB 3OYMA 1HYOA 3CC7T 1TWBA 2DO3A 5I21A 2RHYA 1N27A 4Z88A 4M78D 4ANJA 5GAN5 2RI2A 3HFNA 1EZZB 4JRKA 5LJ3h 2OTJT 1VQKA 4B9WA 1YJ9A 5HK3A 4RKUE 4GLKA 1X6BA 1UGVA 2E10A 3HRUA 3QDFA 2LT1A 1KHCA 1QMCA 1YWOA 1YJWQ 5GMKj 1FXXA 2C06A 3TCJA 1JXMA 1JXOA 1Q82R 4M77E 2HL3A 1U1SA 2QQSA 3J80E 2M16A 2M0YA 3M59A 1D0XA 2EQKA 2QK0A 4M78A 3RR6A 2GQVA 5HY6A 2VUBA 3CC4T 1QCNA 1NBEB 3JCMW 2GTOA 1YBYA 2J6KA 4M7AG 3FDRA 4ZTJA 3EH1A 1RAGB 1WIEA 1NJIR 2HQHA 1NLOC 3M4GA 4F7UA 2AKLA 1HXDA 1WA7A 4A4KA 2QQ9A 3EHQA 1UEBA 3CCUQ 4MMKA 2OTJA 3VS3A 2KRSA 2KYBA 3LWIA 4R55A 2YLBA 2M1HA 1KC8U 2V8IA 1VQMA 4E7HA 3A1PA 4BACA 4AFQC 1K0XA 4MZMA 4CI0C
chains in the Genus database with same CATH topology
3QKJA 3V7SA 1LOJA 3OMGA 3FB9A 4ZN1A 1QVFA 3JSCA 3PIPA 4EMKC 1Q86U 4X9DA 4XTUA 3MHXA 4JUVA 3KUFA 4N4HA 4JLGA 3EAEA 2LT4A 5CKBA 3JCMQ 4IURA 5GAMd 1JBMA 3V7CA 1SSFA 3L42A 4M78F 4PJOG 1MHNA 3VJPA 3JAME 3L2WA 1BIAA 2DXTA 2GF7A 5I2SA 5KE3A 1M1GA 1NJIU 2FVUA 3CXCS 4XAXB 1YI2A 4RMOA 3CPWA 2PUOB 4XTZA 4M7AE 2M0OA 3X24B 2PVDB 2X4YA 5GAMh 1VQLT 2K3YA 3L2ZA 4M77A 4BDZA 2RM4A 3V8JA 4O6JA 3META 4L5GA 3NTIA 3JCMb 4JRIA 4RCBA 3V7RA 4IUUA 4C0GA 3X20B 4C92E 5CCAA 3EFRA 5CKFA 3CEYA 3I55A 2K3XA 3OYCA 3CBOA 4OB0B 4Y28E 2DZ9A 4OVAA 2WSFE 3RMSA 3QJ6A 4M77G 3FIFA 5CKHA 3MEWA 3CMEA 5FRMA 1WGSA 4II1A 5GAMj 2CKKA 2K2VA 2JOYA 3C95A 4M7DD 4X34A 1VQ8T 4JS4A 4J83A 1M9SA 3NTHA 2CZ0B 5FROA 4JS5A 3VU3C 4BI3A 4BD3A 3AHUA 2RI5A 1Q81C 2D6FA 2EQJA 4HT9A 3Q1JA 2BKDN 4C5HA 5A0DA 3CCMA 5CK9A 2EIFA 3A8HB 1WJSA 2DIQA 3OW2S 3JCMg 2L5QA 2HNIA 2RH2A 2XDPA 1B34B 4MDWA 4VUBA 5HK0A 5GMKl 1VQ4T 3M9QA 4KBMB 4RG8A 2AHJB 4M7AD 4MZTA 4XQ3A 3E9FA 1XQHA 4QVDA 2VC8A 1Q7YU 3VV0A 5LJ5d 3FEOA 3RKYA 1JJ2A 4M7DB 1BI2A 2LCCA 5GANh 5GANf 3RIRA 3OYAA 3JB9J 2EJ9A 4ME7A 5GAMg 4BE2A 4C92D 2MMPA 3OYHA 4PJOE 3G71T 4IKFA 3G4ST 2X4JA 4KUIA 4M7DA 1KQ1A 3JB9D 3SB2A 3SWNC 3HKSA 4OGCA 4J6WA 4M75B 1UGSB 1RL2A 4IUTA 1ZQ1A 4M77F 2E70A 3QPHA 3SD4A 2L8DA 3J7AF 1D3BB 5KCHA 5DY9A 1I8FA 3S3MA 5D6XA 4EMHA 2CGHA 2WSCE 3P8BB 4M7AB 3CCEA 4C5EA 3ASKA 3CD6T 2CYZB 3ZFJA 1XTDA 2BIVA 2D0QB 2XG8D 4FT4A 4M78B 2X35A 4P5NA 5IN1A 4BUGA 3QDRB 3RESA 1UGQB 2VXFA 3CCQA 2O01E 3M56A 2Y4XA 3PGGA 2QXFA 4M7AA 4JJNK 4LDWA 4OP0A 2HBPA 4FSXA 3X28B 2DJZA 3CCLT 1YIJT 1KQ2A 1M90C 4C0DB 1VQ8A 1OYXA 5D6YA 1YHQT 3EFSA 1WJRA 2LCLA 1LNXA 4KULA 2RJEA 4C92A 1VQOA 4E47A 3CCRA 2VGMA 4DOVA 5IT9E 1QVGA 3JCMP 4E7KA 3GIBA 2O4XB 3QG1A 4M75C 3CCUT 2PUKB 1KD1U 4PJOD 4C5IA 3PTAA 4QVCA 1NPPA 2RD1A 2LC4A 4HKEA 4OB2B 5CVIA 4LDXA 3GLXA 1VIEA 3PT9A 3L2VA 2D9TA 4C92G 1I5LA 2KQWA 4QVZA 2QEXA 3CMAT 2IVWA 3CCET 5LJ5g 1UGPB 2O4XA 2JTFA 4NL3A 4LD9K 1PSFA 2CS7A 1P92A 2VXEA 3CC7A 3HFOA 1YJWA 2X4XA 3DLMA 2RO0A 4M78C 3JB9G 3OYDA 3QXEB 3C4SA 2RJDA 2KVQG 4BI4A 1BI3A 1VQPT 4KT0E 3P8DA 2FYKA 4QQDA 1G3WA 4FIBA 5LJ3d 3CCJT 4M7DF 4NS5A 4C0DC 4N0AA 3OYIA 1G3YA 2DAQA 1WQ7A 4PJOB 4V2SA 3QYHB 2LNVA 4A54A 2P0QA 3OYYA 2JTMA 4JLIA 3X25B 5DLOA 4BE1A 1KQSA 2V8KA 5A2QE 2R58A 3H8ZA 4PJOA 1W2BS 2EJGA 3QO3A 1U1TA 2IG0A 3QYGB 3CCST 4JRQA 3CCVT 4E7LA 3OA6A 3JCMJ 3NFCA 1X6OA 5A0GA 4YTLA 2CZ6B 5LJ3j 4M7AF 3HP9A 3OSVA 3H6ZA 3INZA 4M77B 2DTOA 3CCLA 1YIJA 1Q82C 3VUBA 1K8AC 3OQ5A 4UC4A 3URGA 4C92F 1KC8C 3CC4A 1QVFS 3V8KA 1TH7A 4PKCC 1VUBA 5GAN8 2HQEA 5CO7A 3JB9F 1BYMA 2LQ8A 3CCUA 3VYHB 1M1KU 5CR2A 5LJ5f 2K5IA 2DKGA 2LVMA 2RHZA 4HT8A 2EKOA 5A0LA 3CPWS 5FRNA 3L2UA 3C12A 3MEUA 5C0MA 3PMTA 3J81E 1FWZA 1MGQA 3L1AA 1Q86C 4L59A 1QW1A 2YHTA 1VQKT 4QQ6A 4OB1B 3LYIA 3HL8A 2KMTA 3MO8A 2DZCA 3A8GB 3TU4K 1RI0A 4PL6A 1NJIC 5LJ3g 3HRSA 2QQBA 2XD0A 2E6ZA 4L6V5 1VQPA 4M77C 4BE0A 1YITT 2LRQA 3I56T 4J6XA 1OI1A 4TVRA 1QP3A 1VQ6T 3LGLA 5GAOr 1O9SA 3O8VA 4IUQA 5FU7B 2XKOC 3OBYA 3OSSC 3GF5A 2WSEE 4OMFB 2RHIA 2RB6A 4XTWA 2G3RA 4DOWA 4A4HA 1XOVA 2DD4A 3OS0A 2RI3A 4XTYA 4PJOF 3A8LB 3LLRA 4XU2A 1N8RU 2DD5A 3P8HA 2V8JA 4PLIA 3JCMc 2OTLT 3CCSA 2MWPA 2DVEA 2RHUA 3HRTA 3WXMB 2ZCFB 1N9SA 4FL6A 4F7UE 4ZGDB 1H3ZA 3HPWA 1V29B 1BI0A 1VIFA 3QZ5B 3BW1A 3GP8A 5CIUA 4B9XA 4C8QE 3UT1A 2DXBA 2YLCA 4JRPA 5J26A 1WNLA 3E9GA 3FC3A 4N4IA 2FHDA 3S3OA 4Y91A 1YJNA 1JJ2S 2R5AA 5KE2A 4J7FA 1BIBA 2VV5A 3JRZA 3T9NA 5DM7R 1VQLA 2LX9A 3LX7A 5GAN4 2Y90A 5FU7C 3CC2T 2K4YA 2FB7A 1VQ5T 4D6WA 3FJPA 4LDUA 3ME9A 1Q7YC 2MI6A 2KY9A 2MWOA 1FX7A 5GAN3 1G5VA 5GANe 4OB3B 3ER0A 2QQRA 3QSUA 2A3LA 2LDMA 2P0KA 4C92B 5M9OA 4M7DC 1WPYA 2E41A 2EFIA 2LQKA 4BY6B 3S3NA 4QW2A 1M8VA 1VQ9T 2JZ2A 2E12A 2XICA 3SDZA 3JCMX 1VQMT 2XHCA 1YITA 1BI1A 5FU6B 1O75A 3M58A 3A5ZB 4LDVA 1Y7XA 3CPFA 5CQXA 3JCMh 3JCMf 3WVEB 3BDUA 1VQ7T 3CBPA 4OF1A 5DLQE 3DB4A 2QI2A 4C0ZA 1K73U 1ZHIA 4XTVA 3PMIA 2KK4A 5AYFA 4C8QD 1JRIA 4EMGA 1I4K1 2B8AA 4BDYA 2DTHA 1VQ4A 1QVGS 2E5QA 2XIDA 3M5AA 3RKXA 4M7AC 5GAOn 2MF2A 4J6YA 4C0FA 5GAMf 3A8MB 1AHJB 2XK0A 2JNGA 3QZ9B 4J7IA 1WQWA 2A7YA 4N4GA 1KHIA 2E64A 2RJCA 4M75G 1VQOT 1K9MU 4GY5A 2OTLA 1YI2T 1JB0E 4C92C 2M9UA 2F69A 3BFMA 3N5BB 1HK9A 2ZZDA 4XU3A 4BY6C 3QUIA 3G4SA 3G71A 3JB9H 3E19A 2RHXA 3JCMe 2EQMA 2PU9B 3OYGA 1N6AA 1Y96A 2EQUA 3ZEHA 1KD1C 1WJQA 3OBWA 1K73C 2RJFA 4PNOA 4M78G 3L2QA 4A4EA 2ZPBB 2CZ1B 2GFAA 2XU8A 3OS5A 4Q5WA 5FU6C 4BI8B 4CRIA 3HHTB 1GXIE 2PQWA 2DEQA 4WF2A 5CAIA 2NLUA 3CMET 3MP1A 3CC2A 1NZ9A 1EIFA 5EG2A 5GAMe 3CD6A 1I81A 5GANj 4C8QA 3DB3A 2QA4T 4FM4B 1QVPA 2QQAA 3MEVA 3OYKA 4ZTFA 4EPCA 3M53A 4EMKA 4N0AC 1KQSS 3OB9A 4F7UG 2E1HA 1UB4A 3GNGA 3KBGA 3UPUA 3GNFB 3M4YA 1G3TA 2HD0A 2JUFA 2R5MA 2L89A 3PFSA 4IUPA 3OYEA 1YHQA 1W2BA 1VQ9A 4C8QG 1XNIA 2ZPHB 4DQ2A 4A4FA 1S72T 1IZ6A 3G6ET 4R56A 2GFUA 3CBMA 5GMKh 3OMCA 5IAYA 5GMKi 4C5GA 2E65A 4PJOC 1VQ7A 2KAFA 3PIOA 5LJ5h 3TREA 1R8OB 2VYTA 3CXCA 3R6OA 3OYLA 3HSBA 1N9RA 1NPRA 3CMAA 2OAUA 1UGRB 2LTOA 4M75E 3FRNA 5CQYA 2H3JA 5GANg 1YJ9T 3G6EA 4NOYA 4E7JA 4ZGJB 1NE8A 1OZ3A 4FU6A 2ZGWA 4QQGA 3OYFA 2I2LA 3L2RA 2DXUA 2K57A 1Q81U 3E1SA 4X9CA 3CCJA 4HCBA 5GMKe 2EWNA 4M78E 2DIGA 4DA4A 4E7IA 2EAYA 2ZPFB 1M1KC 1OZ2A 2JN0A 5LJ5e 2XDDA 3KXTA 3OYJA 2L3RA 2DTIA 3GOXA 3QIIA 4LD6A 3QJYA 5CKDA 1M1FA 3M57A 4F7UF 3CCQT 4PLLA 1VQNT 3LW5E 2VGNA 4ZN3A 2XDBA 3M54A 4C8QF 3JCMV 5GMKm 5GAN2 3UDCA 3CCVA 3OW2A 3SWNB 4EDUA 2QA4A 4LDYA 3V8LA 3CCRT 4HCCA 4JDSA 5LL6S 3JB9I 2EYQA 3G7ZA 2ZPGB 5J39A 3A8OB 5KCOA 2JVVA 4M75D 5GAN7 4MMLA 3SWNA 1ZBXA 5CKEA 3MEAA 4OGEA 2CZ7B 1M4ZA 1S72A 2QEXT 1KG1A 1Y71A 5L8RE 3DKMA 4A4GA 4BB7A 3OYMA 2ZPIB 3CC7T 2DO3A 5I21A 1YJWT 1N8RC 2RHYA 1N27A 4M78D 3RUXA 5GAN5 3M55A 1YJNT 2RI2A 3HFNA 3BDLA 3MP8A 3WVDB 3RMQA 1B34A 4JRKA 4NL2A 5LJ3h 5LJ3f 5C6SA 2OTJT 4J5YA 1VQKA 4B9WA 4ELYC 1YJ9A 5HK3A 2HQXA 4GLKA 4RKUE 1M90U 2YRVA 4ATOA 2PVGB 4O5VA 2E10A 3HRUA 5D6WA 1YCYA 5HKCA 2LT1A 3LWHA 2F5TX 5GAOq 3GPLA 1KHCA 2ZPEB 3UWNA 3I56A 2QDYB 1VQ6A 2R57A 3LH0A 5GMKj 4MDXA 5GAOp 2HAXA 2XI9A 1FXXA 3NTKA 1IREB 4J8OA 3TCJA 2C06A 4M7DG 3OS1A 1LJOA 3X26B 5J3BA 4M75A 5LJ5j 2X4WA 4M77E 3OYNA 1H641 1U1SA 2QQSA 5GAN6 3PNWC 4FT2A 3VYGA 1D3BA 3VKIA 4IUVA 3J80E 5LJ3e 2Y4YA 2DK3A 2M16A 2GCXA 1VQNA 3M59A 2BUDA 2EQKA 2RA2A 1Y96B 3RERA 4M78A 5GANd 3OYBA 5I2MA 2GQVA 5HY6A 2VUBA 3CC4T 3JCMW 1YBYA 4M7AG 3FDRA 4XTXA 4Z02A 4F7UB 2QTXA 3OY9A 2P4TA 2RK1A 2RK2A 3BY7A 4XU0A 4ZTJA 3I55T 4ELZC 1W4SA 3TEEA 3OS2A 3S6WA 4C8QB 3C94A 4ZGEB 4RG2A 3DLLA 3M4GA 3VUZA 1QP2A 4RCCA 4EMKB 4F7UA 1VQ5A 2KDSA 1HXDA 3LGFA 3MCAB 1K9MC 2DPPB 4A4KA 1Y07A 1X75C 5GAOm 2EJFA 5FLXE 2QQ9A 1BKBA 1UEBA 2K5LA 2K5FA 2DXCA 2KSSA 4XK8E 2FL7A 4M77D 4MMKA 2OTJA 2F5KA 1M5Q1 1X01A 4MZPA 3CCMT 1Q82U 1K8AU 4HA8A 4KUDK 4HCZA 3LWIA 1PSEA 4R55A 2YLBA 2E6NA 2M1HA 3FLGA 1U8RA 3MP6A 3QHSA 1KC8U 2PVOB 3QBYA 2V8IA 3RKWA 4A53A 1VQMA 4M7DE 2P0PA 4E7HA 5GAOl 3JCMd 3F70A 3SFMA 3ZBDA 4XU1A 2MAMA 1G3SA 4M75F 5KH6A 4BACA 4MZMA 1DJ7B 4C8QC 4CI0C 2WACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXE A;  3V7S A;  1LOJ A;  3QSU A;  3HFO A;  3FB9 A;  4M78 C;  3JB9 G;  4C92 B;  4EMK C;  4C8Q F;  4X9D A;  4XTU A;  4JUV A;  3JCM V;  5GMK m;  5GAN 2;  4M7D C;  3JCM Q;  1WPY A;  2E41 A;  5GAM d;  3SWN B;  1JBM A;  3V7C A;  4PJO G;  4M78 F;  3V8L A;  5LJ3 d;  2FYK A;  1BIA A;  2DXT A;  1M8V A;  4M7D F;  3JB9 I;  3JCM X;  4N0A A;  4M7A E;  4XTZ A;  1WQ7 A;  4M77 A;  3L2Z A;  4M75 D;  5GAN 7;  4MML A;  4PJO B;  4V2S A;  3JCM h;  2RM4 A;  3SWN A;  3JCM f;  3V8J A;  3BDU A;  3JCM b;  4JRI A;  4RCB A;  3V7R A;  4JLI A;  4A54 A;  4C92 E;  3EFR A;  4XTV A;  4C8Q D;  2DZ9 A;  1JRI A;  4EMG A;  1I4K 1;  5I21 A;  2DTH A;  4PJO A;  4M77 G;  2EJG A;  3FIF A;  3QO3 A;  1U1T A;  3RKX A;  4M78 D;  4M7A C;  3RUX A;  5GAN 5;  5GAO n;  5GAM h;  4J6Y A;  3HFN A;  5GAM f;  5GAM j;  3JCM J;  4M7D D;  1B34 A;  1WQW A;  4JRK A;  4NL2 A;  2E64 A;  4M75 G;  5LJ3 h;  5LJ3 f;  5LJ3 j;  4M7A F;  4M77 B;  4J5Y A;  3INZ A;  2DTO A;  4C92 C;  3VU3 C;  3AHU A;  4XU3 A;  3BFM A;  1HK9 A;  4HT9 A;  3QUI A;  2E10 A;  1YCY A;  3JB9 H;  4C92 F;  3JCM e;  5GAO q;  1Y96 A;  3V8K A;  4PNO A;  1TH7 A;  4M78 G;  5GMK j;  5GAO p;  5GAN 8;  3JCM g;  3JB9 F;  4M7D G;  2HNI A;  2DEQ A;  4WF2 A;  1LJO A;  5CAI A;  1B34 B;  4M75 A;  5GMK l;  5LJ5 f;  2DKG A;  4M77 E;  5LJ5 j;  4HT8 A;  1H64 1;  1U1S A;  4M7A D;  5GAM e;  4XQ3 A;  5GAN 6;  4QVD A;  2VC8 A;  4M7D B;  5LJ5 d;  1D3B A;  1I81 A;  1MGQ A;  3L1A A;  3RKY A;  5LJ3 e;  5GAN h;  2YHT A;  5GAN f;  5GAN j;  3RIR A;  4C8Q A;  3JB9 J;  2EJ9 A;  5GAM g;  2DZC A;  4C92 D;  2RA2 A;  4PJO E;  1Y96 B;  3RER A;  4M78 A;  5LJ3 g;  5GAN d;  4EMK A;  4N0A C;  5LJ5 g;  4F7U G;  2E1H A;  4M7D A;  4M77 C;  1KQ1 A;  3JB9 D;  3SB2 A;  4J6X A;  3SWN C;  4J6W A;  4M75 B;  3JCM W;  4C8Q G;  4DQ2 A;  4M7A G;  4XTX A;  4M77 F;  5GAO r;  4F7U B;  2QTX A;  4XU0 A;  3BY7 A;  5GMK h;  1D3B B;  5DY9 A;  1I8F A;  5GMK i;  2E65 A;  4PJO C;  4XTW A;  2RB6 A;  2CGH A;  4M7A B;  4C8Q B;  4EMH A;  5LJ5 h;  4XTY A;  3M4G A;  4RCC A;  4M78 B;  4PJO F;  4EMK B;  1N9R A;  4F7U A;  4XU2 A;  4NL3 A;  1HXD A;  3RES A;  2VXF A;  3JCM c;  4M75 E;  3PGG A;  2DVE A;  5GAN g;  5GAO m;  4M7A A;  2EJF A;  4OP0 A;  1N9S A;  4NOY A;  4F7U E;  1KQ2 A;  2DJZ A;  4M77 D;  4MMK A;  3BW1 A;  3EFS A;  1M5Q 1;  1LNX A;  4C8Q E;  2ZGW A;  1X01 A;  2YLC A;  4C92 A;  3HSB A;  1WNL A;  2I2L A;  2DXU A;  2K57 A;  4HA8 A;  4Y91 A;  4X9C A;  2YLB A;  3JCM P;  5GMK e;  2EWN A;  4M78 E;  1BIB A;  3QHS A;  3GIB A;  4M75 C;  3RKW A;  2EAY A;  4A53 A;  4M7D E;  4PJO D;  2JN0 A;  5LJ5 e;  5GAO l;  4QVC A;  2RD1 A;  3JCM d;  5GAN 4;  2Y90 A;  2DTI A;  4XU1 A;  2FB7 A;  1I5L A;  3FJP A;  4M75 F;  4C92 G;  4C8Q C;  4F7U F;  5GAN 3;  5GAN e; 
#chains in the Genus database with same CATH topology
 3EGX A;  1LOJ A;  3FB9 A;  4PJJ A;  3JSC A;  3PIP A;  4EMK C;  1Q86 U;  4X9D A;  4XTU A;  3EAE A;  5CKB A;  1JBM A;  3V7C A;  1VQO A;  2DXT A;  5KE3 A;  1M1G A;  1YI2 A;  3CPW A;  2NUP B;  2LQW A;  1VQL T;  2K3Y A;  3L2Z A;  4BDZ A;  2RM4 A;  3MET A;  3JCM b;  3V7R A;  4C92 E;  3CBO A;  4E2F B;  4OB0 B;  2DZ9 A;  2COZ A;  3EGD B;  3RMS A;  3FIF A;  5CKH A;  3MEW A;  1YJN Q;  4II1 A;  1GCQ C;  1D1A A;  1VQ8 T;  1X27 A;  3PE0 A;  3VRY A;  2CZ0 B;  3VU3 C;  4BD3 A;  2RI5 A;  1KIK A;  1YN8 A;  1ZSZ C;  1I1J A;  2HL5 C;  5CK9 A;  4WCI A;  3JCM g;  2AZV A;  2L5Q A;  2KYM A;  1VQ4 T;  2LJ0 A;  5GMK l;  1F1B B;  4J9C A;  4MZT A;  4QVD A;  2KXC A;  3RKY A;  1BI2 A;  1QWE A;  2LCC A;  5GAN h;  3OYA A;  2F2X A;  3JB9 J;  4BE2 A;  2MMP A;  5AT1 B;  1ZX6 A;  4J6W A;  3M0R A;  2K79 A;  1OQK A;  3MKD A;  1M2V B;  5KCH A;  1PKT A;  1I8F A;  1RI9 A;  5D6X A;  2CGH A;  2BE7 D;  2QDL A;  2BIV A;  1KK7 A;  2XG8 D;  3G71 Q;  2X35 A;  4P5N A;  5IH2 A;  2A36 A;  2O01 E;  3PGG A;  2QXF A;  1K0S A;  3X28 B;  4C0D B;  1VQ8 A;  5D6Y A;  1G8X A;  1YHQ T;  2M02 A;  4OML A;  4E47 A;  1I07 A;  1M3B A;  4M75 C;  3CCU T;  2PUK B;  1ARK A;  2RD1 A;  4OB2 B;  3L2V A;  2E3I A;  2AT1 B;  1JJ2 P;  1PSF A;  1P92 A;  2DL3 A;  2X4X A;  1YJW A;  3DLM A;  1RAI B;  2J6F A;  3OYD A;  3O5Z A;  3C4S A;  2RJD A;  2KVQ G;  1G2B A;  5LJ3 d;  2HEQ A;  1SEM A;  2HSP A;  4NS5 A;  4N0A A;  3OYI A;  2KI7 A;  1G3Y A;  2DAQ A;  1NEG A;  5DLO A;  1K76 A;  4BE1 A;  1NM7 A;  2V8K A;  4HVV A;  1W2B S;  2A08 A;  1WXT A;  3CCJ Q;  2E3H A;  3NFC A;  1D0Z A;  5LJ3 j;  4M7A F;  3OSV A;  1EFN A;  1HD3 A;  2VWF A;  1T3L A;  1K8A C;  3OQ5 A;  1QCO A;  4QKU A;  1ZSG A;  3CCU A;  3VYH B;  1M1K U;  2RHZ A;  5A0L A;  1WI7 A;  5C0M A;  3PMT A;  1QW1 A;  2DBK A;  3HL8 A;  3A8G B;  2MCN A;  3TU4 K;  2KEA A;  4HVU A;  2KGT A;  1ZUU A;  4M77 C;  4BE0 A;  1OI1 A;  3VS1 A;  2YRC A;  2XMF A;  2OX7 A;  3REA B;  1PRL C;  2WSE E;  5IHI A;  4OMF B;  2I0N A;  2RB6 A;  4XTW A;  1G83 A;  4A4H A;  4XTY A;  2DD5 A;  2V8J A;  1VQ6 Q;  2ZCF B;  4FL6 A;  2RQV A;  2EYW A;  3EG9 A;  3HPW A;  1V29 B;  1BI0 A;  4JRP A;  3FC3 A;  1YJN A;  1QKX A;  2FHD A;  2R5A A;  1K9M R;  1VQN Q;  1ABO A;  2FZK B;  2J06 A;  3LX7 A;  2B86 A;  2Y90 A;  3REB B;  2FB7 A;  4D6W A;  3FJP A;  1YCS B;  2CUB A;  1Q95 G;  1X2Q A;  3QSU A;  1QQJ A;  2P0K A;  2DL7 A;  2JM8 A;  2MK5 A;  1MUZ A;  1JO8 A;  4QW2 A;  1M8V A;  3JCM X;  2E12 A;  2XIC A;  2HDA A;  4E7Z A;  3A5Z B;  1LCK A;  5CQX A;  3BDU A;  3CBP A;  4OF1 A;  5DLQ E;  2QI2 A;  5KYX B;  4C8Q D;  2DBM A;  1T3S A;  2XID A;  1E7O A;  2MF2 A;  4J6Y A;  4C0F A;  5GAM f;  3OW2 P;  2XK0 A;  3QZ9 B;  1WQW A;  4GY5 A;  1JB0 E;  4C92 C;  2M9U A;  2F69 A;  3BFM A;  4XU3 A;  1Y0M A;  4BY6 C;  3G71 A;  3JB9 H;  3OYG A;  2EQU A;  1KD1 C;  4RTT A;  1WJQ A;  4J9F A;  4F14 A;  4Q5W A;  3OS5 A;  1PD1 A;  1GXI E;  4CRI A;  3HHT B;  2PQW A;  3M0S A;  2NLU A;  1WLP B;  2EGA A;  1NZ9 A;  1EIF A;  5GAN j;  4C8Q A;  1RAC B;  2YSQ A;  1KQS S;  3OB9 A;  3VS0 A;  1NLP C;  2JUF A;  2EYX A;  4IUP A;  3CME Q;  4C8Q G;  2ZPH B;  4DQ2 A;  4ZNX A;  5GMK h;  2HZY A;  5GMK i;  2E65 A;  2F2V A;  5FWB A;  1SRM A;  3PIO A;  4AFS C;  1MND A;  3CXC A;  3R6O A;  1EX4 A;  1N9R A;  1NPR A;  1UHC A;  1AWX A;  4PFO A;  2PTK A;  2H3J A;  4NOY A;  5GJV B;  3TSW A;  4ZGJ B;  4FW1 A;  3E1S A;  3CCJ A;  2D8J A;  2EWN A;  4M78 E;  1FMW A;  4E7I A;  2ZPF B;  1OZ2 A;  2MPX C;  1M1F A;  2FPF A;  1VQN T;  3LW5 E;  2KRO A;  3JCM V;  5IHN A;  5GMK m;  4EDU A;  2CRE A;  4LDY A;  2FPE A;  3CCE Q;  4HCK A;  4M4Z A;  5GAN 7;  4F16 A;  1ZBX A;  5CKE A;  3CCQ Q;  2CZ7 B;  2QEX T;  1B3Q A;  5L8R E;  3DKM A;  1N8R C;  1U5S A;  1MMD A;  3RUX A;  2IIM A;  2DEU A;  3WVD B;  2FZG B;  1B34 A;  5C6S A;  2SEM A;  3BE3 A;  2HQX A;  2RMO A;  4O5V A;  4EIK A;  3LWH A;  3GPL A;  2LZ6 B;  2ZPE B;  3CC7 Q;  2QDY B;  1VQ6 A;  4MDX A;  2HAX A;  2XI9 A;  2ESW A;  1IRE B;  4M7D G;  1LJO A;  2X4W A;  2OTJ Q;  3I5S A;  2LNH B;  1KC8 R;  1D3B A;  5LJ3 e;  4D8K A;  4RUG A;  1VQN A;  2RQU A;  2RA2 A;  2D1X A;  2K2M A;  1Q86 R;  3QWX X;  1R77 A;  4F7U B;  4XU0 A;  3BY7 A;  3SHW A;  3H0I A;  4CC4 B;  3CCL Q;  1WHH A;  4ZGE B;  1YIJ Q;  4RG2 A;  3DLL A;  3VUZ A;  4EMK B;  4RTZ A;  1RLQ C;  2DPP B;  3CC4 Q;  1T0H A;  1X75 C;  2RQT A;  2FL7 A;  4MZP A;  1K8A U;  4HA8 A;  4KUD K;  3EG3 A;  3FLG A;  1U8R A;  3MP6 A;  2RF0 A;  2PVO B;  4A53 A;  3RKW A;  4J9E A;  2YDL A;  5GAO l;  1PRM C;  4XU1 A;  2MAM A;  3UAT A;  1DJ7 B;  1U3O A;  3QKJ A;  3V7S A;  3OMG A;  3MHX A;  4JUV A;  4N4H A;  5D7U A;  4JLG A;  2LT4 A;  1MV0 B;  2YWW A;  4PJO G;  3VJP A;  3JAM E;  1MHN A;  4FYW B;  1BIA A;  1ZSZ B;  5I2S A;  2FVU A;  2JM9 A;  4XAX B;  4RMO A;  1OX9 A;  2EVR A;  2ENM A;  1WDX A;  4O6J A;  4L5G A;  3CCE T;  4IUU A;  5CKF A;  2K3X A;  2GBQ A;  3OYC A;  1ZBJ A;  3CME A;  4WTO B;  2KE9 A;  5FRM A;  2W10 A;  4X1V A;  3C95 A;  4FYY B;  1VQL Q;  5FRO A;  4JS5 A;  1Q81 C;  2BKD N;  1AZG B;  4C5H A;  1ZUK A;  5A0D A;  3A8H B;  1WJS A;  5KYW A;  3OW2 S;  2CP2 A;  3M9Q A;  4RG8 A;  2AHJ B;  4M7A D;  3E9F A;  2VC8 A;  5IXF A;  5GAM g;  4IKF A;  2L2P A;  1WYX A;  2O2O A;  2JS2 A;  1E6G A;  4OMP A;  3SB2 A;  1AD5 A;  4OGC A;  1VQ4 Q;  4M75 B;  1UGS B;  2CUD A;  4IUT A;  2E70 A;  2X51 A;  3SD4 A;  3CQT A;  3J7A F;  3S3M A;  2OTL Q;  3PVL A;  1WHK A;  2QYZ A;  4EMH A;  2DM1 A;  3CD6 T;  2WSC E;  3CCE A;  3ASK A;  2YUQ A;  2AZS A;  4OMM A;  4FT4 A;  5IN1 A;  4BUG A;  3QDR B;  1TTH B;  2VXF A;  3CCQ A;  3M56 A;  4M7A A;  4JZ4 A;  1MMA A;  2HBP A;  4FSX A;  3CCL T;  3EFO B;  1YIJ T;  1M90 C;  1OYX A;  1WHL A;  1WJR A;  2VGM A;  2NUZ A;  1OU8 A;  4RTV A;  2NUT A;  1SSH A;  2O9V A;  1KD1 U;  3NGP A;  1GFC A;  1TG0 A;  4QVC A;  5CVI A;  4LDX A;  3GLX A;  3CMA T;  2KQW A;  5LJ5 g;  2O4X A;  4LD9 K;  1YHQ Q;  1VQ9 Q;  3CC7 A;  1V76 A;  4M78 C;  2NWM A;  2RO0 A;  1M1K R;  2EW3 A;  4BI4 A;  1IO6 A;  4Z89 A;  1IHV A;  2H8H A;  2FYK A;  1G3W A;  2OJ2 A;  2QAZ A;  4M7D F;  3THK A;  1GBQ A;  4AFU C;  3QYH B;  2A37 A;  4AG1 C;  2P0Q A;  2JTM A;  4K11 A;  5A2Q E;  4FYX B;  1SHF A;  2YXY A;  1U1T A;  2IG0 A;  3CCV T;  4E7L A;  2COY A;  3OA6 A;  4YTL A;  1K1Z A;  4M77 B;  3CCL A;  1YIJ A;  4KRT A;  1OU9 A;  4UC4 A;  1MNE A;  3URG A;  1XJW B;  3CC4 A;  2FG0 A;  4DBF A;  5GAN 8;  2BZY A;  2HQE A;  5CO7 A;  1BYM A;  3I5R A;  2QA4 Q;  1WXB A;  2K5I A;  4HT8 A;  5L23 A;  2EKO A;  3CPW S;  1UE9 A;  1OOT A;  3EH2 A;  1M2O A;  2MOX A;  4L59 A;  3M0Q A;  1MMN A;  2HSE B;  4PL6 A;  2QQB A;  3EGU A;  2E6Z A;  3I56 T;  1W6X A;  4J6X A;  4TVR A;  2DL8 A;  3LGL A;  1KSW A;  1KQS P;  2RHI A;  2DD4 A;  3R6N A;  4PJO F;  1N8R U;  1D09 B;  4PLI A;  2OTL T;  2ROT A;  1N9S A;  1J3T A;  3QZ5 B;  1M8M A;  4C8Q E;  2DXB A;  2YLC A;  3S3O A;  2O9S A;  1WNL A;  3E9G A;  4N4I A;  4J7F A;  3T9N A;  1VQL A;  1TXQ A;  1SPK A;  3CXC P;  5FU7 C;  2K4Y A;  1VQ5 T;  1Q7Y C;  2MI6 A;  2MWO A;  1ZA1 B;  1KFZ A;  5I11 A;  3ER0 A;  2A3L A;  4C92 B;  1GCP A;  3RBB B;  4BY6 B;  2EFI A;  4RTY A;  1I0C A;  4HXJ A;  1VQ9 T;  3CPF A;  3JCM h;  3WVE B;  1VQ7 T;  4C0Z A;  1ZA2 B;  1K73 U;  1YFN A;  2KK4 A;  4PJL A;  2QGF B;  2B8A A;  1VQ4 A;  3M5A A;  3RKX A;  4ZN3 A;  3A8M B;  3UDC A;  2JNG A;  4N4G A;  1KHI A;  4M75 G;  2OTL A;  1M3A A;  1TUC A;  1HK9 A;  2ZZD A;  3QUI A;  1K4U S;  1N6A A;  1SRL A;  2FEI A;  3L2Q A;  2BZ8 A;  4A4E A;  2GNC A;  3TQ7 P;  5FU6 C;  2DEQ A;  3MP1 A;  4F04 B;  4J9G A;  1BBZ A;  5EG2 A;  2V1R A;  1LVK A;  1WHG A;  3DB3 A;  2QA4 T;  1QVP A;  3H41 A;  4N0A C;  3GNG A;  3KBG A;  3E2U A;  2HD0 A;  2QAS A;  1W2B A;  3PFS A;  3OYE A;  1YHQ A;  1VQ9 A;  1NEB A;  1IZ6 A;  1H92 A;  4R56 A;  2PNI A;  4C5G A;  1AWO A;  3H9N A;  1VQ7 A;  4Y92 A;  3FRN A;  5CQY A;  2DX1 A;  1VYV A;  3VRZ A;  2D8H A;  1NE8 A;  4QQG A;  2I2L A;  1WHJ A;  1TS9 A;  1Q81 U;  4LUE A;  5GMK e;  4DA4 A;  2NYS A;  2EAY A;  2JMA A;  4AFZ C;  2JN0 A;  2K7A A;  2NUP A;  3EG0 A;  3GOX A;  1X69 A;  4DBH A;  2EPD A;  1ABQ A;  3M57 A;  4F7U F;  1QWF A;  2VGN A;  2XDB A;  5GAN 2;  3EGD A;  2EYZ A;  2QA4 A;  1RAH B;  3V8L A;  3CCR T;  4HCC A;  2PZ1 A;  3JB9 I;  5KYU A;  5J39 A;  3A8O B;  2JVV A;  4MML A;  3SWN A;  3MEA A;  4KGX B;  4OGE A;  2COW A;  2A28 A;  2LJ3 A;  2QGG A;  1SG5 A;  2D0N A;  4BB7 A;  1D1C A;  2ZPI B;  4R0K A;  1M27 C;  2A0F B;  2C0T A;  2AKK A;  1UHF A;  2M51 A;  3MP8 A;  4NL2 A;  2F1L A;  2AIR B;  5LJ3 f;  3VS2 A;  4ELY C;  1M90 U;  2YRV A;  2QEX Q;  5HKC A;  1YCY A;  2F5T X;  4JPB W;  5GAO q;  3I35 A;  2CP3 A;  5KYY A;  3LH0 A;  3M0U A;  2DER A;  5J3B A;  5LJ5 j;  1K8A R;  1E6H A;  1H64 1;  2JS0 A;  5GAN 6;  4FT2 A;  1M2V A;  3VYG A;  3VKI A;  4IUV A;  2EYY A;  1SKU B;  2Y4Y A;  2BUD A;  1Y96 B;  3RER A;  3VS5 A;  4IIO A;  5GAN d;  3OYB A;  5I2M A;  3M0T A;  1IHW A;  2HKN A;  4D8D A;  4KGZ B;  2RK2 A;  1W4S A;  3S6W A;  1FYN A;  4DEY A;  2JXB A;  2KDS A;  3MCA B;  4OMQ A;  2BTT A;  1Y07 A;  2EJF A;  1IB8 A;  1BKB A;  2K5L A;  2DXC A;  2F5K A;  1M5Q 1;  4CC2 A;  4HCZ A;  3QBY A;  2P0P A;  2V1Q A;  3JCM d;  3F70 A;  3SFM A;  2DIL A;  1G3S A;  4M75 F;  5KH6 A;  1VQP Q;  4C8Q C;  2WAC A;  2FRW A;  1QVF A;  1OPL A;  2CP7 A;  3JCM Q;  4RTX A;  1QKW A;  1SSF A;  3L2W A;  2GF7 A;  3CXC S;  2VB6 A;  4M7A E;  2M0O A;  3D7S B;  2PVD B;  2X4Y A;  1AVZ C;  1T0J A;  3V8J A;  4JRI A;  4RCB A;  3EFR A;  4JJB A;  4OMO A;  1BCO A;  3G1J A;  2WSF E;  3VS6 A;  2DRM A;  1PHT A;  4AT1 B;  2HMA A;  1WGS A;  4M7D D;  2L3Q A;  4X34 A;  3AT1 B;  4J83 A;  1OUL A;  2D6F A;  4HT9 A;  3Q1J A;  2LJ1 A;  1WFW A;  2CH4 W;  2DIQ A;  2HNI A;  4KGV B;  5HCK A;  1PNJ A;  5HK0 A;  4MDW A;  3H0H A;  4KBM B;  2RQW A;  1XQH A;  1Q7Y U;  1JJ2 A;  1KD1 R;  1YIT Q;  5GAN f;  3RIR A;  1X6G A;  3H0F A;  1I5O B;  3G4S T;  3CPW P;  4M7D A;  1PD0 A;  4M77 F;  3QPH A;  2L8D A;  2P84 A;  2KBT A;  4M7A B;  1RAE B;  2D0Q B;  4M78 B;  3RES A;  3KFV A;  4PJM A;  1UGQ B;  2Y4X A;  4JJN K;  4OP0 A;  1UJY A;  1KQ2 A;  2DJZ A;  2FO0 A;  1KJW A;  1LNX A;  1UJ0 A;  3CC2 Q;  2RJE A;  1QVG A;  3CD6 Q;  4E7K A;  2O4X B;  3QG1 A;  4PJO D;  4C5I A;  1C6V X;  4HKE A;  2X9H A;  1I5L A;  2QEX A;  1CSK A;  2JTF A;  4NL3 A;  2CS7 A;  4JJD A;  2LCS A;  3QXE B;  1PG5 B;  1VQP T;  3P8D A;  4QQD A;  2OAW A;  1WQ7 A;  3CMA Q;  4V2S A;  1NYF A;  1PWT A;  3EGX B;  4A54 A;  3G6E Q;  4JLI A;  1AZE A;  1WX6 A;  2KRM A;  2X3W D;  4PJO A;  2Z0W A;  2EJG A;  3QO3 A;  3QYG B;  4JRQ A;  2EKH A;  2JMC A;  4LE9 A;  1X6O A;  1OEB A;  2CZ6 B;  3INZ A;  2DTO A;  4LUD A;  1Q82 C;  3VUB A;  2CP6 A;  1N8R R;  2DNU A;  4C92 F;  1U06 A;  4J9B A;  1VUB A;  1TUD A;  3JB9 F;  3CCV Q;  1A0N B;  5CR2 A;  2DKG A;  2DET A;  3LH5 A;  2DL4 A;  5FRN A;  3MEU A;  1FWZ A;  3L1A A;  2CP0 A;  1VQK T;  4QQ6 A;  4OB1 B;  2KMT A;  2DZC A;  2HCK A;  1RI0 A;  1S72 Q;  1NJI C;  5LJ3 g;  4E6R A;  1VQP A;  1YIT T;  2LRQ A;  2G6F X;  2YUN A;  3I9Q A;  2C0O A;  1O9S A;  2HBW A;  3O8V A;  4FYV B;  4ORZ A;  2XKO C;  5FU7 B;  3OSS C;  4DOW A;  2VVK A;  3OS0 A;  1GRI A;  4XU2 A;  3JCM c;  3I56 Q;  2MWP A;  4B6M A;  1K73 R;  3RNJ A;  3HRT A;  4ZGD B;  2ED0 A;  3IQL A;  2CSQ A;  2CP5 A;  1VIF A;  3BW1 A;  5CIU A;  4B9X A;  1BIB A;  2VV5 A;  2GQI A;  1FMV A;  4LXC A;  2L3P A;  2LX9 A;  3CC2 T;  4LDU A;  3ME9 A;  2KY9 A;  5GAN 3;  1LPL A;  2KT1 A;  5GAN e;  2YUP A;  4HVW A;  4DBR A;  5M9O A;  1K9A A;  1WPY A;  2E41 A;  7AT1 B;  2LQK A;  8AT1 B;  2JZ2 A;  1M30 A;  3SDZ A;  4ESR A;  1VQM T;  1VQ5 Q;  1YIT A;  5FU6 B;  4LDV A;  1Y7X A;  3EG1 A;  1MMG A;  3DB4 A;  1ZHI A;  4CC3 A;  4EMG A;  1I4K 1;  4BDY A;  2DTH A;  2CDT A;  4M7A C;  5GAO n;  5GAM h;  3G6E T;  1AHJ B;  4J7I A;  1VQO T;  2E64 A;  3HTR A;  1YI2 T;  3N5B B;  4PFZ A;  1YNZ A;  1VQ7 Q;  2EQI A;  3E19 A;  3JCM e;  2EQM A;  1OPK A;  1WXU A;  2K6D A;  1ACM B;  3OBW A;  3ZEH A;  4PNO A;  4M78 G;  2CZ1 B;  2GFA A;  3NPF A;  4BI8 B;  1GL5 A;  1YWP A;  4WF2 A;  5CAI A;  1VYT A;  2LQN A;  1HSQ A;  1Q81 R;  3CC2 A;  3CD6 A;  1QLY A;  2L3S A;  3PVQ A;  1VOM A;  1RAA B;  4FM4 B;  3OYK A;  1RAD B;  4PFP A;  3M53 A;  4EMK A;  3I55 Q;  4F7U G;  1ZLM A;  2J7I A;  2E1H A;  1UB4 A;  3UPU A;  5I22 A;  2CT4 A;  1G3T A;  2VKN A;  1D0Y A;  4A4F A;  1S72 T;  1RLP C;  3CBM A;  3OMC A;  5IAY A;  5LJ5 h;  3TRE A;  1R8O B;  2VYT A;  2KNB B;  3OYL A;  3CMA A;  3CCM Q;  1UGR B;  2LTO A;  1X2K A;  5EC7 A;  2DLP A;  5GAN g;  1UTI A;  3G6E A;  2L0A A;  1GCQ A;  1H3H A;  4FU6 A;  2J05 A;  2V26 A;  3OYF A;  3L2R A;  2DXU A;  2K57 A;  4X9C A;  4DBQ A;  3RDV A;  2DIG A;  2DYI A;  3NMZ C;  1ZSZ A;  2XDD A;  3KXT A;  1M90 R;  2L3R A;  2DTI A;  1Y57 A;  3MJX A;  3QII A;  5CKD A;  3QJY A;  3EG9 B;  4PLL A;  1AWJ A;  5KYU B;  3M54 A;  3CCV A;  3SWN B;  4JDS A;  2EYQ A;  2ZPG B;  2DA9 A;  4M75 D;  1M4Z A;  1S72 A;  1KG1 A;  4IIM A;  4A4G A;  4PJN A;  1YJW T;  1QVF P;  3CCR Q;  4J9I A;  3M55 A;  3BDL A;  3NHN A;  3RMQ A;  2ROL A;  1TUG B;  5KYY B;  4J5Y A;  2CSI A;  4ATO A;  2PVG B;  5D6W A;  1PKS A;  2GTJ A;  3UWN A;  3A98 A;  2H3E B;  3I56 A;  2R57 A;  5GAO p;  3NTK A;  4J8O A;  5IXB A;  2KT8 A;  3OS1 A;  1Z9Q A;  3X26 B;  4M75 A;  2AK5 A;  3OYN A;  5FWC A;  1UUE A;  1UFF A;  3PNW C;  4QT7 A;  2DK3 A;  2GCX A;  2J6O A;  1H8K A;  2FZC B;  2LMJ A;  3EFO A;  4XTX A;  4Z02 A;  2QTX A;  3OY9 A;  2P4T A;  2HKQ B;  1ZUY A;  2RK1 A;  3I55 T;  4ELZ C;  1TOV A;  3TEE A;  3OS2 A;  2O88 A;  4C8Q B;  1BCM A;  3C94 A;  1AEY A;  1QP2 A;  4RCC A;  1VQ5 A;  1AOJ A;  3LGF A;  1K9M C;  1WHM A;  2BZX A;  5GAO m;  5FLX E;  4XK8 E;  2K5F A;  2KSS A;  4M77 D;  5KYN A;  1X01 A;  3CCM T;  1Q82 U;  1PSE A;  4GBQ A;  2E6N A;  3QHS A;  4M7D E;  4F17 A;  4AG2 C;  2C0I A;  3ZBD A;  6AT1 B;  3ZL7 C;  4ZN1 A;  3KUF A;  5GAM d;  4IUR A;  2ED1 A;  3L42 A;  4M78 F;  1YJN T;  1TU0 B;  1QVG P;  1NJI U;  1Q7Y R;  2PUO B;  4XTZ A;  4JZ3 A;  3JV3 A;  1M3C A;  3X24 B;  4M77 A;  3CCS Q;  1FMK A;  3NTI A;  4C0G A;  3X20 B;  5CCA A;  3CEY A;  3I55 A;  1NG2 A;  4Y28 E;  4OVA A;  3QJ6 A;  4M77 G;  2ATC B;  2MYS A;  4RTU A;  3ULR B;  4FCY A;  5GAM j;  1GFD A;  2CKK A;  2K2V A;  2JOY A;  2E4H A;  4JS4 A;  2DL5 A;  1WZO A;  2RQR A;  1M9S A;  2DE0 X;  3NTH A;  3TSZ A;  4BI3 A;  3AHU A;  2EQJ A;  3EG2 A;  1PCX A;  1JU5 C;  1R0C B;  2DRK A;  3EHR A;  3CCM A;  1RUW A;  2VAS A;  2EIF A;  4FSS A;  1TSF A;  2RH2 A;  2XDP A;  1B34 B;  4VUB A;  4XQ3 A;  4M7D B;  3VV0 A;  5LJ5 d;  3FEO A;  2EJ9 A;  4ME7 A;  4C92 D;  3OYH A;  4PJO E;  3G71 T;  2X4J A;  4KUI A;  3VS7 A;  1KQ1 A;  3JB9 D;  3SWN C;  3HKS A;  2ZAE A;  1RL2 A;  1ZQ1 A;  4AMC A;  1BB9 A;  2JW4 A;  1D3B B;  5DY9 A;  5GJW B;  3P8B B;  4C5E A;  2CYZ B;  3ZFJ A;  1XTD A;  9ATC B;  3G4S Q;  3SEM A;  1VYU A;  4LDW A;  2JTE A;  3EFS A;  2LCL A;  4KUL A;  4C92 A;  3CCR A;  5IT9 E;  4DOV A;  2YRD A;  1C1A A;  3JCM P;  3GIB A;  2EGC A;  1R0B G;  1UEC A;  2P4R A;  3PTA A;  1NPP A;  1GBR A;  2LC4 A;  2DJQ A;  1VIE A;  3PT9 A;  2D9T A;  4C92 G;  4QVZ A;  1W70 A;  2IVW A;  1BU1 A;  1UGP B;  2SRC A;  2DYB A;  2VXE A;  3HFO A;  1PM3 A;  3JB9 G;  1BI3 A;  4KT0 E;  1CKB A;  4FIB A;  3CCJ T;  3QWY A;  4C0D C;  1C0M A;  2LX7 A;  4PJO B;  1X43 A;  2RPN A;  1OX8 A;  2LNV A;  3OYY A;  2CH4 A;  3X25 B;  1CKA A;  1KQS A;  2R58 A;  1W1F A;  1NYG A;  3H8Z A;  4J9D A;  4DEX A;  3CCS T;  3JCM J;  2F2W A;  2KXD A;  5A0G A;  3HP9 A;  3H6Z A;  2QTV A;  2RN8 A;  1KC8 C;  2YT6 A;  1QVF S;  3V8K A;  1TH7 A;  4PKC C;  2RNA A;  1UG1 A;  2LQ8 A;  1B7T A;  5LJ5 f;  2EGE A;  2LVM A;  2CT3 A;  1IGU A;  1RAF B;  3L2U A;  3C12 A;  3J81 E;  1SF9 A;  1MGQ A;  1Q86 C;  2YHT A;  3LYI A;  4J9H A;  3MO8 A;  1UDL A;  3M0P A;  1V1C A;  3HRS A;  2XD0 A;  5KYW B;  4L6V 5;  2EBP A;  1VQ6 T;  1QP3 A;  5GAO r;  4Z8A A;  4IUQ A;  3OBY A;  3GF5 A;  1VQK Q;  2G3R A;  1YJ9 Q;  1XOV A;  1S1N A;  2RI3 A;  1D1B A;  2JT4 A;  3A8L B;  3LLR A;  2QG9 B;  2E5K A;  3P8H A;  3CCS A;  2DVE A;  2RHU A;  3WXM B;  2BE9 B;  4F7U E;  1H3Z A;  4FW2 A;  3FJ5 A;  3GP8 A;  3UT1 A;  1RAB B;  5J26 A;  3HSB A;  1JJ2 S;  1AT1 B;  4Y91 A;  1AWW A;  5KE2 A;  2LP5 A;  3JRZ A;  1MV3 A;  2DF6 A;  5DM7 R;  5GAN 4;  1IRX A;  4GLM A;  2W0Z A;  2OI3 A;  1FX7 A;  1N5Z A;  1G5V A;  4OB3 B;  2QQR A;  2LDM A;  4M7D C;  3U23 A;  2NUT B;  3S3N A;  3UF4 A;  2XHC A;  1BI1 A;  4OMN A;  1O75 A;  3M58 A;  3JCM f;  2YUO A;  4A63 B;  4JJC A;  4XTV A;  3PMI A;  5AYF A;  1JRI A;  1QVG S;  2E5Q A;  2K9G A;  4PK4 A;  5KYX A;  5IHK A;  2A7Y A;  1K9M U;  2RJC A;  1VQM Q;  2DMO A;  1HJD A;  1SHG A;  2FPD A;  3G4S A;  4LNP A;  2RHX A;  2PU9 B;  1Y96 A;  1B07 A;  1K73 C;  2RJF A;  2ZPB B;  2XU8 A;  2X3X D;  2K3B A;  3UA7 A;  2GGR A;  3CME T;  1VQO Q;  5GAM e;  1YI2 Q;  2DFU A;  2DVJ A;  1I81 A;  2ECZ A;  3MEV A;  2QQA A;  3C0C A;  4ZTF A;  4EPC A;  1JEG A;  3UA6 A;  3GNF B;  3M4Y A;  2R5M A;  2L89 A;  4E7S A;  1XNI A;  5ECA A;  1Z9Z A;  4RTW A;  3VS4 A;  2GFU A;  4PJO C;  2JJ9 A;  2MIO A;  2KAF A;  2KRN A;  1PC0 A;  1VA7 A;  1JQQ A;  2OAU A;  4M75 E;  3MPU B;  1YJ9 T;  2ABL A;  4E7J A;  1OZ3 A;  4KH0 B;  1IXD A;  2ZGW A;  1OV3 A;  3GBQ A;  1IGQ A;  1QCF A;  4HCB A;  1M1K C;  5LJ5 e;  3OYJ A;  4LD6 A;  3CCQ T;  1BK2 A;  2KR3 A;  2O31 A;  4C8Q F;  3OW2 A;  4LN2 A;  4KH1 B;  1W2B P;  3TVT A;  5LL6 S;  3G7Z A;  2FRY A;  5KCO A;  2IPO B;  1YP5 A;  4CC7 A;  1Y71 A;  5FW9 A;  1VQ8 Q;  8ATC B;  3OYM A;  1HYO A;  3CC7 T;  1TWB A;  2DO3 A;  5I21 A;  2RHY A;  1N27 A;  4Z88 A;  4M78 D;  4ANJ A;  5GAN 5;  2RI2 A;  3HFN A;  1EZZ B;  4JRK A;  5LJ3 h;  2OTJ T;  1VQK A;  4B9W A;  1YJ9 A;  5HK3 A;  4RKU E;  4GLK A;  1X6B A;  1UGV A;  2E10 A;  3HRU A;  3QDF A;  2LT1 A;  1KHC A;  1QMC A;  1YWO A;  1YJW Q;  5GMK j;  1FXX A;  2C06 A;  3TCJ A;  1JXM A;  1JXO A;  1Q82 R;  4M77 E;  2HL3 A;  1U1S A;  2QQS A;  3J80 E;  2M16 A;  2M0Y A;  3M59 A;  1D0X A;  2EQK A;  2QK0 A;  4M78 A;  3RR6 A;  2GQV A;  5HY6 A;  2VUB A;  3CC4 T;  1QCN A;  1NBE B;  3JCM W;  2GTO A;  1YBY A;  2J6K A;  4M7A G;  3FDR A;  4ZTJ A;  3EH1 A;  1RAG B;  1WIE A;  1NJI R;  2HQH A;  1NLO C;  3M4G A;  4F7U A;  2AKL A;  1HXD A;  1WA7 A;  4A4K A;  2QQ9 A;  3EHQ A;  1UEB A;  3CCU Q;  4MMK A;  2OTJ A;  3VS3 A;  2KRS A;  2KYB A;  3LWI A;  4R55 A;  2YLB A;  2M1H A;  1KC8 U;  2V8I A;  1VQM A;  4E7H A;  3A1P A;  4BAC A;  4AFQ C;  1K0X A;  4MZM A;  4CI0 C; 
#chains in the Genus database with same CATH homology
 3QKJ A;  3V7S A;  1LOJ A;  3OMG A;  3FB9 A;  4ZN1 A;  1QVF A;  3JSC A;  3PIP A;  4EMK C;  1Q86 U;  4X9D A;  4XTU A;  3MHX A;  4JUV A;  3KUF A;  4N4H A;  4JLG A;  3EAE A;  2LT4 A;  5CKB A;  3JCM Q;  4IUR A;  5GAM d;  1JBM A;  3V7C A;  1SSF A;  3L42 A;  4M78 F;  4PJO G;  1MHN A;  3VJP A;  3JAM E;  3L2W A;  1BIA A;  2DXT A;  2GF7 A;  5I2S A;  5KE3 A;  1M1G A;  1NJI U;  2FVU A;  3CXC S;  4XAX B;  1YI2 A;  4RMO A;  3CPW A;  2PUO B;  4XTZ A;  4M7A E;  2M0O A;  3X24 B;  2PVD B;  2X4Y A;  5GAM h;  1VQL T;  2K3Y A;  3L2Z A;  4M77 A;  4BDZ A;  2RM4 A;  3V8J A;  4O6J A;  3MET A;  4L5G A;  3NTI A;  3JCM b;  4JRI A;  4RCB A;  3V7R A;  4IUU A;  4C0G A;  3X20 B;  4C92 E;  5CCA A;  3EFR A;  5CKF A;  3CEY A;  3I55 A;  2K3X A;  3OYC A;  3CBO A;  4OB0 B;  4Y28 E;  2DZ9 A;  4OVA A;  2WSF E;  3RMS A;  3QJ6 A;  4M77 G;  3FIF A;  5CKH A;  3MEW A;  3CME A;  5FRM A;  1WGS A;  4II1 A;  5GAM j;  2CKK A;  2K2V A;  2JOY A;  3C95 A;  4M7D D;  4X34 A;  1VQ8 T;  4JS4 A;  4J83 A;  1M9S A;  3NTH A;  2CZ0 B;  5FRO A;  4JS5 A;  3VU3 C;  4BI3 A;  4BD3 A;  3AHU A;  2RI5 A;  1Q81 C;  2D6F A;  2EQJ A;  4HT9 A;  3Q1J A;  2BKD N;  4C5H A;  5A0D A;  3CCM A;  5CK9 A;  2EIF A;  3A8H B;  1WJS A;  2DIQ A;  3OW2 S;  3JCM g;  2L5Q A;  2HNI A;  2RH2 A;  2XDP A;  1B34 B;  4MDW A;  4VUB A;  5HK0 A;  5GMK l;  1VQ4 T;  3M9Q A;  4KBM B;  4RG8 A;  2AHJ B;  4M7A D;  4MZT A;  4XQ3 A;  3E9F A;  1XQH A;  4QVD A;  2VC8 A;  1Q7Y U;  3VV0 A;  5LJ5 d;  3FEO A;  3RKY A;  1JJ2 A;  4M7D B;  1BI2 A;  2LCC A;  5GAN h;  5GAN f;  3RIR A;  3OYA A;  3JB9 J;  2EJ9 A;  4ME7 A;  5GAM g;  4BE2 A;  4C92 D;  2MMP A;  3OYH A;  4PJO E;  3G71 T;  4IKF A;  3G4S T;  2X4J A;  4KUI A;  4M7D A;  1KQ1 A;  3JB9 D;  3SB2 A;  3SWN C;  3HKS A;  4OGC A;  4J6W A;  4M75 B;  1UGS B;  1RL2 A;  4IUT A;  1ZQ1 A;  4M77 F;  2E70 A;  3QPH A;  3SD4 A;  2L8D A;  3J7A F;  1D3B B;  5KCH A;  5DY9 A;  1I8F A;  3S3M A;  5D6X A;  4EMH A;  2CGH A;  2WSC E;  3P8B B;  4M7A B;  3CCE A;  4C5E A;  3ASK A;  3CD6 T;  2CYZ B;  3ZFJ A;  1XTD A;  2BIV A;  2D0Q B;  2XG8 D;  4FT4 A;  4M78 B;  2X35 A;  4P5N A;  5IN1 A;  4BUG A;  3QDR B;  3RES A;  1UGQ B;  2VXF A;  3CCQ A;  2O01 E;  3M56 A;  2Y4X A;  3PGG A;  2QXF A;  4M7A A;  4JJN K;  4LDW A;  4OP0 A;  2HBP A;  4FSX A;  3X28 B;  2DJZ A;  3CCL T;  1YIJ T;  1KQ2 A;  1M90 C;  4C0D B;  1VQ8 A;  1OYX A;  5D6Y A;  1YHQ T;  3EFS A;  1WJR A;  2LCL A;  1LNX A;  4KUL A;  2RJE A;  4C92 A;  1VQO A;  4E47 A;  3CCR A;  2VGM A;  4DOV A;  5IT9 E;  1QVG A;  3JCM P;  4E7K A;  3GIB A;  2O4X B;  3QG1 A;  4M75 C;  3CCU T;  2PUK B;  1KD1 U;  4PJO D;  4C5I A;  3PTA A;  4QVC A;  1NPP A;  2RD1 A;  2LC4 A;  4HKE A;  4OB2 B;  5CVI A;  4LDX A;  3GLX A;  1VIE A;  3PT9 A;  3L2V A;  2D9T A;  4C92 G;  1I5L A;  2KQW A;  4QVZ A;  2QEX A;  3CMA T;  2IVW A;  3CCE T;  5LJ5 g;  1UGP B;  2O4X A;  2JTF A;  4NL3 A;  4LD9 K;  1PSF A;  2CS7 A;  1P92 A;  2VXE A;  3CC7 A;  3HFO A;  1YJW A;  2X4X A;  3DLM A;  2RO0 A;  4M78 C;  3JB9 G;  3OYD A;  3QXE B;  3C4S A;  2RJD A;  2KVQ G;  4BI4 A;  1BI3 A;  1VQP T;  4KT0 E;  3P8D A;  2FYK A;  4QQD A;  1G3W A;  4FIB A;  5LJ3 d;  3CCJ T;  4M7D F;  4NS5 A;  4C0D C;  4N0A A;  3OYI A;  1G3Y A;  2DAQ A;  1WQ7 A;  4PJO B;  4V2S A;  3QYH B;  2LNV A;  4A54 A;  2P0Q A;  3OYY A;  2JTM A;  4JLI A;  3X25 B;  5DLO A;  4BE1 A;  1KQS A;  2V8K A;  5A2Q E;  2R58 A;  3H8Z A;  4PJO A;  1W2B S;  2EJG A;  3QO3 A;  1U1T A;  2IG0 A;  3QYG B;  3CCS T;  4JRQ A;  3CCV T;  4E7L A;  3OA6 A;  3JCM J;  3NFC A;  1X6O A;  5A0G A;  4YTL A;  2CZ6 B;  5LJ3 j;  4M7A F;  3HP9 A;  3OSV A;  3H6Z A;  3INZ A;  4M77 B;  2DTO A;  3CCL A;  1YIJ A;  1Q82 C;  3VUB A;  1K8A C;  3OQ5 A;  4UC4 A;  3URG A;  4C92 F;  1KC8 C;  3CC4 A;  1QVF S;  3V8K A;  1TH7 A;  4PKC C;  1VUB A;  5GAN 8;  2HQE A;  5CO7 A;  3JB9 F;  1BYM A;  2LQ8 A;  3CCU A;  3VYH B;  1M1K U;  5CR2 A;  5LJ5 f;  2K5I A;  2DKG A;  2LVM A;  2RHZ A;  4HT8 A;  2EKO A;  5A0L A;  3CPW S;  5FRN A;  3L2U A;  3C12 A;  3MEU A;  5C0M A;  3PMT A;  3J81 E;  1FWZ A;  1MGQ A;  3L1A A;  1Q86 C;  4L59 A;  1QW1 A;  2YHT A;  1VQK T;  4QQ6 A;  4OB1 B;  3LYI A;  3HL8 A;  2KMT A;  3MO8 A;  2DZC A;  3A8G B;  3TU4 K;  1RI0 A;  4PL6 A;  1NJI C;  5LJ3 g;  3HRS A;  2QQB A;  2XD0 A;  2E6Z A;  4L6V 5;  1VQP A;  4M77 C;  4BE0 A;  1YIT T;  2LRQ A;  3I56 T;  4J6X A;  1OI1 A;  4TVR A;  1QP3 A;  1VQ6 T;  3LGL A;  5GAO r;  1O9S A;  3O8V A;  4IUQ A;  5FU7 B;  2XKO C;  3OBY A;  3OSS C;  3GF5 A;  2WSE E;  4OMF B;  2RHI A;  2RB6 A;  4XTW A;  2G3R A;  4DOW A;  4A4H A;  1XOV A;  2DD4 A;  3OS0 A;  2RI3 A;  4XTY A;  4PJO F;  3A8L B;  3LLR A;  4XU2 A;  1N8R U;  2DD5 A;  3P8H A;  2V8J A;  4PLI A;  3JCM c;  2OTL T;  3CCS A;  2MWP A;  2DVE A;  2RHU A;  3HRT A;  3WXM B;  2ZCF B;  1N9S A;  4FL6 A;  4F7U E;  4ZGD B;  1H3Z A;  3HPW A;  1V29 B;  1BI0 A;  1VIF A;  3QZ5 B;  3BW1 A;  3GP8 A;  5CIU A;  4B9X A;  4C8Q E;  3UT1 A;  2DXB A;  2YLC A;  4JRP A;  5J26 A;  1WNL A;  3E9G A;  3FC3 A;  4N4I A;  2FHD A;  3S3O A;  4Y91 A;  1YJN A;  1JJ2 S;  2R5A A;  5KE2 A;  4J7F A;  1BIB A;  2VV5 A;  3JRZ A;  3T9N A;  5DM7 R;  1VQL A;  2LX9 A;  3LX7 A;  5GAN 4;  2Y90 A;  5FU7 C;  3CC2 T;  2K4Y A;  2FB7 A;  1VQ5 T;  4D6W A;  3FJP A;  4LDU A;  3ME9 A;  1Q7Y C;  2MI6 A;  2KY9 A;  2MWO A;  1FX7 A;  5GAN 3;  1G5V A;  5GAN e;  4OB3 B;  3ER0 A;  2QQR A;  3QSU A;  2A3L A;  2LDM A;  2P0K A;  4C92 B;  5M9O A;  4M7D C;  1WPY A;  2E41 A;  2EFI A;  2LQK A;  4BY6 B;  3S3N A;  4QW2 A;  1M8V A;  1VQ9 T;  2JZ2 A;  2E12 A;  2XIC A;  3SDZ A;  3JCM X;  1VQM T;  2XHC A;  1YIT A;  1BI1 A;  5FU6 B;  1O75 A;  3M58 A;  3A5Z B;  4LDV A;  1Y7X A;  3CPF A;  5CQX A;  3JCM h;  3JCM f;  3WVE B;  3BDU A;  1VQ7 T;  3CBP A;  4OF1 A;  5DLQ E;  3DB4 A;  2QI2 A;  4C0Z A;  1K73 U;  1ZHI A;  4XTV A;  3PMI A;  2KK4 A;  5AYF A;  4C8Q D;  1JRI A;  4EMG A;  1I4K 1;  2B8A A;  4BDY A;  2DTH A;  1VQ4 A;  1QVG S;  2E5Q A;  2XID A;  3M5A A;  3RKX A;  4M7A C;  5GAO n;  2MF2 A;  4J6Y A;  4C0F A;  5GAM f;  3A8M B;  1AHJ B;  2XK0 A;  2JNG A;  3QZ9 B;  4J7I A;  1WQW A;  2A7Y A;  4N4G A;  1KHI A;  2E64 A;  2RJC A;  4M75 G;  1VQO T;  1K9M U;  4GY5 A;  2OTL A;  1YI2 T;  1JB0 E;  4C92 C;  2M9U A;  2F69 A;  3BFM A;  3N5B B;  1HK9 A;  2ZZD A;  4XU3 A;  4BY6 C;  3QUI A;  3G4S A;  3G71 A;  3JB9 H;  3E19 A;  2RHX A;  3JCM e;  2EQM A;  2PU9 B;  3OYG A;  1N6A A;  1Y96 A;  2EQU A;  3ZEH A;  1KD1 C;  1WJQ A;  3OBW A;  1K73 C;  2RJF A;  4PNO A;  4M78 G;  3L2Q A;  4A4E A;  2ZPB B;  2CZ1 B;  2GFA A;  2XU8 A;  3OS5 A;  4Q5W A;  5FU6 C;  4BI8 B;  4CRI A;  3HHT B;  1GXI E;  2PQW A;  2DEQ A;  4WF2 A;  5CAI A;  2NLU A;  3CME T;  3MP1 A;  3CC2 A;  1NZ9 A;  1EIF A;  5EG2 A;  5GAM e;  3CD6 A;  1I81 A;  5GAN j;  4C8Q A;  3DB3 A;  2QA4 T;  4FM4 B;  1QVP A;  2QQA A;  3MEV A;  3OYK A;  4ZTF A;  4EPC A;  3M53 A;  4EMK A;  4N0A C;  1KQS S;  3OB9 A;  4F7U G;  2E1H A;  1UB4 A;  3GNG A;  3KBG A;  3UPU A;  3GNF B;  3M4Y A;  1G3T A;  2HD0 A;  2JUF A;  2R5M A;  2L89 A;  3PFS A;  4IUP A;  3OYE A;  1YHQ A;  1W2B A;  1VQ9 A;  4C8Q G;  1XNI A;  2ZPH B;  4DQ2 A;  4A4F A;  1S72 T;  1IZ6 A;  3G6E T;  4R56 A;  2GFU A;  3CBM A;  5GMK h;  3OMC A;  5IAY A;  5GMK i;  4C5G A;  2E65 A;  4PJO C;  1VQ7 A;  2KAF A;  3PIO A;  5LJ5 h;  3TRE A;  1R8O B;  2VYT A;  3CXC A;  3R6O A;  3OYL A;  3HSB A;  1N9R A;  1NPR A;  3CMA A;  2OAU A;  1UGR B;  2LTO A;  4M75 E;  3FRN A;  5CQY A;  2H3J A;  5GAN g;  1YJ9 T;  3G6E A;  4NOY A;  4E7J A;  4ZGJ B;  1NE8 A;  1OZ3 A;  4FU6 A;  2ZGW A;  4QQG A;  3OYF A;  2I2L A;  3L2R A;  2DXU A;  2K57 A;  1Q81 U;  3E1S A;  4X9C A;  3CCJ A;  4HCB A;  5GMK e;  2EWN A;  4M78 E;  2DIG A;  4DA4 A;  4E7I A;  2EAY A;  2ZPF B;  1M1K C;  1OZ2 A;  2JN0 A;  5LJ5 e;  2XDD A;  3KXT A;  3OYJ A;  2L3R A;  2DTI A;  3GOX A;  3QII A;  4LD6 A;  3QJY A;  5CKD A;  1M1F A;  3M57 A;  4F7U F;  3CCQ T;  4PLL A;  1VQN T;  3LW5 E;  2VGN A;  4ZN3 A;  2XDB A;  3M54 A;  4C8Q F;  3JCM V;  5GMK m;  5GAN 2;  3UDC A;  3CCV A;  3OW2 A;  3SWN B;  4EDU A;  2QA4 A;  4LDY A;  3V8L A;  3CCR T;  4HCC A;  4JDS A;  5LL6 S;  3JB9 I;  2EYQ A;  3G7Z A;  2ZPG B;  5J39 A;  3A8O B;  5KCO A;  2JVV A;  4M75 D;  5GAN 7;  4MML A;  3SWN A;  1ZBX A;  5CKE A;  3MEA A;  4OGE A;  2CZ7 B;  1M4Z A;  1S72 A;  2QEX T;  1KG1 A;  1Y71 A;  5L8R E;  3DKM A;  4A4G A;  4BB7 A;  3OYM A;  2ZPI B;  3CC7 T;  2DO3 A;  5I21 A;  1YJW T;  1N8R C;  2RHY A;  1N27 A;  4M78 D;  3RUX A;  5GAN 5;  3M55 A;  1YJN T;  2RI2 A;  3HFN A;  3BDL A;  3MP8 A;  3WVD B;  3RMQ A;  1B34 A;  4JRK A;  4NL2 A;  5LJ3 h;  5LJ3 f;  5C6S A;  2OTJ T;  4J5Y A;  1VQK A;  4B9W A;  4ELY C;  1YJ9 A;  5HK3 A;  2HQX A;  4GLK A;  4RKU E;  1M90 U;  2YRV A;  4ATO A;  2PVG B;  4O5V A;  2E10 A;  3HRU A;  5D6W A;  1YCY A;  5HKC A;  2LT1 A;  3LWH A;  2F5T X;  5GAO q;  3GPL A;  1KHC A;  2ZPE B;  3UWN A;  3I56 A;  2QDY B;  1VQ6 A;  2R57 A;  3LH0 A;  5GMK j;  4MDX A;  5GAO p;  2HAX A;  2XI9 A;  1FXX A;  3NTK A;  1IRE B;  4J8O A;  3TCJ A;  2C06 A;  4M7D G;  3OS1 A;  1LJO A;  3X26 B;  5J3B A;  4M75 A;  5LJ5 j;  2X4W A;  4M77 E;  3OYN A;  1H64 1;  1U1S A;  2QQS A;  5GAN 6;  3PNW C;  4FT2 A;  3VYG A;  1D3B A;  3VKI A;  4IUV A;  3J80 E;  5LJ3 e;  2Y4Y A;  2DK3 A;  2M16 A;  2GCX A;  1VQN A;  3M59 A;  2BUD A;  2EQK A;  2RA2 A;  1Y96 B;  3RER A;  4M78 A;  5GAN d;  3OYB A;  5I2M A;  2GQV A;  5HY6 A;  2VUB A;  3CC4 T;  3JCM W;  1YBY A;  4M7A G;  3FDR A;  4XTX A;  4Z02 A;  4F7U B;  2QTX A;  3OY9 A;  2P4T A;  2RK1 A;  2RK2 A;  3BY7 A;  4XU0 A;  4ZTJ A;  3I55 T;  4ELZ C;  1W4S A;  3TEE A;  3OS2 A;  3S6W A;  4C8Q B;  3C94 A;  4ZGE B;  4RG2 A;  3DLL A;  3M4G A;  3VUZ A;  1QP2 A;  4RCC A;  4EMK B;  4F7U A;  1VQ5 A;  2KDS A;  1HXD A;  3LGF A;  3MCA B;  1K9M C;  2DPP B;  4A4K A;  1Y07 A;  1X75 C;  5GAO m;  2EJF A;  5FLX E;  2QQ9 A;  1BKB A;  1UEB A;  2K5L A;  2K5F A;  2DXC A;  2KSS A;  4XK8 E;  2FL7 A;  4M77 D;  4MMK A;  2OTJ A;  2F5K A;  1M5Q 1;  1X01 A;  4MZP A;  3CCM T;  1Q82 U;  1K8A U;  4HA8 A;  4KUD K;  4HCZ A;  3LWI A;  1PSE A;  4R55 A;  2YLB A;  2E6N A;  2M1H A;  3FLG A;  1U8R A;  3MP6 A;  3QHS A;  1KC8 U;  2PVO B;  3QBY A;  2V8I A;  3RKW A;  4A53 A;  1VQM A;  4M7D E;  2P0P A;  4E7H A;  5GAO l;  3JCM d;  3F70 A;  3SFM A;  3ZBD A;  4XU1 A;  2MAM A;  1G3S A;  4M75 F;  5KH6 A;  4BAC A;  4MZM A;  1DJ7 B;  4C8Q C;  4CI0 C;  2WAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...