4PJOF

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, f, t
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoF00
2Y90A 3BW1A 4XU1A 3RKXA 4M7AB 3JB9H 5GAMe 1BIBA 4M7DD 2RM4A 5GAN5 5GMKj 2YLCA 5LJ5d 4M75B 2E41A 2DTOA 4MMLA 3RIRA 1LOJA 4XTXA 3SB2A 4EMGA 4N0AA 3JCMc 4C8QB 1U1TA 5LJ5j 2QTXA 1I8FA 1MGQA 2DTIA 3RUXA 3V7SA 2EWNA 3JCMb 4EMKA 5GAN8 3GIBA 4MMKA 3RKYA 5LJ3h 4JUVA 3L2ZA 4F7UF 4C8QC 2DEQA 2DJZA 4XTZA 2RA2A 4F7UA 1BIAA 4JLIA 5GANh 1WQ7A 2E65A 2DXTA 1WNLA 4M77B 3EFRA 4RCBA 5LJ3f 5LJ3g 3JB9I 3EFSA 3RERA 5GANg 5LJ5e 5GMKm 5GANf 4M7AF 4M7AA 2HNIA 4N0AC 4M75F 4HT8A 3HFNA 5GAOq 4M75A 4NL3A 5DY9A 5I21A 4C8QF 4EMKC 4XU2A 2ZGWA 4C8QA 4HT9A 4A54A 4M78B 5GMKh 4PJOB 5GAOm 5GAMj 5GAN2 3JCMX 3SWNB 4C92B 4QVCA 5GAMf 2YHTA 4C8QE 3V8LA 1WQWA 5GAN7 3QO3A 3BFMA 3FIFA 2E64A 3INZA 4M77F 4M7AC 4M77A 1JRIA 1WPYA 4M75C 3QUIA 1X01A 2YLBA 5GAOn 4M7DB 2EAYA 4F7UG 3JCMJ 3JB9J 2DZCA 3V8JA 1HK9A 3JCMh 2DXUA 4XTVA 4C8QD 1Y96B 4M7AG 4M78F 4PJOA 2EJ9A 5LJ3d 3RESA 3JCMf 2VXEA 3JCMg 1HXDA 1LJOA 1N9RA 4M75G 4M78A 4C92F 4X9DA 4DQ2A 3QHSA 4JRIA 4F7UE 1H641 4J6WA 4WF2A 3SWNA 4C92A 5GMKi 5LJ5f 3JB9F 4C8QG 4M77C 2FB7A 4M7AE 4NOYA 4M77D 5GAMh 4HA8A 4JRKA 3JCMP 4M75E 3FB9A 2DTHA 5GAN6 2EJGA 4XU3A 1N9SA 4QVDA 2EJFA 5GAMg 3JCMW 4M7DF 1B34A 4M7DA 1KQ1A 4X9CA 3QSUA 3JCMV 4M77G 4OP0A 4M78C 5GAN3 5LJ3e 4J6YA 4PJOC 4M7AD 1Y96A 3SWNC 4C92C 5GANe 1M8VA 1U1SA 1B34B 1M5Q1 4M75D 3VU3C 4C92D 5GMKl 3FJPA 3V7RA 4M77E 4PNOA 2I2LA 4XQ3A 4M78G 5GANd 4PJOG 5LJ5h 4J5YA 2CGHA 4PJOF 5GAOr 4M7DC 4J6XA 4Y91A 4C92G 1TH7A 4EMHA 3JCMd 5GAOl 5LJ5g 5GMKe 4V2SA 3JB9G 1LNXA 1I4K1 5GAOp 2K57A 4M78E 4PJOE 3V7CA 4C92E 5GAN4 2FYKA 4M7DG 1KQ2A 3HSBA 1D3BA 1I81A 4XTWA 3RKWA 2RB6A 5GAMd 2RD1A 1YCYA 1I5LA 3JCMQ 3BY7A 2DZ9A 5LJ3j 1D3BB 4M78D 4M7DE 4A53A 4PJOD 2DKGA 3JCMe 4EMKB 5GANj 3BDUA 4NL2A 4XU0A 3V8KA 1JBMA 4RCCA 3L1AA 2JN0A 2VC8A 3JB9D 3PGGA 3M4GA 3AHUA 5CAIA 4F7UB 2E1HA 3HFOA 2E10A 4XTUA 2DVEA 2VXFA 4XTYA
chains in the Genus database with same CATH superfamily
5FW9A 1JB0E 4J9FA 4M75B 1FWZA 3OYCA 3X26B 2O4XB 1WHMA 4DBFA 4LUEA 4LN2A 2EGCA 5KYUB 1YJ9A 1AT1B 3RKYA 4JUVA 1TU0B 1N27A 2KSSA 1WJSA 2RQRA 2JT4A 1ZQ1A 4N0AC 2SRCA 3CCUQ 2COWA 4GLMA 1PRMC 5I11A 3G6EQ 5DY9A 4FM4B 1RLQC 5IHKA 2X4JA 1BI2A 5HY6A 2QEXQ 1JJ2S 2YHTA 5D7UA 5IN1A 3BFMA 3N5BB 1K9MR 3JCMJ 2K5FA 2HD0A 2MIOA 3OYLA 3A8LB 4XK8E 3V8LA 3JCMf 2VXEA 2J6OA 4J9CA 4M77C 1M1KU 1QMCA 4C5GA 2LCLA 2VV5A 3PIOA 1Q86C 2BTTA 1B07A 1E6HA 3QIIA 3VS0A 1M5Q1 2AT1B 3CBMA 5FLXE 1K0XA 2KT1A 3NTHA 3VS5A 4D8KA 4M78G 4PJOG 3G4SQ 1UUEA 2V8IA 3NHNA 5LJ5g 2E5QA 1UGPB 2EBPA 4FW1A 1N8RU 2Z0WA 1UTIA 1KQ2A 2HQHA 2DMOA 3REBB 1M90U 2CP6A 1WX6A 3EG9A 4FSXA 4EMKB 1ARKA 2AZVA 1YJNQ 3L1AA 3JB9D 3PGGA 2YWWA 3HFOA 1VQLA 2EFIA 3JAME 4XTUA 2DERA 2RHYA 3LH5A 3BW1A 1BIBA 2CP3A 2DJQA 2RM4A 5GMKj 3FEOA 3VKIA 1NYGA 3CCQA 4A4EA 2K4YA 2A0FB 2EQKA 3M57A 1BIAA 2RJDA 3JB9I 2J6FA 4GY5A 5CK9A 5GMKm 2KRSA 4UC4A 2QDYB 1MMNA 4HT8A 3TREA 4NL3A 3CPWP 2CZ6B 4CC2A 5GMKh 5J39A 3L2WA 2J6KA 4C0ZA 3HL8A 2X35A 5GAMj 1OU9A 4QVCA 3MPUB 3CC4T 5KCOA 1Z9ZA 2VASA 1U3OA 2DPPB 3QO3A 3INZA 5CQYA 3ZFJA 4J9IA 4BI3A 4DEXA 3CCST 4M75C 4M7DB 1RACB 5M9OA 4R56A 4K11A 1VQPQ 3A1PA 3KFVA 1BB9A 2VYTA 4E7SA 5I22A 4O5VA 4M78A 3PT9A 5CKEA 1HJDA 4PJOA 3HRTA 2LQ8A 4JRIA 4KGXB 2QXFA 4C8QG 1MUZA 1WXTA 1KD1R 2RHUA 5GAMh 2DTHA 5FRNA 4X9CA 3QSUA 3QJYA 8AT1B 3CC2T 1VQ5T 2FEIA 1K9AA 2NUTB 3E9GA 3OW2A 2PQWA 2VKNA 2NUPA 4J7FA 5GAOl 3H0HA 1I07A 1RAGB 2QI2A 2XDPA 3BE3A 4ZNXA 1G2BA 2KBTA 2M1HA 2EKHA 4BDZA 3MP8A 3MHXA 1BYMA 2DKGA 3S3OA 2HZYA 4XU0A 2QTVA 2BE9B 2JN0A 5HCKA 3JV3A 4ZN1A 2YRVA 4IUPA 4PFPA 3CMEA 2RJEA 3I55A 4Z88A 3OYBA 1MMAA 4RTWA 3RUXA 2EWNA 4MMKA 2DAQA 3SEMA 4HCCA 4HXJA 2DEQA 5LJ3g 2QG9B 3VYGA 2FHDA 3VYHB 2EYXA 1N8RC 3QZ5B 3ER0A 4C0DB 2RQUA 3UA6A 4EMKC 4C8QA 1BCOA 2COYA 4JJNK 2OTJA 2EQMA 4F17A 2EVRA 5GAMf 2G6FX 4C8QE 2RH2A 2WSCE 3DLLA 3CCVQ 3OSSC 2QK0A 1O9SA 2DXUA 1K9MU 1NLOC 1LJOA 2PTKA 3QHSA 4OB3B 2DNUA 1Y07A 3UATA 3OYYA 4M7AE 4CRIA 3EG0A 3VS1A 4OGEA 2LJ3A 1K8AU 1VQ7A 3JCMW 1GCQA 3L2QA 3JSCA 4RKUE 2LT1A 1PHTA 4BY6C 4C92D 4BDYA 2DYIA 2B86A 3BDLA 3M0QA 2X4WA 1KQSA 2D6FA 4M7DC 1XNIA 2E70A 1QWFA 1JJ2P 1VQ4A 3EFOA 1SG5A 2EPDA 2YUPA 1WGSA 2A36A 3OB9A 3SHWA 3CC4Q 5C6SA 1QKXA 4AFQC 1VQKA 3CCSQ 4M78D 4A53A 4PJOD 2C0TA 4DEYA 4JJBA 2VC8A 2K9GA 1K1ZA 2LJ0A 3MJXA 4XTYA 1BBZA 3UA7A 1FXXA 1OPKA 2YLCA 3KXTA 4C5IA 3CCJT 2DE0X 3TCJA 1PKTA 1MNDA 3CC2Q 1R8OB 1VQ5Q 1VIFA 1FMKA 1X43A 3OS2A 3EFSA 5FU6B 2ZAEA 3EHRA 5HKCA 1KHIA 3LWHA 5KYXB 2KT8A 5GAN2 2R5MA 1OPLA 3HKSA 4E7ZA 1WQWA 2FZKB 3HRUA 3CCMA 3OYJA 1QVGP 4E6RA 1K76A 1FMWA 4F04B 3EGDB 4XTVA 4KUIA 3ZL7C 2K79A 3X28B 3S3NA 4KGZB 5LJ5j 2RNAA 4F7UE 4C92F 1SSFA 2A37A 1BI1A 2EJFA 4PFZA 4QKUA 4C0DC 3NTIA 1N5ZA 3G6EA 4BUGA 1SSHA 2HKNA 3C94A 4MZTA 1I0CA 2RQVA 2CYZB 2QEXA 4AFUC 3OYMA 9ATCB 5LJ5h 2AHJB 4PJOF 1WA7A 2RK1A 5GMKe 4J9EA 1ZHIA 5CKHA 2KYBA 1B3QA 2JVVA 2MAMA 2E3HA 2KRMA 3C4SA 2X3XD 3HSBA 3NGPA 2DL4A 5GAMd 2IVWA 4C0FA 2DRMA 4RTZA 2DZ9A 2L3QA 1NJIU 4RCCA 5KH6A 1EIFA 4ZGDB 3VS6A 1PKSA 1QCNA 1CSKA 1M2VB 3SFMA 1QKWA 1K8AC 4M7AB 2KVQG 5GAMe 2RHIA 2P84A 4RTVA 4ELYC 5FU7B 4MMLA 2MWPA 1RAFB 1JXOA 2D8JA 1MGQA 3G4SA 4FIBA 3URGA 2FPFA 1AOJA 1F1BB 2XKOC 1PG5B 3O8VA 3J81E 2DBMA 3CCET 3GBQA 2JM8A 3RERA 2GQVA 1KG1A 3P8DA 5GANg 1NLPC 1RABB 3FJ5A 5GAOq 4PK4A 1SHFA 2H3EB 4FU6A 3CQTA 4BACA 3OW2S 2O2OA 4F16A 1S72T 2F5TX 2E6ZA 3JCMX 2MF2A 5A0DA 1YJNA 2MWOA 1YHQT 3CD6T 1JRIA 1WPYA 1RLPC 5DM7R 5GAOn 2EAYA 2DZCA 2KEAA 1AWOA 3X24B 3TSWA 3UPUA 4PJMA 2D1XA 1HXDA 1HSQA 1OOTA 4E7HA 5LJ5f 2EYQA 4ZTFA 4M77D 2KDSA 5CKBA 3EGUA 3CCJQ 1KQ1A 2MCNA 4FYVB 1AHJB 1M1GA 5IXBA 1UHCA 1ZX6A 1B34B 4E47A 2W0ZA 4PNOA 1QCOA 4J5YA 4Y91A 4V2SA 1R0BG 5GAOp 1D1CA 4II1A 2DK3A 2ED1A 2P0PA 3M0PA 1VQPA 1I81A 4XTWA 2K6DA 2RB6A 3L2VA 5A2QE 3M0UA 2CKKA 1X27A 1M8MA 3EH1A 5LJ3j 1AZEA 2XDDA 1T0HA 4F7UB 2E1HA 1WXUA 3LYIA 4CC7A 3QZ9B 4JJCA 2DXCA 1AWWA 4IUTA 3MP1A 2X4XA 4D6WA 3RIRA 4EMGA 2LQWA 1IB8A 1B7TA 2L0AA 5GAN8 1OULA 1QQJA 3LGFA 1UB4A 5LJ3h 4C8QC 5DLQE 4JLIA 2E65A 2DXTA 1BK2A 3A8HB 1H92A 1KIKA 4CI0C 1VOMA 5LL6S 1VQMT 2JW4A 2LX7A 1KQSS 1CKAA 2K7AA 1NBEB 1U5SA 2PNIA 1VQ9A 1OZ2A 1KC8R 4M77F 4M7AC 1IXDA 3QJ6A 1NJIC 3LWIA 5FU7C 2YLBA 3M0SA 4OMNA 5J26A 2AKKA 3TSZA 2HEQA 3I5SA 4MDWA 2HBPA 4DQ2A 1Q82R 2M9UA 2EQIA 4FL6A 2RI5A 2ZZDA 2DBKA 3RNJA 5C0MA 4QQDA 4Z02A 4ATOA 1MV0B 1VQ6T 4HA8A 2J05A 2KROA 2JMAA 1PM3A 1P92A 2MOXA 2LVMA 1R77A 1Q81R 3CCEQ 1OQKA 2MK5A 4J6XA 3CCVA 4C92G 4QT7A 4N4HA 1V29B 2HSEB 1U06A 5IH2A 1TWBA 3PE0A 2VUBA 2COZA 3GNGA 1YHQQ 3CCLA 2K3XA 3CD6Q 2P4RA 1SEMA 2XI9A 4DA4A 5I2MA 1ZLMA 1GFCA 2RMOA 1KFZA 3V8KA 2CS7A 2K5LA 2K2MA 1YJ9T 4AG2C 4E2FB 4ZGEB 2DVEA 1XOVA 1GBQA 2CZ1B 2VXFA 4A4HA 5A0LA 1W4SA 5LJ5d 1D09B 2VWFA 2HQEA 1TUDA 2DTIA 3V7SA 1SF9A 3OYHA 2EW3A 4F14A 3L2ZA 5IXFA 1V76A 4YTLA 1K73U 1ABOA 3LGLA 1G8XA 3QBYA 2YSQA 5LJ5e 1Q7YR 2HNIA 4M75F 3CC4A 3HFNA 1IHWA 5IAYA 2ROLA 1BCMA 2BUDA 5GAOm 3NFCA 4FW2A 4BE2A 2OTLA 3M59A 3OBYA 1WHGA 2EKOA 1X01A 3OA6A 2DL5A 2JXBA 1LCKA 2CP2A 4N4IA 1K0SA 4HVWA 4ORZA 2ZCFB 2LZ6B 2E12A 4TVRA 2HMAA 4C92A 5IHNA 2R58A 3QYHB 3RMQA 1AWXA 2Y4XA 1UGRB 5KCHA 1YJWA 1VQ5A 3MEUA 3CXCA 2KRNA 4BY6B 5GAN6 1WHKA 1VYTA 2LNHB 2B8AA 2QQRA 2DF6A 2ROTA 1Q95G 1Y96A 4L5GA 2FL7A 3M9QA 4IIOA 1XJWB 2KXDA 3V7RA 1RADB 2I2LA 1X75C 1WZOA 1IRXA 2GF7A 3OW2P 1QVFA 1UHFA 1VQMQ 2AK5A 3J80E 1I4K1 1VQOA 2DEUA 4M78E 2F1LA 4PJOE 4OMOA 1VQLT 1SPKA 4LUDA 2O01E 2EQUA 1QP2A 1WHHA 4O6JA 1YITT 3A5ZB 1FX7A 4CC4B 3PIPA 1ZSZA 3GPLA 5GANj 3BDUA 3T9NA 3PVLA 2QASA 4JS4A 3CPWA 3AHUA 5EG2A 1UEBA 4B9XA 1WHLA 1D1BA 3G71T 2QQBA 2LQNA 2ZPBB 4RMOA 4E7KA 3MCAB 1VQ6Q 2XHCA 2P4TA 2CH4W 3VRYA 2HAXA 2MYSA 1IGUA 5GANh 1X6BA 3M5AA 5CQXA 1FMVA 5CO7A 2XG8D 1M1KC 2JM9A 5FWCA 3LX7A 3E1SA 4B6MA 4CC3A 1IZ6A 2Y4YA 5GAN7 1CKBA 2LTOA 4FYXB 1OEBA 1KC8U 3V8JA 5I2SA 1I1JA 3SDZA 1WJRA 2NYSA 3MP6A 1YWOA 1QCFA 2RN8A 5LJ3d 3JCMg 1YJ9Q 3CMAT 2QA4T 1W70A 2DYBA 3SWNA 4WF2A 1PNJA 2GFUA 1PD1A 1YNZA 1RI0A 3FB9A 2DD5A 4M7DF 4HVUA 1IHVA 1M90C 4PLLA 4M77G 5LJ3e 1K73C 3CC7A 2FRYA 1GXIE 2HBWA 3G7ZA 3O5ZA 1Q81U 2YRDA 3EG9B 4XQ3A 2GFAA 3PMTA 2CT4A 2GCXA 1G3SA 1KQSP 2DL3A 4AFZC 3M54A 4KUDK 3MEVA 3L42A 1UE9A 1UJ0A 2QGFB 1Q86R 4HVVA 5CR2A 3CMET 2O88A 2DIGA 2JJ9A 1OX9A 4BB7A 1ACMB 2ZPIB 4JZ4A 4PLIA 2IIMA 2HCKA 5J3BA 4DBRA 3VS4A 2JZ2A 3WXMB 5KE2A 4Q5WA 1W2BA 2V1RA 1VQ8T 3VUZA 1PD0A 2OI3A 3CPFA 4N0AA 4HCBA 1I8FA 2DXBA 2CDTA 2EYWA 4LD6A 5IT9E 3I56A 4FCYA 2YUNA 1OX8A 1UDLA 3NTKA 3VUBA 4FT4A 1WJQA 1WHJA 1UECA 4M78B 3ZEHA 4IIMA 4PJOB 4AT1B 4AG1C 1VQLQ 1PWTA 1JXMA 1TXQA 3A8MB 5KYYB 4BE1A 3THKA 2HL5C 4M77A 1YITQ 1WLPB 3I35A 2J06A 2OX7A 2WACA 2GNCA 2C0IA 5D6XA 4LDUA 3RESA 4QQGA 4Z89A 4M75G 2RQTA 1NG2A 3G1JA 3G71Q 2LP5A 4J83A 2DRKA 4ME7A 1QP3A 2NUPB 2D9TA 5DLOA 1B34A 1R0CB 2ECZA 2GQIA 2DX1A 4OP0A 3OS5A 3PNWC 1JU5C 4OB2B 3REAB 4KRTA 3EGXA 2QGGA 1H8KA 2V8JA 2CGHA 3ME9A 1LPLA 2A3LA 2VVKA 2LCSA 3D7SB 4OMPA 1K4US 2HSPA 5KYWA 1KD1U 3CCUA 2F2WA 4B9WA 4EDUA 4PKCC 1D3BB 3UWNA 1Z9QA 5EC7A 3GOXA 2WSFE 1VQNT 1QWEA 1JBMA 1TS9A 3CMAQ 2QA4Q 2L3SA 2A7YA 5GAN5 2BZYA 4Z8AA 2BIVA 3OBWA 2OAUA 1LOJA 4OMQA 1LVKA 3SB2A 2X51A 1QVGA 2XD0A 1G3YA 4C8QB 4LNPA 2HDAA 3CXCS 2DLPA 2LDMA 1AVZC 3C12A 4OVAA 3HHTB 1K9MC 4AMCA 1GL5A 1ZA2B 4Y28E 3PMIA 2O31A 4VUBA 2CP0A 3OYEA 1OV3A 4M75A 1YHQA 2M51A 4RG8A 1KK7A 2O4XA 4A54A 3QYGB 3FC3A 5KYUA 1QVFS 2VB6A 5IHIA 1YIJT 5HK3A 1EZZB 4J7IA 5CVIA 1D0XA 1IO6A 3CMEQ 1SHGA 4HKEA 4RTTA 3JB9J 2P0KA 2HKQB 1N8RR 5GANd 2C0OA 3DKMA 3CPWS 1PSFA 5CKDA 1VQ8Q 2AZSA 5CCAA 1HYOA 2DL7A 3EG2A 3EFOB 1GCPA 3CCRT 4M78C 4PJOC 3P8HA 5GANe 2CUBA 1NPRA 2CP5A 2PU9B 1S1NA 4J9BA 4KGVB 2BE7D 1Y71A 3OSVA 1ZUUA 3X20B 3UT1A 1N6AA 4RTYA 4M7DG 1YI2T 1ZSGA 3M56A 4WTOB 3VS2A 4OB1B 2H8HA 1GFDA 3RMSA 2G3RA 1PCXA 4E7IA 3Q1JA 2M0YA 2RI2A 2O9SA 4NL2A 5GJVB 1XTDA 3M4GA 5L8RE 4A4FA 3GP8A 4KT0E 3RKXA 3EH2A 3E2UA 2E41A 2DTOA 2RHXA 2JTEA 3I5RA 2L8DA 4RTXA 5KE3A 4EMKA 2JTFA 1JEGA 3M58A 2JNGA 3HRSA 3QKJA 3EFRA 4M7AF 3LH0A 4C5EA 1Y7XA 2KQWA 4KH0B 1E7OA 2O9VA 5I21A 4XU2A 2CSQA 2ZGWA 2YDLA 1KHCA 3OYFA 1UG1A 1KD1C 2EYYA 5CIUA 4BE0A 4HCZA 2E5KA 2FPDA 3FIFA 2E64A 3OYAA 2M0OA 3WVEB 1HK9A 1VQNQ 3JCMh 4LXCA 1UGVA 2RJCA 4PFOA 4PL6A 1WYXA 2K3YA 1N9RA 1YBYA 3QWXX 2KE9A 1H641 4J6WA 3FDRA 2EQJA 1ZBJA 2CREA 3QDRB 1W2BS 4OF1A 4A63B 4M7DA 2RK2A 3H0IA 1UFFA 4LDVA 2PVDB 1U1SA 4M75D 1UJYA 1H3HA 3C95A 1GCQC 4PJLA 4AFSC 1AWJA 2JS2A 2K57A 2LMJA 3V7CA 1M9SA 2LCCA 1YIJQ 2LNVA 3R6OA 1MMGA 3PVQA 4C0GA 2NUTA 2XIDA 4ZN3A 1D1AA 1OU8A 1RAHB 4KBMB 3WVDB 4A4KA 2BZXA 2VGMA 2KNBB 2GTJA 2LC4A 2Y90A 3VS3A 4JRQA 4FYYB 2CH4A 3TU4K 3ULRB 1KSWA 1S72Q 2LX9A 3I9QA 3J7AF 3CCRQ 1QLYA 4LD9K 3GIBA 8ATCB 4F7UF 2L5QA 2PZ1A 1VQ9T 5LJ3f 2DO3A 2V8KA 2FZGB 1M2OA 1K8AR 2CZ0B 4Y92A 4P5NA 2DILA 4HT9A 1GRIA 3FRNA 2QQ9A 2FG0A 4N4GA 4RG2A 1YI2Q 2IPOB 1PSEA 4D8DA 2RPNA 4BI8B 3H9NA 3DB4A 2R57A 1GBRA 3A98A 1YN8A 3MKDA 4LDYA 4MZMA 2W10A 5GAOr 4FYWB 5GMKi 2I0NA 3EG1A 3CCSA 1NM7A 3OYNA 3JCMP 2E4HA 1IGQA 2EJGA 3CXCP 2EYZA 3CCVT 1SKUB 1PC0A 4RTUA 2XICA 3META 4R0KA 1E6GA 1QVGS 3H41A 4MDXA 1M8VA 1VUBA 4E7JA 3OS0A 3CCLT 3RDVA 1TUCA 1WI7A 4E7LA 1YITA 1QVFP 3CC2A 3UDCA 4C5HA 1TG0A 4C92E 3C0CA 3RKWA 4OMFB 4LE9A 3G71A 1BKBA 2RF0A 3TQ7P 2V1QA 3ASKA 1WFWA 2X9HA 2R5AA 3VV0A 2RHZA 2KK4A 1X2KA 3VRZA 4DBQA 4RUGA 2KI7A 2CUDA 1XQHA 4M7DD 3EAEA 4EPCA 2C06A 2JOYA 3JCMc 2QTXA 1NEGA 2L2PA 2ZPGB 3E19A 4XTZA 1WQ7A 4RCBA 2OTLT 2X4YA 3DLMA 4ANJA 3CCQT 2KY9A 2HQXA 5AT1B 5KYYA 1QVPA 3F70A 2PUKB 2H3JA 3CBOA 2QAZA 1OZ3A 1C0MA 1VYVA 4R55A 1YJWT 3CMAA 2QA4A 1G5VA 4ESRA 2D0NA 1D0YA 4JRPA 2E3IA 3UF4A 4GBQA 4J9HA 1J3TA 1H3ZA 4LDXA 3PFSA 4M7AG 2EJ9A 5KYXA 2K5IA 2OAWA 2SEMA 1UGSB 3MEAA 4X9DA 4QW2A 1KJWA 1VA7A 3JB9F 1RUWA 4NOYA 4DOWA 2A28A 4XU3A 2JS0A 1TSFA 1M3AA 4J9DA 1NJIR 1VQOT 3EGDA 5GMKl 1FYNA 3FJPA 1ZUYA 1VQ9Q 3QXEB 1YFNA 3EHQA 3MO8A 3JCMd 1X2QA 2KXCA 1Q82U 3S6WA 1D3BA 4BI4A 2D8HA 2RD1A 1YCYA 1EFNA 1X6OA 1ABQA 1ZUKA 3OYDA 3JCMe 1C6VX 2EGAA 4JDSA 4L59A 1VQ8A 3OYKA 4KULA 3KUFA 2VGNA 3AT1B 7AT1B 1MNEA 3CBPA 2CT3A 5AYFA 3JB9H 1RAEB 1W2BP 2NWMA 1AZGB 1NE8A 1QW1A 2FPEA 2ZPHB 2IG0A 5FRMA 3L2RA 2PVOB 1O75A 1WIEA 4WCIA 3I55T 2RQWA 5FWBA 1M2VA 5GANf 4M7AA 1BI3A 3CCLQ 3CCJA 1NEBA 3L2UA 1JO8A 1MV3A 3MEWA 2X3WD 4HCKA 4DOVA 2ENMA 2LJ1A 4C92B 4JJDA 3CEYA 4M4ZA 4J8OA 2GGRA 4IUUA 3HP9A 1WXBA 1M4ZA 2ZPFB 3QUIA 2OTJT 2EGEA 4F7UG 2QQSA 1BU1A 1OYXA 2MMPA 2PUOB 1Y96B 4PJJA 4ELZC 3CC7T 2DFUA 3NMZC 3M0RA 1Q7YU 2XU8A 4PJNA 2BZ8A 3PTAA 6AT1B 4OB0B 2P0QA 1M1FA 4J6YA 3H8ZA 2NUZA 3VU3C 4NS5A 2KGTA 1VQ7T 2OTLQ 4M77E 2NLUA 2FO0A 3JRZA 2JTMA 4OMLA 1ZSZB 2MPXC 3CCQQ 2V26A 1JJ2A 1LNXA 1W1FA 3LW5E 3KBGA 4L6V5 3QWYA 3HPWA 4ZGJB 1NZ9A 1VQNA 2FYKA 1M30A 1VIEA 3JCMQ 1YJWQ 2QQAA 3H6ZA 3BY7A 1VQ4T 1YP5A 2GBQA 1VYUA 1T0JA 3QG1A 1I5OB 1D0ZA 2F5KA 2YT6A 1VQKT 2E10A 3I56T 4XU1A 3OMCA 2QYZA 3OMGA 4XTXA 2L3PA 3M0TA 3EG3A 2OJ2A 2HL3A 4GLKA 4LDWA 3JCMb 2MI6A 1KC8C 1VQOQ 2ATCB 2DM1A 2RJFA 1UGQB 4F7UA 2E6NA 2YUQA 1Y0MA 3OQ5A 4FSSA 1YIJA 1Q82C 2XDBA 1PRLC 2FZCB 3M53A 5HK0A 3SWNB 3GNFB 2ESWA 1OI1A 2A08A 3CCEA 1TUGB 1JQQA 3GLXA 2JMCA 1ZBXA 3SD4A 1SRMA 1M3CA 3QPHA 3H0FA 2YUOA 5KYNA 1Q81C 1M3BA 4C8QD 3CCMT 1S72A 2DD4A 4M78F 1M1KR 2EIFA 5GJWB 3CCRA 2FB7A 3CD6A 1RAIB 2M02A 3OYGA 1WDXA 2LQKA 2XMFA 4JRKA 4M75E 2M16A 1IREB 4QVDA 1G3TA 5GAMg 2J7IA 2KAFA 4FT2A 4KH1B 1V1CA 5GAN3 2LRQA 3IQLA 2F69A 4M7AD 4C92C 2KYMA 3I55Q 3TEEA 2D0QB 5FROA 2JUFA 3CCUT 1X6GA 1ZA1B 2F2XA 1YI2A 3G6ET 3OYIA 1TH7A 4EMHA 2GTOA 2K2VA 2WSEE 2BKDN 4BD3A 3JB9G 1RI9A 4XAXB 4QVZA 2QEXT 5A0GA 2ABLA 5GAN4 4IUQA 1M90R 1MHNA 3TVTA 1K73R 3ZBDA 1I5LA 5L23A 3P8BB 1RAAB 2L89A 2OTJQ 2DA9A 1NYFA 2XK0A 1W6XA 1HD3A 2AKLA 1X69A 1YCSB 2YXYA 3M55A 5D6YA 1Q7YC 3CC7Q 3NPFA 1TTHB 4EIKA 1ZSZC 1C1AA 1U1TA 4JLGA 1BI0A 1T3LA 3GF5A 1Q86U 3FLGA 1YWPA 4IURA 1SRLA 2DJZA 2RA2A 2DL8A 4M77B 1RL2A 1WNLA 1VQ7Q 3DB3A 4X34A 1G3WA 3G4ST 1M27C 4DBHA 1MMDA 1TOVA 4C8QF 4ZTJA 2K3BA 4JPBW 5FU6C 3S3MA 2AIRB 1Y57A 2CP7A 2RO0A 5ECAA 3A8OB 2F2VA 3A8GB 4JZ3A 4QQ6A 4X1VA 3LLRA 3QDFA 1NPPA 1T3SA 1VQ4Q 1VQMA 4IUVA 1YJNT 5D6WA 2DETA 4IKFA 3EGXB 3OY9A 1VQKQ 1EX4A 3I56Q 3OS1A 4JS5A 2CSIA 3VS7A 4A4GA 3RBBB 1N9SA 4J9GA 1A0NB 2DVJA 2YRCA 3JCMV 3VJPA 3SWNC 4OGCA 5KYWB 3E9FA 2KR3A 2PVGB 1VQ6A 4MZPA 3HTRA 2RI3A 3U23A 1U8RA 3M4YA 2QDLA 2ZPEB 2CZ7B 1AEYA 1G83A 3R6NA 2DIQA 3RR6A 2ED0A 2L3RA 1AD5A 2FVUA 4M7DE 2LT4A 2KMTA 1VQPT 1DJ7B 4OMMA 3CCMQ 5CAIA 2FRWA 3X25B 5CKFA
chains in the Genus database with same CATH topology
1W2BA 3SFMA 1K8AC 1XQHA 2KVQG 4M7AB 5GAMe 4M7DD 1JB0E 2RHIA 4M75B 4ELYC 5FU7B 4MMLA 1VQ8T 2MWPA 3EAEA 1FWZA 3VUZA 4EPCA 3OYCA 2C06A 4N0AA 2JOYA 3CPFA 3X26B 2O4XB 3JCMc 4HCBA 2QTXA 1I8FA 1MGQA 2DXBA 3G4SA 4FIBA 4LD6A 3URGA 1YJ9A 5IT9E 3J81E 2XKOC 3O8VA 3RKYA 3I56A 4JUVA 2ZPGB 3E19A 4XTZA 3CCET 1N27A 1WQ7A 4RCBA 2OTLT 3RERA 2GQVA 1KG1A 2KSSA 2X4YA 1WJSA 3NTKA 3P8DA 5GANg 3DLMA 1ZQ1A 4N0AC 3VUBA 3CCQT 2KY9A 4FT4A 5GAOq 1WJQA 5DY9A 4FU6A 3OW2S 2HQXA 4BACA 4FM4B 4M78B 3ZEHA 1QVPA 4PJOB 1S72T 3F70A 2F5TX 2E6ZA 2X4JA 3JCMX 1BI2A 5HY6A 2MF2A 5A0DA 1JJ2S 2YHTA 2PUKB 2H3JA 1YJNA 3CBOA 3V8LA 1OZ3A 5IN1A 3A8MB 2MWOA 4R55A 3BFMA 4BE1A 1YHQT 1YJWT 3CD6T 3CMAA 2QA4A 4M77A 1G5VA 1JRIA 1WPYA 5DM7R 5GAOn 4JRPA 2EAYA 3N5BB 3JCMJ 2DZCA 2K5FA 2HD0A 1H3ZA 3X24B 4LDXA 3PFSA 2WACA 3OYLA 3UPUA 4M7AG 3A8LB 5D6XA 4XK8E 2EJ9A 4LDUA 2K5IA 4QQGA 2VXEA 3RESA 1HXDA 4M75G 1UGSB 3JCMf 3MEAA 4X9DA 4E7HA 4QW2A 5LJ5f 3JB9F 2EYQA 4M77C 4ZTFA 4J83A 1M1KU 4NOYA 4ME7A 1QP3A 4M77D 4C5GA 2KDSA 4DOWA 5CKBA 2D9TA 4XU3A 5DLOA 2LCLA 2VV5A 3PIOA 1B34A 1KQ1A 1Q86C 4OP0A 1AHJB 1M1GA 1VQOT 3OS5A 3QIIA 3PNWC 1B34B 1M5Q1 4OB2B 5GMKl 3CBMA 3FJPA 5FLXE 4E47A 4PNOA 3NTHA 3QXEB 4M78G 2V8JA 4PJOG 3MO8A 2CGHA 4J5YA 2V8IA 3ME9A 4Y91A 3JCMd 2A3LA 5LJ5g 4V2SA 2E5QA 1UGPB 5GAOp 1N8RU 4II1A 2DK3A 1Q82U 2P0PA 3S6WA 1VQPA 1KQ2A 1D3BA 1I81A 4XTWA 4BI4A 2RB6A 3L2VA 1KD1U 2RD1A 1YCYA 2CKKA 5A2QE 3CCUA 1M90U 4B9WA 4EDUA 1X6OA 5LJ3j 4PKCC 1D3BB 3OYDA 4FSXA 3JCMe 3UWNA 4EMKB 3GOXA 2WSFE 1VQNT 4JDSA 4L59A 1JBMA 1VQ8A 3L1AA 2XDDA 3JB9D 3OYKA 4KULA 3PGGA 3KUFA 2VGNA 4F7UB 2E1HA 3HFOA 1VQLA 2EFIA 3LYIA 4XTUA 3JAME 2RHYA 3CBPA 3QZ9B 3BW1A 5AYFA 3JB9H 2A7YA 2DXCA 1BIBA 2RM4A 5GAN5 5GMKj 2BIVA 3OBWA 3MP1A 4IUTA 2OAUA 2X4XA 1NE8A 1LOJA 3RIRA 3SB2A 4D6WA 4EMGA 1QVGA 2XD0A 1G3YA 1QW1A 4C8QB 3FEOA 3VKIA 3CXCS 2ZPHB 5FRMA 2IG0A 5GAN8 2PVOB 4A4EA 3L2RA 2LDMA 1O75A 3CCQA 3C12A 3LGFA 2K4YA 4OVAA 1UB4A 5LJ3h 3I55T 3M57A 2EQKA 5DLQE 4C8QC 1BIAA 3HHTB 2RJDA 4JLIA 1K9MC 2E65A 2DXTA 3JB9I 4GY5A 4Y28E 5CK9A 3A8HB 3PMIA 1BI3A 4UC4A 4VUBA 2QDYB 5GMKm 3CCJA 4M7AA 4CI0C 3OYEA 4HT8A 4M75A 5LL6S 3TREA 4NL3A 3L2UA 1VQMT 1YHQA 3MEWA 4RG8A 2CZ6B 2O4XA 1KQSS 4A54A 3QYGB 4DOVA 5J39A 4C0ZA 5GMKh 3HL8A 3L2WA 2X35A 5GAMj 3FC3A 1QVFS 4QVCA 4C92B 3CEYA 4J8OA 4IUUA 3HP9A 5KCOA 3CC4T 1VQ9A 1YIJT 2DPPB 5HK3A 1M4ZA 1OZ2A 3QO3A 4J7IA 3INZA 4M77F 5CQYA 5CVIA 3ZFJA 2ZPFB 4BI3A 4M7AC 3CCST 3QJ6A 1NJIC 4M75C 3LWIA 3QUIA 5FU7C 2YLBA 4M7DB 2OTJT 4HKEA 4F7UG 3JB9J 2QQSA 1OYXA 5J26A 5M9OA 4R56A 2MMPA 2PUOB 1Y96B 2P0KA 2VYTA 4MDWA 4ELZC 4O5VA 2HBPA 4M78A 3PT9A 5CKEA 4DQ2A 3CC7T 5GANd 3HRTA 2LQ8A 4JRIA 4PJOA 2M9UA 3DKMA 2QXFA 4FL6A 2RI5A 2ZZDA 4C8QG 3CPWS 5C0MA 1Q7YU 4QQDA 4Z02A 4ATOA 2XU8A 1PSFA 2RHUA 4HA8A 5GAMh 1VQ6T 5CKDA 2DTHA 5CCAA 5FRNA 1P92A 4X9CA 3PTAA 3QSUA 3QJYA 3CCRT 4OB0B 3CC2T 4M78C 2P0QA 1VQ5T 1M1FA 4J6YA 2LVMA 4PJOC 3P8HA 3H8ZA 5GANe 3VU3C 4NS5A 1VQ7T 1NPRA 2PU9B 4M77E 2NLUA 3JRZA 3E9GA 3OW2A 2JTMA 2PQWA 4J6XA 3CCVA 4J7FA 4C92G 1JJ2A 5GAOl 1Y71A 3OSVA 3X20B 1LNXA 4N4HA 3LW5E 3KBGA 1V29B 2QI2A 4L6V5 3HPWA 2XDPA 4ZGJB 3UT1A 1NZ9A 1N6AA 1VQNA 2VUBA 2FYKA 4M7DG 1YI2T 2M1HA 3M56A 4BDZA 1VIEA 3GNGA 4OB1B 3JCMQ 2K3XA 3CCLA 2QQAA 3RMSA 2G3RA 3BY7A 3H6ZA 3MP8A 4E7IA 1VQ4T 2XI9A 4DA4A 3MHXA 3Q1JA 5I2MA 1BYMA 2DKGA 2RI2A 3S3OA 4NL2A 4XU0A 3V8KA 3QG1A 2CS7A 2K5LA 2JN0A 1XTDA 3M4GA 1YJ9T 2F5KA 5L8RE 1VQKT 2E10A 4ZGEB 2DVEA 1XOVA 2CZ1B 4ZN1A 2VXFA 2YRVA 4IUPA 4A4FA 3I56T 3GP8A 4XU1A 4KT0E 3RKXA 4A4HA 5A0LA 3CMEA 2RJEA 1W4SA 3OMCA 5LJ5d 2E41A 2DTOA 3OMGA 2RHXA 3I55A 4XTXA 3OYBA 2L8DA 2HQEA 3V7SA 2DTIA 4GLKA 3RUXA 2EWNA 4LDWA 5KE3A 4EMKA 3JCMb 2JTFA 2MI6A 3OYHA 1KC8C 4MMKA 2DAQA 3M58A 2RJFA 3L2ZA 4HCCA 2JNGA 2DEQA 4YTLA 1UGQB 4F7UA 3HRSA 1K73U 3LGLA 3QKJA 2E6NA 3QBYA 5LJ3g 3EFRA 3VYGA 4M7AF 3OQ5A 5LJ5e 2FHDA 3VYHB 3LH0A 2HNIA 1Y7XA 4C5EA 4M75F 3CC4A 1N8RC 3HFNA 3QZ5B 2KQWA 1YIJA 3ER0A 4C0DB 1Q82C 2XDBA 5I21A 4EMKC 4XU2A 5IAYA 2ZGWA 4C8QA 3M53A 5HK0A 2BUDA 1KHCA 5GAOm 3NFCA 3OYFA 4JJNK 2EQMA 2OTJA 3SWNB 3GNFB 1KD1C 5GAMf 1OI1A 1VQ5A 3CCEA 5CIUA 4BE2A 4C8QE 2RH2A 2WSCE 4BE0A 3GLXA 3DLLA 4HCZA 3M59A 2OTLA 3FIFA 1ZBXA 2E64A 3SD4A 3OYAA 3OBYA 3OSSC 3QPHA 2EKOA 1X01A 3OA6A 2M0OA 1Q81C 3WVEB 1HK9A 5GANf 1O9SA 3JCMh 2DXUA 4N4IA 4C8QD 3CCMT 2RJCA 1S72A 1K9MU 2DD4A 4M78F 4PL6A 2K3YA 1N9RA 1LJOA 1YBYA 2ZCFB 3QHSA 2E12A 4TVRA 1H641 4J6WA 4C92A 2EIFA 4OB3B 2R58A 3QYHB 3RMQA 3CCRA 1Y07A 2Y4XA 1UGRB 2FB7A 3FDRA 3OYYA 2EQJA 3MEUA 4CRIA 5KCHA 1YJWA 3OYGA 3CD6A 3CXCA 4M7AE 4OGEA 2LQKA 4JRKA 3QDRB 4M75E 1K8AU 2M16A 1IREB 4BY6B 4OF1A 5GAN6 1G3TA 4QVDA 5GAMg 3JCMW 1W2BS 1VQ7A 4M7DA 2KAFA 2RK2A 4FT2A 3L2QA 3JSCA 4RKUE 2B8AA 2QQRA 5GAN3 2LRQA 2LT1A 2F69A 4M7AD 1Y96A 4L5GA 4LDVA 4BY6C 2PVDB 4C92C 1U1SA 2FL7A 3M9QA 4M75D 3TEEA 4C92D 4BDYA 2D0QB 5FROA 3V7RA 2JUFA 3BDLA 2I2LA 3CCUT 1X75C 2X4WA 1KQSA 3C95A 1YI2A 3G6ET 2D6FA 2GF7A 1XNIA 4M7DC 1QVFA 2E70A 1TH7A 4EMHA 3OYIA 2K2VA 2WSEE 2BKDN 4BD3A 3JB9G 3J80E 1I4K1 2K57A 1VQ4A 1VQOA 4XAXB 4M78E 4QVZA 2QEXT 4PJOE 5A0GA 3V7CA 1M9SA 1WGSA 4IUQA 5GAN4 1VQLT 3OB9A 5C6SA 1MHNA 2LCCA 2LNVA 2O01E 3R6OA 2EQUA 3ZBDA 1QP2A 4O6JA 1YITT 1I5LA 1VQKA 3A5ZB 3P8BB 1FX7A 4C0GA 2L89A 4M78D 4A53A 3PIPA 4PJOD 2XK0A 3GPLA 5GANj 3BDUA 2XIDA 4ZN3A 3T9NA 2VC8A 4JS4A 3M55A 5D6YA 3CPWA 3AHUA 5EG2A 1UEBA 4KBMB 3WVDB 4A4KA 4B9XA 1Q7YC 3G71T 4XTYA 2VGMA 2LC4A 4JRQA 2Y90A 2QQBA 2ZPBB 4RMOA 4E7KA 1FXXA 3MCAB 2YLCA 3KXTA 3TU4K 4C5IA 2XHCA 3CCJT 2P4TA 2LX9A 1U1TA 4JLGA 3TCJA 2HAXA 3J7AF 1BI0A 4LD9K 3GIBA 1R8OB 1VIFA 3GF5A 1Q86U 4F7UF 3FLGA 2L5QA 4IURA 2DJZA 2RA2A 5GANh 1VQ9T 4M77B 1RL2A 1WNLA 2DO3A 3M5AA 5CQXA 5LJ3f 3DB3A 3EFSA 3OS2A 2V8KA 5CO7A 4X34A 5FU6B 1G3WA 3G4ST 2XG8D 5HKCA 1M1KC 1KHIA 2CZ0B 4C8QF 3LX7A 4ZTJA 3LWHA 4P5NA 4HT9A 3E1SA 5FU6C 3FRNA 2QQ9A 5GAN2 3S3MA 2R5MA 3HKSA 1IZ6A 2RO0A 2Y4YA 4N4GA 4RG2A 5GAN7 1WQWA 3HRUA 3CCMA 3OYJA 3A8OB 1PSEA 3A8GB 2LTOA 4QQ6A 3LLRA 1NPPA 4BI8B 3DB4A 2R57A 1VQMA 1KC8U 3V8JA 4IUVA 1YJNT 5D6WA 5I2SA 3SDZA 1WJRA 3MP6A 4KUIA 4XTVA 4LDYA 4MZMA 4IKFA 3X28B 5LJ3d 3JCMg 3S3NA 3CMAT 2QA4T 5LJ5j 5GAOr 4F7UE 3OY9A 4C92F 1SSFA 5GMKi 3SWNA 4WF2A 3OS1A 4JS5A 2GFUA 1RI0A 3CCSA 3OYNA 3JCMP 4A4GA 3FB9A 1BI1A 2DD5A 2EJGA 1N9SA 4M7DF 2EJFA 3CCVT 4C0DC 1M90C 2XICA 3META 4PLLA 3NTIA 4M77G 3JCMV 5LJ3e 4BUGA 3G6EA 3VJPA 3CC7A 1QVGS 1K73C 3SWNC 4MDXA 1M8VA 1VUBA 4OGCA 3C94A 4MZTA 1GXIE 4E7JA 3G7ZA 2CYZB 3OS0A 3E9FA 2QEXA 1Q81U 2PVGB 3OYMA 4MZPA 1VQ6A 2RI3A 3CCLT 4XQ3A 2GFAA 3PMTA 5LJ5h 2AHJB 4PJOF 2GCXA 2RK1A 1G3SA 1U8RA 3M4YA 5GMKe 4E7LA 3M54A 1YITA 2ZPEB 4KUDK 1ZHIA 2CZ7B 3MEVA 5CKHA 3CC2A 3L42A 3UDCA 4C5HA 2JVVA 2MAMA 4C92E 3C4SA 2DIQA 3HSBA 3RKWA 4OMFB 5CR2A 5GAMd 3CMET 2IVWA 4C0FA 2DIGA 2L3RA 3G71A 4BB7A 1BKBA 2DZ9A 2FVUA 2ZPIB 3ASKA 4M7DE 2LT4A 2KMTA 4PLIA 1NJIU 1VQPT 1DJ7B 4RCCA 5KH6A 1EIFA 5J3BA 2R5AA 3VV0A 2RHZA 4ZGDB 2JZ2A 2KK4A 5CAIA 3WXMB 5KE2A 3X25B 5CKFA 4Q5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y90 A;  3BW1 A;  4XU1 A;  3RKX A;  4M7A B;  3JB9 H;  5GAM e;  1BIB A;  4M7D D;  2RM4 A;  5GAN 5;  5GMK j;  2YLC A;  5LJ5 d;  4M75 B;  2E41 A;  2DTO A;  4MML A;  3RIR A;  1LOJ A;  4XTX A;  3SB2 A;  4EMG A;  4N0A A;  3JCM c;  4C8Q B;  1U1T A;  5LJ5 j;  2QTX A;  1I8F A;  1MGQ A;  2DTI A;  3RUX A;  3V7S A;  2EWN A;  3JCM b;  4EMK A;  5GAN 8;  3GIB A;  4MMK A;  3RKY A;  5LJ3 h;  4JUV A;  3L2Z A;  4F7U F;  4C8Q C;  2DEQ A;  2DJZ A;  4XTZ A;  2RA2 A;  4F7U A;  1BIA A;  4JLI A;  5GAN h;  1WQ7 A;  2E65 A;  2DXT A;  1WNL A;  4M77 B;  3EFR A;  4RCB A;  5LJ3 f;  5LJ3 g;  3JB9 I;  3EFS A;  3RER A;  5GAN g;  5LJ5 e;  5GMK m;  5GAN f;  4M7A F;  4M7A A;  2HNI A;  4N0A C;  4M75 F;  4HT8 A;  3HFN A;  5GAO q;  4M75 A;  4NL3 A;  5DY9 A;  5I21 A;  4C8Q F;  4EMK C;  4XU2 A;  2ZGW A;  4C8Q A;  4HT9 A;  4A54 A;  4M78 B;  5GMK h;  4PJO B;  5GAO m;  5GAM j;  5GAN 2;  3JCM X;  3SWN B;  4C92 B;  4QVC A;  5GAM f;  2YHT A;  4C8Q E;  3V8L A;  1WQW A;  5GAN 7;  3QO3 A;  3BFM A;  3FIF A;  2E64 A;  3INZ A;  4M77 F;  4M7A C;  4M77 A;  1JRI A;  1WPY A;  4M75 C;  3QUI A;  1X01 A;  2YLB A;  5GAO n;  4M7D B;  2EAY A;  4F7U G;  3JCM J;  3JB9 J;  2DZC A;  3V8J A;  1HK9 A;  3JCM h;  2DXU A;  4XTV A;  4C8Q D;  1Y96 B;  4M7A G;  4M78 F;  4PJO A;  2EJ9 A;  5LJ3 d;  3RES A;  3JCM f;  2VXE A;  3JCM g;  1HXD A;  1LJO A;  1N9R A;  4M75 G;  4M78 A;  4C92 F;  4X9D A;  4DQ2 A;  3QHS A;  4JRI A;  4F7U E;  1H64 1;  4J6W A;  4WF2 A;  3SWN A;  4C92 A;  5GMK i;  5LJ5 f;  3JB9 F;  4C8Q G;  4M77 C;  2FB7 A;  4M7A E;  4NOY A;  4M77 D;  5GAM h;  4HA8 A;  4JRK A;  3JCM P;  4M75 E;  3FB9 A;  2DTH A;  5GAN 6;  2EJG A;  4XU3 A;  1N9S A;  4QVD A;  2EJF A;  5GAM g;  3JCM W;  4M7D F;  1B34 A;  4M7D A;  1KQ1 A;  4X9C A;  3QSU A;  3JCM V;  4M77 G;  4OP0 A;  4M78 C;  5GAN 3;  5LJ3 e;  4J6Y A;  4PJO C;  4M7A D;  1Y96 A;  3SWN C;  4C92 C;  5GAN e;  1M8V A;  1U1S A;  1B34 B;  1M5Q 1;  4M75 D;  3VU3 C;  4C92 D;  5GMK l;  3FJP A;  3V7R A;  4M77 E;  4PNO A;  2I2L A;  4XQ3 A;  4M78 G;  5GAN d;  4PJO G;  5LJ5 h;  4J5Y A;  2CGH A;  4PJO F;  5GAO r;  4M7D C;  4J6X A;  4Y91 A;  4C92 G;  1TH7 A;  4EMH A;  3JCM d;  5GAO l;  5LJ5 g;  5GMK e;  4V2S A;  3JB9 G;  1LNX A;  1I4K 1;  5GAO p;  2K57 A;  4M78 E;  4PJO E;  3V7C A;  4C92 E;  5GAN 4;  2FYK A;  4M7D G;  1KQ2 A;  3HSB A;  1D3B A;  1I81 A;  4XTW A;  3RKW A;  2RB6 A;  5GAM d;  2RD1 A;  1YCY A;  1I5L A;  3JCM Q;  3BY7 A;  2DZ9 A;  5LJ3 j;  1D3B B;  4M78 D;  4M7D E;  4A53 A;  4PJO D;  2DKG A;  3JCM e;  4EMK B;  5GAN j;  3BDU A;  4NL2 A;  4XU0 A;  3V8K A;  1JBM A;  4RCC A;  3L1A A;  2JN0 A;  2VC8 A;  3JB9 D;  3PGG A;  3M4G A;  3AHU A;  5CAI A;  4F7U B;  2E1H A;  3HFO A;  2E10 A;  4XTU A;  2DVE A;  2VXF A;  4XTY A; 
#chains in the Genus database with same CATH topology
 5FW9 A;  1JB0 E;  4J9F A;  4M75 B;  1FWZ A;  3OYC A;  3X26 B;  2O4X B;  1WHM A;  4DBF A;  4LUE A;  4LN2 A;  2EGC A;  5KYU B;  1YJ9 A;  1AT1 B;  3RKY A;  4JUV A;  1TU0 B;  1N27 A;  2KSS A;  1WJS A;  2RQR A;  2JT4 A;  1ZQ1 A;  4N0A C;  2SRC A;  3CCU Q;  2COW A;  4GLM A;  1PRM C;  5I11 A;  3G6E Q;  5DY9 A;  4FM4 B;  1RLQ C;  5IHK A;  2X4J A;  1BI2 A;  5HY6 A;  2QEX Q;  1JJ2 S;  2YHT A;  5D7U A;  5IN1 A;  3BFM A;  3N5B B;  1K9M R;  3JCM J;  2K5F A;  2HD0 A;  2MIO A;  3OYL A;  3A8L B;  4XK8 E;  3V8L A;  3JCM f;  2VXE A;  2J6O A;  4J9C A;  4M77 C;  1M1K U;  1QMC A;  4C5G A;  2LCL A;  2VV5 A;  3PIO A;  1Q86 C;  2BTT A;  1B07 A;  1E6H A;  3QII A;  3VS0 A;  1M5Q 1;  2AT1 B;  3CBM A;  5FLX E;  1K0X A;  2KT1 A;  3NTH A;  3VS5 A;  4D8K A;  4M78 G;  4PJO G;  3G4S Q;  1UUE A;  2V8I A;  3NHN A;  5LJ5 g;  2E5Q A;  1UGP B;  2EBP A;  4FW1 A;  1N8R U;  2Z0W A;  1UTI A;  1KQ2 A;  2HQH A;  2DMO A;  3REB B;  1M90 U;  2CP6 A;  1WX6 A;  3EG9 A;  4FSX A;  4EMK B;  1ARK A;  2AZV A;  1YJN Q;  3L1A A;  3JB9 D;  3PGG A;  2YWW A;  3HFO A;  1VQL A;  2EFI A;  3JAM E;  4XTU A;  2DER A;  2RHY A;  3LH5 A;  3BW1 A;  1BIB A;  2CP3 A;  2DJQ A;  2RM4 A;  5GMK j;  3FEO A;  3VKI A;  1NYG A;  3CCQ A;  4A4E A;  2K4Y A;  2A0F B;  2EQK A;  3M57 A;  1BIA A;  2RJD A;  3JB9 I;  2J6F A;  4GY5 A;  5CK9 A;  5GMK m;  2KRS A;  4UC4 A;  2QDY B;  1MMN A;  4HT8 A;  3TRE A;  4NL3 A;  3CPW P;  2CZ6 B;  4CC2 A;  5GMK h;  5J39 A;  3L2W A;  2J6K A;  4C0Z A;  3HL8 A;  2X35 A;  5GAM j;  1OU9 A;  4QVC A;  3MPU B;  3CC4 T;  5KCO A;  1Z9Z A;  2VAS A;  1U3O A;  2DPP B;  3QO3 A;  3INZ A;  5CQY A;  3ZFJ A;  4J9I A;  4BI3 A;  4DEX A;  3CCS T;  4M75 C;  4M7D B;  1RAC B;  5M9O A;  4R56 A;  4K11 A;  1VQP Q;  3A1P A;  3KFV A;  1BB9 A;  2VYT A;  4E7S A;  5I22 A;  4O5V A;  4M78 A;  3PT9 A;  5CKE A;  1HJD A;  4PJO A;  3HRT A;  2LQ8 A;  4JRI A;  4KGX B;  2QXF A;  4C8Q G;  1MUZ A;  1WXT A;  1KD1 R;  2RHU A;  5GAM h;  2DTH A;  5FRN A;  4X9C A;  3QSU A;  3QJY A;  8AT1 B;  3CC2 T;  1VQ5 T;  2FEI A;  1K9A A;  2NUT B;  3E9G A;  3OW2 A;  2PQW A;  2VKN A;  2NUP A;  4J7F A;  5GAO l;  3H0H A;  1I07 A;  1RAG B;  2QI2 A;  2XDP A;  3BE3 A;  4ZNX A;  1G2B A;  2KBT A;  2M1H A;  2EKH A;  4BDZ A;  3MP8 A;  3MHX A;  1BYM A;  2DKG A;  3S3O A;  2HZY A;  4XU0 A;  2QTV A;  2BE9 B;  2JN0 A;  5HCK A;  3JV3 A;  4ZN1 A;  2YRV A;  4IUP A;  4PFP A;  3CME A;  2RJE A;  3I55 A;  4Z88 A;  3OYB A;  1MMA A;  4RTW A;  3RUX A;  2EWN A;  4MMK A;  2DAQ A;  3SEM A;  4HCC A;  4HXJ A;  2DEQ A;  5LJ3 g;  2QG9 B;  3VYG A;  2FHD A;  3VYH B;  2EYX A;  1N8R C;  3QZ5 B;  3ER0 A;  4C0D B;  2RQU A;  3UA6 A;  4EMK C;  4C8Q A;  1BCO A;  2COY A;  4JJN K;  2OTJ A;  2EQM A;  4F17 A;  2EVR A;  5GAM f;  2G6F X;  4C8Q E;  2RH2 A;  2WSC E;  3DLL A;  3CCV Q;  3OSS C;  2QK0 A;  1O9S A;  2DXU A;  1K9M U;  1NLO C;  1LJO A;  2PTK A;  3QHS A;  4OB3 B;  2DNU A;  1Y07 A;  3UAT A;  3OYY A;  4M7A E;  4CRI A;  3EG0 A;  3VS1 A;  4OGE A;  2LJ3 A;  1K8A U;  1VQ7 A;  3JCM W;  1GCQ A;  3L2Q A;  3JSC A;  4RKU E;  2LT1 A;  1PHT A;  4BY6 C;  4C92 D;  4BDY A;  2DYI A;  2B86 A;  3BDL A;  3M0Q A;  2X4W A;  1KQS A;  2D6F A;  4M7D C;  1XNI A;  2E70 A;  1QWF A;  1JJ2 P;  1VQ4 A;  3EFO A;  1SG5 A;  2EPD A;  2YUP A;  1WGS A;  2A36 A;  3OB9 A;  3SHW A;  3CC4 Q;  5C6S A;  1QKX A;  4AFQ C;  1VQK A;  3CCS Q;  4M78 D;  4A53 A;  4PJO D;  2C0T A;  4DEY A;  4JJB A;  2VC8 A;  2K9G A;  1K1Z A;  2LJ0 A;  3MJX A;  4XTY A;  1BBZ A;  3UA7 A;  1FXX A;  1OPK A;  2YLC A;  3KXT A;  4C5I A;  3CCJ T;  2DE0 X;  3TCJ A;  1PKT A;  1MND A;  3CC2 Q;  1R8O B;  1VQ5 Q;  1VIF A;  1FMK A;  1X43 A;  3OS2 A;  3EFS A;  5FU6 B;  2ZAE A;  3EHR A;  5HKC A;  1KHI A;  3LWH A;  5KYX B;  2KT8 A;  5GAN 2;  2R5M A;  1OPL A;  3HKS A;  4E7Z A;  1WQW A;  2FZK B;  3HRU A;  3CCM A;  3OYJ A;  1QVG P;  4E6R A;  1K76 A;  1FMW A;  4F04 B;  3EGD B;  4XTV A;  4KUI A;  3ZL7 C;  2K79 A;  3X28 B;  3S3N A;  4KGZ B;  5LJ5 j;  2RNA A;  4F7U E;  4C92 F;  1SSF A;  2A37 A;  1BI1 A;  2EJF A;  4PFZ A;  4QKU A;  4C0D C;  3NTI A;  1N5Z A;  3G6E A;  4BUG A;  1SSH A;  2HKN A;  3C94 A;  4MZT A;  1I0C A;  2RQV A;  2CYZ B;  2QEX A;  4AFU C;  3OYM A;  9ATC B;  5LJ5 h;  2AHJ B;  4PJO F;  1WA7 A;  2RK1 A;  5GMK e;  4J9E A;  1ZHI A;  5CKH A;  2KYB A;  1B3Q A;  2JVV A;  2MAM A;  2E3H A;  2KRM A;  3C4S A;  2X3X D;  3HSB A;  3NGP A;  2DL4 A;  5GAM d;  2IVW A;  4C0F A;  2DRM A;  4RTZ A;  2DZ9 A;  2L3Q A;  1NJI U;  4RCC A;  5KH6 A;  1EIF A;  4ZGD B;  3VS6 A;  1PKS A;  1QCN A;  1CSK A;  1M2V B;  3SFM A;  1QKW A;  1K8A C;  4M7A B;  2KVQ G;  5GAM e;  2RHI A;  2P84 A;  4RTV A;  4ELY C;  5FU7 B;  4MML A;  2MWP A;  1RAF B;  1JXO A;  2D8J A;  1MGQ A;  3G4S A;  4FIB A;  3URG A;  2FPF A;  1AOJ A;  1F1B B;  2XKO C;  1PG5 B;  3O8V A;  3J81 E;  2DBM A;  3CCE T;  3GBQ A;  2JM8 A;  3RER A;  2GQV A;  1KG1 A;  3P8D A;  5GAN g;  1NLP C;  1RAB B;  3FJ5 A;  5GAO q;  4PK4 A;  1SHF A;  2H3E B;  4FU6 A;  3CQT A;  4BAC A;  3OW2 S;  2O2O A;  4F16 A;  1S72 T;  2F5T X;  2E6Z A;  3JCM X;  2MF2 A;  5A0D A;  1YJN A;  2MWO A;  1YHQ T;  3CD6 T;  1JRI A;  1WPY A;  1RLP C;  5DM7 R;  5GAO n;  2EAY A;  2DZC A;  2KEA A;  1AWO A;  3X24 B;  3TSW A;  3UPU A;  4PJM A;  2D1X A;  1HXD A;  1HSQ A;  1OOT A;  4E7H A;  5LJ5 f;  2EYQ A;  4ZTF A;  4M77 D;  2KDS A;  5CKB A;  3EGU A;  3CCJ Q;  1KQ1 A;  2MCN A;  4FYV B;  1AHJ B;  1M1G A;  5IXB A;  1UHC A;  1ZX6 A;  1B34 B;  4E47 A;  2W0Z A;  4PNO A;  1QCO A;  4J5Y A;  4Y91 A;  4V2S A;  1R0B G;  5GAO p;  1D1C A;  4II1 A;  2DK3 A;  2ED1 A;  2P0P A;  3M0P A;  1VQP A;  1I81 A;  4XTW A;  2K6D A;  2RB6 A;  3L2V A;  5A2Q E;  3M0U A;  2CKK A;  1X27 A;  1M8M A;  3EH1 A;  5LJ3 j;  1AZE A;  2XDD A;  1T0H A;  4F7U B;  2E1H A;  1WXU A;  3LYI A;  4CC7 A;  3QZ9 B;  4JJC A;  2DXC A;  1AWW A;  4IUT A;  3MP1 A;  2X4X A;  4D6W A;  3RIR A;  4EMG A;  2LQW A;  1IB8 A;  1B7T A;  2L0A A;  5GAN 8;  1OUL A;  1QQJ A;  3LGF A;  1UB4 A;  5LJ3 h;  4C8Q C;  5DLQ E;  4JLI A;  2E65 A;  2DXT A;  1BK2 A;  3A8H B;  1H92 A;  1KIK A;  4CI0 C;  1VOM A;  5LL6 S;  1VQM T;  2JW4 A;  2LX7 A;  1KQS S;  1CKA A;  2K7A A;  1NBE B;  1U5S A;  2PNI A;  1VQ9 A;  1OZ2 A;  1KC8 R;  4M77 F;  4M7A C;  1IXD A;  3QJ6 A;  1NJI C;  3LWI A;  5FU7 C;  2YLB A;  3M0S A;  4OMN A;  5J26 A;  2AKK A;  3TSZ A;  2HEQ A;  3I5S A;  4MDW A;  2HBP A;  4DQ2 A;  1Q82 R;  2M9U A;  2EQI A;  4FL6 A;  2RI5 A;  2ZZD A;  2DBK A;  3RNJ A;  5C0M A;  4QQD A;  4Z02 A;  4ATO A;  1MV0 B;  1VQ6 T;  4HA8 A;  2J05 A;  2KRO A;  2JMA A;  1PM3 A;  1P92 A;  2MOX A;  2LVM A;  1R77 A;  1Q81 R;  3CCE Q;  1OQK A;  2MK5 A;  4J6X A;  3CCV A;  4C92 G;  4QT7 A;  4N4H A;  1V29 B;  2HSE B;  1U06 A;  5IH2 A;  1TWB A;  3PE0 A;  2VUB A;  2COZ A;  3GNG A;  1YHQ Q;  3CCL A;  2K3X A;  3CD6 Q;  2P4R A;  1SEM A;  2XI9 A;  4DA4 A;  5I2M A;  1ZLM A;  1GFC A;  2RMO A;  1KFZ A;  3V8K A;  2CS7 A;  2K5L A;  2K2M A;  1YJ9 T;  4AG2 C;  4E2F B;  4ZGE B;  2DVE A;  1XOV A;  1GBQ A;  2CZ1 B;  2VXF A;  4A4H A;  5A0L A;  1W4S A;  5LJ5 d;  1D09 B;  2VWF A;  2HQE A;  1TUD A;  2DTI A;  3V7S A;  1SF9 A;  3OYH A;  2EW3 A;  4F14 A;  3L2Z A;  5IXF A;  1V76 A;  4YTL A;  1K73 U;  1ABO A;  3LGL A;  1G8X A;  3QBY A;  2YSQ A;  5LJ5 e;  1Q7Y R;  2HNI A;  4M75 F;  3CC4 A;  3HFN A;  1IHW A;  5IAY A;  2ROL A;  1BCM A;  2BUD A;  5GAO m;  3NFC A;  4FW2 A;  4BE2 A;  2OTL A;  3M59 A;  3OBY A;  1WHG A;  2EKO A;  1X01 A;  3OA6 A;  2DL5 A;  2JXB A;  1LCK A;  2CP2 A;  4N4I A;  1K0S A;  4HVW A;  4ORZ A;  2ZCF B;  2LZ6 B;  2E12 A;  4TVR A;  2HMA A;  4C92 A;  5IHN A;  2R58 A;  3QYH B;  3RMQ A;  1AWX A;  2Y4X A;  1UGR B;  5KCH A;  1YJW A;  1VQ5 A;  3MEU A;  3CXC A;  2KRN A;  4BY6 B;  5GAN 6;  1WHK A;  1VYT A;  2LNH B;  2B8A A;  2QQR A;  2DF6 A;  2ROT A;  1Q95 G;  1Y96 A;  4L5G A;  2FL7 A;  3M9Q A;  4IIO A;  1XJW B;  2KXD A;  3V7R A;  1RAD B;  2I2L A;  1X75 C;  1WZO A;  1IRX A;  2GF7 A;  3OW2 P;  1QVF A;  1UHF A;  1VQM Q;  2AK5 A;  3J80 E;  1I4K 1;  1VQO A;  2DEU A;  4M78 E;  2F1L A;  4PJO E;  4OMO A;  1VQL T;  1SPK A;  4LUD A;  2O01 E;  2EQU A;  1QP2 A;  1WHH A;  4O6J A;  1YIT T;  3A5Z B;  1FX7 A;  4CC4 B;  3PIP A;  1ZSZ A;  3GPL A;  5GAN j;  3BDU A;  3T9N A;  3PVL A;  2QAS A;  4JS4 A;  3CPW A;  3AHU A;  5EG2 A;  1UEB A;  4B9X A;  1WHL A;  1D1B A;  3G71 T;  2QQB A;  2LQN A;  2ZPB B;  4RMO A;  4E7K A;  3MCA B;  1VQ6 Q;  2XHC A;  2P4T A;  2CH4 W;  3VRY A;  2HAX A;  2MYS A;  1IGU A;  5GAN h;  1X6B A;  3M5A A;  5CQX A;  1FMV A;  5CO7 A;  2XG8 D;  1M1K C;  2JM9 A;  5FWC A;  3LX7 A;  3E1S A;  4B6M A;  4CC3 A;  1IZ6 A;  2Y4Y A;  5GAN 7;  1CKB A;  2LTO A;  4FYX B;  1OEB A;  1KC8 U;  3V8J A;  5I2S A;  1I1J A;  3SDZ A;  1WJR A;  2NYS A;  3MP6 A;  1YWO A;  1QCF A;  2RN8 A;  5LJ3 d;  3JCM g;  1YJ9 Q;  3CMA T;  2QA4 T;  1W70 A;  2DYB A;  3SWN A;  4WF2 A;  1PNJ A;  2GFU A;  1PD1 A;  1YNZ A;  1RI0 A;  3FB9 A;  2DD5 A;  4M7D F;  4HVU A;  1IHV A;  1M90 C;  4PLL A;  4M77 G;  5LJ3 e;  1K73 C;  3CC7 A;  2FRY A;  1GXI E;  2HBW A;  3G7Z A;  3O5Z A;  1Q81 U;  2YRD A;  3EG9 B;  4XQ3 A;  2GFA A;  3PMT A;  2CT4 A;  2GCX A;  1G3S A;  1KQS P;  2DL3 A;  4AFZ C;  3M54 A;  4KUD K;  3MEV A;  3L42 A;  1UE9 A;  1UJ0 A;  2QGF B;  1Q86 R;  4HVV A;  5CR2 A;  3CME T;  2O88 A;  2DIG A;  2JJ9 A;  1OX9 A;  4BB7 A;  1ACM B;  2ZPI B;  4JZ4 A;  4PLI A;  2IIM A;  2HCK A;  5J3B A;  4DBR A;  3VS4 A;  2JZ2 A;  3WXM B;  5KE2 A;  4Q5W A;  1W2B A;  2V1R A;  1VQ8 T;  3VUZ A;  1PD0 A;  2OI3 A;  3CPF A;  4N0A A;  4HCB A;  1I8F A;  2DXB A;  2CDT A;  2EYW A;  4LD6 A;  5IT9 E;  3I56 A;  4FCY A;  2YUN A;  1OX8 A;  1UDL A;  3NTK A;  3VUB A;  4FT4 A;  1WJQ A;  1WHJ A;  1UEC A;  4M78 B;  3ZEH A;  4IIM A;  4PJO B;  4AT1 B;  4AG1 C;  1VQL Q;  1PWT A;  1JXM A;  1TXQ A;  3A8M B;  5KYY B;  4BE1 A;  3THK A;  2HL5 C;  4M77 A;  1YIT Q;  1WLP B;  3I35 A;  2J06 A;  2OX7 A;  2WAC A;  2GNC A;  2C0I A;  5D6X A;  4LDU A;  3RES A;  4QQG A;  4Z89 A;  4M75 G;  2RQT A;  1NG2 A;  3G1J A;  3G71 Q;  2LP5 A;  4J83 A;  2DRK A;  4ME7 A;  1QP3 A;  2NUP B;  2D9T A;  5DLO A;  1B34 A;  1R0C B;  2ECZ A;  2GQI A;  2DX1 A;  4OP0 A;  3OS5 A;  3PNW C;  1JU5 C;  4OB2 B;  3REA B;  4KRT A;  3EGX A;  2QGG A;  1H8K A;  2V8J A;  2CGH A;  3ME9 A;  1LPL A;  2A3L A;  2VVK A;  2LCS A;  3D7S B;  4OMP A;  1K4U S;  2HSP A;  5KYW A;  1KD1 U;  3CCU A;  2F2W A;  4B9W A;  4EDU A;  4PKC C;  1D3B B;  3UWN A;  1Z9Q A;  5EC7 A;  3GOX A;  2WSF E;  1VQN T;  1QWE A;  1JBM A;  1TS9 A;  3CMA Q;  2QA4 Q;  2L3S A;  2A7Y A;  5GAN 5;  2BZY A;  4Z8A A;  2BIV A;  3OBW A;  2OAU A;  1LOJ A;  4OMQ A;  1LVK A;  3SB2 A;  2X51 A;  1QVG A;  2XD0 A;  1G3Y A;  4C8Q B;  4LNP A;  2HDA A;  3CXC S;  2DLP A;  2LDM A;  1AVZ C;  3C12 A;  4OVA A;  3HHT B;  1K9M C;  4AMC A;  1GL5 A;  1ZA2 B;  4Y28 E;  3PMI A;  2O31 A;  4VUB A;  2CP0 A;  3OYE A;  1OV3 A;  4M75 A;  1YHQ A;  2M51 A;  4RG8 A;  1KK7 A;  2O4X A;  4A54 A;  3QYG B;  3FC3 A;  5KYU A;  1QVF S;  2VB6 A;  5IHI A;  1YIJ T;  5HK3 A;  1EZZ B;  4J7I A;  5CVI A;  1D0X A;  1IO6 A;  3CME Q;  1SHG A;  4HKE A;  4RTT A;  3JB9 J;  2P0K A;  2HKQ B;  1N8R R;  5GAN d;  2C0O A;  3DKM A;  3CPW S;  1PSF A;  5CKD A;  1VQ8 Q;  2AZS A;  5CCA A;  1HYO A;  2DL7 A;  3EG2 A;  3EFO B;  1GCP A;  3CCR T;  4M78 C;  4PJO C;  3P8H A;  5GAN e;  2CUB A;  1NPR A;  2CP5 A;  2PU9 B;  1S1N A;  4J9B A;  4KGV B;  2BE7 D;  1Y71 A;  3OSV A;  1ZUU A;  3X20 B;  3UT1 A;  1N6A A;  4RTY A;  4M7D G;  1YI2 T;  1ZSG A;  3M56 A;  4WTO B;  3VS2 A;  4OB1 B;  2H8H A;  1GFD A;  3RMS A;  2G3R A;  1PCX A;  4E7I A;  3Q1J A;  2M0Y A;  2RI2 A;  2O9S A;  4NL2 A;  5GJV B;  1XTD A;  3M4G A;  5L8R E;  4A4F A;  3GP8 A;  4KT0 E;  3RKX A;  3EH2 A;  3E2U A;  2E41 A;  2DTO A;  2RHX A;  2JTE A;  3I5R A;  2L8D A;  4RTX A;  5KE3 A;  4EMK A;  2JTF A;  1JEG A;  3M58 A;  2JNG A;  3HRS A;  3QKJ A;  3EFR A;  4M7A F;  3LH0 A;  4C5E A;  1Y7X A;  2KQW A;  4KH0 B;  1E7O A;  2O9V A;  5I21 A;  4XU2 A;  2CSQ A;  2ZGW A;  2YDL A;  1KHC A;  3OYF A;  1UG1 A;  1KD1 C;  2EYY A;  5CIU A;  4BE0 A;  4HCZ A;  2E5K A;  2FPD A;  3FIF A;  2E64 A;  3OYA A;  2M0O A;  3WVE B;  1HK9 A;  1VQN Q;  3JCM h;  4LXC A;  1UGV A;  2RJC A;  4PFO A;  4PL6 A;  1WYX A;  2K3Y A;  1N9R A;  1YBY A;  3QWX X;  2KE9 A;  1H64 1;  4J6W A;  3FDR A;  2EQJ A;  1ZBJ A;  2CRE A;  3QDR B;  1W2B S;  4OF1 A;  4A63 B;  4M7D A;  2RK2 A;  3H0I A;  1UFF A;  4LDV A;  2PVD B;  1U1S A;  4M75 D;  1UJY A;  1H3H A;  3C95 A;  1GCQ C;  4PJL A;  4AFS C;  1AWJ A;  2JS2 A;  2K57 A;  2LMJ A;  3V7C A;  1M9S A;  2LCC A;  1YIJ Q;  2LNV A;  3R6O A;  1MMG A;  3PVQ A;  4C0G A;  2NUT A;  2XID A;  4ZN3 A;  1D1A A;  1OU8 A;  1RAH B;  4KBM B;  3WVD B;  4A4K A;  2BZX A;  2VGM A;  2KNB B;  2GTJ A;  2LC4 A;  2Y90 A;  3VS3 A;  4JRQ A;  4FYY B;  2CH4 A;  3TU4 K;  3ULR B;  1KSW A;  1S72 Q;  2LX9 A;  3I9Q A;  3J7A F;  3CCR Q;  1QLY A;  4LD9 K;  3GIB A;  8ATC B;  4F7U F;  2L5Q A;  2PZ1 A;  1VQ9 T;  5LJ3 f;  2DO3 A;  2V8K A;  2FZG B;  1M2O A;  1K8A R;  2CZ0 B;  4Y92 A;  4P5N A;  2DIL A;  4HT9 A;  1GRI A;  3FRN A;  2QQ9 A;  2FG0 A;  4N4G A;  4RG2 A;  1YI2 Q;  2IPO B;  1PSE A;  4D8D A;  2RPN A;  4BI8 B;  3H9N A;  3DB4 A;  2R57 A;  1GBR A;  3A98 A;  1YN8 A;  3MKD A;  4LDY A;  4MZM A;  2W10 A;  5GAO r;  4FYW B;  5GMK i;  2I0N A;  3EG1 A;  3CCS A;  1NM7 A;  3OYN A;  3JCM P;  2E4H A;  1IGQ A;  2EJG A;  3CXC P;  2EYZ A;  3CCV T;  1SKU B;  1PC0 A;  4RTU A;  2XIC A;  3MET A;  4R0K A;  1E6G A;  1QVG S;  3H41 A;  4MDX A;  1M8V A;  1VUB A;  4E7J A;  3OS0 A;  3CCL T;  3RDV A;  1TUC A;  1WI7 A;  4E7L A;  1YIT A;  1QVF P;  3CC2 A;  3UDC A;  4C5H A;  1TG0 A;  4C92 E;  3C0C A;  3RKW A;  4OMF B;  4LE9 A;  3G71 A;  1BKB A;  2RF0 A;  3TQ7 P;  2V1Q A;  3ASK A;  1WFW A;  2X9H A;  2R5A A;  3VV0 A;  2RHZ A;  2KK4 A;  1X2K A;  3VRZ A;  4DBQ A;  4RUG A;  2KI7 A;  2CUD A;  1XQH A;  4M7D D;  3EAE A;  4EPC A;  2C06 A;  2JOY A;  3JCM c;  2QTX A;  1NEG A;  2L2P A;  2ZPG B;  3E19 A;  4XTZ A;  1WQ7 A;  4RCB A;  2OTL T;  2X4Y A;  3DLM A;  4ANJ A;  3CCQ T;  2KY9 A;  2HQX A;  5AT1 B;  5KYY A;  1QVP A;  3F70 A;  2PUK B;  2H3J A;  3CBO A;  2QAZ A;  1OZ3 A;  1C0M A;  1VYV A;  4R55 A;  1YJW T;  3CMA A;  2QA4 A;  1G5V A;  4ESR A;  2D0N A;  1D0Y A;  4JRP A;  2E3I A;  3UF4 A;  4GBQ A;  4J9H A;  1J3T A;  1H3Z A;  4LDX A;  3PFS A;  4M7A G;  2EJ9 A;  5KYX A;  2K5I A;  2OAW A;  2SEM A;  1UGS B;  3MEA A;  4X9D A;  4QW2 A;  1KJW A;  1VA7 A;  3JB9 F;  1RUW A;  4NOY A;  4DOW A;  2A28 A;  4XU3 A;  2JS0 A;  1TSF A;  1M3A A;  4J9D A;  1NJI R;  1VQO T;  3EGD A;  5GMK l;  1FYN A;  3FJP A;  1ZUY A;  1VQ9 Q;  3QXE B;  1YFN A;  3EHQ A;  3MO8 A;  3JCM d;  1X2Q A;  2KXC A;  1Q82 U;  3S6W A;  1D3B A;  4BI4 A;  2D8H A;  2RD1 A;  1YCY A;  1EFN A;  1X6O A;  1ABQ A;  1ZUK A;  3OYD A;  3JCM e;  1C6V X;  2EGA A;  4JDS A;  4L59 A;  1VQ8 A;  3OYK A;  4KUL A;  3KUF A;  2VGN A;  3AT1 B;  7AT1 B;  1MNE A;  3CBP A;  2CT3 A;  5AYF A;  3JB9 H;  1RAE B;  1W2B P;  2NWM A;  1AZG B;  1NE8 A;  1QW1 A;  2FPE A;  2ZPH B;  2IG0 A;  5FRM A;  3L2R A;  2PVO B;  1O75 A;  1WIE A;  4WCI A;  3I55 T;  2RQW A;  5FWB A;  1M2V A;  5GAN f;  4M7A A;  1BI3 A;  3CCL Q;  3CCJ A;  1NEB A;  3L2U A;  1JO8 A;  1MV3 A;  3MEW A;  2X3W D;  4HCK A;  4DOV A;  2ENM A;  2LJ1 A;  4C92 B;  4JJD A;  3CEY A;  4M4Z A;  4J8O A;  2GGR A;  4IUU A;  3HP9 A;  1WXB A;  1M4Z A;  2ZPF B;  3QUI A;  2OTJ T;  2EGE A;  4F7U G;  2QQS A;  1BU1 A;  1OYX A;  2MMP A;  2PUO B;  1Y96 B;  4PJJ A;  4ELZ C;  3CC7 T;  2DFU A;  3NMZ C;  3M0R A;  1Q7Y U;  2XU8 A;  4PJN A;  2BZ8 A;  3PTA A;  6AT1 B;  4OB0 B;  2P0Q A;  1M1F A;  4J6Y A;  3H8Z A;  2NUZ A;  3VU3 C;  4NS5 A;  2KGT A;  1VQ7 T;  2OTL Q;  4M77 E;  2NLU A;  2FO0 A;  3JRZ A;  2JTM A;  4OML A;  1ZSZ B;  2MPX C;  3CCQ Q;  2V26 A;  1JJ2 A;  1LNX A;  1W1F A;  3LW5 E;  3KBG A;  4L6V 5;  3QWY A;  3HPW A;  4ZGJ B;  1NZ9 A;  1VQN A;  2FYK A;  1M30 A;  1VIE A;  3JCM Q;  1YJW Q;  2QQA A;  3H6Z A;  3BY7 A;  1VQ4 T;  1YP5 A;  2GBQ A;  1VYU A;  1T0J A;  3QG1 A;  1I5O B;  1D0Z A;  2F5K A;  2YT6 A;  1VQK T;  2E10 A;  3I56 T;  4XU1 A;  3OMC A;  2QYZ A;  3OMG A;  4XTX A;  2L3P A;  3M0T A;  3EG3 A;  2OJ2 A;  2HL3 A;  4GLK A;  4LDW A;  3JCM b;  2MI6 A;  1KC8 C;  1VQO Q;  2ATC B;  2DM1 A;  2RJF A;  1UGQ B;  4F7U A;  2E6N A;  2YUQ A;  1Y0M A;  3OQ5 A;  4FSS A;  1YIJ A;  1Q82 C;  2XDB A;  1PRL C;  2FZC B;  3M53 A;  5HK0 A;  3SWN B;  3GNF B;  2ESW A;  1OI1 A;  2A08 A;  3CCE A;  1TUG B;  1JQQ A;  3GLX A;  2JMC A;  1ZBX A;  3SD4 A;  1SRM A;  1M3C A;  3QPH A;  3H0F A;  2YUO A;  5KYN A;  1Q81 C;  1M3B A;  4C8Q D;  3CCM T;  1S72 A;  2DD4 A;  4M78 F;  1M1K R;  2EIF A;  5GJW B;  3CCR A;  2FB7 A;  3CD6 A;  1RAI B;  2M02 A;  3OYG A;  1WDX A;  2LQK A;  2XMF A;  4JRK A;  4M75 E;  2M16 A;  1IRE B;  4QVD A;  1G3T A;  5GAM g;  2J7I A;  2KAF A;  4FT2 A;  4KH1 B;  1V1C A;  5GAN 3;  2LRQ A;  3IQL A;  2F69 A;  4M7A D;  4C92 C;  2KYM A;  3I55 Q;  3TEE A;  2D0Q B;  5FRO A;  2JUF A;  3CCU T;  1X6G A;  1ZA1 B;  2F2X A;  1YI2 A;  3G6E T;  3OYI A;  1TH7 A;  4EMH A;  2GTO A;  2K2V A;  2WSE E;  2BKD N;  4BD3 A;  3JB9 G;  1RI9 A;  4XAX B;  4QVZ A;  2QEX T;  5A0G A;  2ABL A;  5GAN 4;  4IUQ A;  1M90 R;  1MHN A;  3TVT A;  1K73 R;  3ZBD A;  1I5L A;  5L23 A;  3P8B B;  1RAA B;  2L89 A;  2OTJ Q;  2DA9 A;  1NYF A;  2XK0 A;  1W6X A;  1HD3 A;  2AKL A;  1X69 A;  1YCS B;  2YXY A;  3M55 A;  5D6Y A;  1Q7Y C;  3CC7 Q;  3NPF A;  1TTH B;  4EIK A;  1ZSZ C;  1C1A A;  1U1T A;  4JLG A;  1BI0 A;  1T3L A;  3GF5 A;  1Q86 U;  3FLG A;  1YWP A;  4IUR A;  1SRL A;  2DJZ A;  2RA2 A;  2DL8 A;  4M77 B;  1RL2 A;  1WNL A;  1VQ7 Q;  3DB3 A;  4X34 A;  1G3W A;  3G4S T;  1M27 C;  4DBH A;  1MMD A;  1TOV A;  4C8Q F;  4ZTJ A;  2K3B A;  4JPB W;  5FU6 C;  3S3M A;  2AIR B;  1Y57 A;  2CP7 A;  2RO0 A;  5ECA A;  3A8O B;  2F2V A;  3A8G B;  4JZ3 A;  4QQ6 A;  4X1V A;  3LLR A;  3QDF A;  1NPP A;  1T3S A;  1VQ4 Q;  1VQM A;  4IUV A;  1YJN T;  5D6W A;  2DET A;  4IKF A;  3EGX B;  3OY9 A;  1VQK Q;  1EX4 A;  3I56 Q;  3OS1 A;  4JS5 A;  2CSI A;  3VS7 A;  4A4G A;  3RBB B;  1N9S A;  4J9G A;  1A0N B;  2DVJ A;  2YRC A;  3JCM V;  3VJP A;  3SWN C;  4OGC A;  5KYW B;  3E9F A;  2KR3 A;  2PVG B;  1VQ6 A;  4MZP A;  3HTR A;  2RI3 A;  3U23 A;  1U8R A;  3M4Y A;  2QDL A;  2ZPE B;  2CZ7 B;  1AEY A;  1G83 A;  3R6N A;  2DIQ A;  3RR6 A;  2ED0 A;  2L3R A;  1AD5 A;  2FVU A;  4M7D E;  2LT4 A;  2KMT A;  1VQP T;  1DJ7 B;  4OMM A;  3CCM Q;  5CAI A;  2FRW A;  3X25 B;  5CKF A; 
#chains in the Genus database with same CATH homology
 1W2B A;  3SFM A;  1K8A C;  1XQH A;  2KVQ G;  4M7A B;  5GAM e;  4M7D D;  1JB0 E;  2RHI A;  4M75 B;  4ELY C;  5FU7 B;  4MML A;  1VQ8 T;  2MWP A;  3EAE A;  1FWZ A;  3VUZ A;  4EPC A;  3OYC A;  2C06 A;  4N0A A;  2JOY A;  3CPF A;  3X26 B;  2O4X B;  3JCM c;  4HCB A;  2QTX A;  1I8F A;  1MGQ A;  2DXB A;  3G4S A;  4FIB A;  4LD6 A;  3URG A;  1YJ9 A;  5IT9 E;  3J81 E;  2XKO C;  3O8V A;  3RKY A;  3I56 A;  4JUV A;  2ZPG B;  3E19 A;  4XTZ A;  3CCE T;  1N27 A;  1WQ7 A;  4RCB A;  2OTL T;  3RER A;  2GQV A;  1KG1 A;  2KSS A;  2X4Y A;  1WJS A;  3NTK A;  3P8D A;  5GAN g;  3DLM A;  1ZQ1 A;  4N0A C;  3VUB A;  3CCQ T;  2KY9 A;  4FT4 A;  5GAO q;  1WJQ A;  5DY9 A;  4FU6 A;  3OW2 S;  2HQX A;  4BAC A;  4FM4 B;  4M78 B;  3ZEH A;  1QVP A;  4PJO B;  1S72 T;  3F70 A;  2F5T X;  2E6Z A;  2X4J A;  3JCM X;  1BI2 A;  5HY6 A;  2MF2 A;  5A0D A;  1JJ2 S;  2YHT A;  2PUK B;  2H3J A;  1YJN A;  3CBO A;  3V8L A;  1OZ3 A;  5IN1 A;  3A8M B;  2MWO A;  4R55 A;  3BFM A;  4BE1 A;  1YHQ T;  1YJW T;  3CD6 T;  3CMA A;  2QA4 A;  4M77 A;  1G5V A;  1JRI A;  1WPY A;  5DM7 R;  5GAO n;  4JRP A;  2EAY A;  3N5B B;  3JCM J;  2DZC A;  2K5F A;  2HD0 A;  1H3Z A;  3X24 B;  4LDX A;  3PFS A;  2WAC A;  3OYL A;  3UPU A;  4M7A G;  3A8L B;  5D6X A;  4XK8 E;  2EJ9 A;  4LDU A;  2K5I A;  4QQG A;  2VXE A;  3RES A;  1HXD A;  4M75 G;  1UGS B;  3JCM f;  3MEA A;  4X9D A;  4E7H A;  4QW2 A;  5LJ5 f;  3JB9 F;  2EYQ A;  4M77 C;  4ZTF A;  4J83 A;  1M1K U;  4NOY A;  4ME7 A;  1QP3 A;  4M77 D;  4C5G A;  2KDS A;  4DOW A;  5CKB A;  2D9T A;  4XU3 A;  5DLO A;  2LCL A;  2VV5 A;  3PIO A;  1B34 A;  1KQ1 A;  1Q86 C;  4OP0 A;  1AHJ B;  1M1G A;  1VQO T;  3OS5 A;  3QII A;  3PNW C;  1B34 B;  1M5Q 1;  4OB2 B;  5GMK l;  3CBM A;  3FJP A;  5FLX E;  4E47 A;  4PNO A;  3NTH A;  3QXE B;  4M78 G;  2V8J A;  4PJO G;  3MO8 A;  2CGH A;  4J5Y A;  2V8I A;  3ME9 A;  4Y91 A;  3JCM d;  2A3L A;  5LJ5 g;  4V2S A;  2E5Q A;  1UGP B;  5GAO p;  1N8R U;  4II1 A;  2DK3 A;  1Q82 U;  2P0P A;  3S6W A;  1VQP A;  1KQ2 A;  1D3B A;  1I81 A;  4XTW A;  4BI4 A;  2RB6 A;  3L2V A;  1KD1 U;  2RD1 A;  1YCY A;  2CKK A;  5A2Q E;  3CCU A;  1M90 U;  4B9W A;  4EDU A;  1X6O A;  5LJ3 j;  4PKC C;  1D3B B;  3OYD A;  4FSX A;  3JCM e;  3UWN A;  4EMK B;  3GOX A;  2WSF E;  1VQN T;  4JDS A;  4L59 A;  1JBM A;  1VQ8 A;  3L1A A;  2XDD A;  3JB9 D;  3OYK A;  4KUL A;  3PGG A;  3KUF A;  2VGN A;  4F7U B;  2E1H A;  3HFO A;  1VQL A;  2EFI A;  3LYI A;  4XTU A;  3JAM E;  2RHY A;  3CBP A;  3QZ9 B;  3BW1 A;  5AYF A;  3JB9 H;  2A7Y A;  2DXC A;  1BIB A;  2RM4 A;  5GAN 5;  5GMK j;  2BIV A;  3OBW A;  3MP1 A;  4IUT A;  2OAU A;  2X4X A;  1NE8 A;  1LOJ A;  3RIR A;  3SB2 A;  4D6W A;  4EMG A;  1QVG A;  2XD0 A;  1G3Y A;  1QW1 A;  4C8Q B;  3FEO A;  3VKI A;  3CXC S;  2ZPH B;  5FRM A;  2IG0 A;  5GAN 8;  2PVO B;  4A4E A;  3L2R A;  2LDM A;  1O75 A;  3CCQ A;  3C12 A;  3LGF A;  2K4Y A;  4OVA A;  1UB4 A;  5LJ3 h;  3I55 T;  3M57 A;  2EQK A;  5DLQ E;  4C8Q C;  1BIA A;  3HHT B;  2RJD A;  4JLI A;  1K9M C;  2E65 A;  2DXT A;  3JB9 I;  4GY5 A;  4Y28 E;  5CK9 A;  3A8H B;  3PMI A;  1BI3 A;  4UC4 A;  4VUB A;  2QDY B;  5GMK m;  3CCJ A;  4M7A A;  4CI0 C;  3OYE A;  4HT8 A;  4M75 A;  5LL6 S;  3TRE A;  4NL3 A;  3L2U A;  1VQM T;  1YHQ A;  3MEW A;  4RG8 A;  2CZ6 B;  2O4X A;  1KQS S;  4A54 A;  3QYG B;  4DOV A;  5J39 A;  4C0Z A;  5GMK h;  3HL8 A;  3L2W A;  2X35 A;  5GAM j;  3FC3 A;  1QVF S;  4QVC A;  4C92 B;  3CEY A;  4J8O A;  4IUU A;  3HP9 A;  5KCO A;  3CC4 T;  1VQ9 A;  1YIJ T;  2DPP B;  5HK3 A;  1M4Z A;  1OZ2 A;  3QO3 A;  4J7I A;  3INZ A;  4M77 F;  5CQY A;  5CVI A;  3ZFJ A;  2ZPF B;  4BI3 A;  4M7A C;  3CCS T;  3QJ6 A;  1NJI C;  4M75 C;  3LWI A;  3QUI A;  5FU7 C;  2YLB A;  4M7D B;  2OTJ T;  4HKE A;  4F7U G;  3JB9 J;  2QQS A;  1OYX A;  5J26 A;  5M9O A;  4R56 A;  2MMP A;  2PUO B;  1Y96 B;  2P0K A;  2VYT A;  4MDW A;  4ELZ C;  4O5V A;  2HBP A;  4M78 A;  3PT9 A;  5CKE A;  4DQ2 A;  3CC7 T;  5GAN d;  3HRT A;  2LQ8 A;  4JRI A;  4PJO A;  2M9U A;  3DKM A;  2QXF A;  4FL6 A;  2RI5 A;  2ZZD A;  4C8Q G;  3CPW S;  5C0M A;  1Q7Y U;  4QQD A;  4Z02 A;  4ATO A;  2XU8 A;  1PSF A;  2RHU A;  4HA8 A;  5GAM h;  1VQ6 T;  5CKD A;  2DTH A;  5CCA A;  5FRN A;  1P92 A;  4X9C A;  3PTA A;  3QSU A;  3QJY A;  3CCR T;  4OB0 B;  3CC2 T;  4M78 C;  2P0Q A;  1VQ5 T;  1M1F A;  4J6Y A;  2LVM A;  4PJO C;  3P8H A;  3H8Z A;  5GAN e;  3VU3 C;  4NS5 A;  1VQ7 T;  1NPR A;  2PU9 B;  4M77 E;  2NLU A;  3JRZ A;  3E9G A;  3OW2 A;  2JTM A;  2PQW A;  4J6X A;  3CCV A;  4J7F A;  4C92 G;  1JJ2 A;  5GAO l;  1Y71 A;  3OSV A;  3X20 B;  1LNX A;  4N4H A;  3LW5 E;  3KBG A;  1V29 B;  2QI2 A;  4L6V 5;  3HPW A;  2XDP A;  4ZGJ B;  3UT1 A;  1NZ9 A;  1N6A A;  1VQN A;  2VUB A;  2FYK A;  4M7D G;  1YI2 T;  2M1H A;  3M56 A;  4BDZ A;  1VIE A;  3GNG A;  4OB1 B;  3JCM Q;  2K3X A;  3CCL A;  2QQA A;  3RMS A;  2G3R A;  3BY7 A;  3H6Z A;  3MP8 A;  4E7I A;  1VQ4 T;  2XI9 A;  4DA4 A;  3MHX A;  3Q1J A;  5I2M A;  1BYM A;  2DKG A;  2RI2 A;  3S3O A;  4NL2 A;  4XU0 A;  3V8K A;  3QG1 A;  2CS7 A;  2K5L A;  2JN0 A;  1XTD A;  3M4G A;  1YJ9 T;  2F5K A;  5L8R E;  1VQK T;  2E10 A;  4ZGE B;  2DVE A;  1XOV A;  2CZ1 B;  4ZN1 A;  2VXF A;  2YRV A;  4IUP A;  4A4F A;  3I56 T;  3GP8 A;  4XU1 A;  4KT0 E;  3RKX A;  4A4H A;  5A0L A;  3CME A;  2RJE A;  1W4S A;  3OMC A;  5LJ5 d;  2E41 A;  2DTO A;  3OMG A;  2RHX A;  3I55 A;  4XTX A;  3OYB A;  2L8D A;  2HQE A;  3V7S A;  2DTI A;  4GLK A;  3RUX A;  2EWN A;  4LDW A;  5KE3 A;  4EMK A;  3JCM b;  2JTF A;  2MI6 A;  3OYH A;  1KC8 C;  4MMK A;  2DAQ A;  3M58 A;  2RJF A;  3L2Z A;  4HCC A;  2JNG A;  2DEQ A;  4YTL A;  1UGQ B;  4F7U A;  3HRS A;  1K73 U;  3LGL A;  3QKJ A;  2E6N A;  3QBY A;  5LJ3 g;  3EFR A;  3VYG A;  4M7A F;  3OQ5 A;  5LJ5 e;  2FHD A;  3VYH B;  3LH0 A;  2HNI A;  1Y7X A;  4C5E A;  4M75 F;  3CC4 A;  1N8R C;  3HFN A;  3QZ5 B;  2KQW A;  1YIJ A;  3ER0 A;  4C0D B;  1Q82 C;  2XDB A;  5I21 A;  4EMK C;  4XU2 A;  5IAY A;  2ZGW A;  4C8Q A;  3M53 A;  5HK0 A;  2BUD A;  1KHC A;  5GAO m;  3NFC A;  3OYF A;  4JJN K;  2EQM A;  2OTJ A;  3SWN B;  3GNF B;  1KD1 C;  5GAM f;  1OI1 A;  1VQ5 A;  3CCE A;  5CIU A;  4BE2 A;  4C8Q E;  2RH2 A;  2WSC E;  4BE0 A;  3GLX A;  3DLL A;  4HCZ A;  3M59 A;  2OTL A;  3FIF A;  1ZBX A;  2E64 A;  3SD4 A;  3OYA A;  3OBY A;  3OSS C;  3QPH A;  2EKO A;  1X01 A;  3OA6 A;  2M0O A;  1Q81 C;  3WVE B;  1HK9 A;  5GAN f;  1O9S A;  3JCM h;  2DXU A;  4N4I A;  4C8Q D;  3CCM T;  2RJC A;  1S72 A;  1K9M U;  2DD4 A;  4M78 F;  4PL6 A;  2K3Y A;  1N9R A;  1LJO A;  1YBY A;  2ZCF B;  3QHS A;  2E12 A;  4TVR A;  1H64 1;  4J6W A;  4C92 A;  2EIF A;  4OB3 B;  2R58 A;  3QYH B;  3RMQ A;  3CCR A;  1Y07 A;  2Y4X A;  1UGR B;  2FB7 A;  3FDR A;  3OYY A;  2EQJ A;  3MEU A;  4CRI A;  5KCH A;  1YJW A;  3OYG A;  3CD6 A;  3CXC A;  4M7A E;  4OGE A;  2LQK A;  4JRK A;  3QDR B;  4M75 E;  1K8A U;  2M16 A;  1IRE B;  4BY6 B;  4OF1 A;  5GAN 6;  1G3T A;  4QVD A;  5GAM g;  3JCM W;  1W2B S;  1VQ7 A;  4M7D A;  2KAF A;  2RK2 A;  4FT2 A;  3L2Q A;  3JSC A;  4RKU E;  2B8A A;  2QQR A;  5GAN 3;  2LRQ A;  2LT1 A;  2F69 A;  4M7A D;  1Y96 A;  4L5G A;  4LDV A;  4BY6 C;  2PVD B;  4C92 C;  1U1S A;  2FL7 A;  3M9Q A;  4M75 D;  3TEE A;  4C92 D;  4BDY A;  2D0Q B;  5FRO A;  3V7R A;  2JUF A;  3BDL A;  2I2L A;  3CCU T;  1X75 C;  2X4W A;  1KQS A;  3C95 A;  1YI2 A;  3G6E T;  2D6F A;  2GF7 A;  1XNI A;  4M7D C;  1QVF A;  2E70 A;  1TH7 A;  4EMH A;  3OYI A;  2K2V A;  2WSE E;  2BKD N;  4BD3 A;  3JB9 G;  3J80 E;  1I4K 1;  2K57 A;  1VQ4 A;  1VQO A;  4XAX B;  4M78 E;  4QVZ A;  2QEX T;  4PJO E;  5A0G A;  3V7C A;  1M9S A;  1WGS A;  4IUQ A;  5GAN 4;  1VQL T;  3OB9 A;  5C6S A;  1MHN A;  2LCC A;  2LNV A;  2O01 E;  3R6O A;  2EQU A;  3ZBD A;  1QP2 A;  4O6J A;  1YIT T;  1I5L A;  1VQK A;  3A5Z B;  3P8B B;  1FX7 A;  4C0G A;  2L89 A;  4M78 D;  4A53 A;  3PIP A;  4PJO D;  2XK0 A;  3GPL A;  5GAN j;  3BDU A;  2XID A;  4ZN3 A;  3T9N A;  2VC8 A;  4JS4 A;  3M55 A;  5D6Y A;  3CPW A;  3AHU A;  5EG2 A;  1UEB A;  4KBM B;  3WVD B;  4A4K A;  4B9X A;  1Q7Y C;  3G71 T;  4XTY A;  2VGM A;  2LC4 A;  4JRQ A;  2Y90 A;  2QQB A;  2ZPB B;  4RMO A;  4E7K A;  1FXX A;  3MCA B;  2YLC A;  3KXT A;  3TU4 K;  4C5I A;  2XHC A;  3CCJ T;  2P4T A;  2LX9 A;  1U1T A;  4JLG A;  3TCJ A;  2HAX A;  3J7A F;  1BI0 A;  4LD9 K;  3GIB A;  1R8O B;  1VIF A;  3GF5 A;  1Q86 U;  4F7U F;  3FLG A;  2L5Q A;  4IUR A;  2DJZ A;  2RA2 A;  5GAN h;  1VQ9 T;  4M77 B;  1RL2 A;  1WNL A;  2DO3 A;  3M5A A;  5CQX A;  5LJ3 f;  3DB3 A;  3EFS A;  3OS2 A;  2V8K A;  5CO7 A;  4X34 A;  5FU6 B;  1G3W A;  3G4S T;  2XG8 D;  5HKC A;  1M1K C;  1KHI A;  2CZ0 B;  4C8Q F;  3LX7 A;  4ZTJ A;  3LWH A;  4P5N A;  4HT9 A;  3E1S A;  5FU6 C;  3FRN A;  2QQ9 A;  5GAN 2;  3S3M A;  2R5M A;  3HKS A;  1IZ6 A;  2RO0 A;  2Y4Y A;  4N4G A;  4RG2 A;  5GAN 7;  1WQW A;  3HRU A;  3CCM A;  3OYJ A;  3A8O B;  1PSE A;  3A8G B;  2LTO A;  4QQ6 A;  3LLR A;  1NPP A;  4BI8 B;  3DB4 A;  2R57 A;  1VQM A;  1KC8 U;  3V8J A;  4IUV A;  1YJN T;  5D6W A;  5I2S A;  3SDZ A;  1WJR A;  3MP6 A;  4KUI A;  4XTV A;  4LDY A;  4MZM A;  4IKF A;  3X28 B;  5LJ3 d;  3JCM g;  3S3N A;  3CMA T;  2QA4 T;  5LJ5 j;  5GAO r;  4F7U E;  3OY9 A;  4C92 F;  1SSF A;  5GMK i;  3SWN A;  4WF2 A;  3OS1 A;  4JS5 A;  2GFU A;  1RI0 A;  3CCS A;  3OYN A;  3JCM P;  4A4G A;  3FB9 A;  1BI1 A;  2DD5 A;  2EJG A;  1N9S A;  4M7D F;  2EJF A;  3CCV T;  4C0D C;  1M90 C;  2XIC A;  3MET A;  4PLL A;  3NTI A;  4M77 G;  3JCM V;  5LJ3 e;  4BUG A;  3G6E A;  3VJP A;  3CC7 A;  1QVG S;  1K73 C;  3SWN C;  4MDX A;  1M8V A;  1VUB A;  4OGC A;  3C94 A;  4MZT A;  1GXI E;  4E7J A;  3G7Z A;  2CYZ B;  3OS0 A;  3E9F A;  2QEX A;  1Q81 U;  2PVG B;  3OYM A;  4MZP A;  1VQ6 A;  2RI3 A;  3CCL T;  4XQ3 A;  2GFA A;  3PMT A;  5LJ5 h;  2AHJ B;  4PJO F;  2GCX A;  2RK1 A;  1G3S A;  1U8R A;  3M4Y A;  5GMK e;  4E7L A;  3M54 A;  1YIT A;  2ZPE B;  4KUD K;  1ZHI A;  2CZ7 B;  3MEV A;  5CKH A;  3CC2 A;  3L42 A;  3UDC A;  4C5H A;  2JVV A;  2MAM A;  4C92 E;  3C4S A;  2DIQ A;  3HSB A;  3RKW A;  4OMF B;  5CR2 A;  5GAM d;  3CME T;  2IVW A;  4C0F A;  2DIG A;  2L3R A;  3G71 A;  4BB7 A;  1BKB A;  2DZ9 A;  2FVU A;  2ZPI B;  3ASK A;  4M7D E;  2LT4 A;  2KMT A;  4PLI A;  1NJI U;  1VQP T;  1DJ7 B;  4RCC A;  5KH6 A;  1EIF A;  5J3B A;  2R5A A;  3VV0 A;  2RHZ A;  4ZGD B;  2JZ2 A;  2KK4 A;  5CAI A;  3WXM B;  5KE2 A;  3X25 B;  5CKF A;  4Q5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...