4PJOF

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, f, t
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoF00
2E10A 5GAN4 4C92A 2DTHA 4M78F 3V8KA 5GAN3 4C92B 1HK9A 1YCYA 3L2ZA 4M78E 2EJ9A 2JN0A 1BIAA 4MMLA 4X9CA 4C92G 2DTIA 5LJ5d 4NL3A 4C8QF 3FJPA 4QVDA 5GAMe 1BIBA 3JB9D 4NL2A 2RA2A 5GAMg 5GMKe 2DTOA 4XTWA 5GAN2 1I4K1 4XU0A 3VU3C 4M75D 3V8LA 5GAN7 4JLIA 1JBMA 1Y96A 5LJ3g 3FIFA 1HXDA 3JB9I 4J6WA 4M7DB 4EMKA 1Y96B 3JCMd 2DVEA 3AHUA 4PJOD 3RIRA 3HFNA 4EMKB 3RESA 5LJ5f 4M7DF 1I81A 5GANh 3SB2A 5GANd 5GAOn 2DXUA 4NOYA 4M78B 2VXEA 4J6XA 4PNOA 4WF2A 4M75C 1WQ7A 3L1AA 5GANj 4M77D 4C8QA 3JB9H 4XTVA 4EMHA 1KQ2A 4M7AD 4XU3A 3SWNC 4C8QB 4N0AA 3JCMf 3JCMc 4C8QG 4M75E 2YHTA 3BFMA 2EJGA 2RM4A 4QVCA 2EWNA 4PJOF 3QSUA 3RUXA 1B34A 3EFRA 4F7UE 2FB7A 1LNXA 1D3BB 3BY7A 3EFSA 5GANf 4HT8A 4PJOE 4C92D 1B34B 2EJFA 1X01A 5LJ3e 4M7DA 4RCBA 1JRIA 3RKYA 4M77C 1LOJA 5GAOp 1I5LA 5LJ5e 4M7AC 1N9RA 5GAMh 4M7DG 5LJ5g 5GAOr 2DJZA 4J5YA 1MGQA 2VC8A 5GMKh 2E64A 2Y90A 4M77E 3JCMP 3JB9J 5GAMj 3PGGA 4M78A 2FYKA 4M7AE 2DZ9A 5GMKj 4DQ2A 4HT9A 3V7RA 5GAOl 4RCCA 3JB9F 4C92C 4M78G 3V8JA 5GAOm 3JCMe 3RKXA 2QTXA 4EMGA 3RKWA 4M75F 3JCMg 2CGHA 4XTYA 3JCMX 4PJOB 4C92E 2RD1A 2DEQA 3BW1A 3JCMQ 4F7UF 3RERA 1D3BA 4V2SA 4XU2A 3BDUA 4HA8A 3QUIA 2DXTA 4C8QD 3V7CA 3JCMW 2I2LA 4JRIA 3GIBA 4M77B 4EMKC 1I8FA 1M8VA 4A53A 4PJOC 4M77F 3V7SA 4Y91A 5GAMd 5GAN6 4M7AF 3HFOA 2VXFA 4XQ3A 1TH7A 4M78C 5GMKi 5GAOq 5LJ3h 1U1SA 4M75A 5LJ3d 4M7DD 1U1TA 3JB9G 5LJ5h 4M75B 1M5Q1 1WNLA 4X9DA 3SWNA 4C8QC 5CAIA 4M75G 4F7UA 5LJ3j 2E1HA 4J6YA 3INZA 4N0AC 5DY9A 3SWNB 4C92F 2YLBA 5LJ5j 4PJOA 4F7UB 4C8QE 4F7UG 2E41A 4XTZA 5I21A 4JRKA 4PJOG 2HNIA 4M78D 3JCMV 5GAMf 1LJOA 5GANe 5GMKl 3JCMJ 2YLCA 4XTXA 5GANg 4XTUA 5GMKm 3FB9A 4OP0A 3JCMb 3QHSA 4A54A 3JCMh 4MMKA 5LJ3f 5GAN5 4M7DC 4M77A 4XU1A 2DZCA 1H641 1WPYA 2DKGA 4M7AA 2RB6A 4JUVA 2K57A 2ZGWA 4M77G 4M7AB 5GAN8 4M7DE 2E65A 3HSBA 2EAYA 4M7AG 3M4GA 1KQ1A 1WQWA 1N9SA 3QO3A
chains in the Genus database with same CATH superfamily
3THKA 1LPLA 3PVLA 4A4KA 2LQKA 3M0PA 1MMNA 2YDLA 3TU4K 2JN0A 4J8OA 4X9CA 1VIEA 1IHVA 3VS3A 1BIBA 4ELYC 4M75D 2D0QB 4MZPA 4M7DB 4ME7A 4JJDA 3UATA 2VGNA 1UTIA 4BDYA 1I81A 2ECZA 5FRMA 3CC7A 4JJCA 4C5IA 3CCRQ 2EKOA 1FMWA 1PC0A 4C8QB 3EGDA 3JCMc 4M75E 2D9TA 4PJOF 2FB7A 2ZZDA 1B34B 4RUGA 3CEYA 2R5AA 3FEOA 2DXBA 2EGAA 4RTZA 3CD6A 1WGSA 1RAIB 1NG2A 2F2XA 3GNFB 1UGVA 1QVPA 3QZ9B 2KYBA 3AT1B 3NMZC 2FVUA 1YJNA 1QMCA 1BK2A 2QEXT 3BW1A 3DB4A 2RQWA 4FYYB 2QXFA 4A4GA 3TREA 3EH1A 3GNGA 2CP0A 1TUCA 1PKSA 3GIBA 2XHCA 5EG2A 5CKHA 2DBKA 2LCCA 4M7AF 2IVWA 2YWWA 4XQ3A 3MCAB 4BY6B 3E9GA 4IUVA 1K9MR 2VVKA 3JB9G 2C06A 1E6HA 2OX7A 2F2WA 2E5KA 2E1HA 2RMOA 3H0HA 3SEMA 1M3AA 5KYUB 4HXJA 3LGLA 5IH2A 5GAMf 3JCMV 2GQVA 1Y57A 1BYMA 3JCMb 3U23A 2JW4A 4M7DC 2K9GA 5FROA 4PKCC 3OYCA 4HCKA 2K79A 2E65A 3RNJA 4AG2C 3QO3A 2MMPA 4MDWA 2AT1B 1YHQA 2X4XA 2CKKA 3OYGA 1K8AU 2LZ6B 4XU0A 1VQ9Q 1I1JA 1I07A 5CQXA 4K11A 2EW3A 2EYZA 2D6FA 2LT1A 2IIMA 4AFQC 3O8VA 1KC8U 2QEXQ 1OZ2A 3VS5A 3CCUT 4C8QA 3CCQT 3OB9A 3REBB 1VQOA 3JCMf 2LNHB 1SRMA 2NWMA 1B34A 1UG1A 4LDUA 2VGMA 5LJ3e 4J9EA 2PUOB 4FYXB 3RKYA 2BUDA 1I5LA 3OS5A 1SF9A 4J5YA 4J9DA 1X75C 1MGQA 2VC8A 1WHKA 3VS6A 2CP2A 1WXTA 5GMKj 3X26B 3LH5A 4OMPA 4HT9A 4OVAA 4R0KA 4RCCA 3V8JA 5CR2A 1IB8A 2LDMA 4AFSC 3CCJA 2NLUA 2R58A 2X51A 4F7UF 2AKKA 1G83A 1AZGB 3ZFJA 1WXBA 1PD1A 2K2VA 3HP9A 1I8FA 2KI7A 2JT4A 4A53A 2DD5A 1YI2T 2HZYA 3HFOA 5GAOq 3ZL7C 1HD3A 2FO0A 4C0DB 4ZGEB 2A28A 4N0AC 4GLMA 3P8BB 3UT1A 5I21A 4XTZA 5FU7C 3VS1A 1FX7A 1NJIU 5LJ3f 1S1NA 3H41A 4LDXA 3PNWC 4VUBA 1MUZA 2K57A 3CCQQ 2PTKA 3Q1JA 4M7AG 1VQKA 2RK2A 2DL3A 2F1LA 4LNPA 2YRCA 1Q86U 4CC4B 4E47A 3CCVA 2ED0A 2DD4A 5KYWB 2EJ9A 3DB3A 2OI3A 4FYVB 1Q82R 3CC7T 1Q86C 9ATCB 2MOXA 2GQIA 4LDWA 5IHNA 1ACMB 1SEMA 3EGUA 1ZLMA 2EPDA 3HHTB 4R56A 3HFNA 2A37A 2OTJA 3SB2A 2JUFA 4BE2A 3CC4A 3TSZA 4EMHA 4J9GA 1M3CA 2YHTA 4PFOA 2LX9A 4QVCA 4E7ZA 3OYLA 3MEWA 4OB0B 3BY7A 1YI2Q 1KD1R 2CP7A 2EJFA 2QTVA 3C94A 3CCLQ 4JS4A 1O75A 1M3BA 2QA4T 1GCQA 4DBHA 1NPPA 2LCLA 2LQ8A 1VQPA 2NUTB 4LUEA 4LDYA 2KT8A 1OU8A 1NPRA 1IZ6A 4ZTFA 1WJRA 4PJOB 2J06A 3OYAA 2DF6A 1K0SA 2F2VA 2E12A 1XJWB 3V7CA 4HCBA 2QGGA 2L5QA 2R5MA 3C12A 4E7HA 4YTLA 4A4EA 1Q7YR 3L2UA 3JSCA 2Z0WA 2KYMA 4FW2A 1ZA2B 3SWNB 2BZ8A 5LJ5j 1K73R 1UHFA 4F7UG 1LJOA 1YHQT 1ZHIA 1G3WA 4BD3A 2MYSA 2QK0A 2QI2A 3LW5E 2LQNA 1X69A 3CD6Q 2WACA 3MPUB 4M7AB 2HBWA 1YJ9A 5IXFA 2LQWA 1YJNQ 2LNVA 3UF4A 4FSSA 5GMKe 3VU3C 2C0OA 1QW1A 1Z9ZA 3J81E 2YRDA 5KCHA 2KRNA 2DIGA 3M0SA 4M7DF 3OYBA 4ZGJB 2X9HA 4OMMA 1K9MU 4NOYA 2DM1A 4B9WA 3I5SA 4XU3A 4WTOB 2KMTA 1OEBA 1W70A 3EFSA 1VIFA 4LD6A 3PIOA 2D0NA 3NTKA 2E6ZA 2DL8A 2OAUA 3E19A 3DLLA 4KGZB 3CCEA 1VQ7A 2D1XA 3LX7A 2NUTA 4N4HA 4C92C 1YHQQ 3TEEA 4JZ4A 2PVDB 2PUKB 4RG2A 3WXMB 3QKJA 2VWFA 4PJMA 2RNAA 1D0ZA 2KNBB 4FW1A 1QCFA 2RJFA 3I56A 2NUZA 2ZPBB 3NTHA 4UC4A 3CCSA 4OB3B 4GBQA 3OYDA 4Y91A 2GFAA 1N5ZA 5GMKi 4BB7A 2DX1A 4PLLA 5CK9A 1VQOQ 1M5Q1 3SWNA 2L3PA 1WIEA 3ZEHA 3CXCP 2KSSA 1G3SA 4F7UB 4OGEA 2LVMA 1IXDA 2NYSA 3UWNA 4M78D 4BDZA 1VA7A 1GXIE 3QIIA 3PMTA 2L2PA 2DLPA 4M7AA 4JUVA 1QWFA 3CQTA 1QVGP 1F1BB 2AKLA 4PK4A 1WX6A 1R0BG 1YIJA 4M78E 3CCJQ 3X25B 3OYEA 4NL2A 2XG8D 1VYVA 1RAHB 3FIFA 3JB9I 2KRSA 4EMKB 3IQLA 2HDAA 2FL7A 3CMAA 5GAOn 3E9FA 3VJPA 2ABLA 4WF2A 3S3NA 5IHKA 1WHMA 3PTAA 3MKDA 3OSSC 3SHWA 2EQJA 4F14A 4R55A 1JQQA 1GFCA 1WHLA 1RI0A 2RPNA 1UHCA 2X4YA 1VOMA 5LJ5e 4JJBA 4MZTA 5GAMh 4M7DG 3FRNA 3CXCA 1VQKQ 3NHNA 5CO7A 4N4IA 3CCVQ 2JS0A 2RHXA 2L3QA 1T0HA 1WZOA 5DLOA 4EDUA 2QTXA 4KH1B 3RKWA 2CGHA 2MF2A 2M0YA 8ATCB 1QVGA 2GF7A 4AFZC 1KG1A 4FIBA 4Z8AA 1IRXA 4M77B 2X35A 1YITA 2LJ0A 2OTJQ 3S6WA 1H92A 4M78C 1VQ4A 3VS7A 1U1SA 4IUTA 2CREA 3CC4Q 1ZBXA 2LP5A 1D1AA 4F7UA 4TVRA 4J6YA 4N4GA 2E41A 5HK0A 3M0TA 1KD1U 3CCRT 2DBMA 3FB9A 4A54A 3JCMh 4MMKA 4ESRA 3MEUA 4KRTA 4EIKA 1G3TA 3UA7A 5FU6B 1M90C 1QWEA 1ZUUA 3CBMA 1VQPQ 5J3BA 2JTFA 4PJNA 1PRMC 1WQWA 1VQ6A 2HBPA 2BTTA 3GBQA 4OB1B 3PFSA 4RKUE 5GAN3 2GGRA 1NYFA 2DO3A 2CT4A 4JS5A 1BBZA 2CZ1B 2MPXC 2RQVA 1IGUA 3LWHA 1RABB 3A8GB 4CI0C 4JLIA 2WSEE 2V1RA 4EMKA 3QPHA 2V26A 2I0NA 4DA4A 3RESA 1RADB 1WA7A 1AZEA 4C0GA 1WHJA 1Q7YU 2K3BA 1T3LA 4XTVA 3M0QA 1KQ2A 6AT1B 3UPUA 2LTOA 4IUQA 3G7ZA 1VQ8Q 2HSPA 1Q81U 1ZUYA 4O6JA 1K76A 4QT7A 1PHTA 1N6AA 1GFDA 3M0RA 4M77C 3VS2A 5GAOp 1Q81C 4BE0A 1N9RA 3NGPA 1YJ9Q 3I56T 1NEGA 4MDXA 3G71A 1ABOA 4QKUA 4D6WA 5HY6A 3CPWS 3RKXA 1HSQA 4HKEA 4FU6A 4DBQA 1JU5C 3EGXB 3VYGA 4C8QD 2KROA 2CUDA 2P0QA 5FU6C 2CUBA 1JXMA 1V76A 1W2BP 4AT1B 1VQ9T 2KT1A 2CDTA 2HAXA 1GL5A 3OY9A 1Q95G 1UE9A 2Y4YA 1DJ7B 3CCMA 4J7FA 4X9DA 1C6VX 2K7AA 1I0CA 1MV3A 4C92F 1SSHA 2YT6A 3VS4A 4C8QE 2JMCA 4JRKA 5GMKl 2NUPB 4OF1A 4OP0A 2X3WD 3QHSA 1LVKA 4XU1A 3CCEQ 1VQ7Q 1QCOA 2HL5C 2COYA 1UB4A 1QKXA 1WDXA 2CP5A 3HSBA 1YFNA 4IUUA 5GAN4 1NZ9A 2KVQG 4XK8E 3CMAT 1YCYA 3VUZA 5LJ5d 1T0JA 3M57A 3KUFA 1I4K1 3I56Q 3V8LA 1YCSB 4J6WA 2KRMA 2COZA 2XU8A 2DVEA 3CCSQ 5CKBA 2MK5A 2RJEA 5GANh 5M9OA 1QVFS 3DKMA 3OW2P 4M75C 2EIFA 2W10A 3EHRA 1GBRA 2QQRA 5IT9E 4QQ6A 4PJJA 4Z88A 2EJGA 2RM4A 2QQ9A 5I2SA 1CKAA 1FMKA 2COWA 1MMDA 3RUXA 1W2BA 1PWTA 5FU7B 1M2OA 2EQUA 3G6EA 3EG0A 2XI9A 4M7DA 4RCBA 3A8MB 1VYUA 1K8AC 3HRUA 5KCOA 3HRSA 2CZ0B 2E5QA 4C0FA 5I2MA 1FMVA 2FYKA 1ZBJA 2IPOB 2ROLA 1YIJQ 1N8RU 1RL2A 2BZYA 5KE3A 3C4SA 1VQ4T 1KC8C 1N8RC 4KT0E 2KY9A 1EZZB 2E4HA 2EQIA 2CP6A 3QJYA 3E2UA 3QUIA 1M1KR 2O88A 4BACA 1BI2A 3WVEB 1TS9A 1ZUKA 1M8VA 2F5TX 3CMAQ 2CYZB 3A8OB 2VXFA 1U3OA 3QWXX 1JJ2P 2CS7A 3VKIA 5DLQE 3VYHB 1RUWA 2P84A 2OTLA 5IN1A 1VQ6T 2NUPA 4PJOG 5KYNA 2FPFA 1J3TA 3OW2A 2DZCA 1UGPB 2JNGA 2CH4A 4FT4A 3SD4A 2JVVA 1M27C 2RI5A 2KEAA 2RHUA 3CCLT 3OS0A 3AHUA 2EYYA 3BE3A 3VRYA 4M78F 1K4US 2DAQA 1RAAB 5KYUA 4C92G 3LYIA 4QVDA 1XQHA 3OYJA 3JB9D 3OBWA 5GAN7 4LN2A 5HK3A 4BUGA 1XTDA 1HXDA 1YITQ 1BI0A 3HL8A 2FZGB 1NJIC 2ESWA 1VQ4Q 4E7SA 1BI1A 2JTMA 1UUEA 3BDLA 2C0TA 2EQKA 4J6XA 1AOJA 2DXCA 4N0AA 2CSIA 2A7YA 2RQRA 3BFMA 1TSFA 5FW9A 1LCKA 3OYHA 2HMAA 3I55A 2QAZA 1JJ2A 4C5EA 5D6XA 2EVRA 2SRCA 4DEXA 2DL7A 3M54A 2B86A 5LJ5g 4QQGA 1OX8A 1NYGA 2XK0A 1VQ6Q 3TVTA 2JS2A 1WI7A 1UGRB 3CD6T 4LD9K 2QQSA 1PSEA 1YJNT 2AHJB 2I2LA 3ZBDA 2LC4A 3A98A 2M9UA 2QDLA 1ZX6A 4M77F 1W1FA 3H8ZA 4KGXB 5DY9A 1Z9QA 5KYYB 3OYIA 3S3MA 2MIOA 2DE0X 2ATCB 7AT1B 5C0MA 4QVZA 4JZ3A 3M5AA 2ZAEA 3MO8A 3G71Q 1WHGA 2G6FX 2O9SA 3GPLA 2GTOA 4LDVA 1N9SA 1KQSS 1PD0A 4C5HA 3KXTA 1OPKA 3FC3A 4C92B 2O9VA 4L59A 1VQNA 1IHWA 3FJPA 2FRYA 4JPBW 2QQBA 2EBPA 5GAN2 1VQ8A 3CMEA 2JMAA 2HQXA 2KXCA 2ROTA 1FYNA 3RDVA 2EKHA 3J7AF 3KFVA 4Y92A 3CCMQ 4D8DA 3L1AA 5KYWA 2PZ1A 3ASKA 4M7AD 3M9QA 3M4YA 1U06A 2EWNA 3QSUA 2O31A 3EH2A 5C6SA 1D1CA 1D3BB 1VQOT 3MEAA 2KAFA 5CKDA 1OPLA 4KULA 3LWIA 3JCMP 3PGGA 1R0CB 4M7AE 2GCXA 1PSFA 1Y07A 2K2MA 3S3OA 1QLYA 5GAOm 3PE0A 1AWWA 4M75F 1KFZA 2RI2A 1K9MC 3PT9A 3G4SA 1WXUA 2JOYA 3R6NA 2MI6A 1V29B 3RERA 2YSQA 2Y4XA 2OTLT 3M0UA 2O4XB 3X28B 2XDPA 3CCJT 1M2VB 1VQ5Q 2A36A 3LLRA 3JAME 2LX7A 1B3QA 5GAN6 3NFCA 2YXYA 4OMLA 4ANJA 2A08A 4JLGA 4PJOA 2GFUA 5CIUA 5KYYA 1PRLC 3QJ6A 3G6EQ 1PM3A 4F17A 4OMFB 2KXDA 1W4SA 1IGQA 1H641 4OMNA 1WPYA 1PCXA 2WSFE 1GBQA 4M77G 4CRIA 2BE9B 5L8RE 2E10A 4RTXA 4FL6A 4C92A 4IURA 3CPFA 3V8KA 3L2ZA 4ZGDB 1VQKT 1BU1A 1SSFA 2KE9A 1VQMA 3CCVT 2RJCA 1K0XA 2DNUA 1M1KU 1RLPC 5LL6S 1Y0MA 3T9NA 3P8HA 2F69A 3I55T 2DRMA 3REAB 5GANd 4WCIA 3KBGA 4IUPA 2DXUA 4M78B 2L3SA 4E7IA 2YUPA 2OTLQ 3QWYA 1H3ZA 1KK7A 2OTJT 2HKNA 4OB2B 1EFNA 1TXQA 2CT3A 2O2OA 3CC4T 4F7UE 1B07A 4LE9A 1UJ0A 3VUBA 1U5SA 2E64A 3JB9J 5GAMj 1W2BS 2QYZA 3EAEA 5A0GA 3JCMX 1VQPT 1OYXA 2DIQA 3X24B 2O4XA 3OYYA 5FWCA 1MMGA 2RJDA 4V2SA 4XU2A 2FZKB 2EQMA 4ZTJA 3OBYA 4MZMA 1OZ3A 3V7SA 1OULA 1X2KA 1G2BA 1ZSZC 5CAIA 3A5ZB 3GP8A 4M75G 2RHYA 1Q82U 2E3IA 1E6GA 3I55Q 2KR3A 1Q82C 1JB0E 3A8HB 2X3XD 1KSWA 2KQWA 1BCOA 1OQKA 4M4ZA 1VQ8T 3RBBB 2XDBA 4Q5WA 1TWBA 1MMAA 1AWOA 2MCNA 3SDZA 1G8XA 5IHIA 1NEBA 1V1CA 1YJ9T 3OW2S 3EGDB 5HCKA 5KYXB 2DVJA 1T3SA 4FYWB 3FDRA 2E70A 3MEVA 1JBMA 1NLPC 3QDFA 2X4WA 1XOVA 3HKSA 4FM4B 3CCUA 4E7LA 1AWXA 2E6NA 1KD1C 2FHDA 2RHZA 1K9AA 5HKCA 5LJ5f 3OYNA 5CKEA 4QW2A 1X2QA 2HQEA 1Q86R 1WHHA 4OMQA 2O01E 4KBMB 1AVZC 3EFOB 2JZ2A 1GCPA 1O9SA 2LT4A 2DYIA 1D0XA 3EFRA 1LNXA 3GF5A 4FSXA 3QZ5B 3UA6A 5GAOr 2DJZA 1UGQB 2CH4W 2GNCA 4AFUC 2JM9A 3V7RA 3CCET 2KBTA 1VQ7T 1JJ2S 1M1GA 1VQNQ 1KIKA 1UEBA 2HSEB 1S72A 1EIFA 3H6ZA 3DLMA 1K73U 1Q7YC 3HRTA 4RMOA 1OI1A 3CMEQ 2V1QA 1BI3A 1K73C 1ZSGA 3JV3A 2E3HA 3PVQA 1OOTA 1KJWA 4FT2A 1TH7A 3ME9A 5LJ3h 5KE2A 1FWZA 4M7DD 1Y7XA 1R8OB 2HCKA 4F04B 4M75B 3CCST 1WNLA 3M53A 2VYTA 3OMGA 2C0IA 2HNIA 3I35A 3C0CA 2LJ3A 2QASA 2DA9A 1QQJA 2YUQA 4M77A 4E2FB 1VQMT 5D6WA 5AYFA 4IIMA 1UGSB 4IKFA 2P4RA 4M7DE 4HVUA 2PQWA 3EHQA 3M4GA 5I22A 1YJWA 3QBYA 3TSWA 4C5GA 3M59A 1OV3A 1I5OB 4A4FA 4MMLA 5KYXA 2SEMA 3G4SQ 4A4HA 2K5LA 4L6V5 5GAMe 3E1SA 4GLKA 1VYTA 2DTOA 4XTWA 4ORZA 1YIJT 4J9HA 4J9BA 2P4TA 1Y96B 1X6BA 2GTJA 3RIRA 2BIVA 2JTEA 4L5GA 1H8KA 2ZPFB 3META 3EFOA 5GANj 2G3RA 1Y71A 3L2QA 2H3EB 3M55A 4JDSA 2XDDA 2ZPIB 1AWJA 2QA4A 1M30A 4OGCA 1UECA 4HT8A 2DJQA 1BCMA 4DBFA 4J7IA 3LGFA 3L2WA 2HL3A 1VQ5A 4BI3A 4EPCA 1PNJA 3A8LB 1JXOA 4HCCA 2PVOB 1HYOA 1P92A 3JCMe 4EMGA 1M8MA 1X6GA 2KK4A 4ZNXA 1SG5A 1AHJB 2IG0A 1VQMQ 3JCMQ 3L42A 2ZCFB 1QKWA 2ZPHB 4CC3A 1JO8A 2GBQA 3TQ7P 1WFWA 5CVIA 5KH6A 4M75A 1WYXA 1YITT 1N27A 2FZCB 4CC2A 4C8QC 1GRIA 3MP1A 1MNEA 3H0FA 4B6MA 1VQLA 2W0ZA 4RTVA 1BKBA 3EGXA 3L2RA 2DYBA 2YLCA 1UDLA 4XTUA 5IXBA 2AZVA 4O5VA 5GAN5 1PG5B 1ZQ1A 5EC7A 2ZGWA 1G3YA 3QXEB 3QYHB 3EG1A 1KQ1A 1E7OA 2HKQB 4PFZA 4DBRA 5I11A 4RTUA 1M4ZA 3UDCA 3C95A 2HD0A 3N5BB 4PL6A 1SPKA 4E7JA 5D7UA 1Y96A 2ED1A 2ZPEB 2FPEA 2J05A 2OJ2A 5A0DA 2PNIA 1M1FA 2J6OA 5D6YA 4BY6C 5AT1B 1QCNA 2VXEA 2V8JA 2P0PA 4PNOA 4ATOA 4CC7A 2FRWA 4DOVA 3VV0A 1OU9A 3ULRB 3CC2A 1RAGB 1S72T 3OMCA 2HEQA 2OAWA 1JRIA 4JRQA 1WJQA 3LH0A 2V8KA 4J9FA 2P0KA 2MAMA 5GMKh 2KDSA 2WSCE 3CPWP 3M56A 1RI9A 2VV5A 2EYQA 2X4JA 4XTYA 3G71T 2RD1A 3G1JA 1CKBA 5J26A 3PIPA 2EYWA 2RO0A 3BDUA 2LCSA 2DERA 2DXTA 3X20B 3JCMW 2K6DA 3CCUQ 1MHNA 2QQAA 3EG9B 4A63B 4P5NA 5GAMd 3PMIA 5L23A 1M9SA 2RH2A 1U1TA 3VS0A 5J39A 2EGCA 1YJWT 2J6FA 2EGEA 1D09B 4E6RA 1W6XA 3RMSA 4J9IA 3CCMT 5GANe 3CXCS 1UFFA 2RHIA 2CSQA 4BI8B 2EYXA 2M0OA 3A1PA 2DKGA 3HTRA 1GCQC 2L8DA 1CSKA 1QVGS 5IAYA 3M58A 4RG8A 2J7IA 3QG1A 1S72Q 4NL3A 1B7TA 3CPWA 4D8KA 1M90R 3JCMd 1QVFP 4PJOD 4JJNK 2B8AA 3R6OA 1TOVA 1QP3A 1KHCA 2K5FA 5DM7R 3MP8A 3L2VA 2K3XA 4C0DC 1VQ5T 2LMJA 2QDYB 3OYMA 1U8RA 2DILA 2RF0A 4KUDK 3D7SB 5GANf 4PJOE 4PJLA 4C92D 5GJWB 1X01A 4RTWA 2YUNA 2DEUA 1LOJA 2H8HA 4C0ZA 3ER0A 3CC7Q 3G6ET 1YJWQ 2DZ9A 1AEYA 5CKFA 1H3HA 4KH0B 2RQUA 4M78G 1RAFB 5CQYA 1RAEB 4C92E 2FEIA 1Q81R 5A2QE 3RMQA 4HA8A 1VQLT 3OYKA 2BE7D 4JRIA 1UJYA 3EG9A 1RLQC 4FCYA 4E7KA 2VKNA 4AMCA 2A3LA 5LJ3d 3EG3A 3TCJA 1TUGB 2QG9B 3CCRA 5LJ5h 1PKTA 1QVFA 2YLBA 3WVDB 2QA4Q 1AT1B 2RB6A 1NM7A 8AT1B 4LUDA 5GAN8 3CBOA 1HJDA 2L0AA 5FLXE 1ABQA 1YWOA 2DTHA 1FXXA 1G5VA 2DL5A 1HK9A 4PJOC 2DTIA 2PVGB 4DEYA 4C8QF 1AD5A 2R57A 5GAMg 4DOWA 4HCZA 2RQTA 1YN8A 3QYGB 2AK5A 4RTYA 3CC2T 2D8JA 4KGVB 4HVVA 1QP2A 2VASA 4PLIA 4F16A 2FG0A 2RI3A 4B9XA 2VB6A 2XD0A 1X27A 1ZSZB 1NE8A 4Z89A 3SWNC 1NLOC 1C1AA 2DPPB 1MNDA 1TG0A 1VQLQ 3I9QA 2ENMA 3OYFA 2L89A 3MHXA 4JRPA 4PFPA 1TTHB 2QGFB 2K3YA 4M7AC 2MWPA 5CCAA 1IO6A 1M1KC 1EX4A 3FJ5A 2JM8A 2BKDN 4ZN1A 2DFUA 5GAOl 2M02A 3JCMg 1D0YA 2KGTA 5GJVB 4QQDA 4Z02A 3OA6A 1X43A 3P8DA 1D3BA 3J80E 4ELZC 1K8AR 2AIRB 1VQ9A 2XKOC 3CBPA 2A0FB 5A0LA 1SKUB 2F5KA 4LXCA 1NBEB 3HPWA 1XNIA 2RK1A 3MJXA 1KC8R 2QEXA 3OSVA 1N8RR 2XIDA 3SFMA 4J83A 4Y28E 4XAXB 2K4YA 3CC2Q 2K5IA 2DMOA 2EFIA 4XTXA 2M16A 1M2VA 2LRQA 2RN8A 4NS5A 1KQSP 2LJ1A 3OS1A 1R77A 1SHFA 2EAYA 3QDRB 3H9NA 2BZXA 4IIOA 1D1BA 1BIAA 2XMFA 2CP3A 2RA2A 1A0NB 2M1HA 2VUBA 5LJ3g 1ZA1B 1VQNT 3EG2A 4RTTA 2FPDA 2MWOA 3CMET 2YRVA 2CZ7B 3JRZA 1ZSZA 3GLXA 1WQ7A 3NPFA 3JB9H 4M77D 1RACB 3FLGA 4KUIA 2J6KA 4X1VA 4C8QG 1TU0B 3H0IA 1SRLA 4J9CA 1K1ZA 4AG1C 2H3JA 2CZ6B 3MP6A 3VRZA 1KHIA 1WJSA 1NJIR 3GOXA 1TUDA 1C0MA 1MV0B 2DK3A 2DRKA 3CCQA 2Y90A 1YBYA 4M77E 2L3RA 4HVWA 4M78A 4ZN3A 2DETA 1OX9A 3I5RA 4DQ2A 1ARKA 3JB9F 2XICA 4BE1A 2DEQA 1KQSA 1M90U 1VUBA 1YP5A 1YNZA 3G4ST 4EMKC 4II1A 2PU9B 3O5ZA 2ZPGB 1WLPB 2AZSA 4BI4A 3F70A 2HQHA 1X6OA 4X34A 1YWPA 5LJ3j 4GY5A 3INZA 5ECAA 1IREB 2JJ9A 4OMOA 3NTIA 5FRNA 2JXBA 3JCMJ 2M51A 5GANg 5GMKm 5FWBA 1YI2A 2DL4A 3CCLA 3OQ5A 3URGA 2V8IA 1SHGA 1JEGA 3OS2A 1BB9A 2YUOA 2D8HA 3RR6A
chains in the Genus database with same CATH topology
1KQSS 4A4KA 4C5HA 3KXTA 2LQKA 1YIJA 3FC3A 4C92B 3TU4K 4M78E 2JN0A 4J8OA 4X9CA 4L59A 1M4ZA 3X25B 1VIEA 1VQNA 3FJPA 3UDCA 1BIBA 3OYEA 2QQBA 4NL2A 2XG8D 5GAN2 1VQ8A 4ELYC 3C95A 2HD0A 3N5BB 4M75D 2D0QB 4MZPA 4PL6A 4E7JA 3CMEA 1Y96A 3FIFA 2ZPEB 2HQXA 3JB9I 4M7DB 3J7AF 4ME7A 5A0DA 2VGNA 4EMKB 4BDYA 1I81A 1M1FA 2FL7A 3CMAA 5D6YA 4BY6C 5GAOn 5FRMA 3CC7A 3E9FA 3VJPA 2VXEA 2V8JA 2P0PA 4PNOA 4WF2A 3L1AA 4C5IA 2EKOA 3S3NA 4ATOA 3ASKA 3PTAA 4M7AD 3M9QA 4DOVA 4C8QB 3M4YA 3JCMc 4M75E 3VV0A 3OSSC 2D9TA 2EQJA 2EWNA 4PJOF 4R55A 3CC2A 3QSUA 5C6SA 2FB7A 1D3BB 2ZZDA 1VQOT 1B34B 1S72T 3OMCA 1RI0A 3MEAA 2X4YA 1JRIA 2KAFA 4JRQA 1WJQA 3CEYA 3LH0A 2R5AA 3FEOA 5CKDA 2DXBA 4MZTA 5LJ5e 2V8KA 5GAMh 4M7DG 4KULA 3LWIA 3FRNA 1WGSA 2P0KA 2MAMA 5GMKh 2KDSA 2WSCE 3CXCA 3JCMP 3PGGA 3GNFB 5CO7A 3M56A 4M7AE 4N4IA 1QVPA 2GCXA 1PSFA 1Y07A 3QZ9B 3S3OA 2RHXA 2VV5A 2FVUA 5DLOA 1YJNA 2EYQA 5GAOm 2X4JA 4EDUA 2QTXA 3RKWA 4M75F 2CGHA 4XTYA 3G71T 2RI2A 2MF2A 1K9MC 3PT9A 2QEXT 3G4SA 2RD1A 2JOYA 3BW1A 3DB4A 1QVGA 3RERA 2MI6A 1V29B 5J26A 3PIPA 2Y4XA 2RO0A 2OTLT 2GF7A 2O4XB 2QXFA 3BDUA 3X28B 4A4GA 3TREA 2DXTA 3GNGA 3X20B 1KG1A 4FIBA 3JCMW 2XDPA 3CCJT 3GIBA 4M77B 2X35A 2XHCA 5EG2A 1YITA 5CKHA 3LLRA 1MHNA 2QQAA 3JAME 4P5NA 5GAMd 2LCCA 3S6WA 3PMIA 5GAN6 4M7AF 2IVWA 4XQ3A 4M78C 3MCAB 1VQ4A 4BY6B 1M9SA 2RH2A 1U1SA 3E9GA 3NFCA 4IUTA 4IUVA 2C06A 1U1TA 3JB9G 5J39A 1ZBXA 4JLGA 4F7UA 4TVRA 2E1HA 4J6YA 1YJWT 4PJOA 2GFUA 4N4GA 3RMSA 5CIUA 2E41A 3LGLA 5HK0A 5GAMf 3CCMT 3JCMV 1KD1U 5GANe 2GQVA 3QJ6A 3CXCS 3CCRT 1BYMA 3FB9A 3JCMb 4A54A 3JCMh 2RHIA 4MMKA 4BI8B 4OMFB 4M7DC 3MEUA 1W4SA 2M0OA 1H641 1WPYA 2DKGA 1G3TA 2WSFE 5FU6B 5FROA 1M90C 4PKCC 4M77G 3OYCA 2E65A 3CBMA 4CRIA 2L8DA 5J3BA 2JTFA 1WQWA 5L8RE 1QVGS 3QO3A 2E10A 2MMPA 5IAYA 3M58A 2HBPA 4FL6A 4RG8A 4C92A 1VQ6A 4MDWA 4OB1B 3PFSA 3CPFA 4IURA 4RKUE 3V8KA 5GAN3 3QG1A 3L2ZA 4ZGDB 1YHQA 2X4XA 1VQKT 2CKKA 1SSFA 4NL3A 3OYGA 2DO3A 4JS5A 2CZ1B 1K8AU 3CPWA 3LWHA 2RJCA 3CCVT 1VQMA 3A8GB 4XU0A 4CI0C 4JLIA 1M1KU 2WSEE 5LL6S 4EMKA 3QPHA 5CQXA 3JCMd 3T9NA 4PJOD 4DA4A 3P8HA 2F69A 3RESA 4JJNK 3I55T 2B8AA 2D6FA 3R6OA 2LT1A 5GANd 1QP3A 1KHCA 2K5FA 3KBGA 3O8VA 4IUPA 4C0GA 5DM7R 3MP8A 2DXUA 1OZ2A 2K3XA 4M78B 3L2VA 4C0DC 1Q7YU 3CD6A 4E7IA 3CCUT 4C8QA 1VQ5T 4XTVA 1KQ2A 3CCQT 2QDYB 3OYMA 1H3ZA 3OB9A 1VQOA 1U8RA 2OTJT 3JCMf 3UPUA 4OB2B 2LTOA 4IUQA 3G7ZA 4KUDK 1Q81U 1B34A 3CC4T 4F7UE 5GANf 4LDUA 4PJOE 4O6JA 4C92D 2VGMA 1N6AA 1X01A 5LJ3e 2PUOB 3RKYA 4M77C 1LOJA 2BUDA 5GAOp 1Q81C 1I5LA 4BE0A 3OS5A 1N9RA 4J5YA 3VUBA 1X75C 1MGQA 2VC8A 3ER0A 4C0ZA 3I56T 2E64A 3G6ET 4MDXA 3JB9J 5GAMj 3G71A 2DZ9A 4D6WA 5CKFA 3X26B 5GMKj 5HY6A 3CPWS 1W2BS 4HT9A 4OVAA 4RCCA 4M78G 3V8JA 3EAEA 3RKXA 5A0GA 5CR2A 2LDMA 5CQYA 3CCJA 3JCMX 1VQPT 4C92E 2NLUA 1OYXA 2DIQA 4FU6A 2O4XA 2R58A 3OYYA 4HKEA 3X24B 2RJDA 4F7UF 4V2SA 4XU2A 5A2QE 3RMQA 3VYGA 4HA8A 4C8QD 3ZFJA 1VQLT 3OYKA 2EQMA 4JRIA 2K2VA 2P0QA 3HP9A 1I8FA 5FU6C 4ZTJA 3OBYA 4MZMA 4A53A 2DD5A 1OZ3A 3V7SA 1YI2T 1VQ9T 3HFOA 4E7KA 5GAOq 2HAXA 3OY9A 2Y4YA 2A3LA 5LJ3d 1DJ7B 3TCJA 3CCMA 4J7FA 4C0DB 3CCRA 5LJ5h 5CAIA 3A5ZB 4X9DA 3GP8A 4M75G 4ZGEB 2RHYA 1Q82U 4N0AC 4C92F 1QVFA 2YLBA 3WVDB 3P8BB 3UT1A 4C8QE 5I21A 4XTZA 5FU7C 4JRKA 1FX7A 5GMKl 1Q82C 4OF1A 1JB0E 1NJIU 3A8HB 4OP0A 3QHSA 5LJ3f 4LDXA 4XU1A 3PNWC 2KQWA 4VUBA 2RB6A 1VQ8T 2XDBA 4Q5WA 2K57A 1UB4A 5GAN8 3Q1JA 3HSBA 4M7AG 1VQKA 3CBOA 2RK2A 4IUUA 3SDZA 5FLXE 1Q86U 5GAN4 4E47A 2DTHA 3CCVA 1NZ9A 1FXXA 2KVQG 2DD4A 4XK8E 1G5VA 3CMAT 1HK9A 1YCYA 3VUZA 5LJ5d 2EJ9A 3DB3A 3OW2S 1YJ9T 4PJOC 2DTIA 2PVGB 3CC7T 4C8QF 1Q86C 2R57A 3M57A 5GAMg 3KUFA 4LDWA 4DOWA 4HCZA 1I4K1 2E70A 3FDRA 3V8LA 3MEVA 1JBMA 3QYGB 3HHTB 2X4WA 4J6WA 1XOVA 2XU8A 3HKSA 4R56A 2DVEA 3CC2T 4FM4B 3CCUA 4E7LA 1KD1C 2E6NA 3HFNA 2FHDA 2RHZA 5CKBA 2RJEA 5HKCA 5LJ5f 3OYNA 2OTJA 5GANh 1QP2A 4PLIA 3SB2A 5M9OA 1QVFS 5CKEA 3DKMA 4QW2A 2HQEA 2RI3A 4B9XA 2JUFA 4M75C 4BE2A 2O01E 2XD0A 3CC4A 4KBMB 4EMHA 2EIFA 2JZ2A 1NE8A 2QQRA 5IT9E 3SWNC 2DPPB 4QQ6A 1O9SA 2YHTA 2EJGA 3OYFA 2RM4A 2LX9A 2QQ9A 4QVCA 2L89A 5I2SA 3OYLA 2LT4A 3MHXA 3MEWA 3RUXA 4JRPA 1W2BA 3EFRA 4OB0B 1LNXA 3BY7A 5FU7B 2EQUA 3G6EA 2EJFA 3C94A 3GF5A 2XI9A 4FSXA 4JS4A 4M7DA 1O75A 4RCBA 3A8MB 1K8AC 3QZ5B 2K3YA 3HRUA 4M7AC 2MWPA 5KCOA 3HRSA 2DJZA 2CZ0B 5CCAA 2QA4T 5GAOr 1UGQB 1M1KC 2E5QA 4C0FA 5I2MA 1NPPA 2FYKA 2LCLA 2LQ8A 1VQPA 3V7RA 2BKDN 4LDYA 4ZN1A 5GAOl 1N8RU 1VQ7T 3CCET 1RL2A 1JJ2S 1M1GA 5KE3A 3JCMg 1NPRA 1IZ6A 1UEBA 3C4SA 1VQ4T 1S72A 1EIFA 4ZTFA 1WJRA 3H6ZA 3DLMA 1KC8C 4PJOB 1K73U 1Q7YC 1N8RC 4QQDA 4KT0E 2KY9A 4Z02A 3OA6A 3P8DA 1D3BA 3J80E 3HRTA 4ELZC 3OYAA 4RMOA 1OI1A 3QJYA 3QUIA 1BI3A 2E12A 1VQ9A 2XKOC 3V7CA 1K73C 3CBPA 4HCBA 5A0LA 4BACA 2L5QA 2R5MA 1BI2A 3C12A 3WVEB 1KC8U 1M8VA 2F5KA 4YTLA 2F5TX 4E7HA 4A4EA 2CYZB 4FT2A 3HPWA 1XNIA 3A8OB 2VXFA 2RK1A 1TH7A 4LDVA 3ME9A 2CS7A 5LJ3h 3VKIA 5KE2A 2QEXA 1FWZA 5DLQE 4M7DD 1Y7XA 3OSVA 3L2UA 3VYHB 1R8OB 3CCST 4M75B 2XIDA 1WNLA 2OTLA 3JSCA 4J83A 3SFMA 4Y28E 3M53A 5IN1A 3SWNB 5LJ5j 1VQ6T 2VYTA 4XAXB 2K4YA 4F7UG 2K5IA 3OMGA 4PJOG 2HNIA 2EFIA 1LJOA 1YHQT 1ZHIA 4XTXA 1G3WA 2M16A 4BD3A 2LRQA 4M77A 3OW2A 2DZCA 2QI2A 1UGPB 2JNGA 4FT4A 3LW5E 5D6WA 3SD4A 5AYFA 1VQMT 2JVVA 4NS5A 2WACA 4M7AB 1UGSB 4IKFA 4M7DE 2RI5A 3OS1A 2EAYA 2PQWA 3M4GA 1YJ9A 2RHUA 3CCLT 1YJWA 3QBYA 3QDRB 3OS0A 3AHUA 4C5GA 4M78F 3M59A 2DAQA 4A4FA 4MMLA 1BIAA 4C92G 2LNVA 3LYIA 2K5LA 4A4HA 4QVDA 4L6V5 5GAMe 1XQHA 3E1SA 4GLKA 3OBWA 2RA2A 3OYJA 3JB9D 5GMKe 2DTOA 4XTWA 2M1HA 2VUBA 3VU3C 5HK3A 5GAN7 1QW1A 4BUGA 1YIJT 1XTDA 3J81E 5KCHA 5LJ3g 1HXDA 1VQNT 2P4TA 1BI0A 1Y96B 2DIGA 3HL8A 3RIRA 4M7DF 3OYBA 2BIVA 4ZGJB 2MWOA 1NJIC 4L5GA 3CMET 1BI1A 2JTMA 2CZ7B 2YRVA 2ZPFB 3JRZA 3META 1K9MU 4NOYA 3BDLA 5GANj 2EQKA 4J6XA 2G3RA 3GLXA 1WQ7A 3JB9H 1Y71A 4M77D 4B9WA 3FLGA 4KUIA 3L2QA 2DXCA 4XU3A 3M55A 4JDSA 4N0AA 4C8QG 2A7YA 3BFMA 2XDDA 2ZPIB 2KMTA 2QA4A 3OYHA 2H3JA 4OGCA 3EFSA 4HT8A 2CZ6B 1VIFA 3MP6A 4LD6A 3PIOA 3I55A 1KHIA 1JJ2A 1WJSA 3NTKA 4C5EA 2E6ZA 5D6XA 2OAUA 3E19A 3LGFA 4J7IA 3L2WA 3GOXA 3DLLA 3CCEA 1VQ7A 3M54A 5LJ5g 2DK3A 4QQGA 1VQ5A 4BI3A 2XK0A 3CCQA 2Y90A 1YBYA 3LX7A 4M77E 4EPCA 2L3RA 3A8LB 4M78A 4ZN3A 4HCCA 2PVOB 4DQ2A 4N4HA 3JB9F 4C92C 1UGRB 3JCMe 1P92A 3CD6T 2XICA 4EMGA 3TEEA 4BE1A 4LD9K 2KK4A 2PVDB 2PUKB 2DEQA 1AHJB 2IG0A 2QQSA 3QKJA 4RG2A 3WXMB 3JCMQ 1PSEA 1KQSA 3L42A 1M90U 2ZCFB 1YJNT 1VUBA 2RJFA 3I56A 2AHJB 2ZPBB 2I2LA 3ZBDA 2ZPHB 3NTHA 2LC4A 3G4ST 4EMKC 4II1A 2M9UA 2PU9B 4UC4A 3CCSA 4OB3B 4M77F 2ZPGB 3OYDA 4Y91A 2GFAA 5CVIA 4BI4A 5GMKi 3F70A 5KH6A 4BB7A 4M75A 4PLLA 1YITT 1N27A 1X6OA 4X34A 5CK9A 4C8QC 1M5Q1 3SWNA 3MP1A 5LJ3j 3H8ZA 4GY5A 3ZEHA 3INZA 5DY9A 1IREB 1G3SA 2KSSA 4F7UB 1VQLA 4OGEA 2LVMA 3UWNA 1BKBA 3NTIA 4M78D 5FRNA 3L2RA 3JCMJ 4BDZA 2YLCA 5GANg 1GXIE 4XTUA 3QIIA 5GMKm 1YI2A 3OYIA 3PMTA 3S3MA 4O5VA 5GAN5 3CCLA 3OQ5A 3URGA 4M7AA 5C0MA 4QVZA 4JUVA 1ZQ1A 3M5AA 3MO8A 2V8IA 2ZGWA 1G3YA 3QXEB 3QYHB 3OS2A 1KQ1A 3GPLA 1N9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E10 A;  5GAN 4;  4C92 A;  2DTH A;  4M78 F;  3V8K A;  5GAN 3;  4C92 B;  1HK9 A;  1YCY A;  3L2Z A;  4M78 E;  2EJ9 A;  2JN0 A;  1BIA A;  4MML A;  4X9C A;  4C92 G;  2DTI A;  5LJ5 d;  4NL3 A;  4C8Q F;  3FJP A;  4QVD A;  5GAM e;  1BIB A;  3JB9 D;  4NL2 A;  2RA2 A;  5GAM g;  5GMK e;  2DTO A;  4XTW A;  5GAN 2;  1I4K 1;  4XU0 A;  3VU3 C;  4M75 D;  3V8L A;  5GAN 7;  4JLI A;  1JBM A;  1Y96 A;  5LJ3 g;  3FIF A;  1HXD A;  3JB9 I;  4J6W A;  4M7D B;  4EMK A;  1Y96 B;  3JCM d;  2DVE A;  3AHU A;  4PJO D;  3RIR A;  3HFN A;  4EMK B;  3RES A;  5LJ5 f;  4M7D F;  1I81 A;  5GAN h;  3SB2 A;  5GAN d;  5GAO n;  2DXU A;  4NOY A;  4M78 B;  2VXE A;  4J6X A;  4PNO A;  4WF2 A;  4M75 C;  1WQ7 A;  3L1A A;  5GAN j;  4M77 D;  4C8Q A;  3JB9 H;  4XTV A;  4EMH A;  1KQ2 A;  4M7A D;  4XU3 A;  3SWN C;  4C8Q B;  4N0A A;  3JCM f;  3JCM c;  4C8Q G;  4M75 E;  2YHT A;  3BFM A;  2EJG A;  2RM4 A;  4QVC A;  2EWN A;  4PJO F;  3QSU A;  3RUX A;  1B34 A;  3EFR A;  4F7U E;  2FB7 A;  1LNX A;  1D3B B;  3BY7 A;  3EFS A;  5GAN f;  4HT8 A;  4PJO E;  4C92 D;  1B34 B;  2EJF A;  1X01 A;  5LJ3 e;  4M7D A;  4RCB A;  1JRI A;  3RKY A;  4M77 C;  1LOJ A;  5GAO p;  1I5L A;  5LJ5 e;  4M7A C;  1N9R A;  5GAM h;  4M7D G;  5LJ5 g;  5GAO r;  2DJZ A;  4J5Y A;  1MGQ A;  2VC8 A;  5GMK h;  2E64 A;  2Y90 A;  4M77 E;  3JCM P;  3JB9 J;  5GAM j;  3PGG A;  4M78 A;  2FYK A;  4M7A E;  2DZ9 A;  5GMK j;  4DQ2 A;  4HT9 A;  3V7R A;  5GAO l;  4RCC A;  3JB9 F;  4C92 C;  4M78 G;  3V8J A;  5GAO m;  3JCM e;  3RKX A;  2QTX A;  4EMG A;  3RKW A;  4M75 F;  3JCM g;  2CGH A;  4XTY A;  3JCM X;  4PJO B;  4C92 E;  2RD1 A;  2DEQ A;  3BW1 A;  3JCM Q;  4F7U F;  3RER A;  1D3B A;  4V2S A;  4XU2 A;  3BDU A;  4HA8 A;  3QUI A;  2DXT A;  4C8Q D;  3V7C A;  3JCM W;  2I2L A;  4JRI A;  3GIB A;  4M77 B;  4EMK C;  1I8F A;  1M8V A;  4A53 A;  4PJO C;  4M77 F;  3V7S A;  4Y91 A;  5GAM d;  5GAN 6;  4M7A F;  3HFO A;  2VXF A;  4XQ3 A;  1TH7 A;  4M78 C;  5GMK i;  5GAO q;  5LJ3 h;  1U1S A;  4M75 A;  5LJ3 d;  4M7D D;  1U1T A;  3JB9 G;  5LJ5 h;  4M75 B;  1M5Q 1;  1WNL A;  4X9D A;  3SWN A;  4C8Q C;  5CAI A;  4M75 G;  4F7U A;  5LJ3 j;  2E1H A;  4J6Y A;  3INZ A;  4N0A C;  5DY9 A;  3SWN B;  4C92 F;  2YLB A;  5LJ5 j;  4PJO A;  4F7U B;  4C8Q E;  4F7U G;  2E41 A;  4XTZ A;  5I21 A;  4JRK A;  4PJO G;  2HNI A;  4M78 D;  3JCM V;  5GAM f;  1LJO A;  5GAN e;  5GMK l;  3JCM J;  2YLC A;  4XTX A;  5GAN g;  4XTU A;  5GMK m;  3FB9 A;  4OP0 A;  3JCM b;  3QHS A;  4A54 A;  3JCM h;  4MMK A;  5LJ3 f;  5GAN 5;  4M7D C;  4M77 A;  4XU1 A;  2DZC A;  1H64 1;  1WPY A;  2DKG A;  4M7A A;  2RB6 A;  4JUV A;  2K57 A;  2ZGW A;  4M77 G;  4M7A B;  5GAN 8;  4M7D E;  2E65 A;  3HSB A;  2EAY A;  4M7A G;  3M4G A;  1KQ1 A;  1WQW A;  1N9S A;  3QO3 A; 
#chains in the Genus database with same CATH topology
 3THK A;  1LPL A;  3PVL A;  4A4K A;  2LQK A;  3M0P A;  1MMN A;  2YDL A;  3TU4 K;  2JN0 A;  4J8O A;  4X9C A;  1VIE A;  1IHV A;  3VS3 A;  1BIB A;  4ELY C;  4M75 D;  2D0Q B;  4MZP A;  4M7D B;  4ME7 A;  4JJD A;  3UAT A;  2VGN A;  1UTI A;  4BDY A;  1I81 A;  2ECZ A;  5FRM A;  3CC7 A;  4JJC A;  4C5I A;  3CCR Q;  2EKO A;  1FMW A;  1PC0 A;  4C8Q B;  3EGD A;  3JCM c;  4M75 E;  2D9T A;  4PJO F;  2FB7 A;  2ZZD A;  1B34 B;  4RUG A;  3CEY A;  2R5A A;  3FEO A;  2DXB A;  2EGA A;  4RTZ A;  3CD6 A;  1WGS A;  1RAI B;  1NG2 A;  2F2X A;  3GNF B;  1UGV A;  1QVP A;  3QZ9 B;  2KYB A;  3AT1 B;  3NMZ C;  2FVU A;  1YJN A;  1QMC A;  1BK2 A;  2QEX T;  3BW1 A;  3DB4 A;  2RQW A;  4FYY B;  2QXF A;  4A4G A;  3TRE A;  3EH1 A;  3GNG A;  2CP0 A;  1TUC A;  1PKS A;  3GIB A;  2XHC A;  5EG2 A;  5CKH A;  2DBK A;  2LCC A;  4M7A F;  2IVW A;  2YWW A;  4XQ3 A;  3MCA B;  4BY6 B;  3E9G A;  4IUV A;  1K9M R;  2VVK A;  3JB9 G;  2C06 A;  1E6H A;  2OX7 A;  2F2W A;  2E5K A;  2E1H A;  2RMO A;  3H0H A;  3SEM A;  1M3A A;  5KYU B;  4HXJ A;  3LGL A;  5IH2 A;  5GAM f;  3JCM V;  2GQV A;  1Y57 A;  1BYM A;  3JCM b;  3U23 A;  2JW4 A;  4M7D C;  2K9G A;  5FRO A;  4PKC C;  3OYC A;  4HCK A;  2K79 A;  2E65 A;  3RNJ A;  4AG2 C;  3QO3 A;  2MMP A;  4MDW A;  2AT1 B;  1YHQ A;  2X4X A;  2CKK A;  3OYG A;  1K8A U;  2LZ6 B;  4XU0 A;  1VQ9 Q;  1I1J A;  1I07 A;  5CQX A;  4K11 A;  2EW3 A;  2EYZ A;  2D6F A;  2LT1 A;  2IIM A;  4AFQ C;  3O8V A;  1KC8 U;  2QEX Q;  1OZ2 A;  3VS5 A;  3CCU T;  4C8Q A;  3CCQ T;  3OB9 A;  3REB B;  1VQO A;  3JCM f;  2LNH B;  1SRM A;  2NWM A;  1B34 A;  1UG1 A;  4LDU A;  2VGM A;  5LJ3 e;  4J9E A;  2PUO B;  4FYX B;  3RKY A;  2BUD A;  1I5L A;  3OS5 A;  1SF9 A;  4J5Y A;  4J9D A;  1X75 C;  1MGQ A;  2VC8 A;  1WHK A;  3VS6 A;  2CP2 A;  1WXT A;  5GMK j;  3X26 B;  3LH5 A;  4OMP A;  4HT9 A;  4OVA A;  4R0K A;  4RCC A;  3V8J A;  5CR2 A;  1IB8 A;  2LDM A;  4AFS C;  3CCJ A;  2NLU A;  2R58 A;  2X51 A;  4F7U F;  2AKK A;  1G83 A;  1AZG B;  3ZFJ A;  1WXB A;  1PD1 A;  2K2V A;  3HP9 A;  1I8F A;  2KI7 A;  2JT4 A;  4A53 A;  2DD5 A;  1YI2 T;  2HZY A;  3HFO A;  5GAO q;  3ZL7 C;  1HD3 A;  2FO0 A;  4C0D B;  4ZGE B;  2A28 A;  4N0A C;  4GLM A;  3P8B B;  3UT1 A;  5I21 A;  4XTZ A;  5FU7 C;  3VS1 A;  1FX7 A;  1NJI U;  5LJ3 f;  1S1N A;  3H41 A;  4LDX A;  3PNW C;  4VUB A;  1MUZ A;  2K57 A;  3CCQ Q;  2PTK A;  3Q1J A;  4M7A G;  1VQK A;  2RK2 A;  2DL3 A;  2F1L A;  4LNP A;  2YRC A;  1Q86 U;  4CC4 B;  4E47 A;  3CCV A;  2ED0 A;  2DD4 A;  5KYW B;  2EJ9 A;  3DB3 A;  2OI3 A;  4FYV B;  1Q82 R;  3CC7 T;  1Q86 C;  9ATC B;  2MOX A;  2GQI A;  4LDW A;  5IHN A;  1ACM B;  1SEM A;  3EGU A;  1ZLM A;  2EPD A;  3HHT B;  4R56 A;  3HFN A;  2A37 A;  2OTJ A;  3SB2 A;  2JUF A;  4BE2 A;  3CC4 A;  3TSZ A;  4EMH A;  4J9G A;  1M3C A;  2YHT A;  4PFO A;  2LX9 A;  4QVC A;  4E7Z A;  3OYL A;  3MEW A;  4OB0 B;  3BY7 A;  1YI2 Q;  1KD1 R;  2CP7 A;  2EJF A;  2QTV A;  3C94 A;  3CCL Q;  4JS4 A;  1O75 A;  1M3B A;  2QA4 T;  1GCQ A;  4DBH A;  1NPP A;  2LCL A;  2LQ8 A;  1VQP A;  2NUT B;  4LUE A;  4LDY A;  2KT8 A;  1OU8 A;  1NPR A;  1IZ6 A;  4ZTF A;  1WJR A;  4PJO B;  2J06 A;  3OYA A;  2DF6 A;  1K0S A;  2F2V A;  2E12 A;  1XJW B;  3V7C A;  4HCB A;  2QGG A;  2L5Q A;  2R5M A;  3C12 A;  4E7H A;  4YTL A;  4A4E A;  1Q7Y R;  3L2U A;  3JSC A;  2Z0W A;  2KYM A;  4FW2 A;  1ZA2 B;  3SWN B;  2BZ8 A;  5LJ5 j;  1K73 R;  1UHF A;  4F7U G;  1LJO A;  1YHQ T;  1ZHI A;  1G3W A;  4BD3 A;  2MYS A;  2QK0 A;  2QI2 A;  3LW5 E;  2LQN A;  1X69 A;  3CD6 Q;  2WAC A;  3MPU B;  4M7A B;  2HBW A;  1YJ9 A;  5IXF A;  2LQW A;  1YJN Q;  2LNV A;  3UF4 A;  4FSS A;  5GMK e;  3VU3 C;  2C0O A;  1QW1 A;  1Z9Z A;  3J81 E;  2YRD A;  5KCH A;  2KRN A;  2DIG A;  3M0S A;  4M7D F;  3OYB A;  4ZGJ B;  2X9H A;  4OMM A;  1K9M U;  4NOY A;  2DM1 A;  4B9W A;  3I5S A;  4XU3 A;  4WTO B;  2KMT A;  1OEB A;  1W70 A;  3EFS A;  1VIF A;  4LD6 A;  3PIO A;  2D0N A;  3NTK A;  2E6Z A;  2DL8 A;  2OAU A;  3E19 A;  3DLL A;  4KGZ B;  3CCE A;  1VQ7 A;  2D1X A;  3LX7 A;  2NUT A;  4N4H A;  4C92 C;  1YHQ Q;  3TEE A;  4JZ4 A;  2PVD B;  2PUK B;  4RG2 A;  3WXM B;  3QKJ A;  2VWF A;  4PJM A;  2RNA A;  1D0Z A;  2KNB B;  4FW1 A;  1QCF A;  2RJF A;  3I56 A;  2NUZ A;  2ZPB B;  3NTH A;  4UC4 A;  3CCS A;  4OB3 B;  4GBQ A;  3OYD A;  4Y91 A;  2GFA A;  1N5Z A;  5GMK i;  4BB7 A;  2DX1 A;  4PLL A;  5CK9 A;  1VQO Q;  1M5Q 1;  3SWN A;  2L3P A;  1WIE A;  3ZEH A;  3CXC P;  2KSS A;  1G3S A;  4F7U B;  4OGE A;  2LVM A;  1IXD A;  2NYS A;  3UWN A;  4M78 D;  4BDZ A;  1VA7 A;  1GXI E;  3QII A;  3PMT A;  2L2P A;  2DLP A;  4M7A A;  4JUV A;  1QWF A;  3CQT A;  1QVG P;  1F1B B;  2AKL A;  4PK4 A;  1WX6 A;  1R0B G;  1YIJ A;  4M78 E;  3CCJ Q;  3X25 B;  3OYE A;  4NL2 A;  2XG8 D;  1VYV A;  1RAH B;  3FIF A;  3JB9 I;  2KRS A;  4EMK B;  3IQL A;  2HDA A;  2FL7 A;  3CMA A;  5GAO n;  3E9F A;  3VJP A;  2ABL A;  4WF2 A;  3S3N A;  5IHK A;  1WHM A;  3PTA A;  3MKD A;  3OSS C;  3SHW A;  2EQJ A;  4F14 A;  4R55 A;  1JQQ A;  1GFC A;  1WHL A;  1RI0 A;  2RPN A;  1UHC A;  2X4Y A;  1VOM A;  5LJ5 e;  4JJB A;  4MZT A;  5GAM h;  4M7D G;  3FRN A;  3CXC A;  1VQK Q;  3NHN A;  5CO7 A;  4N4I A;  3CCV Q;  2JS0 A;  2RHX A;  2L3Q A;  1T0H A;  1WZO A;  5DLO A;  4EDU A;  2QTX A;  4KH1 B;  3RKW A;  2CGH A;  2MF2 A;  2M0Y A;  8ATC B;  1QVG A;  2GF7 A;  4AFZ C;  1KG1 A;  4FIB A;  4Z8A A;  1IRX A;  4M77 B;  2X35 A;  1YIT A;  2LJ0 A;  2OTJ Q;  3S6W A;  1H92 A;  4M78 C;  1VQ4 A;  3VS7 A;  1U1S A;  4IUT A;  2CRE A;  3CC4 Q;  1ZBX A;  2LP5 A;  1D1A A;  4F7U A;  4TVR A;  4J6Y A;  4N4G A;  2E41 A;  5HK0 A;  3M0T A;  1KD1 U;  3CCR T;  2DBM A;  3FB9 A;  4A54 A;  3JCM h;  4MMK A;  4ESR A;  3MEU A;  4KRT A;  4EIK A;  1G3T A;  3UA7 A;  5FU6 B;  1M90 C;  1QWE A;  1ZUU A;  3CBM A;  1VQP Q;  5J3B A;  2JTF A;  4PJN A;  1PRM C;  1WQW A;  1VQ6 A;  2HBP A;  2BTT A;  3GBQ A;  4OB1 B;  3PFS A;  4RKU E;  5GAN 3;  2GGR A;  1NYF A;  2DO3 A;  2CT4 A;  4JS5 A;  1BBZ A;  2CZ1 B;  2MPX C;  2RQV A;  1IGU A;  3LWH A;  1RAB B;  3A8G B;  4CI0 C;  4JLI A;  2WSE E;  2V1R A;  4EMK A;  3QPH A;  2V26 A;  2I0N A;  4DA4 A;  3RES A;  1RAD B;  1WA7 A;  1AZE A;  4C0G A;  1WHJ A;  1Q7Y U;  2K3B A;  1T3L A;  4XTV A;  3M0Q A;  1KQ2 A;  6AT1 B;  3UPU A;  2LTO A;  4IUQ A;  3G7Z A;  1VQ8 Q;  2HSP A;  1Q81 U;  1ZUY A;  4O6J A;  1K76 A;  4QT7 A;  1PHT A;  1N6A A;  1GFD A;  3M0R A;  4M77 C;  3VS2 A;  5GAO p;  1Q81 C;  4BE0 A;  1N9R A;  3NGP A;  1YJ9 Q;  3I56 T;  1NEG A;  4MDX A;  3G71 A;  1ABO A;  4QKU A;  4D6W A;  5HY6 A;  3CPW S;  3RKX A;  1HSQ A;  4HKE A;  4FU6 A;  4DBQ A;  1JU5 C;  3EGX B;  3VYG A;  4C8Q D;  2KRO A;  2CUD A;  2P0Q A;  5FU6 C;  2CUB A;  1JXM A;  1V76 A;  1W2B P;  4AT1 B;  1VQ9 T;  2KT1 A;  2CDT A;  2HAX A;  1GL5 A;  3OY9 A;  1Q95 G;  1UE9 A;  2Y4Y A;  1DJ7 B;  3CCM A;  4J7F A;  4X9D A;  1C6V X;  2K7A A;  1I0C A;  1MV3 A;  4C92 F;  1SSH A;  2YT6 A;  3VS4 A;  4C8Q E;  2JMC A;  4JRK A;  5GMK l;  2NUP B;  4OF1 A;  4OP0 A;  2X3W D;  3QHS A;  1LVK A;  4XU1 A;  3CCE Q;  1VQ7 Q;  1QCO A;  2HL5 C;  2COY A;  1UB4 A;  1QKX A;  1WDX A;  2CP5 A;  3HSB A;  1YFN A;  4IUU A;  5GAN 4;  1NZ9 A;  2KVQ G;  4XK8 E;  3CMA T;  1YCY A;  3VUZ A;  5LJ5 d;  1T0J A;  3M57 A;  3KUF A;  1I4K 1;  3I56 Q;  3V8L A;  1YCS B;  4J6W A;  2KRM A;  2COZ A;  2XU8 A;  2DVE A;  3CCS Q;  5CKB A;  2MK5 A;  2RJE A;  5GAN h;  5M9O A;  1QVF S;  3DKM A;  3OW2 P;  4M75 C;  2EIF A;  2W10 A;  3EHR A;  1GBR A;  2QQR A;  5IT9 E;  4QQ6 A;  4PJJ A;  4Z88 A;  2EJG A;  2RM4 A;  2QQ9 A;  5I2S A;  1CKA A;  1FMK A;  2COW A;  1MMD A;  3RUX A;  1W2B A;  1PWT A;  5FU7 B;  1M2O A;  2EQU A;  3G6E A;  3EG0 A;  2XI9 A;  4M7D A;  4RCB A;  3A8M B;  1VYU A;  1K8A C;  3HRU A;  5KCO A;  3HRS A;  2CZ0 B;  2E5Q A;  4C0F A;  5I2M A;  1FMV A;  2FYK A;  1ZBJ A;  2IPO B;  2ROL A;  1YIJ Q;  1N8R U;  1RL2 A;  2BZY A;  5KE3 A;  3C4S A;  1VQ4 T;  1KC8 C;  1N8R C;  4KT0 E;  2KY9 A;  1EZZ B;  2E4H A;  2EQI A;  2CP6 A;  3QJY A;  3E2U A;  3QUI A;  1M1K R;  2O88 A;  4BAC A;  1BI2 A;  3WVE B;  1TS9 A;  1ZUK A;  1M8V A;  2F5T X;  3CMA Q;  2CYZ B;  3A8O B;  2VXF A;  1U3O A;  3QWX X;  1JJ2 P;  2CS7 A;  3VKI A;  5DLQ E;  3VYH B;  1RUW A;  2P84 A;  2OTL A;  5IN1 A;  1VQ6 T;  2NUP A;  4PJO G;  5KYN A;  2FPF A;  1J3T A;  3OW2 A;  2DZC A;  1UGP B;  2JNG A;  2CH4 A;  4FT4 A;  3SD4 A;  2JVV A;  1M27 C;  2RI5 A;  2KEA A;  2RHU A;  3CCL T;  3OS0 A;  3AHU A;  2EYY A;  3BE3 A;  3VRY A;  4M78 F;  1K4U S;  2DAQ A;  1RAA B;  5KYU A;  4C92 G;  3LYI A;  4QVD A;  1XQH A;  3OYJ A;  3JB9 D;  3OBW A;  5GAN 7;  4LN2 A;  5HK3 A;  4BUG A;  1XTD A;  1HXD A;  1YIT Q;  1BI0 A;  3HL8 A;  2FZG B;  1NJI C;  2ESW A;  1VQ4 Q;  4E7S A;  1BI1 A;  2JTM A;  1UUE A;  3BDL A;  2C0T A;  2EQK A;  4J6X A;  1AOJ A;  2DXC A;  4N0A A;  2CSI A;  2A7Y A;  2RQR A;  3BFM A;  1TSF A;  5FW9 A;  1LCK A;  3OYH A;  2HMA A;  3I55 A;  2QAZ A;  1JJ2 A;  4C5E A;  5D6X A;  2EVR A;  2SRC A;  4DEX A;  2DL7 A;  3M54 A;  2B86 A;  5LJ5 g;  4QQG A;  1OX8 A;  1NYG A;  2XK0 A;  1VQ6 Q;  3TVT A;  2JS2 A;  1WI7 A;  1UGR B;  3CD6 T;  4LD9 K;  2QQS A;  1PSE A;  1YJN T;  2AHJ B;  2I2L A;  3ZBD A;  2LC4 A;  3A98 A;  2M9U A;  2QDL A;  1ZX6 A;  4M77 F;  1W1F A;  3H8Z A;  4KGX B;  5DY9 A;  1Z9Q A;  5KYY B;  3OYI A;  3S3M A;  2MIO A;  2DE0 X;  2ATC B;  7AT1 B;  5C0M A;  4QVZ A;  4JZ3 A;  3M5A A;  2ZAE A;  3MO8 A;  3G71 Q;  1WHG A;  2G6F X;  2O9S A;  3GPL A;  2GTO A;  4LDV A;  1N9S A;  1KQS S;  1PD0 A;  4C5H A;  3KXT A;  1OPK A;  3FC3 A;  4C92 B;  2O9V A;  4L59 A;  1VQN A;  1IHW A;  3FJP A;  2FRY A;  4JPB W;  2QQB A;  2EBP A;  5GAN 2;  1VQ8 A;  3CME A;  2JMA A;  2HQX A;  2KXC A;  2ROT A;  1FYN A;  3RDV A;  2EKH A;  3J7A F;  3KFV A;  4Y92 A;  3CCM Q;  4D8D A;  3L1A A;  5KYW A;  2PZ1 A;  3ASK A;  4M7A D;  3M9Q A;  3M4Y A;  1U06 A;  2EWN A;  3QSU A;  2O31 A;  3EH2 A;  5C6S A;  1D1C A;  1D3B B;  1VQO T;  3MEA A;  2KAF A;  5CKD A;  1OPL A;  4KUL A;  3LWI A;  3JCM P;  3PGG A;  1R0C B;  4M7A E;  2GCX A;  1PSF A;  1Y07 A;  2K2M A;  3S3O A;  1QLY A;  5GAO m;  3PE0 A;  1AWW A;  4M75 F;  1KFZ A;  2RI2 A;  1K9M C;  3PT9 A;  3G4S A;  1WXU A;  2JOY A;  3R6N A;  2MI6 A;  1V29 B;  3RER A;  2YSQ A;  2Y4X A;  2OTL T;  3M0U A;  2O4X B;  3X28 B;  2XDP A;  3CCJ T;  1M2V B;  1VQ5 Q;  2A36 A;  3LLR A;  3JAM E;  2LX7 A;  1B3Q A;  5GAN 6;  3NFC A;  2YXY A;  4OML A;  4ANJ A;  2A08 A;  4JLG A;  4PJO A;  2GFU A;  5CIU A;  5KYY A;  1PRL C;  3QJ6 A;  3G6E Q;  1PM3 A;  4F17 A;  4OMF B;  2KXD A;  1W4S A;  1IGQ A;  1H64 1;  4OMN A;  1WPY A;  1PCX A;  2WSF E;  1GBQ A;  4M77 G;  4CRI A;  2BE9 B;  5L8R E;  2E10 A;  4RTX A;  4FL6 A;  4C92 A;  4IUR A;  3CPF A;  3V8K A;  3L2Z A;  4ZGD B;  1VQK T;  1BU1 A;  1SSF A;  2KE9 A;  1VQM A;  3CCV T;  2RJC A;  1K0X A;  2DNU A;  1M1K U;  1RLP C;  5LL6 S;  1Y0M A;  3T9N A;  3P8H A;  2F69 A;  3I55 T;  2DRM A;  3REA B;  5GAN d;  4WCI A;  3KBG A;  4IUP A;  2DXU A;  4M78 B;  2L3S A;  4E7I A;  2YUP A;  2OTL Q;  3QWY A;  1H3Z A;  1KK7 A;  2OTJ T;  2HKN A;  4OB2 B;  1EFN A;  1TXQ A;  2CT3 A;  2O2O A;  3CC4 T;  4F7U E;  1B07 A;  4LE9 A;  1UJ0 A;  3VUB A;  1U5S A;  2E64 A;  3JB9 J;  5GAM j;  1W2B S;  2QYZ A;  3EAE A;  5A0G A;  3JCM X;  1VQP T;  1OYX A;  2DIQ A;  3X24 B;  2O4X A;  3OYY A;  5FWC A;  1MMG A;  2RJD A;  4V2S A;  4XU2 A;  2FZK B;  2EQM A;  4ZTJ A;  3OBY A;  4MZM A;  1OZ3 A;  3V7S A;  1OUL A;  1X2K A;  1G2B A;  1ZSZ C;  5CAI A;  3A5Z B;  3GP8 A;  4M75 G;  2RHY A;  1Q82 U;  2E3I A;  1E6G A;  3I55 Q;  2KR3 A;  1Q82 C;  1JB0 E;  3A8H B;  2X3X D;  1KSW A;  2KQW A;  1BCO A;  1OQK A;  4M4Z A;  1VQ8 T;  3RBB B;  2XDB A;  4Q5W A;  1TWB A;  1MMA A;  1AWO A;  2MCN A;  3SDZ A;  1G8X A;  5IHI A;  1NEB A;  1V1C A;  1YJ9 T;  3OW2 S;  3EGD B;  5HCK A;  5KYX B;  2DVJ A;  1T3S A;  4FYW B;  3FDR A;  2E70 A;  3MEV A;  1JBM A;  1NLP C;  3QDF A;  2X4W A;  1XOV A;  3HKS A;  4FM4 B;  3CCU A;  4E7L A;  1AWX A;  2E6N A;  1KD1 C;  2FHD A;  2RHZ A;  1K9A A;  5HKC A;  5LJ5 f;  3OYN A;  5CKE A;  4QW2 A;  1X2Q A;  2HQE A;  1Q86 R;  1WHH A;  4OMQ A;  2O01 E;  4KBM B;  1AVZ C;  3EFO B;  2JZ2 A;  1GCP A;  1O9S A;  2LT4 A;  2DYI A;  1D0X A;  3EFR A;  1LNX A;  3GF5 A;  4FSX A;  3QZ5 B;  3UA6 A;  5GAO r;  2DJZ A;  1UGQ B;  2CH4 W;  2GNC A;  4AFU C;  2JM9 A;  3V7R A;  3CCE T;  2KBT A;  1VQ7 T;  1JJ2 S;  1M1G A;  1VQN Q;  1KIK A;  1UEB A;  2HSE B;  1S72 A;  1EIF A;  3H6Z A;  3DLM A;  1K73 U;  1Q7Y C;  3HRT A;  4RMO A;  1OI1 A;  3CME Q;  2V1Q A;  1BI3 A;  1K73 C;  1ZSG A;  3JV3 A;  2E3H A;  3PVQ A;  1OOT A;  1KJW A;  4FT2 A;  1TH7 A;  3ME9 A;  5LJ3 h;  5KE2 A;  1FWZ A;  4M7D D;  1Y7X A;  1R8O B;  2HCK A;  4F04 B;  4M75 B;  3CCS T;  1WNL A;  3M53 A;  2VYT A;  3OMG A;  2C0I A;  2HNI A;  3I35 A;  3C0C A;  2LJ3 A;  2QAS A;  2DA9 A;  1QQJ A;  2YUQ A;  4M77 A;  4E2F B;  1VQM T;  5D6W A;  5AYF A;  4IIM A;  1UGS B;  4IKF A;  2P4R A;  4M7D E;  4HVU A;  2PQW A;  3EHQ A;  3M4G A;  5I22 A;  1YJW A;  3QBY A;  3TSW A;  4C5G A;  3M59 A;  1OV3 A;  1I5O B;  4A4F A;  4MML A;  5KYX A;  2SEM A;  3G4S Q;  4A4H A;  2K5L A;  4L6V 5;  5GAM e;  3E1S A;  4GLK A;  1VYT A;  2DTO A;  4XTW A;  4ORZ A;  1YIJ T;  4J9H A;  4J9B A;  2P4T A;  1Y96 B;  1X6B A;  2GTJ A;  3RIR A;  2BIV A;  2JTE A;  4L5G A;  1H8K A;  2ZPF B;  3MET A;  3EFO A;  5GAN j;  2G3R A;  1Y71 A;  3L2Q A;  2H3E B;  3M55 A;  4JDS A;  2XDD A;  2ZPI B;  1AWJ A;  2QA4 A;  1M30 A;  4OGC A;  1UEC A;  4HT8 A;  2DJQ A;  1BCM A;  4DBF A;  4J7I A;  3LGF A;  3L2W A;  2HL3 A;  1VQ5 A;  4BI3 A;  4EPC A;  1PNJ A;  3A8L B;  1JXO A;  4HCC A;  2PVO B;  1HYO A;  1P92 A;  3JCM e;  4EMG A;  1M8M A;  1X6G A;  2KK4 A;  4ZNX A;  1SG5 A;  1AHJ B;  2IG0 A;  1VQM Q;  3JCM Q;  3L42 A;  2ZCF B;  1QKW A;  2ZPH B;  4CC3 A;  1JO8 A;  2GBQ A;  3TQ7 P;  1WFW A;  5CVI A;  5KH6 A;  4M75 A;  1WYX A;  1YIT T;  1N27 A;  2FZC B;  4CC2 A;  4C8Q C;  1GRI A;  3MP1 A;  1MNE A;  3H0F A;  4B6M A;  1VQL A;  2W0Z A;  4RTV A;  1BKB A;  3EGX A;  3L2R A;  2DYB A;  2YLC A;  1UDL A;  4XTU A;  5IXB A;  2AZV A;  4O5V A;  5GAN 5;  1PG5 B;  1ZQ1 A;  5EC7 A;  2ZGW A;  1G3Y A;  3QXE B;  3QYH B;  3EG1 A;  1KQ1 A;  1E7O A;  2HKQ B;  4PFZ A;  4DBR A;  5I11 A;  4RTU A;  1M4Z A;  3UDC A;  3C95 A;  2HD0 A;  3N5B B;  4PL6 A;  1SPK A;  4E7J A;  5D7U A;  1Y96 A;  2ED1 A;  2ZPE B;  2FPE A;  2J05 A;  2OJ2 A;  5A0D A;  2PNI A;  1M1F A;  2J6O A;  5D6Y A;  4BY6 C;  5AT1 B;  1QCN A;  2VXE A;  2V8J A;  2P0P A;  4PNO A;  4ATO A;  4CC7 A;  2FRW A;  4DOV A;  3VV0 A;  1OU9 A;  3ULR B;  3CC2 A;  1RAG B;  1S72 T;  3OMC A;  2HEQ A;  2OAW A;  1JRI A;  4JRQ A;  1WJQ A;  3LH0 A;  2V8K A;  4J9F A;  2P0K A;  2MAM A;  5GMK h;  2KDS A;  2WSC E;  3CPW P;  3M56 A;  1RI9 A;  2VV5 A;  2EYQ A;  2X4J A;  4XTY A;  3G71 T;  2RD1 A;  3G1J A;  1CKB A;  5J26 A;  3PIP A;  2EYW A;  2RO0 A;  3BDU A;  2LCS A;  2DER A;  2DXT A;  3X20 B;  3JCM W;  2K6D A;  3CCU Q;  1MHN A;  2QQA A;  3EG9 B;  4A63 B;  4P5N A;  5GAM d;  3PMI A;  5L23 A;  1M9S A;  2RH2 A;  1U1T A;  3VS0 A;  5J39 A;  2EGC A;  1YJW T;  2J6F A;  2EGE A;  1D09 B;  4E6R A;  1W6X A;  3RMS A;  4J9I A;  3CCM T;  5GAN e;  3CXC S;  1UFF A;  2RHI A;  2CSQ A;  4BI8 B;  2EYX A;  2M0O A;  3A1P A;  2DKG A;  3HTR A;  1GCQ C;  2L8D A;  1CSK A;  1QVG S;  5IAY A;  3M58 A;  4RG8 A;  2J7I A;  3QG1 A;  1S72 Q;  4NL3 A;  1B7T A;  3CPW A;  4D8K A;  1M90 R;  3JCM d;  1QVF P;  4PJO D;  4JJN K;  2B8A A;  3R6O A;  1TOV A;  1QP3 A;  1KHC A;  2K5F A;  5DM7 R;  3MP8 A;  3L2V A;  2K3X A;  4C0D C;  1VQ5 T;  2LMJ A;  2QDY B;  3OYM A;  1U8R A;  2DIL A;  2RF0 A;  4KUD K;  3D7S B;  5GAN f;  4PJO E;  4PJL A;  4C92 D;  5GJW B;  1X01 A;  4RTW A;  2YUN A;  2DEU A;  1LOJ A;  2H8H A;  4C0Z A;  3ER0 A;  3CC7 Q;  3G6E T;  1YJW Q;  2DZ9 A;  1AEY A;  5CKF A;  1H3H A;  4KH0 B;  2RQU A;  4M78 G;  1RAF B;  5CQY A;  1RAE B;  4C92 E;  2FEI A;  1Q81 R;  5A2Q E;  3RMQ A;  4HA8 A;  1VQL T;  3OYK A;  2BE7 D;  4JRI A;  1UJY A;  3EG9 A;  1RLQ C;  4FCY A;  4E7K A;  2VKN A;  4AMC A;  2A3L A;  5LJ3 d;  3EG3 A;  3TCJ A;  1TUG B;  2QG9 B;  3CCR A;  5LJ5 h;  1PKT A;  1QVF A;  2YLB A;  3WVD B;  2QA4 Q;  1AT1 B;  2RB6 A;  1NM7 A;  8AT1 B;  4LUD A;  5GAN 8;  3CBO A;  1HJD A;  2L0A A;  5FLX E;  1ABQ A;  1YWO A;  2DTH A;  1FXX A;  1G5V A;  2DL5 A;  1HK9 A;  4PJO C;  2DTI A;  2PVG B;  4DEY A;  4C8Q F;  1AD5 A;  2R57 A;  5GAM g;  4DOW A;  4HCZ A;  2RQT A;  1YN8 A;  3QYG B;  2AK5 A;  4RTY A;  3CC2 T;  2D8J A;  4KGV B;  4HVV A;  1QP2 A;  2VAS A;  4PLI A;  4F16 A;  2FG0 A;  2RI3 A;  4B9X A;  2VB6 A;  2XD0 A;  1X27 A;  1ZSZ B;  1NE8 A;  4Z89 A;  3SWN C;  1NLO C;  1C1A A;  2DPP B;  1MND A;  1TG0 A;  1VQL Q;  3I9Q A;  2ENM A;  3OYF A;  2L89 A;  3MHX A;  4JRP A;  4PFP A;  1TTH B;  2QGF B;  2K3Y A;  4M7A C;  2MWP A;  5CCA A;  1IO6 A;  1M1K C;  1EX4 A;  3FJ5 A;  2JM8 A;  2BKD N;  4ZN1 A;  2DFU A;  5GAO l;  2M02 A;  3JCM g;  1D0Y A;  2KGT A;  5GJV B;  4QQD A;  4Z02 A;  3OA6 A;  1X43 A;  3P8D A;  1D3B A;  3J80 E;  4ELZ C;  1K8A R;  2AIR B;  1VQ9 A;  2XKO C;  3CBP A;  2A0F B;  5A0L A;  1SKU B;  2F5K A;  4LXC A;  1NBE B;  3HPW A;  1XNI A;  2RK1 A;  3MJX A;  1KC8 R;  2QEX A;  3OSV A;  1N8R R;  2XID A;  3SFM A;  4J83 A;  4Y28 E;  4XAX B;  2K4Y A;  3CC2 Q;  2K5I A;  2DMO A;  2EFI A;  4XTX A;  2M16 A;  1M2V A;  2LRQ A;  2RN8 A;  4NS5 A;  1KQS P;  2LJ1 A;  3OS1 A;  1R77 A;  1SHF A;  2EAY A;  3QDR B;  3H9N A;  2BZX A;  4IIO A;  1D1B A;  1BIA A;  2XMF A;  2CP3 A;  2RA2 A;  1A0N B;  2M1H A;  2VUB A;  5LJ3 g;  1ZA1 B;  1VQN T;  3EG2 A;  4RTT A;  2FPD A;  2MWO A;  3CME T;  2YRV A;  2CZ7 B;  3JRZ A;  1ZSZ A;  3GLX A;  1WQ7 A;  3NPF A;  3JB9 H;  4M77 D;  1RAC B;  3FLG A;  4KUI A;  2J6K A;  4X1V A;  4C8Q G;  1TU0 B;  3H0I A;  1SRL A;  4J9C A;  1K1Z A;  4AG1 C;  2H3J A;  2CZ6 B;  3MP6 A;  3VRZ A;  1KHI A;  1WJS A;  1NJI R;  3GOX A;  1TUD A;  1C0M A;  1MV0 B;  2DK3 A;  2DRK A;  3CCQ A;  2Y90 A;  1YBY A;  4M77 E;  2L3R A;  4HVW A;  4M78 A;  4ZN3 A;  2DET A;  1OX9 A;  3I5R A;  4DQ2 A;  1ARK A;  3JB9 F;  2XIC A;  4BE1 A;  2DEQ A;  1KQS A;  1M90 U;  1VUB A;  1YP5 A;  1YNZ A;  3G4S T;  4EMK C;  4II1 A;  2PU9 B;  3O5Z A;  2ZPG B;  1WLP B;  2AZS A;  4BI4 A;  3F70 A;  2HQH A;  1X6O A;  4X34 A;  1YWP A;  5LJ3 j;  4GY5 A;  3INZ A;  5ECA A;  1IRE B;  2JJ9 A;  4OMO A;  3NTI A;  5FRN A;  2JXB A;  3JCM J;  2M51 A;  5GAN g;  5GMK m;  5FWB A;  1YI2 A;  2DL4 A;  3CCL A;  3OQ5 A;  3URG A;  2V8I A;  1SHG A;  1JEG A;  3OS2 A;  1BB9 A;  2YUO A;  2D8H A;  3RR6 A; 
#chains in the Genus database with same CATH homology
 1KQS S;  4A4K A;  4C5H A;  3KXT A;  2LQK A;  1YIJ A;  3FC3 A;  4C92 B;  3TU4 K;  4M78 E;  2JN0 A;  4J8O A;  4X9C A;  4L59 A;  1M4Z A;  3X25 B;  1VIE A;  1VQN A;  3FJP A;  3UDC A;  1BIB A;  3OYE A;  2QQB A;  4NL2 A;  2XG8 D;  5GAN 2;  1VQ8 A;  4ELY C;  3C95 A;  2HD0 A;  3N5B B;  4M75 D;  2D0Q B;  4MZP A;  4PL6 A;  4E7J A;  3CME A;  1Y96 A;  3FIF A;  2ZPE B;  2HQX A;  3JB9 I;  4M7D B;  3J7A F;  4ME7 A;  5A0D A;  2VGN A;  4EMK B;  4BDY A;  1I81 A;  1M1F A;  2FL7 A;  3CMA A;  5D6Y A;  4BY6 C;  5GAO n;  5FRM A;  3CC7 A;  3E9F A;  3VJP A;  2VXE A;  2V8J A;  2P0P A;  4PNO A;  4WF2 A;  3L1A A;  4C5I A;  2EKO A;  3S3N A;  4ATO A;  3ASK A;  3PTA A;  4M7A D;  3M9Q A;  4DOV A;  4C8Q B;  3M4Y A;  3JCM c;  4M75 E;  3VV0 A;  3OSS C;  2D9T A;  2EQJ A;  2EWN A;  4PJO F;  4R55 A;  3CC2 A;  3QSU A;  5C6S A;  2FB7 A;  1D3B B;  2ZZD A;  1VQO T;  1B34 B;  1S72 T;  3OMC A;  1RI0 A;  3MEA A;  2X4Y A;  1JRI A;  2KAF A;  4JRQ A;  1WJQ A;  3CEY A;  3LH0 A;  2R5A A;  3FEO A;  5CKD A;  2DXB A;  4MZT A;  5LJ5 e;  2V8K A;  5GAM h;  4M7D G;  4KUL A;  3LWI A;  3FRN A;  1WGS A;  2P0K A;  2MAM A;  5GMK h;  2KDS A;  2WSC E;  3CXC A;  3JCM P;  3PGG A;  3GNF B;  5CO7 A;  3M56 A;  4M7A E;  4N4I A;  1QVP A;  2GCX A;  1PSF A;  1Y07 A;  3QZ9 B;  3S3O A;  2RHX A;  2VV5 A;  2FVU A;  5DLO A;  1YJN A;  2EYQ A;  5GAO m;  2X4J A;  4EDU A;  2QTX A;  3RKW A;  4M75 F;  2CGH A;  4XTY A;  3G71 T;  2RI2 A;  2MF2 A;  1K9M C;  3PT9 A;  2QEX T;  3G4S A;  2RD1 A;  2JOY A;  3BW1 A;  3DB4 A;  1QVG A;  3RER A;  2MI6 A;  1V29 B;  5J26 A;  3PIP A;  2Y4X A;  2RO0 A;  2OTL T;  2GF7 A;  2O4X B;  2QXF A;  3BDU A;  3X28 B;  4A4G A;  3TRE A;  2DXT A;  3GNG A;  3X20 B;  1KG1 A;  4FIB A;  3JCM W;  2XDP A;  3CCJ T;  3GIB A;  4M77 B;  2X35 A;  2XHC A;  5EG2 A;  1YIT A;  5CKH A;  3LLR A;  1MHN A;  2QQA A;  3JAM E;  4P5N A;  5GAM d;  2LCC A;  3S6W A;  3PMI A;  5GAN 6;  4M7A F;  2IVW A;  4XQ3 A;  4M78 C;  3MCA B;  1VQ4 A;  4BY6 B;  1M9S A;  2RH2 A;  1U1S A;  3E9G A;  3NFC A;  4IUT A;  4IUV A;  2C06 A;  1U1T A;  3JB9 G;  5J39 A;  1ZBX A;  4JLG A;  4F7U A;  4TVR A;  2E1H A;  4J6Y A;  1YJW T;  4PJO A;  2GFU A;  4N4G A;  3RMS A;  5CIU A;  2E41 A;  3LGL A;  5HK0 A;  5GAM f;  3CCM T;  3JCM V;  1KD1 U;  5GAN e;  2GQV A;  3QJ6 A;  3CXC S;  3CCR T;  1BYM A;  3FB9 A;  3JCM b;  4A54 A;  3JCM h;  2RHI A;  4MMK A;  4BI8 B;  4OMF B;  4M7D C;  3MEU A;  1W4S A;  2M0O A;  1H64 1;  1WPY A;  2DKG A;  1G3T A;  2WSF E;  5FU6 B;  5FRO A;  1M90 C;  4PKC C;  4M77 G;  3OYC A;  2E65 A;  3CBM A;  4CRI A;  2L8D A;  5J3B A;  2JTF A;  1WQW A;  5L8R E;  1QVG S;  3QO3 A;  2E10 A;  2MMP A;  5IAY A;  3M58 A;  2HBP A;  4FL6 A;  4RG8 A;  4C92 A;  1VQ6 A;  4MDW A;  4OB1 B;  3PFS A;  3CPF A;  4IUR A;  4RKU E;  3V8K A;  5GAN 3;  3QG1 A;  3L2Z A;  4ZGD B;  1YHQ A;  2X4X A;  1VQK T;  2CKK A;  1SSF A;  4NL3 A;  3OYG A;  2DO3 A;  4JS5 A;  2CZ1 B;  1K8A U;  3CPW A;  3LWH A;  2RJC A;  3CCV T;  1VQM A;  3A8G B;  4XU0 A;  4CI0 C;  4JLI A;  1M1K U;  2WSE E;  5LL6 S;  4EMK A;  3QPH A;  5CQX A;  3JCM d;  3T9N A;  4PJO D;  4DA4 A;  3P8H A;  2F69 A;  3RES A;  4JJN K;  3I55 T;  2B8A A;  2D6F A;  3R6O A;  2LT1 A;  5GAN d;  1QP3 A;  1KHC A;  2K5F A;  3KBG A;  3O8V A;  4IUP A;  4C0G A;  5DM7 R;  3MP8 A;  2DXU A;  1OZ2 A;  2K3X A;  4M78 B;  3L2V A;  4C0D C;  1Q7Y U;  3CD6 A;  4E7I A;  3CCU T;  4C8Q A;  1VQ5 T;  4XTV A;  1KQ2 A;  3CCQ T;  2QDY B;  3OYM A;  1H3Z A;  3OB9 A;  1VQO A;  1U8R A;  2OTJ T;  3JCM f;  3UPU A;  4OB2 B;  2LTO A;  4IUQ A;  3G7Z A;  4KUD K;  1Q81 U;  1B34 A;  3CC4 T;  4F7U E;  5GAN f;  4LDU A;  4PJO E;  4O6J A;  4C92 D;  2VGM A;  1N6A A;  1X01 A;  5LJ3 e;  2PUO B;  3RKY A;  4M77 C;  1LOJ A;  2BUD A;  5GAO p;  1Q81 C;  1I5L A;  4BE0 A;  3OS5 A;  1N9R A;  4J5Y A;  3VUB A;  1X75 C;  1MGQ A;  2VC8 A;  3ER0 A;  4C0Z A;  3I56 T;  2E64 A;  3G6E T;  4MDX A;  3JB9 J;  5GAM j;  3G71 A;  2DZ9 A;  4D6W A;  5CKF A;  3X26 B;  5GMK j;  5HY6 A;  3CPW S;  1W2B S;  4HT9 A;  4OVA A;  4RCC A;  4M78 G;  3V8J A;  3EAE A;  3RKX A;  5A0G A;  5CR2 A;  2LDM A;  5CQY A;  3CCJ A;  3JCM X;  1VQP T;  4C92 E;  2NLU A;  1OYX A;  2DIQ A;  4FU6 A;  2O4X A;  2R58 A;  3OYY A;  4HKE A;  3X24 B;  2RJD A;  4F7U F;  4V2S A;  4XU2 A;  5A2Q E;  3RMQ A;  3VYG A;  4HA8 A;  4C8Q D;  3ZFJ A;  1VQL T;  3OYK A;  2EQM A;  4JRI A;  2K2V A;  2P0Q A;  3HP9 A;  1I8F A;  5FU6 C;  4ZTJ A;  3OBY A;  4MZM A;  4A53 A;  2DD5 A;  1OZ3 A;  3V7S A;  1YI2 T;  1VQ9 T;  3HFO A;  4E7K A;  5GAO q;  2HAX A;  3OY9 A;  2Y4Y A;  2A3L A;  5LJ3 d;  1DJ7 B;  3TCJ A;  3CCM A;  4J7F A;  4C0D B;  3CCR A;  5LJ5 h;  5CAI A;  3A5Z B;  4X9D A;  3GP8 A;  4M75 G;  4ZGE B;  2RHY A;  1Q82 U;  4N0A C;  4C92 F;  1QVF A;  2YLB A;  3WVD B;  3P8B B;  3UT1 A;  4C8Q E;  5I21 A;  4XTZ A;  5FU7 C;  4JRK A;  1FX7 A;  5GMK l;  1Q82 C;  4OF1 A;  1JB0 E;  1NJI U;  3A8H B;  4OP0 A;  3QHS A;  5LJ3 f;  4LDX A;  4XU1 A;  3PNW C;  2KQW A;  4VUB A;  2RB6 A;  1VQ8 T;  2XDB A;  4Q5W A;  2K57 A;  1UB4 A;  5GAN 8;  3Q1J A;  3HSB A;  4M7A G;  1VQK A;  3CBO A;  2RK2 A;  4IUU A;  3SDZ A;  5FLX E;  1Q86 U;  5GAN 4;  4E47 A;  2DTH A;  3CCV A;  1NZ9 A;  1FXX A;  2KVQ G;  2DD4 A;  4XK8 E;  1G5V A;  3CMA T;  1HK9 A;  1YCY A;  3VUZ A;  5LJ5 d;  2EJ9 A;  3DB3 A;  3OW2 S;  1YJ9 T;  4PJO C;  2DTI A;  2PVG B;  3CC7 T;  4C8Q F;  1Q86 C;  2R57 A;  3M57 A;  5GAM g;  3KUF A;  4LDW A;  4DOW A;  4HCZ A;  1I4K 1;  2E70 A;  3FDR A;  3V8L A;  3MEV A;  1JBM A;  3QYG B;  3HHT B;  2X4W A;  4J6W A;  1XOV A;  2XU8 A;  3HKS A;  4R56 A;  2DVE A;  3CC2 T;  4FM4 B;  3CCU A;  4E7L A;  1KD1 C;  2E6N A;  3HFN A;  2FHD A;  2RHZ A;  5CKB A;  2RJE A;  5HKC A;  5LJ5 f;  3OYN A;  2OTJ A;  5GAN h;  1QP2 A;  4PLI A;  3SB2 A;  5M9O A;  1QVF S;  5CKE A;  3DKM A;  4QW2 A;  2HQE A;  2RI3 A;  4B9X A;  2JUF A;  4M75 C;  4BE2 A;  2O01 E;  2XD0 A;  3CC4 A;  4KBM B;  4EMH A;  2EIF A;  2JZ2 A;  1NE8 A;  2QQR A;  5IT9 E;  3SWN C;  2DPP B;  4QQ6 A;  1O9S A;  2YHT A;  2EJG A;  3OYF A;  2RM4 A;  2LX9 A;  2QQ9 A;  4QVC A;  2L89 A;  5I2S A;  3OYL A;  2LT4 A;  3MHX A;  3MEW A;  3RUX A;  4JRP A;  1W2B A;  3EFR A;  4OB0 B;  1LNX A;  3BY7 A;  5FU7 B;  2EQU A;  3G6E A;  2EJF A;  3C94 A;  3GF5 A;  2XI9 A;  4FSX A;  4JS4 A;  4M7D A;  1O75 A;  4RCB A;  3A8M B;  1K8A C;  3QZ5 B;  2K3Y A;  3HRU A;  4M7A C;  2MWP A;  5KCO A;  3HRS A;  2DJZ A;  2CZ0 B;  5CCA A;  2QA4 T;  5GAO r;  1UGQ B;  1M1K C;  2E5Q A;  4C0F A;  5I2M A;  1NPP A;  2FYK A;  2LCL A;  2LQ8 A;  1VQP A;  3V7R A;  2BKD N;  4LDY A;  4ZN1 A;  5GAO l;  1N8R U;  1VQ7 T;  3CCE T;  1RL2 A;  1JJ2 S;  1M1G A;  5KE3 A;  3JCM g;  1NPR A;  1IZ6 A;  1UEB A;  3C4S A;  1VQ4 T;  1S72 A;  1EIF A;  4ZTF A;  1WJR A;  3H6Z A;  3DLM A;  1KC8 C;  4PJO B;  1K73 U;  1Q7Y C;  1N8R C;  4QQD A;  4KT0 E;  2KY9 A;  4Z02 A;  3OA6 A;  3P8D A;  1D3B A;  3J80 E;  3HRT A;  4ELZ C;  3OYA A;  4RMO A;  1OI1 A;  3QJY A;  3QUI A;  1BI3 A;  2E12 A;  1VQ9 A;  2XKO C;  3V7C A;  1K73 C;  3CBP A;  4HCB A;  5A0L A;  4BAC A;  2L5Q A;  2R5M A;  1BI2 A;  3C12 A;  3WVE B;  1KC8 U;  1M8V A;  2F5K A;  4YTL A;  2F5T X;  4E7H A;  4A4E A;  2CYZ B;  4FT2 A;  3HPW A;  1XNI A;  3A8O B;  2VXF A;  2RK1 A;  1TH7 A;  4LDV A;  3ME9 A;  2CS7 A;  5LJ3 h;  3VKI A;  5KE2 A;  2QEX A;  1FWZ A;  5DLQ E;  4M7D D;  1Y7X A;  3OSV A;  3L2U A;  3VYH B;  1R8O B;  3CCS T;  4M75 B;  2XID A;  1WNL A;  2OTL A;  3JSC A;  4J83 A;  3SFM A;  4Y28 E;  3M53 A;  5IN1 A;  3SWN B;  5LJ5 j;  1VQ6 T;  2VYT A;  4XAX B;  2K4Y A;  4F7U G;  2K5I A;  3OMG A;  4PJO G;  2HNI A;  2EFI A;  1LJO A;  1YHQ T;  1ZHI A;  4XTX A;  1G3W A;  2M16 A;  4BD3 A;  2LRQ A;  4M77 A;  3OW2 A;  2DZC A;  2QI2 A;  1UGP B;  2JNG A;  4FT4 A;  3LW5 E;  5D6W A;  3SD4 A;  5AYF A;  1VQM T;  2JVV A;  4NS5 A;  2WAC A;  4M7A B;  1UGS B;  4IKF A;  4M7D E;  2RI5 A;  3OS1 A;  2EAY A;  2PQW A;  3M4G A;  1YJ9 A;  2RHU A;  3CCL T;  1YJW A;  3QBY A;  3QDR B;  3OS0 A;  3AHU A;  4C5G A;  4M78 F;  3M59 A;  2DAQ A;  4A4F A;  4MML A;  1BIA A;  4C92 G;  2LNV A;  3LYI A;  2K5L A;  4A4H A;  4QVD A;  4L6V 5;  5GAM e;  1XQH A;  3E1S A;  4GLK A;  3OBW A;  2RA2 A;  3OYJ A;  3JB9 D;  5GMK e;  2DTO A;  4XTW A;  2M1H A;  2VUB A;  3VU3 C;  5HK3 A;  5GAN 7;  1QW1 A;  4BUG A;  1YIJ T;  1XTD A;  3J81 E;  5KCH A;  5LJ3 g;  1HXD A;  1VQN T;  2P4T A;  1BI0 A;  1Y96 B;  2DIG A;  3HL8 A;  3RIR A;  4M7D F;  3OYB A;  2BIV A;  4ZGJ B;  2MWO A;  1NJI C;  4L5G A;  3CME T;  1BI1 A;  2JTM A;  2CZ7 B;  2YRV A;  2ZPF B;  3JRZ A;  3MET A;  1K9M U;  4NOY A;  3BDL A;  5GAN j;  2EQK A;  4J6X A;  2G3R A;  3GLX A;  1WQ7 A;  3JB9 H;  1Y71 A;  4M77 D;  4B9W A;  3FLG A;  4KUI A;  3L2Q A;  2DXC A;  4XU3 A;  3M55 A;  4JDS A;  4N0A A;  4C8Q G;  2A7Y A;  3BFM A;  2XDD A;  2ZPI B;  2KMT A;  2QA4 A;  3OYH A;  2H3J A;  4OGC A;  3EFS A;  4HT8 A;  2CZ6 B;  1VIF A;  3MP6 A;  4LD6 A;  3PIO A;  3I55 A;  1KHI A;  1JJ2 A;  1WJS A;  3NTK A;  4C5E A;  2E6Z A;  5D6X A;  2OAU A;  3E19 A;  3LGF A;  4J7I A;  3L2W A;  3GOX A;  3DLL A;  3CCE A;  1VQ7 A;  3M54 A;  5LJ5 g;  2DK3 A;  4QQG A;  1VQ5 A;  4BI3 A;  2XK0 A;  3CCQ A;  2Y90 A;  1YBY A;  3LX7 A;  4M77 E;  4EPC A;  2L3R A;  3A8L B;  4M78 A;  4ZN3 A;  4HCC A;  2PVO B;  4DQ2 A;  4N4H A;  3JB9 F;  4C92 C;  1UGR B;  3JCM e;  1P92 A;  3CD6 T;  2XIC A;  4EMG A;  3TEE A;  4BE1 A;  4LD9 K;  2KK4 A;  2PVD B;  2PUK B;  2DEQ A;  1AHJ B;  2IG0 A;  2QQS A;  3QKJ A;  4RG2 A;  3WXM B;  3JCM Q;  1PSE A;  1KQS A;  3L42 A;  1M90 U;  2ZCF B;  1YJN T;  1VUB A;  2RJF A;  3I56 A;  2AHJ B;  2ZPB B;  2I2L A;  3ZBD A;  2ZPH B;  3NTH A;  2LC4 A;  3G4S T;  4EMK C;  4II1 A;  2M9U A;  2PU9 B;  4UC4 A;  3CCS A;  4OB3 B;  4M77 F;  2ZPG B;  3OYD A;  4Y91 A;  2GFA A;  5CVI A;  4BI4 A;  5GMK i;  3F70 A;  5KH6 A;  4BB7 A;  4M75 A;  4PLL A;  1YIT T;  1N27 A;  1X6O A;  4X34 A;  5CK9 A;  4C8Q C;  1M5Q 1;  3SWN A;  3MP1 A;  5LJ3 j;  3H8Z A;  4GY5 A;  3ZEH A;  3INZ A;  5DY9 A;  1IRE B;  1G3S A;  2KSS A;  4F7U B;  1VQL A;  4OGE A;  2LVM A;  3UWN A;  1BKB A;  3NTI A;  4M78 D;  5FRN A;  3L2R A;  3JCM J;  4BDZ A;  2YLC A;  5GAN g;  1GXI E;  4XTU A;  3QII A;  5GMK m;  1YI2 A;  3OYI A;  3PMT A;  3S3M A;  4O5V A;  5GAN 5;  3CCL A;  3OQ5 A;  3URG A;  4M7A A;  5C0M A;  4QVZ A;  4JUV A;  1ZQ1 A;  3M5A A;  3MO8 A;  2V8I A;  2ZGW A;  1G3Y A;  3QXE B;  3QYH B;  3OS2 A;  1KQ1 A;  3GPL A;  1N9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...