4PJOF

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, f, t
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoF00
4XTZA 1LJOA 1HXDA 1MGQA 2RA2A 4XTYA 4HA8A 3V8KA 5LJ5d 4M7AG 2HNIA 2RD1A 4PJOB 5GAMd 3JCMc 1M8VA 5CAIA 3RERA 2DXUA 2I2LA 5GAOp 2VXFA 4C8QC 1X01A 2E64A 4F7UE 3M4GA 3SWNC 4XTXA 4XU0A 3FIFA 4C8QB 5GMKi 5GMKh 2EWNA 3SWNB 4NL2A 4M77E 1YCYA 4Y91A 5GAN2 4M7DE 4J5YA 1I8FA 4C92C 3JB9J 1I81A 2DZ9A 2E10A 2EJGA 4PJOF 5LJ3j 5GAN3 4C92B 4M77A 3V8JA 4F7UF 4M7DA 1JRIA 3QO3A 5GANh 3JCMg 4PJOD 3GIBA 2Y90A 3JCMV 5GAOq 5GAN4 4OP0A 2YHTA 4XTUA 4C8QF 5GMKm 4M78A 2DZCA 4WF2A 4XTWA 5GANd 4JRKA 4M75A 5LJ3g 4C8QD 4PJOG 2FYKA 3JCMh 4C92F 2FB7A 4F7UB 4J6WA 4C92D 4JUVA 4XQ3A 1B34A 5LJ3h 3JCMd 4M7AA 1BIBA 1H641 4X9CA 4C8QG 5GAOl 2CGHA 3L1AA 4QVCA 1D3BA 3RKYA 1U1TA 5LJ3d 3QSUA 4QVDA 4HT9A 1TH7A 3FJPA 1BIAA 5GANf 2RM4A 1Y96B 3PGGA 1U1SA 1N9RA 3BFMA 3INZA 3L2ZA 3VU3C 5GAN8 4HT8A 2YLCA 2E1HA 4JRIA 4J6XA 2DTHA 5LJ5f 2DXTA 5GAN5 4M78E 4J6YA 4A53A 4M75E 4M77F 5GAMf 3JCMX 4M7DF 4N0AA 2EAYA 3V7CA 2DEQA 4EMKA 3JCMP 3BW1A 4M77D 3JB9I 4M7DD 3RUXA 2DTIA 2VC8A 3RIRA 4V2SA 1LOJA 2EJ9A 4M75F 3JCMb 4M7AE 2YLBA 5GANe 4F7UG 4XU2A 2E65A 2RB6A 1N9SA 2JN0A 4EMHA 5GAOn 4M77C 4PJOA 4M7DC 3QHSA 3FB9A 5LJ5e 4M77B 2QTXA 1JBMA 1WQWA 1KQ2A 4M7DB 5GAMe 1WPYA 4M7AF 1HK9A 3V8LA 4RCBA 4M78C 4C8QA 4XU3A 4M75C 4XU1A 3HSBA 3SWNA 1WNLA 4M78B 4C92G 4M7AD 1M5Q1 2E41A 4M75B 3V7SA 3BY7A 4A54A 4NOYA 4C92A 3JB9H 1LNXA 3SB2A 5GMKe 2DKGA 4MMLA 2DTOA 3JCMf 4M7AC 3V7RA 4XTVA 1B34B 4M7AB 5GAOm 3JB9F 5DY9A 5LJ5j 2VXEA 4M78F 5LJ3f 5GMKl 4PJOE 2DVEA 3JCMW 5GAMj 1I5LA 1D3BB 5GAN6 3JB9D 1WQ7A 4NL3A 5GANg 4M78D 3HFNA 4MMKA 4M75D 4M77G 4F7UA 3QUIA 3JCMQ 4M7DG 4C8QE 5LJ5g 5I21A 2EJFA 4JLIA 4N0AC 3RKWA 4EMGA 5GAN7 4PNOA 5GAMg 3EFRA 3RKXA 4EMKC 3JCMe 5GAOr 3JB9G 5GMKj 1KQ1A 4M78G 4C92E 4M75G 3HFOA 4EMKB 3EFSA 4X9DA 2DJZA 1I4K1 3RESA 5LJ3e 1Y96A 5LJ5h 4RCCA 2K57A 4DQ2A 3JCMJ 3AHUA 2ZGWA 3BDUA 5GAMh 4PJOC 5GANj
chains in the Genus database with same CATH superfamily
3N5BB 1QCOA 3DLLA 4E7IA 1OX9A 2NUTB 3SDZA 2ZPBB 1K4US 3FIFA 3CQTA 1KG1A 2O31A 1KK7A 5I11A 2OTJA 8AT1B 1M4ZA 2CSQA 4AG1C 1FMWA 5C0MA 5KE2A 3CPWP 3I5RA 3GIBA 4OP0A 3RMSA 2RI2A 4N4IA 5GANd 5FWBA 2FZGB 4FSSA 2MWOA 2VVKA 2BUDA 2LNHB 3L2WA 2NUZA 1K8AU 2EVRA 1Q82U 4C92D 4X9CA 2CZ1B 1BI1A 2SEMA 1BIAA 4F16A 2NUPA 4PKCC 2X9HA 1ZUYA 3JRZA 1G5VA 2CUDA 3CCLT 1YIJQ 3OY9A 2V8KA 3CCSQ 2O2OA 3EAEA 2GFUA 4IIOA 3G71A 2DTIA 2OTLA 4M75F 4DEXA 5A2QE 2AZSA 1YJWQ 2QTXA 1TTHB 1WQWA 2K9GA 1RAHB 3X26B 3P8HA 1WXUA 3QBYA 4MZPA 1Y07A 4XAXB 4A63B 1KHIA 4EPCA 3U23A 2X3XD 3LX7A 5CO7A 4GY5A 1JJ2P 1M1KR 2RJEA 1VQ4T 1SSFA 2XU8A 3M0SA 1K9MR 1JXMA 2PNIA 2RHYA 4C8QE 4O5VA 3EFRA 4LXCA 3X20B 2MIOA 5DLQE 2DD5A 2FVUA 1Q86R 3S3OA 1VQOQ 2EGCA 4PJOC 2CP3A 2VWFA 5LJ5d 1Y7XA 3HRTA 2VXFA 2EQMA 4IUQA 4DBRA 1W6XA 1HD3A 2WSEE 2ROLA 3CCVQ 3CCJA 1WFWA 3CXCS 2GTJA 1H8KA 2OI3A 2E5QA 2AT1B 3KUFA 3CMAA 3EGUA 4CC7A 4E7LA 1PG5B 1W1FA 1J3TA 1KD1U 2ECZA 3VS4A 2CP0A 1N27A 1K9AA 3OYLA 4YTLA 1VQ9T 2MCNA 4A4EA 1U1SA 3L2ZA 5GAMf 2D6FA 2V26A 3VUBA 4CC4B 2XKOC 5GJWB 2ZPHB 2RI3A 2E65A 5GAOn 4M77C 3M57A 3FB9A 5LJ5e 2KGTA 1KQ2A 1XJWB 4RTUA 1VQNT 3HSBA 4CRIA 1NG2A 1BB9A 3ME9A 1UUEA 1VQLQ 4NS5A 1PNJA 3HRUA 2JTFA 1QW1A 2JNGA 3OYDA 4XK8E 3HL8A 1QWEA 1Q7YR 3OYYA 3TVTA 4JJBA 5GANg 3HFNA 2DJQA 5CQYA 3ZFJA 4BI8B 5KYUB 3CCUQ 3QJ6A 2ZAEA 3JB9G 2YDLA 4E47A 3H6ZA 3PVLA 4X9DA 1YP5A 2CH4A 5CCAA 2RQUA 2CP2A 2KT8A 5CKHA 1N8RR 1NBEB 1RI0A 3SD4A 1B07A 3S6WA 4OGEA 5GMKi 1LPLA 1YCYA 4M77E 4X1VA 5EC7A 1HJDA 1F1BB 1NLOC 2VUBA 3VS6A 2R57A 4KBMB 3JCMV 5HK0A 1VQKQ 2BIVA 1VIEA 2EYWA 1H3ZA 2LJ3A 2J6KA 1YHQQ 1PKSA 3OSSC 4C0DC 5J3BA 4OMOA 3EG3A 1VQ8Q 4X34A 1Z9QA 1BIBA 4ME7A 2M0OA 1RL2A 3QYHB 1VQ7A 3CEYA 2EQUA 2ED0A 3OMCA 4J9GA 1O9SA 3I55T 1YIJT 1YWPA 4ZN3A 4GLKA 2KQWA 1AT1B 4FL6A 2LC4A 2CDTA 4LD6A 2FRYA 4M4ZA 2DO3A 2QA4Q 2X4YA 3ASKA 4J7FA 1JBMA 3X25B 1I1JA 3OW2S 4M7AF 2PVOB 1GBRA 1PSEA 4RCBA 3V8LA 5D7UA 3OA6A 2MK5A 4C92A 4MZTA 1QCNA 1AZEA 2KRSA 2KE9A 3MP6A 4F14A 5LJ3f 1PRLC 1Q95G 1ZUUA 3A8LB 4M78D 1TG0A 2HKQB 1X6GA 4PNOA 1UB4A 2EYXA 2P0KA 3CC2A 3OS5A 5I2MA 1KQ1A 3QWXX 2P4TA 3KBGA 1M3AA 2OTJQ 4ZGDB 3CCSA 1Y96A 2VGNA 1WGSA 2JT4A 2LCLA 1RAIB 2KSSA 4BE2A 2JJ9A 1FX7A 1NLPC 4C8QB 3CCVT 1I8FA 4A4GA 1KQSA 1WA7A 2A37A 2JOYA 1PKTA 1X2QA 1G3SA 4IURA 4C8QF 1SG5A 1Z9ZA 4WTOB 1MHNA 3G71Q 1OI1A 3F70A 2LQ8A 2OTLQ 4Z88A 2E4HA 2VV5A 3CD6T 1U1TA 3FC3A 3E9GA 1T3SA 3M0RA 3TSZA 4M75E 1PM3A 3JCMX 2LCSA 3V7CA 1OQKA 2E6ZA 3A8HB 1GCQA 2MWPA 3GF5A 4F7UG 4D6WA 4BDYA 4IUPA 4ZTFA 1QWFA 4C0GA 3VYHB 3EGDB 1YJNT 3EG9A 5CKDA 1XNIA 1JB0E 1VQLT 1K0XA 3LH0A 3SB2A 3PTAA 3OYMA 1VUBA 1G83A 5GAOm 1UGRB 5KYXB 4IUUA 4F7UA 4M7DG 3JCMQ 3DB3A 4FYXB 1PC0A 2W0ZA 2K5IA 5HKCA 1VIFA 1Q86U 2DAQA 3A8OB 3NMZC 3ZBDA 3CCJQ 1I4K1 2BZ8A 1AWWA 2QTVA 3QKJA 1HXDA 1RAAB 3CMAQ 1FMKA 2LRQA 5AT1B 2DD4A 3I56A 2E64A 1MUZA 4XU0A 1M27C 3CCQT 2J6FA 1D09B 2CUBA 4F04B 2K2VA 1ABQA 2DFUA 4EIKA 3HRSA 5CQXA 1YNZA 4M7DA 3LYIA 4KT0E 1OOTA 2DE0X 4ZGJB 4LUDA 1D1AA 5L23A 2JMCA 2HDAA 2QDLA 1VQ8T 1WX6A 4BACA 4LDYA 1WJQA 4OMMA 2V1RA 2CT3A 3FJPA 3JV3A 3PGGA 2CREA 2ZZDA 1Q81R 3PFSA 1GRIA 4M77F 2DLPA 3CC7A 4HCBA 4EMKA 3JCMP 2DBKA 3JB9I 3RIRA 2EJ9A 2VASA 1EX4A 2QA4T 3UA6A 1WJSA 3HPWA 4C5HA 2CZ6B 3UATA 1UEBA 2X4WA 1JU5C 3CXCA 1ZSGA 5DLOA 4XU3A 2KRMA 4LN2A 2KRNA 3BY7A 4Q5WA 3OYCA 4C5GA 4AG2C 1GFCA 2ENMA 1AD5A 2AHJB 3VYGA 5FROA 2KNBB 4PFPA 3QIIA 2DRMA 2XG8D 2QEXA 2RJFA 3E1SA 2EGAA 1XQHA 3VS3A 4DBQA 2Z0WA 1YJ9A 1M2VA 3OBYA 4M78G 1WYXA 2MPXC 2F69A 3RESA 9ATCB 1U3OA 1XOVA 1RADB 2RI5A 1WI7A 4JS4A 1UHFA 5GAMd 5IN1A 2A3LA 4BY6C 2QAZA 3UPUA 1ZSZB 2OAWA 2IPOB 4RTXA 5GMKh 3CCET 1VA7A 2O9VA 1OV3A 3MHXA 4C92C 4RMOA 1I81A 2E10A 2DL3A 2KVQG 3V8JA 2QQAA 3QO3A 3JCMg 2EYZA 1SKUB 1VQ7Q 2LJ1A 1YITA 3MEVA 4M78A 5A0DA 4R55A 1ZBJA 1SEMA 2RF0A 4JJNK 3JCMh 3G71T 2OTLT 3OYHA 1VYUA 3MEAA 2PUOB 3EGXB 1UG1A 2JMAA 5FWCA 4ZN1A 1AWOA 1D3BA 5IHNA 5DM7R 2KROA 4QVDA 1M90R 2DERA 2RM4A 3RNJA 4HT8A 3GP8A 2COYA 4OB2B 2RHIA 4J6XA 3M0TA 1TUCA 2VKNA 2E5KA 3OYEA 2LZ6B 2DEQA 3GPLA 3BW1A 3RUXA 2KDSA 2VC8A 3CMEA 5KYWB 3RR6A 3G1JA 4M7AE 2RHUA 5I2SA 2XI9A 2RB6A 3A1PA 3GLXA 2G3RA 4FCYA 1IB8A 5GAMe 4MDXA 2YUOA 1HK9A 5HK3A 3OS2A 1M3BA 2K3YA 4OB3B 4XU1A 4M7AD 4M75B 4ZTJA 3BE3A 3CC2Q 2RK2A 2FZKB 4P5NA 4ZGEB 1CKAA 1AWJA 1VQ5A 3CBOA 3JCMW 5FU6C 2XICA 1RLQC 4C0FA 5I21A 3M54A 4KGXB 1QVFS 1GCQC 2FPEA 2LTOA 3HTRA 2M02A 3TEEA 1VQ6T 3CCJT 1Y57A 2E6NA 3MO8A 1G3WA 3NGPA 2W10A 3A98A 3CC4A 2K3BA 3CBPA 1MGQA 4AFQC 3VJPA 1FMVA 1X6OA 2FZCB 4OB1B 1M9SA 2I2LA 3OSVA 2RH2A 2L8DA 1TUDA 1VYVA 2D1XA 1RACB 2LT4A 1IXDA 1H3HA 3VS2A 2KMTA 2DILA 4JZ4A 3JAME 2GTOA 2Y90A 4XTUA 2DK3A 3EG1A 4F17A 3O8VA 5FU7C 4GLMA 1KC8C 1G8XA 4C8QD 1RUWA 2VGMA 1UFFA 2C0OA 2GQIA 3TREA 1NJIC 4XQ3A 4HVVA 5HY6A 1RI9A 2CGHA 5LJ3d 1TH7A 3PNWC 3PMTA 3UWNA 2A28A 2R5AA 1RAGB 2MI6A 2X3WD 4N0AA 1D0XA 2DA9A 1NJIR 3NTIA 2O88A 3H41A 2L5QA 3C95A 3M9QA 4QQGA 2HSEB 1KQSP 1EIFA 2JN0A 4M7DC 3REAB 1VQPT 2NYSA 1NYFA 2YRVA 1BI2A 1WNLA 3EH1A 1M5Q1 2WSCE 4CC3A 2CH4W 4PJNA 1WDXA 2HAXA 1GFDA 3JB9H 2H8HA 3IQLA 4AFZC 4KGVB 1OULA 2DL5A 3S3NA 2FO0A 2AKKA 2JW4A 4XTVA 1NEBA 2OAUA 4PJOE 1C6VX 2DL4A 2OX7A 3QJYA 1MMNA 3VV0A 3QUIA 3I56Q 2HKNA 3RKXA 4EMKC 2MOXA 5GMKj 1HSQA 5CK9A 2CSIA 1CKBA 5LJ3e 4JRPA 1D1CA 1R0BG 3GNGA 2VB6A 4QQDA 4DA4A 2M16A 3OS1A 2HZYA 1OZ2A 3SWNB 4NL2A 2F5KA 2HSPA 4M7DE 4R0KA 3I35A 1SRMA 1UECA 5IXBA 1PCXA 5FLXE 2EBPA 2HBWA 2YUNA 1VQ7T 5GANh 3QPHA 4B9XA 1MNEA 4FW1A 1M2OA 1JQQA 4ELZC 4KUDK 4E7SA 3G4SA 1M30A 3CC7Q 1AHJB 1VQ9A 3TCJA 4OMNA 1Q81U 1KSWA 3MEWA 4HT9A 5GANf 3INZA 2YLCA 5KYUA 4J6YA 3LWIA 1E7OA 2EAYA 1K0SA 2DYBA 4CI0C 4M77D 2A36A 1X2KA 3S3MA 1IHWA 1QVGA 2YRDA 4BE1A 5FRMA 3QHSA 1VQNA 4IUVA 4MZMA 2F5TX 4M78C 1LVKA 2QEXQ 5IT9E 4PFOA 1YFNA 4HVWA 4C92G 2COZA 1HYOA 2LCCA 4A54A 3CC2T 7AT1B 1SRLA 1YJ9Q 3EG0A 3M58A 3QWYA 3CCST 1R8OB 1G2BA 2K2MA 2A08A 3GBQA 3O5ZA 4M7AB 2QQRA 2LP5A 5GMKl 1YCSB 4ELYC 1YJWT 2E70A 1U8RA 1NEGA 2RHZA 4PJLA 2HCKA 5LJ5g 2EJFA 2X4JA 3M0QA 5HCKA 1M1GA 5LJ5h 4RCCA 1TWBA 4R56A 1YITQ 2XD0A 2PVDB 3CXCP 3C4SA 5CKEA 4JPBW 2X51A 1WHHA 2V8IA 2CZ7B 2K5LA 1SSHA 2KXCA 4Z89A 4E7HA 3G6EA 5GAN4 2L89A 4ANJA 2JXBA 4XTWA 1VQOT 1XTDA 2PTKA 1BU1A 1UGSB 3ZL7C 2QQ9A 3CMEQ 1M90U 4C8QG 2RQWA 1S72A 3L1AA 1TXQA 3RKYA 3I55A 1BKBA 2EKOA 2AZVA 2P0PA 2QGGA 1AOJA 2DRKA 5GAN5 3RBBB 1YI2A 2DEUA 4JJDA 4AMCA 1WJRA 3H8ZA 5D6XA 3G7ZA 1IZ6A 2DXCA 4EMHA 2CZ0B 3OYJA 4L5GA 1ACMB 1VQ5Q 6AT1B 1NE8A 1PHTA 3VRYA 4JZ3A 1D1BA 3DB4A 1M8MA 4C8QA 1QKXA 2PQWA 2EQIA 2RQVA 3EFOB 2MF2A 1PWTA 2EKHA 3CCMA 3OYIA 3VS5A 1GL5A 3ER0A 5KH6A 2C0IA 1B34B 1I0CA 3EHQA 3KXTA 3I9QA 5D6WA 3CC4Q 4OMQA 4ESRA 5GAN6 1ABOA 2A0FB 1WQ7A 2WSFE 2QG9B 4M75D 2ZPEB 3I56T 3MEUA 4J9BA 4N0AC 4J9IA 2HQHA 2XDDA 1K73C 3VS1A 5KYNA 1GXIE 4II1A 1UHCA 3H0FA 5GANj 2YXYA 1AZGB 4PJOB 1BCMA 1VYTA 2FHDA 2RD1A 4OMFB 1SHFA 1QVPA 1W2BS 2E3IA 1A0NB 5CKBA 1BI0A 1K73R 5GAN2 1T0HA 5FRNA 4PLIA 3CCUT 1M3CA 1ZA1B 4PJOF 4LE9A 4E2FB 4F7UF 3OS0A 3CCRA 2MMPA 2EPDA 3EGDA 2YUPA 2DETA 1OU9A 5LL6S 3QDFA 3CC7T 1QP3A 1SHGA 2ATCB 2EQJA 3CPWS 3PT9A 2ZPFB 3CD6A 3LH5A 2XMFA 4HKEA 2DF6A 1KC8U 1QVFA 5GAN8 2EQKA 4L6V5 3CBMA 1NJIU 1ZBXA 1FXXA 4VUBA 4M7DF 2D9TA 1VQKT 4C5IA 2YRCA 3M0PA 3QZ9B 4FYYB 5FW9A 5IHIA 3ZEHA 1YHQT 1MNDA 2HQXA 2YLBA 1TSFA 3P8DA 3J7AF 3HP9A 2X35A 4O6JA 1YJNA 2LQWA 5IAYA 3OMGA 4M77B 4J83A 1WPYA 2QEXT 2R5MA 3TSWA 1MV0B 5EG2A 3V7SA 2E41A 1YJ9T 2E12A 3MKDA 4NOYA 4HCKA 3OYAA 4RG8A 4MMLA 1WIEA 2K4YA 4FT4A 3V7RA 1VOMA 4J9HA 1OYXA 2Y4YA 5LJ5j 3L2UA 1Y71A 4FYWB 4J9EA 1KIKA 2D0NA 3E9FA 8ATCB 2DIGA 4HVUA 1LCKA 3CPFA 1JJ2S 2M1HA 1UE9A 4IUTA 2O4XB 2RPNA 3HFOA 3EFSA 1PRMC 1EFNA 2G6FX 2K57A 2AK5A 3R6OA 3J80E 2XDPA 2JTEA 1QCFA 2RA2A 4XTYA 3V8KA 1KFZA 1U5SA 2ZCFB 3J81E 2LX9A 3JCMc 3G4SQ 2DXUA 3CCQA 2RK1A 5A0GA 2DX1A 1QMCA 3E19A 2XK0A 3FLGA 1VQ9Q 1FYNA 4Y28E 2KT1A 1IRXA 3UF4A 2OTJT 2RJDA 2O01E 2DZCA 2AKLA 2ZPGB 3L2RA 5KYYB 1QP2A 2P84A 3CMET 4C0DB 1UGVA 3EG2A 1V76A 2EW3A 1T3LA 1DJ7B 4RTZA 2C06A 2RMOA 1VQNQ 2BE7D 2FG0A 1PD0A 4CC2A 2K6DA 1U06A 3UA7A 4A53A 4EDUA 1R0CB 4QVZA 1C1AA 3QXEB 2DIQA 2V8JA 2KI7A 4RTWA 2CP7A 5CVIA 4E7ZA 2DM1A 1N9SA 1VQ5T 1ZLMA 2XHCA 2K79A 1G3TA 2GF7A 1WHGA 1H92A 2BZYA 2M9UA 2YUQA 4DBHA 2R58A 2ROTA 1ZUKA 3JCMf 4JRQA 5CKFA 1BBZA 1WHKA 3CC4T 1VQMA 2EYQA 2MYSA 2X4XA 3JSCA 2NUPB 5GJVB 3M59A 2K3XA 4EMGA 2NUTA 2QK0A 3EGXA 5GAOr 5IXFA 3WVDB 2PUKB 4C0ZA 4C92E 1W4SA 4M75G 2V1QA 4DQ2A 1QVGP 1WHJA 3AHUA 3X24B 3META 3G6EQ 4FYVB 4OGCA 2KEAA 3CCEA 2GFAA 5GAOp 4C8QC 1X01A 1WXBA 5KYWA 3LW5E 1WLPB 2RO0A 4J5YA 1BK2A 1KHCA 2EJGA 4JS5A 1S72Q 2HQEA 3I5SA 3I55Q 3PIPA 1B7TA 1NPPA 4WF2A 1NZ9A 4M75A 3CMAT 1X75C 1YI2Q 3TQ7P 3REBB 2GQVA 2FRWA 4DBFA 5KCOA 1M1KC 3OW2A 4AFSC 2Y4XA 1K9MC 2GBQA 2QDYB 2CP5A 2LMJA 3L42A 4D8DA 4KH1B 2KAFA 2RQTA 3LGFA 5IH2A 3FEOA 4QQ6A 3CCMQ 4V2SA 1LOJA 3JCMb 1Q86C 2H3JA 5GANe 4BI3A 2SRCA 1PSFA 3E2UA 1IHVA 2HBPA 2FPDA 2GNCA 2RQRA 1C0MA 4RTTA 1QQJA 3CCLA 1OPLA 1WHMA 1WXTA 4OVAA 4LDVA 1KC8R 2J6OA 4LDWA 1D0YA 1ZA2B 2B8AA 2JM9A 4OMPA 4DOWA 4PJJA 2KK4A 4L59A 4Z02A 4AT1B 1WZOA 2K7AA 2LVMA 3C12A 4HCZA 1VQ6A 4JLIA 1AEYA 5GAMg 5ECAA 2C0TA 1IGUA 2DJZA 3PE0A 2KR3A 2L2PA 3CCRQ 3JCMJ 2ZGWA 3BDUA 5GAMh 1ARKA 1GBQA 3QZ5B 1OU8A 3A8GB 3FRNA 1VQ4A 3H0HA 4HA8A 3G4ST 1BCOA 2YSQA 1K73U 3VKIA 4F7UE 1IO6A 2LDMA 1E6HA 2EWNA 4KRTA 4Y91A 3OYGA 1M1FA 3CD6Q 3FDRA 1FWZA 2BKDN 2JS0A 4PJOD 4HCCA 2YHTA 4RTYA 4ORZA 1R77A 3VS0A 2PZ1A 4IIMA 3LLRA 3NHNA 2J06A 1V1CA 3QG1A 2FPFA 4J6WA 1OZ3A 3KFVA 2DNUA 1H641 1RABB 2LX7A 1UDLA 1Q7YC 3QSUA 1YN8A 1YJNQ 3AT1B 1TUGB 2QGFB 1N9RA 1G3YA 1JO8A 4JRIA 2DTHA 2DXTA 2GCXA 4E7JA 1B3QA 4PLLA 3M0UA 2BZXA 1WHLA 2RHXA 2L3PA 2P4RA 4M7DD 2QI2A 4BD3A 2D8HA 2QASA 2QQBA 2A7YA 2F2WA 1VQPA 1W2BA 4OMLA 4Z8AA 2DXBA 4LUEA 2KY9A 1N8RC 2QYZA 2B86A 3H0IA 1D0ZA 3M4YA 2H3EB 1OX8A 5J26A 1X6BA 3SWNA 3RDVA 2JZ2A 5I22A 2KYBA 2F1LA 2L3QA 1ZHIA 1LNXA 2DKGA 3CPWA 3ULRB 2RN8A 3JB9F 4KUIA 1NYGA 1OPKA 2YWWA 1I5LA 1QVFP 3A8MB 3PMIA 2RJCA 2HMAA 3PVQA 1TOVA 3CCQQ 2JS2A 3MCAB 5IHKA 2CKKA 1I07A 2DPPB 5D6YA 1K1ZA 1YBYA 4FM4B 3TU4K 4N4HA 1Y0MA 2LJ0A 4J7IA 2JUFA 4UC4A 3VS7A 2BTTA 3G6ET 2PVGB 1LJOA 4M7AG 1MMDA 4FU6A 1M8VA 3RERA 1ZSZC 4J9FA 3M53A 4LDUA 3M4GA 4BY6B 4DOVA 4LD9K 2FEIA 3SEMA 3A5ZB 3JB9J 2DZ9A 4C5EA 1S72T 4C92B 4AFUC 3GNFB 1K8AC 1Q82C 4FW2A 4Y92A 2CT4A 1UGPB 4JRKA 4DEYA 5LJ3g 1OEBA 4RTVA 1YI2T 4C92F 2J7IA 3X28B 2F2XA 3T9NA 4JUVA 5LJ3h 2F2VA 4M7AA 5GAOl 2NWMA 1K8AR 1JJ2A 4QVCA 2ESWA 1Q82R 3EHRA 3BDLA 1K76A 1Y96B 3BFMA 1V29B 5LJ5f 2XIDA 4PK4A 4M78E 3OYKA 2LT1A 3CCMT 4QKUA 2AIRB 2EFIA 3NFCA 2QQSA 1VQMQ 4ATOA 1X43A 1NPRA 1YIJA 4M75C 2LNVA 3R6NA 3OYBA 2M51A 4J9DA 4ZNXA 3NPFA 5L8RE 3OYNA 3M56A 3H9NA 2L3SA 3RMQA 3FJ5A 1YJWA 4IKFA 4MDWA 5GAMj 5C6SA 3OBWA 3SFMA 2K5FA 4MMKA 1JEGA 5FU6B 3D7SB 4BB7A 3CCEQ 4B6MA 1TU0B 4A4KA 4LDXA 1UGQB 4JLGA 3RKWA 5GAN7 5CIUA 2NLUA 1KJWA 4KGZB 1YWOA 3PIOA 3CCRT 4BDZA 1X69A 2E3HA 2P0QA 1S1NA 2PU9B 1O75A 1RAFB 2M0YA 3THKA 1BYMA 4XTXA 2HL3A 2WACA 3EG9B 1W70A 2EIFA 2KYMA 4BUGA 2MAMA 5GAN3 4QT7A 1JRIA 2D0QB 2XDBA 4A4HA 2O9SA 1VQOA 1KD1C 3DKMA 4JDSA 1N5ZA 3HKSA 1GCPA 4KH0B 2BE9B 5GMKm 4BE0A 4PJMA 3QDRB 1X27A 2L3RA 3EFOA 1ZX6A 5FU7B 4PJOG 2FYKA 3M55A 2LQNA 4F7UB 1B34A 3JCMd 3OB9A 4KULA 4LNPA 4N4GA 3CCVA 2IG0A 1KD1R 4PL6A 3VU3C 2D8JA 1RLPC 2EGEA 4FIBA 2E1HA 1MMAA 2I0NA 2CS7A 4HXJA 1MMGA 3L2QA 3CCLQ 1M1KU 3M5AA 3VRZA 3UDCA 2DYIA 3UT1A 2HEQA 3OYFA 1K9MU 3VUZA 4XU2A 3WVEB 4RG2A 4PJOA 2JVVA 3NTKA 4M7DB 1ZQ1A 5KYXA 1E6GA 1PD1A 1SPKA 2QXFA 3Q1JA 4FSXA 4RUGA 3SHWA 4OB0B 1VQ6Q 3QYGB 2DL8A 2DMOA 2L0AA 2VYTA 2ZPIB 2DVJA 2IIMA 5GMKe 1P92A 2DTOA 4BI4A 2RNAA 2OJ2A 3OQ5A 1I5OB 2GGRA 3OW2P 1QVGS 1IREB 4K11A 1VQ4Q 4NL3A 3MPUB 4JJCA 4M77G 3JCMe 1VQLA 5M9OA 2KBTA 4EMKB 3LGLA 2DL7A 3HHTB 1Q81C 1TS9A 4XTZA 1UTIA 2HNIA 3EH2A 5CAIA 4PFZA 3CCUA 3SWNC 1EZZB 1NM7A 1BI3A 5LJ3j 1T0JA 1CSKA 3MP1A 4E6RA 4M77A 4QW2A 4J8OA 5GAOq 1SF9A 1AVZC 3MJXA 5CR2A 1YITT 2DBMA 2FB7A 1QLYA 4GBQA 1M2VB 2HL5C 1VQPQ 5AYFA 2LQKA 4J9CA 4FT2A 3NTHA 1N6AA 1VQKA 4WCIA 2JM8A 3WXMB 4RKUE 1YHQA 2O4XA 1QKWA 1Q7YU 1VQ8A 4B9WA 2COWA 1IGQA 2IVWA 3GOXA 2CYZB 4OF1A 1VQMT 5A0LA 3URGA 2YT6A 2JTMA 3C0CA 1JXOA 2ED1A 2CP6A 4D8KA 1KQSS 4M78B 4E7KA 2HD0A 1N8RU 3P8BB 1MV3A 3MP8A 4TVRA 4M7AC 2FL7A 5KE3A 2QA4A 3L2VA 4A4FA 1RAEB 5DY9A 2VXEA 4M78F 3LWHA 2DVEA 1D3BB 5KYYA 3C94A 3JB9D 5J39A 1UJYA 2ABLA 2J05A 1ZSZA 2EYYA 1UJ0A 1AWXA 3DLMA 2KXDA 5KCHA 1M90C 1W2BP
chains in the Genus database with same CATH topology
3N5BB 3A8GB 1HXDA 3FRNA 2XD0A 1VQ4A 4HA8A 3G4ST 3DLLA 2LRQA 2PVDB 1K73U 3VKIA 2DD4A 4E7IA 3I56A 2E64A 3C4SA 5CKEA 3SDZA 4F7UE 2ZPBB 2LDMA 4XU0A 3FIFA 2V8IA 1KG1A 2EWNA 2CZ7B 2K5LA 3CCQT 4Y91A 3OYGA 1M1FA 3FDRA 2K2VA 2OTJA 1M4ZA 4E7HA 3HRSA 5CQXA 1FWZA 2BKDN 4M7DA 3LYIA 5KE2A 5C0MA 4KT0E 4PJOD 3G6EA 4ZGJB 4HCCA 3GIBA 5GAN4 4OP0A 2YHTA 2L89A 3RMSA 2RI2A 4N4IA 4XTWA 1VQOT 1XTDA 5GANd 1UGSB 2MWOA 3LLRA 3QG1A 2BUDA 3L2WA 1VQ8T 2QQ9A 1K8AU 4BACA 4J6WA 4LDYA 1OZ3A 4C92D 1Q82U 1WJQA 1H641 4X9CA 1M90U 4C8QG 2CZ1B 1S72A 1BI1A 3L1AA 3RKYA 1Q7YC 3I55A 3QSUA 3FJPA 1BIAA 1BKBA 3PGGA 2EKOA 1N9RA 1G3YA 4PKCC 2P0PA 2ZZDA 4JRIA 3PFSA 3JRZA 2DTHA 5GAN5 2DXTA 1G5VA 2GCXA 4E7JA 3CCLT 4M77F 4PLLA 3OY9A 3CC7A 4HCBA 1YI2A 2V8KA 4EMKA 3JCMP 2RHXA 3EAEA 2GFUA 3JB9I 3G71A 4M7DD 2DTIA 2OTLA 1WJRA 3H8ZA 5D6XA 2QI2A 3G7ZA 3RIRA 1IZ6A 2EJ9A 4M75F 4BD3A 2DXCA 2QQBA 2A7YA 2QA4T 1VQPA 1W2BA 1WJSA 3HPWA 4C5HA 4EMHA 2CZ6B 2DXBA 2CZ0B 5A2QE 3OYJA 4L5GA 2KY9A 1N8RC 1UEBA 2X4WA 2QTXA 1WQWA 1NE8A 3M4YA 3CXCA 3DB4A 5J26A 5DLOA 4C8QA 4XU3A 2PQWA 3X26B 3SWNA 3P8HA 2JZ2A 4Q5WA 3BY7A 3QBYA 3OYCA 4C5GA 4MZPA 1Y07A 1ZHIA 2MF2A 4XAXB 1LNXA 1KHIA 3CCMA 4EPCA 3OYIA 2DKGA 2AHJB 3LX7A 3VYGA 3ER0A 3CPWA 5FROA 5KH6A 5CO7A 1B34B 4GY5A 3JB9F 3KXTA 4KUIA 5D6WA 3QIIA 2XG8D 2RJEA 1VQ4T 1I5LA 3A8MB 3PMIA 5GAN6 1SSFA 1WQ7A 2XU8A 2WSFE 2RJCA 2QEXA 4M75D 2ZPEB 3I56T 3MEUA 2RHYA 2RJFA 3MCAB 4C8QE 3E1SA 1XQHA 2CKKA 4N0AC 4O5VA 1YJ9A 2DPPB 3EFRA 5D6YA 3OBYA 3X20B 1YBYA 4M78G 2XDDA 1K73C 4FM4B 5DLQE 3TU4K 2F69A 4N4HA 2DD5A 2FVUA 3RESA 4J7IA 2JUFA 4UC4A 3G6ET 4II1A 3S3OA 1GXIE 1XOVA 4PJOC 2PVGB 5GANj 2RI5A 4JS4A 1LJOA 5LJ5d 4M7AG 4PJOB 2FHDA 2RD1A 4OMFB 4FU6A 5GAMd 1Y7XA 5IN1A 3HRTA 1M8VA 3RERA 2A3LA 4BY6C 3M53A 1QVPA 2VXFA 2EQMA 4IUQA 3UPUA 4LDUA 3M4GA 1W2BS 4BY6B 5CKBA 1BI0A 5GMKh 4DOVA 5GAN2 3CCET 3J7AF 4LD9K 5FRNA 3A5ZB 2WSEE 4PLIA 3CCUT 3MHXA 4C92C 4RMOA 3JB9J 1I81A 2DZ9A 2E10A 2KVQG 4PJOF 4C5EA 3CCJA 1S72T 4C92B 3V8JA 4F7UF 3OS0A 3CXCS 2QQAA 3CCRA 2MMPA 3GNFB 3QO3A 2E5QA 3JCMg 1K8AC 3KUFA 1Q82C 1YITA 3CMAA 3MEVA 4M78A 1UGPB 4JRKA 5LJ3g 5A0DA 5LL6S 4R55A 4E7LA 3CC7T 4JJNK 1YI2T 1QP3A 3JCMh 4C92F 2EQJA 3CPWS 3PT9A 3G71T 3X28B 2ZPFB 2OTLT 3OYHA 1KD1U 3CD6A 3T9NA 4JUVA 3MEAA 1N27A 5LJ3h 4M7AA 2PUOB 4HKEA 4YTLA 3OYLA 5GAOl 4ZN1A 1JJ2A 4QVCA 1KC8U 1D3BA 5DM7R 1VQ9T 3BDLA 1QVFA 4QVDA 2RM4A 1Y96B 4A4EA 1U1SA 3BFMA 3L2ZA 5GAN8 4HT8A 1V29B 2EQKA 3GP8A 4OB2B 2RHIA 3CBMA 4J6XA 4L6V5 2XIDA 5LJ5f 1ZBXA 1NJIU 1FXXA 4M78E 3OYKA 2LT1A 4VUBA 5GAMf 3OYEA 2D6FA 4M7DF 3VUBA 2D9TA 1VQKT 4C5IA 2XKOC 2DEQA 3QZ9B 3GPLA 3BW1A 3CCMT 3RUXA 2KDSA 2VC8A 3ZEHA 3CMEA 1YHQT 2EFIA 2ZPHB 2HQXA 4M7AE 2RHUA 2YLBA 2RI3A 5I2SA 2XI9A 2E65A 2RB6A 3NFCA 3GLXA 3P8DA 2QQSA 3HP9A 4M77C 2X35A 3M57A 5GAOn 4O6JA 1YJNA 3FB9A 5IAYA 2G3RA 3OMGA 4M77B 5LJ5e 1KQ2A 4ATOA 4J83A 5GAMe 1WPYA 2QEXT 2R5MA 4MDXA 1HK9A 1VQNT 1NPRA 5HK3A 5EG2A 2K3YA 4OB3B 4XU1A 4M75C 3OS2A 1YIJA 4CRIA 3HSBA 2LNVA 4M7AD 3V7SA 2E41A 4M75B 3OYBA 1YJ9T 2E12A 4NOYA 3ME9A 4ZTJA 3OYAA 4RG8A 4NS5A 2RK2A 4P5NA 4MMLA 4R56A 3HRUA 5L8RE 2JTFA 3M56A 4ZGEB 1QW1A 2JNGA 2K4YA 4FT4A 3V7RA 3OYNA 3OYDA 4XK8E 1OYXA 2Y4YA 3HL8A 3RMQA 5LJ5j 5GMKj 1VQ5A 3L2UA 1Y71A 1YJWA 4IKFA 4MDWA 3CBOA 3JCMW 5GAMj 5C6SA 3OBWA 3SFMA 3OYYA 2K5FA 5FU6C 5GANg 3HFNA 5CQYA 4MMKA 3ZFJA 2XICA 4BI8B 3E9FA 5FU6B 4BB7A 2DIGA 4C0FA 4A4KA 4LDXA 5I21A 3CPFA 1UGQB 3M54A 4JLGA 3RKWA 2M1HA 3QJ6A 5CIUA 5GAN7 1JJ2S 1QVFS 3JB9G 4IUTA 2LTOA 2NLUA 4E47A 2O4XB 3H6ZA 3TEEA 1VQ6T 3CCJT 3HFOA 3EFSA 4X9DA 2E6NA 3MO8A 3PIOA 3CCRT 1G3WA 2K57A 5CCAA 4BDZA 2P0QA 3CC4A 3R6OA 3J80E 2XDPA 3CBPA 2RA2A 4XTYA 1MGQA 5CKHA 3V8KA 3VJPA 2ZCFB 3J81E 2LX9A 1X6OA 4OB1B 1RI0A 3JCMc 2PU9B 1O75A 1M9SA 2DXUA 2I2LA 3SD4A 3CCQA 2RK1A 3OSVA 2RH2A 2L8DA 5A0GA 1BYMA 4XTXA 3S6WA 2WACA 4OGEA 5GMKi 4M77E 1YCYA 2LT4A 3E19A 2EIFA 4BUGA 2XK0A 3FLGA 2MAMA 5GAN3 2KMTA 4Y28E 1JRIA 2D0QB 3JAME 2XDBA 2VUBA 4A4HA 2R57A 1VQOA 1KD1C 2OTJT 2RJDA 2O01E 2Y90A 3DKMA 4JDSA 4KBMB 3JCMV 3HKSA 5HK0A 4XTUA 2DK3A 5GMKm 4BE0A 2DZCA 2ZPGB 3QDRB 2BIVA 3O8VA 2L3RA 5FU7C 1VIEA 3L2RA 1KC8C 1H3ZA 4C8QD 1QP2A 5FU7B 4PJOG 2FYKA 2VGMA 3OSSC 4C0DC 3M55A 5J3BA 4F7UB 3TREA 3CMET 4C0DB 4X34A 1NJIC 4XQ3A 1B34A 3JCMd 3OB9A 1BIBA 4KULA 4N4GA 3CCVA 5HY6A 2IG0A 2CGHA 4ME7A 2M0OA 4PL6A 1DJ7B 2C06A 5LJ3d 1RL2A 3QYHB 1TH7A 1VQ7A 3PNWC 3CEYA 3PMTA 2EQUA 3UWNA 4FIBA 3VU3C 3OMCA 1O9SA 2E1HA 3I55T 2R5AA 1YIJT 2MI6A 4A53A 4ZN3A 4GLKA 4EDUA 2CS7A 2KQWA 4N0AA 3L2QA 4QVZA 1M1KU 3M5AA 3UDCA 4FL6A 2LC4A 3NTIA 3UT1A 3QXEB 2DIQA 2V8JA 4LD6A 2L5QA 3OYFA 1K9MU 3VUZA 3C95A 5CVIA 2DO3A 3M9QA 4QQGA 4XU2A 1N9SA 1EIFA 2JN0A 2X4YA 1VQ5T 3WVEB 4RG2A 4PJOA 2JVVA 2XHCA 4M7DC 3NTKA 3ASKA 1VQPT 4J7FA 1JBMA 4M7DB 3X25B 1G3TA 1ZQ1A 3OW2S 4M7AF 2PVOB 2GF7A 1PSEA 4RCBA 3V8LA 3Q1JA 2QXFA 4FSXA 2YRVA 1BI2A 1WNLA 2M9UA 4OB0B 1M5Q1 2WSCE 3QYGB 2VYTA 2ZPIB 3OA6A 2R58A 2HAXA 4C92A 3JB9H 4MZTA 5GMKe 1P92A 3S3NA 2DTOA 3JCMf 4BI4A 4JRQA 5CKFA 4XTVA 3CC4T 3OQ5A 1VQMA 2OAUA 2EYQA 3MP6A 5LJ3f 4PJOE 2X4XA 1QVGS 1IREB 3QJYA 3A8LB 3JSCA 4NL3A 4M78D 3VV0A 4M77G 3M59A 2K3XA 3QUIA 4EMGA 4PNOA 1UB4A 5GAOr 2P0KA 3RKXA 4EMKC 3JCMe 3CC2A 3OS5A 1VQLA 3WVDB 5I2MA 1KQ1A 2PUKB 4C0ZA 5M9OA 4C92E 1W4SA 2P4TA 4M75G 3KBGA 3LGLA 4EMKB 5CK9A 4ZGDB 3CCSA 5LJ3e 1Y96A 4JRPA 2VGNA 3GNGA 4DQ2A 3AHUA 3HHTB 1WGSA 3META 4QQDA 3X24B 1Q81C 4XTZA 4OGCA 4DA4A 2HNIA 2M16A 2LCLA 3OS1A 5CAIA 2KSSA 3CCEA 2GFAA 5GAOp 4BE2A 4C8QC 1X01A 3CCUA 3SWNC 3LW5E 1FX7A 1OZ2A 4C8QB 3SWNB 4NL2A 1BI3A 2F5KA 4M7DE 3CCVT 2RO0A 4J5YA 1I8FA 4A4GA 1KQSA 2EJGA 1KHCA 5LJ3j 3MP1A 5FLXE 2JOYA 4M77A 2HQEA 4JS5A 1VQ7T 4QW2A 1G3SA 5GANh 4IURA 3PIPA 4J8OA 3QPHA 4B9XA 5GAOq 4C8QF 1NPPA 4ELZC 4WF2A 4KUDK 1NZ9A 4M75A 3G4SA 5CR2A 1YITT 3CMAT 1X75C 2FB7A 2GQVA 1MHNA 1AHJB 1OI1A 3F70A 2LQ8A 1VQ9A 3TCJA 2VV5A 5KCOA 5AYFA 1M1KC 3CD6T 3OW2A 1Q81U 2LQKA 1U1TA 3MEWA 4HT9A 5GANf 2Y4XA 4FT2A 3FC3A 3NTHA 3E9GA 3INZA 1K9MC 2YLCA 1N6AA 1VQKA 2QDYB 4J6YA 3L42A 3LWIA 4M75E 3WXMB 3JCMX 4RKUE 2EAYA 1YHQA 3V7CA 2O4XA 2E6ZA 3A8HB 1Q7YU 2KAFA 2MWPA 4CI0C 4M77D 3GF5A 1VQ8A 4B9WA 3LGFA 2IVWA 3FEOA 4QQ6A 3GOXA 4V2SA 1LOJA 3S3MA 3JCMb 1Q86C 1QVGA 2H3JA 4F7UG 2CYZB 4D6WA 4OF1A 5GANe 4IUPA 4BDYA 1VQMT 5A0LA 3URGA 4BI3A 4BE1A 4ZTFA 1PSFA 5FRMA 3QHSA 1VQNA 2JTMA 4IUVA 4MZMA 2F5TX 4C0GA 3VYHB 1YJNT 2HBPA 4M78C 5IT9E 5CKDA 1KQSS 4M78B 4C92G 3CCLA 4E7KA 1XNIA 1JB0E 2HD0A 2LCCA 4LDVA 4OVAA 4A54A 1VQLT 3CC2T 4LDWA 3P8BB 1N8RU 3M58A 3LH0A 3SB2A 3CCST 1R8OB 3MP8A 4TVRA 4M7AC 3PTAA 3OYMA 2FL7A 5KE3A 2QA4A 1VUBA 3L2VA 4M7AB 4A4FA 5GAOm 1UGRB 5DY9A 2QQRA 2B8AA 2VXEA 4M78F 3LWHA 5GMKl 2DVEA 4DOWA 1D3BB 3C94A 4ELYC 3JB9D 2KK4A 4IUUA 4L59A 4Z02A 1YJWT 2E70A 1U8RA 5J39A 4F7UA 4M7DG 3JCMQ 2RHZA 3DB3A 2LVMA 3C12A 4HCZA 5LJ5g 2EJFA 4JLIA 1VQ6A 2K5IA 5GAMg 2X4JA 5HKCA 3DLMA 1VIFA 1Q86U 2DAQA 3A8OB 3ZBDA 1M1GA 2DJZA 1I4K1 5KCHA 4RCCA 5LJ5h 1M90C 3JCMJ 2ZGWA 3BDUA 5GAMh 3QKJA 3QZ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTZ A;  1LJO A;  1HXD A;  1MGQ A;  2RA2 A;  4XTY A;  4HA8 A;  3V8K A;  5LJ5 d;  4M7A G;  2HNI A;  2RD1 A;  4PJO B;  5GAM d;  3JCM c;  1M8V A;  5CAI A;  3RER A;  2DXU A;  2I2L A;  5GAO p;  2VXF A;  4C8Q C;  1X01 A;  2E64 A;  4F7U E;  3M4G A;  3SWN C;  4XTX A;  4XU0 A;  3FIF A;  4C8Q B;  5GMK i;  5GMK h;  2EWN A;  3SWN B;  4NL2 A;  4M77 E;  1YCY A;  4Y91 A;  5GAN 2;  4M7D E;  4J5Y A;  1I8F A;  4C92 C;  3JB9 J;  1I81 A;  2DZ9 A;  2E10 A;  2EJG A;  4PJO F;  5LJ3 j;  5GAN 3;  4C92 B;  4M77 A;  3V8J A;  4F7U F;  4M7D A;  1JRI A;  3QO3 A;  5GAN h;  3JCM g;  4PJO D;  3GIB A;  2Y90 A;  3JCM V;  5GAO q;  5GAN 4;  4OP0 A;  2YHT A;  4XTU A;  4C8Q F;  5GMK m;  4M78 A;  2DZC A;  4WF2 A;  4XTW A;  5GAN d;  4JRK A;  4M75 A;  5LJ3 g;  4C8Q D;  4PJO G;  2FYK A;  3JCM h;  4C92 F;  2FB7 A;  4F7U B;  4J6W A;  4C92 D;  4JUV A;  4XQ3 A;  1B34 A;  5LJ3 h;  3JCM d;  4M7A A;  1BIB A;  1H64 1;  4X9C A;  4C8Q G;  5GAO l;  2CGH A;  3L1A A;  4QVC A;  1D3B A;  3RKY A;  1U1T A;  5LJ3 d;  3QSU A;  4QVD A;  4HT9 A;  1TH7 A;  3FJP A;  1BIA A;  5GAN f;  2RM4 A;  1Y96 B;  3PGG A;  1U1S A;  1N9R A;  3BFM A;  3INZ A;  3L2Z A;  3VU3 C;  5GAN 8;  4HT8 A;  2YLC A;  2E1H A;  4JRI A;  4J6X A;  2DTH A;  5LJ5 f;  2DXT A;  5GAN 5;  4M78 E;  4J6Y A;  4A53 A;  4M75 E;  4M77 F;  5GAM f;  3JCM X;  4M7D F;  4N0A A;  2EAY A;  3V7C A;  2DEQ A;  4EMK A;  3JCM P;  3BW1 A;  4M77 D;  3JB9 I;  4M7D D;  3RUX A;  2DTI A;  2VC8 A;  3RIR A;  4V2S A;  1LOJ A;  2EJ9 A;  4M75 F;  3JCM b;  4M7A E;  2YLB A;  5GAN e;  4F7U G;  4XU2 A;  2E65 A;  2RB6 A;  1N9S A;  2JN0 A;  4EMH A;  5GAO n;  4M77 C;  4PJO A;  4M7D C;  3QHS A;  3FB9 A;  5LJ5 e;  4M77 B;  2QTX A;  1JBM A;  1WQW A;  1KQ2 A;  4M7D B;  5GAM e;  1WPY A;  4M7A F;  1HK9 A;  3V8L A;  4RCB A;  4M78 C;  4C8Q A;  4XU3 A;  4M75 C;  4XU1 A;  3HSB A;  3SWN A;  1WNL A;  4M78 B;  4C92 G;  4M7A D;  1M5Q 1;  2E41 A;  4M75 B;  3V7S A;  3BY7 A;  4A54 A;  4NOY A;  4C92 A;  3JB9 H;  1LNX A;  3SB2 A;  5GMK e;  2DKG A;  4MML A;  2DTO A;  3JCM f;  4M7A C;  3V7R A;  4XTV A;  1B34 B;  4M7A B;  5GAO m;  3JB9 F;  5DY9 A;  5LJ5 j;  2VXE A;  4M78 F;  5LJ3 f;  5GMK l;  4PJO E;  2DVE A;  3JCM W;  5GAM j;  1I5L A;  1D3B B;  5GAN 6;  3JB9 D;  1WQ7 A;  4NL3 A;  5GAN g;  4M78 D;  3HFN A;  4MMK A;  4M75 D;  4M77 G;  4F7U A;  3QUI A;  3JCM Q;  4M7D G;  4C8Q E;  5LJ5 g;  5I21 A;  2EJF A;  4JLI A;  4N0A C;  3RKW A;  4EMG A;  5GAN 7;  4PNO A;  5GAM g;  3EFR A;  3RKX A;  4EMK C;  3JCM e;  5GAO r;  3JB9 G;  5GMK j;  1KQ1 A;  4M78 G;  4C92 E;  4M75 G;  3HFO A;  4EMK B;  3EFS A;  4X9D A;  2DJZ A;  1I4K 1;  3RES A;  5LJ3 e;  1Y96 A;  5LJ5 h;  4RCC A;  2K57 A;  4DQ2 A;  3JCM J;  3AHU A;  2ZGW A;  3BDU A;  5GAM h;  4PJO C;  5GAN j; 
#chains in the Genus database with same CATH topology
 3N5B B;  1QCO A;  3DLL A;  4E7I A;  1OX9 A;  2NUT B;  3SDZ A;  2ZPB B;  1K4U S;  3FIF A;  3CQT A;  1KG1 A;  2O31 A;  1KK7 A;  5I11 A;  2OTJ A;  8AT1 B;  1M4Z A;  2CSQ A;  4AG1 C;  1FMW A;  5C0M A;  5KE2 A;  3CPW P;  3I5R A;  3GIB A;  4OP0 A;  3RMS A;  2RI2 A;  4N4I A;  5GAN d;  5FWB A;  2FZG B;  4FSS A;  2MWO A;  2VVK A;  2BUD A;  2LNH B;  3L2W A;  2NUZ A;  1K8A U;  2EVR A;  1Q82 U;  4C92 D;  4X9C A;  2CZ1 B;  1BI1 A;  2SEM A;  1BIA A;  4F16 A;  2NUP A;  4PKC C;  2X9H A;  1ZUY A;  3JRZ A;  1G5V A;  2CUD A;  3CCL T;  1YIJ Q;  3OY9 A;  2V8K A;  3CCS Q;  2O2O A;  3EAE A;  2GFU A;  4IIO A;  3G71 A;  2DTI A;  2OTL A;  4M75 F;  4DEX A;  5A2Q E;  2AZS A;  1YJW Q;  2QTX A;  1TTH B;  1WQW A;  2K9G A;  1RAH B;  3X26 B;  3P8H A;  1WXU A;  3QBY A;  4MZP A;  1Y07 A;  4XAX B;  4A63 B;  1KHI A;  4EPC A;  3U23 A;  2X3X D;  3LX7 A;  5CO7 A;  4GY5 A;  1JJ2 P;  1M1K R;  2RJE A;  1VQ4 T;  1SSF A;  2XU8 A;  3M0S A;  1K9M R;  1JXM A;  2PNI A;  2RHY A;  4C8Q E;  4O5V A;  3EFR A;  4LXC A;  3X20 B;  2MIO A;  5DLQ E;  2DD5 A;  2FVU A;  1Q86 R;  3S3O A;  1VQO Q;  2EGC A;  4PJO C;  2CP3 A;  2VWF A;  5LJ5 d;  1Y7X A;  3HRT A;  2VXF A;  2EQM A;  4IUQ A;  4DBR A;  1W6X A;  1HD3 A;  2WSE E;  2ROL A;  3CCV Q;  3CCJ A;  1WFW A;  3CXC S;  2GTJ A;  1H8K A;  2OI3 A;  2E5Q A;  2AT1 B;  3KUF A;  3CMA A;  3EGU A;  4CC7 A;  4E7L A;  1PG5 B;  1W1F A;  1J3T A;  1KD1 U;  2ECZ A;  3VS4 A;  2CP0 A;  1N27 A;  1K9A A;  3OYL A;  4YTL A;  1VQ9 T;  2MCN A;  4A4E A;  1U1S A;  3L2Z A;  5GAM f;  2D6F A;  2V26 A;  3VUB A;  4CC4 B;  2XKO C;  5GJW B;  2ZPH B;  2RI3 A;  2E65 A;  5GAO n;  4M77 C;  3M57 A;  3FB9 A;  5LJ5 e;  2KGT A;  1KQ2 A;  1XJW B;  4RTU A;  1VQN T;  3HSB A;  4CRI A;  1NG2 A;  1BB9 A;  3ME9 A;  1UUE A;  1VQL Q;  4NS5 A;  1PNJ A;  3HRU A;  2JTF A;  1QW1 A;  2JNG A;  3OYD A;  4XK8 E;  3HL8 A;  1QWE A;  1Q7Y R;  3OYY A;  3TVT A;  4JJB A;  5GAN g;  3HFN A;  2DJQ A;  5CQY A;  3ZFJ A;  4BI8 B;  5KYU B;  3CCU Q;  3QJ6 A;  2ZAE A;  3JB9 G;  2YDL A;  4E47 A;  3H6Z A;  3PVL A;  4X9D A;  1YP5 A;  2CH4 A;  5CCA A;  2RQU A;  2CP2 A;  2KT8 A;  5CKH A;  1N8R R;  1NBE B;  1RI0 A;  3SD4 A;  1B07 A;  3S6W A;  4OGE A;  5GMK i;  1LPL A;  1YCY A;  4M77 E;  4X1V A;  5EC7 A;  1HJD A;  1F1B B;  1NLO C;  2VUB A;  3VS6 A;  2R57 A;  4KBM B;  3JCM V;  5HK0 A;  1VQK Q;  2BIV A;  1VIE A;  2EYW A;  1H3Z A;  2LJ3 A;  2J6K A;  1YHQ Q;  1PKS A;  3OSS C;  4C0D C;  5J3B A;  4OMO A;  3EG3 A;  1VQ8 Q;  4X34 A;  1Z9Q A;  1BIB A;  4ME7 A;  2M0O A;  1RL2 A;  3QYH B;  1VQ7 A;  3CEY A;  2EQU A;  2ED0 A;  3OMC A;  4J9G A;  1O9S A;  3I55 T;  1YIJ T;  1YWP A;  4ZN3 A;  4GLK A;  2KQW A;  1AT1 B;  4FL6 A;  2LC4 A;  2CDT A;  4LD6 A;  2FRY A;  4M4Z A;  2DO3 A;  2QA4 Q;  2X4Y A;  3ASK A;  4J7F A;  1JBM A;  3X25 B;  1I1J A;  3OW2 S;  4M7A F;  2PVO B;  1GBR A;  1PSE A;  4RCB A;  3V8L A;  5D7U A;  3OA6 A;  2MK5 A;  4C92 A;  4MZT A;  1QCN A;  1AZE A;  2KRS A;  2KE9 A;  3MP6 A;  4F14 A;  5LJ3 f;  1PRL C;  1Q95 G;  1ZUU A;  3A8L B;  4M78 D;  1TG0 A;  2HKQ B;  1X6G A;  4PNO A;  1UB4 A;  2EYX A;  2P0K A;  3CC2 A;  3OS5 A;  5I2M A;  1KQ1 A;  3QWX X;  2P4T A;  3KBG A;  1M3A A;  2OTJ Q;  4ZGD B;  3CCS A;  1Y96 A;  2VGN A;  1WGS A;  2JT4 A;  2LCL A;  1RAI B;  2KSS A;  4BE2 A;  2JJ9 A;  1FX7 A;  1NLP C;  4C8Q B;  3CCV T;  1I8F A;  4A4G A;  1KQS A;  1WA7 A;  2A37 A;  2JOY A;  1PKT A;  1X2Q A;  1G3S A;  4IUR A;  4C8Q F;  1SG5 A;  1Z9Z A;  4WTO B;  1MHN A;  3G71 Q;  1OI1 A;  3F70 A;  2LQ8 A;  2OTL Q;  4Z88 A;  2E4H A;  2VV5 A;  3CD6 T;  1U1T A;  3FC3 A;  3E9G A;  1T3S A;  3M0R A;  3TSZ A;  4M75 E;  1PM3 A;  3JCM X;  2LCS A;  3V7C A;  1OQK A;  2E6Z A;  3A8H B;  1GCQ A;  2MWP A;  3GF5 A;  4F7U G;  4D6W A;  4BDY A;  4IUP A;  4ZTF A;  1QWF A;  4C0G A;  3VYH B;  3EGD B;  1YJN T;  3EG9 A;  5CKD A;  1XNI A;  1JB0 E;  1VQL T;  1K0X A;  3LH0 A;  3SB2 A;  3PTA A;  3OYM A;  1VUB A;  1G83 A;  5GAO m;  1UGR B;  5KYX B;  4IUU A;  4F7U A;  4M7D G;  3JCM Q;  3DB3 A;  4FYX B;  1PC0 A;  2W0Z A;  2K5I A;  5HKC A;  1VIF A;  1Q86 U;  2DAQ A;  3A8O B;  3NMZ C;  3ZBD A;  3CCJ Q;  1I4K 1;  2BZ8 A;  1AWW A;  2QTV A;  3QKJ A;  1HXD A;  1RAA B;  3CMA Q;  1FMK A;  2LRQ A;  5AT1 B;  2DD4 A;  3I56 A;  2E64 A;  1MUZ A;  4XU0 A;  1M27 C;  3CCQ T;  2J6F A;  1D09 B;  2CUB A;  4F04 B;  2K2V A;  1ABQ A;  2DFU A;  4EIK A;  3HRS A;  5CQX A;  1YNZ A;  4M7D A;  3LYI A;  4KT0 E;  1OOT A;  2DE0 X;  4ZGJ B;  4LUD A;  1D1A A;  5L23 A;  2JMC A;  2HDA A;  2QDL A;  1VQ8 T;  1WX6 A;  4BAC A;  4LDY A;  1WJQ A;  4OMM A;  2V1R A;  2CT3 A;  3FJP A;  3JV3 A;  3PGG A;  2CRE A;  2ZZD A;  1Q81 R;  3PFS A;  1GRI A;  4M77 F;  2DLP A;  3CC7 A;  4HCB A;  4EMK A;  3JCM P;  2DBK A;  3JB9 I;  3RIR A;  2EJ9 A;  2VAS A;  1EX4 A;  2QA4 T;  3UA6 A;  1WJS A;  3HPW A;  4C5H A;  2CZ6 B;  3UAT A;  1UEB A;  2X4W A;  1JU5 C;  3CXC A;  1ZSG A;  5DLO A;  4XU3 A;  2KRM A;  4LN2 A;  2KRN A;  3BY7 A;  4Q5W A;  3OYC A;  4C5G A;  4AG2 C;  1GFC A;  2ENM A;  1AD5 A;  2AHJ B;  3VYG A;  5FRO A;  2KNB B;  4PFP A;  3QII A;  2DRM A;  2XG8 D;  2QEX A;  2RJF A;  3E1S A;  2EGA A;  1XQH A;  3VS3 A;  4DBQ A;  2Z0W A;  1YJ9 A;  1M2V A;  3OBY A;  4M78 G;  1WYX A;  2MPX C;  2F69 A;  3RES A;  9ATC B;  1U3O A;  1XOV A;  1RAD B;  2RI5 A;  1WI7 A;  4JS4 A;  1UHF A;  5GAM d;  5IN1 A;  2A3L A;  4BY6 C;  2QAZ A;  3UPU A;  1ZSZ B;  2OAW A;  2IPO B;  4RTX A;  5GMK h;  3CCE T;  1VA7 A;  2O9V A;  1OV3 A;  3MHX A;  4C92 C;  4RMO A;  1I81 A;  2E10 A;  2DL3 A;  2KVQ G;  3V8J A;  2QQA A;  3QO3 A;  3JCM g;  2EYZ A;  1SKU B;  1VQ7 Q;  2LJ1 A;  1YIT A;  3MEV A;  4M78 A;  5A0D A;  4R55 A;  1ZBJ A;  1SEM A;  2RF0 A;  4JJN K;  3JCM h;  3G71 T;  2OTL T;  3OYH A;  1VYU A;  3MEA A;  2PUO B;  3EGX B;  1UG1 A;  2JMA A;  5FWC A;  4ZN1 A;  1AWO A;  1D3B A;  5IHN A;  5DM7 R;  2KRO A;  4QVD A;  1M90 R;  2DER A;  2RM4 A;  3RNJ A;  4HT8 A;  3GP8 A;  2COY A;  4OB2 B;  2RHI A;  4J6X A;  3M0T A;  1TUC A;  2VKN A;  2E5K A;  3OYE A;  2LZ6 B;  2DEQ A;  3GPL A;  3BW1 A;  3RUX A;  2KDS A;  2VC8 A;  3CME A;  5KYW B;  3RR6 A;  3G1J A;  4M7A E;  2RHU A;  5I2S A;  2XI9 A;  2RB6 A;  3A1P A;  3GLX A;  2G3R A;  4FCY A;  1IB8 A;  5GAM e;  4MDX A;  2YUO A;  1HK9 A;  5HK3 A;  3OS2 A;  1M3B A;  2K3Y A;  4OB3 B;  4XU1 A;  4M7A D;  4M75 B;  4ZTJ A;  3BE3 A;  3CC2 Q;  2RK2 A;  2FZK B;  4P5N A;  4ZGE B;  1CKA A;  1AWJ A;  1VQ5 A;  3CBO A;  3JCM W;  5FU6 C;  2XIC A;  1RLQ C;  4C0F A;  5I21 A;  3M54 A;  4KGX B;  1QVF S;  1GCQ C;  2FPE A;  2LTO A;  3HTR A;  2M02 A;  3TEE A;  1VQ6 T;  3CCJ T;  1Y57 A;  2E6N A;  3MO8 A;  1G3W A;  3NGP A;  2W10 A;  3A98 A;  3CC4 A;  2K3B A;  3CBP A;  1MGQ A;  4AFQ C;  3VJP A;  1FMV A;  1X6O A;  2FZC B;  4OB1 B;  1M9S A;  2I2L A;  3OSV A;  2RH2 A;  2L8D A;  1TUD A;  1VYV A;  2D1X A;  1RAC B;  2LT4 A;  1IXD A;  1H3H A;  3VS2 A;  2KMT A;  2DIL A;  4JZ4 A;  3JAM E;  2GTO A;  2Y90 A;  4XTU A;  2DK3 A;  3EG1 A;  4F17 A;  3O8V A;  5FU7 C;  4GLM A;  1KC8 C;  1G8X A;  4C8Q D;  1RUW A;  2VGM A;  1UFF A;  2C0O A;  2GQI A;  3TRE A;  1NJI C;  4XQ3 A;  4HVV A;  5HY6 A;  1RI9 A;  2CGH A;  5LJ3 d;  1TH7 A;  3PNW C;  3PMT A;  3UWN A;  2A28 A;  2R5A A;  1RAG B;  2MI6 A;  2X3W D;  4N0A A;  1D0X A;  2DA9 A;  1NJI R;  3NTI A;  2O88 A;  3H41 A;  2L5Q A;  3C95 A;  3M9Q A;  4QQG A;  2HSE B;  1KQS P;  1EIF A;  2JN0 A;  4M7D C;  3REA B;  1VQP T;  2NYS A;  1NYF A;  2YRV A;  1BI2 A;  1WNL A;  3EH1 A;  1M5Q 1;  2WSC E;  4CC3 A;  2CH4 W;  4PJN A;  1WDX A;  2HAX A;  1GFD A;  3JB9 H;  2H8H A;  3IQL A;  4AFZ C;  4KGV B;  1OUL A;  2DL5 A;  3S3N A;  2FO0 A;  2AKK A;  2JW4 A;  4XTV A;  1NEB A;  2OAU A;  4PJO E;  1C6V X;  2DL4 A;  2OX7 A;  3QJY A;  1MMN A;  3VV0 A;  3QUI A;  3I56 Q;  2HKN A;  3RKX A;  4EMK C;  2MOX A;  5GMK j;  1HSQ A;  5CK9 A;  2CSI A;  1CKB A;  5LJ3 e;  4JRP A;  1D1C A;  1R0B G;  3GNG A;  2VB6 A;  4QQD A;  4DA4 A;  2M16 A;  3OS1 A;  2HZY A;  1OZ2 A;  3SWN B;  4NL2 A;  2F5K A;  2HSP A;  4M7D E;  4R0K A;  3I35 A;  1SRM A;  1UEC A;  5IXB A;  1PCX A;  5FLX E;  2EBP A;  2HBW A;  2YUN A;  1VQ7 T;  5GAN h;  3QPH A;  4B9X A;  1MNE A;  4FW1 A;  1M2O A;  1JQQ A;  4ELZ C;  4KUD K;  4E7S A;  3G4S A;  1M30 A;  3CC7 Q;  1AHJ B;  1VQ9 A;  3TCJ A;  4OMN A;  1Q81 U;  1KSW A;  3MEW A;  4HT9 A;  5GAN f;  3INZ A;  2YLC A;  5KYU A;  4J6Y A;  3LWI A;  1E7O A;  2EAY A;  1K0S A;  2DYB A;  4CI0 C;  4M77 D;  2A36 A;  1X2K A;  3S3M A;  1IHW A;  1QVG A;  2YRD A;  4BE1 A;  5FRM A;  3QHS A;  1VQN A;  4IUV A;  4MZM A;  2F5T X;  4M78 C;  1LVK A;  2QEX Q;  5IT9 E;  4PFO A;  1YFN A;  4HVW A;  4C92 G;  2COZ A;  1HYO A;  2LCC A;  4A54 A;  3CC2 T;  7AT1 B;  1SRL A;  1YJ9 Q;  3EG0 A;  3M58 A;  3QWY A;  3CCS T;  1R8O B;  1G2B A;  2K2M A;  2A08 A;  3GBQ A;  3O5Z A;  4M7A B;  2QQR A;  2LP5 A;  5GMK l;  1YCS B;  4ELY C;  1YJW T;  2E70 A;  1U8R A;  1NEG A;  2RHZ A;  4PJL A;  2HCK A;  5LJ5 g;  2EJF A;  2X4J A;  3M0Q A;  5HCK A;  1M1G A;  5LJ5 h;  4RCC A;  1TWB A;  4R56 A;  1YIT Q;  2XD0 A;  2PVD B;  3CXC P;  3C4S A;  5CKE A;  4JPB W;  2X51 A;  1WHH A;  2V8I A;  2CZ7 B;  2K5L A;  1SSH A;  2KXC A;  4Z89 A;  4E7H A;  3G6E A;  5GAN 4;  2L89 A;  4ANJ A;  2JXB A;  4XTW A;  1VQO T;  1XTD A;  2PTK A;  1BU1 A;  1UGS B;  3ZL7 C;  2QQ9 A;  3CME Q;  1M90 U;  4C8Q G;  2RQW A;  1S72 A;  3L1A A;  1TXQ A;  3RKY A;  3I55 A;  1BKB A;  2EKO A;  2AZV A;  2P0P A;  2QGG A;  1AOJ A;  2DRK A;  5GAN 5;  3RBB B;  1YI2 A;  2DEU A;  4JJD A;  4AMC A;  1WJR A;  3H8Z A;  5D6X A;  3G7Z A;  1IZ6 A;  2DXC A;  4EMH A;  2CZ0 B;  3OYJ A;  4L5G A;  1ACM B;  1VQ5 Q;  6AT1 B;  1NE8 A;  1PHT A;  3VRY A;  4JZ3 A;  1D1B A;  3DB4 A;  1M8M A;  4C8Q A;  1QKX A;  2PQW A;  2EQI A;  2RQV A;  3EFO B;  2MF2 A;  1PWT A;  2EKH A;  3CCM A;  3OYI A;  3VS5 A;  1GL5 A;  3ER0 A;  5KH6 A;  2C0I A;  1B34 B;  1I0C A;  3EHQ A;  3KXT A;  3I9Q A;  5D6W A;  3CC4 Q;  4OMQ A;  4ESR A;  5GAN 6;  1ABO A;  2A0F B;  1WQ7 A;  2WSF E;  2QG9 B;  4M75 D;  2ZPE B;  3I56 T;  3MEU A;  4J9B A;  4N0A C;  4J9I A;  2HQH A;  2XDD A;  1K73 C;  3VS1 A;  5KYN A;  1GXI E;  4II1 A;  1UHC A;  3H0F A;  5GAN j;  2YXY A;  1AZG B;  4PJO B;  1BCM A;  1VYT A;  2FHD A;  2RD1 A;  4OMF B;  1SHF A;  1QVP A;  1W2B S;  2E3I A;  1A0N B;  5CKB A;  1BI0 A;  1K73 R;  5GAN 2;  1T0H A;  5FRN A;  4PLI A;  3CCU T;  1M3C A;  1ZA1 B;  4PJO F;  4LE9 A;  4E2F B;  4F7U F;  3OS0 A;  3CCR A;  2MMP A;  2EPD A;  3EGD A;  2YUP A;  2DET A;  1OU9 A;  5LL6 S;  3QDF A;  3CC7 T;  1QP3 A;  1SHG A;  2ATC B;  2EQJ A;  3CPW S;  3PT9 A;  2ZPF B;  3CD6 A;  3LH5 A;  2XMF A;  4HKE A;  2DF6 A;  1KC8 U;  1QVF A;  5GAN 8;  2EQK A;  4L6V 5;  3CBM A;  1NJI U;  1ZBX A;  1FXX A;  4VUB A;  4M7D F;  2D9T A;  1VQK T;  4C5I A;  2YRC A;  3M0P A;  3QZ9 B;  4FYY B;  5FW9 A;  5IHI A;  3ZEH A;  1YHQ T;  1MND A;  2HQX A;  2YLB A;  1TSF A;  3P8D A;  3J7A F;  3HP9 A;  2X35 A;  4O6J A;  1YJN A;  2LQW A;  5IAY A;  3OMG A;  4M77 B;  4J83 A;  1WPY A;  2QEX T;  2R5M A;  3TSW A;  1MV0 B;  5EG2 A;  3V7S A;  2E41 A;  1YJ9 T;  2E12 A;  3MKD A;  4NOY A;  4HCK A;  3OYA A;  4RG8 A;  4MML A;  1WIE A;  2K4Y A;  4FT4 A;  3V7R A;  1VOM A;  4J9H A;  1OYX A;  2Y4Y A;  5LJ5 j;  3L2U A;  1Y71 A;  4FYW B;  4J9E A;  1KIK A;  2D0N A;  3E9F A;  8ATC B;  2DIG A;  4HVU A;  1LCK A;  3CPF A;  1JJ2 S;  2M1H A;  1UE9 A;  4IUT A;  2O4X B;  2RPN A;  3HFO A;  3EFS A;  1PRM C;  1EFN A;  2G6F X;  2K57 A;  2AK5 A;  3R6O A;  3J80 E;  2XDP A;  2JTE A;  1QCF A;  2RA2 A;  4XTY A;  3V8K A;  1KFZ A;  1U5S A;  2ZCF B;  3J81 E;  2LX9 A;  3JCM c;  3G4S Q;  2DXU A;  3CCQ A;  2RK1 A;  5A0G A;  2DX1 A;  1QMC A;  3E19 A;  2XK0 A;  3FLG A;  1VQ9 Q;  1FYN A;  4Y28 E;  2KT1 A;  1IRX A;  3UF4 A;  2OTJ T;  2RJD A;  2O01 E;  2DZC A;  2AKL A;  2ZPG B;  3L2R A;  5KYY B;  1QP2 A;  2P84 A;  3CME T;  4C0D B;  1UGV A;  3EG2 A;  1V76 A;  2EW3 A;  1T3L A;  1DJ7 B;  4RTZ A;  2C06 A;  2RMO A;  1VQN Q;  2BE7 D;  2FG0 A;  1PD0 A;  4CC2 A;  2K6D A;  1U06 A;  3UA7 A;  4A53 A;  4EDU A;  1R0C B;  4QVZ A;  1C1A A;  3QXE B;  2DIQ A;  2V8J A;  2KI7 A;  4RTW A;  2CP7 A;  5CVI A;  4E7Z A;  2DM1 A;  1N9S A;  1VQ5 T;  1ZLM A;  2XHC A;  2K79 A;  1G3T A;  2GF7 A;  1WHG A;  1H92 A;  2BZY A;  2M9U A;  2YUQ A;  4DBH A;  2R58 A;  2ROT A;  1ZUK A;  3JCM f;  4JRQ A;  5CKF A;  1BBZ A;  1WHK A;  3CC4 T;  1VQM A;  2EYQ A;  2MYS A;  2X4X A;  3JSC A;  2NUP B;  5GJV B;  3M59 A;  2K3X A;  4EMG A;  2NUT A;  2QK0 A;  3EGX A;  5GAO r;  5IXF A;  3WVD B;  2PUK B;  4C0Z A;  4C92 E;  1W4S A;  4M75 G;  2V1Q A;  4DQ2 A;  1QVG P;  1WHJ A;  3AHU A;  3X24 B;  3MET A;  3G6E Q;  4FYV B;  4OGC A;  2KEA A;  3CCE A;  2GFA A;  5GAO p;  4C8Q C;  1X01 A;  1WXB A;  5KYW A;  3LW5 E;  1WLP B;  2RO0 A;  4J5Y A;  1BK2 A;  1KHC A;  2EJG A;  4JS5 A;  1S72 Q;  2HQE A;  3I5S A;  3I55 Q;  3PIP A;  1B7T A;  1NPP A;  4WF2 A;  1NZ9 A;  4M75 A;  3CMA T;  1X75 C;  1YI2 Q;  3TQ7 P;  3REB B;  2GQV A;  2FRW A;  4DBF A;  5KCO A;  1M1K C;  3OW2 A;  4AFS C;  2Y4X A;  1K9M C;  2GBQ A;  2QDY B;  2CP5 A;  2LMJ A;  3L42 A;  4D8D A;  4KH1 B;  2KAF A;  2RQT A;  3LGF A;  5IH2 A;  3FEO A;  4QQ6 A;  3CCM Q;  4V2S A;  1LOJ A;  3JCM b;  1Q86 C;  2H3J A;  5GAN e;  4BI3 A;  2SRC A;  1PSF A;  3E2U A;  1IHV A;  2HBP A;  2FPD A;  2GNC A;  2RQR A;  1C0M A;  4RTT A;  1QQJ A;  3CCL A;  1OPL A;  1WHM A;  1WXT A;  4OVA A;  4LDV A;  1KC8 R;  2J6O A;  4LDW A;  1D0Y A;  1ZA2 B;  2B8A A;  2JM9 A;  4OMP A;  4DOW A;  4PJJ A;  2KK4 A;  4L59 A;  4Z02 A;  4AT1 B;  1WZO A;  2K7A A;  2LVM A;  3C12 A;  4HCZ A;  1VQ6 A;  4JLI A;  1AEY A;  5GAM g;  5ECA A;  2C0T A;  1IGU A;  2DJZ A;  3PE0 A;  2KR3 A;  2L2P A;  3CCR Q;  3JCM J;  2ZGW A;  3BDU A;  5GAM h;  1ARK A;  1GBQ A;  3QZ5 B;  1OU8 A;  3A8G B;  3FRN A;  1VQ4 A;  3H0H A;  4HA8 A;  3G4S T;  1BCO A;  2YSQ A;  1K73 U;  3VKI A;  4F7U E;  1IO6 A;  2LDM A;  1E6H A;  2EWN A;  4KRT A;  4Y91 A;  3OYG A;  1M1F A;  3CD6 Q;  3FDR A;  1FWZ A;  2BKD N;  2JS0 A;  4PJO D;  4HCC A;  2YHT A;  4RTY A;  4ORZ A;  1R77 A;  3VS0 A;  2PZ1 A;  4IIM A;  3LLR A;  3NHN A;  2J06 A;  1V1C A;  3QG1 A;  2FPF A;  4J6W A;  1OZ3 A;  3KFV A;  2DNU A;  1H64 1;  1RAB B;  2LX7 A;  1UDL A;  1Q7Y C;  3QSU A;  1YN8 A;  1YJN Q;  3AT1 B;  1TUG B;  2QGF B;  1N9R A;  1G3Y A;  1JO8 A;  4JRI A;  2DTH A;  2DXT A;  2GCX A;  4E7J A;  1B3Q A;  4PLL A;  3M0U A;  2BZX A;  1WHL A;  2RHX A;  2L3P A;  2P4R A;  4M7D D;  2QI2 A;  4BD3 A;  2D8H A;  2QAS A;  2QQB A;  2A7Y A;  2F2W A;  1VQP A;  1W2B A;  4OML A;  4Z8A A;  2DXB A;  4LUE A;  2KY9 A;  1N8R C;  2QYZ A;  2B86 A;  3H0I A;  1D0Z A;  3M4Y A;  2H3E B;  1OX8 A;  5J26 A;  1X6B A;  3SWN A;  3RDV A;  2JZ2 A;  5I22 A;  2KYB A;  2F1L A;  2L3Q A;  1ZHI A;  1LNX A;  2DKG A;  3CPW A;  3ULR B;  2RN8 A;  3JB9 F;  4KUI A;  1NYG A;  1OPK A;  2YWW A;  1I5L A;  1QVF P;  3A8M B;  3PMI A;  2RJC A;  2HMA A;  3PVQ A;  1TOV A;  3CCQ Q;  2JS2 A;  3MCA B;  5IHK A;  2CKK A;  1I07 A;  2DPP B;  5D6Y A;  1K1Z A;  1YBY A;  4FM4 B;  3TU4 K;  4N4H A;  1Y0M A;  2LJ0 A;  4J7I A;  2JUF A;  4UC4 A;  3VS7 A;  2BTT A;  3G6E T;  2PVG B;  1LJO A;  4M7A G;  1MMD A;  4FU6 A;  1M8V A;  3RER A;  1ZSZ C;  4J9F A;  3M53 A;  4LDU A;  3M4G A;  4BY6 B;  4DOV A;  4LD9 K;  2FEI A;  3SEM A;  3A5Z B;  3JB9 J;  2DZ9 A;  4C5E A;  1S72 T;  4C92 B;  4AFU C;  3GNF B;  1K8A C;  1Q82 C;  4FW2 A;  4Y92 A;  2CT4 A;  1UGP B;  4JRK A;  4DEY A;  5LJ3 g;  1OEB A;  4RTV A;  1YI2 T;  4C92 F;  2J7I A;  3X28 B;  2F2X A;  3T9N A;  4JUV A;  5LJ3 h;  2F2V A;  4M7A A;  5GAO l;  2NWM A;  1K8A R;  1JJ2 A;  4QVC A;  2ESW A;  1Q82 R;  3EHR A;  3BDL A;  1K76 A;  1Y96 B;  3BFM A;  1V29 B;  5LJ5 f;  2XID A;  4PK4 A;  4M78 E;  3OYK A;  2LT1 A;  3CCM T;  4QKU A;  2AIR B;  2EFI A;  3NFC A;  2QQS A;  1VQM Q;  4ATO A;  1X43 A;  1NPR A;  1YIJ A;  4M75 C;  2LNV A;  3R6N A;  3OYB A;  2M51 A;  4J9D A;  4ZNX A;  3NPF A;  5L8R E;  3OYN A;  3M56 A;  3H9N A;  2L3S A;  3RMQ A;  3FJ5 A;  1YJW A;  4IKF A;  4MDW A;  5GAM j;  5C6S A;  3OBW A;  3SFM A;  2K5F A;  4MMK A;  1JEG A;  5FU6 B;  3D7S B;  4BB7 A;  3CCE Q;  4B6M A;  1TU0 B;  4A4K A;  4LDX A;  1UGQ B;  4JLG A;  3RKW A;  5GAN 7;  5CIU A;  2NLU A;  1KJW A;  4KGZ B;  1YWO A;  3PIO A;  3CCR T;  4BDZ A;  1X69 A;  2E3H A;  2P0Q A;  1S1N A;  2PU9 B;  1O75 A;  1RAF B;  2M0Y A;  3THK A;  1BYM A;  4XTX A;  2HL3 A;  2WAC A;  3EG9 B;  1W70 A;  2EIF A;  2KYM A;  4BUG A;  2MAM A;  5GAN 3;  4QT7 A;  1JRI A;  2D0Q B;  2XDB A;  4A4H A;  2O9S A;  1VQO A;  1KD1 C;  3DKM A;  4JDS A;  1N5Z A;  3HKS A;  1GCP A;  4KH0 B;  2BE9 B;  5GMK m;  4BE0 A;  4PJM A;  3QDR B;  1X27 A;  2L3R A;  3EFO A;  1ZX6 A;  5FU7 B;  4PJO G;  2FYK A;  3M55 A;  2LQN A;  4F7U B;  1B34 A;  3JCM d;  3OB9 A;  4KUL A;  4LNP A;  4N4G A;  3CCV A;  2IG0 A;  1KD1 R;  4PL6 A;  3VU3 C;  2D8J A;  1RLP C;  2EGE A;  4FIB A;  2E1H A;  1MMA A;  2I0N A;  2CS7 A;  4HXJ A;  1MMG A;  3L2Q A;  3CCL Q;  1M1K U;  3M5A A;  3VRZ A;  3UDC A;  2DYI A;  3UT1 A;  2HEQ A;  3OYF A;  1K9M U;  3VUZ A;  4XU2 A;  3WVE B;  4RG2 A;  4PJO A;  2JVV A;  3NTK A;  4M7D B;  1ZQ1 A;  5KYX A;  1E6G A;  1PD1 A;  1SPK A;  2QXF A;  3Q1J A;  4FSX A;  4RUG A;  3SHW A;  4OB0 B;  1VQ6 Q;  3QYG B;  2DL8 A;  2DMO A;  2L0A A;  2VYT A;  2ZPI B;  2DVJ A;  2IIM A;  5GMK e;  1P92 A;  2DTO A;  4BI4 A;  2RNA A;  2OJ2 A;  3OQ5 A;  1I5O B;  2GGR A;  3OW2 P;  1QVG S;  1IRE B;  4K11 A;  1VQ4 Q;  4NL3 A;  3MPU B;  4JJC A;  4M77 G;  3JCM e;  1VQL A;  5M9O A;  2KBT A;  4EMK B;  3LGL A;  2DL7 A;  3HHT B;  1Q81 C;  1TS9 A;  4XTZ A;  1UTI A;  2HNI A;  3EH2 A;  5CAI A;  4PFZ A;  3CCU A;  3SWN C;  1EZZ B;  1NM7 A;  1BI3 A;  5LJ3 j;  1T0J A;  1CSK A;  3MP1 A;  4E6R A;  4M77 A;  4QW2 A;  4J8O A;  5GAO q;  1SF9 A;  1AVZ C;  3MJX A;  5CR2 A;  1YIT T;  2DBM A;  2FB7 A;  1QLY A;  4GBQ A;  1M2V B;  2HL5 C;  1VQP Q;  5AYF A;  2LQK A;  4J9C A;  4FT2 A;  3NTH A;  1N6A A;  1VQK A;  4WCI A;  2JM8 A;  3WXM B;  4RKU E;  1YHQ A;  2O4X A;  1QKW A;  1Q7Y U;  1VQ8 A;  4B9W A;  2COW A;  1IGQ A;  2IVW A;  3GOX A;  2CYZ B;  4OF1 A;  1VQM T;  5A0L A;  3URG A;  2YT6 A;  2JTM A;  3C0C A;  1JXO A;  2ED1 A;  2CP6 A;  4D8K A;  1KQS S;  4M78 B;  4E7K A;  2HD0 A;  1N8R U;  3P8B B;  1MV3 A;  3MP8 A;  4TVR A;  4M7A C;  2FL7 A;  5KE3 A;  2QA4 A;  3L2V A;  4A4F A;  1RAE B;  5DY9 A;  2VXE A;  4M78 F;  3LWH A;  2DVE A;  1D3B B;  5KYY A;  3C94 A;  3JB9 D;  5J39 A;  1UJY A;  2ABL A;  2J05 A;  1ZSZ A;  2EYY A;  1UJ0 A;  1AWX A;  3DLM A;  2KXD A;  5KCH A;  1M90 C;  1W2B P; 
#chains in the Genus database with same CATH homology
 3N5B B;  3A8G B;  1HXD A;  3FRN A;  2XD0 A;  1VQ4 A;  4HA8 A;  3G4S T;  3DLL A;  2LRQ A;  2PVD B;  1K73 U;  3VKI A;  2DD4 A;  4E7I A;  3I56 A;  2E64 A;  3C4S A;  5CKE A;  3SDZ A;  4F7U E;  2ZPB B;  2LDM A;  4XU0 A;  3FIF A;  2V8I A;  1KG1 A;  2EWN A;  2CZ7 B;  2K5L A;  3CCQ T;  4Y91 A;  3OYG A;  1M1F A;  3FDR A;  2K2V A;  2OTJ A;  1M4Z A;  4E7H A;  3HRS A;  5CQX A;  1FWZ A;  2BKD N;  4M7D A;  3LYI A;  5KE2 A;  5C0M A;  4KT0 E;  4PJO D;  3G6E A;  4ZGJ B;  4HCC A;  3GIB A;  5GAN 4;  4OP0 A;  2YHT A;  2L89 A;  3RMS A;  2RI2 A;  4N4I A;  4XTW A;  1VQO T;  1XTD A;  5GAN d;  1UGS B;  2MWO A;  3LLR A;  3QG1 A;  2BUD A;  3L2W A;  1VQ8 T;  2QQ9 A;  1K8A U;  4BAC A;  4J6W A;  4LDY A;  1OZ3 A;  4C92 D;  1Q82 U;  1WJQ A;  1H64 1;  4X9C A;  1M90 U;  4C8Q G;  2CZ1 B;  1S72 A;  1BI1 A;  3L1A A;  3RKY A;  1Q7Y C;  3I55 A;  3QSU A;  3FJP A;  1BIA A;  1BKB A;  3PGG A;  2EKO A;  1N9R A;  1G3Y A;  4PKC C;  2P0P A;  2ZZD A;  4JRI A;  3PFS A;  3JRZ A;  2DTH A;  5GAN 5;  2DXT A;  1G5V A;  2GCX A;  4E7J A;  3CCL T;  4M77 F;  4PLL A;  3OY9 A;  3CC7 A;  4HCB A;  1YI2 A;  2V8K A;  4EMK A;  3JCM P;  2RHX A;  3EAE A;  2GFU A;  3JB9 I;  3G71 A;  4M7D D;  2DTI A;  2OTL A;  1WJR A;  3H8Z A;  5D6X A;  2QI2 A;  3G7Z A;  3RIR A;  1IZ6 A;  2EJ9 A;  4M75 F;  4BD3 A;  2DXC A;  2QQB A;  2A7Y A;  2QA4 T;  1VQP A;  1W2B A;  1WJS A;  3HPW A;  4C5H A;  4EMH A;  2CZ6 B;  2DXB A;  2CZ0 B;  5A2Q E;  3OYJ A;  4L5G A;  2KY9 A;  1N8R C;  1UEB A;  2X4W A;  2QTX A;  1WQW A;  1NE8 A;  3M4Y A;  3CXC A;  3DB4 A;  5J26 A;  5DLO A;  4C8Q A;  4XU3 A;  2PQW A;  3X26 B;  3SWN A;  3P8H A;  2JZ2 A;  4Q5W A;  3BY7 A;  3QBY A;  3OYC A;  4C5G A;  4MZP A;  1Y07 A;  1ZHI A;  2MF2 A;  4XAX B;  1LNX A;  1KHI A;  3CCM A;  4EPC A;  3OYI A;  2DKG A;  2AHJ B;  3LX7 A;  3VYG A;  3ER0 A;  3CPW A;  5FRO A;  5KH6 A;  5CO7 A;  1B34 B;  4GY5 A;  3JB9 F;  3KXT A;  4KUI A;  5D6W A;  3QII A;  2XG8 D;  2RJE A;  1VQ4 T;  1I5L A;  3A8M B;  3PMI A;  5GAN 6;  1SSF A;  1WQ7 A;  2XU8 A;  2WSF E;  2RJC A;  2QEX A;  4M75 D;  2ZPE B;  3I56 T;  3MEU A;  2RHY A;  2RJF A;  3MCA B;  4C8Q E;  3E1S A;  1XQH A;  2CKK A;  4N0A C;  4O5V A;  1YJ9 A;  2DPP B;  3EFR A;  5D6Y A;  3OBY A;  3X20 B;  1YBY A;  4M78 G;  2XDD A;  1K73 C;  4FM4 B;  5DLQ E;  3TU4 K;  2F69 A;  4N4H A;  2DD5 A;  2FVU A;  3RES A;  4J7I A;  2JUF A;  4UC4 A;  3G6E T;  4II1 A;  3S3O A;  1GXI E;  1XOV A;  4PJO C;  2PVG B;  5GAN j;  2RI5 A;  4JS4 A;  1LJO A;  5LJ5 d;  4M7A G;  4PJO B;  2FHD A;  2RD1 A;  4OMF B;  4FU6 A;  5GAM d;  1Y7X A;  5IN1 A;  3HRT A;  1M8V A;  3RER A;  2A3L A;  4BY6 C;  3M53 A;  1QVP A;  2VXF A;  2EQM A;  4IUQ A;  3UPU A;  4LDU A;  3M4G A;  1W2B S;  4BY6 B;  5CKB A;  1BI0 A;  5GMK h;  4DOV A;  5GAN 2;  3CCE T;  3J7A F;  4LD9 K;  5FRN A;  3A5Z B;  2WSE E;  4PLI A;  3CCU T;  3MHX A;  4C92 C;  4RMO A;  3JB9 J;  1I81 A;  2DZ9 A;  2E10 A;  2KVQ G;  4PJO F;  4C5E A;  3CCJ A;  1S72 T;  4C92 B;  3V8J A;  4F7U F;  3OS0 A;  3CXC S;  2QQA A;  3CCR A;  2MMP A;  3GNF B;  3QO3 A;  2E5Q A;  3JCM g;  1K8A C;  3KUF A;  1Q82 C;  1YIT A;  3CMA A;  3MEV A;  4M78 A;  1UGP B;  4JRK A;  5LJ3 g;  5A0D A;  5LL6 S;  4R55 A;  4E7L A;  3CC7 T;  4JJN K;  1YI2 T;  1QP3 A;  3JCM h;  4C92 F;  2EQJ A;  3CPW S;  3PT9 A;  3G71 T;  3X28 B;  2ZPF B;  2OTL T;  3OYH A;  1KD1 U;  3CD6 A;  3T9N A;  4JUV A;  3MEA A;  1N27 A;  5LJ3 h;  4M7A A;  2PUO B;  4HKE A;  4YTL A;  3OYL A;  5GAO l;  4ZN1 A;  1JJ2 A;  4QVC A;  1KC8 U;  1D3B A;  5DM7 R;  1VQ9 T;  3BDL A;  1QVF A;  4QVD A;  2RM4 A;  1Y96 B;  4A4E A;  1U1S A;  3BFM A;  3L2Z A;  5GAN 8;  4HT8 A;  1V29 B;  2EQK A;  3GP8 A;  4OB2 B;  2RHI A;  3CBM A;  4J6X A;  4L6V 5;  2XID A;  5LJ5 f;  1ZBX A;  1NJI U;  1FXX A;  4M78 E;  3OYK A;  2LT1 A;  4VUB A;  5GAM f;  3OYE A;  2D6F A;  4M7D F;  3VUB A;  2D9T A;  1VQK T;  4C5I A;  2XKO C;  2DEQ A;  3QZ9 B;  3GPL A;  3BW1 A;  3CCM T;  3RUX A;  2KDS A;  2VC8 A;  3ZEH A;  3CME A;  1YHQ T;  2EFI A;  2ZPH B;  2HQX A;  4M7A E;  2RHU A;  2YLB A;  2RI3 A;  5I2S A;  2XI9 A;  2E65 A;  2RB6 A;  3NFC A;  3GLX A;  3P8D A;  2QQS A;  3HP9 A;  4M77 C;  2X35 A;  3M57 A;  5GAO n;  4O6J A;  1YJN A;  3FB9 A;  5IAY A;  2G3R A;  3OMG A;  4M77 B;  5LJ5 e;  1KQ2 A;  4ATO A;  4J83 A;  5GAM e;  1WPY A;  2QEX T;  2R5M A;  4MDX A;  1HK9 A;  1VQN T;  1NPR A;  5HK3 A;  5EG2 A;  2K3Y A;  4OB3 B;  4XU1 A;  4M75 C;  3OS2 A;  1YIJ A;  4CRI A;  3HSB A;  2LNV A;  4M7A D;  3V7S A;  2E41 A;  4M75 B;  3OYB A;  1YJ9 T;  2E12 A;  4NOY A;  3ME9 A;  4ZTJ A;  3OYA A;  4RG8 A;  4NS5 A;  2RK2 A;  4P5N A;  4MML A;  4R56 A;  3HRU A;  5L8R E;  2JTF A;  3M56 A;  4ZGE B;  1QW1 A;  2JNG A;  2K4Y A;  4FT4 A;  3V7R A;  3OYN A;  3OYD A;  4XK8 E;  1OYX A;  2Y4Y A;  3HL8 A;  3RMQ A;  5LJ5 j;  5GMK j;  1VQ5 A;  3L2U A;  1Y71 A;  1YJW A;  4IKF A;  4MDW A;  3CBO A;  3JCM W;  5GAM j;  5C6S A;  3OBW A;  3SFM A;  3OYY A;  2K5F A;  5FU6 C;  5GAN g;  3HFN A;  5CQY A;  4MMK A;  3ZFJ A;  2XIC A;  4BI8 B;  3E9F A;  5FU6 B;  4BB7 A;  2DIG A;  4C0F A;  4A4K A;  4LDX A;  5I21 A;  3CPF A;  1UGQ B;  3M54 A;  4JLG A;  3RKW A;  2M1H A;  3QJ6 A;  5CIU A;  5GAN 7;  1JJ2 S;  1QVF S;  3JB9 G;  4IUT A;  2LTO A;  2NLU A;  4E47 A;  2O4X B;  3H6Z A;  3TEE A;  1VQ6 T;  3CCJ T;  3HFO A;  3EFS A;  4X9D A;  2E6N A;  3MO8 A;  3PIO A;  3CCR T;  1G3W A;  2K57 A;  5CCA A;  4BDZ A;  2P0Q A;  3CC4 A;  3R6O A;  3J80 E;  2XDP A;  3CBP A;  2RA2 A;  4XTY A;  1MGQ A;  5CKH A;  3V8K A;  3VJP A;  2ZCF B;  3J81 E;  2LX9 A;  1X6O A;  4OB1 B;  1RI0 A;  3JCM c;  2PU9 B;  1O75 A;  1M9S A;  2DXU A;  2I2L A;  3SD4 A;  3CCQ A;  2RK1 A;  3OSV A;  2RH2 A;  2L8D A;  5A0G A;  1BYM A;  4XTX A;  3S6W A;  2WAC A;  4OGE A;  5GMK i;  4M77 E;  1YCY A;  2LT4 A;  3E19 A;  2EIF A;  4BUG A;  2XK0 A;  3FLG A;  2MAM A;  5GAN 3;  2KMT A;  4Y28 E;  1JRI A;  2D0Q B;  3JAM E;  2XDB A;  2VUB A;  4A4H A;  2R57 A;  1VQO A;  1KD1 C;  2OTJ T;  2RJD A;  2O01 E;  2Y90 A;  3DKM A;  4JDS A;  4KBM B;  3JCM V;  3HKS A;  5HK0 A;  4XTU A;  2DK3 A;  5GMK m;  4BE0 A;  2DZC A;  2ZPG B;  3QDR B;  2BIV A;  3O8V A;  2L3R A;  5FU7 C;  1VIE A;  3L2R A;  1KC8 C;  1H3Z A;  4C8Q D;  1QP2 A;  5FU7 B;  4PJO G;  2FYK A;  2VGM A;  3OSS C;  4C0D C;  3M55 A;  5J3B A;  4F7U B;  3TRE A;  3CME T;  4C0D B;  4X34 A;  1NJI C;  4XQ3 A;  1B34 A;  3JCM d;  3OB9 A;  1BIB A;  4KUL A;  4N4G A;  3CCV A;  5HY6 A;  2IG0 A;  2CGH A;  4ME7 A;  2M0O A;  4PL6 A;  1DJ7 B;  2C06 A;  5LJ3 d;  1RL2 A;  3QYH B;  1TH7 A;  1VQ7 A;  3PNW C;  3CEY A;  3PMT A;  2EQU A;  3UWN A;  4FIB A;  3VU3 C;  3OMC A;  1O9S A;  2E1H A;  3I55 T;  2R5A A;  1YIJ T;  2MI6 A;  4A53 A;  4ZN3 A;  4GLK A;  4EDU A;  2CS7 A;  2KQW A;  4N0A A;  3L2Q A;  4QVZ A;  1M1K U;  3M5A A;  3UDC A;  4FL6 A;  2LC4 A;  3NTI A;  3UT1 A;  3QXE B;  2DIQ A;  2V8J A;  4LD6 A;  2L5Q A;  3OYF A;  1K9M U;  3VUZ A;  3C95 A;  5CVI A;  2DO3 A;  3M9Q A;  4QQG A;  4XU2 A;  1N9S A;  1EIF A;  2JN0 A;  2X4Y A;  1VQ5 T;  3WVE B;  4RG2 A;  4PJO A;  2JVV A;  2XHC A;  4M7D C;  3NTK A;  3ASK A;  1VQP T;  4J7F A;  1JBM A;  4M7D B;  3X25 B;  1G3T A;  1ZQ1 A;  3OW2 S;  4M7A F;  2PVO B;  2GF7 A;  1PSE A;  4RCB A;  3V8L A;  3Q1J A;  2QXF A;  4FSX A;  2YRV A;  1BI2 A;  1WNL A;  2M9U A;  4OB0 B;  1M5Q 1;  2WSC E;  3QYG B;  2VYT A;  2ZPI B;  3OA6 A;  2R58 A;  2HAX A;  4C92 A;  3JB9 H;  4MZT A;  5GMK e;  1P92 A;  3S3N A;  2DTO A;  3JCM f;  4BI4 A;  4JRQ A;  5CKF A;  4XTV A;  3CC4 T;  3OQ5 A;  1VQM A;  2OAU A;  2EYQ A;  3MP6 A;  5LJ3 f;  4PJO E;  2X4X A;  1QVG S;  1IRE B;  3QJY A;  3A8L B;  3JSC A;  4NL3 A;  4M78 D;  3VV0 A;  4M77 G;  3M59 A;  2K3X A;  3QUI A;  4EMG A;  4PNO A;  1UB4 A;  5GAO r;  2P0K A;  3RKX A;  4EMK C;  3JCM e;  3CC2 A;  3OS5 A;  1VQL A;  3WVD B;  5I2M A;  1KQ1 A;  2PUK B;  4C0Z A;  5M9O A;  4C92 E;  1W4S A;  2P4T A;  4M75 G;  3KBG A;  3LGL A;  4EMK B;  5CK9 A;  4ZGD B;  3CCS A;  5LJ3 e;  1Y96 A;  4JRP A;  2VGN A;  3GNG A;  4DQ2 A;  3AHU A;  3HHT B;  1WGS A;  3MET A;  4QQD A;  3X24 B;  1Q81 C;  4XTZ A;  4OGC A;  4DA4 A;  2HNI A;  2M16 A;  2LCL A;  3OS1 A;  5CAI A;  2KSS A;  3CCE A;  2GFA A;  5GAO p;  4BE2 A;  4C8Q C;  1X01 A;  3CCU A;  3SWN C;  3LW5 E;  1FX7 A;  1OZ2 A;  4C8Q B;  3SWN B;  4NL2 A;  1BI3 A;  2F5K A;  4M7D E;  3CCV T;  2RO0 A;  4J5Y A;  1I8F A;  4A4G A;  1KQS A;  2EJG A;  1KHC A;  5LJ3 j;  3MP1 A;  5FLX E;  2JOY A;  4M77 A;  2HQE A;  4JS5 A;  1VQ7 T;  4QW2 A;  1G3S A;  5GAN h;  4IUR A;  3PIP A;  4J8O A;  3QPH A;  4B9X A;  5GAO q;  4C8Q F;  1NPP A;  4ELZ C;  4WF2 A;  4KUD K;  1NZ9 A;  4M75 A;  3G4S A;  5CR2 A;  1YIT T;  3CMA T;  1X75 C;  2FB7 A;  2GQV A;  1MHN A;  1AHJ B;  1OI1 A;  3F70 A;  2LQ8 A;  1VQ9 A;  3TCJ A;  2VV5 A;  5KCO A;  5AYF A;  1M1K C;  3CD6 T;  3OW2 A;  1Q81 U;  2LQK A;  1U1T A;  3MEW A;  4HT9 A;  5GAN f;  2Y4X A;  4FT2 A;  3FC3 A;  3NTH A;  3E9G A;  3INZ A;  1K9M C;  2YLC A;  1N6A A;  1VQK A;  2QDY B;  4J6Y A;  3L42 A;  3LWI A;  4M75 E;  3WXM B;  3JCM X;  4RKU E;  2EAY A;  1YHQ A;  3V7C A;  2O4X A;  2E6Z A;  3A8H B;  1Q7Y U;  2KAF A;  2MWP A;  4CI0 C;  4M77 D;  3GF5 A;  1VQ8 A;  4B9W A;  3LGF A;  2IVW A;  3FEO A;  4QQ6 A;  3GOX A;  4V2S A;  1LOJ A;  3S3M A;  3JCM b;  1Q86 C;  1QVG A;  2H3J A;  4F7U G;  2CYZ B;  4D6W A;  4OF1 A;  5GAN e;  4IUP A;  4BDY A;  1VQM T;  5A0L A;  3URG A;  4BI3 A;  4BE1 A;  4ZTF A;  1PSF A;  5FRM A;  3QHS A;  1VQN A;  2JTM A;  4IUV A;  4MZM A;  2F5T X;  4C0G A;  3VYH B;  1YJN T;  2HBP A;  4M78 C;  5IT9 E;  5CKD A;  1KQS S;  4M78 B;  4C92 G;  3CCL A;  4E7K A;  1XNI A;  1JB0 E;  2HD0 A;  2LCC A;  4LDV A;  4OVA A;  4A54 A;  1VQL T;  3CC2 T;  4LDW A;  3P8B B;  1N8R U;  3M58 A;  3LH0 A;  3SB2 A;  3CCS T;  1R8O B;  3MP8 A;  4TVR A;  4M7A C;  3PTA A;  3OYM A;  2FL7 A;  5KE3 A;  2QA4 A;  1VUB A;  3L2V A;  4M7A B;  4A4F A;  5GAO m;  1UGR B;  5DY9 A;  2QQR A;  2B8A A;  2VXE A;  4M78 F;  3LWH A;  5GMK l;  2DVE A;  4DOW A;  1D3B B;  3C94 A;  4ELY C;  3JB9 D;  2KK4 A;  4IUU A;  4L59 A;  4Z02 A;  1YJW T;  2E70 A;  1U8R A;  5J39 A;  4F7U A;  4M7D G;  3JCM Q;  2RHZ A;  3DB3 A;  2LVM A;  3C12 A;  4HCZ A;  5LJ5 g;  2EJF A;  4JLI A;  1VQ6 A;  2K5I A;  5GAM g;  2X4J A;  5HKC A;  3DLM A;  1VIF A;  1Q86 U;  2DAQ A;  3A8O B;  3ZBD A;  1M1G A;  2DJZ A;  1I4K 1;  5KCH A;  4RCC A;  5LJ5 h;  1M90 C;  3JCM J;  2ZGW A;  3BDU A;  5GAM h;  3QKJ A;  3QZ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...