4PJOF

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
total genus 15
structure length 73
sequence length 73
chains with identical sequence T, f, t
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoF00
2DXTA 3L1AA 5LJ3j 4PJOE 2I2LA 2EJ9A 4C92C 1BIAA 4M7AF 1I81A 4JRIA 3V7SA 4M75F 4F7UA 4DQ2A 4M7DG 2EJGA 5GMKh 1YCYA 4PJOF 5GAOq 1BIBA 4XTUA 3JCMQ 4X9DA 3JCMP 4M7DD 3RUXA 1LJOA 1U1TA 4NOYA 1B34B 3V8KA 1JBMA 2DKGA 4RCCA 4A53A 3RKXA 4C92F 4M77B 5GANg 5GAN8 1H641 3JB9I 4M7AC 1LOJA 5GAOm 4XTXA 4C8QB 3JB9G 4M7AE 2E65A 1B34A 3BY7A 1WPYA 3HFOA 2DEQA 5GMKm 3JB9D 4M78C 2FB7A 5GANd 4C8QA 5LJ5g 3JCMW 4Y91A 3QSUA 4C8QD 4M78A 4XU1A 5GAN5 5GANh 5GAMe 5GAMf 3AHUA 5LJ5h 3PGGA 4NL3A 4HT9A 2VXEA 1N9SA 3JCMb 3VU3C 5GAMj 3BDUA 2RM4A 4EMGA 5GAMd 2QTXA 4XU0A 4EMKB 2E1HA 4M77G 3JB9F 2YHTA 4M7DB 4C8QF 4XTZA 1TH7A 2E64A 4M7DF 5I21A 3EFRA 4M7DA 3FB9A 3JCMV 1U1SA 4EMKC 4X9CA 1KQ1A 3QUIA 3QO3A 4F7UE 4QVDA 5GAN3 3V7RA 4XU2A 4PJOC 4M75G 2RD1A 3INZA 4J6WA 3JCMg 5GAMg 4M75B 3JCMc 3JCMJ 4C92D 5GANe 4XQ3A 5GANf 4M78G 4C8QE 4HA8A 5CAIA 3L2ZA 4N0AA 3V7CA 2CGHA 5GAN6 3SWNC 4M75A 4M78D 4M77A 4F7UF 5GAOp 5GAOn 1M8VA 2DTOA 3FIFA 4J6XA 2RB6A 3BFMA 4F7UB 4F7UG 1JRIA 5LJ3h 1I4K1 5GMKi 3JB9J 3BW1A 4M75C 4M7AB 4M78F 4N0AC 4JUVA 5LJ5j 5GANj 3SWNB 2YLBA 2DZ9A 5GMKj 5GAN2 4PJOB 4M78B 2Y90A 3V8LA 1LNXA 2HNIA 3QHSA 3JCMd 3HSBA 2VC8A 4XTWA 4PJOA 3GIBA 2EJFA 4EMKA 1WQ7A 4XU3A 4M7DC 4C8QG 5LJ3g 1Y96A 2VXFA 3RIRA 1I8FA 5GAOl 4M77F 4M78E 5GAN7 4NL2A 4QVCA 3JCMX 4M75E 5LJ3f 5LJ3e 1Y96B 4M77D 3SB2A 3FJPA 4C92E 5LJ3d 2JN0A 2EAYA 4WF2A 3M4GA 4J6YA 1WNLA 2YLCA 3JCMh 3RERA 2EWNA 4XTVA 4C8QC 4HT8A 1M5Q1 2ZGWA 1X01A 3RKWA 4M7DE 5GAOr 2E41A 1HXDA 5GMKl 4MMKA 2DTHA 2E10A 3RKYA 3V8JA 1I5LA 4OP0A 3JB9H 4C92G 4PJOD 3HFNA 5LJ5d 2DTIA 4PNOA 1HK9A 4M7AA 2DVEA 5DY9A 4M7AD 4V2SA 4PJOG 5GAMh 2DJZA 5LJ5f 5LJ5e 1KQ2A 4JRKA 1WQWA 4EMHA 5GMKe 4M7AG 4XTYA 3RESA 3JCMf 3JCMe 2RA2A 1D3BA 4C92A 2K57A 2DXUA 4JLIA 3EFSA 1N9RA 4MMLA 1MGQA 4J5YA 4A54A 4M77C 1D3BB 3SWNA 4C92B 4M75D 2DZCA 2FYKA 5GAN4 4M77E 4RCBA
chains in the Genus database with same CATH superfamily
3LYIA 5CCAA 1SKUB 3OW2P 1I07A 5GJWB 3VV0A 1QP2A 4X9DA 1MV0B 1U1TA 3VS0A 4ELZC 4LDUA 3RKXA 1M1KU 2DPPB 1VQ7A 2DILA 2O4XB 3DLLA 1VQNQ 4FYVB 3MKDA 3CCRQ 1YJ9A 4CC4B 1W70A 3PGGA 1ARKA 2MOXA 2DIGA 1TXQA 3A1PA 1LVKA 1ZHIA 1QKXA 3NHNA 5IXFA 4DOWA 2R58A 3JCMg 2EFIA 1QCFA 4ANJA 4PJJA 5CK9A 4LDVA 4EIKA 4R55A 3L2ZA 4N0AA 1Z9ZA 1VQPA 1Q86C 1M4ZA 1SSHA 1QCOA 1RI0A 5GANj 1TSFA 1N8RR 1XQHA 3PT9A 5EG2A 3RMQA 3CC2T 2HKNA 3M54A 1Q81R 2QI2A 2KEAA 2BZYA 4C8QG 4CC3A 2V1QA 4OB3B 1PD0A 5I2SA 2F1LA 3VUZA 2CP6A 2A3LA 4AFSC 1VQOQ 4BE2A 1VQLA 1V1CA 3Q1JA 1YITA 3VS7A 1X75C 2G3RA 1WHMA 2JN0A 3M4GA 1VYUA 4DBHA 3CPFA 2KBTA 3OA6A 2C0OA 1X01A 1WZOA 4AFZC 4B6MA 1H3HA 5LJ5d 1KHIA 3CCJA 2PVOB 1M90U 2D1XA 2COWA 2K3BA 6AT1B 1VQMQ 4XTYA 1M3CA 3NTIA 3CCQT 1CKAA 2ZPIB 3KBGA 4HCBA 4D8KA 5FROA 1M8MA 1WFWA 3EHRA 1Z9QA 4JLGA 5LJ3j 2ECZA 1QW1A 3CMAT 3FEOA 4FCYA 3VYGA 5FU6C 1OYXA 5HY6A 2L89A 3H41A 3G71Q 1UHCA 1B34B 1PSEA 2KT8A 4M7DG 1H641 3CPWS 1SHFA 1JJ2P 1QKWA 1BI0A 2X9HA 2DEQA 3UDCA 1Q95G 5GMKm 4OMLA 4C8QA 4Y91A 5FLXE 5GAN5 2JUFA 2K2MA 3CC2A 3JCMb 2XDBA 4EMGA 1EFNA 2RK2A 4MDWA 4IIOA 2RQRA 3M0RA 2DK3A 3EFRA 3OYBA 2JS2A 3FB9A 2E4HA 3JCMV 1JB0E 1VQLT 5DLOA 5GAMg 5GANe 3CCEQ 4M78G 5CAIA 3OYNA 3QWXX 4A4GA 3CMET 2YRVA 1M1FA 3FIFA 2ESWA 4F7UB 4QT7A 2XICA 4M75C 5KYYA 2BE7D 4FYYB 3V8LA 1NLPC 2ZPBB 1X6OA 3I5RA 1T0JA 2FPFA 4IUQA 2RH2A 2D9TA 1KFZA 3LH0A 2P84A 4X1VA 3CCLT 1YHQA 5I11A 3MO8A 2RHIA 4JJBA 1NLOC 2RJEA 2KI7A 2JMCA 4JS5A 3L2RA 5CKFA 2RPNA 1HK9A 4LDXA 4M7AD 4PJOG 1M90C 1H3ZA 1WQWA 4RTVA 1F1BB 4JLIA 3A8HB 4LN2A 2BZXA 1KK7A 2EGAA 3C4SA 5D6WA 2FL7A 3MP1A 3QKJA 3HP9A 2CT3A 3I55Q 1KC8U 1BIAA 4DEXA 1BIBA 4XTUA 2DRMA 1FMWA 1K9AA 4A53A 1B3QA 2O4XA 2RQWA 4DEYA 3EG9A 2GQIA 4E7SA 1SF9A 4HCCA 4C8QD 4OGCA 5GANh 3MP6A 3MPUB 3QG1A 2LMJA 1M30A 3M57A 3CCMA 2YRDA 1UJ0A 5IHIA 1UFFA 5L8RE 1K9MC 3HTRA 4XTZA 3CC7Q 4M7DF 2EW3A 2EQJA 2GFUA 1LCKA 5CVIA 2O88A 4M75B 1YP5A 2CP0A 3RMSA 4A4HA 3E1SA 5EC7A 2HZYA 3M5AA 2E70A 4E7JA 3M0PA 1VQ4T 2YDLA 3JB9J 3UT1A 5GMKi 1X27A 1R0BG 1WHKA 1PNJA 1J3TA 4LNPA 4JDSA 1VQ8A 1P92A 5LJ3g 3OQ5A 4F16A 3ZL7C 5LJ3f 1HSQA 4FT4A 3I5SA 3PMTA 5CIUA 2QA4T 3CCEA 3RDVA 3CBPA 3M0TA 1ZA1B 2NUPB 4BACA 1WJSA 2CKKA 2JTEA 4OP0A 1VIFA 4M7AA 4M4ZA 3NMZC 4L5GA 2XD0A 4JRKA 2OTJQ 2RJCA 1K73C 2PNIA 3JCMe 2K57A 1K0XA 1YIJT 5C6SA 2FYKA 1E6HA 4RCBA 4DQ2A 3TSZA 2JZ2A 1JU5C 3QZ9B 3O5ZA 2HQEA 4PJOF 3JCMP 3CD6T 3CCQQ 1QCNA 1QVPA 2LX9A 1Q82R 4J9BA 2J05A 4R0KA 5GANg 3MEVA 1VA7A 2FRYA 2HMAA 3OS0A 4E47A 3HFOA 3GNGA 3JB9D 1U06A 4KULA 1PSFA 2C0TA 1SSFA 1ZLMA 4ZN3A 2JNGA 5LJ5h 3LW5E 1TU0B 3OYDA 1VQ7T 1UJYA 2DYBA 2LJ3A 1NJIC 5IHKA 2LQWA 2RJFA 4KUDK 4O6JA 3GBQA 4M75G 4PFPA 4JPBW 4F14A 1AZGB 3TSWA 3TCJA 4J9DA 1VQ9Q 3V7CA 4R56A 2LJ1A 2EQMA 4C0FA 4B9XA 4M7AB 2MCNA 1W6XA 3PMIA 3CXCS 2VWFA 5GMKj 1KQSA 2EIFA 1OZ2A 4QKUA 3M56A 1VQKT 1VQMA 3BE3A 3QHSA 1VQPT 2PTKA 4N4HA 2Y4YA 2CT4A 1YIJA 4PK4A 3BDLA 2ZPFB 3CC7A 2DERA 1WHGA 2LDMA 3VUBA 3DB3A 1T3SA 1UEBA 3ZEHA 5A2QE 2FEIA 4EDUA 4WF2A 3JAME 1D0ZA 3JCMh 1I5OB 2VUBA 3CD6A 3LGLA 2LT4A 4BI3A 2LVMA 1HXDA 4MMKA 4ZTJA 2WSEE 1NZ9A 2O2OA 1YBYA 3G4SA 3MCAB 3M9QA 3I55T 3RESA 1K9MU 3GP8A 1R77A 3UF4A 2DXUA 3EFSA 1MGQA 1MMAA 3CCJT 2RHZA 2DNUA 2ROTA 1I81A 2M1HA 3M58A 4KBMB 2KRNA 2E5QA 1WGSA 3MHXA 4F04B 3MEAA 1LJOA 1MNDA 4DA4A 3HRSA 1N8RU 2DKGA 4C92F 4M7AC 2LC4A 5IH2A 2H8HA 5KH6A 2LJ0A 3OS5A 5LL6S 3OYMA 4M78C 4IIMA 2BKDN 1OZ3A 1YN8A 3I56A 3S3MA 1H8KA 2HEQA 5CKBA 1VQKA 3CCRA 3VU3C 3HKSA 2MK5A 2RM4A 3JB9F 1QVGS 2O9VA 1G8XA 1ZA2B 2K5FA 1ZUUA 5KE3A 2F2VA 3KUFA 2V8KA 2MAMA 3CPWP 2HDAA 4DBFA 2QASA 3WXMB 1FMKA 1QQJA 1G2BA 1WJRA 2CGHA 2OTLT 1M8VA 2GFAA 3UA6A 2QEXA 3UA7A 2JJ9A 2EYYA 3EG3A 1TOVA 3U23A 1QVGP 1YFNA 4JUVA 1VOMA 3CC4Q 2DZ9A 4E7ZA 3I55A 2G6FX 3NTHA 4XTWA 1W2BS 4PJOA 1WQ7A 1ZUKA 2LQ8A 1BKBA 3KXTA 2P4RA 1IO6A 3RIRA 3C95A 2M16A 1AWWA 3VYHB 1WNLA 1QWFA 2EWNA 1QVFA 2K5IA 3TREA 5J3BA 2YUPA 4QQ6A 3A8LB 2EYXA 3QXEB 3A98A 5IT9E 4Z88A 2ZCFB 3CCSQ 2B8AA 2DTIA 4D6WA 4RTZA 1UHFA 2D0NA 5KYWA 3OYEA 1ZQ1A 3CMAQ 1OX8A 1ABQA 4JRPA 1VQNA 3ZFJA 1M3BA 4A4KA 3PIPA 2WSCE 1OULA 2KRMA 1U5SA 2DXTA 2CP2A 4Z89A 3OYCA 2DAQA 1RAEB 2MMPA 3JCMQ 1W4SA 3PFSA 4RCCA 3PE0A 1PRLC 2AKLA 2OAUA 4K11A 1LOJA 4C8QB 3FLGA 1B34A 1WPYA 1Q82U 1TG0A 4FT2A 2QGGA 4OVAA 2M02A 1BB9A 4QW2A 2P0KA 3EGDA 2KYBA 2WACA 2VXEA 4J9CA 2P0QA 1TH7A 3H0HA 4E6RA 5I21A 4M7DA 2EYZA 1U1SA 4Z02A 3JSCA 3P8BB 3T9NA 3V7RA 5FRMA 2RD1A 1VQ5Q 2A7YA 3G71T 3JCMJ 1OOTA 4L59A 4C8QE 2K6DA 4A63B 4M78D 5D7UA 5GAOp 2DFUA 3EGUA 3TVTA 2O01E 3X24B 2EQIA 2PU9B 1K1ZA 5GAN2 4FL6A 3LLRA 1OX9A 2VC8A 1Q7YU 2RI5A 5AT1B 4AG1C 1UGSB 2DF6A 3A5ZB 4QVCA 2OAWA 2L2PA 4C92E 1NE8A 2EAYA 1H92A 4FW2A 2NUTA 5IAYA 4OGEA 5CKEA 2E41A 4MZPA 5GMKl 2K2VA 2F2WA 2PQWA 5CKHA 1KC8C 4LDYA 2DA9A 1S72A 2DEUA 4M7AG 1UTIA 1YJNA 5IN1A 1Y7XA 4A54A 1YJNQ 1D3BB 1PRMC 1WYXA 2LCSA 3CD6Q 2A28A 1VQ6Q 2M0YA 2YRCA 1ZBJA 2KSSA 4PJOE 4FIBA 2EJGA 3VS4A 2F69A 3WVEB 1YJWA 3LH5A 3OBWA 2QK0A 5J39A 3QYHB 3MJXA 2RJDA 1GFDA 1NPRA 3J7AF 1GCQA 1WXTA 1PG5B 2L3QA 3JCMW 3QSUA 1SG5A 4IUVA 1AD5A 1NEBA 1XJWB 1VUBA 5GAMe 2DX1A 2YUOA 4O5VA 2X4XA 2J6OA 4EMKB 2KROA 2XDDA 5L23A 3EHQA 3P8DA 3NGPA 4ORZA 2C06A 3QBYA 2DM1A 2KT1A 2EQUA 4QVDA 2HSPA 2QQAA 1Q86U 2O9SA 3SEMA 1TUDA 2E3HA 2ED1A 1JRIA 5LJ3h 2D8HA 3TEEA 3CCQA 4M78F 2K3XA 1WX6A 1YI2T 2FHDA 3SWNB 2DRKA 2HQHA 4HVVA 3CMEQ 1K8AU 4C5GA 1LPLA 1K8AR 1M2VA 2BZ8A 4TVRA 2VKNA 1NJIU 2JXBA 3OW2S 4M7DC 2CZ1B 3TU4K 1BK2A 1Y96B 2COZA 3FRNA 5IHNA 4OMMA 3REAB 3H9NA 5HK0A 4OB2B 1HYOA 4M7DE 3LX7A 2DMOA 1MV3A 4QQDA 2DTHA 3V8JA 1JO8A 1K9MR 4FSXA 1VQ8T 3X26B 3THKA 3CC2Q 1RAGB 2DJZA 1VQ4A 2LT1A 5HK3A 1M27C 4J5YA 5D6YA 2EKOA 3DLMA 1FXXA 2PZ1A 4KT0E 1M2VB 2GTJA 1BI3A 4OB1B 2BTTA 2VVKA 4IUUA 2CS7A 2M51A 1OU9A 3HHTB 3HPWA 4CC7A 4CRIA 2DL5A 4F7UA 4IKFA 3ME9A 1UECA 3RUXA 3G6EA 1E7OA 3VS2A 2QEXQ 1M3AA 2E65A 1B7TA 1KD1C 3A8MB 3P8HA 4ME7A 4FU6A 4UC4A 2CZ6B 3OS2A 3C12A 3OYLA 2CZ0B 2R57A 4FSSA 3CCST 1U8RA 3C94A 2DYIA 4C8QF 2YSQA 3M0SA 1ZSZB 1PD1A 1K73R 3I56T 3OYHA 4PJOC 2HBWA 1WLPB 2D0QB 4NS5A 5GANf 1AWJA 2QAZA 3SD4A 2DL8A 1A0NB 2CSIA 2CSQA 1ACMB 1GRIA 3BW1A 5KYXB 1JEGA 1G3SA 4LE9A 4PJOB 4OB0B 1K8AC 2HNIA 2XKOC 4B9WA 2OTLA 4L6V5 3JRZA 1V76A 2MWPA 3OYIA 1I8FA 1KD1U 1S72T 1UB4A 2JOYA 3QZ5B 2YUNA 7AT1B 3IQLA 5LJ3d 1CKBA 2JTMA 2HKQB 3RERA 4KGVB 3ULRB 1KG1A 1I0CA 4PNOA 1WHLA 4RMOA 5LJ5e 2DBMA 1Q86R 3EGDB 1UGVA 1N9RA 1JJ2S 2FZCB 1JXOA 3EH1A 3NPFA 3L2UA 3PVQA 3OYGA 3CQTA 3QDRB 3QJYA 4HXJA 5C0MA 3G4ST 2YUQA 1SEMA 1GBRA 1MHNA 2RMOA 2QDYB 3CCJQ 1T0HA 4J83A 2KK4A 5FU7C 2JMAA 3OSVA 8AT1B 2KYMA 1Q7YC 3PIOA 2KVQG 2KQWA 3DKMA 1VIEA 2A37A 2OX7A 4KUIA 2JW4A 1GCQC 1FMVA 1Y07A 4XU0A 4HCZA 4M7DB 3G1JA 2QG9B 5FU7B 5DLQE 3ER0A 2LP5A 2MYSA 1WA7A 2XHCA 3EG0A 2X4WA 1BYMA 2VGMA 2V26A 4M75A 2DTOA 3M53A 2W10A 2EPDA 2RB6A 3BFMA 2GQVA 1S1NA 2SRCA 1I1JA 4J9FA 4DOVA 1VQPQ 4OMPA 1VQ5A 1KIKA 1OQKA 1IXDA 2K5LA 4Y28E 3GIBA 4GLMA 1YNZA 2DIQA 1UG1A 2F5TX 4M78E 5GAN7 1K4US 5LJ3e 1AT1B 2ZPGB 1RABB 1QVGA 4J6YA 2JM9A 2YLCA 5A0DA 2NUZA 4ZGEB 1OI1A 4LUEA 2E10A 2L3SA 3CC4T 3OW2A 4IURA 4A4FA 4OMOA 1UE9A 3M0QA 2E5KA 2HD0A 4E2FB 4MMLA 3SWNA 4II1A 5FRNA 1XTDA 4C0DC 5GAN4 3EH2A 1B07A 4M77E 3QPHA 2EGEA 1PM3A 2KXCA 1KD1R 2R5MA 2GNCA 1VYTA 3VKIA 4J7IA 4OF1A 1VQKQ 1X2KA 2JM8A 2LNVA 3EFOA 5GAOm 2DBKA 2SEMA 1GFCA 1X6GA 1SRMA 2OTJT 2RHUA 5GANd 3RR6A 1AEYA 1V29B 1WXBA 4YTLA 4NL3A 5KCOA 3A8OB 2PVDB 1D0XA 2KRSA 4WTOB 2FZGB 3VJPA 3X28B 3QYGB 5CR2A 4BDZA 4ZTFA 4JRQA 1PKSA 2DE0X 4OMQA 2RF0A 1GL5A 1KSWA 3QUIA 3QO3A 3INZA 4KH0B 4C0DB 2DVJA 1EZZB 5CKDA 2DL3A 2K9GA 3MEUA 4J9IA 2NYSA 2ZPHB 5GAN6 2RI3A 3OYJA 2FPDA 3CEYA 2E3IA 3LWIA 2P0PA 4JZ4A 1R8OB 1HJDA 1XOVA 2QA4A 2FZKB 3C0CA 2IG0A 3R6OA 5GJVB 3VRZA 1YI2A 2QYZA 1NG2A 3M0UA 3OYKA 4GLKA 1BCOA 2RNAA 2PUKB 2FO0A 3G6EQ 2KAFA 2NUPA 1I5LA 3G71A 3PNWC 3HFNA 1M1KC 3S3OA 1CSKA 2DJQA 2BIVA 2DL7A 2M0OA 4GBQA 1Y57A 2LCLA 1AWXA 3CCUQ 1O9SA 4XAXB 2CYZB 2FPEA 1JJ2A 2J6KA 1E6GA 4LUDA 5M9OA 3J81E 2RI2A 3KFVA 4M75F 2QGFB 2QEXT 2XIDA 3CBMA 3GPLA 2LZ6B 1GBQA 3JV3A 5GAN8 3JB9I 2D6FA 4XTXA 4M7AE 2X4JA 2X4YA 1UGRB 2CUBA 4QVZA 1DJ7B 5LJ5g 2C0IA 4XU1A 2HBPA 5GAMj 5FWCA 1UDLA 1WHHA 2X35A 1RUWA 2AKKA 4M77G 1FYNA 3H8ZA 1VQ5T 1RACB 4AT1B 1YJWT 4X9CA 1ZX6A 4BI8B 4F7UE 3REBB 3X20B 3LWHA 4DBQA 3JCMc 4C92D 4ELYC 2HSEB 2PVGB 4JS4A 4HA8A 2L3RA 4VUBA 1G3YA 2QDLA 2M9UA 4J6XA 4F7UG 3L2WA 4ZN1A 1M1KR 3FDRA 4WCIA 1VQ9T 1ABOA 2X3XD 2YLBA 4M78B 4BD3A 1LNXA 4JJCA 4Z8AA 3OYYA 3E9GA 1N5ZA 3PTAA 2FVUA 1K76A 4M77D 2ZPEB 2CP3A 3OMCA 4RUGA 3L2QA 1QVFS 2AIRB 2YWWA 1X2QA 1C0MA 4BY6B 2W0ZA 1BI2A 3QDFA 2O31A 1W2BP 1IHVA 4C92G 4KH1B 1AHJB 3H0IA 1MMGA 4RTUA 1YHQT 1GCPA 1KQSP 1W2BA 1TUGB 2I0NA 2JVVA 4N4GA 1Q82C 1YITQ 3AT1B 2BUDA 4C92B 4M75D 4ATOA 3G4SQ 1PKTA 1RL2A 3CCVT 4C0GA 2MF2A 4CC2A 4D8DA 1PC0A 2QQBA 4OMFB 1QMCA 2NUTB 5GMKh 1TS9A 5GAOq 1VQLQ 4NOYA 2GCXA 1JBMA 5D6XA 3EG9B 4LXCA 3WVDB 2GBQA 2KMTA 4M78A 2Z0WA 4KGXB 4KGZB 3VS1A 2QTXA 1FWZA 5FWBA 1IGUA 2E6NA 2YHTA 4AG2C 1C1AA 2JTFA 1WHJA 3F70A 5KYUA 3H6ZA 4LDWA 5I2MA 3TQ7P 1QLYA 4JZ3A 2LTOA 1W1FA 2CP5A 2DXCA 3OS1A 3R6NA 1VQ6A 3M59A 3CCVQ 3NFCA 1I4K1 2LX7A 1YCSB 4PJLA 1G3TA 3I56Q 4N0AC 2RQTA 4PFZA 2ATCB 2DXBA 2AHJB 2P4TA 4PL6A 3G7ZA 3URGA 2FRWA 5KE2A 4AMCA 4Q5WA 4EMKA 3SFMA 2EVRA 4BY6C 3I35A 2RN8A 1VYVA 3JCMX 3E19A 2KY9A 3DB4A 2YXYA 2L3PA 2J06A 2CUDA 1NYFA 1KJWA 2VASA 9ATCB 1RAFB 3GF5A 4XTVA 4C8QC 2GTOA 4HT8A 4PFOA 2A08A 1VQOT 3UWNA 2V1RA 4FYWB 2WSFE 3CMEA 5GMKe 2KR3A 1QVFP 2COYA 5AYFA 4C5IA 3CC4A 1GXIE 5KYUB 4BE1A 8ATCB 3L1AA 1OV3A 3SHWA 2I2LA 4QQGA 2EBPA 4BE0A 4C92C 4M7AF 3VS5A 1NBEB 2RQVA 4IUPA 1QP3A 2BE9B 3MEWA 1S72Q 1UUEA 5J26A 4MZTA 2EKHA 2DO3A 1RAIB 2ED0A 2OJ2A 5KYWB 2HL5C 3OYFA 4PJMA 2MPXC 5GAMf 4OMNA 2XMFA 4FM4B 3L42A 4C0ZA 1KC8R 1BCMA 1M90R 3BDUA 1X43A 4J8OA 2E1HA 3EGXA 1VQ9A 4JJNK 2HL3A 4RTWA 1KQ1A 2QQRA 2HCKA 1PWTA 2K79A 4J6WA 4MZMA 4ZGJB 1D1AA 1X6BA 2ZAEA 5ECAA 4M77A 1YITT 5CQYA 2KNBB 4JJDA 3S6WA 4F17A 3VS3A 1WIEA 4E7KA 4J7FA 2EJFA 2EQKA 1NM7A 2DETA 4XU3A 1MMNA 1WJQA 2E12A 1SRLA 4AFUC 2LQNA 2QQ9A 3EG1A 4M75E 4KRTA 3VRYA 3VS6A 1TUCA 3G6ET 2CDTA 2LQKA 3PVLA 3RBBB 2RO0A 2ZGWA 1Y71A 3CC7T 1HD3A 1IB8A 4IUTA 3RKYA 2HQXA 4J9EA 4V2SA 1BU1A 2OI3A 4PLLA 1KQ2A 4BB7A 2VYTA 3JCMf 2J7IA 1PHTA 2NLUA 3GOXA 2DZCA 4RTTA 2JS0A 2QA4Q 3FJ5A 2KXDA 1RLPC 4EPCA 1EX4A 1SPKA 4DBRA 2LCCA 4LD6A 3SDZA 5A0LA 3V8KA 4RG8A 3NTKA 2KDSA 1BI1A 1YHQQ 2EYQA 3FC3A 2EYWA 3N5BB 1Y0MA 3L2VA 3AHUA 3MP8A 1C6VX 1OU8A 4ESRA 4RTXA 5GAMd 1R0CB 1BBZA 2IVWA 2A36A 2MI6A 1K0SA 3I9QA 4EMKC 4XU2A 2D8JA 2DD5A 2OTJA 5DM7R 1D0YA 2A0FB 1AOJA 1RLQC 2VGNA 2JT4A 4F7UF 1KQSS 2RK1A 3CCLA 1VQOA 2K3YA 5KYYB 1IREB 1NPPA 2NWMA 3JCMd 3OY9A 1ZSGA 3GNFB 2CZ7B 1YI2Q 2VXFA 4M77F 3H0FA 4NL2A 1Q81U 1JXMA 5IXBA 2ZZDA 2H3EB 1AWOA 2F5KA 1VQ8Q 1M9SA 2QTVA 1M5Q1 1ZBXA 2FG0A 2GGRA 1N8RC 4RG2A 1WDXA 2DVEA 1YIJQ 4HVUA 5GAMh 2QQSA 5LJ5f 1PCXA 4BUGA 4C92A 3GLXA 2RHYA 1D1CA 4J9HA 2EGCA 4RKUE 1VQMT 2LRQA 4RTYA 5HKCA 1X69A 2CH4A 1VQNT 1TTHB 1NJIR 2AK5A 3V7SA 4MDXA 1YCYA 2YT6A 2XG8D 1MMDA 1KHCA 2K7AA 1T3LA 4FYXB 3CCSA 2F2XA 3BY7A 4BI4A 2H3JA 2KGTA 2E6ZA 3EGXB 3CCMQ 4HKEA 4C5HA 3OMGA 3CXCP 3CCET 3CPWA 3HRTA 2LNHB 3QJ6A 5GAN3 1AZEA 3CXCA 3ASKA 4LD9K 1UGQB 3D7SB 1ZSZC 1XNIA 1FX7A 5CQXA 1YJ9T 5GAOn 4J9GA 5CO7A 4HVWA 1Q81C 4CI0C 3EAEA 4E7IA 5KYXA 3HL8A 2Y4XA 3E9FA 2MWOA 3J80E 2AZVA 3OB9A 3QIIA 2R5AA 5KYNA 3META 1WI7A 4N4IA 1JQQA 2GF7A 1OPLA 3CCRT 2VB6A 5I22A 4E7HA 2ROLA 3O8VA 3EFOB 3SB2A 3FJPA 4BDYA 2KE9A 2X51A 1YWOA 1G83A 5GAOr 1IRXA 3X25B 3JB9H 3M55A 2J6FA 1YWPA 2RQUA 5DY9A 2V8JA 2CH4W 2ENMA 3S3NA 4ZNXA 4XK8E 2AT1B 1VQ4Q 1D3BA 1TWBA 1RADB 3ZBDA 1OEBA 4M77C 4A4EA 2IIMA 3OBYA 3CCUT 1U3OA 4X34A 2EJ9A 1YJNT 4PJNA 2DLPA 4JRIA 1D1BA 2AZSA 1Q7YR 5HCKA 4M7DD 2L8DA 1M1GA 3LGFA 1IGQA 4M77B 3CCMT 3UATA 3JB9G 2XDPA 3CBOA 2CREA 1WXUA 2FB7A 4PLIA 4GY5A 5KCHA 4HT9A 1N9SA 2XU8A 3CCLQ 4FW1A 3CMAA 1D09B 1RAAB 1IZ6A 3OYAA 2ABLA 2DD4A 1NEGA 1IHWA 5FW9A 2E64A 2HAXA 1ZUYA 1YJ9Q 1G3WA 2IPOB 1MUZA 5FU6B 4XQ3A 1EIFA 3CCVA 1VQ7Q 3SWNC 2PUOB 1N27A 2RHXA 2XK0A 2V8IA 5LJ5j 1SHGA 2B86A 3E2UA 1RI9A 2VV5A 2OTLQ 2Y90A 2L5QA 1G5VA 1M2OA 3HSBA 1N6AA 1OPKA 2CP7A 3HRUA 2DL4A 4PKCC 3UPUA 4E7LA 1Y96A 5GAOl 1MNEA 2L0AA 3CCUA 1RAHB 1VQ6T 4HCKA 4AFQC 3A8GB 2XI9A 3QWYA 1K73U 1UGPB 2QXFA 2X3WD 3RKWA 4ZGDB 2MIOA 4PJOD 4Y92A 3EG2A 4P5NA 1YJWQ 4EMHA 1NYGA 4C5EA 1O75A 3RNJA 2RA2A 3OSSC 5A0GA 2K4YA 1QWEA 1AVZC 1ZSZA 3M4YA
chains in the Genus database with same CATH topology
4BE1A 3LYIA 3QDRB 3L1AA 5CCAA 2I2LA 4QQGA 4BE0A 4C92C 3QJYA 4M7AF 1I81A 2M1HA 3M58A 4KBMB 3VV0A 2E5QA 1WGSA 3MHXA 1QP2A 4X9DA 3MEAA 4IUPA 5C0MA 3G4ST 1LJOA 1U1TA 1QP3A 3HRSA 4ELZC 3MEWA 2DKGA 4C92F 4DA4A 4LDUA 3RKXA 1N8RU 1MHNA 4MZTA 2QDYB 5J26A 1M1KU 2DO3A 2DPPB 4J83A 2LC4A 2KK4A 5FU7C 1VQ7A 3OSVA 5KH6A 3OS5A 5LL6S 2O4XB 3DLLA 3OYMA 1Q7YC 3PIOA 4M78C 2KVQG 2BKDN 3OYFA 2KQWA 3DKMA 1VIEA 1OZ3A 3I56A 3S3MA 5CKBA 5GAMf 1YJ9A 4FM4B 3PGGA 3L42A 4C0ZA 4KUIA 1VQKA 2DIGA 3VU3C 3CCRA 3BDUA 3HKSA 2RM4A 1Y07A 4XU0A 4J8OA 2E1HA 4HCZA 3JB9F 1QVGS 4M7DB 1ZHIA 1VQ9A 4JJNK 5FU7B 2K5FA 5KE3A 5DLQE 3ER0A 3KUFA 2V8KA 1KQ1A 2MAMA 2QQRA 4DOWA 2R58A 2XHCA 4J6WA 4MZMA 3JCMg 2EFIA 3WXMB 4ZGJB 2X4WA 1BYMA 2VGMA 5CK9A 4LDVA 4R55A 3L2ZA 4N0AA 1WJRA 2CGHA 4M75A 2OTLT 4M77A 1VQPA 1Q86C 1M4ZA 2GFAA 1M8VA 2DTOA 3M53A 1YITT 2QEXA 2RB6A 3BFMA 2GQVA 5CQYA 4DOVA 3S6WA 1RI0A 1VQ5A 4JUVA 5GANj 2DZ9A 1XQHA 3PT9A 5EG2A 3RMQA 3I55A 2K5LA 3CC2T 4E7KA 3NTHA 4Y28E 4XTWA 1W2BS 4PJOA 3M54A 2QI2A 4J7FA 2EJFA 3GIBA 1WQ7A 2EQKA 1BKBA 2LQ8A 2DIQA 4XU3A 3KXTA 4C8QG 3RIRA 1WJQA 2E12A 3C95A 2F5TX 2M16A 4M78E 4OB3B 5I2SA 5GAN7 2QQ9A 4M75E 3VUZA 5LJ3e 2A3LA 4BE2A 1VQLA 3Q1JA 3G6ET 1YITA 1X75C 2G3RA 2LQKA 2ZPGB 2JN0A 3VYHB 1QVGA 3M4GA 4J6YA 1WNLA 2YLCA 5A0DA 3CPFA 2EWNA 2RO0A 2K5IA 3TREA 3OA6A 1QVFA 5J3BA 2ZGWA 1X01A 1Y71A 3A8LB 4QQ6A 4ZGEB 1OI1A 3CC7T 3QXEB 4IUTA 5IT9E 2E10A 3RKYA 4HCBA 2ZCFB 1KQSA 1GXIE 5LJ5d 1KHIA 2B8AA 2DTIA 2PVOB 4D6WA 3CC4T 2HQXA 3CCJA 3OW2A 4IURA 1M90U 4V2SA 3OYEA 1ZQ1A 4PLLA 4A4FA 1KQ2A 4BB7A 2VYTA 4JRPA 1VQNA 4XTYA 2HD0A 3JCMf 3NTIA 3ZFJA 3CCQT 2NLUA 4MMLA 4A4KA 2ZPIB 3PIPA 3KBGA 4II1A 3SWNA 3GOXA 1XTDA 4C0DC 2WSCE 5FROA 2DZCA 5GAN4 5FRNA 4M77E 3QPHA 2DXTA 4JLGA 5LJ3j 1QW1A 3CMAT 4EPCA 3FEOA 3OYCA 3VYGA 2DAQA 5FU6C 2MMPA 1OYXA 2R5MA 5HY6A 2L89A 3JCMQ 2LCCA 4LD6A 3SDZA 1W4SA 3VKIA 4J7IA 5A0LA 3PFSA 1B34B 1PSEA 4OF1A 3NTKA 4RCCA 4RG8A 3V8KA 2KDSA 2LNVA 4M7DG 1H641 2OAUA 1BI1A 1LOJA 3CPWS 5GAOm 2EYQA 4C8QB 3FC3A 3FLGA 1B34A 1BI0A 1WPYA 3UDCA 2DEQA 3N5BB 1Q82U 2OTJT 2RHUA 4FT2A 5GMKm 4OVAA 5GANd 4C8QA 4Y91A 1V29B 4QW2A 2P0KA 5FLXE 5GAN5 2JUFA 3L2VA 2WACA 3MP8A 4YTLA 4NL3A 3CC2A 2VXEA 3AHUA 3JCMb 2XDBA 5KCOA 3A8OB 2PVDB 4EMGA 2RK2A 5GAMd 4MDWA 3VJPA 2P0QA 3X28B 1TH7A 3QYGB 5CR2A 2DK3A 2IVWA 4BDZA 5I21A 3EFRA 3OYBA 4JRQA 4ZTFA 4M7DA 2MI6A 3FB9A 3JCMV 1U1SA 4EMKC 4Z02A 3QUIA 3JSCA 1JB0E 3P8BB 3QO3A 3T9NA 3V7RA 4XU2A 5FRMA 1VQLT 2RD1A 3INZA 4C0DB 5CKDA 5DLOA 2A7YA 5GAMg 3G71T 2DD5A 3JCMJ 5GANe 5DM7R 2OTJA 3MEUA 4L59A 4M78G 4C8QE 5CAIA 3OYNA 2ZPHB 4A4GA 2VGNA 5GAN6 3CMET 4F7UF 4M78D 5GAOp 1KQSS 2YRVA 1M1FA 2RK1A 3FIFA 2RI3A 3OYJA 4F7UB 3CCLA 3CEYA 2O01E 2XICA 4M75C 2P0PA 3X24B 3LWIA 2PU9B 5GAN2 1VQOA 2K3YA 4FL6A 3V8LA 1R8OB 3LLRA 1IREB 1NPPA 1XOVA 2ZPBB 3JCMd 3OY9A 2VC8A 2QA4A 2RI5A 1X6OA 3GNFB 1Q7YU 2CZ7B 2IG0A 4IUQA 1UGSB 2RH2A 2VXFA 2D9TA 3A5ZB 3R6OA 4M77F 4NL2A 4QVCA 1YI2A 3LH0A 1Q81U 3OYKA 4GLKA 4M7AC 4C92E 2ZZDA 3CCLT 1NE8A 2EAYA 2PUKB 1YHQA 2F5KA 3MO8A 5IAYA 1M9SA 2RHIA 4OGEA 5CKEA 1M5Q1 1ZBXA 2RJEA 2E41A 4MZPA 5GMKl 2KAFA 1N8RC 4JS5A 3G71A 1I5LA 2K2VA 3PNWC 4RG2A 5CKFA 3L2RA 3HFNA 1M1KC 1HK9A 4LDXA 3S3OA 2DVEA 2BIVA 4M7AD 2M0OA 4PJOG 5GAMh 1M90C 2QQSA 5LJ5f 1H3ZA 2PQWA 5CKHA 1KC8C 1WQWA 4LDYA 1S72A 4M7AG 2LCLA 1YJNA 4BUGA 4C92A 4JLIA 3A8HB 5IN1A 1O9SA 3C4SA 3GLXA 1Y7XA 4A54A 4XAXB 5D6WA 2RHYA 1D3BB 2CYZB 2FL7A 3MP1A 1JJ2A 4RKUE 1VQMT 2LRQA 5HKCA 3QKJA 2KSSA 3HP9A 4PJOE 5M9OA 1KC8U 1VQNT 3J81E 1BIAA 4FIBA 2RI2A 3V7SA 4M75F 2QEXT 2EJGA 4MDXA 1YCYA 1BIBA 4XTUA 2F69A 2XIDA 3CBMA 3WVEB 1YJWA 3GPLA 2XG8D 3OBWA 4A53A 5J39A 5GAN8 3QYHB 1KHCA 2O4XA 2RJDA 3JB9I 2D6FA 1NPRA 3CCSA 3J7AF 4XTXA 4M7AE 2X4JA 2X4YA 3BY7A 1UGRB 4BI4A 4QVZA 1DJ7B 2H3JA 5LJ5g 3JCMW 4HCCA 3QSUA 4C8QD 2HBPA 4IUVA 4OGCA 4XU1A 1VUBA 2E6ZA 5GAMe 5GANh 3MP6A 3HSBA 4O5VA 3QG1A 4HKEA 2X35A 5GAMj 3M57A 2X4XA 4EMKB 4C5HA 3CCMA 4M77G 5L8RE 3H8ZA 2XDDA 1VQ5T 1K9MC 3OMGA 4XTZA 3CCET 3CPWA 3P8DA 1YJWT 4M7DF 2C06A 3QBYA 3HRTA 2EQJA 2GFUA 4X9CA 2EQUA 4BI8B 3QJ6A 4F7UE 3X20B 4QVDA 5GAN3 3LWHA 2QQAA 3CXCA 1Q86U 5CVIA 3ASKA 4LD9K 4M75B 1UGQB 3JCMc 4C92D 4ELYC 2PVGB 4JS4A 4HA8A 1XNIA 3RMSA 4A4HA 3E1SA 2L3RA 3M5AA 2E70A 1FX7A 5CQXA 4VUBA 4E7JA 5GAOn 1VQ4T 1YJ9T 1G3YA 5CO7A 2M9UA 4J6XA 3JB9J 4F7UG 3L2WA 1JRIA 5LJ3h 3UT1A 4ZN1A 5GMKi 3TEEA 3CCQA 4M78F 2K3XA 3FDRA 1VQ9T 4CI0C 2FHDA 3EAEA 3SWNB 2YLBA 1YI2T 1Q81C 1K8AU 4E7IA 4C5GA 4M78B 3HL8A 4BD3A 1LNXA 2Y4XA 4TVRA 3E9FA 4JDSA 2MWOA 3J80E 3OB9A 3QIIA 2R5AA 1NJIU 3OYYA 3E9GA 1VQ8A 3OW2S 1P92A 3META 4M7DC 4N4IA 5LJ3g 2GF7A 3OQ5A 2CZ1B 3TU4K 3CCRT 5LJ3f 1Y96B 3PTAA 4E7HA 3FRNA 2FVUA 3O8VA 4M77D 2ZPEB 3SB2A 3FJPA 3OMCA 3L2QA 4FT4A 3PMTA 5CIUA 5HK0A 2QA4T 4OB2B 4BDYA 1QVFS 3CCEA 4BY6B 3CBPA 1G5VA 4BACA 1BI2A 5GAOr 4M7DE 3LX7A 1WJSA 4QQDA 2CKKA 3X25B 2DTHA 3V8JA 4OP0A 3JB9H 4C92G 3M55A 1AHJB 1VIFA 4FSXA 1VQ8T 4M7AA 3X26B 1YHQT 5DY9A 4L5GA 2XD0A 2DJZA 2V8JA 1VQ4A 4JRKA 3S3NA 1W2BA 2LT1A 2JVVA 4XK8E 2RJCA 1K73C 4N4GA 3JCMe 1D3BA 2K57A 1Q82C 5HK3A 1YIJT 4J5YA 5D6YA 5C6SA 3ZBDA 2BUDA 2EKOA 4M77C 4C92B 4M75D 4A4EA 3DLMA 1FXXA 2FYKA 4ATOA 4KT0E 3OBYA 4RCBA 4DQ2A 3CCUT 1BI3A 1RL2A 3CCVT 4C0GA 2MF2A 4OB1B 4X34A 2JZ2A 4IUUA 2CS7A 2EJ9A 1YJNT 2QQBA 4JRIA 3HPWA 3HHTB 3QZ9B 4CRIA 4F7UA 2HQEA 2L8DA 4OMFB 1M1GA 4PJOF 5GMKh 3ME9A 5GAOq 3JCMP 4IKFA 3CD6T 3RUXA 1QVPA 2LX9A 3LGFA 4NOYA 2GCXA 1JBMA 3G6EA 5GANg 4M77B 5D6XA 3MEVA 3CCMT 3JB9G 2E65A 3WVDB 3OS0A 2XDPA 3HFOA 3GNGA 4E47A 3CBOA 1KD1C 3A8MB 3P8HA 4ME7A 2FB7A 2KMTA 4KULA 4PLIA 3JB9D 1PSFA 4FU6A 4M78A 4GY5A 5KCHA 1SSFA 5LJ5h 4UC4A 2CZ6B 2JNGA 4ZN3A 1N9SA 4HT9A 2XU8A 3LW5E 3C12A 3OS2A 3CMAA 3OYLA 1IZ6A 2CZ0B 2QTXA 2R57A 3OYDA 1FWZA 3C94A 3CCST 1U8RA 1VQ7T 2YHTA 2E6NA 3OYAA 1NJIC 4C8QF 2DD4A 2JTFA 2E64A 2RJFA 3F70A 2HAXA 4KUDK 3H6ZA 4LDWA 5I2MA 3I56T 1G3WA 4O6JA 3OYHA 4PJOC 4M75G 2LTOA 2D0QB 5FU6B 4NS5A 5GANf 4XQ3A 2DXCA 3TCJA 1EIFA 3CCVA 3V7CA 3SD4A 4R56A 3SWNC 3OS1A 1VQ6A 3M59A 2PUOB 1N27A 2RHXA 2XK0A 3NFCA 1I4K1 2EQMA 2V8IA 4C0FA 3BW1A 4B9XA 4M7AB 1G3TA 1G3SA 4N0AC 5LJ5j 3PMIA 3CXCS 4PJOB 5GMKj 4OB0B 2EIFA 2DXBA 2VV5A 2Y90A 2L5QA 1OZ2A 2AHJB 3M56A 1K8AC 2P4TA 1VQKT 2HNIA 4PL6A 2XKOC 3G7ZA 3QHSA 1N6AA 3URGA 4B9WA 1VQMA 2OTLA 3HRUA 4L6V5 5KE2A 1VQPT 3JRZA 4PKCC 4Q5WA 4EMKA 3SFMA 4N4HA 2Y4YA 1YIJA 2MWPA 4BY6C 3OYIA 3BDLA 1Y96A 3UPUA 4E7LA 2ZPFB 1I8FA 5GAOl 3CC7A 2LDMA 3VUBA 3DB3A 1KD1U 3JCMX 1S72T 1UB4A 3E19A 2JOYA 3QZ5B 3CCUA 2KY9A 3DB4A 1VQ6T 1UEBA 3ZEHA 5A2QE 5LJ3d 4EDUA 2JTMA 4WF2A 3JAME 3JCMh 2VUBA 3A8GB 3RERA 2XI9A 3GF5A 4XTVA 4C8QC 1K73U 3CD6A 3LGLA 4HT8A 1UGPB 2LT4A 2QXFA 3RKWA 4BI3A 1VQOT 2LVMA 1HXDA 4MMKA 4ZGDB 3UWNA 4ZTJA 4M7DD 2WSEE 4PJOD 1KG1A 4PNOA 1NZ9A 1YBYA 2WSFE 4P5NA 4RMOA 3MCAB 5LJ5e 3G4SA 3M9QA 3I55T 3CMEA 4EMHA 4C5EA 5GMKe 1O75A 3RESA 1K9MU 3GP8A 2RA2A 3OSSC 2DXUA 5A0GA 3EFSA 1N9RA 1JJ2S 1MGQA 2K4YA 5AYFA 3L2UA 4C5IA 3CCJT 3CC4A 3OYGA 2RHZA 3M4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXT A;  3L1A A;  5LJ3 j;  4PJO E;  2I2L A;  2EJ9 A;  4C92 C;  1BIA A;  4M7A F;  1I81 A;  4JRI A;  3V7S A;  4M75 F;  4F7U A;  4DQ2 A;  4M7D G;  2EJG A;  5GMK h;  1YCY A;  4PJO F;  5GAO q;  1BIB A;  4XTU A;  3JCM Q;  4X9D A;  3JCM P;  4M7D D;  3RUX A;  1LJO A;  1U1T A;  4NOY A;  1B34 B;  3V8K A;  1JBM A;  2DKG A;  4RCC A;  4A53 A;  3RKX A;  4C92 F;  4M77 B;  5GAN g;  5GAN 8;  1H64 1;  3JB9 I;  4M7A C;  1LOJ A;  5GAO m;  4XTX A;  4C8Q B;  3JB9 G;  4M7A E;  2E65 A;  1B34 A;  3BY7 A;  1WPY A;  3HFO A;  2DEQ A;  5GMK m;  3JB9 D;  4M78 C;  2FB7 A;  5GAN d;  4C8Q A;  5LJ5 g;  3JCM W;  4Y91 A;  3QSU A;  4C8Q D;  4M78 A;  4XU1 A;  5GAN 5;  5GAN h;  5GAM e;  5GAM f;  3AHU A;  5LJ5 h;  3PGG A;  4NL3 A;  4HT9 A;  2VXE A;  1N9S A;  3JCM b;  3VU3 C;  5GAM j;  3BDU A;  2RM4 A;  4EMG A;  5GAM d;  2QTX A;  4XU0 A;  4EMK B;  2E1H A;  4M77 G;  3JB9 F;  2YHT A;  4M7D B;  4C8Q F;  4XTZ A;  1TH7 A;  2E64 A;  4M7D F;  5I21 A;  3EFR A;  4M7D A;  3FB9 A;  3JCM V;  1U1S A;  4EMK C;  4X9C A;  1KQ1 A;  3QUI A;  3QO3 A;  4F7U E;  4QVD A;  5GAN 3;  3V7R A;  4XU2 A;  4PJO C;  4M75 G;  2RD1 A;  3INZ A;  4J6W A;  3JCM g;  5GAM g;  4M75 B;  3JCM c;  3JCM J;  4C92 D;  5GAN e;  4XQ3 A;  5GAN f;  4M78 G;  4C8Q E;  4HA8 A;  5CAI A;  3L2Z A;  4N0A A;  3V7C A;  2CGH A;  5GAN 6;  3SWN C;  4M75 A;  4M78 D;  4M77 A;  4F7U F;  5GAO p;  5GAO n;  1M8V A;  2DTO A;  3FIF A;  4J6X A;  2RB6 A;  3BFM A;  4F7U B;  4F7U G;  1JRI A;  5LJ3 h;  1I4K 1;  5GMK i;  3JB9 J;  3BW1 A;  4M75 C;  4M7A B;  4M78 F;  4N0A C;  4JUV A;  5LJ5 j;  5GAN j;  3SWN B;  2YLB A;  2DZ9 A;  5GMK j;  5GAN 2;  4PJO B;  4M78 B;  2Y90 A;  3V8L A;  1LNX A;  2HNI A;  3QHS A;  3JCM d;  3HSB A;  2VC8 A;  4XTW A;  4PJO A;  3GIB A;  2EJF A;  4EMK A;  1WQ7 A;  4XU3 A;  4M7D C;  4C8Q G;  5LJ3 g;  1Y96 A;  2VXF A;  3RIR A;  1I8F A;  5GAO l;  4M77 F;  4M78 E;  5GAN 7;  4NL2 A;  4QVC A;  3JCM X;  4M75 E;  5LJ3 f;  5LJ3 e;  1Y96 B;  4M77 D;  3SB2 A;  3FJP A;  4C92 E;  5LJ3 d;  2JN0 A;  2EAY A;  4WF2 A;  3M4G A;  4J6Y A;  1WNL A;  2YLC A;  3JCM h;  3RER A;  2EWN A;  4XTV A;  4C8Q C;  4HT8 A;  1M5Q 1;  2ZGW A;  1X01 A;  3RKW A;  4M7D E;  5GAO r;  2E41 A;  1HXD A;  5GMK l;  4MMK A;  2DTH A;  2E10 A;  3RKY A;  3V8J A;  1I5L A;  4OP0 A;  3JB9 H;  4C92 G;  4PJO D;  3HFN A;  5LJ5 d;  2DTI A;  4PNO A;  1HK9 A;  4M7A A;  2DVE A;  5DY9 A;  4M7A D;  4V2S A;  4PJO G;  5GAM h;  2DJZ A;  5LJ5 f;  5LJ5 e;  1KQ2 A;  4JRK A;  1WQW A;  4EMH A;  5GMK e;  4M7A G;  4XTY A;  3RES A;  3JCM f;  3JCM e;  2RA2 A;  1D3B A;  4C92 A;  2K57 A;  2DXU A;  4JLI A;  3EFS A;  1N9R A;  4MML A;  1MGQ A;  4J5Y A;  4A54 A;  4M77 C;  1D3B B;  3SWN A;  4C92 B;  4M75 D;  2DZC A;  2FYK A;  5GAN 4;  4M77 E;  4RCB A; 
#chains in the Genus database with same CATH topology
 3LYI A;  5CCA A;  1SKU B;  3OW2 P;  1I07 A;  5GJW B;  3VV0 A;  1QP2 A;  4X9D A;  1MV0 B;  1U1T A;  3VS0 A;  4ELZ C;  4LDU A;  3RKX A;  1M1K U;  2DPP B;  1VQ7 A;  2DIL A;  2O4X B;  3DLL A;  1VQN Q;  4FYV B;  3MKD A;  3CCR Q;  1YJ9 A;  4CC4 B;  1W70 A;  3PGG A;  1ARK A;  2MOX A;  2DIG A;  1TXQ A;  3A1P A;  1LVK A;  1ZHI A;  1QKX A;  3NHN A;  5IXF A;  4DOW A;  2R58 A;  3JCM g;  2EFI A;  1QCF A;  4ANJ A;  4PJJ A;  5CK9 A;  4LDV A;  4EIK A;  4R55 A;  3L2Z A;  4N0A A;  1Z9Z A;  1VQP A;  1Q86 C;  1M4Z A;  1SSH A;  1QCO A;  1RI0 A;  5GAN j;  1TSF A;  1N8R R;  1XQH A;  3PT9 A;  5EG2 A;  3RMQ A;  3CC2 T;  2HKN A;  3M54 A;  1Q81 R;  2QI2 A;  2KEA A;  2BZY A;  4C8Q G;  4CC3 A;  2V1Q A;  4OB3 B;  1PD0 A;  5I2S A;  2F1L A;  3VUZ A;  2CP6 A;  2A3L A;  4AFS C;  1VQO Q;  4BE2 A;  1VQL A;  1V1C A;  3Q1J A;  1YIT A;  3VS7 A;  1X75 C;  2G3R A;  1WHM A;  2JN0 A;  3M4G A;  1VYU A;  4DBH A;  3CPF A;  2KBT A;  3OA6 A;  2C0O A;  1X01 A;  1WZO A;  4AFZ C;  4B6M A;  1H3H A;  5LJ5 d;  1KHI A;  3CCJ A;  2PVO B;  1M90 U;  2D1X A;  2COW A;  2K3B A;  6AT1 B;  1VQM Q;  4XTY A;  1M3C A;  3NTI A;  3CCQ T;  1CKA A;  2ZPI B;  3KBG A;  4HCB A;  4D8K A;  5FRO A;  1M8M A;  1WFW A;  3EHR A;  1Z9Q A;  4JLG A;  5LJ3 j;  2ECZ A;  1QW1 A;  3CMA T;  3FEO A;  4FCY A;  3VYG A;  5FU6 C;  1OYX A;  5HY6 A;  2L89 A;  3H41 A;  3G71 Q;  1UHC A;  1B34 B;  1PSE A;  2KT8 A;  4M7D G;  1H64 1;  3CPW S;  1SHF A;  1JJ2 P;  1QKW A;  1BI0 A;  2X9H A;  2DEQ A;  3UDC A;  1Q95 G;  5GMK m;  4OML A;  4C8Q A;  4Y91 A;  5FLX E;  5GAN 5;  2JUF A;  2K2M A;  3CC2 A;  3JCM b;  2XDB A;  4EMG A;  1EFN A;  2RK2 A;  4MDW A;  4IIO A;  2RQR A;  3M0R A;  2DK3 A;  3EFR A;  3OYB A;  2JS2 A;  3FB9 A;  2E4H A;  3JCM V;  1JB0 E;  1VQL T;  5DLO A;  5GAM g;  5GAN e;  3CCE Q;  4M78 G;  5CAI A;  3OYN A;  3QWX X;  4A4G A;  3CME T;  2YRV A;  1M1F A;  3FIF A;  2ESW A;  4F7U B;  4QT7 A;  2XIC A;  4M75 C;  5KYY A;  2BE7 D;  4FYY B;  3V8L A;  1NLP C;  2ZPB B;  1X6O A;  3I5R A;  1T0J A;  2FPF A;  4IUQ A;  2RH2 A;  2D9T A;  1KFZ A;  3LH0 A;  2P84 A;  4X1V A;  3CCL T;  1YHQ A;  5I11 A;  3MO8 A;  2RHI A;  4JJB A;  1NLO C;  2RJE A;  2KI7 A;  2JMC A;  4JS5 A;  3L2R A;  5CKF A;  2RPN A;  1HK9 A;  4LDX A;  4M7A D;  4PJO G;  1M90 C;  1H3Z A;  1WQW A;  4RTV A;  1F1B B;  4JLI A;  3A8H B;  4LN2 A;  2BZX A;  1KK7 A;  2EGA A;  3C4S A;  5D6W A;  2FL7 A;  3MP1 A;  3QKJ A;  3HP9 A;  2CT3 A;  3I55 Q;  1KC8 U;  1BIA A;  4DEX A;  1BIB A;  4XTU A;  2DRM A;  1FMW A;  1K9A A;  4A53 A;  1B3Q A;  2O4X A;  2RQW A;  4DEY A;  3EG9 A;  2GQI A;  4E7S A;  1SF9 A;  4HCC A;  4C8Q D;  4OGC A;  5GAN h;  3MP6 A;  3MPU B;  3QG1 A;  2LMJ A;  1M30 A;  3M57 A;  3CCM A;  2YRD A;  1UJ0 A;  5IHI A;  1UFF A;  5L8R E;  1K9M C;  3HTR A;  4XTZ A;  3CC7 Q;  4M7D F;  2EW3 A;  2EQJ A;  2GFU A;  1LCK A;  5CVI A;  2O88 A;  4M75 B;  1YP5 A;  2CP0 A;  3RMS A;  4A4H A;  3E1S A;  5EC7 A;  2HZY A;  3M5A A;  2E70 A;  4E7J A;  3M0P A;  1VQ4 T;  2YDL A;  3JB9 J;  3UT1 A;  5GMK i;  1X27 A;  1R0B G;  1WHK A;  1PNJ A;  1J3T A;  4LNP A;  4JDS A;  1VQ8 A;  1P92 A;  5LJ3 g;  3OQ5 A;  4F16 A;  3ZL7 C;  5LJ3 f;  1HSQ A;  4FT4 A;  3I5S A;  3PMT A;  5CIU A;  2QA4 T;  3CCE A;  3RDV A;  3CBP A;  3M0T A;  1ZA1 B;  2NUP B;  4BAC A;  1WJS A;  2CKK A;  2JTE A;  4OP0 A;  1VIF A;  4M7A A;  4M4Z A;  3NMZ C;  4L5G A;  2XD0 A;  4JRK A;  2OTJ Q;  2RJC A;  1K73 C;  2PNI A;  3JCM e;  2K57 A;  1K0X A;  1YIJ T;  5C6S A;  2FYK A;  1E6H A;  4RCB A;  4DQ2 A;  3TSZ A;  2JZ2 A;  1JU5 C;  3QZ9 B;  3O5Z A;  2HQE A;  4PJO F;  3JCM P;  3CD6 T;  3CCQ Q;  1QCN A;  1QVP A;  2LX9 A;  1Q82 R;  4J9B A;  2J05 A;  4R0K A;  5GAN g;  3MEV A;  1VA7 A;  2FRY A;  2HMA A;  3OS0 A;  4E47 A;  3HFO A;  3GNG A;  3JB9 D;  1U06 A;  4KUL A;  1PSF A;  2C0T A;  1SSF A;  1ZLM A;  4ZN3 A;  2JNG A;  5LJ5 h;  3LW5 E;  1TU0 B;  3OYD A;  1VQ7 T;  1UJY A;  2DYB A;  2LJ3 A;  1NJI C;  5IHK A;  2LQW A;  2RJF A;  4KUD K;  4O6J A;  3GBQ A;  4M75 G;  4PFP A;  4JPB W;  4F14 A;  1AZG B;  3TSW A;  3TCJ A;  4J9D A;  1VQ9 Q;  3V7C A;  4R56 A;  2LJ1 A;  2EQM A;  4C0F A;  4B9X A;  4M7A B;  2MCN A;  1W6X A;  3PMI A;  3CXC S;  2VWF A;  5GMK j;  1KQS A;  2EIF A;  1OZ2 A;  4QKU A;  3M56 A;  1VQK T;  1VQM A;  3BE3 A;  3QHS A;  1VQP T;  2PTK A;  4N4H A;  2Y4Y A;  2CT4 A;  1YIJ A;  4PK4 A;  3BDL A;  2ZPF B;  3CC7 A;  2DER A;  1WHG A;  2LDM A;  3VUB A;  3DB3 A;  1T3S A;  1UEB A;  3ZEH A;  5A2Q E;  2FEI A;  4EDU A;  4WF2 A;  3JAM E;  1D0Z A;  3JCM h;  1I5O B;  2VUB A;  3CD6 A;  3LGL A;  2LT4 A;  4BI3 A;  2LVM A;  1HXD A;  4MMK A;  4ZTJ A;  2WSE E;  1NZ9 A;  2O2O A;  1YBY A;  3G4S A;  3MCA B;  3M9Q A;  3I55 T;  3RES A;  1K9M U;  3GP8 A;  1R77 A;  3UF4 A;  2DXU A;  3EFS A;  1MGQ A;  1MMA A;  3CCJ T;  2RHZ A;  2DNU A;  2ROT A;  1I81 A;  2M1H A;  3M58 A;  4KBM B;  2KRN A;  2E5Q A;  1WGS A;  3MHX A;  4F04 B;  3MEA A;  1LJO A;  1MND A;  4DA4 A;  3HRS A;  1N8R U;  2DKG A;  4C92 F;  4M7A C;  2LC4 A;  5IH2 A;  2H8H A;  5KH6 A;  2LJ0 A;  3OS5 A;  5LL6 S;  3OYM A;  4M78 C;  4IIM A;  2BKD N;  1OZ3 A;  1YN8 A;  3I56 A;  3S3M A;  1H8K A;  2HEQ A;  5CKB A;  1VQK A;  3CCR A;  3VU3 C;  3HKS A;  2MK5 A;  2RM4 A;  3JB9 F;  1QVG S;  2O9V A;  1G8X A;  1ZA2 B;  2K5F A;  1ZUU A;  5KE3 A;  2F2V A;  3KUF A;  2V8K A;  2MAM A;  3CPW P;  2HDA A;  4DBF A;  2QAS A;  3WXM B;  1FMK A;  1QQJ A;  1G2B A;  1WJR A;  2CGH A;  2OTL T;  1M8V A;  2GFA A;  3UA6 A;  2QEX A;  3UA7 A;  2JJ9 A;  2EYY A;  3EG3 A;  1TOV A;  3U23 A;  1QVG P;  1YFN A;  4JUV A;  1VOM A;  3CC4 Q;  2DZ9 A;  4E7Z A;  3I55 A;  2G6F X;  3NTH A;  4XTW A;  1W2B S;  4PJO A;  1WQ7 A;  1ZUK A;  2LQ8 A;  1BKB A;  3KXT A;  2P4R A;  1IO6 A;  3RIR A;  3C95 A;  2M16 A;  1AWW A;  3VYH B;  1WNL A;  1QWF A;  2EWN A;  1QVF A;  2K5I A;  3TRE A;  5J3B A;  2YUP A;  4QQ6 A;  3A8L B;  2EYX A;  3QXE B;  3A98 A;  5IT9 E;  4Z88 A;  2ZCF B;  3CCS Q;  2B8A A;  2DTI A;  4D6W A;  4RTZ A;  1UHF A;  2D0N A;  5KYW A;  3OYE A;  1ZQ1 A;  3CMA Q;  1OX8 A;  1ABQ A;  4JRP A;  1VQN A;  3ZFJ A;  1M3B A;  4A4K A;  3PIP A;  2WSC E;  1OUL A;  2KRM A;  1U5S A;  2DXT A;  2CP2 A;  4Z89 A;  3OYC A;  2DAQ A;  1RAE B;  2MMP A;  3JCM Q;  1W4S A;  3PFS A;  4RCC A;  3PE0 A;  1PRL C;  2AKL A;  2OAU A;  4K11 A;  1LOJ A;  4C8Q B;  3FLG A;  1B34 A;  1WPY A;  1Q82 U;  1TG0 A;  4FT2 A;  2QGG A;  4OVA A;  2M02 A;  1BB9 A;  4QW2 A;  2P0K A;  3EGD A;  2KYB A;  2WAC A;  2VXE A;  4J9C A;  2P0Q A;  1TH7 A;  3H0H A;  4E6R A;  5I21 A;  4M7D A;  2EYZ A;  1U1S A;  4Z02 A;  3JSC A;  3P8B B;  3T9N A;  3V7R A;  5FRM A;  2RD1 A;  1VQ5 Q;  2A7Y A;  3G71 T;  3JCM J;  1OOT A;  4L59 A;  4C8Q E;  2K6D A;  4A63 B;  4M78 D;  5D7U A;  5GAO p;  2DFU A;  3EGU A;  3TVT A;  2O01 E;  3X24 B;  2EQI A;  2PU9 B;  1K1Z A;  5GAN 2;  4FL6 A;  3LLR A;  1OX9 A;  2VC8 A;  1Q7Y U;  2RI5 A;  5AT1 B;  4AG1 C;  1UGS B;  2DF6 A;  3A5Z B;  4QVC A;  2OAW A;  2L2P A;  4C92 E;  1NE8 A;  2EAY A;  1H92 A;  4FW2 A;  2NUT A;  5IAY A;  4OGE A;  5CKE A;  2E41 A;  4MZP A;  5GMK l;  2K2V A;  2F2W A;  2PQW A;  5CKH A;  1KC8 C;  4LDY A;  2DA9 A;  1S72 A;  2DEU A;  4M7A G;  1UTI A;  1YJN A;  5IN1 A;  1Y7X A;  4A54 A;  1YJN Q;  1D3B B;  1PRM C;  1WYX A;  2LCS A;  3CD6 Q;  2A28 A;  1VQ6 Q;  2M0Y A;  2YRC A;  1ZBJ A;  2KSS A;  4PJO E;  4FIB A;  2EJG A;  3VS4 A;  2F69 A;  3WVE B;  1YJW A;  3LH5 A;  3OBW A;  2QK0 A;  5J39 A;  3QYH B;  3MJX A;  2RJD A;  1GFD A;  1NPR A;  3J7A F;  1GCQ A;  1WXT A;  1PG5 B;  2L3Q A;  3JCM W;  3QSU A;  1SG5 A;  4IUV A;  1AD5 A;  1NEB A;  1XJW B;  1VUB A;  5GAM e;  2DX1 A;  2YUO A;  4O5V A;  2X4X A;  2J6O A;  4EMK B;  2KRO A;  2XDD A;  5L23 A;  3EHQ A;  3P8D A;  3NGP A;  4ORZ A;  2C06 A;  3QBY A;  2DM1 A;  2KT1 A;  2EQU A;  4QVD A;  2HSP A;  2QQA A;  1Q86 U;  2O9S A;  3SEM A;  1TUD A;  2E3H A;  2ED1 A;  1JRI A;  5LJ3 h;  2D8H A;  3TEE A;  3CCQ A;  4M78 F;  2K3X A;  1WX6 A;  1YI2 T;  2FHD A;  3SWN B;  2DRK A;  2HQH A;  4HVV A;  3CME Q;  1K8A U;  4C5G A;  1LPL A;  1K8A R;  1M2V A;  2BZ8 A;  4TVR A;  2VKN A;  1NJI U;  2JXB A;  3OW2 S;  4M7D C;  2CZ1 B;  3TU4 K;  1BK2 A;  1Y96 B;  2COZ A;  3FRN A;  5IHN A;  4OMM A;  3REA B;  3H9N A;  5HK0 A;  4OB2 B;  1HYO A;  4M7D E;  3LX7 A;  2DMO A;  1MV3 A;  4QQD A;  2DTH A;  3V8J A;  1JO8 A;  1K9M R;  4FSX A;  1VQ8 T;  3X26 B;  3THK A;  3CC2 Q;  1RAG B;  2DJZ A;  1VQ4 A;  2LT1 A;  5HK3 A;  1M27 C;  4J5Y A;  5D6Y A;  2EKO A;  3DLM A;  1FXX A;  2PZ1 A;  4KT0 E;  1M2V B;  2GTJ A;  1BI3 A;  4OB1 B;  2BTT A;  2VVK A;  4IUU A;  2CS7 A;  2M51 A;  1OU9 A;  3HHT B;  3HPW A;  4CC7 A;  4CRI A;  2DL5 A;  4F7U A;  4IKF A;  3ME9 A;  1UEC A;  3RUX A;  3G6E A;  1E7O A;  3VS2 A;  2QEX Q;  1M3A A;  2E65 A;  1B7T A;  1KD1 C;  3A8M B;  3P8H A;  4ME7 A;  4FU6 A;  4UC4 A;  2CZ6 B;  3OS2 A;  3C12 A;  3OYL A;  2CZ0 B;  2R57 A;  4FSS A;  3CCS T;  1U8R A;  3C94 A;  2DYI A;  4C8Q F;  2YSQ A;  3M0S A;  1ZSZ B;  1PD1 A;  1K73 R;  3I56 T;  3OYH A;  4PJO C;  2HBW A;  1WLP B;  2D0Q B;  4NS5 A;  5GAN f;  1AWJ A;  2QAZ A;  3SD4 A;  2DL8 A;  1A0N B;  2CSI A;  2CSQ A;  1ACM B;  1GRI A;  3BW1 A;  5KYX B;  1JEG A;  1G3S A;  4LE9 A;  4PJO B;  4OB0 B;  1K8A C;  2HNI A;  2XKO C;  4B9W A;  2OTL A;  4L6V 5;  3JRZ A;  1V76 A;  2MWP A;  3OYI A;  1I8F A;  1KD1 U;  1S72 T;  1UB4 A;  2JOY A;  3QZ5 B;  2YUN A;  7AT1 B;  3IQL A;  5LJ3 d;  1CKB A;  2JTM A;  2HKQ B;  3RER A;  4KGV B;  3ULR B;  1KG1 A;  1I0C A;  4PNO A;  1WHL A;  4RMO A;  5LJ5 e;  2DBM A;  1Q86 R;  3EGD B;  1UGV A;  1N9R A;  1JJ2 S;  2FZC B;  1JXO A;  3EH1 A;  3NPF A;  3L2U A;  3PVQ A;  3OYG A;  3CQT A;  3QDR B;  3QJY A;  4HXJ A;  5C0M A;  3G4S T;  2YUQ A;  1SEM A;  1GBR A;  1MHN A;  2RMO A;  2QDY B;  3CCJ Q;  1T0H A;  4J83 A;  2KK4 A;  5FU7 C;  2JMA A;  3OSV A;  8AT1 B;  2KYM A;  1Q7Y C;  3PIO A;  2KVQ G;  2KQW A;  3DKM A;  1VIE A;  2A37 A;  2OX7 A;  4KUI A;  2JW4 A;  1GCQ C;  1FMV A;  1Y07 A;  4XU0 A;  4HCZ A;  4M7D B;  3G1J A;  2QG9 B;  5FU7 B;  5DLQ E;  3ER0 A;  2LP5 A;  2MYS A;  1WA7 A;  2XHC A;  3EG0 A;  2X4W A;  1BYM A;  2VGM A;  2V26 A;  4M75 A;  2DTO A;  3M53 A;  2W10 A;  2EPD A;  2RB6 A;  3BFM A;  2GQV A;  1S1N A;  2SRC A;  1I1J A;  4J9F A;  4DOV A;  1VQP Q;  4OMP A;  1VQ5 A;  1KIK A;  1OQK A;  1IXD A;  2K5L A;  4Y28 E;  3GIB A;  4GLM A;  1YNZ A;  2DIQ A;  1UG1 A;  2F5T X;  4M78 E;  5GAN 7;  1K4U S;  5LJ3 e;  1AT1 B;  2ZPG B;  1RAB B;  1QVG A;  4J6Y A;  2JM9 A;  2YLC A;  5A0D A;  2NUZ A;  4ZGE B;  1OI1 A;  4LUE A;  2E10 A;  2L3S A;  3CC4 T;  3OW2 A;  4IUR A;  4A4F A;  4OMO A;  1UE9 A;  3M0Q A;  2E5K A;  2HD0 A;  4E2F B;  4MML A;  3SWN A;  4II1 A;  5FRN A;  1XTD A;  4C0D C;  5GAN 4;  3EH2 A;  1B07 A;  4M77 E;  3QPH A;  2EGE A;  1PM3 A;  2KXC A;  1KD1 R;  2R5M A;  2GNC A;  1VYT A;  3VKI A;  4J7I A;  4OF1 A;  1VQK Q;  1X2K A;  2JM8 A;  2LNV A;  3EFO A;  5GAO m;  2DBK A;  2SEM A;  1GFC A;  1X6G A;  1SRM A;  2OTJ T;  2RHU A;  5GAN d;  3RR6 A;  1AEY A;  1V29 B;  1WXB A;  4YTL A;  4NL3 A;  5KCO A;  3A8O B;  2PVD B;  1D0X A;  2KRS A;  4WTO B;  2FZG B;  3VJP A;  3X28 B;  3QYG B;  5CR2 A;  4BDZ A;  4ZTF A;  4JRQ A;  1PKS A;  2DE0 X;  4OMQ A;  2RF0 A;  1GL5 A;  1KSW A;  3QUI A;  3QO3 A;  3INZ A;  4KH0 B;  4C0D B;  2DVJ A;  1EZZ B;  5CKD A;  2DL3 A;  2K9G A;  3MEU A;  4J9I A;  2NYS A;  2ZPH B;  5GAN 6;  2RI3 A;  3OYJ A;  2FPD A;  3CEY A;  2E3I A;  3LWI A;  2P0P A;  4JZ4 A;  1R8O B;  1HJD A;  1XOV A;  2QA4 A;  2FZK B;  3C0C A;  2IG0 A;  3R6O A;  5GJV B;  3VRZ A;  1YI2 A;  2QYZ A;  1NG2 A;  3M0U A;  3OYK A;  4GLK A;  1BCO A;  2RNA A;  2PUK B;  2FO0 A;  3G6E Q;  2KAF A;  2NUP A;  1I5L A;  3G71 A;  3PNW C;  3HFN A;  1M1K C;  3S3O A;  1CSK A;  2DJQ A;  2BIV A;  2DL7 A;  2M0O A;  4GBQ A;  1Y57 A;  2LCL A;  1AWX A;  3CCU Q;  1O9S A;  4XAX B;  2CYZ B;  2FPE A;  1JJ2 A;  2J6K A;  1E6G A;  4LUD A;  5M9O A;  3J81 E;  2RI2 A;  3KFV A;  4M75 F;  2QGF B;  2QEX T;  2XID A;  3CBM A;  3GPL A;  2LZ6 B;  1GBQ A;  3JV3 A;  5GAN 8;  3JB9 I;  2D6F A;  4XTX A;  4M7A E;  2X4J A;  2X4Y A;  1UGR B;  2CUB A;  4QVZ A;  1DJ7 B;  5LJ5 g;  2C0I A;  4XU1 A;  2HBP A;  5GAM j;  5FWC A;  1UDL A;  1WHH A;  2X35 A;  1RUW A;  2AKK A;  4M77 G;  1FYN A;  3H8Z A;  1VQ5 T;  1RAC B;  4AT1 B;  1YJW T;  4X9C A;  1ZX6 A;  4BI8 B;  4F7U E;  3REB B;  3X20 B;  3LWH A;  4DBQ A;  3JCM c;  4C92 D;  4ELY C;  2HSE B;  2PVG B;  4JS4 A;  4HA8 A;  2L3R A;  4VUB A;  1G3Y A;  2QDL A;  2M9U A;  4J6X A;  4F7U G;  3L2W A;  4ZN1 A;  1M1K R;  3FDR A;  4WCI A;  1VQ9 T;  1ABO A;  2X3X D;  2YLB A;  4M78 B;  4BD3 A;  1LNX A;  4JJC A;  4Z8A A;  3OYY A;  3E9G A;  1N5Z A;  3PTA A;  2FVU A;  1K76 A;  4M77 D;  2ZPE B;  2CP3 A;  3OMC A;  4RUG A;  3L2Q A;  1QVF S;  2AIR B;  2YWW A;  1X2Q A;  1C0M A;  4BY6 B;  2W0Z A;  1BI2 A;  3QDF A;  2O31 A;  1W2B P;  1IHV A;  4C92 G;  4KH1 B;  1AHJ B;  3H0I A;  1MMG A;  4RTU A;  1YHQ T;  1GCP A;  1KQS P;  1W2B A;  1TUG B;  2I0N A;  2JVV A;  4N4G A;  1Q82 C;  1YIT Q;  3AT1 B;  2BUD A;  4C92 B;  4M75 D;  4ATO A;  3G4S Q;  1PKT A;  1RL2 A;  3CCV T;  4C0G A;  2MF2 A;  4CC2 A;  4D8D A;  1PC0 A;  2QQB A;  4OMF B;  1QMC A;  2NUT B;  5GMK h;  1TS9 A;  5GAO q;  1VQL Q;  4NOY A;  2GCX A;  1JBM A;  5D6X A;  3EG9 B;  4LXC A;  3WVD B;  2GBQ A;  2KMT A;  4M78 A;  2Z0W A;  4KGX B;  4KGZ B;  3VS1 A;  2QTX A;  1FWZ A;  5FWB A;  1IGU A;  2E6N A;  2YHT A;  4AG2 C;  1C1A A;  2JTF A;  1WHJ A;  3F70 A;  5KYU A;  3H6Z A;  4LDW A;  5I2M A;  3TQ7 P;  1QLY A;  4JZ3 A;  2LTO A;  1W1F A;  2CP5 A;  2DXC A;  3OS1 A;  3R6N A;  1VQ6 A;  3M59 A;  3CCV Q;  3NFC A;  1I4K 1;  2LX7 A;  1YCS B;  4PJL A;  1G3T A;  3I56 Q;  4N0A C;  2RQT A;  4PFZ A;  2ATC B;  2DXB A;  2AHJ B;  2P4T A;  4PL6 A;  3G7Z A;  3URG A;  2FRW A;  5KE2 A;  4AMC A;  4Q5W A;  4EMK A;  3SFM A;  2EVR A;  4BY6 C;  3I35 A;  2RN8 A;  1VYV A;  3JCM X;  3E19 A;  2KY9 A;  3DB4 A;  2YXY A;  2L3P A;  2J06 A;  2CUD A;  1NYF A;  1KJW A;  2VAS A;  9ATC B;  1RAF B;  3GF5 A;  4XTV A;  4C8Q C;  2GTO A;  4HT8 A;  4PFO A;  2A08 A;  1VQO T;  3UWN A;  2V1R A;  4FYW B;  2WSF E;  3CME A;  5GMK e;  2KR3 A;  1QVF P;  2COY A;  5AYF A;  4C5I A;  3CC4 A;  1GXI E;  5KYU B;  4BE1 A;  8ATC B;  3L1A A;  1OV3 A;  3SHW A;  2I2L A;  4QQG A;  2EBP A;  4BE0 A;  4C92 C;  4M7A F;  3VS5 A;  1NBE B;  2RQV A;  4IUP A;  1QP3 A;  2BE9 B;  3MEW A;  1S72 Q;  1UUE A;  5J26 A;  4MZT A;  2EKH A;  2DO3 A;  1RAI B;  2ED0 A;  2OJ2 A;  5KYW B;  2HL5 C;  3OYF A;  4PJM A;  2MPX C;  5GAM f;  4OMN A;  2XMF A;  4FM4 B;  3L42 A;  4C0Z A;  1KC8 R;  1BCM A;  1M90 R;  3BDU A;  1X43 A;  4J8O A;  2E1H A;  3EGX A;  1VQ9 A;  4JJN K;  2HL3 A;  4RTW A;  1KQ1 A;  2QQR A;  2HCK A;  1PWT A;  2K79 A;  4J6W A;  4MZM A;  4ZGJ B;  1D1A A;  1X6B A;  2ZAE A;  5ECA A;  4M77 A;  1YIT T;  5CQY A;  2KNB B;  4JJD A;  3S6W A;  4F17 A;  3VS3 A;  1WIE A;  4E7K A;  4J7F A;  2EJF A;  2EQK A;  1NM7 A;  2DET A;  4XU3 A;  1MMN A;  1WJQ A;  2E12 A;  1SRL A;  4AFU C;  2LQN A;  2QQ9 A;  3EG1 A;  4M75 E;  4KRT A;  3VRY A;  3VS6 A;  1TUC A;  3G6E T;  2CDT A;  2LQK A;  3PVL A;  3RBB B;  2RO0 A;  2ZGW A;  1Y71 A;  3CC7 T;  1HD3 A;  1IB8 A;  4IUT A;  3RKY A;  2HQX A;  4J9E A;  4V2S A;  1BU1 A;  2OI3 A;  4PLL A;  1KQ2 A;  4BB7 A;  2VYT A;  3JCM f;  2J7I A;  1PHT A;  2NLU A;  3GOX A;  2DZC A;  4RTT A;  2JS0 A;  2QA4 Q;  3FJ5 A;  2KXD A;  1RLP C;  4EPC A;  1EX4 A;  1SPK A;  4DBR A;  2LCC A;  4LD6 A;  3SDZ A;  5A0L A;  3V8K A;  4RG8 A;  3NTK A;  2KDS A;  1BI1 A;  1YHQ Q;  2EYQ A;  3FC3 A;  2EYW A;  3N5B B;  1Y0M A;  3L2V A;  3AHU A;  3MP8 A;  1C6V X;  1OU8 A;  4ESR A;  4RTX A;  5GAM d;  1R0C B;  1BBZ A;  2IVW A;  2A36 A;  2MI6 A;  1K0S A;  3I9Q A;  4EMK C;  4XU2 A;  2D8J A;  2DD5 A;  2OTJ A;  5DM7 R;  1D0Y A;  2A0F B;  1AOJ A;  1RLQ C;  2VGN A;  2JT4 A;  4F7U F;  1KQS S;  2RK1 A;  3CCL A;  1VQO A;  2K3Y A;  5KYY B;  1IRE B;  1NPP A;  2NWM A;  3JCM d;  3OY9 A;  1ZSG A;  3GNF B;  2CZ7 B;  1YI2 Q;  2VXF A;  4M77 F;  3H0F A;  4NL2 A;  1Q81 U;  1JXM A;  5IXB A;  2ZZD A;  2H3E B;  1AWO A;  2F5K A;  1VQ8 Q;  1M9S A;  2QTV A;  1M5Q 1;  1ZBX A;  2FG0 A;  2GGR A;  1N8R C;  4RG2 A;  1WDX A;  2DVE A;  1YIJ Q;  4HVU A;  5GAM h;  2QQS A;  5LJ5 f;  1PCX A;  4BUG A;  4C92 A;  3GLX A;  2RHY A;  1D1C A;  4J9H A;  2EGC A;  4RKU E;  1VQM T;  2LRQ A;  4RTY A;  5HKC A;  1X69 A;  2CH4 A;  1VQN T;  1TTH B;  1NJI R;  2AK5 A;  3V7S A;  4MDX A;  1YCY A;  2YT6 A;  2XG8 D;  1MMD A;  1KHC A;  2K7A A;  1T3L A;  4FYX B;  3CCS A;  2F2X A;  3BY7 A;  4BI4 A;  2H3J A;  2KGT A;  2E6Z A;  3EGX B;  3CCM Q;  4HKE A;  4C5H A;  3OMG A;  3CXC P;  3CCE T;  3CPW A;  3HRT A;  2LNH B;  3QJ6 A;  5GAN 3;  1AZE A;  3CXC A;  3ASK A;  4LD9 K;  1UGQ B;  3D7S B;  1ZSZ C;  1XNI A;  1FX7 A;  5CQX A;  1YJ9 T;  5GAO n;  4J9G A;  5CO7 A;  4HVW A;  1Q81 C;  4CI0 C;  3EAE A;  4E7I A;  5KYX A;  3HL8 A;  2Y4X A;  3E9F A;  2MWO A;  3J80 E;  2AZV A;  3OB9 A;  3QII A;  2R5A A;  5KYN A;  3MET A;  1WI7 A;  4N4I A;  1JQQ A;  2GF7 A;  1OPL A;  3CCR T;  2VB6 A;  5I22 A;  4E7H A;  2ROL A;  3O8V A;  3EFO B;  3SB2 A;  3FJP A;  4BDY A;  2KE9 A;  2X51 A;  1YWO A;  1G83 A;  5GAO r;  1IRX A;  3X25 B;  3JB9 H;  3M55 A;  2J6F A;  1YWP A;  2RQU A;  5DY9 A;  2V8J A;  2CH4 W;  2ENM A;  3S3N A;  4ZNX A;  4XK8 E;  2AT1 B;  1VQ4 Q;  1D3B A;  1TWB A;  1RAD B;  3ZBD A;  1OEB A;  4M77 C;  4A4E A;  2IIM A;  3OBY A;  3CCU T;  1U3O A;  4X34 A;  2EJ9 A;  1YJN T;  4PJN A;  2DLP A;  4JRI A;  1D1B A;  2AZS A;  1Q7Y R;  5HCK A;  4M7D D;  2L8D A;  1M1G A;  3LGF A;  1IGQ A;  4M77 B;  3CCM T;  3UAT A;  3JB9 G;  2XDP A;  3CBO A;  2CRE A;  1WXU A;  2FB7 A;  4PLI A;  4GY5 A;  5KCH A;  4HT9 A;  1N9S A;  2XU8 A;  3CCL Q;  4FW1 A;  3CMA A;  1D09 B;  1RAA B;  1IZ6 A;  3OYA A;  2ABL A;  2DD4 A;  1NEG A;  1IHW A;  5FW9 A;  2E64 A;  2HAX A;  1ZUY A;  1YJ9 Q;  1G3W A;  2IPO B;  1MUZ A;  5FU6 B;  4XQ3 A;  1EIF A;  3CCV A;  1VQ7 Q;  3SWN C;  2PUO B;  1N27 A;  2RHX A;  2XK0 A;  2V8I A;  5LJ5 j;  1SHG A;  2B86 A;  3E2U A;  1RI9 A;  2VV5 A;  2OTL Q;  2Y90 A;  2L5Q A;  1G5V A;  1M2O A;  3HSB A;  1N6A A;  1OPK A;  2CP7 A;  3HRU A;  2DL4 A;  4PKC C;  3UPU A;  4E7L A;  1Y96 A;  5GAO l;  1MNE A;  2L0A A;  3CCU A;  1RAH B;  1VQ6 T;  4HCK A;  4AFQ C;  3A8G B;  2XI9 A;  3QWY A;  1K73 U;  1UGP B;  2QXF A;  2X3W D;  3RKW A;  4ZGD B;  2MIO A;  4PJO D;  4Y92 A;  3EG2 A;  4P5N A;  1YJW Q;  4EMH A;  1NYG A;  4C5E A;  1O75 A;  3RNJ A;  2RA2 A;  3OSS C;  5A0G A;  2K4Y A;  1QWE A;  1AVZ C;  1ZSZ A;  3M4Y A; 
#chains in the Genus database with same CATH homology
 4BE1 A;  3LYI A;  3QDR B;  3L1A A;  5CCA A;  2I2L A;  4QQG A;  4BE0 A;  4C92 C;  3QJY A;  4M7A F;  1I81 A;  2M1H A;  3M58 A;  4KBM B;  3VV0 A;  2E5Q A;  1WGS A;  3MHX A;  1QP2 A;  4X9D A;  3MEA A;  4IUP A;  5C0M A;  3G4S T;  1LJO A;  1U1T A;  1QP3 A;  3HRS A;  4ELZ C;  3MEW A;  2DKG A;  4C92 F;  4DA4 A;  4LDU A;  3RKX A;  1N8R U;  1MHN A;  4MZT A;  2QDY B;  5J26 A;  1M1K U;  2DO3 A;  2DPP B;  4J83 A;  2LC4 A;  2KK4 A;  5FU7 C;  1VQ7 A;  3OSV A;  5KH6 A;  3OS5 A;  5LL6 S;  2O4X B;  3DLL A;  3OYM A;  1Q7Y C;  3PIO A;  4M78 C;  2KVQ G;  2BKD N;  3OYF A;  2KQW A;  3DKM A;  1VIE A;  1OZ3 A;  3I56 A;  3S3M A;  5CKB A;  5GAM f;  1YJ9 A;  4FM4 B;  3PGG A;  3L42 A;  4C0Z A;  4KUI A;  1VQK A;  2DIG A;  3VU3 C;  3CCR A;  3BDU A;  3HKS A;  2RM4 A;  1Y07 A;  4XU0 A;  4J8O A;  2E1H A;  4HCZ A;  3JB9 F;  1QVG S;  4M7D B;  1ZHI A;  1VQ9 A;  4JJN K;  5FU7 B;  2K5F A;  5KE3 A;  5DLQ E;  3ER0 A;  3KUF A;  2V8K A;  1KQ1 A;  2MAM A;  2QQR A;  4DOW A;  2R58 A;  2XHC A;  4J6W A;  4MZM A;  3JCM g;  2EFI A;  3WXM B;  4ZGJ B;  2X4W A;  1BYM A;  2VGM A;  5CK9 A;  4LDV A;  4R55 A;  3L2Z A;  4N0A A;  1WJR A;  2CGH A;  4M75 A;  2OTL T;  4M77 A;  1VQP A;  1Q86 C;  1M4Z A;  2GFA A;  1M8V A;  2DTO A;  3M53 A;  1YIT T;  2QEX A;  2RB6 A;  3BFM A;  2GQV A;  5CQY A;  4DOV A;  3S6W A;  1RI0 A;  1VQ5 A;  4JUV A;  5GAN j;  2DZ9 A;  1XQH A;  3PT9 A;  5EG2 A;  3RMQ A;  3I55 A;  2K5L A;  3CC2 T;  4E7K A;  3NTH A;  4Y28 E;  4XTW A;  1W2B S;  4PJO A;  3M54 A;  2QI2 A;  4J7F A;  2EJF A;  3GIB A;  1WQ7 A;  2EQK A;  1BKB A;  2LQ8 A;  2DIQ A;  4XU3 A;  3KXT A;  4C8Q G;  3RIR A;  1WJQ A;  2E12 A;  3C95 A;  2F5T X;  2M16 A;  4M78 E;  4OB3 B;  5I2S A;  5GAN 7;  2QQ9 A;  4M75 E;  3VUZ A;  5LJ3 e;  2A3L A;  4BE2 A;  1VQL A;  3Q1J A;  3G6E T;  1YIT A;  1X75 C;  2G3R A;  2LQK A;  2ZPG B;  2JN0 A;  3VYH B;  1QVG A;  3M4G A;  4J6Y A;  1WNL A;  2YLC A;  5A0D A;  3CPF A;  2EWN A;  2RO0 A;  2K5I A;  3TRE A;  3OA6 A;  1QVF A;  5J3B A;  2ZGW A;  1X01 A;  1Y71 A;  3A8L B;  4QQ6 A;  4ZGE B;  1OI1 A;  3CC7 T;  3QXE B;  4IUT A;  5IT9 E;  2E10 A;  3RKY A;  4HCB A;  2ZCF B;  1KQS A;  1GXI E;  5LJ5 d;  1KHI A;  2B8A A;  2DTI A;  2PVO B;  4D6W A;  3CC4 T;  2HQX A;  3CCJ A;  3OW2 A;  4IUR A;  1M90 U;  4V2S A;  3OYE A;  1ZQ1 A;  4PLL A;  4A4F A;  1KQ2 A;  4BB7 A;  2VYT A;  4JRP A;  1VQN A;  4XTY A;  2HD0 A;  3JCM f;  3NTI A;  3ZFJ A;  3CCQ T;  2NLU A;  4MML A;  4A4K A;  2ZPI B;  3PIP A;  3KBG A;  4II1 A;  3SWN A;  3GOX A;  1XTD A;  4C0D C;  2WSC E;  5FRO A;  2DZC A;  5GAN 4;  5FRN A;  4M77 E;  3QPH A;  2DXT A;  4JLG A;  5LJ3 j;  1QW1 A;  3CMA T;  4EPC A;  3FEO A;  3OYC A;  3VYG A;  2DAQ A;  5FU6 C;  2MMP A;  1OYX A;  2R5M A;  5HY6 A;  2L89 A;  3JCM Q;  2LCC A;  4LD6 A;  3SDZ A;  1W4S A;  3VKI A;  4J7I A;  5A0L A;  3PFS A;  1B34 B;  1PSE A;  4OF1 A;  3NTK A;  4RCC A;  4RG8 A;  3V8K A;  2KDS A;  2LNV A;  4M7D G;  1H64 1;  2OAU A;  1BI1 A;  1LOJ A;  3CPW S;  5GAO m;  2EYQ A;  4C8Q B;  3FC3 A;  3FLG A;  1B34 A;  1BI0 A;  1WPY A;  3UDC A;  2DEQ A;  3N5B B;  1Q82 U;  2OTJ T;  2RHU A;  4FT2 A;  5GMK m;  4OVA A;  5GAN d;  4C8Q A;  4Y91 A;  1V29 B;  4QW2 A;  2P0K A;  5FLX E;  5GAN 5;  2JUF A;  3L2V A;  2WAC A;  3MP8 A;  4YTL A;  4NL3 A;  3CC2 A;  2VXE A;  3AHU A;  3JCM b;  2XDB A;  5KCO A;  3A8O B;  2PVD B;  4EMG A;  2RK2 A;  5GAM d;  4MDW A;  3VJP A;  2P0Q A;  3X28 B;  1TH7 A;  3QYG B;  5CR2 A;  2DK3 A;  2IVW A;  4BDZ A;  5I21 A;  3EFR A;  3OYB A;  4JRQ A;  4ZTF A;  4M7D A;  2MI6 A;  3FB9 A;  3JCM V;  1U1S A;  4EMK C;  4Z02 A;  3QUI A;  3JSC A;  1JB0 E;  3P8B B;  3QO3 A;  3T9N A;  3V7R A;  4XU2 A;  5FRM A;  1VQL T;  2RD1 A;  3INZ A;  4C0D B;  5CKD A;  5DLO A;  2A7Y A;  5GAM g;  3G71 T;  2DD5 A;  3JCM J;  5GAN e;  5DM7 R;  2OTJ A;  3MEU A;  4L59 A;  4M78 G;  4C8Q E;  5CAI A;  3OYN A;  2ZPH B;  4A4G A;  2VGN A;  5GAN 6;  3CME T;  4F7U F;  4M78 D;  5GAO p;  1KQS S;  2YRV A;  1M1F A;  2RK1 A;  3FIF A;  2RI3 A;  3OYJ A;  4F7U B;  3CCL A;  3CEY A;  2O01 E;  2XIC A;  4M75 C;  2P0P A;  3X24 B;  3LWI A;  2PU9 B;  5GAN 2;  1VQO A;  2K3Y A;  4FL6 A;  3V8L A;  1R8O B;  3LLR A;  1IRE B;  1NPP A;  1XOV A;  2ZPB B;  3JCM d;  3OY9 A;  2VC8 A;  2QA4 A;  2RI5 A;  1X6O A;  3GNF B;  1Q7Y U;  2CZ7 B;  2IG0 A;  4IUQ A;  1UGS B;  2RH2 A;  2VXF A;  2D9T A;  3A5Z B;  3R6O A;  4M77 F;  4NL2 A;  4QVC A;  1YI2 A;  3LH0 A;  1Q81 U;  3OYK A;  4GLK A;  4M7A C;  4C92 E;  2ZZD A;  3CCL T;  1NE8 A;  2EAY A;  2PUK B;  1YHQ A;  2F5K A;  3MO8 A;  5IAY A;  1M9S A;  2RHI A;  4OGE A;  5CKE A;  1M5Q 1;  1ZBX A;  2RJE A;  2E41 A;  4MZP A;  5GMK l;  2KAF A;  1N8R C;  4JS5 A;  3G71 A;  1I5L A;  2K2V A;  3PNW C;  4RG2 A;  5CKF A;  3L2R A;  3HFN A;  1M1K C;  1HK9 A;  4LDX A;  3S3O A;  2DVE A;  2BIV A;  4M7A D;  2M0O A;  4PJO G;  5GAM h;  1M90 C;  2QQS A;  5LJ5 f;  1H3Z A;  2PQW A;  5CKH A;  1KC8 C;  1WQW A;  4LDY A;  1S72 A;  4M7A G;  2LCL A;  1YJN A;  4BUG A;  4C92 A;  4JLI A;  3A8H B;  5IN1 A;  1O9S A;  3C4S A;  3GLX A;  1Y7X A;  4A54 A;  4XAX B;  5D6W A;  2RHY A;  1D3B B;  2CYZ B;  2FL7 A;  3MP1 A;  1JJ2 A;  4RKU E;  1VQM T;  2LRQ A;  5HKC A;  3QKJ A;  2KSS A;  3HP9 A;  4PJO E;  5M9O A;  1KC8 U;  1VQN T;  3J81 E;  1BIA A;  4FIB A;  2RI2 A;  3V7S A;  4M75 F;  2QEX T;  2EJG A;  4MDX A;  1YCY A;  1BIB A;  4XTU A;  2F69 A;  2XID A;  3CBM A;  3WVE B;  1YJW A;  3GPL A;  2XG8 D;  3OBW A;  4A53 A;  5J39 A;  5GAN 8;  3QYH B;  1KHC A;  2O4X A;  2RJD A;  3JB9 I;  2D6F A;  1NPR A;  3CCS A;  3J7A F;  4XTX A;  4M7A E;  2X4J A;  2X4Y A;  3BY7 A;  1UGR B;  4BI4 A;  4QVZ A;  1DJ7 B;  2H3J A;  5LJ5 g;  3JCM W;  4HCC A;  3QSU A;  4C8Q D;  2HBP A;  4IUV A;  4OGC A;  4XU1 A;  1VUB A;  2E6Z A;  5GAM e;  5GAN h;  3MP6 A;  3HSB A;  4O5V A;  3QG1 A;  4HKE A;  2X35 A;  5GAM j;  3M57 A;  2X4X A;  4EMK B;  4C5H A;  3CCM A;  4M77 G;  5L8R E;  3H8Z A;  2XDD A;  1VQ5 T;  1K9M C;  3OMG A;  4XTZ A;  3CCE T;  3CPW A;  3P8D A;  1YJW T;  4M7D F;  2C06 A;  3QBY A;  3HRT A;  2EQJ A;  2GFU A;  4X9C A;  2EQU A;  4BI8 B;  3QJ6 A;  4F7U E;  3X20 B;  4QVD A;  5GAN 3;  3LWH A;  2QQA A;  3CXC A;  1Q86 U;  5CVI A;  3ASK A;  4LD9 K;  4M75 B;  1UGQ B;  3JCM c;  4C92 D;  4ELY C;  2PVG B;  4JS4 A;  4HA8 A;  1XNI A;  3RMS A;  4A4H A;  3E1S A;  2L3R A;  3M5A A;  2E70 A;  1FX7 A;  5CQX A;  4VUB A;  4E7J A;  5GAO n;  1VQ4 T;  1YJ9 T;  1G3Y A;  5CO7 A;  2M9U A;  4J6X A;  3JB9 J;  4F7U G;  3L2W A;  1JRI A;  5LJ3 h;  3UT1 A;  4ZN1 A;  5GMK i;  3TEE A;  3CCQ A;  4M78 F;  2K3X A;  3FDR A;  1VQ9 T;  4CI0 C;  2FHD A;  3EAE A;  3SWN B;  2YLB A;  1YI2 T;  1Q81 C;  1K8A U;  4E7I A;  4C5G A;  4M78 B;  3HL8 A;  4BD3 A;  1LNX A;  2Y4X A;  4TVR A;  3E9F A;  4JDS A;  2MWO A;  3J80 E;  3OB9 A;  3QII A;  2R5A A;  1NJI U;  3OYY A;  3E9G A;  1VQ8 A;  3OW2 S;  1P92 A;  3MET A;  4M7D C;  4N4I A;  5LJ3 g;  2GF7 A;  3OQ5 A;  2CZ1 B;  3TU4 K;  3CCR T;  5LJ3 f;  1Y96 B;  3PTA A;  4E7H A;  3FRN A;  2FVU A;  3O8V A;  4M77 D;  2ZPE B;  3SB2 A;  3FJP A;  3OMC A;  3L2Q A;  4FT4 A;  3PMT A;  5CIU A;  5HK0 A;  2QA4 T;  4OB2 B;  4BDY A;  1QVF S;  3CCE A;  4BY6 B;  3CBP A;  1G5V A;  4BAC A;  1BI2 A;  5GAO r;  4M7D E;  3LX7 A;  1WJS A;  4QQD A;  2CKK A;  3X25 B;  2DTH A;  3V8J A;  4OP0 A;  3JB9 H;  4C92 G;  3M55 A;  1AHJ B;  1VIF A;  4FSX A;  1VQ8 T;  4M7A A;  3X26 B;  1YHQ T;  5DY9 A;  4L5G A;  2XD0 A;  2DJZ A;  2V8J A;  1VQ4 A;  4JRK A;  3S3N A;  1W2B A;  2LT1 A;  2JVV A;  4XK8 E;  2RJC A;  1K73 C;  4N4G A;  3JCM e;  1D3B A;  2K57 A;  1Q82 C;  5HK3 A;  1YIJ T;  4J5Y A;  5D6Y A;  5C6S A;  3ZBD A;  2BUD A;  2EKO A;  4M77 C;  4C92 B;  4M75 D;  4A4E A;  3DLM A;  1FXX A;  2FYK A;  4ATO A;  4KT0 E;  3OBY A;  4RCB A;  4DQ2 A;  3CCU T;  1BI3 A;  1RL2 A;  3CCV T;  4C0G A;  2MF2 A;  4OB1 B;  4X34 A;  2JZ2 A;  4IUU A;  2CS7 A;  2EJ9 A;  1YJN T;  2QQB A;  4JRI A;  3HPW A;  3HHT B;  3QZ9 B;  4CRI A;  4F7U A;  2HQE A;  2L8D A;  4OMF B;  1M1G A;  4PJO F;  5GMK h;  3ME9 A;  5GAO q;  3JCM P;  4IKF A;  3CD6 T;  3RUX A;  1QVP A;  2LX9 A;  3LGF A;  4NOY A;  2GCX A;  1JBM A;  3G6E A;  5GAN g;  4M77 B;  5D6X A;  3MEV A;  3CCM T;  3JB9 G;  2E65 A;  3WVD B;  3OS0 A;  2XDP A;  3HFO A;  3GNG A;  4E47 A;  3CBO A;  1KD1 C;  3A8M B;  3P8H A;  4ME7 A;  2FB7 A;  2KMT A;  4KUL A;  4PLI A;  3JB9 D;  1PSF A;  4FU6 A;  4M78 A;  4GY5 A;  5KCH A;  1SSF A;  5LJ5 h;  4UC4 A;  2CZ6 B;  2JNG A;  4ZN3 A;  1N9S A;  4HT9 A;  2XU8 A;  3LW5 E;  3C12 A;  3OS2 A;  3CMA A;  3OYL A;  1IZ6 A;  2CZ0 B;  2QTX A;  2R57 A;  3OYD A;  1FWZ A;  3C94 A;  3CCS T;  1U8R A;  1VQ7 T;  2YHT A;  2E6N A;  3OYA A;  1NJI C;  4C8Q F;  2DD4 A;  2JTF A;  2E64 A;  2RJF A;  3F70 A;  2HAX A;  4KUD K;  3H6Z A;  4LDW A;  5I2M A;  3I56 T;  1G3W A;  4O6J A;  3OYH A;  4PJO C;  4M75 G;  2LTO A;  2D0Q B;  5FU6 B;  4NS5 A;  5GAN f;  4XQ3 A;  2DXC A;  3TCJ A;  1EIF A;  3CCV A;  3V7C A;  3SD4 A;  4R56 A;  3SWN C;  3OS1 A;  1VQ6 A;  3M59 A;  2PUO B;  1N27 A;  2RHX A;  2XK0 A;  3NFC A;  1I4K 1;  2EQM A;  2V8I A;  4C0F A;  3BW1 A;  4B9X A;  4M7A B;  1G3T A;  1G3S A;  4N0A C;  5LJ5 j;  3PMI A;  3CXC S;  4PJO B;  5GMK j;  4OB0 B;  2EIF A;  2DXB A;  2VV5 A;  2Y90 A;  2L5Q A;  1OZ2 A;  2AHJ B;  3M56 A;  1K8A C;  2P4T A;  1VQK T;  2HNI A;  4PL6 A;  2XKO C;  3G7Z A;  3QHS A;  1N6A A;  3URG A;  4B9W A;  1VQM A;  2OTL A;  3HRU A;  4L6V 5;  5KE2 A;  1VQP T;  3JRZ A;  4PKC C;  4Q5W A;  4EMK A;  3SFM A;  4N4H A;  2Y4Y A;  1YIJ A;  2MWP A;  4BY6 C;  3OYI A;  3BDL A;  1Y96 A;  3UPU A;  4E7L A;  2ZPF B;  1I8F A;  5GAO l;  3CC7 A;  2LDM A;  3VUB A;  3DB3 A;  1KD1 U;  3JCM X;  1S72 T;  1UB4 A;  3E19 A;  2JOY A;  3QZ5 B;  3CCU A;  2KY9 A;  3DB4 A;  1VQ6 T;  1UEB A;  3ZEH A;  5A2Q E;  5LJ3 d;  4EDU A;  2JTM A;  4WF2 A;  3JAM E;  3JCM h;  2VUB A;  3A8G B;  3RER A;  2XI9 A;  3GF5 A;  4XTV A;  4C8Q C;  1K73 U;  3CD6 A;  3LGL A;  4HT8 A;  1UGP B;  2LT4 A;  2QXF A;  3RKW A;  4BI3 A;  1VQO T;  2LVM A;  1HXD A;  4MMK A;  4ZGD B;  3UWN A;  4ZTJ A;  4M7D D;  2WSE E;  4PJO D;  1KG1 A;  4PNO A;  1NZ9 A;  1YBY A;  2WSF E;  4P5N A;  4RMO A;  3MCA B;  5LJ5 e;  3G4S A;  3M9Q A;  3I55 T;  3CME A;  4EMH A;  4C5E A;  5GMK e;  1O75 A;  3RES A;  1K9M U;  3GP8 A;  2RA2 A;  3OSS C;  2DXU A;  5A0G A;  3EFS A;  1N9R A;  1JJ2 S;  1MGQ A;  2K4Y A;  5AYF A;  3L2U A;  4C5I A;  3CCJ T;  3CC4 A;  3OYG A;  2RHZ A;  3M4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...