4EPCA

Crystal structure of autolysin repeat domains from staphylococcus epidermidis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
152
structure length
141
Chain Sequence
b'NNQLTVTNNSGVAQINANSGLYTTVYDTKGKTTNQIQRTLSVTAATLGDFYLVGDYNTGTNYGWVQDEVIYNTASPVKINQTYNVPGVLHTVPWGTYNQVAGTVSGKGDQTFKATQQQIDATYLYGTVNGKSGWISYYLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylmuramoyl-L-alanine amidase
publication title Ligand-binding properties and conformational dynamics of autolysin repeat domains in staphylococcal cell wall recognition.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 23
structure length 141
sequence length 152
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13457 GW GW (Gly-Tryp) dipeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA01
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA02
1M9SA 4EPCA
chains in the Genus database with same CATH superfamily
2QQ9A 2Y4XA 5GAN6 2BKDN 2PNIA 3GPLA 1G3TA 1QVFA 2K3BA 5IHIA 1UDLA 2FZGB 2L3RA 1Q86C 2DA9A 1T3SA 2V8IA 1JBMA 3SB2A 3HRUA 1FMKA 4E7LA 3KBGA 2QYZA 4RKUE 4HVVA 5DLOA 1LCKA 2DEUA 2P0PA 3OYCA 1OEBA 2QDLA 4M75F 2H3JA 4PK4A 3JCMX 2RH2A 1YI2A 1NJIC 3F70A 1OZ3A 4IUVA 2I2LA 2DTHA 2HMAA 2DK3A 1WHJA 4XTUA 2K5FA 3RESA 1NG2A 1JQQA 2EIFA 3OMCA 5IHNA 1N9SA 2YUOA 5I2SA 1PM3A 4ESRA 4PJOG 3OS2A 1SRMA 4XAXB 3HTRA 2K5LA 3KXTA 1QVGP 2ZPFB 1UE9A 1VQOA 2PVOB 8ATCB 4LDUA 2FZCB 4RTWA 3EFOA 1Q86R 2CSIA 3PMIA 1PCXA 3RR6A 3TSZA 4M7AC 5L23A 3RKWA 2MIOA 3REAB 1IB8A 2CP5A 2FPEA 4JPBW 1EFNA 2W0ZA 4OP0A 3VS5A 1NJIR 1ZBJA 3C94A 2GTOA 4BE0A 3CCLQ 4M7AA 1D0XA 3EFSA 2A0FB 2JW4A 2F5TX 2HQXA 3BW1A 3OSSC 5GANh 2JM8A 2F2XA 3CCQQ 3ZEHA 2M9UA 3NPFA 2L8DA 3QYGB 1VQ6Q 2LNVA 1NM7A 4DBHA 1RACB 1I8FA 5HCKA 3AT1B 5GAN4 5KYUA 3P8HA 1D1BA 3OY9A 1PD0A 3M56A 1VQ9A 2ZPGB 3CXCS 1Q95G 5DM7R 4FSXA 3ER0A 5C0MA 2E5QA 1Q7YU 3UA7A 4ATOA 1G83A 3L2RA 4XU3A 1YITQ 3I55Q 1OX9A 4BI8B 1KG1A 1KHIA 2DYBA 4OMNA 1SKUB 2LP5A 3CCQT 2D1XA 3CC7Q 1W6XA 2XDDA 1FYNA 1VQ6T 1AVZC 2F69A 2DVEA 3G71A 3E9FA 3G4SQ 2HCKA 2ROTA 3OS0A 3G7ZA 4A4HA 4C92B 2CYZB 2CP3A 4DOWA 2FO0A 1QQJA 2E6ZA 1MV0B 4M75C 5AT1B 2RQWA 2NUPB 1YITT 2QQAA 3GNFB 4A4KA 2JTEA 1T0HA 3OQ5A 3RIRA 5CQXA 2YRDA 5LJ3d 4RCCA 3R6NA 3VS7A 5KYNA 2FZKB 3SHWA 3CC7T 1K73U 4F7UB 2KROA 3HPWA 4BI4A 4NOYA 2PUKB 4M77B 4M75A 3G4ST 4NL2A 2L0AA 3ZFJA 2IG0A 1XJWB 5GAOq 3BDUA 1ABOA 2QI2A 3M5AA 3HP9A 4PJOF 4AT1B 2HKNA 3I56A 2MWPA 2QG9B 2B86A 1VQLA 1RAIB 1ZQ1A 4M7DB 4QKUA 3EH2A 5GANe 1UGVA 1Z9QA 3HSBA 2MYSA 1D0YA 2GBQA 4DOVA 4DBRA 2DIQA 2RQRA 2WSFE 2DJQA 1IGQA 2DL8A 2MOXA 1A0NB 2D8HA 2DF6A 3FJ5A 3A8GB 2ENMA 3EG9A 2CH4W 2QEXA 3C0CA 1JU5C 4LDXA 1V76A 2GCXA 1XTDA 2C0IA 2YXYA 1KSWA 2AZVA 2LJ3A 1BK2A 2LQNA 1X27A 1N8RU 5A2QE 3VRZA 2KR3A 3HRSA 3MP8A 1NLOC 1N6AA 1X43A 1Q81U 3CCLA 4CC4B 4B9WA 1JXMA 4O5VA 3M55A 4EMGA 3LH0A 1U06A 2SEMA 3CXCA 3QJYA 4OVAA 5LJ3j 1IHVA 1YIJA 2K79A 1OPKA 2EJFA 2NUZA 4XTZA 2M02A 5GAMg 2C06A 2ABLA 4XTYA 4OB3B 4C92E 1AHJB 2YUQA 4C5GA 1KQ2A 4M7AG 3T9NA 1E6GA 2O4XB 2VYTA 4FYWB 1BI1A 2JZ2A 3OSVA 1RAEB 2LTOA 5FU7B 3UDCA 1BKBA 3OBWA 4ELYC 3E9GA 5IXFA 4QQDA 4M78B 1OV3A 2J05A 3EGDB 2EYYA 3A8MB 2EAYA 1TU0B 2CP0A 2E70A 5CK9A 1VQ8A 1Q82C 2EKHA 4C0GA 2BZXA 3LH5A 5GMKi 4FYXB 4C0ZA 2GQIA 2KY9A 2R5AA 2HAXA 4F7UE 1X6OA 3INZA 2HL5C 2V8JA 3EH1A 5KYYB 2KRNA 5D7UA 4M77E 4AFQC 1TOVA 1YN8A 3EG3A 4PFPA 1ZSZC 1PNJA 3ME9A 1NEGA 4RCBA 2JUFA 1NZ9A 4LD6A 2HBWA 3V7RA 1M1KU 3M0PA 3CMEQ 1UHCA 2XK0A 3M0UA 2K4YA 5D6YA 1BIAA 2D9TA 2E1HA 3NMZC 4C92G 4M7DE 5KE3A 3QWXX 1M3CA 5GAN5 4ZGEB 1SHGA 2E65A 1M1FA 2DE0X 3QXEB 4FT4A 3EAEA 1CKBA 1ZSZA 4XTVA 3CD6Q 2CS7A 2K3YA 4J6WA 1AZEA 3LW5E 5GAOr 1IZ6A 3GP8A 2AT1B 3M0TA 3JCMJ 3JCMP 3V8KA 4PJOC 1WYXA 2FPDA 3OYAA 4E7IA 2J6FA 1H3ZA 1Q82R 2QTVA 4NS5A 5AYFA 1VQMQ 4JZ3A 1VQPQ 2KMTA 1BIBA 1VQ4Q 3WVEB 4CI0C 4ZNXA 2KXDA 4J83A 3X25B 1KQSA 3CMET 1W1FA 3SDZA 3TU4K 4IIOA 3OYLA 4J6XA 4QW2A 3JCMh 1JJ2P 3MP1A 3QKJA 4FT2A 1H8KA 1RI0A 2RMOA 1ZSGA 1OYXA 4PJOA 4N0AC 1HSQA 2KSSA 1SSFA 2JS2A 3CCUQ 4AG1C 3CD6T 4OF1A 1BI2A 1W2BP 3ZL7C 3M57A 3EHRA 4L5GA 3OYHA 2ZAEA 1M2VB 3MPUB 3JSCA 5CKHA 1UJ0A 2K57A 3X26B 3CCVA 1WHMA 2G3RA 1VQMT 1VQPT 1VQ4T 2YUNA 3RDVA 4FL6A 1D1AA 4M78E 5GJWB 3VYGA 4J6YA 4OMFB 1BU1A 1VYUA 3MEAA 5J3BA 1ABQA 1FX7A 1H641 3GIBA 2JM9A 2LCSA 3RKYA 3UA6A 2KYBA 3CCRQ 3CCUT 2EYQA 8AT1B 1UECA 1SHFA 4ZGDB 3WVDB 4DBFA 2MPXC 2ROLA 1IXDA 1U5SA 4RG8A 2KGTA 3JCMb 4FYVB 1YWOA 3CQTA 3CPWS 1YI2T 4EMKC 1K0XA 2NUTA 2H8HA 1M27C 4MMKA 1Y96A 1NLPC 2EQIA 2KAFA 1PKTA 2J06A 1G5VA 1K4US 2DPPB 2EQMA 1E7OA 3CCRT 4R0KA 1PHTA 5HY6A 4M78G 1YJWQ 4X34A 2DXCA 2OAUA 1WQ7A 2K2VA 4LDVA 4EMKA 1YJNT 4PJLA 4LXCA 1G3YA 3Q1JA 3JV3A 4O6JA 2QGFB 2M0OA 3NFCA 3V7CA 1GCQC 4JJNK 2CREA 2VASA 3OYBA 4KGVB 5IH2A 4BY6B 4PFZA 1SRLA 4MZPA 1KC8C 4C92F 1S72A 4PJNA 2OTLQ 3JCMW 1FXXA 4BB7A 1BCMA 3NHNA 3X28B 2XIDA 1K9AA 2DL7A 2E41A 3QSUA 3OW2P 1YJWT 2HNIA 1AWWA 4M75D 2DXBA 1GCQA 1N8RC 2X4XA 1YJ9Q 1M1GA 3ASKA 3RNJA 2RM4A 5I22A 5CR2A 1WQWA 3DB4A 4HCZA 3M53A 3CC2A 5GMKj 5LJ5g 4F7UF 3EGXB 3CCMA 2YRVA 1KJWA 5CKEA 2XDBA 3HFOA 2HKQB 4M77F 2FVUA 2L5QA 2RD1A 2LT4A 2AIRB 4OMLA 2DLPA 2X35A 1AEYA 2OTLT 4MZMA 2YUPA 2XMFA 2KE9A 3JCMg 3FEOA 1YBYA 3MCAB 2JTFA 1KFZA 2KNBB 1GL5A 2YLBA 4M7DF 1KC8R 4B9XA 1MMGA 2DZ9A 4AFUC 1YJ9T 4LN2A 4C8QD 3OYKA 3G1JA 4PKCC 2CGHA 3LWIA 1AT1B 1M90C 2J6KA 5FROA 1MNDA 5CAIA 1N8RR 2EQKA 1K1ZA 2JT4A 3G71T 5GAN7 1KQ1A 2RHXA 1I1JA 3V8LA 2D0NA 3CMAQ 1GFDA 2EJ9A 2RJEA 4HXJA 2ZPBB 2F2WA 1ZHIA 3CPWA 3EG2A 1Y07A 4TVRA 3PFSA 3H0HA 1YCSB 2HDAA 1LVKA 3J7AF 4AFZC 2RHZA 4XU0A 3EG1A 2ZPEB 4EDUA 2V8KA 3OYNA 4OMPA 5KCHA 4AMCA 1AWJA 1PSEA 1HK9A 1VQ5A 1WZOA 3REBB 2PVGB 2YSQA 3PVQA 1RL2A 1MMAA 2GFAA 2EFIA 2R58A 3P8BB 3CPFA 1G3SA 4LDYA 1GBRA 4HCCA 3CMAT 1G2BA 4OB2B 3GLXA 5CVIA 2F2VA 1QVPA 2DKGA 3THKA 3LGFA 1T3LA 4E6RA 1M90R 1TWBA 3FC3A 4M78F 1JO8A 5GAMh 2VC8A 3OA6A 1UUEA 4Z02A 4MZTA 3VUZA 4F17A 4J9IA 5GAOl 4WF2A 2XI9A 3NTIA 4C92C 4E2FB 3VU3C 3CBOA 2LX9A 2LT1A 2RHUA 4D8DA 1WA7A 2CZ1B 2E3IA 1VYTA 1JXOA 2ZCFB 3QZ9B 4ZN3A 2RPNA 4E7KA 4LDWA 1K9MU 2CZ7B 2E5KA 2H3EB 3CCJT 4KT0E 2XD0A 2CSQA 4R56A 3MP6A 4Y91A 3VS2A 1WXTA 4PJJA 1QKWA 5LJ3h 1KHCA 3JCMQ 2K9GA 3QDRB 2VKNA 1M8VA 4C92A 3M9QA 2LQ8A 1WHKA 4IIMA 4JS4A 1WX6A 4FW1A 5DY9A 4M77C 3JCMf 3UF4A 3RMQA 1N5ZA 1K8AU 3TREA 1N9RA 2DO3A 2LQKA 4DBQA 1MMDA 5GANd 2V1RA 5HKCA 2VGMA 3JAME 1VQ7Q 1QP3A 3LX7A 2DTIA 3CC4T 2DAQA 3IQLA 4M7DC 4PJOD 2EVRA 1X6GA 2HQEA 1YHQQ 2BZ8A 4F7UA 3G6EQ 4QVCA 3L2UA 5I2MA 1AD5A 4M77A 1BI0A 1OI1A 2LRQA 2P84A 1W4SA 3OYEA 1TXQA 1I0CA 2AK5A 2ZZDA 4GBQA 3PTAA 2OTJQ 4CC7A 4M7DA 1CSKA 1I4K1 2LJ0A 1VQ7T 2L3SA 5A0LA 2EQUA 3FJPA 2RI5A 4J9FA 4DA4A 4BUGA 4ANJA 4Z88A 2FRWA 1KD1C 1YHQT 3G6ET 1GBQA 2GF7A 1KK7A 4FM4B 2RJCA 5GAMe 3TEEA 1O9SA 1WJRA 5L8RE 3VRYA 1NYFA 1BYMA 4X1VA 4JDSA 2M1HA 2GTJA 2MK5A 2IIMA 1VQNQ 2OTJT 3OYDA 1VIEA 4JJCA 1D3BB 2PUOB 1WNLA 1S1NA 2D8JA 3A8OB 2YHTA 2DL4A 2DXTA 3BE3A 1RAAB 4F14A 3VYHB 1VQKQ 2JN0A 5FU7C 3VV0A 1PWTA 4DEYA 5GANj 4M78C 3SWNC 4WCIA 2O9VA 3SFMA 1XOVA 2IPOB 3EG9B 1GXIE 1K0SA 1WXUA 3CCQA 4M4ZA 4C8QB 4JRIA 2EYWA 3QBYA 2COWA 5J39A 1VQ6A 4RTXA 2O4XA 1VA7A 4ZGJB 1Q86U 1KD1R 3JCMc 1VQNT 3KFVA 2GGRA 4JZ4A 2ZPHB 1D09B 4M78A 1MHNA 3EGDA 1U1SA 4GLKA 3SWNA 4BDYA 4KUDK 2VV5A 2MI6A 1QW1A 4HT9A 2OI3A 1VQKT 1YITA 1M3BA 4II1A 3I55A 1Y7XA 2OAWA 2P0KA 4OGCA 5KYXA 3CCVT 1I81A 1YCYA 1NJIU 1PSFA 1RI9A 4HVWA 3C95A 2CP2A 3JB9G 5GAN3 4IURA 5LJ3g 5FWCA 5GAOm 5CKBA 1B3QA 3CC7A 3NTHA 3J80E 2LMJA 1SF9A 3CCSQ 1J3TA 2VGNA 3G4SA 1ZLMA 3I35A 1VIFA 3C12A 3P8DA 3PIPA 1AWOA 4MDWA 5DLQE 2M16A 2B8AA 3OYYA 3X20B 4FW2A 1UB4A 1WHLA 3ZBDA 2VUBA 3OS1A 4RTVA 2KXCA 3MEVA 3CXCP 2QA4Q 2FEIA 1BB9A 4RTYA 2COYA 5CKDA 1OOTA 1B34B 2P0QA 1HYOA 5J26A 5KCOA 3RUXA 2A08A 3FRNA 2DERA 2R5MA 1E6HA 3LYIA 3CCST 5LJ5h 3CCEQ 1QLYA 1WHHA 2RO0A 4F7UG 3O8VA 2NWMA 1R8OB 3GOXA 5KYWB 2CP7A 4M77G 1WGSA 2VXFA 3NGPA 1RAGB 1X2QA 4N4HA 1QKXA 2V1QA 2Y4YA 2MAMA 4KUIA 3A98A 2QA4T 2X4YA 1NBEB 2QAZA 4L59A 2QDYB 1QVGS 1WHGA 4ZTFA 3VS1A 1I5OB 3FLGA 3VUBA 2YRCA 1M2VA 1NPRA 3QJ6A 2AHJB 4M7DG 1V1CA 2C0OA 1X75C 2O01E 4C8QE 5FRNA 5GMKh 2VWFA 1S72T 1Q7YC 1UGQB 3AHUA 4PLIA 3CCET 2YDLA 5ECAA 1RLPC 2DXUA 2FHDA 4X9DA 2RK1A 1Y57A 2K3XA 1ZA1B 1YI2Q 4N0AA 4PJOB 5KE2A 4M7AD 3V8JA 4RUGA 5GAMf 4JRQA 4C0FA 2E10A 3H0FA 3CC2T 1RUWA 1MNEA 3L2VA 1HJDA 1SSHA 2NYSA 3DB3A 3S3OA 5FU6B 4J7FA 1YJNQ 2ED1A 1VQOQ 2XICA 1ARKA 3QO3A 1KQSP 2QGGA 2FL7A 5GJVB 3H0IA 5LJ3f 2JVVA 3PIOA 1U8RA 3QUIA 1V29B 2DRKA 1WLPB 2AKLA 3OYIA 4JRKA 1Q7YR 1K73C 3MO8A 4FSSA 2VXEA 3EGUA 2DBKA 4C5HA 1BBZA 2BIVA 3S3NA 4A54A 4C92D 3JB9F 2LQWA 1RAFB 2XHCA 3RMSA 1C0MA 1VYVA 5LJ5e 4BD3A 4KGZB 2RQVA 3MJXA 2IVWA 4J9CA 2KT8A 4WTOB 3L2WA 3LLRA 1VQOT 3QPHA 5FW9A 4HVUA 2RHYA 2BTTA 1YWPA 1Y96B 3QDFA 3JB9I 3JCMe 2JOYA 3FIFA 1NYGA 3E1SA 4C0DB 4L6V5 3CBMA 3CMEA 3VJPA 1EX4A 4LE9A 4JLGA 2L3QA 3QHSA 4CC3A 2QQSA 2RJFA 2LCLA 2A37A 2KRSA 3WXMB 5CKFA 4N4IA 1UTIA 1O75A 1VQ9Q 1Y71A 2W10A 4E7SA 3H9NA 2KK4A 3CD6A 3I5SA 5A0GA 1WPYA 2P4RA 2VVKA 1ZA2B 1M30A 1K73R 4XQ3A 4EIKA 4Y28E 3EGXA 3OYGA 5I21A 2K7AA 4OMOA 2BE7D 4M7DD 1QVGA 1Q81C 4OMMA 3J81E 3M54A 1VQMA 4BE2A 1VQPA 1VQ4A 1X01A 1HD3A 2BZYA 4ZTJA 1ACMB 1LOJA 1LNXA 1ZUKA 3G71Q 4IUUA 2A28A 5IXBA 4BI3A 2EGCA 2DEQA 2R57A 1VQ9T 3O5ZA 4CC2A 3ULRB 3TCJA 3UWNA 3CCUA 1X2KA 4V2SA 2O88A 1I07A 2P4TA 2HSPA 1QWFA 2CH4A 2D6FA 4HKEA 1M3AA 1UJYA 9ATCB 2XKOC 2BE9B 2EJGA 2WSEE 3GBQA 1IGUA 1BCOA 2WACA 1B7TA 3DLMA 3A8HB 4LUEA 1Q82U 5GMKl 3UATA 2LC4A 1ZUUA 1R0BG 1Q81R 2Y90A 3H41A 2K6DA 5CIUA 3OBYA 1H92A 3I56Q 3CCRA 4RG2A 1QVFP 4EPCA 4PFOA 1VQLQ 2JMAA 2EYZA 4BE1A 1M1KC 1YJNA 4HCKA 3VS4A 1PG5B 2EYXA 4M78D 2EWNA 2JS0A 1WJSA 2SRCA 4C5IA 5FRMA 2DYIA 4C8QF 2PVDB 4UC4A 4JUVA 3EFOB 2CKKA 2BUDA 3JCMV 2KVQG 4F16A 4C5EA 1JB0E 2QEXQ 1MGQA 3CCJQ 3KUFA 1QCOA 1LPLA 1WFWA 2L2PA 1AWXA 4D8KA 3I56T 2DBMA 3MEUA 3FB9A 1YJWA 1OU9A 1VQLT 3VKIA 2F5KA 2O2OA 3C4SA 4J9HA 4XU1A 2E6NA 4GY5A 2DMOA 3HL8A 4HCBA 4LD9K 4J9DA 1WDXA 2JNGA 2L89A 4DEXA 1MUZA 1JEGA 3A1PA 2OJ2A 2Z0WA 2PQWA 4M7AB 1UGPB 2D0QB 4OGEA 1YIJQ 4OB1B 4J7IA 3VS3A 2ED0A 2QEXT 1M1KR 3CPWP 2FYKA 2DX1A 3A5ZB 3PMTA 3CC4Q 2EKOA 2V26A 4QVDA 1CKAA 2ZGWA 2OTLA 2RK2A 2DVJA 3SD4A 2EQJA 3HKSA 3VS6A 1PC0A 5LJ5f 2KDSA 4KGXB 3HHTB 5EG2A 2DL3A 3EFRA 5KYUB 3QZ5B 1FMWA 1R77A 5IN1A 1NPPA 2DFUA 3S6WA 2JMCA 3M58A 2HZYA 3OYJA 3CCLT 1YNZA 4LNPA 1YJ9A 2FB7A 1VQ8Q 2NUPA 4E7ZA 3L2QA 1NE8A 2RB6A 4OB0B 1UGRB 3M59A 5KH6A 3VS0A 1YIJT 3X24B 4VUBA 2CUDA 5GAMd 3BY7A 2PU9B 5M9OA 1FWZA 4KRTA 5D6WA 2X3WD 2CP6A 3DKMA 2JXBA 3GNGA 4R55A 5GAOn 5A0DA 2FG0A 1JJ2S 2HQHA 2A7YA 4BACA 3JB9J 2RQUA 1G3WA 1YP5A 4JJBA 1IO6A 1M8MA 4JLIA 3RERA 3I55T 1AZGB 2HD0A 5D6XA 4A4EA 2EBPA 1RADB 5LL6S 1W2BS 1VQ8T 2LX7A 4PNOA 1D0ZA 3PGGA 1IHWA 1X6BA 2QK0A 4Z89A 1G8XA 4QQ6A 4GLMA 5HK3A 4Q5WA 2EGEA 2KEAA 4AFSC 4E7HA 2E4HA 1QCFA 1NEBA 3CMAA 2DNUA 3D7SB 4PL6A 2QQBA 4QQGA 1QWEA 1UEBA 4J9GA 4J9EA 2PTKA 2RHIA 3PT9A 4M75B 2HBPA 2DL5A 1MMNA 1D3BA 5CQYA 4A53A 3V7SA 4RTTA 1OPLA 2RJDA 4C8QC 1F1BB 4MMLA 2MF2A 3QYHB 4QVZA 3E2UA 1YFNA 2LVMA 3GF5A 3H6ZA 2O9SA 3TSWA 5IT9E 2RI2A 1KC8U 4XU2A 4M7AE 5GMKm 1OU8A 1KQSS 1DJ7B 5LJ3e 2DRMA 1T0JA 3CCJA 2GFUA 2GQVA 2DM1A 2QQRA 3CCVQ 1OZ2A 4FIBA 5GAN2 1TUCA 4C8QA 5GAMj 3JB9H 2NLUA 3EG0A 3MKDA 2C0TA 4YTLA 3HRTA 2XG8D 3LGLA 4PJMA 4KBMB 2LZ6B 4KH1B 3A8LB 2QASA 2DD5A 5CO7A 1WI7A 1UHFA 1GRIA 3QWYA 3M4GA 1X69A 4Z8AA 5GANg 1RLQC 4RMOA 2JJ9A 2MMPA 3QG1A 1EZZB 2ATCB 4NL3A 2ECZA 3CC4A 1H3HA 2RN8A 2KYMA 4IUPA 3E19A 4J5YA 5KYYA 2VB6A 2E64A 1VOMA 5FLXE 4B6MA 5FWBA 1EIFA 3UPUA 2RQTA 4KH0B 4HT8A 5IHKA 3SWNB 3OW2S 3FDRA 3S3MA 1B07A 4A63B 1M90U 1TUDA 4F04B 1TG0A 1JJ2A 2O31A 2CZ6B 1U3OA 2G6FX 5KYXB 4XTXA 1VQ7A 4OMQA 1B34A 4Y92A 3LWHA 1SPKA 1OULA 2I0NA 2CDTA 1W2BA 1YHQA 3I9QA 1GCPA 3G6EA 5HK0A 3JRZA 3CEYA 2X51A 3HFNA 3M0SA 5I11A 2LJ1A 4M75E 3M0QA 3L1AA 3TVTA 4IKFA 1XNIA 2DETA 2J7IA 5IAYA 2KT1A 4ORZA 4E47A 3DLLA 1KIKA 2RF0A 1S72Q 3NTKA 2GNCA 3SEMA 5KYWA 1LJOA 1HXDA 2DJZA 4IUQA 1U1TA 1QCNA 3OS5A 2OTJA 1M5Q1 4EMHA 4JS5A 1GFCA 3BDLA 4N4GA 1TUGB 3I5RA 1OQKA 2CT3A 1R0CB 4KULA 2RI3A 1ZSZB 2KBTA 3M0RA 1OX8A 1IRXA 2RA2A 4ZN1A 1WXBA 1BI3A 3OYMA 4X9CA 2EW3A 6AT1B 3PNWC 3CC2Q 2K2MA 2KRMA 1FMVA 2FPFA 3CCMQ 1RAHB 1TTHB 1QMCA 1Y0MA 3UT1A 5FU6C 3M4YA 2DZCA 4K11A 5CCAA 1PRMC 3N5BB 1K9MC 2HEQA 1QVFS 2XU8A 2HSEB 4M75G 1P92A 1VQNA 2LCCA 2WSCE 3META 2ZPIB 4JJDA 3TQ7P 4ME7A 2YWWA 3OMGA 7AT1B 2AKKA 2E12A 2YLCA 1VQKA 2COZA 2ESWA 1TSFA 2EPDA 3PVLA 3L2ZA 4D6WA 4A4GA 2A36A 1SG5A 1MV3A 5LJ5d 3CCMT 1C1AA 1VUBA 4XK8E 5GANf 1K8AC 2QTXA 1TH7A 2X4WA 3R6OA 1QP2A 1C6VX 3JB9D 2DD4A 2FRYA 1N27A 4PLLA 3JCMd 4FU6A 1D1CA 4ELZC 2DIGA 1XQHA 4MDXA 4RTUA 2J6OA 4QT7A 2CZ0B 4C8QG 2YT6A 1M2OA 1ZBXA 2QXFA 2RNAA 2X4JA 2MCNA 4P5NA 1W70A 4C0DC 1Z9ZA 1PKSA 3URGA 2MWOA 4BY6C 2CT4A 5GAN8 1K9MR 3BFMA 3OW2A 3RBBB 1RABB 1I5LA 4DQ2A 4XTWA 4M7AF 1VQ5Q 2CUBA 4A4FA 2X9HA 3L42A 3CBPA 4BDZA 3EHQA 4HA8A 2KI7A 4FCYA 2NUTB 3CCSA 2DILA 1SEMA 2HL3A 1M9SA 2XDPA 2M0YA 1K8AR 3MEWA 2X3XD 4AG2C 4J8OA 1IREB 3U23A 3RKXA 1UFFA 1KD1U 1PD1A 1ZUYA 2JTMA 3MHXA 1PRLC 4JRPA 2QA4A 4M77D 1UGSB 1M4ZA 5GAOp 4EMKB 1VQ5T 5GMKe 1WJQA 3PE0A 1JRIA 4RTZA 2K5IA 1TS9A 2OX7A 2LNHB 5LJ5j 2F1LA 2M51A 4LUDA 4IUTA 1ZX6A 2DTOA 2LDMA 3OYFA 2PZ1A 3QIIA 4FYYB 5EC7A 4CRIA 4J9BA 2EGAA 1UG1A 2A3LA 5C6SA 3CCEA 4E7JA 2AZSA 3OB9A 3H8ZA 1K76A 1WIEA 2KQWA 2L3PA 4PJOE 1AOJA 2E3HA
chains in the Genus database with same CATH topology
4L5GA 3OYHA 1GXIE 2QQ9A 2RK2A 2Y4XA 3CCQA 5GAN6 2BKDN 3GPLA 3SD4A 1G3TA 2EQJA 3HKSA 5LJ5f 1QVFA 3JSCA 2KDSA 4C8QB 3HHTB 4JRIA 3QBYA 5J39A 5EG2A 2L3RA 1Q86C 3EFRA 5CKHA 1VQ6A 2K57A 2O4XA 3QZ5B 3X26B 3CCVA 4ZGJB 2G3RA 1Q86U 2V8IA 1JBMA 1NPPA 5IN1A 3SB2A 3HRUA 1VQMT 3JCMc 1VQNT 3S6WA 4E7LA 1VQPT 1VQ4T 3KBGA 3M58A 3OYJA 3CCLT 4RKUE 2ZPHB 1YJ9A 5DLOA 4M78A 1MHNA 2FB7A 1U1SA 2P0PA 4GLKA 3SWNA 3OYCA 4FL6A 4BDYA 4KUDK 2VV5A 4M78E 3VYGA 3L2QA 1NE8A 2RB6A 2MI6A 1QW1A 4OB0B 1VQKT 4M75F 4HT9A 2H3JA 4J6YA 1UGRB 1YITA 3M59A 4OMFB 5KH6A 4II1A 3I55A 1Y7XA 3MEAA 5J3BA 3JCMX 1FX7A 1YIJT 1H641 3GIBA 3X24B 2P0KA 4VUBA 2RH2A 1YI2A 4OGCA 1NJIC 3CCVT 1I81A 3RKYA 3F70A 1OZ3A 1YCYA 2I2LA 4IUVA 5GAMd 2DTHA 2PU9B 3BY7A 1PSFA 3CCUT 1NJIU 3C95A 2DK3A 5M9OA 2EYQA 4XTUA 1FWZA 2K5FA 5D6WA 3RESA 3JB9G 5GAN3 4IURA 5LJ3g 3DKMA 4ZGDB 3GNGA 5GAOm 4R55A 5CKBA 5GAOn 3WVDB 5A0DA 2EIFA 3OMCA 3CC7A 1JJ2S 2A7YA 3NTHA 3J80E 4BACA 3JB9J 1N9SA 4RG8A 1G3WA 5I2SA 3JCMb 4PJOG 4JLIA 3OS2A 2VGNA 3RERA 3I55T 4XAXB 3G4SA 2HD0A 2K5LA 3KXTA 2ZPFB 5D6XA 4A4EA 3CPWS 1YI2T 4EMKC 1VIFA 3C12A 3P8DA 3PIPA 4MDWA 5DLQE 5LL6S 1W2BS 4MMKA 1VQOA 2PVOB 1VQ8T 4M7DB 2M16A 1Y96A 4LDUA 2B8AA 4PNOA 3OYYA 3X20B 3PGGA 1UB4A 2KAFA 3ZBDA 2VUBA 3OS1A 1G5VA 2DPPB 4QQ6A 3MEVA 3PMIA 5HK3A 2EQMA 4Q5WA 5CKDA 3CCRT 4M7AC 4E7HA 5HY6A 3RKWA 4M78G 3CMAA 4X34A 1B34B 2DXCA 2P0QA 2OAUA 1WQ7A 2QQBA 4PL6A 4QQGA 2K2VA 4LDVA 4EMKA 5KCOA 5J26A 1YJNT 1UEBA 3RUXA 2RHIA 3PT9A 1G3YA 4M75B 4OP0A 3Q1JA 2HBPA 3FRNA 2R5MA 4O6JA 3LYIA 3CCST 1D3BA 5CQYA 2M0OA 3NFCA 4A53A 3V7SA 5LJ5h 2RJDA 3C94A 4C8QC 3V7CA 4JJNK 4MMLA 2RO0A 3OYBA 4F7UG 2MF2A 3QYHB 3O8VA 4QVZA 4BE0A 1R8OB 3GOXA 4BY6B 4MZPA 1KC8C 4M7AA 3EFSA 3H6ZA 2LVMA 3GF5A 4M77G 1WGSA 2VXFA 4C92F 5IT9E 2RI2A 4N4HA 2F5TX 1S72A 2HQXA 4XU2A 2Y4YA 1KC8U 2MAMA 3BW1A 5GMKm 1KQSS 4M7AE 3OSSC 5GANh 1DJ7B 3JCMW 1FXXA 4BB7A 4KUIA 5LJ3e 3X28B 2QA4T 2XIDA 2X4YA 4L59A 3ZEHA 2QDYB 1QVGS 3CCJA 2GFUA 2M9UA 4ZTFA 2E41A 2L8DA 2GQVA 1VQNA 3QSUA 3FLGA 3QYGB 2LNVA 2QQRA 3VUBA 2HNIA 1YJWT 1OZ2A 1NPRA 1I8FA 3QJ6A 4FIBA 2AHJB 4M75D 4C8QA 5GAN2 2DXBA 4M7DG 5GAMj 5GAN4 1N8RC 1X75C 2X4XA 3JB9H 2O01E 2NLUA 3P8HA 4C8QE 5FRNA 3OY9A 1M1GA 3ASKA 5GMKh 3M56A 2RM4A 1VQ9A 1S72T 2ZPGB 5CR2A 1WQWA 1Q7YC 1UGQB 3AHUA 3CXCS 3DB4A 4HCZA 4FSXA 3ER0A 5DM7R 4PLIA 3M53A 4YTLA 3HRTA 2E5QA 2XG8D 3LGLA 5C0MA 5GMKj 1Q7YU 5LJ5g 3CC2A 3CCET 4ATOA 4F7UF 3L2RA 2DXUA 2FHDA 4KBMB 4XU3A 2YRVA 4X9DA 3CCMA 2RK1A 5CKEA 2K3XA 2XDBA 3HFOA 3A8LB 4M77F 4BI8B 2DD5A 2FVUA 2L5QA 2RD1A 5CO7A 1KG1A 2LT4A 4N0AA 1KHIA 2X35A 4PJOB 2OTLT 3M4GA 4MZMA 5KE2A 4M7AD 3V8JA 5GAMf 3CCQT 3JCMg 5GANg 3FEOA 4JRQA 4C0FA 1YBYA 4RMOA 3MCAB 2E10A 2XDDA 2MMPA 2JTFA 3QG1A 4NL3A 1VQ6T 3CC2T 3CC4A 2F69A 2YLBA 4IUPA 2DVEA 4M7DF 3G71A 3L2VA 3E9FA 3E19A 4J5YA 3OS0A 4B9XA 3DB3A 3G7ZA 2DZ9A 3S3OA 4A4HA 4C92B 5FU6B 2E64A 2CYZB 5FLXE 1YJ9T 4C8QD 4DOWA 4J7FA 1EIFA 2XICA 3UPUA 3QO3A 2E6ZA 3OYKA 4PKCC 2CGHA 3LWIA 4HT8A 4M75C 2FL7A 3SWNB 1YITT 2QQAA 3OW2S 3FDRA 3GNFB 3S3MA 5LJ3f 4A4KA 1M90C 2JVVA 5FROA 3PIOA 1U8RA 3QUIA 5CAIA 1M90U 1V29B 2EQKA 3G71T 3OQ5A 5GAN7 1KQ1A 3RIRA 2RHXA 1JJ2A 5CQXA 3V8LA 3OYIA 2CZ6B 4JRKA 2EJ9A 2RJEA 5LJ3d 4RCCA 4XTXA 2ZPBB 1K73C 1VQ7A 3CC7T 3MO8A 1ZHIA 1K73U 4F7UB 3HPWA 3CPWA 1B34A 1Y07A 4TVRA 3LWHA 2VXEA 4C5HA 3PFSA 4BI4A 4NOYA 2PUKB 2BIVA 3S3NA 4A54A 1W2BA 4M77B 4C92D 4M75A 3JB9F 1YHQA 3G4ST 4NL2A 3G6EA 2XHCA 3RMSA 5HK0A 2RHZA 3JRZA 2IG0A 4XU0A 3ZFJA 3CEYA 3HFNA 5GAOq 4M75E 5LJ5e 3BDUA 2ZPEB 4BD3A 4EDUA 3L1AA 4IKFA 3L2WA 2IVWA 2V8KA 1XNIA 3LLRA 1VQOT 2QI2A 5IAYA 3QPHA 3OYNA 3M5AA 5KCHA 3HP9A 4PJOF 4E47A 3I56A 3DLLA 2MWPA 1PSEA 1HK9A 2RHYA 3NTKA 1VQ5A 2PVGB 1VQLA 1Y96B 1ZQ1A 1RL2A 1LJOA 3JB9I 1HXDA 2DJZA 2EFIA 2GFAA 2R58A 3P8BB 3CPFA 4IUQA 1G3SA 1U1TA 5GANe 3OS5A 3JCMe 2OTJA 1M5Q1 2JOYA 3FIFA 4EMHA 4LDYA 3BDLA 4N4GA 3E1SA 4JS5A 4C0DB 4HCCA 4L6V5 3HSBA 3CBMA 3CMEA 3VJPA 4JLGA 3QHSA 3CMAT 4DOVA 4KULA 4OB2B 3GLXA 2DIQA 5CVIA 2RI3A 2WSFE 2QQSA 2RJFA 2LCLA 1QVPA 2DKGA 3WXMB 5CKFA 3LGFA 4N4IA 3A8GB 2RA2A 4ZN1A 1BI3A 1O75A 3FC3A 3OYMA 1Y71A 2QEXA 4M78F 5GAMh 2VC8A 4X9CA 3OA6A 3PNWC 4Z02A 4LDXA 2GCXA 2KK4A 4MZTA 3CD6A 1XTDA 3VUZA 5A0GA 1WPYA 5GAOl 4WF2A 4XQ3A 4Y28E 2XI9A 3OYGA 3NTIA 4C92C 5I21A 3UT1A 5FU6C 5A2QE 3M4YA 3VU3C 1N8RU 2DZCA 3CBOA 4M7DD 1QVGA 2LX9A 5CCAA 2LT1A 2RHUA 3HRSA 2CZ1B 4ZN3A 2ZCFB 3MP8A 1Q81C 3N5BB 3QZ9B 1K9MC 1QVFS 3J81E 4E7KA 1N6AA 2XU8A 4M75G 3M54A 1VQMA 1P92A 1Q81U 4LDWA 2LCCA 4BE2A 2WSCE 1VQPA 3META 1VQ4A 1K9MU 2CZ7B 1X01A 2ZPIB 4ZTJA 3CCLA 3CCJT 4KT0E 2XD0A 4R56A 4B9WA 3MP6A 4Y91A 1LOJA 4ME7A 3OMGA 1LNXA 3M55A 4O5VA 5LJ3h 4EMGA 3LH0A 4IUUA 2E12A 2YLCA 1KHCA 3CXCA 3QJYA 1VQKA 4OVAA 3JCMQ 4BI3A 5LJ3j 3L2ZA 4D6WA 2DEQA 2R57A 3QDRB 4A4GA 1YIJA 1VQ9T 1M8VA 4QVDA 2EJFA 4C92A 3M9QA 4XTZA 2LQ8A 3TCJA 3UWNA 5GAMg 3CCUA 2C06A 5LJ5d 4XTYA 4OB3B 4C92E 1AHJB 3CCMT 4JS4A 4V2SA 4C5GA 1KQ2A 4M7AG 1VUBA 5DY9A 3T9NA 4M77C 2P4TA 4XK8E 2O4XB 2VYTA 2QTXA 1TH7A 3JCMf 5GANf 3RMQA 2X4WA 1K8AC 1BI1A 2JZ2A 3OSVA 3R6OA 1QP2A 1K8AU 2LTOA 1N9RA 5FU7B 1BKBA 3OBWA 3TREA 3UDCA 2D6FA 2DO3A 2LQKA 2DD4A 4ELYC 3E9GA 4HKEA 3JB9D 1N27A 4PLLA 4QQDA 4M78B 3JCMd 2XKOC 4FU6A 5GANd 4ELZC 3A8MB 2EJGA 2EAYA 2VGMA 2DIGA 2WSEE 5HKCA 1XQHA 1QP3A 3JAME 4MDXA 3LX7A 2E70A 2DTIA 2CZ0B 4C8QG 5CK9A 2DAQA 1ZBXA 3CC4T 4M7DC 1VQ8A 2QXFA 4PJOD 2WACA 1Q82C 2HQEA 2X4JA 3DLMA 4C0GA 4F7UA 3A8HB 4P5NA 4QVCA 3L2UA 5I2MA 4C0DC 5GMKi 5GMKl 4C0ZA 1Q82U 2KY9A 2R5AA 2HAXA 2LC4A 2MWOA 3URGA 1X6OA 3INZA 4M77A 4BY6C 4F7UE 5GAN8 2V8JA 2Y90A 1BI0A 1OI1A 3BFMA 3OW2A 2LRQA 5CIUA 3OBYA 4M77E 1I5LA 1W4SA 3OYEA 3CCRA 4RG2A 4DQ2A 4XTWA 4M7AF 4EPCA 3ME9A 2ZZDA 4A4FA 3L42A 4BE1A 3CBPA 4RCBA 3PTAA 1YJNA 1M1KC 2JUFA 1NZ9A 4LD6A 4BDZA 3V7RA 2OTLA 1M1KU 4HA8A 4M7DA 4M78D 2EWNA 2XK0A 2K4YA 3CCSA 5D6YA 1BIAA 2D9TA 2E1HA 4C92G 4M7DE 1I4K1 1WJSA 5KE3A 4C5IA 1VQ7T 5FRMA 5GAN5 1M9SA 5A0LA 2EQUA 4C8QF 4ZGEB 2OTJT 3FJPA 2RI5A 2PVDB 2XDPA 4UC4A 4JUVA 2E65A 1M1FA 4DA4A 2CKKA 3QXEB 4BUGA 2BUDA 3JCMV 2KVQG 4FT4A 3EAEA 4C5EA 1JB0E 1MGQA 3MEWA 1KD1C 1YHQT 4J8OA 4XTVA 3G6ET 1IREB 3KUFA 2GF7A 3RKXA 4FM4B 2CS7A 2K3YA 2RJCA 4J6WA 5GAMe 1KD1U 3TEEA 2JTMA 3LW5E 5GAOr 1IZ6A 3MHXA 3GP8A 1O9SA 1WJRA 4JRPA 3JCMJ 5L8RE 2QA4A 3JCMP 3V8KA 4PJOC 1BYMA 4M77D 3OYAA 1UGSB 3I56T 1M4ZA 5GAOp 4JDSA 4EMKB 4E7IA 2M1HA 1VQ5T 3MEUA 5GMKe 1WJQA 3FB9A 1YJWA 1VQLT 1JRIA 1H3ZA 3VKIA 2K5IA 2F5KA 3C4SA 4XU1A 4NS5A 5AYFA 2E6NA 4GY5A 3HL8A 4HCBA 4LD9K 2KMTA 3OYDA 1BIBA 1VIEA 3WVEB 5LJ5j 1D3BB 2PUOB 4CI0C 1WNLA 4J83A 4IUTA 3X25B 1KQSA 3CMET 2DTOA 2LDMA 2JNGA 2L89A 3A8OB 3SDZA 3QIIA 3OYFA 2YHTA 4CRIA 3TU4K 2DXTA 3OYLA 4J6XA 4QW2A 3JCMh 2A3LA 3MP1A 5C6SA 3CCEA 3VYHB 3QKJA 4FT2A 4E7JA 2JN0A 1RI0A 2PQWA 5FU7C 3OB9A 3H8ZA 4M7AB 3VV0A 1UGPB 1OYXA 3J7AF 2D0QB 4OGEA 4OB1B 5GANj 4J7IA 4M78C 4N0AC 2QEXT 4PJOA 3SWNC 2KQWA 2FYKA 2KSSA 3A5ZB 3PMTA 1SSFA 3SFMA 3CD6T 1XOVA 4PJOE 2EKOA 4OF1A 1BI2A 3M57A 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9S A;  4EPC A; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  2Y4X A;  5GAN 6;  2BKD N;  2PNI A;  3GPL A;  1G3T A;  1QVF A;  2K3B A;  5IHI A;  1UDL A;  2FZG B;  2L3R A;  1Q86 C;  2DA9 A;  1T3S A;  2V8I A;  1JBM A;  3SB2 A;  3HRU A;  1FMK A;  4E7L A;  3KBG A;  2QYZ A;  4RKU E;  4HVV A;  5DLO A;  1LCK A;  2DEU A;  2P0P A;  3OYC A;  1OEB A;  2QDL A;  4M75 F;  2H3J A;  4PK4 A;  3JCM X;  2RH2 A;  1YI2 A;  1NJI C;  3F70 A;  1OZ3 A;  4IUV A;  2I2L A;  2DTH A;  2HMA A;  2DK3 A;  1WHJ A;  4XTU A;  2K5F A;  3RES A;  1NG2 A;  1JQQ A;  2EIF A;  3OMC A;  5IHN A;  1N9S A;  2YUO A;  5I2S A;  1PM3 A;  4ESR A;  4PJO G;  3OS2 A;  1SRM A;  4XAX B;  3HTR A;  2K5L A;  3KXT A;  1QVG P;  2ZPF B;  1UE9 A;  1VQO A;  2PVO B;  8ATC B;  4LDU A;  2FZC B;  4RTW A;  3EFO A;  1Q86 R;  2CSI A;  3PMI A;  1PCX A;  3RR6 A;  3TSZ A;  4M7A C;  5L23 A;  3RKW A;  2MIO A;  3REA B;  1IB8 A;  2CP5 A;  2FPE A;  4JPB W;  1EFN A;  2W0Z A;  4OP0 A;  3VS5 A;  1NJI R;  1ZBJ A;  3C94 A;  2GTO A;  4BE0 A;  3CCL Q;  4M7A A;  1D0X A;  3EFS A;  2A0F B;  2JW4 A;  2F5T X;  2HQX A;  3BW1 A;  3OSS C;  5GAN h;  2JM8 A;  2F2X A;  3CCQ Q;  3ZEH A;  2M9U A;  3NPF A;  2L8D A;  3QYG B;  1VQ6 Q;  2LNV A;  1NM7 A;  4DBH A;  1RAC B;  1I8F A;  5HCK A;  3AT1 B;  5GAN 4;  5KYU A;  3P8H A;  1D1B A;  3OY9 A;  1PD0 A;  3M56 A;  1VQ9 A;  2ZPG B;  3CXC S;  1Q95 G;  5DM7 R;  4FSX A;  3ER0 A;  5C0M A;  2E5Q A;  1Q7Y U;  3UA7 A;  4ATO A;  1G83 A;  3L2R A;  4XU3 A;  1YIT Q;  3I55 Q;  1OX9 A;  4BI8 B;  1KG1 A;  1KHI A;  2DYB A;  4OMN A;  1SKU B;  2LP5 A;  3CCQ T;  2D1X A;  3CC7 Q;  1W6X A;  2XDD A;  1FYN A;  1VQ6 T;  1AVZ C;  2F69 A;  2DVE A;  3G71 A;  3E9F A;  3G4S Q;  2HCK A;  2ROT A;  3OS0 A;  3G7Z A;  4A4H A;  4C92 B;  2CYZ B;  2CP3 A;  4DOW A;  2FO0 A;  1QQJ A;  2E6Z A;  1MV0 B;  4M75 C;  5AT1 B;  2RQW A;  2NUP B;  1YIT T;  2QQA A;  3GNF B;  4A4K A;  2JTE A;  1T0H A;  3OQ5 A;  3RIR A;  5CQX A;  2YRD A;  5LJ3 d;  4RCC A;  3R6N A;  3VS7 A;  5KYN A;  2FZK B;  3SHW A;  3CC7 T;  1K73 U;  4F7U B;  2KRO A;  3HPW A;  4BI4 A;  4NOY A;  2PUK B;  4M77 B;  4M75 A;  3G4S T;  4NL2 A;  2L0A A;  3ZFJ A;  2IG0 A;  1XJW B;  5GAO q;  3BDU A;  1ABO A;  2QI2 A;  3M5A A;  3HP9 A;  4PJO F;  4AT1 B;  2HKN A;  3I56 A;  2MWP A;  2QG9 B;  2B86 A;  1VQL A;  1RAI B;  1ZQ1 A;  4M7D B;  4QKU A;  3EH2 A;  5GAN e;  1UGV A;  1Z9Q A;  3HSB A;  2MYS A;  1D0Y A;  2GBQ A;  4DOV A;  4DBR A;  2DIQ A;  2RQR A;  2WSF E;  2DJQ A;  1IGQ A;  2DL8 A;  2MOX A;  1A0N B;  2D8H A;  2DF6 A;  3FJ5 A;  3A8G B;  2ENM A;  3EG9 A;  2CH4 W;  2QEX A;  3C0C A;  1JU5 C;  4LDX A;  1V76 A;  2GCX A;  1XTD A;  2C0I A;  2YXY A;  1KSW A;  2AZV A;  2LJ3 A;  1BK2 A;  2LQN A;  1X27 A;  1N8R U;  5A2Q E;  3VRZ A;  2KR3 A;  3HRS A;  3MP8 A;  1NLO C;  1N6A A;  1X43 A;  1Q81 U;  3CCL A;  4CC4 B;  4B9W A;  1JXM A;  4O5V A;  3M55 A;  4EMG A;  3LH0 A;  1U06 A;  2SEM A;  3CXC A;  3QJY A;  4OVA A;  5LJ3 j;  1IHV A;  1YIJ A;  2K79 A;  1OPK A;  2EJF A;  2NUZ A;  4XTZ A;  2M02 A;  5GAM g;  2C06 A;  2ABL A;  4XTY A;  4OB3 B;  4C92 E;  1AHJ B;  2YUQ A;  4C5G A;  1KQ2 A;  4M7A G;  3T9N A;  1E6G A;  2O4X B;  2VYT A;  4FYW B;  1BI1 A;  2JZ2 A;  3OSV A;  1RAE B;  2LTO A;  5FU7 B;  3UDC A;  1BKB A;  3OBW A;  4ELY C;  3E9G A;  5IXF A;  4QQD A;  4M78 B;  1OV3 A;  2J05 A;  3EGD B;  2EYY A;  3A8M B;  2EAY A;  1TU0 B;  2CP0 A;  2E70 A;  5CK9 A;  1VQ8 A;  1Q82 C;  2EKH A;  4C0G A;  2BZX A;  3LH5 A;  5GMK i;  4FYX B;  4C0Z A;  2GQI A;  2KY9 A;  2R5A A;  2HAX A;  4F7U E;  1X6O A;  3INZ A;  2HL5 C;  2V8J A;  3EH1 A;  5KYY B;  2KRN A;  5D7U A;  4M77 E;  4AFQ C;  1TOV A;  1YN8 A;  3EG3 A;  4PFP A;  1ZSZ C;  1PNJ A;  3ME9 A;  1NEG A;  4RCB A;  2JUF A;  1NZ9 A;  4LD6 A;  2HBW A;  3V7R A;  1M1K U;  3M0P A;  3CME Q;  1UHC A;  2XK0 A;  3M0U A;  2K4Y A;  5D6Y A;  1BIA A;  2D9T A;  2E1H A;  3NMZ C;  4C92 G;  4M7D E;  5KE3 A;  3QWX X;  1M3C A;  5GAN 5;  4ZGE B;  1SHG A;  2E65 A;  1M1F A;  2DE0 X;  3QXE B;  4FT4 A;  3EAE A;  1CKB A;  1ZSZ A;  4XTV A;  3CD6 Q;  2CS7 A;  2K3Y A;  4J6W A;  1AZE A;  3LW5 E;  5GAO r;  1IZ6 A;  3GP8 A;  2AT1 B;  3M0T A;  3JCM J;  3JCM P;  3V8K A;  4PJO C;  1WYX A;  2FPD A;  3OYA A;  4E7I A;  2J6F A;  1H3Z A;  1Q82 R;  2QTV A;  4NS5 A;  5AYF A;  1VQM Q;  4JZ3 A;  1VQP Q;  2KMT A;  1BIB A;  1VQ4 Q;  3WVE B;  4CI0 C;  4ZNX A;  2KXD A;  4J83 A;  3X25 B;  1KQS A;  3CME T;  1W1F A;  3SDZ A;  3TU4 K;  4IIO A;  3OYL A;  4J6X A;  4QW2 A;  3JCM h;  1JJ2 P;  3MP1 A;  3QKJ A;  4FT2 A;  1H8K A;  1RI0 A;  2RMO A;  1ZSG A;  1OYX A;  4PJO A;  4N0A C;  1HSQ A;  2KSS A;  1SSF A;  2JS2 A;  3CCU Q;  4AG1 C;  3CD6 T;  4OF1 A;  1BI2 A;  1W2B P;  3ZL7 C;  3M57 A;  3EHR A;  4L5G A;  3OYH A;  2ZAE A;  1M2V B;  3MPU B;  3JSC A;  5CKH A;  1UJ0 A;  2K57 A;  3X26 B;  3CCV A;  1WHM A;  2G3R A;  1VQM T;  1VQP T;  1VQ4 T;  2YUN A;  3RDV A;  4FL6 A;  1D1A A;  4M78 E;  5GJW B;  3VYG A;  4J6Y A;  4OMF B;  1BU1 A;  1VYU A;  3MEA A;  5J3B A;  1ABQ A;  1FX7 A;  1H64 1;  3GIB A;  2JM9 A;  2LCS A;  3RKY A;  3UA6 A;  2KYB A;  3CCR Q;  3CCU T;  2EYQ A;  8AT1 B;  1UEC A;  1SHF A;  4ZGD B;  3WVD B;  4DBF A;  2MPX C;  2ROL A;  1IXD A;  1U5S A;  4RG8 A;  2KGT A;  3JCM b;  4FYV B;  1YWO A;  3CQT A;  3CPW S;  1YI2 T;  4EMK C;  1K0X A;  2NUT A;  2H8H A;  1M27 C;  4MMK A;  1Y96 A;  1NLP C;  2EQI A;  2KAF A;  1PKT A;  2J06 A;  1G5V A;  1K4U S;  2DPP B;  2EQM A;  1E7O A;  3CCR T;  4R0K A;  1PHT A;  5HY6 A;  4M78 G;  1YJW Q;  4X34 A;  2DXC A;  2OAU A;  1WQ7 A;  2K2V A;  4LDV A;  4EMK A;  1YJN T;  4PJL A;  4LXC A;  1G3Y A;  3Q1J A;  3JV3 A;  4O6J A;  2QGF B;  2M0O A;  3NFC A;  3V7C A;  1GCQ C;  4JJN K;  2CRE A;  2VAS A;  3OYB A;  4KGV B;  5IH2 A;  4BY6 B;  4PFZ A;  1SRL A;  4MZP A;  1KC8 C;  4C92 F;  1S72 A;  4PJN A;  2OTL Q;  3JCM W;  1FXX A;  4BB7 A;  1BCM A;  3NHN A;  3X28 B;  2XID A;  1K9A A;  2DL7 A;  2E41 A;  3QSU A;  3OW2 P;  1YJW T;  2HNI A;  1AWW A;  4M75 D;  2DXB A;  1GCQ A;  1N8R C;  2X4X A;  1YJ9 Q;  1M1G A;  3ASK A;  3RNJ A;  2RM4 A;  5I22 A;  5CR2 A;  1WQW A;  3DB4 A;  4HCZ A;  3M53 A;  3CC2 A;  5GMK j;  5LJ5 g;  4F7U F;  3EGX B;  3CCM A;  2YRV A;  1KJW A;  5CKE A;  2XDB A;  3HFO A;  2HKQ B;  4M77 F;  2FVU A;  2L5Q A;  2RD1 A;  2LT4 A;  2AIR B;  4OML A;  2DLP A;  2X35 A;  1AEY A;  2OTL T;  4MZM A;  2YUP A;  2XMF A;  2KE9 A;  3JCM g;  3FEO A;  1YBY A;  3MCA B;  2JTF A;  1KFZ A;  2KNB B;  1GL5 A;  2YLB A;  4M7D F;  1KC8 R;  4B9X A;  1MMG A;  2DZ9 A;  4AFU C;  1YJ9 T;  4LN2 A;  4C8Q D;  3OYK A;  3G1J A;  4PKC C;  2CGH A;  3LWI A;  1AT1 B;  1M90 C;  2J6K A;  5FRO A;  1MND A;  5CAI A;  1N8R R;  2EQK A;  1K1Z A;  2JT4 A;  3G71 T;  5GAN 7;  1KQ1 A;  2RHX A;  1I1J A;  3V8L A;  2D0N A;  3CMA Q;  1GFD A;  2EJ9 A;  2RJE A;  4HXJ A;  2ZPB B;  2F2W A;  1ZHI A;  3CPW A;  3EG2 A;  1Y07 A;  4TVR A;  3PFS A;  3H0H A;  1YCS B;  2HDA A;  1LVK A;  3J7A F;  4AFZ C;  2RHZ A;  4XU0 A;  3EG1 A;  2ZPE B;  4EDU A;  2V8K A;  3OYN A;  4OMP A;  5KCH A;  4AMC A;  1AWJ A;  1PSE A;  1HK9 A;  1VQ5 A;  1WZO A;  3REB B;  2PVG B;  2YSQ A;  3PVQ A;  1RL2 A;  1MMA A;  2GFA A;  2EFI A;  2R58 A;  3P8B B;  3CPF A;  1G3S A;  4LDY A;  1GBR A;  4HCC A;  3CMA T;  1G2B A;  4OB2 B;  3GLX A;  5CVI A;  2F2V A;  1QVP A;  2DKG A;  3THK A;  3LGF A;  1T3L A;  4E6R A;  1M90 R;  1TWB A;  3FC3 A;  4M78 F;  1JO8 A;  5GAM h;  2VC8 A;  3OA6 A;  1UUE A;  4Z02 A;  4MZT A;  3VUZ A;  4F17 A;  4J9I A;  5GAO l;  4WF2 A;  2XI9 A;  3NTI A;  4C92 C;  4E2F B;  3VU3 C;  3CBO A;  2LX9 A;  2LT1 A;  2RHU A;  4D8D A;  1WA7 A;  2CZ1 B;  2E3I A;  1VYT A;  1JXO A;  2ZCF B;  3QZ9 B;  4ZN3 A;  2RPN A;  4E7K A;  4LDW A;  1K9M U;  2CZ7 B;  2E5K A;  2H3E B;  3CCJ T;  4KT0 E;  2XD0 A;  2CSQ A;  4R56 A;  3MP6 A;  4Y91 A;  3VS2 A;  1WXT A;  4PJJ A;  1QKW A;  5LJ3 h;  1KHC A;  3JCM Q;  2K9G A;  3QDR B;  2VKN A;  1M8V A;  4C92 A;  3M9Q A;  2LQ8 A;  1WHK A;  4IIM A;  4JS4 A;  1WX6 A;  4FW1 A;  5DY9 A;  4M77 C;  3JCM f;  3UF4 A;  3RMQ A;  1N5Z A;  1K8A U;  3TRE A;  1N9R A;  2DO3 A;  2LQK A;  4DBQ A;  1MMD A;  5GAN d;  2V1R A;  5HKC A;  2VGM A;  3JAM E;  1VQ7 Q;  1QP3 A;  3LX7 A;  2DTI A;  3CC4 T;  2DAQ A;  3IQL A;  4M7D C;  4PJO D;  2EVR A;  1X6G A;  2HQE A;  1YHQ Q;  2BZ8 A;  4F7U A;  3G6E Q;  4QVC A;  3L2U A;  5I2M A;  1AD5 A;  4M77 A;  1BI0 A;  1OI1 A;  2LRQ A;  2P84 A;  1W4S A;  3OYE A;  1TXQ A;  1I0C A;  2AK5 A;  2ZZD A;  4GBQ A;  3PTA A;  2OTJ Q;  4CC7 A;  4M7D A;  1CSK A;  1I4K 1;  2LJ0 A;  1VQ7 T;  2L3S A;  5A0L A;  2EQU A;  3FJP A;  2RI5 A;  4J9F A;  4DA4 A;  4BUG A;  4ANJ A;  4Z88 A;  2FRW A;  1KD1 C;  1YHQ T;  3G6E T;  1GBQ A;  2GF7 A;  1KK7 A;  4FM4 B;  2RJC A;  5GAM e;  3TEE A;  1O9S A;  1WJR A;  5L8R E;  3VRY A;  1NYF A;  1BYM A;  4X1V A;  4JDS A;  2M1H A;  2GTJ A;  2MK5 A;  2IIM A;  1VQN Q;  2OTJ T;  3OYD A;  1VIE A;  4JJC A;  1D3B B;  2PUO B;  1WNL A;  1S1N A;  2D8J A;  3A8O B;  2YHT A;  2DL4 A;  2DXT A;  3BE3 A;  1RAA B;  4F14 A;  3VYH B;  1VQK Q;  2JN0 A;  5FU7 C;  3VV0 A;  1PWT A;  4DEY A;  5GAN j;  4M78 C;  3SWN C;  4WCI A;  2O9V A;  3SFM A;  1XOV A;  2IPO B;  3EG9 B;  1GXI E;  1K0S A;  1WXU A;  3CCQ A;  4M4Z A;  4C8Q B;  4JRI A;  2EYW A;  3QBY A;  2COW A;  5J39 A;  1VQ6 A;  4RTX A;  2O4X A;  1VA7 A;  4ZGJ B;  1Q86 U;  1KD1 R;  3JCM c;  1VQN T;  3KFV A;  2GGR A;  4JZ4 A;  2ZPH B;  1D09 B;  4M78 A;  1MHN A;  3EGD A;  1U1S A;  4GLK A;  3SWN A;  4BDY A;  4KUD K;  2VV5 A;  2MI6 A;  1QW1 A;  4HT9 A;  2OI3 A;  1VQK T;  1YIT A;  1M3B A;  4II1 A;  3I55 A;  1Y7X A;  2OAW A;  2P0K A;  4OGC A;  5KYX A;  3CCV T;  1I81 A;  1YCY A;  1NJI U;  1PSF A;  1RI9 A;  4HVW A;  3C95 A;  2CP2 A;  3JB9 G;  5GAN 3;  4IUR A;  5LJ3 g;  5FWC A;  5GAO m;  5CKB A;  1B3Q A;  3CC7 A;  3NTH A;  3J80 E;  2LMJ A;  1SF9 A;  3CCS Q;  1J3T A;  2VGN A;  3G4S A;  1ZLM A;  3I35 A;  1VIF A;  3C12 A;  3P8D A;  3PIP A;  1AWO A;  4MDW A;  5DLQ E;  2M16 A;  2B8A A;  3OYY A;  3X20 B;  4FW2 A;  1UB4 A;  1WHL A;  3ZBD A;  2VUB A;  3OS1 A;  4RTV A;  2KXC A;  3MEV A;  3CXC P;  2QA4 Q;  2FEI A;  1BB9 A;  4RTY A;  2COY A;  5CKD A;  1OOT A;  1B34 B;  2P0Q A;  1HYO A;  5J26 A;  5KCO A;  3RUX A;  2A08 A;  3FRN A;  2DER A;  2R5M A;  1E6H A;  3LYI A;  3CCS T;  5LJ5 h;  3CCE Q;  1QLY A;  1WHH A;  2RO0 A;  4F7U G;  3O8V A;  2NWM A;  1R8O B;  3GOX A;  5KYW B;  2CP7 A;  4M77 G;  1WGS A;  2VXF A;  3NGP A;  1RAG B;  1X2Q A;  4N4H A;  1QKX A;  2V1Q A;  2Y4Y A;  2MAM A;  4KUI A;  3A98 A;  2QA4 T;  2X4Y A;  1NBE B;  2QAZ A;  4L59 A;  2QDY B;  1QVG S;  1WHG A;  4ZTF A;  3VS1 A;  1I5O B;  3FLG A;  3VUB A;  2YRC A;  1M2V A;  1NPR A;  3QJ6 A;  2AHJ B;  4M7D G;  1V1C A;  2C0O A;  1X75 C;  2O01 E;  4C8Q E;  5FRN A;  5GMK h;  2VWF A;  1S72 T;  1Q7Y C;  1UGQ B;  3AHU A;  4PLI A;  3CCE T;  2YDL A;  5ECA A;  1RLP C;  2DXU A;  2FHD A;  4X9D A;  2RK1 A;  1Y57 A;  2K3X A;  1ZA1 B;  1YI2 Q;  4N0A A;  4PJO B;  5KE2 A;  4M7A D;  3V8J A;  4RUG A;  5GAM f;  4JRQ A;  4C0F A;  2E10 A;  3H0F A;  3CC2 T;  1RUW A;  1MNE A;  3L2V A;  1HJD A;  1SSH A;  2NYS A;  3DB3 A;  3S3O A;  5FU6 B;  4J7F A;  1YJN Q;  2ED1 A;  1VQO Q;  2XIC A;  1ARK A;  3QO3 A;  1KQS P;  2QGG A;  2FL7 A;  5GJV B;  3H0I A;  5LJ3 f;  2JVV A;  3PIO A;  1U8R A;  3QUI A;  1V29 B;  2DRK A;  1WLP B;  2AKL A;  3OYI A;  4JRK A;  1Q7Y R;  1K73 C;  3MO8 A;  4FSS A;  2VXE A;  3EGU A;  2DBK A;  4C5H A;  1BBZ A;  2BIV A;  3S3N A;  4A54 A;  4C92 D;  3JB9 F;  2LQW A;  1RAF B;  2XHC A;  3RMS A;  1C0M A;  1VYV A;  5LJ5 e;  4BD3 A;  4KGZ B;  2RQV A;  3MJX A;  2IVW A;  4J9C A;  2KT8 A;  4WTO B;  3L2W A;  3LLR A;  1VQO T;  3QPH A;  5FW9 A;  4HVU A;  2RHY A;  2BTT A;  1YWP A;  1Y96 B;  3QDF A;  3JB9 I;  3JCM e;  2JOY A;  3FIF A;  1NYG A;  3E1S A;  4C0D B;  4L6V 5;  3CBM A;  3CME A;  3VJP A;  1EX4 A;  4LE9 A;  4JLG A;  2L3Q A;  3QHS A;  4CC3 A;  2QQS A;  2RJF A;  2LCL A;  2A37 A;  2KRS A;  3WXM B;  5CKF A;  4N4I A;  1UTI A;  1O75 A;  1VQ9 Q;  1Y71 A;  2W10 A;  4E7S A;  3H9N A;  2KK4 A;  3CD6 A;  3I5S A;  5A0G A;  1WPY A;  2P4R A;  2VVK A;  1ZA2 B;  1M30 A;  1K73 R;  4XQ3 A;  4EIK A;  4Y28 E;  3EGX A;  3OYG A;  5I21 A;  2K7A A;  4OMO A;  2BE7 D;  4M7D D;  1QVG A;  1Q81 C;  4OMM A;  3J81 E;  3M54 A;  1VQM A;  4BE2 A;  1VQP A;  1VQ4 A;  1X01 A;  1HD3 A;  2BZY A;  4ZTJ A;  1ACM B;  1LOJ A;  1LNX A;  1ZUK A;  3G71 Q;  4IUU A;  2A28 A;  5IXB A;  4BI3 A;  2EGC A;  2DEQ A;  2R57 A;  1VQ9 T;  3O5Z A;  4CC2 A;  3ULR B;  3TCJ A;  3UWN A;  3CCU A;  1X2K A;  4V2S A;  2O88 A;  1I07 A;  2P4T A;  2HSP A;  1QWF A;  2CH4 A;  2D6F A;  4HKE A;  1M3A A;  1UJY A;  9ATC B;  2XKO C;  2BE9 B;  2EJG A;  2WSE E;  3GBQ A;  1IGU A;  1BCO A;  2WAC A;  1B7T A;  3DLM A;  3A8H B;  4LUE A;  1Q82 U;  5GMK l;  3UAT A;  2LC4 A;  1ZUU A;  1R0B G;  1Q81 R;  2Y90 A;  3H41 A;  2K6D A;  5CIU A;  3OBY A;  1H92 A;  3I56 Q;  3CCR A;  4RG2 A;  1QVF P;  4EPC A;  4PFO A;  1VQL Q;  2JMA A;  2EYZ A;  4BE1 A;  1M1K C;  1YJN A;  4HCK A;  3VS4 A;  1PG5 B;  2EYX A;  4M78 D;  2EWN A;  2JS0 A;  1WJS A;  2SRC A;  4C5I A;  5FRM A;  2DYI A;  4C8Q F;  2PVD B;  4UC4 A;  4JUV A;  3EFO B;  2CKK A;  2BUD A;  3JCM V;  2KVQ G;  4F16 A;  4C5E A;  1JB0 E;  2QEX Q;  1MGQ A;  3CCJ Q;  3KUF A;  1QCO A;  1LPL A;  1WFW A;  2L2P A;  1AWX A;  4D8K A;  3I56 T;  2DBM A;  3MEU A;  3FB9 A;  1YJW A;  1OU9 A;  1VQL T;  3VKI A;  2F5K A;  2O2O A;  3C4S A;  4J9H A;  4XU1 A;  2E6N A;  4GY5 A;  2DMO A;  3HL8 A;  4HCB A;  4LD9 K;  4J9D A;  1WDX A;  2JNG A;  2L89 A;  4DEX A;  1MUZ A;  1JEG A;  3A1P A;  2OJ2 A;  2Z0W A;  2PQW A;  4M7A B;  1UGP B;  2D0Q B;  4OGE A;  1YIJ Q;  4OB1 B;  4J7I A;  3VS3 A;  2ED0 A;  2QEX T;  1M1K R;  3CPW P;  2FYK A;  2DX1 A;  3A5Z B;  3PMT A;  3CC4 Q;  2EKO A;  2V26 A;  4QVD A;  1CKA A;  2ZGW A;  2OTL A;  2RK2 A;  2DVJ A;  3SD4 A;  2EQJ A;  3HKS A;  3VS6 A;  1PC0 A;  5LJ5 f;  2KDS A;  4KGX B;  3HHT B;  5EG2 A;  2DL3 A;  3EFR A;  5KYU B;  3QZ5 B;  1FMW A;  1R77 A;  5IN1 A;  1NPP A;  2DFU A;  3S6W A;  2JMC A;  3M58 A;  2HZY A;  3OYJ A;  3CCL T;  1YNZ A;  4LNP A;  1YJ9 A;  2FB7 A;  1VQ8 Q;  2NUP A;  4E7Z A;  3L2Q A;  1NE8 A;  2RB6 A;  4OB0 B;  1UGR B;  3M59 A;  5KH6 A;  3VS0 A;  1YIJ T;  3X24 B;  4VUB A;  2CUD A;  5GAM d;  3BY7 A;  2PU9 B;  5M9O A;  1FWZ A;  4KRT A;  5D6W A;  2X3W D;  2CP6 A;  3DKM A;  2JXB A;  3GNG A;  4R55 A;  5GAO n;  5A0D A;  2FG0 A;  1JJ2 S;  2HQH A;  2A7Y A;  4BAC A;  3JB9 J;  2RQU A;  1G3W A;  1YP5 A;  4JJB A;  1IO6 A;  1M8M A;  4JLI A;  3RER A;  3I55 T;  1AZG B;  2HD0 A;  5D6X A;  4A4E A;  2EBP A;  1RAD B;  5LL6 S;  1W2B S;  1VQ8 T;  2LX7 A;  4PNO A;  1D0Z A;  3PGG A;  1IHW A;  1X6B A;  2QK0 A;  4Z89 A;  1G8X A;  4QQ6 A;  4GLM A;  5HK3 A;  4Q5W A;  2EGE A;  2KEA A;  4AFS C;  4E7H A;  2E4H A;  1QCF A;  1NEB A;  3CMA A;  2DNU A;  3D7S B;  4PL6 A;  2QQB A;  4QQG A;  1QWE A;  1UEB A;  4J9G A;  4J9E A;  2PTK A;  2RHI A;  3PT9 A;  4M75 B;  2HBP A;  2DL5 A;  1MMN A;  1D3B A;  5CQY A;  4A53 A;  3V7S A;  4RTT A;  1OPL A;  2RJD A;  4C8Q C;  1F1B B;  4MML A;  2MF2 A;  3QYH B;  4QVZ A;  3E2U A;  1YFN A;  2LVM A;  3GF5 A;  3H6Z A;  2O9S A;  3TSW A;  5IT9 E;  2RI2 A;  1KC8 U;  4XU2 A;  4M7A E;  5GMK m;  1OU8 A;  1KQS S;  1DJ7 B;  5LJ3 e;  2DRM A;  1T0J A;  3CCJ A;  2GFU A;  2GQV A;  2DM1 A;  2QQR A;  3CCV Q;  1OZ2 A;  4FIB A;  5GAN 2;  1TUC A;  4C8Q A;  5GAM j;  3JB9 H;  2NLU A;  3EG0 A;  3MKD A;  2C0T A;  4YTL A;  3HRT A;  2XG8 D;  3LGL A;  4PJM A;  4KBM B;  2LZ6 B;  4KH1 B;  3A8L B;  2QAS A;  2DD5 A;  5CO7 A;  1WI7 A;  1UHF A;  1GRI A;  3QWY A;  3M4G A;  1X69 A;  4Z8A A;  5GAN g;  1RLQ C;  4RMO A;  2JJ9 A;  2MMP A;  3QG1 A;  1EZZ B;  2ATC B;  4NL3 A;  2ECZ A;  3CC4 A;  1H3H A;  2RN8 A;  2KYM A;  4IUP A;  3E19 A;  4J5Y A;  5KYY A;  2VB6 A;  2E64 A;  1VOM A;  5FLX E;  4B6M A;  5FWB A;  1EIF A;  3UPU A;  2RQT A;  4KH0 B;  4HT8 A;  5IHK A;  3SWN B;  3OW2 S;  3FDR A;  3S3M A;  1B07 A;  4A63 B;  1M90 U;  1TUD A;  4F04 B;  1TG0 A;  1JJ2 A;  2O31 A;  2CZ6 B;  1U3O A;  2G6F X;  5KYX B;  4XTX A;  1VQ7 A;  4OMQ A;  1B34 A;  4Y92 A;  3LWH A;  1SPK A;  1OUL A;  2I0N A;  2CDT A;  1W2B A;  1YHQ A;  3I9Q A;  1GCP A;  3G6E A;  5HK0 A;  3JRZ A;  3CEY A;  2X51 A;  3HFN A;  3M0S A;  5I11 A;  2LJ1 A;  4M75 E;  3M0Q A;  3L1A A;  3TVT A;  4IKF A;  1XNI A;  2DET A;  2J7I A;  5IAY A;  2KT1 A;  4ORZ A;  4E47 A;  3DLL A;  1KIK A;  2RF0 A;  1S72 Q;  3NTK A;  2GNC A;  3SEM A;  5KYW A;  1LJO A;  1HXD A;  2DJZ A;  4IUQ A;  1U1T A;  1QCN A;  3OS5 A;  2OTJ A;  1M5Q 1;  4EMH A;  4JS5 A;  1GFC A;  3BDL A;  4N4G A;  1TUG B;  3I5R A;  1OQK A;  2CT3 A;  1R0C B;  4KUL A;  2RI3 A;  1ZSZ B;  2KBT A;  3M0R A;  1OX8 A;  1IRX A;  2RA2 A;  4ZN1 A;  1WXB A;  1BI3 A;  3OYM A;  4X9C A;  2EW3 A;  6AT1 B;  3PNW C;  3CC2 Q;  2K2M A;  2KRM A;  1FMV A;  2FPF A;  3CCM Q;  1RAH B;  1TTH B;  1QMC A;  1Y0M A;  3UT1 A;  5FU6 C;  3M4Y A;  2DZC A;  4K11 A;  5CCA A;  1PRM C;  3N5B B;  1K9M C;  2HEQ A;  1QVF S;  2XU8 A;  2HSE B;  4M75 G;  1P92 A;  1VQN A;  2LCC A;  2WSC E;  3MET A;  2ZPI B;  4JJD A;  3TQ7 P;  4ME7 A;  2YWW A;  3OMG A;  7AT1 B;  2AKK A;  2E12 A;  2YLC A;  1VQK A;  2COZ A;  2ESW A;  1TSF A;  2EPD A;  3PVL A;  3L2Z A;  4D6W A;  4A4G A;  2A36 A;  1SG5 A;  1MV3 A;  5LJ5 d;  3CCM T;  1C1A A;  1VUB A;  4XK8 E;  5GAN f;  1K8A C;  2QTX A;  1TH7 A;  2X4W A;  3R6O A;  1QP2 A;  1C6V X;  3JB9 D;  2DD4 A;  2FRY A;  1N27 A;  4PLL A;  3JCM d;  4FU6 A;  1D1C A;  4ELZ C;  2DIG A;  1XQH A;  4MDX A;  4RTU A;  2J6O A;  4QT7 A;  2CZ0 B;  4C8Q G;  2YT6 A;  1M2O A;  1ZBX A;  2QXF A;  2RNA A;  2X4J A;  2MCN A;  4P5N A;  1W70 A;  4C0D C;  1Z9Z A;  1PKS A;  3URG A;  2MWO A;  4BY6 C;  2CT4 A;  5GAN 8;  1K9M R;  3BFM A;  3OW2 A;  3RBB B;  1RAB B;  1I5L A;  4DQ2 A;  4XTW A;  4M7A F;  1VQ5 Q;  2CUB A;  4A4F A;  2X9H A;  3L42 A;  3CBP A;  4BDZ A;  3EHQ A;  4HA8 A;  2KI7 A;  4FCY A;  2NUT B;  3CCS A;  2DIL A;  1SEM A;  2HL3 A;  1M9S A;  2XDP A;  2M0Y A;  1K8A R;  3MEW A;  2X3X D;  4AG2 C;  4J8O A;  1IRE B;  3U23 A;  3RKX A;  1UFF A;  1KD1 U;  1PD1 A;  1ZUY A;  2JTM A;  3MHX A;  1PRL C;  4JRP A;  2QA4 A;  4M77 D;  1UGS B;  1M4Z A;  5GAO p;  4EMK B;  1VQ5 T;  5GMK e;  1WJQ A;  3PE0 A;  1JRI A;  4RTZ A;  2K5I A;  1TS9 A;  2OX7 A;  2LNH B;  5LJ5 j;  2F1L A;  2M51 A;  4LUD A;  4IUT A;  1ZX6 A;  2DTO A;  2LDM A;  3OYF A;  2PZ1 A;  3QII A;  4FYY B;  5EC7 A;  4CRI A;  4J9B A;  2EGA A;  1UG1 A;  2A3L A;  5C6S A;  3CCE A;  4E7J A;  2AZS A;  3OB9 A;  3H8Z A;  1K76 A;  1WIE A;  2KQW A;  2L3P A;  4PJO E;  1AOJ A;  2E3H A; 
#chains in the Genus database with same CATH homology
 4L5G A;  3OYH A;  1GXI E;  2QQ9 A;  2RK2 A;  2Y4X A;  3CCQ A;  5GAN 6;  2BKD N;  3GPL A;  3SD4 A;  1G3T A;  2EQJ A;  3HKS A;  5LJ5 f;  1QVF A;  3JSC A;  2KDS A;  4C8Q B;  3HHT B;  4JRI A;  3QBY A;  5J39 A;  5EG2 A;  2L3R A;  1Q86 C;  3EFR A;  5CKH A;  1VQ6 A;  2K57 A;  2O4X A;  3QZ5 B;  3X26 B;  3CCV A;  4ZGJ B;  2G3R A;  1Q86 U;  2V8I A;  1JBM A;  1NPP A;  5IN1 A;  3SB2 A;  3HRU A;  1VQM T;  3JCM c;  1VQN T;  3S6W A;  4E7L A;  1VQP T;  1VQ4 T;  3KBG A;  3M58 A;  3OYJ A;  3CCL T;  4RKU E;  2ZPH B;  1YJ9 A;  5DLO A;  4M78 A;  1MHN A;  2FB7 A;  1U1S A;  2P0P A;  4GLK A;  3SWN A;  3OYC A;  4FL6 A;  4BDY A;  4KUD K;  2VV5 A;  4M78 E;  3VYG A;  3L2Q A;  1NE8 A;  2RB6 A;  2MI6 A;  1QW1 A;  4OB0 B;  1VQK T;  4M75 F;  4HT9 A;  2H3J A;  4J6Y A;  1UGR B;  1YIT A;  3M59 A;  4OMF B;  5KH6 A;  4II1 A;  3I55 A;  1Y7X A;  3MEA A;  5J3B A;  3JCM X;  1FX7 A;  1YIJ T;  1H64 1;  3GIB A;  3X24 B;  2P0K A;  4VUB A;  2RH2 A;  1YI2 A;  4OGC A;  1NJI C;  3CCV T;  1I81 A;  3RKY A;  3F70 A;  1OZ3 A;  1YCY A;  2I2L A;  4IUV A;  5GAM d;  2DTH A;  2PU9 B;  3BY7 A;  1PSF A;  3CCU T;  1NJI U;  3C95 A;  2DK3 A;  5M9O A;  2EYQ A;  4XTU A;  1FWZ A;  2K5F A;  5D6W A;  3RES A;  3JB9 G;  5GAN 3;  4IUR A;  5LJ3 g;  3DKM A;  4ZGD B;  3GNG A;  5GAO m;  4R55 A;  5CKB A;  5GAO n;  3WVD B;  5A0D A;  2EIF A;  3OMC A;  3CC7 A;  1JJ2 S;  2A7Y A;  3NTH A;  3J80 E;  4BAC A;  3JB9 J;  1N9S A;  4RG8 A;  1G3W A;  5I2S A;  3JCM b;  4PJO G;  4JLI A;  3OS2 A;  2VGN A;  3RER A;  3I55 T;  4XAX B;  3G4S A;  2HD0 A;  2K5L A;  3KXT A;  2ZPF B;  5D6X A;  4A4E A;  3CPW S;  1YI2 T;  4EMK C;  1VIF A;  3C12 A;  3P8D A;  3PIP A;  4MDW A;  5DLQ E;  5LL6 S;  1W2B S;  4MMK A;  1VQO A;  2PVO B;  1VQ8 T;  4M7D B;  2M16 A;  1Y96 A;  4LDU A;  2B8A A;  4PNO A;  3OYY A;  3X20 B;  3PGG A;  1UB4 A;  2KAF A;  3ZBD A;  2VUB A;  3OS1 A;  1G5V A;  2DPP B;  4QQ6 A;  3MEV A;  3PMI A;  5HK3 A;  2EQM A;  4Q5W A;  5CKD A;  3CCR T;  4M7A C;  4E7H A;  5HY6 A;  3RKW A;  4M78 G;  3CMA A;  4X34 A;  1B34 B;  2DXC A;  2P0Q A;  2OAU A;  1WQ7 A;  2QQB A;  4PL6 A;  4QQG A;  2K2V A;  4LDV A;  4EMK A;  5KCO A;  5J26 A;  1YJN T;  1UEB A;  3RUX A;  2RHI A;  3PT9 A;  1G3Y A;  4M75 B;  4OP0 A;  3Q1J A;  2HBP A;  3FRN A;  2R5M A;  4O6J A;  3LYI A;  3CCS T;  1D3B A;  5CQY A;  2M0O A;  3NFC A;  4A53 A;  3V7S A;  5LJ5 h;  2RJD A;  3C94 A;  4C8Q C;  3V7C A;  4JJN K;  4MML A;  2RO0 A;  3OYB A;  4F7U G;  2MF2 A;  3QYH B;  3O8V A;  4QVZ A;  4BE0 A;  1R8O B;  3GOX A;  4BY6 B;  4MZP A;  1KC8 C;  4M7A A;  3EFS A;  3H6Z A;  2LVM A;  3GF5 A;  4M77 G;  1WGS A;  2VXF A;  4C92 F;  5IT9 E;  2RI2 A;  4N4H A;  2F5T X;  1S72 A;  2HQX A;  4XU2 A;  2Y4Y A;  1KC8 U;  2MAM A;  3BW1 A;  5GMK m;  1KQS S;  4M7A E;  3OSS C;  5GAN h;  1DJ7 B;  3JCM W;  1FXX A;  4BB7 A;  4KUI A;  5LJ3 e;  3X28 B;  2QA4 T;  2XID A;  2X4Y A;  4L59 A;  3ZEH A;  2QDY B;  1QVG S;  3CCJ A;  2GFU A;  2M9U A;  4ZTF A;  2E41 A;  2L8D A;  2GQV A;  1VQN A;  3QSU A;  3FLG A;  3QYG B;  2LNV A;  2QQR A;  3VUB A;  2HNI A;  1YJW T;  1OZ2 A;  1NPR A;  1I8F A;  3QJ6 A;  4FIB A;  2AHJ B;  4M75 D;  4C8Q A;  5GAN 2;  2DXB A;  4M7D G;  5GAM j;  5GAN 4;  1N8R C;  1X75 C;  2X4X A;  3JB9 H;  2O01 E;  2NLU A;  3P8H A;  4C8Q E;  5FRN A;  3OY9 A;  1M1G A;  3ASK A;  5GMK h;  3M56 A;  2RM4 A;  1VQ9 A;  1S72 T;  2ZPG B;  5CR2 A;  1WQW A;  1Q7Y C;  1UGQ B;  3AHU A;  3CXC S;  3DB4 A;  4HCZ A;  4FSX A;  3ER0 A;  5DM7 R;  4PLI A;  3M53 A;  4YTL A;  3HRT A;  2E5Q A;  2XG8 D;  3LGL A;  5C0M A;  5GMK j;  1Q7Y U;  5LJ5 g;  3CC2 A;  3CCE T;  4ATO A;  4F7U F;  3L2R A;  2DXU A;  2FHD A;  4KBM B;  4XU3 A;  2YRV A;  4X9D A;  3CCM A;  2RK1 A;  5CKE A;  2K3X A;  2XDB A;  3HFO A;  3A8L B;  4M77 F;  4BI8 B;  2DD5 A;  2FVU A;  2L5Q A;  2RD1 A;  5CO7 A;  1KG1 A;  2LT4 A;  4N0A A;  1KHI A;  2X35 A;  4PJO B;  2OTL T;  3M4G A;  4MZM A;  5KE2 A;  4M7A D;  3V8J A;  5GAM f;  3CCQ T;  3JCM g;  5GAN g;  3FEO A;  4JRQ A;  4C0F A;  1YBY A;  4RMO A;  3MCA B;  2E10 A;  2XDD A;  2MMP A;  2JTF A;  3QG1 A;  4NL3 A;  1VQ6 T;  3CC2 T;  3CC4 A;  2F69 A;  2YLB A;  4IUP A;  2DVE A;  4M7D F;  3G71 A;  3L2V A;  3E9F A;  3E19 A;  4J5Y A;  3OS0 A;  4B9X A;  3DB3 A;  3G7Z A;  2DZ9 A;  3S3O A;  4A4H A;  4C92 B;  5FU6 B;  2E64 A;  2CYZ B;  5FLX E;  1YJ9 T;  4C8Q D;  4DOW A;  4J7F A;  1EIF A;  2XIC A;  3UPU A;  3QO3 A;  2E6Z A;  3OYK A;  4PKC C;  2CGH A;  3LWI A;  4HT8 A;  4M75 C;  2FL7 A;  3SWN B;  1YIT T;  2QQA A;  3OW2 S;  3FDR A;  3GNF B;  3S3M A;  5LJ3 f;  4A4K A;  1M90 C;  2JVV A;  5FRO A;  3PIO A;  1U8R A;  3QUI A;  5CAI A;  1M90 U;  1V29 B;  2EQK A;  3G71 T;  3OQ5 A;  5GAN 7;  1KQ1 A;  3RIR A;  2RHX A;  1JJ2 A;  5CQX A;  3V8L A;  3OYI A;  2CZ6 B;  4JRK A;  2EJ9 A;  2RJE A;  5LJ3 d;  4RCC A;  4XTX A;  2ZPB B;  1K73 C;  1VQ7 A;  3CC7 T;  3MO8 A;  1ZHI A;  1K73 U;  4F7U B;  3HPW A;  3CPW A;  1B34 A;  1Y07 A;  4TVR A;  3LWH A;  2VXE A;  4C5H A;  3PFS A;  4BI4 A;  4NOY A;  2PUK B;  2BIV A;  3S3N A;  4A54 A;  1W2B A;  4M77 B;  4C92 D;  4M75 A;  3JB9 F;  1YHQ A;  3G4S T;  4NL2 A;  3G6E A;  2XHC A;  3RMS A;  5HK0 A;  2RHZ A;  3JRZ A;  2IG0 A;  4XU0 A;  3ZFJ A;  3CEY A;  3HFN A;  5GAO q;  4M75 E;  5LJ5 e;  3BDU A;  2ZPE B;  4BD3 A;  4EDU A;  3L1A A;  4IKF A;  3L2W A;  2IVW A;  2V8K A;  1XNI A;  3LLR A;  1VQO T;  2QI2 A;  5IAY A;  3QPH A;  3OYN A;  3M5A A;  5KCH A;  3HP9 A;  4PJO F;  4E47 A;  3I56 A;  3DLL A;  2MWP A;  1PSE A;  1HK9 A;  2RHY A;  3NTK A;  1VQ5 A;  2PVG B;  1VQL A;  1Y96 B;  1ZQ1 A;  1RL2 A;  1LJO A;  3JB9 I;  1HXD A;  2DJZ A;  2EFI A;  2GFA A;  2R58 A;  3P8B B;  3CPF A;  4IUQ A;  1G3S A;  1U1T A;  5GAN e;  3OS5 A;  3JCM e;  2OTJ A;  1M5Q 1;  2JOY A;  3FIF A;  4EMH A;  4LDY A;  3BDL A;  4N4G A;  3E1S A;  4JS5 A;  4C0D B;  4HCC A;  4L6V 5;  3HSB A;  3CBM A;  3CME A;  3VJP A;  4JLG A;  3QHS A;  3CMA T;  4DOV A;  4KUL A;  4OB2 B;  3GLX A;  2DIQ A;  5CVI A;  2RI3 A;  2WSF E;  2QQS A;  2RJF A;  2LCL A;  1QVP A;  2DKG A;  3WXM B;  5CKF A;  3LGF A;  4N4I A;  3A8G B;  2RA2 A;  4ZN1 A;  1BI3 A;  1O75 A;  3FC3 A;  3OYM A;  1Y71 A;  2QEX A;  4M78 F;  5GAM h;  2VC8 A;  4X9C A;  3OA6 A;  3PNW C;  4Z02 A;  4LDX A;  2GCX A;  2KK4 A;  4MZT A;  3CD6 A;  1XTD A;  3VUZ A;  5A0G A;  1WPY A;  5GAO l;  4WF2 A;  4XQ3 A;  4Y28 E;  2XI9 A;  3OYG A;  3NTI A;  4C92 C;  5I21 A;  3UT1 A;  5FU6 C;  5A2Q E;  3M4Y A;  3VU3 C;  1N8R U;  2DZC A;  3CBO A;  4M7D D;  1QVG A;  2LX9 A;  5CCA A;  2LT1 A;  2RHU A;  3HRS A;  2CZ1 B;  4ZN3 A;  2ZCF B;  3MP8 A;  1Q81 C;  3N5B B;  3QZ9 B;  1K9M C;  1QVF S;  3J81 E;  4E7K A;  1N6A A;  2XU8 A;  4M75 G;  3M54 A;  1VQM A;  1P92 A;  1Q81 U;  4LDW A;  2LCC A;  4BE2 A;  2WSC E;  1VQP A;  3MET A;  1VQ4 A;  1K9M U;  2CZ7 B;  1X01 A;  2ZPI B;  4ZTJ A;  3CCL A;  3CCJ T;  4KT0 E;  2XD0 A;  4R56 A;  4B9W A;  3MP6 A;  4Y91 A;  1LOJ A;  4ME7 A;  3OMG A;  1LNX A;  3M55 A;  4O5V A;  5LJ3 h;  4EMG A;  3LH0 A;  4IUU A;  2E12 A;  2YLC A;  1KHC A;  3CXC A;  3QJY A;  1VQK A;  4OVA A;  3JCM Q;  4BI3 A;  5LJ3 j;  3L2Z A;  4D6W A;  2DEQ A;  2R57 A;  3QDR B;  4A4G A;  1YIJ A;  1VQ9 T;  1M8V A;  4QVD A;  2EJF A;  4C92 A;  3M9Q A;  4XTZ A;  2LQ8 A;  3TCJ A;  3UWN A;  5GAM g;  3CCU A;  2C06 A;  5LJ5 d;  4XTY A;  4OB3 B;  4C92 E;  1AHJ B;  3CCM T;  4JS4 A;  4V2S A;  4C5G A;  1KQ2 A;  4M7A G;  1VUB A;  5DY9 A;  3T9N A;  4M77 C;  2P4T A;  4XK8 E;  2O4X B;  2VYT A;  2QTX A;  1TH7 A;  3JCM f;  5GAN f;  3RMQ A;  2X4W A;  1K8A C;  1BI1 A;  2JZ2 A;  3OSV A;  3R6O A;  1QP2 A;  1K8A U;  2LTO A;  1N9R A;  5FU7 B;  1BKB A;  3OBW A;  3TRE A;  3UDC A;  2D6F A;  2DO3 A;  2LQK A;  2DD4 A;  4ELY C;  3E9G A;  4HKE A;  3JB9 D;  1N27 A;  4PLL A;  4QQD A;  4M78 B;  3JCM d;  2XKO C;  4FU6 A;  5GAN d;  4ELZ C;  3A8M B;  2EJG A;  2EAY A;  2VGM A;  2DIG A;  2WSE E;  5HKC A;  1XQH A;  1QP3 A;  3JAM E;  4MDX A;  3LX7 A;  2E70 A;  2DTI A;  2CZ0 B;  4C8Q G;  5CK9 A;  2DAQ A;  1ZBX A;  3CC4 T;  4M7D C;  1VQ8 A;  2QXF A;  4PJO D;  2WAC A;  1Q82 C;  2HQE A;  2X4J A;  3DLM A;  4C0G A;  4F7U A;  3A8H B;  4P5N A;  4QVC A;  3L2U A;  5I2M A;  4C0D C;  5GMK i;  5GMK l;  4C0Z A;  1Q82 U;  2KY9 A;  2R5A A;  2HAX A;  2LC4 A;  2MWO A;  3URG A;  1X6O A;  3INZ A;  4M77 A;  4BY6 C;  4F7U E;  5GAN 8;  2V8J A;  2Y90 A;  1BI0 A;  1OI1 A;  3BFM A;  3OW2 A;  2LRQ A;  5CIU A;  3OBY A;  4M77 E;  1I5L A;  1W4S A;  3OYE A;  3CCR A;  4RG2 A;  4DQ2 A;  4XTW A;  4M7A F;  4EPC A;  3ME9 A;  2ZZD A;  4A4F A;  3L42 A;  4BE1 A;  3CBP A;  4RCB A;  3PTA A;  1YJN A;  1M1K C;  2JUF A;  1NZ9 A;  4LD6 A;  4BDZ A;  3V7R A;  2OTL A;  1M1K U;  4HA8 A;  4M7D A;  4M78 D;  2EWN A;  2XK0 A;  2K4Y A;  3CCS A;  5D6Y A;  1BIA A;  2D9T A;  2E1H A;  4C92 G;  4M7D E;  1I4K 1;  1WJS A;  5KE3 A;  4C5I A;  1VQ7 T;  5FRM A;  5GAN 5;  1M9S A;  5A0L A;  2EQU A;  4C8Q F;  4ZGE B;  2OTJ T;  3FJP A;  2RI5 A;  2PVD B;  2XDP A;  4UC4 A;  4JUV A;  2E65 A;  1M1F A;  4DA4 A;  2CKK A;  3QXE B;  4BUG A;  2BUD A;  3JCM V;  2KVQ G;  4FT4 A;  3EAE A;  4C5E A;  1JB0 E;  1MGQ A;  3MEW A;  1KD1 C;  1YHQ T;  4J8O A;  4XTV A;  3G6E T;  1IRE B;  3KUF A;  2GF7 A;  3RKX A;  4FM4 B;  2CS7 A;  2K3Y A;  2RJC A;  4J6W A;  5GAM e;  1KD1 U;  3TEE A;  2JTM A;  3LW5 E;  5GAO r;  1IZ6 A;  3MHX A;  3GP8 A;  1O9S A;  1WJR A;  4JRP A;  3JCM J;  5L8R E;  2QA4 A;  3JCM P;  3V8K A;  4PJO C;  1BYM A;  4M77 D;  3OYA A;  1UGS B;  3I56 T;  1M4Z A;  5GAO p;  4JDS A;  4EMK B;  4E7I A;  2M1H A;  1VQ5 T;  3MEU A;  5GMK e;  1WJQ A;  3FB9 A;  1YJW A;  1VQL T;  1JRI A;  1H3Z A;  3VKI A;  2K5I A;  2F5K A;  3C4S A;  4XU1 A;  4NS5 A;  5AYF A;  2E6N A;  4GY5 A;  3HL8 A;  4HCB A;  4LD9 K;  2KMT A;  3OYD A;  1BIB A;  1VIE A;  3WVE B;  5LJ5 j;  1D3B B;  2PUO B;  4CI0 C;  1WNL A;  4J83 A;  4IUT A;  3X25 B;  1KQS A;  3CME T;  2DTO A;  2LDM A;  2JNG A;  2L89 A;  3A8O B;  3SDZ A;  3QII A;  3OYF A;  2YHT A;  4CRI A;  3TU4 K;  2DXT A;  3OYL A;  4J6X A;  4QW2 A;  3JCM h;  2A3L A;  3MP1 A;  5C6S A;  3CCE A;  3VYH B;  3QKJ A;  4FT2 A;  4E7J A;  2JN0 A;  1RI0 A;  2PQW A;  5FU7 C;  3OB9 A;  3H8Z A;  4M7A B;  3VV0 A;  1UGP B;  1OYX A;  3J7A F;  2D0Q B;  4OGE A;  4OB1 B;  5GAN j;  4J7I A;  4M78 C;  4N0A C;  2QEX T;  4PJO A;  3SWN C;  2KQW A;  2FYK A;  2KSS A;  3A5Z B;  3PMT A;  1SSF A;  3SFM A;  3CD6 T;  1XOV A;  4PJO E;  2EKO A;  4OF1 A;  1BI2 A;  3M57 A;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...