4EPCA

Crystal structure of autolysin repeat domains from staphylococcus epidermidis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
152
structure length
141
Chain Sequence
b'NNQLTVTNNSGVAQINANSGLYTTVYDTKGKTTNQIQRTLSVTAATLGDFYLVGDYNTGTNYGWVQDEVIYNTASPVKINQTYNVPGVLHTVPWGTYNQVAGTVSGKGDQTFKATQQQIDATYLYGTVNGKSGWISYYLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylmuramoyl-L-alanine amidase
molecule tags Hydrolase
source organism Staphylococcus epidermidis
publication title Ligand-binding properties and conformational dynamics of autolysin repeat domains in staphylococcal cell wall recognition.
pubmed doi rcsb
total genus 23
structure length 141
sequence length 152
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13457 GW GW (Gly-Tryp) dipeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA01
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA02
4EPCA 1M9SA
chains in the Genus database with same CATH superfamily
2EQUA 3FEOA 4RKUE 2VUBA 1TG0A 1VYVA 2YRVA 1K9MU 1VQLA 4KUIA 4LDUA 4BDYA 3QDRB 2JXBA 1MMDA 2LCSA 2HZYA 5LJ5g 3CCET 1KQ1A 2RHXA 4HCCA 3BDLA 3OYHA 1JEGA 2GTOA 2KYBA 1JJ2P 4M7AA 3RKWA 4AFSC 5LJ3f 3VYHB 2HMAA 2JNGA 5GAMg 2LT4A 3VS1A 2CT4A 4ME7A 2EBPA 3ME9A 3CCQQ 2D9TA 2YXYA 3I56T 4RTXA 2ROLA 2KQWA 2EKOA 3PMIA 1VYUA 5KYWB 5IXBA 3BDUA 4L5GA 4C92D 3BY7A 1VIFA 1ARKA 2XG8D 1BI3A 1VQOQ 4NS5A 4ZN3A 3KXTA 3HL8A 4RTYA 1K8AR 3JCMP 1UB4A 2D8HA 2RQWA 1Y0MA 2VYTA 9ATCB 1FWZA 5FRNA 1UDLA 1WHJA 2SRCA 5FROA 1TUDA 2A36A 1OULA 4XTWA 2JOYA 3QWYA 2DRKA 3CCEA 3A98A 2O4XA 2DXTA 4WF2A 4OB2B 3JCMh 2CUBA 2DETA 1ABQA 1X6BA 1UGVA 2HQHA 2D0NA 2DBKA 4QQGA 3A8LB 3HRSA 3CC2A 1ZSZA 1U5SA 3KUFA 1I5LA 2FPEA 3EG3A 2LZ6B 3Q1JA 2EWNA 3CBOA 4X9CA 3JB9F 3RR6A 2JTFA 3CC4A 2K79A 1Q7YU 3M0SA 3CQTA 4J83A 5GAOm 4JLGA 2XDBA 1KD1U 3KBGA 5FW9A 3GPLA 4DOWA 2X4XA 4WCIA 1QKXA 3LX7A 2X4WA 3H9NA 3CC2T 3VJPA 1NJIU 4FT4A 1I4K1 2LTOA 1GXIE 1M1KU 4EDUA 1G8XA 2M51A 2ZPBB 1D09B 1DJ7B 3PIPA 1RAAB 1X2KA 4F7UE 1VQ8Q 3OYJA 3L2QA 1OOTA 4IIMA 1MMNA 2EYQA 1UHCA 1GBRA 1IO6A 1VQLQ 4A4KA 3L42A 3EGXB 1PKTA 2CP0A 1VQ4T 3C12A 4FW2A 4A63B 2AIRB 1WYXA 2M0OA 4F14A 1MMAA 3FJPA 4M7DA 5GAN5 2E3HA 4FYYB 1QCNA 5DY9A 4C8QC 1QWFA 1JXMA 1TXQA 1W2BA 1VQMT 1C1AA 2L3RA 4HCKA 2PQWA 1K4US 1KJWA 5J26A 4R55A 5GAOp 1OZ2A 3DB4A 3E19A 2GF7A 3CCVT 2VXFA 4EPCA 2H3EB 3I9QA 4PJOG 1WI7A 2DK3A 3OS5A 4NL3A 1I81A 1XOVA 2DEQA 4E7JA 2FO0A 2KRNA 3EH1A 5DLQE 4HVUA 1YITT 4RMOA 2DFUA 5A0LA 5HKCA 1N27A 2ZCFB 1YFNA 2QTVA 1RAHB 1OX8A 2CP2A 2L5QA 2M02A 3VS3A 5C0MA 5HY6A 2NUPA 3H8ZA 2K5IA 3FRNA 2E10A 2AK5A 4PJOF 3GP8A 2WSEE 2BUDA 1ZUUA 2QK0A 4M78B 2JN0A 3RMSA 3G6ET 1VQ6Q 1HJDA 5IAYA 1NM7A 2RHUA 1MGQA 3CCEQ 5L23A 3M53A 5KYUA 1QMCA 2KT1A 3ER0A 1G2BA 2EJGA 4J5YA 1YWOA 2G3RA 4C8QG 1UEBA 4XU2A 3VS2A 4HA8A 4J7FA 1SEMA 1W1FA 1WGSA 4L59A 1UGSB 5CKEA 3VS5A 2V1RA 3RDVA 3X24B 1RL2A 1WA7A 2K7AA 3OYYA 3J80E 2M16A 2MWOA 3I56Q 3V8JA 3G71A 3P8DA 2YDLA 2E6ZA 3GF5A 2DF6A 2DE0X 3PNWC 5HK0A 2RK2A 3BE3A 3MP8A 5LJ3g 4Y91A 1T0HA 1JJ2S 4JJDA 1SSHA 3SD4A 3DKMA 5KCHA 4RTWA 1Q81U 1KQSA 1TTHB 5GANd 1BYMA 1WHHA 2JJ9A 5GAN6 1YITA 3CC4T 5GAMj 4J9IA 3OYLA 8AT1B 2QQ9A 4VUBA 2ECZA 2EW3A 2K57A 2EVRA 1NEBA 2QXFA 2COWA 3NPFA 3OW2A 2VWFA 2XU8A 3LGLA 2YUNA 3QG1A 2J6KA 2E1HA 5GMKj 3VYGA 1W4SA 4FU6A 1VIEA 2DD4A 2RD1A 1VQ9Q 2YLCA 3E1SA 1PNJA 1BBZA 1U1SA 3JCMc 4ESRA 5C6SA 3MCAB 2EIFA 5I21A 2MI6A 4QQDA 1VQNA 3OMCA 1GCPA 2AZSA 5LJ3d 4HT9A 2RJCA 5GAN2 3JCMb 4WTOB 3JCMV 1VQPQ 1BCOA 3NHNA 3SHWA 2DZCA 5IN1A 3OSVA 4N4HA 4KGVB 4A4GA 3INZA 1WJRA 1M1FA 4M75F 3D7SB 1D3BA 2DL8A 2XICA 3CMET 1EX4A 2O4XB 2JTMA 5GAOn 4JJNK 4B9WA 3VKIA 1B3QA 3VS7A 2DX1A 3PT9A 1Y57A 2CP3A 3EGDB 3SWNC 2RB6A 2RPNA 4M77B 5LJ3j 3V8LA 1Q82C 4BI3A 4DA4A 3C94A 1ZSZB 2I0NA 3JB9H 3OQ5A 4F7UA 5LJ5j 2I2LA 4LD6A 2J06A 3JSCA 3JCMf 3JCMX 4R0KA 3EH2A 1YWPA 1I07A 4OMPA 4RTUA 1MNDA 2KR3A 3CCUA 4BACA 4D8KA 1G3YA 1YP5A 3ASKA 2HD0A 1YJWQ 4XK8E 1Q86R 3QYGB 2GFUA 2FRYA 5KYYB 2HL5C 2FL7A 2K3YA 4LNPA 1ACMB 3HFOA 2DL5A 2RHIA 1TWBA 3G6EA 4M77F 3FDRA 3ZFJA 5GJWB 3P8BB 2LJ1A 5GAOl 1QVPA 4XAXB 4J9BA 4GY5A 1CKAA 3X20B 3G7ZA 2LMJA 5D6WA 2E12A 2H3JA 2B86A 3GBQA 4ZN1A 1MV3A 5KCOA 1Q7YR 3M9QA 1X01A 1UHFA 1GBQA 1VQLT 2BZXA 3ZL7C 4FYXB 2VV5A 1YJWT 1X43A 4M7DB 2V8IA 2EQKA 4Q5WA 1YJNQ 2KEAA 1UGQB 4A4HA 5LJ5e 3HP9A 4HVVA 4BY6C 3QBYA 2CP7A 1WPYA 1QCOA 2ZPEB 2FZCB 5IHNA 3OA6A 1G3WA 3OYIA 1U1TA 3N5BB 3RMQA 4J6XA 2D1XA 2KRSA 2MWPA 3JRZA 4O5VA 1IXDA 1NPPA 3M58A 5HK3A 4M78E 4AFZC 4QVDA 4C92G 3PFSA 1ZUYA 3E2UA 3QSUA 3CCVQ 3OYEA 4LUDA 4LXCA 1LNXA 2YSQA 3VS0A 1VQ8A 3CCJA 3MJXA 3C95A 3UDCA 4RG8A 5IHIA 2JMCA 4Y28E 2PU9B 3CPWA 2O9VA 2E3IA 4M77E 3OY9A 3A8MB 1UTIA 5I22A 1P92A 2DILA 2JW4A 4OGCA 1U8RA 1RADB 3JB9I 2HAXA 3MPUB 2ED0A 1PWTA 2RQRA 5FU7B 2COYA 2VC8A 2BTTA 5CO7A 4M78A 3OS0A 1D1AA 2HL3A 1GCQA 2VB6A 3OW2S 3H0FA 5LJ5h 1N5ZA 6AT1B 1YCSB 3I5SA 3GIBA 3JCMQ 2NWMA 4F7UF 4PL6A 1FYNA 1K9AA 3IQLA 4D8DA 3GNGA 2FZKB 1UJ0A 5AYFA 2CGHA 4JZ3A 4OMMA 4PK4A 4OMNA 2JM9A 4JS5A 4FYWB 1F1BB 1O9SA 1PG5B 4NOYA 4IUPA 1H3HA 2G6FX 4N4IA 3CCQA 2AKLA 3AT1B 4X1VA 1K0SA 1JB0E 3CCMA 3QZ9B 4M7AB 2RNAA 4J6WA 1K73C 1QVGA 5I11A 3LGFA 4F04B 4PKCC 2O31A 4M75E 2QDLA 5L8RE 2COZA 2YUPA 3HFNA 4KGZB 3HSBA 1R8OB 1BI2A 5GMKe 3H41A 4C0GA 2XHCA 2PVOB 1M8VA 3CCRA 3TQ7P 2RJFA 3NTKA 1VQOA 2LQNA 1WJQA 3CCUT 4C92E 1QVGP 4Z88A 1HXDA 4F17A 4E7KA 1AZEA 5LJ3h 1T3LA 4CI0C 3V8KA 1M3AA 1N8RR 2FEIA 3I5RA 4PLLA 4LDWA 2PUOB 1VQ4A 5CVIA 1ZBXA 1YIJQ 4AG2C 4ZTFA 4M75G 1VQKT 1OZ3A 2K2MA 1VUBA 1M3CA 2L3PA 3OYAA 3VS4A 2PNIA 1PRLC 2A28A 2P0KA 1IHWA 3QWXX 3VUBA 1QVGS 4IUQA 3JB9J 2QASA 2Y4XA 5AT1B 1VYTA 2L2PA 1QW1A 2GGRA 3LLRA 4M78G 3CCMT 2K5LA 3VU3C 1VQ6T 3JV3A 4ORZA 2P84A 4CRIA 4E47A 4EIKA 3UF4A 4LDXA 4HCZA 1GL5A 3CCRT 1SPKA 1SG5A 5GANh 5LJ3e 2RHYA 5GAN3 1WXUA 2RF0A 1AZGB 3CCLA 1K9MR 3H0HA 2PVGB 4JDSA 3JCMe 4GLMA 1E6GA 1VQ9T 4BY6B 1KHIA 1OEBA 2PZ1A 1IZ6A 3I55T 3NMZC 3EGDA 3WVEB 4ZNXA 1ZQ1A 2RI2A 1RI0A 5CKHA 2DD5A 2NUZA 2CZ7B 4OVAA 2YUQA 4B9XA 2CKKA 2CS7A 1Q81C 3CCMQ 2QGFB 2DXUA 3CPWS 3SEMA 2EKHA 1TH7A 3MEUA 3CCJT 1IREB 2BZ8A 1HD3A 2BE7D 1NEGA 1M8MA 3VRZA 2DVEA 4KH1B 1FMWA 1YHQA 3X26B 3G6EQ 1VQKA 1RAGB 3EGXA 1JRIA 5KE2A 1BIBA 1QVFA 3CBMA 2BZYA 3G1JA 3G4SA 5KYYA 2XDPA 2E5KA 1RABB 4XQ3A 3NGPA 5FU6B 3GLXA 3ZBDA 1K8AC 4FYVB 2OTJQ 2HEQA 1XTDA 2EQIA 2F2WA 2RK1A 3OW2P 2X35A 1V29B 2ZZDA 2ENMA 1M3BA 2DVJA 2P4TA 4F16A 4OP0A 1ZLMA 1SSFA 4AFQC 1D0ZA 1MNEA 1AT1B 3CXCA 3CCRQ 4E7IA 4XU3A 4FL6A 5GAMh 4LE9A 3I35A 2VKNA 4BE0A 2A3LA 2KDSA 4GLKA 2SEMA 3QJ6A 5EG2A 1GFCA 2MAMA 3DLLA 3CXCS 1ZSZC 2F69A 1VQMA 1X6OA 3OBYA 3OMGA 3CCQT 1B07A 1B34A 1JJ2A 3M57A 1CKBA 1D0XA 1K76A 3OB9A 3R6OA 3JB9D 1OU8A 1WDXA 1TS9A 4DEYA 2JT4A 2M0YA 2AT1B 2MF2A 2YRDA 4BE1A 1K9MC 2VASA 1QQJA 3X28B 4KT0E 4ZGEB 2EPDA 3MEAA 2QYZA 5GAMe 1M90U 4JLIA 2BE9B 1YJ9Q 1W2BS 4IUTA 4A4EA 1VQ5T 1YHQQ 2F1LA 3S3MA 3WXMB 2DA9A 4JS4A 2DIGA 3OYBA 4QW2A 2Z0WA 2EJFA 3I56A 2L3QA 2DYIA 2KGTA 4HT8A 1X2QA 3OYKA 1SHFA 3HHTB 4XTXA 1KFZA 1Y96B 5FLXE 2CSQA 4IUUA 3CMAA 1R0BG 2RQTA 1G83A 4DBHA 4Z8AA 2E65A 3MP1A 1TU0B 1YCYA 1K1ZA 1WLPB 3HRUA 3NFCA 4O6JA 1YJNT 2EYWA 3EFSA 1BU1A 2LX9A 1VQ7Q 4M78F 2D6FA 2CZ6B 1RLPC 1YITQ 4FSXA 4E7ZA 2XK0A 3CCSQ 3WVDB 4KUDK 1Y7XA 1LJOA 1U06A 3M5AA 4HVWA 3S3OA 3E9FA 4AT1B 4LDVA 3CBPA 4L6V5 1I8FA 1D1CA 3RKXA 5ECAA 2P0QA 2XIDA 1M9SA 2DERA 1BK2A 2RHZA 3O5ZA 1N9SA 3CCST 3PTAA 1B7TA 2DAQA 1PD0A 2GBQA 4M7DD 1KD1R 4II1A 3SFMA 2R5AA 2EQJA 2BIVA 3G71T 3P8HA 1N8RC 3JB9G 4IKFA 1QP3A 3CCLT 3MEWA 3RERA 4J6YA 1KK7A 4PJLA 4KRTA 4GBQA 1SKUB 2L89A 3S6WA 3TU4K 4M75C 2NYSA 3M55A 4C92B 3J7AF 1VQOT 1HK9A 3EFOB 1RACB 2P4RA 1YJNA 5FU6C 4C0DB 3CMEQ 4MMLA 1KIKA 4JPBW 3G4ST 4RCCA 1AEYA 3TCJA 4RUGA 2LDMA 4C5HA 3SWNB 5D6XA 4AG1C 2HQEA 1NG2A 4C92C 3DB3A 2RH2A 2D0QB 3SDZA 3QO3A 4M77C 2Y4YA 3CC4Q 2QQSA 1ZA2B 1EFNA 2ZAEA 5HCKA 3CPWP 4LD9K 1LPLA 2L8DA 2E5QA 3A8OB 3REAB 1OPLA 5FRMA 1TOVA 4M77A 2LJ3A 2RM4A 3FB9A 4FM4B 4M77D 4P5NA 1WJSA 5D7UA 2OI3A 4JRIA 3PVLA 4F7UB 3OYFA 2DM1A 4J8OA 3M4GA 2KXDA 1Q86C 3BFMA 2EGEA 3H0IA 1WQWA 3EHRA 3CCLQ 4MZMA 2A0FB 2HNIA 2V8KA 4M7AE 2DL4A 4C8QD 5FU7C 1OU9A 5GAN4 1KQ2A 2HQXA 2KT8A 4PJOC 1HSQA 2MPXC 3JCMd 1WZOA 2ESWA 2RI3A 2C0OA 1W2BP 4PLIA 2IPOB 4N0AC 4C92F 1VQKQ 2LNVA 5CKFA 4CC2A 2ATCB 2E70A 2QA4A 4OB3B 1TSFA 3QZ5B 2FYKA 1KHCA 3OS1A 4KULA 3HPWA 4PJMA 2ED1A 3UATA 1R0CB 4C0ZA 5CKDA 4M7DC 2DL7A 1YI2Q 1X6GA 1S72T 1VA7A 2B8AA 2LQWA 5KYXB 1VQ4Q 3HTRA 4XTZA 1KQSS 2LQ8A 1UGRB 3V7SA 1YJWA 2QGGA 2DZ9A 3TVTA 3CC7Q 2QEXA 4J9FA 1RI9A 2X3XD 4ZGDB 2EYZA 2KYMA 4DOVA 2OTJA 2V26A 3UWNA 1NBEB 5GAN7 1YJ9A 3RUXA 1IGUA 3M4YA 1NYGA 3QXEB 4C0FA 4QQ6A 4XTYA 8ATCB 2HCKA 4QKUA 3URGA 1NJIC 1M2VB 1VQ7A 3PIOA 2K6DA 4JRQA 3OS2A 2NUTB 1B34B 4M7AC 4OB1B 4RTTA 2RQUA 4HKEA 2ZPFB 1X69A 1IHVA 4CC4B 1PCXA 1AWXA 4E6RA 1W6XA 5GJVB 4M7AG 1PSFA 5IHKA 3MO8A 4QVCA 2X4YA 2K4YA 2LVMA 1LOJA 3M59A 3CCSA 2LC4A 3V7RA 1KC8U 4M75B 2E64A 3HRTA 4PJOE 1LCKA 5KE3A 3S3NA 3THKA 4XU1A 1H8KA 5J39A 3JAME 1Y96A 1Q82R 2MYSA 4J7IA 2KI7A 3PMTA 2CREA 3KFVA 4E7HA 1E7OA 1Y71A 2IVWA 3PGGA 1YIJA 2GNCA 1M4ZA 2O01E 3EGUA 2KROA 2RJDA 2DTOA 2J05A 4M7DE 3OSSC 3RESA 5LJ5f 1JQQA 1JXOA 2GQIA 3JCMg 1AVZC 2ZPGB 4MZPA 5GMKl 2JUFA 1N9RA 3OBWA 4XTUA 2RMOA 1V1CA 4C8QB 2EJ9A 4A54A 1KSWA 5LL6S 3I55A 4IUVA 1ZX6A 2K3BA 4JRKA 4X34A 3J81E 4Z02A 3QUIA 2FG0A 1UFFA 4EMHA 2RQVA 1X75C 1I1JA 5GANe 4OF1A 3QHSA 2DXBA 1NJIR 5IH2A 1XNIA 1OYXA 1Q82U 3M0RA 1C6VX 2YT6A 2CP6A 2CZ0B 2EFIA 2JS0A 2YWWA 1ZSGA 5GAN8 1PSEA 3QIIA 3A8HB 1ZHIA 1RAEB 1YI2A 1H3ZA 1WXTA 4B6MA 3L2UA 1PD1A 3QDFA 1XQHA 1OX9A 1YBYA 3TSWA 3CCVA 1K73U 4EMKC 1ZBJA 4PFZA 2AZVA 4JUVA 2YLBA 4ANJA 1QWEA 4J9CA 1WHLA 3EFOA 2KXCA 2K9GA 1MMGA 1EZZB 1PC0A 1WX6A 2DIQA 1M30A 4M4ZA 3TEEA 2GFAA 3EHQA 3NTHA 5GAOr 3UPUA 2EGCA 1FMVA 2EYYA 1BI1A 3JCMW 1AHJB 4M77G 1M27C 5DLOA 4LN2A 3M0QA 1WXBA 3A5ZB 2W0ZA 5GMKh 4ZGJB 3QPHA 2DO3A 2XI9A 1E6HA 1G3SA 2R58A 1QVFP 1QVFS 5CK9A 2OTLA 2KE9A 1WFWA 2OAWA 2W10A 1IRXA 2HKQB 2MK5A 1YI2T 2JM8A 1VQ7T 2WSFE 4MDXA 3TREA 3L2ZA 3L2VA 2K3XA 1M90R 3M0UA 5A2QE 3FJ5A 1JO8A 4M78D 1NYFA 2X51A 4BI4A 1UE9A 5CAIA 1QP2A 3VS6A 3CMAT 1KD1C 1R77A 4C8QE 3A1PA 4PFOA 2QEXQ 1CSKA 4KGXB 2MMPA 2XMFA 4BB7A 3G4SQ 3L2WA 2QQRA 1BB9A 2V1QA 3L1AA 4UC4A 5M9OA 1VQ9A 3FIFA 3OYGA 2MCNA 3EG2A 4DEXA 5GMKi 3BW1A 2O88A 4J9EA 3ZEHA 1WHMA 4NL2A 5GMKm 4RTVA 1X27A 2P0PA 4PJNA 2JZ2A 1RUWA 4DBQA 2L0AA 4F7UG 1NZ9A 2QDYB 3FLGA 1VQMQ 5KYNA 2J7IA 2KBTA 4EMKB 3VUZA 2FHDA 2DKGA 3CD6A 1AWWA 4R56A 2WSCE 4RCBA 2H8HA 2DEUA 3ULRB 4C5GA 2BKDN 2CH4W 1PM3A 3EG9A 2F2XA 3M0PA 1TUCA 2YUOA 4MZTA 4KBMB 2CSIA 1RAFB 2CYZB 5CIUA 2PTKA 1C0MA 3M0TA 4JRPA 3VRYA 4DBRA 2OJ2A 2DL3A 2QQBA 1OPKA 2DYBA 1SHGA 5CR2A 1RLQC 5CCAA 1SRMA 1PKSA 2K5FA 4PFPA 4ELYC 3M54A 5I2MA 1FX7A 3EG1A 2MIOA 2RN8A 4OMFB 4RTZA 2HSEB 1Q95G 1NE8A 2WACA 4PJOB 2FVUA 4KH0B 1M2VA 1UUEA 1AWJA 1O75A 2C06A 4DBFA 2DMOA 2OTLQ 2RJEA 2F5TX 4FIBA 3LH5A 2R5MA 2NUTA 3CPFA 1M90C 2CT3A 2O2OA 4A53A 1G5VA 1T0JA 3CC2Q 4V2SA 1QLYA 2LCLA 3M56A 4FT2A 2ZPIB 1SF9A 4QVZA 2CP5A 2NUPB 3EAEA 2AHJB 3MHXA 2KNBB 2HDAA 1VQ5Q 3CEYA 3RKYA 4YTLA 4DQ2A 4N4GA 2X4JA 1UJYA 2KRMA 2GCXA 4C8QF 5DM7R 4K11A 5CQXA 1BI0A 2PUKB 2XD0A 3CC7A 2VGMA 1VQ5A 3UA7A 1IB8A 2L3SA 5KYUB 2A08A 5D6YA 2LCCA 1TUGB 1AOJA 3OYDA 4MDWA 5A0DA 2IG0A 3CMAQ 4E7LA 1KQSP 2DTHA 2FPFA 2QAZA 1YIJT 4XTVA 3FC3A 2D8JA 2A37A 4TVRA 4LDYA 2NLUA 1FXXA 1Q81R 3U23A 4M7AF 3OYNA 2KSSA 2E4HA 3CC7T 1MUZA 2DJZA 3META 3MEVA 4C0DC 2MOXA 2CZ1B 4J9HA 3H6ZA 2XKOC 1YN8A 3UA6A 1Z9QA 2E41A 3LWHA 2RO0A 3LYIA 5KYWA 1VQNQ 1WHKA 1M5Q1 4C92A 4M7DG 1MHNA 4OB0B 4AFUC 3E9GA 1ZUKA 2LX7A 1VQPA 4Y92A 3SWNA 4HCBA 3CMEA 5KH6A 3I55Q 3VV0A 1XJWB 3T9NA 1M1KR 2C0TA 2HBWA 2LRQA 1GRIA 2GTJA 3C0CA 4LUEA 5FWBA 1K0XA 2EGAA 3LW5E 2LQKA 1OI1A 1VOMA 2M9UA 3MKDA 3EFRA 2K2VA 1PHTA 5GANg 1BKBA 1V76A 1VQNT 2YRCA 1A0NB 2KK4A 3RNJA 1K73R 3C4SA 3REBB 2LP5A 4BI8B 2KY9A 4FW1A 1D0YA 2QQAA 2F5KA 1HYOA 2J6OA 1M1GA 1D3BB 1NPRA 3F70A 4BE2A 2GQVA 1UGPB 1H92A 2Y90A 1BIAA 3AHUA 1U3OA 4FSSA 4D6WA 1VQPT 2X9HA 1Q86U 4M7AD 2ZGWA 4BDZA 5CQYA 1S1NA 4CC7A 2CUDA 3EG0A 5CKBA 5EC7A 4M7DF 4RG2A 2RA2A 4JJCA 1J3TA 3JCMJ 5FWCA 1KG1A 3PVQA 1NLPC 5J3BA 1ABOA 4IIOA 4XU0A 4C5IA 1WQ7A 2E6NA 2HBPA 4Z89A 2JMAA 1JU5C 2VGNA 4EMGA 2C0IA 4M75D 3L2RA 1PRMC 4J9GA 1I0CA 3RIRA 3OYMA 4N0AA 2JTEA 1H641 2HKNA 1Q7YC 2KAFA 5KYXA 2OAUA 3A8GB 5I2SA 2CDTA 2HSPA 1T3SA 1LVKA 4PJJA 4ATOA 4ZTJA 3CCUQ 1QKWA 3HKSA 4E7SA 3CD6Q 2JVVA 4JZ4A 4M78C 1YNZA 2RI5A 1QCFA 2VVKA 2PVDB 1AWOA 1SRLA 5A0GA 3DLMA 1M1KC 4J9DA 2FRWA 2LT1A 2EQMA 4A4FA 1OV3A 2EAYA 2JS2A 2O9SA 2XDDA 1S72Q 1AD5A 4EMKA 1WIEA 2QA4T 2AKKA 4JJBA 3UT1A 3EG9B 5GAOq 1WNLA 5GAMf 1KC8R 3CD6T 3X25B 3CXCP 2X3WD 2FB7A 1VQ8T 2QG9B 1D1BA 1FMKA 4E2FB 1S72A 3PE0A 2ROTA 2LNHB 4HXJA 2KVQG 3QKJA 1MV0B 3V7CA 1N6AA 2YHTA 2QA4Q 1EIFA 2QI2A 5GANf 1IGQA 1GCQC 2EYXA 4BUGA 3NTIA 2VXEA 2V8JA 2IIMA 1Z9ZA 2QEXT 2R57A 2DBMA 5LJ5d 4PJOA 2OTJT 2DXCA 1YJ9T 2FPDA 3MP6A 2DRMA 1VQ6A 1OQKA 5GAMd 4C5EA 5IT9E 1YHQT 1M2OA 2FZGB 4M75A 2CH4A 1BCMA 3QJYA 1UG1A 4OGEA 5GANj 2F2VA 1K8AU 1N8RU 2DJQA 3LH0A 2M1HA 3TSZA 3O8VA 2DTIA 4AMCA 4FCYA 1KC8C 2KMTA 3OYCA 7AT1B 1W70A 1G3TA 1RAIB 5IXFA 4BD3A 4QT7A 2J6FA 2LJ0A 2A7YA 4ELZC 4MMKA 1UECA 3CCJQ 2DPPB 1NLOC 1I5OB 3G71Q 2QTXA 1WHGA 3GOXA 4OMLA 2OX7A 2ABLA 2DNUA 3R6NA 4CC3A 3SB2A 2DLPA 1JBMA 1GFDA 3RBBB 1Y07A 4C8QA 4OMQA 4OMOA 4X9DA 4PNOA 2OTLT 4PJOD 2ZPHB 1ZA1B 3QYHB 3LWIA 4IURA 3GNFB
chains in the Genus database with same CATH topology
2P0QA 5GMKi 2EQUA 3BW1A 3HFOA 2RHIA 2XIDA 1M9SA 3FEOA 4RKUE 3ZEHA 2VUBA 2YRVA 4NL2A 5GMKm 4M77F 3G6EA 3FDRA 1K9MU 2RHZA 3ZFJA 1VQLA 2P0PA 5GAOl 3P8BB 4KUIA 1QVPA 4LDUA 3QDRB 4BDYA 2JZ2A 1N9SA 4XAXB 4GY5A 5LJ5g 3CCST 3X20B 3PTAA 3CCET 1KQ1A 2DAQA 2RHXA 3G7ZA 4M7DD 4F7UG 4HCCA 1NZ9A 3BDLA 5D6WA 2E12A 2H3JA 3OYHA 2QDYB 3FLGA 4II1A 4M7AA 3RKWA 3SFMA 4EMKB 3VUZA 4ZN1A 2FHDA 2R5AA 2DKGA 5LJ3f 3CD6A 5KCOA 3VYHB 4R56A 2WSCE 3M9QA 4RCBA 2JNGA 1X01A 5GAMg 4C5GA 2EQJA 2BKDN 2BIVA 2LT4A 3G71T 3P8HA 1VQLT 1N8RC 4MZTA 4KBMB 3JB9G 4IKFA 2CYZB 4ME7A 1QP3A 3CCLT 3MEWA 5CIUA 3RERA 3ME9A 2VV5A 2D9TA 3I56T 1YJWT 4J6YA 4M7DB 2V8IA 2KQWA 4JRPA 2EKOA 3PMIA 2EQKA 4Q5WA 2L89A 2QQBA 1UGQB 3BDUA 4L5GA 4A4HA 4C92D 5LJ5e 3BY7A 3S6WA 5CR2A 1VIFA 4M75C 3HP9A 2XG8D 3M55A 1BI3A 3TU4K 4C92B 5CCAA 1VQOT 1HK9A 3J7AF 4BY6C 3GNFB 3QBYA 2K5FA 1WPYA 4NS5A 2ZPEB 4ELYC 4ZN3A 3M54A 5FU6C 1FX7A 5I2MA 1YJNA 4C0DB 4MMLA 3OA6A 3KXTA 1G3WA 3HL8A 3G4ST 4RCCA 1U1TA 3N5BB 4OMFB 3OYIA 3RMQA 4J6XA 3TCJA 2LDMA 4C5HA 1NE8A 3SWNB 2MWPA 1UB4A 2WACA 5D6XA 3JRZA 4O5VA 3JCMP 4PJOB 1NPPA 2FVUA 2HQEA 2VYTA 3M58A 5HK3A 1FWZA 5FRNA 4M78E 4C92C 3DB3A 4QVDA 2RH2A 2D0QB 3SDZA 4C92G 1O75A 3QO3A 5FROA 2C06A 4XTWA 4M77C 2Y4YA 3PFSA 2JOYA 3QSUA 2RJEA 2QQSA 3CCEA 2F5TX 4FIBA 4LD9K 2R5MA 2O4XA 2DXTA 3CPFA 3OYEA 1M90C 1LNXA 4WF2A 4OB2B 3JCMh 1VQ8A 2L8DA 3CCJA 3C95A 3UDCA 4RG8A 2E5QA 4A53A 1G5VA 4Y28E 3A8OB 4V2SA 2PU9B 5FRMA 2LCLA 3M56A 4M77A 3CPWA 2RM4A 4QQGA 4M77E 3FB9A 3OY9A 3A8MB 4FM4B 4FT2A 2ZPIB 3A8LB 4M77D 4P5NA 1P92A 1WJSA 4OGCA 3HRSA 4QVZA 4JRIA 1U8RA 3CC2A 3KUFA 3EAEA 1I5LA 2AHJB 3JB9I 2HAXA 3MHXA 4F7UB 3OYFA 4J8OA 5FU7B 2VC8A 3M4GA 3Q1JA 3CEYA 2EWNA 3RKYA 4YTLA 5CO7A 4DQ2A 1Q86C 3BFMA 3CBOA 4X9CA 3JB9F 4M78A 3OS0A 4N4GA 2X4JA 2JTFA 3CC4A 2GCXA 4C8QF 5DM7R 3OW2S 1WQWA 1Q7YU 5LJ5h 5CQXA 4J83A 1BI0A 2PUKB 4MZMA 2HNIA 2V8KA 5GAOm 4JLGA 2XD0A 4M7AE 3CC7A 2VGMA 4C8QD 1KD1U 1VQ5A 2XDBA 5FU7C 3GIBA 3KBGA 3JCMQ 4F7UF 5GAN4 3GPLA 1KQ2A 2HQXA 4DOWA 2X4XA 4PL6A 5D6YA 3LX7A 2X4WA 4PJOC 2LCCA 3JCMd 3CC2T 3VJPA 3GNGA 1NJIU 2RI3A 4FT4A 1I4K1 2LTOA 1GXIE 3OYDA 4MDWA 4PLIA 5A0DA 1M1KU 2IG0A 4EDUA 4N0AC 4C92F 5AYFA 4E7LA 2CGHA 2ZPBB 2LNVA 2DTHA 1DJ7B 5CKFA 3PIPA 1YIJT 4XTVA 3FC3A 2E70A 2QA4A 4JS5A 4OB3B 3QZ5B 4TVRA 4F7UE 3OYJA 4LDYA 3L2QA 2NLUA 1FXXA 2FYKA 1O9SA 1KHCA 4NOYA 3OS1A 4KULA 4M7AF 3OYNA 4IUPA 3HPWA 4N4IA 3CCQA 2EYQA 2KSSA 1JB0E 3CCMA 3QZ9B 4M7AB 4C0ZA 3CC7T 5CKDA 4M7DC 4A4KA 4J6WA 2DJZA 1K73C 1QVGA 3META 1S72T 3L42A 3LGFA 3MEVA 4PKCC 4M75E 1VQ4T 4C0DC 2B8AA 3C12A 5L8RE 2CZ1B 4XTZA 3HFNA 3HSBA 1KQSS 2LQ8A 1R8OB 1UGRB 3H6ZA 3V7SA 1YJWA 1BI2A 2XKOC 2DZ9A 5GMKe 2M0OA 4C0GA 2XHCA 2PVOB 3FJPA 1M8VA 3CCRA 2QEXA 4M7DA 2E41A 3LWHA 2RO0A 3LYIA 4ZGDB 2RJFA 3NTKA 5GAN5 1VQOA 5DY9A 1WJQA 3CCUT 4C8QC 4DOVA 4C92E 1HXDA 1M5Q1 4C92A 4M7DG 4E7KA 2OTJA 3UWNA 1W2BA 5LJ3h 5GAN7 1VQMT 1YJ9A 2L3RA 1MHNA 2PQWA 4OB0B 3E9GA 4CI0C 3RUXA 3V8KA 1VQPA 3M4YA 3QXEB 4PLLA 4LDWA 4C0FA 2PUOB 4QQ6A 1VQ4A 5CVIA 4XTYA 3SWNA 4HCBA 1ZBXA 3CMEA 5J26A 4R55A 5KH6A 5GAOp 4ZTFA 1OZ2A 3URGA 3DB4A 3VV0A 4M75G 3E19A 3T9NA 1OZ3A 1VQKT 1NJIC 1VUBA 2GF7A 2LRQA 3CCVT 3OYAA 1VQ7A 2VXFA 2P0KA 3PIOA 4EPCA 4JRQA 4PJOG 2DK3A 3OS5A 3VUBA 4NL3A 1I81A 1XOVA 3OS2A 1QVGS 3LW5E 4IUQA 3JB9J 2Y4XA 1B34B 2LQKA 2DEQA 4E7JA 4M7AC 1OI1A 5DLQE 4OB1B 2M9UA 1YITT 1QW1A 2K2VA 3EFRA 4RMOA 5GANg 1BKBA 4HKEA 5A0LA 5HKCA 1N27A 1VQNT 2ZPFB 2KK4A 2ZCFB 3LLRA 4M78G 3CCMT 2L5QA 4M7AG 2K5LA 1PSFA 3VU3C 1VQ6T 3C4SA 5C0MA 5HY6A 3MO8A 4CRIA 4E47A 4QVCA 3H8ZA 2X4YA 2K5IA 4HCZA 2KY9A 3FRNA 4BI8B 3CCRT 2E10A 4LDXA 2K4YA 2LVMA 2QQAA 1LOJA 2F5KA 4PJOF 3GP8A 3M59A 5GANh 3CCSA 1M1GA 5LJ3e 2RHYA 5GAN3 2WSEE 2LC4A 3V7RA 2BUDA 3CCLA 1D3BB 1NPRA 1KC8U 4M78B 2JN0A 2PVGB 3F70A 3RMSA 4BE2A 4JDSA 3G6ET 4M75B 3JCMe 2E64A 2GQVA 3HRTA 1UGPB 4PJOE 5IAYA 2Y90A 1VQ9T 1BIAA 4BY6B 3AHUA 1KHIA 5KE3A 3S3NA 2RHUA 4D6WA 1IZ6A 4XU1A 1VQPT 1Q86U 1MGQA 2ZGWA 4M7AD 4M7DE 5J39A 3JAME 4BDZA 1Y96A 5CQYA 3M53A 3I55T 4J7IA 3WVEB 5CKBA 3ER0A 3PMTA 2EJGA 1ZQ1A 4M7DF 4J5YA 4RG2A 2RI2A 2RA2A 1RI0A 5CKHA 4E7HA 2DD5A 2G3RA 4C8QG 3JCMJ 2CZ7B 4OVAA 1Y71A 2IVWA 1UEBA 3PGGA 1YIJA 4XU2A 1KG1A 1M4ZA 4B9XA 4HA8A 4J7FA 2O01E 2CKKA 1WGSA 2CS7A 1Q81C 2RJDA 5J3BA 4L59A 2DTOA 1UGSB 4XU0A 1WQ7A 2DXUA 3OSSC 2E6NA 2HBPA 5CKEA 3RESA 3X24B 3CPWS 1RL2A 5LJ5f 1TH7A 3OYYA 3J80E 3MEUA 3CCJT 1IREB 2M16A 2MWOA 3JCMg 2ZPGB 4MZPA 2VGNA 3V8JA 4EMGA 3G71A 3P8DA 2E6ZA 3GF5A 2JUFA 1N9RA 3OBWA 3PNWC 4M75D 2DVEA 4XTUA 5GMKl 3L2RA 4C8QB 5HK0A 2RK2A 3MP8A 1YHQA 3X26B 4Y91A 5LJ3g 1VQKA 2EJ9A 3RIRA 4A54A 3OYMA 4N0AA 1JJ2S 5LL6S 3I55A 1H641 1JRIA 4IUVA 5KE2A 1Q7YC 1BIBA 1QVFA 3J81E 4X34A 2KAFA 3CBMA 4JRKA 2OAUA 4Z02A 3QUIA 3SD4A 3G4SA 3A8GB 3DKMA 5I2SA 5KCHA 1Q81U 1KQSA 2XDPA 5GANd 1BYMA 4XQ3A 5FU6B 4EMHA 3GLXA 3ZBDA 1K8AC 5GAN6 4ATOA 4ZTJA 1X75C 3HKSA 1YITA 3CC4T 2JVVA 5GANe 1XTDA 4M78C 4OF1A 2RI5A 5GAMj 2RK1A 3QHSA 3OYLA 2DXBA 2PVDB 2X35A 1V29B 2QQ9A 2ZZDA 4VUBA 5A0GA 3DLMA 1M1KC 2K57A 2P4TA 1XNIA 4OP0A 1OYXA 2LT1A 1Q82U 1SSFA 2EQMA 4A4FA 3CXCA 2QXFA 4E7IA 2CZ0B 2EAYA 2XDDA 4XU3A 2EFIA 2XU8A 4FL6A 3LGLA 5GAMh 3OW2A 3QG1A 4EMKA 2QA4T 5GMKj 2E1HA 5GAN8 3UT1A 4BE0A 2A3LA 2KDSA 5GAOq 4GLKA 3VYGA 1PSEA 1WNLA 5GAMf 3QIIA 1W4SA 3A8HB 3QJ6A 4FU6A 1ZHIA 5EG2A 3CD6T 2MAMA 1VIEA 2DD4A 2RD1A 3CXCS 3X25B 3DLLA 2YLCA 2FB7A 1YI2A 1VQ8T 1H3ZA 2F69A 1VQMA 1S72A 3L2UA 1X6OA 1XQHA 3E1SA 2KVQG 1U1SA 1YBYA 3QKJA 3V7CA 3JCMc 1N6AA 3OBYA 2YHTA 3OMGA 3CCQT 4EMKC 3CCVA 1K73U 1B34A 1JJ2A 5C6SA 4JUVA 3M57A 1EIFA 2YLBA 2QI2A 3MCAB 2EIFA 5I21A 5GANf 2MI6A 3OB9A 4QQDA 1VQNA 3R6OA 4BUGA 3NTIA 2VXEA 3OMCA 5LJ3d 2V8JA 3JB9D 4HT9A 2DIQA 2RJCA 2QEXT 5GAN2 2MF2A 4BE1A 2R57A 3TEEA 3JCMb 1K9MC 2GFAA 3NTHA 3X28B 5GAOr 3UPUA 3JCMV 4KT0E 4ZGEB 5LJ5d 4PJOA 2OTJT 2DXCA 3MEAA 2DZCA 5IN1A 1BI1A 3OSVA 5GAMe 1YJ9T 1M90U 4JLIA 1W2BS 3MP6A 4IUTA 3JCMW 1AHJB 4N4HA 4A4GA 4M77G 3INZA 1VQ6A 1WJRA 5DLOA 1M1FA 4A4EA 4M75F 5GAMd 1D3BA 1VQ5T 3A5ZB 4C5EA 3S3MA 3WXMB 4C5IA 5IT9E 1YHQT 4JS4A 5GMKh 2DIGA 4ZGJB 3OYBA 4M75A 2XICA 3QPHA 2DO3A 2XI9A 4QW2A 2O4XB 3CMET 3QJYA 4OGEA 2EJFA 2JTMA 5GAOn 3I56A 4JJNK 5GANj 4HT8A 4B9WA 3VKIA 1K8AU 1N8RU 3OYKA 1G3SA 3HHTB 3LH0A 2M1HA 4XTXA 2R58A 3PT9A 3O8VA 1QVFS 5CK9A 2DTIA 1Y96B 5FLXE 2OTLA 1KC8C 4IUUA 3SWNC 2KMTA 2RB6A 3OYCA 4M77B 5LJ3j 3V8LA 3CMAA 1G3TA 1Q82C 4BI3A 4DA4A 1YI2T 4BD3A 1VQ7T 3C94A 2WSFE 4MDXA 2A7YA 3L2ZA 3TREA 4ELZC 2K3XA 3L2VA 3JB9H 3OQ5A 4F7UA 4MMKA 2DPPB 2E65A 3MP1A 5LJ5j 5A2QE 2I2LA 2QTXA 1YCYA 4LD6A 4M78D 3GOXA 3JSCA 3HRUA 3NFCA 4O6JA 3JCMf 3JCMX 1YJNT 4BI4A 3SB2A 3EFSA 2LX9A 1JBMA 4M78F 5CAIA 2D6FA 1QP2A 1Y07A 2CZ6B 3CMAT 4C8QA 1KD1C 3CCUA 4C8QE 4FSXA 4BACA 2XK0A 3WVDB 4X9DA 1G3YA 4KUDK 1Y7XA 1LJOA 3M5AA 4PNOA 2OTLT 4PJOD 2MMPA 3ASKA 2HD0A 4BB7A 4XK8E 3QYGB 3L2WA 3E9FA 3S3OA 2QQRA 2ZPHB 4LDVA 3L1AA 2GFUA 3CBPA 4UC4A 3QYHB 5M9OA 1VQ9A 3FIFA 3OYGA 3LWIA 4L6V5 1I8FA 4IURA 3RKXA 2FL7A 2K3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EPC A;  1M9S A; 
#chains in the Genus database with same CATH topology
 2EQU A;  3FEO A;  4RKU E;  2VUB A;  1TG0 A;  1VYV A;  2YRV A;  1K9M U;  1VQL A;  4KUI A;  4LDU A;  4BDY A;  3QDR B;  2JXB A;  1MMD A;  2LCS A;  2HZY A;  5LJ5 g;  3CCE T;  1KQ1 A;  2RHX A;  4HCC A;  3BDL A;  3OYH A;  1JEG A;  2GTO A;  2KYB A;  1JJ2 P;  4M7A A;  3RKW A;  4AFS C;  5LJ3 f;  3VYH B;  2HMA A;  2JNG A;  5GAM g;  2LT4 A;  3VS1 A;  2CT4 A;  4ME7 A;  2EBP A;  3ME9 A;  3CCQ Q;  2D9T A;  2YXY A;  3I56 T;  4RTX A;  2ROL A;  2KQW A;  2EKO A;  3PMI A;  1VYU A;  5KYW B;  5IXB A;  3BDU A;  4L5G A;  4C92 D;  3BY7 A;  1VIF A;  1ARK A;  2XG8 D;  1BI3 A;  1VQO Q;  4NS5 A;  4ZN3 A;  3KXT A;  3HL8 A;  4RTY A;  1K8A R;  3JCM P;  1UB4 A;  2D8H A;  2RQW A;  1Y0M A;  2VYT A;  9ATC B;  1FWZ A;  5FRN A;  1UDL A;  1WHJ A;  2SRC A;  5FRO A;  1TUD A;  2A36 A;  1OUL A;  4XTW A;  2JOY A;  3QWY A;  2DRK A;  3CCE A;  3A98 A;  2O4X A;  2DXT A;  4WF2 A;  4OB2 B;  3JCM h;  2CUB A;  2DET A;  1ABQ A;  1X6B A;  1UGV A;  2HQH A;  2D0N A;  2DBK A;  4QQG A;  3A8L B;  3HRS A;  3CC2 A;  1ZSZ A;  1U5S A;  3KUF A;  1I5L A;  2FPE A;  3EG3 A;  2LZ6 B;  3Q1J A;  2EWN A;  3CBO A;  4X9C A;  3JB9 F;  3RR6 A;  2JTF A;  3CC4 A;  2K79 A;  1Q7Y U;  3M0S A;  3CQT A;  4J83 A;  5GAO m;  4JLG A;  2XDB A;  1KD1 U;  3KBG A;  5FW9 A;  3GPL A;  4DOW A;  2X4X A;  4WCI A;  1QKX A;  3LX7 A;  2X4W A;  3H9N A;  3CC2 T;  3VJP A;  1NJI U;  4FT4 A;  1I4K 1;  2LTO A;  1GXI E;  1M1K U;  4EDU A;  1G8X A;  2M51 A;  2ZPB B;  1D09 B;  1DJ7 B;  3PIP A;  1RAA B;  1X2K A;  4F7U E;  1VQ8 Q;  3OYJ A;  3L2Q A;  1OOT A;  4IIM A;  1MMN A;  2EYQ A;  1UHC A;  1GBR A;  1IO6 A;  1VQL Q;  4A4K A;  3L42 A;  3EGX B;  1PKT A;  2CP0 A;  1VQ4 T;  3C12 A;  4FW2 A;  4A63 B;  2AIR B;  1WYX A;  2M0O A;  4F14 A;  1MMA A;  3FJP A;  4M7D A;  5GAN 5;  2E3H A;  4FYY B;  1QCN A;  5DY9 A;  4C8Q C;  1QWF A;  1JXM A;  1TXQ A;  1W2B A;  1VQM T;  1C1A A;  2L3R A;  4HCK A;  2PQW A;  1K4U S;  1KJW A;  5J26 A;  4R55 A;  5GAO p;  1OZ2 A;  3DB4 A;  3E19 A;  2GF7 A;  3CCV T;  2VXF A;  4EPC A;  2H3E B;  3I9Q A;  4PJO G;  1WI7 A;  2DK3 A;  3OS5 A;  4NL3 A;  1I81 A;  1XOV A;  2DEQ A;  4E7J A;  2FO0 A;  2KRN A;  3EH1 A;  5DLQ E;  4HVU A;  1YIT T;  4RMO A;  2DFU A;  5A0L A;  5HKC A;  1N27 A;  2ZCF B;  1YFN A;  2QTV A;  1RAH B;  1OX8 A;  2CP2 A;  2L5Q A;  2M02 A;  3VS3 A;  5C0M A;  5HY6 A;  2NUP A;  3H8Z A;  2K5I A;  3FRN A;  2E10 A;  2AK5 A;  4PJO F;  3GP8 A;  2WSE E;  2BUD A;  1ZUU A;  2QK0 A;  4M78 B;  2JN0 A;  3RMS A;  3G6E T;  1VQ6 Q;  1HJD A;  5IAY A;  1NM7 A;  2RHU A;  1MGQ A;  3CCE Q;  5L23 A;  3M53 A;  5KYU A;  1QMC A;  2KT1 A;  3ER0 A;  1G2B A;  2EJG A;  4J5Y A;  1YWO A;  2G3R A;  4C8Q G;  1UEB A;  4XU2 A;  3VS2 A;  4HA8 A;  4J7F A;  1SEM A;  1W1F A;  1WGS A;  4L59 A;  1UGS B;  5CKE A;  3VS5 A;  2V1R A;  3RDV A;  3X24 B;  1RL2 A;  1WA7 A;  2K7A A;  3OYY A;  3J80 E;  2M16 A;  2MWO A;  3I56 Q;  3V8J A;  3G71 A;  3P8D A;  2YDL A;  2E6Z A;  3GF5 A;  2DF6 A;  2DE0 X;  3PNW C;  5HK0 A;  2RK2 A;  3BE3 A;  3MP8 A;  5LJ3 g;  4Y91 A;  1T0H A;  1JJ2 S;  4JJD A;  1SSH A;  3SD4 A;  3DKM A;  5KCH A;  4RTW A;  1Q81 U;  1KQS A;  1TTH B;  5GAN d;  1BYM A;  1WHH A;  2JJ9 A;  5GAN 6;  1YIT A;  3CC4 T;  5GAM j;  4J9I A;  3OYL A;  8AT1 B;  2QQ9 A;  4VUB A;  2ECZ A;  2EW3 A;  2K57 A;  2EVR A;  1NEB A;  2QXF A;  2COW A;  3NPF A;  3OW2 A;  2VWF A;  2XU8 A;  3LGL A;  2YUN A;  3QG1 A;  2J6K A;  2E1H A;  5GMK j;  3VYG A;  1W4S A;  4FU6 A;  1VIE A;  2DD4 A;  2RD1 A;  1VQ9 Q;  2YLC A;  3E1S A;  1PNJ A;  1BBZ A;  1U1S A;  3JCM c;  4ESR A;  5C6S A;  3MCA B;  2EIF A;  5I21 A;  2MI6 A;  4QQD A;  1VQN A;  3OMC A;  1GCP A;  2AZS A;  5LJ3 d;  4HT9 A;  2RJC A;  5GAN 2;  3JCM b;  4WTO B;  3JCM V;  1VQP Q;  1BCO A;  3NHN A;  3SHW A;  2DZC A;  5IN1 A;  3OSV A;  4N4H A;  4KGV B;  4A4G A;  3INZ A;  1WJR A;  1M1F A;  4M75 F;  3D7S B;  1D3B A;  2DL8 A;  2XIC A;  3CME T;  1EX4 A;  2O4X B;  2JTM A;  5GAO n;  4JJN K;  4B9W A;  3VKI A;  1B3Q A;  3VS7 A;  2DX1 A;  3PT9 A;  1Y57 A;  2CP3 A;  3EGD B;  3SWN C;  2RB6 A;  2RPN A;  4M77 B;  5LJ3 j;  3V8L A;  1Q82 C;  4BI3 A;  4DA4 A;  3C94 A;  1ZSZ B;  2I0N A;  3JB9 H;  3OQ5 A;  4F7U A;  5LJ5 j;  2I2L A;  4LD6 A;  2J06 A;  3JSC A;  3JCM f;  3JCM X;  4R0K A;  3EH2 A;  1YWP A;  1I07 A;  4OMP A;  4RTU A;  1MND A;  2KR3 A;  3CCU A;  4BAC A;  4D8K A;  1G3Y A;  1YP5 A;  3ASK A;  2HD0 A;  1YJW Q;  4XK8 E;  1Q86 R;  3QYG B;  2GFU A;  2FRY A;  5KYY B;  2HL5 C;  2FL7 A;  2K3Y A;  4LNP A;  1ACM B;  3HFO A;  2DL5 A;  2RHI A;  1TWB A;  3G6E A;  4M77 F;  3FDR A;  3ZFJ A;  5GJW B;  3P8B B;  2LJ1 A;  5GAO l;  1QVP A;  4XAX B;  4J9B A;  4GY5 A;  1CKA A;  3X20 B;  3G7Z A;  2LMJ A;  5D6W A;  2E12 A;  2H3J A;  2B86 A;  3GBQ A;  4ZN1 A;  1MV3 A;  5KCO A;  1Q7Y R;  3M9Q A;  1X01 A;  1UHF A;  1GBQ A;  1VQL T;  2BZX A;  3ZL7 C;  4FYX B;  2VV5 A;  1YJW T;  1X43 A;  4M7D B;  2V8I A;  2EQK A;  4Q5W A;  1YJN Q;  2KEA A;  1UGQ B;  4A4H A;  5LJ5 e;  3HP9 A;  4HVV A;  4BY6 C;  3QBY A;  2CP7 A;  1WPY A;  1QCO A;  2ZPE B;  2FZC B;  5IHN A;  3OA6 A;  1G3W A;  3OYI A;  1U1T A;  3N5B B;  3RMQ A;  4J6X A;  2D1X A;  2KRS A;  2MWP A;  3JRZ A;  4O5V A;  1IXD A;  1NPP A;  3M58 A;  5HK3 A;  4M78 E;  4AFZ C;  4QVD A;  4C92 G;  3PFS A;  1ZUY A;  3E2U A;  3QSU A;  3CCV Q;  3OYE A;  4LUD A;  4LXC A;  1LNX A;  2YSQ A;  3VS0 A;  1VQ8 A;  3CCJ A;  3MJX A;  3C95 A;  3UDC A;  4RG8 A;  5IHI A;  2JMC A;  4Y28 E;  2PU9 B;  3CPW A;  2O9V A;  2E3I A;  4M77 E;  3OY9 A;  3A8M B;  1UTI A;  5I22 A;  1P92 A;  2DIL A;  2JW4 A;  4OGC A;  1U8R A;  1RAD B;  3JB9 I;  2HAX A;  3MPU B;  2ED0 A;  1PWT A;  2RQR A;  5FU7 B;  2COY A;  2VC8 A;  2BTT A;  5CO7 A;  4M78 A;  3OS0 A;  1D1A A;  2HL3 A;  1GCQ A;  2VB6 A;  3OW2 S;  3H0F A;  5LJ5 h;  1N5Z A;  6AT1 B;  1YCS B;  3I5S A;  3GIB A;  3JCM Q;  2NWM A;  4F7U F;  4PL6 A;  1FYN A;  1K9A A;  3IQL A;  4D8D A;  3GNG A;  2FZK B;  1UJ0 A;  5AYF A;  2CGH A;  4JZ3 A;  4OMM A;  4PK4 A;  4OMN A;  2JM9 A;  4JS5 A;  4FYW B;  1F1B B;  1O9S A;  1PG5 B;  4NOY A;  4IUP A;  1H3H A;  2G6F X;  4N4I A;  3CCQ A;  2AKL A;  3AT1 B;  4X1V A;  1K0S A;  1JB0 E;  3CCM A;  3QZ9 B;  4M7A B;  2RNA A;  4J6W A;  1K73 C;  1QVG A;  5I11 A;  3LGF A;  4F04 B;  4PKC C;  2O31 A;  4M75 E;  2QDL A;  5L8R E;  2COZ A;  2YUP A;  3HFN A;  4KGZ B;  3HSB A;  1R8O B;  1BI2 A;  5GMK e;  3H41 A;  4C0G A;  2XHC A;  2PVO B;  1M8V A;  3CCR A;  3TQ7 P;  2RJF A;  3NTK A;  1VQO A;  2LQN A;  1WJQ A;  3CCU T;  4C92 E;  1QVG P;  4Z88 A;  1HXD A;  4F17 A;  4E7K A;  1AZE A;  5LJ3 h;  1T3L A;  4CI0 C;  3V8K A;  1M3A A;  1N8R R;  2FEI A;  3I5R A;  4PLL A;  4LDW A;  2PUO B;  1VQ4 A;  5CVI A;  1ZBX A;  1YIJ Q;  4AG2 C;  4ZTF A;  4M75 G;  1VQK T;  1OZ3 A;  2K2M A;  1VUB A;  1M3C A;  2L3P A;  3OYA A;  3VS4 A;  2PNI A;  1PRL C;  2A28 A;  2P0K A;  1IHW A;  3QWX X;  3VUB A;  1QVG S;  4IUQ A;  3JB9 J;  2QAS A;  2Y4X A;  5AT1 B;  1VYT A;  2L2P A;  1QW1 A;  2GGR A;  3LLR A;  4M78 G;  3CCM T;  2K5L A;  3VU3 C;  1VQ6 T;  3JV3 A;  4ORZ A;  2P84 A;  4CRI A;  4E47 A;  4EIK A;  3UF4 A;  4LDX A;  4HCZ A;  1GL5 A;  3CCR T;  1SPK A;  1SG5 A;  5GAN h;  5LJ3 e;  2RHY A;  5GAN 3;  1WXU A;  2RF0 A;  1AZG B;  3CCL A;  1K9M R;  3H0H A;  2PVG B;  4JDS A;  3JCM e;  4GLM A;  1E6G A;  1VQ9 T;  4BY6 B;  1KHI A;  1OEB A;  2PZ1 A;  1IZ6 A;  3I55 T;  3NMZ C;  3EGD A;  3WVE B;  4ZNX A;  1ZQ1 A;  2RI2 A;  1RI0 A;  5CKH A;  2DD5 A;  2NUZ A;  2CZ7 B;  4OVA A;  2YUQ A;  4B9X A;  2CKK A;  2CS7 A;  1Q81 C;  3CCM Q;  2QGF B;  2DXU A;  3CPW S;  3SEM A;  2EKH A;  1TH7 A;  3MEU A;  3CCJ T;  1IRE B;  2BZ8 A;  1HD3 A;  2BE7 D;  1NEG A;  1M8M A;  3VRZ A;  2DVE A;  4KH1 B;  1FMW A;  1YHQ A;  3X26 B;  3G6E Q;  1VQK A;  1RAG B;  3EGX A;  1JRI A;  5KE2 A;  1BIB A;  1QVF A;  3CBM A;  2BZY A;  3G1J A;  3G4S A;  5KYY A;  2XDP A;  2E5K A;  1RAB B;  4XQ3 A;  3NGP A;  5FU6 B;  3GLX A;  3ZBD A;  1K8A C;  4FYV B;  2OTJ Q;  2HEQ A;  1XTD A;  2EQI A;  2F2W A;  2RK1 A;  3OW2 P;  2X35 A;  1V29 B;  2ZZD A;  2ENM A;  1M3B A;  2DVJ A;  2P4T A;  4F16 A;  4OP0 A;  1ZLM A;  1SSF A;  4AFQ C;  1D0Z A;  1MNE A;  1AT1 B;  3CXC A;  3CCR Q;  4E7I A;  4XU3 A;  4FL6 A;  5GAM h;  4LE9 A;  3I35 A;  2VKN A;  4BE0 A;  2A3L A;  2KDS A;  4GLK A;  2SEM A;  3QJ6 A;  5EG2 A;  1GFC A;  2MAM A;  3DLL A;  3CXC S;  1ZSZ C;  2F69 A;  1VQM A;  1X6O A;  3OBY A;  3OMG A;  3CCQ T;  1B07 A;  1B34 A;  1JJ2 A;  3M57 A;  1CKB A;  1D0X A;  1K76 A;  3OB9 A;  3R6O A;  3JB9 D;  1OU8 A;  1WDX A;  1TS9 A;  4DEY A;  2JT4 A;  2M0Y A;  2AT1 B;  2MF2 A;  2YRD A;  4BE1 A;  1K9M C;  2VAS A;  1QQJ A;  3X28 B;  4KT0 E;  4ZGE B;  2EPD A;  3MEA A;  2QYZ A;  5GAM e;  1M90 U;  4JLI A;  2BE9 B;  1YJ9 Q;  1W2B S;  4IUT A;  4A4E A;  1VQ5 T;  1YHQ Q;  2F1L A;  3S3M A;  3WXM B;  2DA9 A;  4JS4 A;  2DIG A;  3OYB A;  4QW2 A;  2Z0W A;  2EJF A;  3I56 A;  2L3Q A;  2DYI A;  2KGT A;  4HT8 A;  1X2Q A;  3OYK A;  1SHF A;  3HHT B;  4XTX A;  1KFZ A;  1Y96 B;  5FLX E;  2CSQ A;  4IUU A;  3CMA A;  1R0B G;  2RQT A;  1G83 A;  4DBH A;  4Z8A A;  2E65 A;  3MP1 A;  1TU0 B;  1YCY A;  1K1Z A;  1WLP B;  3HRU A;  3NFC A;  4O6J A;  1YJN T;  2EYW A;  3EFS A;  1BU1 A;  2LX9 A;  1VQ7 Q;  4M78 F;  2D6F A;  2CZ6 B;  1RLP C;  1YIT Q;  4FSX A;  4E7Z A;  2XK0 A;  3CCS Q;  3WVD B;  4KUD K;  1Y7X A;  1LJO A;  1U06 A;  3M5A A;  4HVW A;  3S3O A;  3E9F A;  4AT1 B;  4LDV A;  3CBP A;  4L6V 5;  1I8F A;  1D1C A;  3RKX A;  5ECA A;  2P0Q A;  2XID A;  1M9S A;  2DER A;  1BK2 A;  2RHZ A;  3O5Z A;  1N9S A;  3CCS T;  3PTA A;  1B7T A;  2DAQ A;  1PD0 A;  2GBQ A;  4M7D D;  1KD1 R;  4II1 A;  3SFM A;  2R5A A;  2EQJ A;  2BIV A;  3G71 T;  3P8H A;  1N8R C;  3JB9 G;  4IKF A;  1QP3 A;  3CCL T;  3MEW A;  3RER A;  4J6Y A;  1KK7 A;  4PJL A;  4KRT A;  4GBQ A;  1SKU B;  2L89 A;  3S6W A;  3TU4 K;  4M75 C;  2NYS A;  3M55 A;  4C92 B;  3J7A F;  1VQO T;  1HK9 A;  3EFO B;  1RAC B;  2P4R A;  1YJN A;  5FU6 C;  4C0D B;  3CME Q;  4MML A;  1KIK A;  4JPB W;  3G4S T;  4RCC A;  1AEY A;  3TCJ A;  4RUG A;  2LDM A;  4C5H A;  3SWN B;  5D6X A;  4AG1 C;  2HQE A;  1NG2 A;  4C92 C;  3DB3 A;  2RH2 A;  2D0Q B;  3SDZ A;  3QO3 A;  4M77 C;  2Y4Y A;  3CC4 Q;  2QQS A;  1ZA2 B;  1EFN A;  2ZAE A;  5HCK A;  3CPW P;  4LD9 K;  1LPL A;  2L8D A;  2E5Q A;  3A8O B;  3REA B;  1OPL A;  5FRM A;  1TOV A;  4M77 A;  2LJ3 A;  2RM4 A;  3FB9 A;  4FM4 B;  4M77 D;  4P5N A;  1WJS A;  5D7U A;  2OI3 A;  4JRI A;  3PVL A;  4F7U B;  3OYF A;  2DM1 A;  4J8O A;  3M4G A;  2KXD A;  1Q86 C;  3BFM A;  2EGE A;  3H0I A;  1WQW A;  3EHR A;  3CCL Q;  4MZM A;  2A0F B;  2HNI A;  2V8K A;  4M7A E;  2DL4 A;  4C8Q D;  5FU7 C;  1OU9 A;  5GAN 4;  1KQ2 A;  2HQX A;  2KT8 A;  4PJO C;  1HSQ A;  2MPX C;  3JCM d;  1WZO A;  2ESW A;  2RI3 A;  2C0O A;  1W2B P;  4PLI A;  2IPO B;  4N0A C;  4C92 F;  1VQK Q;  2LNV A;  5CKF A;  4CC2 A;  2ATC B;  2E70 A;  2QA4 A;  4OB3 B;  1TSF A;  3QZ5 B;  2FYK A;  1KHC A;  3OS1 A;  4KUL A;  3HPW A;  4PJM A;  2ED1 A;  3UAT A;  1R0C B;  4C0Z A;  5CKD A;  4M7D C;  2DL7 A;  1YI2 Q;  1X6G A;  1S72 T;  1VA7 A;  2B8A A;  2LQW A;  5KYX B;  1VQ4 Q;  3HTR A;  4XTZ A;  1KQS S;  2LQ8 A;  1UGR B;  3V7S A;  1YJW A;  2QGG A;  2DZ9 A;  3TVT A;  3CC7 Q;  2QEX A;  4J9F A;  1RI9 A;  2X3X D;  4ZGD B;  2EYZ A;  2KYM A;  4DOV A;  2OTJ A;  2V26 A;  3UWN A;  1NBE B;  5GAN 7;  1YJ9 A;  3RUX A;  1IGU A;  3M4Y A;  1NYG A;  3QXE B;  4C0F A;  4QQ6 A;  4XTY A;  8ATC B;  2HCK A;  4QKU A;  3URG A;  1NJI C;  1M2V B;  1VQ7 A;  3PIO A;  2K6D A;  4JRQ A;  3OS2 A;  2NUT B;  1B34 B;  4M7A C;  4OB1 B;  4RTT A;  2RQU A;  4HKE A;  2ZPF B;  1X69 A;  1IHV A;  4CC4 B;  1PCX A;  1AWX A;  4E6R A;  1W6X A;  5GJV B;  4M7A G;  1PSF A;  5IHK A;  3MO8 A;  4QVC A;  2X4Y A;  2K4Y A;  2LVM A;  1LOJ A;  3M59 A;  3CCS A;  2LC4 A;  3V7R A;  1KC8 U;  4M75 B;  2E64 A;  3HRT A;  4PJO E;  1LCK A;  5KE3 A;  3S3N A;  3THK A;  4XU1 A;  1H8K A;  5J39 A;  3JAM E;  1Y96 A;  1Q82 R;  2MYS A;  4J7I A;  2KI7 A;  3PMT A;  2CRE A;  3KFV A;  4E7H A;  1E7O A;  1Y71 A;  2IVW A;  3PGG A;  1YIJ A;  2GNC A;  1M4Z A;  2O01 E;  3EGU A;  2KRO A;  2RJD A;  2DTO A;  2J05 A;  4M7D E;  3OSS C;  3RES A;  5LJ5 f;  1JQQ A;  1JXO A;  2GQI A;  3JCM g;  1AVZ C;  2ZPG B;  4MZP A;  5GMK l;  2JUF A;  1N9R A;  3OBW A;  4XTU A;  2RMO A;  1V1C A;  4C8Q B;  2EJ9 A;  4A54 A;  1KSW A;  5LL6 S;  3I55 A;  4IUV A;  1ZX6 A;  2K3B A;  4JRK A;  4X34 A;  3J81 E;  4Z02 A;  3QUI A;  2FG0 A;  1UFF A;  4EMH A;  2RQV A;  1X75 C;  1I1J A;  5GAN e;  4OF1 A;  3QHS A;  2DXB A;  1NJI R;  5IH2 A;  1XNI A;  1OYX A;  1Q82 U;  3M0R A;  1C6V X;  2YT6 A;  2CP6 A;  2CZ0 B;  2EFI A;  2JS0 A;  2YWW A;  1ZSG A;  5GAN 8;  1PSE A;  3QII A;  3A8H B;  1ZHI A;  1RAE B;  1YI2 A;  1H3Z A;  1WXT A;  4B6M A;  3L2U A;  1PD1 A;  3QDF A;  1XQH A;  1OX9 A;  1YBY A;  3TSW A;  3CCV A;  1K73 U;  4EMK C;  1ZBJ A;  4PFZ A;  2AZV A;  4JUV A;  2YLB A;  4ANJ A;  1QWE A;  4J9C A;  1WHL A;  3EFO A;  2KXC A;  2K9G A;  1MMG A;  1EZZ B;  1PC0 A;  1WX6 A;  2DIQ A;  1M30 A;  4M4Z A;  3TEE A;  2GFA A;  3EHQ A;  3NTH A;  5GAO r;  3UPU A;  2EGC A;  1FMV A;  2EYY A;  1BI1 A;  3JCM W;  1AHJ B;  4M77 G;  1M27 C;  5DLO A;  4LN2 A;  3M0Q A;  1WXB A;  3A5Z B;  2W0Z A;  5GMK h;  4ZGJ B;  3QPH A;  2DO3 A;  2XI9 A;  1E6H A;  1G3S A;  2R58 A;  1QVF P;  1QVF S;  5CK9 A;  2OTL A;  2KE9 A;  1WFW A;  2OAW A;  2W10 A;  1IRX A;  2HKQ B;  2MK5 A;  1YI2 T;  2JM8 A;  1VQ7 T;  2WSF E;  4MDX A;  3TRE A;  3L2Z A;  3L2V A;  2K3X A;  1M90 R;  3M0U A;  5A2Q E;  3FJ5 A;  1JO8 A;  4M78 D;  1NYF A;  2X51 A;  4BI4 A;  1UE9 A;  5CAI A;  1QP2 A;  3VS6 A;  3CMA T;  1KD1 C;  1R77 A;  4C8Q E;  3A1P A;  4PFO A;  2QEX Q;  1CSK A;  4KGX B;  2MMP A;  2XMF A;  4BB7 A;  3G4S Q;  3L2W A;  2QQR A;  1BB9 A;  2V1Q A;  3L1A A;  4UC4 A;  5M9O A;  1VQ9 A;  3FIF A;  3OYG A;  2MCN A;  3EG2 A;  4DEX A;  5GMK i;  3BW1 A;  2O88 A;  4J9E A;  3ZEH A;  1WHM A;  4NL2 A;  5GMK m;  4RTV A;  1X27 A;  2P0P A;  4PJN A;  2JZ2 A;  1RUW A;  4DBQ A;  2L0A A;  4F7U G;  1NZ9 A;  2QDY B;  3FLG A;  1VQM Q;  5KYN A;  2J7I A;  2KBT A;  4EMK B;  3VUZ A;  2FHD A;  2DKG A;  3CD6 A;  1AWW A;  4R56 A;  2WSC E;  4RCB A;  2H8H A;  2DEU A;  3ULR B;  4C5G A;  2BKD N;  2CH4 W;  1PM3 A;  3EG9 A;  2F2X A;  3M0P A;  1TUC A;  2YUO A;  4MZT A;  4KBM B;  2CSI A;  1RAF B;  2CYZ B;  5CIU A;  2PTK A;  1C0M A;  3M0T A;  4JRP A;  3VRY A;  4DBR A;  2OJ2 A;  2DL3 A;  2QQB A;  1OPK A;  2DYB A;  1SHG A;  5CR2 A;  1RLQ C;  5CCA A;  1SRM A;  1PKS A;  2K5F A;  4PFP A;  4ELY C;  3M54 A;  5I2M A;  1FX7 A;  3EG1 A;  2MIO A;  2RN8 A;  4OMF B;  4RTZ A;  2HSE B;  1Q95 G;  1NE8 A;  2WAC A;  4PJO B;  2FVU A;  4KH0 B;  1M2V A;  1UUE A;  1AWJ A;  1O75 A;  2C06 A;  4DBF A;  2DMO A;  2OTL Q;  2RJE A;  2F5T X;  4FIB A;  3LH5 A;  2R5M A;  2NUT A;  3CPF A;  1M90 C;  2CT3 A;  2O2O A;  4A53 A;  1G5V A;  1T0J A;  3CC2 Q;  4V2S A;  1QLY A;  2LCL A;  3M56 A;  4FT2 A;  2ZPI B;  1SF9 A;  4QVZ A;  2CP5 A;  2NUP B;  3EAE A;  2AHJ B;  3MHX A;  2KNB B;  2HDA A;  1VQ5 Q;  3CEY A;  3RKY A;  4YTL A;  4DQ2 A;  4N4G A;  2X4J A;  1UJY A;  2KRM A;  2GCX A;  4C8Q F;  5DM7 R;  4K11 A;  5CQX A;  1BI0 A;  2PUK B;  2XD0 A;  3CC7 A;  2VGM A;  1VQ5 A;  3UA7 A;  1IB8 A;  2L3S A;  5KYU B;  2A08 A;  5D6Y A;  2LCC A;  1TUG B;  1AOJ A;  3OYD A;  4MDW A;  5A0D A;  2IG0 A;  3CMA Q;  4E7L A;  1KQS P;  2DTH A;  2FPF A;  2QAZ A;  1YIJ T;  4XTV A;  3FC3 A;  2D8J A;  2A37 A;  4TVR A;  4LDY A;  2NLU A;  1FXX A;  1Q81 R;  3U23 A;  4M7A F;  3OYN A;  2KSS A;  2E4H A;  3CC7 T;  1MUZ A;  2DJZ A;  3MET A;  3MEV A;  4C0D C;  2MOX A;  2CZ1 B;  4J9H A;  3H6Z A;  2XKO C;  1YN8 A;  3UA6 A;  1Z9Q A;  2E41 A;  3LWH A;  2RO0 A;  3LYI A;  5KYW A;  1VQN Q;  1WHK A;  1M5Q 1;  4C92 A;  4M7D G;  1MHN A;  4OB0 B;  4AFU C;  3E9G A;  1ZUK A;  2LX7 A;  1VQP A;  4Y92 A;  3SWN A;  4HCB A;  3CME A;  5KH6 A;  3I55 Q;  3VV0 A;  1XJW B;  3T9N A;  1M1K R;  2C0T A;  2HBW A;  2LRQ A;  1GRI A;  2GTJ A;  3C0C A;  4LUE A;  5FWB A;  1K0X A;  2EGA A;  3LW5 E;  2LQK A;  1OI1 A;  1VOM A;  2M9U A;  3MKD A;  3EFR A;  2K2V A;  1PHT A;  5GAN g;  1BKB A;  1V76 A;  1VQN T;  2YRC A;  1A0N B;  2KK4 A;  3RNJ A;  1K73 R;  3C4S A;  3REB B;  2LP5 A;  4BI8 B;  2KY9 A;  4FW1 A;  1D0Y A;  2QQA A;  2F5K A;  1HYO A;  2J6O A;  1M1G A;  1D3B B;  1NPR A;  3F70 A;  4BE2 A;  2GQV A;  1UGP B;  1H92 A;  2Y90 A;  1BIA A;  3AHU A;  1U3O A;  4FSS A;  4D6W A;  1VQP T;  2X9H A;  1Q86 U;  4M7A D;  2ZGW A;  4BDZ A;  5CQY A;  1S1N A;  4CC7 A;  2CUD A;  3EG0 A;  5CKB A;  5EC7 A;  4M7D F;  4RG2 A;  2RA2 A;  4JJC A;  1J3T A;  3JCM J;  5FWC A;  1KG1 A;  3PVQ A;  1NLP C;  5J3B A;  1ABO A;  4IIO A;  4XU0 A;  4C5I A;  1WQ7 A;  2E6N A;  2HBP A;  4Z89 A;  2JMA A;  1JU5 C;  2VGN A;  4EMG A;  2C0I A;  4M75 D;  3L2R A;  1PRM C;  4J9G A;  1I0C A;  3RIR A;  3OYM A;  4N0A A;  2JTE A;  1H64 1;  2HKN A;  1Q7Y C;  2KAF A;  5KYX A;  2OAU A;  3A8G B;  5I2S A;  2CDT A;  2HSP A;  1T3S A;  1LVK A;  4PJJ A;  4ATO A;  4ZTJ A;  3CCU Q;  1QKW A;  3HKS A;  4E7S A;  3CD6 Q;  2JVV A;  4JZ4 A;  4M78 C;  1YNZ A;  2RI5 A;  1QCF A;  2VVK A;  2PVD B;  1AWO A;  1SRL A;  5A0G A;  3DLM A;  1M1K C;  4J9D A;  2FRW A;  2LT1 A;  2EQM A;  4A4F A;  1OV3 A;  2EAY A;  2JS2 A;  2O9S A;  2XDD A;  1S72 Q;  1AD5 A;  4EMK A;  1WIE A;  2QA4 T;  2AKK A;  4JJB A;  3UT1 A;  3EG9 B;  5GAO q;  1WNL A;  5GAM f;  1KC8 R;  3CD6 T;  3X25 B;  3CXC P;  2X3W D;  2FB7 A;  1VQ8 T;  2QG9 B;  1D1B A;  1FMK A;  4E2F B;  1S72 A;  3PE0 A;  2ROT A;  2LNH B;  4HXJ A;  2KVQ G;  3QKJ A;  1MV0 B;  3V7C A;  1N6A A;  2YHT A;  2QA4 Q;  1EIF A;  2QI2 A;  5GAN f;  1IGQ A;  1GCQ C;  2EYX A;  4BUG A;  3NTI A;  2VXE A;  2V8J A;  2IIM A;  1Z9Z A;  2QEX T;  2R57 A;  2DBM A;  5LJ5 d;  4PJO A;  2OTJ T;  2DXC A;  1YJ9 T;  2FPD A;  3MP6 A;  2DRM A;  1VQ6 A;  1OQK A;  5GAM d;  4C5E A;  5IT9 E;  1YHQ T;  1M2O A;  2FZG B;  4M75 A;  2CH4 A;  1BCM A;  3QJY A;  1UG1 A;  4OGE A;  5GAN j;  2F2V A;  1K8A U;  1N8R U;  2DJQ A;  3LH0 A;  2M1H A;  3TSZ A;  3O8V A;  2DTI A;  4AMC A;  4FCY A;  1KC8 C;  2KMT A;  3OYC A;  7AT1 B;  1W70 A;  1G3T A;  1RAI B;  5IXF A;  4BD3 A;  4QT7 A;  2J6F A;  2LJ0 A;  2A7Y A;  4ELZ C;  4MMK A;  1UEC A;  3CCJ Q;  2DPP B;  1NLO C;  1I5O B;  3G71 Q;  2QTX A;  1WHG A;  3GOX A;  4OML A;  2OX7 A;  2ABL A;  2DNU A;  3R6N A;  4CC3 A;  3SB2 A;  2DLP A;  1JBM A;  1GFD A;  3RBB B;  1Y07 A;  4C8Q A;  4OMQ A;  4OMO A;  4X9D A;  4PNO A;  2OTL T;  4PJO D;  2ZPH B;  1ZA1 B;  3QYH B;  3LWI A;  4IUR A;  3GNF B; 
#chains in the Genus database with same CATH homology
 2P0Q A;  5GMK i;  2EQU A;  3BW1 A;  3HFO A;  2RHI A;  2XID A;  1M9S A;  3FEO A;  4RKU E;  3ZEH A;  2VUB A;  2YRV A;  4NL2 A;  5GMK m;  4M77 F;  3G6E A;  3FDR A;  1K9M U;  2RHZ A;  3ZFJ A;  1VQL A;  2P0P A;  5GAO l;  3P8B B;  4KUI A;  1QVP A;  4LDU A;  3QDR B;  4BDY A;  2JZ2 A;  1N9S A;  4XAX B;  4GY5 A;  5LJ5 g;  3CCS T;  3X20 B;  3PTA A;  3CCE T;  1KQ1 A;  2DAQ A;  2RHX A;  3G7Z A;  4M7D D;  4F7U G;  4HCC A;  1NZ9 A;  3BDL A;  5D6W A;  2E12 A;  2H3J A;  3OYH A;  2QDY B;  3FLG A;  4II1 A;  4M7A A;  3RKW A;  3SFM A;  4EMK B;  3VUZ A;  4ZN1 A;  2FHD A;  2R5A A;  2DKG A;  5LJ3 f;  3CD6 A;  5KCO A;  3VYH B;  4R56 A;  2WSC E;  3M9Q A;  4RCB A;  2JNG A;  1X01 A;  5GAM g;  4C5G A;  2EQJ A;  2BKD N;  2BIV A;  2LT4 A;  3G71 T;  3P8H A;  1VQL T;  1N8R C;  4MZT A;  4KBM B;  3JB9 G;  4IKF A;  2CYZ B;  4ME7 A;  1QP3 A;  3CCL T;  3MEW A;  5CIU A;  3RER A;  3ME9 A;  2VV5 A;  2D9T A;  3I56 T;  1YJW T;  4J6Y A;  4M7D B;  2V8I A;  2KQW A;  4JRP A;  2EKO A;  3PMI A;  2EQK A;  4Q5W A;  2L89 A;  2QQB A;  1UGQ B;  3BDU A;  4L5G A;  4A4H A;  4C92 D;  5LJ5 e;  3BY7 A;  3S6W A;  5CR2 A;  1VIF A;  4M75 C;  3HP9 A;  2XG8 D;  3M55 A;  1BI3 A;  3TU4 K;  4C92 B;  5CCA A;  1VQO T;  1HK9 A;  3J7A F;  4BY6 C;  3GNF B;  3QBY A;  2K5F A;  1WPY A;  4NS5 A;  2ZPE B;  4ELY C;  4ZN3 A;  3M54 A;  5FU6 C;  1FX7 A;  5I2M A;  1YJN A;  4C0D B;  4MML A;  3OA6 A;  3KXT A;  1G3W A;  3HL8 A;  3G4S T;  4RCC A;  1U1T A;  3N5B B;  4OMF B;  3OYI A;  3RMQ A;  4J6X A;  3TCJ A;  2LDM A;  4C5H A;  1NE8 A;  3SWN B;  2MWP A;  1UB4 A;  2WAC A;  5D6X A;  3JRZ A;  4O5V A;  3JCM P;  4PJO B;  1NPP A;  2FVU A;  2HQE A;  2VYT A;  3M58 A;  5HK3 A;  1FWZ A;  5FRN A;  4M78 E;  4C92 C;  3DB3 A;  4QVD A;  2RH2 A;  2D0Q B;  3SDZ A;  4C92 G;  1O75 A;  3QO3 A;  5FRO A;  2C06 A;  4XTW A;  4M77 C;  2Y4Y A;  3PFS A;  2JOY A;  3QSU A;  2RJE A;  2QQS A;  3CCE A;  2F5T X;  4FIB A;  4LD9 K;  2R5M A;  2O4X A;  2DXT A;  3CPF A;  3OYE A;  1M90 C;  1LNX A;  4WF2 A;  4OB2 B;  3JCM h;  1VQ8 A;  2L8D A;  3CCJ A;  3C95 A;  3UDC A;  4RG8 A;  2E5Q A;  4A53 A;  1G5V A;  4Y28 E;  3A8O B;  4V2S A;  2PU9 B;  5FRM A;  2LCL A;  3M56 A;  4M77 A;  3CPW A;  2RM4 A;  4QQG A;  4M77 E;  3FB9 A;  3OY9 A;  3A8M B;  4FM4 B;  4FT2 A;  2ZPI B;  3A8L B;  4M77 D;  4P5N A;  1P92 A;  1WJS A;  4OGC A;  3HRS A;  4QVZ A;  4JRI A;  1U8R A;  3CC2 A;  3KUF A;  3EAE A;  1I5L A;  2AHJ B;  3JB9 I;  2HAX A;  3MHX A;  4F7U B;  3OYF A;  4J8O A;  5FU7 B;  2VC8 A;  3M4G A;  3Q1J A;  3CEY A;  2EWN A;  3RKY A;  4YTL A;  5CO7 A;  4DQ2 A;  1Q86 C;  3BFM A;  3CBO A;  4X9C A;  3JB9 F;  4M78 A;  3OS0 A;  4N4G A;  2X4J A;  2JTF A;  3CC4 A;  2GCX A;  4C8Q F;  5DM7 R;  3OW2 S;  1WQW A;  1Q7Y U;  5LJ5 h;  5CQX A;  4J83 A;  1BI0 A;  2PUK B;  4MZM A;  2HNI A;  2V8K A;  5GAO m;  4JLG A;  2XD0 A;  4M7A E;  3CC7 A;  2VGM A;  4C8Q D;  1KD1 U;  1VQ5 A;  2XDB A;  5FU7 C;  3GIB A;  3KBG A;  3JCM Q;  4F7U F;  5GAN 4;  3GPL A;  1KQ2 A;  2HQX A;  4DOW A;  2X4X A;  4PL6 A;  5D6Y A;  3LX7 A;  2X4W A;  4PJO C;  2LCC A;  3JCM d;  3CC2 T;  3VJP A;  3GNG A;  1NJI U;  2RI3 A;  4FT4 A;  1I4K 1;  2LTO A;  1GXI E;  3OYD A;  4MDW A;  4PLI A;  5A0D A;  1M1K U;  2IG0 A;  4EDU A;  4N0A C;  4C92 F;  5AYF A;  4E7L A;  2CGH A;  2ZPB B;  2LNV A;  2DTH A;  1DJ7 B;  5CKF A;  3PIP A;  1YIJ T;  4XTV A;  3FC3 A;  2E70 A;  2QA4 A;  4JS5 A;  4OB3 B;  3QZ5 B;  4TVR A;  4F7U E;  3OYJ A;  4LDY A;  3L2Q A;  2NLU A;  1FXX A;  2FYK A;  1O9S A;  1KHC A;  4NOY A;  3OS1 A;  4KUL A;  4M7A F;  3OYN A;  4IUP A;  3HPW A;  4N4I A;  3CCQ A;  2EYQ A;  2KSS A;  1JB0 E;  3CCM A;  3QZ9 B;  4M7A B;  4C0Z A;  3CC7 T;  5CKD A;  4M7D C;  4A4K A;  4J6W A;  2DJZ A;  1K73 C;  1QVG A;  3MET A;  1S72 T;  3L42 A;  3LGF A;  3MEV A;  4PKC C;  4M75 E;  1VQ4 T;  4C0D C;  2B8A A;  3C12 A;  5L8R E;  2CZ1 B;  4XTZ A;  3HFN A;  3HSB A;  1KQS S;  2LQ8 A;  1R8O B;  1UGR B;  3H6Z A;  3V7S A;  1YJW A;  1BI2 A;  2XKO C;  2DZ9 A;  5GMK e;  2M0O A;  4C0G A;  2XHC A;  2PVO B;  3FJP A;  1M8V A;  3CCR A;  2QEX A;  4M7D A;  2E41 A;  3LWH A;  2RO0 A;  3LYI A;  4ZGD B;  2RJF A;  3NTK A;  5GAN 5;  1VQO A;  5DY9 A;  1WJQ A;  3CCU T;  4C8Q C;  4DOV A;  4C92 E;  1HXD A;  1M5Q 1;  4C92 A;  4M7D G;  4E7K A;  2OTJ A;  3UWN A;  1W2B A;  5LJ3 h;  5GAN 7;  1VQM T;  1YJ9 A;  2L3R A;  1MHN A;  2PQW A;  4OB0 B;  3E9G A;  4CI0 C;  3RUX A;  3V8K A;  1VQP A;  3M4Y A;  3QXE B;  4PLL A;  4LDW A;  4C0F A;  2PUO B;  4QQ6 A;  1VQ4 A;  5CVI A;  4XTY A;  3SWN A;  4HCB A;  1ZBX A;  3CME A;  5J26 A;  4R55 A;  5KH6 A;  5GAO p;  4ZTF A;  1OZ2 A;  3URG A;  3DB4 A;  3VV0 A;  4M75 G;  3E19 A;  3T9N A;  1OZ3 A;  1VQK T;  1NJI C;  1VUB A;  2GF7 A;  2LRQ A;  3CCV T;  3OYA A;  1VQ7 A;  2VXF A;  2P0K A;  3PIO A;  4EPC A;  4JRQ A;  4PJO G;  2DK3 A;  3OS5 A;  3VUB A;  4NL3 A;  1I81 A;  1XOV A;  3OS2 A;  1QVG S;  3LW5 E;  4IUQ A;  3JB9 J;  2Y4X A;  1B34 B;  2LQK A;  2DEQ A;  4E7J A;  4M7A C;  1OI1 A;  5DLQ E;  4OB1 B;  2M9U A;  1YIT T;  1QW1 A;  2K2V A;  3EFR A;  4RMO A;  5GAN g;  1BKB A;  4HKE A;  5A0L A;  5HKC A;  1N27 A;  1VQN T;  2ZPF B;  2KK4 A;  2ZCF B;  3LLR A;  4M78 G;  3CCM T;  2L5Q A;  4M7A G;  2K5L A;  1PSF A;  3VU3 C;  1VQ6 T;  3C4S A;  5C0M A;  5HY6 A;  3MO8 A;  4CRI A;  4E47 A;  4QVC A;  3H8Z A;  2X4Y A;  2K5I A;  4HCZ A;  2KY9 A;  3FRN A;  4BI8 B;  3CCR T;  2E10 A;  4LDX A;  2K4Y A;  2LVM A;  2QQA A;  1LOJ A;  2F5K A;  4PJO F;  3GP8 A;  3M59 A;  5GAN h;  3CCS A;  1M1G A;  5LJ3 e;  2RHY A;  5GAN 3;  2WSE E;  2LC4 A;  3V7R A;  2BUD A;  3CCL A;  1D3B B;  1NPR A;  1KC8 U;  4M78 B;  2JN0 A;  2PVG B;  3F70 A;  3RMS A;  4BE2 A;  4JDS A;  3G6E T;  4M75 B;  3JCM e;  2E64 A;  2GQV A;  3HRT A;  1UGP B;  4PJO E;  5IAY A;  2Y90 A;  1VQ9 T;  1BIA A;  4BY6 B;  3AHU A;  1KHI A;  5KE3 A;  3S3N A;  2RHU A;  4D6W A;  1IZ6 A;  4XU1 A;  1VQP T;  1Q86 U;  1MGQ A;  2ZGW A;  4M7A D;  4M7D E;  5J39 A;  3JAM E;  4BDZ A;  1Y96 A;  5CQY A;  3M53 A;  3I55 T;  4J7I A;  3WVE B;  5CKB A;  3ER0 A;  3PMT A;  2EJG A;  1ZQ1 A;  4M7D F;  4J5Y A;  4RG2 A;  2RI2 A;  2RA2 A;  1RI0 A;  5CKH A;  4E7H A;  2DD5 A;  2G3R A;  4C8Q G;  3JCM J;  2CZ7 B;  4OVA A;  1Y71 A;  2IVW A;  1UEB A;  3PGG A;  1YIJ A;  4XU2 A;  1KG1 A;  1M4Z A;  4B9X A;  4HA8 A;  4J7F A;  2O01 E;  2CKK A;  1WGS A;  2CS7 A;  1Q81 C;  2RJD A;  5J3B A;  4L59 A;  2DTO A;  1UGS B;  4XU0 A;  1WQ7 A;  2DXU A;  3OSS C;  2E6N A;  2HBP A;  5CKE A;  3RES A;  3X24 B;  3CPW S;  1RL2 A;  5LJ5 f;  1TH7 A;  3OYY A;  3J80 E;  3MEU A;  3CCJ T;  1IRE B;  2M16 A;  2MWO A;  3JCM g;  2ZPG B;  4MZP A;  2VGN A;  3V8J A;  4EMG A;  3G71 A;  3P8D A;  2E6Z A;  3GF5 A;  2JUF A;  1N9R A;  3OBW A;  3PNW C;  4M75 D;  2DVE A;  4XTU A;  5GMK l;  3L2R A;  4C8Q B;  5HK0 A;  2RK2 A;  3MP8 A;  1YHQ A;  3X26 B;  4Y91 A;  5LJ3 g;  1VQK A;  2EJ9 A;  3RIR A;  4A54 A;  3OYM A;  4N0A A;  1JJ2 S;  5LL6 S;  3I55 A;  1H64 1;  1JRI A;  4IUV A;  5KE2 A;  1Q7Y C;  1BIB A;  1QVF A;  3J81 E;  4X34 A;  2KAF A;  3CBM A;  4JRK A;  2OAU A;  4Z02 A;  3QUI A;  3SD4 A;  3G4S A;  3A8G B;  3DKM A;  5I2S A;  5KCH A;  1Q81 U;  1KQS A;  2XDP A;  5GAN d;  1BYM A;  4XQ3 A;  5FU6 B;  4EMH A;  3GLX A;  3ZBD A;  1K8A C;  5GAN 6;  4ATO A;  4ZTJ A;  1X75 C;  3HKS A;  1YIT A;  3CC4 T;  2JVV A;  5GAN e;  1XTD A;  4M78 C;  4OF1 A;  2RI5 A;  5GAM j;  2RK1 A;  3QHS A;  3OYL A;  2DXB A;  2PVD B;  2X35 A;  1V29 B;  2QQ9 A;  2ZZD A;  4VUB A;  5A0G A;  3DLM A;  1M1K C;  2K57 A;  2P4T A;  1XNI A;  4OP0 A;  1OYX A;  2LT1 A;  1Q82 U;  1SSF A;  2EQM A;  4A4F A;  3CXC A;  2QXF A;  4E7I A;  2CZ0 B;  2EAY A;  2XDD A;  4XU3 A;  2EFI A;  2XU8 A;  4FL6 A;  3LGL A;  5GAM h;  3OW2 A;  3QG1 A;  4EMK A;  2QA4 T;  5GMK j;  2E1H A;  5GAN 8;  3UT1 A;  4BE0 A;  2A3L A;  2KDS A;  5GAO q;  4GLK A;  3VYG A;  1PSE A;  1WNL A;  5GAM f;  3QII A;  1W4S A;  3A8H B;  3QJ6 A;  4FU6 A;  1ZHI A;  5EG2 A;  3CD6 T;  2MAM A;  1VIE A;  2DD4 A;  2RD1 A;  3CXC S;  3X25 B;  3DLL A;  2YLC A;  2FB7 A;  1YI2 A;  1VQ8 T;  1H3Z A;  2F69 A;  1VQM A;  1S72 A;  3L2U A;  1X6O A;  1XQH A;  3E1S A;  2KVQ G;  1U1S A;  1YBY A;  3QKJ A;  3V7C A;  3JCM c;  1N6A A;  3OBY A;  2YHT A;  3OMG A;  3CCQ T;  4EMK C;  3CCV A;  1K73 U;  1B34 A;  1JJ2 A;  5C6S A;  4JUV A;  3M57 A;  1EIF A;  2YLB A;  2QI2 A;  3MCA B;  2EIF A;  5I21 A;  5GAN f;  2MI6 A;  3OB9 A;  4QQD A;  1VQN A;  3R6O A;  4BUG A;  3NTI A;  2VXE A;  3OMC A;  5LJ3 d;  2V8J A;  3JB9 D;  4HT9 A;  2DIQ A;  2RJC A;  2QEX T;  5GAN 2;  2MF2 A;  4BE1 A;  2R57 A;  3TEE A;  3JCM b;  1K9M C;  2GFA A;  3NTH A;  3X28 B;  5GAO r;  3UPU A;  3JCM V;  4KT0 E;  4ZGE B;  5LJ5 d;  4PJO A;  2OTJ T;  2DXC A;  3MEA A;  2DZC A;  5IN1 A;  1BI1 A;  3OSV A;  5GAM e;  1YJ9 T;  1M90 U;  4JLI A;  1W2B S;  3MP6 A;  4IUT A;  3JCM W;  1AHJ B;  4N4H A;  4A4G A;  4M77 G;  3INZ A;  1VQ6 A;  1WJR A;  5DLO A;  1M1F A;  4A4E A;  4M75 F;  5GAM d;  1D3B A;  1VQ5 T;  3A5Z B;  4C5E A;  3S3M A;  3WXM B;  4C5I A;  5IT9 E;  1YHQ T;  4JS4 A;  5GMK h;  2DIG A;  4ZGJ B;  3OYB A;  4M75 A;  2XIC A;  3QPH A;  2DO3 A;  2XI9 A;  4QW2 A;  2O4X B;  3CME T;  3QJY A;  4OGE A;  2EJF A;  2JTM A;  5GAO n;  3I56 A;  4JJN K;  5GAN j;  4HT8 A;  4B9W A;  3VKI A;  1K8A U;  1N8R U;  3OYK A;  1G3S A;  3HHT B;  3LH0 A;  2M1H A;  4XTX A;  2R58 A;  3PT9 A;  3O8V A;  1QVF S;  5CK9 A;  2DTI A;  1Y96 B;  5FLX E;  2OTL A;  1KC8 C;  4IUU A;  3SWN C;  2KMT A;  2RB6 A;  3OYC A;  4M77 B;  5LJ3 j;  3V8L A;  3CMA A;  1G3T A;  1Q82 C;  4BI3 A;  4DA4 A;  1YI2 T;  4BD3 A;  1VQ7 T;  3C94 A;  2WSF E;  4MDX A;  2A7Y A;  3L2Z A;  3TRE A;  4ELZ C;  2K3X A;  3L2V A;  3JB9 H;  3OQ5 A;  4F7U A;  4MMK A;  2DPP B;  2E65 A;  3MP1 A;  5LJ5 j;  5A2Q E;  2I2L A;  2QTX A;  1YCY A;  4LD6 A;  4M78 D;  3GOX A;  3JSC A;  3HRU A;  3NFC A;  4O6J A;  3JCM f;  3JCM X;  1YJN T;  4BI4 A;  3SB2 A;  3EFS A;  2LX9 A;  1JBM A;  4M78 F;  5CAI A;  2D6F A;  1QP2 A;  1Y07 A;  2CZ6 B;  3CMA T;  4C8Q A;  1KD1 C;  3CCU A;  4C8Q E;  4FSX A;  4BAC A;  2XK0 A;  3WVD B;  4X9D A;  1G3Y A;  4KUD K;  1Y7X A;  1LJO A;  3M5A A;  4PNO A;  2OTL T;  4PJO D;  2MMP A;  3ASK A;  2HD0 A;  4BB7 A;  4XK8 E;  3QYG B;  3L2W A;  3E9F A;  3S3O A;  2QQR A;  2ZPH B;  4LDV A;  3L1A A;  2GFU A;  3CBP A;  4UC4 A;  3QYH B;  5M9O A;  1VQ9 A;  3FIF A;  3OYG A;  3LWI A;  4L6V 5;  1I8F A;  4IUR A;  3RKX A;  2FL7 A;  2K3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...