4EPCA

Crystal structure of autolysin repeat domains from staphylococcus epidermidis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
152
structure length
141
Chain Sequence
NNQLTVTNNSGVAQINANSGLYTTVYDTKGKTTNQIQRTLSVTAATLGDFYLVGDYNTGTNYGWVQDEVIYNTASPVKINQTYNVPGVLHTVPWGTYNQVAGTVSGKGDQTFKATQQQIDATYLYGTVNGKSGWISYYLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylmuramoyl-L-alanine amidase
publication title Ligand-binding properties and conformational dynamics of autolysin repeat domains in staphylococcal cell wall recognition.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 23
structure length 141
sequence length 152
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13457 GW GW (Gly-Tryp) dipeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA01
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA02
1M9SA 4EPCA
chains in the Genus database with same CATH superfamily
3G6EA 1TXQA 3JCMW 3EG9A 8AT1B 3H41A 1SF9A 3JRZA 3OYLA 3M9QA 5D6WA 2XKOC 2JN0A 4J5YA 1I81A 1ARKA 3CCQA 1VQ8Q 2G3RA 2QI2A 2K3YA 1K1ZA 2QG9B 1KC8U 3CD6Q 1AWXA 4NS5A 2DFUA 1YCSB 3VYGA 1K73U 5GAN7 1VQ9T 4DBRA 1KQ1A 4M75A 3VV0A 4J9EA 4O6JA 5I22A 1JO8A 2M9UA 3G4SA 2DXCA 1KG1A 5A0GA 1VQPA 1VQKA 1PRMC 4Y92A 1WA7A 4M7DE 1PG5B 2VB6A 4MMLA 5LJ5e 3QWXX 4DOWA 3UT1A 2DD4A 1JJ2S 3PVLA 4PLIA 1N9RA 1AWJA 4EMHA 2RQTA 4Z02A 5L8RE 3CCRA 3LW5E 3TREA 1VQ7Q 2JTFA 3OYCA 2OTLT 1WIEA 2V1RA 4M75C 2GFAA 3CCUT 2D0QB 2EJFA 2JTEA 1YIJT 4M7AF 2VV5A 3O8VA 1OU9A 3QDFA 1D0ZA 1RI9A 2DL8A 2RJCA 2KQWA 1ACMB 4OMPA 1R0BG 3NFCA 1DJ7B 2EBPA 2DX1A 2KXCA 1VQ6A 2GTJA 2LJ0A 2JM9A 4C92E 1G83A 2O01E 4C0DB 3I35A 2VYTA 2E41A 2OTJA 2CP7A 4IUTA 4DBQA 2DLPA 4J9FA 4LDXA 2HZYA 4M7DG 1TG0A 3JCMf 1G3YA 1UG1A 5GAN4 5HKCA 2E12A 1EZZB 2LDMA 5GAMf 3CCLA 5DY9A 4YTLA 2QQRA 1YBYA 5IHIA 3MEAA 3CCQQ 2X9HA 1ZSZB 2CH4A 4N4HA 3KUFA 4DA4A 1ZUYA 1OU8A 5KYXB 3OW2P 2P0KA 2YDLA 3MEWA 3O5ZA 3JB9G 2RO0A 3EG0A 4IKFA 2BIVA 1I07A 4C8QD 3CCVT 1LNXA 1G3SA 1OULA 2CKKA 2E3HA 1VQPQ 2YUQA 1PHTA 5I2MA 1YWOA 1VQKQ 2RHYA 2RQUA 2DL3A 1XOVA 3REBB 1G3WA 2OX7A 4RCBA 1MMAA 2RNAA 4E6RA 4M78E 3HFOA 4UC4A 1RUWA 1S72T 1JRIA 2M1HA 2K5IA 3EGDB 4RTUA 4RTVA 1VIFA 3EFOB 1R77A 3CXCA 1M2OA 3FJ5A 4C92G 1H3HA 3S3MA 2QA4T 1UGRB 2ZPGB 2D9TA 2EW3A 2KYBA 1SPKA 2JVVA 1VQLT 4Z8AA 1WPYA 2L3SA 1YJNA 5KYYB 1QW1A 4BDYA 3P8BB 4V2SA 3AT1B 4DBHA 3HRSA 2E6ZA 3OYBA 4M77D 4NOYA 1JB0E 1RAGB 3V7RA 2L8DA 4OB3B 1YP5A 2CP2A 2KT1A 3RERA 3J80E 3CMAA 2O31A 1KC8C 4BE2A 5IN1A 4J9IA 4AG2C 5GAN3 2YRVA 3I56A 2NUTB 3EG2A 3JCMg 1VQ6Q 3GBQA 4VUBA 4LD9K 4C5IA 4FL6A 4JUVA 1E6GA 2W0ZA 4M75G 3JV3A 3D7SB 4F7UF 4IUUA 1UGPB 2XK0A 5GAMj 4M7DB 2KXDA 4KH1B 4X1VA 1ZHIA 4JRQA 1ZQ1A 4M78G 3UA6A 2K5FA 4JLGA 2YRCA 5FWBA 4RMOA 2QDLA 4J7IA 1QVFS 3JB9F 2YHTA 1VYVA 1Q86U 2DBMA 1N8RR 3OB9A 3CCST 4JZ4A 3V8JA 2KI7A 4JLIA 1GCPA 3CC2T 1UE9A 2LCCA 4EMKA 5GANj 4CC4B 2CT4A 2KBTA 4EPCA 1YJ9T 1FMVA 5ECAA 1PD1A 3GOXA 2L89A 3PMTA 2IIMA 2WSEE 1JU5C 5GMKl 3E1SA 1W70A 1VYUA 3TQ7P 4C92F 2E64A 5GMKm 2EYQA 1I0CA 4PL6A 1LVKA 2RI5A 4C92B 1MMNA 2CP6A 4IIMA 2GCXA 4LDUA 2L5QA 1OZ3A 1QLYA 2DKGA 4FYYB 2XHCA 3DB3A 4O5VA 2YLCA 3UWNA 4JPBW 1SRLA 2E70A 3G71A 4MZMA 2X3XD 3DB4A 2DTOA 4EMKC 1RABB 3NTHA 1WGSA 5A2QE 1PRLC 2DRKA 4IIOA 1X6BA 3X28B 1D1BA 2K3XA 4ANJA 2QQSA 4M75F 3NPFA 3CMAQ 1E6HA 2PTKA 3OYNA 4E47A 1NM7A 1D0XA 2KDSA 2R58A 1WHKA 2MIOA 3CCMQ 2EKOA 2ROTA 4PJOB 1EIFA 2YRDA 1M1KR 2SEMA 3M58A 5KYWB 2A3LA 2KROA 4XU3A 4ZGJB 3L2VA 3QBYA 2VGMA 2F2VA 1BB9A 2LP5A 4IUPA 2MI6A 4M78B 3L2RA 2WACA 3EGUA 1NEGA 4ORZA 2FO0A 2HSPA 1T3SA 1G2BA 3G6ET 1YCYA 3MKDA 3A98A 2EPDA 2K5LA 2BKDN 1QKXA 3OY9A 2IG0A 1ZA1B 4PJOD 4BY6B 5AYFA 1VQ9Q 3M53A 5LJ5f 3CCQT 3BE3A 1PD0A 3QO3A 3CCVA 3M4GA 3QIIA 2ABLA 1Y96B 2EGEA 1UJ0A 3HSBA 4EDUA 2R5AA 2ZZDA 3EH2A 4M7AA 2P0QA 1N8RU 3KBGA 2OJ2A 1W2BP 3VYHB 2SRCA 3ZEHA 1SG5A 1X27A 2EGCA 3G4ST 1BIBA 3FJPA 4RTTA 1VQNA 2PU9B 2JT4A 2Y90A 1X6GA 2WSFE 2DXTA 3ZBDA 1XQHA 1TUDA 2YWWA 3G71Q 2DJZA 1FYNA 4A63B 1G3TA 2OTLQ 3JCMh 5GANe 1TSFA 2J05A 3H6ZA 3CCUQ 2MYSA 1KHCA 1YIJQ 3CCRT 1ZSZA 2B8AA 1OX8A 5HY6A 5KYXA 1X01A 4F04B 1M90R 4M7AC 2DD5A 4PKCC 1WXTA 4ZN1A 1GFDA 1GCQA 1QP2A 3RDVA 1K9AA 4CC7A 1I8FA 2DMOA 4C0DC 2NUPB 3OMGA 5LJ3d 3SEMA 4QVCA 5IT9E 5KE2A 1AWWA 1Y71A 1K0XA 2CSIA 1YHQT 3EFSA 2VXFA 4A4GA 2H3EB 5GMKi 1WHHA 1M5Q1 1Q7YU 3EGDA 5GMKh 3EFOA 1Q82U 3G1JA 1M8VA 2KNBB 4J6WA 2OAWA 2DTHA 4EIKA 2OTJT 3WVDB 1ZSZC 2EQUA 3LGLA 4FYWB 3I55A 1M1KU 5LJ5g 1OOTA 2LX9A 3X26B 1WYXA 2MOXA 5LJ3e 5KYYA 1K73R 3LH0A 1IO6A 2O4XA 1GCQC 4C5EA 4Z88A 4KGVB 2X3WD 1IB8A 3CCLT 5D7UA 2E10A 4BI8B 1I5LA 3CCVQ 5LJ3h 1RAEB 2FEIA 2FVUA 2MWOA 3CEYA 3RKXA 2RN8A 4BI3A 1UEBA 2M0OA 3UDCA 2QGFB 4QVZA 1QVGP 3QHSA 1HSQA 1NE8A 5I11A 4IURA 2NUTA 1S72Q 2GBQA 3HRTA 1U1SA 2Z0WA 1KD1C 4C8QE 3L2WA 1M9SA 3A8OB 4MZTA 1KIKA 2EFIA 2QA4Q 3OW2A 4X9DA 4M7DA 4JDSA 2W10A 1VQLQ 4PK4A 1JBMA 4NL2A 2CUDA 2CZ0B 1M3AA 2EYYA 2RM4A 2V8IA 3CPWS 4FSSA 4J7FA 2HBWA 2LQKA 2RK2A 3X20B 3JCMP 4JJNK 1YJNT 2RH2A 3QXEB 2RHXA 1RAAB 1JXOA 4BUGA 3ZFJA 2NLUA 1PKTA 1UHCA 2DVJA 4D8DA 2JXBA 4F16A 1KHIA 1KQ2A 2DNUA 1KSWA 1Y7XA 2FZGB 1LOJA 1K0SA 4M77E 1AZEA 4M7DC 1KFZA 2RJEA 5IH2A 2LNVA 2K9GA 3SWNA 4PFPA 1MMDA 3E2UA 1N8RC 3I56T 4A4HA 1M90U 2KAFA 3SB2A 4R56A 2J06A 4J6YA 5KCHA 1U1TA 1QP3A 4R0KA 5FU7B 3SFMA 1M2VB 2CS7A 4C92A 3OYJA 3E9FA 4C8QG 1TH7A 2DVEA 1OV3A 2HQXA 1T0HA 2E5KA 2LT1A 1OX9A 4P5NA 1FX7A 2RI2A 3CC4A 3CCSQ 3HFNA 1K8AR 1X6OA 2CZ6B 3CC2Q 2XMFA 3TEEA 2JW4A 1N27A 5DM7R 1YJ9Q 3M5AA 5C6SA 4N0AA 2DILA 2ZPBB 2FL7A 2DK3A 5IAYA 3SWNC 3A8HB 4OP0A 2ECZA 2IVWA 4JJBA 4JRKA 2NWMA 2PNIA 3OBYA 3OYIA 2A28A 4C92C 4QT7A 1CKAA 5KYWA 2RK1A 1BK2A 1JEGA 4FW2A 1XTDA 4M78A 4AFUC 4E7HA 5CQXA 2V1QA 1BKBA 4L6V5 2EWNA 1QQJA 1YWPA 4HCZA 3L2QA 1AEYA 4HT9A 4N0AC 2QK0A 2DIGA 3M54A 5FWCA 2XIDA 2WSCE 2E4HA 2EJGA 3BY7A 4CRIA 3G71T 3QSUA 4X9CA 3M4YA 4J9GA 4IUVA 4PJOC 3JB9J 2OI3A 3L2ZA 4CC2A 3H0HA 3OBWA 6AT1B 1B7TA 3CCET 4RTYA 2QEXA 2OAUA 4BB7A 3EH1A 4M78C 4DBFA 1YHQA 3C0CA 3VU3C 1TS9A 2A7YA 3QJ6A 1NYGA 1T3LA 3TSWA 1Q86R 2EYXA 4C8QB 4E7KA 5CK9A 4N4GA 2DL5A 3G6EQ 1WJSA 1F1BB 3PNWC 1PSFA 4JRIA 1NG2A 2K6DA 3BFMA 3PE0A 1C1AA 4II1A 4JJDA 1SKUB 2J6KA 2E3IA 3JCMc 4BY6C 1IHWA 2CREA 3M0RA 4HVVA 2H8HA 3CPFA 1Z9QA 3LWIA 3DKMA 4KULA 3AHUA 2H3JA 2M0YA 1MV3A 1Z9ZA 4ZNXA 2EQMA 2GQVA 1KQSP 1KK7A 2DJQA 3LWHA 4ELZC 3OS2A 5GAOp 1K8AU 1J3TA 5GAOl 3PTAA 4FYXB 4HVWA 4PJOE 1PCXA 2NUPA 3G4SQ 1VUBA 4M77B 1NLOC 3RIRA 5GAOm 5GANf 2K79A 3CMEA 1MUZA 3RKYA 1EFNA 5DLOA 3OYHA 2A37A 1LJOA 4OGCA 2QTXA 3M56A 1QCNA 2KVQG 4JS5A 2RB6A 4ZTJA 2BTTA 1VQNT 1BI1A 3UF4A 1NPRA 3CCRQ 4PJLA 3OS0A 3T9NA 1UJYA 5C0MA 2CGHA 2EAYA 1W2BA 4OMLA 2FB7A 2HQHA 4XU0A 4Q5WA 2DE0X 4A4EA 1G5VA 1H92A 4AT1B 5KCOA 1RACB 1BI3A 2CUBA 2LQNA 1UTIA 1YHQQ 2D1XA 1OZ2A 4FU6A 2VASA 1K73C 4M7DF 4HVUA 2V26A 4PJOG 3N5BB 1SHGA 1WI7A 5GAMg 2OTJQ 5HCKA 5D6YA 3M0UA 1MNEA 1SSFA 2DZCA 3A8MB 4LDVA 4QQDA 2XU8A 1TUCA 3CCLQ 3I55T 3JB9H 3NTIA 1O9SA 2JUFA 3OYYA 3G7ZA 3CXCS 4C5HA 3V7SA 2Y4XA 1D3BB 4E7SA 2LJ3A 2ZGWA 2DAQA 4MDWA 2BE7D 2DERA 1WLPB 2BE9B 2PUKB 2ZAEA 2DEQA 1S1NA 4D8KA 1QVPA 4WCIA 2C0TA 3META 2YUOA 3CBOA 5A0LA 3OSVA 4AFSC 2C0IA 2L2PA 3CMEQ 1BCMA 4WTOB 1SSHA 1D09B 1LCKA 3JAME 4KGZB 2LCLA 4KT0E 1M2VA 2DEUA 1IRXA 2COZA 5GMKj 3MP8A 4XU2A 2D6FA 1D1CA 1BYMA 3QZ5B 1TTHB 1QVGA 2EGAA 1YJNQ 2DL7A 2E65A 3C95A 3GF5A 1VA7A 2CT3A 1U5SA 2YXYA 3CCJT 1PWTA 2V8JA 2B86A 3MJXA 2JS2A 2RHZA 4XTYA 5LJ3j 3H0IA 7AT1B 3CCEA 4PJOF 2RQVA 1PC0A 1Y0MA 3JB9D 1OQKA 1R0CB 1NEBA 4RG8A 1Q7YR 3I56Q 5FU7C 1Q82R 1K8AC 2HD0A 2R5MA 4M78F 2VC8A 3U23A 2F2XA 2CDTA 2KGTA 1PNJA 3THKA 5KYUB 3JCMV 1HK9A 4ESRA 3C4SA 3I5SA 4C0ZA 3PIOA 4KGXB 3X24B 2BUDA 1QKWA 4PJMA 2X4YA 2EQIA 3QZ9B 1UHFA 2ESWA 3QUIA 2BZYA 3ER0A 3MP6A 3A1PA 2C0OA 5CKEA 2QTVA 3CC4T 2VGNA 1ZUKA 4ATOA 3QDRB 2X4XA 3OQ5A 1GL5A 2HL5C 4QVDA 4CC3A 3JCMd 3REAB 4XAXB 2MPXC 2K2MA 2LX7A 1BIAA 1I4K1 2FRYA 2O9VA 2JTMA 1RLQC 2HCKA 1UECA 3A5ZB 4ZTFA 3GPLA 2JS0A 2O9SA 5IXBA 1OYXA 2XG8D 2JMAA 2MAMA 4M75D 4ZGDB 1QVFP 3F70A 4C8QA 4QQ6A 3JCMe 2MF2A 2P0PA 2CZ7B 2K3BA 1SRMA 2DL4A 4PJNA 1RAHB 2X51A 2Y4YA 3WXMB 1CSKA 3S3NA 1W4SA 1WXUA 2DZ9A 1Q81R 2EIFA 4KUDK 2JOYA 2DRMA 3RKWA 1Q86C 5GAMh 3CCEQ 2KRMA 1IGQA 4B9WA 2CSQA 2XICA 1VQMA 2DXBA 4FIBA 2D8JA 5GJVB 8ATCB 4C8QC 1B07A 1FXXA 3ASKA 4FT2A 2QEXT 1PSEA 4M77A 5GMKe 3JCMQ 1WHGA 2O2OA 3HKSA 5IHKA 3PIPA 1UGSB 1X69A 2KSSA 2KT8A 3JCMJ 4C5GA 2EQKA 3BW1A 2HNIA 5GAOr 3DLLA 1QCOA 1WJRA 4KRTA 3OYDA 1I1JA 4HXJA 4HT8A 4HA8A 2AT1B 2ED1A 1WHJA 4QQGA 1PKSA 2AZSA 2PVGB 1WJQA 1AVZC 2KEAA 4M77C 5GAN5 4F17A 4Y28E 3OS1A 4KUIA 1H8KA 5FU6B 1IHVA 3FDRA 1QMCA 1K9MR 1VQNQ 1YN8A 4HCCA 1M30A 3MCAB 3C94A 1VQ8A 4QKUA 3CMET 4MDXA 3NMZC 1KQSA 1B34B 2RJDA 2F69A 3EHQA 1MV0B 3CD6A 3LLRA 2XI9A 4K11A 2QASA 2FHDA 1VQOT 3CCJA 4XTXA 4ME7A 4C0FA 5CKFA 2M51A 1IXDA 1C0MA 1ZA2B 3RMSA 1D3BA 3Q1JA 3SD4A 4XTUA 2M02A 1T0JA 1ABOA 1WDXA 4LXCA 4J8OA 2PQWA 1UB4A 2DBKA 1YITT 1Q81U 4OMMA 1W1FA 2HEQA 3V8LA 2AZVA 2QQ9A 3KFVA 4LDWA 3L1AA 1ZLMA 1AOJA 1WHMA 2QXFA 2HKQB 4TVRA 2LT4A 1M3CA 2D0NA 1VQ7A 3H0FA 1WZOA 4J9CA 5FRMA 4LN2A 3I55Q 1WFWA 2ZPHB 3RBBB 2F1LA 3UPUA 1B3QA 4XTWA 5J3BA 3OW2S 4A4FA 1KQSS 1OEBA 4J6XA 2LQ8A 1C6VX 2K4YA 4AMCA 2L3RA 4RKUE 4KH0B 2YUNA 4E7IA 2E5QA 3V8KA 1MNDA 3V7CA 2IPOB 3HRUA 4DEXA 3JB9I 3EGXB 2LTOA 2RI3A 4BE0A 4FCYA 1M4ZA 4E7ZA 3QPHA 4AFZC 2GTOA 3E19A 1TU0B 4PJOA 5IHNA 1RLPC 2MWPA 4OB2B 4M77G 5LJ5d 5KYUA 1NJIR 1RL2A 2D8HA 3JSCA 1RADB 5GAN8 3SDZA 2XD0A 3OYAA 1Q7YC 5J26A 1MGQA 1U3OA 3CCJQ 1Q82C 3URGA 4B6MA 1BI2A 2BZ8A 1M1KC 1K9MU 1K76A 4ZGEB 2F5TX 1WHLA 3VS6A 2RA2A 1EX4A 2O88A 1LPLA 2FYKA 1VQ4A 2HDAA 2KRNA 4OVAA 3GP8A 4Z89A 2FG0A 4OMNA 1ZBJA 2AIRB 4E7LA 4F7UE 2XDBA 2RQRA 3FC3A 4LUEA 3OA6A 4N4IA 3MHXA 1AT1B 1Y96A 3VS3A 5LJ5h 2P4RA 2PVOB 4D6WA 4C8QF 3GIBA 2RMOA 3VS1A 2KYMA 4LUDA 2AKKA 2GNCA 1UGVA 3BDLA 4J9HA 2GQIA 3NTKA 1AD5A 3CPWP 1HJDA 3LGFA 2DF6A 3QWYA 4JS4A 2RD1A 1VYTA 1W6XA 1TOVA 3P8DA 1X75C 3VS0A 3CC4Q 1WXBA 4RTXA 2ZPIB 4M7AB 3VS7A 3BDUA 1TWBA 1G8XA 1GBQA 3OYGA 4QW2A 2ZPEB 2RHUA 5GAOn 5GAN2 5EG2A 4JRPA 3OMCA 4M77F 1GBRA 4GBQA 3L2UA 2VXEA 3EG3A 4LE9A 5GAN6 2JJ9A 1HYOA 1VQ5T 2J6OA 4OF1A 1Q81C 4F7UG 4E7JA 1IREB 3DLMA 3A8LB 3OYMA 3H8ZA 2X4WA 1YJWT 3RUXA 1BCOA 5I21A 2LMJA 4M7AD 3J7AF 3CC7T 1OI1A 1M90C 1U06A 2LRQA 1D0YA 3CBPA 5J39A 3PFSA 4M75E 1UFFA 5IXFA 3LX7A 2COYA 3S6WA 1VQOA 1RAFB 4DOVA 1AZGB 2CYZB 1UUEA 1NBEB 1NJIU 3QKJA 4FT4A 4J83A 4BDZA 3VJPA 1VQ4Q 1RI0A 1UDLA 2CP3A 1QVFA 4OB1B 1YI2A 2ROLA 1YITA 2ATCB 4FYVB 2QEXQ 1UGQB 4B9XA 5FW9A 1Y07A 2QGGA 4WF2A 3OS5A 1BI0A 3PGGA 1D1AA 1VQMT 3ME9A 2O4XB 4DEYA 2AHJB 2LC4A 3E9GA 4GLKA 3ZL7C 1KD1R 5LJ3f 1JJ2P 4PFOA 1JQQA 1HD3A 2FZKB 3OYFA 1E7OA 2HSEB 5CKHA 3M57A 1H641 2A08A 5D6XA 2AK5A 2E1HA 1B34A 2I0NA 1BBZA 5EC7A 2PUOB 2KRSA 3M0TA 1OPKA 1R8OB 2YUPA 3CBMA 3CCMA 2HL3A 3UATA 2ED0A 2K57A 2EVRA 2QYZA 2KK4A 2HMAA 1K9MC 1U8RA 3GNGA 2CZ1B 2MCNA 2ENMA 3HTRA 5FU6C 5GANg 1M1GA 5FRNA 2L3QA 3HHTB 3LYIA 5KH6A 1W2BS 3PMIA 3VRZA 2XDDA 4F7UB 3EHRA 4BD3A 1WX6A 4GLMA 2KMTA 4FM4B 5DLQE 4BACA 2PVDB 1A0NB 1VOMA 4AFQC 3L42A 1ZUUA 3OYEA 4L5GA 1YNZA 4RG2A 5CKDA 2A36A 2DXUA 2LNHB 2K2VA 2BZXA 3FB9A 3QG1A 1K4US 1VQ9A 5CR2A 2M16A 1VQOQ 3JCMX 1VQ8T 2K7AA 1N5ZA 4M7DD 4OGEA 2MK5A 3CD6T 2DYBA 5GAOq 3SWNB 3R6NA 4PLLA 1YI2Q 1V29B 4CI0C 1YITQ 3FIFA 5LJ3g 2DETA 1M8MA 4FW1A 3VS4A 2LZ6B 2HBPA 3A8GB 1BU1A 3M59A 1N6AA 3EG9B 3EGXA 2RHIA 4HCBA 2RPNA 4X34A 1SHFA 2DTIA 2LJ1A 2YSQA 2KR3A 1GFCA 2OTLA 1ZBXA 3WVEB 2FZCB 3GNFB 5CO7A 2DM1A 1IGUA 3CCUA 1HXDA 2LCSA 2JM8A 1GRIA 1YIJA 4Y91A 1I5OB 2QAZA 3QYGB 1YFNA 3QJYA 3H9NA 4JJCA 3HP9A 1VQ7T 3FRNA 3INZA 4J9BA 2GF7A 2V8KA 2P4TA 4FSXA 3EAEA 4XU1A 2LVMA 1KJWA 4HKEA 4M75B 4C92D 5FLXE 3M55A 1KD1U 3VUZA 1PM3A 2HAXA 1XJWB 2DPPB 4M4ZA 4XK8E 1NJIC 5CQYA 1QVGS 4L59A 4KBMB 2FPDA 4OMOA 2EYWA 3MEVA 1V1CA 4PFZA 2JNGA 2R57A 1VQ5A 3S3OA 2EJ9A 5CAIA 2VKNA 4LNPA 3VUBA 3LH5A 5GAMd 2F2WA 3QYHB 4BE1A 4HCKA 3IQLA 1QWFA 1YJWA 3TSZA 5FROA 5M9OA 3CC7A 2RQWA 5GJWB 2AKLA 2P84A 2A0FB 3SHWA 3FLGA 2EYZA 2FPFA 3CXCP 3VRYA 2FPEA 1ZSGA 1QCFA 2F5KA 4ELYC 2ZCFB 2CH4W 5GAMe 4M78D 1CKBA 4RCCA 1ABQA 5GANd 3OYKA 1NPPA 3MO8A 2I2LA 1S72A 2HKNA 1NZ9A 2XDPA 3HPWA 2EKHA 1VQPT 1WNLA 3UA7A 1GXIE 2LQWA 1VQKT 2X35A 2GGRA 2QA4A 4PNOA 5CCAA 3RR6A 2MMPA 1VQ4T 2DIQA 1VQLA 2FRWA 1NYFA 1M3BA 4OMQA 3VS2A 3RNJA 3VS5A 2YLBA 3TCJA 3C12A 2QQBA 2C06A 1V76A 4A54A 4NL3A 5CIUA 5GANh 5KYNA 2EQJA 1O75A 2QDYB 3I5RA 1X43A 1FMKA 3FEOA 9ATCB 3M0QA 2VUBA 4ZN3A 4RTWA 1Y57A 1QWEA 3RMQA 1M1FA 2RF0A 1MHNA 2DA9A 1VQ6T 4E2FB 2L3PA 4C0GA 3CPWA 3MP1A 4F14A 3PT9A 1VQ5Q 2G6FX 4PJJA 2CP5A 1AHJB 3MEUA 5I2SA 2PZ1A 1FWZA 2VVKA 1YJWQ 5CKBA 1KC8R 5LJ5j 4OMFB 3GLXA 2RJFA 1JXMA 3CCSA 1M27C 2DO3A 3M0SA 2NYSA 3CC7Q 3TVTA 1VIEA 3CC2A 4A4KA 2NUZA 3J81E 3EFRA 1YJ9A 3R6OA 3PVQA 4DQ2A 1P92A 5HK0A 3JCMb 1MMGA 2VWFA 4M7AE 2JMCA 4BI4A 3I9QA 1XNIA 2L0AA 4XQ3A 3NHNA 2COWA 1SEMA 3M0PA 4XTVA 4GY5A 4R55A 2DYIA 1NLPC 4LDYA 4MZPA 1FMWA 3CQTA 1ZX6A 1WQWA 4LD6A 1H3ZA 1VQMQ 3OSSC 1YI2T 4XTZA 1TUGB 1X2QA 4F7UA 4RTZA 2ZPFB 4A53A 3TU4K 5AT1B 3X25B 4OB0B 2J6FA 3MPUB 2J7IA 1OPLA 4J9DA 3NGPA 3RESA 2KY9A 2HQEA 2X4JA 3EG1A 4EMGA 4EMKB 2CP0A 4AG1C 5A0DA 3HL8A 1X2KA 4MMKA 5KE3A 1WQ7A 1Q95G 5LL6S 2GFUA 3VKIA 3CMAT 1AWOA 2JZ2A 2QQAA 2YT6A 4RUGA 4M7AG 4IUQA 1RAIB 1JJ2A 3CCMT 1IZ6A 2KE9A 3P8HA 2E6NA 5HK3A 3KXTA 1N9SA 3ULRB 5L23A 5CVIA 4JZ3A
chains in the Genus database with same CATH topology
4C0DC 3G6EA 3CC7T 1OI1A 3OMGA 5LJ3d 3CCJT 1M90C 2LRQA 3JCMW 3CBPA 2V8JA 5J39A 4QVCA 5IT9E 5KE2A 3JRZA 3OYLA 3M9QA 3PFSA 1Y71A 2RHZA 4M75E 4XTYA 5D6WA 3EFSA 1YHQT 3LX7A 5LJ3j 2VXFA 2XKOC 3S6WA 4A4GA 2JN0A 4J5YA 4PJOF 4DOVA 3CCEA 1VQOA 5GMKi 3JB9D 2CYZB 1M5Q1 1Q7YU 1I81A 4RG8A 5GMKh 1Q82U 3CCQA 1NJIU 3QKJA 1M8VA 4J6WA 5FU7C 2G3RA 2QI2A 4FT4A 2K3YA 2DTHA 4J83A 4BDZA 3VJPA 1K8AC 2OTJT 2HD0A 2R5MA 3WVDB 3LGLA 2EQUA 1RI0A 1M1KU 3I55A 5LJ5g 2LX9A 4M78F 2VC8A 3X26B 1QVFA 1KC8U 4NS5A 5LJ3e 4OB1B 1YI2A 3VYGA 1K73U 1YITA 5GAN7 1VQ9T 3JCMV 1HK9A 1KQ1A 3LH0A 4M75A 3C4SA 3VV0A 4C0ZA 1UGQB 2O4XA 3X24B 4B9XA 3PIOA 2BUDA 4C5EA 1Y07A 4WF2A 2X4YA 3OS5A 4O6JA 3CCLT 1BI0A 3PGGA 2M9UA 2E10A 4BI8B 3G4SA 2DXCA 3QZ9B 3QUIA 5A0GA 1I5LA 1VQPA 1VQMT 1KG1A 3ME9A 5LJ3h 1VQKA 2MWOA 3ER0A 2FVUA 3CEYA 3RKXA 4BI3A 4M7DE 2O4XB 3MP6A 4MMLA 2AHJB 2LC4A 3E9GA 5LJ5e 4GLKA 4DOWA 1UEBA 5LJ3f 2M0OA 3UDCA 3UT1A 5CKEA 2DD4A 4QVZA 3OYFA 3CC4T 3QHSA 2VGNA 5CKHA 1JJ2S 4ATOA 1NE8A 4PLIA 3M57A 3QDRB 1H641 1N9RA 2X4XA 3OQ5A 4IURA 3HRTA 4EMHA 1U1SA 5D6XA 4QVDA 2E1HA 4Z02A 5L8RE 3CCRA 1B34A 3LW5E 1KD1C 4C8QE 3JCMd 1M9SA 3L2WA 4XAXB 3A8OB 4MZTA 2EFIA 2PUOB 3TREA 3OW2A 1R8OB 4X9DA 4M7DA 2JTFA 3CBMA 4JDSA 3OYCA 3CCMA 2OTLT 1BIAA 1I4K1 2JTMA 4M75C 2GFAA 3CCUT 1JBMA 2D0QB 2K57A 2EJFA 2KK4A 3A5ZB 4NL2A 1YIJT 4M7AF 2VV5A 4ZTFA 3GPLA 1K9MC 2CZ0B 3O8VA 1U8RA 3GNGA 2CZ1B 2RM4A 2V8IA 1OYXA 2XG8D 4J7FA 3CPWS 2MAMA 5FU6C 5GANg 4M75D 4ZGDB 1M1GA 2LQKA 2RK2A 5FRNA 2RJCA 2KQWA 5KH6A 3HHTB 3LYIA 3F70A 1W2BS 3PMIA 4C8QA 3X20B 4QQ6A 2XDDA 3JCMP 4JJNK 3JCMe 3NFCA 1DJ7B 2RH2A 3QXEB 2MF2A 4F7UB 1YJNT 2P0PA 2RHXA 4BD3A 2CZ7B 4BUGA 2KMTA 3ZFJA 1VQ6A 4FM4B 2NLUA 5DLQE 4BACA 4C92E 2PVDB 2O01E 4C0DB 2Y4YA 3L42A 3WXMB 1KHIA 2VYTA 1W4SA 3OYEA 4L5GA 2E41A 3S3NA 2DZ9A 4RG2A 1KQ2A 5CKDA 2OTJA 2EIFA 4IUTA 2DXUA 1Y7XA 1LOJA 2K2VA 4M77E 4LDXA 4KUDK 2JOYA 4M7DG 3FB9A 3QG1A 1G3YA 3JCMf 4M7DC 2RJEA 3RKWA 2LNVA 1Q86C 5GAMh 5GAN4 1VQ9A 3SWNA 5CR2A 2M16A 3I56T 3JCMX 4A4HA 5HKCA 2KAFA 1N8RC 3SB2A 4R56A 2E12A 1M90U 2LDMA 4J6YA 5GAMf 1VQ8T 4B9WA 5DY9A 3CCLA 5KCHA 1U1TA 1QP3A 4YTLA 2QQRA 4OGEA 1YBYA 5FU7B 4M7DD 3MEAA 2XICA 3SFMA 2CS7A 1VQMA 2DXBA 4C92A 4N4HA 3KUFA 3OYJA 5GAOq 3CD6T 3E9FA 3SWNB 4DA4A 4FIBA 4C8QG 1TH7A 2DVEA 4C8QC 1FXXA 2HQXA 2P0KA 3ASKA 3MEWA 4FT2A 2LT1A 2QEXT 1PSEA 4M77A 4PLLA 5GMKe 3JCMQ 4P5NA 1FX7A 3JB9G 1V29B 2RI2A 2RO0A 4CI0C 3CC4A 3HFNA 4IKFA 3HKSA 3FIFA 5LJ3g 2BIVA 3PIPA 4C8QD 3CCVT 1LNXA 1G3SA 1UGSB 1X6OA 2CZ6B 2CKKA 2HBPA 2KSSA 3A8GB 3JCMJ 4C5GA 2EQKA 3M59A 3TEEA 4PJOD 1N6AA 3BW1A 2RHIA 5I2MA 1N27A 5DM7R 4HCBA 2HNIA 2RHYA 3M5AA 5C6SA 1XOVA 4X34A 4N0AA 2ZPBB 2DTIA 1G3WA 5GAOr 4RCBA 3DLLA 2FL7A 2OTLA 1ZBXA 2DK3A 3HFOA 4M78E 4UC4A 3WVEB 5IAYA 3GNFB 5CO7A 1S72T 1JRIA 2M1HA 3SWNC 1WJRA 3A8HB 1HXDA 3OYDA 2K5IA 3CCUA 4OP0A 1YIJA 4Y91A 4HA8A 1VIFA 2IVWA 4JRKA 4HT8A 3CXCA 3OYIA 3OBYA 4C92G 3QYGB 4QQGA 3S3MA 4C92C 2QA4T 3QJYA 1UGRB 3HP9A 1VQ7T 3FRNA 2PVGB 2GF7A 2V8KA 2P4TA 2D9TA 2ZPGB 3INZA 4FSXA 3EAEA 1VQLT 2JVVA 2RK1A 4XU1A 1WJQA 1WPYA 1YJNA 2LVMA 1QW1A 4M77C 4HKEA 4M75B 4C92D 5FLXE 3M55A 3P8BB 4BDYA 5GAN5 4Y28E 1KD1U 4V2SA 3VUZA 1XTDA 4M78A 4E7HA 5CQXA 3OS1A 4KUIA 1BKBA 4L6V5 2EWNA 3HRSA 2E6ZA 3OYBA 2HAXA 4M77D 5FU6B 4NOYA 1JB0E 2DPPB 4HCZA 3L2QA 3V7RA 3FDRA 2L8DA 4XK8E 4OB3B 1NJIC 5CQYA 1QVGS 4L59A 3RERA 4KBMB 4HT9A 4N0AC 3J80E 2DIGA 3CMAA 3MEVA 3M54A 2JNGA 2R57A 2XIDA 1KC8C 2WSCE 4BE2A 5IN1A 4HCCA 2EJGA 3BY7A 4CRIA 5GAN3 2YRVA 3I56A 3MCAB 2EJ9A 3C94A 3JCMg 5CAIA 3G71T 3VUBA 3S3OA 1VQ8A 3QSUA 4VUBA 3CMET 4LD9K 4X9CA 4C5IA 1KQSA 4MDXA 4FL6A 4JUVA 5GAMd 3M4YA 3QYHB 4BE1A 4M75G 1B34B 2RJDA 4IUVA 2F69A 1YJWA 3CD6A 4PJOC 3JB9J 3L2ZA 3LLRA 5FROA 2XI9A 4F7UF 4IUUA 1UGPB 2XK0A 3OBWA 5GAMj 4M7DB 2FHDA 5M9OA 3CC7A 1VQOT 2QEXA 4XTXA 4ME7A 3CCJA 3CCET 2OAUA 4C0FA 5CKFA 1ZHIA 4BB7A 4JRQA 1ZQ1A 4M78G 2K5FA 4JLGA 4M78C 3RMSA 1YHQA 1D3BA 3FLGA 3Q1JA 4RMOA 3VU3C 3SD4A 4J7IA 4XTUA 2A7YA 1QVFS 3JB9F 3QJ6A 2YHTA 2F5KA 4ELYC 1Q86U 4J8OA 2PQWA 2ZCFB 5GAMe 4M78D 1UB4A 4C8QB 4E7KA 5CK9A 4RCCA 5GANd 4N4GA 3OB9A 3CCST 1YITT 1Q81U 3V8JA 3V8LA 3OYKA 1NPPA 2QQ9A 3MO8A 1WJSA 2I2LA 4LDWA 4JLIA 1S72A 1NZ9A 3L1AA 3CC2T 3PNWC 2QXFA 1PSFA 2LCCA 2XDPA 3HPWA 4EMKA 5GANj 4JRIA 1VQPT 3BFMA 1WNLA 4EPCA 4TVRA 1GXIE 1VQKT 2LT4A 2X35A 4II1A 1YJ9T 3JCMc 3GOXA 4PNOA 4BY6C 2L89A 5CCAA 2QA4A 1VQ7A 3PMTA 2WSEE 2MMPA 5GMKl 1VQ4T 2DIQA 1VQLA 3E1SA 4C92F 3CPFA 3LWIA 3DKMA 2E64A 4KULA 2H3JA 5FRMA 3AHUA 5GMKm 2EYQA 2EQMA 2ZPHB 2GQVA 4PL6A 3UPUA 2YLBA 4XTWA 5J3BA 2RI5A 3LWHA 3OW2S 4C92B 4ELZC 3OS2A 5GAOp 1K8AU 3TCJA 3C12A 4A4FA 2QQBA 5GAOl 3PTAA 1KQSS 2C06A 4J6XA 2LQ8A 4A54A 4PJOE 2GCXA 4LDUA 2K4YA 4NL3A 2L5QA 5CIUA 1OZ3A 5GANh 1VUBA 4M77B 2DKGA 3RIRA 2L3RA 2XHCA 3DB3A 4RKUE 4O5VA 5GAOm 2EQJA 1O75A 2QDYB 2YLCA 3UWNA 5GANf 4E7IA 2E5QA 2E70A 3V8KA 3G71A 4MZMA 3FEOA 3DB4A 2DTOA 4EMKC 3CMEA 3V7CA 2VUBA 3RKYA 5DLOA 3HRUA 3NTHA 1WGSA 5A2QE 3JB9I 3OYHA 2LTOA 4ZN3A 1LJOA 4OGCA 2RI3A 2QTXA 3M56A 4BE0A 2KVQG 1M4ZA 2RB6A 3X28B 4JS5A 4ZTJA 2K3XA 1VQNT 1BI1A 3RMQA 2QQSA 4M75F 3QPHA 1M1FA 1NPRA 3E19A 1MHNA 4PJOA 3OS0A 1VQ6T 4C0GA 3T9NA 3OYNA 4E47A 5C0MA 3MP1A 3CPWA 2MWPA 2CGHA 2KDSA 3PT9A 2EAYA 4OB2B 2R58A 4M77G 5LJ5d 1W2BA 1RL2A 2EKOA 2FB7A 1AHJB 3JSCA 3MEUA 5I2SA 4PJOB 4XU0A 1FWZA 1EIFA 5GAN8 4Q5WA 3SDZA 2XD0A 3M58A 5CKBA 4A4EA 2A3LA 4OMFB 5LJ5j 3GLXA 2RJFA 4XU3A 4ZGJB 3OYAA 5KCOA 3L2VA 1G5VA 3CCSA 1Q7YC 3QBYA 2VGMA 2DO3A 5J26A 1MGQA 4IUPA 1BI3A 3URGA 1Q82C 2MI6A 1VIEA 4M78B 3L2RA 3CC2A 1BI2A 2WACA 4A4KA 1K9MU 1M1KC 4ZGEB 2F5TX 3J81E 1OZ2A 2RA2A 3EFRA 4FU6A 1YJ9A 3R6OA 4DQ2A 1K73C 4M7DF 1P92A 2FYKA 3G6ET 5HK0A 1VQ4A 4OVAA 3JCMb 3GP8A 1YCYA 4M7AE 4PJOG 3N5BB 4BI4A 5GAMg 4E7LA 4F7UE 2K5LA 1XNIA 2BKDN 4XQ3A 2XDBA 3FC3A 3OA6A 5D6YA 4N4IA 3MHXA 1SSFA 1Y96A 4XTVA 4GY5A 2DZCA 2IG0A 5LJ5h 3OY9A 3A8MB 4LDVA 4QQDA 2XU8A 2PVOB 5AYFA 4BY6B 4D6WA 4C8QF 3M53A 4R55A 3GIBA 5LJ5f 3CCQT 3QO3A 3CCVA 4LDYA 4MZPA 3M4GA 3QIIA 1Y96B 3I55T 3BDLA 1WQWA 4LD6A 3JB9H 3NTIA 1O9SA 2JUFA 3HSBA 1H3ZA 3OSSC 3OYYA 4EDUA 2R5AA 2ZZDA 3G7ZA 3CXCS 3NTKA 4M7AA 1YI2T 2P0QA 4XTZA 4C5HA 3KBGA 3V7SA 3LGFA 1N8RU 2Y4XA 1D3BB 4F7UA 4JS4A 3VYHB 2ZGWA 2ZPFB 4A53A 3TU4K 2RD1A 3ZEHA 2DAQA 3P8DA 3X25B 1X75C 4MDWA 4OB0B 2ZPIB 4M7AB 1BIBA 2PUKB 3FJPA 3G4ST 2DEQA 1VQNA 2PU9B 3BDUA 2Y90A 3RESA 2KY9A 2HQEA 1QVPA 2WSFE 2DXTA 2X4JA 3META 4EMGA 3ZBDA 3CBOA 1XQHA 4EMKB 5A0LA 3OYGA 2DJZA 3OSVA 5A0DA 4QW2A 3HL8A 4MMKA 1G3TA 5KE3A 1WQ7A 3JCMh 5GANe 2ZPEB 2RHUA 5GAOn 5LL6S 3H6ZA 2GFUA 5GAN2 5EG2A 4JRPA 1KHCA 3VKIA 3JAME 3OMCA 4M77F 3CMAT 2LCLA 3CCRT 4KT0E 3L2UA 2JZ2A 2VXEA 2QQAA 5GAN6 3MP8A 2B8AA 5GMKj 1VQ5T 5HY6A 4XU2A 4M7AG 1X01A 4OF1A 4IUQA 2D6FA 4M7AC 1Q81C 3CCMT 1JJ2A 1IZ6A 4F7UG 4E7JA 2DD5A 4PKCC 1IREB 3DLMA 1BYMA 3QZ5B 3A8LB 3P8HA 3OYMA 3H8ZA 1QVGA 2X4WA 4ZN1A 1YJWT 2E6NA 2E65A 3RUXA 3C95A 3GF5A 1QP2A 5I21A 5HK3A 3KXTA 1N9SA 1I8FA 3J7AF 4M7AD 1VQ5A 5CVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9S A;  4EPC A; 
#chains in the Genus database with same CATH topology
 3G6E A;  1TXQ A;  3JCM W;  3EG9 A;  8AT1 B;  3H41 A;  1SF9 A;  3JRZ A;  3OYL A;  3M9Q A;  5D6W A;  2XKO C;  2JN0 A;  4J5Y A;  1I81 A;  1ARK A;  3CCQ A;  1VQ8 Q;  2G3R A;  2QI2 A;  2K3Y A;  1K1Z A;  2QG9 B;  1KC8 U;  3CD6 Q;  1AWX A;  4NS5 A;  2DFU A;  1YCS B;  3VYG A;  1K73 U;  5GAN 7;  1VQ9 T;  4DBR A;  1KQ1 A;  4M75 A;  3VV0 A;  4J9E A;  4O6J A;  5I22 A;  1JO8 A;  2M9U A;  3G4S A;  2DXC A;  1KG1 A;  5A0G A;  1VQP A;  1VQK A;  1PRM C;  4Y92 A;  1WA7 A;  4M7D E;  1PG5 B;  2VB6 A;  4MML A;  5LJ5 e;  3QWX X;  4DOW A;  3UT1 A;  2DD4 A;  1JJ2 S;  3PVL A;  4PLI A;  1N9R A;  1AWJ A;  4EMH A;  2RQT A;  4Z02 A;  5L8R E;  3CCR A;  3LW5 E;  3TRE A;  1VQ7 Q;  2JTF A;  3OYC A;  2OTL T;  1WIE A;  2V1R A;  4M75 C;  2GFA A;  3CCU T;  2D0Q B;  2EJF A;  2JTE A;  1YIJ T;  4M7A F;  2VV5 A;  3O8V A;  1OU9 A;  3QDF A;  1D0Z A;  1RI9 A;  2DL8 A;  2RJC A;  2KQW A;  1ACM B;  4OMP A;  1R0B G;  3NFC A;  1DJ7 B;  2EBP A;  2DX1 A;  2KXC A;  1VQ6 A;  2GTJ A;  2LJ0 A;  2JM9 A;  4C92 E;  1G83 A;  2O01 E;  4C0D B;  3I35 A;  2VYT A;  2E41 A;  2OTJ A;  2CP7 A;  4IUT A;  4DBQ A;  2DLP A;  4J9F A;  4LDX A;  2HZY A;  4M7D G;  1TG0 A;  3JCM f;  1G3Y A;  1UG1 A;  5GAN 4;  5HKC A;  2E12 A;  1EZZ B;  2LDM A;  5GAM f;  3CCL A;  5DY9 A;  4YTL A;  2QQR A;  1YBY A;  5IHI A;  3MEA A;  3CCQ Q;  2X9H A;  1ZSZ B;  2CH4 A;  4N4H A;  3KUF A;  4DA4 A;  1ZUY A;  1OU8 A;  5KYX B;  3OW2 P;  2P0K A;  2YDL A;  3MEW A;  3O5Z A;  3JB9 G;  2RO0 A;  3EG0 A;  4IKF A;  2BIV A;  1I07 A;  4C8Q D;  3CCV T;  1LNX A;  1G3S A;  1OUL A;  2CKK A;  2E3H A;  1VQP Q;  2YUQ A;  1PHT A;  5I2M A;  1YWO A;  1VQK Q;  2RHY A;  2RQU A;  2DL3 A;  1XOV A;  3REB B;  1G3W A;  2OX7 A;  4RCB A;  1MMA A;  2RNA A;  4E6R A;  4M78 E;  3HFO A;  4UC4 A;  1RUW A;  1S72 T;  1JRI A;  2M1H A;  2K5I A;  3EGD B;  4RTU A;  4RTV A;  1VIF A;  3EFO B;  1R77 A;  3CXC A;  1M2O A;  3FJ5 A;  4C92 G;  1H3H A;  3S3M A;  2QA4 T;  1UGR B;  2ZPG B;  2D9T A;  2EW3 A;  2KYB A;  1SPK A;  2JVV A;  1VQL T;  4Z8A A;  1WPY A;  2L3S A;  1YJN A;  5KYY B;  1QW1 A;  4BDY A;  3P8B B;  4V2S A;  3AT1 B;  4DBH A;  3HRS A;  2E6Z A;  3OYB A;  4M77 D;  4NOY A;  1JB0 E;  1RAG B;  3V7R A;  2L8D A;  4OB3 B;  1YP5 A;  2CP2 A;  2KT1 A;  3RER A;  3J80 E;  3CMA A;  2O31 A;  1KC8 C;  4BE2 A;  5IN1 A;  4J9I A;  4AG2 C;  5GAN 3;  2YRV A;  3I56 A;  2NUT B;  3EG2 A;  3JCM g;  1VQ6 Q;  3GBQ A;  4VUB A;  4LD9 K;  4C5I A;  4FL6 A;  4JUV A;  1E6G A;  2W0Z A;  4M75 G;  3JV3 A;  3D7S B;  4F7U F;  4IUU A;  1UGP B;  2XK0 A;  5GAM j;  4M7D B;  2KXD A;  4KH1 B;  4X1V A;  1ZHI A;  4JRQ A;  1ZQ1 A;  4M78 G;  3UA6 A;  2K5F A;  4JLG A;  2YRC A;  5FWB A;  4RMO A;  2QDL A;  4J7I A;  1QVF S;  3JB9 F;  2YHT A;  1VYV A;  1Q86 U;  2DBM A;  1N8R R;  3OB9 A;  3CCS T;  4JZ4 A;  3V8J A;  2KI7 A;  4JLI A;  1GCP A;  3CC2 T;  1UE9 A;  2LCC A;  4EMK A;  5GAN j;  4CC4 B;  2CT4 A;  2KBT A;  4EPC A;  1YJ9 T;  1FMV A;  5ECA A;  1PD1 A;  3GOX A;  2L89 A;  3PMT A;  2IIM A;  2WSE E;  1JU5 C;  5GMK l;  3E1S A;  1W70 A;  1VYU A;  3TQ7 P;  4C92 F;  2E64 A;  5GMK m;  2EYQ A;  1I0C A;  4PL6 A;  1LVK A;  2RI5 A;  4C92 B;  1MMN A;  2CP6 A;  4IIM A;  2GCX A;  4LDU A;  2L5Q A;  1OZ3 A;  1QLY A;  2DKG A;  4FYY B;  2XHC A;  3DB3 A;  4O5V A;  2YLC A;  3UWN A;  4JPB W;  1SRL A;  2E70 A;  3G71 A;  4MZM A;  2X3X D;  3DB4 A;  2DTO A;  4EMK C;  1RAB B;  3NTH A;  1WGS A;  5A2Q E;  1PRL C;  2DRK A;  4IIO A;  1X6B A;  3X28 B;  1D1B A;  2K3X A;  4ANJ A;  2QQS A;  4M75 F;  3NPF A;  3CMA Q;  1E6H A;  2PTK A;  3OYN A;  4E47 A;  1NM7 A;  1D0X A;  2KDS A;  2R58 A;  1WHK A;  2MIO A;  3CCM Q;  2EKO A;  2ROT A;  4PJO B;  1EIF A;  2YRD A;  1M1K R;  2SEM A;  3M58 A;  5KYW B;  2A3L A;  2KRO A;  4XU3 A;  4ZGJ B;  3L2V A;  3QBY A;  2VGM A;  2F2V A;  1BB9 A;  2LP5 A;  4IUP A;  2MI6 A;  4M78 B;  3L2R A;  2WAC A;  3EGU A;  1NEG A;  4ORZ A;  2FO0 A;  2HSP A;  1T3S A;  1G2B A;  3G6E T;  1YCY A;  3MKD A;  3A98 A;  2EPD A;  2K5L A;  2BKD N;  1QKX A;  3OY9 A;  2IG0 A;  1ZA1 B;  4PJO D;  4BY6 B;  5AYF A;  1VQ9 Q;  3M53 A;  5LJ5 f;  3CCQ T;  3BE3 A;  1PD0 A;  3QO3 A;  3CCV A;  3M4G A;  3QII A;  2ABL A;  1Y96 B;  2EGE A;  1UJ0 A;  3HSB A;  4EDU A;  2R5A A;  2ZZD A;  3EH2 A;  4M7A A;  2P0Q A;  1N8R U;  3KBG A;  2OJ2 A;  1W2B P;  3VYH B;  2SRC A;  3ZEH A;  1SG5 A;  1X27 A;  2EGC A;  3G4S T;  1BIB A;  3FJP A;  4RTT A;  1VQN A;  2PU9 B;  2JT4 A;  2Y90 A;  1X6G A;  2WSF E;  2DXT A;  3ZBD A;  1XQH A;  1TUD A;  2YWW A;  3G71 Q;  2DJZ A;  1FYN A;  4A63 B;  1G3T A;  2OTL Q;  3JCM h;  5GAN e;  1TSF A;  2J05 A;  3H6Z A;  3CCU Q;  2MYS A;  1KHC A;  1YIJ Q;  3CCR T;  1ZSZ A;  2B8A A;  1OX8 A;  5HY6 A;  5KYX A;  1X01 A;  4F04 B;  1M90 R;  4M7A C;  2DD5 A;  4PKC C;  1WXT A;  4ZN1 A;  1GFD A;  1GCQ A;  1QP2 A;  3RDV A;  1K9A A;  4CC7 A;  1I8F A;  2DMO A;  4C0D C;  2NUP B;  3OMG A;  5LJ3 d;  3SEM A;  4QVC A;  5IT9 E;  5KE2 A;  1AWW A;  1Y71 A;  1K0X A;  2CSI A;  1YHQ T;  3EFS A;  2VXF A;  4A4G A;  2H3E B;  5GMK i;  1WHH A;  1M5Q 1;  1Q7Y U;  3EGD A;  5GMK h;  3EFO A;  1Q82 U;  3G1J A;  1M8V A;  2KNB B;  4J6W A;  2OAW A;  2DTH A;  4EIK A;  2OTJ T;  3WVD B;  1ZSZ C;  2EQU A;  3LGL A;  4FYW B;  3I55 A;  1M1K U;  5LJ5 g;  1OOT A;  2LX9 A;  3X26 B;  1WYX A;  2MOX A;  5LJ3 e;  5KYY A;  1K73 R;  3LH0 A;  1IO6 A;  2O4X A;  1GCQ C;  4C5E A;  4Z88 A;  4KGV B;  2X3W D;  1IB8 A;  3CCL T;  5D7U A;  2E10 A;  4BI8 B;  1I5L A;  3CCV Q;  5LJ3 h;  1RAE B;  2FEI A;  2FVU A;  2MWO A;  3CEY A;  3RKX A;  2RN8 A;  4BI3 A;  1UEB A;  2M0O A;  3UDC A;  2QGF B;  4QVZ A;  1QVG P;  3QHS A;  1HSQ A;  1NE8 A;  5I11 A;  4IUR A;  2NUT A;  1S72 Q;  2GBQ A;  3HRT A;  1U1S A;  2Z0W A;  1KD1 C;  4C8Q E;  3L2W A;  1M9S A;  3A8O B;  4MZT A;  1KIK A;  2EFI A;  2QA4 Q;  3OW2 A;  4X9D A;  4M7D A;  4JDS A;  2W10 A;  1VQL Q;  4PK4 A;  1JBM A;  4NL2 A;  2CUD A;  2CZ0 B;  1M3A A;  2EYY A;  2RM4 A;  2V8I A;  3CPW S;  4FSS A;  4J7F A;  2HBW A;  2LQK A;  2RK2 A;  3X20 B;  3JCM P;  4JJN K;  1YJN T;  2RH2 A;  3QXE B;  2RHX A;  1RAA B;  1JXO A;  4BUG A;  3ZFJ A;  2NLU A;  1PKT A;  1UHC A;  2DVJ A;  4D8D A;  2JXB A;  4F16 A;  1KHI A;  1KQ2 A;  2DNU A;  1KSW A;  1Y7X A;  2FZG B;  1LOJ A;  1K0S A;  4M77 E;  1AZE A;  4M7D C;  1KFZ A;  2RJE A;  5IH2 A;  2LNV A;  2K9G A;  3SWN A;  4PFP A;  1MMD A;  3E2U A;  1N8R C;  3I56 T;  4A4H A;  1M90 U;  2KAF A;  3SB2 A;  4R56 A;  2J06 A;  4J6Y A;  5KCH A;  1U1T A;  1QP3 A;  4R0K A;  5FU7 B;  3SFM A;  1M2V B;  2CS7 A;  4C92 A;  3OYJ A;  3E9F A;  4C8Q G;  1TH7 A;  2DVE A;  1OV3 A;  2HQX A;  1T0H A;  2E5K A;  2LT1 A;  1OX9 A;  4P5N A;  1FX7 A;  2RI2 A;  3CC4 A;  3CCS Q;  3HFN A;  1K8A R;  1X6O A;  2CZ6 B;  3CC2 Q;  2XMF A;  3TEE A;  2JW4 A;  1N27 A;  5DM7 R;  1YJ9 Q;  3M5A A;  5C6S A;  4N0A A;  2DIL A;  2ZPB B;  2FL7 A;  2DK3 A;  5IAY A;  3SWN C;  3A8H B;  4OP0 A;  2ECZ A;  2IVW A;  4JJB A;  4JRK A;  2NWM A;  2PNI A;  3OBY A;  3OYI A;  2A28 A;  4C92 C;  4QT7 A;  1CKA A;  5KYW A;  2RK1 A;  1BK2 A;  1JEG A;  4FW2 A;  1XTD A;  4M78 A;  4AFU C;  4E7H A;  5CQX A;  2V1Q A;  1BKB A;  4L6V 5;  2EWN A;  1QQJ A;  1YWP A;  4HCZ A;  3L2Q A;  1AEY A;  4HT9 A;  4N0A C;  2QK0 A;  2DIG A;  3M54 A;  5FWC A;  2XID A;  2WSC E;  2E4H A;  2EJG A;  3BY7 A;  4CRI A;  3G71 T;  3QSU A;  4X9C A;  3M4Y A;  4J9G A;  4IUV A;  4PJO C;  3JB9 J;  2OI3 A;  3L2Z A;  4CC2 A;  3H0H A;  3OBW A;  6AT1 B;  1B7T A;  3CCE T;  4RTY A;  2QEX A;  2OAU A;  4BB7 A;  3EH1 A;  4M78 C;  4DBF A;  1YHQ A;  3C0C A;  3VU3 C;  1TS9 A;  2A7Y A;  3QJ6 A;  1NYG A;  1T3L A;  3TSW A;  1Q86 R;  2EYX A;  4C8Q B;  4E7K A;  5CK9 A;  4N4G A;  2DL5 A;  3G6E Q;  1WJS A;  1F1B B;  3PNW C;  1PSF A;  4JRI A;  1NG2 A;  2K6D A;  3BFM A;  3PE0 A;  1C1A A;  4II1 A;  4JJD A;  1SKU B;  2J6K A;  2E3I A;  3JCM c;  4BY6 C;  1IHW A;  2CRE A;  3M0R A;  4HVV A;  2H8H A;  3CPF A;  1Z9Q A;  3LWI A;  3DKM A;  4KUL A;  3AHU A;  2H3J A;  2M0Y A;  1MV3 A;  1Z9Z A;  4ZNX A;  2EQM A;  2GQV A;  1KQS P;  1KK7 A;  2DJQ A;  3LWH A;  4ELZ C;  3OS2 A;  5GAO p;  1K8A U;  1J3T A;  5GAO l;  3PTA A;  4FYX B;  4HVW A;  4PJO E;  1PCX A;  2NUP A;  3G4S Q;  1VUB A;  4M77 B;  1NLO C;  3RIR A;  5GAO m;  5GAN f;  2K79 A;  3CME A;  1MUZ A;  3RKY A;  1EFN A;  5DLO A;  3OYH A;  2A37 A;  1LJO A;  4OGC A;  2QTX A;  3M56 A;  1QCN A;  2KVQ G;  4JS5 A;  2RB6 A;  4ZTJ A;  2BTT A;  1VQN T;  1BI1 A;  3UF4 A;  1NPR A;  3CCR Q;  4PJL A;  3OS0 A;  3T9N A;  1UJY A;  5C0M A;  2CGH A;  2EAY A;  1W2B A;  4OML A;  2FB7 A;  2HQH A;  4XU0 A;  4Q5W A;  2DE0 X;  4A4E A;  1G5V A;  1H92 A;  4AT1 B;  5KCO A;  1RAC B;  1BI3 A;  2CUB A;  2LQN A;  1UTI A;  1YHQ Q;  2D1X A;  1OZ2 A;  4FU6 A;  2VAS A;  1K73 C;  4M7D F;  4HVU A;  2V26 A;  4PJO G;  3N5B B;  1SHG A;  1WI7 A;  5GAM g;  2OTJ Q;  5HCK A;  5D6Y A;  3M0U A;  1MNE A;  1SSF A;  2DZC A;  3A8M B;  4LDV A;  4QQD A;  2XU8 A;  1TUC A;  3CCL Q;  3I55 T;  3JB9 H;  3NTI A;  1O9S A;  2JUF A;  3OYY A;  3G7Z A;  3CXC S;  4C5H A;  3V7S A;  2Y4X A;  1D3B B;  4E7S A;  2LJ3 A;  2ZGW A;  2DAQ A;  4MDW A;  2BE7 D;  2DER A;  1WLP B;  2BE9 B;  2PUK B;  2ZAE A;  2DEQ A;  1S1N A;  4D8K A;  1QVP A;  4WCI A;  2C0T A;  3MET A;  2YUO A;  3CBO A;  5A0L A;  3OSV A;  4AFS C;  2C0I A;  2L2P A;  3CME Q;  1BCM A;  4WTO B;  1SSH A;  1D09 B;  1LCK A;  3JAM E;  4KGZ B;  2LCL A;  4KT0 E;  1M2V A;  2DEU A;  1IRX A;  2COZ A;  5GMK j;  3MP8 A;  4XU2 A;  2D6F A;  1D1C A;  1BYM A;  3QZ5 B;  1TTH B;  1QVG A;  2EGA A;  1YJN Q;  2DL7 A;  2E65 A;  3C95 A;  3GF5 A;  1VA7 A;  2CT3 A;  1U5S A;  2YXY A;  3CCJ T;  1PWT A;  2V8J A;  2B86 A;  3MJX A;  2JS2 A;  2RHZ A;  4XTY A;  5LJ3 j;  3H0I A;  7AT1 B;  3CCE A;  4PJO F;  2RQV A;  1PC0 A;  1Y0M A;  3JB9 D;  1OQK A;  1R0C B;  1NEB A;  4RG8 A;  1Q7Y R;  3I56 Q;  5FU7 C;  1Q82 R;  1K8A C;  2HD0 A;  2R5M A;  4M78 F;  2VC8 A;  3U23 A;  2F2X A;  2CDT A;  2KGT A;  1PNJ A;  3THK A;  5KYU B;  3JCM V;  1HK9 A;  4ESR A;  3C4S A;  3I5S A;  4C0Z A;  3PIO A;  4KGX B;  3X24 B;  2BUD A;  1QKW A;  4PJM A;  2X4Y A;  2EQI A;  3QZ9 B;  1UHF A;  2ESW A;  3QUI A;  2BZY A;  3ER0 A;  3MP6 A;  3A1P A;  2C0O A;  5CKE A;  2QTV A;  3CC4 T;  2VGN A;  1ZUK A;  4ATO A;  3QDR B;  2X4X A;  3OQ5 A;  1GL5 A;  2HL5 C;  4QVD A;  4CC3 A;  3JCM d;  3REA B;  4XAX B;  2MPX C;  2K2M A;  2LX7 A;  1BIA A;  1I4K 1;  2FRY A;  2O9V A;  2JTM A;  1RLQ C;  2HCK A;  1UEC A;  3A5Z B;  4ZTF A;  3GPL A;  2JS0 A;  2O9S A;  5IXB A;  1OYX A;  2XG8 D;  2JMA A;  2MAM A;  4M75 D;  4ZGD B;  1QVF P;  3F70 A;  4C8Q A;  4QQ6 A;  3JCM e;  2MF2 A;  2P0P A;  2CZ7 B;  2K3B A;  1SRM A;  2DL4 A;  4PJN A;  1RAH B;  2X51 A;  2Y4Y A;  3WXM B;  1CSK A;  3S3N A;  1W4S A;  1WXU A;  2DZ9 A;  1Q81 R;  2EIF A;  4KUD K;  2JOY A;  2DRM A;  3RKW A;  1Q86 C;  5GAM h;  3CCE Q;  2KRM A;  1IGQ A;  4B9W A;  2CSQ A;  2XIC A;  1VQM A;  2DXB A;  4FIB A;  2D8J A;  5GJV B;  8ATC B;  4C8Q C;  1B07 A;  1FXX A;  3ASK A;  4FT2 A;  2QEX T;  1PSE A;  4M77 A;  5GMK e;  3JCM Q;  1WHG A;  2O2O A;  3HKS A;  5IHK A;  3PIP A;  1UGS B;  1X69 A;  2KSS A;  2KT8 A;  3JCM J;  4C5G A;  2EQK A;  3BW1 A;  2HNI A;  5GAO r;  3DLL A;  1QCO A;  1WJR A;  4KRT A;  3OYD A;  1I1J A;  4HXJ A;  4HT8 A;  4HA8 A;  2AT1 B;  2ED1 A;  1WHJ A;  4QQG A;  1PKS A;  2AZS A;  2PVG B;  1WJQ A;  1AVZ C;  2KEA A;  4M77 C;  5GAN 5;  4F17 A;  4Y28 E;  3OS1 A;  4KUI A;  1H8K A;  5FU6 B;  1IHV A;  3FDR A;  1QMC A;  1K9M R;  1VQN Q;  1YN8 A;  4HCC A;  1M30 A;  3MCA B;  3C94 A;  1VQ8 A;  4QKU A;  3CME T;  4MDX A;  3NMZ C;  1KQS A;  1B34 B;  2RJD A;  2F69 A;  3EHQ A;  1MV0 B;  3CD6 A;  3LLR A;  2XI9 A;  4K11 A;  2QAS A;  2FHD A;  1VQO T;  3CCJ A;  4XTX A;  4ME7 A;  4C0F A;  5CKF A;  2M51 A;  1IXD A;  1C0M A;  1ZA2 B;  3RMS A;  1D3B A;  3Q1J A;  3SD4 A;  4XTU A;  2M02 A;  1T0J A;  1ABO A;  1WDX A;  4LXC A;  4J8O A;  2PQW A;  1UB4 A;  2DBK A;  1YIT T;  1Q81 U;  4OMM A;  1W1F A;  2HEQ A;  3V8L A;  2AZV A;  2QQ9 A;  3KFV A;  4LDW A;  3L1A A;  1ZLM A;  1AOJ A;  1WHM A;  2QXF A;  2HKQ B;  4TVR A;  2LT4 A;  1M3C A;  2D0N A;  1VQ7 A;  3H0F A;  1WZO A;  4J9C A;  5FRM A;  4LN2 A;  3I55 Q;  1WFW A;  2ZPH B;  3RBB B;  2F1L A;  3UPU A;  1B3Q A;  4XTW A;  5J3B A;  3OW2 S;  4A4F A;  1KQS S;  1OEB A;  4J6X A;  2LQ8 A;  1C6V X;  2K4Y A;  4AMC A;  2L3R A;  4RKU E;  4KH0 B;  2YUN A;  4E7I A;  2E5Q A;  3V8K A;  1MND A;  3V7C A;  2IPO B;  3HRU A;  4DEX A;  3JB9 I;  3EGX B;  2LTO A;  2RI3 A;  4BE0 A;  4FCY A;  1M4Z A;  4E7Z A;  3QPH A;  4AFZ C;  2GTO A;  3E19 A;  1TU0 B;  4PJO A;  5IHN A;  1RLP C;  2MWP A;  4OB2 B;  4M77 G;  5LJ5 d;  5KYU A;  1NJI R;  1RL2 A;  2D8H A;  3JSC A;  1RAD B;  5GAN 8;  3SDZ A;  2XD0 A;  3OYA A;  1Q7Y C;  5J26 A;  1MGQ A;  1U3O A;  3CCJ Q;  1Q82 C;  3URG A;  4B6M A;  1BI2 A;  2BZ8 A;  1M1K C;  1K9M U;  1K76 A;  4ZGE B;  2F5T X;  1WHL A;  3VS6 A;  2RA2 A;  1EX4 A;  2O88 A;  1LPL A;  2FYK A;  1VQ4 A;  2HDA A;  2KRN A;  4OVA A;  3GP8 A;  4Z89 A;  2FG0 A;  4OMN A;  1ZBJ A;  2AIR B;  4E7L A;  4F7U E;  2XDB A;  2RQR A;  3FC3 A;  4LUE A;  3OA6 A;  4N4I A;  3MHX A;  1AT1 B;  1Y96 A;  3VS3 A;  5LJ5 h;  2P4R A;  2PVO B;  4D6W A;  4C8Q F;  3GIB A;  2RMO A;  3VS1 A;  2KYM A;  4LUD A;  2AKK A;  2GNC A;  1UGV A;  3BDL A;  4J9H A;  2GQI A;  3NTK A;  1AD5 A;  3CPW P;  1HJD A;  3LGF A;  2DF6 A;  3QWY A;  4JS4 A;  2RD1 A;  1VYT A;  1W6X A;  1TOV A;  3P8D A;  1X75 C;  3VS0 A;  3CC4 Q;  1WXB A;  4RTX A;  2ZPI B;  4M7A B;  3VS7 A;  3BDU A;  1TWB A;  1G8X A;  1GBQ A;  3OYG A;  4QW2 A;  2ZPE B;  2RHU A;  5GAO n;  5GAN 2;  5EG2 A;  4JRP A;  3OMC A;  4M77 F;  1GBR A;  4GBQ A;  3L2U A;  2VXE A;  3EG3 A;  4LE9 A;  5GAN 6;  2JJ9 A;  1HYO A;  1VQ5 T;  2J6O A;  4OF1 A;  1Q81 C;  4F7U G;  4E7J A;  1IRE B;  3DLM A;  3A8L B;  3OYM A;  3H8Z A;  2X4W A;  1YJW T;  3RUX A;  1BCO A;  5I21 A;  2LMJ A;  4M7A D;  3J7A F;  3CC7 T;  1OI1 A;  1M90 C;  1U06 A;  2LRQ A;  1D0Y A;  3CBP A;  5J39 A;  3PFS A;  4M75 E;  1UFF A;  5IXF A;  3LX7 A;  2COY A;  3S6W A;  1VQO A;  1RAF B;  4DOV A;  1AZG B;  2CYZ B;  1UUE A;  1NBE B;  1NJI U;  3QKJ A;  4FT4 A;  4J83 A;  4BDZ A;  3VJP A;  1VQ4 Q;  1RI0 A;  1UDL A;  2CP3 A;  1QVF A;  4OB1 B;  1YI2 A;  2ROL A;  1YIT A;  2ATC B;  4FYV B;  2QEX Q;  1UGQ B;  4B9X A;  5FW9 A;  1Y07 A;  2QGG A;  4WF2 A;  3OS5 A;  1BI0 A;  3PGG A;  1D1A A;  1VQM T;  3ME9 A;  2O4X B;  4DEY A;  2AHJ B;  2LC4 A;  3E9G A;  4GLK A;  3ZL7 C;  1KD1 R;  5LJ3 f;  1JJ2 P;  4PFO A;  1JQQ A;  1HD3 A;  2FZK B;  3OYF A;  1E7O A;  2HSE B;  5CKH A;  3M57 A;  1H64 1;  2A08 A;  5D6X A;  2AK5 A;  2E1H A;  1B34 A;  2I0N A;  1BBZ A;  5EC7 A;  2PUO B;  2KRS A;  3M0T A;  1OPK A;  1R8O B;  2YUP A;  3CBM A;  3CCM A;  2HL3 A;  3UAT A;  2ED0 A;  2K57 A;  2EVR A;  2QYZ A;  2KK4 A;  2HMA A;  1K9M C;  1U8R A;  3GNG A;  2CZ1 B;  2MCN A;  2ENM A;  3HTR A;  5FU6 C;  5GAN g;  1M1G A;  5FRN A;  2L3Q A;  3HHT B;  3LYI A;  5KH6 A;  1W2B S;  3PMI A;  3VRZ A;  2XDD A;  4F7U B;  3EHR A;  4BD3 A;  1WX6 A;  4GLM A;  2KMT A;  4FM4 B;  5DLQ E;  4BAC A;  2PVD B;  1A0N B;  1VOM A;  4AFQ C;  3L42 A;  1ZUU A;  3OYE A;  4L5G A;  1YNZ A;  4RG2 A;  5CKD A;  2A36 A;  2DXU A;  2LNH B;  2K2V A;  2BZX A;  3FB9 A;  3QG1 A;  1K4U S;  1VQ9 A;  5CR2 A;  2M16 A;  1VQO Q;  3JCM X;  1VQ8 T;  2K7A A;  1N5Z A;  4M7D D;  4OGE A;  2MK5 A;  3CD6 T;  2DYB A;  5GAO q;  3SWN B;  3R6N A;  4PLL A;  1YI2 Q;  1V29 B;  4CI0 C;  1YIT Q;  3FIF A;  5LJ3 g;  2DET A;  1M8M A;  4FW1 A;  3VS4 A;  2LZ6 B;  2HBP A;  3A8G B;  1BU1 A;  3M59 A;  1N6A A;  3EG9 B;  3EGX A;  2RHI A;  4HCB A;  2RPN A;  4X34 A;  1SHF A;  2DTI A;  2LJ1 A;  2YSQ A;  2KR3 A;  1GFC A;  2OTL A;  1ZBX A;  3WVE B;  2FZC B;  3GNF B;  5CO7 A;  2DM1 A;  1IGU A;  3CCU A;  1HXD A;  2LCS A;  2JM8 A;  1GRI A;  1YIJ A;  4Y91 A;  1I5O B;  2QAZ A;  3QYG B;  1YFN A;  3QJY A;  3H9N A;  4JJC A;  3HP9 A;  1VQ7 T;  3FRN A;  3INZ A;  4J9B A;  2GF7 A;  2V8K A;  2P4T A;  4FSX A;  3EAE A;  4XU1 A;  2LVM A;  1KJW A;  4HKE A;  4M75 B;  4C92 D;  5FLX E;  3M55 A;  1KD1 U;  3VUZ A;  1PM3 A;  2HAX A;  1XJW B;  2DPP B;  4M4Z A;  4XK8 E;  1NJI C;  5CQY A;  1QVG S;  4L59 A;  4KBM B;  2FPD A;  4OMO A;  2EYW A;  3MEV A;  1V1C A;  4PFZ A;  2JNG A;  2R57 A;  1VQ5 A;  3S3O A;  2EJ9 A;  5CAI A;  2VKN A;  4LNP A;  3VUB A;  3LH5 A;  5GAM d;  2F2W A;  3QYH B;  4BE1 A;  4HCK A;  3IQL A;  1QWF A;  1YJW A;  3TSZ A;  5FRO A;  5M9O A;  3CC7 A;  2RQW A;  5GJW B;  2AKL A;  2P84 A;  2A0F B;  3SHW A;  3FLG A;  2EYZ A;  2FPF A;  3CXC P;  3VRY A;  2FPE A;  1ZSG A;  1QCF A;  2F5K A;  4ELY C;  2ZCF B;  2CH4 W;  5GAM e;  4M78 D;  1CKB A;  4RCC A;  1ABQ A;  5GAN d;  3OYK A;  1NPP A;  3MO8 A;  2I2L A;  1S72 A;  2HKN A;  1NZ9 A;  2XDP A;  3HPW A;  2EKH A;  1VQP T;  1WNL A;  3UA7 A;  1GXI E;  2LQW A;  1VQK T;  2X35 A;  2GGR A;  2QA4 A;  4PNO A;  5CCA A;  3RR6 A;  2MMP A;  1VQ4 T;  2DIQ A;  1VQL A;  2FRW A;  1NYF A;  1M3B A;  4OMQ A;  3VS2 A;  3RNJ A;  3VS5 A;  2YLB A;  3TCJ A;  3C12 A;  2QQB A;  2C06 A;  1V76 A;  4A54 A;  4NL3 A;  5CIU A;  5GAN h;  5KYN A;  2EQJ A;  1O75 A;  2QDY B;  3I5R A;  1X43 A;  1FMK A;  3FEO A;  9ATC B;  3M0Q A;  2VUB A;  4ZN3 A;  4RTW A;  1Y57 A;  1QWE A;  3RMQ A;  1M1F A;  2RF0 A;  1MHN A;  2DA9 A;  1VQ6 T;  4E2F B;  2L3P A;  4C0G A;  3CPW A;  3MP1 A;  4F14 A;  3PT9 A;  1VQ5 Q;  2G6F X;  4PJJ A;  2CP5 A;  1AHJ B;  3MEU A;  5I2S A;  2PZ1 A;  1FWZ A;  2VVK A;  1YJW Q;  5CKB A;  1KC8 R;  5LJ5 j;  4OMF B;  3GLX A;  2RJF A;  1JXM A;  3CCS A;  1M27 C;  2DO3 A;  3M0S A;  2NYS A;  3CC7 Q;  3TVT A;  1VIE A;  3CC2 A;  4A4K A;  2NUZ A;  3J81 E;  3EFR A;  1YJ9 A;  3R6O A;  3PVQ A;  4DQ2 A;  1P92 A;  5HK0 A;  3JCM b;  1MMG A;  2VWF A;  4M7A E;  2JMC A;  4BI4 A;  3I9Q A;  1XNI A;  2L0A A;  4XQ3 A;  3NHN A;  2COW A;  1SEM A;  3M0P A;  4XTV A;  4GY5 A;  4R55 A;  2DYI A;  1NLP C;  4LDY A;  4MZP A;  1FMW A;  3CQT A;  1ZX6 A;  1WQW A;  4LD6 A;  1H3Z A;  1VQM Q;  3OSS C;  1YI2 T;  4XTZ A;  1TUG B;  1X2Q A;  4F7U A;  4RTZ A;  2ZPF B;  4A53 A;  3TU4 K;  5AT1 B;  3X25 B;  4OB0 B;  2J6F A;  3MPU B;  2J7I A;  1OPL A;  4J9D A;  3NGP A;  3RES A;  2KY9 A;  2HQE A;  2X4J A;  3EG1 A;  4EMG A;  4EMK B;  2CP0 A;  4AG1 C;  5A0D A;  3HL8 A;  1X2K A;  4MMK A;  5KE3 A;  1WQ7 A;  1Q95 G;  5LL6 S;  2GFU A;  3VKI A;  3CMA T;  1AWO A;  2JZ2 A;  2QQA A;  2YT6 A;  4RUG A;  4M7A G;  4IUQ A;  1RAI B;  1JJ2 A;  3CCM T;  1IZ6 A;  2KE9 A;  3P8H A;  2E6N A;  5HK3 A;  3KXT A;  1N9S A;  3ULR B;  5L23 A;  5CVI A;  4JZ3 A; 
#chains in the Genus database with same CATH homology
 4C0D C;  3G6E A;  3CC7 T;  1OI1 A;  3OMG A;  5LJ3 d;  3CCJ T;  1M90 C;  2LRQ A;  3JCM W;  3CBP A;  2V8J A;  5J39 A;  4QVC A;  5IT9 E;  5KE2 A;  3JRZ A;  3OYL A;  3M9Q A;  3PFS A;  1Y71 A;  2RHZ A;  4M75 E;  4XTY A;  5D6W A;  3EFS A;  1YHQ T;  3LX7 A;  5LJ3 j;  2VXF A;  2XKO C;  3S6W A;  4A4G A;  2JN0 A;  4J5Y A;  4PJO F;  4DOV A;  3CCE A;  1VQO A;  5GMK i;  3JB9 D;  2CYZ B;  1M5Q 1;  1Q7Y U;  1I81 A;  4RG8 A;  5GMK h;  1Q82 U;  3CCQ A;  1NJI U;  3QKJ A;  1M8V A;  4J6W A;  5FU7 C;  2G3R A;  2QI2 A;  4FT4 A;  2K3Y A;  2DTH A;  4J83 A;  4BDZ A;  3VJP A;  1K8A C;  2OTJ T;  2HD0 A;  2R5M A;  3WVD B;  3LGL A;  2EQU A;  1RI0 A;  1M1K U;  3I55 A;  5LJ5 g;  2LX9 A;  4M78 F;  2VC8 A;  3X26 B;  1QVF A;  1KC8 U;  4NS5 A;  5LJ3 e;  4OB1 B;  1YI2 A;  3VYG A;  1K73 U;  1YIT A;  5GAN 7;  1VQ9 T;  3JCM V;  1HK9 A;  1KQ1 A;  3LH0 A;  4M75 A;  3C4S A;  3VV0 A;  4C0Z A;  1UGQ B;  2O4X A;  3X24 B;  4B9X A;  3PIO A;  2BUD A;  4C5E A;  1Y07 A;  4WF2 A;  2X4Y A;  3OS5 A;  4O6J A;  3CCL T;  1BI0 A;  3PGG A;  2M9U A;  2E10 A;  4BI8 B;  3G4S A;  2DXC A;  3QZ9 B;  3QUI A;  5A0G A;  1I5L A;  1VQP A;  1VQM T;  1KG1 A;  3ME9 A;  5LJ3 h;  1VQK A;  2MWO A;  3ER0 A;  2FVU A;  3CEY A;  3RKX A;  4BI3 A;  4M7D E;  2O4X B;  3MP6 A;  4MML A;  2AHJ B;  2LC4 A;  3E9G A;  5LJ5 e;  4GLK A;  4DOW A;  1UEB A;  5LJ3 f;  2M0O A;  3UDC A;  3UT1 A;  5CKE A;  2DD4 A;  4QVZ A;  3OYF A;  3CC4 T;  3QHS A;  2VGN A;  5CKH A;  1JJ2 S;  4ATO A;  1NE8 A;  4PLI A;  3M57 A;  3QDR B;  1H64 1;  1N9R A;  2X4X A;  3OQ5 A;  4IUR A;  3HRT A;  4EMH A;  1U1S A;  5D6X A;  4QVD A;  2E1H A;  4Z02 A;  5L8R E;  3CCR A;  1B34 A;  3LW5 E;  1KD1 C;  4C8Q E;  3JCM d;  1M9S A;  3L2W A;  4XAX B;  3A8O B;  4MZT A;  2EFI A;  2PUO B;  3TRE A;  3OW2 A;  1R8O B;  4X9D A;  4M7D A;  2JTF A;  3CBM A;  4JDS A;  3OYC A;  3CCM A;  2OTL T;  1BIA A;  1I4K 1;  2JTM A;  4M75 C;  2GFA A;  3CCU T;  1JBM A;  2D0Q B;  2K57 A;  2EJF A;  2KK4 A;  3A5Z B;  4NL2 A;  1YIJ T;  4M7A F;  2VV5 A;  4ZTF A;  3GPL A;  1K9M C;  2CZ0 B;  3O8V A;  1U8R A;  3GNG A;  2CZ1 B;  2RM4 A;  2V8I A;  1OYX A;  2XG8 D;  4J7F A;  3CPW S;  2MAM A;  5FU6 C;  5GAN g;  4M75 D;  4ZGD B;  1M1G A;  2LQK A;  2RK2 A;  5FRN A;  2RJC A;  2KQW A;  5KH6 A;  3HHT B;  3LYI A;  3F70 A;  1W2B S;  3PMI A;  4C8Q A;  3X20 B;  4QQ6 A;  2XDD A;  3JCM P;  4JJN K;  3JCM e;  3NFC A;  1DJ7 B;  2RH2 A;  3QXE B;  2MF2 A;  4F7U B;  1YJN T;  2P0P A;  2RHX A;  4BD3 A;  2CZ7 B;  4BUG A;  2KMT A;  3ZFJ A;  1VQ6 A;  4FM4 B;  2NLU A;  5DLQ E;  4BAC A;  4C92 E;  2PVD B;  2O01 E;  4C0D B;  2Y4Y A;  3L42 A;  3WXM B;  1KHI A;  2VYT A;  1W4S A;  3OYE A;  4L5G A;  2E41 A;  3S3N A;  2DZ9 A;  4RG2 A;  1KQ2 A;  5CKD A;  2OTJ A;  2EIF A;  4IUT A;  2DXU A;  1Y7X A;  1LOJ A;  2K2V A;  4M77 E;  4LDX A;  4KUD K;  2JOY A;  4M7D G;  3FB9 A;  3QG1 A;  1G3Y A;  3JCM f;  4M7D C;  2RJE A;  3RKW A;  2LNV A;  1Q86 C;  5GAM h;  5GAN 4;  1VQ9 A;  3SWN A;  5CR2 A;  2M16 A;  3I56 T;  3JCM X;  4A4H A;  5HKC A;  2KAF A;  1N8R C;  3SB2 A;  4R56 A;  2E12 A;  1M90 U;  2LDM A;  4J6Y A;  5GAM f;  1VQ8 T;  4B9W A;  5DY9 A;  3CCL A;  5KCH A;  1U1T A;  1QP3 A;  4YTL A;  2QQR A;  4OGE A;  1YBY A;  5FU7 B;  4M7D D;  3MEA A;  2XIC A;  3SFM A;  2CS7 A;  1VQM A;  2DXB A;  4C92 A;  4N4H A;  3KUF A;  3OYJ A;  5GAO q;  3CD6 T;  3E9F A;  3SWN B;  4DA4 A;  4FIB A;  4C8Q G;  1TH7 A;  2DVE A;  4C8Q C;  1FXX A;  2HQX A;  2P0K A;  3ASK A;  3MEW A;  4FT2 A;  2LT1 A;  2QEX T;  1PSE A;  4M77 A;  4PLL A;  5GMK e;  3JCM Q;  4P5N A;  1FX7 A;  3JB9 G;  1V29 B;  2RI2 A;  2RO0 A;  4CI0 C;  3CC4 A;  3HFN A;  4IKF A;  3HKS A;  3FIF A;  5LJ3 g;  2BIV A;  3PIP A;  4C8Q D;  3CCV T;  1LNX A;  1G3S A;  1UGS B;  1X6O A;  2CZ6 B;  2CKK A;  2HBP A;  2KSS A;  3A8G B;  3JCM J;  4C5G A;  2EQK A;  3M59 A;  3TEE A;  4PJO D;  1N6A A;  3BW1 A;  2RHI A;  5I2M A;  1N27 A;  5DM7 R;  4HCB A;  2HNI A;  2RHY A;  3M5A A;  5C6S A;  1XOV A;  4X34 A;  4N0A A;  2ZPB B;  2DTI A;  1G3W A;  5GAO r;  4RCB A;  3DLL A;  2FL7 A;  2OTL A;  1ZBX A;  2DK3 A;  3HFO A;  4M78 E;  4UC4 A;  3WVE B;  5IAY A;  3GNF B;  5CO7 A;  1S72 T;  1JRI A;  2M1H A;  3SWN C;  1WJR A;  3A8H B;  1HXD A;  3OYD A;  2K5I A;  3CCU A;  4OP0 A;  1YIJ A;  4Y91 A;  4HA8 A;  1VIF A;  2IVW A;  4JRK A;  4HT8 A;  3CXC A;  3OYI A;  3OBY A;  4C92 G;  3QYG B;  4QQG A;  3S3M A;  4C92 C;  2QA4 T;  3QJY A;  1UGR B;  3HP9 A;  1VQ7 T;  3FRN A;  2PVG B;  2GF7 A;  2V8K A;  2P4T A;  2D9T A;  2ZPG B;  3INZ A;  4FSX A;  3EAE A;  1VQL T;  2JVV A;  2RK1 A;  4XU1 A;  1WJQ A;  1WPY A;  1YJN A;  2LVM A;  1QW1 A;  4M77 C;  4HKE A;  4M75 B;  4C92 D;  5FLX E;  3M55 A;  3P8B B;  4BDY A;  5GAN 5;  4Y28 E;  1KD1 U;  4V2S A;  3VUZ A;  1XTD A;  4M78 A;  4E7H A;  5CQX A;  3OS1 A;  4KUI A;  1BKB A;  4L6V 5;  2EWN A;  3HRS A;  2E6Z A;  3OYB A;  2HAX A;  4M77 D;  5FU6 B;  4NOY A;  1JB0 E;  2DPP B;  4HCZ A;  3L2Q A;  3V7R A;  3FDR A;  2L8D A;  4XK8 E;  4OB3 B;  1NJI C;  5CQY A;  1QVG S;  4L59 A;  3RER A;  4KBM B;  4HT9 A;  4N0A C;  3J80 E;  2DIG A;  3CMA A;  3MEV A;  3M54 A;  2JNG A;  2R57 A;  2XID A;  1KC8 C;  2WSC E;  4BE2 A;  5IN1 A;  4HCC A;  2EJG A;  3BY7 A;  4CRI A;  5GAN 3;  2YRV A;  3I56 A;  3MCA B;  2EJ9 A;  3C94 A;  3JCM g;  5CAI A;  3G71 T;  3VUB A;  3S3O A;  1VQ8 A;  3QSU A;  4VUB A;  3CME T;  4LD9 K;  4X9C A;  4C5I A;  1KQS A;  4MDX A;  4FL6 A;  4JUV A;  5GAM d;  3M4Y A;  3QYH B;  4BE1 A;  4M75 G;  1B34 B;  2RJD A;  4IUV A;  2F69 A;  1YJW A;  3CD6 A;  4PJO C;  3JB9 J;  3L2Z A;  3LLR A;  5FRO A;  2XI9 A;  4F7U F;  4IUU A;  1UGP B;  2XK0 A;  3OBW A;  5GAM j;  4M7D B;  2FHD A;  5M9O A;  3CC7 A;  1VQO T;  2QEX A;  4XTX A;  4ME7 A;  3CCJ A;  3CCE T;  2OAU A;  4C0F A;  5CKF A;  1ZHI A;  4BB7 A;  4JRQ A;  1ZQ1 A;  4M78 G;  2K5F A;  4JLG A;  4M78 C;  3RMS A;  1YHQ A;  1D3B A;  3FLG A;  3Q1J A;  4RMO A;  3VU3 C;  3SD4 A;  4J7I A;  4XTU A;  2A7Y A;  1QVF S;  3JB9 F;  3QJ6 A;  2YHT A;  2F5K A;  4ELY C;  1Q86 U;  4J8O A;  2PQW A;  2ZCF B;  5GAM e;  4M78 D;  1UB4 A;  4C8Q B;  4E7K A;  5CK9 A;  4RCC A;  5GAN d;  4N4G A;  3OB9 A;  3CCS T;  1YIT T;  1Q81 U;  3V8J A;  3V8L A;  3OYK A;  1NPP A;  2QQ9 A;  3MO8 A;  1WJS A;  2I2L A;  4LDW A;  4JLI A;  1S72 A;  1NZ9 A;  3L1A A;  3CC2 T;  3PNW C;  2QXF A;  1PSF A;  2LCC A;  2XDP A;  3HPW A;  4EMK A;  5GAN j;  4JRI A;  1VQP T;  3BFM A;  1WNL A;  4EPC A;  4TVR A;  1GXI E;  1VQK T;  2LT4 A;  2X35 A;  4II1 A;  1YJ9 T;  3JCM c;  3GOX A;  4PNO A;  4BY6 C;  2L89 A;  5CCA A;  2QA4 A;  1VQ7 A;  3PMT A;  2WSE E;  2MMP A;  5GMK l;  1VQ4 T;  2DIQ A;  1VQL A;  3E1S A;  4C92 F;  3CPF A;  3LWI A;  3DKM A;  2E64 A;  4KUL A;  2H3J A;  5FRM A;  3AHU A;  5GMK m;  2EYQ A;  2EQM A;  2ZPH B;  2GQV A;  4PL6 A;  3UPU A;  2YLB A;  4XTW A;  5J3B A;  2RI5 A;  3LWH A;  3OW2 S;  4C92 B;  4ELZ C;  3OS2 A;  5GAO p;  1K8A U;  3TCJ A;  3C12 A;  4A4F A;  2QQB A;  5GAO l;  3PTA A;  1KQS S;  2C06 A;  4J6X A;  2LQ8 A;  4A54 A;  4PJO E;  2GCX A;  4LDU A;  2K4Y A;  4NL3 A;  2L5Q A;  5CIU A;  1OZ3 A;  5GAN h;  1VUB A;  4M77 B;  2DKG A;  3RIR A;  2L3R A;  2XHC A;  3DB3 A;  4RKU E;  4O5V A;  5GAO m;  2EQJ A;  1O75 A;  2QDY B;  2YLC A;  3UWN A;  5GAN f;  4E7I A;  2E5Q A;  2E70 A;  3V8K A;  3G71 A;  4MZM A;  3FEO A;  3DB4 A;  2DTO A;  4EMK C;  3CME A;  3V7C A;  2VUB A;  3RKY A;  5DLO A;  3HRU A;  3NTH A;  1WGS A;  5A2Q E;  3JB9 I;  3OYH A;  2LTO A;  4ZN3 A;  1LJO A;  4OGC A;  2RI3 A;  2QTX A;  3M56 A;  4BE0 A;  2KVQ G;  1M4Z A;  2RB6 A;  3X28 B;  4JS5 A;  4ZTJ A;  2K3X A;  1VQN T;  1BI1 A;  3RMQ A;  2QQS A;  4M75 F;  3QPH A;  1M1F A;  1NPR A;  3E19 A;  1MHN A;  4PJO A;  3OS0 A;  1VQ6 T;  4C0G A;  3T9N A;  3OYN A;  4E47 A;  5C0M A;  3MP1 A;  3CPW A;  2MWP A;  2CGH A;  2KDS A;  3PT9 A;  2EAY A;  4OB2 B;  2R58 A;  4M77 G;  5LJ5 d;  1W2B A;  1RL2 A;  2EKO A;  2FB7 A;  1AHJ B;  3JSC A;  3MEU A;  5I2S A;  4PJO B;  4XU0 A;  1FWZ A;  1EIF A;  5GAN 8;  4Q5W A;  3SDZ A;  2XD0 A;  3M58 A;  5CKB A;  4A4E A;  2A3L A;  4OMF B;  5LJ5 j;  3GLX A;  2RJF A;  4XU3 A;  4ZGJ B;  3OYA A;  5KCO A;  3L2V A;  1G5V A;  3CCS A;  1Q7Y C;  3QBY A;  2VGM A;  2DO3 A;  5J26 A;  1MGQ A;  4IUP A;  1BI3 A;  3URG A;  1Q82 C;  2MI6 A;  1VIE A;  4M78 B;  3L2R A;  3CC2 A;  1BI2 A;  2WAC A;  4A4K A;  1K9M U;  1M1K C;  4ZGE B;  2F5T X;  3J81 E;  1OZ2 A;  2RA2 A;  3EFR A;  4FU6 A;  1YJ9 A;  3R6O A;  4DQ2 A;  1K73 C;  4M7D F;  1P92 A;  2FYK A;  3G6E T;  5HK0 A;  1VQ4 A;  4OVA A;  3JCM b;  3GP8 A;  1YCY A;  4M7A E;  4PJO G;  3N5B B;  4BI4 A;  5GAM g;  4E7L A;  4F7U E;  2K5L A;  1XNI A;  2BKD N;  4XQ3 A;  2XDB A;  3FC3 A;  3OA6 A;  5D6Y A;  4N4I A;  3MHX A;  1SSF A;  1Y96 A;  4XTV A;  4GY5 A;  2DZC A;  2IG0 A;  5LJ5 h;  3OY9 A;  3A8M B;  4LDV A;  4QQD A;  2XU8 A;  2PVO B;  5AYF A;  4BY6 B;  4D6W A;  4C8Q F;  3M53 A;  4R55 A;  3GIB A;  5LJ5 f;  3CCQ T;  3QO3 A;  3CCV A;  4LDY A;  4MZP A;  3M4G A;  3QII A;  1Y96 B;  3I55 T;  3BDL A;  1WQW A;  4LD6 A;  3JB9 H;  3NTI A;  1O9S A;  2JUF A;  3HSB A;  1H3Z A;  3OSS C;  3OYY A;  4EDU A;  2R5A A;  2ZZD A;  3G7Z A;  3CXC S;  3NTK A;  4M7A A;  1YI2 T;  2P0Q A;  4XTZ A;  4C5H A;  3KBG A;  3V7S A;  3LGF A;  1N8R U;  2Y4X A;  1D3B B;  4F7U A;  4JS4 A;  3VYH B;  2ZGW A;  2ZPF B;  4A53 A;  3TU4 K;  2RD1 A;  3ZEH A;  2DAQ A;  3P8D A;  3X25 B;  1X75 C;  4MDW A;  4OB0 B;  2ZPI B;  4M7A B;  1BIB A;  2PUK B;  3FJP A;  3G4S T;  2DEQ A;  1VQN A;  2PU9 B;  3BDU A;  2Y90 A;  3RES A;  2KY9 A;  2HQE A;  1QVP A;  2WSF E;  2DXT A;  2X4J A;  3MET A;  4EMG A;  3ZBD A;  3CBO A;  1XQH A;  4EMK B;  5A0L A;  3OYG A;  2DJZ A;  3OSV A;  5A0D A;  4QW2 A;  3HL8 A;  4MMK A;  1G3T A;  5KE3 A;  1WQ7 A;  3JCM h;  5GAN e;  2ZPE B;  2RHU A;  5GAO n;  5LL6 S;  3H6Z A;  2GFU A;  5GAN 2;  5EG2 A;  4JRP A;  1KHC A;  3VKI A;  3JAM E;  3OMC A;  4M77 F;  3CMA T;  2LCL A;  3CCR T;  4KT0 E;  3L2U A;  2JZ2 A;  2VXE A;  2QQA A;  5GAN 6;  3MP8 A;  2B8A A;  5GMK j;  1VQ5 T;  5HY6 A;  4XU2 A;  4M7A G;  1X01 A;  4OF1 A;  4IUQ A;  2D6F A;  4M7A C;  1Q81 C;  3CCM T;  1JJ2 A;  1IZ6 A;  4F7U G;  4E7J A;  2DD5 A;  4PKC C;  1IRE B;  3DLM A;  1BYM A;  3QZ5 B;  3A8L B;  3P8H A;  3OYM A;  3H8Z A;  1QVG A;  2X4W A;  4ZN1 A;  1YJW T;  2E6N A;  2E65 A;  3RUX A;  3C95 A;  3GF5 A;  1QP2 A;  5I21 A;  5HK3 A;  3KXT A;  1N9S A;  1I8F A;  3J7A F;  4M7A D;  1VQ5 A;  5CVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...