4EPCA

Crystal structure of autolysin repeat domains from staphylococcus epidermidis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
152
structure length
141
Chain Sequence
NNQLTVTNNSGVAQINANSGLYTTVYDTKGKTTNQIQRTLSVTAATLGDFYLVGDYNTGTNYGWVQDEVIYNTASPVKINQTYNVPGVLHTVPWGTYNQVAGTVSGKGDQTFKATQQQIDATYLYGTVNGKSGWISYYLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords N-acetylmuramoyl-L-alanine amidase
publication title Ligand-binding properties and conformational dynamics of autolysin repeat domains in staphylococcal cell wall recognition.
pubmed doi rcsb
source organism Staphylococcus epidermidis
total genus 23
structure length 141
sequence length 152
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13457 GW GW (Gly-Tryp) dipeptide domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA01
2.30.30.170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4epcA02
4EPCA 1M9SA
chains in the Genus database with same CATH superfamily
1UTIA 2EW3A 4GY5A 1M9SA 1UGPB 1VQ8A 1K9MC 1MNEA 4E7KA 3OMGA 2E70A 2QYZA 1AZGB 2DZCA 1JXMA 2QTXA 5IXFA 2YUQA 3FB9A 4C0DB 2RQTA 1KSWA 4C92C 2COWA 2BTTA 2DLPA 1Y57A 3BW1A 2J6OA 4CC2A 2EFIA 1VQ6T 1YJWT 4EMKC 2K3XA 2EGAA 3NMZC 2PUKB 1YI2T 2L2PA 2QQBA 5KYYA 1M2VA 1KQ1A 4KGZB 1Q82R 2RK1A 3VS7A 2K2MA 5GMKi 1AZEA 1NM7A 3JCMb 1VQ9Q 2DL3A 1Y96B 1VQ5Q 1X2KA 3NTHA 3EH1A 1H3ZA 4RTVA 1YIJQ 1UJ0A 4IUUA 2DRKA 1VQNQ 2C0IA 5KYWB 2DJQA 5GAN2 4OB1B 1O75A 1M1GA 1BI3A 3OW2P 2DYBA 1PKSA 1M8MA 3UWNA 2HQXA 2ZPGB 3EG9A 3V8LA 1U1TA 3JB9I 1VQ4Q 2DJZA 4LDYA 1ZLMA 4JRPA 3HRUA 1UDLA 4A53A 1RLPC 1SKUB 1T0HA 1KD1U 2IIMA 2KAFA 2OTLA 1OEBA 3SFMA 2EYWA 1NLOC 2KVQG 2RPNA 2DMOA 3H9NA 2LRQA 3DLMA 3QDFA 2A28A 4N4IA 1M1FA 1WHHA 3VYGA 1VQPT 4KGVB 4XTUA 2CDTA 4BUGA 1AWOA 5LJ3h 3LWHA 4JS5A 4XAXB 1WLPB 4PJNA 2E41A 3EGDA 3CCRT 1KG1A 1S72A 1WPYA 5FU7C 1K73C 2VGNA 3CQTA 2DK3A 1PM3A 2O01E 3OW2S 1YWOA 1JU5C 3GIBA 2QAZA 4FYWB 2CREA 4E7SA 2VXEA 2RHZA 3VS6A 1KK7A 2YHTA 4ATOA 3QPHA 2IG0A 2M51A 5CCAA 3H8ZA 4J7IA 2QEXT 4HCCA 4Z02A 4AFSC 2W0ZA 4JRQA 2XKOC 2XD0A 3NTIA 1U1SA 2KT1A 3OYIA 2CZ0B 3PIOA 2V1RA 3I56T 3QSUA 4B6MA 1YJNT 2M0OA 4M78C 4M7DF 1KD1R 1YITA 1XNIA 1WHLA 4AFUC 2X9HA 5FROA 2R57A 2H3EB 5CKBA 2E12A 3EG2A 1AT1B 3CCUQ 2XG8D 3JCMd 3WXMB 4PFOA 3CXCP 2RHIA 3EFOA 4KH0B 2XHCA 1WX6A 1B3QA 3UA6A 8AT1B 4XTWA 1GCPA 4MMLA 2JN0A 3SWNA 1BI1A 3G4SA 2LJ1A 2EYYA 2JVVA 2GF7A 4UC4A 1UECA 2F5KA 4C5GA 1BCOA 2AKKA 1K0XA 1X27A 2KRSA 2DNUA 4XU2A 5IAYA 1M4ZA 4HA8A 4C8QB 3I9QA 2EWNA 3TEEA 2E3IA 2B8AA 2FB7A 2QA4T 1OQKA 2MAMA 2ZPFB 4QW2A 1K76A 3CXCS 2OTJQ 2JUFA 2KSSA 1N8RC 2K5IA 1Z9ZA 3CPFA 1HYOA 3QYHB 3NFCA 2QDYB 4FSXA 2XMFA 2CUDA 3A8OB 1Y0MA 2CSQA 1WNLA 2EGCA 4E6RA 3OB9A 1M1KC 1VQMT 1VQOQ 1TUCA 5GAMf 5I11A 1JB0E 4DQ2A 1N5ZA 2VXFA 1GFDA 3SHWA 3KXTA 5HCKA 3CC4A 4GLMA 3QWYA 1JJ2P 2NUTA 5KH6A 1M27C 1WJRA 1N27A 3JCMf 4OMOA 4A4HA 4C0FA 1G83A 4C5IA 2LZ6B 4BB7A 4AMCA 3OYNA 4PNOA 1I8FA 2CP2A 3N5BB 4X34A 3FC3A 3OA6A 5FRMA 2K57A 1SSHA 2BZYA 2DVJA 4JJBA 1MV3A 3QO3A 4JZ3A 1NEBA 3RMQA 3TU4K 5GMKl 2COYA 1PRMC 4C8QF 2VUBA 2QASA 1I5LA 1CSKA 2CT4A 1U8RA 1JJ2S 3KBGA 5HK3A 2MYSA 4J9HA 1VQLQ 1RL2A 2KRMA 3M56A 1OX8A 3CCEQ 4B9WA 3G6ET 4J9GA 1I4K1 2JNGA 3HHTB 4MMKA 1D0YA 4HT9A 1Y71A 2P0QA 2YRDA 3CC2T 4C92G 1K8AU 1UGSB 4J5YA 4ZN3A 2D6FA 1VQ6A 1IGQA 1YJWA 3I55T 1AWWA 2FVUA 4Z88A 3HPWA 2ATCB 1TU0B 2LT4A 4BI8B 4OVAA 1YI2A 1I1JA 4NL2A 2FPEA 2I0NA 2SEMA 3R6NA 4DBQA 4DA4A 1AOJA 3SWNC 2BKDN 2DZ9A 1I5OB 5DLOA 2QGFB 3JSCA 4M75E 2LQ8A 3M57A 3RKYA 4DEYA 3GOXA 3CMEQ 3GPLA 3G7ZA 1GCQA 2X3WD 1OPKA 1FMVA 2FZCB 1WJSA 4PK4A 2X4WA 3E1SA 3C95A 4O5VA 1WGSA 3GNGA 2YUNA 4JRKA 3KUFA 1VQ9T 1VQ5T 3MEWA 3TSWA 2ESWA 1RACB 2O2OA 4IUQA 1YIJT 2GCXA 1TOVA 1J3TA 3MP8A 1VQNT 1AD5A 2IVWA 3PT9A 2HKQB 3VS0A 1V1CA 4F7UB 3L42A 4M77E 3GP8A 1K8AR 3CC7Q 1YITT 1O9SA 1VQPA 2K7AA 1KHIA 2ROTA 1ARKA 2QGGA 1ZSZB 2DERA 1RADB 1VQ7Q 2YRVA 3HKSA 1VQ4T 3RBBB 5A0GA 2L3RA 1UHFA 1QKXA 1Q81C 1IXDA 1JEGA 1IREB 1C1AA 2EYQA 4WF2A 4AG2C 2DL5A 3MP1A 2DRMA 1GBQA 2K79A 4JRIA 1QP2A 3PE0A 1FMWA 2F2VA 4EMHA 5LJ5j 2VC8A 2JT4A 1OPLA 3HFOA 3OSVA 4PJOB 2LQNA 2O88A 2QEXA 4QVCA 3H0FA 5FU7B 2JTEA 3VYHB 4M4ZA 2KGTA 3RMSA 2MPXC 2HQHA 2EJFA 4BE1A 4ORZA 1KJWA 1OU9A 5CAIA 1LCKA 2YLBA 2L8DA 4AT1B 3VUZA 2MMPA 2EKOA 3UPUA 1M90U 1YJNA 2HL3A 2X51A 1X01A 4M78G 2EPDA 3CBMA 3CD6Q 3A1PA 2GTOA 1U06A 2AT1B 2PQWA 2LCCA 5GMKe 4MDWA 3PVLA 4M75D 1CKAA 2DETA 3S6WA 2XK0A 5A0LA 4OMNA 3VS3A 5GANh 2X35A 5KYXA 3DB4A 2D0NA 4N0AA 3CCUT 4F7UF 2FG0A 2DD4A 3M0SA 1WA7A 4J9IA 3MHXA 2L5QA 4LNPA 5KYUB 3JCMW 4M75A 3M0RA 4AFQC 4PJJA 2QQRA 3VKIA 2O9SA 2HDAA 1GBRA 4JLIA 3ZEHA 2ZGWA 3A8GB 1OULA 5GAMe 1Q7YU 2E4HA 4IIMA 1ZUKA 1V76A 4RUGA 2LCSA 3QJYA 1SPKA 2HNIA 4Y28E 5GMKm 4Q5WA 1ACMB 5DM7R 5CK9A 1GCQC 2BE7D 2DL7A 1AWXA 3UT1A 2QK0A 4LXCA 2HZYA 3JCMe 3CEYA 2EQJA 4PJOF 4CC4B 4NOYA 3WVEB 1Q86U 1W2BP 3ER0A 1PNJA 1VQMA 1EZZB 2KBTA 2OI3A 3RR6A 2OX7A 4WTOB 5GAOl 4CC7A 2JS2A 1PC0A 3GBQA 2XDDA 3CCLQ 2JXBA 1D09B 1WZOA 1KQSA 2KRNA 4ME7A 4AG1C 2CP6A 3QHSA 2NUPA 5GJVB 5AYFA 2NWMA 3LW5E 1OZ2A 1TXQA 5FWBA 1NYFA 2RNAA 1VQOT 2DBKA 4C0GA 2NLUA 1GXIE 2MCNA 3VS4A 4F17A 1WHJA 1UUEA 1D3BB 3M4YA 1BI2A 4M77F 1Q7YR 1W2BS 4LD9K 1IHWA 1IZ6A 1D0ZA 2P84A 1P92A 1ZX6A 2KR3A 2OAUA 1JQQA 1LJOA 2K5FA 3L2ZA 4OB0B 1QCFA 2L3QA 4HVUA 3BDLA 2LT1A 3TCJA 1NPPA 1JRIA 2DEUA 1PSFA 3EH2A 3QXEB 2L0AA 4D8DA 1I81A 2RQUA 1Q86R 1N9RA 5GAOp 4RCBA 6AT1B 2DXUA 3DB3A 4NS5A 3VRYA 3G6EA 4FIBA 1A0NB 1SEMA 3H0IA 1YHQQ 3HL8A 3OYFA 3VS2A 3JB9F 3CC2A 1PCXA 2LC4A 3OYCA 3CCVQ 3A8MB 1SRMA 5FLXE 3I55A 2XI9A 2JMAA 2NUZA 4LDUA 1D0XA 3PMTA 7AT1B 2Z0WA 2G3RA 2EJ9A 4M7DD 3VUBA 1B34B 4BI4A 3CCET 1TS9A 3OS2A 3CCQQ 1QWEA 4A63B 2JZ2A 2E64A 3E19A 1X75C 4C8QE 2K3BA 4N0AC 1T3LA 3OYBA 1Y96A 1K9MR 2YDLA 3G71Q 1KQ2A 4M7DA 4RMOA 5KYWA 1ZA1B 4M75C 3CMAQ 2YRCA 2O4XA 2WSFE 2COZA 3PMIA 4E47A 3C0CA 4X9CA 1FX7A 4KRTA 5CVIA 1VQ9A 1VQ5A 2CP0A 4ESRA 3M58A 5GAMd 1ZUUA 1YIJA 5CIUA 3JV3A 3OS1A 1VQNA 2CP3A 3CMET 1K73U 4XTYA 2AHJB 3LGLA 2KXCA 3V7RA 1H8KA 1RLQC 2HL5C 3OW2A 2DIGA 2G6FX 1HJDA 3LX7A 5IH2A 5LJ3e 2A7YA 1VQ4A 4JUVA 3H6ZA 3MEAA 3RNJA 4BE2A 1G3TA 4XQ3A 4E7IA 2A36A 4BY6C 4V2SA 2MF2A 5KE3A 2E65A 2KT8A 3EG3A 2F5TX 1NJIC 3Q1JA 3CC7T 2ED1A 4JPBW 1YFNA 2FRWA 3L2QA 2EQIA 2K3YA 4FT2A 1VQ7T 1QVGP 4IUPA 4QQ6A 1IB8A 1MUZA 1M3CA 1H641 4CRIA 3JCMP 3CCJQ 3JCMQ 2CH4W 2RHUA 4RTXA 1AWJA 4JZ4A 4J9CA 3S3NA 3TREA 5FU6B 3OYJA 1QWFA 4FW1A 1R0CB 4FCYA 3O8VA 1UFFA 2MWPA 4VUBA 2J05A 3DLLA 2FZKB 1SSFA 4JJDA 4LN2A 1K73R 2DE0X 4HCZA 3H41A 4Y91A 1TH7A 1RAIB 2ZPEB 3DKMA 4FYYB 3R6OA 2A3LA 5GAOm 2QTVA 3PVQA 1X69A 1T0JA 1C0MA 2RN8A 1QVGS 2K6DA 4J9BA 2GQVA 5CR2A 2EIFA 5LJ5g 5L23A 3OYHA 4C8QD 1WHGA 1WYXA 1BKBA 1X6GA 2C0OA 1BIAA 1G8XA 3CCSQ 4RTWA 4F16A 5ECAA 2AKLA 3CD6T 1YJ9Q 3HRSA 1PG5B 3CCUA 2LP5A 5CKEA 3CXCA 1SG5A 1VQKQ 5EC7A 2HEQA 1N8RU 1UGVA 2FL7A 3PFSA 4C8QA 4A4GA 4F04B 1JO8A 1E6GA 1TWBA 4M7AG 5KCHA 1LOJA 2GGRA 2RJCA 1YWPA 3D7SB 3A98A 2FPFA 3BDUA 4C5HA 3F70A 5L8RE 5HY6A 3CCJA 4M7DC 4KT0E 3OS5A 1TSFA 5KCOA 4M7AB 4KH1B 1OOTA 2RI2A 5FW9A 3TVTA 1WXUA 2XDBA 4KUDK 2E5KA 5GANg 5FRNA 3M53A 2HAXA 2MWOA 2OTJA 1C6VX 1QMCA 4F7UE 1I0CA 4DOWA 1FMKA 1D1CA 2D0QB 1HXDA 3TSZA 3CPWP 2CP5A 1MMAA 1XTDA 1WHKA 2RI3A 1JXOA 2VGMA 1WIEA 1PRLC 3A8HB 3X25B 3NGPA 4HCKA 2D8JA 2DBMA 3M5AA 3EHQA 3UDCA 2R5MA 2OJ2A 1VQOA 4Z8AA 1N8RR 1K4US 5KE2A 2GBQA 2LX9A 4FYVB 1OV3A 3INZA 4QKUA 1RI0A 3E2UA 3CCRQ 5KYNA 2O31A 2BE9B 5LJ3d 5EG2A 3CCLT 2A37A 4C92B 2LJ3A 4OGCA 2D9TA 4PJOE 2LCLA 3MJXA 2QXFA 1JJ2A 3CCMQ 3P8HA 3VJPA 3M9QA 3OBWA 2FHDA 8ATCB 4EMKB 2QQAA 4PFZA 1W4SA 3CPWS 2AK5A 4LDVA 3ZL7C 2LTOA 1VA7A 2HQEA 2ZPBB 1HK9A 1MMNA 2KK4A 4JDSA 1G3WA 5DY9A 1FXXA 4ELZC 5CKHA 1X43A 2J06A 3ZBDA 2JTMA 3I56Q 2FZGB 2SRCA 2P0PA 3MPUB 1B7TA 1PD0A 2V8JA 5FWCA 1N6AA 1VIEA 1U3OA 4MDXA 4FT4A 2ZAEA 4J6YA 1RAFB 3AT1B 4OMLA 1FYNA 1VQLA 3UF4A 4J6WA 2RB6A 3HP9A 3BE3A 4RTYA 3EGXB 3CCEA 1YHQT 2RD1A 3JCMV 1UGRB 3REAB 2RQWA 1H3HA 4BD3A 4CC3A 2L89A 5A2QE 1TTHB 2AIRB 4IKFA 1SHGA 2P4TA 2DVEA 1QVFP 1BK2A 5GMKj 4F14A 1JBMA 3QZ5B 2X4YA 1E6HA 2DL4A 4JS4A 1KC8C 5LJ5h 3L2RA 1WJQA 3ZFJA 4C8QC 2LQKA 1IRXA 1M90C 1M3AA 2LX7A 3JB9H 1QCNA 2ZPIB 5LJ3f 3CCQT 2JM9A 1BB9A 1WFWA 2O9VA 2QA4Q 5GAN7 3META 4FW2A 1QVPA 1EX4A 2B86A 3SD4A 1RAAB 2RHXA 1M8VA 4R56A 4C92F 2JMCA 3J80E 3G71T 1M2OA 3CMEA 2X3XD 4PKCC 1Q81U 1SHFA 4E7ZA 3CMAT 4KULA 4DEXA 4F7UA 3LGFA 3QYGB 2D1XA 5GAMj 5J3BA 2PVOB 2RJEA 2R58A 5IHIA 2RQRA 4PLIA 4RKUE 1QVFS 1ZSZA 4OMFB 2C0TA 1R77A 2HCKA 2YUOA 2XDPA 3ME9A 3RERA 1VYUA 1VQ8Q 1GFCA 2V26A 4C0ZA 4PJOD 2YUPA 2F2XA 2DXBA 2E6NA 3GLXA 4M78B 3HSBA 4LUEA 3CC7A 1ZBXA 2Y90A 1NG2A 4BACA 1Q82C 2QQSA 1Q7YC 2EQUA 1VQ7A 4MZTA 3FDRA 3GF5A 1MHNA 2LDMA 4PJOA 1R8OB 4DBFA 1IO6A 5CKFA 4BY6B 4PJLA 5I2MA 3JCMJ 4RCCA 1BU1A 4QQDA 2MIOA 2CGHA 4EPCA 4TVRA 1QQJA 2HMAA 5GAN5 1XQHA 3X20B 2YT6A 4J9DA 2A0FB 2DD5A 4LDXA 1AVZC 4M77D 2CH4A 1MMDA 1Q81R 3CCJT 2GNCA 2PU9B 2PNIA 4LUDA 4RTUA 1OYXA 1LVKA 5KYYB 1M2VB 3M59A 3HTRA 1NEGA 2CSIA 1W6XA 2A08A 1X6OA 2DM1A 5IHKA 5HKCA 4FM4B 4M77A 2HBPA 4OGEA 5GAOq 2OTJT 2CS7A 2PUOB 4R55A 3JAME 3CD6A 3QUIA 5GANe 3OMCA 3QJ6A 3PTAA 2DTOA 3J7AF 1QP3A 1WQ7A 2OTLQ 4KGXB 3MEUA 1TUDA 2DIQA 3EG9B 1UG1A 5J39A 3JB9D 5KYUA 3JCMc 4IUVA 1MNDA 4O6JA 1PD1A 1S72Q 3CCST 1E7OA 3OYKA 2H8HA 3EGUA 2LNVA 2DO3A 2RO0A 1YJ9T 1UJYA 2Y4YA 4M78F 4QQGA 2K9GA 3OY9A 1CKBA 2M02A 1VQKT 1K9MU 3L1AA 4DOVA 4FL6A 4M7DG 3C12A 2AZSA 3J81E 5GAN8 3RIRA 4BDZA 2L3SA 3EGDB 1YP5A 1GRIA 3LH0A 2EKHA 1RAHB 1KD1C 3O5ZA 2M16A 1WXBA 4D8KA 2AZVA 2XICA 4GBQA 2RQVA 2BIVA 2DEQA 4M7DB 2FYKA 2CT3A 2P0KA 3V8JA 3S3OA 3M0QA 4MZMA 5CQXA 2KYBA 2OAWA 2O4XB 4L59A 1OX9A 1WHMA 1YITQ 3EFSA 1ZHIA 1W2BA 1MMGA 2M1HA 3MCAB 1ZSZC 3UATA 4J83A 3EG1A 4HCBA 1VQLT 2EAYA 4WCIA 2PZ1A 1NLPC 1W70A 1D1BA 3CCLA 1D3BA 1K1ZA 1Y7XA 2DL8A 4BDYA 4ANJA 3REBB 3SDZA 2EBPA 4C5EA 5C0MA 2DILA 2E5QA 2DKGA 4AFZC 3G4SQ 3NTKA 5LJ3j 2EVRA 3L2WA 2J7IA 2JW4A 3OYGA 3PGGA 3EFOB 2R5AA 2HBWA 3SB2A 4J9EA 4PJOC 3X24B 1G5VA 5LJ5d 1KIKA 3AHUA 4J8OA 4HKEA 4ZTFA 4L6V5 5AT1B 3HRTA 3M0PA 3SWNB 2DYIA 1Q95G 3EHRA 3ASKA 3CCMT 1D1AA 2JS0A 2K4YA 3QG1A 2XU8A 1GL5A 1YNZA 1G3SA 5I2SA 2YWWA 2DX1A 4XU0A 2VKNA 1BCMA 3TQ7P 4PL6A 3VV0A 2LJ0A 1VYVA 3VU3C 3FLGA 2WSEE 4M77C 1B34A 1YHQA 2VVKA 4NL3A 4J7FA 4RTTA 2RF0A 2E3HA 2RM4A 2W10A 3CCVA 4II1A 3RDVA 1HSQA 4A4FA 5GAOr 1U5SA 2DTHA 2PVDB 3WVDB 4XU1A 1BYMA 3CC4Q 1XOVA 3OYYA 2QG9B 5GANd 2RMOA 2EQMA 4HT8A 1ABOA 1NYGA 2WSCE 1VUBA 3C94A 3MKDA 4C8QG 5D6XA 3VS5A 4KUIA 2E10A 3P8DA 2KROA 3CCQA 4JLGA 2M9UA 4A4KA 4E2FB 2F1LA 1KFZA 1YCSB 2KQWA 1EFNA 2CZ1B 1SRLA 4M7AE 3G71A 1VYTA 4RTZA 2NUTB 1UE9A 4XTXA 3HFNA 3L2VA 2DXTA 3CMAA 1M3BA 2DFUA 1M30A 2JM8A 4J6XA 3RESA 1ZBJA 1NJIU 2DAQA 3LYIA 2EJGA 4XTZA 5LJ5f 2DF6A 1BI0A 2PVGB 2BZ8A 3E9FA 1M5Q1 3SEMA 1UHCA 3EFRA 5I22A 2KY9A 3LH5A 3FIFA 4PJMA 4XTVA 2CKKA 1WQWA 1H92A 1AEYA 3CBOA 4C0DC 3M0TA 2LNHB 2RK2A 5CO7A 4A4EA 2ECZA 3QKJA 3A8LB 3H0HA 2RHYA 1VQ6Q 1YJWQ 3URGA 1DJ7B 2E6ZA 4ZGDB 5D6WA 4C92E 2QDLA 1S1NA 1VQ8T 1YI2Q 3FJPA 1ZQ1A 3I35A 3JB9J 4LDWA 1RAGB 4Y92A 2MK5A 3M4GA 4L5GA 3QDRB 2QI2A 2KNBB 2VV5A 2HD0A 2HSEB 5GAMg 3A5ZB 4CI0C 4EDUA 2ZPHB 4DBRA 1B07A 1M1KU 2ED0A 1QVGA 1RUWA 5GANf 2KEAA 1TUGB 3V8KA 3OBYA 1VIFA 4ELYC 1NJIR 1IGUA 2ENMA 4ZGJB 4JJNK 1K9AA 5D7UA 3JCMg 4R0KA 4E7LA 1G2BA 1K8AC 5C6SA 3QIIA 2DPPB 5D6YA 1UGQB 1MGQA 2FO0A 4E7HA 5IN1A 5IT9E 1QCOA 2HKNA 2K2VA 2KDSA 3EG0A 1QW1A 1OU8A 2BZXA 4HVWA 1PKTA 5GJWB 1HD3A 1TG0A 2YSQA 3EAEA 1VOMA 3IQLA 4YTLA 3BFMA 2GQIA 1NE8A 1RAEB 1VQPQ 1PSEA 1X2QA 2F2WA 2H3JA 1YCYA 4M7AD 3CCSA 1YBYA 1I07A 1BIBA 2RH2A 4LE9A 2KMTA 2LQWA 4OMMA 2I2LA 1YJ9A 4XU3A 2ABLA 3T9NA 1EIFA 2DTIA 2K5LA 2OTLT 1VQKA 4N4GA 2RJDA 3OQ5A 3UA7A 5CKDA 3L2UA 1F1BB 1OZ3A 4ZGEB 1M1KR 4E7JA 2GTJA 1Z9QA 3V7SA 4GLKA 3P8BB 2J6FA 3X28B 3OYDA 4M7AA 2YLCA 2D8HA 3OYAA 4Z89A 2QEXQ 4K11A 1S72T 3OSSC 5HK0A 1NPRA 3THKA 4QVDA 1FWZA 4BE0A 4OMQA 2J6KA 2F69A 2FPDA 4PFPA 4A54A 2CP7A 2MOXA 2X4JA 1BBZA 3MO8A 1YJNQ 3C4SA 3G1JA 2EQKA 4F7UG 4C92D 3RKWA 3M55A 4M7AF 2KE9A 2RI5A 4X9DA 1MV0B 3S3MA 5IXBA 4ZTJA 2CZ6B 3QBYA 1QKWA 4M78E 3M0UA 4HXJA 1IHVA 3X26B 2VB6A 3CPWA 2RJFA 4QT7A 4KBMB 5GAN3 1RI9A 4ZN1A 1Y07A 2E1HA 3JRZA 3FJ5A 4OB3B 2X4XA 1WI7A 4C92A 3CCVT 4RG2A 5IHNA 5J26A 4B9XA 1KHCA 4D6WA 4EMKA 4JJCA 2KI7A 2VYTA 3I5SA 3CCRA 2VWFA 5GMKh 3E9GA 4PJOG 5LL6S 5GAN4 4M75G 2XIDA 1PWTA 5FU6C 2Y4XA 3CCMA 4FYXB 5KYXB 2V1QA 3G4ST 1R0BG 1YN8A 3FRNA 2V8KA 2DXCA 1RABB 4PLLA 4RG8A 5M9OA 4M75B 4FU6A 3RUXA 1UB4A 2C06A 1AHJB 2HSPA 2P4RA 9ATCB 1ZA2B 5GAMh 2RA2A 3V7CA 2CZ7B 3CBPA 4X1VA 2CYZB 1KC8U 3I56A 2PTKA 1VQMQ 2IPOB 3EGXA 2EYXA 5LJ3g 4J9FA 4M77G 2NYSA 1W1FA 4EMGA 3JCMX 1V29B 1QLYA 2DA9A 5GAN6 2LVMA 2GFAA 2M0YA 4OB2B 3MP6A 4IUTA 5GAOn 3VS1A 1KQSP 1N9SA 5A0DA 3M54A 4LD6A 4ZNXA 3JCMh 2GFUA 4DBHA 3LWIA 3QZ9B 3PNWC 5LJ5e 5CQYA 4M77B 4OMPA 1UEBA 4QVZA 4FSSA 2ZCFB 4OP0A 1G3YA 2ROLA 3OYMA 3I5RA 5GANj 3GNFB 3OS0A 1WXTA 4EIKA 2NUPB 4N4HA 1LPLA 1QVFA 1NZ9A 2JOYA 3CC4T 2EGEA 2V8IA 2VASA 1Q86C 2CUBA 2L3PA 2JJ9A 3JB9G 2BUDA 1OI1A 1K0SA 4BI3A 4M7AC 3U23A 1LNXA 1ZUYA 2YXYA 3ULRB 4M78D 1NBEB 2EYZA 3MEVA 3BY7A 1KQSS 4MZPA 1Q82U 4M7DE 2QA4A 1WDXA 3KFVA 1PHTA 2KXDA 5DLQE 2FEIA 2LMJA 2MI6A 4XK8E 4P5NA 1KC8R 1SF9A 1XJWB 4OF1A 1M90R 3NHNA 3RKXA 3PIPA 3OYLA 2WACA 3G6EQ 4IIOA 3OYEA 5I21A 4M78A 2JTFA 3FEOA 3QWXX 1ABQA 2KYMA 3LLRA 3VRZA 2ZZDA 2FRYA 1T3SA 3CC2Q 1X6BA 3NPFA 4IURA 2QQ9A 4M75F 1ZSGA 4HVVA 3I55Q
chains in the Genus database with same CATH topology
1Q81C 4GY5A 1M9SA 1G3SA 4C5HA 3BDUA 5I2SA 1IREB 2EYQA 3F70A 1UGPB 5L8RE 4WF2A 5HY6A 3CCJA 1K9MC 1VQ8A 4KT0E 3MP1A 4XU0A 4M7DC 4E7KA 3OS5A 3OMGA 2E70A 4JRIA 5KCOA 1QP2A 4M7AB 2RI2A 4PL6A 3VV0A 4EMHA 3VU3C 5LJ5j 2DZCA 2QTXA 2VC8A 3FLGA 3FB9A 4C0DB 2XDBA 2WSEE 4C92C 4M77C 1B34A 3HFOA 1YHQA 4KUDK 3OSVA 5GANg 4NL3A 4J7FA 4PJOB 5FRNA 2RM4A 3BW1A 2QEXA 4QVCA 3M53A 5FU7B 4II1A 3CCVA 2EFIA 2HAXA 1YJWT 2MWOA 1VQ6T 2OTJA 3VYHB 4EMKC 2K3XA 3RMSA 4F7UE 4A4FA 4DOWA 5GAOr 2EJFA 2D0QB 1HXDA 2DTHA 3WVDB 2PVDB 2PUKB 4XU1A 4BE1A 1BYMA 1YI2T 5CAIA 1XOVA 1XTDA 2RI3A 3OYYA 3J7AF 2YLBA 2L8DA 5GANd 2VGMA 3VUZA 2QQBA 2MMPA 3A8HB 3X25B 2EKOA 2EQMA 4HT8A 1KQ1A 3UPUA 2WSCE 2RK1A 3M5AA 1M90U 1VUBA 3C94A 1YJNA 4C8QG 5D6XA 4KUIA 2E10A 3P8DA 5GMKi 3UDCA 3JCMb 1X01A 1Y96B 2R5MA 3CCQA 4JLGA 2M9UA 3NTHA 4M78G 4A4KA 1VQOA 1H3ZA 3CBMA 5KE2A 2KQWA 2LX9A 2CZ1B 3INZA 1RI0A 4IUUA 4M7AE 3G71A 5LJ3d 5GAN2 4OB1B 5EG2A 1O75A 3CCLT 4XTXA 2PQWA 2LCCA 3HFNA 5GMKe 1M1GA 4C92B 1BI3A 4OGCA 3L2VA 2D9TA 2DXTA 2LCLA 4MDWA 3CMAA 4PJOE 2QXFA 3UWNA 2HQXA 1JJ2A 2ZPGB 4M75D 4J6XA 3P8HA 3RESA 3M9QA 3OBWA 2FHDA 3V8LA 3VJPA 1NJIU 2DAQA 3S6WA 4EMKB 2QQAA 1U1TA 2XK0A 3LYIA 2EJGA 4XTZA 5A0LA 5LJ5f 3JB9I 2DJZA 4LDYA 5GANh 2X35A 1W4SA 1BI0A 3DB4A 4LDVA 4N0AA 3CPWS 3HRUA 2PVGB 4JRPA 3E9FA 1M5Q1 2LTOA 3EFRA 3CCUT 2HQEA 2ZPBB 1HK9A 4F7UF 4A53A 1KD1U 2KY9A 2KK4A 4JDSA 2DD4A 2KAFA 1G3WA 2OTLA 3SFMA 5DY9A 1FXXA 2KVQG 4ELZC 5CKHA 2LRQA 3DLMA 2L5QA 3MHXA 3JCMW 3FIFA 4M75A 4N4IA 3ZBDA 2JTMA 1M1FA 3VYGA 2QQRA 3VKIA 1VQPT 4XTVA 4XTUA 2CKKA 1WQWA 4JLIA 4BUGA 3ZEHA 2ZGWA 3CBOA 4C0DC 5LJ3h 3A8GB 2RK2A 5GAMe 3LWHA 1Q7YU 4JS5A 5CO7A 4A4EA 2P0PA 4XAXB 2E41A 3QKJA 3CCRT 3A8LB 1KG1A 2V8JA 2RHYA 1N6AA 1S72A 1WPYA 5FU7C 3URGA 1VIEA 1K73C 1DJ7B 2E6ZA 2VGNA 3QJYA 2DK3A 2HNIA 4Y28E 4ZGDB 5GMKm 5D6WA 2O01E 4Q5WA 4MDXA 4C92E 3OW2S 4FT4A 3GIBA 4J6YA 5DM7R 1VQ8T 5CK9A 3FJPA 3UT1A 1ZQ1A 2VXEA 1VQLA 3JB9J 4J6WA 4LDWA 2RHZA 3CEYA 3JCMe 2RB6A 3HP9A 2EQJA 4PJOF 3M4GA 4L5GA 4NOYA 3QDRB 3CCEA 2QI2A 2YHTA 2VV5A 2HD0A 3WVEB 5GAMg 1Q86U 3ER0A 1YHQT 3A5ZB 4ATOA 2RD1A 3QPHA 3JCMV 2IG0A 4EDUA 4CI0C 1VQMA 5CCAA 2ZPHB 1M1KU 3H8ZA 4J7IA 1QVGA 2QEXT 1UGRB 4HCCA 5GANf 4Z02A 4BD3A 5GAOl 2L89A 3V8KA 3OBYA 5A2QE 1VIFA 4IKFA 2P4TA 2XDDA 2DVEA 4JRQA 4ELYC 2XKOC 2XD0A 3NTIA 1U1SA 5GMKj 3OYIA 1JBMA 4ZGJB 2CZ0B 3QZ5B 2X4YA 4JJNK 4ME7A 4JS4A 1KQSA 4PJOD 3QHSA 1KC8C 5LJ5h 3L2RA 1WJQA 5AYFA 3JCMg 3ZFJA 3PIOA 4C8QC 3I56T 3LW5E 1OZ2A 4E7LA 2LQKA 3QSUA 1M90C 1K8AC 5C6SA 1YJNT 3QIIA 2DPPB 2M0OA 1UGQB 4M78C 5D6YA 3JB9H 4M7DF 2ZPIB 1YITA 1MGQA 4E7HA 1XNIA 5IN1A 5LJ3f 3CCQT 5IT9E 2K2VA 1VQOT 5FROA 2R57A 4C0GA 2KDSA 2NLUA 5CKBA 1GXIE 5GAN7 3META 1QVPA 2E12A 3SD4A 2RHXA 1QW1A 1M8VA 2XG8D 3JCMd 1D3BB 3M4YA 3WXMB 4R56A 1BI2A 2RHIA 4M77F 4C92F 3J80E 3G71T 3CMEA 2XHCA 4PKCC 3EAEA 1Q81U 1W2BS 4LD9K 4YTLA 3BFMA 1IZ6A 1NE8A 1P92A 4XTWA 3CMAT 4KULA 2OAUA 1PSEA 4F7UA 3LGFA 3QYGB 1LJOA 2K5FA 5GAMj 5J3BA 3L2ZA 2JN0A 2PVOB 4MMLA 3SWNA 1BI1A 2RJEA 2R58A 4OB0B 3G4SA 4PLIA 2JVVA 4RKUE 2H3JA 1YCYA 3BDLA 2GF7A 2LT1A 1QVFS 3CCSA 1YBYA 4UC4A 4M7AD 4OMFB 2F5KA 1BIBA 1NPPA 3TCJA 4C5GA 2RH2A 1JRIA 2KMTA 1YJ9A 2I2LA 2XDPA 1PSFA 3ME9A 4XU2A 1M4ZA 4XU3A 5IAYA 3RERA 3T9NA 4HA8A 1EIFA 3QXEB 4C8QB 2EWNA 2DTIA 2K5LA 4C0ZA 1I81A 1VQKA 2DXBA 1N9RA 2OTLT 2E6NA 2RJDA 3OQ5A 4N4GA 3TEEA 2B8AA 5CKDA 5GAOp 3GLXA 4RCBA 1OZ3A 4M78B 4ZGEB 3L2UA 2DXUA 4E7JA 3DB3A 3HSBA 3CC7A 4NS5A 1ZBXA 2Y90A 3G6EA 3V7SA 4GLKA 4FIBA 3P8BB 4BACA 3X28B 3OYDA 1Q82C 2FB7A 4M7AA 2QQSA 3HL8A 3OYFA 2EQUA 2QA4T 2YLCA 2MAMA 2ZPFB 4QW2A 4MZTA 1Q7YC 1VQ7A 3FDRA 3JB9F 3CXCS 3OYAA 2LC4A 3OYCA 3CC2A 3GF5A 1S72T 1MHNA 2JUFA 2LDMA 2KSSA 3A8MB 3OSSC 5FLXE 5HK0A 2K5IA 1NPRA 2XI9A 3I55A 1R8OB 1N8RC 4PJOA 4QVDA 4LDUA 3CPFA 3PMTA 3QYHB 1FWZA 5CKFA 4BY6B 4BE0A 5I2MA 2G3RA 2F69A 2QDYB 3NFCA 2EJ9A 4FSXA 3A8OB 4M7DD 3VUBA 3JCMJ 4RCCA 4A54A 1B34B 2X4JA 3MO8A 4QQDA 4BI4A 3CCET 1WNLA 3C4SA 2CGHA 4EPCA 4TVRA 2EQKA 3OB9A 3OS2A 5GAN5 1XQHA 3X20B 4F7UG 1VQMT 1M1KC 2JZ2A 2DD5A 2E64A 3E19A 4M77D 3RKWA 4C92D 5GAMf 3M55A 1X75C 1JB0E 4C8QE 4LDXA 4M7AF 2RI5A 4N0AC 4X9DA 4DQ2A 3OYBA 3CCJT 2VXFA 1Y96A 3S3MA 4ZTJA 2CZ6B 2PU9B 3QBYA 4M78E 1OYXA 1KQ2A 3KXTA 4M7DA 3X26B 3M59A 3CC4A 3CPWA 2RJFA 4RMOA 4KBMB 1X6OA 4M75C 5HKCA 5GAN3 4ZN1A 1Y07A 2E1HA 2O4XA 2WSFE 3JRZA 5KH6A 3PMIA 4E47A 4OB3B 2X4XA 1WJRA 1N27A 3JCMf 4FM4B 4M77A 2HBPA 4A4HA 4C0FA 4OGEA 4RG2A 4X9CA 4C92A 1FX7A 5GAOq 2OTJT 5J26A 2CS7A 5CVIA 4C5IA 2PUOB 4BB7A 1VQ9A 1VQ5A 4R55A 3JAME 3M58A 4B9XA 3OYNA 1KHCA 4PNOA 4D6WA 4EMKA 3CD6A 1I8FA 3QUIA 5GAMd 5GANe 2VYTA 1YIJA 3OMCA 3N5BB 3QJ6A 5CIUA 3CCRA 3PTAA 4X34A 2DTOA 5GMKh 3OS1A 1QP3A 1WQ7A 3FC3A 1VQNA 3E9GA 4PJOG 3CMET 5LL6S 1K73U 3MEUA 5GAN4 3OA6A 4XTYA 2AHJB 4M75G 5FRMA 3LGLA 2K57A 2DIQA 3V7RA 2XIDA 5J39A 3JB9D 5FU6C 3CCVT 3OW2A 2DIGA 2Y4XA 3QO3A 3CCMA 3JCMc 4IUVA 3RMQA 3TU4K 3G4ST 3LX7A 3FRNA 4O6JA 5GMKl 2A7YA 2V8KA 5LJ3e 2DXCA 3CCST 4JUVA 1VQ4A 3H6ZA 3MEAA 3OYKA 4C8QF 4BE2A 2VUBA 4PLLA 4RG8A 2LNVA 5M9OA 2DO3A 2RO0A 1I5LA 1YJ9T 1U8RA 2Y4YA 1G3TA 4M78F 4M75B 4FU6A 4QQGA 4XQ3A 3RUXA 3KBGA 4E7IA 5HK3A 1UB4A 4BY6C 3OY9A 1JJ2S 1VQKT 2MF2A 1AHJB 1K9MU 2C06A 4V2SA 3L1AA 4DOVA 5KE3A 2E65A 2F5TX 1RL2A 3M56A 3C12A 4FL6A 1NJIC 4M7DG 3Q1JA 3J81E 5GAN8 3RIRA 5GAMh 4BDZA 3CC7T 2RA2A 4B9WA 3G6ET 3L2QA 3V7CA 2CZ7B 3CBPA 2CYZB 1I4K1 2JNGA 3HHTB 4MMKA 2K3YA 3LH0A 4FT2A 3I56A 1KC8U 1Y71A 1VQ7T 2P0QA 4HT9A 4M7DB 4IUPA 4QQ6A 3CC2T 5LJ3g 1KD1C 4C92G 1H641 4M77G 1K8AU 1UGSB 4CRIA 4J5YA 3JCMP 4EMGA 4ZN3A 2M16A 3JCMX 1YJWA 3JCMQ 2D6FA 1VQ6A 1V29B 3I55T 2FVUA 2RHUA 2LVMA 5GAN6 2GFAA 2XICA 4OB2B 3HPWA 3MP6A 2BIVA 4IUTA 5GAOn 3S3NA 2DEQA 3TREA 2FYKA 5FU6B 2LT4A 4BI8B 1N9SA 4OVAA 3M54A 5A0DA 4LD6A 3JCMh 3OYJA 2P0KA 1YI2A 2GFUA 3V8JA 4NL2A 3LWIA 3O8VA 3S3OA 3QZ9B 4MZMA 5CQXA 2MWPA 3PNWC 4VUBA 2O4XB 5LJ5e 4DA4A 5CQYA 4L59A 3DLLA 4M77B 4QVZA 1SSFA 1UEBA 3SWNC 3EFSA 1ZHIA 2BKDN 2ZCFB 1W2BA 2DZ9A 1G3YA 2M1HA 4OP0A 5DLOA 3MCAB 3JSCA 4M75E 4J83A 2LQ8A 3M57A 3OYMA 4HCZA 3GNFB 5GANj 3OS0A 3RKYA 3GOXA 4Y91A 1TH7A 4HCBA 1VQLT 2EAYA 2ZPEB 4N4HA 3DKMA 3G7ZA 3GPLA 3R6OA 2A3LA 5GAOm 1QVFA 3CCLA 1NZ9A 2JOYA 1D3BA 1Y7XA 3CC4T 2V8IA 4BDYA 1Q86C 3SDZA 4C5EA 1QVGS 5C0MA 3JB9G 2E5QA 1WJSA 2BUDA 1OI1A 2GQVA 5CR2A 2EIFA 2X4WA 5LJ5g 3E1SA 3C95A 2DKGA 3OYHA 4O5VA 1WGSA 4C8QD 4BI3A 4M7AC 1BKBA 3GNGA 1BIAA 4JRKA 3KUFA 1LNXA 3NTKA 5LJ3j 1VQ9T 1VQ5T 4M78D 3L2WA 3MEWA 3MEVA 3OYGA 3BY7A 3PGGA 4MZPA 1Q82U 1KQSS 4M7DE 2R5AA 2QA4A 3CD6T 3SB2A 4IUQA 3HRSA 4PJOC 3CCUA 1YIJT 3X24B 1G5VA 2GCXA 3MP8A 5CKEA 1VQNT 5DLQE 2IVWA 5LJ5d 3CXCA 3PT9A 2MI6A 4XK8E 1N8RU 4P5NA 4J8OA 3AHUA 2FL7A 4HKEA 4F7UB 4ZTFA 3L42A 4L6V5 4M77E 3HRTA 3PFSA 4OF1A 3SWNB 4C8QA 3GP8A 4A4GA 1YITT 1O9SA 3RKXA 3PIPA 3OYLA 2WACA 1VQPA 1KHIA 3OYEA 5I21A 4M7AG 3ASKA 4M78A 3CCMT 2JTFA 3FEOA 3LLRA 2ZZDA 2YRVA 5KCHA 3HKSA 1LOJA 4IURA 2K4YA 2QQ9A 3QG1A 4M75F 1VQ4T 2XU8A 5A0GA 2RJCA 2L3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EPC A;  1M9S A; 
#chains in the Genus database with same CATH topology
 1UTI A;  2EW3 A;  4GY5 A;  1M9S A;  1UGP B;  1VQ8 A;  1K9M C;  1MNE A;  4E7K A;  3OMG A;  2E70 A;  2QYZ A;  1AZG B;  2DZC A;  1JXM A;  2QTX A;  5IXF A;  2YUQ A;  3FB9 A;  4C0D B;  2RQT A;  1KSW A;  4C92 C;  2COW A;  2BTT A;  2DLP A;  1Y57 A;  3BW1 A;  2J6O A;  4CC2 A;  2EFI A;  1VQ6 T;  1YJW T;  4EMK C;  2K3X A;  2EGA A;  3NMZ C;  2PUK B;  1YI2 T;  2L2P A;  2QQB A;  5KYY A;  1M2V A;  1KQ1 A;  4KGZ B;  1Q82 R;  2RK1 A;  3VS7 A;  2K2M A;  5GMK i;  1AZE A;  1NM7 A;  3JCM b;  1VQ9 Q;  2DL3 A;  1Y96 B;  1VQ5 Q;  1X2K A;  3NTH A;  3EH1 A;  1H3Z A;  4RTV A;  1YIJ Q;  1UJ0 A;  4IUU A;  2DRK A;  1VQN Q;  2C0I A;  5KYW B;  2DJQ A;  5GAN 2;  4OB1 B;  1O75 A;  1M1G A;  1BI3 A;  3OW2 P;  2DYB A;  1PKS A;  1M8M A;  3UWN A;  2HQX A;  2ZPG B;  3EG9 A;  3V8L A;  1U1T A;  3JB9 I;  1VQ4 Q;  2DJZ A;  4LDY A;  1ZLM A;  4JRP A;  3HRU A;  1UDL A;  4A53 A;  1RLP C;  1SKU B;  1T0H A;  1KD1 U;  2IIM A;  2KAF A;  2OTL A;  1OEB A;  3SFM A;  2EYW A;  1NLO C;  2KVQ G;  2RPN A;  2DMO A;  3H9N A;  2LRQ A;  3DLM A;  3QDF A;  2A28 A;  4N4I A;  1M1F A;  1WHH A;  3VYG A;  1VQP T;  4KGV B;  4XTU A;  2CDT A;  4BUG A;  1AWO A;  5LJ3 h;  3LWH A;  4JS5 A;  4XAX B;  1WLP B;  4PJN A;  2E41 A;  3EGD A;  3CCR T;  1KG1 A;  1S72 A;  1WPY A;  5FU7 C;  1K73 C;  2VGN A;  3CQT A;  2DK3 A;  1PM3 A;  2O01 E;  3OW2 S;  1YWO A;  1JU5 C;  3GIB A;  2QAZ A;  4FYW B;  2CRE A;  4E7S A;  2VXE A;  2RHZ A;  3VS6 A;  1KK7 A;  2YHT A;  4ATO A;  3QPH A;  2IG0 A;  2M51 A;  5CCA A;  3H8Z A;  4J7I A;  2QEX T;  4HCC A;  4Z02 A;  4AFS C;  2W0Z A;  4JRQ A;  2XKO C;  2XD0 A;  3NTI A;  1U1S A;  2KT1 A;  3OYI A;  2CZ0 B;  3PIO A;  2V1R A;  3I56 T;  3QSU A;  4B6M A;  1YJN T;  2M0O A;  4M78 C;  4M7D F;  1KD1 R;  1YIT A;  1XNI A;  1WHL A;  4AFU C;  2X9H A;  5FRO A;  2R57 A;  2H3E B;  5CKB A;  2E12 A;  3EG2 A;  1AT1 B;  3CCU Q;  2XG8 D;  3JCM d;  3WXM B;  4PFO A;  3CXC P;  2RHI A;  3EFO A;  4KH0 B;  2XHC A;  1WX6 A;  1B3Q A;  3UA6 A;  8AT1 B;  4XTW A;  1GCP A;  4MML A;  2JN0 A;  3SWN A;  1BI1 A;  3G4S A;  2LJ1 A;  2EYY A;  2JVV A;  2GF7 A;  4UC4 A;  1UEC A;  2F5K A;  4C5G A;  1BCO A;  2AKK A;  1K0X A;  1X27 A;  2KRS A;  2DNU A;  4XU2 A;  5IAY A;  1M4Z A;  4HA8 A;  4C8Q B;  3I9Q A;  2EWN A;  3TEE A;  2E3I A;  2B8A A;  2FB7 A;  2QA4 T;  1OQK A;  2MAM A;  2ZPF B;  4QW2 A;  1K76 A;  3CXC S;  2OTJ Q;  2JUF A;  2KSS A;  1N8R C;  2K5I A;  1Z9Z A;  3CPF A;  1HYO A;  3QYH B;  3NFC A;  2QDY B;  4FSX A;  2XMF A;  2CUD A;  3A8O B;  1Y0M A;  2CSQ A;  1WNL A;  2EGC A;  4E6R A;  3OB9 A;  1M1K C;  1VQM T;  1VQO Q;  1TUC A;  5GAM f;  5I11 A;  1JB0 E;  4DQ2 A;  1N5Z A;  2VXF A;  1GFD A;  3SHW A;  3KXT A;  5HCK A;  3CC4 A;  4GLM A;  3QWY A;  1JJ2 P;  2NUT A;  5KH6 A;  1M27 C;  1WJR A;  1N27 A;  3JCM f;  4OMO A;  4A4H A;  4C0F A;  1G83 A;  4C5I A;  2LZ6 B;  4BB7 A;  4AMC A;  3OYN A;  4PNO A;  1I8F A;  2CP2 A;  3N5B B;  4X34 A;  3FC3 A;  3OA6 A;  5FRM A;  2K57 A;  1SSH A;  2BZY A;  2DVJ A;  4JJB A;  1MV3 A;  3QO3 A;  4JZ3 A;  1NEB A;  3RMQ A;  3TU4 K;  5GMK l;  2COY A;  1PRM C;  4C8Q F;  2VUB A;  2QAS A;  1I5L A;  1CSK A;  2CT4 A;  1U8R A;  1JJ2 S;  3KBG A;  5HK3 A;  2MYS A;  4J9H A;  1VQL Q;  1RL2 A;  2KRM A;  3M56 A;  1OX8 A;  3CCE Q;  4B9W A;  3G6E T;  4J9G A;  1I4K 1;  2JNG A;  3HHT B;  4MMK A;  1D0Y A;  4HT9 A;  1Y71 A;  2P0Q A;  2YRD A;  3CC2 T;  4C92 G;  1K8A U;  1UGS B;  4J5Y A;  4ZN3 A;  2D6F A;  1VQ6 A;  1IGQ A;  1YJW A;  3I55 T;  1AWW A;  2FVU A;  4Z88 A;  3HPW A;  2ATC B;  1TU0 B;  2LT4 A;  4BI8 B;  4OVA A;  1YI2 A;  1I1J A;  4NL2 A;  2FPE A;  2I0N A;  2SEM A;  3R6N A;  4DBQ A;  4DA4 A;  1AOJ A;  3SWN C;  2BKD N;  2DZ9 A;  1I5O B;  5DLO A;  2QGF B;  3JSC A;  4M75 E;  2LQ8 A;  3M57 A;  3RKY A;  4DEY A;  3GOX A;  3CME Q;  3GPL A;  3G7Z A;  1GCQ A;  2X3W D;  1OPK A;  1FMV A;  2FZC B;  1WJS A;  4PK4 A;  2X4W A;  3E1S A;  3C95 A;  4O5V A;  1WGS A;  3GNG A;  2YUN A;  4JRK A;  3KUF A;  1VQ9 T;  1VQ5 T;  3MEW A;  3TSW A;  2ESW A;  1RAC B;  2O2O A;  4IUQ A;  1YIJ T;  2GCX A;  1TOV A;  1J3T A;  3MP8 A;  1VQN T;  1AD5 A;  2IVW A;  3PT9 A;  2HKQ B;  3VS0 A;  1V1C A;  4F7U B;  3L42 A;  4M77 E;  3GP8 A;  1K8A R;  3CC7 Q;  1YIT T;  1O9S A;  1VQP A;  2K7A A;  1KHI A;  2ROT A;  1ARK A;  2QGG A;  1ZSZ B;  2DER A;  1RAD B;  1VQ7 Q;  2YRV A;  3HKS A;  1VQ4 T;  3RBB B;  5A0G A;  2L3R A;  1UHF A;  1QKX A;  1Q81 C;  1IXD A;  1JEG A;  1IRE B;  1C1A A;  2EYQ A;  4WF2 A;  4AG2 C;  2DL5 A;  3MP1 A;  2DRM A;  1GBQ A;  2K79 A;  4JRI A;  1QP2 A;  3PE0 A;  1FMW A;  2F2V A;  4EMH A;  5LJ5 j;  2VC8 A;  2JT4 A;  1OPL A;  3HFO A;  3OSV A;  4PJO B;  2LQN A;  2O88 A;  2QEX A;  4QVC A;  3H0F A;  5FU7 B;  2JTE A;  3VYH B;  4M4Z A;  2KGT A;  3RMS A;  2MPX C;  2HQH A;  2EJF A;  4BE1 A;  4ORZ A;  1KJW A;  1OU9 A;  5CAI A;  1LCK A;  2YLB A;  2L8D A;  4AT1 B;  3VUZ A;  2MMP A;  2EKO A;  3UPU A;  1M90 U;  1YJN A;  2HL3 A;  2X51 A;  1X01 A;  4M78 G;  2EPD A;  3CBM A;  3CD6 Q;  3A1P A;  2GTO A;  1U06 A;  2AT1 B;  2PQW A;  2LCC A;  5GMK e;  4MDW A;  3PVL A;  4M75 D;  1CKA A;  2DET A;  3S6W A;  2XK0 A;  5A0L A;  4OMN A;  3VS3 A;  5GAN h;  2X35 A;  5KYX A;  3DB4 A;  2D0N A;  4N0A A;  3CCU T;  4F7U F;  2FG0 A;  2DD4 A;  3M0S A;  1WA7 A;  4J9I A;  3MHX A;  2L5Q A;  4LNP A;  5KYU B;  3JCM W;  4M75 A;  3M0R A;  4AFQ C;  4PJJ A;  2QQR A;  3VKI A;  2O9S A;  2HDA A;  1GBR A;  4JLI A;  3ZEH A;  2ZGW A;  3A8G B;  1OUL A;  5GAM e;  1Q7Y U;  2E4H A;  4IIM A;  1ZUK A;  1V76 A;  4RUG A;  2LCS A;  3QJY A;  1SPK A;  2HNI A;  4Y28 E;  5GMK m;  4Q5W A;  1ACM B;  5DM7 R;  5CK9 A;  1GCQ C;  2BE7 D;  2DL7 A;  1AWX A;  3UT1 A;  2QK0 A;  4LXC A;  2HZY A;  3JCM e;  3CEY A;  2EQJ A;  4PJO F;  4CC4 B;  4NOY A;  3WVE B;  1Q86 U;  1W2B P;  3ER0 A;  1PNJ A;  1VQM A;  1EZZ B;  2KBT A;  2OI3 A;  3RR6 A;  2OX7 A;  4WTO B;  5GAO l;  4CC7 A;  2JS2 A;  1PC0 A;  3GBQ A;  2XDD A;  3CCL Q;  2JXB A;  1D09 B;  1WZO A;  1KQS A;  2KRN A;  4ME7 A;  4AG1 C;  2CP6 A;  3QHS A;  2NUP A;  5GJV B;  5AYF A;  2NWM A;  3LW5 E;  1OZ2 A;  1TXQ A;  5FWB A;  1NYF A;  2RNA A;  1VQO T;  2DBK A;  4C0G A;  2NLU A;  1GXI E;  2MCN A;  3VS4 A;  4F17 A;  1WHJ A;  1UUE A;  1D3B B;  3M4Y A;  1BI2 A;  4M77 F;  1Q7Y R;  1W2B S;  4LD9 K;  1IHW A;  1IZ6 A;  1D0Z A;  2P84 A;  1P92 A;  1ZX6 A;  2KR3 A;  2OAU A;  1JQQ A;  1LJO A;  2K5F A;  3L2Z A;  4OB0 B;  1QCF A;  2L3Q A;  4HVU A;  3BDL A;  2LT1 A;  3TCJ A;  1NPP A;  1JRI A;  2DEU A;  1PSF A;  3EH2 A;  3QXE B;  2L0A A;  4D8D A;  1I81 A;  2RQU A;  1Q86 R;  1N9R A;  5GAO p;  4RCB A;  6AT1 B;  2DXU A;  3DB3 A;  4NS5 A;  3VRY A;  3G6E A;  4FIB A;  1A0N B;  1SEM A;  3H0I A;  1YHQ Q;  3HL8 A;  3OYF A;  3VS2 A;  3JB9 F;  3CC2 A;  1PCX A;  2LC4 A;  3OYC A;  3CCV Q;  3A8M B;  1SRM A;  5FLX E;  3I55 A;  2XI9 A;  2JMA A;  2NUZ A;  4LDU A;  1D0X A;  3PMT A;  7AT1 B;  2Z0W A;  2G3R A;  2EJ9 A;  4M7D D;  3VUB A;  1B34 B;  4BI4 A;  3CCE T;  1TS9 A;  3OS2 A;  3CCQ Q;  1QWE A;  4A63 B;  2JZ2 A;  2E64 A;  3E19 A;  1X75 C;  4C8Q E;  2K3B A;  4N0A C;  1T3L A;  3OYB A;  1Y96 A;  1K9M R;  2YDL A;  3G71 Q;  1KQ2 A;  4M7D A;  4RMO A;  5KYW A;  1ZA1 B;  4M75 C;  3CMA Q;  2YRC A;  2O4X A;  2WSF E;  2COZ A;  3PMI A;  4E47 A;  3C0C A;  4X9C A;  1FX7 A;  4KRT A;  5CVI A;  1VQ9 A;  1VQ5 A;  2CP0 A;  4ESR A;  3M58 A;  5GAM d;  1ZUU A;  1YIJ A;  5CIU A;  3JV3 A;  3OS1 A;  1VQN A;  2CP3 A;  3CME T;  1K73 U;  4XTY A;  2AHJ B;  3LGL A;  2KXC A;  3V7R A;  1H8K A;  1RLQ C;  2HL5 C;  3OW2 A;  2DIG A;  2G6F X;  1HJD A;  3LX7 A;  5IH2 A;  5LJ3 e;  2A7Y A;  1VQ4 A;  4JUV A;  3H6Z A;  3MEA A;  3RNJ A;  4BE2 A;  1G3T A;  4XQ3 A;  4E7I A;  2A36 A;  4BY6 C;  4V2S A;  2MF2 A;  5KE3 A;  2E65 A;  2KT8 A;  3EG3 A;  2F5T X;  1NJI C;  3Q1J A;  3CC7 T;  2ED1 A;  4JPB W;  1YFN A;  2FRW A;  3L2Q A;  2EQI A;  2K3Y A;  4FT2 A;  1VQ7 T;  1QVG P;  4IUP A;  4QQ6 A;  1IB8 A;  1MUZ A;  1M3C A;  1H64 1;  4CRI A;  3JCM P;  3CCJ Q;  3JCM Q;  2CH4 W;  2RHU A;  4RTX A;  1AWJ A;  4JZ4 A;  4J9C A;  3S3N A;  3TRE A;  5FU6 B;  3OYJ A;  1QWF A;  4FW1 A;  1R0C B;  4FCY A;  3O8V A;  1UFF A;  2MWP A;  4VUB A;  2J05 A;  3DLL A;  2FZK B;  1SSF A;  4JJD A;  4LN2 A;  1K73 R;  2DE0 X;  4HCZ A;  3H41 A;  4Y91 A;  1TH7 A;  1RAI B;  2ZPE B;  3DKM A;  4FYY B;  3R6O A;  2A3L A;  5GAO m;  2QTV A;  3PVQ A;  1X69 A;  1T0J A;  1C0M A;  2RN8 A;  1QVG S;  2K6D A;  4J9B A;  2GQV A;  5CR2 A;  2EIF A;  5LJ5 g;  5L23 A;  3OYH A;  4C8Q D;  1WHG A;  1WYX A;  1BKB A;  1X6G A;  2C0O A;  1BIA A;  1G8X A;  3CCS Q;  4RTW A;  4F16 A;  5ECA A;  2AKL A;  3CD6 T;  1YJ9 Q;  3HRS A;  1PG5 B;  3CCU A;  2LP5 A;  5CKE A;  3CXC A;  1SG5 A;  1VQK Q;  5EC7 A;  2HEQ A;  1N8R U;  1UGV A;  2FL7 A;  3PFS A;  4C8Q A;  4A4G A;  4F04 B;  1JO8 A;  1E6G A;  1TWB A;  4M7A G;  5KCH A;  1LOJ A;  2GGR A;  2RJC A;  1YWP A;  3D7S B;  3A98 A;  2FPF A;  3BDU A;  4C5H A;  3F70 A;  5L8R E;  5HY6 A;  3CCJ A;  4M7D C;  4KT0 E;  3OS5 A;  1TSF A;  5KCO A;  4M7A B;  4KH1 B;  1OOT A;  2RI2 A;  5FW9 A;  3TVT A;  1WXU A;  2XDB A;  4KUD K;  2E5K A;  5GAN g;  5FRN A;  3M53 A;  2HAX A;  2MWO A;  2OTJ A;  1C6V X;  1QMC A;  4F7U E;  1I0C A;  4DOW A;  1FMK A;  1D1C A;  2D0Q B;  1HXD A;  3TSZ A;  3CPW P;  2CP5 A;  1MMA A;  1XTD A;  1WHK A;  2RI3 A;  1JXO A;  2VGM A;  1WIE A;  1PRL C;  3A8H B;  3X25 B;  3NGP A;  4HCK A;  2D8J A;  2DBM A;  3M5A A;  3EHQ A;  3UDC A;  2R5M A;  2OJ2 A;  1VQO A;  4Z8A A;  1N8R R;  1K4U S;  5KE2 A;  2GBQ A;  2LX9 A;  4FYV B;  1OV3 A;  3INZ A;  4QKU A;  1RI0 A;  3E2U A;  3CCR Q;  5KYN A;  2O31 A;  2BE9 B;  5LJ3 d;  5EG2 A;  3CCL T;  2A37 A;  4C92 B;  2LJ3 A;  4OGC A;  2D9T A;  4PJO E;  2LCL A;  3MJX A;  2QXF A;  1JJ2 A;  3CCM Q;  3P8H A;  3VJP A;  3M9Q A;  3OBW A;  2FHD A;  8ATC B;  4EMK B;  2QQA A;  4PFZ A;  1W4S A;  3CPW S;  2AK5 A;  4LDV A;  3ZL7 C;  2LTO A;  1VA7 A;  2HQE A;  2ZPB B;  1HK9 A;  1MMN A;  2KK4 A;  4JDS A;  1G3W A;  5DY9 A;  1FXX A;  4ELZ C;  5CKH A;  1X43 A;  2J06 A;  3ZBD A;  2JTM A;  3I56 Q;  2FZG B;  2SRC A;  2P0P A;  3MPU B;  1B7T A;  1PD0 A;  2V8J A;  5FWC A;  1N6A A;  1VIE A;  1U3O A;  4MDX A;  4FT4 A;  2ZAE A;  4J6Y A;  1RAF B;  3AT1 B;  4OML A;  1FYN A;  1VQL A;  3UF4 A;  4J6W A;  2RB6 A;  3HP9 A;  3BE3 A;  4RTY A;  3EGX B;  3CCE A;  1YHQ T;  2RD1 A;  3JCM V;  1UGR B;  3REA B;  2RQW A;  1H3H A;  4BD3 A;  4CC3 A;  2L89 A;  5A2Q E;  1TTH B;  2AIR B;  4IKF A;  1SHG A;  2P4T A;  2DVE A;  1QVF P;  1BK2 A;  5GMK j;  4F14 A;  1JBM A;  3QZ5 B;  2X4Y A;  1E6H A;  2DL4 A;  4JS4 A;  1KC8 C;  5LJ5 h;  3L2R A;  1WJQ A;  3ZFJ A;  4C8Q C;  2LQK A;  1IRX A;  1M90 C;  1M3A A;  2LX7 A;  3JB9 H;  1QCN A;  2ZPI B;  5LJ3 f;  3CCQ T;  2JM9 A;  1BB9 A;  1WFW A;  2O9V A;  2QA4 Q;  5GAN 7;  3MET A;  4FW2 A;  1QVP A;  1EX4 A;  2B86 A;  3SD4 A;  1RAA B;  2RHX A;  1M8V A;  4R56 A;  4C92 F;  2JMC A;  3J80 E;  3G71 T;  1M2O A;  3CME A;  2X3X D;  4PKC C;  1Q81 U;  1SHF A;  4E7Z A;  3CMA T;  4KUL A;  4DEX A;  4F7U A;  3LGF A;  3QYG B;  2D1X A;  5GAM j;  5J3B A;  2PVO B;  2RJE A;  2R58 A;  5IHI A;  2RQR A;  4PLI A;  4RKU E;  1QVF S;  1ZSZ A;  4OMF B;  2C0T A;  1R77 A;  2HCK A;  2YUO A;  2XDP A;  3ME9 A;  3RER A;  1VYU A;  1VQ8 Q;  1GFC A;  2V26 A;  4C0Z A;  4PJO D;  2YUP A;  2F2X A;  2DXB A;  2E6N A;  3GLX A;  4M78 B;  3HSB A;  4LUE A;  3CC7 A;  1ZBX A;  2Y90 A;  1NG2 A;  4BAC A;  1Q82 C;  2QQS A;  1Q7Y C;  2EQU A;  1VQ7 A;  4MZT A;  3FDR A;  3GF5 A;  1MHN A;  2LDM A;  4PJO A;  1R8O B;  4DBF A;  1IO6 A;  5CKF A;  4BY6 B;  4PJL A;  5I2M A;  3JCM J;  4RCC A;  1BU1 A;  4QQD A;  2MIO A;  2CGH A;  4EPC A;  4TVR A;  1QQJ A;  2HMA A;  5GAN 5;  1XQH A;  3X20 B;  2YT6 A;  4J9D A;  2A0F B;  2DD5 A;  4LDX A;  1AVZ C;  4M77 D;  2CH4 A;  1MMD A;  1Q81 R;  3CCJ T;  2GNC A;  2PU9 B;  2PNI A;  4LUD A;  4RTU A;  1OYX A;  1LVK A;  5KYY B;  1M2V B;  3M59 A;  3HTR A;  1NEG A;  2CSI A;  1W6X A;  2A08 A;  1X6O A;  2DM1 A;  5IHK A;  5HKC A;  4FM4 B;  4M77 A;  2HBP A;  4OGE A;  5GAO q;  2OTJ T;  2CS7 A;  2PUO B;  4R55 A;  3JAM E;  3CD6 A;  3QUI A;  5GAN e;  3OMC A;  3QJ6 A;  3PTA A;  2DTO A;  3J7A F;  1QP3 A;  1WQ7 A;  2OTL Q;  4KGX B;  3MEU A;  1TUD A;  2DIQ A;  3EG9 B;  1UG1 A;  5J39 A;  3JB9 D;  5KYU A;  3JCM c;  4IUV A;  1MND A;  4O6J A;  1PD1 A;  1S72 Q;  3CCS T;  1E7O A;  3OYK A;  2H8H A;  3EGU A;  2LNV A;  2DO3 A;  2RO0 A;  1YJ9 T;  1UJY A;  2Y4Y A;  4M78 F;  4QQG A;  2K9G A;  3OY9 A;  1CKB A;  2M02 A;  1VQK T;  1K9M U;  3L1A A;  4DOV A;  4FL6 A;  4M7D G;  3C12 A;  2AZS A;  3J81 E;  5GAN 8;  3RIR A;  4BDZ A;  2L3S A;  3EGD B;  1YP5 A;  1GRI A;  3LH0 A;  2EKH A;  1RAH B;  1KD1 C;  3O5Z A;  2M16 A;  1WXB A;  4D8K A;  2AZV A;  2XIC A;  4GBQ A;  2RQV A;  2BIV A;  2DEQ A;  4M7D B;  2FYK A;  2CT3 A;  2P0K A;  3V8J A;  3S3O A;  3M0Q A;  4MZM A;  5CQX A;  2KYB A;  2OAW A;  2O4X B;  4L59 A;  1OX9 A;  1WHM A;  1YIT Q;  3EFS A;  1ZHI A;  1W2B A;  1MMG A;  2M1H A;  3MCA B;  1ZSZ C;  3UAT A;  4J83 A;  3EG1 A;  4HCB A;  1VQL T;  2EAY A;  4WCI A;  2PZ1 A;  1NLP C;  1W70 A;  1D1B A;  3CCL A;  1D3B A;  1K1Z A;  1Y7X A;  2DL8 A;  4BDY A;  4ANJ A;  3REB B;  3SDZ A;  2EBP A;  4C5E A;  5C0M A;  2DIL A;  2E5Q A;  2DKG A;  4AFZ C;  3G4S Q;  3NTK A;  5LJ3 j;  2EVR A;  3L2W A;  2J7I A;  2JW4 A;  3OYG A;  3PGG A;  3EFO B;  2R5A A;  2HBW A;  3SB2 A;  4J9E A;  4PJO C;  3X24 B;  1G5V A;  5LJ5 d;  1KIK A;  3AHU A;  4J8O A;  4HKE A;  4ZTF A;  4L6V 5;  5AT1 B;  3HRT A;  3M0P A;  3SWN B;  2DYI A;  1Q95 G;  3EHR A;  3ASK A;  3CCM T;  1D1A A;  2JS0 A;  2K4Y A;  3QG1 A;  2XU8 A;  1GL5 A;  1YNZ A;  1G3S A;  5I2S A;  2YWW A;  2DX1 A;  4XU0 A;  2VKN A;  1BCM A;  3TQ7 P;  4PL6 A;  3VV0 A;  2LJ0 A;  1VYV A;  3VU3 C;  3FLG A;  2WSE E;  4M77 C;  1B34 A;  1YHQ A;  2VVK A;  4NL3 A;  4J7F A;  4RTT A;  2RF0 A;  2E3H A;  2RM4 A;  2W10 A;  3CCV A;  4II1 A;  3RDV A;  1HSQ A;  4A4F A;  5GAO r;  1U5S A;  2DTH A;  2PVD B;  3WVD B;  4XU1 A;  1BYM A;  3CC4 Q;  1XOV A;  3OYY A;  2QG9 B;  5GAN d;  2RMO A;  2EQM A;  4HT8 A;  1ABO A;  1NYG A;  2WSC E;  1VUB A;  3C94 A;  3MKD A;  4C8Q G;  5D6X A;  3VS5 A;  4KUI A;  2E10 A;  3P8D A;  2KRO A;  3CCQ A;  4JLG A;  2M9U A;  4A4K A;  4E2F B;  2F1L A;  1KFZ A;  1YCS B;  2KQW A;  1EFN A;  2CZ1 B;  1SRL A;  4M7A E;  3G71 A;  1VYT A;  4RTZ A;  2NUT B;  1UE9 A;  4XTX A;  3HFN A;  3L2V A;  2DXT A;  3CMA A;  1M3B A;  2DFU A;  1M30 A;  2JM8 A;  4J6X A;  3RES A;  1ZBJ A;  1NJI U;  2DAQ A;  3LYI A;  2EJG A;  4XTZ A;  5LJ5 f;  2DF6 A;  1BI0 A;  2PVG B;  2BZ8 A;  3E9F A;  1M5Q 1;  3SEM A;  1UHC A;  3EFR A;  5I22 A;  2KY9 A;  3LH5 A;  3FIF A;  4PJM A;  4XTV A;  2CKK A;  1WQW A;  1H92 A;  1AEY A;  3CBO A;  4C0D C;  3M0T A;  2LNH B;  2RK2 A;  5CO7 A;  4A4E A;  2ECZ A;  3QKJ A;  3A8L B;  3H0H A;  2RHY A;  1VQ6 Q;  1YJW Q;  3URG A;  1DJ7 B;  2E6Z A;  4ZGD B;  5D6W A;  4C92 E;  2QDL A;  1S1N A;  1VQ8 T;  1YI2 Q;  3FJP A;  1ZQ1 A;  3I35 A;  3JB9 J;  4LDW A;  1RAG B;  4Y92 A;  2MK5 A;  3M4G A;  4L5G A;  3QDR B;  2QI2 A;  2KNB B;  2VV5 A;  2HD0 A;  2HSE B;  5GAM g;  3A5Z B;  4CI0 C;  4EDU A;  2ZPH B;  4DBR A;  1B07 A;  1M1K U;  2ED0 A;  1QVG A;  1RUW A;  5GAN f;  2KEA A;  1TUG B;  3V8K A;  3OBY A;  1VIF A;  4ELY C;  1NJI R;  1IGU A;  2ENM A;  4ZGJ B;  4JJN K;  1K9A A;  5D7U A;  3JCM g;  4R0K A;  4E7L A;  1G2B A;  1K8A C;  5C6S A;  3QII A;  2DPP B;  5D6Y A;  1UGQ B;  1MGQ A;  2FO0 A;  4E7H A;  5IN1 A;  5IT9 E;  1QCO A;  2HKN A;  2K2V A;  2KDS A;  3EG0 A;  1QW1 A;  1OU8 A;  2BZX A;  4HVW A;  1PKT A;  5GJW B;  1HD3 A;  1TG0 A;  2YSQ A;  3EAE A;  1VOM A;  3IQL A;  4YTL A;  3BFM A;  2GQI A;  1NE8 A;  1RAE B;  1VQP Q;  1PSE A;  1X2Q A;  2F2W A;  2H3J A;  1YCY A;  4M7A D;  3CCS A;  1YBY A;  1I07 A;  1BIB A;  2RH2 A;  4LE9 A;  2KMT A;  2LQW A;  4OMM A;  2I2L A;  1YJ9 A;  4XU3 A;  2ABL A;  3T9N A;  1EIF A;  2DTI A;  2K5L A;  2OTL T;  1VQK A;  4N4G A;  2RJD A;  3OQ5 A;  3UA7 A;  5CKD A;  3L2U A;  1F1B B;  1OZ3 A;  4ZGE B;  1M1K R;  4E7J A;  2GTJ A;  1Z9Q A;  3V7S A;  4GLK A;  3P8B B;  2J6F A;  3X28 B;  3OYD A;  4M7A A;  2YLC A;  2D8H A;  3OYA A;  4Z89 A;  2QEX Q;  4K11 A;  1S72 T;  3OSS C;  5HK0 A;  1NPR A;  3THK A;  4QVD A;  1FWZ A;  4BE0 A;  4OMQ A;  2J6K A;  2F69 A;  2FPD A;  4PFP A;  4A54 A;  2CP7 A;  2MOX A;  2X4J A;  1BBZ A;  3MO8 A;  1YJN Q;  3C4S A;  3G1J A;  2EQK A;  4F7U G;  4C92 D;  3RKW A;  3M55 A;  4M7A F;  2KE9 A;  2RI5 A;  4X9D A;  1MV0 B;  3S3M A;  5IXB A;  4ZTJ A;  2CZ6 B;  3QBY A;  1QKW A;  4M78 E;  3M0U A;  4HXJ A;  1IHV A;  3X26 B;  2VB6 A;  3CPW A;  2RJF A;  4QT7 A;  4KBM B;  5GAN 3;  1RI9 A;  4ZN1 A;  1Y07 A;  2E1H A;  3JRZ A;  3FJ5 A;  4OB3 B;  2X4X A;  1WI7 A;  4C92 A;  3CCV T;  4RG2 A;  5IHN A;  5J26 A;  4B9X A;  1KHC A;  4D6W A;  4EMK A;  4JJC A;  2KI7 A;  2VYT A;  3I5S A;  3CCR A;  2VWF A;  5GMK h;  3E9G A;  4PJO G;  5LL6 S;  5GAN 4;  4M75 G;  2XID A;  1PWT A;  5FU6 C;  2Y4X A;  3CCM A;  4FYX B;  5KYX B;  2V1Q A;  3G4S T;  1R0B G;  1YN8 A;  3FRN A;  2V8K A;  2DXC A;  1RAB B;  4PLL A;  4RG8 A;  5M9O A;  4M75 B;  4FU6 A;  3RUX A;  1UB4 A;  2C06 A;  1AHJ B;  2HSP A;  2P4R A;  9ATC B;  1ZA2 B;  5GAM h;  2RA2 A;  3V7C A;  2CZ7 B;  3CBP A;  4X1V A;  2CYZ B;  1KC8 U;  3I56 A;  2PTK A;  1VQM Q;  2IPO B;  3EGX A;  2EYX A;  5LJ3 g;  4J9F A;  4M77 G;  2NYS A;  1W1F A;  4EMG A;  3JCM X;  1V29 B;  1QLY A;  2DA9 A;  5GAN 6;  2LVM A;  2GFA A;  2M0Y A;  4OB2 B;  3MP6 A;  4IUT A;  5GAO n;  3VS1 A;  1KQS P;  1N9S A;  5A0D A;  3M54 A;  4LD6 A;  4ZNX A;  3JCM h;  2GFU A;  4DBH A;  3LWI A;  3QZ9 B;  3PNW C;  5LJ5 e;  5CQY A;  4M77 B;  4OMP A;  1UEB A;  4QVZ A;  4FSS A;  2ZCF B;  4OP0 A;  1G3Y A;  2ROL A;  3OYM A;  3I5R A;  5GAN j;  3GNF B;  3OS0 A;  1WXT A;  4EIK A;  2NUP B;  4N4H A;  1LPL A;  1QVF A;  1NZ9 A;  2JOY A;  3CC4 T;  2EGE A;  2V8I A;  2VAS A;  1Q86 C;  2CUB A;  2L3P A;  2JJ9 A;  3JB9 G;  2BUD A;  1OI1 A;  1K0S A;  4BI3 A;  4M7A C;  3U23 A;  1LNX A;  1ZUY A;  2YXY A;  3ULR B;  4M78 D;  1NBE B;  2EYZ A;  3MEV A;  3BY7 A;  1KQS S;  4MZP A;  1Q82 U;  4M7D E;  2QA4 A;  1WDX A;  3KFV A;  1PHT A;  2KXD A;  5DLQ E;  2FEI A;  2LMJ A;  2MI6 A;  4XK8 E;  4P5N A;  1KC8 R;  1SF9 A;  1XJW B;  4OF1 A;  1M90 R;  3NHN A;  3RKX A;  3PIP A;  3OYL A;  2WAC A;  3G6E Q;  4IIO A;  3OYE A;  5I21 A;  4M78 A;  2JTF A;  3FEO A;  3QWX X;  1ABQ A;  2KYM A;  3LLR A;  3VRZ A;  2ZZD A;  2FRY A;  1T3S A;  3CC2 Q;  1X6B A;  3NPF A;  4IUR A;  2QQ9 A;  4M75 F;  1ZSG A;  4HVV A;  3I55 Q; 
#chains in the Genus database with same CATH homology
 1Q81 C;  4GY5 A;  1M9S A;  1G3S A;  4C5H A;  3BDU A;  5I2S A;  1IRE B;  2EYQ A;  3F70 A;  1UGP B;  5L8R E;  4WF2 A;  5HY6 A;  3CCJ A;  1K9M C;  1VQ8 A;  4KT0 E;  3MP1 A;  4XU0 A;  4M7D C;  4E7K A;  3OS5 A;  3OMG A;  2E70 A;  4JRI A;  5KCO A;  1QP2 A;  4M7A B;  2RI2 A;  4PL6 A;  3VV0 A;  4EMH A;  3VU3 C;  5LJ5 j;  2DZC A;  2QTX A;  2VC8 A;  3FLG A;  3FB9 A;  4C0D B;  2XDB A;  2WSE E;  4C92 C;  4M77 C;  1B34 A;  3HFO A;  1YHQ A;  4KUD K;  3OSV A;  5GAN g;  4NL3 A;  4J7F A;  4PJO B;  5FRN A;  2RM4 A;  3BW1 A;  2QEX A;  4QVC A;  3M53 A;  5FU7 B;  4II1 A;  3CCV A;  2EFI A;  2HAX A;  1YJW T;  2MWO A;  1VQ6 T;  2OTJ A;  3VYH B;  4EMK C;  2K3X A;  3RMS A;  4F7U E;  4A4F A;  4DOW A;  5GAO r;  2EJF A;  2D0Q B;  1HXD A;  2DTH A;  3WVD B;  2PVD B;  2PUK B;  4XU1 A;  4BE1 A;  1BYM A;  1YI2 T;  5CAI A;  1XOV A;  1XTD A;  2RI3 A;  3OYY A;  3J7A F;  2YLB A;  2L8D A;  5GAN d;  2VGM A;  3VUZ A;  2QQB A;  2MMP A;  3A8H B;  3X25 B;  2EKO A;  2EQM A;  4HT8 A;  1KQ1 A;  3UPU A;  2WSC E;  2RK1 A;  3M5A A;  1M90 U;  1VUB A;  3C94 A;  1YJN A;  4C8Q G;  5D6X A;  4KUI A;  2E10 A;  3P8D A;  5GMK i;  3UDC A;  3JCM b;  1X01 A;  1Y96 B;  2R5M A;  3CCQ A;  4JLG A;  2M9U A;  3NTH A;  4M78 G;  4A4K A;  1VQO A;  1H3Z A;  3CBM A;  5KE2 A;  2KQW A;  2LX9 A;  2CZ1 B;  3INZ A;  1RI0 A;  4IUU A;  4M7A E;  3G71 A;  5LJ3 d;  5GAN 2;  4OB1 B;  5EG2 A;  1O75 A;  3CCL T;  4XTX A;  2PQW A;  2LCC A;  3HFN A;  5GMK e;  1M1G A;  4C92 B;  1BI3 A;  4OGC A;  3L2V A;  2D9T A;  2DXT A;  2LCL A;  4MDW A;  3CMA A;  4PJO E;  2QXF A;  3UWN A;  2HQX A;  1JJ2 A;  2ZPG B;  4M75 D;  4J6X A;  3P8H A;  3RES A;  3M9Q A;  3OBW A;  2FHD A;  3V8L A;  3VJP A;  1NJI U;  2DAQ A;  3S6W A;  4EMK B;  2QQA A;  1U1T A;  2XK0 A;  3LYI A;  2EJG A;  4XTZ A;  5A0L A;  5LJ5 f;  3JB9 I;  2DJZ A;  4LDY A;  5GAN h;  2X35 A;  1W4S A;  1BI0 A;  3DB4 A;  4LDV A;  4N0A A;  3CPW S;  3HRU A;  2PVG B;  4JRP A;  3E9F A;  1M5Q 1;  2LTO A;  3EFR A;  3CCU T;  2HQE A;  2ZPB B;  1HK9 A;  4F7U F;  4A53 A;  1KD1 U;  2KY9 A;  2KK4 A;  4JDS A;  2DD4 A;  2KAF A;  1G3W A;  2OTL A;  3SFM A;  5DY9 A;  1FXX A;  2KVQ G;  4ELZ C;  5CKH A;  2LRQ A;  3DLM A;  2L5Q A;  3MHX A;  3JCM W;  3FIF A;  4M75 A;  4N4I A;  3ZBD A;  2JTM A;  1M1F A;  3VYG A;  2QQR A;  3VKI A;  1VQP T;  4XTV A;  4XTU A;  2CKK A;  1WQW A;  4JLI A;  4BUG A;  3ZEH A;  2ZGW A;  3CBO A;  4C0D C;  5LJ3 h;  3A8G B;  2RK2 A;  5GAM e;  3LWH A;  1Q7Y U;  4JS5 A;  5CO7 A;  4A4E A;  2P0P A;  4XAX B;  2E41 A;  3QKJ A;  3CCR T;  3A8L B;  1KG1 A;  2V8J A;  2RHY A;  1N6A A;  1S72 A;  1WPY A;  5FU7 C;  3URG A;  1VIE A;  1K73 C;  1DJ7 B;  2E6Z A;  2VGN A;  3QJY A;  2DK3 A;  2HNI A;  4Y28 E;  4ZGD B;  5GMK m;  5D6W A;  2O01 E;  4Q5W A;  4MDX A;  4C92 E;  3OW2 S;  4FT4 A;  3GIB A;  4J6Y A;  5DM7 R;  1VQ8 T;  5CK9 A;  3FJP A;  3UT1 A;  1ZQ1 A;  2VXE A;  1VQL A;  3JB9 J;  4J6W A;  4LDW A;  2RHZ A;  3CEY A;  3JCM e;  2RB6 A;  3HP9 A;  2EQJ A;  4PJO F;  3M4G A;  4L5G A;  4NOY A;  3QDR B;  3CCE A;  2QI2 A;  2YHT A;  2VV5 A;  2HD0 A;  3WVE B;  5GAM g;  1Q86 U;  3ER0 A;  1YHQ T;  3A5Z B;  4ATO A;  2RD1 A;  3QPH A;  3JCM V;  2IG0 A;  4EDU A;  4CI0 C;  1VQM A;  5CCA A;  2ZPH B;  1M1K U;  3H8Z A;  4J7I A;  1QVG A;  2QEX T;  1UGR B;  4HCC A;  5GAN f;  4Z02 A;  4BD3 A;  5GAO l;  2L89 A;  3V8K A;  3OBY A;  5A2Q E;  1VIF A;  4IKF A;  2P4T A;  2XDD A;  2DVE A;  4JRQ A;  4ELY C;  2XKO C;  2XD0 A;  3NTI A;  1U1S A;  5GMK j;  3OYI A;  1JBM A;  4ZGJ B;  2CZ0 B;  3QZ5 B;  2X4Y A;  4JJN K;  4ME7 A;  4JS4 A;  1KQS A;  4PJO D;  3QHS A;  1KC8 C;  5LJ5 h;  3L2R A;  1WJQ A;  5AYF A;  3JCM g;  3ZFJ A;  3PIO A;  4C8Q C;  3I56 T;  3LW5 E;  1OZ2 A;  4E7L A;  2LQK A;  3QSU A;  1M90 C;  1K8A C;  5C6S A;  1YJN T;  3QII A;  2DPP B;  2M0O A;  1UGQ B;  4M78 C;  5D6Y A;  3JB9 H;  4M7D F;  2ZPI B;  1YIT A;  1MGQ A;  4E7H A;  1XNI A;  5IN1 A;  5LJ3 f;  3CCQ T;  5IT9 E;  2K2V A;  1VQO T;  5FRO A;  2R57 A;  4C0G A;  2KDS A;  2NLU A;  5CKB A;  1GXI E;  5GAN 7;  3MET A;  1QVP A;  2E12 A;  3SD4 A;  2RHX A;  1QW1 A;  1M8V A;  2XG8 D;  3JCM d;  1D3B B;  3M4Y A;  3WXM B;  4R56 A;  1BI2 A;  2RHI A;  4M77 F;  4C92 F;  3J80 E;  3G71 T;  3CME A;  2XHC A;  4PKC C;  3EAE A;  1Q81 U;  1W2B S;  4LD9 K;  4YTL A;  3BFM A;  1IZ6 A;  1NE8 A;  1P92 A;  4XTW A;  3CMA T;  4KUL A;  2OAU A;  1PSE A;  4F7U A;  3LGF A;  3QYG B;  1LJO A;  2K5F A;  5GAM j;  5J3B A;  3L2Z A;  2JN0 A;  2PVO B;  4MML A;  3SWN A;  1BI1 A;  2RJE A;  2R58 A;  4OB0 B;  3G4S A;  4PLI A;  2JVV A;  4RKU E;  2H3J A;  1YCY A;  3BDL A;  2GF7 A;  2LT1 A;  1QVF S;  3CCS A;  1YBY A;  4UC4 A;  4M7A D;  4OMF B;  2F5K A;  1BIB A;  1NPP A;  3TCJ A;  4C5G A;  2RH2 A;  1JRI A;  2KMT A;  1YJ9 A;  2I2L A;  2XDP A;  1PSF A;  3ME9 A;  4XU2 A;  1M4Z A;  4XU3 A;  5IAY A;  3RER A;  3T9N A;  4HA8 A;  1EIF A;  3QXE B;  4C8Q B;  2EWN A;  2DTI A;  2K5L A;  4C0Z A;  1I81 A;  1VQK A;  2DXB A;  1N9R A;  2OTL T;  2E6N A;  2RJD A;  3OQ5 A;  4N4G A;  3TEE A;  2B8A A;  5CKD A;  5GAO p;  3GLX A;  4RCB A;  1OZ3 A;  4M78 B;  4ZGE B;  3L2U A;  2DXU A;  4E7J A;  3DB3 A;  3HSB A;  3CC7 A;  4NS5 A;  1ZBX A;  2Y90 A;  3G6E A;  3V7S A;  4GLK A;  4FIB A;  3P8B B;  4BAC A;  3X28 B;  3OYD A;  1Q82 C;  2FB7 A;  4M7A A;  2QQS A;  3HL8 A;  3OYF A;  2EQU A;  2QA4 T;  2YLC A;  2MAM A;  2ZPF B;  4QW2 A;  4MZT A;  1Q7Y C;  1VQ7 A;  3FDR A;  3JB9 F;  3CXC S;  3OYA A;  2LC4 A;  3OYC A;  3CC2 A;  3GF5 A;  1S72 T;  1MHN A;  2JUF A;  2LDM A;  2KSS A;  3A8M B;  3OSS C;  5FLX E;  5HK0 A;  2K5I A;  1NPR A;  2XI9 A;  3I55 A;  1R8O B;  1N8R C;  4PJO A;  4QVD A;  4LDU A;  3CPF A;  3PMT A;  3QYH B;  1FWZ A;  5CKF A;  4BY6 B;  4BE0 A;  5I2M A;  2G3R A;  2F69 A;  2QDY B;  3NFC A;  2EJ9 A;  4FSX A;  3A8O B;  4M7D D;  3VUB A;  3JCM J;  4RCC A;  4A54 A;  1B34 B;  2X4J A;  3MO8 A;  4QQD A;  4BI4 A;  3CCE T;  1WNL A;  3C4S A;  2CGH A;  4EPC A;  4TVR A;  2EQK A;  3OB9 A;  3OS2 A;  5GAN 5;  1XQH A;  3X20 B;  4F7U G;  1VQM T;  1M1K C;  2JZ2 A;  2DD5 A;  2E64 A;  3E19 A;  4M77 D;  3RKW A;  4C92 D;  5GAM f;  3M55 A;  1X75 C;  1JB0 E;  4C8Q E;  4LDX A;  4M7A F;  2RI5 A;  4N0A C;  4X9D A;  4DQ2 A;  3OYB A;  3CCJ T;  2VXF A;  1Y96 A;  3S3M A;  4ZTJ A;  2CZ6 B;  2PU9 B;  3QBY A;  4M78 E;  1OYX A;  1KQ2 A;  3KXT A;  4M7D A;  3X26 B;  3M59 A;  3CC4 A;  3CPW A;  2RJF A;  4RMO A;  4KBM B;  1X6O A;  4M75 C;  5HKC A;  5GAN 3;  4ZN1 A;  1Y07 A;  2E1H A;  2O4X A;  2WSF E;  3JRZ A;  5KH6 A;  3PMI A;  4E47 A;  4OB3 B;  2X4X A;  1WJR A;  1N27 A;  3JCM f;  4FM4 B;  4M77 A;  2HBP A;  4A4H A;  4C0F A;  4OGE A;  4RG2 A;  4X9C A;  4C92 A;  1FX7 A;  5GAO q;  2OTJ T;  5J26 A;  2CS7 A;  5CVI A;  4C5I A;  2PUO B;  4BB7 A;  1VQ9 A;  1VQ5 A;  4R55 A;  3JAM E;  3M58 A;  4B9X A;  3OYN A;  1KHC A;  4PNO A;  4D6W A;  4EMK A;  3CD6 A;  1I8F A;  3QUI A;  5GAM d;  5GAN e;  2VYT A;  1YIJ A;  3OMC A;  3N5B B;  3QJ6 A;  5CIU A;  3CCR A;  3PTA A;  4X34 A;  2DTO A;  5GMK h;  3OS1 A;  1QP3 A;  1WQ7 A;  3FC3 A;  1VQN A;  3E9G A;  4PJO G;  3CME T;  5LL6 S;  1K73 U;  3MEU A;  5GAN 4;  3OA6 A;  4XTY A;  2AHJ B;  4M75 G;  5FRM A;  3LGL A;  2K57 A;  2DIQ A;  3V7R A;  2XID A;  5J39 A;  3JB9 D;  5FU6 C;  3CCV T;  3OW2 A;  2DIG A;  2Y4X A;  3QO3 A;  3CCM A;  3JCM c;  4IUV A;  3RMQ A;  3TU4 K;  3G4S T;  3LX7 A;  3FRN A;  4O6J A;  5GMK l;  2A7Y A;  2V8K A;  5LJ3 e;  2DXC A;  3CCS T;  4JUV A;  1VQ4 A;  3H6Z A;  3MEA A;  3OYK A;  4C8Q F;  4BE2 A;  2VUB A;  4PLL A;  4RG8 A;  2LNV A;  5M9O A;  2DO3 A;  2RO0 A;  1I5L A;  1YJ9 T;  1U8R A;  2Y4Y A;  1G3T A;  4M78 F;  4M75 B;  4FU6 A;  4QQG A;  4XQ3 A;  3RUX A;  3KBG A;  4E7I A;  5HK3 A;  1UB4 A;  4BY6 C;  3OY9 A;  1JJ2 S;  1VQK T;  2MF2 A;  1AHJ B;  1K9M U;  2C06 A;  4V2S A;  3L1A A;  4DOV A;  5KE3 A;  2E65 A;  2F5T X;  1RL2 A;  3M56 A;  3C12 A;  4FL6 A;  1NJI C;  4M7D G;  3Q1J A;  3J81 E;  5GAN 8;  3RIR A;  5GAM h;  4BDZ A;  3CC7 T;  2RA2 A;  4B9W A;  3G6E T;  3L2Q A;  3V7C A;  2CZ7 B;  3CBP A;  2CYZ B;  1I4K 1;  2JNG A;  3HHT B;  4MMK A;  2K3Y A;  3LH0 A;  4FT2 A;  3I56 A;  1KC8 U;  1Y71 A;  1VQ7 T;  2P0Q A;  4HT9 A;  4M7D B;  4IUP A;  4QQ6 A;  3CC2 T;  5LJ3 g;  1KD1 C;  4C92 G;  1H64 1;  4M77 G;  1K8A U;  1UGS B;  4CRI A;  4J5Y A;  3JCM P;  4EMG A;  4ZN3 A;  2M16 A;  3JCM X;  1YJW A;  3JCM Q;  2D6F A;  1VQ6 A;  1V29 B;  3I55 T;  2FVU A;  2RHU A;  2LVM A;  5GAN 6;  2GFA A;  2XIC A;  4OB2 B;  3HPW A;  3MP6 A;  2BIV A;  4IUT A;  5GAO n;  3S3N A;  2DEQ A;  3TRE A;  2FYK A;  5FU6 B;  2LT4 A;  4BI8 B;  1N9S A;  4OVA A;  3M54 A;  5A0D A;  4LD6 A;  3JCM h;  3OYJ A;  2P0K A;  1YI2 A;  2GFU A;  3V8J A;  4NL2 A;  3LWI A;  3O8V A;  3S3O A;  3QZ9 B;  4MZM A;  5CQX A;  2MWP A;  3PNW C;  4VUB A;  2O4X B;  5LJ5 e;  4DA4 A;  5CQY A;  4L59 A;  3DLL A;  4M77 B;  4QVZ A;  1SSF A;  1UEB A;  3SWN C;  3EFS A;  1ZHI A;  2BKD N;  2ZCF B;  1W2B A;  2DZ9 A;  1G3Y A;  2M1H A;  4OP0 A;  5DLO A;  3MCA B;  3JSC A;  4M75 E;  4J83 A;  2LQ8 A;  3M57 A;  3OYM A;  4HCZ A;  3GNF B;  5GAN j;  3OS0 A;  3RKY A;  3GOX A;  4Y91 A;  1TH7 A;  4HCB A;  1VQL T;  2EAY A;  2ZPE B;  4N4H A;  3DKM A;  3G7Z A;  3GPL A;  3R6O A;  2A3L A;  5GAO m;  1QVF A;  3CCL A;  1NZ9 A;  2JOY A;  1D3B A;  1Y7X A;  3CC4 T;  2V8I A;  4BDY A;  1Q86 C;  3SDZ A;  4C5E A;  1QVG S;  5C0M A;  3JB9 G;  2E5Q A;  1WJS A;  2BUD A;  1OI1 A;  2GQV A;  5CR2 A;  2EIF A;  2X4W A;  5LJ5 g;  3E1S A;  3C95 A;  2DKG A;  3OYH A;  4O5V A;  1WGS A;  4C8Q D;  4BI3 A;  4M7A C;  1BKB A;  3GNG A;  1BIA A;  4JRK A;  3KUF A;  1LNX A;  3NTK A;  5LJ3 j;  1VQ9 T;  1VQ5 T;  4M78 D;  3L2W A;  3MEW A;  3MEV A;  3OYG A;  3BY7 A;  3PGG A;  4MZP A;  1Q82 U;  1KQS S;  4M7D E;  2R5A A;  2QA4 A;  3CD6 T;  3SB2 A;  4IUQ A;  3HRS A;  4PJO C;  3CCU A;  1YIJ T;  3X24 B;  1G5V A;  2GCX A;  3MP8 A;  5CKE A;  1VQN T;  5DLQ E;  2IVW A;  5LJ5 d;  3CXC A;  3PT9 A;  2MI6 A;  4XK8 E;  1N8R U;  4P5N A;  4J8O A;  3AHU A;  2FL7 A;  4HKE A;  4F7U B;  4ZTF A;  3L42 A;  4L6V 5;  4M77 E;  3HRT A;  3PFS A;  4OF1 A;  3SWN B;  4C8Q A;  3GP8 A;  4A4G A;  1YIT T;  1O9S A;  3RKX A;  3PIP A;  3OYL A;  2WAC A;  1VQP A;  1KHI A;  3OYE A;  5I21 A;  4M7A G;  3ASK A;  4M78 A;  3CCM T;  2JTF A;  3FEO A;  3LLR A;  2ZZD A;  2YRV A;  5KCH A;  3HKS A;  1LOJ A;  4IUR A;  2K4Y A;  2QQ9 A;  3QG1 A;  4M75 F;  1VQ4 T;  2XU8 A;  5A0G A;  2RJC A;  2L3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...