4J6XA

Crystal structure of hfq from pseudomonas aeruginosa in complex with utp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j6xA00
5LJ5g 4M7AC 2VXEA 1H641 4F7UE 1JBMA 5GAN7 4A53A 2DZ9A 3QHSA 3SWNB 4M7AE 2Y90A 4XU0A 2FYKA 2DVEA 3L1AA 4M78E 2E64A 4M75C 1Y96A 3JCMX 4M75A 1YCYA 1M8VA 2CGHA 5GMKj 5LJ3f 4M7DB 5GAOq 4JLIA 4PNOA 2K57A 3JCMW 4M7DG 4PJOF 3SWNA 1KQ2A 4C8QC 4Y91A 4NL3A 5GAN3 4XTUA 4XTXA 2E65A 4HT9A 1U1SA 4PJOD 2DTOA 5LJ3d 2E41A 1HK9A 3V8LA 3RKXA 4X9CA 3JB9J 3AHUA 4M7DA 4N0AA 3JB9I 4EMHA 3JCMJ 3JCMh 4C92E 1TH7A 2EAYA 3BFMA 4XQ3A 2VC8A 5CAIA 2DEQA 4M77E 4M78D 4PJOB 1LOJA 1JRIA 5LJ3h 5DY9A 2E1HA 4PJOG 2RA2A 2EJGA 3JCMf 1KQ1A 5GMKm 1WQWA 4XTZA 3VU3C 2DTHA 4EMKB 1LNXA 5GAMf 4M75E 3SWNC 4DQ2A 4F7UB 3JCMd 5GANj 2ZGWA 4PJOA 4RCCA 4M7AB 5LJ3e 2YHTA 4F7UG 5LJ5j 4M78B 4XTYA 4M7AG 5GAN4 3INZA 5GAMd 3FJPA 1LJOA 4M78G 4M7DC 3EFSA 1X01A 4C8QE 3JCMP 4N0AC 4XU3A 2DXTA 4C92F 3GIBA 2RM4A 5GAOl 5LJ3g 4MMKA 4F7UA 2DZCA 4M77F 4C92D 1I81A 2DTIA 2EJFA 2RB6A 4F7UF 5GAN5 4M7AF 5GAOn 4M77D 2DKGA 4M78A 4J5YA 4XU2A 5GMKh 4M78F 1D3BB 4M7AD 2E10A 4V2SA 5GAOp 1I5LA 3BDUA 3V7CA 5GAMh 5GAN8 4NL2A 4XTWA 3JB9H 5GAN6 1N9SA 5GMKl 3RKYA 3BY7A 4JRIA 4NOYA 3JCMe 4C92B 1HXDA 4WF2A 5LJ3j 4PJOC 1D3BA 4M77B 4XTVA 4C92G 2RD1A 2QTXA 1MGQA 4A54A 4M77G 5GAMe 4J6WA 4J6YA 4XU1A 4PJOE 2EJ9A 3SB2A 4C8QD 4EMKC 4J6XA 2VXFA 3JCMg 5GMKi 1M5Q1 2YLCA 4EMKA 4C92A 4EMGA 4M75B 5I21A 5GAMg 3M4GA 4M77A 3RKWA 4JRKA 2HNIA 4M78C 4M75G 3RESA 1B34B 3RIRA 2I2LA 5GAN2 1WQ7A 4M7AA 4M7DE 3JB9G 1I8FA 2FB7A 3QUIA 3FB9A 3JCMV 5GAOr 4JUVA 5GANh 1N9RA 1U1TA 4C8QB 3FIFA 4QVCA 3EFRA 4OP0A 3JCMQ 4RCBA 3V7RA 5LJ5h 4C8QG 2YLBA 4M75F 2EWNA 1BIBA 3V8KA 4HT8A 2DJZA 4HA8A 3BW1A 3V8JA 3V7SA 1B34A 5GANf 1WPYA 1BIAA 4M75D 3JB9F 2DXUA 3HFNA 4QVDA 5GMKe 5GAMj 5GANe 5LJ5f 3QO3A 3JCMc 3JB9D 3HSBA 3RERA 3QSUA 2JN0A 4C8QA 3L2ZA 5LJ5e 4C8QF 5GANd 1WNLA 3RUXA 3PGGA 3HFOA 5LJ5d 5GAOm 3JCMb 4X9DA 4C92C 4M7DF 1I4K1 5GANg 4MMLA 1Y96B 4M77C 4M7DD
chains in the Genus database with same CATH superfamily
5IT9E 2CP7A 3C12A 3CCET 4J9CA 2DXBA 2E3HA 2IIMA 2RQWA 3JCMX 1Y57A 2IVWA 3X24B 4J9GA 2LNVA 4XTXA 4DEXA 3RMQA 3OMGA 4X9CA 4J7FA 2J7IA 4EMHA 4C0DB 1CSKA 1V29B 1YJNT 4PJOB 1PHTA 1VQPT 2O4XA 1IGUA 1QCNA 1QW1A 2DTHA 2HBPA 2R58A 2JNGA 4A4EA 4DQ2A 3JCMd 2ZGWA 2F69A 5CQXA 1ZSGA 3EAEA 3CCJA 5GAMd 3EFSA 5D6XA 5M9OA 1RAIB 5GAN5 2L8DA 3GP8A 4XU2A 2JVVA 1OPKA 1ACMB 1UJ0A 4QW2A 1NJIC 2AZVA 3HHTB 4ANJA 2X3WD 1FMWA 1GL5A 4RTWA 2QQBA 1NG2A 3J80E 1D0YA 4AMCA 3CPWS 4M77A 3RKWA 2PTKA 1KD1R 1M2OA 1DJ7B 2FB7A 2ZPGB 2KYBA 1ZBJA 2XMFA 3RNJA 3A8LB 1X6GA 3RBBB 3H41A 4IKFA 4AT1B 5GAMj 1D0ZA 2FZCB 1VQ7A 4LN2A 2JN0A 5LJ5d 4DOVA 3E9GA 4ELYC 4DBRA 3OYMA 1M3AA 4RTYA 5FU6C 3VKIA 2RQTA 2X4XA 1Y96A 3PT9A 1TUCA 2GQIA 1W4SA 3EG9A 1NPRA 1WHMA 3EGXB 2DTOA 4B9XA 2IPOB 2RK1A 2CT4A 3AHUA 2EW3A 3ZBDA 3L2UA 1WFWA 3M5AA 4E7KA 1N8RR 2KQWA 3G6ET 2YWWA 1KK7A 5GMKm 4F04B 4LXCA 3REAB 2IG0A 2LP5A 4F7UB 5LJ5j 1WHJA 2CP3A 4M7AG 1QCFA 2EFIA 2L2PA 2YSQA 2DNUA 4LD6A 2DTIA 1NBEB 1M3BA 1FYNA 2F5TX 4J9DA 4KUIA 4JDSA 2HQEA 2DIQA 4C92B 4FSSA 5L8RE 3CCRA 2XDPA 1MGQA 2P0PA 4JJNK 3NPFA 1VQ8Q 3M4YA 2LCSA 1YN8A 4J83A 3A98A 1GBQA 4A4FA 1TOVA 5KE2A 2OAWA 3EG0A 1YI2Q 1N9RA 4C8QB 2C0IA 3CPWA 4PKCC 1NYFA 2DYIA 3P8HA 3JB9F 1BI2A 4QVDA 3E2UA 1E6HA 5I22A 1JJ2P 2DF6A 2BTTA 2DBMA 4LDUA 4N4IA 2M1HA 3RUXA 2HD0A 2QGGA 1I4K1 3CCEA 3VUBA 1Q86C 2CP6A 5LJ5g 2PQWA 4F7UE 3QHSA 3SWNB 2CYZB 3L2QA 2HQHA 2L3RA 3OYJA 5CQYA 3OB9A 4JLIA 3R6NA 2RQUA 2DPPB 4E7LA 2EBPA 3ME9A 4KT0E 2XKOC 1G3SA 1GRIA 2JW4A 2EQIA 1MNDA 1YJNA 2LJ0A 4C92E 2P0KA 3HKSA 1VQPA 1W6XA 4MDWA 1I5OB 3EG3A 4N4HA 3NMZC 4AG2C 1BI3A 4FT2A 1M2VB 2L3PA 2DK3A 1XJWB 2QQ9A 2OX7A 1QKWA 2DL3A 4PL6A 2ZZDA 4KGVB 3OYAA 1LJOA 1X01A 4C8QE 2KXCA 4LDYA 2RHYA 3LWHA 3OBWA 5LJ3g 4M4ZA 5GAOn 4M77D 5J3BA 1NEGA 3EFOB 1WZOA 2QA4T 1V1CA 2ZPEB 2L89A 2RJDA 3TQ7P 1VQMT 5C0MA 1YJ9Q 3WVEB 3MEUA 1JQQA 2FEIA 4M75B 3MKDA 4ZGEB 1W1FA 2EYWA 1VYTA 1WQ7A 4GBQA 3OW2A 1WXTA 5AT1B 4KGZB 1OPLA 3V7RA 2CZ1B 3X28B 2YLBA 1PM3A 4HA8A 2V8JA 5GANf 3CXCS 5GMKe 1BBZA 5D6YA 2COWA 1GCPA 2BZ8A 1TUGB 2M51A 3EFOA 3GF5A 3EHRA 2O9SA 4M7DF 1WGSA 2DD5A 3LGFA 5I2MA 4PFOA 4JZ4A 1ZBXA 4A53A 2PZ1A 2WSFE 1EZZB 2DO3A 5KYWB 3PTAA 4M75A 4RTVA 2CUBA 3JCMW 1JU5C 4RTZA 4EDUA 3QJYA 1AWJA 4NL3A 3H0FA 4J8OA 2D8HA 2GFAA 3OS2A 4BI8B 5KYYB 1PG5B 3HRSA 2DVJA 4E7SA 2LCCA 1UECA 1YJWT 3OYKA 5FWBA 1JJ2S 3JCMJ 2LQNA 3JCMh 3G6EA 4BI3A 2D0NA 3QWYA 2VGMA 3CC4Q 1IZ6A 4XTZA 1Y07A 1KFZA 1LNXA 4A4HA 1JO8A 4M75E 4ZGJB 3MJXA 5GAN4 1X69A 2MK5A 4LDVA 5KE3A 3JCMP 1G3YA 3CCVT 5GAOl 2YT6A 2J06A 1W2BA 1S72T 1D3BB 2QASA 3CCUQ 3VS1A 5KYYA 4XTWA 1T0HA 5GMKl 3BY7A 2ED0A 2EVRA 2CT3A 2FRYA 1Q7YR 4OMOA 4J6YA 1CKAA 3CMAT 1SHGA 4OB1B 2Y4XA 2ZPFB 4PJMA 3MEWA 5IHIA 3RIRA 1R0CB 1PWTA 3I55T 4X1VA 1N8RC 3EFRA 5LJ5h 4OMMA 2EWNA 2BZXA 1AWOA 1UHCA 2K3YA 2ZPHB 1HD3A 1RAHB 3FEOA 3KUFA 3CCMT 1E7OA 3LYIA 4P5NA 2EQUA 4LUDA 1MMNA 1Z9QA 1H641 4BE1A 3KXTA 3WVDB 3LH0A 2FYKA 2K79A 2M0OA 5I2SA 3HRUA 2CGHA 2JOYA 1WHHA 2D6FA 2RQVA 3R6OA 2VWFA 5CKBA 1MV0B 2JTMA 1VOMA 3M0SA 1ARKA 1HYOA 4DBQA 4HVVA 2QEXT 2P0QA 1TH7A 1C1AA 1VQ4Q 1PCXA 2PUKB 1Q86U 5LJ3h 2CDTA 3BDLA 2QTVA 3HRTA 2YUPA 3OMCA 1U06A 1EIFA 2QAZA 4BY6B 4IURA 3PMIA 4C5IA 1B3QA 4HCKA 2A3LA 2LX7A 4M7AF 1I1JA 2QQSA 1UGVA 5FRMA 3DB3A 2QA4A 1BB9A 2AZSA 2HBWA 1FXXA 3CCQT 1TU0B 1SEMA 2QGFB 1VQKT 5CR2A 3A8MB 1MMAA 2KNBB 4LDWA 1VQMA 1M9SA 4BD3A 1VQLT 3M58A 2HSPA 4PJNA 3L2WA 1KC8C 2DMOA 4OMNA 2NUPB 4IUTA 1K0XA 4JZ3A 3CMEA 5GAN2 1BCMA 4BDYA 3PIPA 1VQ5Q 4LD9K 5FWCA 2E4HA 5GAOr 1FMVA 1D1BA 2KEAA 1BK2A 1M90C 1GCQC 2DJZA 5HCKA 1KIKA 4M75D 3C0CA 2DXUA 2HKQB 1GFDA 3RERA 3I5RA 2D1XA 4YTLA 1B7TA 1Q82R 1UG1A 3HFOA 2ENMA 2J6FA 3S3NA 3NTHA 3OYDA 1QQJA 1NLOC 3CCSQ 2NWMA 2NUTB 2D9TA 4VUBA 4ZNXA 2Y90A 5J26A 2VKNA 1WI7A 2XI9A 2DFUA 2CSQA 2E6NA 4M7DG 1OV3A 4HT9A 2CSIA 2EQJA 1YHQA 4GLKA 3C95A 2DXCA 2QDYB 2OTJT 1YJWA 2WSEE 3VYHB 2MMPA 3SHWA 1OULA 3GOXA 1YNZA 3TU4K 1N5ZA 4F17A 1ZA1B 1KHIA 4ME7A 2KY9A 1WJRA 1AZEA 4FM4B 2GTOA 2CZ6B 1KHCA 2JUFA 1K1ZA 1SG5A 2DA9A 3CD6T 1U5SA 1O9SA 1UUEA 4RG8A 2NUTA 1AWXA 3CQTA 1W70A 1VQNA 4ESRA 4M7DC 4F16A 5IXFA 2RM4A 1WX6A 2RI3A 1S72A 1WXUA 1K73U 2RB6A 2RH2A 3M59A 3FC3A 4J5YA 1UE9A 2E10A 4LE9A 1VQ7Q 1I5LA 3JB9H 1VQ9T 3RKYA 1ZSZC 3S3OA 2MWOA 4M77B 2KSSA 4AFUC 2XU8A 2RMOA 3CMAA 2V1QA 4L6V5 3VJPA 1M5Q1 1YFNA 3I55A 2JM9A 5FU7C 2M0YA 3OYLA 1E6GA 2E12A 3MHXA 2E5KA 2HDAA 4JUVA 1RAGB 4C0ZA 2W0ZA 1OZ2A 3V8JA 1Q81C 1T3SA 1O75A 2L3QA 2RJCA 1YBYA 5LJ5e 3MO8A 1PSFA 3CCMA 2K7AA 3NHNA 1NE8A 1Y96B 1KQ2A 8AT1B 4FL6A 1K8AU 3CC7T 2PNIA 3VUZA 1N6AA 1AHJB 3EG9B 4E7ZA 1UTIA 3U23A 1QKXA 1X43A 1TXQA 3LW5E 2A28A 1M4ZA 2V8KA 1BCOA 5CIUA 1MNEA 5A0GA 4PJOF 1HSQA 5GAN3 3UA6A 2OTLT 2K4YA 2KROA 1SF9A 4BE0A 1K9MC 2K6DA 2D8JA 2QEXA 1QP2A 2VC8A 4M77E 4II1A 3E9FA 3CCRQ 1JRIA 2MF2A 4OF1A 2COZA 4OMPA 2F2XA 2NLUA 1KSWA 1RADB 1QVFP 5LJ3e 3URGA 4HVWA 4M78G 2WACA 1I81A 4O5VA 4D8DA 2J6OA 1VIFA 3CCQA 1VQKA 1SSHA 4NL2A 4WCIA 2J05A 1QWFA 1QLYA 1XNIA 3RMSA 4BB7A 1VQLA 4WF2A 3CCEQ 3QZ5B 1PC0A 3QYGB 5DLQE 5HK3A 2EQMA 2AK5A 4EMKC 1QVGP 3JCMg 2F2VA 2A36A 2JS2A 5GAMg 2DE0X 3RESA 4M78C 3CXCP 4DOWA 1M30A 1M1KU 3GBQA 4BI4A 1YJ9T 2CH4W 2PVDB 2EYYA 3BW1A 2LT4A 5KYXB 4FYVB 3I56T 1YIJT 1YJNQ 2KRNA 1VQPQ 3PGGA 2QQAA 9ATCB 2P4TA 5KCOA 3OYGA 4M7AC 1B07A 4HKEA 2BUDA 2MOXA 4PK4A 4CC3A 1JBMA 2Z0WA 4N4GA 2MI6A 4XU0A 4AFSC 4BUGA 3MP8A 3RR6A 4BE2A 1M8VA 3LGLA 2KXDA 5LJ3f 3GNFB 1AT1B 4ZGDB 2V26A 2B8AA 1IXDA 2OTJA 2V1RA 3PVQA 3NGPA 5IN1A 5KYXA 3KFVA 4RUGA 5FLXE 5CO7A 3CD6A 4JRQA 1VQ6Q 2YDLA 1G3WA 2XD0A 3M56A 2YRVA 4KH1B 3FLGA 4HCZA 3CC4T 2COYA 2X51A 2WSCE 1WHLA 1Q82C 2O88A 3QYHB 4C92F 5IAYA 4MMKA 3F70A 2EGAA 3CEYA 2K5LA 5GJWB 1VQ9A 2DD4A 2K3XA 5GAN6 1SKUB 5FRNA 1GCQA 3NTIA 4NOYA 4C5GA 2H3JA 3G4ST 1X27A 1WYXA 4GLMA 4RTUA 1M8MA 4BDZA 1KG1A 3PIOA 4QT7A 1QVFS 1G83A 2L5QA 3FB9A 4UC4A 4HT8A 4J9HA 5I11A 3CCLT 3V7SA 1GBRA 1YCSB 3P8DA 3G6EQ 5GANd 3VS0A 4IUQA 3CC7A 2AIRB 4C5HA 1ZSZB 3QBYA 3QIIA 4EIKA 5HY6A 3QZ9B 1X2QA 1D09B 1QVGS 3EGDA 1OI1A 4OB2B 4KBMB 4OGCA 4FIBA 4OB0B 4OMFB 1RL2A 2J6KA 3D7SB 2OTLA 1RUWA 5FU7B 4HCBA 1WLPB 2E65A 1YWPA 1U1SA 1NJIU 5CKHA 3SFMA 2KGTA 3BE3A 2C0TA 1JB0E 4M7DA 1Q81U 4RTXA 5FW9A 3JB9I 2Y4YA 1OEBA 3BFMA 2LRQA 4FW1A 2FG0A 1QVPA 2E3IA 1VQOT 4L5GA 5DY9A 4PJOG 3OSSC 1I0CA 2ATCB 2W10A 1LVKA 1R0BG 5L23A 1ZSZA 5GANj 4JPBW 1JXOA 4EPCA 3CBPA 5KYUA 3INZA 4MZMA 1PSEA 3QG1A 2CS7A 4N0AC 2GNCA 1LCKA 4QQ6A 4A4GA 2LT1A 1G3TA 2DZCA 2GF7A 2ZCFB 3DLMA 5DLOA 4TVRA 1RLPC 1KD1C 2X4JA 4V2SA 3BDUA 4C0GA 5GAMh 2BKDN 2DYBA 4C0DC 1OX9A 4A63B 4Z8AA 2KR3A 4PJOC 4OMLA 3CC2Q 3P8BB 1MUZA 5FU6B 5I21A 3G71Q 4EMGA 2LMJA 3M54A 4JJBA 2KE9A 2RPNA 1YJ9A 2EKHA 2AKLA 3PVLA 4NS5A 4MZTA 1VYVA 2VUBA 2HQXA 1QVFA 3E19A 3I56A 1YIJA 2KRSA 2JMCA 1VQ5T 3JB9D 4QVZA 2DERA 2MPXC 1Y71A 3LH5A 2I0NA 3GNGA 3LX7A 5GANg 1M27C 1D0XA 2F5KA 2FZGB 5GAN7 3THKA 1RAAB 2E64A 3NFCA 4PJJA 5GMKj 4RG2A 1MMDA 1QVGA 3CCST 4Y91A 3H8ZA 3X25B 2RF0A 3ER0A 3Q1JA 2ZAEA 1VUBA 1IB8A 1D1AA 2QA4Q 3CXCA 2E6ZA 1IHVA 1XTDA 3META 1WHKA 3EHQA 5A0DA 2FVUA 2R5MA 2O2OA 3FRNA 1VQMQ 1YITT 3HPWA 4A4KA 3DLLA 2YUNA 5CKDA 3J7AF 3TREA 4QQGA 3O8VA 4QKUA 1X2KA 1UHFA 2JMAA 2QDLA 1A0NB 5J39A 2RQRA 3CMEQ 4M7AB 1OU8A 3VS3A 4F7UG 3OS1A 3HTRA 2C06A 3PNWC 4OB3B 2DX1A 3OSVA 1M1GA 2FRWA 4Y92A 2A0FB 3EH1A 4M78A 4M78F 4KUDK 1SPKA 4BACA 4IIMA 1TTHB 2HL5C 3NTKA 1FX7A 4AG1C 2JS0A 4JRIA 4B9WA 3G4SA 1JJ2A 1WDXA 1QP3A 4C92G 1X6BA 4HCCA 3MP1A 4XU1A 2EJ9A 2AHJB 4E2FB 2EGEA 1GFCA 1WA7A 4K11A 3VYGA 2O9VA 4M7AA 1I8FA 2ABLA 4DEYA 1ZA2B 3OS5A 1YHQQ 3CCLA 1IRXA 3H0HA 4C8QG 1BIBA 1TS9A 1ZUKA 1YJWQ 3GPLA 1LPLA 4C0FA 1B34A 1BIAA 1V76A 4F14A 3HSBA 4J7IA 3ZFJA 1FWZA 3HL8A 4B6MA 4C92C 4FW2A 1K0SA 4M7DD 3H6ZA 4M7AE 3TSWA 1PRLC 1VQNQ 2GFUA 1S72Q 2K3BA 2KI7A 4C8QC 4PLIA 3HP9A 3JAME 1Q86R 3QDFA 1HK9A 3I35A 2LQWA 6AT1B 2LX9A 1VQOA 3TVTA 3OYIA 3QPHA 2DEQA 2PU9B 4XAXB 2DIGA 2RA2A 1MHNA 1BU1A 3CCJQ 1AZGB 1EFNA 1G2BA 2CP0A 2DAQA 3M53A 3SWNC 3L42A 2P84A 3I55Q 3VV0A 2YHTA 3JRZA 4D8KA 1K9AA 2JM8A 1ABOA 3FJPA 2CREA 4Z02A 1JEGA 4ZTFA 4L59A 4ORZA 2DXTA 2OJ2A 2PVGB 2V8IA 2KRMA 1RACB 2VB6A 1UB4A 2DKGA 1Z9ZA 4RTTA 3QWXX 2QI2A 5IHKA 2O31A 1N9SA 2A37A 1NZ9A 1R77A 3CCMQ 2GCXA 3JCMe 2SRCA 4O6JA 5GAMe 1XQHA 5GMKi 3C4SA 4QQDA 1ZX6A 3CCVA 4WTOB 3OY9A 4JRKA 4M75G 1C6VX 2LTOA 1AWWA 1T0JA 2FPFA 5DM7R 5GANh 2PVOB 3OYFA 2QQRA 2FO0A 4PFZA 5AYFA 1VQ5A 3CBMA 3M0PA 1WPYA 1KD1U 3M0RA 3AT1B 3HFNA 5FROA 2QEXQ 4IUUA 1TSFA 3JCMc 2ESWA 2C0OA 4CC7A 4CC2A 4OVAA 2LJ3A 2XK0A 4RMOA 2KVQG 4JS5A 1OU9A 2E70A 2CKKA 3E1SA 4M75C 3OW2P 2DILA 2ROTA 4Q5WA 1VQ8T 1EX4A 2H3EB 3OYCA 3CCSA 3UF4A 2PUOB 3MEAA 3EH2A 5ECAA 2M9UA 4R56A 3I5SA 2KDSA 4J9BA 4FYYB 3MEVA 1YI2T 1AEYA 3CCQQ 4ZN3A 1VQKQ 3RKXA 5CVIA 4N0AA 1RABB 4FSXA 4R55A 4JJDA 1ZLMA 1YITA 1VQLQ 4XQ3A 1PD0A 5CAIA 4MDXA 1WJQA 4M78D 3JCMf 1IO6A 2CP2A 4Z88A 5C6SA 4LDXA 5GAMf 1NPPA 1UFFA 1N8RU 1K73R 4PJOA 2DL7A 2CZ7B 4OMQA 1Q7YC 4IUVA 1VQ6T 1I07A 1OOTA 5KYNA 4M77F 5A2QE 2EJFA 4RKUE 1QWEA 3OYHA 2ROLA 5GMKh 1SSFA 4M7AD 2DJQA 2ECZA 5GAOp 5GAN8 3V7CA 1X6OA 1ZHIA 2X4YA 1VIEA 1UGSB 1M3CA 3UATA 1GXIE 4A54A 2HZYA 1M1FA 4PJOE 3SB2A 4FYXB 2RNAA 2FL7A 7AT1B 2HL3A 1W2BP 1U1TA 1H3HA 2K5FA 2OTJQ 2HEQA 1HJDA 4MZPA 3V8KA 2EGCA 5CKEA 1K8AR 2ED1A 5LJ5f 1UDLA 3VS5A 3QSUA 4Z89A 4J9FA 1UJYA 5GAOm 3VS7A 1OX8A 3CD6Q 2AKKA 1UEBA 2VXEA 1NEBA 1FMKA 4CI0C 2G3RA 3QJ6A 3L1AA 1OYXA 3SD4A 1C0MA 1H8KA 4JJCA 2DEUA 2VVKA 2BE7D 3UT1A 2EYXA 2XDDA 5LJ3d 1UGPB 2RJFA 2LCLA 3H0IA 2RK2A 4FT4A 1VQ9Q 1MV3A 3OA6A 2H8HA 1KQSP 3EGXA 1KC8U 1ABQA 2JTEA 2MAMA 3KBGA 3PE0A 1BI1A 2LDMA 3N5BB 2LC4A 3EGUA 3VU3C 2JXBA 4JLGA 1QCOA 1J3TA 2XHCA 5GJVB 5HKCA 4RCCA 1M90U 3OW2S 2FHDA 3FDRA 4XU3A 2ZPBB 4F7UA 1D1CA 3A8GB 4F7UF 1WXBA 1NYGA 3M0UA 2DL4A 3VS4A 1RI9A 3UWNA 5IXBA 1G8XA 3CC7Q 1HXDA 5LJ3j 2HCKA 5EG2A 2EYQA 1UGQB 2QTXA 5KCHA 1M1KR 1U3OA 3OBYA 3VS2A 2QK0A 3J81E 2JTFA 4C92A 5HK0A 2EKOA 3CC2T 5CCAA 5CK9A 3M55A 2KYMA 4BY6C 2F1LA 1RLQC 2E5QA 3QUIA 2OTLQ 4FCYA 2LVMA 3FIFA 4HVUA 4RCBA 2DETA 3OYNA 1WIEA 2LQ8A 5EC7A 3G71T 2NUZA 5GANe 3QO3A 2KK4A 1KC8R 2JJ9A 4C8QA 1PD1A 3L2ZA 4C8QF 3CCUT 1WNLA 2DL5A 3EGDB 3JCMb 4PFPA 4X9DA 2DRKA 8ATCB 3A8HB 3DKMA 2MIOA 2P4RA 3SEMA 1Y0MA 4GY5A 1ZUUA 1M90R 3O5ZA 1VQ8A 2FZKB 2SEMA 2OAUA 2X35A 4M7DB 1KJWA 5GAOq 1BI0A 3SWNA 1TUDA 4ZTJA 1YI2A 1W2BS 2CZ0B 3A8OB 4PJOD 3A5ZB 2KBTA 4XK8E 1YP5A 2XDBA 3TEEA 2HSEB 3WXMB 2RHZA 2VASA 2YUQA 2AT1B 3UDCA 1U8RA 2RHXA 3G7ZA 5KYUB 2JZ2A 1KQ1A 1R8OB 1Y7XA 1IHWA 2L0AA 3RDVA 4XTYA 2YXYA 1VQ6A 1OZ3A 4PJLA 1NLPC 1M2VA 1PKTA 2RI5A 2RJEA 3CMET 3I56Q 1YIJQ 4E7IA 2DRMA 3M0QA 3MCAB 4J9IA 4PLLA 2M02A 1TG0A 3LLRA 1K76A 1H3ZA 4OGEA 1KQSS 3UPUA 2BZYA 3TCJA 4C5EA 3PMTA 4M77G 1F1BB 1Q95G 4J6WA 1VQ4T 2JT4A 2VXFA 2YRDA 3ULRB 1Q7YU 2MYSA 2HNIA 4M7DE 4IIOA 2I2LA 4JS4A 3JCMV 1K9MU 1AVZC 2GQVA 3MPUB 4OP0A 2F2WA 4M75F 3T9NA 4E7HA 1WJSA 1SRLA 3A1PA 2A7YA 1K73C 2LNHB 4X34A 1YHQT 1G5VA 4MMLA 2KT1A 4M77C 4LNPA 2DZ9A 1AOJA 1NJIR 2DVEA 4LUEA 2R57A 2EYZA 1YCYA 1Q81R 2YRCA 3L2VA 4PNOA 2K57A 2RO0A 3TSZA 4DBFA 3GLXA 1AD5A 2YUOA 4XTUA 3S3MA 2QXFA 1NM7A 5KYWA 3MP6A 2K2MA 2E41A 3FJ5A 1VQNT 3V8LA 1RI0A 3OYBA 2K5IA 1SRMA 2OI3A 2RI2A 3G4SQ 4ATOA 2X9HA 2QYZA 2EJGA 1X75C 1WQWA 2GBQA 4EMKB 3OS0A 1BYMA 3DB4A 3OYYA 3QKJA 2CUDA 2MCNA 1K8AC 1S1NA 2K9GA 4M78B 2HAXA 1BKBA 3M9QA 3QXEB 1K9MR 4KGXB 4E47A 3IQLA 1P92A 3CCJT 5IHNA 3GIBA 3CCLQ 4C92D 4E6RA 3M0TA 1PNJA 3EG1A 2X3XD 4J9EA 4JRPA 2FPEA 1PKSA 2FPDA 3SDZA 2R5AA 2XICA 1D3BA 3ASKA 2B86A 3ZL7C 2HKNA 3CC4A 2DLPA 3CBOA 2GTJA 4C8QD 1KQSA 2HMAA 5KH6A 4EMKA 3CC2A 3M4GA 2EQKA 1B34B 3CPFA 2XIDA 3JB9G 5CKFA 4IUPA 2RHIA 3G71A 3OQ5A 1YWOA 3UA7A 4Y28E 2CH4A 1IGQA 5LL6S 1H92A 4CRIA 4KRTA 3CCUA 2DL8A 1VQOQ 1VQ7T 4AFZC 2VV5A 3S6WA 4FU6A 3X26B 2QG9B 3REBB 3EG2A 1ZQ1A 3LWIA 1Q82U 4M78E 2EIFA 1OQKA 2VGNA 2O01E 5A0LA 2LZ6B 3I9QA 1N27A 1SHFA 2RN8A 4ELZC 5D7UA 1UGRB 2X4WA 3OYEA 1XOVA 2K2VA 1M1KC 3JB9J 2KT8A 2MWPA 3ZEHA 3G1JA 3VRZA 3QDRB 4D6WA 2EPDA 4DA4A 2EAYA 2M16A 3H9NA 1LOJA 2L3SA 2E1HA 2A08A 2VYTA 4HXJA 1PRMC 3CCVQ 2D0QB 4E7JA 3CPWP 1VYUA 1CKBA 2NYSA 2LJ1A 2DM1A 1ZUYA 1JXMA 4DBHA 3L2RA 2GGRA 4R0KA 2ZPIB 1WHGA 2G6FX 3CMAQ 1TWBA 4XTVA 1VQ4A 3VRYA 2RD1A 3C94A 1MMGA 3CCRT 3JV3A 4KH0B 4J6XA 2RHUA 1T3LA 2YLCA 4AFQC 5D6WA 3JSCA 4CC4B 4FYWB 1K4US 3VS6A 4ZN1A 1RAEB 1QMCA 2KAFA 1RAFB 2NUPA 4QVCA 3JCMQ 2XG8D 5IH2A 2BE9B 1VA7A 2DBKA 3X20B 4KULA 2LQKA 2CP5A 1YITQ 3M57A 2KMTA 1IREB 2BIVA 2O4XB 3PFSA
chains in the Genus database with same CATH topology
5IT9E 3C12A 4C5HA 3LYIA 4P5NA 2EQUA 3CCET 1UEBA 2DXBA 3QBYA 3QIIA 2VXEA 5HY6A 1H641 3QZ9B 4BE1A 4CI0C 2G3RA 3QJ6A 3KXTA 3WVDB 3LH0A 2FYKA 1QVGS 3L1AA 1OYXA 1OI1A 2M0OA 4OB2B 3SD4A 4KBMB 4OGCA 4FIBA 3JCMX 5I2SA 3HRUA 4OB0B 2CGHA 4OMFB 2JOYA 1RL2A 2IVWA 3UT1A 2OTLA 5FU7B 3X24B 2XDDA 4HCBA 2D6FA 2LNVA 2E65A 4XTXA 1U1SA 1NJIU 5LJ3d 1UGPB 2RJFA 5CKHA 3R6OA 2LCLA 3RMQA 3SFMA 3OMGA 2RK2A 4FT4A 1JB0E 4M7DA 4X9CA 1Q81U 5CKBA 2JTMA 3OA6A 4J7FA 3JB9I 4EMHA 2Y4YA 4C0DB 2QEXT 2P0QA 1KC8U 1TH7A 2LRQA 3BFMA 1V29B 2MAMA 1YJNT 4PJOB 1QVPA 1VQOT 3KBGA 2PUKB 1Q86U 5LJ3h 1VQPT 4L5GA 1BI1A 2LDMA 2O4XA 3N5BB 2LC4A 3BDLA 3OSSC 5DY9A 4PJOG 1QW1A 3VU3C 3HRTA 2DTHA 2HBPA 2R58A 4JLGA 2XHCA 2JNGA 4A4EA 4DQ2A 3JCMd 5GANj 5HKCA 2ZGWA 4RCCA 2F69A 3OMCA 5CQXA 3EAEA 4EPCA 3CBPA 1M90U 3CCJA 3INZA 1EIFA 4MZMA 5GAMd 1PSEA 2FHDA 3QG1A 4BY6B 3FDRA 3OW2S 2CS7A 3EFSA 5D6XA 4N0AC 4IURA 4XU3A 3PMIA 2ZPBB 4QQ6A 2LT1A 4A4GA 4C5IA 1G3TA 4F7UA 3A8GB 5M9OA 2DZCA 4F7UF 2A3LA 2GF7A 2ZCFB 5GAN5 2L8DA 3GP8A 3DLMA 5DLOA 4M7AF 4TVRA 2QQSA 4XU2A 2JVVA 5FRMA 3DB3A 1KD1C 2X4JA 4V2SA 3UWNA 2QA4A 3BDUA 4C0GA 4QW2A 1FXXA 5GAMh 3CCQT 1NJIC 2BKDN 1VQKT 3HHTB 4C0DC 5CR2A 3A8MB 4LDWA 1HXDA 5LJ3j 4PJOC 1VQMA 5EG2A 1M9SA 1UGQB 2EYQA 2QTXA 4BD3A 1VQLT 2QQBA 3M58A 3J80E 5KCHA 3P8BB 3L2WA 3OBYA 1KC8C 4IUTA 5FU6B 5I21A 2JTFA 3J81E 4C92A 4EMGA 5HK0A 3CMEA 3M54A 3CPWS 4M77A 3RKWA 5GAN2 2EKOA 3CC2T 4BDYA 1YJ9A 5CCAA 5CK9A 1DJ7B 3M55A 3PIPA 4BY6C 4LD9K 2FB7A 2E5QA 3QUIA 5GAOr 2ZPGB 2LVMA 4MZTA 4NS5A 3FIFA 2VUBA 3A8LB 4RCBA 3OYNA 2LQ8A 3G71T 2HQXA 1M90C 4IKFA 1QVFA 2DJZA 3E19A 3I56A 1YIJA 4M75D 1G5VA 2DXUA 1VQ5T 5GAMj 5GANe 3JB9D 3QO3A 2KK4A 1VQ7A 3RERA 4QVZA 4YTLA 2JN0A 4C8QA 3L2ZA 4C8QF 3CCUT 1Y71A 1WNLA 3HFOA 5LJ5d 3GNGA 3JCMb 4X9DA 4DOVA 3LX7A 5GANg 3E9GA 3S3NA 3NTHA 3OYDA 3A8HB 3DKMA 2F5KA 4ELYC 3OYMA 5GAN7 4GY5A 4VUBA 2D9TA 2Y90A 5J26A 5FU6C 3VKIA 1VQ8A 2E64A 3NFCA 2X4XA 2XI9A 1Y96A 3PT9A 2OAUA 2X35A 1W4SA 4RG2A 5GMKj 5GAOq 4M7DB 2E6NA 4M7DG 1NPRA 1BI0A 3SWNA 3CCST 1QVGA 4ZTJA 4Y91A 1YI2A 1W2BS 4HT9A 3H8ZA 3X25B 2CZ0B 2DTOA 2EQJA 3A5ZB 3A8OB 4GLKA 1YHQA 4PJOD 3ER0A 3C95A 3Q1JA 4B9XA 2DXCA 2QDYB 4XK8E 2OTJT 1YJWA 2WSEE 2RK1A 2XDBA 3VYHB 3AHUA 1VUBA 3CXCA 3TEEA 2E6ZA 3WXMB 2MMPA 3ZBDA 2RHZA 1XTDA 3META 3L2UA 5A0DA 3M5AA 2FVUA 3GOXA 4E7KA 3UDCA 2R5MA 3FRNA 3TU4K 1U8RA 2KQWA 1KHIA 2RHXA 4ME7A 2KY9A 1WJRA 3HPWA 4FM4B 4A4KA 5CKDA 3G6ET 3G7ZA 3DLLA 2CZ6B 3J7AF 5GMKm 2JZ2A 1KHCA 1KQ1A 2JUFA 4QQGA 3TREA 2IG0A 1R8OB 3O8VA 3CD6T 1O9SA 1Y7XA 4F7UB 4RG8A 5J39A 4M7AB 4F7UG 5LJ5j 4XTYA 4M7AG 3OS1A 1VQ6A 1VQNA 2EFIA 2C06A 4M7DC 3PNWC 1OZ3A 4OB3B 3OSVA 2RM4A 2RI3A 1M1GA 2RI5A 1S72A 4LD6A 2DTIA 2RJEA 2RB6A 1K73U 3CMET 2RH2A 3M59A 3FC3A 4M78A 4J5YA 4E7IA 4M78F 4KUDK 2E10A 4BACA 3MCAB 1I5LA 4PLLA 2F5TX 4KUIA 3JB9H 3LLRA 1VQ9T 4JDSA 2HQEA 3NTKA 1FX7A 4OGEA 3RKYA 4JRIA 4B9WA 3G4SA 3UPUA 1KQSS 1JJ2A 1QP3A 2DIQA 4C92B 3S3OA 2MWOA 3TCJA 4M77B 5L8RE 4C92G 3CCRA 4C5EA 2KSSA 3PMTA 4HCCA 2XDPA 1MGQA 2XU8A 2P0PA 3MP1A 4M77G 4J6WA 3CMAA 4XU1A 4JJNK 1VQ4T 2EJ9A 2VXFA 2AHJB 4L6V5 3VJPA 3M4YA 1M5Q1 4J83A 3I55A 1Q7YU 5FU7C 3VYGA 2HNIA 4A4FA 4M7DE 2I2LA 3OYLA 4JS4A 4M7AA 2E12A 1I8FA 5KE2A 3MHXA 3JCMV 4JUVA 1N9RA 4C8QB 1K9MU 4C0ZA 2GQVA 4OP0A 3OS5A 3CPWA 3CCLA 4C8QG 4PKCC 1OZ2A 4M75F 1BIBA 3T9NA 4E7HA 1WJSA 3V8JA 4C0FA 3P8HA 1B34A 3GPLA 3JB9F 1BIAA 1BI2A 4QVDA 1Q81C 3HSBA 2A7YA 4J7IA 3ZFJA 1O75A 2RJCA 5LJ5e 1YBYA 1K73C 4LDUA 4N4IA 2M1HA 1FWZA 3HL8A 3MO8A 4X34A 1PSFA 3RUXA 2HD0A 1YHQT 3CCMA 4C92C 1I4K1 3CCEA 1NE8A 4MMLA 1Y96B 4M77C 3VUBA 1K8AU 4FL6A 1Q86C 3CC7T 1KQ2A 4M7DD 5LJ5g 3VUZA 1N6AA 3H6ZA 2PQWA 1AHJB 4F7UE 2DZ9A 3QHSA 3SWNB 4M7AE 2CYZB 3L2QA 2DVEA 2L3RA 3LW5E 2R57A 3OYJA 1M4ZA 2V8KA 1YCYA 5CQYA 3OB9A 3L2VA 5CIUA 4JLIA 4PNOA 2GFUA 2K57A 2RO0A 5A0GA 3GLXA 2DPPB 4PJOF 4E7LA 4C8QC 5GAN3 4XTUA 3ME9A 4PLIA 3S3MA 2QXFA 3HP9A 4KT0E 2OTLT 2K4YA 3JAME 3MP6A 2XKOC 2E41A 1G3SA 1VQNT 1HK9A 3V8LA 4BE0A 1RI0A 1K9MC 2QEXA 3OYBA 2LX9A 1YJNA 2K5IA 4ATOA 1VQOA 2RI2A 4C92E 2P0KA 1QP2A 2VC8A 3HKSA 3QPHA 2DEQA 4M77E 3OYIA 4II1A 1VQPA 4MDWA 3E9FA 1JRIA 2PU9B 4XAXB 2DIGA 2RA2A 2EJGA 1X75C 2MF2A 4OF1A 1MHNA 1WQWA 4N4HA 1YITT 2NLUA 4EMKB 1BI3A 3OS0A 1BYMA 4FT2A 2DAQA 3M53A 3DB4A 3OYYA 3QKJA 2QQ9A 3SWNC 2DK3A 3L42A 1K8AC 5LJ3e 3VV0A 2YHTA 3JRZA 3URGA 4M78B 2HAXA 1BKBA 4PL6A 2ZZDA 3M9QA 3FJPA 1LJOA 3QXEB 4M78G 4Z02A 4E47A 3OYAA 1P92A 4L59A 1X01A 4C8QE 3CCJT 4LDYA 4ZTFA 2DXTA 2PVGB 2RHYA 3LWHA 3GIBA 2V8IA 2WACA 3OBWA 5LJ3g 4C92D 1I81A 4O5VA 1UB4A 5GAOn 4M77D 2DKGA 2QI2A 1VIFA 5J3BA 3CCQA 4JRPA 1VQKA 4NL2A 1N9SA 2QA4T 1NZ9A 3SDZA 1XNIA 2GCXA 3RMSA 3JCMe 2R5AA 4BB7A 1VQLA 4WF2A 2ZPEB 3QZ5B 2XICA 1D3BA 3ASKA 3QYGB 2L89A 4O6JA 2RJDA 5DLQE 3CC4A 5GAMe 5HK3A 3CBOA 2EQMA 1VQMT 1XQHA 5C0MA 4C8QD 4EMKC 1KQSA 3WVEB 3JCMg 3MEUA 3C4SA 4QQDA 5GMKi 3CCVA 5KH6A 4EMKA 4M75B 3CC2A 4ZGEB 5GAMg 3M4GA 3OY9A 4JRKA 2EQKA 2LTOA 4M78C 4M75G 1B34B 3CPFA 2XIDA 3RESA 1WQ7A 4DOWA 3JB9G 5CKFA 5DM7R 4IUPA 2RHIA 3OW2A 1M1KU 4BI4A 1YJ9T 5GANh 2PVDB 3G71A 2PVOB 3OQ5A 3OYFA 3V7RA 2CZ1B 3X28B 2QQRA 2YLBA 4Y28E 4HA8A 5AYFA 2V8JA 3BW1A 3CBMA 5GANf 2LT4A 1WPYA 3CXCS 1KD1U 1VQ5A 3HFNA 5LL6S 5FROA 4IUUA 4CRIA 5GMKe 3I56T 3CCUA 5D6YA 3JCMc 1YIJT 4OVAA 1VQ7T 3PGGA 2QQAA 3GF5A 2VV5A 4M7DF 1WGSA 2DD5A 3LGFA 5I2MA 2P4TA 3S6WA 4FU6A 2XK0A 3X26B 2KVQG 5KCOA 4RMOA 3OYGA 4JS5A 4M7AC 1ZBXA 4HKEA 2BUDA 1JBMA 1ZQ1A 2E70A 4A53A 3LWIA 4N4GA 2MI6A 4XU0A 1Q82U 4BUGA 4M78E 3MP8A 2EIFA 2CKKA 3E1SA 2WSFE 4M75C 2DO3A 2VGNA 4Q5WA 3PTAA 1VQ8T 4M75A 4BE2A 1M8VA 3LGLA 3OYCA 5LJ3f 3GNFB 3CCSA 2O01E 5A0LA 3JCMW 2PUOB 3MEAA 4ZGDB 4EDUA 3QJYA 2B8AA 2M9UA 4NL3A 4R56A 1N27A 4J8OA 2OTJA 2GFAA 2KDSA 4ELZC 1YI2T 1UGRB 2X4WA 3MEVA 3OS2A 3OYEA 1XOVA 2K2VA 4BI8B 4ZN3A 3JB9J 3HRSA 5CVIA 3RKXA 1M1KC 2MWPA 4N0AA 3ZEHA 2LCCA 5IN1A 1YJWT 3QDRB 4D6WA 4FSXA 4R55A 3OYKA 1JJ2S 3JCMJ 3JCMh 3G6EA 4DA4A 1YITA 4BI3A 2EAYA 4XQ3A 5CAIA 4MDXA 1WJQA 2M16A 4M78D 2VGMA 1LOJA 5FLXE 2E1HA 5CO7A 3JCMf 3CD6A 1IZ6A 2VYTA 4XTZA 4JRQA 1Y07A 5C6SA 1LNXA 2D0QB 4A4HA 4E7JA 4LDXA 5GAMf 4M75E 1G3WA 1NPPA 3M56A 1N8RU 2XD0A 2YRVA 4ZGJB 4PJOA 3FLGA 2CZ7B 4HCZA 3CC4T 1Q7YC 5GAN4 4LDVA 4IUVA 5KE3A 2WSCE 3JCMP 1Q82C 1VQ6T 1G3YA 1H3ZA 3QYHB 4C92F 5IAYA 5GAOl 3CCVT 4MMKA 3F70A 4M77F 5A2QE 2EJFA 3CEYA 4RKUE 1W2BA 3L2RA 2K5LA 1S72T 3OYHA 5GMKh 1D3BB 1SSFA 4M7AD 1VQ9A 2DD4A 5GAOp 2ZPIB 5GAN8 3V7CA 1X6OA 4XTWA 2K3XA 5GAN6 5GMKl 1ZHIA 2X4YA 3BY7A 5FRNA 3NTIA 4NOYA 4C5GA 1VIEA 1UGSB 2H3JA 4XTVA 3G4ST 1VQ4A 2RD1A 3C94A 1GXIE 4A54A 1M1FA 4J6YA 4PJOE 3SB2A 3CCRT 4J6XA 3CMAT 2RHUA 4BDZA 4OB1B 2Y4XA 2YLCA 2ZPFB 5D6WA 1KG1A 3PIOA 3MEWA 2FL7A 3JSCA 1QVFS 3RIRA 3I55T 2L5QA 3FB9A 4ZN1A 4UC4A 1N8RC 2KAFA 1U1TA 4QVCA 2K5FA 3EFRA 3JCMQ 4MZPA 5LJ5h 2XG8D 3V8KA 2EWNA 4HT8A 3CCLT 3V7SA 5CKEA 3X20B 4KULA 3P8DA 2LQKA 5LJ5f 2K3YA 2ZPHB 3QSUA 5GANd 3M57A 2KMTA 4IUQA 1IREB 2BIVA 2O4XB 5GAOm 3CC7A 3FEOA 3KUFA 3PFSA 3CCMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 g;  4M7A C;  2VXE A;  1H64 1;  4F7U E;  1JBM A;  5GAN 7;  4A53 A;  2DZ9 A;  3QHS A;  3SWN B;  4M7A E;  2Y90 A;  4XU0 A;  2FYK A;  2DVE A;  3L1A A;  4M78 E;  2E64 A;  4M75 C;  1Y96 A;  3JCM X;  4M75 A;  1YCY A;  1M8V A;  2CGH A;  5GMK j;  5LJ3 f;  4M7D B;  5GAO q;  4JLI A;  4PNO A;  2K57 A;  3JCM W;  4M7D G;  4PJO F;  3SWN A;  1KQ2 A;  4C8Q C;  4Y91 A;  4NL3 A;  5GAN 3;  4XTU A;  4XTX A;  2E65 A;  4HT9 A;  1U1S A;  4PJO D;  2DTO A;  5LJ3 d;  2E41 A;  1HK9 A;  3V8L A;  3RKX A;  4X9C A;  3JB9 J;  3AHU A;  4M7D A;  4N0A A;  3JB9 I;  4EMH A;  3JCM J;  3JCM h;  4C92 E;  1TH7 A;  2EAY A;  3BFM A;  4XQ3 A;  2VC8 A;  5CAI A;  2DEQ A;  4M77 E;  4M78 D;  4PJO B;  1LOJ A;  1JRI A;  5LJ3 h;  5DY9 A;  2E1H A;  4PJO G;  2RA2 A;  2EJG A;  3JCM f;  1KQ1 A;  5GMK m;  1WQW A;  4XTZ A;  3VU3 C;  2DTH A;  4EMK B;  1LNX A;  5GAM f;  4M75 E;  3SWN C;  4DQ2 A;  4F7U B;  3JCM d;  5GAN j;  2ZGW A;  4PJO A;  4RCC A;  4M7A B;  5LJ3 e;  2YHT A;  4F7U G;  5LJ5 j;  4M78 B;  4XTY A;  4M7A G;  5GAN 4;  3INZ A;  5GAM d;  3FJP A;  1LJO A;  4M78 G;  4M7D C;  3EFS A;  1X01 A;  4C8Q E;  3JCM P;  4N0A C;  4XU3 A;  2DXT A;  4C92 F;  3GIB A;  2RM4 A;  5GAO l;  5LJ3 g;  4MMK A;  4F7U A;  2DZC A;  4M77 F;  4C92 D;  1I81 A;  2DTI A;  2EJF A;  2RB6 A;  4F7U F;  5GAN 5;  4M7A F;  5GAO n;  4M77 D;  2DKG A;  4M78 A;  4J5Y A;  4XU2 A;  5GMK h;  4M78 F;  1D3B B;  4M7A D;  2E10 A;  4V2S A;  5GAO p;  1I5L A;  3BDU A;  3V7C A;  5GAM h;  5GAN 8;  4NL2 A;  4XTW A;  3JB9 H;  5GAN 6;  1N9S A;  5GMK l;  3RKY A;  3BY7 A;  4JRI A;  4NOY A;  3JCM e;  4C92 B;  1HXD A;  4WF2 A;  5LJ3 j;  4PJO C;  1D3B A;  4M77 B;  4XTV A;  4C92 G;  2RD1 A;  2QTX A;  1MGQ A;  4A54 A;  4M77 G;  5GAM e;  4J6W A;  4J6Y A;  4XU1 A;  4PJO E;  2EJ9 A;  3SB2 A;  4C8Q D;  4EMK C;  4J6X A;  2VXF A;  3JCM g;  5GMK i;  1M5Q 1;  2YLC A;  4EMK A;  4C92 A;  4EMG A;  4M75 B;  5I21 A;  5GAM g;  3M4G A;  4M77 A;  3RKW A;  4JRK A;  2HNI A;  4M78 C;  4M75 G;  3RES A;  1B34 B;  3RIR A;  2I2L A;  5GAN 2;  1WQ7 A;  4M7A A;  4M7D E;  3JB9 G;  1I8F A;  2FB7 A;  3QUI A;  3FB9 A;  3JCM V;  5GAO r;  4JUV A;  5GAN h;  1N9R A;  1U1T A;  4C8Q B;  3FIF A;  4QVC A;  3EFR A;  4OP0 A;  3JCM Q;  4RCB A;  3V7R A;  5LJ5 h;  4C8Q G;  2YLB A;  4M75 F;  2EWN A;  1BIB A;  3V8K A;  4HT8 A;  2DJZ A;  4HA8 A;  3BW1 A;  3V8J A;  3V7S A;  1B34 A;  5GAN f;  1WPY A;  1BIA A;  4M75 D;  3JB9 F;  2DXU A;  3HFN A;  4QVD A;  5GMK e;  5GAM j;  5GAN e;  5LJ5 f;  3QO3 A;  3JCM c;  3JB9 D;  3HSB A;  3RER A;  3QSU A;  2JN0 A;  4C8Q A;  3L2Z A;  5LJ5 e;  4C8Q F;  5GAN d;  1WNL A;  3RUX A;  3PGG A;  3HFO A;  5LJ5 d;  5GAO m;  3JCM b;  4X9D A;  4C92 C;  4M7D F;  1I4K 1;  5GAN g;  4MML A;  1Y96 B;  4M77 C;  4M7D D; 
#chains in the Genus database with same CATH topology
 5IT9 E;  2CP7 A;  3C12 A;  3CCE T;  4J9C A;  2DXB A;  2E3H A;  2IIM A;  2RQW A;  3JCM X;  1Y57 A;  2IVW A;  3X24 B;  4J9G A;  2LNV A;  4XTX A;  4DEX A;  3RMQ A;  3OMG A;  4X9C A;  4J7F A;  2J7I A;  4EMH A;  4C0D B;  1CSK A;  1V29 B;  1YJN T;  4PJO B;  1PHT A;  1VQP T;  2O4X A;  1IGU A;  1QCN A;  1QW1 A;  2DTH A;  2HBP A;  2R58 A;  2JNG A;  4A4E A;  4DQ2 A;  3JCM d;  2ZGW A;  2F69 A;  5CQX A;  1ZSG A;  3EAE A;  3CCJ A;  5GAM d;  3EFS A;  5D6X A;  5M9O A;  1RAI B;  5GAN 5;  2L8D A;  3GP8 A;  4XU2 A;  2JVV A;  1OPK A;  1ACM B;  1UJ0 A;  4QW2 A;  1NJI C;  2AZV A;  3HHT B;  4ANJ A;  2X3W D;  1FMW A;  1GL5 A;  4RTW A;  2QQB A;  1NG2 A;  3J80 E;  1D0Y A;  4AMC A;  3CPW S;  4M77 A;  3RKW A;  2PTK A;  1KD1 R;  1M2O A;  1DJ7 B;  2FB7 A;  2ZPG B;  2KYB A;  1ZBJ A;  2XMF A;  3RNJ A;  3A8L B;  1X6G A;  3RBB B;  3H41 A;  4IKF A;  4AT1 B;  5GAM j;  1D0Z A;  2FZC B;  1VQ7 A;  4LN2 A;  2JN0 A;  5LJ5 d;  4DOV A;  3E9G A;  4ELY C;  4DBR A;  3OYM A;  1M3A A;  4RTY A;  5FU6 C;  3VKI A;  2RQT A;  2X4X A;  1Y96 A;  3PT9 A;  1TUC A;  2GQI A;  1W4S A;  3EG9 A;  1NPR A;  1WHM A;  3EGX B;  2DTO A;  4B9X A;  2IPO B;  2RK1 A;  2CT4 A;  3AHU A;  2EW3 A;  3ZBD A;  3L2U A;  1WFW A;  3M5A A;  4E7K A;  1N8R R;  2KQW A;  3G6E T;  2YWW A;  1KK7 A;  5GMK m;  4F04 B;  4LXC A;  3REA B;  2IG0 A;  2LP5 A;  4F7U B;  5LJ5 j;  1WHJ A;  2CP3 A;  4M7A G;  1QCF A;  2EFI A;  2L2P A;  2YSQ A;  2DNU A;  4LD6 A;  2DTI A;  1NBE B;  1M3B A;  1FYN A;  2F5T X;  4J9D A;  4KUI A;  4JDS A;  2HQE A;  2DIQ A;  4C92 B;  4FSS A;  5L8R E;  3CCR A;  2XDP A;  1MGQ A;  2P0P A;  4JJN K;  3NPF A;  1VQ8 Q;  3M4Y A;  2LCS A;  1YN8 A;  4J83 A;  3A98 A;  1GBQ A;  4A4F A;  1TOV A;  5KE2 A;  2OAW A;  3EG0 A;  1YI2 Q;  1N9R A;  4C8Q B;  2C0I A;  3CPW A;  4PKC C;  1NYF A;  2DYI A;  3P8H A;  3JB9 F;  1BI2 A;  4QVD A;  3E2U A;  1E6H A;  5I22 A;  1JJ2 P;  2DF6 A;  2BTT A;  2DBM A;  4LDU A;  4N4I A;  2M1H A;  3RUX A;  2HD0 A;  2QGG A;  1I4K 1;  3CCE A;  3VUB A;  1Q86 C;  2CP6 A;  5LJ5 g;  2PQW A;  4F7U E;  3QHS A;  3SWN B;  2CYZ B;  3L2Q A;  2HQH A;  2L3R A;  3OYJ A;  5CQY A;  3OB9 A;  4JLI A;  3R6N A;  2RQU A;  2DPP B;  4E7L A;  2EBP A;  3ME9 A;  4KT0 E;  2XKO C;  1G3S A;  1GRI A;  2JW4 A;  2EQI A;  1MND A;  1YJN A;  2LJ0 A;  4C92 E;  2P0K A;  3HKS A;  1VQP A;  1W6X A;  4MDW A;  1I5O B;  3EG3 A;  4N4H A;  3NMZ C;  4AG2 C;  1BI3 A;  4FT2 A;  1M2V B;  2L3P A;  2DK3 A;  1XJW B;  2QQ9 A;  2OX7 A;  1QKW A;  2DL3 A;  4PL6 A;  2ZZD A;  4KGV B;  3OYA A;  1LJO A;  1X01 A;  4C8Q E;  2KXC A;  4LDY A;  2RHY A;  3LWH A;  3OBW A;  5LJ3 g;  4M4Z A;  5GAO n;  4M77 D;  5J3B A;  1NEG A;  3EFO B;  1WZO A;  2QA4 T;  1V1C A;  2ZPE B;  2L89 A;  2RJD A;  3TQ7 P;  1VQM T;  5C0M A;  1YJ9 Q;  3WVE B;  3MEU A;  1JQQ A;  2FEI A;  4M75 B;  3MKD A;  4ZGE B;  1W1F A;  2EYW A;  1VYT A;  1WQ7 A;  4GBQ A;  3OW2 A;  1WXT A;  5AT1 B;  4KGZ B;  1OPL A;  3V7R A;  2CZ1 B;  3X28 B;  2YLB A;  1PM3 A;  4HA8 A;  2V8J A;  5GAN f;  3CXC S;  5GMK e;  1BBZ A;  5D6Y A;  2COW A;  1GCP A;  2BZ8 A;  1TUG B;  2M51 A;  3EFO A;  3GF5 A;  3EHR A;  2O9S A;  4M7D F;  1WGS A;  2DD5 A;  3LGF A;  5I2M A;  4PFO A;  4JZ4 A;  1ZBX A;  4A53 A;  2PZ1 A;  2WSF E;  1EZZ B;  2DO3 A;  5KYW B;  3PTA A;  4M75 A;  4RTV A;  2CUB A;  3JCM W;  1JU5 C;  4RTZ A;  4EDU A;  3QJY A;  1AWJ A;  4NL3 A;  3H0F A;  4J8O A;  2D8H A;  2GFA A;  3OS2 A;  4BI8 B;  5KYY B;  1PG5 B;  3HRS A;  2DVJ A;  4E7S A;  2LCC A;  1UEC A;  1YJW T;  3OYK A;  5FWB A;  1JJ2 S;  3JCM J;  2LQN A;  3JCM h;  3G6E A;  4BI3 A;  2D0N A;  3QWY A;  2VGM A;  3CC4 Q;  1IZ6 A;  4XTZ A;  1Y07 A;  1KFZ A;  1LNX A;  4A4H A;  1JO8 A;  4M75 E;  4ZGJ B;  3MJX A;  5GAN 4;  1X69 A;  2MK5 A;  4LDV A;  5KE3 A;  3JCM P;  1G3Y A;  3CCV T;  5GAO l;  2YT6 A;  2J06 A;  1W2B A;  1S72 T;  1D3B B;  2QAS A;  3CCU Q;  3VS1 A;  5KYY A;  4XTW A;  1T0H A;  5GMK l;  3BY7 A;  2ED0 A;  2EVR A;  2CT3 A;  2FRY A;  1Q7Y R;  4OMO A;  4J6Y A;  1CKA A;  3CMA T;  1SHG A;  4OB1 B;  2Y4X A;  2ZPF B;  4PJM A;  3MEW A;  5IHI A;  3RIR A;  1R0C B;  1PWT A;  3I55 T;  4X1V A;  1N8R C;  3EFR A;  5LJ5 h;  4OMM A;  2EWN A;  2BZX A;  1AWO A;  1UHC A;  2K3Y A;  2ZPH B;  1HD3 A;  1RAH B;  3FEO A;  3KUF A;  3CCM T;  1E7O A;  3LYI A;  4P5N A;  2EQU A;  4LUD A;  1MMN A;  1Z9Q A;  1H64 1;  4BE1 A;  3KXT A;  3WVD B;  3LH0 A;  2FYK A;  2K79 A;  2M0O A;  5I2S A;  3HRU A;  2CGH A;  2JOY A;  1WHH A;  2D6F A;  2RQV A;  3R6O A;  2VWF A;  5CKB A;  1MV0 B;  2JTM A;  1VOM A;  3M0S A;  1ARK A;  1HYO A;  4DBQ A;  4HVV A;  2QEX T;  2P0Q A;  1TH7 A;  1C1A A;  1VQ4 Q;  1PCX A;  2PUK B;  1Q86 U;  5LJ3 h;  2CDT A;  3BDL A;  2QTV A;  3HRT A;  2YUP A;  3OMC A;  1U06 A;  1EIF A;  2QAZ A;  4BY6 B;  4IUR A;  3PMI A;  4C5I A;  1B3Q A;  4HCK A;  2A3L A;  2LX7 A;  4M7A F;  1I1J A;  2QQS A;  1UGV A;  5FRM A;  3DB3 A;  2QA4 A;  1BB9 A;  2AZS A;  2HBW A;  1FXX A;  3CCQ T;  1TU0 B;  1SEM A;  2QGF B;  1VQK T;  5CR2 A;  3A8M B;  1MMA A;  2KNB B;  4LDW A;  1VQM A;  1M9S A;  4BD3 A;  1VQL T;  3M58 A;  2HSP A;  4PJN A;  3L2W A;  1KC8 C;  2DMO A;  4OMN A;  2NUP B;  4IUT A;  1K0X A;  4JZ3 A;  3CME A;  5GAN 2;  1BCM A;  4BDY A;  3PIP A;  1VQ5 Q;  4LD9 K;  5FWC A;  2E4H A;  5GAO r;  1FMV A;  1D1B A;  2KEA A;  1BK2 A;  1M90 C;  1GCQ C;  2DJZ A;  5HCK A;  1KIK A;  4M75 D;  3C0C A;  2DXU A;  2HKQ B;  1GFD A;  3RER A;  3I5R A;  2D1X A;  4YTL A;  1B7T A;  1Q82 R;  1UG1 A;  3HFO A;  2ENM A;  2J6F A;  3S3N A;  3NTH A;  3OYD A;  1QQJ A;  1NLO C;  3CCS Q;  2NWM A;  2NUT B;  2D9T A;  4VUB A;  4ZNX A;  2Y90 A;  5J26 A;  2VKN A;  1WI7 A;  2XI9 A;  2DFU A;  2CSQ A;  2E6N A;  4M7D G;  1OV3 A;  4HT9 A;  2CSI A;  2EQJ A;  1YHQ A;  4GLK A;  3C95 A;  2DXC A;  2QDY B;  2OTJ T;  1YJW A;  2WSE E;  3VYH B;  2MMP A;  3SHW A;  1OUL A;  3GOX A;  1YNZ A;  3TU4 K;  1N5Z A;  4F17 A;  1ZA1 B;  1KHI A;  4ME7 A;  2KY9 A;  1WJR A;  1AZE A;  4FM4 B;  2GTO A;  2CZ6 B;  1KHC A;  2JUF A;  1K1Z A;  1SG5 A;  2DA9 A;  3CD6 T;  1U5S A;  1O9S A;  1UUE A;  4RG8 A;  2NUT A;  1AWX A;  3CQT A;  1W70 A;  1VQN A;  4ESR A;  4M7D C;  4F16 A;  5IXF A;  2RM4 A;  1WX6 A;  2RI3 A;  1S72 A;  1WXU A;  1K73 U;  2RB6 A;  2RH2 A;  3M59 A;  3FC3 A;  4J5Y A;  1UE9 A;  2E10 A;  4LE9 A;  1VQ7 Q;  1I5L A;  3JB9 H;  1VQ9 T;  3RKY A;  1ZSZ C;  3S3O A;  2MWO A;  4M77 B;  2KSS A;  4AFU C;  2XU8 A;  2RMO A;  3CMA A;  2V1Q A;  4L6V 5;  3VJP A;  1M5Q 1;  1YFN A;  3I55 A;  2JM9 A;  5FU7 C;  2M0Y A;  3OYL A;  1E6G A;  2E12 A;  3MHX A;  2E5K A;  2HDA A;  4JUV A;  1RAG B;  4C0Z A;  2W0Z A;  1OZ2 A;  3V8J A;  1Q81 C;  1T3S A;  1O75 A;  2L3Q A;  2RJC A;  1YBY A;  5LJ5 e;  3MO8 A;  1PSF A;  3CCM A;  2K7A A;  3NHN A;  1NE8 A;  1Y96 B;  1KQ2 A;  8AT1 B;  4FL6 A;  1K8A U;  3CC7 T;  2PNI A;  3VUZ A;  1N6A A;  1AHJ B;  3EG9 B;  4E7Z A;  1UTI A;  3U23 A;  1QKX A;  1X43 A;  1TXQ A;  3LW5 E;  2A28 A;  1M4Z A;  2V8K A;  1BCO A;  5CIU A;  1MNE A;  5A0G A;  4PJO F;  1HSQ A;  5GAN 3;  3UA6 A;  2OTL T;  2K4Y A;  2KRO A;  1SF9 A;  4BE0 A;  1K9M C;  2K6D A;  2D8J A;  2QEX A;  1QP2 A;  2VC8 A;  4M77 E;  4II1 A;  3E9F A;  3CCR Q;  1JRI A;  2MF2 A;  4OF1 A;  2COZ A;  4OMP A;  2F2X A;  2NLU A;  1KSW A;  1RAD B;  1QVF P;  5LJ3 e;  3URG A;  4HVW A;  4M78 G;  2WAC A;  1I81 A;  4O5V A;  4D8D A;  2J6O A;  1VIF A;  3CCQ A;  1VQK A;  1SSH A;  4NL2 A;  4WCI A;  2J05 A;  1QWF A;  1QLY A;  1XNI A;  3RMS A;  4BB7 A;  1VQL A;  4WF2 A;  3CCE Q;  3QZ5 B;  1PC0 A;  3QYG B;  5DLQ E;  5HK3 A;  2EQM A;  2AK5 A;  4EMK C;  1QVG P;  3JCM g;  2F2V A;  2A36 A;  2JS2 A;  5GAM g;  2DE0 X;  3RES A;  4M78 C;  3CXC P;  4DOW A;  1M30 A;  1M1K U;  3GBQ A;  4BI4 A;  1YJ9 T;  2CH4 W;  2PVD B;  2EYY A;  3BW1 A;  2LT4 A;  5KYX B;  4FYV B;  3I56 T;  1YIJ T;  1YJN Q;  2KRN A;  1VQP Q;  3PGG A;  2QQA A;  9ATC B;  2P4T A;  5KCO A;  3OYG A;  4M7A C;  1B07 A;  4HKE A;  2BUD A;  2MOX A;  4PK4 A;  4CC3 A;  1JBM A;  2Z0W A;  4N4G A;  2MI6 A;  4XU0 A;  4AFS C;  4BUG A;  3MP8 A;  3RR6 A;  4BE2 A;  1M8V A;  3LGL A;  2KXD A;  5LJ3 f;  3GNF B;  1AT1 B;  4ZGD B;  2V26 A;  2B8A A;  1IXD A;  2OTJ A;  2V1R A;  3PVQ A;  3NGP A;  5IN1 A;  5KYX A;  3KFV A;  4RUG A;  5FLX E;  5CO7 A;  3CD6 A;  4JRQ A;  1VQ6 Q;  2YDL A;  1G3W A;  2XD0 A;  3M56 A;  2YRV A;  4KH1 B;  3FLG A;  4HCZ A;  3CC4 T;  2COY A;  2X51 A;  2WSC E;  1WHL A;  1Q82 C;  2O88 A;  3QYH B;  4C92 F;  5IAY A;  4MMK A;  3F70 A;  2EGA A;  3CEY A;  2K5L A;  5GJW B;  1VQ9 A;  2DD4 A;  2K3X A;  5GAN 6;  1SKU B;  5FRN A;  1GCQ A;  3NTI A;  4NOY A;  4C5G A;  2H3J A;  3G4S T;  1X27 A;  1WYX A;  4GLM A;  4RTU A;  1M8M A;  4BDZ A;  1KG1 A;  3PIO A;  4QT7 A;  1QVF S;  1G83 A;  2L5Q A;  3FB9 A;  4UC4 A;  4HT8 A;  4J9H A;  5I11 A;  3CCL T;  3V7S A;  1GBR A;  1YCS B;  3P8D A;  3G6E Q;  5GAN d;  3VS0 A;  4IUQ A;  3CC7 A;  2AIR B;  4C5H A;  1ZSZ B;  3QBY A;  3QII A;  4EIK A;  5HY6 A;  3QZ9 B;  1X2Q A;  1D09 B;  1QVG S;  3EGD A;  1OI1 A;  4OB2 B;  4KBM B;  4OGC A;  4FIB A;  4OB0 B;  4OMF B;  1RL2 A;  2J6K A;  3D7S B;  2OTL A;  1RUW A;  5FU7 B;  4HCB A;  1WLP B;  2E65 A;  1YWP A;  1U1S A;  1NJI U;  5CKH A;  3SFM A;  2KGT A;  3BE3 A;  2C0T A;  1JB0 E;  4M7D A;  1Q81 U;  4RTX A;  5FW9 A;  3JB9 I;  2Y4Y A;  1OEB A;  3BFM A;  2LRQ A;  4FW1 A;  2FG0 A;  1QVP A;  2E3I A;  1VQO T;  4L5G A;  5DY9 A;  4PJO G;  3OSS C;  1I0C A;  2ATC B;  2W10 A;  1LVK A;  1R0B G;  5L23 A;  1ZSZ A;  5GAN j;  4JPB W;  1JXO A;  4EPC A;  3CBP A;  5KYU A;  3INZ A;  4MZM A;  1PSE A;  3QG1 A;  2CS7 A;  4N0A C;  2GNC A;  1LCK A;  4QQ6 A;  4A4G A;  2LT1 A;  1G3T A;  2DZC A;  2GF7 A;  2ZCF B;  3DLM A;  5DLO A;  4TVR A;  1RLP C;  1KD1 C;  2X4J A;  4V2S A;  3BDU A;  4C0G A;  5GAM h;  2BKD N;  2DYB A;  4C0D C;  1OX9 A;  4A63 B;  4Z8A A;  2KR3 A;  4PJO C;  4OML A;  3CC2 Q;  3P8B B;  1MUZ A;  5FU6 B;  5I21 A;  3G71 Q;  4EMG A;  2LMJ A;  3M54 A;  4JJB A;  2KE9 A;  2RPN A;  1YJ9 A;  2EKH A;  2AKL A;  3PVL A;  4NS5 A;  4MZT A;  1VYV A;  2VUB A;  2HQX A;  1QVF A;  3E19 A;  3I56 A;  1YIJ A;  2KRS A;  2JMC A;  1VQ5 T;  3JB9 D;  4QVZ A;  2DER A;  2MPX C;  1Y71 A;  3LH5 A;  2I0N A;  3GNG A;  3LX7 A;  5GAN g;  1M27 C;  1D0X A;  2F5K A;  2FZG B;  5GAN 7;  3THK A;  1RAA B;  2E64 A;  3NFC A;  4PJJ A;  5GMK j;  4RG2 A;  1MMD A;  1QVG A;  3CCS T;  4Y91 A;  3H8Z A;  3X25 B;  2RF0 A;  3ER0 A;  3Q1J A;  2ZAE A;  1VUB A;  1IB8 A;  1D1A A;  2QA4 Q;  3CXC A;  2E6Z A;  1IHV A;  1XTD A;  3MET A;  1WHK A;  3EHQ A;  5A0D A;  2FVU A;  2R5M A;  2O2O A;  3FRN A;  1VQM Q;  1YIT T;  3HPW A;  4A4K A;  3DLL A;  2YUN A;  5CKD A;  3J7A F;  3TRE A;  4QQG A;  3O8V A;  4QKU A;  1X2K A;  1UHF A;  2JMA A;  2QDL A;  1A0N B;  5J39 A;  2RQR A;  3CME Q;  4M7A B;  1OU8 A;  3VS3 A;  4F7U G;  3OS1 A;  3HTR A;  2C06 A;  3PNW C;  4OB3 B;  2DX1 A;  3OSV A;  1M1G A;  2FRW A;  4Y92 A;  2A0F B;  3EH1 A;  4M78 A;  4M78 F;  4KUD K;  1SPK A;  4BAC A;  4IIM A;  1TTH B;  2HL5 C;  3NTK A;  1FX7 A;  4AG1 C;  2JS0 A;  4JRI A;  4B9W A;  3G4S A;  1JJ2 A;  1WDX A;  1QP3 A;  4C92 G;  1X6B A;  4HCC A;  3MP1 A;  4XU1 A;  2EJ9 A;  2AHJ B;  4E2F B;  2EGE A;  1GFC A;  1WA7 A;  4K11 A;  3VYG A;  2O9V A;  4M7A A;  1I8F A;  2ABL A;  4DEY A;  1ZA2 B;  3OS5 A;  1YHQ Q;  3CCL A;  1IRX A;  3H0H A;  4C8Q G;  1BIB A;  1TS9 A;  1ZUK A;  1YJW Q;  3GPL A;  1LPL A;  4C0F A;  1B34 A;  1BIA A;  1V76 A;  4F14 A;  3HSB A;  4J7I A;  3ZFJ A;  1FWZ A;  3HL8 A;  4B6M A;  4C92 C;  4FW2 A;  1K0S A;  4M7D D;  3H6Z A;  4M7A E;  3TSW A;  1PRL C;  1VQN Q;  2GFU A;  1S72 Q;  2K3B A;  2KI7 A;  4C8Q C;  4PLI A;  3HP9 A;  3JAM E;  1Q86 R;  3QDF A;  1HK9 A;  3I35 A;  2LQW A;  6AT1 B;  2LX9 A;  1VQO A;  3TVT A;  3OYI A;  3QPH A;  2DEQ A;  2PU9 B;  4XAX B;  2DIG A;  2RA2 A;  1MHN A;  1BU1 A;  3CCJ Q;  1AZG B;  1EFN A;  1G2B A;  2CP0 A;  2DAQ A;  3M53 A;  3SWN C;  3L42 A;  2P84 A;  3I55 Q;  3VV0 A;  2YHT A;  3JRZ A;  4D8K A;  1K9A A;  2JM8 A;  1ABO A;  3FJP A;  2CRE A;  4Z02 A;  1JEG A;  4ZTF A;  4L59 A;  4ORZ A;  2DXT A;  2OJ2 A;  2PVG B;  2V8I A;  2KRM A;  1RAC B;  2VB6 A;  1UB4 A;  2DKG A;  1Z9Z A;  4RTT A;  3QWX X;  2QI2 A;  5IHK A;  2O31 A;  1N9S A;  2A37 A;  1NZ9 A;  1R77 A;  3CCM Q;  2GCX A;  3JCM e;  2SRC A;  4O6J A;  5GAM e;  1XQH A;  5GMK i;  3C4S A;  4QQD A;  1ZX6 A;  3CCV A;  4WTO B;  3OY9 A;  4JRK A;  4M75 G;  1C6V X;  2LTO A;  1AWW A;  1T0J A;  2FPF A;  5DM7 R;  5GAN h;  2PVO B;  3OYF A;  2QQR A;  2FO0 A;  4PFZ A;  5AYF A;  1VQ5 A;  3CBM A;  3M0P A;  1WPY A;  1KD1 U;  3M0R A;  3AT1 B;  3HFN A;  5FRO A;  2QEX Q;  4IUU A;  1TSF A;  3JCM c;  2ESW A;  2C0O A;  4CC7 A;  4CC2 A;  4OVA A;  2LJ3 A;  2XK0 A;  4RMO A;  2KVQ G;  4JS5 A;  1OU9 A;  2E70 A;  2CKK A;  3E1S A;  4M75 C;  3OW2 P;  2DIL A;  2ROT A;  4Q5W A;  1VQ8 T;  1EX4 A;  2H3E B;  3OYC A;  3CCS A;  3UF4 A;  2PUO B;  3MEA A;  3EH2 A;  5ECA A;  2M9U A;  4R56 A;  3I5S A;  2KDS A;  4J9B A;  4FYY B;  3MEV A;  1YI2 T;  1AEY A;  3CCQ Q;  4ZN3 A;  1VQK Q;  3RKX A;  5CVI A;  4N0A A;  1RAB B;  4FSX A;  4R55 A;  4JJD A;  1ZLM A;  1YIT A;  1VQL Q;  4XQ3 A;  1PD0 A;  5CAI A;  4MDX A;  1WJQ A;  4M78 D;  3JCM f;  1IO6 A;  2CP2 A;  4Z88 A;  5C6S A;  4LDX A;  5GAM f;  1NPP A;  1UFF A;  1N8R U;  1K73 R;  4PJO A;  2DL7 A;  2CZ7 B;  4OMQ A;  1Q7Y C;  4IUV A;  1VQ6 T;  1I07 A;  1OOT A;  5KYN A;  4M77 F;  5A2Q E;  2EJF A;  4RKU E;  1QWE A;  3OYH A;  2ROL A;  5GMK h;  1SSF A;  4M7A D;  2DJQ A;  2ECZ A;  5GAO p;  5GAN 8;  3V7C A;  1X6O A;  1ZHI A;  2X4Y A;  1VIE A;  1UGS B;  1M3C A;  3UAT A;  1GXI E;  4A54 A;  2HZY A;  1M1F A;  4PJO E;  3SB2 A;  4FYX B;  2RNA A;  2FL7 A;  7AT1 B;  2HL3 A;  1W2B P;  1U1T A;  1H3H A;  2K5F A;  2OTJ Q;  2HEQ A;  1HJD A;  4MZP A;  3V8K A;  2EGC A;  5CKE A;  1K8A R;  2ED1 A;  5LJ5 f;  1UDL A;  3VS5 A;  3QSU A;  4Z89 A;  4J9F A;  1UJY A;  5GAO m;  3VS7 A;  1OX8 A;  3CD6 Q;  2AKK A;  1UEB A;  2VXE A;  1NEB A;  1FMK A;  4CI0 C;  2G3R A;  3QJ6 A;  3L1A A;  1OYX A;  3SD4 A;  1C0M A;  1H8K A;  4JJC A;  2DEU A;  2VVK A;  2BE7 D;  3UT1 A;  2EYX A;  2XDD A;  5LJ3 d;  1UGP B;  2RJF A;  2LCL A;  3H0I A;  2RK2 A;  4FT4 A;  1VQ9 Q;  1MV3 A;  3OA6 A;  2H8H A;  1KQS P;  3EGX A;  1KC8 U;  1ABQ A;  2JTE A;  2MAM A;  3KBG A;  3PE0 A;  1BI1 A;  2LDM A;  3N5B B;  2LC4 A;  3EGU A;  3VU3 C;  2JXB A;  4JLG A;  1QCO A;  1J3T A;  2XHC A;  5GJV B;  5HKC A;  4RCC A;  1M90 U;  3OW2 S;  2FHD A;  3FDR A;  4XU3 A;  2ZPB B;  4F7U A;  1D1C A;  3A8G B;  4F7U F;  1WXB A;  1NYG A;  3M0U A;  2DL4 A;  3VS4 A;  1RI9 A;  3UWN A;  5IXB A;  1G8X A;  3CC7 Q;  1HXD A;  5LJ3 j;  2HCK A;  5EG2 A;  2EYQ A;  1UGQ B;  2QTX A;  5KCH A;  1M1K R;  1U3O A;  3OBY A;  3VS2 A;  2QK0 A;  3J81 E;  2JTF A;  4C92 A;  5HK0 A;  2EKO A;  3CC2 T;  5CCA A;  5CK9 A;  3M55 A;  2KYM A;  4BY6 C;  2F1L A;  1RLQ C;  2E5Q A;  3QUI A;  2OTL Q;  4FCY A;  2LVM A;  3FIF A;  4HVU A;  4RCB A;  2DET A;  3OYN A;  1WIE A;  2LQ8 A;  5EC7 A;  3G71 T;  2NUZ A;  5GAN e;  3QO3 A;  2KK4 A;  1KC8 R;  2JJ9 A;  4C8Q A;  1PD1 A;  3L2Z A;  4C8Q F;  3CCU T;  1WNL A;  2DL5 A;  3EGD B;  3JCM b;  4PFP A;  4X9D A;  2DRK A;  8ATC B;  3A8H B;  3DKM A;  2MIO A;  2P4R A;  3SEM A;  1Y0M A;  4GY5 A;  1ZUU A;  1M90 R;  3O5Z A;  1VQ8 A;  2FZK B;  2SEM A;  2OAU A;  2X35 A;  4M7D B;  1KJW A;  5GAO q;  1BI0 A;  3SWN A;  1TUD A;  4ZTJ A;  1YI2 A;  1W2B S;  2CZ0 B;  3A8O B;  4PJO D;  3A5Z B;  2KBT A;  4XK8 E;  1YP5 A;  2XDB A;  3TEE A;  2HSE B;  3WXM B;  2RHZ A;  2VAS A;  2YUQ A;  2AT1 B;  3UDC A;  1U8R A;  2RHX A;  3G7Z A;  5KYU B;  2JZ2 A;  1KQ1 A;  1R8O B;  1Y7X A;  1IHW A;  2L0A A;  3RDV A;  4XTY A;  2YXY A;  1VQ6 A;  1OZ3 A;  4PJL A;  1NLP C;  1M2V A;  1PKT A;  2RI5 A;  2RJE A;  3CME T;  3I56 Q;  1YIJ Q;  4E7I A;  2DRM A;  3M0Q A;  3MCA B;  4J9I A;  4PLL A;  2M02 A;  1TG0 A;  3LLR A;  1K76 A;  1H3Z A;  4OGE A;  1KQS S;  3UPU A;  2BZY A;  3TCJ A;  4C5E A;  3PMT A;  4M77 G;  1F1B B;  1Q95 G;  4J6W A;  1VQ4 T;  2JT4 A;  2VXF A;  2YRD A;  3ULR B;  1Q7Y U;  2MYS A;  2HNI A;  4M7D E;  4IIO A;  2I2L A;  4JS4 A;  3JCM V;  1K9M U;  1AVZ C;  2GQV A;  3MPU B;  4OP0 A;  2F2W A;  4M75 F;  3T9N A;  4E7H A;  1WJS A;  1SRL A;  3A1P A;  2A7Y A;  1K73 C;  2LNH B;  4X34 A;  1YHQ T;  1G5V A;  4MML A;  2KT1 A;  4M77 C;  4LNP A;  2DZ9 A;  1AOJ A;  1NJI R;  2DVE A;  4LUE A;  2R57 A;  2EYZ A;  1YCY A;  1Q81 R;  2YRC A;  3L2V A;  4PNO A;  2K57 A;  2RO0 A;  3TSZ A;  4DBF A;  3GLX A;  1AD5 A;  2YUO A;  4XTU A;  3S3M A;  2QXF A;  1NM7 A;  5KYW A;  3MP6 A;  2K2M A;  2E41 A;  3FJ5 A;  1VQN T;  3V8L A;  1RI0 A;  3OYB A;  2K5I A;  1SRM A;  2OI3 A;  2RI2 A;  3G4S Q;  4ATO A;  2X9H A;  2QYZ A;  2EJG A;  1X75 C;  1WQW A;  2GBQ A;  4EMK B;  3OS0 A;  1BYM A;  3DB4 A;  3OYY A;  3QKJ A;  2CUD A;  2MCN A;  1K8A C;  1S1N A;  2K9G A;  4M78 B;  2HAX A;  1BKB A;  3M9Q A;  3QXE B;  1K9M R;  4KGX B;  4E47 A;  3IQL A;  1P92 A;  3CCJ T;  5IHN A;  3GIB A;  3CCL Q;  4C92 D;  4E6R A;  3M0T A;  1PNJ A;  3EG1 A;  2X3X D;  4J9E A;  4JRP A;  2FPE A;  1PKS A;  2FPD A;  3SDZ A;  2R5A A;  2XIC A;  1D3B A;  3ASK A;  2B86 A;  3ZL7 C;  2HKN A;  3CC4 A;  2DLP A;  3CBO A;  2GTJ A;  4C8Q D;  1KQS A;  2HMA A;  5KH6 A;  4EMK A;  3CC2 A;  3M4G A;  2EQK A;  1B34 B;  3CPF A;  2XID A;  3JB9 G;  5CKF A;  4IUP A;  2RHI A;  3G71 A;  3OQ5 A;  1YWO A;  3UA7 A;  4Y28 E;  2CH4 A;  1IGQ A;  5LL6 S;  1H92 A;  4CRI A;  4KRT A;  3CCU A;  2DL8 A;  1VQO Q;  1VQ7 T;  4AFZ C;  2VV5 A;  3S6W A;  4FU6 A;  3X26 B;  2QG9 B;  3REB B;  3EG2 A;  1ZQ1 A;  3LWI A;  1Q82 U;  4M78 E;  2EIF A;  1OQK A;  2VGN A;  2O01 E;  5A0L A;  2LZ6 B;  3I9Q A;  1N27 A;  1SHF A;  2RN8 A;  4ELZ C;  5D7U A;  1UGR B;  2X4W A;  3OYE A;  1XOV A;  2K2V A;  1M1K C;  3JB9 J;  2KT8 A;  2MWP A;  3ZEH A;  3G1J A;  3VRZ A;  3QDR B;  4D6W A;  2EPD A;  4DA4 A;  2EAY A;  2M16 A;  3H9N A;  1LOJ A;  2L3S A;  2E1H A;  2A08 A;  2VYT A;  4HXJ A;  1PRM C;  3CCV Q;  2D0Q B;  4E7J A;  3CPW P;  1VYU A;  1CKB A;  2NYS A;  2LJ1 A;  2DM1 A;  1ZUY A;  1JXM A;  4DBH A;  3L2R A;  2GGR A;  4R0K A;  2ZPI B;  1WHG A;  2G6F X;  3CMA Q;  1TWB A;  4XTV A;  1VQ4 A;  3VRY A;  2RD1 A;  3C94 A;  1MMG A;  3CCR T;  3JV3 A;  4KH0 B;  4J6X A;  2RHU A;  1T3L A;  2YLC A;  4AFQ C;  5D6W A;  3JSC A;  4CC4 B;  4FYW B;  1K4U S;  3VS6 A;  4ZN1 A;  1RAE B;  1QMC A;  2KAF A;  1RAF B;  2NUP A;  4QVC A;  3JCM Q;  2XG8 D;  5IH2 A;  2BE9 B;  1VA7 A;  2DBK A;  3X20 B;  4KUL A;  2LQK A;  2CP5 A;  1YIT Q;  3M57 A;  2KMT A;  1IRE B;  2BIV A;  2O4X B;  3PFS A; 
#chains in the Genus database with same CATH homology
 5IT9 E;  3C12 A;  4C5H A;  3LYI A;  4P5N A;  2EQU A;  3CCE T;  1UEB A;  2DXB A;  3QBY A;  3QII A;  2VXE A;  5HY6 A;  1H64 1;  3QZ9 B;  4BE1 A;  4CI0 C;  2G3R A;  3QJ6 A;  3KXT A;  3WVD B;  3LH0 A;  2FYK A;  1QVG S;  3L1A A;  1OYX A;  1OI1 A;  2M0O A;  4OB2 B;  3SD4 A;  4KBM B;  4OGC A;  4FIB A;  3JCM X;  5I2S A;  3HRU A;  4OB0 B;  2CGH A;  4OMF B;  2JOY A;  1RL2 A;  2IVW A;  3UT1 A;  2OTL A;  5FU7 B;  3X24 B;  2XDD A;  4HCB A;  2D6F A;  2LNV A;  2E65 A;  4XTX A;  1U1S A;  1NJI U;  5LJ3 d;  1UGP B;  2RJF A;  5CKH A;  3R6O A;  2LCL A;  3RMQ A;  3SFM A;  3OMG A;  2RK2 A;  4FT4 A;  1JB0 E;  4M7D A;  4X9C A;  1Q81 U;  5CKB A;  2JTM A;  3OA6 A;  4J7F A;  3JB9 I;  4EMH A;  2Y4Y A;  4C0D B;  2QEX T;  2P0Q A;  1KC8 U;  1TH7 A;  2LRQ A;  3BFM A;  1V29 B;  2MAM A;  1YJN T;  4PJO B;  1QVP A;  1VQO T;  3KBG A;  2PUK B;  1Q86 U;  5LJ3 h;  1VQP T;  4L5G A;  1BI1 A;  2LDM A;  2O4X A;  3N5B B;  2LC4 A;  3BDL A;  3OSS C;  5DY9 A;  4PJO G;  1QW1 A;  3VU3 C;  3HRT A;  2DTH A;  2HBP A;  2R58 A;  4JLG A;  2XHC A;  2JNG A;  4A4E A;  4DQ2 A;  3JCM d;  5GAN j;  5HKC A;  2ZGW A;  4RCC A;  2F69 A;  3OMC A;  5CQX A;  3EAE A;  4EPC A;  3CBP A;  1M90 U;  3CCJ A;  3INZ A;  1EIF A;  4MZM A;  5GAM d;  1PSE A;  2FHD A;  3QG1 A;  4BY6 B;  3FDR A;  3OW2 S;  2CS7 A;  3EFS A;  5D6X A;  4N0A C;  4IUR A;  4XU3 A;  3PMI A;  2ZPB B;  4QQ6 A;  2LT1 A;  4A4G A;  4C5I A;  1G3T A;  4F7U A;  3A8G B;  5M9O A;  2DZC A;  4F7U F;  2A3L A;  2GF7 A;  2ZCF B;  5GAN 5;  2L8D A;  3GP8 A;  3DLM A;  5DLO A;  4M7A F;  4TVR A;  2QQS A;  4XU2 A;  2JVV A;  5FRM A;  3DB3 A;  1KD1 C;  2X4J A;  4V2S A;  3UWN A;  2QA4 A;  3BDU A;  4C0G A;  4QW2 A;  1FXX A;  5GAM h;  3CCQ T;  1NJI C;  2BKD N;  1VQK T;  3HHT B;  4C0D C;  5CR2 A;  3A8M B;  4LDW A;  1HXD A;  5LJ3 j;  4PJO C;  1VQM A;  5EG2 A;  1M9S A;  1UGQ B;  2EYQ A;  2QTX A;  4BD3 A;  1VQL T;  2QQB A;  3M58 A;  3J80 E;  5KCH A;  3P8B B;  3L2W A;  3OBY A;  1KC8 C;  4IUT A;  5FU6 B;  5I21 A;  2JTF A;  3J81 E;  4C92 A;  4EMG A;  5HK0 A;  3CME A;  3M54 A;  3CPW S;  4M77 A;  3RKW A;  5GAN 2;  2EKO A;  3CC2 T;  4BDY A;  1YJ9 A;  5CCA A;  5CK9 A;  1DJ7 B;  3M55 A;  3PIP A;  4BY6 C;  4LD9 K;  2FB7 A;  2E5Q A;  3QUI A;  5GAO r;  2ZPG B;  2LVM A;  4MZT A;  4NS5 A;  3FIF A;  2VUB A;  3A8L B;  4RCB A;  3OYN A;  2LQ8 A;  3G71 T;  2HQX A;  1M90 C;  4IKF A;  1QVF A;  2DJZ A;  3E19 A;  3I56 A;  1YIJ A;  4M75 D;  1G5V A;  2DXU A;  1VQ5 T;  5GAM j;  5GAN e;  3JB9 D;  3QO3 A;  2KK4 A;  1VQ7 A;  3RER A;  4QVZ A;  4YTL A;  2JN0 A;  4C8Q A;  3L2Z A;  4C8Q F;  3CCU T;  1Y71 A;  1WNL A;  3HFO A;  5LJ5 d;  3GNG A;  3JCM b;  4X9D A;  4DOV A;  3LX7 A;  5GAN g;  3E9G A;  3S3N A;  3NTH A;  3OYD A;  3A8H B;  3DKM A;  2F5K A;  4ELY C;  3OYM A;  5GAN 7;  4GY5 A;  4VUB A;  2D9T A;  2Y90 A;  5J26 A;  5FU6 C;  3VKI A;  1VQ8 A;  2E64 A;  3NFC A;  2X4X A;  2XI9 A;  1Y96 A;  3PT9 A;  2OAU A;  2X35 A;  1W4S A;  4RG2 A;  5GMK j;  5GAO q;  4M7D B;  2E6N A;  4M7D G;  1NPR A;  1BI0 A;  3SWN A;  3CCS T;  1QVG A;  4ZTJ A;  4Y91 A;  1YI2 A;  1W2B S;  4HT9 A;  3H8Z A;  3X25 B;  2CZ0 B;  2DTO A;  2EQJ A;  3A5Z B;  3A8O B;  4GLK A;  1YHQ A;  4PJO D;  3ER0 A;  3C95 A;  3Q1J A;  4B9X A;  2DXC A;  2QDY B;  4XK8 E;  2OTJ T;  1YJW A;  2WSE E;  2RK1 A;  2XDB A;  3VYH B;  3AHU A;  1VUB A;  3CXC A;  3TEE A;  2E6Z A;  3WXM B;  2MMP A;  3ZBD A;  2RHZ A;  1XTD A;  3MET A;  3L2U A;  5A0D A;  3M5A A;  2FVU A;  3GOX A;  4E7K A;  3UDC A;  2R5M A;  3FRN A;  3TU4 K;  1U8R A;  2KQW A;  1KHI A;  2RHX A;  4ME7 A;  2KY9 A;  1WJR A;  3HPW A;  4FM4 B;  4A4K A;  5CKD A;  3G6E T;  3G7Z A;  3DLL A;  2CZ6 B;  3J7A F;  5GMK m;  2JZ2 A;  1KHC A;  1KQ1 A;  2JUF A;  4QQG A;  3TRE A;  2IG0 A;  1R8O B;  3O8V A;  3CD6 T;  1O9S A;  1Y7X A;  4F7U B;  4RG8 A;  5J39 A;  4M7A B;  4F7U G;  5LJ5 j;  4XTY A;  4M7A G;  3OS1 A;  1VQ6 A;  1VQN A;  2EFI A;  2C06 A;  4M7D C;  3PNW C;  1OZ3 A;  4OB3 B;  3OSV A;  2RM4 A;  2RI3 A;  1M1G A;  2RI5 A;  1S72 A;  4LD6 A;  2DTI A;  2RJE A;  2RB6 A;  1K73 U;  3CME T;  2RH2 A;  3M59 A;  3FC3 A;  4M78 A;  4J5Y A;  4E7I A;  4M78 F;  4KUD K;  2E10 A;  4BAC A;  3MCA B;  1I5L A;  4PLL A;  2F5T X;  4KUI A;  3JB9 H;  3LLR A;  1VQ9 T;  4JDS A;  2HQE A;  3NTK A;  1FX7 A;  4OGE A;  3RKY A;  4JRI A;  4B9W A;  3G4S A;  3UPU A;  1KQS S;  1JJ2 A;  1QP3 A;  2DIQ A;  4C92 B;  3S3O A;  2MWO A;  3TCJ A;  4M77 B;  5L8R E;  4C92 G;  3CCR A;  4C5E A;  2KSS A;  3PMT A;  4HCC A;  2XDP A;  1MGQ A;  2XU8 A;  2P0P A;  3MP1 A;  4M77 G;  4J6W A;  3CMA A;  4XU1 A;  4JJN K;  1VQ4 T;  2EJ9 A;  2VXF A;  2AHJ B;  4L6V 5;  3VJP A;  3M4Y A;  1M5Q 1;  4J83 A;  3I55 A;  1Q7Y U;  5FU7 C;  3VYG A;  2HNI A;  4A4F A;  4M7D E;  2I2L A;  3OYL A;  4JS4 A;  4M7A A;  2E12 A;  1I8F A;  5KE2 A;  3MHX A;  3JCM V;  4JUV A;  1N9R A;  4C8Q B;  1K9M U;  4C0Z A;  2GQV A;  4OP0 A;  3OS5 A;  3CPW A;  3CCL A;  4C8Q G;  4PKC C;  1OZ2 A;  4M75 F;  1BIB A;  3T9N A;  4E7H A;  1WJS A;  3V8J A;  4C0F A;  3P8H A;  1B34 A;  3GPL A;  3JB9 F;  1BIA A;  1BI2 A;  4QVD A;  1Q81 C;  3HSB A;  2A7Y A;  4J7I A;  3ZFJ A;  1O75 A;  2RJC A;  5LJ5 e;  1YBY A;  1K73 C;  4LDU A;  4N4I A;  2M1H A;  1FWZ A;  3HL8 A;  3MO8 A;  4X34 A;  1PSF A;  3RUX A;  2HD0 A;  1YHQ T;  3CCM A;  4C92 C;  1I4K 1;  3CCE A;  1NE8 A;  4MML A;  1Y96 B;  4M77 C;  3VUB A;  1K8A U;  4FL6 A;  1Q86 C;  3CC7 T;  1KQ2 A;  4M7D D;  5LJ5 g;  3VUZ A;  1N6A A;  3H6Z A;  2PQW A;  1AHJ B;  4F7U E;  2DZ9 A;  3QHS A;  3SWN B;  4M7A E;  2CYZ B;  3L2Q A;  2DVE A;  2L3R A;  3LW5 E;  2R57 A;  3OYJ A;  1M4Z A;  2V8K A;  1YCY A;  5CQY A;  3OB9 A;  3L2V A;  5CIU A;  4JLI A;  4PNO A;  2GFU A;  2K57 A;  2RO0 A;  5A0G A;  3GLX A;  2DPP B;  4PJO F;  4E7L A;  4C8Q C;  5GAN 3;  4XTU A;  3ME9 A;  4PLI A;  3S3M A;  2QXF A;  3HP9 A;  4KT0 E;  2OTL T;  2K4Y A;  3JAM E;  3MP6 A;  2XKO C;  2E41 A;  1G3S A;  1VQN T;  1HK9 A;  3V8L A;  4BE0 A;  1RI0 A;  1K9M C;  2QEX A;  3OYB A;  2LX9 A;  1YJN A;  2K5I A;  4ATO A;  1VQO A;  2RI2 A;  4C92 E;  2P0K A;  1QP2 A;  2VC8 A;  3HKS A;  3QPH A;  2DEQ A;  4M77 E;  3OYI A;  4II1 A;  1VQP A;  4MDW A;  3E9F A;  1JRI A;  2PU9 B;  4XAX B;  2DIG A;  2RA2 A;  2EJG A;  1X75 C;  2MF2 A;  4OF1 A;  1MHN A;  1WQW A;  4N4H A;  1YIT T;  2NLU A;  4EMK B;  1BI3 A;  3OS0 A;  1BYM A;  4FT2 A;  2DAQ A;  3M53 A;  3DB4 A;  3OYY A;  3QKJ A;  2QQ9 A;  3SWN C;  2DK3 A;  3L42 A;  1K8A C;  5LJ3 e;  3VV0 A;  2YHT A;  3JRZ A;  3URG A;  4M78 B;  2HAX A;  1BKB A;  4PL6 A;  2ZZD A;  3M9Q A;  3FJP A;  1LJO A;  3QXE B;  4M78 G;  4Z02 A;  4E47 A;  3OYA A;  1P92 A;  4L59 A;  1X01 A;  4C8Q E;  3CCJ T;  4LDY A;  4ZTF A;  2DXT A;  2PVG B;  2RHY A;  3LWH A;  3GIB A;  2V8I A;  2WAC A;  3OBW A;  5LJ3 g;  4C92 D;  1I81 A;  4O5V A;  1UB4 A;  5GAO n;  4M77 D;  2DKG A;  2QI2 A;  1VIF A;  5J3B A;  3CCQ A;  4JRP A;  1VQK A;  4NL2 A;  1N9S A;  2QA4 T;  1NZ9 A;  3SDZ A;  1XNI A;  2GCX A;  3RMS A;  3JCM e;  2R5A A;  4BB7 A;  1VQL A;  4WF2 A;  2ZPE B;  3QZ5 B;  2XIC A;  1D3B A;  3ASK A;  3QYG B;  2L89 A;  4O6J A;  2RJD A;  5DLQ E;  3CC4 A;  5GAM e;  5HK3 A;  3CBO A;  2EQM A;  1VQM T;  1XQH A;  5C0M A;  4C8Q D;  4EMK C;  1KQS A;  3WVE B;  3JCM g;  3MEU A;  3C4S A;  4QQD A;  5GMK i;  3CCV A;  5KH6 A;  4EMK A;  4M75 B;  3CC2 A;  4ZGE B;  5GAM g;  3M4G A;  3OY9 A;  4JRK A;  2EQK A;  2LTO A;  4M78 C;  4M75 G;  1B34 B;  3CPF A;  2XID A;  3RES A;  1WQ7 A;  4DOW A;  3JB9 G;  5CKF A;  5DM7 R;  4IUP A;  2RHI A;  3OW2 A;  1M1K U;  4BI4 A;  1YJ9 T;  5GAN h;  2PVD B;  3G71 A;  2PVO B;  3OQ5 A;  3OYF A;  3V7R A;  2CZ1 B;  3X28 B;  2QQR A;  2YLB A;  4Y28 E;  4HA8 A;  5AYF A;  2V8J A;  3BW1 A;  3CBM A;  5GAN f;  2LT4 A;  1WPY A;  3CXC S;  1KD1 U;  1VQ5 A;  3HFN A;  5LL6 S;  5FRO A;  4IUU A;  4CRI A;  5GMK e;  3I56 T;  3CCU A;  5D6Y A;  3JCM c;  1YIJ T;  4OVA A;  1VQ7 T;  3PGG A;  2QQA A;  3GF5 A;  2VV5 A;  4M7D F;  1WGS A;  2DD5 A;  3LGF A;  5I2M A;  2P4T A;  3S6W A;  4FU6 A;  2XK0 A;  3X26 B;  2KVQ G;  5KCO A;  4RMO A;  3OYG A;  4JS5 A;  4M7A C;  1ZBX A;  4HKE A;  2BUD A;  1JBM A;  1ZQ1 A;  2E70 A;  4A53 A;  3LWI A;  4N4G A;  2MI6 A;  4XU0 A;  1Q82 U;  4BUG A;  4M78 E;  3MP8 A;  2EIF A;  2CKK A;  3E1S A;  2WSF E;  4M75 C;  2DO3 A;  2VGN A;  4Q5W A;  3PTA A;  1VQ8 T;  4M75 A;  4BE2 A;  1M8V A;  3LGL A;  3OYC A;  5LJ3 f;  3GNF B;  3CCS A;  2O01 E;  5A0L A;  3JCM W;  2PUO B;  3MEA A;  4ZGD B;  4EDU A;  3QJY A;  2B8A A;  2M9U A;  4NL3 A;  4R56 A;  1N27 A;  4J8O A;  2OTJ A;  2GFA A;  2KDS A;  4ELZ C;  1YI2 T;  1UGR B;  2X4W A;  3MEV A;  3OS2 A;  3OYE A;  1XOV A;  2K2V A;  4BI8 B;  4ZN3 A;  3JB9 J;  3HRS A;  5CVI A;  3RKX A;  1M1K C;  2MWP A;  4N0A A;  3ZEH A;  2LCC A;  5IN1 A;  1YJW T;  3QDR B;  4D6W A;  4FSX A;  4R55 A;  3OYK A;  1JJ2 S;  3JCM J;  3JCM h;  3G6E A;  4DA4 A;  1YIT A;  4BI3 A;  2EAY A;  4XQ3 A;  5CAI A;  4MDX A;  1WJQ A;  2M16 A;  4M78 D;  2VGM A;  1LOJ A;  5FLX E;  2E1H A;  5CO7 A;  3JCM f;  3CD6 A;  1IZ6 A;  2VYT A;  4XTZ A;  4JRQ A;  1Y07 A;  5C6S A;  1LNX A;  2D0Q B;  4A4H A;  4E7J A;  4LDX A;  5GAM f;  4M75 E;  1G3W A;  1NPP A;  3M56 A;  1N8R U;  2XD0 A;  2YRV A;  4ZGJ B;  4PJO A;  3FLG A;  2CZ7 B;  4HCZ A;  3CC4 T;  1Q7Y C;  5GAN 4;  4LDV A;  4IUV A;  5KE3 A;  2WSC E;  3JCM P;  1Q82 C;  1VQ6 T;  1G3Y A;  1H3Z A;  3QYH B;  4C92 F;  5IAY A;  5GAO l;  3CCV T;  4MMK A;  3F70 A;  4M77 F;  5A2Q E;  2EJF A;  3CEY A;  4RKU E;  1W2B A;  3L2R A;  2K5L A;  1S72 T;  3OYH A;  5GMK h;  1D3B B;  1SSF A;  4M7A D;  1VQ9 A;  2DD4 A;  5GAO p;  2ZPI B;  5GAN 8;  3V7C A;  1X6O A;  4XTW A;  2K3X A;  5GAN 6;  5GMK l;  1ZHI A;  2X4Y A;  3BY7 A;  5FRN A;  3NTI A;  4NOY A;  4C5G A;  1VIE A;  1UGS B;  2H3J A;  4XTV A;  3G4S T;  1VQ4 A;  2RD1 A;  3C94 A;  1GXI E;  4A54 A;  1M1F A;  4J6Y A;  4PJO E;  3SB2 A;  3CCR T;  4J6X A;  3CMA T;  2RHU A;  4BDZ A;  4OB1 B;  2Y4X A;  2YLC A;  2ZPF B;  5D6W A;  1KG1 A;  3PIO A;  3MEW A;  2FL7 A;  3JSC A;  1QVF S;  3RIR A;  3I55 T;  2L5Q A;  3FB9 A;  4ZN1 A;  4UC4 A;  1N8R C;  2KAF A;  1U1T A;  4QVC A;  2K5F A;  3EFR A;  3JCM Q;  4MZP A;  5LJ5 h;  2XG8 D;  3V8K A;  2EWN A;  4HT8 A;  3CCL T;  3V7S A;  5CKE A;  3X20 B;  4KUL A;  3P8D A;  2LQK A;  5LJ5 f;  2K3Y A;  2ZPH B;  3QSU A;  5GAN d;  3M57 A;  2KMT A;  4IUQ A;  1IRE B;  2BIV A;  2O4X B;  5GAO m;  3CC7 A;  3FEO A;  3KUF A;  3PFS A;  3CCM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...