3EGUA

Crystal structure of the n114a mutant of abl-sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eguA00
2KT1A 3O5ZA 1NEGA 2MOXA 2C0TA 1KFZA 1GBQA 2ENMA 1M3AA 1OEBA 4OMQA 5FWCA 1RLQC 2C0OA 2O88A 3VS2A 1SSHA 3ZL7C 2YSQA 3PVQA 1ZSGA 1EFNA 2A28A 1SHGA 3REBB 2XMFA 1G83A 1RLPC 1YCSB 1NG2A 4FSSA 1HSQA 1OV3A 1YP5A 1I0CA 1UGVA 2YUQA 2DBMA 1M3CA 2DYBA 2L3SA 3PE0A 3VS4A 2G6FX 4AG2C 1UJ0A 3M0QA 1WIEA 4RTZA 1SRMA 2OI3A 2J6FA 2A36A 4OMOA 2JMCA 1T0HA 2F2WA 3H0FA 2VVKA 2DRKA 3I35A 2AKLA 1WA7A 5IHNA 1W70A 1NYFA 1H92A 1WDXA 1XOVA 4JZ3A 5FW9A 1ABOA 1U5SA 2JT4A 2J06A 2AK5A 2P4RA 2RPNA 2KGTA 2BZXA 2IIMA 2RF0A 2CT3A 2LNHB 2JMAA 2KE9A 2BZ8A 2CH4W 2LCSA 3RNJA 3UA6A 2O31A 4GBQA 4AFZC 5IHKA 1ZUYA 4F17A 1VYVA 1MV0B 2CREA 1K9AA 1CKAA 1UDLA 1MUZA 4KRTA 4RTXA 2MIOA 1OPKA 1E6GA 1K76A 2LJ1A 4OMNA 2GBQA 2EGAA 2CSQA 1AZEA 3VS0A 1QKXA 1ZLMA 4R0KA 2L2PA 1B3QA 2NWMA 2X3WD 3R6NA 1M27C 2J6OA 2RNAA 4JJDA 2KNBB 4Z8AA 1VYTA 4A63B 2LX7A 2GTOA 3TSZA 1GL5A 2M0YA 2C0IA 1AD5A 1LCKA 2HEQA 1CKBA 5GJVB 1T0JA 4RUGA 1VYUA 4LUEA 1UHCA 1JXMA 1QWFA 4CC4B 3ULRB 2J05A 3A98A 3M0UA 3NHNA 4J9EA 1NM7A 2NUZA 2EYWA 1AOJA 2OJ2A 4ZNXA 4RTVA 2FPDA 2DVJA 1E6HA 1K4US 1QKWA 4HXJA 1QLYA 5I11A 1JQQA 2KBTA 1NLOC 2HSPA 1X6BA 4CC2A 2W0ZA 1TUDA 1WXBA 4OMMA 3VS6A 1H8KA 2RQUA 1CSKA 2VWFA 2L3QA 1W6XA 2JM9A 1BBZA 1B07A 2J7IA 3M0TA 3REAB 1K1ZA 2DM1A 2HCKA 1AWWA 2DL8A 3NGPA 1E7OA 1BB9A 2HDAA 3EGUA 3I5SA 3U23A 1X69A 2W10A 2RQRA 2DRMA 2DX1A 2H8HA 1N5ZA 4Z88A 4LUDA 2I0NA 1SRLA 2GNCA 4GLMA 2DF6A 4D8DA 1IO6A 3EG0A 5GJWB 4LE9A 2EGCA 1OOTA 2FO0A 2KROA 2KXCA 4X1VA 1HJDA 3SHWA 3TSWA 2JW4A 2A37A 2JS2A 2FPEA 4CC3A 1GBRA 1GCQC 2CH4A 1Z9QA 3KFVA 1GFCA 2LZ6B 3H41A 4RTWA 2RMOA 4LN2A 1PWTA 2YUNA 2FPFA 2KXDA 2VKNA 1PRMC 4Y92A 1ZUUA 2EKHA 1X6GA 1ZBJA 2EVRA 4J9IA 1FYNA 1SEMA 4HVWA 2K3BA 4OMLA 1UHFA 2O9VA 1NYGA 2J6KA 4RTTA 2RQWA 4E6RA 2O2OA 2YDLA 1QWEA 3SEMA 1GFDA 1UTIA 4J9FA 2CSIA 2DLPA 3QWYA 2JTEA 1YNZA 2AZVA 2BZYA 3VS3A 4CC7A 2K6DA 2LMJA 1GCPA 4HCKA 2EW3A 2KYMA 2LJ3A 4WCIA 4IIOA 2RN8A 1TG0A 1YN8A 3GBQA 1TUCA 2KEAA 1G2BA 1PHTA 3TVTA 2ROLA 2CUDA 1JU5C 2KRSA 1U3OA 2CUBA 1Z9ZA 1X2QA 2PZ1A 4J9GA 2ABLA 5HCKA 2ED0A 2GQIA 3UA7A 1KJWA 3M0PA 1WXTA 1QCFA 2X3XD 1T3SA 1A0NB 2AZSA 1UECA 2PTKA 1JO8A 2YT6A 3EG2A 5IHIA 4F14A 2EYXA 3C0CA 4AFQC 1SPKA 2DL4A 3M0RA 2DJQA 2D1XA 2D0NA 5IH2A 1Y0MA 4JZ4A 2V1RA 2KRNA 1AWOA 2HBWA 3NPFA 1M3BA 1VA7A 2JS0A 2V1QA 1PKTA 4OMPA 2GGRA 1U06A 2FRYA 4K11A 2FRWA 3NMZC 4RTYA 4F16A 1AZGB 5L23A 1NLPC 2ESWA 4D8KA 1X2KA 4DEXA 1WFWA 2BTTA 5I22A 2DL3A 2KR3A 1JXOA 4J9HA 4JPBW 2L3PA 4JJCA 2FEIA 1AWXA 1OPLA 4IIMA 2K7AA 3EG1A 2DMOA 2EYZA 2FG0A 3H0IA 2EBPA 4HVUA 1PKSA 1UFFA 2DBKA 3VRZA 5FWBA 1RI9A 1HD3A 4RTUA 3RBBB 1KSWA 2RQVA 2DE0X 1JEGA 2EQIA 3LH5A 2DL5A 2RQTA 2DL7A 3EHQA 1WLPB 3FJ5A 3UATA 2D8JA 1WYXA 2ED1A 1ABQA 4J9DA 1NEBA 3I9QA 2LQWA 1Y57A 1KIKA 1S1NA 1T3LA 2EPDA 1GRIA 2KRMA 3VRYA 1W1FA 4DEYA 2K9GA 1ZX6A 1M30A 2ROTA 2LP5A 3VS1A 3EHRA 1YWPA 4QT7A 1UE9A 2A08A 1AWJA 3JV3A 1I1JA 4M4ZA 2L0AA 2LJ0A 1BK2A 3PVLA 4HVVA 1PNJA 2LQNA 1GCQA 1YWOA 1FMKA 3THKA 2KT8A 2GTJA 2CT4A 2B86A 3EG3A 1UUEA 5IXFA 5EC7A 2YUPA 2K2MA 1ZUKA 1M8MA 4LNPA 2JXBA 4ORZA 4J9BA 4ESRA 2EYYA 2SEMA 1UG1A 4AFSC 1WXUA 2YUOA 1AEYA 1X27A 3UF4A 3CQTA 1V1CA 2K79A 3H0HA 4EIKA 1K0XA 2PNIA 1PRLC 2EGEA 4J9CA 4JJBA 4AFUC 1H3HA 2KYBA 2M51A 1BU1A 2DILA 1WI7A 3QWXX 1RUWA 2DNUA 2CDTA 2OAWA 3IQLA 1X43A 2MCNA 2DA9A 2F2XA 3VS7A 2QDLA 1AVZC 2JM8A 1UJYA 2O9SA 3VS5A 3M0SA 2ECZA 5ECAA 1J3TA 1K0SA 1MV3A 1ARKA 2E5KA 2F2VA 5IXBA 2D8HA 1SHFA 1WX6A 3I5RA 2SRCA 4AG1C 2AKKA 1I07A 4Z89A
chains in the Genus database with same CATH superfamily
1B34B 2KT1A 3G4ST 1WHLA 3VV0A 3PNWC 1NEGA 1TXQA 2MOXA 2C0TA 1KFZA 1GBQA 3OW2S 2R58A 2BIVA 4M77G 5FWCA 2R57A 1VQMA 3OSSC 4M78F 3LH0A 1WHHA 3VS2A 2XU8A 2PVOB 4MDWA 2YSQA 2NLUA 1ZSGA 1EFNA 3JRZA 3JCMb 1SHGA 3PMTA 4XQ3A 1D0YA 2XMFA 2DK3A 1OI1A 1YCSB 3G71T 1I0CA 4PLIA 4XTXA 2DYBA 3OYGA 3PE0A 1JRIA 1ZA2B 1ZQ1A 2G6FX 4C5HA 4FCYA 2AHJB 3M0QA 1WIEA 5J26A 3DLMA 1M4ZA 2FZGB 2OI3A 1C0MA 2L8DA 3QJ6A 1D1AA 4ZN3A 3NTHA 2DRKA 2AKLA 1WA7A 5IHNA 5J39A 4PJOE 1WDXA 4JZ3A 2JT4A 4OF1A 1K73C 2KSSA 1RABB 2VXEA 3CCLQ 2LNHB 3MEVA 3MEUA 2CH4W 2DTOA 2LCSA 1VQ9Q 2HZYA 1QP2A 2M9UA 1ZUYA 2RK2A 4XU1A 3META 1VYVA 1QVGA 1K9AA 1UDLA 5GAOq 2CP6A 4RTXA 1M1KC 3QZ9B 2IG0A 4IUUA 2E64A 2DPPB 3S3OA 1OX9A 4ELYC 4C92F 1LPLA 1UGPB 3CMEQ 4KUDK 3A8LB 4XK8E 3L2WA 4R0KA 2X3WD 3R6NA 2J6OA 2RNAA 3A8MB 1VQNT 4Z8AA 1YBYA 4II1A 3DB4A 1VQ6T 1GL5A 1CKBA 2KMTA 2P0QA 4O5VA 1EZZB 1YJ9Q 4X9CA 3V8JA 4J7IA 3J7AF 1WHMA 4J9EA 3OYFA 4EMKB 1M5Q1 2OJ2A 3LGFA 4RTVA 2FPDA 4ZNXA 3CCUQ 1VQMT 2OTJQ 1QKWA 4HXJA 2LCCA 5I11A 2WSCE 3Q1JA 1NLOC 5FU7C 1X6BA 3FLGA 2ZCFB 4CC2A 2DIGA 2QDYB 1WJSA 1VQ5A 4FT2A 3G6EA 3VS6A 1IB8A 8AT1B 3RDVA 1HYOA 1H8KA 2VWFA 2L3QA 3RKWA 1W6XA 2JM9A 4JLGA 4OB3B 3M4YA 3CD6A 3QG1A 4PLLA 5KCHA 1K1ZA 3OYAA 3MEAA 2DM1A 3PT9A 3CPWA 1MMAA 2DL8A 5GAMg 3NGPA 3PGGA 2HDAA 1BIAA 4NOYA 3H8ZA 2DRMA 2HQHA 2WACA 2YRCA 1FMWA 1RI0A 5GAOl 4AT1B 3BDLA 2PUKB 4GLMA 2HQEA 3GP8A 1IO6A 5GJWB 4LDXA 3TEEA 2EGCA 1KK7A 3SHWA 1M2VA 3EG9A 1QVFP 1XNIA 3L42A 1GFCA 2DTHA 4F7UF 4DBQA 4RTWA 3QDFA 2RMOA 5GAMf 1PWTA 3OYLA 2YUNA 2ZPHB 1G3SA 2H3JA 2LT1A 2BUDA 2VKNA 1P92A 5C6SA 4XTWA 3EGDA 1PRMC 4C92G 2WSEE 3MJXA 4J6WA 5GAOn 4E7JA 4PJOD 1X6GA 1ZBJA 2KQWA 4J9IA 4V2SA 2XG8D 1SEMA 2DETA 3OS5A 1V29B 4HVWA 3I56A 4OMLA 2DXTA 1Q95G 2JNGA 2CP0A 4QVCA 1GFDA 1UTIA 4M7DA 1RL2A 2CSIA 2DLPA 2LCLA 2AZVA 2YXYA 3G1JA 3VS3A 4CC7A 2LMJA 3OS0A 2EW3A 2KYMA 4WCIA 4C0DB 1TG0A 3G4SQ 3TVTA 2ROLA 2QK0A 3HFOA 3G6ET 2KRSA 1ZHIA 3A5ZB 2E6ZA 1X2QA 3H9NA 1VQLQ 4LD9K 4M75A 1MMDA 3CD6T 3GNFB 1IRXA 3UA7A 1KJWA 3FEOA 2LRQA 4OVAA 5KCOA 2MF2A 5GMKj 3HFNA 1UECA 2E6NA 2PTKA 3HKSA 2YT6A 2EKOA 2EQUA 3CCRT 1V76A 3CCMQ 5IHIA 3G71Q 5KYWA 1Y96A 4BACA 4KGVB 1VQOQ 3C0CA 3M0RA 1NPRA 1RAAB 2QQ9A 5KYXA 4JZ4A 1YI2Q 3OS1A 1YJWA 1VA7A 4C5IA 2EQKA 3LWHA 5CKHA 4OMPA 2GGRA 2QGGA 3HRSA 4F16A 3OYYA 3KBGA 5I22A 3CEYA 1JXOA 2L89A 2L3PA 2FEIA 1AWXA 1OPLA 1PSEA 2K7AA 3EG1A 3M59A 4GY5A 1YJ9A 1K9MC 1QQJA 4IKFA 5DLQE 2FG0A 4HVUA 1QMCA 4C8QA 1KQSS 5LJ5f 4DA4A 5LJ3j 2EQIA 1VOMA 5CK9A 2JTMA 2NUTA 1WYXA 4J9DA 3NFCA 3I9QA 4PJOF 2EPDA 1GRIA 2KRMA 1NZ9A 1YJNQ 4DEYA 4JRPA 1W2BS 2XK0A 2LP5A 1K73U 1OZ3A 4M7AG 2XICA 1UE9A 4QT7A 3ZEHA 4A4EA 2L0AA 4XU3A 4F04B 4M77D 1BK2A 1WJRA 2KK4A 3A8GB 1BCMA 3CPFA 1GCQA 1YWOA 1FMKA 2HMAA 1VIFA 2RI3A 1M2VB 1TWBA 2VC8A 3SWNA 1VQ6Q 3EG9B 2C06A 1M1KU 3JCMQ 5FU6B 2D0QB 4M7DC 2JVVA 2E5QA 5IXFA 3OW2A 2YUPA 3MP8A 1FXXA 1M8MA 4J7FA 2XD0A 2JXBA 1PD0A 4J9BA 4WF2A 4ESRA 4GLKA 1UG1A 3CCLT 4XTZA 2I2LA 3EGDB 1X27A 4ZTFA 1VQ9T 4OP0A 1N9SA 1MMGA 5AYFA 1V1CA 4EIKA 5GMKi 1K0XA 3C95A 1B34A 2EGEA 1YFNA 2YHTA 2EFIA 3X25B 4MZPA 2M51A 3JCMe 1WI7A 1RUWA 3CMET 2OAWA 1XQHA 3VS7A 1AVZC 4E7ZA 2JM8A 1SSFA 3HP9A 4LDVA 5CCAA 4Y28E 5ECAA 2CS7A 5GANe 1ARKA 2AT1B 2E5KA 2LX9A 5IXBA 1KD1C 3M54A 3CCVA 1LNXA 1X75C 2RHIA 2RI2A 1YJ9T 3QDRB 4FM4B 1PSFA 3CCJA 4ZGDB 3O5ZA 4M75B 1D1BA 1LJOA 3OYCA 2ENMA 3OYHA 1OEBA 4OMQA 4A4KA 3CCUT 1RAGB 1RLQC 4HT9A 1D1CA 2X4XA 4PFZA 5DY9A 1FWZA 2M1HA 5KYWB 1Y96B 4HA8A 1N6AA 1R8OB 5KYXB 2E10A 4LDYA 1VQLA 4L59A 1YP5A 2XDPA 2YRVA 3O8VA 4HT8A 1M3CA 3JCMh 2L3SA 4J6YA 4FYYB 2JUFA 2FVUA 4RTZA 3OYDA 5CKBA 3CC7Q 1YITA 4M77C 4P5NA 5GANh 1N8RC 3CCMA 1C1AA 1VQOA 2F2WA 2V8KA 3BE3A 2GQVA 2X4WA 4C0FA 3RESA 1NPPA 1W70A 1NYFA 4C8QB 1H92A 1M1GA 4F7UE 1U5SA 2J06A 1PM3A 2AK5A 3QJYA 2X4YA 4M75G 5GAN2 2BZXA 4E2FB 2RF0A 1MGQA 3FRNA 2VB6A 2NUTB 3C12A 3RNJA 2X9HA 2O31A 1VQ5Q 2CREA 1CKAA 3M57A 4PNOA 5GAOm 2MIOA 1OPKA 1E6GA 2E3IA 2HKNA 1TU0B 1QCOA 5I21A 4KH0B 3UDCA 3VS0A 3QZ5B 3SWNB 4J6XA 1BIBA 2JOYA 2CYZB 2LX7A 2P84A 2RA2A 1K8AC 3TSZA 2C0IA 3CBPA 2RH2A 5GJVB 2DKGA 1T0JA 4RUGA 1K73R 1MHNA 4LUEA 1VQ4A 1M8VA 3ULRB 4C92A 3OMCA 2Y4XA 1NM7A 2NUZA 1TUGB 2EYWA 2XKOC 3TQ7P 1QP3A 2DVJA 4BE2A 1QLYA 3C94A 2KBTA 1M1KR 3OYIA 5LJ5j 3UT1A 1VQLT 4PJLA 3VJPA 1BBZA 1F1BB 2CP5A 1B07A 2RD1A 4XAXB 3JCMd 4IUQA 3L2RA 3VU3C 1YITT 1XTDA 3I56Q 3JB9F 4MMLA 4FYVB 3CCMT 5LJ3e 1YIJQ 1K9MU 3PFSA 1VQOT 5GANd 3U23A 2RQRA 1Q81C 2DX1A 1N27A 3S6WA 1YI2T 3LX7A 5GMKh 2KY9A 5KYYA 1I4K1 2QQSA 3WVEB 3OQ5A 3RKXA 3LWIA 1HJDA 4FYWB 2A37A 4JRIA 2HBPA 3MHXA 4FU6A 3JB9J 1GBRA 2QAZA 2CH4A 1Z9QA 3ASKA 3KFVA 2VGMA 2LZ6B 3I55A 1O75A 2LDMA 3EGXA 2KXDA 2HQXA 3G7ZA 4LDUA 4M78B 4QQGA 2QA4A 4A4FA 2EKHA 1SF9A 3P8BB 2A0FB 4EMKC 1YJNT 3LGLA 5LJ3h 2J6KA 2DTIA 2X51A 2H3EB 2VYTA 1YJWQ 1UB4A 2K5FA 1VQ4T 1H641 2Y4YA 4J9FA 3GIBA 3QWYA 2JTEA 1YNZA 2BZYA 3BY7A 1UGSB 2IVWA 4QW2A 1U8RA 3WVDB 3CC7A 3OYBA 4KH1B 2LJ3A 3CBMA 3J81E 4IIOA 4M7AA 2QTVA 3GBQA 2KEAA 1HK9A 3SB2A 1OULA 1KQSA 3E19A 1D3BA 2CUBA 2VGNA 2ABLA 2K5LA 2ED0A 4KULA 2R5AA 1X6OA 2RM4A 1WXTA 1T3SA 1KD1U 3CXCS 2EQJA 3CCQQ 4M78G 1W2BA 1D0XA 4O6JA 5L8RE 5KYUB 1IGUA 8ATCB 1N9RA 1TSFA 3TREA 2DL4A 2DJQA 4ZGEB 5IH2A 4C92B 5IT9E 1BI1A 2HBWA 4YTLA 3UPUA 3BFMA 5I2SA 4E7HA 3LYIA 4BDZA 4K11A 1VQ7A 3NTIA 2ESWA 2ZPFB 4QVZA 1X2KA 3C4SA 3RUXA 2KDSA 4JJCA 4PJMA 3CMAQ 2DMOA 2PUOB 5DM7R 3H0IA 2EBPA 3I55T 1UFFA 2EJFA 2DBKA 2KAFA 5FWBA 3H6ZA 1RI9A 2EQMA 2O01E 3EH2A 3M56A 2LVMA 3LH5A 4EMHA 1N8RU 2DL5A 2RQTA 3EHQA 4M77E 4CRIA 1WLPB 5A0DA 5CR2A 2QA4T 1NEBA 1Y57A 1KIKA 1T3LA 4FL6A 3VRYA 3OB9A 1M30A 4RCCA 2ROTA 4BI8B 5LJ3d 1KQ1A 4C0DC 5KYYB 5KH6A 1Q86C 1OU9A 3PVLA 4KGZB 1PNJA 1GXIE 3TU4K 4FW2A 3CC7T 5CKEA 2MWOA 4PFOA 3CC2Q 2BKDN 3CCVQ 2HAXA 1YIJA 2B86A 5CVIA 1K9MR 2HSEB 3EG3A 2RHXA 1UUEA 2QI2A 4DOVA 3CCJQ 2BE9B 5EC7A 1BI2A 2K2MA 3L2ZA 1KHIA 4IUVA 3RIRA 3JCMc 4M7DD 3EGXB 5AT1B 1BI0A 2RB6A 1JB0E 2EJ9A 3OMGA 3UF4A 1K8AU 1M1FA 1IREB 2FB7A 1VQ5T 2K79A 3JCMX 3H0HA 1Q7YU 2BE7D 2ATCB 4J9CA 1R0BG 4C5EA 4BUGA 1H3HA 2DEUA 1U1SA 4E7SA 4C5GA 1WGSA 2DNUA 2CDTA 4M75D 1X43A 2DA9A 2F2XA 2QDLA 1YITQ 2XIDA 1QVPA 2A3LA 1UJYA 1VQ8A 2ECZA 4RG2A 2HL3A 1MV3A 4XTUA 4M7AB 1PG5B 1I07A 1D3BB 5CAIA 1Y7XA 1ACMB 1IZ6A 3LLRA 3QIIA 2RHYA 3CCEA 1M3AA 2DEQA 2RHUA 3MEWA 1QVGS 2C0OA 5KYNA 3OYMA 2QG9B 4J5YA 3ZL7C 2DJZA 1Q81U 4NL3A 3REBB 3PTAA 2DD5A 4B6MA 1G83A 5FRNA 1NG2A 1HSQA 1I81A 1OYXA 2YUQA 2DBMA 1MNEA 4QKUA 2PQWA 4F7UG 2OTLA 4HKEA 3VS4A 4C8QD 4QQ6A 2FYKA 5J3BA 5FU6C 1AHJB 2XHCA 4AG2C 3EFRA 1KD1R 3OBWA 3CCQA 3QO3A 5LJ5h 1SRMA 3I56T 2CZ1B 2J6FA 1YIJT 4BDYA 4OMOA 2LQKA 2JMCA 4LDWA 1QVFA 1VQ4Q 1ZA1B 3CXCP 1Y07A 3M58A 3QSUA 3EFOA 1ZSZA 4BY6B 5FW9A 1ABOA 2L3RA 1PC0A 2MAMA 2KGTA 2IIMA 4M7DF 4PL6A 2KE9A 3OS2A 2LQ8A 3EAEA 1ZBXA 5CKDA 1D0ZA 2L5QA 5KE2A 3OYKA 3CC4A 4LXCA 3E2UA 4F17A 2EYQA 4JLIA 1MV0B 3CMAA 1MNDA 1MUZA 2MPXC 1WPYA 4KRTA 3CPWS 2GCXA 1WHKA 3FDRA 2LJ1A 5CO7A 2HL5C 2GBQA 2EGAA 3X26B 1AT1B 1N8RR 2D6FA 2L2PA 1B3QA 2K57A 2NWMA 2EWNA 4D6WA 4NS5A 5FRMA 1VYTA 3OSVA 4M75C 4A63B 1M2OA 4PJOB 2M0YA 4PJJA 5GMKm 2P4TA 1LCKA 4BD3A 1YJWT 2RK1A 1VYUA 2RI5A 1JXMA 1BI3A 2J05A 1MMNA 3A98A 3M0UA 3NHNA 1JJ2S 1AOJA 4N0AA 2E70A 3CC2A 1M90C 1JQQA 4TVRA 2NUPB 3JCMg 2HSPA 5IN1A 3URGA 3OY9A 1SKUB 4IUTA 3X24B 1I8FA 3SFMA 3E9GA 1TUDA 3I55Q 1WXBA 4OMMA 1CSKA 2WSFE 2QEXQ 2K3XA 1KHCA 2NYSA 5GANg 4AMCA 3PIOA 2J7IA 5HY6A 4DBHA 3QPHA 2QA4Q 3S3NA 3GOXA 1K8AR 2HCKA 3V7CA 3CCQT 4C8QC 5GAMj 1AWWA 3NTKA 1UEBA 5LJ5d 2RJFA 3E9FA 1E7OA 1BB9A 2K4YA 4E7LA 4A54A 4PJOG 3EGUA 1BKBA 2W10A 2EAYA 1WQWA 2H8HA 3QHSA 1N5ZA 5CKFA 1JBMA 4M77F 3JCMf 4FW1A 4M78A 1H3ZA 2GNCA 1SG5A 2DF6A 1TOVA 3M4GA 1RADB 3GLXA 2FO0A 2KXCA 4X1VA 2XI9A 3TSWA 5GANf 2JS2A 2GFUA 4XU0A 4RG8A 2FPEA 4PKCC 1G8XA 4CC3A 4N4HA 2Y90A 1GCQC 3R6OA 3CMAT 1Q86U 3FJPA 3SWNC 3T9NA 2HNIA 4JDSA 5M9OA 3JB9I 2YLCA 3ZBDA 3PMIA 1VQPQ 2DZ9A 2FPFA 2DZCA 1XJWB 2QQAA 4Y92A 1Q81R 3M55A 1QVGP 2JZ2A 3EFOB 2RQWA 1ZSZB 1VUBA 2O2OA 4OMFB 4X9DA 4L6V5 4DQ2A 1VQ7Q 2K6DA 2QTXA 1O9SA 2G3RA 2LNVA 3DLLA 3CC2T 4HCKA 1YCYA 3CCVT 1Q7YC 2RN8A 5KYUA 1YN8A 4WTOB 5GMKe 2M02A 4BE1A 3V8KA 1TUCA 1G2BA 4JRQA 3CCJT 2CUDA 1JU5C 5D6YA 1G5VA 1U3OA 4HCZA 2RJEA 4N0AC 2PZ1A 4J9GA 5HCKA 1TS9A 3GPLA 4C92D 2D9TA 3M0PA 2COZA 1RAFB 1WQ7A 2X3XD 5DLOA 1A0NB 3HL8A 1WHGA 4E7IA 2VXFA 2RJCA 2ZAEA 1FX7A 1VQNA 5D6WA 3OYJA 4F14A 2JN0A 1SPKA 1TTHB 4RMOA 2D1XA 4Y91A 1Y0MA 1IHWA 2QASA 3NPFA 1I5LA 1KG1A 2V1QA 1PKTA 3SDZA 2CZ0B 3CPWP 1U06A 2FRYA 4XTYA 1KC8U 2FRWA 3JCMW 4FYXB 4D8KA 4DEXA 3P8HA 2DL3A 4JPBW 3EH1A 2PVDB 6AT1B 1QW1A 4M78C 7AT1B 3TCJA 2EYZA 3M9QA 1PKSA 1R0CB 4DOWA 3VRZA 1Q82U 4RTUA 3RBBB 1KSWA 5HK0A 2DE0X 5LJ3g 1JEGA 3UATA 3M53A 2D8JA 1ABQA 1NJIC 1S1NA 1JJ2P 5GMKl 3DB3A 2K9GA 4Z02A 4OGEA 3QKJA 2QEXA 9ATCB 3EHRA 5FROA 1C6VX 3JV3A 4Q5WA 4M4ZA 3VKIA 4J8OA 2LJ0A 1BCOA 1IHVA 4HVVA 1VQ8Q 2LQNA 2E12A 4M7DE 2GTJA 1NE8A 4XU2A 2F1LA 4BB7A 1QCNA 3HTRA 4RCBA 5LJ3f 3VYGA 4F7UA 2DXBA 2MK5A 3JCMV 4IUPA 3CCEQ 3L2QA 1U1TA 4ME7A 5CIUA 3CCSA 2EJGA 2V8IA 2CP7A 2SEMA 5GAN8 4AFSC 1WXUA 2DXCA 1AEYA 4M75E 4C92C 3ER0A 4KUIA 1PRLC 4M7AD 1OZ2A 3WXMB 4A4GA 4PJNA 1Q86R 4MMKA 2OTLQ 1VQPA 1BU1A 3QWXX 3AT1B 3IQLA 2MCNA 1M90U 4DBRA 3EFSA 3FC3A 2O9SA 3VS5A 4HCCA 2DXUA 1J3TA 2XDDA 2F2VA 2K3YA 1IXDA 1WX6A 4QQDA 2K2VA 3JB9G 1PD1A 2AKKA 3MP6A 2MWPA 4Z89A 1YHQQ 1R77A 3JCMJ 4IURA 4J83A 5GAMe 1RAHB 2Z0WA 5GAN7 2F5TX 3V8LA 5GANj 3S3MA 4C8QE 3CC4Q 2CKKA 2O88A 3D7SB 4KGXB 1SSHA 3PVQA 1EIFA 2A28A 4QVDA 4BE0A 5GAOr 5A2QE 1OU8A 3CCRA 1RLPC 4FSSA 1OV3A 1S72A 2QEXT 1UGVA 5FU7B 5CQXA 4ZTJA 1UJ0A 5EG2A 2KI7A 3KUFA 2A36A 1T0HA 3H0FA 3FB9A 3RMSA 2VVKA 3I35A 2ZZDA 4NL2A 3L2UA 5GAOp 2O4XA 4FT4A 1JJ2A 1VQKQ 5KE3A 1XOVA 2A7YA 2P4RA 3SD4A 3CCST 5GAMh 2VASA 2RPNA 4MZMA 4JS4A 1KC8R 2CT3A 5I2MA 2JMAA 2BZ8A 1WJQA 4PJOA 3UA6A 4GBQA 4A53A 1G3YA 4AFZC 5IHKA 4E47A 3INZA 2FZKB 3FIFA 3OW2P 4M7AF 1RAIB 1WZOA 2HD0A 1K76A 4OMNA 1VQPT 5LL6S 4M7AC 4R55A 1Q82R 3E1SA 2ZPIB 4DBFA 2CSQA 1AZEA 2F5KA 4HCBA 1UGRB 1QKXA 1ZLMA 3KXTA 2NUPA 1B7TA 1M27C 4JJDA 4JRKA 1OQKA 2KNBB 2YLBA 3X28B 2JJ9A 3QUIA 1KQ2A 2GTOA 4F7UB 1AD5A 2HEQA 2ZPEB 4X34A 4XTVA 1UHCA 2DIQA 3ME9A 1QWFA 1UGQB 2DYIA 4CC4B 4EPCA 5LJ5e 5C0MA 4ANJA 1VQ7T 2QXFA 3L1AA 3V7SA 1E6HA 1K4US 2HKQB 3CCLA 2EIFA 1VQ9A 3RERA 2W0ZA 3VUBA 2FHDA 3GF5A 4LD6A 1OX8A 5LJ5g 2CZ7B 2RQUA 4C0ZA 2F69A 3ZFJA 2MYSA 1S72T 4MDXA 3M0TA 3REAB 3L2VA 1KC8C 1BYMA 3CMEA 4CI0C 3LW5E 2RHZA 4BY6C 2M0OA 4B9XA 1PCXA 3HRUA 4OB1B 4M78E 3I5SA 2QGFB 1X69A 2E41A 2FL7A 4JUVA 4Z88A 4LUDA 2I0NA 3DKMA 4ELZC 1SRLA 2X4JA 1Q82C 1M90R 4JJNK 5CQYA 4FSXA 2DAQA 4D8DA 3EG0A 4LE9A 5GAMd 2KROA 1OOTA 1TH7A 4OGCA 1NJIU 3P8DA 3CCUA 2JW4A 2VV5A 2OTJA 3HHTB 3QXEB 2DFUA 2RJDA 4KT0E 1YHQA 3H41A 2QYZA 4M77A 4LN2A 4PJOC 1M9SA 3CBOA 2YRDA 4OB2B 4ZN1A 2M16A 1VQNQ 1WHJA 1ZUUA 2EVRA 5A0GA 4B9WA 1FYNA 3PIPA 3BDUA 2K3BA 1UHFA 2O9VA 4PFPA 1NYGA 4RTTA 3V7RA 4E6RA 2B8AA 2YDLA 3SEMA 1QWEA 5GAN3 4JS5A 2O4XB 4M75F 3QYHB 3OYNA 4E7KA 4EMGA 1VQ8T 3MP1A 1GCPA 4C92E 3HPWA 1VQMQ 2E3HA 1W4SA 4PK4A 2V26A 1PHTA 2PU9B 2GF7A 5IAYA 2E65A 4C0GA 4ZGJB 3CCET 3AHUA 2QQRA 1VQKA 1Z9ZA 2P0PA 5GAN4 1HXDA 2GQIA 3N5BB 4M7DB 3VUZA 1QCFA 2OX7A 4VUBA 2AZSA 3OBYA 1JO8A 3JCMP 4MZTA 3F70A 1DJ7B 4N4GA 4R56A 2XDBA 1FMVA 3EG2A 3M5AA 2EYXA 2QQBA 4AFQC 5FLXE 1I5OB 2D0NA 2OTLT 2DERA 3JSCA 3GNGA 2V1RA 4C8QF 2KRNA 3MCAB 2ZPBB 1AWOA 1M3BA 2JS0A 2DO3A 1LVKA 2CGHA 1NBEB 4KBMB 1Q7YR 4BI4A 2E4HA 3NMZC 3MKDA 2IPOB 4RTYA 2LT4A 1AZGB 5L23A 1NLPC 2KVQG 1WFWA 3X20B 2BTTA 2OTJT 1RAEB 3JB9H 2KR3A 4J9HA 2ZPGB 4RKUE 4IIMA 3MPUB 1YHQT 3RR6A 5D7UA 3G4SA 1IGQA 3CCSQ 1RACB 4OB0B 3UWNA 3OA6A 2E1HA 2X35A 1HD3A 5D6XA 4BI3A 2DD4A 2RQVA 2COWA 4M78D 3CC4T 1ZSZC 2DL7A 4M7DG 2OAUA 3FJ5A 1D09B 2ED1A 2LQWA 3JB9D 1W1FA 1ZX6A 2V8JA 3VS1A 3G71A 3CXCA 1G3WA 1YWPA 3RMQA 2A08A 1AWJA 2MI6A 2YWWA 1I1JA 5A0LA 1YI2A 2PVGB 1Y71A 2FZCB 3OYEA 3HRTA 3THKA 5HKCA 3QBYA 2MMPA 2KT8A 3HSBA 5GAN5 3VYHB 2LC4A 3A1PA 2CT4A 1LOJA 4EDUA 1X01A 4A4HA 3G6EQ 2R5MA 1ZUKA 4M7AE 4LNPA 1VQKT 2JTFA 4M77B 2VUBA 3QYGB 2P0KA 2ZGWA 4ORZA 3CD6Q 4N4IA 2EYYA 4EMKA 2YUOA 1VIEA 5HK3A 2CP3A 1NJIR 3CQTA 4ATOA 5GAN6 4L5GA 2CZ6B 2LTOA 3MO8A 3CCRQ 2PNIA 1KQSP 1S72Q 4JJBA 3A8HB 4UC4A 2K5IA 1G3TA 4AFUC 2DVEA 1YJNA 2KYBA 2DILA 1QVFS 1EX4A 2COYA 2CP2A 3RKYA 4C8QG 3M0SA 3BW1A 1W2BP 1K0SA 1WNLA 2GFAA 2AIRB 2D8HA 3J80E 1VQ6A 1SHFA 3A8OB 3I5RA 2SRCA 2RO0A 4AG1C 3JAME 4FIBA
chains in the Genus database with same CATH topology
2KT1A 3O5ZA 1NEGA 2MOXA 2C0TA 1KFZA 1GBQA 2ENMA 1M3AA 1OEBA 4OMQA 5FWCA 1RLQC 2C0OA 2O88A 3VS2A 1SSHA 3ZL7C 2YSQA 3PVQA 1ZSGA 1EFNA 2A28A 1SHGA 3REBB 2XMFA 1G83A 1RLPC 1YCSB 1NG2A 4FSSA 1HSQA 1OV3A 1YP5A 1I0CA 1UGVA 2YUQA 2DBMA 1M3CA 2DYBA 2L3SA 3PE0A 3VS4A 2G6FX 4AG2C 1UJ0A 3M0QA 1WIEA 4RTZA 1SRMA 2OI3A 2J6FA 2A36A 4OMOA 2JMCA 1T0HA 2F2WA 3H0FA 2VVKA 2DRKA 3I35A 2AKLA 1WA7A 5IHNA 1W70A 1NYFA 1H92A 1WDXA 1XOVA 4JZ3A 5FW9A 1ABOA 1U5SA 2JT4A 2J06A 2AK5A 2P4RA 2RPNA 2KGTA 2BZXA 2IIMA 2RF0A 2CT3A 2LNHB 2JMAA 2KE9A 2BZ8A 2CH4W 2LCSA 3RNJA 3UA6A 2O31A 4GBQA 4AFZC 5IHKA 1ZUYA 4F17A 1VYVA 1MV0B 2CREA 1K9AA 1CKAA 1UDLA 1MUZA 4KRTA 4RTXA 2MIOA 1OPKA 1E6GA 1K76A 2LJ1A 4OMNA 2GBQA 2EGAA 2CSQA 1AZEA 3VS0A 1QKXA 1ZLMA 4R0KA 2L2PA 1B3QA 2NWMA 2X3WD 3R6NA 1M27C 2J6OA 2RNAA 4JJDA 2KNBB 4Z8AA 1VYTA 4A63B 2LX7A 2GTOA 3TSZA 1GL5A 2M0YA 2C0IA 1AD5A 1LCKA 2HEQA 1CKBA 5GJVB 1T0JA 4RUGA 1VYUA 4LUEA 1UHCA 1JXMA 1QWFA 4CC4B 3ULRB 2J05A 3A98A 3M0UA 3NHNA 4J9EA 1NM7A 2NUZA 2EYWA 1AOJA 2OJ2A 4ZNXA 4RTVA 2FPDA 2DVJA 1E6HA 1K4US 1QKWA 4HXJA 1QLYA 5I11A 1JQQA 2KBTA 1NLOC 2HSPA 1X6BA 4CC2A 2W0ZA 1TUDA 1WXBA 4OMMA 3VS6A 1H8KA 2RQUA 1CSKA 2VWFA 2L3QA 1W6XA 2JM9A 1BBZA 1B07A 2J7IA 3M0TA 3REAB 1K1ZA 2DM1A 2HCKA 1AWWA 2DL8A 3NGPA 1E7OA 1BB9A 2HDAA 3EGUA 3I5SA 3U23A 1X69A 2W10A 2RQRA 2DRMA 2DX1A 2H8HA 1N5ZA 4Z88A 4LUDA 2I0NA 1SRLA 2GNCA 4GLMA 2DF6A 4D8DA 1IO6A 3EG0A 5GJWB 4LE9A 2EGCA 1OOTA 2FO0A 2KROA 2KXCA 4X1VA 1HJDA 3SHWA 3TSWA 2JW4A 2A37A 2JS2A 2FPEA 4CC3A 1GBRA 1GCQC 2CH4A 1Z9QA 3KFVA 1GFCA 2LZ6B 3H41A 4RTWA 2RMOA 4LN2A 1PWTA 2YUNA 2FPFA 2KXDA 2VKNA 1PRMC 4Y92A 1ZUUA 2EKHA 1X6GA 1ZBJA 2EVRA 4J9IA 1FYNA 1SEMA 4HVWA 2K3BA 4OMLA 1UHFA 2O9VA 1NYGA 2J6KA 4RTTA 2RQWA 4E6RA 2O2OA 2YDLA 1QWEA 3SEMA 1GFDA 1UTIA 4J9FA 2CSIA 2DLPA 3QWYA 2JTEA 1YNZA 2AZVA 2BZYA 3VS3A 4CC7A 2K6DA 2LMJA 1GCPA 4HCKA 2EW3A 2KYMA 2LJ3A 4WCIA 4IIOA 2RN8A 1TG0A 1YN8A 3GBQA 1TUCA 2KEAA 1G2BA 1PHTA 3TVTA 2ROLA 2CUDA 1JU5C 2KRSA 1U3OA 2CUBA 1Z9ZA 1X2QA 2PZ1A 4J9GA 2ABLA 5HCKA 2ED0A 2GQIA 3UA7A 1KJWA 3M0PA 1WXTA 1QCFA 2X3XD 1T3SA 1A0NB 2AZSA 1UECA 2PTKA 1JO8A 2YT6A 3EG2A 5IHIA 4F14A 2EYXA 3C0CA 4AFQC 1SPKA 2DL4A 3M0RA 2DJQA 2D1XA 2D0NA 5IH2A 1Y0MA 4JZ4A 2V1RA 2KRNA 1AWOA 2HBWA 3NPFA 1M3BA 1VA7A 2JS0A 2V1QA 1PKTA 4OMPA 2GGRA 1U06A 2FRYA 4K11A 2FRWA 3NMZC 4RTYA 4F16A 1AZGB 5L23A 1NLPC 2ESWA 4D8KA 1X2KA 4DEXA 1WFWA 2BTTA 5I22A 2DL3A 2KR3A 1JXOA 4J9HA 4JPBW 2L3PA 4JJCA 2FEIA 1AWXA 1OPLA 4IIMA 2K7AA 3EG1A 2DMOA 2EYZA 2FG0A 3H0IA 2EBPA 4HVUA 1PKSA 1UFFA 2DBKA 3VRZA 5FWBA 1RI9A 1HD3A 4RTUA 3RBBB 1KSWA 2RQVA 2DE0X 1JEGA 2EQIA 3LH5A 2DL5A 2RQTA 2DL7A 3EHQA 1WLPB 3FJ5A 3UATA 2D8JA 1WYXA 2ED1A 1ABQA 4J9DA 1NEBA 3I9QA 2LQWA 1Y57A 1KIKA 1S1NA 1T3LA 2EPDA 1GRIA 2KRMA 3VRYA 1W1FA 4DEYA 2K9GA 1ZX6A 1M30A 2ROTA 2LP5A 3VS1A 3EHRA 1YWPA 4QT7A 1UE9A 2A08A 1AWJA 3JV3A 1I1JA 4M4ZA 2L0AA 2LJ0A 1BK2A 3PVLA 4HVVA 1PNJA 2LQNA 1GCQA 1YWOA 1FMKA 3THKA 2KT8A 2GTJA 2CT4A 2B86A 3EG3A 1UUEA 5IXFA 5EC7A 2YUPA 2K2MA 1ZUKA 1M8MA 4LNPA 2JXBA 4ORZA 4J9BA 4ESRA 2EYYA 2SEMA 1UG1A 4AFSC 1WXUA 2YUOA 1AEYA 1X27A 3UF4A 3CQTA 1V1CA 2K79A 3H0HA 4EIKA 1K0XA 2PNIA 1PRLC 2EGEA 4J9CA 4JJBA 4AFUC 1H3HA 2KYBA 2M51A 1BU1A 2DILA 1WI7A 3QWXX 1RUWA 2DNUA 2CDTA 2OAWA 3IQLA 1X43A 2MCNA 2DA9A 2F2XA 3VS7A 2QDLA 1AVZC 2JM8A 1UJYA 2O9SA 3VS5A 3M0SA 2ECZA 5ECAA 1J3TA 1K0SA 1MV3A 1ARKA 2E5KA 2F2VA 5IXBA 2D8HA 1SHFA 1WX6A 3I5RA 2SRCA 4AG1C 2AKKA 1I07A 4Z89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT1 A;  3O5Z A;  1NEG A;  2MOX A;  2C0T A;  1KFZ A;  1GBQ A;  2ENM A;  1M3A A;  1OEB A;  4OMQ A;  5FWC A;  1RLQ C;  2C0O A;  2O88 A;  3VS2 A;  1SSH A;  3ZL7 C;  2YSQ A;  3PVQ A;  1ZSG A;  1EFN A;  2A28 A;  1SHG A;  3REB B;  2XMF A;  1G83 A;  1RLP C;  1YCS B;  1NG2 A;  4FSS A;  1HSQ A;  1OV3 A;  1YP5 A;  1I0C A;  1UGV A;  2YUQ A;  2DBM A;  1M3C A;  2DYB A;  2L3S A;  3PE0 A;  3VS4 A;  2G6F X;  4AG2 C;  1UJ0 A;  3M0Q A;  1WIE A;  4RTZ A;  1SRM A;  2OI3 A;  2J6F A;  2A36 A;  4OMO A;  2JMC A;  1T0H A;  2F2W A;  3H0F A;  2VVK A;  2DRK A;  3I35 A;  2AKL A;  1WA7 A;  5IHN A;  1W70 A;  1NYF A;  1H92 A;  1WDX A;  1XOV A;  4JZ3 A;  5FW9 A;  1ABO A;  1U5S A;  2JT4 A;  2J06 A;  2AK5 A;  2P4R A;  2RPN A;  2KGT A;  2BZX A;  2IIM A;  2RF0 A;  2CT3 A;  2LNH B;  2JMA A;  2KE9 A;  2BZ8 A;  2CH4 W;  2LCS A;  3RNJ A;  3UA6 A;  2O31 A;  4GBQ A;  4AFZ C;  5IHK A;  1ZUY A;  4F17 A;  1VYV A;  1MV0 B;  2CRE A;  1K9A A;  1CKA A;  1UDL A;  1MUZ A;  4KRT A;  4RTX A;  2MIO A;  1OPK A;  1E6G A;  1K76 A;  2LJ1 A;  4OMN A;  2GBQ A;  2EGA A;  2CSQ A;  1AZE A;  3VS0 A;  1QKX A;  1ZLM A;  4R0K A;  2L2P A;  1B3Q A;  2NWM A;  2X3W D;  3R6N A;  1M27 C;  2J6O A;  2RNA A;  4JJD A;  2KNB B;  4Z8A A;  1VYT A;  4A63 B;  2LX7 A;  2GTO A;  3TSZ A;  1GL5 A;  2M0Y A;  2C0I A;  1AD5 A;  1LCK A;  2HEQ A;  1CKB A;  5GJV B;  1T0J A;  4RUG A;  1VYU A;  4LUE A;  1UHC A;  1JXM A;  1QWF A;  4CC4 B;  3ULR B;  2J05 A;  3A98 A;  3M0U A;  3NHN A;  4J9E A;  1NM7 A;  2NUZ A;  2EYW A;  1AOJ A;  2OJ2 A;  4ZNX A;  4RTV A;  2FPD A;  2DVJ A;  1E6H A;  1K4U S;  1QKW A;  4HXJ A;  1QLY A;  5I11 A;  1JQQ A;  2KBT A;  1NLO C;  2HSP A;  1X6B A;  4CC2 A;  2W0Z A;  1TUD A;  1WXB A;  4OMM A;  3VS6 A;  1H8K A;  2RQU A;  1CSK A;  2VWF A;  2L3Q A;  1W6X A;  2JM9 A;  1BBZ A;  1B07 A;  2J7I A;  3M0T A;  3REA B;  1K1Z A;  2DM1 A;  2HCK A;  1AWW A;  2DL8 A;  3NGP A;  1E7O A;  1BB9 A;  2HDA A;  3EGU A;  3I5S A;  3U23 A;  1X69 A;  2W10 A;  2RQR A;  2DRM A;  2DX1 A;  2H8H A;  1N5Z A;  4Z88 A;  4LUD A;  2I0N A;  1SRL A;  2GNC A;  4GLM A;  2DF6 A;  4D8D A;  1IO6 A;  3EG0 A;  5GJW B;  4LE9 A;  2EGC A;  1OOT A;  2FO0 A;  2KRO A;  2KXC A;  4X1V A;  1HJD A;  3SHW A;  3TSW A;  2JW4 A;  2A37 A;  2JS2 A;  2FPE A;  4CC3 A;  1GBR A;  1GCQ C;  2CH4 A;  1Z9Q A;  3KFV A;  1GFC A;  2LZ6 B;  3H41 A;  4RTW A;  2RMO A;  4LN2 A;  1PWT A;  2YUN A;  2FPF A;  2KXD A;  2VKN A;  1PRM C;  4Y92 A;  1ZUU A;  2EKH A;  1X6G A;  1ZBJ A;  2EVR A;  4J9I A;  1FYN A;  1SEM A;  4HVW A;  2K3B A;  4OML A;  1UHF A;  2O9V A;  1NYG A;  2J6K A;  4RTT A;  2RQW A;  4E6R A;  2O2O A;  2YDL A;  1QWE A;  3SEM A;  1GFD A;  1UTI A;  4J9F A;  2CSI A;  2DLP A;  3QWY A;  2JTE A;  1YNZ A;  2AZV A;  2BZY A;  3VS3 A;  4CC7 A;  2K6D A;  2LMJ A;  1GCP A;  4HCK A;  2EW3 A;  2KYM A;  2LJ3 A;  4WCI A;  4IIO A;  2RN8 A;  1TG0 A;  1YN8 A;  3GBQ A;  1TUC A;  2KEA A;  1G2B A;  1PHT A;  3TVT A;  2ROL A;  2CUD A;  1JU5 C;  2KRS A;  1U3O A;  2CUB A;  1Z9Z A;  1X2Q A;  2PZ1 A;  4J9G A;  2ABL A;  5HCK A;  2ED0 A;  2GQI A;  3UA7 A;  1KJW A;  3M0P A;  1WXT A;  1QCF A;  2X3X D;  1T3S A;  1A0N B;  2AZS A;  1UEC A;  2PTK A;  1JO8 A;  2YT6 A;  3EG2 A;  5IHI A;  4F14 A;  2EYX A;  3C0C A;  4AFQ C;  1SPK A;  2DL4 A;  3M0R A;  2DJQ A;  2D1X A;  2D0N A;  5IH2 A;  1Y0M A;  4JZ4 A;  2V1R A;  2KRN A;  1AWO A;  2HBW A;  3NPF A;  1M3B A;  1VA7 A;  2JS0 A;  2V1Q A;  1PKT A;  4OMP A;  2GGR A;  1U06 A;  2FRY A;  4K11 A;  2FRW A;  3NMZ C;  4RTY A;  4F16 A;  1AZG B;  5L23 A;  1NLP C;  2ESW A;  4D8K A;  1X2K A;  4DEX A;  1WFW A;  2BTT A;  5I22 A;  2DL3 A;  2KR3 A;  1JXO A;  4J9H A;  4JPB W;  2L3P A;  4JJC A;  2FEI A;  1AWX A;  1OPL A;  4IIM A;  2K7A A;  3EG1 A;  2DMO A;  2EYZ A;  2FG0 A;  3H0I A;  2EBP A;  4HVU A;  1PKS A;  1UFF A;  2DBK A;  3VRZ A;  5FWB A;  1RI9 A;  1HD3 A;  4RTU A;  3RBB B;  1KSW A;  2RQV A;  2DE0 X;  1JEG A;  2EQI A;  3LH5 A;  2DL5 A;  2RQT A;  2DL7 A;  3EHQ A;  1WLP B;  3FJ5 A;  3UAT A;  2D8J A;  1WYX A;  2ED1 A;  1ABQ A;  4J9D A;  1NEB A;  3I9Q A;  2LQW A;  1Y57 A;  1KIK A;  1S1N A;  1T3L A;  2EPD A;  1GRI A;  2KRM A;  3VRY A;  1W1F A;  4DEY A;  2K9G A;  1ZX6 A;  1M30 A;  2ROT A;  2LP5 A;  3VS1 A;  3EHR A;  1YWP A;  4QT7 A;  1UE9 A;  2A08 A;  1AWJ A;  3JV3 A;  1I1J A;  4M4Z A;  2L0A A;  2LJ0 A;  1BK2 A;  3PVL A;  4HVV A;  1PNJ A;  2LQN A;  1GCQ A;  1YWO A;  1FMK A;  3THK A;  2KT8 A;  2GTJ A;  2CT4 A;  2B86 A;  3EG3 A;  1UUE A;  5IXF A;  5EC7 A;  2YUP A;  2K2M A;  1ZUK A;  1M8M A;  4LNP A;  2JXB A;  4ORZ A;  4J9B A;  4ESR A;  2EYY A;  2SEM A;  1UG1 A;  4AFS C;  1WXU A;  2YUO A;  1AEY A;  1X27 A;  3UF4 A;  3CQT A;  1V1C A;  2K79 A;  3H0H A;  4EIK A;  1K0X A;  2PNI A;  1PRL C;  2EGE A;  4J9C A;  4JJB A;  4AFU C;  1H3H A;  2KYB A;  2M51 A;  1BU1 A;  2DIL A;  1WI7 A;  3QWX X;  1RUW A;  2DNU A;  2CDT A;  2OAW A;  3IQL A;  1X43 A;  2MCN A;  2DA9 A;  2F2X A;  3VS7 A;  2QDL A;  1AVZ C;  2JM8 A;  1UJY A;  2O9S A;  3VS5 A;  3M0S A;  2ECZ A;  5ECA A;  1J3T A;  1K0S A;  1MV3 A;  1ARK A;  2E5K A;  2F2V A;  5IXB A;  2D8H A;  1SHF A;  1WX6 A;  3I5R A;  2SRC A;  4AG1 C;  2AKK A;  1I07 A;  4Z89 A; 
#chains in the Genus database with same CATH topology
 1B34 B;  2KT1 A;  3G4S T;  1WHL A;  3VV0 A;  3PNW C;  1NEG A;  1TXQ A;  2MOX A;  2C0T A;  1KFZ A;  1GBQ A;  3OW2 S;  2R58 A;  2BIV A;  4M77 G;  5FWC A;  2R57 A;  1VQM A;  3OSS C;  4M78 F;  3LH0 A;  1WHH A;  3VS2 A;  2XU8 A;  2PVO B;  4MDW A;  2YSQ A;  2NLU A;  1ZSG A;  1EFN A;  3JRZ A;  3JCM b;  1SHG A;  3PMT A;  4XQ3 A;  1D0Y A;  2XMF A;  2DK3 A;  1OI1 A;  1YCS B;  3G71 T;  1I0C A;  4PLI A;  4XTX A;  2DYB A;  3OYG A;  3PE0 A;  1JRI A;  1ZA2 B;  1ZQ1 A;  2G6F X;  4C5H A;  4FCY A;  2AHJ B;  3M0Q A;  1WIE A;  5J26 A;  3DLM A;  1M4Z A;  2FZG B;  2OI3 A;  1C0M A;  2L8D A;  3QJ6 A;  1D1A A;  4ZN3 A;  3NTH A;  2DRK A;  2AKL A;  1WA7 A;  5IHN A;  5J39 A;  4PJO E;  1WDX A;  4JZ3 A;  2JT4 A;  4OF1 A;  1K73 C;  2KSS A;  1RAB B;  2VXE A;  3CCL Q;  2LNH B;  3MEV A;  3MEU A;  2CH4 W;  2DTO A;  2LCS A;  1VQ9 Q;  2HZY A;  1QP2 A;  2M9U A;  1ZUY A;  2RK2 A;  4XU1 A;  3MET A;  1VYV A;  1QVG A;  1K9A A;  1UDL A;  5GAO q;  2CP6 A;  4RTX A;  1M1K C;  3QZ9 B;  2IG0 A;  4IUU A;  2E64 A;  2DPP B;  3S3O A;  1OX9 A;  4ELY C;  4C92 F;  1LPL A;  1UGP B;  3CME Q;  4KUD K;  3A8L B;  4XK8 E;  3L2W A;  4R0K A;  2X3W D;  3R6N A;  2J6O A;  2RNA A;  3A8M B;  1VQN T;  4Z8A A;  1YBY A;  4II1 A;  3DB4 A;  1VQ6 T;  1GL5 A;  1CKB A;  2KMT A;  2P0Q A;  4O5V A;  1EZZ B;  1YJ9 Q;  4X9C A;  3V8J A;  4J7I A;  3J7A F;  1WHM A;  4J9E A;  3OYF A;  4EMK B;  1M5Q 1;  2OJ2 A;  3LGF A;  4RTV A;  2FPD A;  4ZNX A;  3CCU Q;  1VQM T;  2OTJ Q;  1QKW A;  4HXJ A;  2LCC A;  5I11 A;  2WSC E;  3Q1J A;  1NLO C;  5FU7 C;  1X6B A;  3FLG A;  2ZCF B;  4CC2 A;  2DIG A;  2QDY B;  1WJS A;  1VQ5 A;  4FT2 A;  3G6E A;  3VS6 A;  1IB8 A;  8AT1 B;  3RDV A;  1HYO A;  1H8K A;  2VWF A;  2L3Q A;  3RKW A;  1W6X A;  2JM9 A;  4JLG A;  4OB3 B;  3M4Y A;  3CD6 A;  3QG1 A;  4PLL A;  5KCH A;  1K1Z A;  3OYA A;  3MEA A;  2DM1 A;  3PT9 A;  3CPW A;  1MMA A;  2DL8 A;  5GAM g;  3NGP A;  3PGG A;  2HDA A;  1BIA A;  4NOY A;  3H8Z A;  2DRM A;  2HQH A;  2WAC A;  2YRC A;  1FMW A;  1RI0 A;  5GAO l;  4AT1 B;  3BDL A;  2PUK B;  4GLM A;  2HQE A;  3GP8 A;  1IO6 A;  5GJW B;  4LDX A;  3TEE A;  2EGC A;  1KK7 A;  3SHW A;  1M2V A;  3EG9 A;  1QVF P;  1XNI A;  3L42 A;  1GFC A;  2DTH A;  4F7U F;  4DBQ A;  4RTW A;  3QDF A;  2RMO A;  5GAM f;  1PWT A;  3OYL A;  2YUN A;  2ZPH B;  1G3S A;  2H3J A;  2LT1 A;  2BUD A;  2VKN A;  1P92 A;  5C6S A;  4XTW A;  3EGD A;  1PRM C;  4C92 G;  2WSE E;  3MJX A;  4J6W A;  5GAO n;  4E7J A;  4PJO D;  1X6G A;  1ZBJ A;  2KQW A;  4J9I A;  4V2S A;  2XG8 D;  1SEM A;  2DET A;  3OS5 A;  1V29 B;  4HVW A;  3I56 A;  4OML A;  2DXT A;  1Q95 G;  2JNG A;  2CP0 A;  4QVC A;  1GFD A;  1UTI A;  4M7D A;  1RL2 A;  2CSI A;  2DLP A;  2LCL A;  2AZV A;  2YXY A;  3G1J A;  3VS3 A;  4CC7 A;  2LMJ A;  3OS0 A;  2EW3 A;  2KYM A;  4WCI A;  4C0D B;  1TG0 A;  3G4S Q;  3TVT A;  2ROL A;  2QK0 A;  3HFO A;  3G6E T;  2KRS A;  1ZHI A;  3A5Z B;  2E6Z A;  1X2Q A;  3H9N A;  1VQL Q;  4LD9 K;  4M75 A;  1MMD A;  3CD6 T;  3GNF B;  1IRX A;  3UA7 A;  1KJW A;  3FEO A;  2LRQ A;  4OVA A;  5KCO A;  2MF2 A;  5GMK j;  3HFN A;  1UEC A;  2E6N A;  2PTK A;  3HKS A;  2YT6 A;  2EKO A;  2EQU A;  3CCR T;  1V76 A;  3CCM Q;  5IHI A;  3G71 Q;  5KYW A;  1Y96 A;  4BAC A;  4KGV B;  1VQO Q;  3C0C A;  3M0R A;  1NPR A;  1RAA B;  2QQ9 A;  5KYX A;  4JZ4 A;  1YI2 Q;  3OS1 A;  1YJW A;  1VA7 A;  4C5I A;  2EQK A;  3LWH A;  5CKH A;  4OMP A;  2GGR A;  2QGG A;  3HRS A;  4F16 A;  3OYY A;  3KBG A;  5I22 A;  3CEY A;  1JXO A;  2L89 A;  2L3P A;  2FEI A;  1AWX A;  1OPL A;  1PSE A;  2K7A A;  3EG1 A;  3M59 A;  4GY5 A;  1YJ9 A;  1K9M C;  1QQJ A;  4IKF A;  5DLQ E;  2FG0 A;  4HVU A;  1QMC A;  4C8Q A;  1KQS S;  5LJ5 f;  4DA4 A;  5LJ3 j;  2EQI A;  1VOM A;  5CK9 A;  2JTM A;  2NUT A;  1WYX A;  4J9D A;  3NFC A;  3I9Q A;  4PJO F;  2EPD A;  1GRI A;  2KRM A;  1NZ9 A;  1YJN Q;  4DEY A;  4JRP A;  1W2B S;  2XK0 A;  2LP5 A;  1K73 U;  1OZ3 A;  4M7A G;  2XIC A;  1UE9 A;  4QT7 A;  3ZEH A;  4A4E A;  2L0A A;  4XU3 A;  4F04 B;  4M77 D;  1BK2 A;  1WJR A;  2KK4 A;  3A8G B;  1BCM A;  3CPF A;  1GCQ A;  1YWO A;  1FMK A;  2HMA A;  1VIF A;  2RI3 A;  1M2V B;  1TWB A;  2VC8 A;  3SWN A;  1VQ6 Q;  3EG9 B;  2C06 A;  1M1K U;  3JCM Q;  5FU6 B;  2D0Q B;  4M7D C;  2JVV A;  2E5Q A;  5IXF A;  3OW2 A;  2YUP A;  3MP8 A;  1FXX A;  1M8M A;  4J7F A;  2XD0 A;  2JXB A;  1PD0 A;  4J9B A;  4WF2 A;  4ESR A;  4GLK A;  1UG1 A;  3CCL T;  4XTZ A;  2I2L A;  3EGD B;  1X27 A;  4ZTF A;  1VQ9 T;  4OP0 A;  1N9S A;  1MMG A;  5AYF A;  1V1C A;  4EIK A;  5GMK i;  1K0X A;  3C95 A;  1B34 A;  2EGE A;  1YFN A;  2YHT A;  2EFI A;  3X25 B;  4MZP A;  2M51 A;  3JCM e;  1WI7 A;  1RUW A;  3CME T;  2OAW A;  1XQH A;  3VS7 A;  1AVZ C;  4E7Z A;  2JM8 A;  1SSF A;  3HP9 A;  4LDV A;  5CCA A;  4Y28 E;  5ECA A;  2CS7 A;  5GAN e;  1ARK A;  2AT1 B;  2E5K A;  2LX9 A;  5IXB A;  1KD1 C;  3M54 A;  3CCV A;  1LNX A;  1X75 C;  2RHI A;  2RI2 A;  1YJ9 T;  3QDR B;  4FM4 B;  1PSF A;  3CCJ A;  4ZGD B;  3O5Z A;  4M75 B;  1D1B A;  1LJO A;  3OYC A;  2ENM A;  3OYH A;  1OEB A;  4OMQ A;  4A4K A;  3CCU T;  1RAG B;  1RLQ C;  4HT9 A;  1D1C A;  2X4X A;  4PFZ A;  5DY9 A;  1FWZ A;  2M1H A;  5KYW B;  1Y96 B;  4HA8 A;  1N6A A;  1R8O B;  5KYX B;  2E10 A;  4LDY A;  1VQL A;  4L59 A;  1YP5 A;  2XDP A;  2YRV A;  3O8V A;  4HT8 A;  1M3C A;  3JCM h;  2L3S A;  4J6Y A;  4FYY B;  2JUF A;  2FVU A;  4RTZ A;  3OYD A;  5CKB A;  3CC7 Q;  1YIT A;  4M77 C;  4P5N A;  5GAN h;  1N8R C;  3CCM A;  1C1A A;  1VQO A;  2F2W A;  2V8K A;  3BE3 A;  2GQV A;  2X4W A;  4C0F A;  3RES A;  1NPP A;  1W70 A;  1NYF A;  4C8Q B;  1H92 A;  1M1G A;  4F7U E;  1U5S A;  2J06 A;  1PM3 A;  2AK5 A;  3QJY A;  2X4Y A;  4M75 G;  5GAN 2;  2BZX A;  4E2F B;  2RF0 A;  1MGQ A;  3FRN A;  2VB6 A;  2NUT B;  3C12 A;  3RNJ A;  2X9H A;  2O31 A;  1VQ5 Q;  2CRE A;  1CKA A;  3M57 A;  4PNO A;  5GAO m;  2MIO A;  1OPK A;  1E6G A;  2E3I A;  2HKN A;  1TU0 B;  1QCO A;  5I21 A;  4KH0 B;  3UDC A;  3VS0 A;  3QZ5 B;  3SWN B;  4J6X A;  1BIB A;  2JOY A;  2CYZ B;  2LX7 A;  2P84 A;  2RA2 A;  1K8A C;  3TSZ A;  2C0I A;  3CBP A;  2RH2 A;  5GJV B;  2DKG A;  1T0J A;  4RUG A;  1K73 R;  1MHN A;  4LUE A;  1VQ4 A;  1M8V A;  3ULR B;  4C92 A;  3OMC A;  2Y4X A;  1NM7 A;  2NUZ A;  1TUG B;  2EYW A;  2XKO C;  3TQ7 P;  1QP3 A;  2DVJ A;  4BE2 A;  1QLY A;  3C94 A;  2KBT A;  1M1K R;  3OYI A;  5LJ5 j;  3UT1 A;  1VQL T;  4PJL A;  3VJP A;  1BBZ A;  1F1B B;  2CP5 A;  1B07 A;  2RD1 A;  4XAX B;  3JCM d;  4IUQ A;  3L2R A;  3VU3 C;  1YIT T;  1XTD A;  3I56 Q;  3JB9 F;  4MML A;  4FYV B;  3CCM T;  5LJ3 e;  1YIJ Q;  1K9M U;  3PFS A;  1VQO T;  5GAN d;  3U23 A;  2RQR A;  1Q81 C;  2DX1 A;  1N27 A;  3S6W A;  1YI2 T;  3LX7 A;  5GMK h;  2KY9 A;  5KYY A;  1I4K 1;  2QQS A;  3WVE B;  3OQ5 A;  3RKX A;  3LWI A;  1HJD A;  4FYW B;  2A37 A;  4JRI A;  2HBP A;  3MHX A;  4FU6 A;  3JB9 J;  1GBR A;  2QAZ A;  2CH4 A;  1Z9Q A;  3ASK A;  3KFV A;  2VGM A;  2LZ6 B;  3I55 A;  1O75 A;  2LDM A;  3EGX A;  2KXD A;  2HQX A;  3G7Z A;  4LDU A;  4M78 B;  4QQG A;  2QA4 A;  4A4F A;  2EKH A;  1SF9 A;  3P8B B;  2A0F B;  4EMK C;  1YJN T;  3LGL A;  5LJ3 h;  2J6K A;  2DTI A;  2X51 A;  2H3E B;  2VYT A;  1YJW Q;  1UB4 A;  2K5F A;  1VQ4 T;  1H64 1;  2Y4Y A;  4J9F A;  3GIB A;  3QWY A;  2JTE A;  1YNZ A;  2BZY A;  3BY7 A;  1UGS B;  2IVW A;  4QW2 A;  1U8R A;  3WVD B;  3CC7 A;  3OYB A;  4KH1 B;  2LJ3 A;  3CBM A;  3J81 E;  4IIO A;  4M7A A;  2QTV A;  3GBQ A;  2KEA A;  1HK9 A;  3SB2 A;  1OUL A;  1KQS A;  3E19 A;  1D3B A;  2CUB A;  2VGN A;  2ABL A;  2K5L A;  2ED0 A;  4KUL A;  2R5A A;  1X6O A;  2RM4 A;  1WXT A;  1T3S A;  1KD1 U;  3CXC S;  2EQJ A;  3CCQ Q;  4M78 G;  1W2B A;  1D0X A;  4O6J A;  5L8R E;  5KYU B;  1IGU A;  8ATC B;  1N9R A;  1TSF A;  3TRE A;  2DL4 A;  2DJQ A;  4ZGE B;  5IH2 A;  4C92 B;  5IT9 E;  1BI1 A;  2HBW A;  4YTL A;  3UPU A;  3BFM A;  5I2S A;  4E7H A;  3LYI A;  4BDZ A;  4K11 A;  1VQ7 A;  3NTI A;  2ESW A;  2ZPF B;  4QVZ A;  1X2K A;  3C4S A;  3RUX A;  2KDS A;  4JJC A;  4PJM A;  3CMA Q;  2DMO A;  2PUO B;  5DM7 R;  3H0I A;  2EBP A;  3I55 T;  1UFF A;  2EJF A;  2DBK A;  2KAF A;  5FWB A;  3H6Z A;  1RI9 A;  2EQM A;  2O01 E;  3EH2 A;  3M56 A;  2LVM A;  3LH5 A;  4EMH A;  1N8R U;  2DL5 A;  2RQT A;  3EHQ A;  4M77 E;  4CRI A;  1WLP B;  5A0D A;  5CR2 A;  2QA4 T;  1NEB A;  1Y57 A;  1KIK A;  1T3L A;  4FL6 A;  3VRY A;  3OB9 A;  1M30 A;  4RCC A;  2ROT A;  4BI8 B;  5LJ3 d;  1KQ1 A;  4C0D C;  5KYY B;  5KH6 A;  1Q86 C;  1OU9 A;  3PVL A;  4KGZ B;  1PNJ A;  1GXI E;  3TU4 K;  4FW2 A;  3CC7 T;  5CKE A;  2MWO A;  4PFO A;  3CC2 Q;  2BKD N;  3CCV Q;  2HAX A;  1YIJ A;  2B86 A;  5CVI A;  1K9M R;  2HSE B;  3EG3 A;  2RHX A;  1UUE A;  2QI2 A;  4DOV A;  3CCJ Q;  2BE9 B;  5EC7 A;  1BI2 A;  2K2M A;  3L2Z A;  1KHI A;  4IUV A;  3RIR A;  3JCM c;  4M7D D;  3EGX B;  5AT1 B;  1BI0 A;  2RB6 A;  1JB0 E;  2EJ9 A;  3OMG A;  3UF4 A;  1K8A U;  1M1F A;  1IRE B;  2FB7 A;  1VQ5 T;  2K79 A;  3JCM X;  3H0H A;  1Q7Y U;  2BE7 D;  2ATC B;  4J9C A;  1R0B G;  4C5E A;  4BUG A;  1H3H A;  2DEU A;  1U1S A;  4E7S A;  4C5G A;  1WGS A;  2DNU A;  2CDT A;  4M75 D;  1X43 A;  2DA9 A;  2F2X A;  2QDL A;  1YIT Q;  2XID A;  1QVP A;  2A3L A;  1UJY A;  1VQ8 A;  2ECZ A;  4RG2 A;  2HL3 A;  1MV3 A;  4XTU A;  4M7A B;  1PG5 B;  1I07 A;  1D3B B;  5CAI A;  1Y7X A;  1ACM B;  1IZ6 A;  3LLR A;  3QII A;  2RHY A;  3CCE A;  1M3A A;  2DEQ A;  2RHU A;  3MEW A;  1QVG S;  2C0O A;  5KYN A;  3OYM A;  2QG9 B;  4J5Y A;  3ZL7 C;  2DJZ A;  1Q81 U;  4NL3 A;  3REB B;  3PTA A;  2DD5 A;  4B6M A;  1G83 A;  5FRN A;  1NG2 A;  1HSQ A;  1I81 A;  1OYX A;  2YUQ A;  2DBM A;  1MNE A;  4QKU A;  2PQW A;  4F7U G;  2OTL A;  4HKE A;  3VS4 A;  4C8Q D;  4QQ6 A;  2FYK A;  5J3B A;  5FU6 C;  1AHJ B;  2XHC A;  4AG2 C;  3EFR A;  1KD1 R;  3OBW A;  3CCQ A;  3QO3 A;  5LJ5 h;  1SRM A;  3I56 T;  2CZ1 B;  2J6F A;  1YIJ T;  4BDY A;  4OMO A;  2LQK A;  2JMC A;  4LDW A;  1QVF A;  1VQ4 Q;  1ZA1 B;  3CXC P;  1Y07 A;  3M58 A;  3QSU A;  3EFO A;  1ZSZ A;  4BY6 B;  5FW9 A;  1ABO A;  2L3R A;  1PC0 A;  2MAM A;  2KGT A;  2IIM A;  4M7D F;  4PL6 A;  2KE9 A;  3OS2 A;  2LQ8 A;  3EAE A;  1ZBX A;  5CKD A;  1D0Z A;  2L5Q A;  5KE2 A;  3OYK A;  3CC4 A;  4LXC A;  3E2U A;  4F17 A;  2EYQ A;  4JLI A;  1MV0 B;  3CMA A;  1MND A;  1MUZ A;  2MPX C;  1WPY A;  4KRT A;  3CPW S;  2GCX A;  1WHK A;  3FDR A;  2LJ1 A;  5CO7 A;  2HL5 C;  2GBQ A;  2EGA A;  3X26 B;  1AT1 B;  1N8R R;  2D6F A;  2L2P A;  1B3Q A;  2K57 A;  2NWM A;  2EWN A;  4D6W A;  4NS5 A;  5FRM A;  1VYT A;  3OSV A;  4M75 C;  4A63 B;  1M2O A;  4PJO B;  2M0Y A;  4PJJ A;  5GMK m;  2P4T A;  1LCK A;  4BD3 A;  1YJW T;  2RK1 A;  1VYU A;  2RI5 A;  1JXM A;  1BI3 A;  2J05 A;  1MMN A;  3A98 A;  3M0U A;  3NHN A;  1JJ2 S;  1AOJ A;  4N0A A;  2E70 A;  3CC2 A;  1M90 C;  1JQQ A;  4TVR A;  2NUP B;  3JCM g;  2HSP A;  5IN1 A;  3URG A;  3OY9 A;  1SKU B;  4IUT A;  3X24 B;  1I8F A;  3SFM A;  3E9G A;  1TUD A;  3I55 Q;  1WXB A;  4OMM A;  1CSK A;  2WSF E;  2QEX Q;  2K3X A;  1KHC A;  2NYS A;  5GAN g;  4AMC A;  3PIO A;  2J7I A;  5HY6 A;  4DBH A;  3QPH A;  2QA4 Q;  3S3N A;  3GOX A;  1K8A R;  2HCK A;  3V7C A;  3CCQ T;  4C8Q C;  5GAM j;  1AWW A;  3NTK A;  1UEB A;  5LJ5 d;  2RJF A;  3E9F A;  1E7O A;  1BB9 A;  2K4Y A;  4E7L A;  4A54 A;  4PJO G;  3EGU A;  1BKB A;  2W10 A;  2EAY A;  1WQW A;  2H8H A;  3QHS A;  1N5Z A;  5CKF A;  1JBM A;  4M77 F;  3JCM f;  4FW1 A;  4M78 A;  1H3Z A;  2GNC A;  1SG5 A;  2DF6 A;  1TOV A;  3M4G A;  1RAD B;  3GLX A;  2FO0 A;  2KXC A;  4X1V A;  2XI9 A;  3TSW A;  5GAN f;  2JS2 A;  2GFU A;  4XU0 A;  4RG8 A;  2FPE A;  4PKC C;  1G8X A;  4CC3 A;  4N4H A;  2Y90 A;  1GCQ C;  3R6O A;  3CMA T;  1Q86 U;  3FJP A;  3SWN C;  3T9N A;  2HNI A;  4JDS A;  5M9O A;  3JB9 I;  2YLC A;  3ZBD A;  3PMI A;  1VQP Q;  2DZ9 A;  2FPF A;  2DZC A;  1XJW B;  2QQA A;  4Y92 A;  1Q81 R;  3M55 A;  1QVG P;  2JZ2 A;  3EFO B;  2RQW A;  1ZSZ B;  1VUB A;  2O2O A;  4OMF B;  4X9D A;  4L6V 5;  4DQ2 A;  1VQ7 Q;  2K6D A;  2QTX A;  1O9S A;  2G3R A;  2LNV A;  3DLL A;  3CC2 T;  4HCK A;  1YCY A;  3CCV T;  1Q7Y C;  2RN8 A;  5KYU A;  1YN8 A;  4WTO B;  5GMK e;  2M02 A;  4BE1 A;  3V8K A;  1TUC A;  1G2B A;  4JRQ A;  3CCJ T;  2CUD A;  1JU5 C;  5D6Y A;  1G5V A;  1U3O A;  4HCZ A;  2RJE A;  4N0A C;  2PZ1 A;  4J9G A;  5HCK A;  1TS9 A;  3GPL A;  4C92 D;  2D9T A;  3M0P A;  2COZ A;  1RAF B;  1WQ7 A;  2X3X D;  5DLO A;  1A0N B;  3HL8 A;  1WHG A;  4E7I A;  2VXF A;  2RJC A;  2ZAE A;  1FX7 A;  1VQN A;  5D6W A;  3OYJ A;  4F14 A;  2JN0 A;  1SPK A;  1TTH B;  4RMO A;  2D1X A;  4Y91 A;  1Y0M A;  1IHW A;  2QAS A;  3NPF A;  1I5L A;  1KG1 A;  2V1Q A;  1PKT A;  3SDZ A;  2CZ0 B;  3CPW P;  1U06 A;  2FRY A;  4XTY A;  1KC8 U;  2FRW A;  3JCM W;  4FYX B;  4D8K A;  4DEX A;  3P8H A;  2DL3 A;  4JPB W;  3EH1 A;  2PVD B;  6AT1 B;  1QW1 A;  4M78 C;  7AT1 B;  3TCJ A;  2EYZ A;  3M9Q A;  1PKS A;  1R0C B;  4DOW A;  3VRZ A;  1Q82 U;  4RTU A;  3RBB B;  1KSW A;  5HK0 A;  2DE0 X;  5LJ3 g;  1JEG A;  3UAT A;  3M53 A;  2D8J A;  1ABQ A;  1NJI C;  1S1N A;  1JJ2 P;  5GMK l;  3DB3 A;  2K9G A;  4Z02 A;  4OGE A;  3QKJ A;  2QEX A;  9ATC B;  3EHR A;  5FRO A;  1C6V X;  3JV3 A;  4Q5W A;  4M4Z A;  3VKI A;  4J8O A;  2LJ0 A;  1BCO A;  1IHV A;  4HVV A;  1VQ8 Q;  2LQN A;  2E12 A;  4M7D E;  2GTJ A;  1NE8 A;  4XU2 A;  2F1L A;  4BB7 A;  1QCN A;  3HTR A;  4RCB A;  5LJ3 f;  3VYG A;  4F7U A;  2DXB A;  2MK5 A;  3JCM V;  4IUP A;  3CCE Q;  3L2Q A;  1U1T A;  4ME7 A;  5CIU A;  3CCS A;  2EJG A;  2V8I A;  2CP7 A;  2SEM A;  5GAN 8;  4AFS C;  1WXU A;  2DXC A;  1AEY A;  4M75 E;  4C92 C;  3ER0 A;  4KUI A;  1PRL C;  4M7A D;  1OZ2 A;  3WXM B;  4A4G A;  4PJN A;  1Q86 R;  4MMK A;  2OTL Q;  1VQP A;  1BU1 A;  3QWX X;  3AT1 B;  3IQL A;  2MCN A;  1M90 U;  4DBR A;  3EFS A;  3FC3 A;  2O9S A;  3VS5 A;  4HCC A;  2DXU A;  1J3T A;  2XDD A;  2F2V A;  2K3Y A;  1IXD A;  1WX6 A;  4QQD A;  2K2V A;  3JB9 G;  1PD1 A;  2AKK A;  3MP6 A;  2MWP A;  4Z89 A;  1YHQ Q;  1R77 A;  3JCM J;  4IUR A;  4J83 A;  5GAM e;  1RAH B;  2Z0W A;  5GAN 7;  2F5T X;  3V8L A;  5GAN j;  3S3M A;  4C8Q E;  3CC4 Q;  2CKK A;  2O88 A;  3D7S B;  4KGX B;  1SSH A;  3PVQ A;  1EIF A;  2A28 A;  4QVD A;  4BE0 A;  5GAO r;  5A2Q E;  1OU8 A;  3CCR A;  1RLP C;  4FSS A;  1OV3 A;  1S72 A;  2QEX T;  1UGV A;  5FU7 B;  5CQX A;  4ZTJ A;  1UJ0 A;  5EG2 A;  2KI7 A;  3KUF A;  2A36 A;  1T0H A;  3H0F A;  3FB9 A;  3RMS A;  2VVK A;  3I35 A;  2ZZD A;  4NL2 A;  3L2U A;  5GAO p;  2O4X A;  4FT4 A;  1JJ2 A;  1VQK Q;  5KE3 A;  1XOV A;  2A7Y A;  2P4R A;  3SD4 A;  3CCS T;  5GAM h;  2VAS A;  2RPN A;  4MZM A;  4JS4 A;  1KC8 R;  2CT3 A;  5I2M A;  2JMA A;  2BZ8 A;  1WJQ A;  4PJO A;  3UA6 A;  4GBQ A;  4A53 A;  1G3Y A;  4AFZ C;  5IHK A;  4E47 A;  3INZ A;  2FZK B;  3FIF A;  3OW2 P;  4M7A F;  1RAI B;  1WZO A;  2HD0 A;  1K76 A;  4OMN A;  1VQP T;  5LL6 S;  4M7A C;  4R55 A;  1Q82 R;  3E1S A;  2ZPI B;  4DBF A;  2CSQ A;  1AZE A;  2F5K A;  4HCB A;  1UGR B;  1QKX A;  1ZLM A;  3KXT A;  2NUP A;  1B7T A;  1M27 C;  4JJD A;  4JRK A;  1OQK A;  2KNB B;  2YLB A;  3X28 B;  2JJ9 A;  3QUI A;  1KQ2 A;  2GTO A;  4F7U B;  1AD5 A;  2HEQ A;  2ZPE B;  4X34 A;  4XTV A;  1UHC A;  2DIQ A;  3ME9 A;  1QWF A;  1UGQ B;  2DYI A;  4CC4 B;  4EPC A;  5LJ5 e;  5C0M A;  4ANJ A;  1VQ7 T;  2QXF A;  3L1A A;  3V7S A;  1E6H A;  1K4U S;  2HKQ B;  3CCL A;  2EIF A;  1VQ9 A;  3RER A;  2W0Z A;  3VUB A;  2FHD A;  3GF5 A;  4LD6 A;  1OX8 A;  5LJ5 g;  2CZ7 B;  2RQU A;  4C0Z A;  2F69 A;  3ZFJ A;  2MYS A;  1S72 T;  4MDX A;  3M0T A;  3REA B;  3L2V A;  1KC8 C;  1BYM A;  3CME A;  4CI0 C;  3LW5 E;  2RHZ A;  4BY6 C;  2M0O A;  4B9X A;  1PCX A;  3HRU A;  4OB1 B;  4M78 E;  3I5S A;  2QGF B;  1X69 A;  2E41 A;  2FL7 A;  4JUV A;  4Z88 A;  4LUD A;  2I0N A;  3DKM A;  4ELZ C;  1SRL A;  2X4J A;  1Q82 C;  1M90 R;  4JJN K;  5CQY A;  4FSX A;  2DAQ A;  4D8D A;  3EG0 A;  4LE9 A;  5GAM d;  2KRO A;  1OOT A;  1TH7 A;  4OGC A;  1NJI U;  3P8D A;  3CCU A;  2JW4 A;  2VV5 A;  2OTJ A;  3HHT B;  3QXE B;  2DFU A;  2RJD A;  4KT0 E;  1YHQ A;  3H41 A;  2QYZ A;  4M77 A;  4LN2 A;  4PJO C;  1M9S A;  3CBO A;  2YRD A;  4OB2 B;  4ZN1 A;  2M16 A;  1VQN Q;  1WHJ A;  1ZUU A;  2EVR A;  5A0G A;  4B9W A;  1FYN A;  3PIP A;  3BDU A;  2K3B A;  1UHF A;  2O9V A;  4PFP A;  1NYG A;  4RTT A;  3V7R A;  4E6R A;  2B8A A;  2YDL A;  3SEM A;  1QWE A;  5GAN 3;  4JS5 A;  2O4X B;  4M75 F;  3QYH B;  3OYN A;  4E7K A;  4EMG A;  1VQ8 T;  3MP1 A;  1GCP A;  4C92 E;  3HPW A;  1VQM Q;  2E3H A;  1W4S A;  4PK4 A;  2V26 A;  1PHT A;  2PU9 B;  2GF7 A;  5IAY A;  2E65 A;  4C0G A;  4ZGJ B;  3CCE T;  3AHU A;  2QQR A;  1VQK A;  1Z9Z A;  2P0P A;  5GAN 4;  1HXD A;  2GQI A;  3N5B B;  4M7D B;  3VUZ A;  1QCF A;  2OX7 A;  4VUB A;  2AZS A;  3OBY A;  1JO8 A;  3JCM P;  4MZT A;  3F70 A;  1DJ7 B;  4N4G A;  4R56 A;  2XDB A;  1FMV A;  3EG2 A;  3M5A A;  2EYX A;  2QQB A;  4AFQ C;  5FLX E;  1I5O B;  2D0N A;  2OTL T;  2DER A;  3JSC A;  3GNG A;  2V1R A;  4C8Q F;  2KRN A;  3MCA B;  2ZPB B;  1AWO A;  1M3B A;  2JS0 A;  2DO3 A;  1LVK A;  2CGH A;  1NBE B;  4KBM B;  1Q7Y R;  4BI4 A;  2E4H A;  3NMZ C;  3MKD A;  2IPO B;  4RTY A;  2LT4 A;  1AZG B;  5L23 A;  1NLP C;  2KVQ G;  1WFW A;  3X20 B;  2BTT A;  2OTJ T;  1RAE B;  3JB9 H;  2KR3 A;  4J9H A;  2ZPG B;  4RKU E;  4IIM A;  3MPU B;  1YHQ T;  3RR6 A;  5D7U A;  3G4S A;  1IGQ A;  3CCS Q;  1RAC B;  4OB0 B;  3UWN A;  3OA6 A;  2E1H A;  2X35 A;  1HD3 A;  5D6X A;  4BI3 A;  2DD4 A;  2RQV A;  2COW A;  4M78 D;  3CC4 T;  1ZSZ C;  2DL7 A;  4M7D G;  2OAU A;  3FJ5 A;  1D09 B;  2ED1 A;  2LQW A;  3JB9 D;  1W1F A;  1ZX6 A;  2V8J A;  3VS1 A;  3G71 A;  3CXC A;  1G3W A;  1YWP A;  3RMQ A;  2A08 A;  1AWJ A;  2MI6 A;  2YWW A;  1I1J A;  5A0L A;  1YI2 A;  2PVG B;  1Y71 A;  2FZC B;  3OYE A;  3HRT A;  3THK A;  5HKC A;  3QBY A;  2MMP A;  2KT8 A;  3HSB A;  5GAN 5;  3VYH B;  2LC4 A;  3A1P A;  2CT4 A;  1LOJ A;  4EDU A;  1X01 A;  4A4H A;  3G6E Q;  2R5M A;  1ZUK A;  4M7A E;  4LNP A;  1VQK T;  2JTF A;  4M77 B;  2VUB A;  3QYG B;  2P0K A;  2ZGW A;  4ORZ A;  3CD6 Q;  4N4I A;  2EYY A;  4EMK A;  2YUO A;  1VIE A;  5HK3 A;  2CP3 A;  1NJI R;  3CQT A;  4ATO A;  5GAN 6;  4L5G A;  2CZ6 B;  2LTO A;  3MO8 A;  3CCR Q;  2PNI A;  1KQS P;  1S72 Q;  4JJB A;  3A8H B;  4UC4 A;  2K5I A;  1G3T A;  4AFU C;  2DVE A;  1YJN A;  2KYB A;  2DIL A;  1QVF S;  1EX4 A;  2COY A;  2CP2 A;  3RKY A;  4C8Q G;  3M0S A;  3BW1 A;  1W2B P;  1K0S A;  1WNL A;  2GFA A;  2AIR B;  2D8H A;  3J80 E;  1VQ6 A;  1SHF A;  3A8O B;  3I5R A;  2SRC A;  2RO0 A;  4AG1 C;  3JAM E;  4FIB A; 
#chains in the Genus database with same CATH homology
 2KT1 A;  3O5Z A;  1NEG A;  2MOX A;  2C0T A;  1KFZ A;  1GBQ A;  2ENM A;  1M3A A;  1OEB A;  4OMQ A;  5FWC A;  1RLQ C;  2C0O A;  2O88 A;  3VS2 A;  1SSH A;  3ZL7 C;  2YSQ A;  3PVQ A;  1ZSG A;  1EFN A;  2A28 A;  1SHG A;  3REB B;  2XMF A;  1G83 A;  1RLP C;  1YCS B;  1NG2 A;  4FSS A;  1HSQ A;  1OV3 A;  1YP5 A;  1I0C A;  1UGV A;  2YUQ A;  2DBM A;  1M3C A;  2DYB A;  2L3S A;  3PE0 A;  3VS4 A;  2G6F X;  4AG2 C;  1UJ0 A;  3M0Q A;  1WIE A;  4RTZ A;  1SRM A;  2OI3 A;  2J6F A;  2A36 A;  4OMO A;  2JMC A;  1T0H A;  2F2W A;  3H0F A;  2VVK A;  2DRK A;  3I35 A;  2AKL A;  1WA7 A;  5IHN A;  1W70 A;  1NYF A;  1H92 A;  1WDX A;  1XOV A;  4JZ3 A;  5FW9 A;  1ABO A;  1U5S A;  2JT4 A;  2J06 A;  2AK5 A;  2P4R A;  2RPN A;  2KGT A;  2BZX A;  2IIM A;  2RF0 A;  2CT3 A;  2LNH B;  2JMA A;  2KE9 A;  2BZ8 A;  2CH4 W;  2LCS A;  3RNJ A;  3UA6 A;  2O31 A;  4GBQ A;  4AFZ C;  5IHK A;  1ZUY A;  4F17 A;  1VYV A;  1MV0 B;  2CRE A;  1K9A A;  1CKA A;  1UDL A;  1MUZ A;  4KRT A;  4RTX A;  2MIO A;  1OPK A;  1E6G A;  1K76 A;  2LJ1 A;  4OMN A;  2GBQ A;  2EGA A;  2CSQ A;  1AZE A;  3VS0 A;  1QKX A;  1ZLM A;  4R0K A;  2L2P A;  1B3Q A;  2NWM A;  2X3W D;  3R6N A;  1M27 C;  2J6O A;  2RNA A;  4JJD A;  2KNB B;  4Z8A A;  1VYT A;  4A63 B;  2LX7 A;  2GTO A;  3TSZ A;  1GL5 A;  2M0Y A;  2C0I A;  1AD5 A;  1LCK A;  2HEQ A;  1CKB A;  5GJV B;  1T0J A;  4RUG A;  1VYU A;  4LUE A;  1UHC A;  1JXM A;  1QWF A;  4CC4 B;  3ULR B;  2J05 A;  3A98 A;  3M0U A;  3NHN A;  4J9E A;  1NM7 A;  2NUZ A;  2EYW A;  1AOJ A;  2OJ2 A;  4ZNX A;  4RTV A;  2FPD A;  2DVJ A;  1E6H A;  1K4U S;  1QKW A;  4HXJ A;  1QLY A;  5I11 A;  1JQQ A;  2KBT A;  1NLO C;  2HSP A;  1X6B A;  4CC2 A;  2W0Z A;  1TUD A;  1WXB A;  4OMM A;  3VS6 A;  1H8K A;  2RQU A;  1CSK A;  2VWF A;  2L3Q A;  1W6X A;  2JM9 A;  1BBZ A;  1B07 A;  2J7I A;  3M0T A;  3REA B;  1K1Z A;  2DM1 A;  2HCK A;  1AWW A;  2DL8 A;  3NGP A;  1E7O A;  1BB9 A;  2HDA A;  3EGU A;  3I5S A;  3U23 A;  1X69 A;  2W10 A;  2RQR A;  2DRM A;  2DX1 A;  2H8H A;  1N5Z A;  4Z88 A;  4LUD A;  2I0N A;  1SRL A;  2GNC A;  4GLM A;  2DF6 A;  4D8D A;  1IO6 A;  3EG0 A;  5GJW B;  4LE9 A;  2EGC A;  1OOT A;  2FO0 A;  2KRO A;  2KXC A;  4X1V A;  1HJD A;  3SHW A;  3TSW A;  2JW4 A;  2A37 A;  2JS2 A;  2FPE A;  4CC3 A;  1GBR A;  1GCQ C;  2CH4 A;  1Z9Q A;  3KFV A;  1GFC A;  2LZ6 B;  3H41 A;  4RTW A;  2RMO A;  4LN2 A;  1PWT A;  2YUN A;  2FPF A;  2KXD A;  2VKN A;  1PRM C;  4Y92 A;  1ZUU A;  2EKH A;  1X6G A;  1ZBJ A;  2EVR A;  4J9I A;  1FYN A;  1SEM A;  4HVW A;  2K3B A;  4OML A;  1UHF A;  2O9V A;  1NYG A;  2J6K A;  4RTT A;  2RQW A;  4E6R A;  2O2O A;  2YDL A;  1QWE A;  3SEM A;  1GFD A;  1UTI A;  4J9F A;  2CSI A;  2DLP A;  3QWY A;  2JTE A;  1YNZ A;  2AZV A;  2BZY A;  3VS3 A;  4CC7 A;  2K6D A;  2LMJ A;  1GCP A;  4HCK A;  2EW3 A;  2KYM A;  2LJ3 A;  4WCI A;  4IIO A;  2RN8 A;  1TG0 A;  1YN8 A;  3GBQ A;  1TUC A;  2KEA A;  1G2B A;  1PHT A;  3TVT A;  2ROL A;  2CUD A;  1JU5 C;  2KRS A;  1U3O A;  2CUB A;  1Z9Z A;  1X2Q A;  2PZ1 A;  4J9G A;  2ABL A;  5HCK A;  2ED0 A;  2GQI A;  3UA7 A;  1KJW A;  3M0P A;  1WXT A;  1QCF A;  2X3X D;  1T3S A;  1A0N B;  2AZS A;  1UEC A;  2PTK A;  1JO8 A;  2YT6 A;  3EG2 A;  5IHI A;  4F14 A;  2EYX A;  3C0C A;  4AFQ C;  1SPK A;  2DL4 A;  3M0R A;  2DJQ A;  2D1X A;  2D0N A;  5IH2 A;  1Y0M A;  4JZ4 A;  2V1R A;  2KRN A;  1AWO A;  2HBW A;  3NPF A;  1M3B A;  1VA7 A;  2JS0 A;  2V1Q A;  1PKT A;  4OMP A;  2GGR A;  1U06 A;  2FRY A;  4K11 A;  2FRW A;  3NMZ C;  4RTY A;  4F16 A;  1AZG B;  5L23 A;  1NLP C;  2ESW A;  4D8K A;  1X2K A;  4DEX A;  1WFW A;  2BTT A;  5I22 A;  2DL3 A;  2KR3 A;  1JXO A;  4J9H A;  4JPB W;  2L3P A;  4JJC A;  2FEI A;  1AWX A;  1OPL A;  4IIM A;  2K7A A;  3EG1 A;  2DMO A;  2EYZ A;  2FG0 A;  3H0I A;  2EBP A;  4HVU A;  1PKS A;  1UFF A;  2DBK A;  3VRZ A;  5FWB A;  1RI9 A;  1HD3 A;  4RTU A;  3RBB B;  1KSW A;  2RQV A;  2DE0 X;  1JEG A;  2EQI A;  3LH5 A;  2DL5 A;  2RQT A;  2DL7 A;  3EHQ A;  1WLP B;  3FJ5 A;  3UAT A;  2D8J A;  1WYX A;  2ED1 A;  1ABQ A;  4J9D A;  1NEB A;  3I9Q A;  2LQW A;  1Y57 A;  1KIK A;  1S1N A;  1T3L A;  2EPD A;  1GRI A;  2KRM A;  3VRY A;  1W1F A;  4DEY A;  2K9G A;  1ZX6 A;  1M30 A;  2ROT A;  2LP5 A;  3VS1 A;  3EHR A;  1YWP A;  4QT7 A;  1UE9 A;  2A08 A;  1AWJ A;  3JV3 A;  1I1J A;  4M4Z A;  2L0A A;  2LJ0 A;  1BK2 A;  3PVL A;  4HVV A;  1PNJ A;  2LQN A;  1GCQ A;  1YWO A;  1FMK A;  3THK A;  2KT8 A;  2GTJ A;  2CT4 A;  2B86 A;  3EG3 A;  1UUE A;  5IXF A;  5EC7 A;  2YUP A;  2K2M A;  1ZUK A;  1M8M A;  4LNP A;  2JXB A;  4ORZ A;  4J9B A;  4ESR A;  2EYY A;  2SEM A;  1UG1 A;  4AFS C;  1WXU A;  2YUO A;  1AEY A;  1X27 A;  3UF4 A;  3CQT A;  1V1C A;  2K79 A;  3H0H A;  4EIK A;  1K0X A;  2PNI A;  1PRL C;  2EGE A;  4J9C A;  4JJB A;  4AFU C;  1H3H A;  2KYB A;  2M51 A;  1BU1 A;  2DIL A;  1WI7 A;  3QWX X;  1RUW A;  2DNU A;  2CDT A;  2OAW A;  3IQL A;  1X43 A;  2MCN A;  2DA9 A;  2F2X A;  3VS7 A;  2QDL A;  1AVZ C;  2JM8 A;  1UJY A;  2O9S A;  3VS5 A;  3M0S A;  2ECZ A;  5ECA A;  1J3T A;  1K0S A;  1MV3 A;  1ARK A;  2E5K A;  2F2V A;  5IXB A;  2D8H A;  1SHF A;  1WX6 A;  3I5R A;  2SRC A;  4AG1 C;  2AKK A;  1I07 A;  4Z89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...