3VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
101
structure length
101
Chain Sequence
b'MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCDB
molecule tags Ccdb
source organism Escherichia coli
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
total genus 28
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vubA00
3HPWA 4MZTA 4VUBA 1UB4A 2VUBA 2C06A 3G7ZA 5DLOA 3NFCA 5CKFA 2MF2A 4MZMA 5CKEA 1M1FA 5CO7A 4OF1A 5CKDA 5CQYA 1NE8A 1X75C 4ELZC 5CCAA 3JRZA 1VUBA 5HKCA 3TCJA 4HKEA 2KMTA 4MDXA 4ME7A 3VUBA 5HK3A 5CR2A 3JSCA 5CKBA 5CQXA 5CK9A 5CKHA 5HK0A 4ELYC 4MZPA
chains in the Genus database with same CATH superfamily
1OI1A 3JCMe 4NS5A 3L2ZA 4ANJA 1J3TA 4ZTFA 1AOJA 1M1FA 3URGA 4D6WA 4M7AG 3JCMb 4M77G 2MYSA 2YRVA 4C5EA 3LWIA 2QAZA 4M7AC 2AZVA 2HSPA 3R6NA 3CD6A 2AK5A 4M7AE 1YHQA 5GAMf 4P5NA 4M7AF 2O9SA 1Q86U 2YUQA 2EKHA 2A37A 2AIRB 1X6BA 2MWPA 3JCMf 1M2VA 1YJ9T 1M27C 3BDLA 3M56A 2MIOA 4M7DD 4M78F 1D1BA 3JB9F 2ZPEB 1LVKA 3H0FA 1KC8R 1YCSB 1SRMA 2VWFA 2DPPB 2J06A 5LJ3d 1U5SA 1D1CA 2KBTA 4LDWA 2HCKA 1VQOT 3UT1A 1Q82U 4C92F 1OU8A 1H92A 2MPXC 4M75A 2L3RA 1TXQA 5CKBA 5KE2A 2LNHB 1VQKT 1VQ6A 3CMEA 3RIRA 2PUOB 4MZPA 4E7ZA 5GAN6 1Z9QA 2DA9A 2RPNA 3LGLA 5GJVB 2EGCA 4PJJA 1X69A 2LMJA 4X1VA 4KUIA 2E1HA 1VYTA 2FYKA 1YI2A 1ABOA 3CC2Q 4C0FA 2ROTA 5KE3A 1Q7YU 2CYZB 5FRNA 4M77D 3S3OA 3CC4A 2X4YA 2ZZDA 4AT1B 4FSXA 4ATOA 3OYAA 2ZPBB 5CQYA 4M77A 4A4HA 2KR3A 1M90R 1MV0B 3JRZA 4A53A 2HQXA 2DL4A 4XU2A 1UECA 1YWOA 3G71Q 3CXCA 5KYYB 3M0QA 5J39A 2QG9B 1M90U 2G6FX 2JM9A 4PLLA 2DYBA 4LD9K 3PIPA 4OMFB 2JS2A 3VUZA 1WZOA 1GFCA 3EGXA 3CPFA 3CCVT 2E5KA 3CCUQ 4FL6A 4FT2A 2OTLA 3CCSA 4L6V5 2F69A 4JJCA 1RADB 3J81E 1VQ9A 1WQ7A 4EIKA 4OB0B 3OYBA 3WVDB 4D8DA 1ZBXA 3RNJA 1B34B 4M78C 1IB8A 3UA6A 2DXBA 3CC7Q 1MV3A 2OAWA 2FG0A 1G83A 3KXTA 1M2OA 4Y91A 1BCMA 1IXDA 2D0NA 1PWTA 2DBKA 1VQKQ 2GFUA 4Z02A 3M0UA 4QQDA 5IXFA 4M77C 2X3XD 5GANj 3RR6A 4J5YA 5GAMh 1UEBA 4B6MA 1OZ3A 3EG9A 2KDSA 1KJWA 1OX8A 2CH4A 4ZGEB 1SHGA 2GF7A 1YITT 4QT7A 3PIOA 3RMQA 5IXBA 3X26B 2E6ZA 2P0QA 2EYWA 1OQKA 5A0DA 3M4YA 4ZGDB 1BYMA 3RESA 1N27A 2BIVA 4WTOB 2YRDA 4L5GA 3GNFB 1KC8C 2CSQA 4BACA 1R0CB 2DBMA 2DD4A 1UJ0A 3NTIA 1Q7YR 2VC8A 2JXBA 3OYIA 1ARKA 1IHWA 3CC2A 2RK1A 3DB3A 2L0AA 1KIKA 4J9GA 5GAOp 2OI3A 1FMKA 1MHNA 1AHJB 1H3ZA 2LJ0A 3U23A 3QJYA 2YRCA 3J80E 4IIMA 4JJDA 1RLPC 2ZPHB 2OTJQ 1T3SA 3V7CA 3L1AA 1D09B 3CCMQ 1T0JA 2FPEA 3R6OA 5AYFA 3OA6A 3V8JA 4F17A 2LQKA 1RABB 2ATCB 4Y28E 1M1KR 1AD5A 3GPLA 3H9NA 4HT9A 3MEAA 3MCAB 1TG0A 4KH1B 4KH0B 2DIQA 5LJ5j 3QYGB 2YWWA 3CC4T 5KCHA 5GAMd 4KT0E 2D6FA 3INZA 3OYDA 1X01A 2QQBA 2V8IA 1JO8A 4LN2A 1G3TA 2LZ6B 2EJ9A 2EQUA 1I4K1 3V8LA 3FC3A 2HBPA 1PM3A 4N0AC 4F04B 3QJ6A 3SB2A 3TSZA 3C94A 2V8KA 4DEYA 4MZTA 1VQOA 1VQ8Q 3LWHA 4A4KA 3CCRT 1PHTA 1OU9A 2HQHA 1W2BS 2F1LA 2EJFA 2AZSA 2JUFA 2V1RA 2DD5A 3HP9A 2R5AA 2OTJT 1NYGA 5HKCA 2HMAA 2AKLA 1DJ7B 5DY9A 3OMGA 4XTZA 2V26A 1JU5C 3CBPA 2O88A 2E5QA 1R77A 1Q81C 3O8VA 2I2LA 4FM4B 2RJEA 4XTUA 5LJ5d 4GBQA 2RHZA 1JBMA 3ZL7C 2OTJA 3FIFA 2RI2A 4J9BA 1EIFA 2CZ7B 2HNIA 3L2WA 1AT1B 3TCJA 3RDVA 5GMKm 2F2XA 2BZYA 1JXOA 2BE9B 1M30A 1U1SA 3LW5E 4F7UF 1YHQT 4F7UE 1BIBA 1AZGB 2EYYA 1IO6A 1QKXA 3EHQA 2NYSA 4R56A 1N6AA 2A7YA 5LJ3e 4J6XA 4C92E 3FEOA 3QG1A 2CP6A 5EC7A 4F7UG 2D8JA 1VQNQ 2RQTA 3LLRA 1GCPA 3DLLA 2PUKB 2XHCA 2MAMA 8ATCB 4N4HA 4KGVB 1Q82R 3QZ9B 5IT9E 3CMAT 2VGMA 3E1SA 4M7DE 4JLIA 4A4FA 2F2VA 3OYLA 1VIEA 5KYWA 3PVQA 4M75E 3VRYA 3MP8A 4J7IA 2DL8A 5CQXA 4JS5A 1OZ2A 2RM4A 2SRCA 3MP6A 1YHQQ 3REBB 4NOYA 2WACA 2K7AA 2E6NA 3MP1A 3OSVA 1GL5A 2LJ3A 3ZFJA 5KYXA 1NJIU 1TWBA 3SEMA 3L2VA 3FJPA 2C0TA 2C0IA 5GANd 3J7AF 1VQ9Q 1KQ2A 4PNOA 3N5BB 3JB9I 1K9AA 1VQ7T 1I5LA 2J6OA 2QEXT 2KK4A 2FZGB 4D8KA 3CMAQ 1VIFA 3AHUA 2DE0X 4PKCC 2EVRA 3LH0A 2QEXA 2K5IA 2ZAEA 3OS2A 4E7LA 2L2PA 3GP8A 4RTZA 2QTXA 4IIOA 1TUCA 1C1AA 2BZXA 2LRQA 1VUBA 1YITA 5GAN2 2KRSA 4E7JA 1N8RR 4RCCA 4WF2A 4LDXA 2GFAA 3HRSA 6AT1B 4XTXA 1WX6A 4AG2C 2FPDA 1ABQA 1UFFA 5C6SA 1B07A 5IHNA 1WJRA 3EGXB 4CC3A 5FW9A 4J9DA 3JV3A 4M75C 1PSEA 2KNBB 2LCLA 1VQ9T 5CVIA 4AFZC 3QWXX 2M1HA 2EYZA 1MUZA 1KQSS 4RMOA 2JTEA 2I0NA 3I55Q 1CSKA 5CR2A 1Z9ZA 1VQMA 2WSEE 1TH7A 3HRTA 4J6WA 2JN0A 5GAN3 3VU3C 3OYJA 4BE1A 4MMLA 1WXBA 4E7HA 4PLIA 4BI3A 2A08A 1MMNA 2LC4A 4JPBW 4KGXB 5I21A 1D3BA 4KRTA 5GMKh 4V2SA 1PRMC 1SHFA 3HFOA 1RAAB 4JRPA 1UHFA 3OQ5A 3EGDB 3OW2S 1QVGA 3UDCA 2K4YA 3I5RA 3EH1A 2FRYA 5GANh 1NLPC 3X28B 3UATA 1YN8A 2P0KA 5J3BA 2BKDN 2EYQA 1PKTA 2DTHA 3LYIA 3MHXA 1B3QA 2XK0A 4QW2A 1HJDA 2X4WA 3E19A 2Y4XA 1ZUUA 3M59A 5HY6A 5KYNA 2JMCA 3EG0A 2KE9A 4J9HA 2CP2A 2AT1B 2P0PA 3THKA 2ZGWA 1BK2A 3CCLQ 1VQMT 2VXEA 2H3JA 4PJOD 5LJ5e 1VQNT 2V8JA 2ED1A 3VYHB 3JCMd 5L23A 4KUDK 3LGFA 5FU6C 2E4HA 1QCNA 4FIBA 3BE3A 2PQWA 3I56Q 1E7OA 1NZ9A 3M57A 1R8OB 2DX1A 3H41A 3G71A 4M4ZA 4QQGA 2FZKB 5LL6S 2JTMA 3ME9A 4FCYA 1KQSA 5KYUB 1RAGB 4Y92A 4FYWB 1P92A 1ZUYA 3VS6A 5GMKl 5GAMe 3VUBA 3C12A 2GGRA 1TUGB 2QXFA 1HSQA 5D6XA 3CC7A 4F16A 1QW1A 2E3IA 3VJPA 3UWNA 3CCSQ 1SF9A 4BDZA 1RAHB 2COYA 5GAOq 1N8RC 2LVMA 2K5LA 2IPOB 3M54A 3OS1A 1JJ2A 1PD0A 4HVWA 2H3EB 2RQUA 4PFOA 4O5VA 2HKQB 2O4XA 3VS2A 3NFCA 3CCQT 3M58A 1Y96A 2KAFA 2QI2A 4A63B 2JMAA 2CUDA 1RACB 2RNAA 2GTOA 3OYNA 1WHKA 1RUWA 3SWNB 2JTFA 5GAN8 1MMDA 5D6YA 2K6DA 4IUVA 3L2UA 3T9NA 3EFOA 4R0KA 2RHIA 5GANe 4Q5WA 3CCLT 3CEYA 2EW3A 1ZSZA 3VS5A 1Q86C 1A0NB 4EDUA 3X24B 3CPWP 3OYGA 1VQ5T 3MEVA 4HT8A 3ASKA 3V7RA 1Y0MA 5GANg 1HK9A 3META 2AHJB 4JLGA 1X27A 1YI2Q 1NJIC 3EG1A 1W2BA 5GAN7 4OB3B 1YJWQ 3M55A 2DILA 4VUBA 4JRQA 4DQ2A 2MCNA 5GAOl 4C92C 2R57A 2KYBA 1KQ1A 1D3BB 3PGGA 3TREA 1M3BA 1Y7XA 4RTXA 3EFSA 4M75F 3HHTB 2RH2A 3PE0A 4XU1A 4E47A 4IUPA 2VV5A 4FSSA 3RKWA 4PJNA 1FYNA 2LNVA 3GNGA 2DMOA 3JCMc 4AFUC 2AKKA 2A36A 2DF6A 1VQPT 1OV3A 1H3HA 2QA4Q 2ED0A 4M7DA 1SSHA 1QLYA 3CCVQ 2PTKA 2L3SA 4RTYA 4M7AA 4XAXB 4XU0A 2ESWA 2K5FA 3A8OB 1RAIB 4XU3A 5I11A 3KFVA 4KGZB 2RHUA 2DL3A 1OPLA 2KQWA 3M53A 3G71T 2Y4YA 1ZHIA 1HYOA 3GOXA 5FU7C 2VYTA 3JCMP 2ENMA 4RCBA 4EMHA 1NG2A 2XIDA 3UF4A 1VQPA 4QVCA 1BKBA 2JW4A 1EX4A 1FXXA 2RB6A 2KRNA 5GJWB 4A54A 2COZA 1UGRB 4FT4A 3TSWA 1Q86R 3VS3A 1N5ZA 2EGEA 3GLXA 3OYFA 2W10A 2LT1A 4JDSA 2EQIA 2HL5C 2EQKA 3MEUA 4Z88A 3WVEB 1YJNT 2R58A 2EFIA 3ER0A 3G6ET 1JB0E 3NHNA 1VQMQ 4RTTA 3EHRA 4QKUA 4IUTA 3UPUA 2K2VA 4MMKA 4EMKA 3CC2T 2NUTB 3PT9A 2F5KA 4EMKC 2M9UA 3LX7A 4M78B 2PU9B 1D1AA 5EG2A 1RI0A 2LQ8A 2KVQG 4XQ3A 2M16A 3M9QA 2DZCA 4XTWA 1QCOA 1I07A 1YNZA 1KHCA 2CZ6B 2DYIA 1EFNA 1M5Q1 4ELYC 4DOVA 3D7SB 1VQLT 3FJ5A 1E6HA 3RERA 2KY9A 2L5QA 4FYXB 1K9MC 3OS0A 3CCMT 2LX9A 3VYGA 3UA7A 3G6EQ 1SKUB 5I2MA 4CC2A 5KYXB 2EIFA 2B86A 4XTVA 1M1KC 1B7TA 3KBGA 3HL8A 2XD0A 2FHDA 3P8DA 3QXEB 1WHMA 4M7AD 4J9IA 2DKGA 2HEQA 1XTDA 4N0AA 2EPDA 2RJDA 2O31A 2MMPA 3A8GB 4UC4A 1FMWA 3M0PA 2VKNA 4C92G 2KXDA 4DBHA 2HAXA 1MGQA 3OBYA 4ZNXA 4JUVA 3RUXA 4HA8A 1QP3A 3NMZC 2J05A 4J9CA 2B8AA 1C6VX 3CCMA 4F7UA 3QWYA 2KSSA 1JRIA 1XOVA 3CPWS 1C0MA 3M5AA 1SEMA 2K2MA 2DAQA 3A8MB 2DL5A 1WPYA 1VYVA 4J6YA 1KD1C 3CCST 3I5SA 2YLCA 1TOVA 2FO0A 1IHVA 1VOMA 3JCMV 1D0XA 1VQNA 3SD4A 1Q81R 1IGQA 3JCMJ 1UHCA 4PJOE 1K9MU 1BI3A 5A0LA 3MEWA 1JXMA 3QPHA 5DLOA 4J83A 1W4SA 2RO0A 2PNIA 1WIEA 4PJOC 3TVTA 3CXCP 1UG1A 5GMKi 1IREB 3PTAA 4LDUA 4PJOG 2SEMA 2YUOA 3G6EA 2OAUA 4ME7A 1ZA1B 1NBEB 4E7KA 2K3BA 3H0IA 5LJ5g 1VQ8A 3EH2A 5GAN5 3A98A 5FRMA 4GLMA 5GAMj 4C8QC 1AWJA 1QQJA 2M0OA 2DXCA 2LQWA 2HBWA 1NE8A 1M3AA 4JJNK 4C8QE 2L3QA 3V8KA 1VQKA 1TU0B 2RI5A 1BI2A 3QUIA 4PJOA 3BW1A 5LJ5h 3DKMA 5HK0A 4BY6C 1OEBA 3CCUA 1AWWA 4AMCA 1ZLMA 1U3OA 3JB9D 2RJFA 4DA4A 4OB2B 4J8OA 4M78D 2EKOA 4DBFA 1S72Q 2DO3A 2DJQA 2V1QA 2HDAA 5FWCA 1VQOQ 2DXTA 4IURA 2JOYA 1SSFA 4M75G 1AEYA 2EBPA 2KROA 1KHIA 2GBQA 1YJ9A 1ZSZB 9ATCB 2DERA 4KBMB 4M77F 4M77E 1O75A 3I56A 2BE7D 3JCMW 1VQPQ 5CIUA 5D7UA 4M75B 2DEQA 3QBYA 5J26A 3CCRQ 1Y57A 1G2BA 1TS9A 1ZX6A 3HKSA 1UJYA 5M9OA 4OVAA 2CH4W 5HCKA 3CCRA 1XQHA 4JZ3A 2CP5A 1YCYA 5KH6A 3CCUT 5A2QE 2YSQA 1SRLA 1YIJQ 1UGPB 1O9SA 4BE2A 1GXIE 1G5VA 1MMAA 2VXFA 2D9TA 5LJ3h 2LCCA 2DVEA 2K9GA 3L42A 4AFSC 1PRLC 2E3HA 5C0MA 4IKFA 4J9EA 2D1XA 4LNPA 3M0SA 3MKDA 1CKAA 3CMEQ 4BI4A 3RMSA 4M7DF 4DBQA 2P4TA 3VS1A 4PJMA 1T0HA 3OYYA 2QQ9A 4BDYA 1I5OB 5KYYA 1BBZA 2NLUA 2KMTA 1OPKA 2ZPGB 1KD1R 1NEGA 3TU4K 2E41A 4FW1A 1QVGP 3HPWA 1WFWA 1K0SA 1D0ZA 1UGQB 1VQ4T 1UDLA 5CKEA 2O2OA 2J6KA 4OF1A 5D6WA 4HVVA 2R5MA 4M7AB 1K0XA 2VVKA 1SG5A 1ZSGA 2EQMA 2X3WD 1NEBA 1YBYA 2ECZA 2P4RA 3M0TA 3SWNC 1U8RA 1ZUKA 1X43A 1AWOA 3CCET 1QKWA 4IUUA 4EPCA 2MF2A 3A5ZB 1MNDA 1K73C 4LD6A 4N4IA 2E12A 5CCAA 2YDLA 2E70A 2CP0A 2QQAA 3C95A 3H6ZA 1TSFA 2IG0A 4E7SA 3CCJT 1NLOC 3JCMQ 1ZQ1A 2K57A 4C8QA 4JZ4A 4RTWA 1W6XA 3SHWA 2EWNA 1UB4A 1VQLA 2QK0A 2DEUA 1QP2A 1PD1A 2PZ1A 4DBRA 3I56T 3VS4A 1WA7A 4C5IA 1XNIA 4L59A 4OMNA 1QWEA 1QVGS 3P8HA 5GMKe 2OTLT 1WJQA 4X9DA 2L8DA 3L2RA 2FVUA 2QGGA 3QZ5B 2ZPIB 4R55A 1S72T 3VKIA 2VUBA 4PJLA 1GBQA 1PCXA 2LJ1A 2XMFA 3EGUA 2MOXA 3MO8A 3QO3A 2YLBA 4X34A 2K3YA 3PNWC 2DL7A 2EGAA 4M7DG 2CS7A 2YXYA 3GBQA 1VQ4Q 4C8QB 1X6GA 2RQVA 5LJ3g 2VB6A 3E2UA 3AT1B 1I81A 2RK2A 4BI8B 3FLGA 1KD1U 2DK3A 3BFMA 4TVRA 3JCMh 2LX7A 4DOWA 3CD6Q 1KFZA 3S3NA 3NPFA 3L2QA 1I0CA 2RD1A 4MDXA 1YI2T 3HFNA 4JS4A 3RKYA 4Z8AA 1PG5B 2IIMA 2ZCFB 4NL2A 3JCMX 2PVGB 2GCXA 1VQ8T 4FW2A 2YT6A 1I8FA 4C0DC 1K76A 2NUTA 3HRUA 4ZN1A 3I55T 2GQVA 4M77B 2JT4A 1NM7A 3A1PA 4ESRA 1VQLQ 2EJGA 2JVVA 2G3RA 4AFQC 3REAB 3OS5A 1UUEA 4IUQA 5LJ5f 1VQ6T 3QYHB 1JJ2S 2FZCB 1I1JA 2DXUA 1XJWB 2OX7A 1W2BP 1NYFA 2J7IA 1GRIA 7AT1B 3OW2P 2RA2A 4ELZC 3BDUA 2RQWA 1V1CA 3OMCA 4OMQA 3CQTA 1N8RU 1AZEA 5A0GA 4B9XA 3Q1JA 1VYUA 2GTJA 4OGEA 4C0ZA 1WI7A 4DEXA 3TEEA 2GQIA 2D8HA 2XDPA 4C8QG 4YTLA 5ECAA 2QTVA 3E9GA 3PVLA 4QVZA 2GNCA 4M7DB 1EZZB 1NPRA 3GIBA 3V7SA 4E7IA 2RJCA 3C4SA 3CD6T 3CCEQ 1WHLA 3EAEA 3MJXA 2CP3A 2YUNA 2HSEB 1FMVA 2X4JA 2KI7A 2O9VA 1M90C 2HZYA 1VQ5A 2FRWA 1JJ2P 2QA4A 1OX9A 2NUPA 4FU6A 2DVJA 4J7FA 4N4GA 4ZTJA 2DZ9A 1H8KA 4C92D 1BI0A 2OJ2A 3I9QA 1WXTA 2CT3A 2O4XB 2QA4T 1CKBA 2DJZA 3G4SQ 5FWBA 1B34A 2RQRA 3VS7A 1X75C 2JM8A 2CUBA 1ZBJA 4BD3A 2O01E 2QDYB 1TTHB 1K1ZA 1KSWA 3E9FA 2CDTA 5DM7R 4PJOB 3JSCA 1KK7A 4C0DB 3TQ7P 2DIGA 4M7DC 5GAMg 3CC7T 3OYEA 5AT1B 1MNEA 2C06A 1YP5A 1H641 1UTIA 4MDWA 3PMIA 1UGVA 3RKXA 2DNUA 1LPLA 1KC8U 2JNGA 4HCKA 2KEAA 2KGTA 2FL7A 5DLQE 4AG1C 4GY5A 4K11A 2HKNA 1K8AC 2HQEA 2LP5A 2DTOA 1X2KA 2X9HA 2QDLA 2KRMA 4C92A 2X35A 2HL3A 1BB9A 3G4SA 2D0QB 4CC7A 1UE9A 1YITQ 1WYXA 1VA7A 2FPFA 3NTHA 4GLKA 3M0RA 2CGHA 2JJ9A 2VGNA 3ZEHA 2WSCE 2A28A 1GFDA 2EQJA 2XDBA 2JZ2A 1E6GA 1PSFA 2J6FA 2XI9A 2KXCA 2MWOA 3H0HA 4F14A 3PFSA 2QYZA 1Y71A 2DLPA 4ZN3A 4C8QD 4LDYA 4PK4A 2MI6A 2L89A 1IRXA 3OBWA 1AVZC 1Q95G 2XU8A 2H8HA 5GAOn 1HXDA 2DM1A 3OSSC 5FU6B 3OB9A 4E2FB 1G3SA 3FB9A 3QKJA 4WCIA 4LE9A 1PC0A 3WXMB 1RLQC 3I55A 1F1BB 2CKKA 1YWPA 4JRKA 3OW2A 1RI9A 3SDZA 3SFMA 4C92B 1GCQA 3EFRA 3G4ST 1VQ6Q 3ZBDA 3KUFA 4E6RA 2E10A 1ACMB 2A3LA 3CBOA 5GAOr 2QASA 1LOJA 1LCKA 2KT8A 3FDRA 1QVFS 2LCSA 5HK3A 4M78E 5LJ3f 3MPUB 3QDRB 4EMKB 1RAEB 1Y07A 3X25B 3CC4Q 4M78A 3G7ZA 2YUPA 2ROLA 3CPWA 1M1KU 4LUEA 1MMGA 3OYCA 1Q81U 8AT1B 1IGUA 1Y96B 1WHHA 3OYKA 3X20B 4LDVA 2CSIA 1WJSA 1QWFA 1YJNQ 5FU7B 2FB7A 4ORZA 3F70A 2E64A 1M2VB 2PVDB 2X4XA 1BI1A 1WLPB 3QIIA 3JB9G 2F5TX 1K73R 3S3MA 1G3WA 2YHTA 2RI3A 4PFPA 1GCQC 5CKFA 3CBMA 5CO7A 4C5GA 3JCMg 4OP0A 3BY7A 2NWMA 2BZ8A 3S6WA 4BB7A 3O5ZA 2NUZA 4M75D 3IQLA 3CCQQ 3GF5A 1W1FA 2F2WA 2QGFB 5CAIA 3CCJA 1YFNA 1YJWA 4FYVB 1IZ6A 3NGPA 4HCBA 3EG3A 2EYXA 2E65A 1FWZA 3A8HB 4RG8A 1SPKA 1FX7A 1NJIR 3JAME 4QVDA 4BE0A 1OULA 2DETA 1K8AR 3FRNA 1M9SA 1GBRA 2C0OA 1M1GA 4RTVA 2ABLA 2LT4A 5FROA 5L8RE 3CCVA 1X2QA 1YIJT 1RAFB 4OMLA 1VQ7A 1WNLA 3JB9J 4QQ6A 5IH2A 4X9CA 1BU1A 2RMOA 2M02A 4PL6A 1U06A 4OGCA 2LTOA 1TUDA 1KG1A 1VQ5Q 1WHGA 3EG9B 5KYWB 2RHYA 1Q82C 1R0BG 2MK5A 4OB1B 1UGSB 4HCCA 1YJ9Q 1M8VA 4MZMA 4RTUA 1ZSZC 2K3XA 3SWNA 5IN1A 3HSBA 4XK8E 3EFOB 1QVFA 3LH5A 3H8ZA 2HD0A 1YJNA 2QEXQ 4BUGA 3CMAA 4HCZA 4FYYB 2DRKA 1WHJA 2ZPFB 1QVFP 2LDMA 3JB9H 3VS0A 2K79A 5CKDA 1OOTA 3CMET 1BIAA 1T3LA 1S1NA 1VQ7Q 1Q7YC 4HXJA 4OMPA 3DLMA 4LXCA 4A4GA 1PNJA 2RN8A 4PFZA 2Y90A 1M8MA 4KULA 1BCOA 1S72A 2X51A 1ZA2B 5IHIA 4Z89A 3HTRA 3QHSA 4O6JA 1QMCA 2CREA 3CCJQ 5CK9A 5IAYA 2KT1A 4PJOF 1NPPA 1D0YA 2DRMA 2Z0WA 1N9RA 1K8AU 2COWA 2WSFE 1WXUA 4OMOA 4RUGA 1N9SA 2BTTA 2DFUA 5GANf 1G8XA 1U1TA 2XKOC 2XICA 3P8BB 3A8LB 1AWXA 4C5HA 3QSUA 3QDFA 2NUPB 3ULRB 1M3CA 2XG8D 2CZ1B 4A4EA 5LJ3j 1RL2A 5GAN4 3C0CA 1PKSA 1G3YA 5KCOA 1JEGA 4ZGJB 1QVPA 1KQSP 2CP7A 5GAOm 2PVOB 4C0GA 2P84A 2VASA 3I35A 1YIJA 1OYXA 4CI0C 2RHXA 1W70A 5KYUA 1WGSA 4RKUE 3M4GA 3G1JA 5GMKj 2XDDA 4HKEA 1M4ZA 5FLXE 4CC4B 2W0ZA 5CKHA 5I22A 4OMMA 3OYHA 4BY6B 3CCEA 2M0YA 2QQRA 4NL3A 4EMGA 1VQ4A 4JRIA 3OYMA 1LNXA 3CCLA 1WQWA 1YJWT 4LUDA 1V29B 1WDXA 4HVUA 2LQNA 3PMTA 4XTYA 4B9WA 2L3PA 2DTIA 2IVWA 2RF0A 2EAYA 3EGDA 3VRZA 1K73U 4CRIA 3RBBB 3VV0A 1K4US 2M51A 2CT4A 4RG2A 1JQQA 5I2SA 2JS0A 2KYMA 3CXCS 1K9MR 2FEIA 3DB4A 1QCFA 3NTKA 4J9FA 2QQSA 4C8QF 4F7UB 5IHKA 2A0FB 2BUDA 2CZ0B 3OY9A 4JJBA 1V76A 1HD3A 4M78G 1LJOA 2OTLQ 3EG2A 4II1A 1X6OA 3CCQA
chains in the Genus database with same CATH topology
1BI0A 1OI1A 4NS5A 4F7UA 1VIFA 3JCMe 3AHUA 2KSSA 1JRIA 4PKCC 2QEXA 3LH0A 1XOVA 3L2ZA 2K5IA 3CPWS 2O4XB 3M5AA 3OS2A 2DJZA 2QA4T 3GP8A 1M1FA 3URGA 4E7LA 4ZTFA 2QTXA 4D6WA 1B34A 2DAQA 1X75C 4M7AG 3A8MB 3JCMb 2LRQA 4M77G 4BD3A 2O01E 1VUBA 2QDYB 2YRVA 1YITA 1WPYA 5GAN2 4E7JA 4C5EA 4J6YA 4RCCA 3LWIA 3CCST 3E9FA 2YLCA 4WF2A 1KD1C 4LDXA 2GFAA 5DM7R 4M7AC 3HRSA 3JCMV 4PJOB 3JSCA 4XTXA 4C0DB 1VQNA 1VQ6T 3CD6A 2DIGA 3SD4A 4M7DC 5GAMg 4M7AE 3CC7T 5C6SA 3OYEA 5GAMf 4P5NA 1YHQA 3JCMJ 4M7AF 1WJRA 4PJOE 1K9MU 1BI3A 5A0LA 3MEWA 1Q86U 3QPHA 2C06A 5DLOA 4J83A 1W4SA 1H641 2RO0A 4MDWA 3PMIA 3RKXA 4PJOC 4M75C 1PSEA 1KC8U 2JNGA 2LCLA 5GMKi 1VQ9T 5CVIA 1IREB 3PTAA 4LDUA 4PJOG 2MWPA 2FL7A 2M1HA 3JCMf 5DLQE 1YJ9T 4GY5A 1KQSS 4RMOA 3G6EA 1K8AC 2HQEA 2OAUA 3BDLA 3M56A 4ME7A 4M78F 4M7DD 5CR2A 2DTOA 3JB9F 4E7KA 1VQMA 2WSEE 2ZPEB 5LJ5g 1VQ8A 4C92A 2X35A 1TH7A 3HRTA 4J6WA 2JN0A 5GAN3 5GAN5 3VU3C 3OYJA 2DPPB 5LJ3d 4BE1A 5FRMA 3G4SA 2D0QB 4MMLA 4LDWA 4C8QC 5GAMj 2M0OA 4E7HA 4PLIA 3NTHA 2DXCA 1VQOT 3UT1A 4GLKA 4BI3A 1Q82U 2CGHA 2VGNA 1NE8A 2LC4A 3ZEHA 2WSCE 4C92F 4JJNK 4C8QE 2EQJA 2XDBA 2JZ2A 3V8KA 1VQKA 1PSFA 5I21A 4M75A 2RI5A 1BI2A 2L3RA 1D3BA 3QUIA 2XI9A 4PJOA 2MWOA 3BW1A 5LJ5h 3DKMA 5CKBA 5KE2A 3PFSA 5GMKh 5HK0A 1VQKT 1VQ6A 4V2SA 4BY6C 3CMEA 1Y71A 2PUOB 3RIRA 3CCUA 4MZPA 4ZN3A 5GAN6 4C8QD 3HFOA 4LDYA 3LGLA 3JB9D 4JRPA 2RJFA 2MI6A 4DA4A 2L89A 3OQ5A 4OB2B 4J8OA 4M78D 2EKOA 2XU8A 3OBWA 3OW2S 1QVGA 3UDCA 5GAOn 1HXDA 4KUIA 2DO3A 3OSSC 2E1HA 5FU6B 3OB9A 4C92D 2K4YA 1G3SA 3FB9A 5GANh 2DXTA 3QKJA 2FYKA 4IURA 2JOYA 1YI2A 3WXMB 3X28B 1SSFA 3I55A 4M75G 2P0KA 5J3BA 2BKDN 4C0FA 2EYQA 5KE3A 1Q7YU 1KHIA 2CKKA 2CYZB 2DTHA 3LYIA 3MHXA 2XK0A 4QW2A 1YJ9A 5FRNA 2X4WA 4JRKA 3OW2A 3E19A 4M77D 3S3OA 2Y4XA 4KBMB 3CC4A 3SDZA 3SFMA 4C92B 3M59A 2X4YA 3EFRA 4M77F 5HY6A 3ZBDA 3G4ST 4M77E 2ZZDA 3KUFA 1O75A 3I56A 2E10A 3JCMW 4FSXA 2P0PA 2A3LA 5CIUA 2ZGWA 4ATOA 3CBOA 1VQMT 5GAOr 3OYAA 4M75B 2VXEA 2DEQA 3QBYA 1LOJA 2H3JA 2ZPBB 5CQYA 4PJOD 4M77A 5J26A 4A4HA 5LJ5e 1VQNT 2V8JA 3JRZA 4A53A 3HKSA 2HQXA 3FDRA 3VYHB 5M9OA 4XU2A 3JCMd 1QVFS 4OVAA 4KUDK 5HK3A 4M78E 3LGFA 5FU6C 3CXCA 3CCRA 5J39A 4FIBA 5LJ3f 1M90U 1XQHA 3QDRB 4EMKB 1YCYA 2PQWA 5KH6A 1NZ9A 4PLLA 1Y07A 3M57A 3CCUT 3X25B 4LD9K 3PIPA 1R8OB 3G71A 4OMFB 5A2QE 4M78A 3G7ZA 4QQGA 3VUZA 1UGPB 5LL6S 1O9SA 2JTMA 4BE2A 1M1KU 3CPWA 3ME9A 1GXIE 3CPFA 3CCVT 3OYCA 1Q81U 1KQSA 1G5VA 4FL6A 4FT2A 2OTLA 3CCSA 2VXFA 2D9TA 4L6V5 5LJ3h 2LCCA 1P92A 2F69A 1Y96B 2DVEA 3L42A 5GMKl 3OYKA 3X20B 5GAMe 3J81E 4LDVA 1WJSA 1VQ9A 3VUBA 5C0MA 3C12A 2FB7A 5FU7B 3F70A 1WQ7A 2E64A 4IKFA 2PVDB 2X4XA 1BI1A 4OB0B 3QIIA 3OYBA 3JB9G 3WVDB 1ZBXA 2F5TX 1B34B 2QXFA 4M78C 3S3MA 1G3WA 2DXBA 2YHTA 2RI3A 5D6XA 4BI4A 3RMSA 4M7DF 5CKFA 3CC7A 2P4TA 3CBMA 3KXTA 4Y91A 5CO7A 4C5GA 3JCMg 3OYYA 2QQ9A 4OP0A 1QW1A 2GFUA 3BY7A 4Z02A 3VJPA 4BDYA 3UWNA 2NLUA 4QQDA 2KMTA 4BDZA 5GAOq 2ZPGB 3S6WA 4BB7A 1N8RC 4M77C 2LVMA 5GANj 2K5LA 4M75D 3M54A 4J5YA 3GF5A 3OS1A 3TU4K 1JJ2A 2E41A 5GAMh 1UEBA 1OZ3A 3HPWA 2KDSA 5CAIA 3CCJA 1YJWA 4O5VA 2O4XA 1IZ6A 4ZGEB 3NFCA 3CCQT 2GF7A 1UGQB 1VQ4T 4HCBA 5CKEA 3M58A 1Y96A 4OF1A 1YITT 2KAFA 2QI2A 5D6WA 3PIOA 3RMQA 2E65A 2R5MA 2E6ZA 2P0QA 1FWZA 4M7AB 3X26B 3A8HB 4RG8A 3OYNA 3SWNB 2JTFA 1FX7A 5A0DA 5GAN8 5D6YA 3M4YA 2EQMA 4IUVA 3JAME 4QVDA 3L2UA 4BE0A 3T9NA 3FRNA 4ZGDB 1M9SA 1BYMA 2RHIA 3RESA 1N27A 2BIVA 4Q5WA 1M1GA 5GANe 3CCLT 1YBYA 2LT4A 4L5GA 3CEYA 3GNFB 1KC8C 5FROA 5L8RE 3SWNC 3CCVA 4BACA 1YIJT 1U8RA 1Q86C 2DD4A 3NTIA 1VQ7A 3CCET 4IUUA 4EDUA 1WNLA 4EPCA 4QQ6A 3JB9J 2MF2A 2VC8A 3X24B 3A5ZB 4X9CA 3OYGA 3OYIA 1VQ5T 3MEVA 3CC2A 2RK1A 3DB3A 1K73C 4HT8A 4LD6A 3ASKA 4N4IA 3V7RA 5GAOp 4PL6A 5GANg 1HK9A 2E12A 1MHNA 3META 2AHJB 5CCAA 1AHJB 4JLGA 4OGCA 2E70A 2LTOA 1KG1A 1H3ZA 2QQAA 3C95A 3H6ZA 3QJYA 2IG0A 1NJIC 1W2BA 3J80E 5GAN7 3CCMA 2ZPHB 3CCJT 2RHYA 4OB3B 3JCMQ 1ZQ1A 2K57A 3L1AA 3V7CA 3M55A 4C8QA 1Q82C 2EWNA 4OB1B 1UGSB 4VUBA 4JRQA 1UB4A 4DQ2A 4HCCA 1VQLA 5GAOl 4C92C 3R6OA 1QP2A 2R57A 1M8VA 1KQ1A 1D3BB 4MZMA 3I56T 2K3XA 5AYFA 3PGGA 3SWNA 3TREA 4C5IA 1Y7XA 1XNIA 4L59A 5IN1A 3OA6A 3V8JA 4XK8E 3HSBA 3EFSA 1QVGS 1QVFA 2LQKA 3H8ZA 4M75F 2HD0A 3HHTB 4Y28E 2RH2A 3P8HA 4XU1A 4E47A 5GMKe 1YJNA 2OTLT 3GPLA 4IUPA 1WJQA 4X9DA 2VV5A 2L8DA 4BUGA 3CMAA 4HT9A 3MEAA 4HCZA 2FVUA 3QZ5B 3RKWA 3MCAB 2LNVA 3GNGA 3L2RA 3JCMc 2ZPIB 2ZPFB 4R55A 1S72T 1VQPT 2DIQA 3VKIA 2VUBA 5LJ5j 2LDMA 3QYGB 3CC4T 5KCHA 3JB9H 4M7DA 5GAMd 4KT0E 5CKDA 2D6FA 3INZA 3OYDA 1X01A 4M7AA 3CMET 4XAXB 1BIAA 2K5FA 2QQBA 3MO8A 3QO3A 2YLBA 4XU0A 2V8IA 4X34A 3A8OB 4XU3A 1G3TA 2EJ9A 2EQUA 1I4K1 2K3YA 1Q7YC 3PNWC 4M7DG 2RHUA 2CS7A 3M53A 2KQWA 3DLMA 3G71T 3V8LA 3FC3A 2Y4YA 1ZHIA 2HBPA 4C8QB 4N0AC 3QJ6A 3SB2A 4A4GA 3C94A 2V8KA 5FU7C 4MZTA 3GOXA 2VYTA 3LWHA 4A4KA 3JCMP 3CCRT 5LJ3g 1VQOA 2Y90A 4RCBA 1I81A 4EMHA 2RK2A 4KULA 1W2BS 4BI8B 3FLGA 1KD1U 2DK3A 2XIDA 3BFMA 4TVRA 3JCMh 1VQPA 1S72A 4DOWA 1BKBA 4QVCA 2EJFA 3S3NA 2JUFA 1FXXA 2DD5A 3HP9A 3QHSA 2R5AA 2RB6A 3L2QA 2OTJT 5HKCA 4O6JA 2RD1A 4MDXA 1YI2T 1DJ7B 3HFNA 5DY9A 4A54A 3OMGA 4JS4A 3RKYA 1UGRB 4XTZA 4FT4A 5CK9A 3CBPA 5IAYA 2E5QA 3GLXA 2ZCFB 1Q81C 3O8VA 2I2LA 3OYFA 4NL2A 4FM4B 2LT1A 3JCMX 2PVGB 1NPPA 2RJEA 2GCXA 4JDSA 4PJOF 4XTUA 1N9RA 2EQKA 5LJ5d 1VQ8T 3MEUA 1I8FA 1K8AU 2WSFE 2RHZA 3WVEB 4C0DC 3I55T 1N9SA 1JBMA 3HRUA 4ZN1A 2GQVA 1YJNT 2OTJA 5GANf 1U1TA 2R58A 2RI2A 2XKOC 3FIFA 2EFIA 3ER0A 4M77B 2XICA 3P8BB 3G6ET 1EIFA 2CZ7B 2HNIA 3A8LB 3L2WA 4C5HA 3TCJA 1JB0E 3QSUA 2EJGA 2JVVA 2G3RA 2XG8D 2CZ1B 5GMKm 4A4EA 4IUTA 5LJ3j 1RL2A 3OS5A 3UPUA 2K2VA 5GAN4 4MMKA 1G3YA 4EMKA 3CC2T 4IUQA 5KCOA 1U1SA 5LJ5f 3LW5E 3PT9A 2F5KA 3QYHB 4F7UF 1QVPA 4ZGJB 4F7UE 1BIBA 4EMKC 1YHQT 5GAOm 1JJ2S 2M9UA 3LX7A 2PVOB 4M78B 2PU9B 4C0GA 5EG2A 4R56A 1OYXA 1YIJA 1N6AA 2DXUA 1RI0A 2A7YA 2LQ8A 4CI0C 5LJ3e 4J6XA 2RHXA 2RA2A 4C92E 1WGSA 2KVQG 3FEOA 4RKUE 3BDUA 3M4GA 4XQ3A 3QG1A 4ELZC 5GMKj 2M16A 3M9QA 4F7UG 2XDDA 3OMCA 4HKEA 2DZCA 4XTWA 3LLRA 1M4ZA 1N8RU 3DLLA 5A0GA 2CZ6B 5FLXE 1KHCA 2PUKB 2XHCA 2MAMA 1M5Q1 5CKHA 4B9XA 4ELYC 3Q1JA 3OYHA 4N4HA 4BY6B 4OGEA 4C0ZA 3CCEA 4DOVA 1VQLT 2QQRA 4NL3A 3RERA 3QZ9B 5IT9E 2KY9A 2L5QA 3CMAT 1K9MC 2VGMA 4EMGA 3OS0A 1VQ4A 3CCMT 4JRIA 3OYMA 2LX9A 3E1SA 3TEEA 4M7DE 1LNXA 4JLIA 3CCLA 3VYGA 1WQWA 4A4FA 1YJWT 2XDPA 1V29B 3OYLA 1VIEA 4C8QG 3PMTA 4YTLA 4XTYA 3E9GA 4QVZA 5I2MA 4M75E 2EIFA 4M7DB 4B9WA 3MP8A 2DTIA 2IVWA 4XTVA 1M1KC 2EAYA 3KBGA 3HL8A 4J7IA 5CQXA 4JS5A 2FHDA 2XD0A 1NPRA 1OZ2A 3GIBA 2RM4A 3V7SA 3P8DA 3QXEB 4E7IA 4M7AD 2RJCA 3MP6A 2DKGA 4CRIA 1K73U 3VV0A 3C4SA 3CD6T 4NOYA 2WACA 3EAEA 2E6NA 3MP1A 3OSVA 1XTDA 4RG2A 4N0AA 5I2SA 2RJDA 3CXCS 2MMPA 3A8GB 4UC4A 3ZFJA 2X4JA 1NJIU 3DB4A 3NTKA 4F7UB 2QQSA 4C8QF 4C92G 3L2VA 1M90C 3FJPA 2BUDA 5GANd 2CZ0B 3OY9A 3J7AF 1VQ5A 2HAXA 4PNOA 1KQ2A 3N5BB 1MGQA 3OBYA 2QA4A 3JB9I 4FU6A 4JUVA 4J7FA 3RUXA 1VQ7T 4M78G 4N4GA 1I5LA 4HA8A 1LJOA 1QP3A 4ZTJA 2QEXT 1X6OA 2DZ9A 2KK4A 4II1A 2B8AA 3CCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPW A;  4MZT A;  4VUB A;  1UB4 A;  2VUB A;  2C06 A;  3G7Z A;  5DLO A;  3NFC A;  5CKF A;  2MF2 A;  4MZM A;  5CKE A;  1M1F A;  5CO7 A;  4OF1 A;  5CKD A;  5CQY A;  1NE8 A;  1X75 C;  4ELZ C;  5CCA A;  3JRZ A;  1VUB A;  5HKC A;  3TCJ A;  4HKE A;  2KMT A;  4MDX A;  4ME7 A;  3VUB A;  5HK3 A;  5CR2 A;  3JSC A;  5CKB A;  5CQX A;  5CK9 A;  5CKH A;  5HK0 A;  4ELY C;  4MZP A; 
#chains in the Genus database with same CATH topology
 1OI1 A;  3JCM e;  4NS5 A;  3L2Z A;  4ANJ A;  1J3T A;  4ZTF A;  1AOJ A;  1M1F A;  3URG A;  4D6W A;  4M7A G;  3JCM b;  4M77 G;  2MYS A;  2YRV A;  4C5E A;  3LWI A;  2QAZ A;  4M7A C;  2AZV A;  2HSP A;  3R6N A;  3CD6 A;  2AK5 A;  4M7A E;  1YHQ A;  5GAM f;  4P5N A;  4M7A F;  2O9S A;  1Q86 U;  2YUQ A;  2EKH A;  2A37 A;  2AIR B;  1X6B A;  2MWP A;  3JCM f;  1M2V A;  1YJ9 T;  1M27 C;  3BDL A;  3M56 A;  2MIO A;  4M7D D;  4M78 F;  1D1B A;  3JB9 F;  2ZPE B;  1LVK A;  3H0F A;  1KC8 R;  1YCS B;  1SRM A;  2VWF A;  2DPP B;  2J06 A;  5LJ3 d;  1U5S A;  1D1C A;  2KBT A;  4LDW A;  2HCK A;  1VQO T;  3UT1 A;  1Q82 U;  4C92 F;  1OU8 A;  1H92 A;  2MPX C;  4M75 A;  2L3R A;  1TXQ A;  5CKB A;  5KE2 A;  2LNH B;  1VQK T;  1VQ6 A;  3CME A;  3RIR A;  2PUO B;  4MZP A;  4E7Z A;  5GAN 6;  1Z9Q A;  2DA9 A;  2RPN A;  3LGL A;  5GJV B;  2EGC A;  4PJJ A;  1X69 A;  2LMJ A;  4X1V A;  4KUI A;  2E1H A;  1VYT A;  2FYK A;  1YI2 A;  1ABO A;  3CC2 Q;  4C0F A;  2ROT A;  5KE3 A;  1Q7Y U;  2CYZ B;  5FRN A;  4M77 D;  3S3O A;  3CC4 A;  2X4Y A;  2ZZD A;  4AT1 B;  4FSX A;  4ATO A;  3OYA A;  2ZPB B;  5CQY A;  4M77 A;  4A4H A;  2KR3 A;  1M90 R;  1MV0 B;  3JRZ A;  4A53 A;  2HQX A;  2DL4 A;  4XU2 A;  1UEC A;  1YWO A;  3G71 Q;  3CXC A;  5KYY B;  3M0Q A;  5J39 A;  2QG9 B;  1M90 U;  2G6F X;  2JM9 A;  4PLL A;  2DYB A;  4LD9 K;  3PIP A;  4OMF B;  2JS2 A;  3VUZ A;  1WZO A;  1GFC A;  3EGX A;  3CPF A;  3CCV T;  2E5K A;  3CCU Q;  4FL6 A;  4FT2 A;  2OTL A;  3CCS A;  4L6V 5;  2F69 A;  4JJC A;  1RAD B;  3J81 E;  1VQ9 A;  1WQ7 A;  4EIK A;  4OB0 B;  3OYB A;  3WVD B;  4D8D A;  1ZBX A;  3RNJ A;  1B34 B;  4M78 C;  1IB8 A;  3UA6 A;  2DXB A;  3CC7 Q;  1MV3 A;  2OAW A;  2FG0 A;  1G83 A;  3KXT A;  1M2O A;  4Y91 A;  1BCM A;  1IXD A;  2D0N A;  1PWT A;  2DBK A;  1VQK Q;  2GFU A;  4Z02 A;  3M0U A;  4QQD A;  5IXF A;  4M77 C;  2X3X D;  5GAN j;  3RR6 A;  4J5Y A;  5GAM h;  1UEB A;  4B6M A;  1OZ3 A;  3EG9 A;  2KDS A;  1KJW A;  1OX8 A;  2CH4 A;  4ZGE B;  1SHG A;  2GF7 A;  1YIT T;  4QT7 A;  3PIO A;  3RMQ A;  5IXB A;  3X26 B;  2E6Z A;  2P0Q A;  2EYW A;  1OQK A;  5A0D A;  3M4Y A;  4ZGD B;  1BYM A;  3RES A;  1N27 A;  2BIV A;  4WTO B;  2YRD A;  4L5G A;  3GNF B;  1KC8 C;  2CSQ A;  4BAC A;  1R0C B;  2DBM A;  2DD4 A;  1UJ0 A;  3NTI A;  1Q7Y R;  2VC8 A;  2JXB A;  3OYI A;  1ARK A;  1IHW A;  3CC2 A;  2RK1 A;  3DB3 A;  2L0A A;  1KIK A;  4J9G A;  5GAO p;  2OI3 A;  1FMK A;  1MHN A;  1AHJ B;  1H3Z A;  2LJ0 A;  3U23 A;  3QJY A;  2YRC A;  3J80 E;  4IIM A;  4JJD A;  1RLP C;  2ZPH B;  2OTJ Q;  1T3S A;  3V7C A;  3L1A A;  1D09 B;  3CCM Q;  1T0J A;  2FPE A;  3R6O A;  5AYF A;  3OA6 A;  3V8J A;  4F17 A;  2LQK A;  1RAB B;  2ATC B;  4Y28 E;  1M1K R;  1AD5 A;  3GPL A;  3H9N A;  4HT9 A;  3MEA A;  3MCA B;  1TG0 A;  4KH1 B;  4KH0 B;  2DIQ A;  5LJ5 j;  3QYG B;  2YWW A;  3CC4 T;  5KCH A;  5GAM d;  4KT0 E;  2D6F A;  3INZ A;  3OYD A;  1X01 A;  2QQB A;  2V8I A;  1JO8 A;  4LN2 A;  1G3T A;  2LZ6 B;  2EJ9 A;  2EQU A;  1I4K 1;  3V8L A;  3FC3 A;  2HBP A;  1PM3 A;  4N0A C;  4F04 B;  3QJ6 A;  3SB2 A;  3TSZ A;  3C94 A;  2V8K A;  4DEY A;  4MZT A;  1VQO A;  1VQ8 Q;  3LWH A;  4A4K A;  3CCR T;  1PHT A;  1OU9 A;  2HQH A;  1W2B S;  2F1L A;  2EJF A;  2AZS A;  2JUF A;  2V1R A;  2DD5 A;  3HP9 A;  2R5A A;  2OTJ T;  1NYG A;  5HKC A;  2HMA A;  2AKL A;  1DJ7 B;  5DY9 A;  3OMG A;  4XTZ A;  2V26 A;  1JU5 C;  3CBP A;  2O88 A;  2E5Q A;  1R77 A;  1Q81 C;  3O8V A;  2I2L A;  4FM4 B;  2RJE A;  4XTU A;  5LJ5 d;  4GBQ A;  2RHZ A;  1JBM A;  3ZL7 C;  2OTJ A;  3FIF A;  2RI2 A;  4J9B A;  1EIF A;  2CZ7 B;  2HNI A;  3L2W A;  1AT1 B;  3TCJ A;  3RDV A;  5GMK m;  2F2X A;  2BZY A;  1JXO A;  2BE9 B;  1M30 A;  1U1S A;  3LW5 E;  4F7U F;  1YHQ T;  4F7U E;  1BIB A;  1AZG B;  2EYY A;  1IO6 A;  1QKX A;  3EHQ A;  2NYS A;  4R56 A;  1N6A A;  2A7Y A;  5LJ3 e;  4J6X A;  4C92 E;  3FEO A;  3QG1 A;  2CP6 A;  5EC7 A;  4F7U G;  2D8J A;  1VQN Q;  2RQT A;  3LLR A;  1GCP A;  3DLL A;  2PUK B;  2XHC A;  2MAM A;  8ATC B;  4N4H A;  4KGV B;  1Q82 R;  3QZ9 B;  5IT9 E;  3CMA T;  2VGM A;  3E1S A;  4M7D E;  4JLI A;  4A4F A;  2F2V A;  3OYL A;  1VIE A;  5KYW A;  3PVQ A;  4M75 E;  3VRY A;  3MP8 A;  4J7I A;  2DL8 A;  5CQX A;  4JS5 A;  1OZ2 A;  2RM4 A;  2SRC A;  3MP6 A;  1YHQ Q;  3REB B;  4NOY A;  2WAC A;  2K7A A;  2E6N A;  3MP1 A;  3OSV A;  1GL5 A;  2LJ3 A;  3ZFJ A;  5KYX A;  1NJI U;  1TWB A;  3SEM A;  3L2V A;  3FJP A;  2C0T A;  2C0I A;  5GAN d;  3J7A F;  1VQ9 Q;  1KQ2 A;  4PNO A;  3N5B B;  3JB9 I;  1K9A A;  1VQ7 T;  1I5L A;  2J6O A;  2QEX T;  2KK4 A;  2FZG B;  4D8K A;  3CMA Q;  1VIF A;  3AHU A;  2DE0 X;  4PKC C;  2EVR A;  3LH0 A;  2QEX A;  2K5I A;  2ZAE A;  3OS2 A;  4E7L A;  2L2P A;  3GP8 A;  4RTZ A;  2QTX A;  4IIO A;  1TUC A;  1C1A A;  2BZX A;  2LRQ A;  1VUB A;  1YIT A;  5GAN 2;  2KRS A;  4E7J A;  1N8R R;  4RCC A;  4WF2 A;  4LDX A;  2GFA A;  3HRS A;  6AT1 B;  4XTX A;  1WX6 A;  4AG2 C;  2FPD A;  1ABQ A;  1UFF A;  5C6S A;  1B07 A;  5IHN A;  1WJR A;  3EGX B;  4CC3 A;  5FW9 A;  4J9D A;  3JV3 A;  4M75 C;  1PSE A;  2KNB B;  2LCL A;  1VQ9 T;  5CVI A;  4AFZ C;  3QWX X;  2M1H A;  2EYZ A;  1MUZ A;  1KQS S;  4RMO A;  2JTE A;  2I0N A;  3I55 Q;  1CSK A;  5CR2 A;  1Z9Z A;  1VQM A;  2WSE E;  1TH7 A;  3HRT A;  4J6W A;  2JN0 A;  5GAN 3;  3VU3 C;  3OYJ A;  4BE1 A;  4MML A;  1WXB A;  4E7H A;  4PLI A;  4BI3 A;  2A08 A;  1MMN A;  2LC4 A;  4JPB W;  4KGX B;  5I21 A;  1D3B A;  4KRT A;  5GMK h;  4V2S A;  1PRM C;  1SHF A;  3HFO A;  1RAA B;  4JRP A;  1UHF A;  3OQ5 A;  3EGD B;  3OW2 S;  1QVG A;  3UDC A;  2K4Y A;  3I5R A;  3EH1 A;  2FRY A;  5GAN h;  1NLP C;  3X28 B;  3UAT A;  1YN8 A;  2P0K A;  5J3B A;  2BKD N;  2EYQ A;  1PKT A;  2DTH A;  3LYI A;  3MHX A;  1B3Q A;  2XK0 A;  4QW2 A;  1HJD A;  2X4W A;  3E19 A;  2Y4X A;  1ZUU A;  3M59 A;  5HY6 A;  5KYN A;  2JMC A;  3EG0 A;  2KE9 A;  4J9H A;  2CP2 A;  2AT1 B;  2P0P A;  3THK A;  2ZGW A;  1BK2 A;  3CCL Q;  1VQM T;  2VXE A;  2H3J A;  4PJO D;  5LJ5 e;  1VQN T;  2V8J A;  2ED1 A;  3VYH B;  3JCM d;  5L23 A;  4KUD K;  3LGF A;  5FU6 C;  2E4H A;  1QCN A;  4FIB A;  3BE3 A;  2PQW A;  3I56 Q;  1E7O A;  1NZ9 A;  3M57 A;  1R8O B;  2DX1 A;  3H41 A;  3G71 A;  4M4Z A;  4QQG A;  2FZK B;  5LL6 S;  2JTM A;  3ME9 A;  4FCY A;  1KQS A;  5KYU B;  1RAG B;  4Y92 A;  4FYW B;  1P92 A;  1ZUY A;  3VS6 A;  5GMK l;  5GAM e;  3VUB A;  3C12 A;  2GGR A;  1TUG B;  2QXF A;  1HSQ A;  5D6X A;  3CC7 A;  4F16 A;  1QW1 A;  2E3I A;  3VJP A;  3UWN A;  3CCS Q;  1SF9 A;  4BDZ A;  1RAH B;  2COY A;  5GAO q;  1N8R C;  2LVM A;  2K5L A;  2IPO B;  3M54 A;  3OS1 A;  1JJ2 A;  1PD0 A;  4HVW A;  2H3E B;  2RQU A;  4PFO A;  4O5V A;  2HKQ B;  2O4X A;  3VS2 A;  3NFC A;  3CCQ T;  3M58 A;  1Y96 A;  2KAF A;  2QI2 A;  4A63 B;  2JMA A;  2CUD A;  1RAC B;  2RNA A;  2GTO A;  3OYN A;  1WHK A;  1RUW A;  3SWN B;  2JTF A;  5GAN 8;  1MMD A;  5D6Y A;  2K6D A;  4IUV A;  3L2U A;  3T9N A;  3EFO A;  4R0K A;  2RHI A;  5GAN e;  4Q5W A;  3CCL T;  3CEY A;  2EW3 A;  1ZSZ A;  3VS5 A;  1Q86 C;  1A0N B;  4EDU A;  3X24 B;  3CPW P;  3OYG A;  1VQ5 T;  3MEV A;  4HT8 A;  3ASK A;  3V7R A;  1Y0M A;  5GAN g;  1HK9 A;  3MET A;  2AHJ B;  4JLG A;  1X27 A;  1YI2 Q;  1NJI C;  3EG1 A;  1W2B A;  5GAN 7;  4OB3 B;  1YJW Q;  3M55 A;  2DIL A;  4VUB A;  4JRQ A;  4DQ2 A;  2MCN A;  5GAO l;  4C92 C;  2R57 A;  2KYB A;  1KQ1 A;  1D3B B;  3PGG A;  3TRE A;  1M3B A;  1Y7X A;  4RTX A;  3EFS A;  4M75 F;  3HHT B;  2RH2 A;  3PE0 A;  4XU1 A;  4E47 A;  4IUP A;  2VV5 A;  4FSS A;  3RKW A;  4PJN A;  1FYN A;  2LNV A;  3GNG A;  2DMO A;  3JCM c;  4AFU C;  2AKK A;  2A36 A;  2DF6 A;  1VQP T;  1OV3 A;  1H3H A;  2QA4 Q;  2ED0 A;  4M7D A;  1SSH A;  1QLY A;  3CCV Q;  2PTK A;  2L3S A;  4RTY A;  4M7A A;  4XAX B;  4XU0 A;  2ESW A;  2K5F A;  3A8O B;  1RAI B;  4XU3 A;  5I11 A;  3KFV A;  4KGZ B;  2RHU A;  2DL3 A;  1OPL A;  2KQW A;  3M53 A;  3G71 T;  2Y4Y A;  1ZHI A;  1HYO A;  3GOX A;  5FU7 C;  2VYT A;  3JCM P;  2ENM A;  4RCB A;  4EMH A;  1NG2 A;  2XID A;  3UF4 A;  1VQP A;  4QVC A;  1BKB A;  2JW4 A;  1EX4 A;  1FXX A;  2RB6 A;  2KRN A;  5GJW B;  4A54 A;  2COZ A;  1UGR B;  4FT4 A;  3TSW A;  1Q86 R;  3VS3 A;  1N5Z A;  2EGE A;  3GLX A;  3OYF A;  2W10 A;  2LT1 A;  4JDS A;  2EQI A;  2HL5 C;  2EQK A;  3MEU A;  4Z88 A;  3WVE B;  1YJN T;  2R58 A;  2EFI A;  3ER0 A;  3G6E T;  1JB0 E;  3NHN A;  1VQM Q;  4RTT A;  3EHR A;  4QKU A;  4IUT A;  3UPU A;  2K2V A;  4MMK A;  4EMK A;  3CC2 T;  2NUT B;  3PT9 A;  2F5K A;  4EMK C;  2M9U A;  3LX7 A;  4M78 B;  2PU9 B;  1D1A A;  5EG2 A;  1RI0 A;  2LQ8 A;  2KVQ G;  4XQ3 A;  2M16 A;  3M9Q A;  2DZC A;  4XTW A;  1QCO A;  1I07 A;  1YNZ A;  1KHC A;  2CZ6 B;  2DYI A;  1EFN A;  1M5Q 1;  4ELY C;  4DOV A;  3D7S B;  1VQL T;  3FJ5 A;  1E6H A;  3RER A;  2KY9 A;  2L5Q A;  4FYX B;  1K9M C;  3OS0 A;  3CCM T;  2LX9 A;  3VYG A;  3UA7 A;  3G6E Q;  1SKU B;  5I2M A;  4CC2 A;  5KYX B;  2EIF A;  2B86 A;  4XTV A;  1M1K C;  1B7T A;  3KBG A;  3HL8 A;  2XD0 A;  2FHD A;  3P8D A;  3QXE B;  1WHM A;  4M7A D;  4J9I A;  2DKG A;  2HEQ A;  1XTD A;  4N0A A;  2EPD A;  2RJD A;  2O31 A;  2MMP A;  3A8G B;  4UC4 A;  1FMW A;  3M0P A;  2VKN A;  4C92 G;  2KXD A;  4DBH A;  2HAX A;  1MGQ A;  3OBY A;  4ZNX A;  4JUV A;  3RUX A;  4HA8 A;  1QP3 A;  3NMZ C;  2J05 A;  4J9C A;  2B8A A;  1C6V X;  3CCM A;  4F7U A;  3QWY A;  2KSS A;  1JRI A;  1XOV A;  3CPW S;  1C0M A;  3M5A A;  1SEM A;  2K2M A;  2DAQ A;  3A8M B;  2DL5 A;  1WPY A;  1VYV A;  4J6Y A;  1KD1 C;  3CCS T;  3I5S A;  2YLC A;  1TOV A;  2FO0 A;  1IHV A;  1VOM A;  3JCM V;  1D0X A;  1VQN A;  3SD4 A;  1Q81 R;  1IGQ A;  3JCM J;  1UHC A;  4PJO E;  1K9M U;  1BI3 A;  5A0L A;  3MEW A;  1JXM A;  3QPH A;  5DLO A;  4J83 A;  1W4S A;  2RO0 A;  2PNI A;  1WIE A;  4PJO C;  3TVT A;  3CXC P;  1UG1 A;  5GMK i;  1IRE B;  3PTA A;  4LDU A;  4PJO G;  2SEM A;  2YUO A;  3G6E A;  2OAU A;  4ME7 A;  1ZA1 B;  1NBE B;  4E7K A;  2K3B A;  3H0I A;  5LJ5 g;  1VQ8 A;  3EH2 A;  5GAN 5;  3A98 A;  5FRM A;  4GLM A;  5GAM j;  4C8Q C;  1AWJ A;  1QQJ A;  2M0O A;  2DXC A;  2LQW A;  2HBW A;  1NE8 A;  1M3A A;  4JJN K;  4C8Q E;  2L3Q A;  3V8K A;  1VQK A;  1TU0 B;  2RI5 A;  1BI2 A;  3QUI A;  4PJO A;  3BW1 A;  5LJ5 h;  3DKM A;  5HK0 A;  4BY6 C;  1OEB A;  3CCU A;  1AWW A;  4AMC A;  1ZLM A;  1U3O A;  3JB9 D;  2RJF A;  4DA4 A;  4OB2 B;  4J8O A;  4M78 D;  2EKO A;  4DBF A;  1S72 Q;  2DO3 A;  2DJQ A;  2V1Q A;  2HDA A;  5FWC A;  1VQO Q;  2DXT A;  4IUR A;  2JOY A;  1SSF A;  4M75 G;  1AEY A;  2EBP A;  2KRO A;  1KHI A;  2GBQ A;  1YJ9 A;  1ZSZ B;  9ATC B;  2DER A;  4KBM B;  4M77 F;  4M77 E;  1O75 A;  3I56 A;  2BE7 D;  3JCM W;  1VQP Q;  5CIU A;  5D7U A;  4M75 B;  2DEQ A;  3QBY A;  5J26 A;  3CCR Q;  1Y57 A;  1G2B A;  1TS9 A;  1ZX6 A;  3HKS A;  1UJY A;  5M9O A;  4OVA A;  2CH4 W;  5HCK A;  3CCR A;  1XQH A;  4JZ3 A;  2CP5 A;  1YCY A;  5KH6 A;  3CCU T;  5A2Q E;  2YSQ A;  1SRL A;  1YIJ Q;  1UGP B;  1O9S A;  4BE2 A;  1GXI E;  1G5V A;  1MMA A;  2VXF A;  2D9T A;  5LJ3 h;  2LCC A;  2DVE A;  2K9G A;  3L42 A;  4AFS C;  1PRL C;  2E3H A;  5C0M A;  4IKF A;  4J9E A;  2D1X A;  4LNP A;  3M0S A;  3MKD A;  1CKA A;  3CME Q;  4BI4 A;  3RMS A;  4M7D F;  4DBQ A;  2P4T A;  3VS1 A;  4PJM A;  1T0H A;  3OYY A;  2QQ9 A;  4BDY A;  1I5O B;  5KYY A;  1BBZ A;  2NLU A;  2KMT A;  1OPK A;  2ZPG B;  1KD1 R;  1NEG A;  3TU4 K;  2E41 A;  4FW1 A;  1QVG P;  3HPW A;  1WFW A;  1K0S A;  1D0Z A;  1UGQ B;  1VQ4 T;  1UDL A;  5CKE A;  2O2O A;  2J6K A;  4OF1 A;  5D6W A;  4HVV A;  2R5M A;  4M7A B;  1K0X A;  2VVK A;  1SG5 A;  1ZSG A;  2EQM A;  2X3W D;  1NEB A;  1YBY A;  2ECZ A;  2P4R A;  3M0T A;  3SWN C;  1U8R A;  1ZUK A;  1X43 A;  1AWO A;  3CCE T;  1QKW A;  4IUU A;  4EPC A;  2MF2 A;  3A5Z B;  1MND A;  1K73 C;  4LD6 A;  4N4I A;  2E12 A;  5CCA A;  2YDL A;  2E70 A;  2CP0 A;  2QQA A;  3C95 A;  3H6Z A;  1TSF A;  2IG0 A;  4E7S A;  3CCJ T;  1NLO C;  3JCM Q;  1ZQ1 A;  2K57 A;  4C8Q A;  4JZ4 A;  4RTW A;  1W6X A;  3SHW A;  2EWN A;  1UB4 A;  1VQL A;  2QK0 A;  2DEU A;  1QP2 A;  1PD1 A;  2PZ1 A;  4DBR A;  3I56 T;  3VS4 A;  1WA7 A;  4C5I A;  1XNI A;  4L59 A;  4OMN A;  1QWE A;  1QVG S;  3P8H A;  5GMK e;  2OTL T;  1WJQ A;  4X9D A;  2L8D A;  3L2R A;  2FVU A;  2QGG A;  3QZ5 B;  2ZPI B;  4R55 A;  1S72 T;  3VKI A;  2VUB A;  4PJL A;  1GBQ A;  1PCX A;  2LJ1 A;  2XMF A;  3EGU A;  2MOX A;  3MO8 A;  3QO3 A;  2YLB A;  4X34 A;  2K3Y A;  3PNW C;  2DL7 A;  2EGA A;  4M7D G;  2CS7 A;  2YXY A;  3GBQ A;  1VQ4 Q;  4C8Q B;  1X6G A;  2RQV A;  5LJ3 g;  2VB6 A;  3E2U A;  3AT1 B;  1I81 A;  2RK2 A;  4BI8 B;  3FLG A;  1KD1 U;  2DK3 A;  3BFM A;  4TVR A;  3JCM h;  2LX7 A;  4DOW A;  3CD6 Q;  1KFZ A;  3S3N A;  3NPF A;  3L2Q A;  1I0C A;  2RD1 A;  4MDX A;  1YI2 T;  3HFN A;  4JS4 A;  3RKY A;  4Z8A A;  1PG5 B;  2IIM A;  2ZCF B;  4NL2 A;  3JCM X;  2PVG B;  2GCX A;  1VQ8 T;  4FW2 A;  2YT6 A;  1I8F A;  4C0D C;  1K76 A;  2NUT A;  3HRU A;  4ZN1 A;  3I55 T;  2GQV A;  4M77 B;  2JT4 A;  1NM7 A;  3A1P A;  4ESR A;  1VQL Q;  2EJG A;  2JVV A;  2G3R A;  4AFQ C;  3REA B;  3OS5 A;  1UUE A;  4IUQ A;  5LJ5 f;  1VQ6 T;  3QYH B;  1JJ2 S;  2FZC B;  1I1J A;  2DXU A;  1XJW B;  2OX7 A;  1W2B P;  1NYF A;  2J7I A;  1GRI A;  7AT1 B;  3OW2 P;  2RA2 A;  4ELZ C;  3BDU A;  2RQW A;  1V1C A;  3OMC A;  4OMQ A;  3CQT A;  1N8R U;  1AZE A;  5A0G A;  4B9X A;  3Q1J A;  1VYU A;  2GTJ A;  4OGE A;  4C0Z A;  1WI7 A;  4DEX A;  3TEE A;  2GQI A;  2D8H A;  2XDP A;  4C8Q G;  4YTL A;  5ECA A;  2QTV A;  3E9G A;  3PVL A;  4QVZ A;  2GNC A;  4M7D B;  1EZZ B;  1NPR A;  3GIB A;  3V7S A;  4E7I A;  2RJC A;  3C4S A;  3CD6 T;  3CCE Q;  1WHL A;  3EAE A;  3MJX A;  2CP3 A;  2YUN A;  2HSE B;  1FMV A;  2X4J A;  2KI7 A;  2O9V A;  1M90 C;  2HZY A;  1VQ5 A;  2FRW A;  1JJ2 P;  2QA4 A;  1OX9 A;  2NUP A;  4FU6 A;  2DVJ A;  4J7F A;  4N4G A;  4ZTJ A;  2DZ9 A;  1H8K A;  4C92 D;  1BI0 A;  2OJ2 A;  3I9Q A;  1WXT A;  2CT3 A;  2O4X B;  2QA4 T;  1CKB A;  2DJZ A;  3G4S Q;  5FWB A;  1B34 A;  2RQR A;  3VS7 A;  1X75 C;  2JM8 A;  2CUB A;  1ZBJ A;  4BD3 A;  2O01 E;  2QDY B;  1TTH B;  1K1Z A;  1KSW A;  3E9F A;  2CDT A;  5DM7 R;  4PJO B;  3JSC A;  1KK7 A;  4C0D B;  3TQ7 P;  2DIG A;  4M7D C;  5GAM g;  3CC7 T;  3OYE A;  5AT1 B;  1MNE A;  2C06 A;  1YP5 A;  1H64 1;  1UTI A;  4MDW A;  3PMI A;  1UGV A;  3RKX A;  2DNU A;  1LPL A;  1KC8 U;  2JNG A;  4HCK A;  2KEA A;  2KGT A;  2FL7 A;  5DLQ E;  4AG1 C;  4GY5 A;  4K11 A;  2HKN A;  1K8A C;  2HQE A;  2LP5 A;  2DTO A;  1X2K A;  2X9H A;  2QDL A;  2KRM A;  4C92 A;  2X35 A;  2HL3 A;  1BB9 A;  3G4S A;  2D0Q B;  4CC7 A;  1UE9 A;  1YIT Q;  1WYX A;  1VA7 A;  2FPF A;  3NTH A;  4GLK A;  3M0R A;  2CGH A;  2JJ9 A;  2VGN A;  3ZEH A;  2WSC E;  2A28 A;  1GFD A;  2EQJ A;  2XDB A;  2JZ2 A;  1E6G A;  1PSF A;  2J6F A;  2XI9 A;  2KXC A;  2MWO A;  3H0H A;  4F14 A;  3PFS A;  2QYZ A;  1Y71 A;  2DLP A;  4ZN3 A;  4C8Q D;  4LDY A;  4PK4 A;  2MI6 A;  2L89 A;  1IRX A;  3OBW A;  1AVZ C;  1Q95 G;  2XU8 A;  2H8H A;  5GAO n;  1HXD A;  2DM1 A;  3OSS C;  5FU6 B;  3OB9 A;  4E2F B;  1G3S A;  3FB9 A;  3QKJ A;  4WCI A;  4LE9 A;  1PC0 A;  3WXM B;  1RLQ C;  3I55 A;  1F1B B;  2CKK A;  1YWP A;  4JRK A;  3OW2 A;  1RI9 A;  3SDZ A;  3SFM A;  4C92 B;  1GCQ A;  3EFR A;  3G4S T;  1VQ6 Q;  3ZBD A;  3KUF A;  4E6R A;  2E10 A;  1ACM B;  2A3L A;  3CBO A;  5GAO r;  2QAS A;  1LOJ A;  1LCK A;  2KT8 A;  3FDR A;  1QVF S;  2LCS A;  5HK3 A;  4M78 E;  5LJ3 f;  3MPU B;  3QDR B;  4EMK B;  1RAE B;  1Y07 A;  3X25 B;  3CC4 Q;  4M78 A;  3G7Z A;  2YUP A;  2ROL A;  3CPW A;  1M1K U;  4LUE A;  1MMG A;  3OYC A;  1Q81 U;  8AT1 B;  1IGU A;  1Y96 B;  1WHH A;  3OYK A;  3X20 B;  4LDV A;  2CSI A;  1WJS A;  1QWF A;  1YJN Q;  5FU7 B;  2FB7 A;  4ORZ A;  3F70 A;  2E64 A;  1M2V B;  2PVD B;  2X4X A;  1BI1 A;  1WLP B;  3QII A;  3JB9 G;  2F5T X;  1K73 R;  3S3M A;  1G3W A;  2YHT A;  2RI3 A;  4PFP A;  1GCQ C;  5CKF A;  3CBM A;  5CO7 A;  4C5G A;  3JCM g;  4OP0 A;  3BY7 A;  2NWM A;  2BZ8 A;  3S6W A;  4BB7 A;  3O5Z A;  2NUZ A;  4M75 D;  3IQL A;  3CCQ Q;  3GF5 A;  1W1F A;  2F2W A;  2QGF B;  5CAI A;  3CCJ A;  1YFN A;  1YJW A;  4FYV B;  1IZ6 A;  3NGP A;  4HCB A;  3EG3 A;  2EYX A;  2E65 A;  1FWZ A;  3A8H B;  4RG8 A;  1SPK A;  1FX7 A;  1NJI R;  3JAM E;  4QVD A;  4BE0 A;  1OUL A;  2DET A;  1K8A R;  3FRN A;  1M9S A;  1GBR A;  2C0O A;  1M1G A;  4RTV A;  2ABL A;  2LT4 A;  5FRO A;  5L8R E;  3CCV A;  1X2Q A;  1YIJ T;  1RAF B;  4OML A;  1VQ7 A;  1WNL A;  3JB9 J;  4QQ6 A;  5IH2 A;  4X9C A;  1BU1 A;  2RMO A;  2M02 A;  4PL6 A;  1U06 A;  4OGC A;  2LTO A;  1TUD A;  1KG1 A;  1VQ5 Q;  1WHG A;  3EG9 B;  5KYW B;  2RHY A;  1Q82 C;  1R0B G;  2MK5 A;  4OB1 B;  1UGS B;  4HCC A;  1YJ9 Q;  1M8V A;  4MZM A;  4RTU A;  1ZSZ C;  2K3X A;  3SWN A;  5IN1 A;  3HSB A;  4XK8 E;  3EFO B;  1QVF A;  3LH5 A;  3H8Z A;  2HD0 A;  1YJN A;  2QEX Q;  4BUG A;  3CMA A;  4HCZ A;  4FYY B;  2DRK A;  1WHJ A;  2ZPF B;  1QVF P;  2LDM A;  3JB9 H;  3VS0 A;  2K79 A;  5CKD A;  1OOT A;  3CME T;  1BIA A;  1T3L A;  1S1N A;  1VQ7 Q;  1Q7Y C;  4HXJ A;  4OMP A;  3DLM A;  4LXC A;  4A4G A;  1PNJ A;  2RN8 A;  4PFZ A;  2Y90 A;  1M8M A;  4KUL A;  1BCO A;  1S72 A;  2X51 A;  1ZA2 B;  5IHI A;  4Z89 A;  3HTR A;  3QHS A;  4O6J A;  1QMC A;  2CRE A;  3CCJ Q;  5CK9 A;  5IAY A;  2KT1 A;  4PJO F;  1NPP A;  1D0Y A;  2DRM A;  2Z0W A;  1N9R A;  1K8A U;  2COW A;  2WSF E;  1WXU A;  4OMO A;  4RUG A;  1N9S A;  2BTT A;  2DFU A;  5GAN f;  1G8X A;  1U1T A;  2XKO C;  2XIC A;  3P8B B;  3A8L B;  1AWX A;  4C5H A;  3QSU A;  3QDF A;  2NUP B;  3ULR B;  1M3C A;  2XG8 D;  2CZ1 B;  4A4E A;  5LJ3 j;  1RL2 A;  5GAN 4;  3C0C A;  1PKS A;  1G3Y A;  5KCO A;  1JEG A;  4ZGJ B;  1QVP A;  1KQS P;  2CP7 A;  5GAO m;  2PVO B;  4C0G A;  2P84 A;  2VAS A;  3I35 A;  1YIJ A;  1OYX A;  4CI0 C;  2RHX A;  1W70 A;  5KYU A;  1WGS A;  4RKU E;  3M4G A;  3G1J A;  5GMK j;  2XDD A;  4HKE A;  1M4Z A;  5FLX E;  4CC4 B;  2W0Z A;  5CKH A;  5I22 A;  4OMM A;  3OYH A;  4BY6 B;  3CCE A;  2M0Y A;  2QQR A;  4NL3 A;  4EMG A;  1VQ4 A;  4JRI A;  3OYM A;  1LNX A;  3CCL A;  1WQW A;  1YJW T;  4LUD A;  1V29 B;  1WDX A;  4HVU A;  2LQN A;  3PMT A;  4XTY A;  4B9W A;  2L3P A;  2DTI A;  2IVW A;  2RF0 A;  2EAY A;  3EGD A;  3VRZ A;  1K73 U;  4CRI A;  3RBB B;  3VV0 A;  1K4U S;  2M51 A;  2CT4 A;  4RG2 A;  1JQQ A;  5I2S A;  2JS0 A;  2KYM A;  3CXC S;  1K9M R;  2FEI A;  3DB4 A;  1QCF A;  3NTK A;  4J9F A;  2QQS A;  4C8Q F;  4F7U B;  5IHK A;  2A0F B;  2BUD A;  2CZ0 B;  3OY9 A;  4JJB A;  1V76 A;  1HD3 A;  4M78 G;  1LJO A;  2OTL Q;  3EG2 A;  4II1 A;  1X6O A;  3CCQ A; 
#chains in the Genus database with same CATH homology
 1BI0 A;  1OI1 A;  4NS5 A;  4F7U A;  1VIF A;  3JCM e;  3AHU A;  2KSS A;  1JRI A;  4PKC C;  2QEX A;  3LH0 A;  1XOV A;  3L2Z A;  2K5I A;  3CPW S;  2O4X B;  3M5A A;  3OS2 A;  2DJZ A;  2QA4 T;  3GP8 A;  1M1F A;  3URG A;  4E7L A;  4ZTF A;  2QTX A;  4D6W A;  1B34 A;  2DAQ A;  1X75 C;  4M7A G;  3A8M B;  3JCM b;  2LRQ A;  4M77 G;  4BD3 A;  2O01 E;  1VUB A;  2QDY B;  2YRV A;  1YIT A;  1WPY A;  5GAN 2;  4E7J A;  4C5E A;  4J6Y A;  4RCC A;  3LWI A;  3CCS T;  3E9F A;  2YLC A;  4WF2 A;  1KD1 C;  4LDX A;  2GFA A;  5DM7 R;  4M7A C;  3HRS A;  3JCM V;  4PJO B;  3JSC A;  4XTX A;  4C0D B;  1VQN A;  1VQ6 T;  3CD6 A;  2DIG A;  3SD4 A;  4M7D C;  5GAM g;  4M7A E;  3CC7 T;  5C6S A;  3OYE A;  5GAM f;  4P5N A;  1YHQ A;  3JCM J;  4M7A F;  1WJR A;  4PJO E;  1K9M U;  1BI3 A;  5A0L A;  3MEW A;  1Q86 U;  3QPH A;  2C06 A;  5DLO A;  4J83 A;  1W4S A;  1H64 1;  2RO0 A;  4MDW A;  3PMI A;  3RKX A;  4PJO C;  4M75 C;  1PSE A;  1KC8 U;  2JNG A;  2LCL A;  5GMK i;  1VQ9 T;  5CVI A;  1IRE B;  3PTA A;  4LDU A;  4PJO G;  2MWP A;  2FL7 A;  2M1H A;  3JCM f;  5DLQ E;  1YJ9 T;  4GY5 A;  1KQS S;  4RMO A;  3G6E A;  1K8A C;  2HQE A;  2OAU A;  3BDL A;  3M56 A;  4ME7 A;  4M78 F;  4M7D D;  5CR2 A;  2DTO A;  3JB9 F;  4E7K A;  1VQM A;  2WSE E;  2ZPE B;  5LJ5 g;  1VQ8 A;  4C92 A;  2X35 A;  1TH7 A;  3HRT A;  4J6W A;  2JN0 A;  5GAN 3;  5GAN 5;  3VU3 C;  3OYJ A;  2DPP B;  5LJ3 d;  4BE1 A;  5FRM A;  3G4S A;  2D0Q B;  4MML A;  4LDW A;  4C8Q C;  5GAM j;  2M0O A;  4E7H A;  4PLI A;  3NTH A;  2DXC A;  1VQO T;  3UT1 A;  4GLK A;  4BI3 A;  1Q82 U;  2CGH A;  2VGN A;  1NE8 A;  2LC4 A;  3ZEH A;  2WSC E;  4C92 F;  4JJN K;  4C8Q E;  2EQJ A;  2XDB A;  2JZ2 A;  3V8K A;  1VQK A;  1PSF A;  5I21 A;  4M75 A;  2RI5 A;  1BI2 A;  2L3R A;  1D3B A;  3QUI A;  2XI9 A;  4PJO A;  2MWO A;  3BW1 A;  5LJ5 h;  3DKM A;  5CKB A;  5KE2 A;  3PFS A;  5GMK h;  5HK0 A;  1VQK T;  1VQ6 A;  4V2S A;  4BY6 C;  3CME A;  1Y71 A;  2PUO B;  3RIR A;  3CCU A;  4MZP A;  4ZN3 A;  5GAN 6;  4C8Q D;  3HFO A;  4LDY A;  3LGL A;  3JB9 D;  4JRP A;  2RJF A;  2MI6 A;  4DA4 A;  2L89 A;  3OQ5 A;  4OB2 B;  4J8O A;  4M78 D;  2EKO A;  2XU8 A;  3OBW A;  3OW2 S;  1QVG A;  3UDC A;  5GAO n;  1HXD A;  4KUI A;  2DO3 A;  3OSS C;  2E1H A;  5FU6 B;  3OB9 A;  4C92 D;  2K4Y A;  1G3S A;  3FB9 A;  5GAN h;  2DXT A;  3QKJ A;  2FYK A;  4IUR A;  2JOY A;  1YI2 A;  3WXM B;  3X28 B;  1SSF A;  3I55 A;  4M75 G;  2P0K A;  5J3B A;  2BKD N;  4C0F A;  2EYQ A;  5KE3 A;  1Q7Y U;  1KHI A;  2CKK A;  2CYZ B;  2DTH A;  3LYI A;  3MHX A;  2XK0 A;  4QW2 A;  1YJ9 A;  5FRN A;  2X4W A;  4JRK A;  3OW2 A;  3E19 A;  4M77 D;  3S3O A;  2Y4X A;  4KBM B;  3CC4 A;  3SDZ A;  3SFM A;  4C92 B;  3M59 A;  2X4Y A;  3EFR A;  4M77 F;  5HY6 A;  3ZBD A;  3G4S T;  4M77 E;  2ZZD A;  3KUF A;  1O75 A;  3I56 A;  2E10 A;  3JCM W;  4FSX A;  2P0P A;  2A3L A;  5CIU A;  2ZGW A;  4ATO A;  3CBO A;  1VQM T;  5GAO r;  3OYA A;  4M75 B;  2VXE A;  2DEQ A;  3QBY A;  1LOJ A;  2H3J A;  2ZPB B;  5CQY A;  4PJO D;  4M77 A;  5J26 A;  4A4H A;  5LJ5 e;  1VQN T;  2V8J A;  3JRZ A;  4A53 A;  3HKS A;  2HQX A;  3FDR A;  3VYH B;  5M9O A;  4XU2 A;  3JCM d;  1QVF S;  4OVA A;  4KUD K;  5HK3 A;  4M78 E;  3LGF A;  5FU6 C;  3CXC A;  3CCR A;  5J39 A;  4FIB A;  5LJ3 f;  1M90 U;  1XQH A;  3QDR B;  4EMK B;  1YCY A;  2PQW A;  5KH6 A;  1NZ9 A;  4PLL A;  1Y07 A;  3M57 A;  3CCU T;  3X25 B;  4LD9 K;  3PIP A;  1R8O B;  3G71 A;  4OMF B;  5A2Q E;  4M78 A;  3G7Z A;  4QQG A;  3VUZ A;  1UGP B;  5LL6 S;  1O9S A;  2JTM A;  4BE2 A;  1M1K U;  3CPW A;  3ME9 A;  1GXI E;  3CPF A;  3CCV T;  3OYC A;  1Q81 U;  1KQS A;  1G5V A;  4FL6 A;  4FT2 A;  2OTL A;  3CCS A;  2VXF A;  2D9T A;  4L6V 5;  5LJ3 h;  2LCC A;  1P92 A;  2F69 A;  1Y96 B;  2DVE A;  3L42 A;  5GMK l;  3OYK A;  3X20 B;  5GAM e;  3J81 E;  4LDV A;  1WJS A;  1VQ9 A;  3VUB A;  5C0M A;  3C12 A;  2FB7 A;  5FU7 B;  3F70 A;  1WQ7 A;  2E64 A;  4IKF A;  2PVD B;  2X4X A;  1BI1 A;  4OB0 B;  3QII A;  3OYB A;  3JB9 G;  3WVD B;  1ZBX A;  2F5T X;  1B34 B;  2QXF A;  4M78 C;  3S3M A;  1G3W A;  2DXB A;  2YHT A;  2RI3 A;  5D6X A;  4BI4 A;  3RMS A;  4M7D F;  5CKF A;  3CC7 A;  2P4T A;  3CBM A;  3KXT A;  4Y91 A;  5CO7 A;  4C5G A;  3JCM g;  3OYY A;  2QQ9 A;  4OP0 A;  1QW1 A;  2GFU A;  3BY7 A;  4Z02 A;  3VJP A;  4BDY A;  3UWN A;  2NLU A;  4QQD A;  2KMT A;  4BDZ A;  5GAO q;  2ZPG B;  3S6W A;  4BB7 A;  1N8R C;  4M77 C;  2LVM A;  5GAN j;  2K5L A;  4M75 D;  3M54 A;  4J5Y A;  3GF5 A;  3OS1 A;  3TU4 K;  1JJ2 A;  2E41 A;  5GAM h;  1UEB A;  1OZ3 A;  3HPW A;  2KDS A;  5CAI A;  3CCJ A;  1YJW A;  4O5V A;  2O4X A;  1IZ6 A;  4ZGE B;  3NFC A;  3CCQ T;  2GF7 A;  1UGQ B;  1VQ4 T;  4HCB A;  5CKE A;  3M58 A;  1Y96 A;  4OF1 A;  1YIT T;  2KAF A;  2QI2 A;  5D6W A;  3PIO A;  3RMQ A;  2E65 A;  2R5M A;  2E6Z A;  2P0Q A;  1FWZ A;  4M7A B;  3X26 B;  3A8H B;  4RG8 A;  3OYN A;  3SWN B;  2JTF A;  1FX7 A;  5A0D A;  5GAN 8;  5D6Y A;  3M4Y A;  2EQM A;  4IUV A;  3JAM E;  4QVD A;  3L2U A;  4BE0 A;  3T9N A;  3FRN A;  4ZGD B;  1M9S A;  1BYM A;  2RHI A;  3RES A;  1N27 A;  2BIV A;  4Q5W A;  1M1G A;  5GAN e;  3CCL T;  1YBY A;  2LT4 A;  4L5G A;  3CEY A;  3GNF B;  1KC8 C;  5FRO A;  5L8R E;  3SWN C;  3CCV A;  4BAC A;  1YIJ T;  1U8R A;  1Q86 C;  2DD4 A;  3NTI A;  1VQ7 A;  3CCE T;  4IUU A;  4EDU A;  1WNL A;  4EPC A;  4QQ6 A;  3JB9 J;  2MF2 A;  2VC8 A;  3X24 B;  3A5Z B;  4X9C A;  3OYG A;  3OYI A;  1VQ5 T;  3MEV A;  3CC2 A;  2RK1 A;  3DB3 A;  1K73 C;  4HT8 A;  4LD6 A;  3ASK A;  4N4I A;  3V7R A;  5GAO p;  4PL6 A;  5GAN g;  1HK9 A;  2E12 A;  1MHN A;  3MET A;  2AHJ B;  5CCA A;  1AHJ B;  4JLG A;  4OGC A;  2E70 A;  2LTO A;  1KG1 A;  1H3Z A;  2QQA A;  3C95 A;  3H6Z A;  3QJY A;  2IG0 A;  1NJI C;  1W2B A;  3J80 E;  5GAN 7;  3CCM A;  2ZPH B;  3CCJ T;  2RHY A;  4OB3 B;  3JCM Q;  1ZQ1 A;  2K57 A;  3L1A A;  3V7C A;  3M55 A;  4C8Q A;  1Q82 C;  2EWN A;  4OB1 B;  1UGS B;  4VUB A;  4JRQ A;  1UB4 A;  4DQ2 A;  4HCC A;  1VQL A;  5GAO l;  4C92 C;  3R6O A;  1QP2 A;  2R57 A;  1M8V A;  1KQ1 A;  1D3B B;  4MZM A;  3I56 T;  2K3X A;  5AYF A;  3PGG A;  3SWN A;  3TRE A;  4C5I A;  1Y7X A;  1XNI A;  4L59 A;  5IN1 A;  3OA6 A;  3V8J A;  4XK8 E;  3HSB A;  3EFS A;  1QVG S;  1QVF A;  2LQK A;  3H8Z A;  4M75 F;  2HD0 A;  3HHT B;  4Y28 E;  2RH2 A;  3P8H A;  4XU1 A;  4E47 A;  5GMK e;  1YJN A;  2OTL T;  3GPL A;  4IUP A;  1WJQ A;  4X9D A;  2VV5 A;  2L8D A;  4BUG A;  3CMA A;  4HT9 A;  3MEA A;  4HCZ A;  2FVU A;  3QZ5 B;  3RKW A;  3MCA B;  2LNV A;  3GNG A;  3L2R A;  3JCM c;  2ZPI B;  2ZPF B;  4R55 A;  1S72 T;  1VQP T;  2DIQ A;  3VKI A;  2VUB A;  5LJ5 j;  2LDM A;  3QYG B;  3CC4 T;  5KCH A;  3JB9 H;  4M7D A;  5GAM d;  4KT0 E;  5CKD A;  2D6F A;  3INZ A;  3OYD A;  1X01 A;  4M7A A;  3CME T;  4XAX B;  1BIA A;  2K5F A;  2QQB A;  3MO8 A;  3QO3 A;  2YLB A;  4XU0 A;  2V8I A;  4X34 A;  3A8O B;  4XU3 A;  1G3T A;  2EJ9 A;  2EQU A;  1I4K 1;  2K3Y A;  1Q7Y C;  3PNW C;  4M7D G;  2RHU A;  2CS7 A;  3M53 A;  2KQW A;  3DLM A;  3G71 T;  3V8L A;  3FC3 A;  2Y4Y A;  1ZHI A;  2HBP A;  4C8Q B;  4N0A C;  3QJ6 A;  3SB2 A;  4A4G A;  3C94 A;  2V8K A;  5FU7 C;  4MZT A;  3GOX A;  2VYT A;  3LWH A;  4A4K A;  3JCM P;  3CCR T;  5LJ3 g;  1VQO A;  2Y90 A;  4RCB A;  1I81 A;  4EMH A;  2RK2 A;  4KUL A;  1W2B S;  4BI8 B;  3FLG A;  1KD1 U;  2DK3 A;  2XID A;  3BFM A;  4TVR A;  3JCM h;  1VQP A;  1S72 A;  4DOW A;  1BKB A;  4QVC A;  2EJF A;  3S3N A;  2JUF A;  1FXX A;  2DD5 A;  3HP9 A;  3QHS A;  2R5A A;  2RB6 A;  3L2Q A;  2OTJ T;  5HKC A;  4O6J A;  2RD1 A;  4MDX A;  1YI2 T;  1DJ7 B;  3HFN A;  5DY9 A;  4A54 A;  3OMG A;  4JS4 A;  3RKY A;  1UGR B;  4XTZ A;  4FT4 A;  5CK9 A;  3CBP A;  5IAY A;  2E5Q A;  3GLX A;  2ZCF B;  1Q81 C;  3O8V A;  2I2L A;  3OYF A;  4NL2 A;  4FM4 B;  2LT1 A;  3JCM X;  2PVG B;  1NPP A;  2RJE A;  2GCX A;  4JDS A;  4PJO F;  4XTU A;  1N9R A;  2EQK A;  5LJ5 d;  1VQ8 T;  3MEU A;  1I8F A;  1K8A U;  2WSF E;  2RHZ A;  3WVE B;  4C0D C;  3I55 T;  1N9S A;  1JBM A;  3HRU A;  4ZN1 A;  2GQV A;  1YJN T;  2OTJ A;  5GAN f;  1U1T A;  2R58 A;  2RI2 A;  2XKO C;  3FIF A;  2EFI A;  3ER0 A;  4M77 B;  2XIC A;  3P8B B;  3G6E T;  1EIF A;  2CZ7 B;  2HNI A;  3A8L B;  3L2W A;  4C5H A;  3TCJ A;  1JB0 E;  3QSU A;  2EJG A;  2JVV A;  2G3R A;  2XG8 D;  2CZ1 B;  5GMK m;  4A4E A;  4IUT A;  5LJ3 j;  1RL2 A;  3OS5 A;  3UPU A;  2K2V A;  5GAN 4;  4MMK A;  1G3Y A;  4EMK A;  3CC2 T;  4IUQ A;  5KCO A;  1U1S A;  5LJ5 f;  3LW5 E;  3PT9 A;  2F5K A;  3QYH B;  4F7U F;  1QVP A;  4ZGJ B;  4F7U E;  1BIB A;  4EMK C;  1YHQ T;  5GAO m;  1JJ2 S;  2M9U A;  3LX7 A;  2PVO B;  4M78 B;  2PU9 B;  4C0G A;  5EG2 A;  4R56 A;  1OYX A;  1YIJ A;  1N6A A;  2DXU A;  1RI0 A;  2A7Y A;  2LQ8 A;  4CI0 C;  5LJ3 e;  4J6X A;  2RHX A;  2RA2 A;  4C92 E;  1WGS A;  2KVQ G;  3FEO A;  4RKU E;  3BDU A;  3M4G A;  4XQ3 A;  3QG1 A;  4ELZ C;  5GMK j;  2M16 A;  3M9Q A;  4F7U G;  2XDD A;  3OMC A;  4HKE A;  2DZC A;  4XTW A;  3LLR A;  1M4Z A;  1N8R U;  3DLL A;  5A0G A;  2CZ6 B;  5FLX E;  1KHC A;  2PUK B;  2XHC A;  2MAM A;  1M5Q 1;  5CKH A;  4B9X A;  4ELY C;  3Q1J A;  3OYH A;  4N4H A;  4BY6 B;  4OGE A;  4C0Z A;  3CCE A;  4DOV A;  1VQL T;  2QQR A;  4NL3 A;  3RER A;  3QZ9 B;  5IT9 E;  2KY9 A;  2L5Q A;  3CMA T;  1K9M C;  2VGM A;  4EMG A;  3OS0 A;  1VQ4 A;  3CCM T;  4JRI A;  3OYM A;  2LX9 A;  3E1S A;  3TEE A;  4M7D E;  1LNX A;  4JLI A;  3CCL A;  3VYG A;  1WQW A;  4A4F A;  1YJW T;  2XDP A;  1V29 B;  3OYL A;  1VIE A;  4C8Q G;  3PMT A;  4YTL A;  4XTY A;  3E9G A;  4QVZ A;  5I2M A;  4M75 E;  2EIF A;  4M7D B;  4B9W A;  3MP8 A;  2DTI A;  2IVW A;  4XTV A;  1M1K C;  2EAY A;  3KBG A;  3HL8 A;  4J7I A;  5CQX A;  4JS5 A;  2FHD A;  2XD0 A;  1NPR A;  1OZ2 A;  3GIB A;  2RM4 A;  3V7S A;  3P8D A;  3QXE B;  4E7I A;  4M7A D;  2RJC A;  3MP6 A;  2DKG A;  4CRI A;  1K73 U;  3VV0 A;  3C4S A;  3CD6 T;  4NOY A;  2WAC A;  3EAE A;  2E6N A;  3MP1 A;  3OSV A;  1XTD A;  4RG2 A;  4N0A A;  5I2S A;  2RJD A;  3CXC S;  2MMP A;  3A8G B;  4UC4 A;  3ZFJ A;  2X4J A;  1NJI U;  3DB4 A;  3NTK A;  4F7U B;  2QQS A;  4C8Q F;  4C92 G;  3L2V A;  1M90 C;  3FJP A;  2BUD A;  5GAN d;  2CZ0 B;  3OY9 A;  3J7A F;  1VQ5 A;  2HAX A;  4PNO A;  1KQ2 A;  3N5B B;  1MGQ A;  3OBY A;  2QA4 A;  3JB9 I;  4FU6 A;  4JUV A;  4J7F A;  3RUX A;  1VQ7 T;  4M78 G;  4N4G A;  1I5L A;  4HA8 A;  1LJO A;  1QP3 A;  4ZTJ A;  2QEX T;  1X6O A;  2DZ9 A;  2KK4 A;  4II1 A;  2B8A A;  3CCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...