3VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ccdb
molecule keywords CCDB
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vubA00
1NE8A 3NFCA 3TCJA 1UB4A 5CKHA 4VUBA 5CQXA 5HK3A 2C06A 5CKBA 5CK9A 5DLOA 4MZPA 3JRZA 3G7ZA 2KMTA 5CCAA 2MF2A 5CO7A 4ME7A 5CR2A 5CQYA 5CKFA 4MZMA 5CKEA 5CKDA 4ELZC 1X75C 3VUBA 1M1FA 5HK0A 2VUBA 4OF1A 4MZTA 5HKCA 1VUBA 4HKEA 3JSCA 3HPWA 4MDXA 4ELYC
chains in the Genus database with same CATH superfamily
2RHZA 3UA6A 3OS1A 3VRYA 1MNDA 4C8QA 1WA7A 3C0CA 1Q82R 5C0MA 2DL5A 4FSXA 2DRMA 4XU3A 3CCEQ 3L2VA 2DRKA 2PU9B 2EPDA 4FIBA 1AWJA 3QHSA 3LGFA 4OMOA 1BI2A 3M0RA 1K1ZA 2COYA 2I0NA 3I35A 4BI8B 2LNVA 2XMFA 3CCMA 1JJ2P 1PD1A 5GAMh 3PIOA 1RAAB 4BACA 4HCZA 2LT1A 2KMTA 1HYOA 4RCBA 5IN1A 3V7RA 1NYGA 2LJ3A 2FRWA 5GAOm 1Q81R 4XTXA 1OX9A 1PCXA 1WGSA 4J9GA 5CIUA 2P4TA 2DL7A 1ZBXA 3AT1B 5A0DA 1SRMA 3MEWA 4ZGEB 3RUXA 4LE9A 3L2QA 3M0SA 4E7KA 4MZMA 3G6ET 3CBOA 1YJWT 2D0NA 2K79A 1VQ6A 1RAEB 3JSCA 3CC7Q 1S72T 3M58A 2CZ6B 3SD4A 2VB6A 3GOXA 4ZTFA 2A0FB 2K7AA 2LZ6B 4Z88A 3C12A 3HFNA 2CZ1B 4J6WA 1FX7A 2WACA 4YTLA 2JVVA 2LC4A 2HL5C 2A7YA 2FRYA 2QAZA 4II1A 2FO0A 1OPLA 2GQIA 3RKWA 2MOXA 2HL3A 3T9NA 5GANf 4QKUA 4JJNK 3RMSA 3CC4T 1QWEA 1Y07A 2MF2A 2E6ZA 4J9DA 3A5ZB 5GAMd 5L8RE 1WIEA 1SHFA 2HNIA 4Z89A 1OQKA 3RNJA 4FYVB 3JCMb 3M53A 2ESWA 3NFCA 1RLQC 5GJVB 2VYTA 2D9TA 1VQ4T 1YIJT 1KQ2A 2W0ZA 2DLPA 2CGHA 1K9MC 3GNGA 4N0AC 3CXCS 4EDUA 2L3QA 2YUQA 1BB9A 1W1FA 2LMJA 1G2BA 1R0CB 1P92A 3EG1A 2ATCB 2NUZA 4HXJA 3PT9A 3H0FA 1KHIA 2E5QA 4OGCA 5CKHA 3EGXB 3UA7A 2QTXA 1JXMA 4IUVA 2NLUA 2X4WA 1X6OA 2KT1A 3V8JA 4HCCA 1VQNT 2HSPA 2PVDB 2AIRB 3P8HA 1QCFA 5CQYA 3EGDB 1SF9A 3RDVA 1JO8A 3LH0A 2DL8A 4M7AE 2H3EB 1UFFA 4AG1C 2RQRA 2K9GA 1GL5A 1OZ3A 1WXUA 4E6RA 2FPDA 3CCRT 1VQ7A 3CCUT 4A54A 2H8HA 2HQXA 2A36A 2AKLA 2RJEA 3CMAT 4OB0B 2K3YA 4RTXA 1AEYA 4A53A 1GCPA 4M7AA 4D8DA 4QVCA 2QYZA 3CQTA 1F1BB 4FSSA 5GAOl 4JJDA 1QLYA 1W70A 3JCMV 1VOMA 3CCLQ 1TWBA 1RADB 1UECA 1QVGS 3G7ZA 2P0PA 4GLMA 4RCCA 3FJ5A 1VYUA 4CC4B 2EBPA 1AZEA 2QEXQ 3I55T 2XHCA 5J39A 1M1FA 1PKTA 1H641 2DVJA 1YCSB 3C94A 1Q82U 4J6YA 2V8KA 2XICA 1QVFA 1K76A 2WSFE 1IHVA 4KT0E 2A3LA 3V7CA 3VS3A 5GANd 2EGEA 5FROA 2VWFA 1W4SA 3KUFA 3BFMA 1KD1C 4X9DA 1ZX6A 1NLOC 2RJFA 2ZCFB 2V8JA 3A8GB 4ESRA 1X6BA 3RMQA 1B34A 3QWXX 1QVFS 1OI1A 5FLXE 3A8HB 3QPHA 4F16A 1VQOA 1Q81U 3EG2A 4RTYA 5D6YA 1TXQA 4ZGDB 2E1HA 4EMKC 4RG8A 5LJ5g 1VIEA 1KK7A 3CPWA 2KRMA 1N6AA 2R5AA 2QTVA 1ACMB 4PFZA 1TS9A 3CCSA 1U06A 3JCMQ 4IIMA 1DJ7B 4RMOA 1IHWA 2DKGA 4RUGA 4KUIA 3EG9B 5GMKe 1VQ5T 2KXCA 2KR3A 5GAMj 4FL6A 2RD1A 1M90R 1QKXA 3L2RA 3M0PA 2RI3A 3M0UA 4BE2A 1BBZA 2AZSA 3GF5A 3X20B 5A2QE 4A4GA 3UATA 4BB7A 2FPEA 5KYNA 2QA4A 1RUWA 4X34A 3LX7A 4PLLA 5CQXA 5FU6B 2XD0A 3H41A 2E65A 2RB6A 1UDLA 2VGMA 5I21A 1X6GA 5GMKj 3HSBA 2O4XA 5I11A 1PM3A 4M7DD 4A4HA 3DB4A 1PSEA 5A0GA 2K57A 3VS6A 1X43A 2F2WA 3OY9A 5I2MA 4M75E 1TOVA 1JXOA 3DLMA 2JT4A 1AZGB 4C92B 1WQ7A 3JB9I 2BKDN 1ZUYA 2JJ9A 2FPFA 2M02A 3H0HA 4PKCC 1G83A 3CCET 1H3HA 1ZLMA 2VXEA 3SB2A 3HRUA 2KY9A 2EYXA 1ZSZB 4LDYA 1VYVA 5C6SA 4PJOE 4HT8A 3HFOA 4A4EA 5KH6A 1TUDA 4D6WA 4LXCA 2K3XA 4M75A 2CSQA 2VXFA 5GAN5 3J80E 4M77B 2Z0WA 2K5IA 1GFDA 2ZPFB 4DEYA 4OB2B 4PLIA 4DA4A 3HRTA 1WHKA 2DERA 1ZA2B 1D3BA 3QUIA 3RIRA 2JS0A 4PJOA 4PJMA 2D8HA 3M0QA 2HKQB 3OYBA 3GBQA 4PJLA 3X28B 1N9SA 2EIFA 3O8VA 1YJ9Q 1YHQA 4JRQA 3H8ZA 2CDTA 1D09B 4JRKA 4ELYC 4PJOC 2C0TA 4CC3A 3PMIA 1T3LA 3OW2P 1XQHA 4IIOA 1OV3A 5GANe 4JPBW 5IHNA 4C0DC 1SRLA 1VQ9Q 5IXBA 1WHMA 1YCYA 2YUNA 5GAOr 1M5Q1 5KE3A 3CMEQ 1YJNQ 4OGEA 2B8AA 3CC7T 5DY9A 2L3PA 1YITT 2QDLA 3EFOB 2AHJB 3HPWA 5LJ3f 1EZZB 3BY7A 2HZYA 1R77A 2XK0A 1D1AA 3MEVA 1G5VA 3OS2A 2GFUA 2F5KA 4J6XA 3OYKA 4MZPA 5GANj 2YHTA 2EYZA 1CKAA 2RHIA 3MJXA 1VQKA 2O31A 3CCVA 3PVQA 1B07A 1IGUA 4XTVA 3VUZA 3L2WA 3G6EA 2ENMA 1D1BA 4N4HA 2L3SA 4LNPA 3MEAA 4F7UF 1S72A 1Q86R 3CCMQ 2QXFA 3G4SA 4BUGA 3VS7A 2AT1B 4BI4A 4M78E 4NL2A 4M7DG 1VYTA 2KYMA 4DEXA 4XAXB 2P84A 4BI3A 3TVTA 3HP9A 1M90C 2K5FA 2DA9A 3OSSC 1TH7A 1ARKA 2JNGA 4O6JA 2Y4YA 4BDZA 2DXUA 5LJ3h 4KUDK 2XI9A 2MWPA 1M3BA 1CSKA 4QQ6A 2GF7A 4J5YA 2FZGB 3BDUA 4M78A 1G3TA 4DOWA 4RTZA 2RPNA 3X25B 3VYHB 2K2MA 3NTKA 1AWXA 2NUPB 1SSFA 4LUEA 2X9HA 3NPFA 1UHFA 1VQPA 1VQ6Q 4AMCA 3JV3A 1JB0E 2L8DA 2M0OA 2RQWA 2WSEE 2CT3A 4AFUC 1YIJA 2HQEA 4IURA 5LJ5h 3JCMX 1NBEB 2XKOC 4GY5A 2ABLA 5GANg 1TUCA 1MGQA 4IUPA 4JS4A 2QQAA 3UWNA 4FM4B 3JB9J 1IXDA 3SWNB 2KGTA 1WHJA 4DOVA 2LQ8A 2IPOB 1LPLA 2DETA 2MIOA 1UUEA 1C0MA 1M1GA 2H3JA 4C8QG 3LWIA 3BDLA 3MHXA 2OX7A 4E7LA 1G8XA 2F69A 1M2VA 2KT8A 1SKUB 4ZTJA 4HCBA 4EMHA 2DIQA 2DL4A 3QZ5B 2NWMA 3EHRA 3OS0A 3ME9A 4OB3B 3JB9D 1VA7A 3GLXA 5HCKA 4Q5WA 4MDWA 1WJSA 1MV0B 3TU4K 3UT1A 2BTTA 3PFSA 4IUQA 3LH5A 1QP2A 4E7SA 1SG5A 1OU8A 2RO0A 3JRZA 4ZNXA 2QEXT 3CCRA 2LX9A 3PMTA 1BI3A 1WXBA 1AVZC 2RHXA 1BKBA 3JCMg 2JMCA 2RF0A 2E64A 1Q95G 1PD0A 5GAOn 3A1PA 1U8RA 1E6HA 1WLPB 4ATOA 4GLKA 2NUTB 3X26B 2JZ2A 5HK3A 4M7DB 1Y7XA 3G1JA 1Y0MA 1WHHA 1QP3A 2DE0X 1K0SA 2KEAA 3OYHA 2YLCA 1YWOA 2DXBA 3R6OA 3QJ6A 5CKEA 2ZAEA 3VKIA 1HXDA 4A4FA 3REBB 4L5GA 2CKKA 1N5ZA 5DM7R 4KH0B 3A8OB 2V1QA 2F1LA 4ELZC 1N27A 2BIVA 4RTTA 3OBYA 1M9SA 1ZQ1A 1ZHIA 2CH4A 1VQ7Q 4MMKA 4ME7A 3QBYA 1KQSP 4BDYA 4OVAA 2YT6A 3WVDB 1X2KA 1MUZA 2A28A 2ZPGB 2EWNA 3ZEHA 2K6DA 3OB9A 2DXTA 3GIBA 4UC4A 2KRSA 1UGRB 4LUDA 2E5KA 2DVEA 2ZPBB 3S3OA 4OMMA 1JJ2S 4C92D 3VU3C 2HCKA 3CPFA 1EFNA 2AZVA 4JJCA 3BE3A 4XTWA 3DKMA 2KBTA 4J9CA 1H3ZA 2OTJT 2CP0A 3GPLA 2JTEA 4AFSC 5KYYA 4C8QB 3KFVA 3HKSA 3J7AF 1VQLA 5IHIA 2D8JA 1WPYA 1PSFA 4M77D 1BCMA 1PG5B 3JCMc 3CCJA 3META 3JB9G 2IG0A 2FZCB 2HBPA 2LNHB 3CXCA 3NMZC 1Q86U 1R0BG 5KYUB 4N0AA 1HSQA 5DLQE 5GAN8 1LNXA 2KDSA 3J81E 2R5MA 1VQOQ 5GJWB 1MMGA 3MPUB 2DPPB 8AT1B 1VQ8T 3M5AA 1RI9A 2XDPA 2LQNA 2JUFA 2E12A 2QQRA 4F04B 4MDXA 3OSVA 2VKNA 4E7IA 1X27A 3CCSQ 4WTOB 2VV5A 4HCKA 1LOJA 3HTRA 3TEEA 2DYIA 4HVWA 5DLOA 1AWWA 1Q82C 4C0ZA 5EC7A 2LX7A 4L59A 2M9UA 3S6WA 1I5OB 1YJ9T 4PFPA 4X9CA 5I2SA 1I07A 2PTKA 1NPRA 1Y57A 2QA4Q 4JDSA 5LJ3j 1FYNA 1WQWA 3S3NA 4J7FA 1VQ9T 2HAXA 2VASA 3CMET 1YI2A 3H0IA 1TSFA 1QVGA 1Q81C 2CP2A 1D0ZA 5GMKi 1VQMT 1PNJA 4C5IA 5HKCA 5KCOA 2DZCA 1PWTA 4M4ZA 3MKDA 4C92G 3ZL7C 2FEIA 2DNUA 2KYBA 5KYXA 2EGAA 1SHGA 1YFNA 2X4YA 2YLBA 5CO7A 3OYYA 1R8OB 2P0QA 4JRIA 1X75C 2E10A 5IAYA 3E2UA 3LLRA 3CCMT 5D6WA 2KE9A 1YITA 4J9FA 4M77G 2JMAA 3JCMJ 3JCMh 3OYLA 1GCQC 3I56A 5EG2A 1X69A 3LGLA 2DTIA 3CD6A 2AKKA 1KHCA 2MCNA 4EMGA 3FIFA 1YHQQ 4EMKA 1ZUUA 1OU9A 3OYEA 2K4YA 2EYQA 4XTYA 1WJQA 4LDVA 5GAMe 5CCAA 3CPWP 2MK5A 4C92C 1YP5A 2ZZDA 1VQ6T 3QZ9B 2O2OA 3C4SA 4NL3A 3EG3A 4LDXA 1E6GA 2J7IA 2OTLT 2COWA 2CSIA 1LCKA 2ECZA 1ZSZC 1IZ6A 3H6ZA 2EJ9A 4DBRA 5A0LA 2XDDA 3QDRB 5FW9A 2HSEB 1MHNA 4KH1B 4B9WA 1AHJB 1YBYA 1MMAA 3N5BB 4M7AB 1VQKQ 2DD5A 5HY6A 3CCVQ 3GP8A 3G6EQ 6AT1B 4RTVA 3Q1JA 4A4KA 2YSQA 3G71A 4F17A 4C92F 3NTHA 1OPKA 2JTMA 4F14A 1S72Q 3QWYA 3G4SQ 4FU6A 3I5RA 3MP8A 4C0FA 2L89A 5GAN2 2MPXC 3DLLA 1Y96A 1M27C 2DXCA 1U1TA 2F5TX 2HQHA 2J6KA 4FT2A 4XU1A 3TQ7P 4M77F 5IT9E 1WJRA 4ZN1A 2LQWA 3OBWA 4PJJA 3CC2A 2FL7A 5KYWA 1M2OA 4JLGA 1JBMA 2LJ0A 1BCOA 2A37A 2G3RA 2YUPA 3CCQA 3FB9A 1G3SA 2DO3A 4XU0A 1IGQA 1FMWA 2YWWA 1VQPQ 4Z8AA 1B34B 3JAME 2KNBB 4F7UE 1M4ZA 2DTHA 1TU0B 3QDFA 2LCLA 1K8AR 4RKUE 2F2XA 2JW4A 4ZN3A 3TREA 2O88A 3LW5E 5GAMg 1RLPC 3CBMA 1KC8R 1PHTA 2CZ7B 3P8BB 5HK0A 2EKHA 4FYWB 1WFWA 2ZPEB 2C0IA 3REAB 1K0XA 2IVWA 1OX8A 2ED1A 1N9RA 1KQ1A 4F7UA 5AT1B 4WCIA 1VQ7T 2DZ9A 1K73R 2PQWA 1RAIB 2FHDA 3EH2A 4C8QD 3FC3A 1GBRA 2DAQA 2BZ8A 3SHWA 4OMNA 3JCMP 1WX6A 1BK2A 1KIKA 1ZBJA 2BZYA 2YRDA 1M1KR 2XG8D 1Z9ZA 2ZGWA 2DD4A 2LJ1A 2BE9B 4OP0A 1NYFA 2L2PA 2O4XB 1M3AA 1PKSA 1V76A 4JRPA 4NOYA 1OOTA 2JTFA 3CBPA 2X51A 3RR6A 4BY6C 2D1XA 1YJWA 4HKEA 2RQUA 2HMAA 2M1HA 1XOVA 4M78G 3OW2S 1BU1A 4QT7A 3SWNC 1BI1A 4J9BA 3M0TA 3H9NA 4JJBA 5LJ5f 1QVPA 1XJWB 1ZSGA 4M75B 4B6MA 1K9AA 5GAOp 1Q7YU 2KAFA 1UGPB 2DJQA 4O5VA 1RAFB 2OTJA 1QKWA 5KCHA 1VQOT 4DBHA 3HHTB 1D3BB 4PJOB 4Y91A 2LCSA 5J26A 1BYMA 1W2BP 2M16A 2SRCA 3CC4A 1TUGB 4J7IA 3OYDA 3I9QA 5IXFA 3CCST 2L3RA 4PJNA 2EQJA 2KROA 1UGSB 2VVKA 3EGUA 1JRIA 1VQ4A 4M7DA 2DBKA 3OQ5A 2RK1A 4BE1A 4CC2A 1OZ2A 2ED0A 1IREB 1O9SA 3RKXA 1FXXA 4ZGJB 1VQ8A 3PE0A 4M7DC 3SFMA 2M51A 2IIMA 4E47A 3QSUA 4JUVA 2P4RA 1QCOA 1C1AA 3QJYA 1K8AC 1VQLQ 4XQ3A 2GCXA 5AYFA 1HD3A 3DB3A 3CCJQ 5FWCA 2CUBA 3RERA 1M3CA 2DEUA 1VQNA 1D0XA 5FU7B 1QWFA 5GMKm 4OMLA 1HK9A 2PVOB 2J6FA 4WF2A 1M8VA 4FYXB 1I81A 1I0CA 3CCLT 4KRTA 1KJWA 5LJ3d 2JM8A 2A08A 3IQLA 4M7DF 2XDBA 1WI7A 2ZPIB 3CCUA 4E7JA 2YRCA 2EKOA 1NLPC 5FRNA 4LN2A 1TTHB 3L2UA 2SEMA 5GAN3 4AFQC 1M1KC 3CMAA 1VQMA 3A98A 3E19A 1N8RU 2DFUA 2MI6A 3OYCA 4M78B 1IB8A 4XTUA 2L0AA 2Y90A 2C06A 4DBFA 5LL6S 4DBQA 2CP6A 2DJZA 2MMPA 3NTIA 2CP5A 3UF4A 2OAUA 3RBBB 5LJ5d 2JS2A 2V26A 4C8QC 1C6VX 4BE0A 2DL3A 1YHQT 3V7SA 3I55A 2FYKA 1W6XA 1AWOA 1K8AU 3OYAA 5KYUA 3TCJA 2DILA 1Q86C 2KI7A 4M7AD 2PNIA 4J9EA 1KC8U 2DMOA 2EVRA 5CK9A 2DEQA 2HEQA 2JM9A 2HDAA 1YI2Q 2RI2A 1QMCA 2LCCA 1JJ2A 4Y92A 3ASKA 1UGQB 3OYFA 1X01A 5M9OA 3MP1A 4X1VA 1Y71A 4IUUA 4OB1B 2EQMA 1K73U 2ROLA 4PK4A 5GMKh 4C8QF 1AT1B 1M2VB 3EGXA 4JZ3A 3M56A 3V8LA 1VQKT 3M4GA 1M1KU 3CCVT 2FZKB 2HKNA 3FJPA 4R56A 1NG2A 2RQTA 2X3XD 3EGDA 3E9FA 3SDZA 1ZA1B 1KQSA 2JOYA 3VS5A 4D8KA 3G4ST 2EGCA 1YITQ 1GBQA 2OTLA 4LD6A 4ANJA 5D6XA 3I5SA 3CXCP 2PVGB 3EH1A 3I56Q 1VQ5A 1NJIR 1S1NA 1IO6A 4FW1A 4JLIA 3CD6Q 2KRNA 1T3SA 1KQSS 1KD1R 2RHYA 3VRZA 3D7SB 5IHKA 2V1RA 1H92A 2GBQA 4J9IA 4KGXB 1JEGA 2EQKA 2PUOB 2GTOA 3NHNA 1WHLA 2AK5A 2C0OA 3ULRB 1UTIA 1UGVA 4K11A 2CP7A 3HL8A 1LVKA 3V8KA 2EJFA 2RNAA 2R58A 1VQPT 3JCMW 4R0KA 3URGA 4ORZA 5GMKl 3L42A 3E1SA 1ABQA 4V2SA 1KG1A 3M54A 4QW2A 1K4US 5LJ3e 2JXBA 2PZ1A 3FEOA 4QVDA 1RI0A 4FT4A 2ZPHB 4PFOA 1ZUKA 3CCEA 2CYZB 4PL6A 2X3WD 1SEMA 3VJPA 3LYIA 5CKDA 2EQIA 5KE2A 3EFRA 2VUBA 4LDWA 4M7AG 1RAGB 3U23A 3MO8A 1V1CA 2O9SA 3G71Q 4HVUA 5GANh 2LQKA 1MV3A 1JU5C 2R57A 4KGZB 2BE7D 2FB7A 1E7OA 1QVGP 2EYWA 3JCMf 2RH2A 3X24B 4C0GA 5LJ5e 2QK0A 1GFCA 1YJNT 2EW3A 3VYGA 2K2VA 4P5NA 4R55A 1O75A 2CZ0B 7AT1B 5KYYB 1NEGA 4MZTA 2COZA 2DIGA 4JZ4A 1QCNA 4C5GA 2RJDA 3MEUA 4M75D 1WYXA 4MMLA 1YWPA 3CC2Q 2K3BA 3F70A 2XIDA 2MWOA 2KVQG 3OMGA 3GNFB 3JB9F 2RHUA 3EG9A 5LJ5j 1I5LA 2GTJA 3CCQQ 1EIFA 8ATCB 4XTZA 3M4YA 1GCQA 4PJOD 3QYGB 3CC7A 3L1AA 1K9MU 1NE8A 1QVFP 1CKBA 1Q7YR 1RAHB 3TSZA 4C92E 1NZ9A 1PRMC 2LRQA 3FLGA 4M7AC 3FRNA 5GAOq 2RA2A 4IUTA 3SEMA 1TG0A 2O01E 4EIKA 2RJCA 3RESA 2K5LA 3P8DA 5FWBA 3EAEA 5FU6C 4AG2C 1OYXA 1UJYA 3MCAB 4LDUA 2DF6A 1UB4A 1YN8A 4M77E 4CI0C 4C92A 1KSWA 2MAMA 5LJ3g 4CC7A 3WVEB 2QQSA 2QGGA 1NJIC 5CAIA 1KFZA 1EX4A 2OJ2A 4KGVB 2BZXA 1ZSZA 1FMVA 3E9GA 1RL2A 2E41A 3EG0A 2NYSA 2RM4A 3BW1A 4M7AF 4M77A 2MYSA 4VUBA 3A8MB 4RTWA 2W10A 2I2LA 1JQQA 2Y4XA 3KBGA 4L6V5 4M77C 1I4K1 3VV0A 1GRIA 1B3QA 3S3MA 1B7TA 4J8OA 1AD5A 2OAWA 1MNEA 4XK8E 3L2ZA 2V8IA 4J9HA 4KULA 1VIFA 4OMQA 3VS0A 1FWZA 3PVLA 1YJWQ 2LT4A 1QW1A 1VQLT 3EFSA 2CP3A 3HRSA 1BIAA 5KYXB 1M8MA 1X2QA 3CCJT 1J3TA 2DX1A 4M78D 2D0QB 4Z02A 4C5HA 1Z9QA 3JCMd 1HJDA 3CPWS 3O5ZA 4OMFB 3VS1A 4AFZC 2DBMA 4M75G 2VC8A 2YUOA 2X35A 4HA8A 2FVUA 2CH4W 3EFOA 2OTJQ 3M57A 1NJIU 1WNLA 4IKFA 1NEBA 4XU2A 2EJGA 5IH2A 1N8RR 1KD1U 4NS5A 1T0JA 2KQWA 2KXDA 4PJOG 3CC4Q 2WSCE 3KXTA 2E4HA 1RABB 3QO3A 5D7UA 3INZA 2RQVA 4HT9A 4E7ZA 1VUBA 3OYGA 4A63B 4EMKB 4GBQA 4FCYA 1M30A 4F7UG 1WXTA 2B86A 3CCLA 4RTUA 2EAYA 1OEBA 2G6FX 2PUKB 3OYJA 1YIJQ 3RKYA 1VQ4Q 1D0YA 4PNOA 2E6NA 2L5QA 1U5SA 1LJOA 2QEXA 2J6OA 3UDCA 2DTOA 1VQ8Q 3M59A 4OF1A 3ZFJA 3VS4A 5GAN7 3PNWC 3ZBDA 4KBMB 1AOJA 4N4GA 2BUDA 3PTAA 1Q7YC 2D6FA 2LVMA 4C5EA 2GGRA 4M75C 2F2VA 1YI2T 4LD9K 2M0YA 2QI2A 5L23A 5CR2A 3CEYA 1VQNQ 4FYYB 2XU8A 2KK4A 3VUBA 1BI0A 5CVIA 2NUPA 5J3BA 4QQGA 2YXYA 2GFAA 2LP5A 1G3WA 1QQJA 2LDMA 1UHCA 1YNZA 1RACB 3QG1A 3EHQA 5I22A 1NPPA 3FDRA 2QQ9A 4AT1B 3VS2A 3LWHA 1UE9A 1Y96B 2J05A 1ABOA 3OW2A 3CCRQ 3CCUQ 2VGNA 5CKFA 4TVRA 4M75F 2DK3A 3SWNA 1GXIE 3CMAQ 1VQMQ 4E2FB 1V29B 1I1JA 1PRLC 1PC0A 4EPCA 2LTOA 5KYWB 2HBWA 3ER0A 3QKJA 3OYNA 3I56T 1T0HA 2YRVA 2OI3A 3MP6A 3AHUA 3CD6T 4PJOF 2YDLA 2E3IA 2RN8A 5GAN6 4BD3A 4QQDA 2HD0A 3C95A 2X4XA 1WDXA 5ECAA 3WXMB 4FW2A 3I55Q 2QASA 4JS5A 1OULA 2J06A 3OS5A 2P0KA 3QXEB 2RI5A 2EQUA 5FU7C 2FG0A 1H8KA 3JCMe 4M7DE 2EFIA 3OYIA 9ATCB 2O9VA 1U3OA 2DM1A 4C0DB 2GNCA 2JN0A 4F7UB 3PGGA 3NGPA 5FRMA 1UJ0A 3OYMA 3PIPA 3M9QA 4OMPA 2NUTA 2E3HA 2EYYA 3R6NA 5CKBA 1N8RC 2RK2A 3QYHB 4CRIA 4N4IA 2CT4A 1I8FA 4M78C 1W2BA 3JB9H 2CUDA 3OA6A 4DQ2A 3G71T 4RG2A 2QA4T 1SSHA 1MMNA 2X4JA 1MMDA 1BIBA 1FMKA 2CS7A 4BY6B 1IRXA 2OTLQ 4HVVA 1D1CA 2KSSA 3QIIA 2QDYB 1NM7A 2GQVA 1WZOA 2CREA 4J83A 1VQ5Q 1XNIA 3OMCA 3A8LB 1W2BS 2QQBA 1KC8C 1U1SA 5GAN4 3TSWA 2QG9B 2QGFB 2ROTA 4QVZA 1UEBA 1YJ9A 1WHGA 2DYBA 1UG1A 3CC2T 1XTDA 3THKA 4E7HA 1M90U 4M78F 1A0NB 4C8QE 5GAMf 3M55A 1K73C 3UPUA 1VQ9A 3CCQT 1K9MR 1G3YA 3CMEA 1SPKA 1YJNA 2RMOA 2E70A 4B9XA 4Y28E
chains in the Genus database with same CATH topology
3M54A 2RHZA 3BY7A 4QW2A 5LJ3e 3OS1A 1IZ6A 2XK0A 3H6ZA 3MEVA 1G5VA 4C8QA 3OS2A 2EJ9A 2GFUA 3FEOA 2F5KA 5A0LA 4J6XA 4QVDA 3OYKA 4MZPA 5GANj 1RI0A 2XDDA 5C0MA 4FT4A 2ZPHB 2YHTA 4FSXA 3QDRB 3CCEA 2CYZB 4PL6A 4XU3A 3L2VA 1MHNA 2RHIA 2PU9B 1AHJB 1YBYA 3VJPA 3LYIA 4B9WA 3N5BB 5CKDA 4FIBA 1VQKA 4M7AB 5KE2A 3CCVA 2DD5A 5HY6A 4XTVA 3VUZA 3GP8A 3QHSA 3L2WA 3G6EA 3EFRA 2VUBA 3LGFA 4LDWA 1BI2A 4M7AG 3Q1JA 3MO8A 4N4HA 4A4KA 3G71A 4BI8B 2LNVA 3MEAA 4F7UF 4C92F 3NTHA 1S72A 3CCMA 5GANh 2JTMA 2LQKA 2QXFA 3G4SA 2R57A 4BUGA 5GAMh 3PIOA 2FB7A 4FU6A 4BI4A 4M78E 4HCZA 4NL2A 4BACA 3MP8A 2RH2A 3JCMf 3X24B 4M7DG 4C0FA 4C0GA 2LT1A 2KMTA 2L89A 4RCBA 5LJ5e 4XAXB 5GAN2 4BI3A 1YJNT 5IN1A 3V7RA 1M90C 3HP9A 3DLLA 2K5FA 1Y96A 5GAOm 3VYGA 2DXCA 2K2VA 3OSSC 1U1TA 1TH7A 2F5TX 2JNGA 4XTXA 4P5NA 4O6JA 4R55A 1WGSA 2Y4YA 1O75A 4FT2A 4BDZA 2CZ0B 2DXUA 4MZTA 4XU1A 5CIUA 5LJ3h 2DIGA 4KUDK 2P4TA 4C5GA 2XI9A 4M77F 2RJDA 3MEUA 2MWPA 5IT9E 1WJRA 4ZN1A 4M75D 3OBWA 4MMLA 3CC2A 4QQ6A 1ZBXA 2FL7A 2GF7A 4J5YA 3F70A 5A0DA 2XIDA 3BDUA 4M78A 1G3TA 2MWOA 3MEWA 4DOWA 4ZGEB 3RUXA 2KVQG 3L2QA 3X25B 3OMGA 3GNFB 4JLGA 1JBMA 3VYHB 3NTKA 3JB9F 2RHUA 2G3RA 5LJ5j 4E7KA 3CCQA 1I5LA 4MZMA 3FB9A 1G3SA 2DO3A 3G6ET 1EIFA 1SSFA 3CBOA 4XU0A 1YJWT 4XTZA 3M4YA 1VQPA 4PJOD 3QYGB 1VQ6A 3CC7A 3L1AA 3JSCA 1B34B 1S72T 1K9MU 3M58A 1NE8A 2CZ6B 3JAME 3SD4A 1JB0E 2L8DA 3GOXA 4F7UE 2M0OA 4C92E 1M4ZA 2WSEE 2DTHA 4ZTFA 1YIJA 2HQEA 4IURA 5LJ5h 1NZ9A 3JCMX 2LCLA 2LRQA 3FLGA 4M7AC 3FRNA 4RKUE 2XKOC 4GY5A 5GAOq 2RA2A 4IUTA 3TREA 4ZN3A 5GANg 3LW5E 2O01E 1MGQA 2RJCA 3C12A 3HFNA 4IUPA 2CZ1B 2K5LA 4J6WA 2QQAA 3RESA 4JS4A 3UWNA 5GAMg 4FM4B 3JB9J 1FX7A 3CBMA 3P8DA 3SWNB 2WACA 2CZ7B 3P8BB 4YTLA 2JVVA 2LC4A 4DOVA 2A7YA 2LQ8A 3EAEA 5HK0A 5FU6C 2ZPEB 1OYXA 4II1A 3MCAB 4LDUA 3RKWA 2IVWA 1N9RA 1UB4A 1KQ1A 4M77E 4F7UA 4C92A 4CI0C 2H3JA 1M1GA 1VQ7T 4C8QG 2MAMA 3T9NA 3LWIA 5LJ3g 5GANf 3BDLA 3MHXA 4JJNK 2DZ9A 3RMSA 4E7LA 2F69A 3WVEB 3CC4T 2PQWA 1Y07A 2QQSA 4ZTJA 4HCBA 4EMHA 2FHDA 2MF2A 2E6ZA 2DIQA 1NJIC 3FC3A 3QZ5B 4C8QD 3A5ZB 5CAIA 2DAQA 5GAMd 5L8RE 3E9GA 3OS0A 1RL2A 2E41A 3ME9A 3JCMP 4OB3B 3JB9D 2RM4A 3BW1A 2HNIA 4M7AF 3GLXA 3JCMb 2XG8D 4Q5WA 4MDWA 3M53A 4M77A 3NFCA 2ZGWA 2DD4A 2VYTA 1WJSA 2D9TA 4VUBA 1VQ4T 1YIJT 3TU4K 1KQ2A 4OP0A 3A8MB 3UT1A 3PFSA 4IUQA 1QP2A 2O4XB 2CGHA 2I2LA 1K9MC 2RO0A 3GNGA 3JRZA 4N0AC 3CXCS 2Y4XA 4EDUA 2QEXT 3CCRA 3KBGA 4L6V5 2LX9A 4JRPA 3PMTA 1BI3A 4M77C 4NOYA 1I4K1 3VV0A 2RHXA 1BKBA 3S3MA 3JCMg 2JTFA 3CBPA 4J8OA 1P92A 2E64A 5GAOn 1U8RA 4BY6C 4XK8E 1YJWA 3L2ZA 3PT9A 2V8IA 4HKEA 4KULA 1VIFA 1KHIA 1FWZA 2LT4A 2E5QA 4ATOA 1QW1A 4OGCA 4GLKA 5CKHA 3X26B 1VQLT 3EFSA 2M1HA 2QTXA 3HRSA 1BIAA 1XOVA 2JZ2A 4IUVA 5HK3A 3CCJT 2NLUA 2X4WA 1X6OA 4M78G 4M7DB 3V8JA 1Y7XA 3OW2S 5LJ3f 4HCCA 3SWNC 1BI1A 1VQNT 1QP3A 2PVDB 5LJ5f 3P8HA 3OYHA 1QVPA 4M78D 2D0QB 2YLCA 4Z02A 5CQYA 2DXBA 3R6OA 4M75B 4C5HA 3QJ6A 3JCMd 5CKEA 3CPWS 3VKIA 1HXDA 4OMFB 5GAOp 3LH0A 4A4FA 1Q7YU 4L5GA 2CKKA 4M75G 2KAFA 2VC8A 1UGPB 5DM7R 3A8OB 4O5VA 4M7AE 2X35A 4ELZC 2OTJA 1N27A 4HA8A 2FVUA 2BIVA 5KCHA 1VQOT 3M57A 1NJIU 1WNLA 3OBYA 1OZ3A 3HHTB 1D3BB 1M9SA 1ZQ1A 4XU2A 4IKFA 1ZHIA 2EJGA 4Y91A 3CCRT 3CCUT 1KD1U 1VQ7A 5J26A 4NS5A 4A54A 1BYMA 4MMKA 2M16A 2HQXA 2KQWA 4ME7A 3QBYA 4PJOG 3CC4A 4J7IA 3OYDA 4BDYA 4OVAA 3WVDB 2WSCE 3KXTA 2RJEA 3CMAT 3QO3A 4OB0B 3INZA 2K3YA 2ZPGB 2EWNA 3ZEHA 4A53A 3OB9A 2DXTA 3CCST 4QVCA 3GIBA 4UC4A 4HT9A 2L3RA 1VUBA 5GAOl 3OYGA 2EQJA 1UGRB 4EMKB 1UGSB 4F7UG 3CCLA 3JCMV 2DVEA 1JRIA 2ZPBB 2EAYA 3HPWA 3S3OA 3OYJA 2PUKB 1VQ4A 4M7DA 3RKYA 1JJ2S 4PNOA 3OQ5A 2RK1A 3G7ZA 2P0PA 3VU3C 2E6NA 4RCCA 4C92D 2L5QA 4BE1A 1QVGS 3CPFA 1OZ2A 1LJOA 2QEXA 1IREB 1O9SA 3RKXA 3UDCA 3I55T 1FXXA 4ZGJB 2XHCA 2DTOA 5J39A 1VQ8A 1M1FA 4XTWA 3DKMA 3M59A 4M7DC 1H641 4OF1A 3ZFJA 1H3ZA 3SFMA 2OTJT 5GAN7 3PNWC 3GPLA 3ZBDA 4KBMB 3C94A 4N4GA 4J6YA 4C8QB 1Q82U 4E47A 3QSUA 4JUVA 2BUDA 3PTAA 2V8KA 2XICA 1Q7YC 2D6FA 3HKSA 2LVMA 4C5EA 3J7AF 3QJYA 4M75C 1VQLA 1K8AC 1YI2T 1WPYA 1PSFA 4LD9K 4M77D 4XQ3A 1QVFA 3JCMc 2GCXA 3CCJA 5AYFA 3DB3A 2WSFE 2QI2A 4KT0E 2A3LA 3META 3V7CA 3JB9G 3RERA 5GANd 1VQNA 2IG0A 5CR2A 2HBPA 3CEYA 3CXCA 5FU7B 5FROA 1W4SA 5GMKm 3KUFA 2XU8A 3BFMA 2KK4A 1KD1C 3VUBA 1BI0A 4X9DA 1HK9A 5CVIA 1Q86U 5J3BA 2PVOB 4QQGA 2GFAA 4N0AA 4WF2A 2RJFA 1M8VA 1G3WA 2ZCFB 1I81A 2V8JA 3A8GB 2LDMA 3RMQA 1B34A 3CCLT 5DLQE 5GAN8 1LNXA 2KDSA 1OI1A 3QG1A 1QVFS 1NPPA 3A8HB 3FDRA 2QQ9A 3QPHA 2R5MA 5LJ3d 5FLXE 3J81E 1VQOA 1Q81U 4M7DF 3LWHA 5D6YA 2XDBA 1Y96B 3OW2A 2ZPIB 4ZGDB 2E1HA 3CCUA 4E7JA 2DPPB 2VGNA 5CKFA 2EKOA 1VQ8T 5FRNA 4EMKC 4RG8A 5LJ5g 3L2UA 4TVRA 4M75F 5GAN3 1VIEA 3M5AA 2DK3A 2XDPA 3CPWA 3SWNA 1M1KC 2JUFA 1N6AA 3CMAA 1VQMA 3E19A 2R5AA 1N8RU 1GXIE 2E12A 2MI6A 2QQRA 1V29B 4MDXA 3OSVA 3CCSA 3JCMQ 3OYCA 4E7IA 4M78B 4EPCA 2VV5A 1DJ7B 2LTOA 4XTUA 4RMOA 2DKGA 1LOJA 2Y90A 3TEEA 2C06A 3ER0A 3I56T 3QKJA 3OYNA 4KUIA 2YRVA 5GMKe 5LL6S 5DLOA 1VQ5T 3MP6A 1Q82C 4C0ZA 3AHUA 3CD6T 5GAMj 4FL6A 4PJOF 2DJZA 2MMPA 3NTIA 4L59A 2RD1A 5GAN6 3L2RA 2OAUA 2M9UA 3S6WA 4BD3A 5LJ5d 4QQDA 2RI3A 4C8QC 4BE2A 1YJ9T 4BE0A 2HD0A 3C95A 3GF5A 2X4XA 3X20B 4X9CA 5A2QE 1YHQT 3V7SA 3WXMB 3I55A 5I2SA 2FYKA 4A4GA 4PJOB 4BB7A 1NPRA 1K8AU 4JS5A 3OYAA 2QA4A 3OS5A 3TCJA 4X34A 4JDSA 3LX7A 5LJ3j 4PLLA 1WQWA 5CQXA 5FU6B 2P0KA 3S3NA 1Q86C 2XD0A 4M7AD 4J7FA 3QXEB 2E65A 2EQUA 2RB6A 2RI5A 5FU7C 1VQ9T 1KC8U 2HAXA 5CK9A 2VGMA 2DEQA 5I21A 5GMKj 3JCMe 3CMET 1YI2A 3HSBA 4M7DE 2O4XA 2RI2A 2LCCA 1JJ2A 2EFIA 3ASKA 1UGQB 3OYFA 3OYIA 4A4HA 1Q81C 1X01A 3DB4A 1QVGA 4M7DD 1PSEA 5A0GA 5M9OA 3MP1A 5GMKi 1VQMT 2K57A 4C0DB 1Y71A 4IUUA 3OY9A 4OB1B 4M75E 2EQMA 5I2MA 2JN0A 4C5IA 3DLMA 5HKCA 4F7UB 4C92B 5KCOA 1WQ7A 3JB9I 3PGGA 1K73U 2DZCA 2BKDN 5FRMA 5GMKh 4C92G 4C8QF 3OYMA 4V2SA 3PIPA 3M9QA 1N8RC 4PKCC 5CKBA 3CCET 2RK2A 2VXEA 3QYHB 4CRIA 3M56A 3SB2A 3HRUA 3V8LA 2KY9A 2X4YA 4M7AA 1VQKT 4N4IA 2YLBA 3M4GA 5CO7A 4LDYA 3CCVT 1M1KU 3OYYA 5C6SA 4PJOE 4HT8A 3HFOA 4A4EA 1R8OB 2P0QA 5KH6A 4JRIA 4D6WA 1X75C 2E10A 1I8FA 3FJPA 4M78C 4R56A 1W2BA 3JB9H 2K3XA 4M75A 5IAYA 3LLRA 3E9FA 2VXFA 3SDZA 5GAN5 4M77B 3J80E 4DQ2A 3OA6A 3G71T 4RG2A 2QA4T 1KQSA 2JOYA 3CCMT 5D6WA 1YITA 3G4ST 2X4JA 2CS7A 1BIBA 4M77G 2K5IA 2OTLA 4LD6A 4BY6B 2ZPFB 3JCMJ 5D6XA 4OB2B 4PLIA 3JCMh 3OYLA 4DA4A 3HRTA 2KSSA 3QIIA 2PVGB 3I56A 2QDYB 5EG2A 1D3BA 3QUIA 3RIRA 3LGLA 2GQVA 1VQ5A 4PJOA 4J83A 2DTIA 1XNIA 3OMCA 3OYBA 3A8LB 1W2BS 3CD6A 2QQBA 4JLIA 1KC8C 1U1SA 5GAN4 1KHCA 4QVZA 1KQSS 2RHYA 3X28B 4EMGA 1UEBA 1YJ9A 1N9SA 2EIFA 3O8VA 1YHQA 4JRQA 3FIFA 3H8ZA 3CC2T 1XTDA 4JRKA 4ELYC 4PJOC 3PMIA 4E7HA 2EQKA 2PUOB 1M90U 4EMKA 4M78F 3OYEA 1XQHA 2K4YA 4C8QE 2EYQA 5GANe 4XTYA 5GAMf 3M55A 1K73C 1WJQA 3UPUA 4LDVA 4C0DC 3CCQT 5GAMe 1VQ9A 3HL8A 3V8KA 5CCAA 1YCYA 1G3YA 2EJFA 5GAOr 1M5Q1 2R58A 5KE3A 3CMEA 4C92C 2ZZDA 1YJNA 1VQPT 2E70A 4B9XA 4OGEA 2B8AA 1VQ6T 3QZ9B 3JCMW 3CC7T 4Y28E 5DY9A 3C4SA 3URGA 4NL3A 1YITT 4LDXA 2AHJB 5GMKl 3L42A 3E1SA 2OTLT 1KG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE8 A;  3NFC A;  3TCJ A;  1UB4 A;  5CKH A;  4VUB A;  5CQX A;  5HK3 A;  2C06 A;  5CKB A;  5CK9 A;  5DLO A;  4MZP A;  3JRZ A;  3G7Z A;  2KMT A;  5CCA A;  2MF2 A;  5CO7 A;  4ME7 A;  5CR2 A;  5CQY A;  5CKF A;  4MZM A;  5CKE A;  5CKD A;  4ELZ C;  1X75 C;  3VUB A;  1M1F A;  5HK0 A;  2VUB A;  4OF1 A;  4MZT A;  5HKC A;  1VUB A;  4HKE A;  3JSC A;  3HPW A;  4MDX A;  4ELY C; 
#chains in the Genus database with same CATH topology
 2RHZ A;  3UA6 A;  3OS1 A;  3VRY A;  1MND A;  4C8Q A;  1WA7 A;  3C0C A;  1Q82 R;  5C0M A;  2DL5 A;  4FSX A;  2DRM A;  4XU3 A;  3CCE Q;  3L2V A;  2DRK A;  2PU9 B;  2EPD A;  4FIB A;  1AWJ A;  3QHS A;  3LGF A;  4OMO A;  1BI2 A;  3M0R A;  1K1Z A;  2COY A;  2I0N A;  3I35 A;  4BI8 B;  2LNV A;  2XMF A;  3CCM A;  1JJ2 P;  1PD1 A;  5GAM h;  3PIO A;  1RAA B;  4BAC A;  4HCZ A;  2LT1 A;  2KMT A;  1HYO A;  4RCB A;  5IN1 A;  3V7R A;  1NYG A;  2LJ3 A;  2FRW A;  5GAO m;  1Q81 R;  4XTX A;  1OX9 A;  1PCX A;  1WGS A;  4J9G A;  5CIU A;  2P4T A;  2DL7 A;  1ZBX A;  3AT1 B;  5A0D A;  1SRM A;  3MEW A;  4ZGE B;  3RUX A;  4LE9 A;  3L2Q A;  3M0S A;  4E7K A;  4MZM A;  3G6E T;  3CBO A;  1YJW T;  2D0N A;  2K79 A;  1VQ6 A;  1RAE B;  3JSC A;  3CC7 Q;  1S72 T;  3M58 A;  2CZ6 B;  3SD4 A;  2VB6 A;  3GOX A;  4ZTF A;  2A0F B;  2K7A A;  2LZ6 B;  4Z88 A;  3C12 A;  3HFN A;  2CZ1 B;  4J6W A;  1FX7 A;  2WAC A;  4YTL A;  2JVV A;  2LC4 A;  2HL5 C;  2A7Y A;  2FRY A;  2QAZ A;  4II1 A;  2FO0 A;  1OPL A;  2GQI A;  3RKW A;  2MOX A;  2HL3 A;  3T9N A;  5GAN f;  4QKU A;  4JJN K;  3RMS A;  3CC4 T;  1QWE A;  1Y07 A;  2MF2 A;  2E6Z A;  4J9D A;  3A5Z B;  5GAM d;  5L8R E;  1WIE A;  1SHF A;  2HNI A;  4Z89 A;  1OQK A;  3RNJ A;  4FYV B;  3JCM b;  3M53 A;  2ESW A;  3NFC A;  1RLQ C;  5GJV B;  2VYT A;  2D9T A;  1VQ4 T;  1YIJ T;  1KQ2 A;  2W0Z A;  2DLP A;  2CGH A;  1K9M C;  3GNG A;  4N0A C;  3CXC S;  4EDU A;  2L3Q A;  2YUQ A;  1BB9 A;  1W1F A;  2LMJ A;  1G2B A;  1R0C B;  1P92 A;  3EG1 A;  2ATC B;  2NUZ A;  4HXJ A;  3PT9 A;  3H0F A;  1KHI A;  2E5Q A;  4OGC A;  5CKH A;  3EGX B;  3UA7 A;  2QTX A;  1JXM A;  4IUV A;  2NLU A;  2X4W A;  1X6O A;  2KT1 A;  3V8J A;  4HCC A;  1VQN T;  2HSP A;  2PVD B;  2AIR B;  3P8H A;  1QCF A;  5CQY A;  3EGD B;  1SF9 A;  3RDV A;  1JO8 A;  3LH0 A;  2DL8 A;  4M7A E;  2H3E B;  1UFF A;  4AG1 C;  2RQR A;  2K9G A;  1GL5 A;  1OZ3 A;  1WXU A;  4E6R A;  2FPD A;  3CCR T;  1VQ7 A;  3CCU T;  4A54 A;  2H8H A;  2HQX A;  2A36 A;  2AKL A;  2RJE A;  3CMA T;  4OB0 B;  2K3Y A;  4RTX A;  1AEY A;  4A53 A;  1GCP A;  4M7A A;  4D8D A;  4QVC A;  2QYZ A;  3CQT A;  1F1B B;  4FSS A;  5GAO l;  4JJD A;  1QLY A;  1W70 A;  3JCM V;  1VOM A;  3CCL Q;  1TWB A;  1RAD B;  1UEC A;  1QVG S;  3G7Z A;  2P0P A;  4GLM A;  4RCC A;  3FJ5 A;  1VYU A;  4CC4 B;  2EBP A;  1AZE A;  2QEX Q;  3I55 T;  2XHC A;  5J39 A;  1M1F A;  1PKT A;  1H64 1;  2DVJ A;  1YCS B;  3C94 A;  1Q82 U;  4J6Y A;  2V8K A;  2XIC A;  1QVF A;  1K76 A;  2WSF E;  1IHV A;  4KT0 E;  2A3L A;  3V7C A;  3VS3 A;  5GAN d;  2EGE A;  5FRO A;  2VWF A;  1W4S A;  3KUF A;  3BFM A;  1KD1 C;  4X9D A;  1ZX6 A;  1NLO C;  2RJF A;  2ZCF B;  2V8J A;  3A8G B;  4ESR A;  1X6B A;  3RMQ A;  1B34 A;  3QWX X;  1QVF S;  1OI1 A;  5FLX E;  3A8H B;  3QPH A;  4F16 A;  1VQO A;  1Q81 U;  3EG2 A;  4RTY A;  5D6Y A;  1TXQ A;  4ZGD B;  2E1H A;  4EMK C;  4RG8 A;  5LJ5 g;  1VIE A;  1KK7 A;  3CPW A;  2KRM A;  1N6A A;  2R5A A;  2QTV A;  1ACM B;  4PFZ A;  1TS9 A;  3CCS A;  1U06 A;  3JCM Q;  4IIM A;  1DJ7 B;  4RMO A;  1IHW A;  2DKG A;  4RUG A;  4KUI A;  3EG9 B;  5GMK e;  1VQ5 T;  2KXC A;  2KR3 A;  5GAM j;  4FL6 A;  2RD1 A;  1M90 R;  1QKX A;  3L2R A;  3M0P A;  2RI3 A;  3M0U A;  4BE2 A;  1BBZ A;  2AZS A;  3GF5 A;  3X20 B;  5A2Q E;  4A4G A;  3UAT A;  4BB7 A;  2FPE A;  5KYN A;  2QA4 A;  1RUW A;  4X34 A;  3LX7 A;  4PLL A;  5CQX A;  5FU6 B;  2XD0 A;  3H41 A;  2E65 A;  2RB6 A;  1UDL A;  2VGM A;  5I21 A;  1X6G A;  5GMK j;  3HSB A;  2O4X A;  5I11 A;  1PM3 A;  4M7D D;  4A4H A;  3DB4 A;  1PSE A;  5A0G A;  2K57 A;  3VS6 A;  1X43 A;  2F2W A;  3OY9 A;  5I2M A;  4M75 E;  1TOV A;  1JXO A;  3DLM A;  2JT4 A;  1AZG B;  4C92 B;  1WQ7 A;  3JB9 I;  2BKD N;  1ZUY A;  2JJ9 A;  2FPF A;  2M02 A;  3H0H A;  4PKC C;  1G83 A;  3CCE T;  1H3H A;  1ZLM A;  2VXE A;  3SB2 A;  3HRU A;  2KY9 A;  2EYX A;  1ZSZ B;  4LDY A;  1VYV A;  5C6S A;  4PJO E;  4HT8 A;  3HFO A;  4A4E A;  5KH6 A;  1TUD A;  4D6W A;  4LXC A;  2K3X A;  4M75 A;  2CSQ A;  2VXF A;  5GAN 5;  3J80 E;  4M77 B;  2Z0W A;  2K5I A;  1GFD A;  2ZPF B;  4DEY A;  4OB2 B;  4PLI A;  4DA4 A;  3HRT A;  1WHK A;  2DER A;  1ZA2 B;  1D3B A;  3QUI A;  3RIR A;  2JS0 A;  4PJO A;  4PJM A;  2D8H A;  3M0Q A;  2HKQ B;  3OYB A;  3GBQ A;  4PJL A;  3X28 B;  1N9S A;  2EIF A;  3O8V A;  1YJ9 Q;  1YHQ A;  4JRQ A;  3H8Z A;  2CDT A;  1D09 B;  4JRK A;  4ELY C;  4PJO C;  2C0T A;  4CC3 A;  3PMI A;  1T3L A;  3OW2 P;  1XQH A;  4IIO A;  1OV3 A;  5GAN e;  4JPB W;  5IHN A;  4C0D C;  1SRL A;  1VQ9 Q;  5IXB A;  1WHM A;  1YCY A;  2YUN A;  5GAO r;  1M5Q 1;  5KE3 A;  3CME Q;  1YJN Q;  4OGE A;  2B8A A;  3CC7 T;  5DY9 A;  2L3P A;  1YIT T;  2QDL A;  3EFO B;  2AHJ B;  3HPW A;  5LJ3 f;  1EZZ B;  3BY7 A;  2HZY A;  1R77 A;  2XK0 A;  1D1A A;  3MEV A;  1G5V A;  3OS2 A;  2GFU A;  2F5K A;  4J6X A;  3OYK A;  4MZP A;  5GAN j;  2YHT A;  2EYZ A;  1CKA A;  2RHI A;  3MJX A;  1VQK A;  2O31 A;  3CCV A;  3PVQ A;  1B07 A;  1IGU A;  4XTV A;  3VUZ A;  3L2W A;  3G6E A;  2ENM A;  1D1B A;  4N4H A;  2L3S A;  4LNP A;  3MEA A;  4F7U F;  1S72 A;  1Q86 R;  3CCM Q;  2QXF A;  3G4S A;  4BUG A;  3VS7 A;  2AT1 B;  4BI4 A;  4M78 E;  4NL2 A;  4M7D G;  1VYT A;  2KYM A;  4DEX A;  4XAX B;  2P84 A;  4BI3 A;  3TVT A;  3HP9 A;  1M90 C;  2K5F A;  2DA9 A;  3OSS C;  1TH7 A;  1ARK A;  2JNG A;  4O6J A;  2Y4Y A;  4BDZ A;  2DXU A;  5LJ3 h;  4KUD K;  2XI9 A;  2MWP A;  1M3B A;  1CSK A;  4QQ6 A;  2GF7 A;  4J5Y A;  2FZG B;  3BDU A;  4M78 A;  1G3T A;  4DOW A;  4RTZ A;  2RPN A;  3X25 B;  3VYH B;  2K2M A;  3NTK A;  1AWX A;  2NUP B;  1SSF A;  4LUE A;  2X9H A;  3NPF A;  1UHF A;  1VQP A;  1VQ6 Q;  4AMC A;  3JV3 A;  1JB0 E;  2L8D A;  2M0O A;  2RQW A;  2WSE E;  2CT3 A;  4AFU C;  1YIJ A;  2HQE A;  4IUR A;  5LJ5 h;  3JCM X;  1NBE B;  2XKO C;  4GY5 A;  2ABL A;  5GAN g;  1TUC A;  1MGQ A;  4IUP A;  4JS4 A;  2QQA A;  3UWN A;  4FM4 B;  3JB9 J;  1IXD A;  3SWN B;  2KGT A;  1WHJ A;  4DOV A;  2LQ8 A;  2IPO B;  1LPL A;  2DET A;  2MIO A;  1UUE A;  1C0M A;  1M1G A;  2H3J A;  4C8Q G;  3LWI A;  3BDL A;  3MHX A;  2OX7 A;  4E7L A;  1G8X A;  2F69 A;  1M2V A;  2KT8 A;  1SKU B;  4ZTJ A;  4HCB A;  4EMH A;  2DIQ A;  2DL4 A;  3QZ5 B;  2NWM A;  3EHR A;  3OS0 A;  3ME9 A;  4OB3 B;  3JB9 D;  1VA7 A;  3GLX A;  5HCK A;  4Q5W A;  4MDW A;  1WJS A;  1MV0 B;  3TU4 K;  3UT1 A;  2BTT A;  3PFS A;  4IUQ A;  3LH5 A;  1QP2 A;  4E7S A;  1SG5 A;  1OU8 A;  2RO0 A;  3JRZ A;  4ZNX A;  2QEX T;  3CCR A;  2LX9 A;  3PMT A;  1BI3 A;  1WXB A;  1AVZ C;  2RHX A;  1BKB A;  3JCM g;  2JMC A;  2RF0 A;  2E64 A;  1Q95 G;  1PD0 A;  5GAO n;  3A1P A;  1U8R A;  1E6H A;  1WLP B;  4ATO A;  4GLK A;  2NUT B;  3X26 B;  2JZ2 A;  5HK3 A;  4M7D B;  1Y7X A;  3G1J A;  1Y0M A;  1WHH A;  1QP3 A;  2DE0 X;  1K0S A;  2KEA A;  3OYH A;  2YLC A;  1YWO A;  2DXB A;  3R6O A;  3QJ6 A;  5CKE A;  2ZAE A;  3VKI A;  1HXD A;  4A4F A;  3REB B;  4L5G A;  2CKK A;  1N5Z A;  5DM7 R;  4KH0 B;  3A8O B;  2V1Q A;  2F1L A;  4ELZ C;  1N27 A;  2BIV A;  4RTT A;  3OBY A;  1M9S A;  1ZQ1 A;  1ZHI A;  2CH4 A;  1VQ7 Q;  4MMK A;  4ME7 A;  3QBY A;  1KQS P;  4BDY A;  4OVA A;  2YT6 A;  3WVD B;  1X2K A;  1MUZ A;  2A28 A;  2ZPG B;  2EWN A;  3ZEH A;  2K6D A;  3OB9 A;  2DXT A;  3GIB A;  4UC4 A;  2KRS A;  1UGR B;  4LUD A;  2E5K A;  2DVE A;  2ZPB B;  3S3O A;  4OMM A;  1JJ2 S;  4C92 D;  3VU3 C;  2HCK A;  3CPF A;  1EFN A;  2AZV A;  4JJC A;  3BE3 A;  4XTW A;  3DKM A;  2KBT A;  4J9C A;  1H3Z A;  2OTJ T;  2CP0 A;  3GPL A;  2JTE A;  4AFS C;  5KYY A;  4C8Q B;  3KFV A;  3HKS A;  3J7A F;  1VQL A;  5IHI A;  2D8J A;  1WPY A;  1PSF A;  4M77 D;  1BCM A;  1PG5 B;  3JCM c;  3CCJ A;  3MET A;  3JB9 G;  2IG0 A;  2FZC B;  2HBP A;  2LNH B;  3CXC A;  3NMZ C;  1Q86 U;  1R0B G;  5KYU B;  4N0A A;  1HSQ A;  5DLQ E;  5GAN 8;  1LNX A;  2KDS A;  3J81 E;  2R5M A;  1VQO Q;  5GJW B;  1MMG A;  3MPU B;  2DPP B;  8AT1 B;  1VQ8 T;  3M5A A;  1RI9 A;  2XDP A;  2LQN A;  2JUF A;  2E12 A;  2QQR A;  4F04 B;  4MDX A;  3OSV A;  2VKN A;  4E7I A;  1X27 A;  3CCS Q;  4WTO B;  2VV5 A;  4HCK A;  1LOJ A;  3HTR A;  3TEE A;  2DYI A;  4HVW A;  5DLO A;  1AWW A;  1Q82 C;  4C0Z A;  5EC7 A;  2LX7 A;  4L59 A;  2M9U A;  3S6W A;  1I5O B;  1YJ9 T;  4PFP A;  4X9C A;  5I2S A;  1I07 A;  2PTK A;  1NPR A;  1Y57 A;  2QA4 Q;  4JDS A;  5LJ3 j;  1FYN A;  1WQW A;  3S3N A;  4J7F A;  1VQ9 T;  2HAX A;  2VAS A;  3CME T;  1YI2 A;  3H0I A;  1TSF A;  1QVG A;  1Q81 C;  2CP2 A;  1D0Z A;  5GMK i;  1VQM T;  1PNJ A;  4C5I A;  5HKC A;  5KCO A;  2DZC A;  1PWT A;  4M4Z A;  3MKD A;  4C92 G;  3ZL7 C;  2FEI A;  2DNU A;  2KYB A;  5KYX A;  2EGA A;  1SHG A;  1YFN A;  2X4Y A;  2YLB A;  5CO7 A;  3OYY A;  1R8O B;  2P0Q A;  4JRI A;  1X75 C;  2E10 A;  5IAY A;  3E2U A;  3LLR A;  3CCM T;  5D6W A;  2KE9 A;  1YIT A;  4J9F A;  4M77 G;  2JMA A;  3JCM J;  3JCM h;  3OYL A;  1GCQ C;  3I56 A;  5EG2 A;  1X69 A;  3LGL A;  2DTI A;  3CD6 A;  2AKK A;  1KHC A;  2MCN A;  4EMG A;  3FIF A;  1YHQ Q;  4EMK A;  1ZUU A;  1OU9 A;  3OYE A;  2K4Y A;  2EYQ A;  4XTY A;  1WJQ A;  4LDV A;  5GAM e;  5CCA A;  3CPW P;  2MK5 A;  4C92 C;  1YP5 A;  2ZZD A;  1VQ6 T;  3QZ9 B;  2O2O A;  3C4S A;  4NL3 A;  3EG3 A;  4LDX A;  1E6G A;  2J7I A;  2OTL T;  2COW A;  2CSI A;  1LCK A;  2ECZ A;  1ZSZ C;  1IZ6 A;  3H6Z A;  2EJ9 A;  4DBR A;  5A0L A;  2XDD A;  3QDR B;  5FW9 A;  2HSE B;  1MHN A;  4KH1 B;  4B9W A;  1AHJ B;  1YBY A;  1MMA A;  3N5B B;  4M7A B;  1VQK Q;  2DD5 A;  5HY6 A;  3CCV Q;  3GP8 A;  3G6E Q;  6AT1 B;  4RTV A;  3Q1J A;  4A4K A;  2YSQ A;  3G71 A;  4F17 A;  4C92 F;  3NTH A;  1OPK A;  2JTM A;  4F14 A;  1S72 Q;  3QWY A;  3G4S Q;  4FU6 A;  3I5R A;  3MP8 A;  4C0F A;  2L89 A;  5GAN 2;  2MPX C;  3DLL A;  1Y96 A;  1M27 C;  2DXC A;  1U1T A;  2F5T X;  2HQH A;  2J6K A;  4FT2 A;  4XU1 A;  3TQ7 P;  4M77 F;  5IT9 E;  1WJR A;  4ZN1 A;  2LQW A;  3OBW A;  4PJJ A;  3CC2 A;  2FL7 A;  5KYW A;  1M2O A;  4JLG A;  1JBM A;  2LJ0 A;  1BCO A;  2A37 A;  2G3R A;  2YUP A;  3CCQ A;  3FB9 A;  1G3S A;  2DO3 A;  4XU0 A;  1IGQ A;  1FMW A;  2YWW A;  1VQP Q;  4Z8A A;  1B34 B;  3JAM E;  2KNB B;  4F7U E;  1M4Z A;  2DTH A;  1TU0 B;  3QDF A;  2LCL A;  1K8A R;  4RKU E;  2F2X A;  2JW4 A;  4ZN3 A;  3TRE A;  2O88 A;  3LW5 E;  5GAM g;  1RLP C;  3CBM A;  1KC8 R;  1PHT A;  2CZ7 B;  3P8B B;  5HK0 A;  2EKH A;  4FYW B;  1WFW A;  2ZPE B;  2C0I A;  3REA B;  1K0X A;  2IVW A;  1OX8 A;  2ED1 A;  1N9R A;  1KQ1 A;  4F7U A;  5AT1 B;  4WCI A;  1VQ7 T;  2DZ9 A;  1K73 R;  2PQW A;  1RAI B;  2FHD A;  3EH2 A;  4C8Q D;  3FC3 A;  1GBR A;  2DAQ A;  2BZ8 A;  3SHW A;  4OMN A;  3JCM P;  1WX6 A;  1BK2 A;  1KIK A;  1ZBJ A;  2BZY A;  2YRD A;  1M1K R;  2XG8 D;  1Z9Z A;  2ZGW A;  2DD4 A;  2LJ1 A;  2BE9 B;  4OP0 A;  1NYF A;  2L2P A;  2O4X B;  1M3A A;  1PKS A;  1V76 A;  4JRP A;  4NOY A;  1OOT A;  2JTF A;  3CBP A;  2X51 A;  3RR6 A;  4BY6 C;  2D1X A;  1YJW A;  4HKE A;  2RQU A;  2HMA A;  2M1H A;  1XOV A;  4M78 G;  3OW2 S;  1BU1 A;  4QT7 A;  3SWN C;  1BI1 A;  4J9B A;  3M0T A;  3H9N A;  4JJB A;  5LJ5 f;  1QVP A;  1XJW B;  1ZSG A;  4M75 B;  4B6M A;  1K9A A;  5GAO p;  1Q7Y U;  2KAF A;  1UGP B;  2DJQ A;  4O5V A;  1RAF B;  2OTJ A;  1QKW A;  5KCH A;  1VQO T;  4DBH A;  3HHT B;  1D3B B;  4PJO B;  4Y91 A;  2LCS A;  5J26 A;  1BYM A;  1W2B P;  2M16 A;  2SRC A;  3CC4 A;  1TUG B;  4J7I A;  3OYD A;  3I9Q A;  5IXF A;  3CCS T;  2L3R A;  4PJN A;  2EQJ A;  2KRO A;  1UGS B;  2VVK A;  3EGU A;  1JRI A;  1VQ4 A;  4M7D A;  2DBK A;  3OQ5 A;  2RK1 A;  4BE1 A;  4CC2 A;  1OZ2 A;  2ED0 A;  1IRE B;  1O9S A;  3RKX A;  1FXX A;  4ZGJ B;  1VQ8 A;  3PE0 A;  4M7D C;  3SFM A;  2M51 A;  2IIM A;  4E47 A;  3QSU A;  4JUV A;  2P4R A;  1QCO A;  1C1A A;  3QJY A;  1K8A C;  1VQL Q;  4XQ3 A;  2GCX A;  5AYF A;  1HD3 A;  3DB3 A;  3CCJ Q;  5FWC A;  2CUB A;  3RER A;  1M3C A;  2DEU A;  1VQN A;  1D0X A;  5FU7 B;  1QWF A;  5GMK m;  4OML A;  1HK9 A;  2PVO B;  2J6F A;  4WF2 A;  1M8V A;  4FYX B;  1I81 A;  1I0C A;  3CCL T;  4KRT A;  1KJW A;  5LJ3 d;  2JM8 A;  2A08 A;  3IQL A;  4M7D F;  2XDB A;  1WI7 A;  2ZPI B;  3CCU A;  4E7J A;  2YRC A;  2EKO A;  1NLP C;  5FRN A;  4LN2 A;  1TTH B;  3L2U A;  2SEM A;  5GAN 3;  4AFQ C;  1M1K C;  3CMA A;  1VQM A;  3A98 A;  3E19 A;  1N8R U;  2DFU A;  2MI6 A;  3OYC A;  4M78 B;  1IB8 A;  4XTU A;  2L0A A;  2Y90 A;  2C06 A;  4DBF A;  5LL6 S;  4DBQ A;  2CP6 A;  2DJZ A;  2MMP A;  3NTI A;  2CP5 A;  3UF4 A;  2OAU A;  3RBB B;  5LJ5 d;  2JS2 A;  2V26 A;  4C8Q C;  1C6V X;  4BE0 A;  2DL3 A;  1YHQ T;  3V7S A;  3I55 A;  2FYK A;  1W6X A;  1AWO A;  1K8A U;  3OYA A;  5KYU A;  3TCJ A;  2DIL A;  1Q86 C;  2KI7 A;  4M7A D;  2PNI A;  4J9E A;  1KC8 U;  2DMO A;  2EVR A;  5CK9 A;  2DEQ A;  2HEQ A;  2JM9 A;  2HDA A;  1YI2 Q;  2RI2 A;  1QMC A;  2LCC A;  1JJ2 A;  4Y92 A;  3ASK A;  1UGQ B;  3OYF A;  1X01 A;  5M9O A;  3MP1 A;  4X1V A;  1Y71 A;  4IUU A;  4OB1 B;  2EQM A;  1K73 U;  2ROL A;  4PK4 A;  5GMK h;  4C8Q F;  1AT1 B;  1M2V B;  3EGX A;  4JZ3 A;  3M56 A;  3V8L A;  1VQK T;  3M4G A;  1M1K U;  3CCV T;  2FZK B;  2HKN A;  3FJP A;  4R56 A;  1NG2 A;  2RQT A;  2X3X D;  3EGD A;  3E9F A;  3SDZ A;  1ZA1 B;  1KQS A;  2JOY A;  3VS5 A;  4D8K A;  3G4S T;  2EGC A;  1YIT Q;  1GBQ A;  2OTL A;  4LD6 A;  4ANJ A;  5D6X A;  3I5S A;  3CXC P;  2PVG B;  3EH1 A;  3I56 Q;  1VQ5 A;  1NJI R;  1S1N A;  1IO6 A;  4FW1 A;  4JLI A;  3CD6 Q;  2KRN A;  1T3S A;  1KQS S;  1KD1 R;  2RHY A;  3VRZ A;  3D7S B;  5IHK A;  2V1R A;  1H92 A;  2GBQ A;  4J9I A;  4KGX B;  1JEG A;  2EQK A;  2PUO B;  2GTO A;  3NHN A;  1WHL A;  2AK5 A;  2C0O A;  3ULR B;  1UTI A;  1UGV A;  4K11 A;  2CP7 A;  3HL8 A;  1LVK A;  3V8K A;  2EJF A;  2RNA A;  2R58 A;  1VQP T;  3JCM W;  4R0K A;  3URG A;  4ORZ A;  5GMK l;  3L42 A;  3E1S A;  1ABQ A;  4V2S A;  1KG1 A;  3M54 A;  4QW2 A;  1K4U S;  5LJ3 e;  2JXB A;  2PZ1 A;  3FEO A;  4QVD A;  1RI0 A;  4FT4 A;  2ZPH B;  4PFO A;  1ZUK A;  3CCE A;  2CYZ B;  4PL6 A;  2X3W D;  1SEM A;  3VJP A;  3LYI A;  5CKD A;  2EQI A;  5KE2 A;  3EFR A;  2VUB A;  4LDW A;  4M7A G;  1RAG B;  3U23 A;  3MO8 A;  1V1C A;  2O9S A;  3G71 Q;  4HVU A;  5GAN h;  2LQK A;  1MV3 A;  1JU5 C;  2R57 A;  4KGZ B;  2BE7 D;  2FB7 A;  1E7O A;  1QVG P;  2EYW A;  3JCM f;  2RH2 A;  3X24 B;  4C0G A;  5LJ5 e;  2QK0 A;  1GFC A;  1YJN T;  2EW3 A;  3VYG A;  2K2V A;  4P5N A;  4R55 A;  1O75 A;  2CZ0 B;  7AT1 B;  5KYY B;  1NEG A;  4MZT A;  2COZ A;  2DIG A;  4JZ4 A;  1QCN A;  4C5G A;  2RJD A;  3MEU A;  4M75 D;  1WYX A;  4MML A;  1YWP A;  3CC2 Q;  2K3B A;  3F70 A;  2XID A;  2MWO A;  2KVQ G;  3OMG A;  3GNF B;  3JB9 F;  2RHU A;  3EG9 A;  5LJ5 j;  1I5L A;  2GTJ A;  3CCQ Q;  1EIF A;  8ATC B;  4XTZ A;  3M4Y A;  1GCQ A;  4PJO D;  3QYG B;  3CC7 A;  3L1A A;  1K9M U;  1NE8 A;  1QVF P;  1CKB A;  1Q7Y R;  1RAH B;  3TSZ A;  4C92 E;  1NZ9 A;  1PRM C;  2LRQ A;  3FLG A;  4M7A C;  3FRN A;  5GAO q;  2RA2 A;  4IUT A;  3SEM A;  1TG0 A;  2O01 E;  4EIK A;  2RJC A;  3RES A;  2K5L A;  3P8D A;  5FWB A;  3EAE A;  5FU6 C;  4AG2 C;  1OYX A;  1UJY A;  3MCA B;  4LDU A;  2DF6 A;  1UB4 A;  1YN8 A;  4M77 E;  4CI0 C;  4C92 A;  1KSW A;  2MAM A;  5LJ3 g;  4CC7 A;  3WVE B;  2QQS A;  2QGG A;  1NJI C;  5CAI A;  1KFZ A;  1EX4 A;  2OJ2 A;  4KGV B;  2BZX A;  1ZSZ A;  1FMV A;  3E9G A;  1RL2 A;  2E41 A;  3EG0 A;  2NYS A;  2RM4 A;  3BW1 A;  4M7A F;  4M77 A;  2MYS A;  4VUB A;  3A8M B;  4RTW A;  2W10 A;  2I2L A;  1JQQ A;  2Y4X A;  3KBG A;  4L6V 5;  4M77 C;  1I4K 1;  3VV0 A;  1GRI A;  1B3Q A;  3S3M A;  1B7T A;  4J8O A;  1AD5 A;  2OAW A;  1MNE A;  4XK8 E;  3L2Z A;  2V8I A;  4J9H A;  4KUL A;  1VIF A;  4OMQ A;  3VS0 A;  1FWZ A;  3PVL A;  1YJW Q;  2LT4 A;  1QW1 A;  1VQL T;  3EFS A;  2CP3 A;  3HRS A;  1BIA A;  5KYX B;  1M8M A;  1X2Q A;  3CCJ T;  1J3T A;  2DX1 A;  4M78 D;  2D0Q B;  4Z02 A;  4C5H A;  1Z9Q A;  3JCM d;  1HJD A;  3CPW S;  3O5Z A;  4OMF B;  3VS1 A;  4AFZ C;  2DBM A;  4M75 G;  2VC8 A;  2YUO A;  2X35 A;  4HA8 A;  2FVU A;  2CH4 W;  3EFO A;  2OTJ Q;  3M57 A;  1NJI U;  1WNL A;  4IKF A;  1NEB A;  4XU2 A;  2EJG A;  5IH2 A;  1N8R R;  1KD1 U;  4NS5 A;  1T0J A;  2KQW A;  2KXD A;  4PJO G;  3CC4 Q;  2WSC E;  3KXT A;  2E4H A;  1RAB B;  3QO3 A;  5D7U A;  3INZ A;  2RQV A;  4HT9 A;  4E7Z A;  1VUB A;  3OYG A;  4A63 B;  4EMK B;  4GBQ A;  4FCY A;  1M30 A;  4F7U G;  1WXT A;  2B86 A;  3CCL A;  4RTU A;  2EAY A;  1OEB A;  2G6F X;  2PUK B;  3OYJ A;  1YIJ Q;  3RKY A;  1VQ4 Q;  1D0Y A;  4PNO A;  2E6N A;  2L5Q A;  1U5S A;  1LJO A;  2QEX A;  2J6O A;  3UDC A;  2DTO A;  1VQ8 Q;  3M59 A;  4OF1 A;  3ZFJ A;  3VS4 A;  5GAN 7;  3PNW C;  3ZBD A;  4KBM B;  1AOJ A;  4N4G A;  2BUD A;  3PTA A;  1Q7Y C;  2D6F A;  2LVM A;  4C5E A;  2GGR A;  4M75 C;  2F2V A;  1YI2 T;  4LD9 K;  2M0Y A;  2QI2 A;  5L23 A;  5CR2 A;  3CEY A;  1VQN Q;  4FYY B;  2XU8 A;  2KK4 A;  3VUB A;  1BI0 A;  5CVI A;  2NUP A;  5J3B A;  4QQG A;  2YXY A;  2GFA A;  2LP5 A;  1G3W A;  1QQJ A;  2LDM A;  1UHC A;  1YNZ A;  1RAC B;  3QG1 A;  3EHQ A;  5I22 A;  1NPP A;  3FDR A;  2QQ9 A;  4AT1 B;  3VS2 A;  3LWH A;  1UE9 A;  1Y96 B;  2J05 A;  1ABO A;  3OW2 A;  3CCR Q;  3CCU Q;  2VGN A;  5CKF A;  4TVR A;  4M75 F;  2DK3 A;  3SWN A;  1GXI E;  3CMA Q;  1VQM Q;  4E2F B;  1V29 B;  1I1J A;  1PRL C;  1PC0 A;  4EPC A;  2LTO A;  5KYW B;  2HBW A;  3ER0 A;  3QKJ A;  3OYN A;  3I56 T;  1T0H A;  2YRV A;  2OI3 A;  3MP6 A;  3AHU A;  3CD6 T;  4PJO F;  2YDL A;  2E3I A;  2RN8 A;  5GAN 6;  4BD3 A;  4QQD A;  2HD0 A;  3C95 A;  2X4X A;  1WDX A;  5ECA A;  3WXM B;  4FW2 A;  3I55 Q;  2QAS A;  4JS5 A;  1OUL A;  2J06 A;  3OS5 A;  2P0K A;  3QXE B;  2RI5 A;  2EQU A;  5FU7 C;  2FG0 A;  1H8K A;  3JCM e;  4M7D E;  2EFI A;  3OYI A;  9ATC B;  2O9V A;  1U3O A;  2DM1 A;  4C0D B;  2GNC A;  2JN0 A;  4F7U B;  3PGG A;  3NGP A;  5FRM A;  1UJ0 A;  3OYM A;  3PIP A;  3M9Q A;  4OMP A;  2NUT A;  2E3H A;  2EYY A;  3R6N A;  5CKB A;  1N8R C;  2RK2 A;  3QYH B;  4CRI A;  4N4I A;  2CT4 A;  1I8F A;  4M78 C;  1W2B A;  3JB9 H;  2CUD A;  3OA6 A;  4DQ2 A;  3G71 T;  4RG2 A;  2QA4 T;  1SSH A;  1MMN A;  2X4J A;  1MMD A;  1BIB A;  1FMK A;  2CS7 A;  4BY6 B;  1IRX A;  2OTL Q;  4HVV A;  1D1C A;  2KSS A;  3QII A;  2QDY B;  1NM7 A;  2GQV A;  1WZO A;  2CRE A;  4J83 A;  1VQ5 Q;  1XNI A;  3OMC A;  3A8L B;  1W2B S;  2QQB A;  1KC8 C;  1U1S A;  5GAN 4;  3TSW A;  2QG9 B;  2QGF B;  2ROT A;  4QVZ A;  1UEB A;  1YJ9 A;  1WHG A;  2DYB A;  1UG1 A;  3CC2 T;  1XTD A;  3THK A;  4E7H A;  1M90 U;  4M78 F;  1A0N B;  4C8Q E;  5GAM f;  3M55 A;  1K73 C;  3UPU A;  1VQ9 A;  3CCQ T;  1K9M R;  1G3Y A;  3CME A;  1SPK A;  1YJN A;  2RMO A;  2E70 A;  4B9X A;  4Y28 E; 
#chains in the Genus database with same CATH homology
 3M54 A;  2RHZ A;  3BY7 A;  4QW2 A;  5LJ3 e;  3OS1 A;  1IZ6 A;  2XK0 A;  3H6Z A;  3MEV A;  1G5V A;  4C8Q A;  3OS2 A;  2EJ9 A;  2GFU A;  3FEO A;  2F5K A;  5A0L A;  4J6X A;  4QVD A;  3OYK A;  4MZP A;  5GAN j;  1RI0 A;  2XDD A;  5C0M A;  4FT4 A;  2ZPH B;  2YHT A;  4FSX A;  3QDR B;  3CCE A;  2CYZ B;  4PL6 A;  4XU3 A;  3L2V A;  1MHN A;  2RHI A;  2PU9 B;  1AHJ B;  1YBY A;  3VJP A;  3LYI A;  4B9W A;  3N5B B;  5CKD A;  4FIB A;  1VQK A;  4M7A B;  5KE2 A;  3CCV A;  2DD5 A;  5HY6 A;  4XTV A;  3VUZ A;  3GP8 A;  3QHS A;  3L2W A;  3G6E A;  3EFR A;  2VUB A;  3LGF A;  4LDW A;  1BI2 A;  4M7A G;  3Q1J A;  3MO8 A;  4N4H A;  4A4K A;  3G71 A;  4BI8 B;  2LNV A;  3MEA A;  4F7U F;  4C92 F;  3NTH A;  1S72 A;  3CCM A;  5GAN h;  2JTM A;  2LQK A;  2QXF A;  3G4S A;  2R57 A;  4BUG A;  5GAM h;  3PIO A;  2FB7 A;  4FU6 A;  4BI4 A;  4M78 E;  4HCZ A;  4NL2 A;  4BAC A;  3MP8 A;  2RH2 A;  3JCM f;  3X24 B;  4M7D G;  4C0F A;  4C0G A;  2LT1 A;  2KMT A;  2L89 A;  4RCB A;  5LJ5 e;  4XAX B;  5GAN 2;  4BI3 A;  1YJN T;  5IN1 A;  3V7R A;  1M90 C;  3HP9 A;  3DLL A;  2K5F A;  1Y96 A;  5GAO m;  3VYG A;  2DXC A;  2K2V A;  3OSS C;  1U1T A;  1TH7 A;  2F5T X;  2JNG A;  4XTX A;  4P5N A;  4O6J A;  4R55 A;  1WGS A;  2Y4Y A;  1O75 A;  4FT2 A;  4BDZ A;  2CZ0 B;  2DXU A;  4MZT A;  4XU1 A;  5CIU A;  5LJ3 h;  2DIG A;  4KUD K;  2P4T A;  4C5G A;  2XI9 A;  4M77 F;  2RJD A;  3MEU A;  2MWP A;  5IT9 E;  1WJR A;  4ZN1 A;  4M75 D;  3OBW A;  4MML A;  3CC2 A;  4QQ6 A;  1ZBX A;  2FL7 A;  2GF7 A;  4J5Y A;  3F70 A;  5A0D A;  2XID A;  3BDU A;  4M78 A;  1G3T A;  2MWO A;  3MEW A;  4DOW A;  4ZGE B;  3RUX A;  2KVQ G;  3L2Q A;  3X25 B;  3OMG A;  3GNF B;  4JLG A;  1JBM A;  3VYH B;  3NTK A;  3JB9 F;  2RHU A;  2G3R A;  5LJ5 j;  4E7K A;  3CCQ A;  1I5L A;  4MZM A;  3FB9 A;  1G3S A;  2DO3 A;  3G6E T;  1EIF A;  1SSF A;  3CBO A;  4XU0 A;  1YJW T;  4XTZ A;  3M4Y A;  1VQP A;  4PJO D;  3QYG B;  1VQ6 A;  3CC7 A;  3L1A A;  3JSC A;  1B34 B;  1S72 T;  1K9M U;  3M58 A;  1NE8 A;  2CZ6 B;  3JAM E;  3SD4 A;  1JB0 E;  2L8D A;  3GOX A;  4F7U E;  2M0O A;  4C92 E;  1M4Z A;  2WSE E;  2DTH A;  4ZTF A;  1YIJ A;  2HQE A;  4IUR A;  5LJ5 h;  1NZ9 A;  3JCM X;  2LCL A;  2LRQ A;  3FLG A;  4M7A C;  3FRN A;  4RKU E;  2XKO C;  4GY5 A;  5GAO q;  2RA2 A;  4IUT A;  3TRE A;  4ZN3 A;  5GAN g;  3LW5 E;  2O01 E;  1MGQ A;  2RJC A;  3C12 A;  3HFN A;  4IUP A;  2CZ1 B;  2K5L A;  4J6W A;  2QQA A;  3RES A;  4JS4 A;  3UWN A;  5GAM g;  4FM4 B;  3JB9 J;  1FX7 A;  3CBM A;  3P8D A;  3SWN B;  2WAC A;  2CZ7 B;  3P8B B;  4YTL A;  2JVV A;  2LC4 A;  4DOV A;  2A7Y A;  2LQ8 A;  3EAE A;  5HK0 A;  5FU6 C;  2ZPE B;  1OYX A;  4II1 A;  3MCA B;  4LDU A;  3RKW A;  2IVW A;  1N9R A;  1UB4 A;  1KQ1 A;  4M77 E;  4F7U A;  4C92 A;  4CI0 C;  2H3J A;  1M1G A;  1VQ7 T;  4C8Q G;  2MAM A;  3T9N A;  3LWI A;  5LJ3 g;  5GAN f;  3BDL A;  3MHX A;  4JJN K;  2DZ9 A;  3RMS A;  4E7L A;  2F69 A;  3WVE B;  3CC4 T;  2PQW A;  1Y07 A;  2QQS A;  4ZTJ A;  4HCB A;  4EMH A;  2FHD A;  2MF2 A;  2E6Z A;  2DIQ A;  1NJI C;  3FC3 A;  3QZ5 B;  4C8Q D;  3A5Z B;  5CAI A;  2DAQ A;  5GAM d;  5L8R E;  3E9G A;  3OS0 A;  1RL2 A;  2E41 A;  3ME9 A;  3JCM P;  4OB3 B;  3JB9 D;  2RM4 A;  3BW1 A;  2HNI A;  4M7A F;  3GLX A;  3JCM b;  2XG8 D;  4Q5W A;  4MDW A;  3M53 A;  4M77 A;  3NFC A;  2ZGW A;  2DD4 A;  2VYT A;  1WJS A;  2D9T A;  4VUB A;  1VQ4 T;  1YIJ T;  3TU4 K;  1KQ2 A;  4OP0 A;  3A8M B;  3UT1 A;  3PFS A;  4IUQ A;  1QP2 A;  2O4X B;  2CGH A;  2I2L A;  1K9M C;  2RO0 A;  3GNG A;  3JRZ A;  4N0A C;  3CXC S;  2Y4X A;  4EDU A;  2QEX T;  3CCR A;  3KBG A;  4L6V 5;  2LX9 A;  4JRP A;  3PMT A;  1BI3 A;  4M77 C;  4NOY A;  1I4K 1;  3VV0 A;  2RHX A;  1BKB A;  3S3M A;  3JCM g;  2JTF A;  3CBP A;  4J8O A;  1P92 A;  2E64 A;  5GAO n;  1U8R A;  4BY6 C;  4XK8 E;  1YJW A;  3L2Z A;  3PT9 A;  2V8I A;  4HKE A;  4KUL A;  1VIF A;  1KHI A;  1FWZ A;  2LT4 A;  2E5Q A;  4ATO A;  1QW1 A;  4OGC A;  4GLK A;  5CKH A;  3X26 B;  1VQL T;  3EFS A;  2M1H A;  2QTX A;  3HRS A;  1BIA A;  1XOV A;  2JZ2 A;  4IUV A;  5HK3 A;  3CCJ T;  2NLU A;  2X4W A;  1X6O A;  4M78 G;  4M7D B;  3V8J A;  1Y7X A;  3OW2 S;  5LJ3 f;  4HCC A;  3SWN C;  1BI1 A;  1VQN T;  1QP3 A;  2PVD B;  5LJ5 f;  3P8H A;  3OYH A;  1QVP A;  4M78 D;  2D0Q B;  2YLC A;  4Z02 A;  5CQY A;  2DXB A;  3R6O A;  4M75 B;  4C5H A;  3QJ6 A;  3JCM d;  5CKE A;  3CPW S;  3VKI A;  1HXD A;  4OMF B;  5GAO p;  3LH0 A;  4A4F A;  1Q7Y U;  4L5G A;  2CKK A;  4M75 G;  2KAF A;  2VC8 A;  1UGP B;  5DM7 R;  3A8O B;  4O5V A;  4M7A E;  2X35 A;  4ELZ C;  2OTJ A;  1N27 A;  4HA8 A;  2FVU A;  2BIV A;  5KCH A;  1VQO T;  3M57 A;  1NJI U;  1WNL A;  3OBY A;  1OZ3 A;  3HHT B;  1D3B B;  1M9S A;  1ZQ1 A;  4XU2 A;  4IKF A;  1ZHI A;  2EJG A;  4Y91 A;  3CCR T;  3CCU T;  1KD1 U;  1VQ7 A;  5J26 A;  4NS5 A;  4A54 A;  1BYM A;  4MMK A;  2M16 A;  2HQX A;  2KQW A;  4ME7 A;  3QBY A;  4PJO G;  3CC4 A;  4J7I A;  3OYD A;  4BDY A;  4OVA A;  3WVD B;  2WSC E;  3KXT A;  2RJE A;  3CMA T;  3QO3 A;  4OB0 B;  3INZ A;  2K3Y A;  2ZPG B;  2EWN A;  3ZEH A;  4A53 A;  3OB9 A;  2DXT A;  3CCS T;  4QVC A;  3GIB A;  4UC4 A;  4HT9 A;  2L3R A;  1VUB A;  5GAO l;  3OYG A;  2EQJ A;  1UGR B;  4EMK B;  1UGS B;  4F7U G;  3CCL A;  3JCM V;  2DVE A;  1JRI A;  2ZPB B;  2EAY A;  3HPW A;  3S3O A;  3OYJ A;  2PUK B;  1VQ4 A;  4M7D A;  3RKY A;  1JJ2 S;  4PNO A;  3OQ5 A;  2RK1 A;  3G7Z A;  2P0P A;  3VU3 C;  2E6N A;  4RCC A;  4C92 D;  2L5Q A;  4BE1 A;  1QVG S;  3CPF A;  1OZ2 A;  1LJO A;  2QEX A;  1IRE B;  1O9S A;  3RKX A;  3UDC A;  3I55 T;  1FXX A;  4ZGJ B;  2XHC A;  2DTO A;  5J39 A;  1VQ8 A;  1M1F A;  4XTW A;  3DKM A;  3M59 A;  4M7D C;  1H64 1;  4OF1 A;  3ZFJ A;  1H3Z A;  3SFM A;  2OTJ T;  5GAN 7;  3PNW C;  3GPL A;  3ZBD A;  4KBM B;  3C94 A;  4N4G A;  4J6Y A;  4C8Q B;  1Q82 U;  4E47 A;  3QSU A;  4JUV A;  2BUD A;  3PTA A;  2V8K A;  2XIC A;  1Q7Y C;  2D6F A;  3HKS A;  2LVM A;  4C5E A;  3J7A F;  3QJY A;  4M75 C;  1VQL A;  1K8A C;  1YI2 T;  1WPY A;  1PSF A;  4LD9 K;  4M77 D;  4XQ3 A;  1QVF A;  3JCM c;  2GCX A;  3CCJ A;  5AYF A;  3DB3 A;  2WSF E;  2QI2 A;  4KT0 E;  2A3L A;  3MET A;  3V7C A;  3JB9 G;  3RER A;  5GAN d;  1VQN A;  2IG0 A;  5CR2 A;  2HBP A;  3CEY A;  3CXC A;  5FU7 B;  5FRO A;  1W4S A;  5GMK m;  3KUF A;  2XU8 A;  3BFM A;  2KK4 A;  1KD1 C;  3VUB A;  1BI0 A;  4X9D A;  1HK9 A;  5CVI A;  1Q86 U;  5J3B A;  2PVO B;  4QQG A;  2GFA A;  4N0A A;  4WF2 A;  2RJF A;  1M8V A;  1G3W A;  2ZCF B;  1I81 A;  2V8J A;  3A8G B;  2LDM A;  3RMQ A;  1B34 A;  3CCL T;  5DLQ E;  5GAN 8;  1LNX A;  2KDS A;  1OI1 A;  3QG1 A;  1QVF S;  1NPP A;  3A8H B;  3FDR A;  2QQ9 A;  3QPH A;  2R5M A;  5LJ3 d;  5FLX E;  3J81 E;  1VQO A;  1Q81 U;  4M7D F;  3LWH A;  5D6Y A;  2XDB A;  1Y96 B;  3OW2 A;  2ZPI B;  4ZGD B;  2E1H A;  3CCU A;  4E7J A;  2DPP B;  2VGN A;  5CKF A;  2EKO A;  1VQ8 T;  5FRN A;  4EMK C;  4RG8 A;  5LJ5 g;  3L2U A;  4TVR A;  4M75 F;  5GAN 3;  1VIE A;  3M5A A;  2DK3 A;  2XDP A;  3CPW A;  3SWN A;  1M1K C;  2JUF A;  1N6A A;  3CMA A;  1VQM A;  3E19 A;  2R5A A;  1N8R U;  1GXI E;  2E12 A;  2MI6 A;  2QQR A;  1V29 B;  4MDX A;  3OSV A;  3CCS A;  3JCM Q;  3OYC A;  4E7I A;  4M78 B;  4EPC A;  2VV5 A;  1DJ7 B;  2LTO A;  4XTU A;  4RMO A;  2DKG A;  1LOJ A;  2Y90 A;  3TEE A;  2C06 A;  3ER0 A;  3I56 T;  3QKJ A;  3OYN A;  4KUI A;  2YRV A;  5GMK e;  5LL6 S;  5DLO A;  1VQ5 T;  3MP6 A;  1Q82 C;  4C0Z A;  3AHU A;  3CD6 T;  5GAM j;  4FL6 A;  4PJO F;  2DJZ A;  2MMP A;  3NTI A;  4L59 A;  2RD1 A;  5GAN 6;  3L2R A;  2OAU A;  2M9U A;  3S6W A;  4BD3 A;  5LJ5 d;  4QQD A;  2RI3 A;  4C8Q C;  4BE2 A;  1YJ9 T;  4BE0 A;  2HD0 A;  3C95 A;  3GF5 A;  2X4X A;  3X20 B;  4X9C A;  5A2Q E;  1YHQ T;  3V7S A;  3WXM B;  3I55 A;  5I2S A;  2FYK A;  4A4G A;  4PJO B;  4BB7 A;  1NPR A;  1K8A U;  4JS5 A;  3OYA A;  2QA4 A;  3OS5 A;  3TCJ A;  4X34 A;  4JDS A;  3LX7 A;  5LJ3 j;  4PLL A;  1WQW A;  5CQX A;  5FU6 B;  2P0K A;  3S3N A;  1Q86 C;  2XD0 A;  4M7A D;  4J7F A;  3QXE B;  2E65 A;  2EQU A;  2RB6 A;  2RI5 A;  5FU7 C;  1VQ9 T;  1KC8 U;  2HAX A;  5CK9 A;  2VGM A;  2DEQ A;  5I21 A;  5GMK j;  3JCM e;  3CME T;  1YI2 A;  3HSB A;  4M7D E;  2O4X A;  2RI2 A;  2LCC A;  1JJ2 A;  2EFI A;  3ASK A;  1UGQ B;  3OYF A;  3OYI A;  4A4H A;  1Q81 C;  1X01 A;  3DB4 A;  1QVG A;  4M7D D;  1PSE A;  5A0G A;  5M9O A;  3MP1 A;  5GMK i;  1VQM T;  2K57 A;  4C0D B;  1Y71 A;  4IUU A;  3OY9 A;  4OB1 B;  4M75 E;  2EQM A;  5I2M A;  2JN0 A;  4C5I A;  3DLM A;  5HKC A;  4F7U B;  4C92 B;  5KCO A;  1WQ7 A;  3JB9 I;  3PGG A;  1K73 U;  2DZC A;  2BKD N;  5FRM A;  5GMK h;  4C92 G;  4C8Q F;  3OYM A;  4V2S A;  3PIP A;  3M9Q A;  1N8R C;  4PKC C;  5CKB A;  3CCE T;  2RK2 A;  2VXE A;  3QYH B;  4CRI A;  3M56 A;  3SB2 A;  3HRU A;  3V8L A;  2KY9 A;  2X4Y A;  4M7A A;  1VQK T;  4N4I A;  2YLB A;  3M4G A;  5CO7 A;  4LDY A;  3CCV T;  1M1K U;  3OYY A;  5C6S A;  4PJO E;  4HT8 A;  3HFO A;  4A4E A;  1R8O B;  2P0Q A;  5KH6 A;  4JRI A;  4D6W A;  1X75 C;  2E10 A;  1I8F A;  3FJP A;  4M78 C;  4R56 A;  1W2B A;  3JB9 H;  2K3X A;  4M75 A;  5IAY A;  3LLR A;  3E9F A;  2VXF A;  3SDZ A;  5GAN 5;  4M77 B;  3J80 E;  4DQ2 A;  3OA6 A;  3G71 T;  4RG2 A;  2QA4 T;  1KQS A;  2JOY A;  3CCM T;  5D6W A;  1YIT A;  3G4S T;  2X4J A;  2CS7 A;  1BIB A;  4M77 G;  2K5I A;  2OTL A;  4LD6 A;  4BY6 B;  2ZPF B;  3JCM J;  5D6X A;  4OB2 B;  4PLI A;  3JCM h;  3OYL A;  4DA4 A;  3HRT A;  2KSS A;  3QII A;  2PVG B;  3I56 A;  2QDY B;  5EG2 A;  1D3B A;  3QUI A;  3RIR A;  3LGL A;  2GQV A;  1VQ5 A;  4PJO A;  4J83 A;  2DTI A;  1XNI A;  3OMC A;  3OYB A;  3A8L B;  1W2B S;  3CD6 A;  2QQB A;  4JLI A;  1KC8 C;  1U1S A;  5GAN 4;  1KHC A;  4QVZ A;  1KQS S;  2RHY A;  3X28 B;  4EMG A;  1UEB A;  1YJ9 A;  1N9S A;  2EIF A;  3O8V A;  1YHQ A;  4JRQ A;  3FIF A;  3H8Z A;  3CC2 T;  1XTD A;  4JRK A;  4ELY C;  4PJO C;  3PMI A;  4E7H A;  2EQK A;  2PUO B;  1M90 U;  4EMK A;  4M78 F;  3OYE A;  1XQH A;  2K4Y A;  4C8Q E;  2EYQ A;  5GAN e;  4XTY A;  5GAM f;  3M55 A;  1K73 C;  1WJQ A;  3UPU A;  4LDV A;  4C0D C;  3CCQ T;  5GAM e;  1VQ9 A;  3HL8 A;  3V8K A;  5CCA A;  1YCY A;  1G3Y A;  2EJF A;  5GAO r;  1M5Q 1;  2R58 A;  5KE3 A;  3CME A;  4C92 C;  2ZZD A;  1YJN A;  1VQP T;  2E70 A;  4B9X A;  4OGE A;  2B8A A;  1VQ6 T;  3QZ9 B;  3JCM W;  3CC7 T;  4Y28 E;  5DY9 A;  3C4S A;  3URG A;  4NL3 A;  1YIT T;  4LDX A;  2AHJ B;  5GMK l;  3L42 A;  3E1S A;  2OTL T;  1KG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...