3VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
101
structure length
101
Chain Sequence
b'MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCDB
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ccdb
total genus 28
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vubA00
5CKBA 4ELZC 4ELYC 3G7ZA 4MZTA 5CKHA 1UB4A 5CQXA 3JSCA 5CCAA 5CO7A 4HKEA 3JRZA 4MDXA 5CQYA 5HK0A 1M1FA 1X75C 3HPWA 1NE8A 5CK9A 2C06A 3NFCA 5CKFA 5HKCA 4ME7A 2MF2A 4OF1A 2KMTA 5HK3A 3TCJA 4VUBA 3VUBA 4MZMA 5CKDA 1VUBA 2VUBA 5DLOA 5CKEA 5CR2A 4MZPA
chains in the Genus database with same CATH superfamily
1UEBA 3HRSA 1SHGA 3NMZC 1NJIC 3OYBA 2RI2A 3CQTA 1RAEB 3X26B 4CI0C 4M7DD 2I0NA 1WXTA 4BACA 1S72Q 1EIFA 2DXUA 2NYSA 4MZMA 2SEMA 1G5VA 1M1GA 1WHMA 3CCSA 3PFSA 2JS0A 3G7ZA 3VYGA 5GAN4 2E12A 4C0DC 3MPUB 3HSBA 2LVMA 4KULA 1VQ7Q 1WZOA 1UGQB 2K5FA 2MIOA 3G6EA 5KYWA 1PRLC 1RUWA 4NL3A 4C8QE 1P92A 1YP5A 3CPFA 4IIOA 4NS5A 5LJ3f 1TUGB 4E47A 1VQ5Q 3NGPA 3DB4A 2A28A 4QVDA 5LJ5g 1K9MR 4HCBA 3OS2A 2DRKA 4IURA 4OMNA 2E5QA 1PSEA 3JB9G 2V8JA 4Y92A 3VS7A 1TG0A 2DIGA 2RHZA 3KFVA 5GAOp 3AT1B 4L5GA 2RK2A 1LPLA 1VQ9T 1Q81U 2DMOA 1Q86C 1SHFA 3VU3C 1Q82U 5LL6S 1GCPA 1VIEA 2JM9A 3L2VA 5EC7A 1RACB 3CCUT 1UGPB 1F1BB 1UFFA 1RLPC 2HL3A 3A8HB 3OS5A 2NUPA 2AIRB 2KRNA 2YHTA 4GLMA 2KSSA 4M7AC 2F5KA 5KCHA 2EAYA 1K73U 5J39A 3M4GA 2EYXA 2R5AA 4MDXA 1SKUB 5GAN6 1BIBA 2ZZDA 2CP3A 1NM7A 3RNJA 3U23A 4R0KA 3OYAA 1PNJA 1PD1A 3JAME 3GPLA 3RESA 2EYYA 1ZA1B 2EIFA 5GAN3 5CKEA 1SSHA 1D1CA 2D8JA 3A98A 2DZCA 1QP2A 3CC4A 1NJIU 2BZXA 4OMLA 3JRZA 3EH2A 4M77A 4CRIA 4M4ZA 4M7DE 2D0NA 2YRDA 1PKTA 2RQRA 1OX8A 3CCQT 1K0SA 2A3LA 3V8LA 3OSVA 2DBKA 3J81E 2P0PA 4QVCA 5KCOA 4M78F 1W6XA 1QVFS 1OPKA 1M2VA 1RAIB 1VQLQ 2YLBA 3BE3A 3EH1A 3OYEA 4O6JA 3JB9J 5LJ5h 2CZ0B 4J9GA 3JCMf 2V26A 4FYVB 4C92F 1BU1A 1SSFA 2RI3A 2DTOA 1Y07A 2CP2A 3QJ6A 2XDDA 1Q86U 1GL5A 4PJOG 1VQNA 1N9RA 2C06A 1KFZA 2DTHA 1WXUA 3GP8A 2RMOA 5KYWB 3GOXA 5GMKi 2KXDA 1OULA 2A37A 3UATA 2EGAA 2J6OA 3M0QA 3OBYA 3NTHA 5GJVB 1U5SA 1Y71A 3VRYA 4LUDA 1YIJQ 1ZHIA 2KAFA 2NUTA 1MGQA 3WVDB 4IUQA 1QKXA 2PVDB 3BW1A 2CYZB 4KT0E 4HVWA 4XU1A 4RTYA 3EFRA 3OYFA 4F17A 2EWNA 4E7SA 2IG0A 5L23A 2BKDN 5GAMg 1OOTA 4MZTA 2KI7A 1NEBA 2NUPB 1Q7YR 2QEXA 4M75D 3O5ZA 1I81A 2RD1A 3OYJA 1D0XA 1GBQA 4OF1A 2KMTA 2M51A 3HRTA 3CCSQ 2QA4A 1Y0MA 1W4SA 5DY9A 5FWCA 2KYMA 4ELYC 4R55A 2JZ2A 1QVPA 3G6EQ 1E7OA 4QKUA 3EFOA 1WA7A 4M78G 1H641 4XTWA 4ZTFA 4M77B 3MEAA 1UGSB 2BTTA 5FW9A 2Y4XA 5GMKl 2D8HA 1H3HA 2MMPA 2X4WA 3CCUA 5CR2A 5GAOr 1RABB 4KBMB 3JV3A 3R6OA 2D1XA 1MMNA 4D8KA 3MHXA 1TUDA 3OYGA 3S3NA 3M55A 2EQKA 2BIVA 5GANj 1K9MC 1M2VB 2KYBA 4M7AD 4GLKA 2M1HA 4JUVA 4DEXA 3M5AA 3PIOA 2XICA 1KG1A 2CGHA 3S6WA 3QG1A 1CKAA 4PFZA 2EQIA 4XU3A 2HDAA 4J9CA 2HBWA 2DAQA 3CMET 4C8QC 1UECA 2QG9B 2CZ7B 3URGA 3H41A 1NPPA 4OB1B 3EG9A 1I5OB 5LJ3d 4FU6A 2CUDA 3A1PA 3FIFA 2AK5A 1HK9A 1TH7A 1RAHB 3CC4Q 3PNWC 4E6RA 1SRMA 1KQSA 3CCMT 1ZBJA 4HA8A 1N8RR 5CAIA 5GAN8 4ZGJB 1GCQC 2LQNA 3H9NA 5CKHA 5CQXA 1PD0A 5A0GA 3LWIA 1WNLA 1NZ9A 2VXEA 2NUTB 1KQSP 3M9QA 1ZSGA 3OYMA 2HSPA 4FCYA 2QTXA 1TSFA 1JJ2A 4N4IA 4Y28E 4ELZC 4OP0A 4PJMA 1QCNA 2B86A 1RAGB 2LX7A 3QUIA 2GQIA 4JJNK 1SG5A 3F70A 1R77A 4ESRA 1JJ2P 3ZEHA 1WYXA 4VUBA 3BDUA 1QVGP 4FYYB 3CCVQ 1S72A 1K76A 3GIBA 2K3XA 1GRIA 4M7DC 2CP5A 4BDYA 1YWOA 3CCJT 1K9MU 3EFOB 3RKXA 4HT8A 2X4JA 5HK3A 5L8RE 1G3WA 2DPPB 2J6FA 1X01A 4PJJA 5FU7B 3OYLA 5IH2A 2Y90A 4RCCA 2QTVA 1OYXA 2CUBA 1SPKA 2EBPA 4BUGA 2CP7A 1KD1R 4PJOA 5IN1A 2YRVA 1LNXA 2E10A 3JCMJ 3EG2A 3L2RA 2JNGA 2P84A 5CK9A 2X9HA 2EJ9A 4FT4A 4UC4A 2JXBA 2ZPBB 3CC2T 2DK3A 4WCIA 4PLLA 1NLPC 4KUDK 2P4RA 3JCMd 1FWZA 2DL3A 4RCBA 1AWXA 2K2VA 3CCET 3KXTA 1G83A 1IREB 1B34A 4FW2A 2LMJA 2DL7A 4HVUA 1MNDA 5GMKm 5KYUA 4JJDA 2K6DA 3E9FA 3Q1JA 4F7UE 4Q5WA 2QA4Q 3EG9B 1B7TA 1E6GA 4EPCA 2O9SA 1OU8A 1BI2A 2H3EB 3RBBB 3S3OA 6AT1B 1G3TA 1OZ3A 4F16A 1VQ6T 1KQ1A 4C5IA 1WX6A 2ATCB 3FC3A 3V8JA 5HK0A 4DQ2A 5D6XA 3I9QA 4KGVB 2VXFA 2F5TX 3MP8A 4J8OA 3CCUQ 2PZ1A 2JM8A 1M4ZA 1QQJA 1AD5A 3S3MA 1LJOA 5GANf 5CO7A 2MYSA 2DA9A 2M02A 4M78A 1JXMA 2COZA 4WF2A 2DILA 2VB6A 1D09B 2DBMA 2OX7A 4J9DA 2IPOB 2RK1A 3LYIA 5KH6A 4EMKC 5CKFA 4ZTJA 2JTFA 1N9SA 4RTZA 5IHIA 3QZ9B 4C8QD 1VQLA 3FEOA 3H0IA 2DKGA 3QPHA 4DEYA 4EIKA 1XNIA 2QAZA 3FRNA 2CH4W 3E19A 5GAOm 3UWNA 5GAMj 3GF5A 3CCMA 1DJ7B 1UB4A 2EJGA 3CBMA 4C92A 1MHNA 4N4GA 3MP1A 3M4YA 3FDRA 2QASA 2KQWA 1N6AA 3CCQQ 1BI0A 2FPFA 1QVFA 1G3YA 1PC0A 2RN8A 1QVGS 4HCKA 2CREA 4M7AG 1FX7A 1LCKA 3CC7A 4X1VA 2P4TA 3GNFB 4MDWA 2XDPA 3X24B 2LQ8A 3HTRA 2RJCA 3V7CA 4PJOB 4LXCA 2J7IA 3PMIA 2A08A 1YIJA 1HYOA 5CIUA 1N8RC 3J7AF 3CCLT 2AT1B 2X3WD 3JCMW 2V8IA 4HVVA 3JCMP 1Q7YU 2DYBA 4MZPA 1HXDA 1B34B 4PFPA 2L0AA 4LDVA 2FL7A 1KSWA 2LX9A 3ZL7C 1PHTA 1U1SA 4ZN1A 3JB9I 5KYUB 3SWNA 1VQOT 3CCJA 2L8DA 1D1AA 4C5HA 2DO3A 4AFZC 3JCMe 5IT9E 2WSEE 2J06A 3M53A 1ZSZA 3REBB 1VQMT 4M75C 1VYUA 2LQWA 5I21A 2RI5A 4A63B 3MEWA 3ULRB 2YT6A 3OMGA 2X4XA 2OJ2A 2EJFA 2KT1A 4JS5A 2A7YA 1YITA 4QQDA 4LDYA 4RMOA 4J6WA 2P0KA 3NTKA 1WHLA 3CC2A 1B3QA 1WXBA 2L5QA 3PVQA 3EG0A 1RI0A 3CBOA 4PJOF 5DM7R 1OU9A 3QWXX 2W10A 2K7AA 4M78B 5FU6B 1HD3A 1X2KA 3CPWP 4L59A 3CMAT 1IZ6A 1OV3A 4Y91A 1U8RA 1KD1C 5I2MA 4LDXA 3G71T 1JBMA 1K1ZA 5GAN5 5GAOq 1ZUUA 2GFUA 1T0JA 3QJYA 2YRCA 1VQ6A 1I0CA 3RDVA 1X6BA 4C92B 1QWFA 2DJQA 1CSKA 1SEMA 2CP0A 3QYHB 3A8LB 1N8RU 4A4FA 3FB9A 1GFDA 2AZSA 5EG2A 2EGEA 1AZEA 4FSXA 1IO6A 4A53A 2R58A 2KRSA 3OYCA 3L2WA 2O9VA 1C0MA 1M3CA 3OMCA 3JSCA 4XAXB 3VS0A 1VQ8T 3M54A 2EQUA 5C0MA 2V1RA 3UDCA 4BE0A 2MCNA 3QDFA 1NPRA 1QWEA 3HHTB 4NOYA 2O2OA 4M78E 2RM4A 4A4GA 2E41A 1VYVA 2LQKA 1WHKA 4ZNXA 3SD4A 5LJ3g 1VQ4T 3RERA 2F2XA 2DRMA 2RHIA 3LGFA 3DLMA 2I2LA 1WHGA 3X20B 3I56T 2NUZA 2YWWA 3PVLA 3ASKA 1N5ZA 4QVZA 3SWNB 4C92E 5GAMf 2RB6A 3CCMQ 2MAMA 2RQVA 1JO8A 3ZBDA 1UHFA 3KBGA 1ZSZB 1KIKA 3EGUA 4XK8E 2KXCA 2OTLT 1D3BB 3EFSA 3CCVA 1FYNA 2XG8D 2XKOC 3VJPA 2QYZA 1YJNA 2DF6A 3CC7Q 1KD1U 4JRIA 2FG0A 3M57A 3QWYA 2FRYA 1AT1B 2GFAA 2L3SA 1QCFA 2DE0X 1T3SA 3CD6T 4OB3B 2MI6A 3QKJA 1UJYA 3RKWA 2WSFE 4BB7A 3REAB 2HSEB 2HNIA 4J83A 2L3PA 3JCMc 2CS7A 2ECZA 2PU9B 2JN0A 2X51A 3VS3A 4E7ZA 3BDLA 1ABQA 4OB2B 3M59A 3OW2P 4M77D 2COYA 1VQMA 5CCAA 4JJBA 2DVJA 1A0NB 3UA7A 5D6WA 3VS6A 1X27A 2EYWA 2K5IA 3CCJQ 3CPWS 4AFUC 4BDZA 2M16A 3MCAB 1M1KR 5AT1B 2COWA 4IUPA 3WXMB 1WFWA 2A36A 4RKUE 5GMKh 1VQ5T 2PQWA 1VYTA 1UE9A 2AKKA 2JS2A 5LJ3h 3D7SB 2B8AA 3I35A 3UT1A 1PM3A 1YITQ 2ESWA 2E5KA 3MEUA 3SEMA 3JCMg 1AEYA 1FMVA 1NE8A 3CC2Q 1VQ9A 2HQEA 4J9EA 4J5YA 4OB0B 4JS4A 3CMAA 2ZPHB 4N0AC 2LCCA 1G8XA 2R57A 1H8KA 5J3BA 4M7DG 2RJFA 4PLIA 2L3RA 3H8ZA 2XMFA 3OQ5A 5C6SA 4Z89A 3SHWA 3L1AA 3VYHB 2BZ8A 4XTZA 1RLQC 1K8AR 1KC8C 5KYNA 3V7RA 3I5SA 2VWFA 3PGGA 2HCKA 2QI2A 2GF7A 2KRMA 2YDLA 1N27A 1VQ6Q 1KHCA 1YNZA 1V76A 1VQKT 4FT2A 4C0DB 3C12A 2VGNA 1WQWA 2EKOA 5IXBA 2BE7D 4LNPA 3INZA 2CZ1B 1BB9A 3UF4A 2FYKA 3DB3A 4RTWA 4IKFA 4C5EA 4ZGEB 2J6KA 3LX7A 2CSQA 3A8GB 1BI3A 1X43A 3VS4A 4J9FA 2M0OA 3V7SA 1YHQT 4DBHA 4N4HA 2QDLA 4M77E 3CCQA 3MKDA 2Y4YA 1YJ9T 3RR6A 2DLPA 2LDMA 3ER0A 2FVUA 4J6XA 4PNOA 2OTJT 1FMWA 2RQUA 2JJ9A 1AWOA 3NFCA 3TEEA 3UPUA 1MMAA 2AHJB 1WHJA 4X9DA 1RAFB 5GANe 5A0LA 1WDXA 2DM1A 5LJ5j 3JCMV 2F69A 2VVKA 1W2BP 2P0QA 2F2VA 4XTXA 5HCKA 4E7HA 4AT1B 4RG2A 1QVGA 1AZGB 3JCMh 3RUXA 1OZ2A 2OTLA 3TREA 2KR3A 4M75F 2Z0WA 2VV5A 2RHXA 1IGQA 4NL2A 3H0HA 4PK4A 4O5VA 4QW2A 3I55T 3OW2S 2NWMA 4RTXA 2MWOA 4XQ3A 3ME9A 1M1FA 1YJNQ 3CD6A 2OI3A 3QHSA 4J9HA 4QT7A 4DBFA 2GNCA 1H3ZA 3NHNA 3JB9D 3OYKA 3OY9A 1UG1A 1M2OA 2DL5A 1X6OA 1PG5B 1R0BG 4B9XA 4A4HA 2FHDA 4BI8B 3HKSA 2ZPGB 4ZGDB 3META 2VC8A 4CC3A 3OYDA 1WLPB 1G3SA 2RO0A 4MMLA 4C92C 3HRUA 1J3TA 1ZLMA 3NPFA 2MF2A 4E7LA 4M7AF 5GMKj 4YTLA 3L2UA 3CCST 2WSCE 1VQMQ 1OI1A 4LDWA 4XU0A 5LJ3j 2DX1A 5CVIA 1C1AA 4HKEA 3G6ET 2E64A 3G1JA 3EG1A 2RF0A 2E3HA 3IQLA 4F04B 2L2PA 2FZKB 1IGUA 4FL6A 9ATCB 3CCRT 1GCQA 5FROA 1HJDA 2QDYB 2WACA 2VUBA 2E6ZA 3MJXA 1UHCA 1M1KC 5KYYA 3G4ST 5FRNA 1VQ9Q 4GBQA 1WQ7A 2FZGB 3CMAQ 4EDUA 2O01E 4RG8A 1ZUYA 2DEUA 2NLUA 2HQHA 2XD0A 2E4HA 3CXCP 4M75G 3SWNC 2CZ6B 2XHCA 2K2MA 1WJSA 1Q95G 2QK0A 4PJLA 1IXDA 4C5GA 1M5Q1 1K4US 2CH4A 1KQ2A 3GNGA 3CMEA 4JRKA 1I8FA 4TVRA 1U3OA 2XI9A 1FMKA 4L6V5 1D1BA 2DL8A 1IHVA 3M0SA 2DJZA 4EMGA 1YCYA 3CC4T 2V8KA 2CT3A 4PJOD 2PVGB 3T9NA 1W2BS 1YHQA 1T3LA 1K8AC 4FYXB 1T0HA 4PKCC 2GBQA 5GAN7 4C0GA 3HFNA 1WJRA 1ZBXA 1O75A 3C94A 3FLGA 2KEAA 4OGEA 3OYYA 2LCLA 2DETA 1OX9A 1MV0B 2JUFA 2RJDA 1TXQA 1ZA2B 4JZ4A 1QMCA 2MWPA 2R5MA 1Z9ZA 2K5LA 1BI1A 2HKNA 4LUEA 5LJ5f 1X6GA 3DKMA 2K4YA 3E1SA 4JZ3A 2PNIA 2ZPFB 2YUOA 5DLOA 1WIEA 4JRPA 1M1KU 1VQNT 4WTOB 3I55A 2OTLQ 4AG1C 2QGFB 2HD0A 2YUNA 3BFMA 4JLGA 3M0RA 5GAMe 2DVEA 2RHYA 2JT4A 3EG3A 4M77C 5J26A 5D6YA 1JQQA 4M78D 2KDSA 3ZFJA 4II1A 1TS9A 1MMDA 1K0XA 4F7UG 2MPXC 4XTYA 1VQPT 2RHUA 1H92A 3CD6Q 1D3BA 1QW1A 1X75C 5KYYB 4RUGA 3JCMb 3EGXB 1BIAA 3C95A 4AFSC 1JEGA 4ZN3A 4PJOE 2LNVA 1PWTA 3CPWA 1KC8R 4C92D 1AWJA 1WI7A 5CQYA 1K8AU 4QQGA 1M90R 2JOYA 5FLXE 1KK7A 3CCEA 2QEXT 4EMKA 4BE1A 5D7UA 4BY6B 4OMPA 1QLYA 3OYHA 3MEVA 4FW1A 2QA4T 3CXCS 4OMQA 1MUZA 1FXXA 1U1TA 4C8QF 2V1QA 5FRMA 3NTIA 3L42A 2HQXA 3CCRA 4OMOA 4M7DB 4HXJA 1UTIA 2C0OA 2ABLA 4EMHA 2ROTA 2PVOB 4J7FA 3QIIA 4R56A 1YFNA 3TSZA 1YWPA 2MOXA 3G4SA 2RJEA 1LOJA 2H3JA 4DOWA 2K3YA 2KROA 3A5ZB 1ZUKA 1M3BA 1JXOA 3WVEB 5KE3A 4F14A 5IHNA 2M9UA 2EPDA 2ZCFB 3X28B 2XK0A 3VS5A 4E7JA 4DOVA 3RIRA 4JPBW 2EVRA 1EFNA 4AFQC 2K3BA 1BYMA 2X35A 2KNBB 1NG2A 2QQSA 4RTTA 5A0DA 3TU4K 3HL8A 2BZYA 4CC4B 2X3XD 1WPYA 5GANh 4LD9K 1YJWT 3P8HA 3PIPA 1PCXA 4JDSA 1VQKQ 1TU0B 3H6ZA 4HCZA 3N5BB 2KK4A 2LRQA 1CKBA 1YI2T 1WGSA 3CMEQ 1AHJB 2AZVA 1RL2A 1JU5C 1NBEB 2QQ9A 1JRIA 4RTUA 2L89A 4M75A 2VASA 4M7DF 1YHQQ 3VUBA 3VS2A 1YJ9Q 1PKSA 3AHUA 2A0FB 5FU7C 1VIFA 3EGDA 1TOVA 1OPLA 5KYXA 2OTJQ 1PRMC 2CSIA 2X4YA 1M9SA 3SDZA 2E1HA 4E7IA 1Y96A 2RQTA 1D0ZA 4OMMA 4BD3A 1GXIE 2HKQB 2DFUA 2EYZA 3OB9A 4FSSA 2CP6A 4FYWB 2HMAA 3CCLA 1U06A 2DXTA 5GANd 3JCMQ 5M9OA 2F2WA 4C8QG 1BCMA 1NEGA 3H0FA 2DERA 2CKKA 4EMKB 1UUEA 2JVVA 2ZPIB 2GTOA 3OW2A 4KGXB 2OAUA 3L2QA 1X2QA 2FO0A 2EKHA 4A4KA 2VYTA 1VQOA 1S72T 4M7AA 2KGTA 3I55Q 1BK2A 5HY6A 2DXCA 3C0CA 2EYQA 3J80E 1E6HA 4Z8AA 2LCSA 1VQPA 3THKA 1VQ7T 2GCXA 7AT1B 3E2UA 2ZPEB 2D0QB 4FIBA 2QGGA 1B07A 4IIMA 1R8OB 4AG2C 2PUOB 4GY5A 1ZQ1A 5KE2A 2ED1A 3LW5E 1YCSB 1KJWA 2F1LA 1I1JA 2O88A 2RA2A 2K57A 4LD6A 5GAN2 2EGCA 3OYNA 8AT1B 2DD5A 3OBWA 4XTVA 1BKBA 5LJ5d 1XQHA 5IHKA 4DBQA 5I22A 3C4SA 1ZX6A 4C0ZA 1O9SA 3LWHA 3DLLA 3BY7A 2ENMA 2LJ3A 5FWBA 3CCEQ 4F7UA 4OMFB 3G71A 4X9CA 2E65A 1S1NA 3A8MB 1AWWA 4JLIA 1NYGA 2LC4A 4PJNA 4KGZB 3CEYA 4LDUA 3A8OB 2YLCA 2QQAA 4K11A 3CCRQ 3MP6A 1M3AA 4LN2A 1M90C 4M75B 3SFMA 1XTDA 1IRXA 2DTIA 1ABOA 3SB2A 1K9AA 3G4SQ 3EGDB 4HCCA 4C92G 1D0YA 2RPNA 4ATOA 2CDTA 2BUDA 5KYXB 2LT1A 1VQ8A 4PJOC 1C6VX 1UDLA 1PSFA 3QYGB 1V29B 1Y7XA 2EQMA 1YJWA 1Q81R 1Y96B 4PFOA 1MV3A 4B9WA 1MNEA 1BBZA 3LH5A 1Q82R 1QP3A 2QXFA 2E70A 1VQ4A 8ATCB 4BE2A 2LP5A 1BCOA 4P5NA 4OGCA 1YI2A 2KY9A 1W2BA 2YUQA 1VQLT 2G6FX 5I2SA 1G2BA 1SRLA 2EW3A 1K73R 2CT4A 2ROLA 2MK5A 3I56A 1I4K1 3P8DA 4Z02A 4MMKA 3HP9A 4M7AB 4C0FA 2L3QA 5GAMh 3PTAA 2C0TA 4M77F 2JTMA 2GQVA 4M75E 3QO3A 2HZYA 3TVTA 3LH0A 2FEIA 2RQWA 3P8BB 1OEBA 2KVQG 2OAWA 4ORZA 5GAOl 1NJIR 2O4XA 2DEQA 2FRWA 3FJPA 2J05A 4ME7A 2RH2A 3OS0A 3CC7T 3TCJA 3UA6A 2DL4A 2KBTA 4D8DA 2DYIA 2IVWA 2DZ9A 3L2ZA 1MMGA 1X69A 2JTEA 4BI4A 1TWBA 3PT9A 3V8KA 1YIJT 1QKWA 1ARKA 1KC8U 4BY6C 4KRTA 1RAAB 3M0UA 4D6WA 4N0AA 2D6FA 1I07A 4M78C 5FU6C 1M90U 3E9GA 2C0IA 4XU2A 3RMQA 3CCLQ 1YBYA 1V1CA 1NYFA 1UJ0A 2HL5C 3JB9H 1VQNQ 5I11A 1JB0E 1IB8A 4F7UB 2XIDA 4FM4B 5LJ5e 1UGRB 1M8MA 1RI9A 4M7AE 2GGRA 4LE9A 2DXBA 1VQOQ 1VQ7A 4CC2A 2ZGWA 1IHWA 5GAMd 3M56A 1Q86R 5ECAA 2LJ1A 3RKYA 2PUKB 2DIQA 3QDRB 2HAXA 1VQ5A 4C8QA 2E6NA 3M0TA 1VQPQ 4X34A 1VOMA 3PE0A 4DBRA 2FB7A 5GJWB 2JMAA 2H8HA 2RNAA 3CBPA 1YITT 5DLQE 1QCOA 3EHQA 4E2FB 1SF9A 2FZCB 3EHRA 2PTKA 4IUTA 5HKCA 4BI3A 1M30A 3TSWA 2EFIA 1XOVA 4B6MA 4PL6A 4J9IA 3M0PA 2EQJA 1EZZB 2LJ0A 4HT9A 3VRZA 2QEXQ 5IAYA 2QQBA 1TTHB 3CXCA 2DNUA 4KUIA 2O31A 1Y57A 3OS1A 3VKIA 4M77G 3RMSA 4J6YA 4Z88A 1NLOC 3EGXA 1OQKA 3M58A 4A54A 3OYIA 2GTJA 2VGMA 2K9GA 5IXFA 3G71Q 4CC7A 4F7UF 1GBRA 2FPDA 2W0ZA 1Q7YC 2E3IA 5GMKe 2BE9B 1ZSZC 1VQKA 3OSSC 2LT4A 5LJ3e 1YN8A 1ACMB 2K79A 4DA4A 2LNHB 1XJWB 4KH1B 1TUCA 2VKNA 1UGVA 2O4XB 3R6NA 3VUZA 3QBYA 3QSUA 4M7DA 4V2SA 2KT8A 1VQ8Q 3OA6A 1YJ9A 3EAEA 2LTOA 2YSQA 3VS1A 4JRQA 1W70A 2KE9A 1KQSS 2YUPA 2HBPA 1YJWQ 2ZAEA 4E7KA 1AOJA 2OTJA 3JB9F 1EX4A 4JJCA 1WHHA 2HEQA 1M27C 2IIMA 4XTUA 4IUUA 1GFCA 1VQ4Q 1LVKA 3QZ5B 3LGLA 2LZ6B 4ANJA 1YI2Q 2DD4A 2JW4A 4OVAA 2XDBA 3TQ7P 3HPWA 3GBQA 4J7IA 1Q81C 1JJ2S 2SRCA 3I56Q 3GLXA 3VV0A 3FJ5A 1RADB 1Q82C 4AMCA 2M0YA 3X25B 2QQRA 2AKLA 4J9BA 5AYFA 2XU8A 1HSQA 3LLRA 3KUFA 1AVZC 5CKBA 3CCVT 4A4EA 4QQ6A 4C8QB 1I5LA 1KHIA 1VA7A 2D9TA 1QVFP 3HFOA 1K73C 1WJQA 3PMTA 2ED0A 1YJNT 4IUVA 3QXEB 2JMCA 5GANg 1Z9QA 2FPEA 1W1FA 3O8VA 1R0CB 2G3RA 5A2QE 3JCMX 4KH0B 3MO8A 1M8VA 3I5RA 5CKDA 1VUBA 5GAOn 4RTVA 2YXYA
chains in the Genus database with same CATH topology
5FU7C 1VIFA 1UEBA 3C12A 3HRSA 2VGNA 4FT2A 4C0DB 1WQWA 2EKOA 1NJIC 3INZA 3OYBA 2CZ1B 2RI2A 5GMKm 2FYKA 3DB3A 2X4YA 1M9SA 1IREB 3E9FA 3X26B 3Q1JA 4IKFA 4C5EA 4CI0C 3SDZA 2E1HA 4F7UE 4E7IA 4Q5WA 4ZGEB 4M7DD 3LX7A 1Y96A 4BACA 3A8GB 4EPCA 1BI3A 1EIFA 2DXUA 4BD3A 1GXIE 1BI2A 2M0OA 4MZMA 3V7SA 1YHQT 4N4HA 3S3OA 3OB9A 4M77E 3CCQA 1G5VA 1M1GA 2Y4YA 1YJ9T 3CCLA 1OZ3A 1G3TA 2DXTA 5GANd 1VQ6T 3CCSA 3PFSA 3JCMQ 5M9OA 1KQ1A 2LDMA 3G7ZA 3VYGA 4C8QG 4C5IA 3FC3A 5GAN4 3ER0A 2E12A 4C0DC 2FVUA 2LVMA 2CKKA 3V8JA 4KULA 3HSBA 5HK0A 1UGQB 2K5FA 4DQ2A 4J6XA 2JVVA 2ZPIB 4PNOA 5D6XA 4EMKB 2OTJT 3OW2A 3G6EA 3NFCA 2OAUA 3TEEA 3UPUA 2VXFA 4NL3A 4C8QE 2F5TX 3MP8A 1P92A 4NS5A 3CPFA 3L2QA 2AHJB 5LJ3f 4E47A 4J8OA 4A4KA 2VYTA 3DB4A 4X9DA 1VQOA 4QVDA 5GANe 5A0LA 5LJ5g 1S72T 4M7AA 5KCHA 4HCBA 1M4ZA 3OS2A 5LJ5j 3JCMV 4IURA 2F69A 5HY6A 2E5QA 1PSEA 3JB9G 2V8JA 2DXCA 2P0QA 2EYQA 2DIGA 2RHZA 1LJOA 3S3MA 4XTXA 5GANf 3J80E 5GAOp 5CO7A 4M78A 4L5GA 2RK2A 4E7HA 4RG2A 1VQPA 1QVGA 4WF2A 1VQ9T 1Q81U 3JCMh 3RUXA 2GCXA 1Q86C 1VQ7T 1OZ2A 2OTLA 3TREA 2RK1A 3LYIA 5KH6A 2ZPEB 4EMKC 5CKFA 4M75F 2D0QB 4FIBA 2JTFA 3VU3C 4ZTJA 1Q82U 1N9SA 5LL6S 1VIEA 3QZ9B 3L2VA 4C8QD 2VV5A 3FEOA 1VQLA 1R8OB 2DKGA 2RHXA 1UGPB 3QPHA 3CCUT 4NL2A 1XNIA 4O5VA 2PUOB 4QW2A 3FRNA 1ZQ1A 3A8HB 3OS5A 4GY5A 3E19A 5KE2A 3I55T 3OW2S 3LW5E 5GAOm 2YHTA 3UWNA 2MWOA 5GAMj 2KSSA 3GF5A 3CCMA 4M7AC 2RA2A 1DJ7B 1UB4A 2EJGA 2F5KA 2K57A 1MHNA 3CBMA 3ME9A 4LD6A 4XQ3A 2EAYA 4N4GA 4C92A 5J39A 3M4GA 2DD5A 3M4YA 3MP1A 3OBWA 2R5AA 4XTVA 4MDXA 1M1FA 1BKBA 3FDRA 5LJ5d 1XQHA 3CD6A 5GAN6 1BIBA 2ZZDA 3QHSA 3C4SA 5GAN2 2KQWA 3OYAA 1H3ZA 4C0ZA 1N6AA 3JAME 3OYNA 3JB9D 1O9SA 1BI0A 3OYKA 3LWHA 3GPLA 3DLLA 1QVFA 1G3YA 3RESA 3BY7A 3OY9A 2EIFA 1QVGS 5GAN3 5CKEA 1FX7A 3CC7A 4M7AG 4F7UA 1X6OA 4OMFB 2P4TA 3GNFB 4MDWA 2XDPA 3X24B 3G71A 2DZCA 4X9CA 2E65A 1QP2A 4A4HA 2FHDA 2LQ8A 4B9XA 3HKSA 4BI8B 1NJIU 3CC4A 2ZPGB 3A8MB 4ZGDB 3META 2VC8A 4JLIA 3JRZA 2RJCA 4M77A 3V7CA 4PJOB 2LC4A 3OYDA 4CRIA 1G3SA 4M7DE 2RO0A 4MMLA 4C92C 3HRUA 3PMIA 3CEYA 4LDUA 3A8OB 1YIJA 2YLCA 2MF2A 2QQAA 5CIUA 3CCQT 4E7LA 1N8RC 3J7AF 5GMKj 3MP6A 4M7AF 4YTLA 3CCLT 2A3LA 3V8LA 3L2UA 1M90C 3CCST 2WSCE 3JCMW 4M75B 3OSVA 3SFMA 2V8IA 1OI1A 1XTDA 3J81E 2P0PA 4LDWA 2DTIA 3JCMP 1Q7YU 4QVCA 5KCOA 4XU0A 5LJ3j 4MZPA 4M78F 1HXDA 3SB2A 1B34B 5CVIA 4LDVA 2FL7A 4HKEA 3G6ET 2E64A 4C92G 4HCCA 1QVFS 4ATOA 2LX9A 2BUDA 1U1SA 2LT1A 1VQ8A 4ZN1A 3JB9I 2YLBA 4PJOC 3SWNA 1VQOT 3CCJA 1PSFA 2L8DA 3QYGB 4C5HA 1V29B 2DO3A 4FL6A 1Y7XA 3JCMe 5IT9E 3OYEA 3CCRT 2WSEE 2EQMA 1YJWA 5FROA 1Y96B 2QDYB 2WACA 3M53A 4O6JA 2VUBA 2E6ZA 3JB9J 4B9WA 5LJ5h 2CZ0B 1VQMT 3JCMf 4C92F 4M75C 5I21A 1QP3A 2QXFA 2E70A 2RI5A 1SSFA 2RI3A 1M1KC 2DTOA 1VQ4A 3MEWA 1Y07A 4BE2A 2XDDA 3QJ6A 1Q86U 3G4ST 5FRNA 4PJOG 4P5NA 4OGCA 3OMGA 1VQNA 2X4XA 1N9RA 2EJFA 1YI2A 1WQ7A 2C06A 2KY9A 1W2BA 4JS5A 2A7YA 2DTHA 4QQDA 1YITA 4LDYA 1VQLT 3GP8A 5I2SA 4EDUA 2O01E 4RG8A 4RMOA 2NLUA 4J6WA 2XD0A 2P0KA 3GOXA 5GMKi 3I56A 3NTKA 1I4K1 4M75G 3SWNC 2CZ6B 3CC2A 3P8DA 4Z02A 4MMKA 2L5QA 3HP9A 2XHCA 3OBYA 4M7AB 4C0FA 1RI0A 1WJSA 3CBOA 3NTHA 4PJOF 5DM7R 5GAMh 3PTAA 4M77F 2JTMA 2GQVA 1Y71A 4M75E 3QO3A 3LH0A 4C5GA 1M5Q1 1ZHIA 2KAFA 3P8BB 4M78B 5FU6B 2KVQG 5GAOl 1KQ2A 1MGQA 4L59A 3GNGA 3CMEA 4JRKA 1I8FA 2O4XA 4TVRA 2DEQA 3FJPA 2PVDB 3BW1A 4IUQA 4ME7A 2CYZB 3CMAT 2XI9A 2RH2A 4KT0E 4L6V5 3OS0A 3CC7T 4XU1A 3TCJA 1IZ6A 3EFRA 4Y91A 1U8RA 3OYFA 1KD1C 2DJZA 5I2MA 4EMGA 3G71T 1YCYA 4LDXA 2EWNA 2IVWA 3CC4T 1JBMA 2DZ9A 3L2ZA 2V8KA 4PJOD 2IG0A 2PVGB 3T9NA 1W2BS 2BKDN 5GAN5 5GAOq 4BI4A 1YHQA 2GFUA 5GAMg 3QJYA 1K8AC 4MZTA 3PT9A 4PKCC 5GAN7 1VQ6A 4C0GA 3V8KA 3HFNA 4C92B 1YIJT 2QEXA 1WJRA 1ZBXA 4M75D 1KC8U 1O75A 1I81A 4BY6C 3QYHB 4D6WA 4N0AA 2D6FA 3A8LB 3C94A 4M78C 2RD1A 5FU6C 3OYJA 1N8RU 4A4FA 3FLGA 3FB9A 4OF1A 2KMTA 4OGEA 1M90U 3E9GA 3HRTA 4XU2A 3RMQA 1YBYA 3OYYA 2LCLA 2QA4A 5EG2A 1W4SA 5DY9A 3JB9H 4FSXA 1JB0E 2R58A 4A53A 3OYCA 4F7UB 2JUFA 2RJDA 2XIDA 4ELYC 3OMCA 4XAXB 2JZ2A 3JSCA 4FM4B 4R55A 3L2WA 3M54A 1VQ8T 1QVPA 2EQUA 5LJ5e 5C0MA 1UGRB 2MWPA 2R5MA 2K5LA 4M78G 4M7AE 1BI1A 3UDCA 4BE0A 1H641 4XTWA 4ZTFA 4M77B 2DXBA 3MEAA 5LJ5f 1VQ7A 1UGSB 2ZGWA 3DKMA 5GAMd 3M56A 1NPRA 3HHTB 4NOYA 2K4YA 2Y4XA 3E1SA 4M78E 2RM4A 5GMKl 3RKYA 2ZPFB 4A4GA 2E41A 2PUKB 3WVDB 2LQKA 5DLOA 2MMPA 2X4WA 2DIQA 3QDRB 5LJ3g 3SD4A 3CCUA 4JRPA 1VQ4T 5CR2A 5GAOr 4C8QA 2E6NA 4KBMB 1VQ5A 2HAXA 4X34A 3RERA 1M1KU 1VQNT 2FB7A 3LGFA 2RHIA 3CBPA 3R6OA 3I55A 3DLMA 2HD0A 2I2LA 5DLQE 1YITT 3BFMA 3MHXA 4JLGA 5GAMe 3X20B 3OYGA 3S3NA 3M55A 2DVEA 2EQKA 2RHYA 2BIVA 5GANj 1K9MC 4IUTA 3I56T 4M7AD 4GLKA 5HKCA 2M1HA 3ASKA 4M77C 4JUVA 4BI3A 5J26A 4QVZA 3SWNB 4C92E 5GAMf 3M5AA 3PIOA 2XICA 2EFIA 1XOVA 2RB6A 4PL6A 1KG1A 2CGHA 5D6YA 2MAMA 3S6WA 2EQJA 3QG1A 2KDSA 4M78D 3ZBDA 3ZFJA 4II1A 4XU3A 4HT9A 3KBGA 4F7UG 4XTYA 5IAYA 2RHUA 2QQBA 1VQPT 1D3BA 4XK8E 3CXCA 2DAQA 2OTLT 1D3BB 3EFSA 4KUIA 3CMET 4C8QC 3CCVA 1QW1A 1X75C 2XG8D 3OS1A 2CZ7B 3URGA 3VKIA 4M77G 1NPPA 4OB1B 3RMSA 2XKOC 4J6YA 3VJPA 5LJ3d 4FU6A 3JCMb 3FIFA 3M58A 1YJNA 4A54A 1BIAA 3OYIA 1HK9A 1TH7A 3C95A 4JRIA 1KD1U 3M57A 4ZN3A 4PJOE 2GFAA 2VGMA 2LNVA 4F7UF 3PNWC 3CPWA 4C92D 1KQSA 3CCMT 1Q7YC 5CQYA 4HA8A 5GMKe 1K8AU 5CAIA 4QQGA 5GAN8 4ZGJB 2JOYA 5CKHA 5FLXE 5CQXA 3CCEA 2QEXT 4EMKA 3CD6T 4OB3B 2MI6A 4BE1A 1VQKA 3QKJA 3OSSC 2LT4A 5A0GA 5LJ3e 4BY6B 3LWIA 3RKWA 2WSFE 4DA4A 4BB7A 3OYHA 1WNLA 1NZ9A 2VXEA 3MEVA 3M9QA 2HNIA 2QA4T 4J83A 3OYMA 3JCMc 2CS7A 2O4XB 3CXCS 2PU9B 2JN0A 2QTXA 3VUZA 3QBYA 1FXXA 1U1TA 3BDLA 4OB2B 4C8QF 3QSUA 5FRMA 3NTIA 3L42A 2HQXA 3CCRA 1JJ2A 4M7DA 4V2SA 4N4IA 4Y28E 3M59A 4M7DB 4M77D 4ELZC 4OP0A 1VQMA 5CCAA 3OA6A 1YJ9A 3EAEA 2LTOA 5D6WA 4JRQA 3QUIA 4EMHA 4JJNK 2PVOB 2K5IA 4J7FA 3F70A 3QIIA 4R56A 3CPWS 4BDZA 1KQSS 2M16A 3MCAB 3G4SA 2HBPA 2RJEA 1LOJA 4IUPA 3ZEHA 4E7KA 2H3JA 3WXMB 4DOWA 2K3YA 2OTJA 3A5ZB 4RKUE 3JB9F 3WVEB 4VUBA 5KE3A 5GMKh 1VQ5T 2M9UA 2PQWA 4XTUA 3BDUA 4IUUA 2ZCFB 3X28B 2XK0A 4E7JA 3QZ5B 1S72A 3LGLA 5LJ3h 4DOVA 3RIRA 3GIBA 2B8AA 1K73U 2DD4A 2K3XA 3UT1A 4M7DC 4OVAA 2XDBA 3MEUA 3JCMg 1BYMA 2X35A 2QQSA 5A0DA 4BDYA 3HPWA 1NE8A 3TU4K 3HL8A 3CCJT 1K9MU 4J7IA 1Q81C 1JJ2S 3RKXA 1WPYA 5GANh 3GLXA 4HT8A 4LD9K 1VQ9A 1YJWT 2X4JA 2HQEA 3VV0A 4J5YA 3P8HA 3PIPA 5HK3A 4OB0B 1Q82C 3X25B 5L8RE 1G3WA 2QQRA 4JS4A 2DPPB 4JDSA 3CMAA 2ZPHB 1X01A 5FU7B 3OYLA 4N0AC 5AYFA 2LCCA 2R57A 2XU8A 2Y90A 3LLRA 4RCCA 5J3BA 3KUFA 4M7DG 3H6ZA 4HCZA 2RJFA 3N5BB 1OYXA 4PLIA 2KK4A 2L3RA 2LRQA 5CKBA 4BUGA 3CCVT 3H8ZA 4A4EA 4QQ6A 4C8QB 1I5LA 4PJOA 1KHIA 2YRVA 1WGSA 5IN1A 1YI2T 2D9TA 3OQ5A 1LNXA 1AHJB 2E10A 5C6SA 3HFOA 3JCMJ 1K73C 1WJQA 3L1AA 3PMTA 3VYHB 2JNGA 3L2RA 1YJNT 4IUVA 4XTZA 3QXEB 5CK9A 5GANg 1KC8C 1RL2A 2EJ9A 4FT4A 4UC4A 3O8VA 2QQ9A 1JRIA 2ZPBB 3PGGA 2G3RA 3V7RA 2DK3A 3JCMX 5A2QE 3CC2T 2L89A 4M75A 2QI2A 3MO8A 4PLLA 1M8VA 2GF7A 4M7DF 3VUBA 4KUDK 3JCMd 1FWZA 4RCBA 5CKDA 1VUBA 5GAOn 1N27A 2K2VA 3CCET 1KHCA 3KXTA 3AHUA 1B34A 1VQKT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKB A;  4ELZ C;  4ELY C;  3G7Z A;  4MZT A;  5CKH A;  1UB4 A;  5CQX A;  3JSC A;  5CCA A;  5CO7 A;  4HKE A;  3JRZ A;  4MDX A;  5CQY A;  5HK0 A;  1M1F A;  1X75 C;  3HPW A;  1NE8 A;  5CK9 A;  2C06 A;  3NFC A;  5CKF A;  5HKC A;  4ME7 A;  2MF2 A;  4OF1 A;  2KMT A;  5HK3 A;  3TCJ A;  4VUB A;  3VUB A;  4MZM A;  5CKD A;  1VUB A;  2VUB A;  5DLO A;  5CKE A;  5CR2 A;  4MZP A; 
#chains in the Genus database with same CATH topology
 1UEB A;  3HRS A;  1SHG A;  3NMZ C;  1NJI C;  3OYB A;  2RI2 A;  3CQT A;  1RAE B;  3X26 B;  4CI0 C;  4M7D D;  2I0N A;  1WXT A;  4BAC A;  1S72 Q;  1EIF A;  2DXU A;  2NYS A;  4MZM A;  2SEM A;  1G5V A;  1M1G A;  1WHM A;  3CCS A;  3PFS A;  2JS0 A;  3G7Z A;  3VYG A;  5GAN 4;  2E12 A;  4C0D C;  3MPU B;  3HSB A;  2LVM A;  4KUL A;  1VQ7 Q;  1WZO A;  1UGQ B;  2K5F A;  2MIO A;  3G6E A;  5KYW A;  1PRL C;  1RUW A;  4NL3 A;  4C8Q E;  1P92 A;  1YP5 A;  3CPF A;  4IIO A;  4NS5 A;  5LJ3 f;  1TUG B;  4E47 A;  1VQ5 Q;  3NGP A;  3DB4 A;  2A28 A;  4QVD A;  5LJ5 g;  1K9M R;  4HCB A;  3OS2 A;  2DRK A;  4IUR A;  4OMN A;  2E5Q A;  1PSE A;  3JB9 G;  2V8J A;  4Y92 A;  3VS7 A;  1TG0 A;  2DIG A;  2RHZ A;  3KFV A;  5GAO p;  3AT1 B;  4L5G A;  2RK2 A;  1LPL A;  1VQ9 T;  1Q81 U;  2DMO A;  1Q86 C;  1SHF A;  3VU3 C;  1Q82 U;  5LL6 S;  1GCP A;  1VIE A;  2JM9 A;  3L2V A;  5EC7 A;  1RAC B;  3CCU T;  1UGP B;  1F1B B;  1UFF A;  1RLP C;  2HL3 A;  3A8H B;  3OS5 A;  2NUP A;  2AIR B;  2KRN A;  2YHT A;  4GLM A;  2KSS A;  4M7A C;  2F5K A;  5KCH A;  2EAY A;  1K73 U;  5J39 A;  3M4G A;  2EYX A;  2R5A A;  4MDX A;  1SKU B;  5GAN 6;  1BIB A;  2ZZD A;  2CP3 A;  1NM7 A;  3RNJ A;  3U23 A;  4R0K A;  3OYA A;  1PNJ A;  1PD1 A;  3JAM E;  3GPL A;  3RES A;  2EYY A;  1ZA1 B;  2EIF A;  5GAN 3;  5CKE A;  1SSH A;  1D1C A;  2D8J A;  3A98 A;  2DZC A;  1QP2 A;  3CC4 A;  1NJI U;  2BZX A;  4OML A;  3JRZ A;  3EH2 A;  4M77 A;  4CRI A;  4M4Z A;  4M7D E;  2D0N A;  2YRD A;  1PKT A;  2RQR A;  1OX8 A;  3CCQ T;  1K0S A;  2A3L A;  3V8L A;  3OSV A;  2DBK A;  3J81 E;  2P0P A;  4QVC A;  5KCO A;  4M78 F;  1W6X A;  1QVF S;  1OPK A;  1M2V A;  1RAI B;  1VQL Q;  2YLB A;  3BE3 A;  3EH1 A;  3OYE A;  4O6J A;  3JB9 J;  5LJ5 h;  2CZ0 B;  4J9G A;  3JCM f;  2V26 A;  4FYV B;  4C92 F;  1BU1 A;  1SSF A;  2RI3 A;  2DTO A;  1Y07 A;  2CP2 A;  3QJ6 A;  2XDD A;  1Q86 U;  1GL5 A;  4PJO G;  1VQN A;  1N9R A;  2C06 A;  1KFZ A;  2DTH A;  1WXU A;  3GP8 A;  2RMO A;  5KYW B;  3GOX A;  5GMK i;  2KXD A;  1OUL A;  2A37 A;  3UAT A;  2EGA A;  2J6O A;  3M0Q A;  3OBY A;  3NTH A;  5GJV B;  1U5S A;  1Y71 A;  3VRY A;  4LUD A;  1YIJ Q;  1ZHI A;  2KAF A;  2NUT A;  1MGQ A;  3WVD B;  4IUQ A;  1QKX A;  2PVD B;  3BW1 A;  2CYZ B;  4KT0 E;  4HVW A;  4XU1 A;  4RTY A;  3EFR A;  3OYF A;  4F17 A;  2EWN A;  4E7S A;  2IG0 A;  5L23 A;  2BKD N;  5GAM g;  1OOT A;  4MZT A;  2KI7 A;  1NEB A;  2NUP B;  1Q7Y R;  2QEX A;  4M75 D;  3O5Z A;  1I81 A;  2RD1 A;  3OYJ A;  1D0X A;  1GBQ A;  4OF1 A;  2KMT A;  2M51 A;  3HRT A;  3CCS Q;  2QA4 A;  1Y0M A;  1W4S A;  5DY9 A;  5FWC A;  2KYM A;  4ELY C;  4R55 A;  2JZ2 A;  1QVP A;  3G6E Q;  1E7O A;  4QKU A;  3EFO A;  1WA7 A;  4M78 G;  1H64 1;  4XTW A;  4ZTF A;  4M77 B;  3MEA A;  1UGS B;  2BTT A;  5FW9 A;  2Y4X A;  5GMK l;  2D8H A;  1H3H A;  2MMP A;  2X4W A;  3CCU A;  5CR2 A;  5GAO r;  1RAB B;  4KBM B;  3JV3 A;  3R6O A;  2D1X A;  1MMN A;  4D8K A;  3MHX A;  1TUD A;  3OYG A;  3S3N A;  3M55 A;  2EQK A;  2BIV A;  5GAN j;  1K9M C;  1M2V B;  2KYB A;  4M7A D;  4GLK A;  2M1H A;  4JUV A;  4DEX A;  3M5A A;  3PIO A;  2XIC A;  1KG1 A;  2CGH A;  3S6W A;  3QG1 A;  1CKA A;  4PFZ A;  2EQI A;  4XU3 A;  2HDA A;  4J9C A;  2HBW A;  2DAQ A;  3CME T;  4C8Q C;  1UEC A;  2QG9 B;  2CZ7 B;  3URG A;  3H41 A;  1NPP A;  4OB1 B;  3EG9 A;  1I5O B;  5LJ3 d;  4FU6 A;  2CUD A;  3A1P A;  3FIF A;  2AK5 A;  1HK9 A;  1TH7 A;  1RAH B;  3CC4 Q;  3PNW C;  4E6R A;  1SRM A;  1KQS A;  3CCM T;  1ZBJ A;  4HA8 A;  1N8R R;  5CAI A;  5GAN 8;  4ZGJ B;  1GCQ C;  2LQN A;  3H9N A;  5CKH A;  5CQX A;  1PD0 A;  5A0G A;  3LWI A;  1WNL A;  1NZ9 A;  2VXE A;  2NUT B;  1KQS P;  3M9Q A;  1ZSG A;  3OYM A;  2HSP A;  4FCY A;  2QTX A;  1TSF A;  1JJ2 A;  4N4I A;  4Y28 E;  4ELZ C;  4OP0 A;  4PJM A;  1QCN A;  2B86 A;  1RAG B;  2LX7 A;  3QUI A;  2GQI A;  4JJN K;  1SG5 A;  3F70 A;  1R77 A;  4ESR A;  1JJ2 P;  3ZEH A;  1WYX A;  4VUB A;  3BDU A;  1QVG P;  4FYY B;  3CCV Q;  1S72 A;  1K76 A;  3GIB A;  2K3X A;  1GRI A;  4M7D C;  2CP5 A;  4BDY A;  1YWO A;  3CCJ T;  1K9M U;  3EFO B;  3RKX A;  4HT8 A;  2X4J A;  5HK3 A;  5L8R E;  1G3W A;  2DPP B;  2J6F A;  1X01 A;  4PJJ A;  5FU7 B;  3OYL A;  5IH2 A;  2Y90 A;  4RCC A;  2QTV A;  1OYX A;  2CUB A;  1SPK A;  2EBP A;  4BUG A;  2CP7 A;  1KD1 R;  4PJO A;  5IN1 A;  2YRV A;  1LNX A;  2E10 A;  3JCM J;  3EG2 A;  3L2R A;  2JNG A;  2P84 A;  5CK9 A;  2X9H A;  2EJ9 A;  4FT4 A;  4UC4 A;  2JXB A;  2ZPB B;  3CC2 T;  2DK3 A;  4WCI A;  4PLL A;  1NLP C;  4KUD K;  2P4R A;  3JCM d;  1FWZ A;  2DL3 A;  4RCB A;  1AWX A;  2K2V A;  3CCE T;  3KXT A;  1G83 A;  1IRE B;  1B34 A;  4FW2 A;  2LMJ A;  2DL7 A;  4HVU A;  1MND A;  5GMK m;  5KYU A;  4JJD A;  2K6D A;  3E9F A;  3Q1J A;  4F7U E;  4Q5W A;  2QA4 Q;  3EG9 B;  1B7T A;  1E6G A;  4EPC A;  2O9S A;  1OU8 A;  1BI2 A;  2H3E B;  3RBB B;  3S3O A;  6AT1 B;  1G3T A;  1OZ3 A;  4F16 A;  1VQ6 T;  1KQ1 A;  4C5I A;  1WX6 A;  2ATC B;  3FC3 A;  3V8J A;  5HK0 A;  4DQ2 A;  5D6X A;  3I9Q A;  4KGV B;  2VXF A;  2F5T X;  3MP8 A;  4J8O A;  3CCU Q;  2PZ1 A;  2JM8 A;  1M4Z A;  1QQJ A;  1AD5 A;  3S3M A;  1LJO A;  5GAN f;  5CO7 A;  2MYS A;  2DA9 A;  2M02 A;  4M78 A;  1JXM A;  2COZ A;  4WF2 A;  2DIL A;  2VB6 A;  1D09 B;  2DBM A;  2OX7 A;  4J9D A;  2IPO B;  2RK1 A;  3LYI A;  5KH6 A;  4EMK C;  5CKF A;  4ZTJ A;  2JTF A;  1N9S A;  4RTZ A;  5IHI A;  3QZ9 B;  4C8Q D;  1VQL A;  3FEO A;  3H0I A;  2DKG A;  3QPH A;  4DEY A;  4EIK A;  1XNI A;  2QAZ A;  3FRN A;  2CH4 W;  3E19 A;  5GAO m;  3UWN A;  5GAM j;  3GF5 A;  3CCM A;  1DJ7 B;  1UB4 A;  2EJG A;  3CBM A;  4C92 A;  1MHN A;  4N4G A;  3MP1 A;  3M4Y A;  3FDR A;  2QAS A;  2KQW A;  1N6A A;  3CCQ Q;  1BI0 A;  2FPF A;  1QVF A;  1G3Y A;  1PC0 A;  2RN8 A;  1QVG S;  4HCK A;  2CRE A;  4M7A G;  1FX7 A;  1LCK A;  3CC7 A;  4X1V A;  2P4T A;  3GNF B;  4MDW A;  2XDP A;  3X24 B;  2LQ8 A;  3HTR A;  2RJC A;  3V7C A;  4PJO B;  4LXC A;  2J7I A;  3PMI A;  2A08 A;  1YIJ A;  1HYO A;  5CIU A;  1N8R C;  3J7A F;  3CCL T;  2AT1 B;  2X3W D;  3JCM W;  2V8I A;  4HVV A;  3JCM P;  1Q7Y U;  2DYB A;  4MZP A;  1HXD A;  1B34 B;  4PFP A;  2L0A A;  4LDV A;  2FL7 A;  1KSW A;  2LX9 A;  3ZL7 C;  1PHT A;  1U1S A;  4ZN1 A;  3JB9 I;  5KYU B;  3SWN A;  1VQO T;  3CCJ A;  2L8D A;  1D1A A;  4C5H A;  2DO3 A;  4AFZ C;  3JCM e;  5IT9 E;  2WSE E;  2J06 A;  3M53 A;  1ZSZ A;  3REB B;  1VQM T;  4M75 C;  1VYU A;  2LQW A;  5I21 A;  2RI5 A;  4A63 B;  3MEW A;  3ULR B;  2YT6 A;  3OMG A;  2X4X A;  2OJ2 A;  2EJF A;  2KT1 A;  4JS5 A;  2A7Y A;  1YIT A;  4QQD A;  4LDY A;  4RMO A;  4J6W A;  2P0K A;  3NTK A;  1WHL A;  3CC2 A;  1B3Q A;  1WXB A;  2L5Q A;  3PVQ A;  3EG0 A;  1RI0 A;  3CBO A;  4PJO F;  5DM7 R;  1OU9 A;  3QWX X;  2W10 A;  2K7A A;  4M78 B;  5FU6 B;  1HD3 A;  1X2K A;  3CPW P;  4L59 A;  3CMA T;  1IZ6 A;  1OV3 A;  4Y91 A;  1U8R A;  1KD1 C;  5I2M A;  4LDX A;  3G71 T;  1JBM A;  1K1Z A;  5GAN 5;  5GAO q;  1ZUU A;  2GFU A;  1T0J A;  3QJY A;  2YRC A;  1VQ6 A;  1I0C A;  3RDV A;  1X6B A;  4C92 B;  1QWF A;  2DJQ A;  1CSK A;  1SEM A;  2CP0 A;  3QYH B;  3A8L B;  1N8R U;  4A4F A;  3FB9 A;  1GFD A;  2AZS A;  5EG2 A;  2EGE A;  1AZE A;  4FSX A;  1IO6 A;  4A53 A;  2R58 A;  2KRS A;  3OYC A;  3L2W A;  2O9V A;  1C0M A;  1M3C A;  3OMC A;  3JSC A;  4XAX B;  3VS0 A;  1VQ8 T;  3M54 A;  2EQU A;  5C0M A;  2V1R A;  3UDC A;  4BE0 A;  2MCN A;  3QDF A;  1NPR A;  1QWE A;  3HHT B;  4NOY A;  2O2O A;  4M78 E;  2RM4 A;  4A4G A;  2E41 A;  1VYV A;  2LQK A;  1WHK A;  4ZNX A;  3SD4 A;  5LJ3 g;  1VQ4 T;  3RER A;  2F2X A;  2DRM A;  2RHI A;  3LGF A;  3DLM A;  2I2L A;  1WHG A;  3X20 B;  3I56 T;  2NUZ A;  2YWW A;  3PVL A;  3ASK A;  1N5Z A;  4QVZ A;  3SWN B;  4C92 E;  5GAM f;  2RB6 A;  3CCM Q;  2MAM A;  2RQV A;  1JO8 A;  3ZBD A;  1UHF A;  3KBG A;  1ZSZ B;  1KIK A;  3EGU A;  4XK8 E;  2KXC A;  2OTL T;  1D3B B;  3EFS A;  3CCV A;  1FYN A;  2XG8 D;  2XKO C;  3VJP A;  2QYZ A;  1YJN A;  2DF6 A;  3CC7 Q;  1KD1 U;  4JRI A;  2FG0 A;  3M57 A;  3QWY A;  2FRY A;  1AT1 B;  2GFA A;  2L3S A;  1QCF A;  2DE0 X;  1T3S A;  3CD6 T;  4OB3 B;  2MI6 A;  3QKJ A;  1UJY A;  3RKW A;  2WSF E;  4BB7 A;  3REA B;  2HSE B;  2HNI A;  4J83 A;  2L3P A;  3JCM c;  2CS7 A;  2ECZ A;  2PU9 B;  2JN0 A;  2X51 A;  3VS3 A;  4E7Z A;  3BDL A;  1ABQ A;  4OB2 B;  3M59 A;  3OW2 P;  4M77 D;  2COY A;  1VQM A;  5CCA A;  4JJB A;  2DVJ A;  1A0N B;  3UA7 A;  5D6W A;  3VS6 A;  1X27 A;  2EYW A;  2K5I A;  3CCJ Q;  3CPW S;  4AFU C;  4BDZ A;  2M16 A;  3MCA B;  1M1K R;  5AT1 B;  2COW A;  4IUP A;  3WXM B;  1WFW A;  2A36 A;  4RKU E;  5GMK h;  1VQ5 T;  2PQW A;  1VYT A;  1UE9 A;  2AKK A;  2JS2 A;  5LJ3 h;  3D7S B;  2B8A A;  3I35 A;  3UT1 A;  1PM3 A;  1YIT Q;  2ESW A;  2E5K A;  3MEU A;  3SEM A;  3JCM g;  1AEY A;  1FMV A;  1NE8 A;  3CC2 Q;  1VQ9 A;  2HQE A;  4J9E A;  4J5Y A;  4OB0 B;  4JS4 A;  3CMA A;  2ZPH B;  4N0A C;  2LCC A;  1G8X A;  2R57 A;  1H8K A;  5J3B A;  4M7D G;  2RJF A;  4PLI A;  2L3R A;  3H8Z A;  2XMF A;  3OQ5 A;  5C6S A;  4Z89 A;  3SHW A;  3L1A A;  3VYH B;  2BZ8 A;  4XTZ A;  1RLQ C;  1K8A R;  1KC8 C;  5KYN A;  3V7R A;  3I5S A;  2VWF A;  3PGG A;  2HCK A;  2QI2 A;  2GF7 A;  2KRM A;  2YDL A;  1N27 A;  1VQ6 Q;  1KHC A;  1YNZ A;  1V76 A;  1VQK T;  4FT2 A;  4C0D B;  3C12 A;  2VGN A;  1WQW A;  2EKO A;  5IXB A;  2BE7 D;  4LNP A;  3INZ A;  2CZ1 B;  1BB9 A;  3UF4 A;  2FYK A;  3DB3 A;  4RTW A;  4IKF A;  4C5E A;  4ZGE B;  2J6K A;  3LX7 A;  2CSQ A;  3A8G B;  1BI3 A;  1X43 A;  3VS4 A;  4J9F A;  2M0O A;  3V7S A;  1YHQ T;  4DBH A;  4N4H A;  2QDL A;  4M77 E;  3CCQ A;  3MKD A;  2Y4Y A;  1YJ9 T;  3RR6 A;  2DLP A;  2LDM A;  3ER0 A;  2FVU A;  4J6X A;  4PNO A;  2OTJ T;  1FMW A;  2RQU A;  2JJ9 A;  1AWO A;  3NFC A;  3TEE A;  3UPU A;  1MMA A;  2AHJ B;  1WHJ A;  4X9D A;  1RAF B;  5GAN e;  5A0L A;  1WDX A;  2DM1 A;  5LJ5 j;  3JCM V;  2F69 A;  2VVK A;  1W2B P;  2P0Q A;  2F2V A;  4XTX A;  5HCK A;  4E7H A;  4AT1 B;  4RG2 A;  1QVG A;  1AZG B;  3JCM h;  3RUX A;  1OZ2 A;  2OTL A;  3TRE A;  2KR3 A;  4M75 F;  2Z0W A;  2VV5 A;  2RHX A;  1IGQ A;  4NL2 A;  3H0H A;  4PK4 A;  4O5V A;  4QW2 A;  3I55 T;  3OW2 S;  2NWM A;  4RTX A;  2MWO A;  4XQ3 A;  3ME9 A;  1M1F A;  1YJN Q;  3CD6 A;  2OI3 A;  3QHS A;  4J9H A;  4QT7 A;  4DBF A;  2GNC A;  1H3Z A;  3NHN A;  3JB9 D;  3OYK A;  3OY9 A;  1UG1 A;  1M2O A;  2DL5 A;  1X6O A;  1PG5 B;  1R0B G;  4B9X A;  4A4H A;  2FHD A;  4BI8 B;  3HKS A;  2ZPG B;  4ZGD B;  3MET A;  2VC8 A;  4CC3 A;  3OYD A;  1WLP B;  1G3S A;  2RO0 A;  4MML A;  4C92 C;  3HRU A;  1J3T A;  1ZLM A;  3NPF A;  2MF2 A;  4E7L A;  4M7A F;  5GMK j;  4YTL A;  3L2U A;  3CCS T;  2WSC E;  1VQM Q;  1OI1 A;  4LDW A;  4XU0 A;  5LJ3 j;  2DX1 A;  5CVI A;  1C1A A;  4HKE A;  3G6E T;  2E64 A;  3G1J A;  3EG1 A;  2RF0 A;  2E3H A;  3IQL A;  4F04 B;  2L2P A;  2FZK B;  1IGU A;  4FL6 A;  9ATC B;  3CCR T;  1GCQ A;  5FRO A;  1HJD A;  2QDY B;  2WAC A;  2VUB A;  2E6Z A;  3MJX A;  1UHC A;  1M1K C;  5KYY A;  3G4S T;  5FRN A;  1VQ9 Q;  4GBQ A;  1WQ7 A;  2FZG B;  3CMA Q;  4EDU A;  2O01 E;  4RG8 A;  1ZUY A;  2DEU A;  2NLU A;  2HQH A;  2XD0 A;  2E4H A;  3CXC P;  4M75 G;  3SWN C;  2CZ6 B;  2XHC A;  2K2M A;  1WJS A;  1Q95 G;  2QK0 A;  4PJL A;  1IXD A;  4C5G A;  1M5Q 1;  1K4U S;  2CH4 A;  1KQ2 A;  3GNG A;  3CME A;  4JRK A;  1I8F A;  4TVR A;  1U3O A;  2XI9 A;  1FMK A;  4L6V 5;  1D1B A;  2DL8 A;  1IHV A;  3M0S A;  2DJZ A;  4EMG A;  1YCY A;  3CC4 T;  2V8K A;  2CT3 A;  4PJO D;  2PVG B;  3T9N A;  1W2B S;  1YHQ A;  1T3L A;  1K8A C;  4FYX B;  1T0H A;  4PKC C;  2GBQ A;  5GAN 7;  4C0G A;  3HFN A;  1WJR A;  1ZBX A;  1O75 A;  3C94 A;  3FLG A;  2KEA A;  4OGE A;  3OYY A;  2LCL A;  2DET A;  1OX9 A;  1MV0 B;  2JUF A;  2RJD A;  1TXQ A;  1ZA2 B;  4JZ4 A;  1QMC A;  2MWP A;  2R5M A;  1Z9Z A;  2K5L A;  1BI1 A;  2HKN A;  4LUE A;  5LJ5 f;  1X6G A;  3DKM A;  2K4Y A;  3E1S A;  4JZ3 A;  2PNI A;  2ZPF B;  2YUO A;  5DLO A;  1WIE A;  4JRP A;  1M1K U;  1VQN T;  4WTO B;  3I55 A;  2OTL Q;  4AG1 C;  2QGF B;  2HD0 A;  2YUN A;  3BFM A;  4JLG A;  3M0R A;  5GAM e;  2DVE A;  2RHY A;  2JT4 A;  3EG3 A;  4M77 C;  5J26 A;  5D6Y A;  1JQQ A;  4M78 D;  2KDS A;  3ZFJ A;  4II1 A;  1TS9 A;  1MMD A;  1K0X A;  4F7U G;  2MPX C;  4XTY A;  1VQP T;  2RHU A;  1H92 A;  3CD6 Q;  1D3B A;  1QW1 A;  1X75 C;  5KYY B;  4RUG A;  3JCM b;  3EGX B;  1BIA A;  3C95 A;  4AFS C;  1JEG A;  4ZN3 A;  4PJO E;  2LNV A;  1PWT A;  3CPW A;  1KC8 R;  4C92 D;  1AWJ A;  1WI7 A;  5CQY A;  1K8A U;  4QQG A;  1M90 R;  2JOY A;  5FLX E;  1KK7 A;  3CCE A;  2QEX T;  4EMK A;  4BE1 A;  5D7U A;  4BY6 B;  4OMP A;  1QLY A;  3OYH A;  3MEV A;  4FW1 A;  2QA4 T;  3CXC S;  4OMQ A;  1MUZ A;  1FXX A;  1U1T A;  4C8Q F;  2V1Q A;  5FRM A;  3NTI A;  3L42 A;  2HQX A;  3CCR A;  4OMO A;  4M7D B;  4HXJ A;  1UTI A;  2C0O A;  2ABL A;  4EMH A;  2ROT A;  2PVO B;  4J7F A;  3QII A;  4R56 A;  1YFN A;  3TSZ A;  1YWP A;  2MOX A;  3G4S A;  2RJE A;  1LOJ A;  2H3J A;  4DOW A;  2K3Y A;  2KRO A;  3A5Z B;  1ZUK A;  1M3B A;  1JXO A;  3WVE B;  5KE3 A;  4F14 A;  5IHN A;  2M9U A;  2EPD A;  2ZCF B;  3X28 B;  2XK0 A;  3VS5 A;  4E7J A;  4DOV A;  3RIR A;  4JPB W;  2EVR A;  1EFN A;  4AFQ C;  2K3B A;  1BYM A;  2X35 A;  2KNB B;  1NG2 A;  2QQS A;  4RTT A;  5A0D A;  3TU4 K;  3HL8 A;  2BZY A;  4CC4 B;  2X3X D;  1WPY A;  5GAN h;  4LD9 K;  1YJW T;  3P8H A;  3PIP A;  1PCX A;  4JDS A;  1VQK Q;  1TU0 B;  3H6Z A;  4HCZ A;  3N5B B;  2KK4 A;  2LRQ A;  1CKB A;  1YI2 T;  1WGS A;  3CME Q;  1AHJ B;  2AZV A;  1RL2 A;  1JU5 C;  1NBE B;  2QQ9 A;  1JRI A;  4RTU A;  2L89 A;  4M75 A;  2VAS A;  4M7D F;  1YHQ Q;  3VUB A;  3VS2 A;  1YJ9 Q;  1PKS A;  3AHU A;  2A0F B;  5FU7 C;  1VIF A;  3EGD A;  1TOV A;  1OPL A;  5KYX A;  2OTJ Q;  1PRM C;  2CSI A;  2X4Y A;  1M9S A;  3SDZ A;  2E1H A;  4E7I A;  1Y96 A;  2RQT A;  1D0Z A;  4OMM A;  4BD3 A;  1GXI E;  2HKQ B;  2DFU A;  2EYZ A;  3OB9 A;  4FSS A;  2CP6 A;  4FYW B;  2HMA A;  3CCL A;  1U06 A;  2DXT A;  5GAN d;  3JCM Q;  5M9O A;  2F2W A;  4C8Q G;  1BCM A;  1NEG A;  3H0F A;  2DER A;  2CKK A;  4EMK B;  1UUE A;  2JVV A;  2ZPI B;  2GTO A;  3OW2 A;  4KGX B;  2OAU A;  3L2Q A;  1X2Q A;  2FO0 A;  2EKH A;  4A4K A;  2VYT A;  1VQO A;  1S72 T;  4M7A A;  2KGT A;  3I55 Q;  1BK2 A;  5HY6 A;  2DXC A;  3C0C A;  2EYQ A;  3J80 E;  1E6H A;  4Z8A A;  2LCS A;  1VQP A;  3THK A;  1VQ7 T;  2GCX A;  7AT1 B;  3E2U A;  2ZPE B;  2D0Q B;  4FIB A;  2QGG A;  1B07 A;  4IIM A;  1R8O B;  4AG2 C;  2PUO B;  4GY5 A;  1ZQ1 A;  5KE2 A;  2ED1 A;  3LW5 E;  1YCS B;  1KJW A;  2F1L A;  1I1J A;  2O88 A;  2RA2 A;  2K57 A;  4LD6 A;  5GAN 2;  2EGC A;  3OYN A;  8AT1 B;  2DD5 A;  3OBW A;  4XTV A;  1BKB A;  5LJ5 d;  1XQH A;  5IHK A;  4DBQ A;  5I22 A;  3C4S A;  1ZX6 A;  4C0Z A;  1O9S A;  3LWH A;  3DLL A;  3BY7 A;  2ENM A;  2LJ3 A;  5FWB A;  3CCE Q;  4F7U A;  4OMF B;  3G71 A;  4X9C A;  2E65 A;  1S1N A;  3A8M B;  1AWW A;  4JLI A;  1NYG A;  2LC4 A;  4PJN A;  4KGZ B;  3CEY A;  4LDU A;  3A8O B;  2YLC A;  2QQA A;  4K11 A;  3CCR Q;  3MP6 A;  1M3A A;  4LN2 A;  1M90 C;  4M75 B;  3SFM A;  1XTD A;  1IRX A;  2DTI A;  1ABO A;  3SB2 A;  1K9A A;  3G4S Q;  3EGD B;  4HCC A;  4C92 G;  1D0Y A;  2RPN A;  4ATO A;  2CDT A;  2BUD A;  5KYX B;  2LT1 A;  1VQ8 A;  4PJO C;  1C6V X;  1UDL A;  1PSF A;  3QYG B;  1V29 B;  1Y7X A;  2EQM A;  1YJW A;  1Q81 R;  1Y96 B;  4PFO A;  1MV3 A;  4B9W A;  1MNE A;  1BBZ A;  3LH5 A;  1Q82 R;  1QP3 A;  2QXF A;  2E70 A;  1VQ4 A;  8ATC B;  4BE2 A;  2LP5 A;  1BCO A;  4P5N A;  4OGC A;  1YI2 A;  2KY9 A;  1W2B A;  2YUQ A;  1VQL T;  2G6F X;  5I2S A;  1G2B A;  1SRL A;  2EW3 A;  1K73 R;  2CT4 A;  2ROL A;  2MK5 A;  3I56 A;  1I4K 1;  3P8D A;  4Z02 A;  4MMK A;  3HP9 A;  4M7A B;  4C0F A;  2L3Q A;  5GAM h;  3PTA A;  2C0T A;  4M77 F;  2JTM A;  2GQV A;  4M75 E;  3QO3 A;  2HZY A;  3TVT A;  3LH0 A;  2FEI A;  2RQW A;  3P8B B;  1OEB A;  2KVQ G;  2OAW A;  4ORZ A;  5GAO l;  1NJI R;  2O4X A;  2DEQ A;  2FRW A;  3FJP A;  2J05 A;  4ME7 A;  2RH2 A;  3OS0 A;  3CC7 T;  3TCJ A;  3UA6 A;  2DL4 A;  2KBT A;  4D8D A;  2DYI A;  2IVW A;  2DZ9 A;  3L2Z A;  1MMG A;  1X69 A;  2JTE A;  4BI4 A;  1TWB A;  3PT9 A;  3V8K A;  1YIJ T;  1QKW A;  1ARK A;  1KC8 U;  4BY6 C;  4KRT A;  1RAA B;  3M0U A;  4D6W A;  4N0A A;  2D6F A;  1I07 A;  4M78 C;  5FU6 C;  1M90 U;  3E9G A;  2C0I A;  4XU2 A;  3RMQ A;  3CCL Q;  1YBY A;  1V1C A;  1NYF A;  1UJ0 A;  2HL5 C;  3JB9 H;  1VQN Q;  5I11 A;  1JB0 E;  1IB8 A;  4F7U B;  2XID A;  4FM4 B;  5LJ5 e;  1UGR B;  1M8M A;  1RI9 A;  4M7A E;  2GGR A;  4LE9 A;  2DXB A;  1VQO Q;  1VQ7 A;  4CC2 A;  2ZGW A;  1IHW A;  5GAM d;  3M56 A;  1Q86 R;  5ECA A;  2LJ1 A;  3RKY A;  2PUK B;  2DIQ A;  3QDR B;  2HAX A;  1VQ5 A;  4C8Q A;  2E6N A;  3M0T A;  1VQP Q;  4X34 A;  1VOM A;  3PE0 A;  4DBR A;  2FB7 A;  5GJW B;  2JMA A;  2H8H A;  2RNA A;  3CBP A;  1YIT T;  5DLQ E;  1QCO A;  3EHQ A;  4E2F B;  1SF9 A;  2FZC B;  3EHR A;  2PTK A;  4IUT A;  5HKC A;  4BI3 A;  1M30 A;  3TSW A;  2EFI A;  1XOV A;  4B6M A;  4PL6 A;  4J9I A;  3M0P A;  2EQJ A;  1EZZ B;  2LJ0 A;  4HT9 A;  3VRZ A;  2QEX Q;  5IAY A;  2QQB A;  1TTH B;  3CXC A;  2DNU A;  4KUI A;  2O31 A;  1Y57 A;  3OS1 A;  3VKI A;  4M77 G;  3RMS A;  4J6Y A;  4Z88 A;  1NLO C;  3EGX A;  1OQK A;  3M58 A;  4A54 A;  3OYI A;  2GTJ A;  2VGM A;  2K9G A;  5IXF A;  3G71 Q;  4CC7 A;  4F7U F;  1GBR A;  2FPD A;  2W0Z A;  1Q7Y C;  2E3I A;  5GMK e;  2BE9 B;  1ZSZ C;  1VQK A;  3OSS C;  2LT4 A;  5LJ3 e;  1YN8 A;  1ACM B;  2K79 A;  4DA4 A;  2LNH B;  1XJW B;  4KH1 B;  1TUC A;  2VKN A;  1UGV A;  2O4X B;  3R6N A;  3VUZ A;  3QBY A;  3QSU A;  4M7D A;  4V2S A;  2KT8 A;  1VQ8 Q;  3OA6 A;  1YJ9 A;  3EAE A;  2LTO A;  2YSQ A;  3VS1 A;  4JRQ A;  1W70 A;  2KE9 A;  1KQS S;  2YUP A;  2HBP A;  1YJW Q;  2ZAE A;  4E7K A;  1AOJ A;  2OTJ A;  3JB9 F;  1EX4 A;  4JJC A;  1WHH A;  2HEQ A;  1M27 C;  2IIM A;  4XTU A;  4IUU A;  1GFC A;  1VQ4 Q;  1LVK A;  3QZ5 B;  3LGL A;  2LZ6 B;  4ANJ A;  1YI2 Q;  2DD4 A;  2JW4 A;  4OVA A;  2XDB A;  3TQ7 P;  3HPW A;  3GBQ A;  4J7I A;  1Q81 C;  1JJ2 S;  2SRC A;  3I56 Q;  3GLX A;  3VV0 A;  3FJ5 A;  1RAD B;  1Q82 C;  4AMC A;  2M0Y A;  3X25 B;  2QQR A;  2AKL A;  4J9B A;  5AYF A;  2XU8 A;  1HSQ A;  3LLR A;  3KUF A;  1AVZ C;  5CKB A;  3CCV T;  4A4E A;  4QQ6 A;  4C8Q B;  1I5L A;  1KHI A;  1VA7 A;  2D9T A;  1QVF P;  3HFO A;  1K73 C;  1WJQ A;  3PMT A;  2ED0 A;  1YJN T;  4IUV A;  3QXE B;  2JMC A;  5GAN g;  1Z9Q A;  2FPE A;  1W1F A;  3O8V A;  1R0C B;  2G3R A;  5A2Q E;  3JCM X;  4KH0 B;  3MO8 A;  1M8V A;  3I5R A;  5CKD A;  1VUB A;  5GAO n;  4RTV A;  2YXY A; 
#chains in the Genus database with same CATH homology
 5FU7 C;  1VIF A;  1UEB A;  3C12 A;  3HRS A;  2VGN A;  4FT2 A;  4C0D B;  1WQW A;  2EKO A;  1NJI C;  3INZ A;  3OYB A;  2CZ1 B;  2RI2 A;  5GMK m;  2FYK A;  3DB3 A;  2X4Y A;  1M9S A;  1IRE B;  3E9F A;  3X26 B;  3Q1J A;  4IKF A;  4C5E A;  4CI0 C;  3SDZ A;  2E1H A;  4F7U E;  4E7I A;  4Q5W A;  4ZGE B;  4M7D D;  3LX7 A;  1Y96 A;  4BAC A;  3A8G B;  4EPC A;  1BI3 A;  1EIF A;  2DXU A;  4BD3 A;  1GXI E;  1BI2 A;  2M0O A;  4MZM A;  3V7S A;  1YHQ T;  4N4H A;  3S3O A;  3OB9 A;  4M77 E;  3CCQ A;  1G5V A;  1M1G A;  2Y4Y A;  1YJ9 T;  3CCL A;  1OZ3 A;  1G3T A;  2DXT A;  5GAN d;  1VQ6 T;  3CCS A;  3PFS A;  3JCM Q;  5M9O A;  1KQ1 A;  2LDM A;  3G7Z A;  3VYG A;  4C8Q G;  4C5I A;  3FC3 A;  5GAN 4;  3ER0 A;  2E12 A;  4C0D C;  2FVU A;  2LVM A;  2CKK A;  3V8J A;  4KUL A;  3HSB A;  5HK0 A;  1UGQ B;  2K5F A;  4DQ2 A;  4J6X A;  2JVV A;  2ZPI B;  4PNO A;  5D6X A;  4EMK B;  2OTJ T;  3OW2 A;  3G6E A;  3NFC A;  2OAU A;  3TEE A;  3UPU A;  2VXF A;  4NL3 A;  4C8Q E;  2F5T X;  3MP8 A;  1P92 A;  4NS5 A;  3CPF A;  3L2Q A;  2AHJ B;  5LJ3 f;  4E47 A;  4J8O A;  4A4K A;  2VYT A;  3DB4 A;  4X9D A;  1VQO A;  4QVD A;  5GAN e;  5A0L A;  5LJ5 g;  1S72 T;  4M7A A;  5KCH A;  4HCB A;  1M4Z A;  3OS2 A;  5LJ5 j;  3JCM V;  4IUR A;  2F69 A;  5HY6 A;  2E5Q A;  1PSE A;  3JB9 G;  2V8J A;  2DXC A;  2P0Q A;  2EYQ A;  2DIG A;  2RHZ A;  1LJO A;  3S3M A;  4XTX A;  5GAN f;  3J80 E;  5GAO p;  5CO7 A;  4M78 A;  4L5G A;  2RK2 A;  4E7H A;  4RG2 A;  1VQP A;  1QVG A;  4WF2 A;  1VQ9 T;  1Q81 U;  3JCM h;  3RUX A;  2GCX A;  1Q86 C;  1VQ7 T;  1OZ2 A;  2OTL A;  3TRE A;  2RK1 A;  3LYI A;  5KH6 A;  2ZPE B;  4EMK C;  5CKF A;  4M75 F;  2D0Q B;  4FIB A;  2JTF A;  3VU3 C;  4ZTJ A;  1Q82 U;  1N9S A;  5LL6 S;  1VIE A;  3QZ9 B;  3L2V A;  4C8Q D;  2VV5 A;  3FEO A;  1VQL A;  1R8O B;  2DKG A;  2RHX A;  1UGP B;  3QPH A;  3CCU T;  4NL2 A;  1XNI A;  4O5V A;  2PUO B;  4QW2 A;  3FRN A;  1ZQ1 A;  3A8H B;  3OS5 A;  4GY5 A;  3E19 A;  5KE2 A;  3I55 T;  3OW2 S;  3LW5 E;  5GAO m;  2YHT A;  3UWN A;  2MWO A;  5GAM j;  2KSS A;  3GF5 A;  3CCM A;  4M7A C;  2RA2 A;  1DJ7 B;  1UB4 A;  2EJG A;  2F5K A;  2K57 A;  1MHN A;  3CBM A;  3ME9 A;  4LD6 A;  4XQ3 A;  2EAY A;  4N4G A;  4C92 A;  5J39 A;  3M4G A;  2DD5 A;  3M4Y A;  3MP1 A;  3OBW A;  2R5A A;  4XTV A;  4MDX A;  1M1F A;  1BKB A;  3FDR A;  5LJ5 d;  1XQH A;  3CD6 A;  5GAN 6;  1BIB A;  2ZZD A;  3QHS A;  3C4S A;  5GAN 2;  2KQW A;  3OYA A;  1H3Z A;  4C0Z A;  1N6A A;  3JAM E;  3OYN A;  3JB9 D;  1O9S A;  1BI0 A;  3OYK A;  3LWH A;  3GPL A;  3DLL A;  1QVF A;  1G3Y A;  3RES A;  3BY7 A;  3OY9 A;  2EIF A;  1QVG S;  5GAN 3;  5CKE A;  1FX7 A;  3CC7 A;  4M7A G;  4F7U A;  1X6O A;  4OMF B;  2P4T A;  3GNF B;  4MDW A;  2XDP A;  3X24 B;  3G71 A;  2DZC A;  4X9C A;  2E65 A;  1QP2 A;  4A4H A;  2FHD A;  2LQ8 A;  4B9X A;  3HKS A;  4BI8 B;  1NJI U;  3CC4 A;  2ZPG B;  3A8M B;  4ZGD B;  3MET A;  2VC8 A;  4JLI A;  3JRZ A;  2RJC A;  4M77 A;  3V7C A;  4PJO B;  2LC4 A;  3OYD A;  4CRI A;  1G3S A;  4M7D E;  2RO0 A;  4MML A;  4C92 C;  3HRU A;  3PMI A;  3CEY A;  4LDU A;  3A8O B;  1YIJ A;  2YLC A;  2MF2 A;  2QQA A;  5CIU A;  3CCQ T;  4E7L A;  1N8R C;  3J7A F;  5GMK j;  3MP6 A;  4M7A F;  4YTL A;  3CCL T;  2A3L A;  3V8L A;  3L2U A;  1M90 C;  3CCS T;  2WSC E;  3JCM W;  4M75 B;  3OSV A;  3SFM A;  2V8I A;  1OI1 A;  1XTD A;  3J81 E;  2P0P A;  4LDW A;  2DTI A;  3JCM P;  1Q7Y U;  4QVC A;  5KCO A;  4XU0 A;  5LJ3 j;  4MZP A;  4M78 F;  1HXD A;  3SB2 A;  1B34 B;  5CVI A;  4LDV A;  2FL7 A;  4HKE A;  3G6E T;  2E64 A;  4C92 G;  4HCC A;  1QVF S;  4ATO A;  2LX9 A;  2BUD A;  1U1S A;  2LT1 A;  1VQ8 A;  4ZN1 A;  3JB9 I;  2YLB A;  4PJO C;  3SWN A;  1VQO T;  3CCJ A;  1PSF A;  2L8D A;  3QYG B;  4C5H A;  1V29 B;  2DO3 A;  4FL6 A;  1Y7X A;  3JCM e;  5IT9 E;  3OYE A;  3CCR T;  2WSE E;  2EQM A;  1YJW A;  5FRO A;  1Y96 B;  2QDY B;  2WAC A;  3M53 A;  4O6J A;  2VUB A;  2E6Z A;  3JB9 J;  4B9W A;  5LJ5 h;  2CZ0 B;  1VQM T;  3JCM f;  4C92 F;  4M75 C;  5I21 A;  1QP3 A;  2QXF A;  2E70 A;  2RI5 A;  1SSF A;  2RI3 A;  1M1K C;  2DTO A;  1VQ4 A;  3MEW A;  1Y07 A;  4BE2 A;  2XDD A;  3QJ6 A;  1Q86 U;  3G4S T;  5FRN A;  4PJO G;  4P5N A;  4OGC A;  3OMG A;  1VQN A;  2X4X A;  1N9R A;  2EJF A;  1YI2 A;  1WQ7 A;  2C06 A;  2KY9 A;  1W2B A;  4JS5 A;  2A7Y A;  2DTH A;  4QQD A;  1YIT A;  4LDY A;  1VQL T;  3GP8 A;  5I2S A;  4EDU A;  2O01 E;  4RG8 A;  4RMO A;  2NLU A;  4J6W A;  2XD0 A;  2P0K A;  3GOX A;  5GMK i;  3I56 A;  3NTK A;  1I4K 1;  4M75 G;  3SWN C;  2CZ6 B;  3CC2 A;  3P8D A;  4Z02 A;  4MMK A;  2L5Q A;  3HP9 A;  2XHC A;  3OBY A;  4M7A B;  4C0F A;  1RI0 A;  1WJS A;  3CBO A;  3NTH A;  4PJO F;  5DM7 R;  5GAM h;  3PTA A;  4M77 F;  2JTM A;  2GQV A;  1Y71 A;  4M75 E;  3QO3 A;  3LH0 A;  4C5G A;  1M5Q 1;  1ZHI A;  2KAF A;  3P8B B;  4M78 B;  5FU6 B;  2KVQ G;  5GAO l;  1KQ2 A;  1MGQ A;  4L59 A;  3GNG A;  3CME A;  4JRK A;  1I8F A;  2O4X A;  4TVR A;  2DEQ A;  3FJP A;  2PVD B;  3BW1 A;  4IUQ A;  4ME7 A;  2CYZ B;  3CMA T;  2XI9 A;  2RH2 A;  4KT0 E;  4L6V 5;  3OS0 A;  3CC7 T;  4XU1 A;  3TCJ A;  1IZ6 A;  3EFR A;  4Y91 A;  1U8R A;  3OYF A;  1KD1 C;  2DJZ A;  5I2M A;  4EMG A;  3G71 T;  1YCY A;  4LDX A;  2EWN A;  2IVW A;  3CC4 T;  1JBM A;  2DZ9 A;  3L2Z A;  2V8K A;  4PJO D;  2IG0 A;  2PVG B;  3T9N A;  1W2B S;  2BKD N;  5GAN 5;  5GAO q;  4BI4 A;  1YHQ A;  2GFU A;  5GAM g;  3QJY A;  1K8A C;  4MZT A;  3PT9 A;  4PKC C;  5GAN 7;  1VQ6 A;  4C0G A;  3V8K A;  3HFN A;  4C92 B;  1YIJ T;  2QEX A;  1WJR A;  1ZBX A;  4M75 D;  1KC8 U;  1O75 A;  1I81 A;  4BY6 C;  3QYH B;  4D6W A;  4N0A A;  2D6F A;  3A8L B;  3C94 A;  4M78 C;  2RD1 A;  5FU6 C;  3OYJ A;  1N8R U;  4A4F A;  3FLG A;  3FB9 A;  4OF1 A;  2KMT A;  4OGE A;  1M90 U;  3E9G A;  3HRT A;  4XU2 A;  3RMQ A;  1YBY A;  3OYY A;  2LCL A;  2QA4 A;  5EG2 A;  1W4S A;  5DY9 A;  3JB9 H;  4FSX A;  1JB0 E;  2R58 A;  4A53 A;  3OYC A;  4F7U B;  2JUF A;  2RJD A;  2XID A;  4ELY C;  3OMC A;  4XAX B;  2JZ2 A;  3JSC A;  4FM4 B;  4R55 A;  3L2W A;  3M54 A;  1VQ8 T;  1QVP A;  2EQU A;  5LJ5 e;  5C0M A;  1UGR B;  2MWP A;  2R5M A;  2K5L A;  4M78 G;  4M7A E;  1BI1 A;  3UDC A;  4BE0 A;  1H64 1;  4XTW A;  4ZTF A;  4M77 B;  2DXB A;  3MEA A;  5LJ5 f;  1VQ7 A;  1UGS B;  2ZGW A;  3DKM A;  5GAM d;  3M56 A;  1NPR A;  3HHT B;  4NOY A;  2K4Y A;  2Y4X A;  3E1S A;  4M78 E;  2RM4 A;  5GMK l;  3RKY A;  2ZPF B;  4A4G A;  2E41 A;  2PUK B;  3WVD B;  2LQK A;  5DLO A;  2MMP A;  2X4W A;  2DIQ A;  3QDR B;  5LJ3 g;  3SD4 A;  3CCU A;  4JRP A;  1VQ4 T;  5CR2 A;  5GAO r;  4C8Q A;  2E6N A;  4KBM B;  1VQ5 A;  2HAX A;  4X34 A;  3RER A;  1M1K U;  1VQN T;  2FB7 A;  3LGF A;  2RHI A;  3CBP A;  3R6O A;  3I55 A;  3DLM A;  2HD0 A;  2I2L A;  5DLQ E;  1YIT T;  3BFM A;  3MHX A;  4JLG A;  5GAM e;  3X20 B;  3OYG A;  3S3N A;  3M55 A;  2DVE A;  2EQK A;  2RHY A;  2BIV A;  5GAN j;  1K9M C;  4IUT A;  3I56 T;  4M7A D;  4GLK A;  5HKC A;  2M1H A;  3ASK A;  4M77 C;  4JUV A;  4BI3 A;  5J26 A;  4QVZ A;  3SWN B;  4C92 E;  5GAM f;  3M5A A;  3PIO A;  2XIC A;  2EFI A;  1XOV A;  2RB6 A;  4PL6 A;  1KG1 A;  2CGH A;  5D6Y A;  2MAM A;  3S6W A;  2EQJ A;  3QG1 A;  2KDS A;  4M78 D;  3ZBD A;  3ZFJ A;  4II1 A;  4XU3 A;  4HT9 A;  3KBG A;  4F7U G;  4XTY A;  5IAY A;  2RHU A;  2QQB A;  1VQP T;  1D3B A;  4XK8 E;  3CXC A;  2DAQ A;  2OTL T;  1D3B B;  3EFS A;  4KUI A;  3CME T;  4C8Q C;  3CCV A;  1QW1 A;  1X75 C;  2XG8 D;  3OS1 A;  2CZ7 B;  3URG A;  3VKI A;  4M77 G;  1NPP A;  4OB1 B;  3RMS A;  2XKO C;  4J6Y A;  3VJP A;  5LJ3 d;  4FU6 A;  3JCM b;  3FIF A;  3M58 A;  1YJN A;  4A54 A;  1BIA A;  3OYI A;  1HK9 A;  1TH7 A;  3C95 A;  4JRI A;  1KD1 U;  3M57 A;  4ZN3 A;  4PJO E;  2GFA A;  2VGM A;  2LNV A;  4F7U F;  3PNW C;  3CPW A;  4C92 D;  1KQS A;  3CCM T;  1Q7Y C;  5CQY A;  4HA8 A;  5GMK e;  1K8A U;  5CAI A;  4QQG A;  5GAN 8;  4ZGJ B;  2JOY A;  5CKH A;  5FLX E;  5CQX A;  3CCE A;  2QEX T;  4EMK A;  3CD6 T;  4OB3 B;  2MI6 A;  4BE1 A;  1VQK A;  3QKJ A;  3OSS C;  2LT4 A;  5A0G A;  5LJ3 e;  4BY6 B;  3LWI A;  3RKW A;  2WSF E;  4DA4 A;  4BB7 A;  3OYH A;  1WNL A;  1NZ9 A;  2VXE A;  3MEV A;  3M9Q A;  2HNI A;  2QA4 T;  4J83 A;  3OYM A;  3JCM c;  2CS7 A;  2O4X B;  3CXC S;  2PU9 B;  2JN0 A;  2QTX A;  3VUZ A;  3QBY A;  1FXX A;  1U1T A;  3BDL A;  4OB2 B;  4C8Q F;  3QSU A;  5FRM A;  3NTI A;  3L42 A;  2HQX A;  3CCR A;  1JJ2 A;  4M7D A;  4V2S A;  4N4I A;  4Y28 E;  3M59 A;  4M7D B;  4M77 D;  4ELZ C;  4OP0 A;  1VQM A;  5CCA A;  3OA6 A;  1YJ9 A;  3EAE A;  2LTO A;  5D6W A;  4JRQ A;  3QUI A;  4EMH A;  4JJN K;  2PVO B;  2K5I A;  4J7F A;  3F70 A;  3QII A;  4R56 A;  3CPW S;  4BDZ A;  1KQS S;  2M16 A;  3MCA B;  3G4S A;  2HBP A;  2RJE A;  1LOJ A;  4IUP A;  3ZEH A;  4E7K A;  2H3J A;  3WXM B;  4DOW A;  2K3Y A;  2OTJ A;  3A5Z B;  4RKU E;  3JB9 F;  3WVE B;  4VUB A;  5KE3 A;  5GMK h;  1VQ5 T;  2M9U A;  2PQW A;  4XTU A;  3BDU A;  4IUU A;  2ZCF B;  3X28 B;  2XK0 A;  4E7J A;  3QZ5 B;  1S72 A;  3LGL A;  5LJ3 h;  4DOV A;  3RIR A;  3GIB A;  2B8A A;  1K73 U;  2DD4 A;  2K3X A;  3UT1 A;  4M7D C;  4OVA A;  2XDB A;  3MEU A;  3JCM g;  1BYM A;  2X35 A;  2QQS A;  5A0D A;  4BDY A;  3HPW A;  1NE8 A;  3TU4 K;  3HL8 A;  3CCJ T;  1K9M U;  4J7I A;  1Q81 C;  1JJ2 S;  3RKX A;  1WPY A;  5GAN h;  3GLX A;  4HT8 A;  4LD9 K;  1VQ9 A;  1YJW T;  2X4J A;  2HQE A;  3VV0 A;  4J5Y A;  3P8H A;  3PIP A;  5HK3 A;  4OB0 B;  1Q82 C;  3X25 B;  5L8R E;  1G3W A;  2QQR A;  4JS4 A;  2DPP B;  4JDS A;  3CMA A;  2ZPH B;  1X01 A;  5FU7 B;  3OYL A;  4N0A C;  5AYF A;  2LCC A;  2R57 A;  2XU8 A;  2Y90 A;  3LLR A;  4RCC A;  5J3B A;  3KUF A;  4M7D G;  3H6Z A;  4HCZ A;  2RJF A;  3N5B B;  1OYX A;  4PLI A;  2KK4 A;  2L3R A;  2LRQ A;  5CKB A;  4BUG A;  3CCV T;  3H8Z A;  4A4E A;  4QQ6 A;  4C8Q B;  1I5L A;  4PJO A;  1KHI A;  2YRV A;  1WGS A;  5IN1 A;  1YI2 T;  2D9T A;  3OQ5 A;  1LNX A;  1AHJ B;  2E10 A;  5C6S A;  3HFO A;  3JCM J;  1K73 C;  1WJQ A;  3L1A A;  3PMT A;  3VYH B;  2JNG A;  3L2R A;  1YJN T;  4IUV A;  4XTZ A;  3QXE B;  5CK9 A;  5GAN g;  1KC8 C;  1RL2 A;  2EJ9 A;  4FT4 A;  4UC4 A;  3O8V A;  2QQ9 A;  1JRI A;  2ZPB B;  3PGG A;  2G3R A;  3V7R A;  2DK3 A;  3JCM X;  5A2Q E;  3CC2 T;  2L89 A;  4M75 A;  2QI2 A;  3MO8 A;  4PLL A;  1M8V A;  2GF7 A;  4M7D F;  3VUB A;  4KUD K;  3JCM d;  1FWZ A;  4RCB A;  5CKD A;  1VUB A;  5GAO n;  1N27 A;  2K2V A;  3CCE T;  1KHC A;  3KXT A;  3AHU A;  1B34 A;  1VQK T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...