3VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCDB
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ccdb
total genus 28
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vubA00
3HPWA 5CKFA 4ELZC 5CQXA 3JSCA 3JRZA 3TCJA 3G7ZA 2VUBA 5CKDA 3NFCA 4ME7A 5CKHA 4MZPA 5CR2A 1NE8A 5CKBA 5HKCA 5DLOA 2KMTA 4VUBA 2C06A 5CQYA 5CK9A 1VUBA 5HK0A 3VUBA 4ELYC 2MF2A 4HKEA 5CO7A 5CCAA 1M1FA 4OF1A 4MZTA 5HK3A 4MDXA 5CKEA 1UB4A 1X75C 4MZMA
chains in the Genus database with same CATH superfamily
2K2MA 1UJ0A 2RJCA 1RL2A 2FPDA 2L3PA 3CMAA 4F7UG 2EBPA 4V2SA 2ZPGB 5A0DA 2D1XA 2DL8A 1VUBA 1KSWA 2X9HA 2J7IA 2HEQA 3OB9A 3VS2A 2DXTA 3OYDA 1C6VX 1WPYA 3ASKA 3JCMf 3CC4A 1UUEA 1TSFA 4FW1A 2A0FB 5KYXA 3QKJA 2VB6A 5A0GA 5L8RE 1X2QA 4HA8A 1VQMA 1V76A 3V8KA 4OB2B 2FRWA 2LP5A 3I5RA 3JCMP 1WJQA 3S3OA 1Y7XA 2DKGA 2LZ6B 5LJ3d 1PWTA 3JAME 5GAMf 4R0KA 3EGUA 3RMQA 2JM9A 1VQNT 5HK3A 3PVQA 4M7DB 5A2QE 3OYMA 1RLQC 4R55A 2MMPA 3O5ZA 1WX6A 4M77D 1UGVA 2OAWA 4IUPA 1AOJA 4AFUC 3JV3A 1UE9A 1ZUYA 1VQ9T 2B8AA 3KFVA 1WGSA 4A4EA 3S6WA 3OQ5A 2JTFA 3EG9A 3D7SB 2QGGA 1RAIB 4L6V5 1IRXA 4BI8B 4EMKA 4DBRA 5GAOl 1BIBA 1Y0MA 2KDSA 4Z8AA 1VQ8T 4XTUA 4F7UE 2LX7A 3PTAA 3CC2A 3LH0A 4J9CA 4DA4A 2QXFA 3CD6Q 4X9CA 2LQNA 2OJ2A 2JMAA 1QWEA 5KYUA 1KC8C 5FRMA 4XU3A 3C94A 2P4TA 2VKNA 4QW2A 5KCHA 3CCLA 2MCNA 2EKHA 4PFOA 1PSEA 4ME7A 2KROA 2E41A 1JQQA 2V1QA 3BDLA 2LX9A 1PHTA 2AT1B 1Y96B 1OYXA 3CC4T 4JS4A 2F5KA 5CCAA 3OW2P 5KYYA 2DFUA 1M4ZA 2RN8A 1VQMT 1LPLA 1ZSZA 4IIOA 3VRZA 4QVZA 3FDRA 2E6ZA 5D6YA 1VQOA 1BK2A 2F1LA 2QQRA 1BCOA 2L89A 4CI0C 1NZ9A 4EMGA 5GANg 1YITA 1PRLC 4JRQA 2FL7A 2EPDA 1QP3A 1N9SA 1U06A 4F7UB 2MPXC 3VJPA 1KC8U 1N8RC 3QZ9B 4PJOF 4EPCA 2CSQA 1T0JA 1M3BA 3EFSA 3G71Q 1AT1B 1O9SA 2PQWA 4R56A 1YJWA 2GTJA 3CCRA 2HNIA 3FJPA 1BB9A 3M0QA 4QT7A 2RI3A 4A53A 1TWBA 3RR6A 1X43A 3CXCS 1YP5A 2KK4A 4N0AA 3L2RA 3CC2T 2JZ2A 1OI1A 2BZ8A 2KR3A 1NLPC 2KYMA 3BE3A 4DOVA 3OSSC 1KQ1A 3NTHA 5GMKm 4XU1A 2KMTA 4M77G 4AMCA 1ABOA 4X1VA 2LVMA 3X20B 1BBZA 1RABB 4E7KA 2OTJA 1B7TA 1I07A 2LJ0A 2YLCA 3OYGA 3CCLT 2OTLQ 4A4HA 1WLPB 1N8RU 1AZGB 1KK7A 4KUDK 4BI3A 1YNZA 2V8JA 2K2VA 2K5LA 1VQPA 1I5OB 1VQ7Q 1VIFA 3LGLA 3C12A 2JVVA 1GCQA 5GANj 1PKSA 3EG0A 4J6XA 2DD5A 1R8OB 1OULA 4JJNK 2YLBA 4PJOA 4JUVA 4EMKC 2DK3A 2Y4XA 1ZLMA 5GAOp 3ME9A 1JJ2P 2COWA 4BI4A 1MUZA 3M56A 1QVFA 1YITT 1MGQA 4M7AD 4PL6A 2CSIA 2MOXA 3MP1A 5I22A 3P8BB 2E4HA 3QUIA 5GANh 1VQLA 5LL6S 3M54A 3CPWA 2LCLA 4JRIA 3CMEA 4JRPA 3QSUA 3NTKA 2R58A 3BFMA 4J8OA 2M9UA 4AG2C 1YHQQ 3UDCA 2GBQA 2EKOA 2XMFA 4HT9A 1YJWT 4ZN1A 4OB1B 4N4IA 1CSKA 1W2BP 2YUQA 4M77E 2VGMA 1C0MA 1K73C 3OA6A 2ROTA 1ZSZC 1VYTA 2I0NA 3PT9A 1YI2T 3DB4A 4JJCA 3R6NA 2I2LA 2F69A 2BTTA 5IN1A 2CUBA 2EYXA 2ZPFB 3QBYA 1N6AA 3J80E 4OMLA 2O9VA 2O2OA 2PVDB 2J6FA 1QKXA 3G6EQ 1VQKA 4RUGA 2X51A 3RIRA 3SB2A 5CR2A 1OX9A 3OYEA 1YIJQ 4NS5A 2ZPIB 1WFWA 3PIPA 1VYUA 4QQ6A 1B34A 2WSEE 1VQPT 1AWOA 2K6DA 2HBWA 2K7AA 3MP6A 3EG1A 5GANe 2H8HA 3CCET 1PNJA 1MV0B 2DL3A 2L5QA 2CDTA 2PVOB 4OGEA 2M0OA 4N0AC 5I2MA 1PKTA 5GJWB 2L3SA 4DBQA 4M77B 2CZ7B 2O4XB 3RKXA 4AFZC 2OAUA 1PCXA 3QWYA 3H41A 2BKDN 3H0FA 3HHTB 2QA4Q 1W1FA 1QW1A 3QYHB 1UG1A 1WA7A 4OGCA 2QEXQ 4KT0E 2VVKA 4L5GA 4XTWA 3ZFJA 2E6NA 1M8MA 4JZ3A 2ED0A 4DBHA 3OYIA 3JB9D 3TSWA 1IB8A 1UHCA 2MK5A 2D9TA 2PVGB 3VS0A 3HSBA 1NM7A 1RACB 4PJOC 1G3YA 4M7AG 2K79A 1VOMA 3FEOA 3REAB 2KGTA 4C0DC 2LJ1A 3QJ6A 2K5FA 2RO0A 1A0NB 1YJNQ 1YN8A 5GMKj 5FLXE 3MKDA 2QTXA 2DAQA 4XTVA 1UGPB 3URGA 1ZHIA 2YDLA 1D3BA 3OYYA 4LN2A 4AFQC 5GAN4 2CZ0B 3L2WA 1TUDA 2RJDA 4BUGA 2H3JA 1YWOA 2C0TA 1I8FA 4HCZA 4QVCA 1UGSB 3WVEB 2X35A 1IGQA 4M7AF 3M4GA 2Y4YA 5KCOA 2MWPA 5GMKh 1X69A 2COYA 4BY6B 5D6XA 4JDSA 3S3NA 2ZPEB 1BCMA 2E1HA 2HD0A 4Z02A 1KFZA 1ZBXA 1KHIA 2RK1A 2V1RA 2NUPB 3EHRA 2KXCA 1MV3A 4JJDA 1QMCA 4CC7A 2NUZA 2RNAA 5FU6C 2XHCA 1IO6A 2BZXA 4EIKA 1SHGA 4C8QB 3JCMd 4FYXB 1AWJA 2O01E 5EC7A 3HRUA 3LLRA 1VQ4Q 2XK0A 4FYYB 4M7AE 1VA7A 3VRYA 2VV5A 4C0GA 2QASA 5GAN8 2RB6A 1GXIE 2DXUA 4C5GA 1PD0A 3SHWA 3UA7A 5GAMd 2VASA 1K4US 2P0KA 3CD6T 4PKCC 1D1BA 1VIEA 4CC3A 3HL8A 1OPKA 3EGXB 4KGZB 1OQKA 1OZ2A 1XTDA 1I1JA 2EYZA 1EIFA 3JCMQ 3CCQQ 3TQ7P 2CH4W 3A5ZB 4M7AA 1G5VA 2XIDA 4KH0B 4DEXA 1ARKA 3AT1B 2A28A 2KE9A 3GPLA 3OYLA 3EGDA 4FSXA 3RKYA 1XJWB 1M90C 2DERA 4C5HA 2HBPA 4FIBA 1CKBA 1RI9A 1JU5C 2SRCA 3E9GA 3JB9G 4NL3A 2QQSA 3TCJA 1LOJA 1I4K1 5GANf 4CC4B 2X3XD 1VQNA 3MJXA 2A37A 3MO8A 1X01A 3MPUB 4LUDA 3ZEHA 3QO3A 1K0SA 4RG8A 3JB9J 2DIQA 2RJEA 3LWHA 1FWZA 3PE0A 5GAN3 3S3MA 3M58A 2NUTA 3I35A 4RTVA 3QWXX 5HKCA 3OS2A 1GFDA 3A8LB 2JS0A 2JJ9A 3JB9F 2DA9A 2XI9A 3G71T 4FU6A 3Q1JA 2EW3A 2IG0A 4J9BA 1QVPA 4D8DA 1VQ8A 2RPNA 4PJNA 3CCJQ 4BE1A 2AZSA 4ZTFA 4RMOA 3OBYA 3BY7A 3REBB 4M78C 3QDFA 2DL4A 4E7SA 4Y28E 2FHDA 3P8DA 4N4HA 1UFFA 2F2XA 1NEGA 1ZA1B 3CCUA 3UPUA 3SEMA 2LCSA 5KYNA 3G6EA 2NWMA 3H8ZA 4OVAA 3OS5A 5EG2A 1WXUA 2KYBA 4C92A 3T9NA 1BU1A 3CCSQ 3M0SA 2XICA 5CKBA 2M02A 3BDUA 3JB9I 3FC3A 2HKNA 1WJRA 2RHIA 5I21A 1I81A 1GCPA 4MDWA 3E2UA 3LYIA 2EJ9A 3M0TA 3VS6A 2M0YA 3TSZA 1WHHA 2ABLA 1H92A 2EQUA 2PUOB 1HK9A 1TUGB 2C0OA 2DRKA 3M55A 5LJ5j 1RI0A 3QIIA 3CXCA 1K73R 2VUBA 1WI7A 2R57A 3HRTA 2QQAA 2NLUA 1HJDA 1W4SA 4A63B 2O9SA 2W10A 1KG1A 2GQVA 1OU9A 1NBEB 5KYXB 4O6JA 1AZEA 3CCVQ 1QLYA 2QA4A 4F14A 2YRVA 2DILA 3V8JA 1SEMA 4M7AC 4FL6A 2CYZB 4HXJA 1Q95G 1SF9A 3VV0A 2EYQA 2M1HA 1YHQT 4OB3B 4WCIA 2DJZA 1NPPA 2O88A 3C4SA 2L8DA 5LJ5h 1OU8A 3H9NA 3QHSA 4FT2A 3WXMB 1RAHB 1M9SA 4HVWA 2QTVA 3H0HA 3SFMA 3L2QA 1QVFP 2HCKA 2DEQA 2A08A 2L3RA 4AFSC 1WHKA 3CPFA 4LDWA 4QQGA 4RKUE 3HPWA 4C5IA 4A4FA 3KUFA 4GY5A 3CPWP 3EG3A 3EG9B 5CKHA 3CCUT 4VUBA 2V26A 1PSFA 3G6ET 1SKUB 4P5NA 2GCXA 4EMKB 4TVRA 3RNJA 4PJOG 4XTYA 4M75A 4RTWA 1UJYA 3PMTA 3V7CA 1NYFA 3H6ZA 3CC7Q 1K9AA 1KQ2A 5FU7C 3AHUA 4FM4B 4E7HA 2R5AA 1TTHB 4ATOA 1UTIA 1TOVA 2IPOB 1BI2A 5HCKA 2W0ZA 3A8MB 1D1AA 5KE3A 3JCMV 1QQJA 2Z0WA 1OX8A 2K3XA 3QYGB 1M27C 5GJVB 2R5MA 2HQEA 1SSFA 4GLMA 5KYYB 4JLGA 2QA4T 4M78D 2QYZA 3VUZA 5IHNA 4HCKA 1D0ZA 1ZSZB 3KXTA 1YBYA 3GLXA 4HVUA 3E9FA 4PJMA 2QEXT 1RAEB 4RTXA 2HSPA 3I9QA 1MMAA 4J6WA 1IHWA 4E7LA 1VQ4A 4FYVB 2VGNA 1GRIA 1BYMA 4C92C 3FRNA 2RQRA 4ZGJB 5IH2A 2CP7A 1AWXA 1YI2A 3JRZA 2EIFA 2L2PA 2PZ1A 3M0UA 2JUFA 1NEBA 2LDMA 2JOYA 5CIUA 4WTOB 4XK8E 4JS5A 2AKLA 4XTZA 2DRMA 2MYSA 4HKEA 4PJOE 1X2KA 4LE9A 1Q81C 3EH1A 2LTOA 2XD0A 2HSEB 1DJ7B 1I5LA 1M3CA 2KNBB 1WDXA 2ED1A 5CQYA 5HK0A 2NYSA 2DE0X 5GMKi 3CCEA 4LNPA 3M57A 3NMZC 2JXBA 3A1PA 1UB4A 4B6MA 4F16A 5AYFA 2E64A 2D8HA 4OB0B 2DVJA 3QPHA 1H8KA 3INZA 3OMGA 3JB9H 1VQ6Q 4HT8A 2AKKA 2HKQB 1Q81U 1M1FA 1ACMB 4RTUA 3CBPA 5J3BA 2RM4A 3X25B 5CQXA 3EHQA 1LNXA 4PJOB 4A54A 1YCSB 1VQ9Q 3CCMQ 4C0DB 4PJLA 2DVEA 1SPKA 2LRQA 1VQ4T 4M75C 2C06A 1M1KC 1M90R 1KQSS 4HVVA 4J9EA 2HMAA 3GF5A 4J6YA 3UF4A 1M2VA 4ZTJA 1IHVA 5L23A 3A8OB 3I56Q 3KBGA 3RDVA 1MHNA 3LW5E 5ECAA 5IHKA 3U23A 1U5SA 4MZPA 2ZAEA 3CCQT 2GFUA 2LQKA 5HY6A 1T0HA 4M78G 4PNOA 5J26A 1K9MC 2JS2A 3CMAQ 3GNGA 2VC8A 2K4YA 3CCSA 5KYWA 4A4GA 3I55Q 1SHFA 2EQIA 2YXYA 2KRMA 2ZCFB 2EYWA 2V8IA 1ZUKA 1M1KU 1H3HA 1MMNA 3X28B 5FU6B 1K73U 1MNDA 1KD1C 4M4ZA 1WIEA 3JCMW 4M78F 2DX1A 3EFOA 2RI5A 1AEYA 2RHZA 1X75C 5LJ5f 2FZGB 3OYAA 4C92D 1B34B 1ZA2B 3CCVA 2E3IA 2CH4A 1FXXA 4M7DD 2DL7A 4OMMA 4J9GA 2P0PA 2WSCE 2DJQA 2GQIA 5A0LA 1K9MU 3UATA 2RHUA 3A8GB 2F2VA 5FRNA 3CCJT 3GP8A 1YFNA 3MEWA 5GAOq 3EFRA 3G7ZA 1CKAA 3CD6A 4J7FA 4KGVB 5GANd 5GAN6 4IUVA 2XDPA 4M78E 2PU9B 3DLLA 1F1BB 1KD1U 5IT9E 4ELYC 2KI7A 4E7IA 1NG2A 1NJIC 3CC2Q 4YTLA 3X24B 5CKFA 2HQXA 3ZL7C 5GMKl 3MCAB 2FZKB 2FVUA 5CK9A 3CCST 4M78A 3M9QA 2P4RA 2FZCB 1JO8A 3PVLA 4IURA 1IZ6A 1N9RA 5FW9A 2FPEA 3OYFA 1D0YA 3ULRB 3UA6A 1M5Q1 1D3BB 2FYKA 3M53A 4C8QA 2ATCB 1TS9A 3SD4A 2QQ9A 3OMCA 1VQOQ 3IQLA 4XAXB 5GAN5 4JRKA 1MMDA 1OV3A 4M75D 1U1TA 3CCVT 2LT4A 1G3WA 3G71A 1YITQ 1NJIU 5CKEA 1ABQA 3RBBB 2E10A 2QDYB 2CP5A 5FROA 4KULA 4BE2A 1TU0B 2CZ1B 5GAOm 4LD9K 2KY9A 3NHNA 4FT4A 1IREB 1Q7YR 2J6OA 2CREA 3G4SQ 3X26B 3VKIA 5LJ3j 4BDZA 4PFPA 3M4YA 2PNIA 1K1ZA 5FWBA 3CXCP 1T3LA 1TXQA 3CCRQ 1QVGA 5FWCA 2MIOA 2K57A 1X6GA 2CP3A 3NFCA 3TEEA 4C92G 2RF0A 4JZ4A 4M7DG 2KSSA 2C0IA 2OTLA 5GMKe 1Q82C 4Z88A 2GTOA 2VYTA 2B86A 5LJ3h 2HQHA 3L2UA 1VQ7A 1TH7A 1OEBA 1QCNA 1UHFA 1YJ9Q 2OTJQ 2BE9B 1BKBA 2DYIA 2RQVA 1ZX6A 5CKDA 3SWNA 1D1CA 1ZQ1A 2JTEA 3HFOA 5I11A 4BACA 3OSVA 1TG0A 2DETA 1VQPQ 3WVDB 1EZZB 4C92F 2CGHA 1Y07A 1PD1A 1HD3A 3GOXA 4M7AB 2JM8A 4M7DF 2RH2A 1RAFB 2KQWA 1GBRA 3THKA 2IIMA 4IIMA 1JJ2S 2DTHA 2EVRA 3EGDB 2M51A 2D8JA 1VQ6A 4JLIA 5LJ5g 1KIKA 1BI1A 2O31A 2KEAA 1YHQA 1Q81R 2F2WA 2QI2A 1YCYA 2WSFE 1Q82U 2WACA 7AT1B 3CEYA 1H641 3L42A 3FLGA 3QDRB 2G3RA 4E47A 2EYYA 3CCMA 5D7UA 1IGUA 1M2OA 1M90U 4BY6C 1VQLQ 2K3BA 3CMEQ 2BE7D 2V8KA 3TU4K 3BW1A 3OS0A 1K76A 1WHGA 4C92E 1HXDA 4M7DE 1V29B 3I56A 1W2BS 1QCFA 3I5SA 2KT1A 1N27A 4MMLA 3VU3C 2LMJA 3HFNA 4LD6A 4II1A 3NGPA 4M75G 1ZSGA 1YIJA 5FU7B 1AWWA 4ZGDB 4C8QC 2XKOC 2OTLT 3G1JA 2FEIA 4OMPA 2EAYA 3SDZA 5CVIA 2P0QA 1VQ7T 4M7DA 2EGCA 3VUBA 3I55A 1PC0A 1VQKQ 1P92A 2ROLA 3MP8A 1GL5A 3M0RA 1NYGA 2DBMA 2ECZA 2EQKA 2SEMA 1S72Q 4MDXA 4FYWB 1QVGS 2COZA 1PG5B 1MNEA 3DB3A 2QGFB 2DL5A 4OP0A 1M1KR 3VS5A 4M75F 4BD3A 1RLPC 4E7JA 2QDLA 2P84A 4PLIA 3PNWC 3E1SA 5IHIA 2DPPB 4J9FA 3LWIA 4F7UF 2J05A 1E6GA 4C92B 2FRYA 3OYNA 2EGEA 4XU2A 1VQ6T 3EG2A 4GBQA 5CAIA 2KRNA 3O8VA 2K3YA 4FCYA 1HYOA 2DXCA 2QEXA 5D6WA 1U3OA 4X9DA 1FYNA 1K9MR 2CP2A 4Q5WA 3RUXA 2DZCA 1RAGB 3CCMT 4LXCA 3TVTA 1Q86R 2YUOA 3LGFA 3QXEB 4C0ZA 3SWNC 4M75E 5IXBA 1JBMA 2ESWA 1Y96A 4KBMB 3GNFB 2LNHB 4ZN3A 1YJNA 1LJOA 3I56T 1R0CB 4ORZA 1KD1R 3JCMJ 6AT1B 2DEUA 1M1GA 4IUTA 1YIJT 2D0NA 1VQ5Q 2RQTA 2DLPA 2YSQA 1Q7YC 3UT1A 1SRLA 3CMAT 1WHJA 1WXTA 1JRIA 2HZYA 2RQUA 2EQJA 1HSQA 2A36A 2VXFA 1BI3A 3I55T 4F7UA 3OYKA 5KYUB 1QP2A 2GNCA 2QQBA 1KQSA 3F70A 1X27A 1WNLA 4J83A 2ZPBB 1WZOA 3META 5LJ5e 2YRCA 2YRDA 3RESA 1WHLA 4OMFB 1ZUUA 2DO3A 4M75B 2E65A 2GF7A 2FB7A 4E7ZA 2KRSA 3EAEA 1NJIR 4KRTA 1K0XA 4MMKA 2AHJB 4ZGEB 2X3WD 1Q7YU 3PGGA 1UGRB 3PFSA 1SG5A 3JCMc 2DM1A 2YHTA 1XQHA 2CS7A 2OX7A 4PFZA 3G4SA 4M7DC 2DF6A 4EMHA 4JPBW 1LCKA 1FMKA 2YT6A 3VS3A 5IXFA 1OZ3A 4C8QD 5GAOn 5LJ3f 1WYXA 1Y57A 8ATCB 3DLMA 5DM7R 2K9GA 1K8AC 4Z89A 1UDLA 1UGQB 3MHXA 4MZTA 3CCQA 2DYBA 1YJNT 2OI3A 2YWWA 4AT1B 4C5EA 3M59A 4ELZC 5LJ5d 2LC4A 4PK4A 4HCCA 2X4YA 1Y71A 4WF2A 4Y92A 5DLOA 4DOWA 5IAYA 5GAOr 2RD1A 2AIRB 1YJ9A 4L59A 2VXEA 2Y90A 4DQ2A 1O75A 4ZNXA 2H3EB 3VS4A 4A4KA 2RK2A 3LH5A 3VYGA 3L1AA 3OBWA 2E70A 1R77A 1D09B 1Z9ZA 2JMCA 1N5ZA 3JCMg 2BIVA 2JNGA 1M3AA 2ZGWA 4J7IA 3CBMA 4BDYA 1RUWA 1U1SA 2DXBA 2QK0A 2XU8A 1LVKA 5I2SA 1K8AU 1VQNQ 4M77F 2XDDA 3PMIA 1VQOT 2JW4A 5GAMg 2RQWA 1OOTA 1QKWA 3OYBA 2JN0A 1G3TA 4OMOA 4ANJA 1Q82R 1UEBA 1KHCA 3CCJA 4QQDA 3GBQA 2DBKA 1BI0A 4O5VA 3G4ST 2MF2A 4J5YA 5CO7A 3OYCA 2GGRA 2X4WA 3M5AA 3RERA 1UECA 3E19A 3CCRT 1AHJB 1VQ8Q 3OW2A 4J9IA 2DTIA 2DTOA 1PRMC 3VS1A 1WHMA 1WXBA 5C0MA 1G3SA 3CQTA 1E7OA 2E3HA 3V7SA 5DY9A 2A7YA 2CP0A 4QVDA 1WQ7A 1X6BA 1Q86C 4RG2A 1XNIA 3GIBA 4JJBA 1D0XA 4RTTA 4MZMA 3CCUQ 4LDYA 2LQWA 3JSCA 5J39A 1YJ9T 2OTJT 3MEVA 5GAN7 1M2VB 1AVZC 1NE8A 4M77A 3CC4Q 1S72A 4OMQA 2O4XA 4KUIA 2J06A 2CKKA 3EH2A 4RCBA 4C8QG 1QVGP 5GAMj 1VQMQ 2AK5A 2DD4A 4GLKA 1ZBJA 3RMSA 3CBOA 3NTIA 2HL5C 4LDVA 1OPLA 1AD5A 3L2VA 4NL2A 4RTYA 2AZVA 3JCMh 2YUNA 1I0CA 4AG1C 5KYWB 1G2BA 1X6OA 4D8KA 1M8VA 1JEGA 2MI6A 2E12A 1RADB 3MEAA 3QZ5B 1H3ZA 4C8QF 1Q86U 5KH6A 5GAMh 1G8XA 2M16A 4CRIA 4NOYA 2DIGA 4RTZA 1V1CA 2F5TX 2IVWA 1VQLT 1GFCA 3HP9A 3CMET 1QWFA 1NPRA 2K5IA 2X4XA 2BUDA 3EFOB 4E6RA 2CT3A 4J9DA 1S1NA 4B9WA 2E5KA 5LJ3g 3OY9A 2HL3A 1RAAB 4J9HA 2D6FA 3L2ZA 2J6KA 2DZ9A 1GCQC 1JXOA 2RA2A 2DNUA 1QVFS 3H0IA 4KGXB 2RJFA 4C0FA 4LDUA 3J81E 1NLOC 2MAMA 1VQ5A 3PIOA 4QKUA 1JJ2A 3M0PA 3CPWS 2ZZDA 2KBTA 4C8QE 4F17A 2FPFA 2L3QA 3CCLQ 3CC7A 1EFNA 2FG0A 3FJ5A 5M9OA 3NPFA 2LCCA 3JCMe 1VQKT 2ZPHB 4X34A 4B9XA 2NUPA 2RI2A 3OW2S 4Y91A 3MEUA 1S72T 3HTRA 1TUCA 2EQMA 2LNVA 4UC4A 1FX7A 3OS1A 2L0AA 3C0CA 4EDUA 5GAMe 3VYHB 1JXMA 1W2BA 2CUDA 4DBFA 2KT8A 2LQ8A 1QCOA 2X4JA 3LX7A 4M78B 1WJSA 2CZ6B 3P8HA 3RKWA 2QG9B 2PTKA 2EFIA 3TREA 4E2FB 1G83A 2DMOA 1KC8R 3EGXA 3VS7A 2KAFA 1B3QA 3J7AF 2EJFA 3OYJA 2D0QB 1YJWQ 2HAXA 4K11A 4M77C 4D6WA 5C6SA 3JCMX 2RMOA 4IKFA 1SRMA 2JTMA 3HKSA 4RCCA 4ESRA 1SSHA 4FW2A 2HDAA 4PJJA 1YI2Q 1KJWA 1JB0E 4N4GA 3QG1A 4OMNA 2QAZA 4F04B 2KXDA 1VQ5T 2XDBA 2RHYA 3JCMb 1GBQA 1W70A 2JT4A 2RHXA 1E6HA 5KE2A 3HRSA 3CC7T 2E5QA 2FO0A 3OYHA 3C95A 4BE0A 1J3TA 1N8RR 2LT1A 4OF1A 1XOVA 2CT4A 1R0BG 4PLLA 2XG8D 1T3SA 9ATCB 4LUEA 2ENMA 3CCEQ 5DLQE 1MMGA 1B07A 1W6XA 2EWNA 3R6OA 3A8HB 1YWPA 3A98A 2MWOA 3ZBDA 4FSSA 3FB9A 1K8AR 1WQWA 3V7RA 4BB7A 2YUPA 1VYVA 1U8RA 4HCBA 2G6FX 3QJYA 2CP6A 2EGAA 1IXDA 2KVQG 1BIAA 4IUUA 4IUQA 4KH1B 3FIFA 1EX4A 3SWNB 2BZYA 4XQ3A 2LJ3A 1C1AA 1M30A 1VQ9A 1Z9QA 5AT1B 1FMWA 4XTXA 3DKMA 8AT1B 2PUKB 1KQSP 3V8LA 4LDXA 5LJ3e 2A3LA 4CC2A 4PJOD 3ER0A 2VWFA 2NUTB 1PM3A 4DEYA 2EJGA 3UWNA 1FMVA 2GFAA 4XU0A 3N5BB 5GAN2
chains in the Genus database with same CATH topology
3KBGA 3RESA 3S3NA 1MHNA 2ZPEB 3LW5E 4OMFB 2RJCA 2E1HA 1RL2A 2HD0A 2DO3A 4Z02A 3CMAA 4M75B 4MZPA 4F7UG 1ZBXA 2E65A 1KHIA 2RK1A 2GF7A 2GFUA 3CCQT 2LQKA 5HY6A 4V2SA 2FB7A 2ZPGB 4M78G 5A0DA 4PNOA 1VUBA 5J26A 3EAEA 1K9MC 5FU6C 4MMKA 2AHJB 2XHCA 4ZGEB 3OB9A 3GNGA 2DXTA 3PGGA 3OYDA 2VC8A 1Q7YU 1UGRB 2K4YA 3PFSA 3CCSA 3JCMc 2YHTA 1XQHA 2CS7A 1WPYA 3ASKA 3JCMf 4A4GA 3CC4A 3G4SA 4C8QB 4M7DC 3JCMd 4EMHA 3QKJA 2O01E 5A0GA 5L8RE 3HRUA 3LLRA 4HA8A 2XK0A 4M7AE 1VQMA 2VV5A 2ZCFB 4C0GA 3V8KA 4OB2B 1OZ3A 2V8IA 4C8QD 5GAN8 5GAOn 3JCMP 2RB6A 5LJ3f 1WJQA 1GXIE 3S3OA 1M1KU 1Y7XA 2DKGA 5FU6B 5LJ3d 3X28B 1K73U 2DXUA 3JAME 1KD1C 3DLMA 4C5GA 5GAMf 5DM7R 1K8AC 3RMQA 5GAMd 1UGQB 2P0KA 3MHXA 3JCMW 4MZTA 3CCQA 1YJNT 4M78F 4PKCC 1VQNT 5HK3A 3CD6T 1VIEA 3HL8A 4M7DB 2RI5A 5A2QE 3OYMA 4C5EA 2RHZA 1X75C 3M59A 5LJ5f 4ELZC 1OZ2A 1XTDA 5LJ5d 3OYAA 2LC4A 1EIFA 4C92D 1B34B 4R55A 3CCVA 4HCCA 2MMPA 3JCMQ 3A5ZB 4M77D 4M7AA 1FXXA 2X4YA 2XIDA 1Y71A 4M7DD 1G5VA 4WF2A 4IUPA 5DLOA 4DOWA 5IAYA 5GAOr 2P0PA 2RD1A 2WSCE 3GPLA 1YJ9A 4L59A 1VQ9T 2VXEA 5A0LA 2B8AA 2Y90A 1K9MU 4DQ2A 1O75A 1WGSA 4A4EA 3S6WA 3OQ5A 3OYLA 3RKYA 4FSXA 4A4KA 2JTFA 2RK2A 1M90C 4C5HA 2HBPA 4FIBA 2RHUA 3A8GB 3L1AA 3OBWA 3VYGA 2E70A 5FRNA 4L6V5 3CCJT 3GP8A 3E9GA 3JB9G 3MEWA 4BI8B 5GAOq 4EMKA 4NL3A 3EFRA 2QQSA 3G7ZA 3TCJA 1BIBA 3JCMg 5GAOl 2BIVA 2KDSA 1LOJA 2JNGA 1I4K1 5GANf 3CD6A 1VQ8T 4J7FA 4XTUA 1VQNA 5GANd 4F7UE 2ZGWA 3MO8A 4IUVA 4J7IA 5GAN6 3CBMA 1X01A 2XDPA 4BDYA 3ZEHA 4M78E 3PTAA 3CC2A 3QO3A 2PU9B 3LH0A 3DLLA 2DXBA 1U1SA 2XU8A 4RG8A 4DA4A 3JB9J 2QXFA 5IT9E 1KD1U 2DIQA 4ELYC 5I2SA 1K8AU 2RJEA 4M77F 4X9CA 2XDDA 3PMIA 3LWHA 1VQOT 4E7IA 1FWZA 5GAMg 1KC8C 1NJIC 5FRMA 4YTLA 5GAN3 3OYBA 4XU3A 3C94A 2P4TA 2JN0A 3S3MA 3X24B 5CKFA 1G3TA 4QW2A 3M58A 5KCHA 2HQXA 3CCLA 1UEBA 5GMKl 1KHCA 1PSEA 3MCAB 4ME7A 2FVUA 5HKCA 4QQDA 3OS2A 2E41A 3CCJA 3A8LB 3JB9F 2XI9A 3BDLA 2LX9A 5CK9A 3G71T 3CCST 4M78A 4FU6A 1Y96B 1OYXA 3M9QA 3Q1JA 1BI0A 2IG0A 4O5VA 3CC4T 3G4ST 2MF2A 4JS4A 1QVPA 2F5KA 4J5YA 5CO7A 5CCAA 3OYCA 1VQ8A 1M4ZA 4BE1A 4ZTFA 4IURA 4RMOA 3OBYA 1VQMT 2X4WA 3M5AA 3RERA 3BY7A 3E19A 1IZ6A 3CCRT 4M78C 1AHJB 1N9RA 3OW2A 4QVZA 3FDRA 2DTIA 2E6ZA 5D6YA 1VQOA 2DTOA 2QQRA 3OYFA 2L89A 4CI0C 4Y28E 2FHDA 1NZ9A 3P8DA 4EMGA 5GANg 1M5Q1 4N4HA 1D3BB 2FYKA 3M53A 1YITA 4C8QA 5C0MA 1G3SA 3SD4A 2QQ9A 3OMCA 3V7SA 4XAXB 4JRQA 2FL7A 5GAN5 1QP3A 5DY9A 4JRKA 2A7YA 1N9SA 4QVDA 3CCUA 3UPUA 1WQ7A 4M75D 4F7UB 1U1TA 3CCVT 3G6EA 3VJPA 2LT4A 1G3WA 3G71A 1Q86C 4RG2A 1NJIU 1KC8U 1XNIA 1N8RC 5CKEA 3QZ9B 3GIBA 3H8ZA 2E10A 2QDYB 4PJOF 5FROA 4KULA 4MZMA 4OVAA 4EPCA 4BE2A 4LDYA 3JSCA 3OS5A 5J39A 5EG2A 1YJ9T 2OTJT 3MEVA 2CZ1B 5GAN7 3EFSA 4C92A 3T9NA 5GAOm 4LD9K 2KY9A 1O9SA 2PQWA 1NE8A 2XICA 1IREB 4FT4A 4M77A 5CKBA 4R56A 1YJWA 3BDUA 3JB9I 2HNIA 2O4XA 3FJPA 1WJRA 2RHIA 4KUIA 3FC3A 3CCRA 3X26B 2CKKA 3VKIA 4RCBA 1I81A 4C8QG 5I21A 5LJ3j 4BDZA 4MDWA 3M4YA 2RI3A 4A53A 3LYIA 5GAMj 2EJ9A 2DD4A 4GLKA 3CXCS 2KK4A 4N0AA 3L2RA 3RMSA 3CBOA 3NTIA 1QVGA 4LDVA 2EQUA 2PUOB 1HK9A 3M55A 5LJ5j 3CXCA 2JZ2A 3L2VA 1OI1A 1RI0A 3QIIA 4NL2A 2VUBA 2K57A 2R57A 3HRTA 2QQAA 3TEEA 3NFCA 3JCMh 4C92G 2NLUA 4DOVA 3OSSC 1KQ1A 1W4SA 3NTHA 5GMKm 4XU1A 2KMTA 4M77G 1KG1A 2GQVA 2KSSA 4M7DG 2OTLA 1X6OA 2LVMA 5GMKe 1Q82C 4O6JA 3X20B 4E7KA 2OTJA 1M8VA 2VYTA 2QA4A 1S72A 2MI6A 2YLCA 2YRVA 5LJ3h 3OYGA 3L2UA 2E12A 3CCLT 1TH7A 1VQ7A 4M7AD 3MEAA 3QZ5B 3V8JA 4A4HA 4M7AC 4FL6A 4C8QF 1Q86U 5KH6A 2CYZB 5GAMh 1H3ZA 1N8RU 2M16A 4CRIA 4NOYA 2DIGA 2EYQA 1BKBA 2M1HA 3VV0A 1YHQT 4OB3B 4KUDK 4BI3A 2F5TX 2K2VA 2K5LA 2IVWA 2V8JA 1VQPA 1VQLT 2DJZA 3HP9A 5CKDA 1NPPA 1VIFA 3LGLA 3CMET 3C12A 3SWNA 2JVVA 1NPRA 3C4SA 5GANj 2K5IA 1ZQ1A 2L8DA 5LJ5h 3QHSA 4FT2A 2X4XA 2BUDA 3HFOA 3WXMB 4BACA 4J6XA 3OSVA 2DD5A 1R8OB 1M9SA 3SFMA 3WVDB 4B9WA 4JJNK 2YLBA 4C92F 2CGHA 4PJOA 4JUVA 1Y07A 2DK3A 4EMKC 5LJ3g 3OY9A 3L2QA 2D6FA 2DEQA 2Y4XA 4M7AB 3GOXA 3L2ZA 2RH2A 2DZ9A 4M7DF 5GAOp 3ME9A 2KQWA 2RA2A 1QVFS 2L3RA 3CPFA 4RKUE 4LDWA 4QQGA 4BI4A 3HPWA 2RJFA 3M56A 4C0FA 4C5IA 1QVFA 4LDUA 3J81E 1MGQA 1YITT 4PL6A 3KUFA 2DTHA 4GY5A 4A4FA 2MAMA 3MP1A 1JJ2S 1VQ5A 1VQ6A 4JLIA 3P8BB 3PIOA 5LJ5g 1JJ2A 5CKHA 3CCUT 1BI1A 4VUBA 2ZZDA 3CPWS 3QUIA 1YHQA 1PSFA 4C8QE 3G6ET 2WSFE 1YCYA 2QI2A 2GCXA 4P5NA 3M54A 5LL6S 4EMKB 2WACA 5GANh 4TVRA 3CPWA 3CEYA 2LCLA 4JRIA 3CMEA 1H641 3CC7A 3NTKA 4JRPA 3QSUA 2R58A 4PJOG 3L42A 3FLGA 3QDRB 2G3RA 4E47A 3BFMA 4J8OA 2M9UA 4XTYA 4M75A 2LCCA 5M9OA 3JCMe 3PMTA 3UDCA 3CCMA 1M90U 1VQKT 2ZPHB 4X34A 4B9XA 2EKOA 3V7CA 2RI2A 4BY6C 4Y91A 3OW2S 4HT9A 3MEUA 3H6ZA 1YJWT 2V8KA 1KQ2A 5FU7C 3TU4K 1S72T 3AHUA 4ZN1A 3BW1A 4FM4B 4OB1B 4N4IA 3OS0A 2EQMA 4C92E 2LNVA 4E7HA 2R5AA 4UC4A 1HXDA 1FX7A 3OS1A 4ATOA 4M77E 4M7DE 2VGMA 1K73C 1BI2A 1V29B 4EDUA 5GAMe 3VYHB 3OA6A 3I56A 1W2BS 1YI2T 3A8MB 1N27A 3PT9A 4MMLA 3DB4A 3VU3C 2I2LA 1W2BA 3HFNA 4LD6A 5KE3A 2F69A 2LQ8A 4II1A 3JCMV 5IN1A 4M75G 2X4JA 2ZPFB 3QBYA 1YIJA 5FU7B 1N6AA 3LX7A 4M78B 3QYGB 2K3XA 1WJSA 2CZ6B 3P8HA 3RKWA 2R5MA 4C8QC 4ZGDB 2XKOC 3J80E 2OTLT 2HQEA 1SSFA 2PVDB 2EAYA 2EFIA 3SDZA 1VQKA 5CVIA 4JLGA 3TREA 5CR2A 3RIRA 3SB2A 4M78D 3OYEA 2P0QA 3VUZA 2QA4T 1VQ7T 4M7DA 4NS5A 3KXTA 1YBYA 2ZPIB 3GLXA 2KAFA 3E9FA 3VUBA 2QEXT 3J7AF 3PIPA 3I55A 4QQ6A 2EJFA 1B34A 1P92A 4J6WA 4E7LA 1VQ4A 2WSEE 3MP8A 2VGNA 3OYJA 1VQPT 1BYMA 2D0QB 3FRNA 4C92C 2HAXA 2EQKA 4MDXA 4ZGJB 1QVGS 3MP6A 4M77C 4D6WA 5C6SA 3DB3A 3JCMX 1YI2A 4OP0A 4IKFA 3JRZA 5GANe 2JTMA 3HKSA 4RCCA 3CCET 2EIFA 4M75F 2JUFA 2L5QA 2PVOB 4BD3A 2LDMA 2JOYA 5CIUA 4E7JA 4OGEA 4XK8E 3PNWC 4PLIA 3E1SA 4JS5A 1JB0E 2M0OA 4N0AC 2DPPB 3QG1A 4N4GA 5I2MA 3LWIA 4XTZA 4HKEA 4F7UF 4PJOE 4C92B 1Q81C 1Q82U 3OYNA 2LTOA 4XU2A 1VQ5T 2XDBA 4M77B 2RHYA 1VQ6T 2XD0A 2CZ7B 5CAIA 2O4XB 3JCMb 3O8VA 2K3YA 3RKXA 2DXCA 2QEXA 2OAUA 1DJ7B 5D6WA 2BKDN 1I5LA 2RHXA 3HHTB 5KE2A 4X9DA 3HRSA 1QW1A 3QYHB 3CC7T 4Q5WA 3RUXA 4OGCA 2DZCA 2E5QA 5CQYA 3OYHA 3C95A 4KT0E 3CCMT 4BE0A 5HK0A 4L5GA 4XTWA 5GMKi 3ZFJA 3CCEA 2E6NA 3LGFA 3M57A 2LT1A 3QXEB 4C0ZA 1VQLA 4OF1A 1XOVA 3SWNC 4M75E 4PLLA 3OYIA 2XG8D 1JBMA 3JB9D 1UB4A 5DLQE 2D9TA 1Y96A 2PVGB 4KBMB 3HSBA 3GNFB 4ZN3A 2EWNA 1YJNA 1LJOA 3R6OA 3I56T 4PJOC 3A8HB 1G3YA 5AYFA 4M7AG 2E64A 3FEOA 2MWOA 4OB0B 3ZBDA 3JCMJ 3FB9A 3QPHA 1WQWA 3V7RA 4BB7A 4C0DC 1M1GA 1U8RA 3INZA 2K5FA 2RO0A 3QJ6A 4IUTA 3QJYA 4HCBA 1YIJT 3OMGA 3JB9H 5GMKj 5FLXE 2KVQG 4HT8A 1BIAA 4IUUA 4IUQA 2QTXA 3FIFA 3SWNB 1Q7YC 2DAQA 4XTVA 4XQ3A 1Q81U 1M1FA 1UGPB 3UT1A 3URGA 1ZHIA 3CMAT 1VQ9A 1D3BA 3CBPA 3OYYA 1JRIA 5J3BA 2RM4A 3X25B 5CQXA 2VXFA 2EQJA 5GAN4 2CZ0B 1LNXA 1BI3A 4XTXA 4PJOB 3L2WA 2RJDA 4BUGA 3DKMA 4A54A 2H3JA 2PUKB 1I8FA 3I55T 4HCZA 4F7UA 3V8LA 3OYKA 4C0DB 4QVCA 1UGSB 4LDXA 2DVEA 2LRQA 5LJ3e 1VQ4T 4M75C 2C06A 2A3LA 1M1KC 1QP2A 4PJOD 1KQSS 3WVEB 2X35A 3CC2T 3GF5A 3ER0A 4J6YA 4M7AF 1KQSA 2QQBA 3F70A 1WNLA 3M4GA 2Y4YA 4J83A 5KCOA 2MWPA 2EJGA 5GMKh 2ZPBB 4BY6B 3META 5D6XA 3UWNA 4ZTJA 2GFAA 4JDSA 4XU0A 5LJ5e 3N5BB 3A8OB 5GAN2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPW A;  5CKF A;  4ELZ C;  5CQX A;  3JSC A;  3JRZ A;  3TCJ A;  3G7Z A;  2VUB A;  5CKD A;  3NFC A;  4ME7 A;  5CKH A;  4MZP A;  5CR2 A;  1NE8 A;  5CKB A;  5HKC A;  5DLO A;  2KMT A;  4VUB A;  2C06 A;  5CQY A;  5CK9 A;  1VUB A;  5HK0 A;  3VUB A;  4ELY C;  2MF2 A;  4HKE A;  5CO7 A;  5CCA A;  1M1F A;  4OF1 A;  4MZT A;  5HK3 A;  4MDX A;  5CKE A;  1UB4 A;  1X75 C;  4MZM A; 
#chains in the Genus database with same CATH topology
 2K2M A;  1UJ0 A;  2RJC A;  1RL2 A;  2FPD A;  2L3P A;  3CMA A;  4F7U G;  2EBP A;  4V2S A;  2ZPG B;  5A0D A;  2D1X A;  2DL8 A;  1VUB A;  1KSW A;  2X9H A;  2J7I A;  2HEQ A;  3OB9 A;  3VS2 A;  2DXT A;  3OYD A;  1C6V X;  1WPY A;  3ASK A;  3JCM f;  3CC4 A;  1UUE A;  1TSF A;  4FW1 A;  2A0F B;  5KYX A;  3QKJ A;  2VB6 A;  5A0G A;  5L8R E;  1X2Q A;  4HA8 A;  1VQM A;  1V76 A;  3V8K A;  4OB2 B;  2FRW A;  2LP5 A;  3I5R A;  3JCM P;  1WJQ A;  3S3O A;  1Y7X A;  2DKG A;  2LZ6 B;  5LJ3 d;  1PWT A;  3JAM E;  5GAM f;  4R0K A;  3EGU A;  3RMQ A;  2JM9 A;  1VQN T;  5HK3 A;  3PVQ A;  4M7D B;  5A2Q E;  3OYM A;  1RLQ C;  4R55 A;  2MMP A;  3O5Z A;  1WX6 A;  4M77 D;  1UGV A;  2OAW A;  4IUP A;  1AOJ A;  4AFU C;  3JV3 A;  1UE9 A;  1ZUY A;  1VQ9 T;  2B8A A;  3KFV A;  1WGS A;  4A4E A;  3S6W A;  3OQ5 A;  2JTF A;  3EG9 A;  3D7S B;  2QGG A;  1RAI B;  4L6V 5;  1IRX A;  4BI8 B;  4EMK A;  4DBR A;  5GAO l;  1BIB A;  1Y0M A;  2KDS A;  4Z8A A;  1VQ8 T;  4XTU A;  4F7U E;  2LX7 A;  3PTA A;  3CC2 A;  3LH0 A;  4J9C A;  4DA4 A;  2QXF A;  3CD6 Q;  4X9C A;  2LQN A;  2OJ2 A;  2JMA A;  1QWE A;  5KYU A;  1KC8 C;  5FRM A;  4XU3 A;  3C94 A;  2P4T A;  2VKN A;  4QW2 A;  5KCH A;  3CCL A;  2MCN A;  2EKH A;  4PFO A;  1PSE A;  4ME7 A;  2KRO A;  2E41 A;  1JQQ A;  2V1Q A;  3BDL A;  2LX9 A;  1PHT A;  2AT1 B;  1Y96 B;  1OYX A;  3CC4 T;  4JS4 A;  2F5K A;  5CCA A;  3OW2 P;  5KYY A;  2DFU A;  1M4Z A;  2RN8 A;  1VQM T;  1LPL A;  1ZSZ A;  4IIO A;  3VRZ A;  4QVZ A;  3FDR A;  2E6Z A;  5D6Y A;  1VQO A;  1BK2 A;  2F1L A;  2QQR A;  1BCO A;  2L89 A;  4CI0 C;  1NZ9 A;  4EMG A;  5GAN g;  1YIT A;  1PRL C;  4JRQ A;  2FL7 A;  2EPD A;  1QP3 A;  1N9S A;  1U06 A;  4F7U B;  2MPX C;  3VJP A;  1KC8 U;  1N8R C;  3QZ9 B;  4PJO F;  4EPC A;  2CSQ A;  1T0J A;  1M3B A;  3EFS A;  3G71 Q;  1AT1 B;  1O9S A;  2PQW A;  4R56 A;  1YJW A;  2GTJ A;  3CCR A;  2HNI A;  3FJP A;  1BB9 A;  3M0Q A;  4QT7 A;  2RI3 A;  4A53 A;  1TWB A;  3RR6 A;  1X43 A;  3CXC S;  1YP5 A;  2KK4 A;  4N0A A;  3L2R A;  3CC2 T;  2JZ2 A;  1OI1 A;  2BZ8 A;  2KR3 A;  1NLP C;  2KYM A;  3BE3 A;  4DOV A;  3OSS C;  1KQ1 A;  3NTH A;  5GMK m;  4XU1 A;  2KMT A;  4M77 G;  4AMC A;  1ABO A;  4X1V A;  2LVM A;  3X20 B;  1BBZ A;  1RAB B;  4E7K A;  2OTJ A;  1B7T A;  1I07 A;  2LJ0 A;  2YLC A;  3OYG A;  3CCL T;  2OTL Q;  4A4H A;  1WLP B;  1N8R U;  1AZG B;  1KK7 A;  4KUD K;  4BI3 A;  1YNZ A;  2V8J A;  2K2V A;  2K5L A;  1VQP A;  1I5O B;  1VQ7 Q;  1VIF A;  3LGL A;  3C12 A;  2JVV A;  1GCQ A;  5GAN j;  1PKS A;  3EG0 A;  4J6X A;  2DD5 A;  1R8O B;  1OUL A;  4JJN K;  2YLB A;  4PJO A;  4JUV A;  4EMK C;  2DK3 A;  2Y4X A;  1ZLM A;  5GAO p;  3ME9 A;  1JJ2 P;  2COW A;  4BI4 A;  1MUZ A;  3M56 A;  1QVF A;  1YIT T;  1MGQ A;  4M7A D;  4PL6 A;  2CSI A;  2MOX A;  3MP1 A;  5I22 A;  3P8B B;  2E4H A;  3QUI A;  5GAN h;  1VQL A;  5LL6 S;  3M54 A;  3CPW A;  2LCL A;  4JRI A;  3CME A;  4JRP A;  3QSU A;  3NTK A;  2R58 A;  3BFM A;  4J8O A;  2M9U A;  4AG2 C;  1YHQ Q;  3UDC A;  2GBQ A;  2EKO A;  2XMF A;  4HT9 A;  1YJW T;  4ZN1 A;  4OB1 B;  4N4I A;  1CSK A;  1W2B P;  2YUQ A;  4M77 E;  2VGM A;  1C0M A;  1K73 C;  3OA6 A;  2ROT A;  1ZSZ C;  1VYT A;  2I0N A;  3PT9 A;  1YI2 T;  3DB4 A;  4JJC A;  3R6N A;  2I2L A;  2F69 A;  2BTT A;  5IN1 A;  2CUB A;  2EYX A;  2ZPF B;  3QBY A;  1N6A A;  3J80 E;  4OML A;  2O9V A;  2O2O A;  2PVD B;  2J6F A;  1QKX A;  3G6E Q;  1VQK A;  4RUG A;  2X51 A;  3RIR A;  3SB2 A;  5CR2 A;  1OX9 A;  3OYE A;  1YIJ Q;  4NS5 A;  2ZPI B;  1WFW A;  3PIP A;  1VYU A;  4QQ6 A;  1B34 A;  2WSE E;  1VQP T;  1AWO A;  2K6D A;  2HBW A;  2K7A A;  3MP6 A;  3EG1 A;  5GAN e;  2H8H A;  3CCE T;  1PNJ A;  1MV0 B;  2DL3 A;  2L5Q A;  2CDT A;  2PVO B;  4OGE A;  2M0O A;  4N0A C;  5I2M A;  1PKT A;  5GJW B;  2L3S A;  4DBQ A;  4M77 B;  2CZ7 B;  2O4X B;  3RKX A;  4AFZ C;  2OAU A;  1PCX A;  3QWY A;  3H41 A;  2BKD N;  3H0F A;  3HHT B;  2QA4 Q;  1W1F A;  1QW1 A;  3QYH B;  1UG1 A;  1WA7 A;  4OGC A;  2QEX Q;  4KT0 E;  2VVK A;  4L5G A;  4XTW A;  3ZFJ A;  2E6N A;  1M8M A;  4JZ3 A;  2ED0 A;  4DBH A;  3OYI A;  3JB9 D;  3TSW A;  1IB8 A;  1UHC A;  2MK5 A;  2D9T A;  2PVG B;  3VS0 A;  3HSB A;  1NM7 A;  1RAC B;  4PJO C;  1G3Y A;  4M7A G;  2K79 A;  1VOM A;  3FEO A;  3REA B;  2KGT A;  4C0D C;  2LJ1 A;  3QJ6 A;  2K5F A;  2RO0 A;  1A0N B;  1YJN Q;  1YN8 A;  5GMK j;  5FLX E;  3MKD A;  2QTX A;  2DAQ A;  4XTV A;  1UGP B;  3URG A;  1ZHI A;  2YDL A;  1D3B A;  3OYY A;  4LN2 A;  4AFQ C;  5GAN 4;  2CZ0 B;  3L2W A;  1TUD A;  2RJD A;  4BUG A;  2H3J A;  1YWO A;  2C0T A;  1I8F A;  4HCZ A;  4QVC A;  1UGS B;  3WVE B;  2X35 A;  1IGQ A;  4M7A F;  3M4G A;  2Y4Y A;  5KCO A;  2MWP A;  5GMK h;  1X69 A;  2COY A;  4BY6 B;  5D6X A;  4JDS A;  3S3N A;  2ZPE B;  1BCM A;  2E1H A;  2HD0 A;  4Z02 A;  1KFZ A;  1ZBX A;  1KHI A;  2RK1 A;  2V1R A;  2NUP B;  3EHR A;  2KXC A;  1MV3 A;  4JJD A;  1QMC A;  4CC7 A;  2NUZ A;  2RNA A;  5FU6 C;  2XHC A;  1IO6 A;  2BZX A;  4EIK A;  1SHG A;  4C8Q B;  3JCM d;  4FYX B;  1AWJ A;  2O01 E;  5EC7 A;  3HRU A;  3LLR A;  1VQ4 Q;  2XK0 A;  4FYY B;  4M7A E;  1VA7 A;  3VRY A;  2VV5 A;  4C0G A;  2QAS A;  5GAN 8;  2RB6 A;  1GXI E;  2DXU A;  4C5G A;  1PD0 A;  3SHW A;  3UA7 A;  5GAM d;  2VAS A;  1K4U S;  2P0K A;  3CD6 T;  4PKC C;  1D1B A;  1VIE A;  4CC3 A;  3HL8 A;  1OPK A;  3EGX B;  4KGZ B;  1OQK A;  1OZ2 A;  1XTD A;  1I1J A;  2EYZ A;  1EIF A;  3JCM Q;  3CCQ Q;  3TQ7 P;  2CH4 W;  3A5Z B;  4M7A A;  1G5V A;  2XID A;  4KH0 B;  4DEX A;  1ARK A;  3AT1 B;  2A28 A;  2KE9 A;  3GPL A;  3OYL A;  3EGD A;  4FSX A;  3RKY A;  1XJW B;  1M90 C;  2DER A;  4C5H A;  2HBP A;  4FIB A;  1CKB A;  1RI9 A;  1JU5 C;  2SRC A;  3E9G A;  3JB9 G;  4NL3 A;  2QQS A;  3TCJ A;  1LOJ A;  1I4K 1;  5GAN f;  4CC4 B;  2X3X D;  1VQN A;  3MJX A;  2A37 A;  3MO8 A;  1X01 A;  3MPU B;  4LUD A;  3ZEH A;  3QO3 A;  1K0S A;  4RG8 A;  3JB9 J;  2DIQ A;  2RJE A;  3LWH A;  1FWZ A;  3PE0 A;  5GAN 3;  3S3M A;  3M58 A;  2NUT A;  3I35 A;  4RTV A;  3QWX X;  5HKC A;  3OS2 A;  1GFD A;  3A8L B;  2JS0 A;  2JJ9 A;  3JB9 F;  2DA9 A;  2XI9 A;  3G71 T;  4FU6 A;  3Q1J A;  2EW3 A;  2IG0 A;  4J9B A;  1QVP A;  4D8D A;  1VQ8 A;  2RPN A;  4PJN A;  3CCJ Q;  4BE1 A;  2AZS A;  4ZTF A;  4RMO A;  3OBY A;  3BY7 A;  3REB B;  4M78 C;  3QDF A;  2DL4 A;  4E7S A;  4Y28 E;  2FHD A;  3P8D A;  4N4H A;  1UFF A;  2F2X A;  1NEG A;  1ZA1 B;  3CCU A;  3UPU A;  3SEM A;  2LCS A;  5KYN A;  3G6E A;  2NWM A;  3H8Z A;  4OVA A;  3OS5 A;  5EG2 A;  1WXU A;  2KYB A;  4C92 A;  3T9N A;  1BU1 A;  3CCS Q;  3M0S A;  2XIC A;  5CKB A;  2M02 A;  3BDU A;  3JB9 I;  3FC3 A;  2HKN A;  1WJR A;  2RHI A;  5I21 A;  1I81 A;  1GCP A;  4MDW A;  3E2U A;  3LYI A;  2EJ9 A;  3M0T A;  3VS6 A;  2M0Y A;  3TSZ A;  1WHH A;  2ABL A;  1H92 A;  2EQU A;  2PUO B;  1HK9 A;  1TUG B;  2C0O A;  2DRK A;  3M55 A;  5LJ5 j;  1RI0 A;  3QII A;  3CXC A;  1K73 R;  2VUB A;  1WI7 A;  2R57 A;  3HRT A;  2QQA A;  2NLU A;  1HJD A;  1W4S A;  4A63 B;  2O9S A;  2W10 A;  1KG1 A;  2GQV A;  1OU9 A;  1NBE B;  5KYX B;  4O6J A;  1AZE A;  3CCV Q;  1QLY A;  2QA4 A;  4F14 A;  2YRV A;  2DIL A;  3V8J A;  1SEM A;  4M7A C;  4FL6 A;  2CYZ B;  4HXJ A;  1Q95 G;  1SF9 A;  3VV0 A;  2EYQ A;  2M1H A;  1YHQ T;  4OB3 B;  4WCI A;  2DJZ A;  1NPP A;  2O88 A;  3C4S A;  2L8D A;  5LJ5 h;  1OU8 A;  3H9N A;  3QHS A;  4FT2 A;  3WXM B;  1RAH B;  1M9S A;  4HVW A;  2QTV A;  3H0H A;  3SFM A;  3L2Q A;  1QVF P;  2HCK A;  2DEQ A;  2A08 A;  2L3R A;  4AFS C;  1WHK A;  3CPF A;  4LDW A;  4QQG A;  4RKU E;  3HPW A;  4C5I A;  4A4F A;  3KUF A;  4GY5 A;  3CPW P;  3EG3 A;  3EG9 B;  5CKH A;  3CCU T;  4VUB A;  2V26 A;  1PSF A;  3G6E T;  1SKU B;  4P5N A;  2GCX A;  4EMK B;  4TVR A;  3RNJ A;  4PJO G;  4XTY A;  4M75 A;  4RTW A;  1UJY A;  3PMT A;  3V7C A;  1NYF A;  3H6Z A;  3CC7 Q;  1K9A A;  1KQ2 A;  5FU7 C;  3AHU A;  4FM4 B;  4E7H A;  2R5A A;  1TTH B;  4ATO A;  1UTI A;  1TOV A;  2IPO B;  1BI2 A;  5HCK A;  2W0Z A;  3A8M B;  1D1A A;  5KE3 A;  3JCM V;  1QQJ A;  2Z0W A;  1OX8 A;  2K3X A;  3QYG B;  1M27 C;  5GJV B;  2R5M A;  2HQE A;  1SSF A;  4GLM A;  5KYY B;  4JLG A;  2QA4 T;  4M78 D;  2QYZ A;  3VUZ A;  5IHN A;  4HCK A;  1D0Z A;  1ZSZ B;  3KXT A;  1YBY A;  3GLX A;  4HVU A;  3E9F A;  4PJM A;  2QEX T;  1RAE B;  4RTX A;  2HSP A;  3I9Q A;  1MMA A;  4J6W A;  1IHW A;  4E7L A;  1VQ4 A;  4FYV B;  2VGN A;  1GRI A;  1BYM A;  4C92 C;  3FRN A;  2RQR A;  4ZGJ B;  5IH2 A;  2CP7 A;  1AWX A;  1YI2 A;  3JRZ A;  2EIF A;  2L2P A;  2PZ1 A;  3M0U A;  2JUF A;  1NEB A;  2LDM A;  2JOY A;  5CIU A;  4WTO B;  4XK8 E;  4JS5 A;  2AKL A;  4XTZ A;  2DRM A;  2MYS A;  4HKE A;  4PJO E;  1X2K A;  4LE9 A;  1Q81 C;  3EH1 A;  2LTO A;  2XD0 A;  2HSE B;  1DJ7 B;  1I5L A;  1M3C A;  2KNB B;  1WDX A;  2ED1 A;  5CQY A;  5HK0 A;  2NYS A;  2DE0 X;  5GMK i;  3CCE A;  4LNP A;  3M57 A;  3NMZ C;  2JXB A;  3A1P A;  1UB4 A;  4B6M A;  4F16 A;  5AYF A;  2E64 A;  2D8H A;  4OB0 B;  2DVJ A;  3QPH A;  1H8K A;  3INZ A;  3OMG A;  3JB9 H;  1VQ6 Q;  4HT8 A;  2AKK A;  2HKQ B;  1Q81 U;  1M1F A;  1ACM B;  4RTU A;  3CBP A;  5J3B A;  2RM4 A;  3X25 B;  5CQX A;  3EHQ A;  1LNX A;  4PJO B;  4A54 A;  1YCS B;  1VQ9 Q;  3CCM Q;  4C0D B;  4PJL A;  2DVE A;  1SPK A;  2LRQ A;  1VQ4 T;  4M75 C;  2C06 A;  1M1K C;  1M90 R;  1KQS S;  4HVV A;  4J9E A;  2HMA A;  3GF5 A;  4J6Y A;  3UF4 A;  1M2V A;  4ZTJ A;  1IHV A;  5L23 A;  3A8O B;  3I56 Q;  3KBG A;  3RDV A;  1MHN A;  3LW5 E;  5ECA A;  5IHK A;  3U23 A;  1U5S A;  4MZP A;  2ZAE A;  3CCQ T;  2GFU A;  2LQK A;  5HY6 A;  1T0H A;  4M78 G;  4PNO A;  5J26 A;  1K9M C;  2JS2 A;  3CMA Q;  3GNG A;  2VC8 A;  2K4Y A;  3CCS A;  5KYW A;  4A4G A;  3I55 Q;  1SHF A;  2EQI A;  2YXY A;  2KRM A;  2ZCF B;  2EYW A;  2V8I A;  1ZUK A;  1M1K U;  1H3H A;  1MMN A;  3X28 B;  5FU6 B;  1K73 U;  1MND A;  1KD1 C;  4M4Z A;  1WIE A;  3JCM W;  4M78 F;  2DX1 A;  3EFO A;  2RI5 A;  1AEY A;  2RHZ A;  1X75 C;  5LJ5 f;  2FZG B;  3OYA A;  4C92 D;  1B34 B;  1ZA2 B;  3CCV A;  2E3I A;  2CH4 A;  1FXX A;  4M7D D;  2DL7 A;  4OMM A;  4J9G A;  2P0P A;  2WSC E;  2DJQ A;  2GQI A;  5A0L A;  1K9M U;  3UAT A;  2RHU A;  3A8G B;  2F2V A;  5FRN A;  3CCJ T;  3GP8 A;  1YFN A;  3MEW A;  5GAO q;  3EFR A;  3G7Z A;  1CKA A;  3CD6 A;  4J7F A;  4KGV B;  5GAN d;  5GAN 6;  4IUV A;  2XDP A;  4M78 E;  2PU9 B;  3DLL A;  1F1B B;  1KD1 U;  5IT9 E;  4ELY C;  2KI7 A;  4E7I A;  1NG2 A;  1NJI C;  3CC2 Q;  4YTL A;  3X24 B;  5CKF A;  2HQX A;  3ZL7 C;  5GMK l;  3MCA B;  2FZK B;  2FVU A;  5CK9 A;  3CCS T;  4M78 A;  3M9Q A;  2P4R A;  2FZC B;  1JO8 A;  3PVL A;  4IUR A;  1IZ6 A;  1N9R A;  5FW9 A;  2FPE A;  3OYF A;  1D0Y A;  3ULR B;  3UA6 A;  1M5Q 1;  1D3B B;  2FYK A;  3M53 A;  4C8Q A;  2ATC B;  1TS9 A;  3SD4 A;  2QQ9 A;  3OMC A;  1VQO Q;  3IQL A;  4XAX B;  5GAN 5;  4JRK A;  1MMD A;  1OV3 A;  4M75 D;  1U1T A;  3CCV T;  2LT4 A;  1G3W A;  3G71 A;  1YIT Q;  1NJI U;  5CKE A;  1ABQ A;  3RBB B;  2E10 A;  2QDY B;  2CP5 A;  5FRO A;  4KUL A;  4BE2 A;  1TU0 B;  2CZ1 B;  5GAO m;  4LD9 K;  2KY9 A;  3NHN A;  4FT4 A;  1IRE B;  1Q7Y R;  2J6O A;  2CRE A;  3G4S Q;  3X26 B;  3VKI A;  5LJ3 j;  4BDZ A;  4PFP A;  3M4Y A;  2PNI A;  1K1Z A;  5FWB A;  3CXC P;  1T3L A;  1TXQ A;  3CCR Q;  1QVG A;  5FWC A;  2MIO A;  2K57 A;  1X6G A;  2CP3 A;  3NFC A;  3TEE A;  4C92 G;  2RF0 A;  4JZ4 A;  4M7D G;  2KSS A;  2C0I A;  2OTL A;  5GMK e;  1Q82 C;  4Z88 A;  2GTO A;  2VYT A;  2B86 A;  5LJ3 h;  2HQH A;  3L2U A;  1VQ7 A;  1TH7 A;  1OEB A;  1QCN A;  1UHF A;  1YJ9 Q;  2OTJ Q;  2BE9 B;  1BKB A;  2DYI A;  2RQV A;  1ZX6 A;  5CKD A;  3SWN A;  1D1C A;  1ZQ1 A;  2JTE A;  3HFO A;  5I11 A;  4BAC A;  3OSV A;  1TG0 A;  2DET A;  1VQP Q;  3WVD B;  1EZZ B;  4C92 F;  2CGH A;  1Y07 A;  1PD1 A;  1HD3 A;  3GOX A;  4M7A B;  2JM8 A;  4M7D F;  2RH2 A;  1RAF B;  2KQW A;  1GBR A;  3THK A;  2IIM A;  4IIM A;  1JJ2 S;  2DTH A;  2EVR A;  3EGD B;  2M51 A;  2D8J A;  1VQ6 A;  4JLI A;  5LJ5 g;  1KIK A;  1BI1 A;  2O31 A;  2KEA A;  1YHQ A;  1Q81 R;  2F2W A;  2QI2 A;  1YCY A;  2WSF E;  1Q82 U;  2WAC A;  7AT1 B;  3CEY A;  1H64 1;  3L42 A;  3FLG A;  3QDR B;  2G3R A;  4E47 A;  2EYY A;  3CCM A;  5D7U A;  1IGU A;  1M2O A;  1M90 U;  4BY6 C;  1VQL Q;  2K3B A;  3CME Q;  2BE7 D;  2V8K A;  3TU4 K;  3BW1 A;  3OS0 A;  1K76 A;  1WHG A;  4C92 E;  1HXD A;  4M7D E;  1V29 B;  3I56 A;  1W2B S;  1QCF A;  3I5S A;  2KT1 A;  1N27 A;  4MML A;  3VU3 C;  2LMJ A;  3HFN A;  4LD6 A;  4II1 A;  3NGP A;  4M75 G;  1ZSG A;  1YIJ A;  5FU7 B;  1AWW A;  4ZGD B;  4C8Q C;  2XKO C;  2OTL T;  3G1J A;  2FEI A;  4OMP A;  2EAY A;  3SDZ A;  5CVI A;  2P0Q A;  1VQ7 T;  4M7D A;  2EGC A;  3VUB A;  3I55 A;  1PC0 A;  1VQK Q;  1P92 A;  2ROL A;  3MP8 A;  1GL5 A;  3M0R A;  1NYG A;  2DBM A;  2ECZ A;  2EQK A;  2SEM A;  1S72 Q;  4MDX A;  4FYW B;  1QVG S;  2COZ A;  1PG5 B;  1MNE A;  3DB3 A;  2QGF B;  2DL5 A;  4OP0 A;  1M1K R;  3VS5 A;  4M75 F;  4BD3 A;  1RLP C;  4E7J A;  2QDL A;  2P84 A;  4PLI A;  3PNW C;  3E1S A;  5IHI A;  2DPP B;  4J9F A;  3LWI A;  4F7U F;  2J05 A;  1E6G A;  4C92 B;  2FRY A;  3OYN A;  2EGE A;  4XU2 A;  1VQ6 T;  3EG2 A;  4GBQ A;  5CAI A;  2KRN A;  3O8V A;  2K3Y A;  4FCY A;  1HYO A;  2DXC A;  2QEX A;  5D6W A;  1U3O A;  4X9D A;  1FYN A;  1K9M R;  2CP2 A;  4Q5W A;  3RUX A;  2DZC A;  1RAG B;  3CCM T;  4LXC A;  3TVT A;  1Q86 R;  2YUO A;  3LGF A;  3QXE B;  4C0Z A;  3SWN C;  4M75 E;  5IXB A;  1JBM A;  2ESW A;  1Y96 A;  4KBM B;  3GNF B;  2LNH B;  4ZN3 A;  1YJN A;  1LJO A;  3I56 T;  1R0C B;  4ORZ A;  1KD1 R;  3JCM J;  6AT1 B;  2DEU A;  1M1G A;  4IUT A;  1YIJ T;  2D0N A;  1VQ5 Q;  2RQT A;  2DLP A;  2YSQ A;  1Q7Y C;  3UT1 A;  1SRL A;  3CMA T;  1WHJ A;  1WXT A;  1JRI A;  2HZY A;  2RQU A;  2EQJ A;  1HSQ A;  2A36 A;  2VXF A;  1BI3 A;  3I55 T;  4F7U A;  3OYK A;  5KYU B;  1QP2 A;  2GNC A;  2QQB A;  1KQS A;  3F70 A;  1X27 A;  1WNL A;  4J83 A;  2ZPB B;  1WZO A;  3MET A;  5LJ5 e;  2YRC A;  2YRD A;  3RES A;  1WHL A;  4OMF B;  1ZUU A;  2DO3 A;  4M75 B;  2E65 A;  2GF7 A;  2FB7 A;  4E7Z A;  2KRS A;  3EAE A;  1NJI R;  4KRT A;  1K0X A;  4MMK A;  2AHJ B;  4ZGE B;  2X3W D;  1Q7Y U;  3PGG A;  1UGR B;  3PFS A;  1SG5 A;  3JCM c;  2DM1 A;  2YHT A;  1XQH A;  2CS7 A;  2OX7 A;  4PFZ A;  3G4S A;  4M7D C;  2DF6 A;  4EMH A;  4JPB W;  1LCK A;  1FMK A;  2YT6 A;  3VS3 A;  5IXF A;  1OZ3 A;  4C8Q D;  5GAO n;  5LJ3 f;  1WYX A;  1Y57 A;  8ATC B;  3DLM A;  5DM7 R;  2K9G A;  1K8A C;  4Z89 A;  1UDL A;  1UGQ B;  3MHX A;  4MZT A;  3CCQ A;  2DYB A;  1YJN T;  2OI3 A;  2YWW A;  4AT1 B;  4C5E A;  3M59 A;  4ELZ C;  5LJ5 d;  2LC4 A;  4PK4 A;  4HCC A;  2X4Y A;  1Y71 A;  4WF2 A;  4Y92 A;  5DLO A;  4DOW A;  5IAY A;  5GAO r;  2RD1 A;  2AIR B;  1YJ9 A;  4L59 A;  2VXE A;  2Y90 A;  4DQ2 A;  1O75 A;  4ZNX A;  2H3E B;  3VS4 A;  4A4K A;  2RK2 A;  3LH5 A;  3VYG A;  3L1A A;  3OBW A;  2E70 A;  1R77 A;  1D09 B;  1Z9Z A;  2JMC A;  1N5Z A;  3JCM g;  2BIV A;  2JNG A;  1M3A A;  2ZGW A;  4J7I A;  3CBM A;  4BDY A;  1RUW A;  1U1S A;  2DXB A;  2QK0 A;  2XU8 A;  1LVK A;  5I2S A;  1K8A U;  1VQN Q;  4M77 F;  2XDD A;  3PMI A;  1VQO T;  2JW4 A;  5GAM g;  2RQW A;  1OOT A;  1QKW A;  3OYB A;  2JN0 A;  1G3T A;  4OMO A;  4ANJ A;  1Q82 R;  1UEB A;  1KHC A;  3CCJ A;  4QQD A;  3GBQ A;  2DBK A;  1BI0 A;  4O5V A;  3G4S T;  2MF2 A;  4J5Y A;  5CO7 A;  3OYC A;  2GGR A;  2X4W A;  3M5A A;  3RER A;  1UEC A;  3E19 A;  3CCR T;  1AHJ B;  1VQ8 Q;  3OW2 A;  4J9I A;  2DTI A;  2DTO A;  1PRM C;  3VS1 A;  1WHM A;  1WXB A;  5C0M A;  1G3S A;  3CQT A;  1E7O A;  2E3H A;  3V7S A;  5DY9 A;  2A7Y A;  2CP0 A;  4QVD A;  1WQ7 A;  1X6B A;  1Q86 C;  4RG2 A;  1XNI A;  3GIB A;  4JJB A;  1D0X A;  4RTT A;  4MZM A;  3CCU Q;  4LDY A;  2LQW A;  3JSC A;  5J39 A;  1YJ9 T;  2OTJ T;  3MEV A;  5GAN 7;  1M2V B;  1AVZ C;  1NE8 A;  4M77 A;  3CC4 Q;  1S72 A;  4OMQ A;  2O4X A;  4KUI A;  2J06 A;  2CKK A;  3EH2 A;  4RCB A;  4C8Q G;  1QVG P;  5GAM j;  1VQM Q;  2AK5 A;  2DD4 A;  4GLK A;  1ZBJ A;  3RMS A;  3CBO A;  3NTI A;  2HL5 C;  4LDV A;  1OPL A;  1AD5 A;  3L2V A;  4NL2 A;  4RTY A;  2AZV A;  3JCM h;  2YUN A;  1I0C A;  4AG1 C;  5KYW B;  1G2B A;  1X6O A;  4D8K A;  1M8V A;  1JEG A;  2MI6 A;  2E12 A;  1RAD B;  3MEA A;  3QZ5 B;  1H3Z A;  4C8Q F;  1Q86 U;  5KH6 A;  5GAM h;  1G8X A;  2M16 A;  4CRI A;  4NOY A;  2DIG A;  4RTZ A;  1V1C A;  2F5T X;  2IVW A;  1VQL T;  1GFC A;  3HP9 A;  3CME T;  1QWF A;  1NPR A;  2K5I A;  2X4X A;  2BUD A;  3EFO B;  4E6R A;  2CT3 A;  4J9D A;  1S1N A;  4B9W A;  2E5K A;  5LJ3 g;  3OY9 A;  2HL3 A;  1RAA B;  4J9H A;  2D6F A;  3L2Z A;  2J6K A;  2DZ9 A;  1GCQ C;  1JXO A;  2RA2 A;  2DNU A;  1QVF S;  3H0I A;  4KGX B;  2RJF A;  4C0F A;  4LDU A;  3J81 E;  1NLO C;  2MAM A;  1VQ5 A;  3PIO A;  4QKU A;  1JJ2 A;  3M0P A;  3CPW S;  2ZZD A;  2KBT A;  4C8Q E;  4F17 A;  2FPF A;  2L3Q A;  3CCL Q;  3CC7 A;  1EFN A;  2FG0 A;  3FJ5 A;  5M9O A;  3NPF A;  2LCC A;  3JCM e;  1VQK T;  2ZPH B;  4X34 A;  4B9X A;  2NUP A;  2RI2 A;  3OW2 S;  4Y91 A;  3MEU A;  1S72 T;  3HTR A;  1TUC A;  2EQM A;  2LNV A;  4UC4 A;  1FX7 A;  3OS1 A;  2L0A A;  3C0C A;  4EDU A;  5GAM e;  3VYH B;  1JXM A;  1W2B A;  2CUD A;  4DBF A;  2KT8 A;  2LQ8 A;  1QCO A;  2X4J A;  3LX7 A;  4M78 B;  1WJS A;  2CZ6 B;  3P8H A;  3RKW A;  2QG9 B;  2PTK A;  2EFI A;  3TRE A;  4E2F B;  1G83 A;  2DMO A;  1KC8 R;  3EGX A;  3VS7 A;  2KAF A;  1B3Q A;  3J7A F;  2EJF A;  3OYJ A;  2D0Q B;  1YJW Q;  2HAX A;  4K11 A;  4M77 C;  4D6W A;  5C6S A;  3JCM X;  2RMO A;  4IKF A;  1SRM A;  2JTM A;  3HKS A;  4RCC A;  4ESR A;  1SSH A;  4FW2 A;  2HDA A;  4PJJ A;  1YI2 Q;  1KJW A;  1JB0 E;  4N4G A;  3QG1 A;  4OMN A;  2QAZ A;  4F04 B;  2KXD A;  1VQ5 T;  2XDB A;  2RHY A;  3JCM b;  1GBQ A;  1W70 A;  2JT4 A;  2RHX A;  1E6H A;  5KE2 A;  3HRS A;  3CC7 T;  2E5Q A;  2FO0 A;  3OYH A;  3C95 A;  4BE0 A;  1J3T A;  1N8R R;  2LT1 A;  4OF1 A;  1XOV A;  2CT4 A;  1R0B G;  4PLL A;  2XG8 D;  1T3S A;  9ATC B;  4LUE A;  2ENM A;  3CCE Q;  5DLQ E;  1MMG A;  1B07 A;  1W6X A;  2EWN A;  3R6O A;  3A8H B;  1YWP A;  3A98 A;  2MWO A;  3ZBD A;  4FSS A;  3FB9 A;  1K8A R;  1WQW A;  3V7R A;  4BB7 A;  2YUP A;  1VYV A;  1U8R A;  4HCB A;  2G6F X;  3QJY A;  2CP6 A;  2EGA A;  1IXD A;  2KVQ G;  1BIA A;  4IUU A;  4IUQ A;  4KH1 B;  3FIF A;  1EX4 A;  3SWN B;  2BZY A;  4XQ3 A;  2LJ3 A;  1C1A A;  1M30 A;  1VQ9 A;  1Z9Q A;  5AT1 B;  1FMW A;  4XTX A;  3DKM A;  8AT1 B;  2PUK B;  1KQS P;  3V8L A;  4LDX A;  5LJ3 e;  2A3L A;  4CC2 A;  4PJO D;  3ER0 A;  2VWF A;  2NUT B;  1PM3 A;  4DEY A;  2EJG A;  3UWN A;  1FMV A;  2GFA A;  4XU0 A;  3N5B B;  5GAN 2; 
#chains in the Genus database with same CATH homology
 3KBG A;  3RES A;  3S3N A;  1MHN A;  2ZPE B;  3LW5 E;  4OMF B;  2RJC A;  2E1H A;  1RL2 A;  2HD0 A;  2DO3 A;  4Z02 A;  3CMA A;  4M75 B;  4MZP A;  4F7U G;  1ZBX A;  2E65 A;  1KHI A;  2RK1 A;  2GF7 A;  2GFU A;  3CCQ T;  2LQK A;  5HY6 A;  4V2S A;  2FB7 A;  2ZPG B;  4M78 G;  5A0D A;  4PNO A;  1VUB A;  5J26 A;  3EAE A;  1K9M C;  5FU6 C;  4MMK A;  2AHJ B;  2XHC A;  4ZGE B;  3OB9 A;  3GNG A;  2DXT A;  3PGG A;  3OYD A;  2VC8 A;  1Q7Y U;  1UGR B;  2K4Y A;  3PFS A;  3CCS A;  3JCM c;  2YHT A;  1XQH A;  2CS7 A;  1WPY A;  3ASK A;  3JCM f;  4A4G A;  3CC4 A;  3G4S A;  4C8Q B;  4M7D C;  3JCM d;  4EMH A;  3QKJ A;  2O01 E;  5A0G A;  5L8R E;  3HRU A;  3LLR A;  4HA8 A;  2XK0 A;  4M7A E;  1VQM A;  2VV5 A;  2ZCF B;  4C0G A;  3V8K A;  4OB2 B;  1OZ3 A;  2V8I A;  4C8Q D;  5GAN 8;  5GAO n;  3JCM P;  2RB6 A;  5LJ3 f;  1WJQ A;  1GXI E;  3S3O A;  1M1K U;  1Y7X A;  2DKG A;  5FU6 B;  5LJ3 d;  3X28 B;  1K73 U;  2DXU A;  3JAM E;  1KD1 C;  3DLM A;  4C5G A;  5GAM f;  5DM7 R;  1K8A C;  3RMQ A;  5GAM d;  1UGQ B;  2P0K A;  3MHX A;  3JCM W;  4MZT A;  3CCQ A;  1YJN T;  4M78 F;  4PKC C;  1VQN T;  5HK3 A;  3CD6 T;  1VIE A;  3HL8 A;  4M7D B;  2RI5 A;  5A2Q E;  3OYM A;  4C5E A;  2RHZ A;  1X75 C;  3M59 A;  5LJ5 f;  4ELZ C;  1OZ2 A;  1XTD A;  5LJ5 d;  3OYA A;  2LC4 A;  1EIF A;  4C92 D;  1B34 B;  4R55 A;  3CCV A;  4HCC A;  2MMP A;  3JCM Q;  3A5Z B;  4M77 D;  4M7A A;  1FXX A;  2X4Y A;  2XID A;  1Y71 A;  4M7D D;  1G5V A;  4WF2 A;  4IUP A;  5DLO A;  4DOW A;  5IAY A;  5GAO r;  2P0P A;  2RD1 A;  2WSC E;  3GPL A;  1YJ9 A;  4L59 A;  1VQ9 T;  2VXE A;  5A0L A;  2B8A A;  2Y90 A;  1K9M U;  4DQ2 A;  1O75 A;  1WGS A;  4A4E A;  3S6W A;  3OQ5 A;  3OYL A;  3RKY A;  4FSX A;  4A4K A;  2JTF A;  2RK2 A;  1M90 C;  4C5H A;  2HBP A;  4FIB A;  2RHU A;  3A8G B;  3L1A A;  3OBW A;  3VYG A;  2E70 A;  5FRN A;  4L6V 5;  3CCJ T;  3GP8 A;  3E9G A;  3JB9 G;  3MEW A;  4BI8 B;  5GAO q;  4EMK A;  4NL3 A;  3EFR A;  2QQS A;  3G7Z A;  3TCJ A;  1BIB A;  3JCM g;  5GAO l;  2BIV A;  2KDS A;  1LOJ A;  2JNG A;  1I4K 1;  5GAN f;  3CD6 A;  1VQ8 T;  4J7F A;  4XTU A;  1VQN A;  5GAN d;  4F7U E;  2ZGW A;  3MO8 A;  4IUV A;  4J7I A;  5GAN 6;  3CBM A;  1X01 A;  2XDP A;  4BDY A;  3ZEH A;  4M78 E;  3PTA A;  3CC2 A;  3QO3 A;  2PU9 B;  3LH0 A;  3DLL A;  2DXB A;  1U1S A;  2XU8 A;  4RG8 A;  4DA4 A;  3JB9 J;  2QXF A;  5IT9 E;  1KD1 U;  2DIQ A;  4ELY C;  5I2S A;  1K8A U;  2RJE A;  4M77 F;  4X9C A;  2XDD A;  3PMI A;  3LWH A;  1VQO T;  4E7I A;  1FWZ A;  5GAM g;  1KC8 C;  1NJI C;  5FRM A;  4YTL A;  5GAN 3;  3OYB A;  4XU3 A;  3C94 A;  2P4T A;  2JN0 A;  3S3M A;  3X24 B;  5CKF A;  1G3T A;  4QW2 A;  3M58 A;  5KCH A;  2HQX A;  3CCL A;  1UEB A;  5GMK l;  1KHC A;  1PSE A;  3MCA B;  4ME7 A;  2FVU A;  5HKC A;  4QQD A;  3OS2 A;  2E41 A;  3CCJ A;  3A8L B;  3JB9 F;  2XI9 A;  3BDL A;  2LX9 A;  5CK9 A;  3G71 T;  3CCS T;  4M78 A;  4FU6 A;  1Y96 B;  1OYX A;  3M9Q A;  3Q1J A;  1BI0 A;  2IG0 A;  4O5V A;  3CC4 T;  3G4S T;  2MF2 A;  4JS4 A;  1QVP A;  2F5K A;  4J5Y A;  5CO7 A;  5CCA A;  3OYC A;  1VQ8 A;  1M4Z A;  4BE1 A;  4ZTF A;  4IUR A;  4RMO A;  3OBY A;  1VQM T;  2X4W A;  3M5A A;  3RER A;  3BY7 A;  3E19 A;  1IZ6 A;  3CCR T;  4M78 C;  1AHJ B;  1N9R A;  3OW2 A;  4QVZ A;  3FDR A;  2DTI A;  2E6Z A;  5D6Y A;  1VQO A;  2DTO A;  2QQR A;  3OYF A;  2L89 A;  4CI0 C;  4Y28 E;  2FHD A;  1NZ9 A;  3P8D A;  4EMG A;  5GAN g;  1M5Q 1;  4N4H A;  1D3B B;  2FYK A;  3M53 A;  1YIT A;  4C8Q A;  5C0M A;  1G3S A;  3SD4 A;  2QQ9 A;  3OMC A;  3V7S A;  4XAX B;  4JRQ A;  2FL7 A;  5GAN 5;  1QP3 A;  5DY9 A;  4JRK A;  2A7Y A;  1N9S A;  4QVD A;  3CCU A;  3UPU A;  1WQ7 A;  4M75 D;  4F7U B;  1U1T A;  3CCV T;  3G6E A;  3VJP A;  2LT4 A;  1G3W A;  3G71 A;  1Q86 C;  4RG2 A;  1NJI U;  1KC8 U;  1XNI A;  1N8R C;  5CKE A;  3QZ9 B;  3GIB A;  3H8Z A;  2E10 A;  2QDY B;  4PJO F;  5FRO A;  4KUL A;  4MZM A;  4OVA A;  4EPC A;  4BE2 A;  4LDY A;  3JSC A;  3OS5 A;  5J39 A;  5EG2 A;  1YJ9 T;  2OTJ T;  3MEV A;  2CZ1 B;  5GAN 7;  3EFS A;  4C92 A;  3T9N A;  5GAO m;  4LD9 K;  2KY9 A;  1O9S A;  2PQW A;  1NE8 A;  2XIC A;  1IRE B;  4FT4 A;  4M77 A;  5CKB A;  4R56 A;  1YJW A;  3BDU A;  3JB9 I;  2HNI A;  2O4X A;  3FJP A;  1WJR A;  2RHI A;  4KUI A;  3FC3 A;  3CCR A;  3X26 B;  2CKK A;  3VKI A;  4RCB A;  1I81 A;  4C8Q G;  5I21 A;  5LJ3 j;  4BDZ A;  4MDW A;  3M4Y A;  2RI3 A;  4A53 A;  3LYI A;  5GAM j;  2EJ9 A;  2DD4 A;  4GLK A;  3CXC S;  2KK4 A;  4N0A A;  3L2R A;  3RMS A;  3CBO A;  3NTI A;  1QVG A;  4LDV A;  2EQU A;  2PUO B;  1HK9 A;  3M55 A;  5LJ5 j;  3CXC A;  2JZ2 A;  3L2V A;  1OI1 A;  1RI0 A;  3QII A;  4NL2 A;  2VUB A;  2K57 A;  2R57 A;  3HRT A;  2QQA A;  3TEE A;  3NFC A;  3JCM h;  4C92 G;  2NLU A;  4DOV A;  3OSS C;  1KQ1 A;  1W4S A;  3NTH A;  5GMK m;  4XU1 A;  2KMT A;  4M77 G;  1KG1 A;  2GQV A;  2KSS A;  4M7D G;  2OTL A;  1X6O A;  2LVM A;  5GMK e;  1Q82 C;  4O6J A;  3X20 B;  4E7K A;  2OTJ A;  1M8V A;  2VYT A;  2QA4 A;  1S72 A;  2MI6 A;  2YLC A;  2YRV A;  5LJ3 h;  3OYG A;  3L2U A;  2E12 A;  3CCL T;  1TH7 A;  1VQ7 A;  4M7A D;  3MEA A;  3QZ5 B;  3V8J A;  4A4H A;  4M7A C;  4FL6 A;  4C8Q F;  1Q86 U;  5KH6 A;  2CYZ B;  5GAM h;  1H3Z A;  1N8R U;  2M16 A;  4CRI A;  4NOY A;  2DIG A;  2EYQ A;  1BKB A;  2M1H A;  3VV0 A;  1YHQ T;  4OB3 B;  4KUD K;  4BI3 A;  2F5T X;  2K2V A;  2K5L A;  2IVW A;  2V8J A;  1VQP A;  1VQL T;  2DJZ A;  3HP9 A;  5CKD A;  1NPP A;  1VIF A;  3LGL A;  3CME T;  3C12 A;  3SWN A;  2JVV A;  1NPR A;  3C4S A;  5GAN j;  2K5I A;  1ZQ1 A;  2L8D A;  5LJ5 h;  3QHS A;  4FT2 A;  2X4X A;  2BUD A;  3HFO A;  3WXM B;  4BAC A;  4J6X A;  3OSV A;  2DD5 A;  1R8O B;  1M9S A;  3SFM A;  3WVD B;  4B9W A;  4JJN K;  2YLB A;  4C92 F;  2CGH A;  4PJO A;  4JUV A;  1Y07 A;  2DK3 A;  4EMK C;  5LJ3 g;  3OY9 A;  3L2Q A;  2D6F A;  2DEQ A;  2Y4X A;  4M7A B;  3GOX A;  3L2Z A;  2RH2 A;  2DZ9 A;  4M7D F;  5GAO p;  3ME9 A;  2KQW A;  2RA2 A;  1QVF S;  2L3R A;  3CPF A;  4RKU E;  4LDW A;  4QQG A;  4BI4 A;  3HPW A;  2RJF A;  3M56 A;  4C0F A;  4C5I A;  1QVF A;  4LDU A;  3J81 E;  1MGQ A;  1YIT T;  4PL6 A;  3KUF A;  2DTH A;  4GY5 A;  4A4F A;  2MAM A;  3MP1 A;  1JJ2 S;  1VQ5 A;  1VQ6 A;  4JLI A;  3P8B B;  3PIO A;  5LJ5 g;  1JJ2 A;  5CKH A;  3CCU T;  1BI1 A;  4VUB A;  2ZZD A;  3CPW S;  3QUI A;  1YHQ A;  1PSF A;  4C8Q E;  3G6E T;  2WSF E;  1YCY A;  2QI2 A;  2GCX A;  4P5N A;  3M54 A;  5LL6 S;  4EMK B;  2WAC A;  5GAN h;  4TVR A;  3CPW A;  3CEY A;  2LCL A;  4JRI A;  3CME A;  1H64 1;  3CC7 A;  3NTK A;  4JRP A;  3QSU A;  2R58 A;  4PJO G;  3L42 A;  3FLG A;  3QDR B;  2G3R A;  4E47 A;  3BFM A;  4J8O A;  2M9U A;  4XTY A;  4M75 A;  2LCC A;  5M9O A;  3JCM e;  3PMT A;  3UDC A;  3CCM A;  1M90 U;  1VQK T;  2ZPH B;  4X34 A;  4B9X A;  2EKO A;  3V7C A;  2RI2 A;  4BY6 C;  4Y91 A;  3OW2 S;  4HT9 A;  3MEU A;  3H6Z A;  1YJW T;  2V8K A;  1KQ2 A;  5FU7 C;  3TU4 K;  1S72 T;  3AHU A;  4ZN1 A;  3BW1 A;  4FM4 B;  4OB1 B;  4N4I A;  3OS0 A;  2EQM A;  4C92 E;  2LNV A;  4E7H A;  2R5A A;  4UC4 A;  1HXD A;  1FX7 A;  3OS1 A;  4ATO A;  4M77 E;  4M7D E;  2VGM A;  1K73 C;  1BI2 A;  1V29 B;  4EDU A;  5GAM e;  3VYH B;  3OA6 A;  3I56 A;  1W2B S;  1YI2 T;  3A8M B;  1N27 A;  3PT9 A;  4MML A;  3DB4 A;  3VU3 C;  2I2L A;  1W2B A;  3HFN A;  4LD6 A;  5KE3 A;  2F69 A;  2LQ8 A;  4II1 A;  3JCM V;  5IN1 A;  4M75 G;  2X4J A;  2ZPF B;  3QBY A;  1YIJ A;  5FU7 B;  1N6A A;  3LX7 A;  4M78 B;  3QYG B;  2K3X A;  1WJS A;  2CZ6 B;  3P8H A;  3RKW A;  2R5M A;  4C8Q C;  4ZGD B;  2XKO C;  3J80 E;  2OTL T;  2HQE A;  1SSF A;  2PVD B;  2EAY A;  2EFI A;  3SDZ A;  1VQK A;  5CVI A;  4JLG A;  3TRE A;  5CR2 A;  3RIR A;  3SB2 A;  4M78 D;  3OYE A;  2P0Q A;  3VUZ A;  2QA4 T;  1VQ7 T;  4M7D A;  4NS5 A;  3KXT A;  1YBY A;  2ZPI B;  3GLX A;  2KAF A;  3E9F A;  3VUB A;  2QEX T;  3J7A F;  3PIP A;  3I55 A;  4QQ6 A;  2EJF A;  1B34 A;  1P92 A;  4J6W A;  4E7L A;  1VQ4 A;  2WSE E;  3MP8 A;  2VGN A;  3OYJ A;  1VQP T;  1BYM A;  2D0Q B;  3FRN A;  4C92 C;  2HAX A;  2EQK A;  4MDX A;  4ZGJ B;  1QVG S;  3MP6 A;  4M77 C;  4D6W A;  5C6S A;  3DB3 A;  3JCM X;  1YI2 A;  4OP0 A;  4IKF A;  3JRZ A;  5GAN e;  2JTM A;  3HKS A;  4RCC A;  3CCE T;  2EIF A;  4M75 F;  2JUF A;  2L5Q A;  2PVO B;  4BD3 A;  2LDM A;  2JOY A;  5CIU A;  4E7J A;  4OGE A;  4XK8 E;  3PNW C;  4PLI A;  3E1S A;  4JS5 A;  1JB0 E;  2M0O A;  4N0A C;  2DPP B;  3QG1 A;  4N4G A;  5I2M A;  3LWI A;  4XTZ A;  4HKE A;  4F7U F;  4PJO E;  4C92 B;  1Q81 C;  1Q82 U;  3OYN A;  2LTO A;  4XU2 A;  1VQ5 T;  2XDB A;  4M77 B;  2RHY A;  1VQ6 T;  2XD0 A;  2CZ7 B;  5CAI A;  2O4X B;  3JCM b;  3O8V A;  2K3Y A;  3RKX A;  2DXC A;  2QEX A;  2OAU A;  1DJ7 B;  5D6W A;  2BKD N;  1I5L A;  2RHX A;  3HHT B;  5KE2 A;  4X9D A;  3HRS A;  1QW1 A;  3QYH B;  3CC7 T;  4Q5W A;  3RUX A;  4OGC A;  2DZC A;  2E5Q A;  5CQY A;  3OYH A;  3C95 A;  4KT0 E;  3CCM T;  4BE0 A;  5HK0 A;  4L5G A;  4XTW A;  5GMK i;  3ZFJ A;  3CCE A;  2E6N A;  3LGF A;  3M57 A;  2LT1 A;  3QXE B;  4C0Z A;  1VQL A;  4OF1 A;  1XOV A;  3SWN C;  4M75 E;  4PLL A;  3OYI A;  2XG8 D;  1JBM A;  3JB9 D;  1UB4 A;  5DLQ E;  2D9T A;  1Y96 A;  2PVG B;  4KBM B;  3HSB A;  3GNF B;  4ZN3 A;  2EWN A;  1YJN A;  1LJO A;  3R6O A;  3I56 T;  4PJO C;  3A8H B;  1G3Y A;  5AYF A;  4M7A G;  2E64 A;  3FEO A;  2MWO A;  4OB0 B;  3ZBD A;  3JCM J;  3FB9 A;  3QPH A;  1WQW A;  3V7R A;  4BB7 A;  4C0D C;  1M1G A;  1U8R A;  3INZ A;  2K5F A;  2RO0 A;  3QJ6 A;  4IUT A;  3QJY A;  4HCB A;  1YIJ T;  3OMG A;  3JB9 H;  5GMK j;  5FLX E;  2KVQ G;  4HT8 A;  1BIA A;  4IUU A;  4IUQ A;  2QTX A;  3FIF A;  3SWN B;  1Q7Y C;  2DAQ A;  4XTV A;  4XQ3 A;  1Q81 U;  1M1F A;  1UGP B;  3UT1 A;  3URG A;  1ZHI A;  3CMA T;  1VQ9 A;  1D3B A;  3CBP A;  3OYY A;  1JRI A;  5J3B A;  2RM4 A;  3X25 B;  5CQX A;  2VXF A;  2EQJ A;  5GAN 4;  2CZ0 B;  1LNX A;  1BI3 A;  4XTX A;  4PJO B;  3L2W A;  2RJD A;  4BUG A;  3DKM A;  4A54 A;  2H3J A;  2PUK B;  1I8F A;  3I55 T;  4HCZ A;  4F7U A;  3V8L A;  3OYK A;  4C0D B;  4QVC A;  1UGS B;  4LDX A;  2DVE A;  2LRQ A;  5LJ3 e;  1VQ4 T;  4M75 C;  2C06 A;  2A3L A;  1M1K C;  1QP2 A;  4PJO D;  1KQS S;  3WVE B;  2X35 A;  3CC2 T;  3GF5 A;  3ER0 A;  4J6Y A;  4M7A F;  1KQS A;  2QQB A;  3F70 A;  1WNL A;  3M4G A;  2Y4Y A;  4J83 A;  5KCO A;  2MWP A;  2EJG A;  5GMK h;  2ZPB B;  4BY6 B;  3MET A;  5D6X A;  3UWN A;  4ZTJ A;  2GFA A;  4JDS A;  4XU0 A;  5LJ5 e;  3N5B B;  3A8O B;  5GAN 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...