2EW3A

Solution structure of the sh3 domain of human sh3gl3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
MDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SH3-containing GRB2-like protein 3
publication title Structural Basis for the Binding Specificities of Huntingtin Proline-Rich Region with SH3 and WW Domains
rcsb
source organism Homo sapiens
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ew3A00
5FW9A 2EW3A 2KRSA 1CKBA 1NYGA 2KYMA 4GBQA 4J9DA 3KFVA 2RMOA 1GRIA 2KRNA 1B07A 5IH2A 1AZGB 2O2OA 2EQIA 1ABOA 4JJBA 2MCNA 2JMCA 4E6RA 1YWOA 3H0IA 4HVVA 1Z9QA 1HSQA 2DMOA 3VS4A 3UF4A 1WXUA 2KT1A 1OV3A 1UECA 4EIKA 2XMFA 1K76A 1UHCA 1VA7A 1N5ZA 2A08A 5IXFA 4AFUC 3U23A 1M3AA 2A28A 1UFFA 3PVLA 1SSHA 2I0NA 2DX1A 1GCPA 2GTOA 1K4US 1W1FA 2GTJA 1NG2A 3A98A 3C0CA 5FWCA 1WIEA 2EYYA 3IQLA 2ROLA 2D1XA 2KBTA 1M3CA 1GBQA 1W70A 1TUCA 1FYNA 4RTUA 2X3XD 1TG0A 1U5SA 4K11A 1GFDA 4F16A 1H3HA 2ENMA 4HXJA 1PRMC 2P4RA 3SEMA 2G6FX 1IO6A 3JV3A 1G83A 1UHFA 1I1JA 1QWEA 2DJQA 2ED0A 2W10A 4RTWA 1PWTA 2EVRA 4J9HA 3REAB 4JPBW 1HJDA 2HDAA 4RTTA 4F17A 1YCSB 2MOXA 2BZYA 2K7AA 2JT4A 3UA6A 3NHNA 4IIOA 2YUQA 3I35A 3O5ZA 2DRKA 2AZVA 2KE9A 4RUGA 1M30A 1J3TA 4QT7A 1GCQA 4Y92A 2M0YA 4HCKA 2F2XA 2KROA 3ZL7C 3M0UA 2SEMA 2EBPA 1YN8A 2DE0X 2K3BA 2V1QA 4R0KA 3VS7A 1JXOA 2CREA 4GLMA 1RLQC 4JJCA 1W6XA 4F14A 1MUZA 2CT4A 2LNHB 2QDLA 2DM1A 1AD5A 3PE0A 2FRYA 2OAWA 1ZX6A 4RTYA 4M4ZA 2K2MA 4AG1C 2J7IA 1M27C 4JJDA 2OJ2A 3TSZA 2YDLA 2KGTA 4Z88A 2JS2A 1PRLC 1ZSGA 2HSPA 1WI7A 4CC7A 2JMAA 1SPKA 4Z8AA 1U3OA 3R6NA 1SHFA 2BTTA 2F2WA 3VRZA 4D8KA 2AZSA 3UA7A 2FPDA 2DBMA 2C0TA 1AOJA 1YNZA 2DLPA 4AG2C 3LH5A 2VWFA 1YP5A 1NEBA 2KRMA 2NWMA 1Y57A 1MV3A 4IIMA 2EGEA 2K6DA 5IXBA 2NUZA 1RUWA 1UDLA 1V1CA 1JU5C 2D0NA 2RQVA 4JZ3A 4J9CA 1AVZC 2H8HA 1RI9A 1MV0B 1E7OA 2DYBA 5I22A 1PKSA 1ZUUA 2CUBA 2CDTA 2PNIA 2ROTA 2ED1A 4LUEA 1SHGA 2L2PA 1WXBA 4J9GA 4AFSC 4OMMA 2DA9A 2L3QA 3RNJA 2O31A 4ZNXA 3EG1A 1VYVA 2LQNA 1T3LA 3M0RA 2A37A 2KXCA 2KNBB 1NLPC 3GBQA 2BZXA 2YUOA 2DL8A 5L23A 2FRWA 1JXMA 2ESWA 4LUDA 2FO0A 2RQUA 1ZBJA 3TVTA 2JS0A 2JXBA 1AZEA 1KSWA 1ZUKA 4CC2A 4FSSA 3M0TA 2KR3A 3VS3A 4OMLA 4D8DA 1QCFA 1UUEA 1OPKA 1TUDA 1GCQC 1JEGA 1X27A 2CH4A 1NLOC 2C0IA 1GBRA 4DEYA 2K9GA 1K0SA 2CSQA 5FWBA 2CSIA 4OMPA 1KJWA 2GBQA 1JO8A 2EPDA 3QWXX 5I11A 5IHIA 2DILA 1K9AA 1T0HA 3EG0A 3FJ5A 1WA7A 2KXDA 4ESRA 2EYWA 1U06A 2RNAA 1UE9A 1M8MA 2DF6A 3H0FA 4JZ4A 2YSQA 2HEQA 4RTXA 1H92A 2CUDA 2FPFA 3I5SA 2RQRA 3M0PA 2A36A 1QLYA 2ECZA 1T0JA 2AKLA 1LCKA 2YUPA 2JW4A 3VRYA 1B3QA 2J05A 2DL7A 2J06A 1E6GA 3CQTA 3VS1A 1SRMA 3EHQA 1OOTA 1UG1A 4J9EA 1XOVA 3H41A 1ABQA 4A63B 3VS0A 4OMQA 2EKHA 1FMKA 2O9VA 2IIMA 2J6FA 2DBKA 2JM8A 4LN2A 2RF0A 3THKA 1BU1A 1X2QA 3I9QA 1YWPA 1QKXA 1SEMA 2D8JA 1SRLA 2J6KA 4LE9A 2KEAA 2AK5A 1ARKA 3I5RA 3UATA 2JTEA 1BK2A 1S1NA 4AFZC 1WYXA 2SRCA 1OPLA 2GQIA 2EYZA 3M0SA 1G2BA 1KIKA 2DNUA 3EGUA 2EYXA 2YUNA 1UJ0A 1KFZA 2VKNA 1NEGA 4OMNA 1UJYA 5GJWB 2L0AA 2B86A 4KRTA 2RQTA 5ECAA 4J9BA 1OEBA 1EFNA 3EHRA 1PNJA 4J9FA 2LJ0A 3RBBB 1NM7A 4LNPA 1HD3A 4Z89A 3NGPA 4DEXA 1QWFA 1UTIA 1X43A 2CT3A 3EG3A 2O88A 2ABLA 5EC7A 2CH4W 1ZLMA 4J9IA 2KYBA 1X6BA 1E6HA 1X2KA 1Z9ZA 4RTZA 2HCKA 3REBB 4HVUA 1QKWA 1AEYA 2LQWA 1K1ZA 4CC3A 5HCKA 1UGVA 1CKAA 2V1RA 2YT6A 1BBZA 1GL5A 2X3WD 3TSWA 2RQWA 2C0OA 3VS6A 1WLPB 2F2VA 1AWOA 1K0XA 1BB9A 2LP5A 2MIOA 2DL5A 2DRMA 2LZ6B 2FG0A 2L3SA 2LCSA 3QWYA 1M3BA 1Y0MA 3EG2A 2KT8A 3ULRB 5IHKA 2FEIA 2RPNA 2AKKA 2M51A 1VYTA 1I07A 1RLPC 2EGCA 2JM9A 1CSKA 1PKTA 1NYFA 4OMOA 4RTVA 4X1VA 2J6OA 2PZ1A 2LMJA 1WFWA 1WX6A 2BZ8A 2K79A 4WCIA 2E5KA 5IHNA 3SHWA 1X6GA 4HVWA 1X69A 2VVKA 2LJ3A 3PVQA 1T3SA 4ORZA 2GGRA 1WDXA 2FPEA 2DL3A 5GJVB 2RN8A 2PTKA 1GFCA 3VS2A 2OI3A 1AWXA 1ZUYA 3H0HA 2HBWA 1JQQA 3VS5A 2O9SA 3NPFA 1WXTA 2DL4A 2L3PA 2LX7A 4AFQC 2W0ZA 2GNCA 1VYUA 1H8KA 1PHTA 2D8HA 3NMZC 1AWJA 2DVJA 2EGAA 4CC4B 1A0NB 2LJ1A 1I0CA 1AWWA 3M0QA
chains in the Genus database with same CATH superfamily
4QVCA 2KRSA 1NYGA 1F1BB 2KYMA 3TQ7P 1YIJQ 1VQ5T 3LGFA 4J9DA 3M59A 4KH0B 1YHQA 4N4GA 4EMKB 1AZGB 4PJOB 2X51A 1ABOA 3MPUB 4JRIA 4E6RA 1EZZB 4M77D 2QI2A 3CC4Q 4A53A 2XDBA 2ZPGB 2DO3A 3LX7A 4M78A 3OYBA 1C0MA 2DMOA 3VS4A 2EJFA 1VQ9Q 2QA4Q 1WXUA 2CZ7B 2KT1A 2QQRA 4J6YA 1M90C 1N5ZA 5C6SA 1TWBA 3GLXA 3EFSA 3U23A 3MO8A 5J39A 5GMKl 4XAXB 2E64A 5FU7C 3FC3A 3C4SA 1W1FA 1QP2A 2OTLA 2BIVA 2JJ9A 3CCSA 4M7DG 1NJIC 1I81A 3RMQA 3URGA 4OB3B 4LD9K 5A0LA 2RH2A 1FYNA 2X3XD 2RHXA 1GFDA 3HSBA 3PIOA 2P0QA 1H3HA 2ENMA 2FHDA 2JNGA 1IO6A 3JV3A 1UHFA 2M1HA 1IRXA 1BIAA 3KBGA 4M7DD 1S72Q 3J7AF 1HJDA 2HDAA 4F17A 5C0MA 1YCSB 1YI2A 2MOXA 2R57A 2K7AA 3NHNA 4IIOA 1LOJA 2L8DA 1OZ3A 4FL6A 3I56A 2E10A 1KQ2A 2XDPA 4M75C 1J3TA 2FYKA 1Q7YU 1ACMB 2K3BA 5LJ3f 4R0KA 4E7IA 3VS7A 1JXOA 2CREA 1X01A 2R5AA 2X4JA 1LPLA 2P84A 1W6XA 2HL5C 4ZGEB 3VUZA 3GP8A 1AD5A 4JDSA 3OS1A 2FRYA 4E7HA 3X28B 5IAYA 1FMVA 2DTOA 3CCLT 1W2BA 2K2MA 3LYIA 2OJ2A 2YDLA 1KG1A 3RKWA 2HSPA 2PVOB 4ZGDB 4M77E 5LJ5f 1TSFA 3MEUA 1U3OA 5DM7R 4JS4A 3CBPA 1WJRA 3VRZA 1VQPQ 4ANJA 1X6OA 2CP7A 3CMAT 2DFUA 2GCXA 4C5GA 4D6WA 2HNIA 1IB8A 5GAMh 2VXEA 2DLPA 1C6VX 3JCMX 3LH5A 1YHQQ 3CXCP 1JB0E 3FB9A 5KYYA 1KHIA 4A4FA 2EKOA 3CPWP 4KULA 3L2QA 4IIMA 2XU8A 2K6DA 5IXBA 2NUZA 1JU5C 1HXDA 3UWNA 3S3MA 2EQJA 2MF2A 1MV0B 2E5QA 4IUQA 4LD6A 1VUBA 5I22A 3CXCS 2CP3A 2V8IA 1B7TA 1PKSA 2CDTA 2D6FA 5LJ3d 1WXBA 2K57A 4J9GA 2L3QA 3EG1A 4R55A 2A3LA 3H6ZA 5CKBA 4C92G 2LCCA 3GBQA 3QPHA 2YUOA 5L23A 4M7DE 2ESWA 4C0DB 5CKDA 5D7UA 2OTLQ 3I55A 3S6WA 2FO0A 3CCSQ 2JS0A 2MPXC 1JJ2P 1VQ4T 1U1TA 3AHUA 4CC2A 3M57A 1VOMA 4ATOA 3QO3A 4M7AF 1GCQC 1JEGA 1X27A 5LJ5d 4C92D 3CCJT 4OP0A 1JJ2S 2HZYA 1G3SA 1K73R 1VQ8T 4C8QD 3OYFA 4ZN3A 3FLGA 1YI2Q 1K9AA 1ZSZA 3EG0A 1M1KR 3FRNA 3L2UA 1Q82R 1M5Q1 1QVFA 1WA7A 3EFOB 4PLLA 1LJOA 2JTMA 3PFSA 4ESRA 2BE7D 2EYWA 4B6MA 1UE9A 4JZ4A 3H0FA 4E7JA 2HEQA 3I56Q 1YJNA 5GAMe 2PVDB 3I5SA 4X34A 1UGSB 2EJ9A 3OB9A 2A36A 1QLYA 5GMKj 3CCRA 3VRYA 4FYXB 4BY6B 2Y4YA 4PFZA 3JCMb 1E6GA 3VU3C 2ATCB 2ZPHB 5IN1A 3OQ5A 4ZGJB 2EKHA 3L2RA 3LGLA 4EMHA 3JCMW 4C5HA 4M77A 4VUBA 1U8RA 4HA8A 3A8MB 4LN2A 3THKA 3QZ5B 2K3XA 1BU1A 1YWPA 5KYNA 1SRLA 2FVUA 2J6KA 3OS0A 3C94A 3BY7A 5GAN6 1BIBA 1HYOA 5GANf 1BK2A 1S1NA 5KCHA 4AFZC 2SRCA 1OPLA 2EYZA 5GAN5 1G2BA 1KIKA 2AHJB 2YUNA 1NEGA 1WHJA 2HQHA 1Y07A 1O75A 1WHMA 2L0AA 4M78F 3RKYA 4B9WA 5FROA 1TTHB 1UGRB 2XICA 2LJ0A 1NM7A 4MZMA 1UTIA 1X43A 1ZQ1A 2CT3A 4Q5WA 1OZ2A 2CH4W 4J9IA 1X6BA 1E6HA 1Z9ZA 4RTZA 2HCKA 3G71T 4PK4A 2ZPFB 4M7DA 2NYSA 4RMOA 2XD0A 3PMTA 1K73U 2VUBA 3M5AA 4RG8A 3V7RA 4C92E 1AWOA 1K0XA 2LP5A 2MIOA 3OYHA 2X35A 3QYGB 2LZ6B 1PD1A 4C8QE 1W4SA 2GFUA 5GANh 3I55Q 3JB9H 4EMKC 5GAN2 4PJOC 2RI5A 2E3HA 1M3BA 5EG2A 2MWPA 2D9TA 4FW2A 3ZFJA 1I8FA 3HP9A 1VYTA 1RLPC 2EGCA 4RTVA 1YJ9T 1PC0A 3QSUA 2LMJA 5D6WA 2K79A 3QG1A 1X6GA 3BW1A 3EAEA 4HVWA 4M75G 4BI8B 1D0ZA 1G3YA 3PVQA 3T9NA 1WDXA 2DPPB 4M75F 2OI3A 1M2VB 2CP0A 3P8HA 2HBWA 1JQQA 1QVGA 5CQXA 2K2VA 1YJNQ 3JRZA 2LX7A 3FJPA 1AWJA 2EGAA 4C5EA 1A0NB 2E70A 2RQTA 1BKBA 2M0OA 4XU2A 1AWWA 3MEWA 4DBQA 4MDXA 3CCRQ 4GBQA 3KFVA 3OYDA 1GRIA 2KRNA 2NUTA 1VQNT 1OX9A 2LX9A 3CC7T 4UC4A 3H0IA 1G8XA 3VYGA 4HVVA 1Z9QA 4Y28E 4A4GA 2JOYA 3UF4A 2RHIA 5GANe 2XMFA 1UHCA 2DK3A 3G7ZA 1NPRA 4P5NA 2RD1A 1UFFA 4C5IA 4XU0A 4II1A 3PVLA 3CD6A 2KY9A 1K73C 1WJQA 2GTOA 3A8HB 3A98A 2XIDA 3C0CA 3CCQA 1LVKA 4M77B 3WXMB 1VQ6T 2ROLA 1FXXA 4PLIA 4M7AC 3HRSA 2RI3A 3QZ9B 1GBQA 1W70A 1TUCA 3V8KA 3OYMA 1TG0A 2QASA 4K11A 4C92A 4RG2A 2CZ6B 1Q95G 1G83A 5CKFA 3QUIA 3QBYA 2W10A 3REAB 2NUPA 3OYLA 2RK2A 4C8QA 4LDWA 4RTTA 1VQKT 2CP2A 2LVMA 1K8AR 1VQMA 2BZYA 3QDFA 2JT4A 3NTHA 4FYVB 3O5ZA 1TH7A 3OYJA 1KQSP 4QW2A 2AZVA 1QCNA 2RHZA 3M55A 3HFNA 4BI3A 4PJLA 5GAMg 2LT4A 2QDYB 3HL8A 2SEMA 1YN8A 2DE0X 2V1QA 1WHLA 5LJ3g 4BE1A 2KQWA 3JCMf 4GLMA 4M7DB 1B34A 4KUIA 3GNFB 2DM1A 4ME7A 1Q7YR 2QQBA 1YIJT 1D0XA 3HHTB 3O8VA 5GMKi 3TSZA 2KGTA 4Z88A 1IHVA 2EQMA 5A2QE 2QAZA 3HRUA 5D6XA 1YCYA 1WI7A 2QTXA 5D6YA 4CC7A 4Z8AA 5CR2A 3KXTA 3CC4T 1XQHA 2QXFA 5LJ5g 2H3EB 4J83A 1VQ9T 4XTWA 2WSEE 4M78C 1YITT 4E7SA 2DZ9A 3CMET 2QA4T 5GMKm 5FU6B 4F7UE 2XKOC 5GAOl 5KYUA 2EAYA 4HKEA 2DBMA 1WJSA 3G6EA 5HK0A 4MZPA 2XI9A 1DJ7B 1NEBA 4E47A 3TEEA 5KYWA 4PJJA 3EGXB 4NL2A 1RUWA 2D0NA 4JZ3A 3OW2P 2H8HA 2F69A 1RI9A 2DYBA 2DXUA 1X75C 2ED1A 3EFOA 2MWOA 3HTRA 2FL7A 3E9GA 5GAOp 3JCMd 2DA9A 2YHTA 2PU9B 2O31A 3TREA 3MHXA 1VYVA 3EH2A 3JCMQ 1T3LA 3DB3A 4B9XA 2A37A 3R6OA 2KNBB 1K8AU 1S72T 4BY6C 4KGXB 1VQLA 2FRWA 3CD6Q 3EG9A 2NUTB 3JCMc 2DXTA 4LUDA 2RQUA 2EFIA 3CCMT 2YRCA 2JXBA 3CBOA 3CCQQ 2DEUA 4HCBA 1KSWA 1SG5A 2MMPA 4OMLA 4D8DA 3MP8A 2E1HA 2QEXA 4Z02A 3M9QA 3ME9A 4OMFB 2C0IA 3BDUA 2DERA 2F5TX 1GBRA 3SDZA 1K0SA 2CSIA 4OMPA 3MKDA 5I11A 1VQMQ 3DLMA 1WHGA 4PJOF 2KXDA 1G3TA 2RNAA 4QQDA 1IXDA 2YSQA 3OYCA 2YRDA 4N4IA 1H92A 2CUDA 3LWIA 2RM4A 4PL6A 1OULA 2KK4A 4C92B 3CXCA 1LCKA 2YUPA 1KC8U 1D1AA 2JW4A 4BACA 3E19A 2NUPB 2J06A 2IG0A 4C8QB 3VS1A 1SRMA 2VYTA 1RI0A 1VQPT 1XOVA 3V8LA 5KE2A 4A63B 3VS0A 5A0DA 4J5YA 2JM8A 1YHQT 5GAOn 1X2QA 2DTHA 2D8JA 4F7UA 4FYYB 4LE9A 3OMCA 1WHKA 4NS5A 2AK5A 4IUTA 1ARKA 2EQKA 2GQVA 4BE2A 3PNWC 5GANg 5LJ3h 3L2ZA 1MHNA 1B34B 2GQIA 3M0SA 1JJ2A 3EGUA 2EYXA 1UJ0A 5IT9E 1RADB 1UJYA 3RIRA 2LNVA 3HKSA 3UDCA 4N4HA 2B86A 1FMWA 3CPWS 3G6EQ 1K8AC 1G3WA 2LCLA 3PTAA 2O01E 4N0AA 3EHRA 4J9FA 4LNPA 2OTLT 3CCST 2LQ8A 1KK7A 1ZLMA 1WZOA 3JB9J 4EMGA 2CZ1B 1QKWA 5LJ5h 2LQWA 1K1ZA 3GIBA 1XTDA 2QQAA 1BBZA 1M2VA 1O9SA 3TSWA 1N8RR 5KYUB 2RQWA 2C0OA 3VS6A 4M7AG 1RABB 4LDYA 3LW5E 3OS5A 3JSCA 5DLQE 1Q7YC 1PSEA 4J7IA 2Y4XA 2QQ9A 1VQLQ 2X4XA 3H8ZA 2LC4A 2VC8A 1YI2T 5KYWB 2PUOB 5CQYA 2MK5A 1D1CA 2GF7A 1ZSZC 3QWYA 4QQ6A 4C8QF 3C12A 2E41A 3I56T 5GAN3 2AKKA 2M51A 2JM9A 4HCZA 1I07A 1CSKA 1PKTA 2J6OA 2QEXQ 4AT1B 2L3RA 2BZ8A 5IHNA 1YJWA 4ELZC 2LT1A 3LWHA 2MI6A 1M4ZA 2CGHA 4XQ3A 3CCUT 3HFOA 2VVKA 3TCJA 5LJ3e 2WSCE 2DL3A 2VGNA 1RL2A 3EG9B 3RMSA 2X4YA 2QYZA 2JVVA 2PTKA 2QQSA 3V7CA 3VS2A 4AMCA 5GAN7 4LDVA 1ZUYA 2RJEA 3NTKA 5CCAA 2O9SA 3NPFA 1WXTA 4M77C 2DD5A 1Q81R 1VYUA 1PHTA 1YFNA 2OX7A 2DVJA 2CKKA 3SWNA 5FW9A 1D1BA 2EW3A 5CVIA 2RMOA 5LJ5e 1OU9A 2R5MA 2EQIA 1K9MR 2MCNA 2JMCA 4DOWA 1YWOA 5A0GA 4QVDA 4M78G 4YTLA 1NBEB 3CCEA 1QQJA 1OV3A 1UECA 4EIKA 1R0BG 1WQ7A 1VA7A 3OYNA 3META 9ATCB 4O5VA 3KUFA 1N8RU 1SSHA 3G4SA 2DX1A 4M7DC 2OTJA 1GCPA 1PG5B 3H9NA 3E1SA 3OYAA 3P8DA 1K4US 3QJYA 2I2LA 1NG2A 1TXQA 4XTZA 3IQLA 2ZZDA 3CCVA 8ATCB 2KBTA 1M3CA 3VYHB 2RJCA 3OS2A 3I55T 4RTUA 2HQXA 4F7UB 3JAME 1PRMC 3SEMA 1I1JA 1QWEA 3X20B 2ED0A 4RTWA 1PWTA 1V29B 2EVRA 4M7AE 1VQOA 3L2VA 3C95A 3OMGA 3OYKA 1GXIE 1OU8A 4GY5A 3RERA 3UA6A 4A54A 1JRIA 2DRKA 4RUGA 1M30A 1Y96A 4Y92A 3V8JA 4HCKA 2KROA 1Y7XA 4OF1A 1EIFA 1Q86U 2EBPA 2P0KA 3GPLA 1Q81U 5FRNA 4DOVA 1YJNT 1RLQC 3JCMg 4JJCA 3TU4K 4F14A 3EGXA 1MUZA 2LNHB 2QDLA 3INZA 2VXFA 1YJWQ 2HSEB 2OAWA 1ZX6A 4RTYA 3CCRT 3OA6A 3CC2A 2J7IA 1MMGA 4M75D 2YLBA 2RHUA 1K9MU 1VQ7A 2V26A 5CK9A 2KDSA 1RAEB 1PRLC 4OGCA 3DLLA 4LDXA 4C0ZA 2HAXA 1SPKA 2NLUA 1I5OB 3R6NA 1VQ5A 1SHFA 4QVZA 2F2WA 1P92A 1M8VA 1MMNA 2FZCB 2AZSA 3CEYA 2E6NA 3JCMV 5GAMj 1WHHA 3RDVA 2A0FB 1YNZA 4LDUA 1YITA 3CMEA 4AG2C 1N8RC 2VWFA 1YP5A 1KD1R 3G1JA 1XJWB 1D3BA 2F1LA 2KRMA 2NWMA 2EGEA 3JCMJ 3DKMA 4MZTA 3FDRA 2QK0A 4M78E 1AVZC 2EQUA 4JRKA 1IREB 4J8OA 2CUBA 3CCEQ 4JJNK 4LUEA 3OYGA 3QJ6A 3WVDB 3SWNB 4MDWA 4AFSC 2A7YA 1PD0A 4C92C 3A1PA 4XTYA 5KH6A 1EX4A 1NLPC 2YXYA 3ZBDA 4MMKA 4E2FB 2DL8A 3G4SQ 1N9RA 1NZ9A 2OTJQ 4X9CA 2ZPEB 4C8QC 1ZA1B 3F70A 2ZPIB 4NL3A 5FRMA 3TVTA 3JB9F 4HT9A 1AZEA 4EDUA 4F04B 3CCVQ 1ZUKA 1MGQA 3UPUA 3M0TA 4FM4B 2KR3A 2JN0A 1QCFA 3CCMA 1NJIU 3OBYA 2CH4A 2RJDA 2GFAA 1Q81C 3OSSC 2VASA 4L6V5 1QCOA 2CSQA 1KJWA 2GBQA 4QQGA 2EPDA 1VQOQ 1QP3A 4WTOB 3PMIA 1KQSS 2RB6A 2EWNA 3AT1B 1M1FA 3A8LB 2DF6A 4TVRA 2CS7A 3MCAB 1K9MC 1RAFB 4RTXA 4M75E 1UEBA 2FPFA 5CKHA 2RQRA 3E9FA 4ZTJA 3M0PA 4DBHA 2P4TA 4RKUE 2AKLA 2DYIA 5GAOm 3CCLA 4OB2B 2J05A 4C0DC 2L89A 1OOTA 5GMKh 1V76A 3H41A 3VJPA 1ABQA 4OMQA 2LRQA 4C0FA 2DJZA 5HKCA 4M77G 1KC8R 1FMKA 2O9VA 4J6XA 2IIMA 1KD1U 3CC2Q 2J6FA 2DBKA 4M77F 2CYZB 3M4GA 2E3IA 1Y96B 1VQ7Q 1UGPB 1QKXA 3PT9A 2DAQA 3I5RA 3CMAA 3M58A 1BCMA 2HKQB 2KI7A 1VQ5Q 1PM3A 4KH1B 3JCMh 3L42A 3QXEB 3NFCA 5GAOq 4JRPA 4OMNA 3E2UA 5GJWB 2AT1B 6AT1B 1YITQ 4KRTA 3CMEQ 4J9BA 5HY6A 1EFNA 2FZGB 2YWWA 3CD6T 2CZ0B 3OW2S 4J7FA 1AT1B 1QWFA 1RAHB 3EG3A 2ABLA 2O88A 5EC7A 3CCQT 2WACA 3ASKA 4FIBA 1X2KA 4IKFA 4HVUA 3GOXA 1AEYA 5M9OA 2ZAEA 5CIUA 4XK8E 5HCKA 1UGVA 3S3OA 4M7DF 2V1RA 2YT6A 3J80E 1GL5A 2X3WD 2M02A 2F2VA 3OYIA 1H641 4DBFA 1BB9A 4C0GA 1VQ4A 5GANj 2HL3A 2RK1A 2CP6A 3X25B 2DL5A 1D3BB 1XNIA 1VQMT 1R0CB 2K5IA 3RUXA 4HT8A 5GMKe 2L5QA 3MP6A 2LCSA 2IVWA 3CCJA 1Y0MA 3ULRB 4PJOG 5IHKA 2RPNA 2OAUA 1IHWA 4EPCA 3CCMQ 2DETA 4X1VA 4IUVA 5I2SA 1VQ8A 2PZ1A 3A8GB 1WFWA 3PIPA 4E7LA 2RI2A 3MJXA 2CP5A 3SHWA 1PCXA 3P8BB 5GAMf 4FW1A 4A4HA 1LNXA 3OYYA 4A4EA 4M75A 3QDRB 1T3SA 4ORZA 3CPWA 3JCMe 3RKXA 4PKCC 1OX8A 3NTIA 4PJOD 3CCUA 1KD1C 1GFCA 3OSVA 3VS5A 2EYQA 4FT4A 2L3PA 2W0ZA 4M7AB 3NMZC 1H8KA 5I21A 4CC4B 1MNDA 2YLCA 4ZNXA 2QGFB 2LTOA 1CKBA 8AT1B 3CCLQ 2COZA 5LL6S 1D09B 1NE8A 1B07A 5IH2A 2DIQA 2Z0WA 5J3BA 2O2OA 2COYA 1KHCA 1SKUB 2QG9B 2V8JA 4JJBA 3OYEA 2KAFA 1R8OB 3RR6A 3G6ET 3J81E 4PFPA 2G3RA 1HSQA 4N0AC 4ZN1A 1UGQB 5GAN8 1W2BP 1ZA2B 4DBRA 3FIFA 3CMAQ 1K76A 2RA2A 5CO7A 2A08A 5IXFA 2Y90A 1C1AA 4AFUC 1IGQA 1M3AA 2A28A 2I0NA 1W2BS 5GAMd 2X9HA 4XU3A 5KYXA 5DLOA 2GTJA 4JLIA 1U1SA 2HD0A 5FWCA 1WIEA 2EYYA 3LLRA 2D1XA 3SFMA 1VQLT 2QTVA 3VKIA 4L59A 3BFMA 5CKEA 3G71A 3LH0A 5HK3A 1U5SA 2VV5A 4F16A 3M54A 4GLKA 4HXJA 1I4K1 4FYWB 4C92F 2P4RA 2G6FX 5KCOA 4BUGA 4FCYA 4C8QG 2DJQA 4J9HA 2QEXT 4JPBW 1ZHIA 2RHYA 3N5BB 4M78B 1H3ZA 3EGDA 2H3JA 1JBMA 4IUUA 1VIFA 2K3YA 4M7AD 3OY9A 2YUQA 3I35A 1VQ4Q 4E7KA 5DY9A 1M2OA 1Y71A 2KE9A 3PGGA 1KC8C 4QT7A 1GCQA 2K5LA 2M0YA 1YJ9A 2PUKB 2F2XA 3ZL7C 3M0UA 4PJOE 4BB7A 3CCJQ 1BI2A 3OBWA 4KGVB 4KGZB 3M4YA 2BE9B 5FU7B 2CT4A 1VQ8Q 2KMTA 1WPYA 2K4YA 3PE0A 5L8RE 1Q86R 3M53A 3M56A 4JUVA 1BCOA 4XTVA 4M4ZA 3SWNC 2HMAA 3ER0A 3V7SA 4AG1C 1M27C 4JJDA 5GAN4 2JS2A 2DXCA 3CCUQ 1ZSGA 4RCBA 2RO0A 2VB6A 3CBMA 2JMAA 3RESA 3QYHB 1AHJB 4MMLA 1QVFP 2BTTA 2M16A 1M1GA 2K5FA 4O6JA 4ZTFA 5I2MA 4D8KA 1N27A 4Y91A 1QMCA 3UA7A 4OVAA 2FPDA 2XK0A 1VQNA 2C0TA 4IURA 4JS5A 1AOJA 2LQKA 4OGEA 1BI1A 4WF2A 1QVFS 2ZCFB 4M75B 3CC7A 4XTXA 2BKDN 1BI3A 2EIFA 1Y57A 1MV3A 1RAGB 2F5KA 1QVPA 1UDLA 1V1CA 2FZKB 2RQVA 1MNEA 4J9CA 4OB0B 1E7OA 4HCCA 1VIEA 2DD4A 4M78D 1ZUUA 2O4XA 2PNIA 2ROTA 2X4WA 1SHGA 3EH1A 2L2PA 2DIGA 4KBMB 3CPFA 4OMMA 3RNJA 2DVEA 2LQNA 3M0RA 1VQ6A 2KXCA 4BD3A 4LXCA 2R58A 1OYXA 2BZXA 4PFOA 3MP1A 1JXMA 2WSFE 2MYSA 4FSXA 1ZBJA 3L1AA 2LDMA 4FSSA 2E65A 2HBPA 3VS3A 3G71Q 1M90R 5FU6C 1UUEA 1OPKA 1TUDA 2M9UA 5KYYB 1M1KU 3WVEB 1VQKA 1NLOC 4JLGA 1BYMA 1Q82U 4RCCA 1ZBXA 4DEYA 5FLXE 2K9GA 3D7SB 3QKJA 3EFRA 5FWBA 4X9DA 1NJIR 1JO8A 2E12A 3QWXX 5AYFA 5IHIA 2YRVA 4EMKA 5KYXB 2DILA 1YJWT 1T0HA 2AIRB 1UB4A 2PQWA 3FJ5A 2ZGWA 4PJOA 3ZEHA 2COWA 4PJMA 5GANd 1OI1A 1U06A 1M8MA 2DXBA 4DA4A 4CRIA 1NPPA 5J26A 2JTFA 1YJ9Q 2ECZA 2KVQG 1T0JA 5GAOr 4IUPA 3QIIA 4BE0A 2E4HA 3X26B 1TS9A 3S3NA 3MEAA 2VGMA 3BE3A 4DQ2A 2C06A 1YIJA 1B3QA 2QGGA 3GF5A 4BDYA 2DL7A 3CQTA 4NOYA 3EHQA 1UG1A 4J9EA 3SB2A 4BI4A 2DZCA 4L5GA 1MMDA 3MEVA 1WQWA 3EGDB 3VV0A 1G5VA 1OQKA 1RAAB 2HKNA 4XU1A 2RF0A 3CC4A 7AT1B 3I9QA 4PJNA 1TUGB 2KSSA 4F7UG 4J6WA 1SEMA 1VQ9A 5KE3A 5LJ3j 1RAIB 2KEAA 1N9SA 2QA4A 4F7UF 4FT2A 2RJFA 2ZPBB 1ZSZB 3UATA 2JTEA 1MMAA 1WYXA 2MAMA 2HQEA 3CCET 1HK9A 3SD4A 2DNUA 2EJGA 1IGUA 2XG8D 1QVGP 2VKNA 1KFZA 1VQNQ 4CI0C 5ECAA 4R56A 3CC7Q 1OEBA 1KQSA 3G4ST 1RACB 1IZ6A 1PNJA 4BDZA 2OTJT 3RBBB 2JUFA 3A5ZB 1QVGS 1HD3A 4Z89A 3NGPA 4DEXA 1SF9A 5LJ5j 3CCVT 2PVGB 2KYBA 1D0YA 1M90U 3GNGA 3JB9G 4PNOA 3REBB 2XHCA 1BI0A 3Q1JA 4E7ZA 1R77A 4CC3A 2P0PA 1S72A 1CKAA 1M1KC 2JZ2A 3X24B 2DEQA 4A4KA 1I5LA 2DKGA 4ELYC 1YBYA 1Q82C 2E6ZA 4V2SA 3HPWA 1FX7A 1WLPB 4M7AA 2DTIA 3DB4A 1VQ6Q 1Q86C 2DRMA 1VQOT 3L2WA 3QHSA 3JB9D 3JCMP 2FG0A 2L3SA 2B8AA 5AT1B 3EG2A 2KT8A 1FWZA 1SSFA 2FEIA 2BUDA 4KUDK 2O4XB 2D0QB 4OMOA 1NYFA 3BDLA 4FU6A 1WNLA 1WX6A 4WCIA 1VQKQ 2E5KA 5CAIA 1WGSA 2XDDA 2FB7A 3A8OB 4OB1B 3UT1A 1TOVA 1X69A 3HRTA 3VUBA 2LJ3A 3JB9I 2GGRA 4XTUA 2FPEA 4QKUA 3FEOA 5GJVB 2RN8A 2IPOB 1TU0B 3CC2T 1AWXA 1PSFA 3H0HA 2V8KA 3OW2A 1QW1A 2DL4A 4AFQC 4JRQA 2D8HA 1KQ1A 1N6AA 2GNCA 1VQ7T 1M9SA 4KT0E 1VQPA 2LJ1A 1I0CA 3M0QA
chains in the Genus database with same CATH topology
5FW9A 2EW3A 2KRSA 1CKBA 1NYGA 2KYMA 4GBQA 4J9DA 3KFVA 2RMOA 1GRIA 2KRNA 1B07A 5IH2A 1AZGB 2O2OA 2EQIA 1ABOA 4JJBA 2MCNA 2JMCA 4E6RA 1YWOA 3H0IA 4HVVA 1Z9QA 1HSQA 2DMOA 3VS4A 3UF4A 1WXUA 2KT1A 1OV3A 1UECA 4EIKA 2XMFA 1K76A 1UHCA 1VA7A 1N5ZA 2A08A 5IXFA 4AFUC 3U23A 1M3AA 2A28A 1UFFA 3PVLA 1SSHA 2I0NA 2DX1A 1GCPA 2GTOA 1K4US 1W1FA 2GTJA 1NG2A 3A98A 3C0CA 5FWCA 1WIEA 2EYYA 3IQLA 2ROLA 2D1XA 2KBTA 1M3CA 1GBQA 1W70A 1TUCA 1FYNA 4RTUA 2X3XD 1TG0A 1U5SA 4K11A 1GFDA 4F16A 1H3HA 2ENMA 4HXJA 1PRMC 2P4RA 3SEMA 2G6FX 1IO6A 3JV3A 1G83A 1UHFA 1I1JA 1QWEA 2DJQA 2ED0A 2W10A 4RTWA 1PWTA 2EVRA 4J9HA 3REAB 4JPBW 1HJDA 2HDAA 4RTTA 4F17A 1YCSB 2MOXA 2BZYA 2K7AA 2JT4A 3UA6A 3NHNA 4IIOA 2YUQA 3I35A 3O5ZA 2DRKA 2AZVA 2KE9A 4RUGA 1M30A 1J3TA 4QT7A 1GCQA 4Y92A 2M0YA 4HCKA 2F2XA 2KROA 3ZL7C 3M0UA 2SEMA 2EBPA 1YN8A 2DE0X 2K3BA 2V1QA 4R0KA 3VS7A 1JXOA 2CREA 4GLMA 1RLQC 4JJCA 1W6XA 4F14A 1MUZA 2CT4A 2LNHB 2QDLA 2DM1A 1AD5A 3PE0A 2FRYA 2OAWA 1ZX6A 4RTYA 4M4ZA 2K2MA 4AG1C 2J7IA 1M27C 4JJDA 2OJ2A 3TSZA 2YDLA 2KGTA 4Z88A 2JS2A 1PRLC 1ZSGA 2HSPA 1WI7A 4CC7A 2JMAA 1SPKA 4Z8AA 1U3OA 3R6NA 1SHFA 2BTTA 2F2WA 3VRZA 4D8KA 2AZSA 3UA7A 2FPDA 2DBMA 2C0TA 1AOJA 1YNZA 2DLPA 4AG2C 3LH5A 2VWFA 1YP5A 1NEBA 2KRMA 2NWMA 1Y57A 1MV3A 4IIMA 2EGEA 2K6DA 5IXBA 2NUZA 1RUWA 1UDLA 1V1CA 1JU5C 2D0NA 2RQVA 4JZ3A 4J9CA 1AVZC 2H8HA 1RI9A 1MV0B 1E7OA 2DYBA 5I22A 1PKSA 1ZUUA 2CUBA 2CDTA 2PNIA 2ROTA 2ED1A 4LUEA 1SHGA 2L2PA 1WXBA 4J9GA 4AFSC 4OMMA 2DA9A 2L3QA 3RNJA 2O31A 4ZNXA 3EG1A 1VYVA 2LQNA 1T3LA 3M0RA 2A37A 2KXCA 2KNBB 1NLPC 3GBQA 2BZXA 2YUOA 2DL8A 5L23A 2FRWA 1JXMA 2ESWA 4LUDA 2FO0A 2RQUA 1ZBJA 3TVTA 2JS0A 2JXBA 1AZEA 1KSWA 1ZUKA 4CC2A 4FSSA 3M0TA 2KR3A 3VS3A 4OMLA 4D8DA 1QCFA 1UUEA 1OPKA 1TUDA 1GCQC 1JEGA 1X27A 2CH4A 1NLOC 2C0IA 1GBRA 4DEYA 2K9GA 1K0SA 2CSQA 5FWBA 2CSIA 4OMPA 1KJWA 2GBQA 1JO8A 2EPDA 3QWXX 5I11A 5IHIA 2DILA 1K9AA 1T0HA 3EG0A 3FJ5A 1WA7A 2KXDA 4ESRA 2EYWA 1U06A 2RNAA 1UE9A 1M8MA 2DF6A 3H0FA 4JZ4A 2YSQA 2HEQA 4RTXA 1H92A 2CUDA 2FPFA 3I5SA 2RQRA 3M0PA 2A36A 1QLYA 2ECZA 1T0JA 2AKLA 1LCKA 2YUPA 2JW4A 3VRYA 1B3QA 2J05A 2DL7A 2J06A 1E6GA 3CQTA 3VS1A 1SRMA 3EHQA 1OOTA 1UG1A 4J9EA 1XOVA 3H41A 1ABQA 4A63B 3VS0A 4OMQA 2EKHA 1FMKA 2O9VA 2IIMA 2J6FA 2DBKA 2JM8A 4LN2A 2RF0A 3THKA 1BU1A 1X2QA 3I9QA 1YWPA 1QKXA 1SEMA 2D8JA 1SRLA 2J6KA 4LE9A 2KEAA 2AK5A 1ARKA 3I5RA 3UATA 2JTEA 1BK2A 1S1NA 4AFZC 1WYXA 2SRCA 1OPLA 2GQIA 2EYZA 3M0SA 1G2BA 1KIKA 2DNUA 3EGUA 2EYXA 2YUNA 1UJ0A 1KFZA 2VKNA 1NEGA 4OMNA 1UJYA 5GJWB 2L0AA 2B86A 4KRTA 2RQTA 5ECAA 4J9BA 1OEBA 1EFNA 3EHRA 1PNJA 4J9FA 2LJ0A 3RBBB 1NM7A 4LNPA 1HD3A 4Z89A 3NGPA 4DEXA 1QWFA 1UTIA 1X43A 2CT3A 3EG3A 2O88A 2ABLA 5EC7A 2CH4W 1ZLMA 4J9IA 2KYBA 1X6BA 1E6HA 1X2KA 1Z9ZA 4RTZA 2HCKA 3REBB 4HVUA 1QKWA 1AEYA 2LQWA 1K1ZA 4CC3A 5HCKA 1UGVA 1CKAA 2V1RA 2YT6A 1BBZA 1GL5A 2X3WD 3TSWA 2RQWA 2C0OA 3VS6A 1WLPB 2F2VA 1AWOA 1K0XA 1BB9A 2LP5A 2MIOA 2DL5A 2DRMA 2LZ6B 2FG0A 2L3SA 2LCSA 3QWYA 1M3BA 1Y0MA 3EG2A 2KT8A 3ULRB 5IHKA 2FEIA 2RPNA 2AKKA 2M51A 1VYTA 1I07A 1RLPC 2EGCA 2JM9A 1CSKA 1PKTA 1NYFA 4OMOA 4RTVA 4X1VA 2J6OA 2PZ1A 2LMJA 1WFWA 1WX6A 2BZ8A 2K79A 4WCIA 2E5KA 5IHNA 3SHWA 1X6GA 4HVWA 1X69A 2VVKA 2LJ3A 3PVQA 1T3SA 4ORZA 2GGRA 1WDXA 2FPEA 2DL3A 5GJVB 2RN8A 2PTKA 1GFCA 3VS2A 2OI3A 1AWXA 1ZUYA 3H0HA 2HBWA 1JQQA 3VS5A 2O9SA 3NPFA 1WXTA 2DL4A 2L3PA 2LX7A 4AFQC 2W0ZA 2GNCA 1VYUA 1H8KA 1PHTA 2D8HA 3NMZC 1AWJA 2DVJA 2EGAA 4CC4B 1A0NB 2LJ1A 1I0CA 1AWWA 3M0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW9 A;  2EW3 A;  2KRS A;  1CKB A;  1NYG A;  2KYM A;  4GBQ A;  4J9D A;  3KFV A;  2RMO A;  1GRI A;  2KRN A;  1B07 A;  5IH2 A;  1AZG B;  2O2O A;  2EQI A;  1ABO A;  4JJB A;  2MCN A;  2JMC A;  4E6R A;  1YWO A;  3H0I A;  4HVV A;  1Z9Q A;  1HSQ A;  2DMO A;  3VS4 A;  3UF4 A;  1WXU A;  2KT1 A;  1OV3 A;  1UEC A;  4EIK A;  2XMF A;  1K76 A;  1UHC A;  1VA7 A;  1N5Z A;  2A08 A;  5IXF A;  4AFU C;  3U23 A;  1M3A A;  2A28 A;  1UFF A;  3PVL A;  1SSH A;  2I0N A;  2DX1 A;  1GCP A;  2GTO A;  1K4U S;  1W1F A;  2GTJ A;  1NG2 A;  3A98 A;  3C0C A;  5FWC A;  1WIE A;  2EYY A;  3IQL A;  2ROL A;  2D1X A;  2KBT A;  1M3C A;  1GBQ A;  1W70 A;  1TUC A;  1FYN A;  4RTU A;  2X3X D;  1TG0 A;  1U5S A;  4K11 A;  1GFD A;  4F16 A;  1H3H A;  2ENM A;  4HXJ A;  1PRM C;  2P4R A;  3SEM A;  2G6F X;  1IO6 A;  3JV3 A;  1G83 A;  1UHF A;  1I1J A;  1QWE A;  2DJQ A;  2ED0 A;  2W10 A;  4RTW A;  1PWT A;  2EVR A;  4J9H A;  3REA B;  4JPB W;  1HJD A;  2HDA A;  4RTT A;  4F17 A;  1YCS B;  2MOX A;  2BZY A;  2K7A A;  2JT4 A;  3UA6 A;  3NHN A;  4IIO A;  2YUQ A;  3I35 A;  3O5Z A;  2DRK A;  2AZV A;  2KE9 A;  4RUG A;  1M30 A;  1J3T A;  4QT7 A;  1GCQ A;  4Y92 A;  2M0Y A;  4HCK A;  2F2X A;  2KRO A;  3ZL7 C;  3M0U A;  2SEM A;  2EBP A;  1YN8 A;  2DE0 X;  2K3B A;  2V1Q A;  4R0K A;  3VS7 A;  1JXO A;  2CRE A;  4GLM A;  1RLQ C;  4JJC A;  1W6X A;  4F14 A;  1MUZ A;  2CT4 A;  2LNH B;  2QDL A;  2DM1 A;  1AD5 A;  3PE0 A;  2FRY A;  2OAW A;  1ZX6 A;  4RTY A;  4M4Z A;  2K2M A;  4AG1 C;  2J7I A;  1M27 C;  4JJD A;  2OJ2 A;  3TSZ A;  2YDL A;  2KGT A;  4Z88 A;  2JS2 A;  1PRL C;  1ZSG A;  2HSP A;  1WI7 A;  4CC7 A;  2JMA A;  1SPK A;  4Z8A A;  1U3O A;  3R6N A;  1SHF A;  2BTT A;  2F2W A;  3VRZ A;  4D8K A;  2AZS A;  3UA7 A;  2FPD A;  2DBM A;  2C0T A;  1AOJ A;  1YNZ A;  2DLP A;  4AG2 C;  3LH5 A;  2VWF A;  1YP5 A;  1NEB A;  2KRM A;  2NWM A;  1Y57 A;  1MV3 A;  4IIM A;  2EGE A;  2K6D A;  5IXB A;  2NUZ A;  1RUW A;  1UDL A;  1V1C A;  1JU5 C;  2D0N A;  2RQV A;  4JZ3 A;  4J9C A;  1AVZ C;  2H8H A;  1RI9 A;  1MV0 B;  1E7O A;  2DYB A;  5I22 A;  1PKS A;  1ZUU A;  2CUB A;  2CDT A;  2PNI A;  2ROT A;  2ED1 A;  4LUE A;  1SHG A;  2L2P A;  1WXB A;  4J9G A;  4AFS C;  4OMM A;  2DA9 A;  2L3Q A;  3RNJ A;  2O31 A;  4ZNX A;  3EG1 A;  1VYV A;  2LQN A;  1T3L A;  3M0R A;  2A37 A;  2KXC A;  2KNB B;  1NLP C;  3GBQ A;  2BZX A;  2YUO A;  2DL8 A;  5L23 A;  2FRW A;  1JXM A;  2ESW A;  4LUD A;  2FO0 A;  2RQU A;  1ZBJ A;  3TVT A;  2JS0 A;  2JXB A;  1AZE A;  1KSW A;  1ZUK A;  4CC2 A;  4FSS A;  3M0T A;  2KR3 A;  3VS3 A;  4OML A;  4D8D A;  1QCF A;  1UUE A;  1OPK A;  1TUD A;  1GCQ C;  1JEG A;  1X27 A;  2CH4 A;  1NLO C;  2C0I A;  1GBR A;  4DEY A;  2K9G A;  1K0S A;  2CSQ A;  5FWB A;  2CSI A;  4OMP A;  1KJW A;  2GBQ A;  1JO8 A;  2EPD A;  3QWX X;  5I11 A;  5IHI A;  2DIL A;  1K9A A;  1T0H A;  3EG0 A;  3FJ5 A;  1WA7 A;  2KXD A;  4ESR A;  2EYW A;  1U06 A;  2RNA A;  1UE9 A;  1M8M A;  2DF6 A;  3H0F A;  4JZ4 A;  2YSQ A;  2HEQ A;  4RTX A;  1H92 A;  2CUD A;  2FPF A;  3I5S A;  2RQR A;  3M0P A;  2A36 A;  1QLY A;  2ECZ A;  1T0J A;  2AKL A;  1LCK A;  2YUP A;  2JW4 A;  3VRY A;  1B3Q A;  2J05 A;  2DL7 A;  2J06 A;  1E6G A;  3CQT A;  3VS1 A;  1SRM A;  3EHQ A;  1OOT A;  1UG1 A;  4J9E A;  1XOV A;  3H41 A;  1ABQ A;  4A63 B;  3VS0 A;  4OMQ A;  2EKH A;  1FMK A;  2O9V A;  2IIM A;  2J6F A;  2DBK A;  2JM8 A;  4LN2 A;  2RF0 A;  3THK A;  1BU1 A;  1X2Q A;  3I9Q A;  1YWP A;  1QKX A;  1SEM A;  2D8J A;  1SRL A;  2J6K A;  4LE9 A;  2KEA A;  2AK5 A;  1ARK A;  3I5R A;  3UAT A;  2JTE A;  1BK2 A;  1S1N A;  4AFZ C;  1WYX A;  2SRC A;  1OPL A;  2GQI A;  2EYZ A;  3M0S A;  1G2B A;  1KIK A;  2DNU A;  3EGU A;  2EYX A;  2YUN A;  1UJ0 A;  1KFZ A;  2VKN A;  1NEG A;  4OMN A;  1UJY A;  5GJW B;  2L0A A;  2B86 A;  4KRT A;  2RQT A;  5ECA A;  4J9B A;  1OEB A;  1EFN A;  3EHR A;  1PNJ A;  4J9F A;  2LJ0 A;  3RBB B;  1NM7 A;  4LNP A;  1HD3 A;  4Z89 A;  3NGP A;  4DEX A;  1QWF A;  1UTI A;  1X43 A;  2CT3 A;  3EG3 A;  2O88 A;  2ABL A;  5EC7 A;  2CH4 W;  1ZLM A;  4J9I A;  2KYB A;  1X6B A;  1E6H A;  1X2K A;  1Z9Z A;  4RTZ A;  2HCK A;  3REB B;  4HVU A;  1QKW A;  1AEY A;  2LQW A;  1K1Z A;  4CC3 A;  5HCK A;  1UGV A;  1CKA A;  2V1R A;  2YT6 A;  1BBZ A;  1GL5 A;  2X3W D;  3TSW A;  2RQW A;  2C0O A;  3VS6 A;  1WLP B;  2F2V A;  1AWO A;  1K0X A;  1BB9 A;  2LP5 A;  2MIO A;  2DL5 A;  2DRM A;  2LZ6 B;  2FG0 A;  2L3S A;  2LCS A;  3QWY A;  1M3B A;  1Y0M A;  3EG2 A;  2KT8 A;  3ULR B;  5IHK A;  2FEI A;  2RPN A;  2AKK A;  2M51 A;  1VYT A;  1I07 A;  1RLP C;  2EGC A;  2JM9 A;  1CSK A;  1PKT A;  1NYF A;  4OMO A;  4RTV A;  4X1V A;  2J6O A;  2PZ1 A;  2LMJ A;  1WFW A;  1WX6 A;  2BZ8 A;  2K79 A;  4WCI A;  2E5K A;  5IHN A;  3SHW A;  1X6G A;  4HVW A;  1X69 A;  2VVK A;  2LJ3 A;  3PVQ A;  1T3S A;  4ORZ A;  2GGR A;  1WDX A;  2FPE A;  2DL3 A;  5GJV B;  2RN8 A;  2PTK A;  1GFC A;  3VS2 A;  2OI3 A;  1AWX A;  1ZUY A;  3H0H A;  2HBW A;  1JQQ A;  3VS5 A;  2O9S A;  3NPF A;  1WXT A;  2DL4 A;  2L3P A;  2LX7 A;  4AFQ C;  2W0Z A;  2GNC A;  1VYU A;  1H8K A;  1PHT A;  2D8H A;  3NMZ C;  1AWJ A;  2DVJ A;  2EGA A;  4CC4 B;  1A0N B;  2LJ1 A;  1I0C A;  1AWW A;  3M0Q A; 
#chains in the Genus database with same CATH topology
 4QVC A;  2KRS A;  1NYG A;  1F1B B;  2KYM A;  3TQ7 P;  1YIJ Q;  1VQ5 T;  3LGF A;  4J9D A;  3M59 A;  4KH0 B;  1YHQ A;  4N4G A;  4EMK B;  1AZG B;  4PJO B;  2X51 A;  1ABO A;  3MPU B;  4JRI A;  4E6R A;  1EZZ B;  4M77 D;  2QI2 A;  3CC4 Q;  4A53 A;  2XDB A;  2ZPG B;  2DO3 A;  3LX7 A;  4M78 A;  3OYB A;  1C0M A;  2DMO A;  3VS4 A;  2EJF A;  1VQ9 Q;  2QA4 Q;  1WXU A;  2CZ7 B;  2KT1 A;  2QQR A;  4J6Y A;  1M90 C;  1N5Z A;  5C6S A;  1TWB A;  3GLX A;  3EFS A;  3U23 A;  3MO8 A;  5J39 A;  5GMK l;  4XAX B;  2E64 A;  5FU7 C;  3FC3 A;  3C4S A;  1W1F A;  1QP2 A;  2OTL A;  2BIV A;  2JJ9 A;  3CCS A;  4M7D G;  1NJI C;  1I81 A;  3RMQ A;  3URG A;  4OB3 B;  4LD9 K;  5A0L A;  2RH2 A;  1FYN A;  2X3X D;  2RHX A;  1GFD A;  3HSB A;  3PIO A;  2P0Q A;  1H3H A;  2ENM A;  2FHD A;  2JNG A;  1IO6 A;  3JV3 A;  1UHF A;  2M1H A;  1IRX A;  1BIA A;  3KBG A;  4M7D D;  1S72 Q;  3J7A F;  1HJD A;  2HDA A;  4F17 A;  5C0M A;  1YCS B;  1YI2 A;  2MOX A;  2R57 A;  2K7A A;  3NHN A;  4IIO A;  1LOJ A;  2L8D A;  1OZ3 A;  4FL6 A;  3I56 A;  2E10 A;  1KQ2 A;  2XDP A;  4M75 C;  1J3T A;  2FYK A;  1Q7Y U;  1ACM B;  2K3B A;  5LJ3 f;  4R0K A;  4E7I A;  3VS7 A;  1JXO A;  2CRE A;  1X01 A;  2R5A A;  2X4J A;  1LPL A;  2P84 A;  1W6X A;  2HL5 C;  4ZGE B;  3VUZ A;  3GP8 A;  1AD5 A;  4JDS A;  3OS1 A;  2FRY A;  4E7H A;  3X28 B;  5IAY A;  1FMV A;  2DTO A;  3CCL T;  1W2B A;  2K2M A;  3LYI A;  2OJ2 A;  2YDL A;  1KG1 A;  3RKW A;  2HSP A;  2PVO B;  4ZGD B;  4M77 E;  5LJ5 f;  1TSF A;  3MEU A;  1U3O A;  5DM7 R;  4JS4 A;  3CBP A;  1WJR A;  3VRZ A;  1VQP Q;  4ANJ A;  1X6O A;  2CP7 A;  3CMA T;  2DFU A;  2GCX A;  4C5G A;  4D6W A;  2HNI A;  1IB8 A;  5GAM h;  2VXE A;  2DLP A;  1C6V X;  3JCM X;  3LH5 A;  1YHQ Q;  3CXC P;  1JB0 E;  3FB9 A;  5KYY A;  1KHI A;  4A4F A;  2EKO A;  3CPW P;  4KUL A;  3L2Q A;  4IIM A;  2XU8 A;  2K6D A;  5IXB A;  2NUZ A;  1JU5 C;  1HXD A;  3UWN A;  3S3M A;  2EQJ A;  2MF2 A;  1MV0 B;  2E5Q A;  4IUQ A;  4LD6 A;  1VUB A;  5I22 A;  3CXC S;  2CP3 A;  2V8I A;  1B7T A;  1PKS A;  2CDT A;  2D6F A;  5LJ3 d;  1WXB A;  2K57 A;  4J9G A;  2L3Q A;  3EG1 A;  4R55 A;  2A3L A;  3H6Z A;  5CKB A;  4C92 G;  2LCC A;  3GBQ A;  3QPH A;  2YUO A;  5L23 A;  4M7D E;  2ESW A;  4C0D B;  5CKD A;  5D7U A;  2OTL Q;  3I55 A;  3S6W A;  2FO0 A;  3CCS Q;  2JS0 A;  2MPX C;  1JJ2 P;  1VQ4 T;  1U1T A;  3AHU A;  4CC2 A;  3M57 A;  1VOM A;  4ATO A;  3QO3 A;  4M7A F;  1GCQ C;  1JEG A;  1X27 A;  5LJ5 d;  4C92 D;  3CCJ T;  4OP0 A;  1JJ2 S;  2HZY A;  1G3S A;  1K73 R;  1VQ8 T;  4C8Q D;  3OYF A;  4ZN3 A;  3FLG A;  1YI2 Q;  1K9A A;  1ZSZ A;  3EG0 A;  1M1K R;  3FRN A;  3L2U A;  1Q82 R;  1M5Q 1;  1QVF A;  1WA7 A;  3EFO B;  4PLL A;  1LJO A;  2JTM A;  3PFS A;  4ESR A;  2BE7 D;  2EYW A;  4B6M A;  1UE9 A;  4JZ4 A;  3H0F A;  4E7J A;  2HEQ A;  3I56 Q;  1YJN A;  5GAM e;  2PVD B;  3I5S A;  4X34 A;  1UGS B;  2EJ9 A;  3OB9 A;  2A36 A;  1QLY A;  5GMK j;  3CCR A;  3VRY A;  4FYX B;  4BY6 B;  2Y4Y A;  4PFZ A;  3JCM b;  1E6G A;  3VU3 C;  2ATC B;  2ZPH B;  5IN1 A;  3OQ5 A;  4ZGJ B;  2EKH A;  3L2R A;  3LGL A;  4EMH A;  3JCM W;  4C5H A;  4M77 A;  4VUB A;  1U8R A;  4HA8 A;  3A8M B;  4LN2 A;  3THK A;  3QZ5 B;  2K3X A;  1BU1 A;  1YWP A;  5KYN A;  1SRL A;  2FVU A;  2J6K A;  3OS0 A;  3C94 A;  3BY7 A;  5GAN 6;  1BIB A;  1HYO A;  5GAN f;  1BK2 A;  1S1N A;  5KCH A;  4AFZ C;  2SRC A;  1OPL A;  2EYZ A;  5GAN 5;  1G2B A;  1KIK A;  2AHJ B;  2YUN A;  1NEG A;  1WHJ A;  2HQH A;  1Y07 A;  1O75 A;  1WHM A;  2L0A A;  4M78 F;  3RKY A;  4B9W A;  5FRO A;  1TTH B;  1UGR B;  2XIC A;  2LJ0 A;  1NM7 A;  4MZM A;  1UTI A;  1X43 A;  1ZQ1 A;  2CT3 A;  4Q5W A;  1OZ2 A;  2CH4 W;  4J9I A;  1X6B A;  1E6H A;  1Z9Z A;  4RTZ A;  2HCK A;  3G71 T;  4PK4 A;  2ZPF B;  4M7D A;  2NYS A;  4RMO A;  2XD0 A;  3PMT A;  1K73 U;  2VUB A;  3M5A A;  4RG8 A;  3V7R A;  4C92 E;  1AWO A;  1K0X A;  2LP5 A;  2MIO A;  3OYH A;  2X35 A;  3QYG B;  2LZ6 B;  1PD1 A;  4C8Q E;  1W4S A;  2GFU A;  5GAN h;  3I55 Q;  3JB9 H;  4EMK C;  5GAN 2;  4PJO C;  2RI5 A;  2E3H A;  1M3B A;  5EG2 A;  2MWP A;  2D9T A;  4FW2 A;  3ZFJ A;  1I8F A;  3HP9 A;  1VYT A;  1RLP C;  2EGC A;  4RTV A;  1YJ9 T;  1PC0 A;  3QSU A;  2LMJ A;  5D6W A;  2K79 A;  3QG1 A;  1X6G A;  3BW1 A;  3EAE A;  4HVW A;  4M75 G;  4BI8 B;  1D0Z A;  1G3Y A;  3PVQ A;  3T9N A;  1WDX A;  2DPP B;  4M75 F;  2OI3 A;  1M2V B;  2CP0 A;  3P8H A;  2HBW A;  1JQQ A;  1QVG A;  5CQX A;  2K2V A;  1YJN Q;  3JRZ A;  2LX7 A;  3FJP A;  1AWJ A;  2EGA A;  4C5E A;  1A0N B;  2E70 A;  2RQT A;  1BKB A;  2M0O A;  4XU2 A;  1AWW A;  3MEW A;  4DBQ A;  4MDX A;  3CCR Q;  4GBQ A;  3KFV A;  3OYD A;  1GRI A;  2KRN A;  2NUT A;  1VQN T;  1OX9 A;  2LX9 A;  3CC7 T;  4UC4 A;  3H0I A;  1G8X A;  3VYG A;  4HVV A;  1Z9Q A;  4Y28 E;  4A4G A;  2JOY A;  3UF4 A;  2RHI A;  5GAN e;  2XMF A;  1UHC A;  2DK3 A;  3G7Z A;  1NPR A;  4P5N A;  2RD1 A;  1UFF A;  4C5I A;  4XU0 A;  4II1 A;  3PVL A;  3CD6 A;  2KY9 A;  1K73 C;  1WJQ A;  2GTO A;  3A8H B;  3A98 A;  2XID A;  3C0C A;  3CCQ A;  1LVK A;  4M77 B;  3WXM B;  1VQ6 T;  2ROL A;  1FXX A;  4PLI A;  4M7A C;  3HRS A;  2RI3 A;  3QZ9 B;  1GBQ A;  1W70 A;  1TUC A;  3V8K A;  3OYM A;  1TG0 A;  2QAS A;  4K11 A;  4C92 A;  4RG2 A;  2CZ6 B;  1Q95 G;  1G83 A;  5CKF A;  3QUI A;  3QBY A;  2W10 A;  3REA B;  2NUP A;  3OYL A;  2RK2 A;  4C8Q A;  4LDW A;  4RTT A;  1VQK T;  2CP2 A;  2LVM A;  1K8A R;  1VQM A;  2BZY A;  3QDF A;  2JT4 A;  3NTH A;  4FYV B;  3O5Z A;  1TH7 A;  3OYJ A;  1KQS P;  4QW2 A;  2AZV A;  1QCN A;  2RHZ A;  3M55 A;  3HFN A;  4BI3 A;  4PJL A;  5GAM g;  2LT4 A;  2QDY B;  3HL8 A;  2SEM A;  1YN8 A;  2DE0 X;  2V1Q A;  1WHL A;  5LJ3 g;  4BE1 A;  2KQW A;  3JCM f;  4GLM A;  4M7D B;  1B34 A;  4KUI A;  3GNF B;  2DM1 A;  4ME7 A;  1Q7Y R;  2QQB A;  1YIJ T;  1D0X A;  3HHT B;  3O8V A;  5GMK i;  3TSZ A;  2KGT A;  4Z88 A;  1IHV A;  2EQM A;  5A2Q E;  2QAZ A;  3HRU A;  5D6X A;  1YCY A;  1WI7 A;  2QTX A;  5D6Y A;  4CC7 A;  4Z8A A;  5CR2 A;  3KXT A;  3CC4 T;  1XQH A;  2QXF A;  5LJ5 g;  2H3E B;  4J83 A;  1VQ9 T;  4XTW A;  2WSE E;  4M78 C;  1YIT T;  4E7S A;  2DZ9 A;  3CME T;  2QA4 T;  5GMK m;  5FU6 B;  4F7U E;  2XKO C;  5GAO l;  5KYU A;  2EAY A;  4HKE A;  2DBM A;  1WJS A;  3G6E A;  5HK0 A;  4MZP A;  2XI9 A;  1DJ7 B;  1NEB A;  4E47 A;  3TEE A;  5KYW A;  4PJJ A;  3EGX B;  4NL2 A;  1RUW A;  2D0N A;  4JZ3 A;  3OW2 P;  2H8H A;  2F69 A;  1RI9 A;  2DYB A;  2DXU A;  1X75 C;  2ED1 A;  3EFO A;  2MWO A;  3HTR A;  2FL7 A;  3E9G A;  5GAO p;  3JCM d;  2DA9 A;  2YHT A;  2PU9 B;  2O31 A;  3TRE A;  3MHX A;  1VYV A;  3EH2 A;  3JCM Q;  1T3L A;  3DB3 A;  4B9X A;  2A37 A;  3R6O A;  2KNB B;  1K8A U;  1S72 T;  4BY6 C;  4KGX B;  1VQL A;  2FRW A;  3CD6 Q;  3EG9 A;  2NUT B;  3JCM c;  2DXT A;  4LUD A;  2RQU A;  2EFI A;  3CCM T;  2YRC A;  2JXB A;  3CBO A;  3CCQ Q;  2DEU A;  4HCB A;  1KSW A;  1SG5 A;  2MMP A;  4OML A;  4D8D A;  3MP8 A;  2E1H A;  2QEX A;  4Z02 A;  3M9Q A;  3ME9 A;  4OMF B;  2C0I A;  3BDU A;  2DER A;  2F5T X;  1GBR A;  3SDZ A;  1K0S A;  2CSI A;  4OMP A;  3MKD A;  5I11 A;  1VQM Q;  3DLM A;  1WHG A;  4PJO F;  2KXD A;  1G3T A;  2RNA A;  4QQD A;  1IXD A;  2YSQ A;  3OYC A;  2YRD A;  4N4I A;  1H92 A;  2CUD A;  3LWI A;  2RM4 A;  4PL6 A;  1OUL A;  2KK4 A;  4C92 B;  3CXC A;  1LCK A;  2YUP A;  1KC8 U;  1D1A A;  2JW4 A;  4BAC A;  3E19 A;  2NUP B;  2J06 A;  2IG0 A;  4C8Q B;  3VS1 A;  1SRM A;  2VYT A;  1RI0 A;  1VQP T;  1XOV A;  3V8L A;  5KE2 A;  4A63 B;  3VS0 A;  5A0D A;  4J5Y A;  2JM8 A;  1YHQ T;  5GAO n;  1X2Q A;  2DTH A;  2D8J A;  4F7U A;  4FYY B;  4LE9 A;  3OMC A;  1WHK A;  4NS5 A;  2AK5 A;  4IUT A;  1ARK A;  2EQK A;  2GQV A;  4BE2 A;  3PNW C;  5GAN g;  5LJ3 h;  3L2Z A;  1MHN A;  1B34 B;  2GQI A;  3M0S A;  1JJ2 A;  3EGU A;  2EYX A;  1UJ0 A;  5IT9 E;  1RAD B;  1UJY A;  3RIR A;  2LNV A;  3HKS A;  3UDC A;  4N4H A;  2B86 A;  1FMW A;  3CPW S;  3G6E Q;  1K8A C;  1G3W A;  2LCL A;  3PTA A;  2O01 E;  4N0A A;  3EHR A;  4J9F A;  4LNP A;  2OTL T;  3CCS T;  2LQ8 A;  1KK7 A;  1ZLM A;  1WZO A;  3JB9 J;  4EMG A;  2CZ1 B;  1QKW A;  5LJ5 h;  2LQW A;  1K1Z A;  3GIB A;  1XTD A;  2QQA A;  1BBZ A;  1M2V A;  1O9S A;  3TSW A;  1N8R R;  5KYU B;  2RQW A;  2C0O A;  3VS6 A;  4M7A G;  1RAB B;  4LDY A;  3LW5 E;  3OS5 A;  3JSC A;  5DLQ E;  1Q7Y C;  1PSE A;  4J7I A;  2Y4X A;  2QQ9 A;  1VQL Q;  2X4X A;  3H8Z A;  2LC4 A;  2VC8 A;  1YI2 T;  5KYW B;  2PUO B;  5CQY A;  2MK5 A;  1D1C A;  2GF7 A;  1ZSZ C;  3QWY A;  4QQ6 A;  4C8Q F;  3C12 A;  2E41 A;  3I56 T;  5GAN 3;  2AKK A;  2M51 A;  2JM9 A;  4HCZ A;  1I07 A;  1CSK A;  1PKT A;  2J6O A;  2QEX Q;  4AT1 B;  2L3R A;  2BZ8 A;  5IHN A;  1YJW A;  4ELZ C;  2LT1 A;  3LWH A;  2MI6 A;  1M4Z A;  2CGH A;  4XQ3 A;  3CCU T;  3HFO A;  2VVK A;  3TCJ A;  5LJ3 e;  2WSC E;  2DL3 A;  2VGN A;  1RL2 A;  3EG9 B;  3RMS A;  2X4Y A;  2QYZ A;  2JVV A;  2PTK A;  2QQS A;  3V7C A;  3VS2 A;  4AMC A;  5GAN 7;  4LDV A;  1ZUY A;  2RJE A;  3NTK A;  5CCA A;  2O9S A;  3NPF A;  1WXT A;  4M77 C;  2DD5 A;  1Q81 R;  1VYU A;  1PHT A;  1YFN A;  2OX7 A;  2DVJ A;  2CKK A;  3SWN A;  5FW9 A;  1D1B A;  2EW3 A;  5CVI A;  2RMO A;  5LJ5 e;  1OU9 A;  2R5M A;  2EQI A;  1K9M R;  2MCN A;  2JMC A;  4DOW A;  1YWO A;  5A0G A;  4QVD A;  4M78 G;  4YTL A;  1NBE B;  3CCE A;  1QQJ A;  1OV3 A;  1UEC A;  4EIK A;  1R0B G;  1WQ7 A;  1VA7 A;  3OYN A;  3MET A;  9ATC B;  4O5V A;  3KUF A;  1N8R U;  1SSH A;  3G4S A;  2DX1 A;  4M7D C;  2OTJ A;  1GCP A;  1PG5 B;  3H9N A;  3E1S A;  3OYA A;  3P8D A;  1K4U S;  3QJY A;  2I2L A;  1NG2 A;  1TXQ A;  4XTZ A;  3IQL A;  2ZZD A;  3CCV A;  8ATC B;  2KBT A;  1M3C A;  3VYH B;  2RJC A;  3OS2 A;  3I55 T;  4RTU A;  2HQX A;  4F7U B;  3JAM E;  1PRM C;  3SEM A;  1I1J A;  1QWE A;  3X20 B;  2ED0 A;  4RTW A;  1PWT A;  1V29 B;  2EVR A;  4M7A E;  1VQO A;  3L2V A;  3C95 A;  3OMG A;  3OYK A;  1GXI E;  1OU8 A;  4GY5 A;  3RER A;  3UA6 A;  4A54 A;  1JRI A;  2DRK A;  4RUG A;  1M30 A;  1Y96 A;  4Y92 A;  3V8J A;  4HCK A;  2KRO A;  1Y7X A;  4OF1 A;  1EIF A;  1Q86 U;  2EBP A;  2P0K A;  3GPL A;  1Q81 U;  5FRN A;  4DOV A;  1YJN T;  1RLQ C;  3JCM g;  4JJC A;  3TU4 K;  4F14 A;  3EGX A;  1MUZ A;  2LNH B;  2QDL A;  3INZ A;  2VXF A;  1YJW Q;  2HSE B;  2OAW A;  1ZX6 A;  4RTY A;  3CCR T;  3OA6 A;  3CC2 A;  2J7I A;  1MMG A;  4M75 D;  2YLB A;  2RHU A;  1K9M U;  1VQ7 A;  2V26 A;  5CK9 A;  2KDS A;  1RAE B;  1PRL C;  4OGC A;  3DLL A;  4LDX A;  4C0Z A;  2HAX A;  1SPK A;  2NLU A;  1I5O B;  3R6N A;  1VQ5 A;  1SHF A;  4QVZ A;  2F2W A;  1P92 A;  1M8V A;  1MMN A;  2FZC B;  2AZS A;  3CEY A;  2E6N A;  3JCM V;  5GAM j;  1WHH A;  3RDV A;  2A0F B;  1YNZ A;  4LDU A;  1YIT A;  3CME A;  4AG2 C;  1N8R C;  2VWF A;  1YP5 A;  1KD1 R;  3G1J A;  1XJW B;  1D3B A;  2F1L A;  2KRM A;  2NWM A;  2EGE A;  3JCM J;  3DKM A;  4MZT A;  3FDR A;  2QK0 A;  4M78 E;  1AVZ C;  2EQU A;  4JRK A;  1IRE B;  4J8O A;  2CUB A;  3CCE Q;  4JJN K;  4LUE A;  3OYG A;  3QJ6 A;  3WVD B;  3SWN B;  4MDW A;  4AFS C;  2A7Y A;  1PD0 A;  4C92 C;  3A1P A;  4XTY A;  5KH6 A;  1EX4 A;  1NLP C;  2YXY A;  3ZBD A;  4MMK A;  4E2F B;  2DL8 A;  3G4S Q;  1N9R A;  1NZ9 A;  2OTJ Q;  4X9C A;  2ZPE B;  4C8Q C;  1ZA1 B;  3F70 A;  2ZPI B;  4NL3 A;  5FRM A;  3TVT A;  3JB9 F;  4HT9 A;  1AZE A;  4EDU A;  4F04 B;  3CCV Q;  1ZUK A;  1MGQ A;  3UPU A;  3M0T A;  4FM4 B;  2KR3 A;  2JN0 A;  1QCF A;  3CCM A;  1NJI U;  3OBY A;  2CH4 A;  2RJD A;  2GFA A;  1Q81 C;  3OSS C;  2VAS A;  4L6V 5;  1QCO A;  2CSQ A;  1KJW A;  2GBQ A;  4QQG A;  2EPD A;  1VQO Q;  1QP3 A;  4WTO B;  3PMI A;  1KQS S;  2RB6 A;  2EWN A;  3AT1 B;  1M1F A;  3A8L B;  2DF6 A;  4TVR A;  2CS7 A;  3MCA B;  1K9M C;  1RAF B;  4RTX A;  4M75 E;  1UEB A;  2FPF A;  5CKH A;  2RQR A;  3E9F A;  4ZTJ A;  3M0P A;  4DBH A;  2P4T A;  4RKU E;  2AKL A;  2DYI A;  5GAO m;  3CCL A;  4OB2 B;  2J05 A;  4C0D C;  2L89 A;  1OOT A;  5GMK h;  1V76 A;  3H41 A;  3VJP A;  1ABQ A;  4OMQ A;  2LRQ A;  4C0F A;  2DJZ A;  5HKC A;  4M77 G;  1KC8 R;  1FMK A;  2O9V A;  4J6X A;  2IIM A;  1KD1 U;  3CC2 Q;  2J6F A;  2DBK A;  4M77 F;  2CYZ B;  3M4G A;  2E3I A;  1Y96 B;  1VQ7 Q;  1UGP B;  1QKX A;  3PT9 A;  2DAQ A;  3I5R A;  3CMA A;  3M58 A;  1BCM A;  2HKQ B;  2KI7 A;  1VQ5 Q;  1PM3 A;  4KH1 B;  3JCM h;  3L42 A;  3QXE B;  3NFC A;  5GAO q;  4JRP A;  4OMN A;  3E2U A;  5GJW B;  2AT1 B;  6AT1 B;  1YIT Q;  4KRT A;  3CME Q;  4J9B A;  5HY6 A;  1EFN A;  2FZG B;  2YWW A;  3CD6 T;  2CZ0 B;  3OW2 S;  4J7F A;  1AT1 B;  1QWF A;  1RAH B;  3EG3 A;  2ABL A;  2O88 A;  5EC7 A;  3CCQ T;  2WAC A;  3ASK A;  4FIB A;  1X2K A;  4IKF A;  4HVU A;  3GOX A;  1AEY A;  5M9O A;  2ZAE A;  5CIU A;  4XK8 E;  5HCK A;  1UGV A;  3S3O A;  4M7D F;  2V1R A;  2YT6 A;  3J80 E;  1GL5 A;  2X3W D;  2M02 A;  2F2V A;  3OYI A;  1H64 1;  4DBF A;  1BB9 A;  4C0G A;  1VQ4 A;  5GAN j;  2HL3 A;  2RK1 A;  2CP6 A;  3X25 B;  2DL5 A;  1D3B B;  1XNI A;  1VQM T;  1R0C B;  2K5I A;  3RUX A;  4HT8 A;  5GMK e;  2L5Q A;  3MP6 A;  2LCS A;  2IVW A;  3CCJ A;  1Y0M A;  3ULR B;  4PJO G;  5IHK A;  2RPN A;  2OAU A;  1IHW A;  4EPC A;  3CCM Q;  2DET A;  4X1V A;  4IUV A;  5I2S A;  1VQ8 A;  2PZ1 A;  3A8G B;  1WFW A;  3PIP A;  4E7L A;  2RI2 A;  3MJX A;  2CP5 A;  3SHW A;  1PCX A;  3P8B B;  5GAM f;  4FW1 A;  4A4H A;  1LNX A;  3OYY A;  4A4E A;  4M75 A;  3QDR B;  1T3S A;  4ORZ A;  3CPW A;  3JCM e;  3RKX A;  4PKC C;  1OX8 A;  3NTI A;  4PJO D;  3CCU A;  1KD1 C;  1GFC A;  3OSV A;  3VS5 A;  2EYQ A;  4FT4 A;  2L3P A;  2W0Z A;  4M7A B;  3NMZ C;  1H8K A;  5I21 A;  4CC4 B;  1MND A;  2YLC A;  4ZNX A;  2QGF B;  2LTO A;  1CKB A;  8AT1 B;  3CCL Q;  2COZ A;  5LL6 S;  1D09 B;  1NE8 A;  1B07 A;  5IH2 A;  2DIQ A;  2Z0W A;  5J3B A;  2O2O A;  2COY A;  1KHC A;  1SKU B;  2QG9 B;  2V8J A;  4JJB A;  3OYE A;  2KAF A;  1R8O B;  3RR6 A;  3G6E T;  3J81 E;  4PFP A;  2G3R A;  1HSQ A;  4N0A C;  4ZN1 A;  1UGQ B;  5GAN 8;  1W2B P;  1ZA2 B;  4DBR A;  3FIF A;  3CMA Q;  1K76 A;  2RA2 A;  5CO7 A;  2A08 A;  5IXF A;  2Y90 A;  1C1A A;  4AFU C;  1IGQ A;  1M3A A;  2A28 A;  2I0N A;  1W2B S;  5GAM d;  2X9H A;  4XU3 A;  5KYX A;  5DLO A;  2GTJ A;  4JLI A;  1U1S A;  2HD0 A;  5FWC A;  1WIE A;  2EYY A;  3LLR A;  2D1X A;  3SFM A;  1VQL T;  2QTV A;  3VKI A;  4L59 A;  3BFM A;  5CKE A;  3G71 A;  3LH0 A;  5HK3 A;  1U5S A;  2VV5 A;  4F16 A;  3M54 A;  4GLK A;  4HXJ A;  1I4K 1;  4FYW B;  4C92 F;  2P4R A;  2G6F X;  5KCO A;  4BUG A;  4FCY A;  4C8Q G;  2DJQ A;  4J9H A;  2QEX T;  4JPB W;  1ZHI A;  2RHY A;  3N5B B;  4M78 B;  1H3Z A;  3EGD A;  2H3J A;  1JBM A;  4IUU A;  1VIF A;  2K3Y A;  4M7A D;  3OY9 A;  2YUQ A;  3I35 A;  1VQ4 Q;  4E7K A;  5DY9 A;  1M2O A;  1Y71 A;  2KE9 A;  3PGG A;  1KC8 C;  4QT7 A;  1GCQ A;  2K5L A;  2M0Y A;  1YJ9 A;  2PUK B;  2F2X A;  3ZL7 C;  3M0U A;  4PJO E;  4BB7 A;  3CCJ Q;  1BI2 A;  3OBW A;  4KGV B;  4KGZ B;  3M4Y A;  2BE9 B;  5FU7 B;  2CT4 A;  1VQ8 Q;  2KMT A;  1WPY A;  2K4Y A;  3PE0 A;  5L8R E;  1Q86 R;  3M53 A;  3M56 A;  4JUV A;  1BCO A;  4XTV A;  4M4Z A;  3SWN C;  2HMA A;  3ER0 A;  3V7S A;  4AG1 C;  1M27 C;  4JJD A;  5GAN 4;  2JS2 A;  2DXC A;  3CCU Q;  1ZSG A;  4RCB A;  2RO0 A;  2VB6 A;  3CBM A;  2JMA A;  3RES A;  3QYH B;  1AHJ B;  4MML A;  1QVF P;  2BTT A;  2M16 A;  1M1G A;  2K5F A;  4O6J A;  4ZTF A;  5I2M A;  4D8K A;  1N27 A;  4Y91 A;  1QMC A;  3UA7 A;  4OVA A;  2FPD A;  2XK0 A;  1VQN A;  2C0T A;  4IUR A;  4JS5 A;  1AOJ A;  2LQK A;  4OGE A;  1BI1 A;  4WF2 A;  1QVF S;  2ZCF B;  4M75 B;  3CC7 A;  4XTX A;  2BKD N;  1BI3 A;  2EIF A;  1Y57 A;  1MV3 A;  1RAG B;  2F5K A;  1QVP A;  1UDL A;  1V1C A;  2FZK B;  2RQV A;  1MNE A;  4J9C A;  4OB0 B;  1E7O A;  4HCC A;  1VIE A;  2DD4 A;  4M78 D;  1ZUU A;  2O4X A;  2PNI A;  2ROT A;  2X4W A;  1SHG A;  3EH1 A;  2L2P A;  2DIG A;  4KBM B;  3CPF A;  4OMM A;  3RNJ A;  2DVE A;  2LQN A;  3M0R A;  1VQ6 A;  2KXC A;  4BD3 A;  4LXC A;  2R58 A;  1OYX A;  2BZX A;  4PFO A;  3MP1 A;  1JXM A;  2WSF E;  2MYS A;  4FSX A;  1ZBJ A;  3L1A A;  2LDM A;  4FSS A;  2E65 A;  2HBP A;  3VS3 A;  3G71 Q;  1M90 R;  5FU6 C;  1UUE A;  1OPK A;  1TUD A;  2M9U A;  5KYY B;  1M1K U;  3WVE B;  1VQK A;  1NLO C;  4JLG A;  1BYM A;  1Q82 U;  4RCC A;  1ZBX A;  4DEY A;  5FLX E;  2K9G A;  3D7S B;  3QKJ A;  3EFR A;  5FWB A;  4X9D A;  1NJI R;  1JO8 A;  2E12 A;  3QWX X;  5AYF A;  5IHI A;  2YRV A;  4EMK A;  5KYX B;  2DIL A;  1YJW T;  1T0H A;  2AIR B;  1UB4 A;  2PQW A;  3FJ5 A;  2ZGW A;  4PJO A;  3ZEH A;  2COW A;  4PJM A;  5GAN d;  1OI1 A;  1U06 A;  1M8M A;  2DXB A;  4DA4 A;  4CRI A;  1NPP A;  5J26 A;  2JTF A;  1YJ9 Q;  2ECZ A;  2KVQ G;  1T0J A;  5GAO r;  4IUP A;  3QII A;  4BE0 A;  2E4H A;  3X26 B;  1TS9 A;  3S3N A;  3MEA A;  2VGM A;  3BE3 A;  4DQ2 A;  2C06 A;  1YIJ A;  1B3Q A;  2QGG A;  3GF5 A;  4BDY A;  2DL7 A;  3CQT A;  4NOY A;  3EHQ A;  1UG1 A;  4J9E A;  3SB2 A;  4BI4 A;  2DZC A;  4L5G A;  1MMD A;  3MEV A;  1WQW A;  3EGD B;  3VV0 A;  1G5V A;  1OQK A;  1RAA B;  2HKN A;  4XU1 A;  2RF0 A;  3CC4 A;  7AT1 B;  3I9Q A;  4PJN A;  1TUG B;  2KSS A;  4F7U G;  4J6W A;  1SEM A;  1VQ9 A;  5KE3 A;  5LJ3 j;  1RAI B;  2KEA A;  1N9S A;  2QA4 A;  4F7U F;  4FT2 A;  2RJF A;  2ZPB B;  1ZSZ B;  3UAT A;  2JTE A;  1MMA A;  1WYX A;  2MAM A;  2HQE A;  3CCE T;  1HK9 A;  3SD4 A;  2DNU A;  2EJG A;  1IGU A;  2XG8 D;  1QVG P;  2VKN A;  1KFZ A;  1VQN Q;  4CI0 C;  5ECA A;  4R56 A;  3CC7 Q;  1OEB A;  1KQS A;  3G4S T;  1RAC B;  1IZ6 A;  1PNJ A;  4BDZ A;  2OTJ T;  3RBB B;  2JUF A;  3A5Z B;  1QVG S;  1HD3 A;  4Z89 A;  3NGP A;  4DEX A;  1SF9 A;  5LJ5 j;  3CCV T;  2PVG B;  2KYB A;  1D0Y A;  1M90 U;  3GNG A;  3JB9 G;  4PNO A;  3REB B;  2XHC A;  1BI0 A;  3Q1J A;  4E7Z A;  1R77 A;  4CC3 A;  2P0P A;  1S72 A;  1CKA A;  1M1K C;  2JZ2 A;  3X24 B;  2DEQ A;  4A4K A;  1I5L A;  2DKG A;  4ELY C;  1YBY A;  1Q82 C;  2E6Z A;  4V2S A;  3HPW A;  1FX7 A;  1WLP B;  4M7A A;  2DTI A;  3DB4 A;  1VQ6 Q;  1Q86 C;  2DRM A;  1VQO T;  3L2W A;  3QHS A;  3JB9 D;  3JCM P;  2FG0 A;  2L3S A;  2B8A A;  5AT1 B;  3EG2 A;  2KT8 A;  1FWZ A;  1SSF A;  2FEI A;  2BUD A;  4KUD K;  2O4X B;  2D0Q B;  4OMO A;  1NYF A;  3BDL A;  4FU6 A;  1WNL A;  1WX6 A;  4WCI A;  1VQK Q;  2E5K A;  5CAI A;  1WGS A;  2XDD A;  2FB7 A;  3A8O B;  4OB1 B;  3UT1 A;  1TOV A;  1X69 A;  3HRT A;  3VUB A;  2LJ3 A;  3JB9 I;  2GGR A;  4XTU A;  2FPE A;  4QKU A;  3FEO A;  5GJV B;  2RN8 A;  2IPO B;  1TU0 B;  3CC2 T;  1AWX A;  1PSF A;  3H0H A;  2V8K A;  3OW2 A;  1QW1 A;  2DL4 A;  4AFQ C;  4JRQ A;  2D8H A;  1KQ1 A;  1N6A A;  2GNC A;  1VQ7 T;  1M9S A;  4KT0 E;  1VQP A;  2LJ1 A;  1I0C A;  3M0Q A; 
#chains in the Genus database with same CATH homology
 5FW9 A;  2EW3 A;  2KRS A;  1CKB A;  1NYG A;  2KYM A;  4GBQ A;  4J9D A;  3KFV A;  2RMO A;  1GRI A;  2KRN A;  1B07 A;  5IH2 A;  1AZG B;  2O2O A;  2EQI A;  1ABO A;  4JJB A;  2MCN A;  2JMC A;  4E6R A;  1YWO A;  3H0I A;  4HVV A;  1Z9Q A;  1HSQ A;  2DMO A;  3VS4 A;  3UF4 A;  1WXU A;  2KT1 A;  1OV3 A;  1UEC A;  4EIK A;  2XMF A;  1K76 A;  1UHC A;  1VA7 A;  1N5Z A;  2A08 A;  5IXF A;  4AFU C;  3U23 A;  1M3A A;  2A28 A;  1UFF A;  3PVL A;  1SSH A;  2I0N A;  2DX1 A;  1GCP A;  2GTO A;  1K4U S;  1W1F A;  2GTJ A;  1NG2 A;  3A98 A;  3C0C A;  5FWC A;  1WIE A;  2EYY A;  3IQL A;  2ROL A;  2D1X A;  2KBT A;  1M3C A;  1GBQ A;  1W70 A;  1TUC A;  1FYN A;  4RTU A;  2X3X D;  1TG0 A;  1U5S A;  4K11 A;  1GFD A;  4F16 A;  1H3H A;  2ENM A;  4HXJ A;  1PRM C;  2P4R A;  3SEM A;  2G6F X;  1IO6 A;  3JV3 A;  1G83 A;  1UHF A;  1I1J A;  1QWE A;  2DJQ A;  2ED0 A;  2W10 A;  4RTW A;  1PWT A;  2EVR A;  4J9H A;  3REA B;  4JPB W;  1HJD A;  2HDA A;  4RTT A;  4F17 A;  1YCS B;  2MOX A;  2BZY A;  2K7A A;  2JT4 A;  3UA6 A;  3NHN A;  4IIO A;  2YUQ A;  3I35 A;  3O5Z A;  2DRK A;  2AZV A;  2KE9 A;  4RUG A;  1M30 A;  1J3T A;  4QT7 A;  1GCQ A;  4Y92 A;  2M0Y A;  4HCK A;  2F2X A;  2KRO A;  3ZL7 C;  3M0U A;  2SEM A;  2EBP A;  1YN8 A;  2DE0 X;  2K3B A;  2V1Q A;  4R0K A;  3VS7 A;  1JXO A;  2CRE A;  4GLM A;  1RLQ C;  4JJC A;  1W6X A;  4F14 A;  1MUZ A;  2CT4 A;  2LNH B;  2QDL A;  2DM1 A;  1AD5 A;  3PE0 A;  2FRY A;  2OAW A;  1ZX6 A;  4RTY A;  4M4Z A;  2K2M A;  4AG1 C;  2J7I A;  1M27 C;  4JJD A;  2OJ2 A;  3TSZ A;  2YDL A;  2KGT A;  4Z88 A;  2JS2 A;  1PRL C;  1ZSG A;  2HSP A;  1WI7 A;  4CC7 A;  2JMA A;  1SPK A;  4Z8A A;  1U3O A;  3R6N A;  1SHF A;  2BTT A;  2F2W A;  3VRZ A;  4D8K A;  2AZS A;  3UA7 A;  2FPD A;  2DBM A;  2C0T A;  1AOJ A;  1YNZ A;  2DLP A;  4AG2 C;  3LH5 A;  2VWF A;  1YP5 A;  1NEB A;  2KRM A;  2NWM A;  1Y57 A;  1MV3 A;  4IIM A;  2EGE A;  2K6D A;  5IXB A;  2NUZ A;  1RUW A;  1UDL A;  1V1C A;  1JU5 C;  2D0N A;  2RQV A;  4JZ3 A;  4J9C A;  1AVZ C;  2H8H A;  1RI9 A;  1MV0 B;  1E7O A;  2DYB A;  5I22 A;  1PKS A;  1ZUU A;  2CUB A;  2CDT A;  2PNI A;  2ROT A;  2ED1 A;  4LUE A;  1SHG A;  2L2P A;  1WXB A;  4J9G A;  4AFS C;  4OMM A;  2DA9 A;  2L3Q A;  3RNJ A;  2O31 A;  4ZNX A;  3EG1 A;  1VYV A;  2LQN A;  1T3L A;  3M0R A;  2A37 A;  2KXC A;  2KNB B;  1NLP C;  3GBQ A;  2BZX A;  2YUO A;  2DL8 A;  5L23 A;  2FRW A;  1JXM A;  2ESW A;  4LUD A;  2FO0 A;  2RQU A;  1ZBJ A;  3TVT A;  2JS0 A;  2JXB A;  1AZE A;  1KSW A;  1ZUK A;  4CC2 A;  4FSS A;  3M0T A;  2KR3 A;  3VS3 A;  4OML A;  4D8D A;  1QCF A;  1UUE A;  1OPK A;  1TUD A;  1GCQ C;  1JEG A;  1X27 A;  2CH4 A;  1NLO C;  2C0I A;  1GBR A;  4DEY A;  2K9G A;  1K0S A;  2CSQ A;  5FWB A;  2CSI A;  4OMP A;  1KJW A;  2GBQ A;  1JO8 A;  2EPD A;  3QWX X;  5I11 A;  5IHI A;  2DIL A;  1K9A A;  1T0H A;  3EG0 A;  3FJ5 A;  1WA7 A;  2KXD A;  4ESR A;  2EYW A;  1U06 A;  2RNA A;  1UE9 A;  1M8M A;  2DF6 A;  3H0F A;  4JZ4 A;  2YSQ A;  2HEQ A;  4RTX A;  1H92 A;  2CUD A;  2FPF A;  3I5S A;  2RQR A;  3M0P A;  2A36 A;  1QLY A;  2ECZ A;  1T0J A;  2AKL A;  1LCK A;  2YUP A;  2JW4 A;  3VRY A;  1B3Q A;  2J05 A;  2DL7 A;  2J06 A;  1E6G A;  3CQT A;  3VS1 A;  1SRM A;  3EHQ A;  1OOT A;  1UG1 A;  4J9E A;  1XOV A;  3H41 A;  1ABQ A;  4A63 B;  3VS0 A;  4OMQ A;  2EKH A;  1FMK A;  2O9V A;  2IIM A;  2J6F A;  2DBK A;  2JM8 A;  4LN2 A;  2RF0 A;  3THK A;  1BU1 A;  1X2Q A;  3I9Q A;  1YWP A;  1QKX A;  1SEM A;  2D8J A;  1SRL A;  2J6K A;  4LE9 A;  2KEA A;  2AK5 A;  1ARK A;  3I5R A;  3UAT A;  2JTE A;  1BK2 A;  1S1N A;  4AFZ C;  1WYX A;  2SRC A;  1OPL A;  2GQI A;  2EYZ A;  3M0S A;  1G2B A;  1KIK A;  2DNU A;  3EGU A;  2EYX A;  2YUN A;  1UJ0 A;  1KFZ A;  2VKN A;  1NEG A;  4OMN A;  1UJY A;  5GJW B;  2L0A A;  2B86 A;  4KRT A;  2RQT A;  5ECA A;  4J9B A;  1OEB A;  1EFN A;  3EHR A;  1PNJ A;  4J9F A;  2LJ0 A;  3RBB B;  1NM7 A;  4LNP A;  1HD3 A;  4Z89 A;  3NGP A;  4DEX A;  1QWF A;  1UTI A;  1X43 A;  2CT3 A;  3EG3 A;  2O88 A;  2ABL A;  5EC7 A;  2CH4 W;  1ZLM A;  4J9I A;  2KYB A;  1X6B A;  1E6H A;  1X2K A;  1Z9Z A;  4RTZ A;  2HCK A;  3REB B;  4HVU A;  1QKW A;  1AEY A;  2LQW A;  1K1Z A;  4CC3 A;  5HCK A;  1UGV A;  1CKA A;  2V1R A;  2YT6 A;  1BBZ A;  1GL5 A;  2X3W D;  3TSW A;  2RQW A;  2C0O A;  3VS6 A;  1WLP B;  2F2V A;  1AWO A;  1K0X A;  1BB9 A;  2LP5 A;  2MIO A;  2DL5 A;  2DRM A;  2LZ6 B;  2FG0 A;  2L3S A;  2LCS A;  3QWY A;  1M3B A;  1Y0M A;  3EG2 A;  2KT8 A;  3ULR B;  5IHK A;  2FEI A;  2RPN A;  2AKK A;  2M51 A;  1VYT A;  1I07 A;  1RLP C;  2EGC A;  2JM9 A;  1CSK A;  1PKT A;  1NYF A;  4OMO A;  4RTV A;  4X1V A;  2J6O A;  2PZ1 A;  2LMJ A;  1WFW A;  1WX6 A;  2BZ8 A;  2K79 A;  4WCI A;  2E5K A;  5IHN A;  3SHW A;  1X6G A;  4HVW A;  1X69 A;  2VVK A;  2LJ3 A;  3PVQ A;  1T3S A;  4ORZ A;  2GGR A;  1WDX A;  2FPE A;  2DL3 A;  5GJV B;  2RN8 A;  2PTK A;  1GFC A;  3VS2 A;  2OI3 A;  1AWX A;  1ZUY A;  3H0H A;  2HBW A;  1JQQ A;  3VS5 A;  2O9S A;  3NPF A;  1WXT A;  2DL4 A;  2L3P A;  2LX7 A;  4AFQ C;  2W0Z A;  2GNC A;  1VYU A;  1H8K A;  1PHT A;  2D8H A;  3NMZ C;  1AWJ A;  2DVJ A;  2EGA A;  4CC4 B;  1A0N B;  2LJ1 A;  1I0C A;  1AWW A;  3M0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...