2EW3A

Solution structure of the sh3 domain of human sh3gl3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
MDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 3
publication title Structural Basis for the Binding Specificities of Huntingtin Proline-Rich Region with SH3 and WW Domains
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ew3A00
3M0TA 1SSHA 2CSQA 1GBRA 3ULRB 1UTIA 1G83A 1HD3A 1UGVA 2ED1A 2KROA 1WI7A 1WYXA 2MCNA 2DLPA 1S1NA 2EPDA 1VA7A 3REAB 1LCKA 1UFFA 4WCIA 1XOVA 3IQLA 2D1XA 2PNIA 2DM1A 1AVZC 2RQRA 1UJ0A 2IIMA 4J9CA 2D0NA 2FPEA 2DJQA 1GFCA 4LN2A 1BK2A 3VS3A 5ECAA 3REBB 2A28A 3TSZA 2JW4A 2K3BA 2V1QA 2AKKA 2LMJA 1J3TA 1SHFA 5GJVB 1K4US 1E6GA 2AZVA 2KYBA 4Z8AA 1AWJA 2AK5A 1ZX6A 3H0FA 2EGEA 3I9QA 2RMOA 1U06A 3VS6A 1VYVA 3NMZC 3PVLA 2HEQA 4AG1C 4IIOA 2GNCA 2K9GA 2QDLA 1E7OA 2DRMA 1ZLMA 2M0YA 1T3SA 1U3OA 2L3SA 2LP5A 4K11A 3QWYA 2O2OA 1JQQA 3VS1A 3M0SA 2ROTA 2EYWA 2YUOA 4OMPA 1VYUA 1YWOA 2BZYA 2YDLA 3I5RA 1AZGB 2K7AA 2GTOA 3M0UA 1UE9A 1UHFA 4DEXA 2X3XD 2KE9A 1PKTA 1CKAA 2F2WA 4LNPA 2G6FX 2FO0A 4LUDA 1KFZA 1M30A 3NHNA 3THKA 1VYTA 1H3HA 3VRYA 2CSIA 2BTTA 2AZSA 3M0QA 1SRMA 2HSPA 1SPKA 2OAWA 1WXTA 2JS2A 3H41A 2OI3A 3EHRA 1UJYA 2GQIA 2ABLA 2PZ1A 4HXJA 2EBPA 3NGPA 4HVVA 2DVJA 4KRTA 2KT8A 4J9GA 2LJ0A 1PNJA 2DRKA 1BBZA 2ESWA 2KBTA 2L3QA 2DYBA 3PE0A 4R0KA 1SHGA 1RI9A 3GBQA 3R6NA 2DL7A 1MV3A 2H8HA 2CT3A 1X27A 2JM9A 4OMLA 3VS4A 1MV0B 5GJWB 4AFSC 4LE9A 1AWWA 4CC3A 4AG2C 1W6XA 2J06A 4HCKA 4JJBA 2K2MA 1K0SA 1JXMA 2D8JA 1GRIA 4J9BA 1Y0MA 4RTUA 2LCSA 2DBMA 2LQWA 4RUGA 1TG0A 1PKSA 2DL3A 1RLQC 2SRCA 1YN8A 1IO6A 5EC7A 1U5SA 2L3PA 2DL8A 3TSWA 3O5ZA 2GBQA 5FWCA 2O31A 4OMQA 2RQUA 1E6HA 4J9HA 5L23A 2ENMA 4GBQA 3VS0A 1UG1A 4EIKA 4DEYA 4CC4B 4RTXA 1MUZA 2OJ2A 5HCKA 4LUEA 1OV3A 1FYNA 3VS5A 1NG2A 3UF4A 1AWXA 3UA6A 2RQTA 5FW9A 1ABOA 2KRNA 2VVKA 3KFVA 5FWBA 1I1JA 3EG2A 2NWMA 1V1CA 2EQIA 2ED0A 2LNHB 4JPBW 1PRMC 1YNZA 1W70A 2CH4W 1YCSB 1M3AA 2JT4A 5IXBA 1AD5A 1UUEA 1WDXA 1X43A 1JXOA 2RQWA 2O9SA 3CQTA 1M3CA 2K6DA 1BB9A 1BU1A 4QT7A 2YUNA 2B86A 4M4ZA 1CSKA 4IIMA 2LZ6B 2EGAA 2YSQA 2W10A 1QKWA 1KSWA 1ABQA 2M51A 4Y92A 3RNJA 1OPLA 1QWFA 2CDTA 2VWFA 3TVTA 3LH5A 2C0IA 1NEGA 1X6BA 2KXDA 4F16A 2JTEA 2RN8A 5IHIA 1Y57A 4J9DA 4OMNA 1ZUYA 2KGTA 1NLPC 2LQNA 3NPFA 5I22A 1GCQC 4Z88A 1WX6A 2RF0A 2O9VA 4ORZA 1HJDA 2NUZA 2EVRA 3H0HA 2DX1A 2A37A 1EFNA 1QLYA 2HCKA 2PTKA 3A98A 2HDAA 1RLPC 2F2XA 2YUQA 4AFQC 2FEIA 2RNAA 1T3LA 1NYFA 2RQVA 3VS7A 2AKLA 3EG1A 1ZUUA 2KEAA 4RTWA 5I11A 1B07A 4J9EA 1H8KA 2A08A 5IHNA 2DL4A 1QCFA 1JEGA 3U23A 1K0XA 1KIKA 4AFZC 2J6FA 4JZ4A 4D8KA 2L0AA 1AEYA 3UATA 2LJ3A 2DE0X 1M27C 1YP5A 1I0CA 5IXFA 2P4RA 1SRLA 2J6KA 3H0IA 1T0HA 1UECA 1WLPB 1G2BA 4ZNXA 1TUDA 1UDLA 3I35A 4X1VA 1AWOA 1K9AA 1ZSGA 1OEBA 1WFWA 1OPKA 2KNBB 2KR3A 1H92A 3UA7A 2D8HA 3VRZA 2GGRA 1NEBA 1CKBA 2JMCA 2J05A 4CC7A 1NYGA 1M3BA 2JXBA 2HBWA 2KYMA 2X3WD 4OMOA 4ESRA 2YT6A 4A63B 1WA7A 2SEMA 3JV3A 1GCPA 1SEMA 1RUWA 4JZ3A 2ECZA 2JS0A 1K76A 2XMFA 2BZ8A 2W0ZA 1X2QA 2FPFA 3FJ5A 1ZBJA 1AZEA 1T0JA 3I5SA 2LX7A 2C0TA 2KRSA 3EHQA 4OMMA 3SEMA 2DNUA 2CH4A 2EGCA 3EG0A 2EYYA 3QWXX 1JU5C 2FRWA 2L2PA 2DBKA 4CC2A 1PHTA 2GTJA 1AOJA 1KJWA 4JJDA 3ZL7C 1FMKA 1PRLC 3PVQA 1X69A 1WXUA 2C0OA 1NLOC 1QWEA 3SHWA 2J7IA 2J6OA 2EKHA 1OOTA 2K79A 2KT1A 2KXCA 1GFDA 1YWPA 2F2VA 2JM8A 2MOXA 2E5KA 2FRYA 4HVUA 4RTTA 2I0NA 2LJ1A 1W1FA 2JMAA 4JJCA 2KRMA 3VS2A 1GCQA 2EW3A 3M0PA 1X6GA 4J9IA 2FPDA 1UHCA 1X2KA 2YUPA 2CUDA 2CT4A 3EGUA 2A36A 4F14A 4RTVA 1GL5A 1WXBA 2ROLA 1Z9QA 2FG0A 2RPNA 2DL5A 1A0NB 3EG3A 3M0RA 4D8DA 1K1ZA 3RBBB 1PWTA 4E6RA 5IHKA 2DMOA 1N5ZA 2EYXA 2CREA 4Z89A 2MIOA 2DILA 1Z9ZA 4AFUC 4FSSA 2EYZA 1JO8A 1TUCA 2VKNA 1B3QA 4GLMA 1QKXA 4F17A 2BZXA 2O88A 4RTYA 1HSQA 1I07A 1WIEA 1GBQA 2DF6A 3C0CA 4HVWA 1ZUKA 5IH2A 1NM7A 1M8MA 2CUBA 4J9FA 1ARKA 2DA9A 2V1RA 4RTZA
chains in the Genus database with same CATH superfamily
1SSHA 4C92B 4Z02A 3CCEA 4PJLA 5KYXA 3EGXB 4XTUA 4PK4A 1HD3A 3CC2T 1UGVA 3OS2A 2X4XA 3PNWC 1K8AC 1WYXA 1JJ2S 2MCNA 5DLQE 2DLPA 3REAB 4C8QB 2KVQG 1UFFA 1YIJA 4JRPA 2R57A 5CO7A 2PNIA 1XNIA 3L2ZA 1LOJA 1OYXA 2D0NA 2QG9B 3L1AA 4LN2A 3VS3A 3REBB 2MWPA 3EFRA 5CQYA 2RH2A 1X6OA 1J3TA 2G3RA 3FLGA 3G71A 3CCSQ 3CCUQ 3KUFA 3VU3C 4DQ2A 3CMEQ 2AK5A 4UC4A 4WF2A 4XTWA 1ACMB 2RO0A 1OULA 1OU9A 2EGEA 1SG5A 4BE2A 1VQ5A 1U06A 3VS6A 1VYVA 3NMZC 3M5AA 2JTMA 3GLXA 2HEQA 1YJ9A 2KMTA 1ZLMA 4D6WA 2BUDA 2QI2A 1T3SA 4M7AD 2M16A 2RB6A 4KH1B 3PMIA 2CGHA 3M56A 4M78A 1YJNA 3FRNA 1JQQA 3VS1A 4NL3A 4OMPA 1YWOA 3FIFA 2YDLA 4PFPA 1S72A 2GTOA 2ZPFB 1XJWB 1UE9A 2LT1A 2A0FB 4O5VA 1PKTA 1CKAA 4LNPA 2G6FX 2FO0A 1M30A 5CVIA 3X24B 3CCRA 1M1KC 1H3HA 4EMHA 3VRYA 3PIOA 1MNEA 3QO3A 4HCCA 2AZSA 3VUBA 3V8JA 2HSPA 2R58A 1SPKA 3GF5A 5GAOq 4C0ZA 5GMKi 1M90U 2QEXT 3H41A 5GAMg 1VQOQ 4HXJA 4PJOD 3I56A 5GAN7 4DA4A 2KT8A 4DBQA 2LJ0A 1D3BA 1PNJA 4FIBA 3OYNA 3I55T 2ESWA 2M9UA 4ZGJB 5CKDA 1JB0E 1SHGA 3HKSA 4FYWB 2GCXA 1TTHB 2CT3A 1X27A 4C5EA 1WQWA 1JJ2P 3CCLT 3VS4A 4LE9A 1AWWA 4L59A 4CC3A 4AG2C 4C92E 1K0SA 2OTJQ 4RUGA 1TU0B 5EC7A 2L3PA 3SDZA 3CC4Q 5GAOl 5FWCA 2O31A 3G71Q 4OMQA 2DTIA 3OMGA 1N9SA 2E10A 3BDLA 1VQNA 2E3HA 4XK8E 3OY9A 4M77G 4LUEA 1OV3A 1YJ9Q 2VV5A 4EPCA 1Q86C 1MMAA 1AWXA 4JRQA 5EG2A 5CCAA 1PD0A 5LJ5h 1ABOA 1NZ9A 4BDZA 1VQMQ 2RJDA 4F7UF 2VVKA 3KFVA 1I1JA 2JNGA 2A7YA 2NWMA 1V1CA 5FRNA 1YJWA 3MO8A 2LNHB 1ZQ1A 1PRMC 1N8RR 1YNZA 2BKDN 3JCMb 1YHQA 1N8RC 1M3AA 1K73C 1AD5A 1UUEA 3ME9A 4C0DC 1M3CA 3LGFA 1BB9A 2YUNA 2B86A 2RI2A 4M4ZA 5GAOm 5GAMe 4IIMA 3LX7A 3G6EA 3M4GA 1ABQA 4Y92A 2ATCB 3A1PA 1QWFA 1TSFA 1WPYA 1X6BA 3I56Q 1NPPA 1Y57A 4J9DA 4OMNA 4KGXB 3OBWA 5KYUA 3E9GA 1GCQC 3OYIA 3SWNC 4Y28E 1WX6A 1HJDA 4QQDA 4Q5WA 2LQKA 2EVRA 1VUBA 2VB6A 2DX1A 2CZ1B 1QLYA 2YLBA 2HDAA 1UGRB 4DBRA 1K8AU 3CD6Q 4E7KA 1WNLA 5I2MA 3M59A 1T3LA 1NYFA 2E3IA 3VS7A 1B07A 3LWHA 4V2SA 2O01E 3P8HA 4OP0A 3X25B 3CMAQ 3U23A 1YIJT 4IUQA 1QVGP 3UWNA 1KQ1A 1O9SA 2HBPA 2J6FA 2IVWA 2LJ3A 2DE0X 4M7AB 1M27C 1I81A 1X75C 1KHIA 1T0HA 1WLPB 4M75C 4ZNXA 1KD1R 3MEUA 2CP3A 1RAFB 3V8KA 3G71T 1UGQB 1K9AA 4BB7A 1OI1A 3S6WA 4J5YA 3TEEA 4XQ3A 4FSXA 1RAEB 1VQ5T 2GGRA 3A5ZB 1NEBA 1YJ9T 4JDSA 2JMCA 2DTOA 5GAN2 2JXBA 2VYTA 2YT6A 1NJIR 4A63B 3OMCA 2QA4A 2NUPB 4EMKC 4JZ3A 5A0LA 1C6VX 4PJOB 4EMGA 2XMFA 1S72T 2W0ZA 1X2QA 1KHCA 5C0MA 1T0JA 3I5SA 2X4YA 3CXCA 2C0TA 3EHQA 4OMMA 1M1KU 2DZ9A 1VQKA 2DNUA 2JOYA 3CCRT 3EG0A 1JU5C 1F1BB 4L6V5 2DBKA 1AOJA 3C12A 3PVQA 1B34B 2COWA 2D0QB 5HK0A 1AHJB 1NLOC 3HRTA 3LGLA 2CS7A 2HQEA 3SHWA 5IAYA 2J7IA 5FRMA 4M7DG 3EH1A 5AT1B 1VQ9A 3CC7Q 3I56T 2K79A 3JSCA 4M77F 4RG2A 2M02A 1SSFA 2E12A 5GAN5 1VQ6Q 1WQ7A 1FWZA 2WSFE 2K57A 3X28B 4HVUA 4FT2A 5J3BA 2I0NA 2LJ1A 1W1FA 3RUXA 3QZ5B 1GCQA 2EW3A 1MNDA 1X2KA 2BE9B 2CT4A 3MP6A 3JB9J 3VYHB 3SD4A 1VQ7A 4BI3A 2DD4A 3HP9A 2DL5A 3EH2A 1A0NB 3QYHB 3KBGA 4E7HA 1HXDA 1K1ZA 2FZGB 3OYAA 3OW2S 4E6RA 3DKMA 3L2QA 2MIOA 1JRIA 3RMSA 1R0BG 4AFUC 1M1FA 1Q7YC 5KYWA 1BI0A 2Z0WA 2QTXA 1VQNT 4M7AE 3CPWA 1HSQA 1Q86U 1Y07A 3OS1A 3NTKA 4HVWA 1NM7A 1M8MA 1TS9A 3JCMQ 2ZPHB 1RAGB 3UDCA 1M90R 2EJFA 3M0TA 2CP7A 4J8OA 1UGSB 4LDYA 4KBMB 1UTIA 2E70A 4C8QC 1YJWT 1N9RA 3HFOA 3V7SA 2DXCA 1K73U 1D0XA 1YHQT 5HK3A 5KYYB 5D6WA 4GLKA 3JCMg 1VQKQ 5GANd 1LCKA 4WCIA 1ZBXA 5CKHA 2EJGA 2HL3A 2D6FA 3G6ET 2IIMA 4PJOE 2DJQA 1G3YA 1GFCA 3QDFA 3CEYA 4M75F 2A28A 4BI8B 2JW4A 2XICA 2DKGA 2K3BA 4HKEA 1VQ9Q 1MMGA 4R55A 1K4US 2AZVA 2KYBA 2YHTA 3X20B 2E6ZA 3UT1A 4B9XA 2LTOA 5FU6B 4IIOA 4J6XA 2GNCA 2K9GA 2QDLA 2O4XA 2FHDA 2AIRB 4M78C 3CCSA 3CCUA 4OB1B 1U3OA 2NLUA 3CMEA 4ZGEB 8ATCB 2EQMA 3QWYA 1YCYA 2IG0A 2LCCA 3L2RA 4DEXA 2EWNA 2X3XD 1WHGA 3BDUA 1V29B 1BCOA 2F2WA 3QZ9B 5GANf 3HSBA 3JB9H 4LUDA 1H3ZA 2RJFA 3OW2P 2BTTA 3TQ7P 3M0QA 1YITQ 5LJ5d 4M7DB 4MZPA 4A4HA 1KQSP 3EHRA 2ABLA 4JLGA 2KI7A 4M7DF 2PZ1A 1M4ZA 2QGGA 4JRKA 3CBPA 4J9GA 3RR6A 4II1A 3JCMe 1AT1B 2CYZB 4C92A 4IUVA 1RADB 2E5QA 3GBQA 1LJOA 3ZFJA 4RCCA 3EGXA 1VQOA 1MV3A 4F7UG 1HK9A 2JM9A 4KULA 3OA6A 4AFSC 2L8DA 4A53A 1K8AR 2K2MA 3CCJQ 1JXMA 1VQKT 3JCMV 4C8QA 2F1LA 3G7ZA 4DOWA 3PFSA 2JZ2A 3PIPA 1Y0MA 4C0FA 2DK3A 4RTUA 5L8RE 2LQWA 4A54A 1TG0A 2DL3A 4OF1A 2SRCA 3L2UA 1U8RA 2FZKB 3E2UA 5IT9E 2DL8A 2RQUA 1YBYA 1XTDA 3A8LB 2OTJA 1VQ9T 2ENMA 4ZN3A 1H641 4GBQA 3VS0A 1UG1A 1D09B 2X51A 2CP5A 4CC4B 5LJ5f 3VYGA 4BUGA 3OYLA 2OJ2A 4E7IA 4A4FA 3C95A 1FYNA 3VS5A 3QBYA 3CC4A 1RAHB 4HT9A 2BIVA 1OU8A 5FW9A 1LVKA 2EQJA 3QJYA 2ZPEB 3EG2A 2E1HA 2EQIA 2P0KA 3OS0A 4JPBW 2JVVA 1MHNA 2QGFB 1W70A 3MP8A 2CH4W 2K3YA 1OX8A 2RI3A 1VQ7T 2VGMA 1JXOA 1IHWA 1VQMA 1FXXA 2R5AA 5KYNA 3OYYA 4IUUA 5DLOA 1CSKA 1WGSA 2EGAA 2YSQA 1EZZB 2DIGA 4LDWA 1Q7YU 5CAIA 1BIBA 2M51A 1K9MC 1M1KR 5IN1A 4WTOB 4JS5A 4LD9K 5LJ3h 1I5LA 2V26A 1YITT 5CKFA 3HRUA 3HTRA 2XD0A 3OB9A 1ZUYA 1UGPB 4JJNK 3N5BB 3DB3A 3NPFA 2QAZA 4PNOA 5GANh 2PVDB 2DZCA 2RF0A 3BW1A 4ORZA 3A8HB 2NUZA 4BY6B 2GFUA 1W2BP 4M7DE 2GFAA 2JTFA 4M78F 4AFQC 2AKLA 3EG1A 4LDVA 4OB2B 3UPUA 2NYSA 3QG1A 4M7AC 1H8KA 2F69A 1QCFA 4FT4A 3SFMA 5GANj 1KIKA 3M9QA 1WHHA 3CD6A 3OBYA 3UATA 3L2WA 1YP5A 3RKYA 5IXFA 1YI2Q 1WJSA 3CMAA 4M77D 1Q82C 2CP0A 3E9FA 4A4KA 2E6NA 4X1VA 2DXBA 4VUBA 1ZSGA 4F04B 1OPKA 2RHXA 2KNBB 3M57A 2XU8A 2COYA 2D8HA 4PLIA 2B8AA 2EIFA 2E41A 4PJOC 1JBMA 2J05A 1PM3A 4CC7A 1PG5B 4OMOA 3JCMW 2X3WD 4J7IA 4DBFA 4ESRA 1Q86R 5M9OA 2CZ7B 3CCST 3CCUT 2SEMA 3CMET 1IGUA 4F7UB 1N6AA 1RUWA 1N27A 1TUGB 1G3WA 2AHJB 2VUBA 1IXDA 1AZEA 4NOYA 4IURA 4C0GA 2LX7A 3QDRB 1K73R 2RJCA 3SEMA 2CZ6B 2CH4A 4CRIA 4X9CA 1R0CB 2FRWA 2L2PA 1PHTA 2GTJA 2FZCB 4XTXA 3ZL7C 1G3SA 2QASA 3QYGB 2Y4XA 1X69A 1KQ2A 2C0OA 4ELYC 2K2VA 1QVGA 1LPLA 5LJ5j 1QWEA 5FU7B 1IREB 1TH7A 4FW2A 3RKWA 3RMQA 1OZ3A 5I2SA 2FB7A 2XDPA 2EKHA 2KT1A 4XU3A 5C6SA 1M2VB 3CPFA 5D7UA 1IHVA 3OYMA 2P84A 2JM8A 5GMKh 2R5MA 3O8VA 4HCZA 2E5KA 4KUDK 1VQOT 3A8MB 1Y96B 3CC7A 2FVUA 3M0PA 3P8DA 1X6GA 4E2FB 2NUTB 2CUDA 2DVEA 2ZZDA 3EGUA 4F14A 2RK1A 1BKBA 4JRIA 3J80E 4M75D 2ROLA 4J6YA 1VQ6A 3EG9B 1KK7A 2RK2A 2FG0A 4QVDA 2X35A 3EFOB 5GMKj 1IZ6A 4N4HA 2L5QA 3M0RA 4D8DA 4ZGDB 3RBBB 4M7AA 3GNGA 1N5ZA 2CREA 1QQJA 5J39A 1OQKA 1Z9ZA 1R77A 2OTJT 2VXEA 2DXTA 2K3XA 1C0MA 3X26B 1KG1A 3FB9A 4FYXB 1QKXA 4M75G 3OSSC 4XTZA 5DM7R 2BZXA 2YRCA 4OGEA 4RG8A 1GBQA 2EAYA 2RHIA 2VGNA 4LDUA 3CXCS 1Y7XA 3CC4T 5IH2A 5AYFA 1ARKA 1D0YA 4KT0E 5KE3A 4RTZA 2PVOB 2CSQA 1GBRA 2LQ8A 3ULRB 2LNVA 3MJXA 5LJ5g 2ED1A 2NUPA 2KROA 4X9DA 1WI7A 2D9TA 1FX7A 4PJOA 1EX4A 2EPDA 5HKCA 5CR2A 1VQMT 1VA7A 4NS5A 1XOVA 1D0ZA 3IQLA 3DB4A 4F7UE 4E7SA 4HA8A 1QVPA 1UJ0A 1K9MU 4J9CA 4M7DD 2XDDA 1BK2A 2L3RA 5ECAA 1B34A 1RI0A 2V1QA 2AKKA 2LMJA 1ZSZC 5HY6A 3FDRA 5GJVB 1OZ2A 2YRVA 1VIEA 4Z8AA 4MZTA 5GAOn 4J83A 2DXUA 2WACA 3I9QA 2COZA 2HMAA 3PVLA 3ZBDA 3MCAB 4HCBA 4M77B 3JB9I 1E7OA 3AT1B 4BI4A 4J6WA 3JB9F 4C5IA 3EGDB 3OYJA 2F5TX 3CBOA 2LVMA 4BE0A 2O2OA 2ZPGB 4RMOA 2ROTA 2EYWA 3PMTA 4PLLA 2BZYA 3JCMJ 3CPWS 2DIQA 2K7AA 2RM4A 3M0UA 1PSFA 3WVDB 2K4YA 3CD6T 1UHFA 3VJPA 4C0DB 7AT1B 4P5NA 4KGVB 4BACA 1VQ8Q 2QQRA 3CCMQ 3NHNA 3THKA 1VYTA 1Q82U 2CSIA 3CMAT 3RIRA 1SRMA 4IUTA 2RI5A 2OAWA 1I8FA 2JS2A 2PUOB 1VIFA 1FMVA 4FYVB 1TWBA 1UJYA 3DLLA 1I4K1 2VASA 5LJ5e 3TCJA 1RACB 1Q7YR 2PQWA 2EBPA 1Y71A 2DVJA 3SWNB 1YITA 4C92C 2LDMA 1G5VA 2L3QA 2DYBA 3PE0A 4R0KA 4A4EA 1RI9A 3QIIA 3WVEB 3P8BB 3OYBA 3R6NA 2DL7A 2V8JA 1KC8C 1W4SA 4QQGA 3E19A 4C8QG 1TXQA 4OMLA 2CP6A 1MV0B 3GP8A 5KYYA 5GAMf 2BE7D 5LJ3d 2KDSA 2E64A 5D6XA 2J06A 1VOMA 2D8JA 1BCMA 1VQPQ 2MF2A 1OX9A 5KYWB 1PKSA 1IO6A 2KSSA 2XKOC 3TSWA 2GBQA 3URGA 3CCQQ 1QVFA 3CCJA 4M75B 4J9HA 3QUIA 2DJZA 3H6ZA 2ZGWA 2P0QA 3EAEA 4EIKA 4M78D 1MMNA 1MUZA 3BY7A 5HCKA 2ZPBB 1QCNA 3UF4A 1ZSZA 3UA6A 1KQSA 2KRNA 5FWBA 2PU9B 3CC7T 3MEWA 4C5GA 2VXFA 4EMKB 4M78G 2JT4A 3CPWP 4M77E 5IXBA 1VQ6T 4JUVA 2YLCA 1WDXA 5A2QE 3QKJA 1XQHA 3H9NA 2KAFA 3M53A 1D1CA 3JCMc 3QXEB 1WZOA 5LJ3f 2CKKA 2EQUA 2LZ6B 3MP1A 3OYEA 1QKWA 4DOVA 3RNJA 1OPLA 4LDXA 2CDTA 3TVTA 3LH5A 3MPUB 1NEGA 2KXDA 4F16A 2JTEA 2EJ9A 3LWIA 2FYKA 2QDYB 2O9VA 3RKXA 1WJQA 1ZHIA 3H0HA 2MMPA 2CP2A 2A37A 3RESA 2HCKA 2PTKA 5I21A 3A98A 2I2LA 1RLPC 4FYYB 2F2XA 1PD1A 2YUQA 3NTHA 2FEIA 4E7LA 4ANJA 2DYIA 4PL6A 4J9EA 4QQ6A 2DL4A 1M2OA 1Q81U 3A8OB 2QQSA 4JZ4A 5GAOr 2L0AA 2WSCE 1I0CA 2A3LA 2P4RA 1SRLA 5KH6A 2RA2A 1QW1A 2JN0A 5GAMh 3GIBA 1AWOA 2C06A 8AT1B 2QQ9A 2KQWA 1H92A 2FL7A 3UA7A 1P92A 9ATCB 2P4TA 1IB8A 2M0OA 1YI2A 2HAXA 3PT9A 4OGCA 2LCLA 1NBEB 4FW1A 4C92F 3CCLQ 1MMDA 1BI1A 4M75E 3RERA 2HNIA 2QYZA 4QVZA 5KYXB 3GOXA 5CK9A 5GAMj 3FEOA 2MPXC 2ECZA 2XK0A 2E4HA 2JUFA 3DLMA 4C8QF 1TOVA 2BZ8A 1W2BA 3RDVA 5KCHA 1PSEA 2EGCA 3QWXX 2EYYA 4PFOA 4ATOA 5FU7C 4HT8A 4PJNA 1PRLC 1WXUA 4AT1B 2F5KA 4MZMA 3M55A 1K9MR 1JJ2A 2J6OA 3EFSA 5CKBA 1WHLA 3C94A 5FROA 5CKEA 2DEUA 3M4YA 1G3TA 3G4SA 2PUKB 4ZTFA 3G1JA 1KC8U 2FRYA 4RTTA 3OYKA 2KRMA 4M78B 2QK0A 4XU2A 1B7TA 1WHJA 2YUPA 4KGZB 1QMCA 2HZYA 1ZA2B 2DD5A 3Q1JA 4J7FA 4RTVA 5GMKl 1GL5A 5D6YA 1Z9QA 1ZA1B 1VQ4Q 5LJ3j 3CCVA 4M7AG 2RPNA 1M8VA 3EG3A 2YWWA 4OB3B 2X4WA 1PWTA 2ZPIB 5IHKA 1V76A 3NFCA 3BFMA 2EYXA 2X9HA 4Z89A 3L42A 4QW2A 2DILA 3JCMd 3CCJT 5GAN4 1SKUB 3HPWA 2ZCFB 2RHUA 2XIDA 3CCEQ 1JO8A 2VKNA 4CI0C 1B3QA 1Q82R 2AT1B 4F17A 3JB9D 2O88A 4RTYA 4FM4B 5FLXE 1WIEA 4X34A 2DF6A 3C0CA 1WHMA 2LC4A 1D3BB 1NE8A 2DA9A 4OMFB 2V1RA 4PJJA 1YIJQ 2K5LA 2DPPB 2MK5A 2V8KA 4PJOG 3H8ZA 1G83A 3J81E 4QKUA 1QVGS 4F7UA 4MDXA 5GMKm 2WSEE 2IPOB 3JB9G 4XU0A 1S1NA 2OTLA 2D1XA 2DM1A 1AVZC 4C8QE 2RQRA 1BYMA 2RHYA 2FPEA 3MEAA 4N0AC 1VQ5Q 3TSZA 1IGQA 2QXFA 1SHFA 2HQHA 4M77C 3ASKA 2EKOA 1E6GA 4GY5A 3JCMf 5LJ3g 1DJ7B 3KXTA 1AWJA 3TU4K 2KK4A 1ZX6A 3H0FA 4DBHA 3G4SQ 1YJNQ 3FC3A 2RMOA 4IUPA 3VUZA 1M2VA 2YXYA 4PFZA 5GANg 4FU6A 4AG1C 1S72Q 4N4IA 1QP3A 3S3NA 3A8GB 2DRMA 4R56A 2M0YA 3JCMX 3LLRA 4O6JA 1SF9A 3CBMA 3OSVA 3MKDA 5GAN3 3CCRQ 1Y96A 2L3SA 2LP5A 4K11A 4ZN1A 3M0SA 2NUTA 4IKFA 2YUOA 5KE2A 1O75A 1YFNA 3D7SB 3CCVQ 1VYUA 3I5RA 3PTAA 1AZGB 2LRQA 4XAXB 3EG9A 2KE9A 1VQ4T 1KFZA 4M78E 3EFOA 3LYIA 5LL6S 1IRXA 5GAN8 4XTVA 1WXTA 3ER0A 4KH0B 2OX7A 1VQ8A 4B9WA 2OI3A 3CCMA 3CCET 5KYUB 1VQLA 2GQIA 2GF7A 1YI2T 3NGPA 4HVVA 4KRTA 2LT4A 2Y4YA 2DRKA 1BBZA 2KBTA 1HYOA 2KY9A 3GNFB 4E7ZA 1MGQA 2HKNA 2K5FA 2H8HA 2OTLQ 4ZTJA 3C4SA 5GJWB 4E7JA 2XDBA 1W6XA 2DFUA 4HCKA 2MWOA 4JJBA 1GRIA 3V8LA 4J9BA 4M7AF 2LCSA 5LJ3e 4A4GA 2DBMA 1VQNQ 1RLQC 3L2VA 1KD1C 3JRZA 4PKCC 3WXMB 1YN8A 3F70A 1U5SA 3O5ZA 2OAUA 3R6OA 1RL2A 4MMLA 1Q81R 4FCYA 5GANe 4FL6A 1E6HA 3V7RA 4XTYA 2V8IA 2H3JA 5L23A 1Q81C 2Y90A 1VQPA 1M1GA 4DEYA 1YJWQ 4RTXA 2HKQB 4YTLA 4N0AA 2YRDA 5CIUA 1NG2A 5FU6C 1YHQQ 3G4ST 1YJNT 1NJIC 2MYSA 2L89A 1U1SA 3CCQA 2RQTA 4M77A 2H3EB 3M58A 2QQAA 3EGDA 2MI6A 2ED0A 4PJOF 4C5HA 4JLIA 3JCMh 4QVCA 3CC2A 3G6EQ 2QQBA 2GQVA 1YCSB 3V7CA 3QSUA 3J7AF 4ME7A 2JJ9A 1X43A 2RQWA 3CCVT 5GAMd 2O9SA 2HL5C 3CQTA 2CZ0B 5GAN6 2K6DA 4QT7A 1BU1A 3OS5A 4RKUE 5CQXA 3VV0A 1M5Q1 2W10A 1BIAA 4BD3A 1PC0A 1KSWA 3ZEHA 3QPHA 4OVAA 4C92D 2VWFA 4M7DC 1RABB 4AMCA 1VQLQ 3JCMP 4MDWA 2C0IA 1NPRA 1BI3A 2RN8A 5IHIA 2EQKA 2KGTA 1NLPC 2LQNA 5I22A 3M54A 2RHZA 4OB0B 4Z88A 4JS4A 3SWNA 4C8QD 3T9NA 1EFNA 1BI2A 2M1HA 3FJPA 3CXCP 4LXCA 4C92G 2HSEB 2RNAA 2RQVA 1ZUUA 2KEAA 4B6MA 3S3OA 5KCOA 2PVGB 1QVFS 4RTWA 5I11A 5GAOp 3GPLA 2A08A 1PCXA 5IHNA 1KC8R 2OTLT 1JEGA 1K0XA 3BE3A 2XG8D 1D1AA 4AFZC 3HL8A 2HD0A 4XU1A 3HFNA 2P0PA 4D8KA 2MAMA 2RD1A 1AEYA 1KQSS 1C1AA 3LH0A 2J6KA 3H0IA 1U1TA 1UECA 2HQXA 1G2BA 1TUDA 1UDLA 3I35A 2EFIA 4M75A 1UEBA 2LX9A 1M9SA 1OEBA 4BE1A 1WFWA 4EDUA 5GMKe 2DEQA 2QEXA 1WJRA 2KR3A 3OYFA 2QA4Q 1M90C 3VRZA 3MHXA 1N8RU 2VC8A 3OYGA 1CKBA 1LNXA 4TVRA 1NYGA 4RCBA 1M3BA 2KYMA 2HBWA 2XI9A 4NL2A 2DO3A 3OW2A 3I55A 1R8OB 3CC2Q 1WA7A 1G8XA 2DETA 3JV3A 1GCPA 3LW5E 4KUIA 1SEMA 3VKIA 3OQ5A 2JS0A 1K76A 1I5OB 2EYQA 3JAME 3S3MA 4EMKA 4LD6A 3CCLA 2FPFA 3FJ5A 1ZBJA 3QHSA 1D1BA 2DAQA 3OYCA 2KRSA 4CC2A 1KJWA 4JJDA 2E65A 1FMKA 1QP2A 6AT1B 1QCOA 4N4GA 1RAAB 1VQ8T 3CCMT 1ZSZB 2DERA 1VQLT 3AHUA 1Q95G 3NTIA 1OOTA 3E1SA 2KXCA 3OYDA 1GFDA 1YWPA 2F2VA 4BY6C 3HHTB 4M7DA 4L5GA 3MEVA 4MMKA 1RAIB 4Y91A 2XHCA 2O4XB 1VQ7Q 2MOXA 3PGGA 2JMAA 4JJCA 1X01A 1FMWA 3VS2A 1QVFP 4J9IA 2FPDA 1UHCA 4PJMA 2RJEA 5DY9A 3OYHA 4ELZC 2A36A 5J26A 1WXBA 1UB4A 1KD1U 5A0DA 3HRSA 2DMOA 2QTVA 4BDYA 1EIFA 2DTHA 3INZA 2QEXQ 1VQ4A 4FSSA 3SB2A 2EYZA 1GXIE 1TUCA 1VQPT 1WHKA 4GLMA 1W2BS 1I07A 2X4JA 1NJIU 3TREA 1ZUKA 3QJ6A 4E47A 2QA4T 2CUBA 4J9FA 2K5IA 3META 2ZAEA 3CCQT 3I55Q 5A0GA
chains in the Genus database with same CATH topology
3M0TA 1SSHA 2CSQA 1GBRA 3ULRB 1UTIA 1G83A 1HD3A 1UGVA 2ED1A 2KROA 1WI7A 1WYXA 2MCNA 2DLPA 1S1NA 2EPDA 1VA7A 3REAB 1LCKA 1UFFA 4WCIA 1XOVA 3IQLA 2D1XA 2PNIA 2DM1A 1AVZC 2RQRA 1UJ0A 2IIMA 4J9CA 2D0NA 2FPEA 2DJQA 1GFCA 4LN2A 1BK2A 3VS3A 5ECAA 3REBB 2A28A 3TSZA 2JW4A 2K3BA 2V1QA 2AKKA 2LMJA 1J3TA 1SHFA 5GJVB 1K4US 1E6GA 2AZVA 2KYBA 4Z8AA 1AWJA 2AK5A 1ZX6A 3H0FA 2EGEA 3I9QA 2RMOA 1U06A 3VS6A 1VYVA 3NMZC 3PVLA 2HEQA 4AG1C 4IIOA 2GNCA 2K9GA 2QDLA 1E7OA 2DRMA 1ZLMA 2M0YA 1T3SA 1U3OA 2L3SA 2LP5A 4K11A 3QWYA 2O2OA 1JQQA 3VS1A 3M0SA 2ROTA 2EYWA 2YUOA 4OMPA 1VYUA 1YWOA 2BZYA 2YDLA 3I5RA 1AZGB 2K7AA 2GTOA 3M0UA 1UE9A 1UHFA 4DEXA 2X3XD 2KE9A 1PKTA 1CKAA 2F2WA 4LNPA 2G6FX 2FO0A 4LUDA 1KFZA 1M30A 3NHNA 3THKA 1VYTA 1H3HA 3VRYA 2CSIA 2BTTA 2AZSA 3M0QA 1SRMA 2HSPA 1SPKA 2OAWA 1WXTA 2JS2A 3H41A 2OI3A 3EHRA 1UJYA 2GQIA 2ABLA 2PZ1A 4HXJA 2EBPA 3NGPA 4HVVA 2DVJA 4KRTA 2KT8A 4J9GA 2LJ0A 1PNJA 2DRKA 1BBZA 2ESWA 2KBTA 2L3QA 2DYBA 3PE0A 4R0KA 1SHGA 1RI9A 3GBQA 3R6NA 2DL7A 1MV3A 2H8HA 2CT3A 1X27A 2JM9A 4OMLA 3VS4A 1MV0B 5GJWB 4AFSC 4LE9A 1AWWA 4CC3A 4AG2C 1W6XA 2J06A 4HCKA 4JJBA 2K2MA 1K0SA 1JXMA 2D8JA 1GRIA 4J9BA 1Y0MA 4RTUA 2LCSA 2DBMA 2LQWA 4RUGA 1TG0A 1PKSA 2DL3A 1RLQC 2SRCA 1YN8A 1IO6A 5EC7A 1U5SA 2L3PA 2DL8A 3TSWA 3O5ZA 2GBQA 5FWCA 2O31A 4OMQA 2RQUA 1E6HA 4J9HA 5L23A 2ENMA 4GBQA 3VS0A 1UG1A 4EIKA 4DEYA 4CC4B 4RTXA 1MUZA 2OJ2A 5HCKA 4LUEA 1OV3A 1FYNA 3VS5A 1NG2A 3UF4A 1AWXA 3UA6A 2RQTA 5FW9A 1ABOA 2KRNA 2VVKA 3KFVA 5FWBA 1I1JA 3EG2A 2NWMA 1V1CA 2EQIA 2ED0A 2LNHB 4JPBW 1PRMC 1YNZA 1W70A 2CH4W 1YCSB 1M3AA 2JT4A 5IXBA 1AD5A 1UUEA 1WDXA 1X43A 1JXOA 2RQWA 2O9SA 3CQTA 1M3CA 2K6DA 1BB9A 1BU1A 4QT7A 2YUNA 2B86A 4M4ZA 1CSKA 4IIMA 2LZ6B 2EGAA 2YSQA 2W10A 1QKWA 1KSWA 1ABQA 2M51A 4Y92A 3RNJA 1OPLA 1QWFA 2CDTA 2VWFA 3TVTA 3LH5A 2C0IA 1NEGA 1X6BA 2KXDA 4F16A 2JTEA 2RN8A 5IHIA 1Y57A 4J9DA 4OMNA 1ZUYA 2KGTA 1NLPC 2LQNA 3NPFA 5I22A 1GCQC 4Z88A 1WX6A 2RF0A 2O9VA 4ORZA 1HJDA 2NUZA 2EVRA 3H0HA 2DX1A 2A37A 1EFNA 1QLYA 2HCKA 2PTKA 3A98A 2HDAA 1RLPC 2F2XA 2YUQA 4AFQC 2FEIA 2RNAA 1T3LA 1NYFA 2RQVA 3VS7A 2AKLA 3EG1A 1ZUUA 2KEAA 4RTWA 5I11A 1B07A 4J9EA 1H8KA 2A08A 5IHNA 2DL4A 1QCFA 1JEGA 3U23A 1K0XA 1KIKA 4AFZC 2J6FA 4JZ4A 4D8KA 2L0AA 1AEYA 3UATA 2LJ3A 2DE0X 1M27C 1YP5A 1I0CA 5IXFA 2P4RA 1SRLA 2J6KA 3H0IA 1T0HA 1UECA 1WLPB 1G2BA 4ZNXA 1TUDA 1UDLA 3I35A 4X1VA 1AWOA 1K9AA 1ZSGA 1OEBA 1WFWA 1OPKA 2KNBB 2KR3A 1H92A 3UA7A 2D8HA 3VRZA 2GGRA 1NEBA 1CKBA 2JMCA 2J05A 4CC7A 1NYGA 1M3BA 2JXBA 2HBWA 2KYMA 2X3WD 4OMOA 4ESRA 2YT6A 4A63B 1WA7A 2SEMA 3JV3A 1GCPA 1SEMA 1RUWA 4JZ3A 2ECZA 2JS0A 1K76A 2XMFA 2BZ8A 2W0ZA 1X2QA 2FPFA 3FJ5A 1ZBJA 1AZEA 1T0JA 3I5SA 2LX7A 2C0TA 2KRSA 3EHQA 4OMMA 3SEMA 2DNUA 2CH4A 2EGCA 3EG0A 2EYYA 3QWXX 1JU5C 2FRWA 2L2PA 2DBKA 4CC2A 1PHTA 2GTJA 1AOJA 1KJWA 4JJDA 3ZL7C 1FMKA 1PRLC 3PVQA 1X69A 1WXUA 2C0OA 1NLOC 1QWEA 3SHWA 2J7IA 2J6OA 2EKHA 1OOTA 2K79A 2KT1A 2KXCA 1GFDA 1YWPA 2F2VA 2JM8A 2MOXA 2E5KA 2FRYA 4HVUA 4RTTA 2I0NA 2LJ1A 1W1FA 2JMAA 4JJCA 2KRMA 3VS2A 1GCQA 2EW3A 3M0PA 1X6GA 4J9IA 2FPDA 1UHCA 1X2KA 2YUPA 2CUDA 2CT4A 3EGUA 2A36A 4F14A 4RTVA 1GL5A 1WXBA 2ROLA 1Z9QA 2FG0A 2RPNA 2DL5A 1A0NB 3EG3A 3M0RA 4D8DA 1K1ZA 3RBBB 1PWTA 4E6RA 5IHKA 2DMOA 1N5ZA 2EYXA 2CREA 4Z89A 2MIOA 2DILA 1Z9ZA 4AFUC 4FSSA 2EYZA 1JO8A 1TUCA 2VKNA 1B3QA 4GLMA 1QKXA 4F17A 2BZXA 2O88A 4RTYA 1HSQA 1I07A 1WIEA 1GBQA 2DF6A 3C0CA 4HVWA 1ZUKA 5IH2A 1NM7A 1M8MA 2CUBA 4J9FA 1ARKA 2DA9A 2V1RA 4RTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0T A;  1SSH A;  2CSQ A;  1GBR A;  3ULR B;  1UTI A;  1G83 A;  1HD3 A;  1UGV A;  2ED1 A;  2KRO A;  1WI7 A;  1WYX A;  2MCN A;  2DLP A;  1S1N A;  2EPD A;  1VA7 A;  3REA B;  1LCK A;  1UFF A;  4WCI A;  1XOV A;  3IQL A;  2D1X A;  2PNI A;  2DM1 A;  1AVZ C;  2RQR A;  1UJ0 A;  2IIM A;  4J9C A;  2D0N A;  2FPE A;  2DJQ A;  1GFC A;  4LN2 A;  1BK2 A;  3VS3 A;  5ECA A;  3REB B;  2A28 A;  3TSZ A;  2JW4 A;  2K3B A;  2V1Q A;  2AKK A;  2LMJ A;  1J3T A;  1SHF A;  5GJV B;  1K4U S;  1E6G A;  2AZV A;  2KYB A;  4Z8A A;  1AWJ A;  2AK5 A;  1ZX6 A;  3H0F A;  2EGE A;  3I9Q A;  2RMO A;  1U06 A;  3VS6 A;  1VYV A;  3NMZ C;  3PVL A;  2HEQ A;  4AG1 C;  4IIO A;  2GNC A;  2K9G A;  2QDL A;  1E7O A;  2DRM A;  1ZLM A;  2M0Y A;  1T3S A;  1U3O A;  2L3S A;  2LP5 A;  4K11 A;  3QWY A;  2O2O A;  1JQQ A;  3VS1 A;  3M0S A;  2ROT A;  2EYW A;  2YUO A;  4OMP A;  1VYU A;  1YWO A;  2BZY A;  2YDL A;  3I5R A;  1AZG B;  2K7A A;  2GTO A;  3M0U A;  1UE9 A;  1UHF A;  4DEX A;  2X3X D;  2KE9 A;  1PKT A;  1CKA A;  2F2W A;  4LNP A;  2G6F X;  2FO0 A;  4LUD A;  1KFZ A;  1M30 A;  3NHN A;  3THK A;  1VYT A;  1H3H A;  3VRY A;  2CSI A;  2BTT A;  2AZS A;  3M0Q A;  1SRM A;  2HSP A;  1SPK A;  2OAW A;  1WXT A;  2JS2 A;  3H41 A;  2OI3 A;  3EHR A;  1UJY A;  2GQI A;  2ABL A;  2PZ1 A;  4HXJ A;  2EBP A;  3NGP A;  4HVV A;  2DVJ A;  4KRT A;  2KT8 A;  4J9G A;  2LJ0 A;  1PNJ A;  2DRK A;  1BBZ A;  2ESW A;  2KBT A;  2L3Q A;  2DYB A;  3PE0 A;  4R0K A;  1SHG A;  1RI9 A;  3GBQ A;  3R6N A;  2DL7 A;  1MV3 A;  2H8H A;  2CT3 A;  1X27 A;  2JM9 A;  4OML A;  3VS4 A;  1MV0 B;  5GJW B;  4AFS C;  4LE9 A;  1AWW A;  4CC3 A;  4AG2 C;  1W6X A;  2J06 A;  4HCK A;  4JJB A;  2K2M A;  1K0S A;  1JXM A;  2D8J A;  1GRI A;  4J9B A;  1Y0M A;  4RTU A;  2LCS A;  2DBM A;  2LQW A;  4RUG A;  1TG0 A;  1PKS A;  2DL3 A;  1RLQ C;  2SRC A;  1YN8 A;  1IO6 A;  5EC7 A;  1U5S A;  2L3P A;  2DL8 A;  3TSW A;  3O5Z A;  2GBQ A;  5FWC A;  2O31 A;  4OMQ A;  2RQU A;  1E6H A;  4J9H A;  5L23 A;  2ENM A;  4GBQ A;  3VS0 A;  1UG1 A;  4EIK A;  4DEY A;  4CC4 B;  4RTX A;  1MUZ A;  2OJ2 A;  5HCK A;  4LUE A;  1OV3 A;  1FYN A;  3VS5 A;  1NG2 A;  3UF4 A;  1AWX A;  3UA6 A;  2RQT A;  5FW9 A;  1ABO A;  2KRN A;  2VVK A;  3KFV A;  5FWB A;  1I1J A;  3EG2 A;  2NWM A;  1V1C A;  2EQI A;  2ED0 A;  2LNH B;  4JPB W;  1PRM C;  1YNZ A;  1W70 A;  2CH4 W;  1YCS B;  1M3A A;  2JT4 A;  5IXB A;  1AD5 A;  1UUE A;  1WDX A;  1X43 A;  1JXO A;  2RQW A;  2O9S A;  3CQT A;  1M3C A;  2K6D A;  1BB9 A;  1BU1 A;  4QT7 A;  2YUN A;  2B86 A;  4M4Z A;  1CSK A;  4IIM A;  2LZ6 B;  2EGA A;  2YSQ A;  2W10 A;  1QKW A;  1KSW A;  1ABQ A;  2M51 A;  4Y92 A;  3RNJ A;  1OPL A;  1QWF A;  2CDT A;  2VWF A;  3TVT A;  3LH5 A;  2C0I A;  1NEG A;  1X6B A;  2KXD A;  4F16 A;  2JTE A;  2RN8 A;  5IHI A;  1Y57 A;  4J9D A;  4OMN A;  1ZUY A;  2KGT A;  1NLP C;  2LQN A;  3NPF A;  5I22 A;  1GCQ C;  4Z88 A;  1WX6 A;  2RF0 A;  2O9V A;  4ORZ A;  1HJD A;  2NUZ A;  2EVR A;  3H0H A;  2DX1 A;  2A37 A;  1EFN A;  1QLY A;  2HCK A;  2PTK A;  3A98 A;  2HDA A;  1RLP C;  2F2X A;  2YUQ A;  4AFQ C;  2FEI A;  2RNA A;  1T3L A;  1NYF A;  2RQV A;  3VS7 A;  2AKL A;  3EG1 A;  1ZUU A;  2KEA A;  4RTW A;  5I11 A;  1B07 A;  4J9E A;  1H8K A;  2A08 A;  5IHN A;  2DL4 A;  1QCF A;  1JEG A;  3U23 A;  1K0X A;  1KIK A;  4AFZ C;  2J6F A;  4JZ4 A;  4D8K A;  2L0A A;  1AEY A;  3UAT A;  2LJ3 A;  2DE0 X;  1M27 C;  1YP5 A;  1I0C A;  5IXF A;  2P4R A;  1SRL A;  2J6K A;  3H0I A;  1T0H A;  1UEC A;  1WLP B;  1G2B A;  4ZNX A;  1TUD A;  1UDL A;  3I35 A;  4X1V A;  1AWO A;  1K9A A;  1ZSG A;  1OEB A;  1WFW A;  1OPK A;  2KNB B;  2KR3 A;  1H92 A;  3UA7 A;  2D8H A;  3VRZ A;  2GGR A;  1NEB A;  1CKB A;  2JMC A;  2J05 A;  4CC7 A;  1NYG A;  1M3B A;  2JXB A;  2HBW A;  2KYM A;  2X3W D;  4OMO A;  4ESR A;  2YT6 A;  4A63 B;  1WA7 A;  2SEM A;  3JV3 A;  1GCP A;  1SEM A;  1RUW A;  4JZ3 A;  2ECZ A;  2JS0 A;  1K76 A;  2XMF A;  2BZ8 A;  2W0Z A;  1X2Q A;  2FPF A;  3FJ5 A;  1ZBJ A;  1AZE A;  1T0J A;  3I5S A;  2LX7 A;  2C0T A;  2KRS A;  3EHQ A;  4OMM A;  3SEM A;  2DNU A;  2CH4 A;  2EGC A;  3EG0 A;  2EYY A;  3QWX X;  1JU5 C;  2FRW A;  2L2P A;  2DBK A;  4CC2 A;  1PHT A;  2GTJ A;  1AOJ A;  1KJW A;  4JJD A;  3ZL7 C;  1FMK A;  1PRL C;  3PVQ A;  1X69 A;  1WXU A;  2C0O A;  1NLO C;  1QWE A;  3SHW A;  2J7I A;  2J6O A;  2EKH A;  1OOT A;  2K79 A;  2KT1 A;  2KXC A;  1GFD A;  1YWP A;  2F2V A;  2JM8 A;  2MOX A;  2E5K A;  2FRY A;  4HVU A;  4RTT A;  2I0N A;  2LJ1 A;  1W1F A;  2JMA A;  4JJC A;  2KRM A;  3VS2 A;  1GCQ A;  2EW3 A;  3M0P A;  1X6G A;  4J9I A;  2FPD A;  1UHC A;  1X2K A;  2YUP A;  2CUD A;  2CT4 A;  3EGU A;  2A36 A;  4F14 A;  4RTV A;  1GL5 A;  1WXB A;  2ROL A;  1Z9Q A;  2FG0 A;  2RPN A;  2DL5 A;  1A0N B;  3EG3 A;  3M0R A;  4D8D A;  1K1Z A;  3RBB B;  1PWT A;  4E6R A;  5IHK A;  2DMO A;  1N5Z A;  2EYX A;  2CRE A;  4Z89 A;  2MIO A;  2DIL A;  1Z9Z A;  4AFU C;  4FSS A;  2EYZ A;  1JO8 A;  1TUC A;  2VKN A;  1B3Q A;  4GLM A;  1QKX A;  4F17 A;  2BZX A;  2O88 A;  4RTY A;  1HSQ A;  1I07 A;  1WIE A;  1GBQ A;  2DF6 A;  3C0C A;  4HVW A;  1ZUK A;  5IH2 A;  1NM7 A;  1M8M A;  2CUB A;  4J9F A;  1ARK A;  2DA9 A;  2V1R A;  4RTZ A; 
#chains in the Genus database with same CATH topology
 1SSH A;  4C92 B;  4Z02 A;  3CCE A;  4PJL A;  5KYX A;  3EGX B;  4XTU A;  4PK4 A;  1HD3 A;  3CC2 T;  1UGV A;  3OS2 A;  2X4X A;  3PNW C;  1K8A C;  1WYX A;  1JJ2 S;  2MCN A;  5DLQ E;  2DLP A;  3REA B;  4C8Q B;  2KVQ G;  1UFF A;  1YIJ A;  4JRP A;  2R57 A;  5CO7 A;  2PNI A;  1XNI A;  3L2Z A;  1LOJ A;  1OYX A;  2D0N A;  2QG9 B;  3L1A A;  4LN2 A;  3VS3 A;  3REB B;  2MWP A;  3EFR A;  5CQY A;  2RH2 A;  1X6O A;  1J3T A;  2G3R A;  3FLG A;  3G71 A;  3CCS Q;  3CCU Q;  3KUF A;  3VU3 C;  4DQ2 A;  3CME Q;  2AK5 A;  4UC4 A;  4WF2 A;  4XTW A;  1ACM B;  2RO0 A;  1OUL A;  1OU9 A;  2EGE A;  1SG5 A;  4BE2 A;  1VQ5 A;  1U06 A;  3VS6 A;  1VYV A;  3NMZ C;  3M5A A;  2JTM A;  3GLX A;  2HEQ A;  1YJ9 A;  2KMT A;  1ZLM A;  4D6W A;  2BUD A;  2QI2 A;  1T3S A;  4M7A D;  2M16 A;  2RB6 A;  4KH1 B;  3PMI A;  2CGH A;  3M56 A;  4M78 A;  1YJN A;  3FRN A;  1JQQ A;  3VS1 A;  4NL3 A;  4OMP A;  1YWO A;  3FIF A;  2YDL A;  4PFP A;  1S72 A;  2GTO A;  2ZPF B;  1XJW B;  1UE9 A;  2LT1 A;  2A0F B;  4O5V A;  1PKT A;  1CKA A;  4LNP A;  2G6F X;  2FO0 A;  1M30 A;  5CVI A;  3X24 B;  3CCR A;  1M1K C;  1H3H A;  4EMH A;  3VRY A;  3PIO A;  1MNE A;  3QO3 A;  4HCC A;  2AZS A;  3VUB A;  3V8J A;  2HSP A;  2R58 A;  1SPK A;  3GF5 A;  5GAO q;  4C0Z A;  5GMK i;  1M90 U;  2QEX T;  3H41 A;  5GAM g;  1VQO Q;  4HXJ A;  4PJO D;  3I56 A;  5GAN 7;  4DA4 A;  2KT8 A;  4DBQ A;  2LJ0 A;  1D3B A;  1PNJ A;  4FIB A;  3OYN A;  3I55 T;  2ESW A;  2M9U A;  4ZGJ B;  5CKD A;  1JB0 E;  1SHG A;  3HKS A;  4FYW B;  2GCX A;  1TTH B;  2CT3 A;  1X27 A;  4C5E A;  1WQW A;  1JJ2 P;  3CCL T;  3VS4 A;  4LE9 A;  1AWW A;  4L59 A;  4CC3 A;  4AG2 C;  4C92 E;  1K0S A;  2OTJ Q;  4RUG A;  1TU0 B;  5EC7 A;  2L3P A;  3SDZ A;  3CC4 Q;  5GAO l;  5FWC A;  2O31 A;  3G71 Q;  4OMQ A;  2DTI A;  3OMG A;  1N9S A;  2E10 A;  3BDL A;  1VQN A;  2E3H A;  4XK8 E;  3OY9 A;  4M77 G;  4LUE A;  1OV3 A;  1YJ9 Q;  2VV5 A;  4EPC A;  1Q86 C;  1MMA A;  1AWX A;  4JRQ A;  5EG2 A;  5CCA A;  1PD0 A;  5LJ5 h;  1ABO A;  1NZ9 A;  4BDZ A;  1VQM Q;  2RJD A;  4F7U F;  2VVK A;  3KFV A;  1I1J A;  2JNG A;  2A7Y A;  2NWM A;  1V1C A;  5FRN A;  1YJW A;  3MO8 A;  2LNH B;  1ZQ1 A;  1PRM C;  1N8R R;  1YNZ A;  2BKD N;  3JCM b;  1YHQ A;  1N8R C;  1M3A A;  1K73 C;  1AD5 A;  1UUE A;  3ME9 A;  4C0D C;  1M3C A;  3LGF A;  1BB9 A;  2YUN A;  2B86 A;  2RI2 A;  4M4Z A;  5GAO m;  5GAM e;  4IIM A;  3LX7 A;  3G6E A;  3M4G A;  1ABQ A;  4Y92 A;  2ATC B;  3A1P A;  1QWF A;  1TSF A;  1WPY A;  1X6B A;  3I56 Q;  1NPP A;  1Y57 A;  4J9D A;  4OMN A;  4KGX B;  3OBW A;  5KYU A;  3E9G A;  1GCQ C;  3OYI A;  3SWN C;  4Y28 E;  1WX6 A;  1HJD A;  4QQD A;  4Q5W A;  2LQK A;  2EVR A;  1VUB A;  2VB6 A;  2DX1 A;  2CZ1 B;  1QLY A;  2YLB A;  2HDA A;  1UGR B;  4DBR A;  1K8A U;  3CD6 Q;  4E7K A;  1WNL A;  5I2M A;  3M59 A;  1T3L A;  1NYF A;  2E3I A;  3VS7 A;  1B07 A;  3LWH A;  4V2S A;  2O01 E;  3P8H A;  4OP0 A;  3X25 B;  3CMA Q;  3U23 A;  1YIJ T;  4IUQ A;  1QVG P;  3UWN A;  1KQ1 A;  1O9S A;  2HBP A;  2J6F A;  2IVW A;  2LJ3 A;  2DE0 X;  4M7A B;  1M27 C;  1I81 A;  1X75 C;  1KHI A;  1T0H A;  1WLP B;  4M75 C;  4ZNX A;  1KD1 R;  3MEU A;  2CP3 A;  1RAF B;  3V8K A;  3G71 T;  1UGQ B;  1K9A A;  4BB7 A;  1OI1 A;  3S6W A;  4J5Y A;  3TEE A;  4XQ3 A;  4FSX A;  1RAE B;  1VQ5 T;  2GGR A;  3A5Z B;  1NEB A;  1YJ9 T;  4JDS A;  2JMC A;  2DTO A;  5GAN 2;  2JXB A;  2VYT A;  2YT6 A;  1NJI R;  4A63 B;  3OMC A;  2QA4 A;  2NUP B;  4EMK C;  4JZ3 A;  5A0L A;  1C6V X;  4PJO B;  4EMG A;  2XMF A;  1S72 T;  2W0Z A;  1X2Q A;  1KHC A;  5C0M A;  1T0J A;  3I5S A;  2X4Y A;  3CXC A;  2C0T A;  3EHQ A;  4OMM A;  1M1K U;  2DZ9 A;  1VQK A;  2DNU A;  2JOY A;  3CCR T;  3EG0 A;  1JU5 C;  1F1B B;  4L6V 5;  2DBK A;  1AOJ A;  3C12 A;  3PVQ A;  1B34 B;  2COW A;  2D0Q B;  5HK0 A;  1AHJ B;  1NLO C;  3HRT A;  3LGL A;  2CS7 A;  2HQE A;  3SHW A;  5IAY A;  2J7I A;  5FRM A;  4M7D G;  3EH1 A;  5AT1 B;  1VQ9 A;  3CC7 Q;  3I56 T;  2K79 A;  3JSC A;  4M77 F;  4RG2 A;  2M02 A;  1SSF A;  2E12 A;  5GAN 5;  1VQ6 Q;  1WQ7 A;  1FWZ A;  2WSF E;  2K57 A;  3X28 B;  4HVU A;  4FT2 A;  5J3B A;  2I0N A;  2LJ1 A;  1W1F A;  3RUX A;  3QZ5 B;  1GCQ A;  2EW3 A;  1MND A;  1X2K A;  2BE9 B;  2CT4 A;  3MP6 A;  3JB9 J;  3VYH B;  3SD4 A;  1VQ7 A;  4BI3 A;  2DD4 A;  3HP9 A;  2DL5 A;  3EH2 A;  1A0N B;  3QYH B;  3KBG A;  4E7H A;  1HXD A;  1K1Z A;  2FZG B;  3OYA A;  3OW2 S;  4E6R A;  3DKM A;  3L2Q A;  2MIO A;  1JRI A;  3RMS A;  1R0B G;  4AFU C;  1M1F A;  1Q7Y C;  5KYW A;  1BI0 A;  2Z0W A;  2QTX A;  1VQN T;  4M7A E;  3CPW A;  1HSQ A;  1Q86 U;  1Y07 A;  3OS1 A;  3NTK A;  4HVW A;  1NM7 A;  1M8M A;  1TS9 A;  3JCM Q;  2ZPH B;  1RAG B;  3UDC A;  1M90 R;  2EJF A;  3M0T A;  2CP7 A;  4J8O A;  1UGS B;  4LDY A;  4KBM B;  1UTI A;  2E70 A;  4C8Q C;  1YJW T;  1N9R A;  3HFO A;  3V7S A;  2DXC A;  1K73 U;  1D0X A;  1YHQ T;  5HK3 A;  5KYY B;  5D6W A;  4GLK A;  3JCM g;  1VQK Q;  5GAN d;  1LCK A;  4WCI A;  1ZBX A;  5CKH A;  2EJG A;  2HL3 A;  2D6F A;  3G6E T;  2IIM A;  4PJO E;  2DJQ A;  1G3Y A;  1GFC A;  3QDF A;  3CEY A;  4M75 F;  2A28 A;  4BI8 B;  2JW4 A;  2XIC A;  2DKG A;  2K3B A;  4HKE A;  1VQ9 Q;  1MMG A;  4R55 A;  1K4U S;  2AZV A;  2KYB A;  2YHT A;  3X20 B;  2E6Z A;  3UT1 A;  4B9X A;  2LTO A;  5FU6 B;  4IIO A;  4J6X A;  2GNC A;  2K9G A;  2QDL A;  2O4X A;  2FHD A;  2AIR B;  4M78 C;  3CCS A;  3CCU A;  4OB1 B;  1U3O A;  2NLU A;  3CME A;  4ZGE B;  8ATC B;  2EQM A;  3QWY A;  1YCY A;  2IG0 A;  2LCC A;  3L2R A;  4DEX A;  2EWN A;  2X3X D;  1WHG A;  3BDU A;  1V29 B;  1BCO A;  2F2W A;  3QZ9 B;  5GAN f;  3HSB A;  3JB9 H;  4LUD A;  1H3Z A;  2RJF A;  3OW2 P;  2BTT A;  3TQ7 P;  3M0Q A;  1YIT Q;  5LJ5 d;  4M7D B;  4MZP A;  4A4H A;  1KQS P;  3EHR A;  2ABL A;  4JLG A;  2KI7 A;  4M7D F;  2PZ1 A;  1M4Z A;  2QGG A;  4JRK A;  3CBP A;  4J9G A;  3RR6 A;  4II1 A;  3JCM e;  1AT1 B;  2CYZ B;  4C92 A;  4IUV A;  1RAD B;  2E5Q A;  3GBQ A;  1LJO A;  3ZFJ A;  4RCC A;  3EGX A;  1VQO A;  1MV3 A;  4F7U G;  1HK9 A;  2JM9 A;  4KUL A;  3OA6 A;  4AFS C;  2L8D A;  4A53 A;  1K8A R;  2K2M A;  3CCJ Q;  1JXM A;  1VQK T;  3JCM V;  4C8Q A;  2F1L A;  3G7Z A;  4DOW A;  3PFS A;  2JZ2 A;  3PIP A;  1Y0M A;  4C0F A;  2DK3 A;  4RTU A;  5L8R E;  2LQW A;  4A54 A;  1TG0 A;  2DL3 A;  4OF1 A;  2SRC A;  3L2U A;  1U8R A;  2FZK B;  3E2U A;  5IT9 E;  2DL8 A;  2RQU A;  1YBY A;  1XTD A;  3A8L B;  2OTJ A;  1VQ9 T;  2ENM A;  4ZN3 A;  1H64 1;  4GBQ A;  3VS0 A;  1UG1 A;  1D09 B;  2X51 A;  2CP5 A;  4CC4 B;  5LJ5 f;  3VYG A;  4BUG A;  3OYL A;  2OJ2 A;  4E7I A;  4A4F A;  3C95 A;  1FYN A;  3VS5 A;  3QBY A;  3CC4 A;  1RAH B;  4HT9 A;  2BIV A;  1OU8 A;  5FW9 A;  1LVK A;  2EQJ A;  3QJY A;  2ZPE B;  3EG2 A;  2E1H A;  2EQI A;  2P0K A;  3OS0 A;  4JPB W;  2JVV A;  1MHN A;  2QGF B;  1W70 A;  3MP8 A;  2CH4 W;  2K3Y A;  1OX8 A;  2RI3 A;  1VQ7 T;  2VGM A;  1JXO A;  1IHW A;  1VQM A;  1FXX A;  2R5A A;  5KYN A;  3OYY A;  4IUU A;  5DLO A;  1CSK A;  1WGS A;  2EGA A;  2YSQ A;  1EZZ B;  2DIG A;  4LDW A;  1Q7Y U;  5CAI A;  1BIB A;  2M51 A;  1K9M C;  1M1K R;  5IN1 A;  4WTO B;  4JS5 A;  4LD9 K;  5LJ3 h;  1I5L A;  2V26 A;  1YIT T;  5CKF A;  3HRU A;  3HTR A;  2XD0 A;  3OB9 A;  1ZUY A;  1UGP B;  4JJN K;  3N5B B;  3DB3 A;  3NPF A;  2QAZ A;  4PNO A;  5GAN h;  2PVD B;  2DZC A;  2RF0 A;  3BW1 A;  4ORZ A;  3A8H B;  2NUZ A;  4BY6 B;  2GFU A;  1W2B P;  4M7D E;  2GFA A;  2JTF A;  4M78 F;  4AFQ C;  2AKL A;  3EG1 A;  4LDV A;  4OB2 B;  3UPU A;  2NYS A;  3QG1 A;  4M7A C;  1H8K A;  2F69 A;  1QCF A;  4FT4 A;  3SFM A;  5GAN j;  1KIK A;  3M9Q A;  1WHH A;  3CD6 A;  3OBY A;  3UAT A;  3L2W A;  1YP5 A;  3RKY A;  5IXF A;  1YI2 Q;  1WJS A;  3CMA A;  4M77 D;  1Q82 C;  2CP0 A;  3E9F A;  4A4K A;  2E6N A;  4X1V A;  2DXB A;  4VUB A;  1ZSG A;  4F04 B;  1OPK A;  2RHX A;  2KNB B;  3M57 A;  2XU8 A;  2COY A;  2D8H A;  4PLI A;  2B8A A;  2EIF A;  2E41 A;  4PJO C;  1JBM A;  2J05 A;  1PM3 A;  4CC7 A;  1PG5 B;  4OMO A;  3JCM W;  2X3W D;  4J7I A;  4DBF A;  4ESR A;  1Q86 R;  5M9O A;  2CZ7 B;  3CCS T;  3CCU T;  2SEM A;  3CME T;  1IGU A;  4F7U B;  1N6A A;  1RUW A;  1N27 A;  1TUG B;  1G3W A;  2AHJ B;  2VUB A;  1IXD A;  1AZE A;  4NOY A;  4IUR A;  4C0G A;  2LX7 A;  3QDR B;  1K73 R;  2RJC A;  3SEM A;  2CZ6 B;  2CH4 A;  4CRI A;  4X9C A;  1R0C B;  2FRW A;  2L2P A;  1PHT A;  2GTJ A;  2FZC B;  4XTX A;  3ZL7 C;  1G3S A;  2QAS A;  3QYG B;  2Y4X A;  1X69 A;  1KQ2 A;  2C0O A;  4ELY C;  2K2V A;  1QVG A;  1LPL A;  5LJ5 j;  1QWE A;  5FU7 B;  1IRE B;  1TH7 A;  4FW2 A;  3RKW A;  3RMQ A;  1OZ3 A;  5I2S A;  2FB7 A;  2XDP A;  2EKH A;  2KT1 A;  4XU3 A;  5C6S A;  1M2V B;  3CPF A;  5D7U A;  1IHV A;  3OYM A;  2P84 A;  2JM8 A;  5GMK h;  2R5M A;  3O8V A;  4HCZ A;  2E5K A;  4KUD K;  1VQO T;  3A8M B;  1Y96 B;  3CC7 A;  2FVU A;  3M0P A;  3P8D A;  1X6G A;  4E2F B;  2NUT B;  2CUD A;  2DVE A;  2ZZD A;  3EGU A;  4F14 A;  2RK1 A;  1BKB A;  4JRI A;  3J80 E;  4M75 D;  2ROL A;  4J6Y A;  1VQ6 A;  3EG9 B;  1KK7 A;  2RK2 A;  2FG0 A;  4QVD A;  2X35 A;  3EFO B;  5GMK j;  1IZ6 A;  4N4H A;  2L5Q A;  3M0R A;  4D8D A;  4ZGD B;  3RBB B;  4M7A A;  3GNG A;  1N5Z A;  2CRE A;  1QQJ A;  5J39 A;  1OQK A;  1Z9Z A;  1R77 A;  2OTJ T;  2VXE A;  2DXT A;  2K3X A;  1C0M A;  3X26 B;  1KG1 A;  3FB9 A;  4FYX B;  1QKX A;  4M75 G;  3OSS C;  4XTZ A;  5DM7 R;  2BZX A;  2YRC A;  4OGE A;  4RG8 A;  1GBQ A;  2EAY A;  2RHI A;  2VGN A;  4LDU A;  3CXC S;  1Y7X A;  3CC4 T;  5IH2 A;  5AYF A;  1ARK A;  1D0Y A;  4KT0 E;  5KE3 A;  4RTZ A;  2PVO B;  2CSQ A;  1GBR A;  2LQ8 A;  3ULR B;  2LNV A;  3MJX A;  5LJ5 g;  2ED1 A;  2NUP A;  2KRO A;  4X9D A;  1WI7 A;  2D9T A;  1FX7 A;  4PJO A;  1EX4 A;  2EPD A;  5HKC A;  5CR2 A;  1VQM T;  1VA7 A;  4NS5 A;  1XOV A;  1D0Z A;  3IQL A;  3DB4 A;  4F7U E;  4E7S A;  4HA8 A;  1QVP A;  1UJ0 A;  1K9M U;  4J9C A;  4M7D D;  2XDD A;  1BK2 A;  2L3R A;  5ECA A;  1B34 A;  1RI0 A;  2V1Q A;  2AKK A;  2LMJ A;  1ZSZ C;  5HY6 A;  3FDR A;  5GJV B;  1OZ2 A;  2YRV A;  1VIE A;  4Z8A A;  4MZT A;  5GAO n;  4J83 A;  2DXU A;  2WAC A;  3I9Q A;  2COZ A;  2HMA A;  3PVL A;  3ZBD A;  3MCA B;  4HCB A;  4M77 B;  3JB9 I;  1E7O A;  3AT1 B;  4BI4 A;  4J6W A;  3JB9 F;  4C5I A;  3EGD B;  3OYJ A;  2F5T X;  3CBO A;  2LVM A;  4BE0 A;  2O2O A;  2ZPG B;  4RMO A;  2ROT A;  2EYW A;  3PMT A;  4PLL A;  2BZY A;  3JCM J;  3CPW S;  2DIQ A;  2K7A A;  2RM4 A;  3M0U A;  1PSF A;  3WVD B;  2K4Y A;  3CD6 T;  1UHF A;  3VJP A;  4C0D B;  7AT1 B;  4P5N A;  4KGV B;  4BAC A;  1VQ8 Q;  2QQR A;  3CCM Q;  3NHN A;  3THK A;  1VYT A;  1Q82 U;  2CSI A;  3CMA T;  3RIR A;  1SRM A;  4IUT A;  2RI5 A;  2OAW A;  1I8F A;  2JS2 A;  2PUO B;  1VIF A;  1FMV A;  4FYV B;  1TWB A;  1UJY A;  3DLL A;  1I4K 1;  2VAS A;  5LJ5 e;  3TCJ A;  1RAC B;  1Q7Y R;  2PQW A;  2EBP A;  1Y71 A;  2DVJ A;  3SWN B;  1YIT A;  4C92 C;  2LDM A;  1G5V A;  2L3Q A;  2DYB A;  3PE0 A;  4R0K A;  4A4E A;  1RI9 A;  3QII A;  3WVE B;  3P8B B;  3OYB A;  3R6N A;  2DL7 A;  2V8J A;  1KC8 C;  1W4S A;  4QQG A;  3E19 A;  4C8Q G;  1TXQ A;  4OML A;  2CP6 A;  1MV0 B;  3GP8 A;  5KYY A;  5GAM f;  2BE7 D;  5LJ3 d;  2KDS A;  2E64 A;  5D6X A;  2J06 A;  1VOM A;  2D8J A;  1BCM A;  1VQP Q;  2MF2 A;  1OX9 A;  5KYW B;  1PKS A;  1IO6 A;  2KSS A;  2XKO C;  3TSW A;  2GBQ A;  3URG A;  3CCQ Q;  1QVF A;  3CCJ A;  4M75 B;  4J9H A;  3QUI A;  2DJZ A;  3H6Z A;  2ZGW A;  2P0Q A;  3EAE A;  4EIK A;  4M78 D;  1MMN A;  1MUZ A;  3BY7 A;  5HCK A;  2ZPB B;  1QCN A;  3UF4 A;  1ZSZ A;  3UA6 A;  1KQS A;  2KRN A;  5FWB A;  2PU9 B;  3CC7 T;  3MEW A;  4C5G A;  2VXF A;  4EMK B;  4M78 G;  2JT4 A;  3CPW P;  4M77 E;  5IXB A;  1VQ6 T;  4JUV A;  2YLC A;  1WDX A;  5A2Q E;  3QKJ A;  1XQH A;  3H9N A;  2KAF A;  3M53 A;  1D1C A;  3JCM c;  3QXE B;  1WZO A;  5LJ3 f;  2CKK A;  2EQU A;  2LZ6 B;  3MP1 A;  3OYE A;  1QKW A;  4DOV A;  3RNJ A;  1OPL A;  4LDX A;  2CDT A;  3TVT A;  3LH5 A;  3MPU B;  1NEG A;  2KXD A;  4F16 A;  2JTE A;  2EJ9 A;  3LWI A;  2FYK A;  2QDY B;  2O9V A;  3RKX A;  1WJQ A;  1ZHI A;  3H0H A;  2MMP A;  2CP2 A;  2A37 A;  3RES A;  2HCK A;  2PTK A;  5I21 A;  3A98 A;  2I2L A;  1RLP C;  4FYY B;  2F2X A;  1PD1 A;  2YUQ A;  3NTH A;  2FEI A;  4E7L A;  4ANJ A;  2DYI A;  4PL6 A;  4J9E A;  4QQ6 A;  2DL4 A;  1M2O A;  1Q81 U;  3A8O B;  2QQS A;  4JZ4 A;  5GAO r;  2L0A A;  2WSC E;  1I0C A;  2A3L A;  2P4R A;  1SRL A;  5KH6 A;  2RA2 A;  1QW1 A;  2JN0 A;  5GAM h;  3GIB A;  1AWO A;  2C06 A;  8AT1 B;  2QQ9 A;  2KQW A;  1H92 A;  2FL7 A;  3UA7 A;  1P92 A;  9ATC B;  2P4T A;  1IB8 A;  2M0O A;  1YI2 A;  2HAX A;  3PT9 A;  4OGC A;  2LCL A;  1NBE B;  4FW1 A;  4C92 F;  3CCL Q;  1MMD A;  1BI1 A;  4M75 E;  3RER A;  2HNI A;  2QYZ A;  4QVZ A;  5KYX B;  3GOX A;  5CK9 A;  5GAM j;  3FEO A;  2MPX C;  2ECZ A;  2XK0 A;  2E4H A;  2JUF A;  3DLM A;  4C8Q F;  1TOV A;  2BZ8 A;  1W2B A;  3RDV A;  5KCH A;  1PSE A;  2EGC A;  3QWX X;  2EYY A;  4PFO A;  4ATO A;  5FU7 C;  4HT8 A;  4PJN A;  1PRL C;  1WXU A;  4AT1 B;  2F5K A;  4MZM A;  3M55 A;  1K9M R;  1JJ2 A;  2J6O A;  3EFS A;  5CKB A;  1WHL A;  3C94 A;  5FRO A;  5CKE A;  2DEU A;  3M4Y A;  1G3T A;  3G4S A;  2PUK B;  4ZTF A;  3G1J A;  1KC8 U;  2FRY A;  4RTT A;  3OYK A;  2KRM A;  4M78 B;  2QK0 A;  4XU2 A;  1B7T A;  1WHJ A;  2YUP A;  4KGZ B;  1QMC A;  2HZY A;  1ZA2 B;  2DD5 A;  3Q1J A;  4J7F A;  4RTV A;  5GMK l;  1GL5 A;  5D6Y A;  1Z9Q A;  1ZA1 B;  1VQ4 Q;  5LJ3 j;  3CCV A;  4M7A G;  2RPN A;  1M8V A;  3EG3 A;  2YWW A;  4OB3 B;  2X4W A;  1PWT A;  2ZPI B;  5IHK A;  1V76 A;  3NFC A;  3BFM A;  2EYX A;  2X9H A;  4Z89 A;  3L42 A;  4QW2 A;  2DIL A;  3JCM d;  3CCJ T;  5GAN 4;  1SKU B;  3HPW A;  2ZCF B;  2RHU A;  2XID A;  3CCE Q;  1JO8 A;  2VKN A;  4CI0 C;  1B3Q A;  1Q82 R;  2AT1 B;  4F17 A;  3JB9 D;  2O88 A;  4RTY A;  4FM4 B;  5FLX E;  1WIE A;  4X34 A;  2DF6 A;  3C0C A;  1WHM A;  2LC4 A;  1D3B B;  1NE8 A;  2DA9 A;  4OMF B;  2V1R A;  4PJJ A;  1YIJ Q;  2K5L A;  2DPP B;  2MK5 A;  2V8K A;  4PJO G;  3H8Z A;  1G83 A;  3J81 E;  4QKU A;  1QVG S;  4F7U A;  4MDX A;  5GMK m;  2WSE E;  2IPO B;  3JB9 G;  4XU0 A;  1S1N A;  2OTL A;  2D1X A;  2DM1 A;  1AVZ C;  4C8Q E;  2RQR A;  1BYM A;  2RHY A;  2FPE A;  3MEA A;  4N0A C;  1VQ5 Q;  3TSZ A;  1IGQ A;  2QXF A;  1SHF A;  2HQH A;  4M77 C;  3ASK A;  2EKO A;  1E6G A;  4GY5 A;  3JCM f;  5LJ3 g;  1DJ7 B;  3KXT A;  1AWJ A;  3TU4 K;  2KK4 A;  1ZX6 A;  3H0F A;  4DBH A;  3G4S Q;  1YJN Q;  3FC3 A;  2RMO A;  4IUP A;  3VUZ A;  1M2V A;  2YXY A;  4PFZ A;  5GAN g;  4FU6 A;  4AG1 C;  1S72 Q;  4N4I A;  1QP3 A;  3S3N A;  3A8G B;  2DRM A;  4R56 A;  2M0Y A;  3JCM X;  3LLR A;  4O6J A;  1SF9 A;  3CBM A;  3OSV A;  3MKD A;  5GAN 3;  3CCR Q;  1Y96 A;  2L3S A;  2LP5 A;  4K11 A;  4ZN1 A;  3M0S A;  2NUT A;  4IKF A;  2YUO A;  5KE2 A;  1O75 A;  1YFN A;  3D7S B;  3CCV Q;  1VYU A;  3I5R A;  3PTA A;  1AZG B;  2LRQ A;  4XAX B;  3EG9 A;  2KE9 A;  1VQ4 T;  1KFZ A;  4M78 E;  3EFO A;  3LYI A;  5LL6 S;  1IRX A;  5GAN 8;  4XTV A;  1WXT A;  3ER0 A;  4KH0 B;  2OX7 A;  1VQ8 A;  4B9W A;  2OI3 A;  3CCM A;  3CCE T;  5KYU B;  1VQL A;  2GQI A;  2GF7 A;  1YI2 T;  3NGP A;  4HVV A;  4KRT A;  2LT4 A;  2Y4Y A;  2DRK A;  1BBZ A;  2KBT A;  1HYO A;  2KY9 A;  3GNF B;  4E7Z A;  1MGQ A;  2HKN A;  2K5F A;  2H8H A;  2OTL Q;  4ZTJ A;  3C4S A;  5GJW B;  4E7J A;  2XDB A;  1W6X A;  2DFU A;  4HCK A;  2MWO A;  4JJB A;  1GRI A;  3V8L A;  4J9B A;  4M7A F;  2LCS A;  5LJ3 e;  4A4G A;  2DBM A;  1VQN Q;  1RLQ C;  3L2V A;  1KD1 C;  3JRZ A;  4PKC C;  3WXM B;  1YN8 A;  3F70 A;  1U5S A;  3O5Z A;  2OAU A;  3R6O A;  1RL2 A;  4MML A;  1Q81 R;  4FCY A;  5GAN e;  4FL6 A;  1E6H A;  3V7R A;  4XTY A;  2V8I A;  2H3J A;  5L23 A;  1Q81 C;  2Y90 A;  1VQP A;  1M1G A;  4DEY A;  1YJW Q;  4RTX A;  2HKQ B;  4YTL A;  4N0A A;  2YRD A;  5CIU A;  1NG2 A;  5FU6 C;  1YHQ Q;  3G4S T;  1YJN T;  1NJI C;  2MYS A;  2L89 A;  1U1S A;  3CCQ A;  2RQT A;  4M77 A;  2H3E B;  3M58 A;  2QQA A;  3EGD A;  2MI6 A;  2ED0 A;  4PJO F;  4C5H A;  4JLI A;  3JCM h;  4QVC A;  3CC2 A;  3G6E Q;  2QQB A;  2GQV A;  1YCS B;  3V7C A;  3QSU A;  3J7A F;  4ME7 A;  2JJ9 A;  1X43 A;  2RQW A;  3CCV T;  5GAM d;  2O9S A;  2HL5 C;  3CQT A;  2CZ0 B;  5GAN 6;  2K6D A;  4QT7 A;  1BU1 A;  3OS5 A;  4RKU E;  5CQX A;  3VV0 A;  1M5Q 1;  2W10 A;  1BIA A;  4BD3 A;  1PC0 A;  1KSW A;  3ZEH A;  3QPH A;  4OVA A;  4C92 D;  2VWF A;  4M7D C;  1RAB B;  4AMC A;  1VQL Q;  3JCM P;  4MDW A;  2C0I A;  1NPR A;  1BI3 A;  2RN8 A;  5IHI A;  2EQK A;  2KGT A;  1NLP C;  2LQN A;  5I22 A;  3M54 A;  2RHZ A;  4OB0 B;  4Z88 A;  4JS4 A;  3SWN A;  4C8Q D;  3T9N A;  1EFN A;  1BI2 A;  2M1H A;  3FJP A;  3CXC P;  4LXC A;  4C92 G;  2HSE B;  2RNA A;  2RQV A;  1ZUU A;  2KEA A;  4B6M A;  3S3O A;  5KCO A;  2PVG B;  1QVF S;  4RTW A;  5I11 A;  5GAO p;  3GPL A;  2A08 A;  1PCX A;  5IHN A;  1KC8 R;  2OTL T;  1JEG A;  1K0X A;  3BE3 A;  2XG8 D;  1D1A A;  4AFZ C;  3HL8 A;  2HD0 A;  4XU1 A;  3HFN A;  2P0P A;  4D8K A;  2MAM A;  2RD1 A;  1AEY A;  1KQS S;  1C1A A;  3LH0 A;  2J6K A;  3H0I A;  1U1T A;  1UEC A;  2HQX A;  1G2B A;  1TUD A;  1UDL A;  3I35 A;  2EFI A;  4M75 A;  1UEB A;  2LX9 A;  1M9S A;  1OEB A;  4BE1 A;  1WFW A;  4EDU A;  5GMK e;  2DEQ A;  2QEX A;  1WJR A;  2KR3 A;  3OYF A;  2QA4 Q;  1M90 C;  3VRZ A;  3MHX A;  1N8R U;  2VC8 A;  3OYG A;  1CKB A;  1LNX A;  4TVR A;  1NYG A;  4RCB A;  1M3B A;  2KYM A;  2HBW A;  2XI9 A;  4NL2 A;  2DO3 A;  3OW2 A;  3I55 A;  1R8O B;  3CC2 Q;  1WA7 A;  1G8X A;  2DET A;  3JV3 A;  1GCP A;  3LW5 E;  4KUI A;  1SEM A;  3VKI A;  3OQ5 A;  2JS0 A;  1K76 A;  1I5O B;  2EYQ A;  3JAM E;  3S3M A;  4EMK A;  4LD6 A;  3CCL A;  2FPF A;  3FJ5 A;  1ZBJ A;  3QHS A;  1D1B A;  2DAQ A;  3OYC A;  2KRS A;  4CC2 A;  1KJW A;  4JJD A;  2E65 A;  1FMK A;  1QP2 A;  6AT1 B;  1QCO A;  4N4G A;  1RAA B;  1VQ8 T;  3CCM T;  1ZSZ B;  2DER A;  1VQL T;  3AHU A;  1Q95 G;  3NTI A;  1OOT A;  3E1S A;  2KXC A;  3OYD A;  1GFD A;  1YWP A;  2F2V A;  4BY6 C;  3HHT B;  4M7D A;  4L5G A;  3MEV A;  4MMK A;  1RAI B;  4Y91 A;  2XHC A;  2O4X B;  1VQ7 Q;  2MOX A;  3PGG A;  2JMA A;  4JJC A;  1X01 A;  1FMW A;  3VS2 A;  1QVF P;  4J9I A;  2FPD A;  1UHC A;  4PJM A;  2RJE A;  5DY9 A;  3OYH A;  4ELZ C;  2A36 A;  5J26 A;  1WXB A;  1UB4 A;  1KD1 U;  5A0D A;  3HRS A;  2DMO A;  2QTV A;  4BDY A;  1EIF A;  2DTH A;  3INZ A;  2QEX Q;  1VQ4 A;  4FSS A;  3SB2 A;  2EYZ A;  1GXI E;  1TUC A;  1VQP T;  1WHK A;  4GLM A;  1W2B S;  1I07 A;  2X4J A;  1NJI U;  3TRE A;  1ZUK A;  3QJ6 A;  4E47 A;  2QA4 T;  2CUB A;  4J9F A;  2K5I A;  3MET A;  2ZAE A;  3CCQ T;  3I55 Q;  5A0G A; 
#chains in the Genus database with same CATH homology
 3M0T A;  1SSH A;  2CSQ A;  1GBR A;  3ULR B;  1UTI A;  1G83 A;  1HD3 A;  1UGV A;  2ED1 A;  2KRO A;  1WI7 A;  1WYX A;  2MCN A;  2DLP A;  1S1N A;  2EPD A;  1VA7 A;  3REA B;  1LCK A;  1UFF A;  4WCI A;  1XOV A;  3IQL A;  2D1X A;  2PNI A;  2DM1 A;  1AVZ C;  2RQR A;  1UJ0 A;  2IIM A;  4J9C A;  2D0N A;  2FPE A;  2DJQ A;  1GFC A;  4LN2 A;  1BK2 A;  3VS3 A;  5ECA A;  3REB B;  2A28 A;  3TSZ A;  2JW4 A;  2K3B A;  2V1Q A;  2AKK A;  2LMJ A;  1J3T A;  1SHF A;  5GJV B;  1K4U S;  1E6G A;  2AZV A;  2KYB A;  4Z8A A;  1AWJ A;  2AK5 A;  1ZX6 A;  3H0F A;  2EGE A;  3I9Q A;  2RMO A;  1U06 A;  3VS6 A;  1VYV A;  3NMZ C;  3PVL A;  2HEQ A;  4AG1 C;  4IIO A;  2GNC A;  2K9G A;  2QDL A;  1E7O A;  2DRM A;  1ZLM A;  2M0Y A;  1T3S A;  1U3O A;  2L3S A;  2LP5 A;  4K11 A;  3QWY A;  2O2O A;  1JQQ A;  3VS1 A;  3M0S A;  2ROT A;  2EYW A;  2YUO A;  4OMP A;  1VYU A;  1YWO A;  2BZY A;  2YDL A;  3I5R A;  1AZG B;  2K7A A;  2GTO A;  3M0U A;  1UE9 A;  1UHF A;  4DEX A;  2X3X D;  2KE9 A;  1PKT A;  1CKA A;  2F2W A;  4LNP A;  2G6F X;  2FO0 A;  4LUD A;  1KFZ A;  1M30 A;  3NHN A;  3THK A;  1VYT A;  1H3H A;  3VRY A;  2CSI A;  2BTT A;  2AZS A;  3M0Q A;  1SRM A;  2HSP A;  1SPK A;  2OAW A;  1WXT A;  2JS2 A;  3H41 A;  2OI3 A;  3EHR A;  1UJY A;  2GQI A;  2ABL A;  2PZ1 A;  4HXJ A;  2EBP A;  3NGP A;  4HVV A;  2DVJ A;  4KRT A;  2KT8 A;  4J9G A;  2LJ0 A;  1PNJ A;  2DRK A;  1BBZ A;  2ESW A;  2KBT A;  2L3Q A;  2DYB A;  3PE0 A;  4R0K A;  1SHG A;  1RI9 A;  3GBQ A;  3R6N A;  2DL7 A;  1MV3 A;  2H8H A;  2CT3 A;  1X27 A;  2JM9 A;  4OML A;  3VS4 A;  1MV0 B;  5GJW B;  4AFS C;  4LE9 A;  1AWW A;  4CC3 A;  4AG2 C;  1W6X A;  2J06 A;  4HCK A;  4JJB A;  2K2M A;  1K0S A;  1JXM A;  2D8J A;  1GRI A;  4J9B A;  1Y0M A;  4RTU A;  2LCS A;  2DBM A;  2LQW A;  4RUG A;  1TG0 A;  1PKS A;  2DL3 A;  1RLQ C;  2SRC A;  1YN8 A;  1IO6 A;  5EC7 A;  1U5S A;  2L3P A;  2DL8 A;  3TSW A;  3O5Z A;  2GBQ A;  5FWC A;  2O31 A;  4OMQ A;  2RQU A;  1E6H A;  4J9H A;  5L23 A;  2ENM A;  4GBQ A;  3VS0 A;  1UG1 A;  4EIK A;  4DEY A;  4CC4 B;  4RTX A;  1MUZ A;  2OJ2 A;  5HCK A;  4LUE A;  1OV3 A;  1FYN A;  3VS5 A;  1NG2 A;  3UF4 A;  1AWX A;  3UA6 A;  2RQT A;  5FW9 A;  1ABO A;  2KRN A;  2VVK A;  3KFV A;  5FWB A;  1I1J A;  3EG2 A;  2NWM A;  1V1C A;  2EQI A;  2ED0 A;  2LNH B;  4JPB W;  1PRM C;  1YNZ A;  1W70 A;  2CH4 W;  1YCS B;  1M3A A;  2JT4 A;  5IXB A;  1AD5 A;  1UUE A;  1WDX A;  1X43 A;  1JXO A;  2RQW A;  2O9S A;  3CQT A;  1M3C A;  2K6D A;  1BB9 A;  1BU1 A;  4QT7 A;  2YUN A;  2B86 A;  4M4Z A;  1CSK A;  4IIM A;  2LZ6 B;  2EGA A;  2YSQ A;  2W10 A;  1QKW A;  1KSW A;  1ABQ A;  2M51 A;  4Y92 A;  3RNJ A;  1OPL A;  1QWF A;  2CDT A;  2VWF A;  3TVT A;  3LH5 A;  2C0I A;  1NEG A;  1X6B A;  2KXD A;  4F16 A;  2JTE A;  2RN8 A;  5IHI A;  1Y57 A;  4J9D A;  4OMN A;  1ZUY A;  2KGT A;  1NLP C;  2LQN A;  3NPF A;  5I22 A;  1GCQ C;  4Z88 A;  1WX6 A;  2RF0 A;  2O9V A;  4ORZ A;  1HJD A;  2NUZ A;  2EVR A;  3H0H A;  2DX1 A;  2A37 A;  1EFN A;  1QLY A;  2HCK A;  2PTK A;  3A98 A;  2HDA A;  1RLP C;  2F2X A;  2YUQ A;  4AFQ C;  2FEI A;  2RNA A;  1T3L A;  1NYF A;  2RQV A;  3VS7 A;  2AKL A;  3EG1 A;  1ZUU A;  2KEA A;  4RTW A;  5I11 A;  1B07 A;  4J9E A;  1H8K A;  2A08 A;  5IHN A;  2DL4 A;  1QCF A;  1JEG A;  3U23 A;  1K0X A;  1KIK A;  4AFZ C;  2J6F A;  4JZ4 A;  4D8K A;  2L0A A;  1AEY A;  3UAT A;  2LJ3 A;  2DE0 X;  1M27 C;  1YP5 A;  1I0C A;  5IXF A;  2P4R A;  1SRL A;  2J6K A;  3H0I A;  1T0H A;  1UEC A;  1WLP B;  1G2B A;  4ZNX A;  1TUD A;  1UDL A;  3I35 A;  4X1V A;  1AWO A;  1K9A A;  1ZSG A;  1OEB A;  1WFW A;  1OPK A;  2KNB B;  2KR3 A;  1H92 A;  3UA7 A;  2D8H A;  3VRZ A;  2GGR A;  1NEB A;  1CKB A;  2JMC A;  2J05 A;  4CC7 A;  1NYG A;  1M3B A;  2JXB A;  2HBW A;  2KYM A;  2X3W D;  4OMO A;  4ESR A;  2YT6 A;  4A63 B;  1WA7 A;  2SEM A;  3JV3 A;  1GCP A;  1SEM A;  1RUW A;  4JZ3 A;  2ECZ A;  2JS0 A;  1K76 A;  2XMF A;  2BZ8 A;  2W0Z A;  1X2Q A;  2FPF A;  3FJ5 A;  1ZBJ A;  1AZE A;  1T0J A;  3I5S A;  2LX7 A;  2C0T A;  2KRS A;  3EHQ A;  4OMM A;  3SEM A;  2DNU A;  2CH4 A;  2EGC A;  3EG0 A;  2EYY A;  3QWX X;  1JU5 C;  2FRW A;  2L2P A;  2DBK A;  4CC2 A;  1PHT A;  2GTJ A;  1AOJ A;  1KJW A;  4JJD A;  3ZL7 C;  1FMK A;  1PRL C;  3PVQ A;  1X69 A;  1WXU A;  2C0O A;  1NLO C;  1QWE A;  3SHW A;  2J7I A;  2J6O A;  2EKH A;  1OOT A;  2K79 A;  2KT1 A;  2KXC A;  1GFD A;  1YWP A;  2F2V A;  2JM8 A;  2MOX A;  2E5K A;  2FRY A;  4HVU A;  4RTT A;  2I0N A;  2LJ1 A;  1W1F A;  2JMA A;  4JJC A;  2KRM A;  3VS2 A;  1GCQ A;  2EW3 A;  3M0P A;  1X6G A;  4J9I A;  2FPD A;  1UHC A;  1X2K A;  2YUP A;  2CUD A;  2CT4 A;  3EGU A;  2A36 A;  4F14 A;  4RTV A;  1GL5 A;  1WXB A;  2ROL A;  1Z9Q A;  2FG0 A;  2RPN A;  2DL5 A;  1A0N B;  3EG3 A;  3M0R A;  4D8D A;  1K1Z A;  3RBB B;  1PWT A;  4E6R A;  5IHK A;  2DMO A;  1N5Z A;  2EYX A;  2CRE A;  4Z89 A;  2MIO A;  2DIL A;  1Z9Z A;  4AFU C;  4FSS A;  2EYZ A;  1JO8 A;  1TUC A;  2VKN A;  1B3Q A;  4GLM A;  1QKX A;  4F17 A;  2BZX A;  2O88 A;  4RTY A;  1HSQ A;  1I07 A;  1WIE A;  1GBQ A;  2DF6 A;  3C0C A;  4HVW A;  1ZUK A;  5IH2 A;  1NM7 A;  1M8M A;  2CUB A;  4J9F A;  1ARK A;  2DA9 A;  2V1R A;  4RTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...