5ECAA

Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 6.5
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
SHMTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 6.5
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 14
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ecaA00
4AG2C 1VYTA 2J05A 2DE0X 3THKA 1NYFA 3FJ5A 2FPEA 1I0CA 2PNIA 4AFZC 2C0IA 2A08A 2AZVA 2I0NA 2O88A 1K4US 2L3PA 2MOXA 2F2VA 3VS5A 2J6KA 2JW4A 2CREA 1QCFA 1Y0MA 1SHFA 1GRIA 1IO6A 1WA7A 3PVQA 1AWJA 1W1FA 2KNBB 4JZ3A 1WLPB 2ROLA 1X6BA 2LJ3A 4ZNXA 3EGUA 1ZUKA 4KRTA 1Z9ZA 3TSZA 1SPKA 4X1VA 2H8HA 1AVZC 3TVTA 3VS1A 3H41A 5FWCA 4HVWA 2YUQA 3VRYA 5EC7A 2JMCA 1QLYA 1PRLC 1OPLA 3M0TA 4F17A 1WX6A 2LJ1A 2CDTA 2EYYA 2L0AA 2V1RA 2GTOA 5L23A 1UHCA 4OMMA 1NG2A 2EGAA 3VS6A 2DF6A 3C0CA 2LCSA 2DM1A 1KFZA 2LMJA 1QKWA 1PWTA 4LUEA 2EKHA 2J06A 2XMFA 3REBB 1M30A 2AK5A 4RTTA 2BZXA 2HDAA 1BB9A 1V1CA 2KBTA 1KIKA 2OAWA 5IXFA 1PKSA 1HD3A 3I5SA 2LNHB 1I1JA 1CSKA 1JQQA 2SEMA 4K11A 2P4RA 1ZX6A 4D8DA 1ZLMA 2X3WD 1FYNA 1GL5A 2RMOA 2FPDA 1OEBA 4AFUC 1JXOA 1RLPC 1X27A 4RUGA 1RI9A 3VRZA 2DBMA 1WYXA 2A36A 2DL3A 1TG0A 1SHGA 1BU1A 2PZ1A 2ROTA 1KJWA 2GBQA 4OMOA 1ZBJA 1H8KA 2ABLA 1CKAA 4CC4B 1TUCA 4OMQA 5ECAA 4WCIA 3RBBB 2EYXA 2EGEA 2GTJA 4RTXA 2DMOA 4D8KA 1FMKA 2DILA 1M3CA 3H0IA 2KT1A 1NM7A 2CUBA 4J9FA 1H92A 2L2PA 5FW9A 4F16A 2CT3A 2EVRA 2KYMA 4DEYA 1U06A 2A37A 2MIOA 2NUZA 4HXJA 4JJBA 5GJVB 4Z8AA 2DLPA 2O9VA 1SRLA 1HJDA 4J9EA 2PTKA 4J9BA 1OPKA 2JTEA 1TUDA 1YWPA 4JJCA 2DL7A 1MV0B 5HCKA 2RPNA 4OMNA 4JZ4A 2BZYA 2KRNA 2ENMA 4JJDA 2J6FA 1UG1A 1UGVA 2B86A 1LCKA 1EFNA 3NPFA 1UE9A 2EYWA 3PE0A 2JT4A 4RTZA 1SEMA 2G6FX 4EIKA 2YT6A 3GBQA 2RNAA 2K9GA 3VS0A 2RQVA 2FPFA 1JO8A 2ECZA 2VKNA 4A63B 2KE9A 2DX1A 2YDLA 4CC3A 1WXUA 1SSHA 2DL4A 2J7IA 3O5ZA 1VYUA 1W6XA 2LZ6B 2CH4A 2KROA 4LE9A 2K2MA 1J3TA 2FO0A 2YUPA 3H0FA 1QWEA 2DA9A 2DVJA 4R0KA 1B3QA 4LNPA 2L3QA 3NMZC 4FSSA 3CQTA 4E6RA 2LX7A 3EG0A 2LQNA 1BK2A 2D1XA 3RNJA 1UJ0A 1VA7A 4HCKA 1ZUYA 2DRKA 2CT4A 2YUNA 2RQRA 2AZSA 3I9QA 3JV3A 3UA7A 3IQLA 4F14A 4RTUA 2M51A 1G2BA 1AEYA 5IXBA 2HCKA 3VS2A 2X3XD 1GCQA 2LP5A 1MV3A 3NHNA 4Y92A 1M3BA 3PVLA 1YP5A 3EG3A 2FG0A 1WXBA 1QWFA 1S1NA 2OI3A 3VS4A 2DNUA 1UTIA 1PNJA 2K3BA 2FRWA 3EG1A 1NLPC 2BZ8A 5I11A 2VVKA 2K7AA 2KR3A 4OMLA 3UF4A 1T3SA 2W10A 3U23A 3M0RA 1ZUUA 1HSQA 1ABQA 4CC7A 1M27C 1AOJA 2GGRA 2F2WA 2KT8A 1E6HA 1NEBA 1PRMC 4OMPA 1RUWA 2RN8A 1UFFA 5IHNA 3LH5A 3QWYA 1NEGA 1GBQA 2JMAA 3SEMA 1GCPA 4J9DA 1K76A 1T0JA 3REAB 1ABOA 2BTTA 1RLQC 4AG1C 1QKXA 4J9CA 1GBRA 2DYBA 4IIMA 2SRCA 1AD5A 3SHWA 1T3LA 1MUZA 2OJ2A 1M8MA 1UDLA 1GFCA 3EHQA 1E7OA 2EGCA 4LN2A 2YUOA 1OV3A 1WFWA 5IHIA 2RQUA 1X43A 1YNZA 2C0TA 2EYZA 5FWBA 2A28A 3M0SA 4RTWA 1YCSB 4DEXA 3UATA 2JS2A 2RQWA 4GLMA 1ARKA 1UECA 2DL8A 2LQWA 2KXCA 1YN8A 3M0UA 2E5KA 5I22A 1T0HA 2CSQA 3R6NA 1ZSGA 4ESRA 3UA6A 2FEIA 1XOVA 4J9HA 2D8JA 2RF0A 3EG2A 3QWXX 2L3SA 5GJWB 4ORZA 1AWOA 2AKLA 2V1QA 1U3OA 1X2QA 1YWOA 1AZEA 4HVUA 1M3AA 2RQTA 5IH2A 2KGTA 3NGPA 2M0YA 1JU5C 2JS0A 2DL5A 1X6GA 2LJ0A 1WXTA 1JXMA 1X2KA 1I07A 1JEGA 2EBPA 2IIMA 2JM8A 3KFVA 1W70A 1PHTA 4HVVA 2D8HA 2KEAA 1UJYA 2YSQA 2KXDA 1SRMA 3VS3A 2VWFA 4Z89A 4AFQC 4GBQA 3H0HA 2DBKA 3A98A 1Y57A 2O2OA 1NYGA 1Z9QA 2K79A 2EW3A 3ZL7C 1N5ZA 2ED0A 1A0NB 4LUDA 2GNCA 1U5SA 3M0QA 4J9IA 4CC2A 2O9SA 2ESWA 2QDLA 2KYBA 1PKTA 2F2XA 1K0SA 4QT7A 2CUDA 1G83A 1E6GA 1GCQC 4AFSC 2DRMA 2J6OA 5IHKA 2KRMA 1UHFA 1K9AA 2K6DA 2D0NA 2JXBA 2CSIA 2ED1A 4RTVA 4M4ZA 1B07A 1VYVA 1AZGB 2MCNA 2HBWA 1GFDA 1WDXA 2O31A 2NWMA 1K0XA 1KSWA 2HEQA 3ULRB 1NLOC 2EPDA 4RTYA 1AWWA 2KRSA 4Z88A 1K1ZA 2CH4W 1WI7A 2JM9A 2W0ZA 1WIEA 4IIOA 2FRYA 3EHRA 1H3HA 3VS7A 2HSPA 4JPBW 1CKBA 2DJQA 3TSWA 2GQIA 3I5RA 1AWXA 3I35A 4J9GA 2C0OA 1OOTA 2AKKA 1X69A 1BBZA 3M0PA 2EQIA 1UUEA
chains in the Genus database with same CATH superfamily
2AIRB 1Q7YR 5FU7B 2M9UA 1Q86C 2O4XA 2DE0X 3KBGA 4PL6A 3META 4Q5WA 4AFZC 1NZ9A 1VQPA 2L3PA 2DO3A 3G4SA 5GAMe 5HKCA 2J6KA 2JW4A 1VQPT 1QCFA 1TU0B 3SWNB 1IO6A 1WA7A 3PVQA 1K73U 5LJ3d 5CVIA 1BCOA 4MZPA 2KNBB 1FMVA 2VXEA 4PJOD 2WSCE 1W2BP 3CC7T 1WLPB 1IGQA 3JCMV 5HY6A 4MDXA 2P0KA 4PJOF 3EGUA 5LJ5f 3L2UA 2PVDB 5I21A 1SPKA 1Q7YC 1M1GA 3TVTA 3H41A 5FWCA 4BDZA 5EC7A 4NL3A 2F69A 1LVKA 1SKUB 2KK4A 2YWWA 4IUVA 4F17A 5DM7R 4E7LA 2EYYA 3EGXB 1V29B 3QJ6A 3JCMh 1M9SA 1PG5B 3MP1A 2QA4Q 2KY9A 1BI2A 2EGAA 2DF6A 2GF7A 3C0CA 2LMJA 2J06A 2HDAA 4MZMA 1Q82R 1OQKA 1V1CA 2EKOA 2OAWA 3G6EQ 4C0DB 4LDYA 3I5SA 4JUVA 4C5IA 4M77B 5LJ5g 1MMAA 1ZX6A 2P4RA 5GAOr 3M4YA 3CCRA 2RMOA 3L2RA 3R6OA 3CCRT 4RUGA 1RI9A 4ZGEB 3VRZA 4C5GA 1VQPQ 2COWA 2CP5A 3G4SQ 5FRMA 2ROTA 2MK5A 2ABLA 1CKAA 2L5QA 2X51A 1TUCA 4OMQA 1Q82C 3RBBB 2EYXA 5HK0A 4M77D 3I55A 4RTXA 2DMOA 1QCNA 4D8KA 1FMKA 1XNIA 1YHQA 1M3CA 4M77F 1VIEA 2E3IA 2FL7A 5AYFA 5IT9E 2ZPFB 3HKSA 2EJGA 4NL2A 4E7IA 1H92A 1YIJT 4F16A 2Y4XA 2KYMA 4M75A 2MIOA 3J80E 3A5ZB 4XK8E 2PQWA 2XI9A 3OYKA 4FSXA 1I8FA 2DL7A 1MV0B 1XTDA 1YI2A 3KUFA 2KRNA 1M8VA 2ENMA 2J6FA 1NE8A 1YI2T 2EYWA 3G1JA 4RTZA 2G6FX 3BDUA 2YT6A 1ZSZB 3VS0A 2R57A 4A63B 2ECZA 2RI3A 4M77E 1SSHA 1D1AA 2DL4A 4O5VA 4N4GA 2CYZB 1W6XA 4PKCC 1Y96B 2FO0A 3FEOA 3CCRQ 4C5HA 2H3JA 4LNPA 1WPYA 4E6RA 1WHHA 2RD1A 4ZGDB 1WHGA 2XU8A 1ZUYA 2ZPIB 2DRKA 1N9SA 3GP8A 3I9QA 1EIFA 2JNGA 4F14A 1W2BA 4IUQA 4BD3A 4OB0B 5GANg 8ATCB 1YITA 1G2BA 3P8DA 3OB9A 1YJ9A 2BIVA 2LCLA 5M9OA 1YITT 4PJLA 3I55Q 4OVAA 2E6NA 1MV3A 1YJ9T 2GCXA 2E6ZA 2X4JA 4FW2A 1YHQQ 2VYTA 3OBWA 1OULA 1BKBA 3QZ9B 3FRNA 1YIJQ 3EH2A 2A3LA 5AT1B 1UTIA 4BI3A 2K3BA 4ELYC 2A7YA 4C5EA 2K7AA 2K5FA 4OMLA 3UF4A 1YI2Q 3JCMc 3U23A 1FXXA 4CC7A 2GGRA 2JUFA 2KT8A 2V26A 2RN8A 5IHNA 3ASKA 1VQLA 1GCPA 4OF1A 2RK2A 1VQLT 1QVGS 3QJYA 1QKXA 5GANd 3CBMA 3OMCA 3S3MA 1Q82U 5DLQE 2X9HA 1TSFA 5LJ3j 4L6V5 1I4K1 1M8MA 3BDLA 5KE3A 3EHQA 1N27A 5IHIA 1YNZA 2EYZA 1VQKT 4RTWA 1YBYA 1AHJB 4AT1B 3UATA 2JS2A 1YITQ 4M75C 4PLLA 3M58A 1YN8A 2KVQG 3VJPA 1YJ9Q 2CSQA 1R0CB 5J3BA 4F04B 1C1AA 2FEIA 3TEEA 3OYLA 4QVCA 2RF0A 3EG2A 3OBYA 5GJWB 2OAUA 2XDDA 4OP0A 1HK9A 2V1QA 1X2QA 4RMOA 1S72T 2RQTA 4M75G 3OS0A 1B34B 3CCSA 4XTZA 5GMKm 2OTLT 3NGPA 2M0YA 5KE2A 1VQOA 2LJ0A 1WXTA 1G3SA 1JXMA 1G5VA 3RDVA 3URGA 4C8QD 1VQOT 2EBPA 2JM8A 3LX7A 4C8QF 1YJNA 3P8HA 2MMPA 2R5AA 4E47A 3X20B 1PCXA 1SRMA 4AFQC 2HBPA 1M2OA 2RHIA 5LJ5h 3HRTA 1VQLQ 3TQ7P 3DB4A 5CKBA 2IPOB 2QAZA 1N5ZA 1A0NB 2DEUA 4LUDA 2V8JA 2EFIA 2M16A 1UGQB 2K5LA 1IHWA 2KYBA 1IB8A 1PKTA 2CUDA 1VIFA 3OYBA 1KQ2A 2DTOA 3CCQA 5IHKA 2HQXA 1UHFA 2K6DA 3DB3A 2L89A 2JXBA 1G3TA 2CSIA 3CCQT 2L3RA 4DOWA 5I2MA 4RTVA 4F7UB 1VYVA 1AZGB 4MMLA 2DKGA 4EMKB 5GMKj 1GFDA 1IXDA 2O31A 3OYIA 2E10A 6AT1B 1NLOC 2EPDA 4A4GA 2VXFA 3WVEB 2RB6A 4C92D 2JVVA 1WI7A 4M78B 3CCMA 2O01E 1VUBA 1WIEA 5LJ5j 4IIOA 4C92F 2QDYB 4HT9A 5GAN8 3VS7A 3CCMT 2HSPA 4JPBW 1N8RU 1CKBA 2RHUA 3CCSQ 3OA6A 2K5IA 5FLXE 3MEVA 2LQKA 1VQOQ 2QQAA 4HCCA 4X34A 4M7AD 2HSEB 3CPWS 4J9GA 4F7UF 4OB3B 2AKKA 4JRPA 1VQ7A 4M7AF 2XK0A 1Y7XA 1UUEA 3MEAA 5D6YA 3HP9A 4EMHA 3OS2A 1VQ5A 4BI4A 4IKFA 1NJIU 1I0CA 4B9XA 2A08A 3CBPA 4M78F 1ZA2B 5CQXA 2MOXA 3L2ZA 1RABB 3LGFA 3RKYA 3JB9G 2H3EB 1D3BA 2PUKB 1D09B 3V7RA 1W1FA 1VQ4A 4BI8B 2HQHA 1VQ4T 1X6BA 3CCQQ 4ZNXA 2YHTA 4F7UE 1ZUKA 4JLGA 5GANh 4M7DB 1AVZC 3OYHA 2K3YA 5LJ3f 2YUQA 1M2VA 4FT4A 2JMCA 2ZGWA 1K8AR 4MZTA 2Y4YA 3FC3A 1WX6A 4M78E 2CDTA 3QG1A 2EJ9A 3CCMQ 5L23A 3TU4K 1K9MR 1GXIE 2EQMA 3BFMA 4J5YA 4X9CA 3VS6A 2DM1A 1RAAB 1ZQ1A 4OMFB 2XMFA 3REBB 1OI1A 1YJWT 1M90R 1SSFA 2XG8D 2KBTA 3RR6A 1KIKA 3JB9H 1PKSA 2IG0A 5CAIA 4LDVA 2PU9B 3X26B 1VQ7Q 2LNHB 3MHXA 2ZPGB 2SEMA 2NUTB 3A8OB 4P5NA 5GAMd 3CXCS 4K11A 1XJWB 1ZLMA 1K8AC 5GANj 1VQ5Q 5LJ3g 3VV0A 1KHIA 3L2WA 1JXOA 1RLPC 2EIFA 2E3HA 1B7TA 4L5GA 2DL3A 5FRNA 1TG0A 2MWOA 1SHGA 4MMKA 2PZ1A 4QVDA 3O8VA 4OMOA 1K9MC 1ZBJA 1QCOA 2QA4A 2M1HA 5KYUB 4XU3A 2ZPEB 5GAOn 2VGNA 4CC4B 2RJFA 1ZHIA 1VQ4Q 2EGEA 3SWNA 1KQSS 4M7DE 2DILA 3OYYA 4ZN3A 2X35A 2LNVA 2KT1A 4C0FA 3QO3A 4ZN1A 4PJOB 5FW9A 3KXTA 2RJEA 1U06A 4JJBA 4Z8AA 5FU6B 4BACA 1SRLA 4J9EA 1SF9A 3OYDA 2RPNA 4LD9K 3JCMQ 1Y07A 2P0PA 4NS5A 1UG1A 1OX8A 5CQYA 1LCKA 3LWHA 1YJWQ 2LC4A 3GLXA 1UE9A 3OYFA 3QDFA 2JT4A 4EIKA 1SEMA 3CC7A 3GBQA 4E7KA 1H3ZA 3CCVA 1WJQA 1AT1B 1JO8A 2RHXA 3CCVT 1TS9A 3O5ZA 1VYUA 3PIOA 3MEUA 4KGZB 1UGPB 2KROA 4LE9A 4M7DG 1J3TA 3CCUT 4R0KA 2X4XA 1B3QA 3VKIA 3MP6A 3M5AA 1X01A 3EG0A 2D1XA 4R56A 3RNJA 5GMKi 1VA7A 5A0GA 2CT4A 2YUNA 2QQRA 2RQRA 2CP2A 3S3NA 2EQUA 1X6OA 2PVOB 4RTUA 2ZPBB 1BIAA 2RM4A 4J6XA 2EQJA 2LDMA 2FHDA 2X4WA 1AEYA 3VS2A 3FIFA 4BE2A 2Y90A 4XU2A 1R8OB 3QKJA 4PJOE 3E19A 1LNXA 2JTFA 3QDRB 1YP5A 1MGQA 3FJPA 3EG9B 1WXBA 2P4TA 2EYQA 1Q81R 1QWFA 1S1NA 2OI3A 1KC8R 2DNUA 1WHJA 1D1BA 1PNJA 1BI0A 3L2QA 2FRWA 3JRZA 4QQDA 5DLOA 1VQ8A 2BZ8A 5I11A 3OW2S 5KCHA 1VQ8T 1K8AU 3CPWP 1PM3A 5GAOq 3WVDB 4OMPA 3CC7Q 4DA4A 4QQGA 1RUWA 2DXUA 2WACA 3FB9A 3CC4T 5FU7C 3CCVQ 3E1SA 4N4HA 1M1KR 3M59A 4ZGJB 1K9MU 1K76A 3RUXA 1T0JA 1YIJA 4AG1C 3H9NA 4J9CA 1Q81C 2DYBA 4GY5A 1KC8C 4IIMA 4R55A 1AD5A 4PJOG 4XU1A 3SWNC 4ZTJA 1E7OA 1TXQA 1OV3A 3QBYA 2C0TA 4RCBA 1OZ3A 2A28A 3M0SA 5GANf 1BCMA 3HFOA 2RQWA 4GLMA 3QPHA 1Q86U 3CD6A 2DL8A 4FYYB 2F5TX 1QP3A 1WHLA 1T0HA 1M1KC 3CD6T 2E4HA 2KSSA 4ESRA 3MPUB 2DXTA 4PK4A 3QWXX 2L3SA 2XICA 2GFUA 3H6ZA 1U3OA 2QQ9A 3HRSA 1YWOA 2VC8A 4JRQA 3PMIA 4LDUA 2VV5A 1QP2A 2FZGB 2QK0A 1VQ8Q 1Q7YU 5CKHA 4HVVA 4C0DC 4E2FB 1MMGA 3M9QA 1FX7A 1UJYA 3I56A 2YSQA 4M77C 3RMSA 3I56T 1LPLA 1Y57A 2O2OA 1Z9QA 3JAME 3ZL7C 3HFNA 5LJ3h 2DEQA 4J6YA 1U5SA 3BY7A 1WJSA 4PNOA 4J9IA 3PIPA 4RCCA 4J6WA 2QDLA 4KULA 1OX9A 4M77G 4QT7A 4BE1A 4RKUE 3BE3A 4M75D 3N5BB 2HQEA 1VQ9T 3L2VA 5LJ5e 3ZFJA 3JSCA 1UB4A 2NYSA 2MYSA 3GIBA 2DERA 1KQSP 1B07A 5DY9A 2COZA 4L59A 4TVRA 4J8OA 3CD6Q 4FT2A 3V7CA 1WDXA 4KGXB 1KSWA 2HEQA 1JJ2P 2YRCA 1NPRA 3EH1A 1K1ZA 2C06A 4PJMA 2JM9A 1G8XA 2R5MA 2M0OA 2LX9A 4FM4B 2NUPB 3TSWA 1V76A 3I5RA 1NPPA 1I5LA 1B34A 1VQKA 3HSBA 3I35A 2QG9B 3CPWA 2RJDA 1ZSZC 1X69A 1BBZA 3M0PA 2EQIA 3CC2T 2MPXC 1KC8U 3D7SB 4AG2C 2J05A 3I56Q 4B6MA 2A0FB 4C8QB 1JRIA 1NYFA 2P0QA 1WGSA 2PNIA 2I0NA 2BUDA 2DIGA 1S72A 2CREA 2L8DA 4E7SA 1Y0MA 1SHFA 3AHUA 5KYWB 2OTLA 3V8JA 1WNLA 1M1KU 2QQSA 3JCMP 3EGDB 2ROLA 2WSFE 3F70A 4FYWB 2XDBA 4KRTA 3VYGA 5GMKh 1Z9ZA 1D1CA 3TSZA 3OYGA 4X1VA 3JB9J 2E41A 1BYMA 1U1TA 4DBQA 4HVWA 1M5Q1 3VRYA 1KD1R 1QLYA 3V8LA 1OU8A 4EMKA 3M0TA 1M4ZA 2LJ1A 3PGGA 4XAXB 2L0AA 4ZTFA 2DD4A 5D7UA 2V1RA 2YLBA 2M02A 2CP6A 1NG2A 4OGCA 1IRXA 3RKXA 1KFZA 2KMTA 4KH0B 3G71T 1PWTA 4LUEA 2EKHA 4M78A 2QTVA 4MDWA 1M30A 2AK5A 4C92B 1QVPA 1BB9A 5KYNA 1VQKQ 1HD3A 1D0ZA 2AT1B 4N0AA 4PFPA 3INZA 1I1JA 1JQQA 3RKWA 4C8QE 4M7AB 2FYKA 2K3XA 2CGHA 2X3WD 1FYNA 1GL5A 1QVFS 2ATCB 1OEBA 1X27A 2HAXA 2NLUA 2A36A 3C94A 1PSFA 3GNGA 2JTMA 2CZ1B 1KJWA 4BE0A 1S72Q 5GAMf 2OTJT 2E12A 1H8KA 1RAFB 5GAN4 4XU0A 2JOYA 2CZ7B 3OQ5A 2OTLQ 2LTOA 2HL5C 4WCIA 3CMAT 1KQSA 2IVWA 4Y28E 1W4SA 2DTHA 5KYYB 3H0IA 3CCLA 3PNWC 3ZBDA 4PJJA 4LXCA 4HCZA 2DIQA 3VUZA 1JJ2A 3CCLT 4JLIA 5KYXB 5CKFA 4M7DA 2L2PA 1FMWA 3CPFA 9ATCB 3MJXA 2CT3A 2EVRA 2A37A 2NUZA 4HXJA 2YXYA 2DLPA 2O9VA 2PTKA 3DKMA 2JTEA 1YWPA 1M1FA 2DPPB 5HCKA 3PTAA 4OMNA 4JZ4A 3G71Q 2QI2A 2BZYA 4BY6B 3E2UA 4C92E 1UGVA 2B86A 3JCMd 3MO8A 3NPFA 5GAMg 2XDPA 3EFOB 3PE0A 2K9GA 1D0XA 2RQVA 2FPFA 4VUBA 2KE9A 2YDLA 7AT1B 4M7AE 2EJFA 3RIRA 2LZ6B 2CH4A 1RAIB 1TUGB 2K2MA 3H0FA 1P92A 1BI1A 2DA9A 2NUTA 4FSSA 3LWIA 4HKEA 2LX7A 3CMEA 2LQNA 1BK2A 1ZA1B 4HCKA 2OTJQ 2LVMA 1G3WA 3OYCA 3MKDA 3CMET 2JZ2A 2AZSA 3ME9A 3EAEA 4PLIA 1YJWA 5IXBA 3G7ZA 2HCKA 5KYUA 2QEXA 4EMKC 2QXFA 3LH0A 2X3XD 3S6WA 4C92G 2QEXT 3T9NA 1M3BA 3CCLQ 3JCMe 2BE7D 1PD1A 3E9FA 1QW1A 3QIIA 4Y91A 4HA8A 2OX7A 4M78C 4F7UG 2P84A 4PJOA 1QVGP 2BE9B 1VOMA 3HRUA 4M7AG 2QGFB 3P8BB 3A1PA 4KUDK 1NLPC 5J39A 4FL6A 4N0AC 2LT1A 3OYEA 2VVKA 2KR3A 3C12A 2Z0WA 4OB1B 2W10A 2DFUA 1HSQA 1MNEA 1AOJA 2V8KA 3PT9A 3CCJA 1M90C 4M78G 1NEBA 3L1AA 4IUUA 4NOYA 3LH5A 3CCJT 1NEGA 3J7AF 3SEMA 3SB2A 3HL8A 3JCMJ 1ABOA 3VYHB 2BTTA 1RLQC 5CR2A 1GBRA 2DVEA 2SRCA 3WXMB 4JRIA 3SHWA 1MUZA 2CP0A 1HXDA 3E9GA 4RG8A 1KHCA 2DJZA 2VASA 3CMEQ 1ZBXA 4LN2A 2EAYA 2YUOA 5HK3A 2CP7A 4PFZA 2D6FA 2RQUA 4XQ3A 3MCAB 5KH6A 3HHTB 2K57A 5GAOp 5FWBA 3EGXA 4A53A 4C0ZA 4M7DC 4DEXA 2DZCA 4OGEA 4II1A 3OYAA 1ARKA 3M0UA 3JB9I 2QEXQ 4FYXB 5I22A 4RG2A 2FZKB 3MEWA 3M54A 3UA6A 2D8JA 3M56A 4FYVB 1AWOA 2AKLA 3G4ST 4LDXA 4HVUA 4AMCA 3CCUA 1KK7A 2EWNA 3EG9A 4M77A 2LT4A 2KGTA 2RJCA 1MMDA 2JS0A 1X6GA 2HL3A 2DETA 2RK1A 2R58A 1RACB 1NBEB 4XTYA 5A2QE 4A4KA 2IIMA 1KG1A 1LOJA 1W70A 2K2VA 1PHTA 4EPCA 2O4XB 2D8HA 3Q1JA 5GAOm 2KXDA 3CCJQ 4FIBA 1N9RA 4GLKA 3H0HA 3A98A 2K79A 1KQ1A 1VQNA 2ED0A 2PVGB 2X4YA 1QVFP 2HMAA 1IGUA 4JS4A 4IUPA 1VQNT 2O9SA 2F2XA 1K0SA 4AFSC 3JCMb 2GQVA 5CKDA 2JJ9A 5LJ3e 1PC0A 1PD0A 3OMGA 2MCNA 3NTHA 3CC4A 4JS5A 1MNDA 4PJOC 2NWMA 4XTVA 2MAMA 3DLMA 3ULRB 5GAN7 3DLLA 3X25B 3UT1A 2KRSA 4KT0E 1RI0A 5FU6C 1ZSZA 4DBFA 1QVGA 1I81A 3CCEA 3PFSA 2FRYA 3CCUQ 3EHRA 1M90U 3CCET 3SD4A 1H641 2DJQA 1Y96A 4C0GA 1C0MA 2YRVA 5GAMh 3I55T 2XD0A 3A8LB 2DTIA 2E65A 2VGMA 1YHQT 3A8MB 1VYTA 3QHSA 3QSUA 2RH2A 2K4YA 2WSEE 3THKA 3FJ5A 3S3OA 2FPEA 2KI7A 2C0IA 5D6XA 5GMKl 4QKUA 2AZVA 1N6AA 2O88A 1K4US 1VQNQ 2F2VA 3VS5A 5LJ5d 1TWBA 3CBOA 2LCCA 4HT8A 4KBMB 1F1BB 1GRIA 2MI6A 1AWJA 3QYGB 3OS5A 2BKDN 4JZ3A 2CZ0B 2XIDA 4KH1B 8AT1B 2LJ3A 2CZ6B 1YFNA 2CS7A 3MP8A 3GOXA 3LYIA 3SDZA 1RADB 4M75B 1OZ2A 2HD0A 2H8HA 3VS1A 5GAMj 3CC4Q 5GAN2 2DZ9A 3OYMA 4EMGA 1PRLC 4YTLA 1OPLA 3CXCP 3M57A 1SG5A 3TREA 5IN1A 2FVUA 5GMKe 2LRQA 1BI3A 1EX4A 3CCEQ 3ER0A 2GTOA 2HKNA 1UHCA 4OMMA 2LCSA 3RERA 1QKWA 1VQ9A 4RTTA 2BZXA 3OYJA 3AT1B 1N8RR 4IUTA 2FB7A 5IXFA 4M75F 2NUPA 3L42A 2E64A 2HKQB 1YCYA 3UDCA 1CSKA 4BDYA 4D8DA 4O6JA 1FWZA 4ATOA 3GPLA 1QVFA 2FPDA 4AFUC 2QASA 1LJOA 1VQMA 2DXCA 4C8QA 2DBMA 1WQWA 1WYXA 2DXBA 1NJIR 1BU1A 4IURA 1VQMT 4J83A 2GBQA 1TOVA 2GFAA 5FROA 4JJNK 2VB6A 5ECAA 1N8RC 2GTJA 3FLGA 5KYWA 5C6SA 3NTKA 4M75E 2B8AA 3CC2A 2RI5A 3EGDA 1VQ6A 1Y71A 3OYNA 1Q81U 2YLCA 3PMTA 1NM7A 2CUBA 1VQ6T 4A54A 4J9FA 3JCMX 3V8KA 2DYIA 2DD5A 1JB0E 4DEYA 5GJVB 1NJIC 1HJDA 3EFRA 4J9BA 1OPKA 1TUDA 4JDSA 1RAGB 4JJCA 1O75A 1O9SA 4LD6A 4JJDA 4CRIA 2G3RA 2V8IA 2JN0A 1EFNA 2E5QA 4QW2A 2RO0A 3QYHB 1VQ9Q 2RNAA 2PUOB 4Z02A 4DBRA 2F1LA 2F5KA 1MMNA 3SFMA 2VKNA 4C92A 1WJRA 2DX1A 2ZCFB 4FU6A 2QQBA 4CC3A 4PFOA 1WXUA 5GAN5 3M4GA 2J7IA 3JCMf 4QVZA 4QQ6A 2YUPA 2CKKA 1QWEA 1RAHB 3OY9A 2LQ8A 5CO7A 4F7UA 2DVJA 4FW1A 1DJ7B 5CIUA 4EDUA 4M7AA 2L3QA 3NMZC 1VQMQ 3CQTA 3CCST 5GAN3 1UJ0A 5D6WA 2HZYA 2KQWA 5GANe 3G71A 3JV3A 3UA7A 2D9TA 4N4IA 3IQLA 1W2BS 2M51A 2ZAEA 3UWNA 4J7FA 1WHKA 3OW2P 1EZZB 3CEYA 1YJNT 3JB9D 2KAFA 2MF2A 3JB9F 2I2LA 1GCQA 2LP5A 3H8ZA 1TH7A 1U1SA 3NHNA 4Y92A 3CC2Q 1UGSB 3RESA 3PVLA 1VQ6Q 3LGLA 2EQKA 3EG3A 2FG0A 2QTXA 5L8RE 1KD1C 3CXCA 5KYYA 3JCMg 2QYZA 3VS4A 4DBHA 3J81E 5KYXA 1I5OB 4D6WA 1C6VX 1WZOA 3EG1A 4B9WA 3LLRA 2OTJA 1PSEA 3A8GB 2DAQA 1T3SA 3M0RA 1ZUUA 1ABQA 4A4HA 1M27C 3GF5A 2F2WA 3CMAA 1E6HA 2RHZA 5C0MA 1PRMC 4UC4A 2MWPA 1UFFA 1K73R 4A4EA 3QWYA 3EFOA 1GBQA 2JMAA 4C8QC 4J9DA 3REAB 2D0QB 4XTWA 2VUBA 5CCAA 1WQ7A 4BUGA 1T3LA 2AHJB 2OJ2A 1R77A 1TTHB 1UDLA 3X28B 4FCYA 3C4SA 1GFCA 4J7IA 5J26A 4ANJA 4C8QG 2EGCA 3FDRA 4OB2B 1WFWA 1X43A 3HTRA 1IHVA 2XHCA 3X24B 1XQHA 2XKOC 1YJNQ 3OS1A 1VQ7T 1IZ6A 1YCSB 3OSSC 2RI2A 1UECA 2LQWA 2KXCA 5EG2A 1K73C 1UEBA 4ELZC 2KDSA 4M78D 2E5KA 4DQ2A 3R6NA 1ZSGA 3BW1A 1VQ5T 1XOVA 4J9HA 3HPWA 1QQJA 4ORZA 1OYXA 3QUIA 1AZEA 2RA2A 2HNIA 4HCBA 1M3AA 1D0YA 4LDWA 1BIBA 5IH2A 3LW5E 5GAOl 4X9DA 3TCJA 1JU5C 2DL5A 2E70A 5CKEA 4C92C 3VU3C 1X2KA 1I07A 2FZCB 1JEGA 2ZPHB 3KFVA 5LL6S 1G3YA 1MHNA 1WHMA 3A8HB 5I2SA 1QMCA 1HYOA 3M55A 1U8RA 2KEAA 3CMAQ 4ME7A 4WF2A 3GNFB 3QXEB 3VS3A 2VWFA 4Z89A 4GBQA 1RAEB 4M7AC 2DBKA 1R0BG 2COYA 1NYGA 2EW3A 2YRDA 1JBMA 4BB7A 1D3BB 2GNCA 5GAN6 1UGRB 3ZEHA 3M0QA 4E7JA 4CC2A 2CP3A 1Q95G 2ESWA 4M7DD 3V7SA 1G83A 2DK3A 1E6GA 4KGVB 3UPUA 4E7HA 4M7DF 1GCQC 5KCOA 2DRMA 2J6OA 2E1HA 2KRMA 1K9AA 2D0NA 3OW2A 5CK9A 1M2VB 2ED1A 3RMQA 1IREB 1KD1U 4M4ZA 3M53A 3QZ5B 2HBWA 5A0DA 1OU9A 4CI0C 4DOVA 4XTXA 4WTOB 1K0XA 4KUIA 4A4FA 1Q86R 3NTIA 5A0LA 4RTYA 1AWWA 4Z88A 4E7ZA 2CH4W 2W0ZA 3EFSA 1X75C 3OSVA 3NFCA 3VUBA 1H3HA 2QA4T 4BY6C 2QGGA 2GQIA 2ZZDA 1AWXA 3G6EA 4PJNA 2C0OA 2RHYA 3JCMW 4V2SA 1OOTA 4JRKA 3C95A 5IAYA 1RL2A 1ACMB 3G6ET 4XTUA 1JJ2S
chains in the Genus database with same CATH topology
4AG2C 1VYTA 2J05A 2DE0X 3THKA 1NYFA 3FJ5A 2FPEA 1I0CA 2PNIA 4AFZC 2C0IA 2A08A 2AZVA 2I0NA 2O88A 1K4US 2L3PA 2MOXA 2F2VA 3VS5A 2J6KA 2JW4A 2CREA 1QCFA 1Y0MA 1SHFA 1GRIA 1IO6A 1WA7A 3PVQA 1AWJA 1W1FA 2KNBB 4JZ3A 1WLPB 2ROLA 1X6BA 2LJ3A 4ZNXA 3EGUA 1ZUKA 4KRTA 1Z9ZA 3TSZA 1SPKA 4X1VA 2H8HA 1AVZC 3TVTA 3VS1A 3H41A 5FWCA 4HVWA 2YUQA 3VRYA 5EC7A 2JMCA 1QLYA 1PRLC 1OPLA 3M0TA 4F17A 1WX6A 2LJ1A 2CDTA 2EYYA 2L0AA 2V1RA 2GTOA 5L23A 1UHCA 4OMMA 1NG2A 2EGAA 3VS6A 2DF6A 3C0CA 2LCSA 2DM1A 1KFZA 2LMJA 1QKWA 1PWTA 4LUEA 2EKHA 2J06A 2XMFA 3REBB 1M30A 2AK5A 4RTTA 2BZXA 2HDAA 1BB9A 1V1CA 2KBTA 1KIKA 2OAWA 5IXFA 1PKSA 1HD3A 3I5SA 2LNHB 1I1JA 1CSKA 1JQQA 2SEMA 4K11A 2P4RA 1ZX6A 4D8DA 1ZLMA 2X3WD 1FYNA 1GL5A 2RMOA 2FPDA 1OEBA 4AFUC 1JXOA 1RLPC 1X27A 4RUGA 1RI9A 3VRZA 2DBMA 1WYXA 2A36A 2DL3A 1TG0A 1SHGA 1BU1A 2PZ1A 2ROTA 1KJWA 2GBQA 4OMOA 1ZBJA 1H8KA 2ABLA 1CKAA 4CC4B 1TUCA 4OMQA 5ECAA 4WCIA 3RBBB 2EYXA 2EGEA 2GTJA 4RTXA 2DMOA 4D8KA 1FMKA 2DILA 1M3CA 3H0IA 2KT1A 1NM7A 2CUBA 4J9FA 1H92A 2L2PA 5FW9A 4F16A 2CT3A 2EVRA 2KYMA 4DEYA 1U06A 2A37A 2MIOA 2NUZA 4HXJA 4JJBA 5GJVB 4Z8AA 2DLPA 2O9VA 1SRLA 1HJDA 4J9EA 2PTKA 4J9BA 1OPKA 2JTEA 1TUDA 1YWPA 4JJCA 2DL7A 1MV0B 5HCKA 2RPNA 4OMNA 4JZ4A 2BZYA 2KRNA 2ENMA 4JJDA 2J6FA 1UG1A 1UGVA 2B86A 1LCKA 1EFNA 3NPFA 1UE9A 2EYWA 3PE0A 2JT4A 4RTZA 1SEMA 2G6FX 4EIKA 2YT6A 3GBQA 2RNAA 2K9GA 3VS0A 2RQVA 2FPFA 1JO8A 2ECZA 2VKNA 4A63B 2KE9A 2DX1A 2YDLA 4CC3A 1WXUA 1SSHA 2DL4A 2J7IA 3O5ZA 1VYUA 1W6XA 2LZ6B 2CH4A 2KROA 4LE9A 2K2MA 1J3TA 2FO0A 2YUPA 3H0FA 1QWEA 2DA9A 2DVJA 4R0KA 1B3QA 4LNPA 2L3QA 3NMZC 4FSSA 3CQTA 4E6RA 2LX7A 3EG0A 2LQNA 1BK2A 2D1XA 3RNJA 1UJ0A 1VA7A 4HCKA 1ZUYA 2DRKA 2CT4A 2YUNA 2RQRA 2AZSA 3I9QA 3JV3A 3UA7A 3IQLA 4F14A 4RTUA 2M51A 1G2BA 1AEYA 5IXBA 2HCKA 3VS2A 2X3XD 1GCQA 2LP5A 1MV3A 3NHNA 4Y92A 1M3BA 3PVLA 1YP5A 3EG3A 2FG0A 1WXBA 1QWFA 1S1NA 2OI3A 3VS4A 2DNUA 1UTIA 1PNJA 2K3BA 2FRWA 3EG1A 1NLPC 2BZ8A 5I11A 2VVKA 2K7AA 2KR3A 4OMLA 3UF4A 1T3SA 2W10A 3U23A 3M0RA 1ZUUA 1HSQA 1ABQA 4CC7A 1M27C 1AOJA 2GGRA 2F2WA 2KT8A 1E6HA 1NEBA 1PRMC 4OMPA 1RUWA 2RN8A 1UFFA 5IHNA 3LH5A 3QWYA 1NEGA 1GBQA 2JMAA 3SEMA 1GCPA 4J9DA 1K76A 1T0JA 3REAB 1ABOA 2BTTA 1RLQC 4AG1C 1QKXA 4J9CA 1GBRA 2DYBA 4IIMA 2SRCA 1AD5A 3SHWA 1T3LA 1MUZA 2OJ2A 1M8MA 1UDLA 1GFCA 3EHQA 1E7OA 2EGCA 4LN2A 2YUOA 1OV3A 1WFWA 5IHIA 2RQUA 1X43A 1YNZA 2C0TA 2EYZA 5FWBA 2A28A 3M0SA 4RTWA 1YCSB 4DEXA 3UATA 2JS2A 2RQWA 4GLMA 1ARKA 1UECA 2DL8A 2LQWA 2KXCA 1YN8A 3M0UA 2E5KA 5I22A 1T0HA 2CSQA 3R6NA 1ZSGA 4ESRA 3UA6A 2FEIA 1XOVA 4J9HA 2D8JA 2RF0A 3EG2A 3QWXX 2L3SA 5GJWB 4ORZA 1AWOA 2AKLA 2V1QA 1U3OA 1X2QA 1YWOA 1AZEA 4HVUA 1M3AA 2RQTA 5IH2A 2KGTA 3NGPA 2M0YA 1JU5C 2JS0A 2DL5A 1X6GA 2LJ0A 1WXTA 1JXMA 1X2KA 1I07A 1JEGA 2EBPA 2IIMA 2JM8A 3KFVA 1W70A 1PHTA 4HVVA 2D8HA 2KEAA 1UJYA 2YSQA 2KXDA 1SRMA 3VS3A 2VWFA 4Z89A 4AFQC 4GBQA 3H0HA 2DBKA 3A98A 1Y57A 2O2OA 1NYGA 1Z9QA 2K79A 2EW3A 3ZL7C 1N5ZA 2ED0A 1A0NB 4LUDA 2GNCA 1U5SA 3M0QA 4J9IA 4CC2A 2O9SA 2ESWA 2QDLA 2KYBA 1PKTA 2F2XA 1K0SA 4QT7A 2CUDA 1G83A 1E6GA 1GCQC 4AFSC 2DRMA 2J6OA 5IHKA 2KRMA 1UHFA 1K9AA 2K6DA 2D0NA 2JXBA 2CSIA 2ED1A 4RTVA 4M4ZA 1B07A 1VYVA 1AZGB 2MCNA 2HBWA 1GFDA 1WDXA 2O31A 2NWMA 1K0XA 1KSWA 2HEQA 3ULRB 1NLOC 2EPDA 4RTYA 1AWWA 2KRSA 4Z88A 1K1ZA 2CH4W 1WI7A 2JM9A 2W0ZA 1WIEA 4IIOA 2FRYA 3EHRA 1H3HA 3VS7A 2HSPA 4JPBW 1CKBA 2DJQA 3TSWA 2GQIA 3I5RA 1AWXA 3I35A 4J9GA 2C0OA 1OOTA 2AKKA 1X69A 1BBZA 3M0PA 2EQIA 1UUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AG2 C;  1VYT A;  2J05 A;  2DE0 X;  3THK A;  1NYF A;  3FJ5 A;  2FPE A;  1I0C A;  2PNI A;  4AFZ C;  2C0I A;  2A08 A;  2AZV A;  2I0N A;  2O88 A;  1K4U S;  2L3P A;  2MOX A;  2F2V A;  3VS5 A;  2J6K A;  2JW4 A;  2CRE A;  1QCF A;  1Y0M A;  1SHF A;  1GRI A;  1IO6 A;  1WA7 A;  3PVQ A;  1AWJ A;  1W1F A;  2KNB B;  4JZ3 A;  1WLP B;  2ROL A;  1X6B A;  2LJ3 A;  4ZNX A;  3EGU A;  1ZUK A;  4KRT A;  1Z9Z A;  3TSZ A;  1SPK A;  4X1V A;  2H8H A;  1AVZ C;  3TVT A;  3VS1 A;  3H41 A;  5FWC A;  4HVW A;  2YUQ A;  3VRY A;  5EC7 A;  2JMC A;  1QLY A;  1PRL C;  1OPL A;  3M0T A;  4F17 A;  1WX6 A;  2LJ1 A;  2CDT A;  2EYY A;  2L0A A;  2V1R A;  2GTO A;  5L23 A;  1UHC A;  4OMM A;  1NG2 A;  2EGA A;  3VS6 A;  2DF6 A;  3C0C A;  2LCS A;  2DM1 A;  1KFZ A;  2LMJ A;  1QKW A;  1PWT A;  4LUE A;  2EKH A;  2J06 A;  2XMF A;  3REB B;  1M30 A;  2AK5 A;  4RTT A;  2BZX A;  2HDA A;  1BB9 A;  1V1C A;  2KBT A;  1KIK A;  2OAW A;  5IXF A;  1PKS A;  1HD3 A;  3I5S A;  2LNH B;  1I1J A;  1CSK A;  1JQQ A;  2SEM A;  4K11 A;  2P4R A;  1ZX6 A;  4D8D A;  1ZLM A;  2X3W D;  1FYN A;  1GL5 A;  2RMO A;  2FPD A;  1OEB A;  4AFU C;  1JXO A;  1RLP C;  1X27 A;  4RUG A;  1RI9 A;  3VRZ A;  2DBM A;  1WYX A;  2A36 A;  2DL3 A;  1TG0 A;  1SHG A;  1BU1 A;  2PZ1 A;  2ROT A;  1KJW A;  2GBQ A;  4OMO A;  1ZBJ A;  1H8K A;  2ABL A;  1CKA A;  4CC4 B;  1TUC A;  4OMQ A;  5ECA A;  4WCI A;  3RBB B;  2EYX A;  2EGE A;  2GTJ A;  4RTX A;  2DMO A;  4D8K A;  1FMK A;  2DIL A;  1M3C A;  3H0I A;  2KT1 A;  1NM7 A;  2CUB A;  4J9F A;  1H92 A;  2L2P A;  5FW9 A;  4F16 A;  2CT3 A;  2EVR A;  2KYM A;  4DEY A;  1U06 A;  2A37 A;  2MIO A;  2NUZ A;  4HXJ A;  4JJB A;  5GJV B;  4Z8A A;  2DLP A;  2O9V A;  1SRL A;  1HJD A;  4J9E A;  2PTK A;  4J9B A;  1OPK A;  2JTE A;  1TUD A;  1YWP A;  4JJC A;  2DL7 A;  1MV0 B;  5HCK A;  2RPN A;  4OMN A;  4JZ4 A;  2BZY A;  2KRN A;  2ENM A;  4JJD A;  2J6F A;  1UG1 A;  1UGV A;  2B86 A;  1LCK A;  1EFN A;  3NPF A;  1UE9 A;  2EYW A;  3PE0 A;  2JT4 A;  4RTZ A;  1SEM A;  2G6F X;  4EIK A;  2YT6 A;  3GBQ A;  2RNA A;  2K9G A;  3VS0 A;  2RQV A;  2FPF A;  1JO8 A;  2ECZ A;  2VKN A;  4A63 B;  2KE9 A;  2DX1 A;  2YDL A;  4CC3 A;  1WXU A;  1SSH A;  2DL4 A;  2J7I A;  3O5Z A;  1VYU A;  1W6X A;  2LZ6 B;  2CH4 A;  2KRO A;  4LE9 A;  2K2M A;  1J3T A;  2FO0 A;  2YUP A;  3H0F A;  1QWE A;  2DA9 A;  2DVJ A;  4R0K A;  1B3Q A;  4LNP A;  2L3Q A;  3NMZ C;  4FSS A;  3CQT A;  4E6R A;  2LX7 A;  3EG0 A;  2LQN A;  1BK2 A;  2D1X A;  3RNJ A;  1UJ0 A;  1VA7 A;  4HCK A;  1ZUY A;  2DRK A;  2CT4 A;  2YUN A;  2RQR A;  2AZS A;  3I9Q A;  3JV3 A;  3UA7 A;  3IQL A;  4F14 A;  4RTU A;  2M51 A;  1G2B A;  1AEY A;  5IXB A;  2HCK A;  3VS2 A;  2X3X D;  1GCQ A;  2LP5 A;  1MV3 A;  3NHN A;  4Y92 A;  1M3B A;  3PVL A;  1YP5 A;  3EG3 A;  2FG0 A;  1WXB A;  1QWF A;  1S1N A;  2OI3 A;  3VS4 A;  2DNU A;  1UTI A;  1PNJ A;  2K3B A;  2FRW A;  3EG1 A;  1NLP C;  2BZ8 A;  5I11 A;  2VVK A;  2K7A A;  2KR3 A;  4OML A;  3UF4 A;  1T3S A;  2W10 A;  3U23 A;  3M0R A;  1ZUU A;  1HSQ A;  1ABQ A;  4CC7 A;  1M27 C;  1AOJ A;  2GGR A;  2F2W A;  2KT8 A;  1E6H A;  1NEB A;  1PRM C;  4OMP A;  1RUW A;  2RN8 A;  1UFF A;  5IHN A;  3LH5 A;  3QWY A;  1NEG A;  1GBQ A;  2JMA A;  3SEM A;  1GCP A;  4J9D A;  1K76 A;  1T0J A;  3REA B;  1ABO A;  2BTT A;  1RLQ C;  4AG1 C;  1QKX A;  4J9C A;  1GBR A;  2DYB A;  4IIM A;  2SRC A;  1AD5 A;  3SHW A;  1T3L A;  1MUZ A;  2OJ2 A;  1M8M A;  1UDL A;  1GFC A;  3EHQ A;  1E7O A;  2EGC A;  4LN2 A;  2YUO A;  1OV3 A;  1WFW A;  5IHI A;  2RQU A;  1X43 A;  1YNZ A;  2C0T A;  2EYZ A;  5FWB A;  2A28 A;  3M0S A;  4RTW A;  1YCS B;  4DEX A;  3UAT A;  2JS2 A;  2RQW A;  4GLM A;  1ARK A;  1UEC A;  2DL8 A;  2LQW A;  2KXC A;  1YN8 A;  3M0U A;  2E5K A;  5I22 A;  1T0H A;  2CSQ A;  3R6N A;  1ZSG A;  4ESR A;  3UA6 A;  2FEI A;  1XOV A;  4J9H A;  2D8J A;  2RF0 A;  3EG2 A;  3QWX X;  2L3S A;  5GJW B;  4ORZ A;  1AWO A;  2AKL A;  2V1Q A;  1U3O A;  1X2Q A;  1YWO A;  1AZE A;  4HVU A;  1M3A A;  2RQT A;  5IH2 A;  2KGT A;  3NGP A;  2M0Y A;  1JU5 C;  2JS0 A;  2DL5 A;  1X6G A;  2LJ0 A;  1WXT A;  1JXM A;  1X2K A;  1I07 A;  1JEG A;  2EBP A;  2IIM A;  2JM8 A;  3KFV A;  1W70 A;  1PHT A;  4HVV A;  2D8H A;  2KEA A;  1UJY A;  2YSQ A;  2KXD A;  1SRM A;  3VS3 A;  2VWF A;  4Z89 A;  4AFQ C;  4GBQ A;  3H0H A;  2DBK A;  3A98 A;  1Y57 A;  2O2O A;  1NYG A;  1Z9Q A;  2K79 A;  2EW3 A;  3ZL7 C;  1N5Z A;  2ED0 A;  1A0N B;  4LUD A;  2GNC A;  1U5S A;  3M0Q A;  4J9I A;  4CC2 A;  2O9S A;  2ESW A;  2QDL A;  2KYB A;  1PKT A;  2F2X A;  1K0S A;  4QT7 A;  2CUD A;  1G83 A;  1E6G A;  1GCQ C;  4AFS C;  2DRM A;  2J6O A;  5IHK A;  2KRM A;  1UHF A;  1K9A A;  2K6D A;  2D0N A;  2JXB A;  2CSI A;  2ED1 A;  4RTV A;  4M4Z A;  1B07 A;  1VYV A;  1AZG B;  2MCN A;  2HBW A;  1GFD A;  1WDX A;  2O31 A;  2NWM A;  1K0X A;  1KSW A;  2HEQ A;  3ULR B;  1NLO C;  2EPD A;  4RTY A;  1AWW A;  2KRS A;  4Z88 A;  1K1Z A;  2CH4 W;  1WI7 A;  2JM9 A;  2W0Z A;  1WIE A;  4IIO A;  2FRY A;  3EHR A;  1H3H A;  3VS7 A;  2HSP A;  4JPB W;  1CKB A;  2DJQ A;  3TSW A;  2GQI A;  3I5R A;  1AWX A;  3I35 A;  4J9G A;  2C0O A;  1OOT A;  2AKK A;  1X69 A;  1BBZ A;  3M0P A;  2EQI A;  1UUE A; 
#chains in the Genus database with same CATH topology
 2AIR B;  1Q7Y R;  5FU7 B;  2M9U A;  1Q86 C;  2O4X A;  2DE0 X;  3KBG A;  4PL6 A;  3MET A;  4Q5W A;  4AFZ C;  1NZ9 A;  1VQP A;  2L3P A;  2DO3 A;  3G4S A;  5GAM e;  5HKC A;  2J6K A;  2JW4 A;  1VQP T;  1QCF A;  1TU0 B;  3SWN B;  1IO6 A;  1WA7 A;  3PVQ A;  1K73 U;  5LJ3 d;  5CVI A;  1BCO A;  4MZP A;  2KNB B;  1FMV A;  2VXE A;  4PJO D;  2WSC E;  1W2B P;  3CC7 T;  1WLP B;  1IGQ A;  3JCM V;  5HY6 A;  4MDX A;  2P0K A;  4PJO F;  3EGU A;  5LJ5 f;  3L2U A;  2PVD B;  5I21 A;  1SPK A;  1Q7Y C;  1M1G A;  3TVT A;  3H41 A;  5FWC A;  4BDZ A;  5EC7 A;  4NL3 A;  2F69 A;  1LVK A;  1SKU B;  2KK4 A;  2YWW A;  4IUV A;  4F17 A;  5DM7 R;  4E7L A;  2EYY A;  3EGX B;  1V29 B;  3QJ6 A;  3JCM h;  1M9S A;  1PG5 B;  3MP1 A;  2QA4 Q;  2KY9 A;  1BI2 A;  2EGA A;  2DF6 A;  2GF7 A;  3C0C A;  2LMJ A;  2J06 A;  2HDA A;  4MZM A;  1Q82 R;  1OQK A;  1V1C A;  2EKO A;  2OAW A;  3G6E Q;  4C0D B;  4LDY A;  3I5S A;  4JUV A;  4C5I A;  4M77 B;  5LJ5 g;  1MMA A;  1ZX6 A;  2P4R A;  5GAO r;  3M4Y A;  3CCR A;  2RMO A;  3L2R A;  3R6O A;  3CCR T;  4RUG A;  1RI9 A;  4ZGE B;  3VRZ A;  4C5G A;  1VQP Q;  2COW A;  2CP5 A;  3G4S Q;  5FRM A;  2ROT A;  2MK5 A;  2ABL A;  1CKA A;  2L5Q A;  2X51 A;  1TUC A;  4OMQ A;  1Q82 C;  3RBB B;  2EYX A;  5HK0 A;  4M77 D;  3I55 A;  4RTX A;  2DMO A;  1QCN A;  4D8K A;  1FMK A;  1XNI A;  1YHQ A;  1M3C A;  4M77 F;  1VIE A;  2E3I A;  2FL7 A;  5AYF A;  5IT9 E;  2ZPF B;  3HKS A;  2EJG A;  4NL2 A;  4E7I A;  1H92 A;  1YIJ T;  4F16 A;  2Y4X A;  2KYM A;  4M75 A;  2MIO A;  3J80 E;  3A5Z B;  4XK8 E;  2PQW A;  2XI9 A;  3OYK A;  4FSX A;  1I8F A;  2DL7 A;  1MV0 B;  1XTD A;  1YI2 A;  3KUF A;  2KRN A;  1M8V A;  2ENM A;  2J6F A;  1NE8 A;  1YI2 T;  2EYW A;  3G1J A;  4RTZ A;  2G6F X;  3BDU A;  2YT6 A;  1ZSZ B;  3VS0 A;  2R57 A;  4A63 B;  2ECZ A;  2RI3 A;  4M77 E;  1SSH A;  1D1A A;  2DL4 A;  4O5V A;  4N4G A;  2CYZ B;  1W6X A;  4PKC C;  1Y96 B;  2FO0 A;  3FEO A;  3CCR Q;  4C5H A;  2H3J A;  4LNP A;  1WPY A;  4E6R A;  1WHH A;  2RD1 A;  4ZGD B;  1WHG A;  2XU8 A;  1ZUY A;  2ZPI B;  2DRK A;  1N9S A;  3GP8 A;  3I9Q A;  1EIF A;  2JNG A;  4F14 A;  1W2B A;  4IUQ A;  4BD3 A;  4OB0 B;  5GAN g;  8ATC B;  1YIT A;  1G2B A;  3P8D A;  3OB9 A;  1YJ9 A;  2BIV A;  2LCL A;  5M9O A;  1YIT T;  4PJL A;  3I55 Q;  4OVA A;  2E6N A;  1MV3 A;  1YJ9 T;  2GCX A;  2E6Z A;  2X4J A;  4FW2 A;  1YHQ Q;  2VYT A;  3OBW A;  1OUL A;  1BKB A;  3QZ9 B;  3FRN A;  1YIJ Q;  3EH2 A;  2A3L A;  5AT1 B;  1UTI A;  4BI3 A;  2K3B A;  4ELY C;  2A7Y A;  4C5E A;  2K7A A;  2K5F A;  4OML A;  3UF4 A;  1YI2 Q;  3JCM c;  3U23 A;  1FXX A;  4CC7 A;  2GGR A;  2JUF A;  2KT8 A;  2V26 A;  2RN8 A;  5IHN A;  3ASK A;  1VQL A;  1GCP A;  4OF1 A;  2RK2 A;  1VQL T;  1QVG S;  3QJY A;  1QKX A;  5GAN d;  3CBM A;  3OMC A;  3S3M A;  1Q82 U;  5DLQ E;  2X9H A;  1TSF A;  5LJ3 j;  4L6V 5;  1I4K 1;  1M8M A;  3BDL A;  5KE3 A;  3EHQ A;  1N27 A;  5IHI A;  1YNZ A;  2EYZ A;  1VQK T;  4RTW A;  1YBY A;  1AHJ B;  4AT1 B;  3UAT A;  2JS2 A;  1YIT Q;  4M75 C;  4PLL A;  3M58 A;  1YN8 A;  2KVQ G;  3VJP A;  1YJ9 Q;  2CSQ A;  1R0C B;  5J3B A;  4F04 B;  1C1A A;  2FEI A;  3TEE A;  3OYL A;  4QVC A;  2RF0 A;  3EG2 A;  3OBY A;  5GJW B;  2OAU A;  2XDD A;  4OP0 A;  1HK9 A;  2V1Q A;  1X2Q A;  4RMO A;  1S72 T;  2RQT A;  4M75 G;  3OS0 A;  1B34 B;  3CCS A;  4XTZ A;  5GMK m;  2OTL T;  3NGP A;  2M0Y A;  5KE2 A;  1VQO A;  2LJ0 A;  1WXT A;  1G3S A;  1JXM A;  1G5V A;  3RDV A;  3URG A;  4C8Q D;  1VQO T;  2EBP A;  2JM8 A;  3LX7 A;  4C8Q F;  1YJN A;  3P8H A;  2MMP A;  2R5A A;  4E47 A;  3X20 B;  1PCX A;  1SRM A;  4AFQ C;  2HBP A;  1M2O A;  2RHI A;  5LJ5 h;  3HRT A;  1VQL Q;  3TQ7 P;  3DB4 A;  5CKB A;  2IPO B;  2QAZ A;  1N5Z A;  1A0N B;  2DEU A;  4LUD A;  2V8J A;  2EFI A;  2M16 A;  1UGQ B;  2K5L A;  1IHW A;  2KYB A;  1IB8 A;  1PKT A;  2CUD A;  1VIF A;  3OYB A;  1KQ2 A;  2DTO A;  3CCQ A;  5IHK A;  2HQX A;  1UHF A;  2K6D A;  3DB3 A;  2L89 A;  2JXB A;  1G3T A;  2CSI A;  3CCQ T;  2L3R A;  4DOW A;  5I2M A;  4RTV A;  4F7U B;  1VYV A;  1AZG B;  4MML A;  2DKG A;  4EMK B;  5GMK j;  1GFD A;  1IXD A;  2O31 A;  3OYI A;  2E10 A;  6AT1 B;  1NLO C;  2EPD A;  4A4G A;  2VXF A;  3WVE B;  2RB6 A;  4C92 D;  2JVV A;  1WI7 A;  4M78 B;  3CCM A;  2O01 E;  1VUB A;  1WIE A;  5LJ5 j;  4IIO A;  4C92 F;  2QDY B;  4HT9 A;  5GAN 8;  3VS7 A;  3CCM T;  2HSP A;  4JPB W;  1N8R U;  1CKB A;  2RHU A;  3CCS Q;  3OA6 A;  2K5I A;  5FLX E;  3MEV A;  2LQK A;  1VQO Q;  2QQA A;  4HCC A;  4X34 A;  4M7A D;  2HSE B;  3CPW S;  4J9G A;  4F7U F;  4OB3 B;  2AKK A;  4JRP A;  1VQ7 A;  4M7A F;  2XK0 A;  1Y7X A;  1UUE A;  3MEA A;  5D6Y A;  3HP9 A;  4EMH A;  3OS2 A;  1VQ5 A;  4BI4 A;  4IKF A;  1NJI U;  1I0C A;  4B9X A;  2A08 A;  3CBP A;  4M78 F;  1ZA2 B;  5CQX A;  2MOX A;  3L2Z A;  1RAB B;  3LGF A;  3RKY A;  3JB9 G;  2H3E B;  1D3B A;  2PUK B;  1D09 B;  3V7R A;  1W1F A;  1VQ4 A;  4BI8 B;  2HQH A;  1VQ4 T;  1X6B A;  3CCQ Q;  4ZNX A;  2YHT A;  4F7U E;  1ZUK A;  4JLG A;  5GAN h;  4M7D B;  1AVZ C;  3OYH A;  2K3Y A;  5LJ3 f;  2YUQ A;  1M2V A;  4FT4 A;  2JMC A;  2ZGW A;  1K8A R;  4MZT A;  2Y4Y A;  3FC3 A;  1WX6 A;  4M78 E;  2CDT A;  3QG1 A;  2EJ9 A;  3CCM Q;  5L23 A;  3TU4 K;  1K9M R;  1GXI E;  2EQM A;  3BFM A;  4J5Y A;  4X9C A;  3VS6 A;  2DM1 A;  1RAA B;  1ZQ1 A;  4OMF B;  2XMF A;  3REB B;  1OI1 A;  1YJW T;  1M90 R;  1SSF A;  2XG8 D;  2KBT A;  3RR6 A;  1KIK A;  3JB9 H;  1PKS A;  2IG0 A;  5CAI A;  4LDV A;  2PU9 B;  3X26 B;  1VQ7 Q;  2LNH B;  3MHX A;  2ZPG B;  2SEM A;  2NUT B;  3A8O B;  4P5N A;  5GAM d;  3CXC S;  4K11 A;  1XJW B;  1ZLM A;  1K8A C;  5GAN j;  1VQ5 Q;  5LJ3 g;  3VV0 A;  1KHI A;  3L2W A;  1JXO A;  1RLP C;  2EIF A;  2E3H A;  1B7T A;  4L5G A;  2DL3 A;  5FRN A;  1TG0 A;  2MWO A;  1SHG A;  4MMK A;  2PZ1 A;  4QVD A;  3O8V A;  4OMO A;  1K9M C;  1ZBJ A;  1QCO A;  2QA4 A;  2M1H A;  5KYU B;  4XU3 A;  2ZPE B;  5GAO n;  2VGN A;  4CC4 B;  2RJF A;  1ZHI A;  1VQ4 Q;  2EGE A;  3SWN A;  1KQS S;  4M7D E;  2DIL A;  3OYY A;  4ZN3 A;  2X35 A;  2LNV A;  2KT1 A;  4C0F A;  3QO3 A;  4ZN1 A;  4PJO B;  5FW9 A;  3KXT A;  2RJE A;  1U06 A;  4JJB A;  4Z8A A;  5FU6 B;  4BAC A;  1SRL A;  4J9E A;  1SF9 A;  3OYD A;  2RPN A;  4LD9 K;  3JCM Q;  1Y07 A;  2P0P A;  4NS5 A;  1UG1 A;  1OX8 A;  5CQY A;  1LCK A;  3LWH A;  1YJW Q;  2LC4 A;  3GLX A;  1UE9 A;  3OYF A;  3QDF A;  2JT4 A;  4EIK A;  1SEM A;  3CC7 A;  3GBQ A;  4E7K A;  1H3Z A;  3CCV A;  1WJQ A;  1AT1 B;  1JO8 A;  2RHX A;  3CCV T;  1TS9 A;  3O5Z A;  1VYU A;  3PIO A;  3MEU A;  4KGZ B;  1UGP B;  2KRO A;  4LE9 A;  4M7D G;  1J3T A;  3CCU T;  4R0K A;  2X4X A;  1B3Q A;  3VKI A;  3MP6 A;  3M5A A;  1X01 A;  3EG0 A;  2D1X A;  4R56 A;  3RNJ A;  5GMK i;  1VA7 A;  5A0G A;  2CT4 A;  2YUN A;  2QQR A;  2RQR A;  2CP2 A;  3S3N A;  2EQU A;  1X6O A;  2PVO B;  4RTU A;  2ZPB B;  1BIA A;  2RM4 A;  4J6X A;  2EQJ A;  2LDM A;  2FHD A;  2X4W A;  1AEY A;  3VS2 A;  3FIF A;  4BE2 A;  2Y90 A;  4XU2 A;  1R8O B;  3QKJ A;  4PJO E;  3E19 A;  1LNX A;  2JTF A;  3QDR B;  1YP5 A;  1MGQ A;  3FJP A;  3EG9 B;  1WXB A;  2P4T A;  2EYQ A;  1Q81 R;  1QWF A;  1S1N A;  2OI3 A;  1KC8 R;  2DNU A;  1WHJ A;  1D1B A;  1PNJ A;  1BI0 A;  3L2Q A;  2FRW A;  3JRZ A;  4QQD A;  5DLO A;  1VQ8 A;  2BZ8 A;  5I11 A;  3OW2 S;  5KCH A;  1VQ8 T;  1K8A U;  3CPW P;  1PM3 A;  5GAO q;  3WVD B;  4OMP A;  3CC7 Q;  4DA4 A;  4QQG A;  1RUW A;  2DXU A;  2WAC A;  3FB9 A;  3CC4 T;  5FU7 C;  3CCV Q;  3E1S A;  4N4H A;  1M1K R;  3M59 A;  4ZGJ B;  1K9M U;  1K76 A;  3RUX A;  1T0J A;  1YIJ A;  4AG1 C;  3H9N A;  4J9C A;  1Q81 C;  2DYB A;  4GY5 A;  1KC8 C;  4IIM A;  4R55 A;  1AD5 A;  4PJO G;  4XU1 A;  3SWN C;  4ZTJ A;  1E7O A;  1TXQ A;  1OV3 A;  3QBY A;  2C0T A;  4RCB A;  1OZ3 A;  2A28 A;  3M0S A;  5GAN f;  1BCM A;  3HFO A;  2RQW A;  4GLM A;  3QPH A;  1Q86 U;  3CD6 A;  2DL8 A;  4FYY B;  2F5T X;  1QP3 A;  1WHL A;  1T0H A;  1M1K C;  3CD6 T;  2E4H A;  2KSS A;  4ESR A;  3MPU B;  2DXT A;  4PK4 A;  3QWX X;  2L3S A;  2XIC A;  2GFU A;  3H6Z A;  1U3O A;  2QQ9 A;  3HRS A;  1YWO A;  2VC8 A;  4JRQ A;  3PMI A;  4LDU A;  2VV5 A;  1QP2 A;  2FZG B;  2QK0 A;  1VQ8 Q;  1Q7Y U;  5CKH A;  4HVV A;  4C0D C;  4E2F B;  1MMG A;  3M9Q A;  1FX7 A;  1UJY A;  3I56 A;  2YSQ A;  4M77 C;  3RMS A;  3I56 T;  1LPL A;  1Y57 A;  2O2O A;  1Z9Q A;  3JAM E;  3ZL7 C;  3HFN A;  5LJ3 h;  2DEQ A;  4J6Y A;  1U5S A;  3BY7 A;  1WJS A;  4PNO A;  4J9I A;  3PIP A;  4RCC A;  4J6W A;  2QDL A;  4KUL A;  1OX9 A;  4M77 G;  4QT7 A;  4BE1 A;  4RKU E;  3BE3 A;  4M75 D;  3N5B B;  2HQE A;  1VQ9 T;  3L2V A;  5LJ5 e;  3ZFJ A;  3JSC A;  1UB4 A;  2NYS A;  2MYS A;  3GIB A;  2DER A;  1KQS P;  1B07 A;  5DY9 A;  2COZ A;  4L59 A;  4TVR A;  4J8O A;  3CD6 Q;  4FT2 A;  3V7C A;  1WDX A;  4KGX B;  1KSW A;  2HEQ A;  1JJ2 P;  2YRC A;  1NPR A;  3EH1 A;  1K1Z A;  2C06 A;  4PJM A;  2JM9 A;  1G8X A;  2R5M A;  2M0O A;  2LX9 A;  4FM4 B;  2NUP B;  3TSW A;  1V76 A;  3I5R A;  1NPP A;  1I5L A;  1B34 A;  1VQK A;  3HSB A;  3I35 A;  2QG9 B;  3CPW A;  2RJD A;  1ZSZ C;  1X69 A;  1BBZ A;  3M0P A;  2EQI A;  3CC2 T;  2MPX C;  1KC8 U;  3D7S B;  4AG2 C;  2J05 A;  3I56 Q;  4B6M A;  2A0F B;  4C8Q B;  1JRI A;  1NYF A;  2P0Q A;  1WGS A;  2PNI A;  2I0N A;  2BUD A;  2DIG A;  1S72 A;  2CRE A;  2L8D A;  4E7S A;  1Y0M A;  1SHF A;  3AHU A;  5KYW B;  2OTL A;  3V8J A;  1WNL A;  1M1K U;  2QQS A;  3JCM P;  3EGD B;  2ROL A;  2WSF E;  3F70 A;  4FYW B;  2XDB A;  4KRT A;  3VYG A;  5GMK h;  1Z9Z A;  1D1C A;  3TSZ A;  3OYG A;  4X1V A;  3JB9 J;  2E41 A;  1BYM A;  1U1T A;  4DBQ A;  4HVW A;  1M5Q 1;  3VRY A;  1KD1 R;  1QLY A;  3V8L A;  1OU8 A;  4EMK A;  3M0T A;  1M4Z A;  2LJ1 A;  3PGG A;  4XAX B;  2L0A A;  4ZTF A;  2DD4 A;  5D7U A;  2V1R A;  2YLB A;  2M02 A;  2CP6 A;  1NG2 A;  4OGC A;  1IRX A;  3RKX A;  1KFZ A;  2KMT A;  4KH0 B;  3G71 T;  1PWT A;  4LUE A;  2EKH A;  4M78 A;  2QTV A;  4MDW A;  1M30 A;  2AK5 A;  4C92 B;  1QVP A;  1BB9 A;  5KYN A;  1VQK Q;  1HD3 A;  1D0Z A;  2AT1 B;  4N0A A;  4PFP A;  3INZ A;  1I1J A;  1JQQ A;  3RKW A;  4C8Q E;  4M7A B;  2FYK A;  2K3X A;  2CGH A;  2X3W D;  1FYN A;  1GL5 A;  1QVF S;  2ATC B;  1OEB A;  1X27 A;  2HAX A;  2NLU A;  2A36 A;  3C94 A;  1PSF A;  3GNG A;  2JTM A;  2CZ1 B;  1KJW A;  4BE0 A;  1S72 Q;  5GAM f;  2OTJ T;  2E12 A;  1H8K A;  1RAF B;  5GAN 4;  4XU0 A;  2JOY A;  2CZ7 B;  3OQ5 A;  2OTL Q;  2LTO A;  2HL5 C;  4WCI A;  3CMA T;  1KQS A;  2IVW A;  4Y28 E;  1W4S A;  2DTH A;  5KYY B;  3H0I A;  3CCL A;  3PNW C;  3ZBD A;  4PJJ A;  4LXC A;  4HCZ A;  2DIQ A;  3VUZ A;  1JJ2 A;  3CCL T;  4JLI A;  5KYX B;  5CKF A;  4M7D A;  2L2P A;  1FMW A;  3CPF A;  9ATC B;  3MJX A;  2CT3 A;  2EVR A;  2A37 A;  2NUZ A;  4HXJ A;  2YXY A;  2DLP A;  2O9V A;  2PTK A;  3DKM A;  2JTE A;  1YWP A;  1M1F A;  2DPP B;  5HCK A;  3PTA A;  4OMN A;  4JZ4 A;  3G71 Q;  2QI2 A;  2BZY A;  4BY6 B;  3E2U A;  4C92 E;  1UGV A;  2B86 A;  3JCM d;  3MO8 A;  3NPF A;  5GAM g;  2XDP A;  3EFO B;  3PE0 A;  2K9G A;  1D0X A;  2RQV A;  2FPF A;  4VUB A;  2KE9 A;  2YDL A;  7AT1 B;  4M7A E;  2EJF A;  3RIR A;  2LZ6 B;  2CH4 A;  1RAI B;  1TUG B;  2K2M A;  3H0F A;  1P92 A;  1BI1 A;  2DA9 A;  2NUT A;  4FSS A;  3LWI A;  4HKE A;  2LX7 A;  3CME A;  2LQN A;  1BK2 A;  1ZA1 B;  4HCK A;  2OTJ Q;  2LVM A;  1G3W A;  3OYC A;  3MKD A;  3CME T;  2JZ2 A;  2AZS A;  3ME9 A;  3EAE A;  4PLI A;  1YJW A;  5IXB A;  3G7Z A;  2HCK A;  5KYU A;  2QEX A;  4EMK C;  2QXF A;  3LH0 A;  2X3X D;  3S6W A;  4C92 G;  2QEX T;  3T9N A;  1M3B A;  3CCL Q;  3JCM e;  2BE7 D;  1PD1 A;  3E9F A;  1QW1 A;  3QII A;  4Y91 A;  4HA8 A;  2OX7 A;  4M78 C;  4F7U G;  2P84 A;  4PJO A;  1QVG P;  2BE9 B;  1VOM A;  3HRU A;  4M7A G;  2QGF B;  3P8B B;  3A1P A;  4KUD K;  1NLP C;  5J39 A;  4FL6 A;  4N0A C;  2LT1 A;  3OYE A;  2VVK A;  2KR3 A;  3C12 A;  2Z0W A;  4OB1 B;  2W10 A;  2DFU A;  1HSQ A;  1MNE A;  1AOJ A;  2V8K A;  3PT9 A;  3CCJ A;  1M90 C;  4M78 G;  1NEB A;  3L1A A;  4IUU A;  4NOY A;  3LH5 A;  3CCJ T;  1NEG A;  3J7A F;  3SEM A;  3SB2 A;  3HL8 A;  3JCM J;  1ABO A;  3VYH B;  2BTT A;  1RLQ C;  5CR2 A;  1GBR A;  2DVE A;  2SRC A;  3WXM B;  4JRI A;  3SHW A;  1MUZ A;  2CP0 A;  1HXD A;  3E9G A;  4RG8 A;  1KHC A;  2DJZ A;  2VAS A;  3CME Q;  1ZBX A;  4LN2 A;  2EAY A;  2YUO A;  5HK3 A;  2CP7 A;  4PFZ A;  2D6F A;  2RQU A;  4XQ3 A;  3MCA B;  5KH6 A;  3HHT B;  2K57 A;  5GAO p;  5FWB A;  3EGX A;  4A53 A;  4C0Z A;  4M7D C;  4DEX A;  2DZC A;  4OGE A;  4II1 A;  3OYA A;  1ARK A;  3M0U A;  3JB9 I;  2QEX Q;  4FYX B;  5I22 A;  4RG2 A;  2FZK B;  3MEW A;  3M54 A;  3UA6 A;  2D8J A;  3M56 A;  4FYV B;  1AWO A;  2AKL A;  3G4S T;  4LDX A;  4HVU A;  4AMC A;  3CCU A;  1KK7 A;  2EWN A;  3EG9 A;  4M77 A;  2LT4 A;  2KGT A;  2RJC A;  1MMD A;  2JS0 A;  1X6G A;  2HL3 A;  2DET A;  2RK1 A;  2R58 A;  1RAC B;  1NBE B;  4XTY A;  5A2Q E;  4A4K A;  2IIM A;  1KG1 A;  1LOJ A;  1W70 A;  2K2V A;  1PHT A;  4EPC A;  2O4X B;  2D8H A;  3Q1J A;  5GAO m;  2KXD A;  3CCJ Q;  4FIB A;  1N9R A;  4GLK A;  3H0H A;  3A98 A;  2K79 A;  1KQ1 A;  1VQN A;  2ED0 A;  2PVG B;  2X4Y A;  1QVF P;  2HMA A;  1IGU A;  4JS4 A;  4IUP A;  1VQN T;  2O9S A;  2F2X A;  1K0S A;  4AFS C;  3JCM b;  2GQV A;  5CKD A;  2JJ9 A;  5LJ3 e;  1PC0 A;  1PD0 A;  3OMG A;  2MCN A;  3NTH A;  3CC4 A;  4JS5 A;  1MND A;  4PJO C;  2NWM A;  4XTV A;  2MAM A;  3DLM A;  3ULR B;  5GAN 7;  3DLL A;  3X25 B;  3UT1 A;  2KRS A;  4KT0 E;  1RI0 A;  5FU6 C;  1ZSZ A;  4DBF A;  1QVG A;  1I81 A;  3CCE A;  3PFS A;  2FRY A;  3CCU Q;  3EHR A;  1M90 U;  3CCE T;  3SD4 A;  1H64 1;  2DJQ A;  1Y96 A;  4C0G A;  1C0M A;  2YRV A;  5GAM h;  3I55 T;  2XD0 A;  3A8L B;  2DTI A;  2E65 A;  2VGM A;  1YHQ T;  3A8M B;  1VYT A;  3QHS A;  3QSU A;  2RH2 A;  2K4Y A;  2WSE E;  3THK A;  3FJ5 A;  3S3O A;  2FPE A;  2KI7 A;  2C0I A;  5D6X A;  5GMK l;  4QKU A;  2AZV A;  1N6A A;  2O88 A;  1K4U S;  1VQN Q;  2F2V A;  3VS5 A;  5LJ5 d;  1TWB A;  3CBO A;  2LCC A;  4HT8 A;  4KBM B;  1F1B B;  1GRI A;  2MI6 A;  1AWJ A;  3QYG B;  3OS5 A;  2BKD N;  4JZ3 A;  2CZ0 B;  2XID A;  4KH1 B;  8AT1 B;  2LJ3 A;  2CZ6 B;  1YFN A;  2CS7 A;  3MP8 A;  3GOX A;  3LYI A;  3SDZ A;  1RAD B;  4M75 B;  1OZ2 A;  2HD0 A;  2H8H A;  3VS1 A;  5GAM j;  3CC4 Q;  5GAN 2;  2DZ9 A;  3OYM A;  4EMG A;  1PRL C;  4YTL A;  1OPL A;  3CXC P;  3M57 A;  1SG5 A;  3TRE A;  5IN1 A;  2FVU A;  5GMK e;  2LRQ A;  1BI3 A;  1EX4 A;  3CCE Q;  3ER0 A;  2GTO A;  2HKN A;  1UHC A;  4OMM A;  2LCS A;  3RER A;  1QKW A;  1VQ9 A;  4RTT A;  2BZX A;  3OYJ A;  3AT1 B;  1N8R R;  4IUT A;  2FB7 A;  5IXF A;  4M75 F;  2NUP A;  3L42 A;  2E64 A;  2HKQ B;  1YCY A;  3UDC A;  1CSK A;  4BDY A;  4D8D A;  4O6J A;  1FWZ A;  4ATO A;  3GPL A;  1QVF A;  2FPD A;  4AFU C;  2QAS A;  1LJO A;  1VQM A;  2DXC A;  4C8Q A;  2DBM A;  1WQW A;  1WYX A;  2DXB A;  1NJI R;  1BU1 A;  4IUR A;  1VQM T;  4J83 A;  2GBQ A;  1TOV A;  2GFA A;  5FRO A;  4JJN K;  2VB6 A;  5ECA A;  1N8R C;  2GTJ A;  3FLG A;  5KYW A;  5C6S A;  3NTK A;  4M75 E;  2B8A A;  3CC2 A;  2RI5 A;  3EGD A;  1VQ6 A;  1Y71 A;  3OYN A;  1Q81 U;  2YLC A;  3PMT A;  1NM7 A;  2CUB A;  1VQ6 T;  4A54 A;  4J9F A;  3JCM X;  3V8K A;  2DYI A;  2DD5 A;  1JB0 E;  4DEY A;  5GJV B;  1NJI C;  1HJD A;  3EFR A;  4J9B A;  1OPK A;  1TUD A;  4JDS A;  1RAG B;  4JJC A;  1O75 A;  1O9S A;  4LD6 A;  4JJD A;  4CRI A;  2G3R A;  2V8I A;  2JN0 A;  1EFN A;  2E5Q A;  4QW2 A;  2RO0 A;  3QYH B;  1VQ9 Q;  2RNA A;  2PUO B;  4Z02 A;  4DBR A;  2F1L A;  2F5K A;  1MMN A;  3SFM A;  2VKN A;  4C92 A;  1WJR A;  2DX1 A;  2ZCF B;  4FU6 A;  2QQB A;  4CC3 A;  4PFO A;  1WXU A;  5GAN 5;  3M4G A;  2J7I A;  3JCM f;  4QVZ A;  4QQ6 A;  2YUP A;  2CKK A;  1QWE A;  1RAH B;  3OY9 A;  2LQ8 A;  5CO7 A;  4F7U A;  2DVJ A;  4FW1 A;  1DJ7 B;  5CIU A;  4EDU A;  4M7A A;  2L3Q A;  3NMZ C;  1VQM Q;  3CQT A;  3CCS T;  5GAN 3;  1UJ0 A;  5D6W A;  2HZY A;  2KQW A;  5GAN e;  3G71 A;  3JV3 A;  3UA7 A;  2D9T A;  4N4I A;  3IQL A;  1W2B S;  2M51 A;  2ZAE A;  3UWN A;  4J7F A;  1WHK A;  3OW2 P;  1EZZ B;  3CEY A;  1YJN T;  3JB9 D;  2KAF A;  2MF2 A;  3JB9 F;  2I2L A;  1GCQ A;  2LP5 A;  3H8Z A;  1TH7 A;  1U1S A;  3NHN A;  4Y92 A;  3CC2 Q;  1UGS B;  3RES A;  3PVL A;  1VQ6 Q;  3LGL A;  2EQK A;  3EG3 A;  2FG0 A;  2QTX A;  5L8R E;  1KD1 C;  3CXC A;  5KYY A;  3JCM g;  2QYZ A;  3VS4 A;  4DBH A;  3J81 E;  5KYX A;  1I5O B;  4D6W A;  1C6V X;  1WZO A;  3EG1 A;  4B9W A;  3LLR A;  2OTJ A;  1PSE A;  3A8G B;  2DAQ A;  1T3S A;  3M0R A;  1ZUU A;  1ABQ A;  4A4H A;  1M27 C;  3GF5 A;  2F2W A;  3CMA A;  1E6H A;  2RHZ A;  5C0M A;  1PRM C;  4UC4 A;  2MWP A;  1UFF A;  1K73 R;  4A4E A;  3QWY A;  3EFO A;  1GBQ A;  2JMA A;  4C8Q C;  4J9D A;  3REA B;  2D0Q B;  4XTW A;  2VUB A;  5CCA A;  1WQ7 A;  4BUG A;  1T3L A;  2AHJ B;  2OJ2 A;  1R77 A;  1TTH B;  1UDL A;  3X28 B;  4FCY A;  3C4S A;  1GFC A;  4J7I A;  5J26 A;  4ANJ A;  4C8Q G;  2EGC A;  3FDR A;  4OB2 B;  1WFW A;  1X43 A;  3HTR A;  1IHV A;  2XHC A;  3X24 B;  1XQH A;  2XKO C;  1YJN Q;  3OS1 A;  1VQ7 T;  1IZ6 A;  1YCS B;  3OSS C;  2RI2 A;  1UEC A;  2LQW A;  2KXC A;  5EG2 A;  1K73 C;  1UEB A;  4ELZ C;  2KDS A;  4M78 D;  2E5K A;  4DQ2 A;  3R6N A;  1ZSG A;  3BW1 A;  1VQ5 T;  1XOV A;  4J9H A;  3HPW A;  1QQJ A;  4ORZ A;  1OYX A;  3QUI A;  1AZE A;  2RA2 A;  2HNI A;  4HCB A;  1M3A A;  1D0Y A;  4LDW A;  1BIB A;  5IH2 A;  3LW5 E;  5GAO l;  4X9D A;  3TCJ A;  1JU5 C;  2DL5 A;  2E70 A;  5CKE A;  4C92 C;  3VU3 C;  1X2K A;  1I07 A;  2FZC B;  1JEG A;  2ZPH B;  3KFV A;  5LL6 S;  1G3Y A;  1MHN A;  1WHM A;  3A8H B;  5I2S A;  1QMC A;  1HYO A;  3M55 A;  1U8R A;  2KEA A;  3CMA Q;  4ME7 A;  4WF2 A;  3GNF B;  3QXE B;  3VS3 A;  2VWF A;  4Z89 A;  4GBQ A;  1RAE B;  4M7A C;  2DBK A;  1R0B G;  2COY A;  1NYG A;  2EW3 A;  2YRD A;  1JBM A;  4BB7 A;  1D3B B;  2GNC A;  5GAN 6;  1UGR B;  3ZEH A;  3M0Q A;  4E7J A;  4CC2 A;  2CP3 A;  1Q95 G;  2ESW A;  4M7D D;  3V7S A;  1G83 A;  2DK3 A;  1E6G A;  4KGV B;  3UPU A;  4E7H A;  4M7D F;  1GCQ C;  5KCO A;  2DRM A;  2J6O A;  2E1H A;  2KRM A;  1K9A A;  2D0N A;  3OW2 A;  5CK9 A;  1M2V B;  2ED1 A;  3RMQ A;  1IRE B;  1KD1 U;  4M4Z A;  3M53 A;  3QZ5 B;  2HBW A;  5A0D A;  1OU9 A;  4CI0 C;  4DOV A;  4XTX A;  4WTO B;  1K0X A;  4KUI A;  4A4F A;  1Q86 R;  3NTI A;  5A0L A;  4RTY A;  1AWW A;  4Z88 A;  4E7Z A;  2CH4 W;  2W0Z A;  3EFS A;  1X75 C;  3OSV A;  3NFC A;  3VUB A;  1H3H A;  2QA4 T;  4BY6 C;  2QGG A;  2GQI A;  2ZZD A;  1AWX A;  3G6E A;  4PJN A;  2C0O A;  2RHY A;  3JCM W;  4V2S A;  1OOT A;  4JRK A;  3C95 A;  5IAY A;  1RL2 A;  1ACM B;  3G6E T;  4XTU A;  1JJ2 S; 
#chains in the Genus database with same CATH homology
 4AG2 C;  1VYT A;  2J05 A;  2DE0 X;  3THK A;  1NYF A;  3FJ5 A;  2FPE A;  1I0C A;  2PNI A;  4AFZ C;  2C0I A;  2A08 A;  2AZV A;  2I0N A;  2O88 A;  1K4U S;  2L3P A;  2MOX A;  2F2V A;  3VS5 A;  2J6K A;  2JW4 A;  2CRE A;  1QCF A;  1Y0M A;  1SHF A;  1GRI A;  1IO6 A;  1WA7 A;  3PVQ A;  1AWJ A;  1W1F A;  2KNB B;  4JZ3 A;  1WLP B;  2ROL A;  1X6B A;  2LJ3 A;  4ZNX A;  3EGU A;  1ZUK A;  4KRT A;  1Z9Z A;  3TSZ A;  1SPK A;  4X1V A;  2H8H A;  1AVZ C;  3TVT A;  3VS1 A;  3H41 A;  5FWC A;  4HVW A;  2YUQ A;  3VRY A;  5EC7 A;  2JMC A;  1QLY A;  1PRL C;  1OPL A;  3M0T A;  4F17 A;  1WX6 A;  2LJ1 A;  2CDT A;  2EYY A;  2L0A A;  2V1R A;  2GTO A;  5L23 A;  1UHC A;  4OMM A;  1NG2 A;  2EGA A;  3VS6 A;  2DF6 A;  3C0C A;  2LCS A;  2DM1 A;  1KFZ A;  2LMJ A;  1QKW A;  1PWT A;  4LUE A;  2EKH A;  2J06 A;  2XMF A;  3REB B;  1M30 A;  2AK5 A;  4RTT A;  2BZX A;  2HDA A;  1BB9 A;  1V1C A;  2KBT A;  1KIK A;  2OAW A;  5IXF A;  1PKS A;  1HD3 A;  3I5S A;  2LNH B;  1I1J A;  1CSK A;  1JQQ A;  2SEM A;  4K11 A;  2P4R A;  1ZX6 A;  4D8D A;  1ZLM A;  2X3W D;  1FYN A;  1GL5 A;  2RMO A;  2FPD A;  1OEB A;  4AFU C;  1JXO A;  1RLP C;  1X27 A;  4RUG A;  1RI9 A;  3VRZ A;  2DBM A;  1WYX A;  2A36 A;  2DL3 A;  1TG0 A;  1SHG A;  1BU1 A;  2PZ1 A;  2ROT A;  1KJW A;  2GBQ A;  4OMO A;  1ZBJ A;  1H8K A;  2ABL A;  1CKA A;  4CC4 B;  1TUC A;  4OMQ A;  5ECA A;  4WCI A;  3RBB B;  2EYX A;  2EGE A;  2GTJ A;  4RTX A;  2DMO A;  4D8K A;  1FMK A;  2DIL A;  1M3C A;  3H0I A;  2KT1 A;  1NM7 A;  2CUB A;  4J9F A;  1H92 A;  2L2P A;  5FW9 A;  4F16 A;  2CT3 A;  2EVR A;  2KYM A;  4DEY A;  1U06 A;  2A37 A;  2MIO A;  2NUZ A;  4HXJ A;  4JJB A;  5GJV B;  4Z8A A;  2DLP A;  2O9V A;  1SRL A;  1HJD A;  4J9E A;  2PTK A;  4J9B A;  1OPK A;  2JTE A;  1TUD A;  1YWP A;  4JJC A;  2DL7 A;  1MV0 B;  5HCK A;  2RPN A;  4OMN A;  4JZ4 A;  2BZY A;  2KRN A;  2ENM A;  4JJD A;  2J6F A;  1UG1 A;  1UGV A;  2B86 A;  1LCK A;  1EFN A;  3NPF A;  1UE9 A;  2EYW A;  3PE0 A;  2JT4 A;  4RTZ A;  1SEM A;  2G6F X;  4EIK A;  2YT6 A;  3GBQ A;  2RNA A;  2K9G A;  3VS0 A;  2RQV A;  2FPF A;  1JO8 A;  2ECZ A;  2VKN A;  4A63 B;  2KE9 A;  2DX1 A;  2YDL A;  4CC3 A;  1WXU A;  1SSH A;  2DL4 A;  2J7I A;  3O5Z A;  1VYU A;  1W6X A;  2LZ6 B;  2CH4 A;  2KRO A;  4LE9 A;  2K2M A;  1J3T A;  2FO0 A;  2YUP A;  3H0F A;  1QWE A;  2DA9 A;  2DVJ A;  4R0K A;  1B3Q A;  4LNP A;  2L3Q A;  3NMZ C;  4FSS A;  3CQT A;  4E6R A;  2LX7 A;  3EG0 A;  2LQN A;  1BK2 A;  2D1X A;  3RNJ A;  1UJ0 A;  1VA7 A;  4HCK A;  1ZUY A;  2DRK A;  2CT4 A;  2YUN A;  2RQR A;  2AZS A;  3I9Q A;  3JV3 A;  3UA7 A;  3IQL A;  4F14 A;  4RTU A;  2M51 A;  1G2B A;  1AEY A;  5IXB A;  2HCK A;  3VS2 A;  2X3X D;  1GCQ A;  2LP5 A;  1MV3 A;  3NHN A;  4Y92 A;  1M3B A;  3PVL A;  1YP5 A;  3EG3 A;  2FG0 A;  1WXB A;  1QWF A;  1S1N A;  2OI3 A;  3VS4 A;  2DNU A;  1UTI A;  1PNJ A;  2K3B A;  2FRW A;  3EG1 A;  1NLP C;  2BZ8 A;  5I11 A;  2VVK A;  2K7A A;  2KR3 A;  4OML A;  3UF4 A;  1T3S A;  2W10 A;  3U23 A;  3M0R A;  1ZUU A;  1HSQ A;  1ABQ A;  4CC7 A;  1M27 C;  1AOJ A;  2GGR A;  2F2W A;  2KT8 A;  1E6H A;  1NEB A;  1PRM C;  4OMP A;  1RUW A;  2RN8 A;  1UFF A;  5IHN A;  3LH5 A;  3QWY A;  1NEG A;  1GBQ A;  2JMA A;  3SEM A;  1GCP A;  4J9D A;  1K76 A;  1T0J A;  3REA B;  1ABO A;  2BTT A;  1RLQ C;  4AG1 C;  1QKX A;  4J9C A;  1GBR A;  2DYB A;  4IIM A;  2SRC A;  1AD5 A;  3SHW A;  1T3L A;  1MUZ A;  2OJ2 A;  1M8M A;  1UDL A;  1GFC A;  3EHQ A;  1E7O A;  2EGC A;  4LN2 A;  2YUO A;  1OV3 A;  1WFW A;  5IHI A;  2RQU A;  1X43 A;  1YNZ A;  2C0T A;  2EYZ A;  5FWB A;  2A28 A;  3M0S A;  4RTW A;  1YCS B;  4DEX A;  3UAT A;  2JS2 A;  2RQW A;  4GLM A;  1ARK A;  1UEC A;  2DL8 A;  2LQW A;  2KXC A;  1YN8 A;  3M0U A;  2E5K A;  5I22 A;  1T0H A;  2CSQ A;  3R6N A;  1ZSG A;  4ESR A;  3UA6 A;  2FEI A;  1XOV A;  4J9H A;  2D8J A;  2RF0 A;  3EG2 A;  3QWX X;  2L3S A;  5GJW B;  4ORZ A;  1AWO A;  2AKL A;  2V1Q A;  1U3O A;  1X2Q A;  1YWO A;  1AZE A;  4HVU A;  1M3A A;  2RQT A;  5IH2 A;  2KGT A;  3NGP A;  2M0Y A;  1JU5 C;  2JS0 A;  2DL5 A;  1X6G A;  2LJ0 A;  1WXT A;  1JXM A;  1X2K A;  1I07 A;  1JEG A;  2EBP A;  2IIM A;  2JM8 A;  3KFV A;  1W70 A;  1PHT A;  4HVV A;  2D8H A;  2KEA A;  1UJY A;  2YSQ A;  2KXD A;  1SRM A;  3VS3 A;  2VWF A;  4Z89 A;  4AFQ C;  4GBQ A;  3H0H A;  2DBK A;  3A98 A;  1Y57 A;  2O2O A;  1NYG A;  1Z9Q A;  2K79 A;  2EW3 A;  3ZL7 C;  1N5Z A;  2ED0 A;  1A0N B;  4LUD A;  2GNC A;  1U5S A;  3M0Q A;  4J9I A;  4CC2 A;  2O9S A;  2ESW A;  2QDL A;  2KYB A;  1PKT A;  2F2X A;  1K0S A;  4QT7 A;  2CUD A;  1G83 A;  1E6G A;  1GCQ C;  4AFS C;  2DRM A;  2J6O A;  5IHK A;  2KRM A;  1UHF A;  1K9A A;  2K6D A;  2D0N A;  2JXB A;  2CSI A;  2ED1 A;  4RTV A;  4M4Z A;  1B07 A;  1VYV A;  1AZG B;  2MCN A;  2HBW A;  1GFD A;  1WDX A;  2O31 A;  2NWM A;  1K0X A;  1KSW A;  2HEQ A;  3ULR B;  1NLO C;  2EPD A;  4RTY A;  1AWW A;  2KRS A;  4Z88 A;  1K1Z A;  2CH4 W;  1WI7 A;  2JM9 A;  2W0Z A;  1WIE A;  4IIO A;  2FRY A;  3EHR A;  1H3H A;  3VS7 A;  2HSP A;  4JPB W;  1CKB A;  2DJQ A;  3TSW A;  2GQI A;  3I5R A;  1AWX A;  3I35 A;  4J9G A;  2C0O A;  1OOT A;  2AKK A;  1X69 A;  1BBZ A;  3M0P A;  2EQI A;  1UUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...