5ECAA

Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 6.5
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
SHMTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 6.5
rcsb
source organism Gallus gallus
total genus 14
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ecaA00
2J6KA 3EHQA 4HVVA 2JM8A 4OMNA 2O9SA 3I35A 2RN8A 2BZXA 1BK2A 1GRIA 2IIMA 3U23A 2HCKA 2K6DA 2VVKA 2EVRA 4RTVA 1AOJA 4DEXA 1MV3A 2LP5A 1E6GA 3PVQA 2YSQA 1NLPC 4J9CA 2DYBA 2CDTA 4QT7A 2DX1A 1T0JA 4EIKA 2EQIA 4F17A 1Y57A 1FMKA 1WXUA 1KJWA 2ECZA 2JW4A 4LN2A 3LH5A 5I11A 2DBMA 3UA7A 2F2WA 2O9VA 2YUOA 1YNZA 2P4RA 1SSHA 4LNPA 4AG2C 2BZYA 1K0SA 1VYTA 2NUZA 4ORZA 1K1ZA 2CT3A 2KEAA 3VS4A 2ESWA 3NHNA 1HD3A 1VA7A 4D8DA 2JM9A 4JZ3A 4WCIA 5IHNA 3EG0A 1X2KA 4AFSC 2DJQA 2L2PA 1X69A 2ABLA 1WXTA 2DL5A 4JJDA 1EFNA 4OMQA 5HCKA 2NWMA 3EG1A 5IXFA 4KRTA 3H0FA 2KRNA 1U5SA 3SHWA 1CKBA 1UHFA 2GNCA 1WI7A 2RQWA 3VS6A 2CUBA 1NYGA 3H0HA 2CSIA 3REAB 2JXBA 4J9HA 2LMJA 2DL7A 2K79A 3TVTA 3EGUA 2J06A 1J3TA 2DL8A 1PHTA 1NG2A 5I22A 2D1XA 5IHIA 3REBB 3GBQA 3M0SA 1UE9A 4M4ZA 1PKSA 1SHFA 1WA7A 2CUDA 1AD5A 4DEYA 1CKAA 1E7OA 1TUCA 1ZSGA 3EG3A 2JTEA 2YUQA 1CSKA 1YCSB 1TUDA 3RBBB 1AZGB 1XOVA 2DL4A 1ABOA 4AFQC 5IXBA 1VYUA 2LQNA 2V1RA 1WIEA 1OOTA 4OMMA 2PZ1A 1QWFA 2EGAA 1JO8A 1MV0B 2J6FA 3THKA 2KBTA 1H8KA 2A36A 4GLMA 5FWBA 4LUEA 2KXDA 1SRMA 4Z89A 2EGCA 3M0TA 3I5RA 1QKXA 1K0XA 3TSZA 2KYBA 2FG0A 1SEMA 3TSWA 2ROTA 2J6OA 2RQTA 2LCSA 1ZX6A 2O88A 1ZUYA 2CH4A 4FSSA 2GTJA 4Z8AA 3SEMA 1UTIA 2LX7A 1UECA 1JEGA 2YDLA 4HCKA 3JV3A 2A28A 1GCQC 1K9AA 2L3QA 1T0HA 2F2VA 1Z9ZA 2GTOA 2RNAA 5L23A 2DNUA 1I1JA 4OMLA 3KFVA 1UHCA 1WLPB 4CC7A 3PVLA 2KRMA 3M0RA 1PRMC 4LUDA 1UFFA 2CT4A 4Z88A 2J7IA 4F16A 4CC4B 5EC7A 1SPKA 1PNJA 1WXBA 3NMZC 1YN8A 2AKLA 4AFZC 1M27C 2LJ1A 2CSQA 2SRCA 2L3SA 3I5SA 2LZ6B 4J9IA 1RI9A 2DA9A 2X3XD 1ABQA 3O5ZA 1X27A 2K2MA 1G83A 1ZLMA 1PKTA 2F2XA 1FYNA 3M0UA 1YWPA 1KFZA 2RPNA 4HVUA 4RTZA 2FPFA 2A08A 2RQRA 2KT1A 1T3SA 1ZUKA 4RTYA 2ENMA 5ECAA 2EGEA 3VS3A 1OPKA 2DLPA 2DRMA 2K7AA 1BU1A 1GCQA 2MIOA 1G2BA 2DL3A 4E6RA 1B07A 4K11A 3VS2A 4J9EA 3H0IA 3QWYA 2V1QA 3I9QA 1AWJA 4A63B 4JZ4A 5GJWB 3CQTA 3NPFA 2EYYA 4RTWA 1KSWA 1BBZA 2MOXA 1KIKA 2HSPA 1QKWA 1QWEA 1T3LA 2OAWA 1UJYA 4F14A 1BB9A 2EBPA 1Y0MA 1M3BA 2DVJA 1PRLC 2H8HA 3H41A 2DM1A 4IIMA 2FEIA 1GBRA 2RQUA 2VWFA 2B86A 1NYFA 4J9DA 1RLPC 1UJ0A 1A0NB 1LCKA 2FRYA 1X6BA 1JXMA 4JPBW 3M0QA 2W10A 1AZEA 2K3BA 2FPDA 3C0CA 1M3CA 1H3HA 4LE9A 2GGRA 2X3WD 4R0KA 1ZUUA 2DRKA 1TG0A 2OI3A 3ZL7C 3UF4A 1SRLA 3VS0A 2ROLA 1H92A 5FW9A 2D0NA 2GBQA 2EW3A 4AFUC 2RMOA 2E5KA 2QDLA 2D8JA 2XMFA 2PNIA 2KT8A 2D8HA 4CC3A 1VYVA 2G6FX 1S1NA 2JS2A 5IH2A 1JU5C 2BZ8A 4IIOA 2DBKA 2YUNA 3R6NA 1RLQC 1QLYA 3QWXX 2KR3A 2KROA 1QCFA 3NGPA 1K4US 2AK5A 1GCPA 2KGTA 2KNBB 2W0ZA 2YUPA 2OJ2A 1RUWA 2L3PA 1NEBA 4ESRA 2EYWA 2JS0A 1YP5A 1U06A 2DF6A 1N5ZA 4RTTA 2HBWA 1X2QA 1AWXA 1PWTA 1WX6A 2AZVA 1UGVA 3IQLA 4HVWA 1WFWA 4JJCA 2JT4A 2VKNA 2KE9A 4JJBA 4CC2A 3VRZA 1AEYA 3A98A 2C0IA 1GBQA 2KRSA 1JXOA 2O2OA 1NEGA 2LJ3A 3EG2A 2SEMA 2MCNA 3EHRA 1M30A 1HSQA 1NLOC 1UG1A 1IO6A 2EYZA 1WDXA 1OV3A 5FWCA 2JMCA 1W1FA 1WYXA 2M0YA 2O31A 3RNJA 1YWOA 4RTUA 2CREA 3VS7A 1W70A 2LJ0A 4D8KA 4RTXA 2FRWA 2RQVA 2AKKA 4OMPA 3UATA 3PE0A 2HEQA 1SHGA 2J05A 4RUGA 2C0OA 1V1CA 4ZNXA 1UDLA 1AVZC 1HJDA 2K9GA 2KXCA 1I0CA 4J9BA 2LQWA 3VRYA 2DMOA 2A37A 3M0PA 2L0AA 4Y92A 2HDAA 1M8MA 3UA6A 1GFDA 1NM7A 1U3OA 1Z9QA 2PTKA 3VS5A 1ZBJA 2FO0A 5IHKA 4AG1C 1I07A 4HXJA 1AWWA 1UUEA 1X43A 1JQQA 2CH4W 1X6GA 1ARKA 3FJ5A 1W6XA 2RF0A 1AWOA 1B3QA 2KYMA 2ED0A 1OPLA 4J9FA 2DILA 1GFCA 1GL5A 2I0NA 2BTTA 1OEBA 2DE0X 4J9GA 1MUZA 2EKHA 2FPEA 1K76A 2EYXA 2YT6A 2M51A 2EPDA 2JMAA 4OMOA 4X1VA 1M3AA 3VS1A 4GBQA 2GQIA 3ULRB 2LNHB 2ED1A 5GJVB 2AZSA 1E6HA 2C0TA
chains in the Genus database with same CATH superfamily
2RHXA 4MZPA 2J6KA 3OS2A 5IT9E 2CZ7B 4HVVA 2CP7A 1NPRA 1PC0A 4OMNA 2HL3A 5KYUA 2O9SA 3OYMA 2B8AA 4M7DA 2HCKA 4M77E 1RAEB 3V8LA 2A0FB 3CCEA 1YJWQ 2AHJB 2LP5A 1E6GA 4BACA 3ZBDA 3A5ZB 4N4IA 3OYHA 3L1AA 2XDDA 3P8DA 4O5VA 1FXXA 2K5FA 2ECZA 4LN2A 3LH5A 4LDUA 1D1AA 4QQDA 1P92A 2HNIA 2F2WA 5KE3A 1OU9A 3NTKA 4OGEA 2FZCB 3OYBA 2DTIA 4C8QF 4ORZA 2DZ9A 3UPUA 2KEAA 3PMTA 3CC7T 3NHNA 2RHZA 1N6AA 3L2ZA 1VA7A 3I55A 1IGQA 5IHNA 3EG0A 1U8RA 3JCMb 1X2KA 1IREB 4JRIA 2GF7A 3E9FA 2DETA 3JSCA 1X69A 4ATOA 1EFNA 2IPOB 5HCKA 1YJNA 2RM4A 3SHWA 4C8QE 4XU0A 5HKCA 1U1TA 2O4XA 2EWNA 4LD9K 1KQSP 5LJ5g 1YHQQ 2R58A 2CUBA 4M75G 2WSFE 4PJOG 3LYIA 3REAB 4B9WA 1SKUB 2OTLT 2QEXQ 2DL7A 3QHSA 1M2VB 3CCVA 1TOVA 4JS4A 2D1XA 1BI3A 2YRDA 3C4SA 1VQNA 2QASA 3BDLA 3MHXA 2QQRA 2DTOA 2K5IA 2E5QA 1WA7A 5KYWB 1VQ9T 2QQBA 4JJNK 1ZSGA 3RIRA 1NJIC 4IUTA 1QCOA 4R56A 4R55A 2RJFA 3RBBB 5GMKm 1AZGB 3OYLA 1RAHB 3MEAA 4C0GA 2X9HA 2LQNA 1R8OB 5L8RE 2V1RA 1OOTA 2XI9A 3HFOA 1MV0B 2L89A 1Y96A 3I56T 2A36A 2MPXC 3SB2A 2KXDA 1SRMA 4P5NA 2BE9B 3VU3C 4Z89A 1QKXA 4E7ZA 1VQ4Q 2EFIA 4C0DC 2KYBA 1TS9A 4TVRA 2PVGB 3FC3A 2J6OA 2LCSA 5GANd 1NPPA 2MWPA 4QQGA 2GTJA 3RDVA 1UTIA 2XKOC 1UECA 4MZTA 2DXTA 2PVOB 2E6NA 2E41A 1RAFB 5L23A 4N4HA 1I1JA 2YWWA 3KFVA 1WLPB 3N5BB 4KUDK 3QBYA 3KUFA 2E3IA 1VQOA 1PRMC 2DYIA 4LUDA 2CKKA 3OYDA 1UFFA 4PFZA 1K8AC 4Z88A 3OQ5A 2PQWA 1SPKA 3V8KA 2DD4A 2LDMA 1QVFP 2G3RA 3VKIA 2EJ9A 2KSSA 2CSQA 2DIGA 2L3SA 2LC4A 1VQMA 1QCNA 1YIJA 1PKTA 2HL5C 5CKBA 3TCJA 2VGMA 2NUTA 3JCMW 3UT1A 4RTYA 3WVEB 5GAMd 1JJ2A 3QDRB 1X6OA 2OTJT 1KD1U 5DLQE 4WF2A 1BU1A 4XK8E 1BYMA 3H6ZA 4K11A 1QVFS 3QWYA 3OYIA 2ZPGB 3I9QA 4A63B 5GJWB 1TXQA 1G8XA 3OYAA 2K5LA 1U1SA 2EAYA 1KIKA 1T3LA 3JB9G 1PD1A 3OS5A 1RAAB 3CCVQ 4DBRA 4F14A 5AYFA 1YJ9A 3SWNB 3PTAA 5HY6A 2RQUA 2VWFA 1NYFA 3G1JA 1UJ0A 4FT4A 1K73R 5GAN4 1FMWA 4JDSA 1AZEA 4KGXB 1VQ8A 4QVZA 2KY9A 2QI2A 4LE9A 2GGRA 5LJ3e 4R0KA 3HTRA 1OU8A 2RHUA 1TWBA 2OI3A 4DOVA 2X35A 1VQKT 1SRLA 4F7UB 2XDPA 2QDLA 1DJ7B 4Y28E 3G6ET 2R5AA 3H9NA 4XU2A 3PIOA 2NYSA 4ELZC 2JS2A 2FL7A 4LD6A 4C5HA 2RHIA 2DBKA 5GMKe 2VUBA 3OBYA 3JCMf 3OYFA 1Y71A 2MF2A 1QCFA 1K4US 1VQ7T 3PNWC 2KGTA 2W0ZA 1YJWT 4M7AG 1NEBA 4PJNA 1KC8U 2XHCA 4RTTA 3CCUT 1UGVA 1VQ5A 4JUVA 1VQLA 4J7FA 4KT0E 4E7JA 3VRZA 3OY9A 1TTHB 1GBQA 3OYCA 4BE1A 4E7KA 2V26A 3URGA 4M78C 1NEGA 3EG2A 2SEMA 4VUBA 2MCNA 1M30A 1HSQA 1NLOC 3S3MA 2HSEB 5KCHA 2EYZA 1VQMQ 1UGQB 2VC8A 4RTUA 2ZPEB 4FM4B 5GANe 1W4SA 3NFCA 5KCOA 3HP9A 3E1SA 1I0CA 2Z0WA 1ZQ1A 2LT1A 5CKFA 4M77C 1MMGA 3HRTA 1KQ2A 3VRYA 2DMOA 1YHQT 1D3BB 1N27A 5D6WA 2NUPA 4Y92A 5A2QE 1QP3A 1F1BB 1LVKA 2QEXT 1N8RR 4C92D 1QVPA 1SG5A 4M78A 3CC2A 1AWWA 1X43A 1JQQA 4M7AF 3CCSA 1ARKA 1VQPQ 4HKEA 2RI5A 3DLLA 2RB6A 1M9SA 3CXCP 1B3QA 2ED0A 4LDVA 1D0ZA 1OPLA 3M4YA 4J9FA 7AT1B 4FL6A 4J83A 2DILA 2BUDA 3PFSA 2R57A 3QYHB 1OEBA 2DE0X 3V7RA 1SF9A 3CCJA 4RG8A 2FPEA 2LQKA 1EX4A 4RCBA 2DERA 2RO0A 4M77A 4NOYA 8AT1B 4ZTFA 3PT9A 4FYYB 4N0AC 5GAOl 3X24B 4C8QC 4EMKB 3HRUA 1FX7A 3QIIA 3SFMA 1UB4A 4GLKA 2CP3A 1S72Q 3EHQA 5LJ5f 2JM8A 2EKOA 1HXDA 1VQ4T 2IIMA 2VVKA 2JZ2A 5J3BA 3HL8A 3OYYA 4HA8A 3CCRA 4FIBA 1JJ2S 4DEXA 2VYTA 4OB1B 2QXFA 1NLPC 4M77D 4HCZA 1W2BP 4QT7A 1D09B 2ZPFB 2EQIA 1UGSB 1Y57A 1WXUA 1WQ7A 1V29B 4C0FA 4BB7A 2GCXA 3X28B 3UA7A 3JCMV 2HMAA 2RHYA 2O9VA 2YUOA 1I4K1 1VQ5Q 5KYXA 1VQLQ 3MP8A 3TQ7P 4N0AA 4AG2C 3J81E 4LDWA 4C8QA 2NUZA 2JUFA 2CT3A 2ESWA 1M1KR 2LNVA 4XTWA 2XICA 3M57A 2DFUA 4JZ3A 4KH0B 4C5GA 3EH2A 2K4YA 2ZAEA 1OX9A 4E2FB 4F7UE 2ZZDA 2D0QB 4OMQA 2DIQA 5C0MA 2FZGB 2NWMA 4PLLA 2K57A 3H0FA 1V76A 1JB0E 1CKBA 4ZGEB 3KXTA 2F5KA 2RQWA 1WI7A 3JCMg 1Q82R 4C5EA 4C0ZA 5GAN3 4C8QD 3H0HA 1K8AU 3C12A 2IVWA 1C1AA 2JXBA 3AHUA 4J9HA 3CCQA 3HFNA 2K79A 1J3TA 1PHTA 2I2LA 3HPWA 5CAIA 3GBQA 3M0SA 5GAOq 1UE9A 2QQAA 3CMAQ 4M75B 3CC2Q 4PJOB 2VXFA 3BY7A 4E7SA 1CKAA 1E7OA 5FU6B 4EPCA 2JTEA 4IUQA 3O8VA 1KC8C 4X9CA 4BD3A 1ABOA 5CKEA 3CCLA 1WIEA 4OMMA 1AT1B 2PZ1A 1QWFA 4OF1A 2BE7D 3NTIA 2EGAA 3THKA 4GLMA 4PJMA 3FB9A 1G3SA 2QA4A 3QSUA 3JCMh 3CC4A 5LL6S 5GAOp 2HQXA 1YI2A 3SD4A 4Y91A 2ROTA 2RQTA 3OYJA 5CK9A 4J5YA 1ZUYA 4CI0C 2LX7A 1LPLA 3LX7A 4NS5A 3JV3A 5GMKi 2QDYB 5GAMf 3CCRQ 1K9AA 1T0HA 2GTOA 3PGGA 4OMLA 5IAYA 1PD0A 2K3YA 1NZ9A 2KRMA 2LVMA 3ASKA 1FMVA 2QGFB 3M0RA 4QVCA 3G4ST 1ZA1B 3EFSA 5I2MA 1QQJA 2VV5A 3NTHA 4EDUA 1M90R 5EC7A 1BCMA 4BI8B 5KYNA 2LCLA 2LJ1A 2SRCA 5GAN2 1YITA 3CCMA 3I5SA 2LZ6B 1RI9A 3OS1A 5LJ3d 2K2MA 5I21A 3G71A 1FYNA 2E1HA 2RJEA 2FPFA 2DVEA 3L2RA 2JTMA 1MNDA 2ENMA 1K9MR 3VUBA 5GAN5 3EGXB 1OPKA 1B34B 2DLPA 1TUGB 4FW1A 2PU9B 2FYKA 4PFPA 1HYOA 4HCCA 3EFOB 2P84A 2MIOA 4BY6B 1B07A 1BIAA 2ZPHB 4FYWB 4M7DG 2CS7A 2EQMA 3H0IA 1AWJA 5GAN8 4JZ4A 3RR6A 3NPFA 1MNEA 2MOXA 3CD6A 1QKWA 1QWEA 3CCQQ 3WXMB 4KUIA 2OAWA 1UJYA 2EBPA 5GAMj 1M2OA 5KYYB 1PRLC 2EQKA 2CGHA 2ZPIB 2EJGA 1VQPT 1IHWA 3ZEHA 1G5VA 1XJWB 3GNFB 5CVIA 3MCAB 1X6BA 1JXMA 2W10A 5CKHA 2CP2A 3E9GA 1UGRB 2FPDA 3FLGA 3C0CA 1BCOA 3JCMQ 1H3HA 3VJPA 2MMPA 3QKJA 6AT1B 2DK3A 1ZUUA 3C95A 4BUGA 3RMQA 2C06A 4OVAA 3RKXA 3GF5A 1H92A 3VS0A 4DA4A 3V8JA 2EW3A 4AFUC 2RMOA 4BDZA 2D8JA 1M2VA 3CCLQ 2KT8A 2D9TA 5LJ5h 5GAN7 2DXCA 1BI0A 2DD5A 2RK2A 4IIOA 4UC4A 1RLQC 1QLYA 1UEBA 1S72T 2KR3A 1IHVA 4JLGA 2KROA 4M75F 3NGPA 5KYWA 3GLXA 1WHHA 4PJOF 3DLMA 1GCPA 3QZ5B 1YI2Q 3CCEQ 2ZCFB 2DXUA 4M7DF 2Y90A 2OJ2A 2EYWA 3E2UA 1U06A 2DF6A 3JCMP 3CMET 2HBWA 1AWXA 3MKDA 2H3JA 1VQ6T 3X26B 4MMLA 2VKNA 2KE9A 4M75E 5GANg 1AEYA 4KH1B 2DXBA 4PJOE 3MP1A 3AT1B 2RA2A 3CC7A 2KRSA 1TU0B 3Q1JA 2DZCA 3DB4A 4NL2A 4M7AB 2JN0A 2K3XA 5FU7B 4CRIA 2LJ3A 3I55Q 3EHRA 2RJDA 4J6WA 4HT9A 3M58A 4OB2B 1IO6A 1OULA 3OMGA 1OV3A 4L6V5 2BKDN 4A4KA 3QZ9B 2ATCB 2M0YA 3VS7A 1W70A 1YJNQ 4RTXA 2AKKA 4OMPA 3PE0A 4O6JA 1SHGA 4RUGA 1Y7XA 4L5GA 4ZNXA 4FCYA 4QQ6A 4ZN1A 1HJDA 2DKGA 4MDWA 1KHCA 3D7SB 2DJZA 2OTLA 2MK5A 2PVDB 3M0PA 1X75C 3EH1A 1M8MA 1Q7YR 5A0DA 5GAMg 4XAXB 2D6FA 1ZBJA 2KQWA 4ZGJB 2XG8D 2XDBA 2DEQA 1VQNQ 3TREA 5KH6A 3DKMA 4IUVA 3FJ5A 1W6XA 1Q81R 3CMAT 2KYMA 2LCCA 5DM7R 1D0XA 2X4YA 1GFCA 1GL5A 2EQJA 1Q86R 4J9GA 2EKHA 2KAFA 5LJ5e 1NBEB 1N8RC 1M90U 2E4HA 1RADB 4KGZB 3I56A 3VS1A 2KI7A 3OSSC 2CP0A 2YRCA 2ED1A 4M7AD 5GJVB 1E6HA 1UG1A 5J26A 4NL3A 4X9DA 4C92C 4DBHA 2E70A 4Z02A 3I35A 3M53A 1BIBA 2QAZA 1OI1A 2BZXA 1K9MU 3U23A 1RI0A 2K6DA 4RTVA 3M4GA 1B7TA 1AOJA 3FIFA 4B6MA 1M5Q1 2DPPB 1MV3A 2MAMA 1HK9A 2M1HA 2DEUA 3PVQA 2RH2A 2YSQA 4J9CA 2CDTA 4D6WA 2X4JA 3JB9F 2DX1A 4N4GA 4FU6A 4EIKA 3DB3A 1FMKA 2JW4A 5I11A 4MZMA 1FWZA 1I5OB 1VQOQ 4F7UA 1YNZA 1MMDA 2NLUA 2P4RA 1SSHA 4E7LA 4LNPA 1K0SA 5DLOA 4JLIA 2CZ6B 3M56A 1QP2A 3VYHB 5CO7A 4C92A 2JM9A 1QVGA 1RABB 2E3HA 1KK7A 4AFSC 5D7UA 1YIJQ 2GFAA 2ABLA 2OTJA 4MMKA 5IXFA 4KRTA 2KRNA 3ME9A 1ZSZB 4QVDA 3RKWA 3VS6A 3T9NA 3JCMJ 3S3NA 1NYGA 2RK1A 4XQ3A 4KULA 2IG0A 2LMJA 1TSFA 1QMCA 2COYA 1RACB 3JCMX 2M02A 3OBWA 3HHTB 3MO8A 5IHIA 3REBB 1ACMB 1YJ9Q 4M4ZA 1M8VA 1PKSA 3EG9B 1SHFA 3JB9I 1Q82C 1AD5A 4DEYA 1TUCA 5I2SA 1JJ2P 1XOVA 1VQ8Q 4M7AE 3M59A 1VQKA 5IXBA 1WHMA 2LTOA 3M54A 4C92G 1H641 3INZA 3G6EA 1D3BA 2J6FA 4EMKC 4LUEA 2WSCE 1IXDA 3FDRA 3I5RA 2WSEE 1K0XA 3TSZA 2A7YA 1VQ7A 3TSWA 1OQKA 2QYZA 4PK4A 2JNGA 5LJ3f 2WACA 4FSSA 9ATCB 4E7HA 4Z8AA 4LDYA 1YJWA 2DTHA 2YDLA 1EZZB 3CCET 2A28A 3CBMA 1GCQC 4HCBA 4M78G 1YBYA 3LWIA 3CCUA 1KQSA 3CPFA 1BI2A 2RNAA 3X20B 4CC7A 3PVLA 2X4WA 2E12A 4FT2A 2YXYA 4RKUE 3H8ZA 2E6ZA 3OW2A 3JAME 2CT4A 3GIBA 2J7IA 1WHGA 4OB0B 4CC4B 4EMKA 4OGCA 3NMZC 1K73U 2AKLA 3LGFA 1IZ6A 3MEWA 4KGVB 4J9IA 3O5ZA 1ABQA 1UGPB 1JRIA 3JCMd 4M77G 3EGDB 3I55T 1ZLMA 4EMHA 1Q86U 3M5AA 2F2XA 1M4ZA 2MYSA 4A4FA 2KT1A 1T3SA 1ZUKA 3GP8A 4YTLA 5ECAA 2DRMA 2OTJQ 2M16A 1YJNT 3OYKA 1R0BG 1GCQA 1M90C 3LGLA 4LXCA 4BI3A 1YHQA 4E6RA 3FRNA 3V7SA 4J9EA 4E7IA 2V1QA 2L8DA 2QEXA 4XTUA 4RTWA 3HRSA 3L2WA 1BBZA 5LJ3j 2HSPA 4WTOB 5CQXA 3CCVT 2RD1A 3L42A 5KYUB 1QW1A 2YLBA 1Y0MA 4M75C 5GMKl 1K9MC 2RI2A 1RAIB 1I5LA 5GANf 2DVJA 2AIRB 2H8HA 3CCSQ 1M1GA 4PJJA 4M78F 1VQNT 4PJOC 3MEVA 3RESA 3SDZA 4M7DB 2FEIA 1GBRA 5FU6C 5GAOr 4J9DA 1RLPC 4F04B 5GMKj 1LCKA 2FRYA 1QVGP 4JPBW 3M0QA 3MJXA 4ZTJA 1IGUA 4C8QG 4DBFA 2HKQB 3JB9J 2K3BA 4J6XA 3CCJQ 1WJSA 1D1CA 2YHTA 4FYXB 2LRQA 2DRKA 4J7IA 3ZL7C 2JTFA 2ROLA 4PNOA 2D0NA 1VQKQ 4DQ2A 1VIFA 5IN1A 1KD1R 2EYQA 1VYVA 4OMFB 4AMCA 5EG2A 5IH2A 1JU5C 3ER0A 3FEOA 1VQ4A 1QVGS 2L3RA 1I8FA 4M75A 3LLRA 5GAOm 4PJOA 2AK5A 1YFNA 4JS5A 1VQ7Q 1OYXA 2XK0A 4A4GA 4B9XA 2L3PA 3OYEA 2P0PA 2QQSA 2O4XB 1N8RU 1N5ZA 1PCXA 2XU8A 4A54A 2HD0A 1X2QA 1PWTA 1WX6A 2AZVA 4PL6A 1WHKA 3IQLA 4JJCA 1WFWA 2EJFA 2R5MA 4JJBA 4CC2A 3CCUQ 5DY9A 3A98A 5GANj 3GPLA 1N9RA 5GAOn 2CP6A 1VQOT 4JRKA 3P8BB 1I81A 5HK0A 4M75D 5A0LA 3OB9A 4FW2A 1Q95G 4ANJA 2O2OA 4PJOD 3UWNA 3JCMc 3A1PA 3J80E 5LJ5d 2BIVA 4M7DD 3L2VA 1JBMA 3QJYA 1TH7A 1VQMT 2KK4A 2CZ0B 3WVDB 5FWCA 1W1FA 1WYXA 2O31A 5D6XA 1YIJT 3E19A 2CREA 2QGGA 2X4XA 2LX9A 4PKCC 4C5IA 3UATA 2HEQA 2KVQG 2ZPBB 2J05A 3A8MB 2C0OA 1V1CA 1ZBXA 1UDLA 4BY6C 1D1BA 2KXCA 2LQWA 3F70A 5LJ3g 2HKNA 2A37A 2OAUA 4II1A 3HSBA 2JJ9A 2L0AA 1Y96B 2HDAA 3VV0A 3UA6A 5CCAA 3G7ZA 1KC8R 1GFDA 1NM7A 4J6YA 1U3OA 5CR2A 2E64A 2FO0A 2P4TA 4AG1C 3OW2P 1ZHIA 3A8LB 2DAQA 3FJPA 1WPYA 4LDXA 1YJ9T 2RF0A 2MWOA 2GQVA 2Y4XA 1KQSS 2I0NA 2BTTA 4PFOA 3JCMe 3EGXA 1B34A 1MUZA 4X34A 1K76A 3EFOA 4BE0A 1Q7YC 2O01E 1VQ8T 1M1KU 2M51A 2EPDA 4OMOA 2FHDA 2H3EB 5HK3A 1OX8A 5C6SA 3OW2S 1MMNA 1Y07A 3EAEA 4GBQA 2GQIA 3ULRB 2HBPA 2V8KA 2M9UA 1K73C 1Q81C 5A0GA 2QA4Q 4OB3B 4Q5WA 3CC4Q 2RI3A 4XU1A 4C0DB 3A8HB 4BE2A 5LJ3h 1Q86C 2RN8A 5KYYA 1Q82U 1BK2A 1GRIA 2EVRA 2NUTB 3BFMA 1KHIA 2DYBA 1T0JA 1VUBA 1MHNA 4F17A 5GMKh 1WQWA 3G4SA 1KJWA 4QW2A 2A3LA 2DBMA 4V2SA 3QUIA 3OSVA 1WHJA 1VQ5T 4M7DE 1VQLT 4J8OA 4XTXA 2M0OA 5M9OA 2VASA 2BZYA 1X01A 1VYTA 4M7AC 1OZ2A 5FU7C 5FRMA 1K1ZA 1RAGB 3VS4A 2OX7A 1HD3A 3MEUA 4D8DA 1YITQ 3CCMQ 4WCIA 3CXCA 2E65A 2QK0A 2QTXA 2DJQA 3G71Q 3JB9D 2L2PA 3BDUA 1WXTA 2DL5A 4JJDA 3EG1A 1U5SA 3QDFA 1UHFA 2GNCA 3L2UA 3OMCA 4ELYC 2V8IA 1WHLA 2F69A 1NJIR 3PMIA 3M9QA 2CSIA 1PG5B 1H3ZA 3TVTA 3EGUA 2J06A 2LQ8A 4HT8A 2DL8A 3CD6Q 3OS0A 1NG2A 1VQ9A 5I22A 4M7AA 3SWNC 5GANh 3M55A 4L59A 2X51A 1M1FA 1VQPA 1C6VX 3CC2T 2PUKB 2CUDA 3CCST 2F1LA 1VIEA 3EG3A 2YUQA 1CSKA 1YCSB 2MI6A 1W2BA 1TUDA 2FZKB 3CEYA 3EFRA 3QG1A 3JRZA 8ATCB 2K2VA 2HZYA 3OA6A 2DL4A 4AFQC 1R77A 3CCJT 1VYUA 2HQEA 4DOWA 1JO8A 1BKBA 4QKUA 3RERA 2KBTA 1H8KA 5FWBA 3GOXA 4XTYA 1KQ1A 2EGCA 3CBOA 2PUOB 3M0TA 4A53A 1S72A 1WJRA 3SWNA 2CZ1B 3PIPA 2FG0A 5CQYA 1K8AR 1LNXA 1SEMA 4C92B 1ZX6A 5GAMh 2O88A 4RCCA 2CH4A 3S6WA 3LWHA 3SEMA 1JEGA 1KG1A 3KBGA 3CCRT 1XNIA 4HCKA 3CMEA 2XD0A 1PM3A 1VQ6A 2L3QA 2F2VA 1Z9ZA 2DNUA 2L5QA 1UHCA 4RMOA 4E47A 2NUPB 3G4SQ 4F16A 4IKFA 4BDYA 3CC7Q 3CBPA 1PNJA 2ZGWA 1WXBA 1YN8A 4AFZC 3CPWA 1SSFA 4M78B 1M27C 3TU4K 2FB7A 1MMAA 2DA9A 3QYGB 2X3XD 3GNGA 1X27A 1G83A 3UDCA 2JVVA 4DBQA 1PSEA 3M0UA 1YWPA 1KFZA 2RPNA 4HVUA 2COZA 4RTZA 2RQRA 2A08A 2KMTA 3C94A 2EGEA 3P8HA 1XQHA 3VS3A 1ZSZC 2K7AA 2XIDA 1GXIE 3A8GB 1M1KC 2LT4A 1G2BA 2DL3A 4EMGA 3OYGA 3TEEA 1PSFA 2OTLQ 4M77B 1G3WA 3VS2A 2DO3A 2CYZB 3CQTA 2EYYA 1KSWA 5GAN6 1C0MA 3R6OA 3CCQT 4XU3A 2V8JA 3RMSA 1D0YA 1AHJB 4JRQA 1BB9A 4GY5A 1N9SA 3CMAA 1VQ9Q 1M3BA 3H41A 2DM1A 3LH0A 4IIMA 4F7UG 4PJLA 3LW5E 2B86A 2P0QA 1A0NB 2HAXA 5FLXE 2VB6A 1ZA2B 5CIUA 1ZSZA 1O75A 1M3CA 3S3OA 4JRPA 2X3WD 1TG0A 2Y4YA 3A8OB 3UF4A 3I56Q 3JB9H 5FW9A 4FSXA 2GBQA 3CCLT 2E5KA 5KYXB 2XMFA 5GAMe 2RJCA 2PNIA 2D8HA 4CC3A 2QQ9A 5FROA 4C8QB 2G6FX 4M78D 1S1NA 2E10A 1MGQA 4IUPA 4OP0A 4MDXA 2COWA 2BZ8A 2QTVA 2YRVA 2YUNA 3CXCS 2QA4T 3R6NA 2CP5A 1BI1A 3QWXX 3CC4T 3EG9A 1VOMA 3OYNA 1YI2T 1WJQA 4RG2A 5CKDA 2KNBB 3V7CA 2FVUA 3MPUB 2YUPA 1NJIU 3VUZA 1RUWA 4ESRA 2JS0A 4KBMB 1Q7YU 1KD1C 1YP5A 4FYVB 1EIFA 5AT1B 2KDSA 1G3TA 3CMEQ 4HVWA 1WGSA 2EIFA 2JT4A 4ZN3A 4AT1B 1IB8A 1VQ6Q 5D6YA 3QO3A 2C0IA 1Q81U 1O9SA 3MP6A 4F7UF 1JXOA 3QJ6A 2GFUA 1OZ3A 1R0CB 4BI4A 1YITT 4C92F 3CCMT 1XTDA 4ZGDB 3J7AF 1WDXA 2JMCA 1W2BS 4IURA 3QXEB 3RNJA 1YWOA 3G71T 1YCYA 2LJ0A 4D8KA 2FRWA 1G3YA 2RQVA 4A4HA 5FRNA 5KE2A 1WZOA 4ME7A 1LJOA 1AVZC 2K9GA 4IUUA 4J9BA 2QG9B 4XTZA 2VXEA 3X25B 4C92E 3BW1A 3RKYA 5LJ5j 2F5TX 3META 2AT1B 1Z9QA 2PTKA 3VS5A 3L2QA 5IHKA 3ZFJA 1NE8A 1I07A 3CD6T 4HXJA 1UUEA 3QPHA 1IRXA 2CH4W 1X6GA 4PLIA 2VGNA 3HKSA 4M7DC 2HQHA 3CPWP 3EGDA 1LOJA 1AWOA 5J39A 2EQUA 3RUXA 4XTVA 4A4EA 4M78E 2JOYA 2EYXA 2YT6A 2JMAA 4X1VA 3VYGA 2P0KA 4M77F 1M3AA 3G6EQ 2YLCA 1QVFA 1RL2A 1WNLA 2LNHB 3BE3A 3CPWS 2AZSA 2C0TA
chains in the Genus database with same CATH topology
2J6KA 3EHQA 4HVVA 2JM8A 4OMNA 2O9SA 3I35A 2RN8A 2BZXA 1BK2A 1GRIA 2IIMA 3U23A 2HCKA 2K6DA 2VVKA 2EVRA 4RTVA 1AOJA 4DEXA 1MV3A 2LP5A 1E6GA 3PVQA 2YSQA 1NLPC 4J9CA 2DYBA 2CDTA 4QT7A 2DX1A 1T0JA 4EIKA 2EQIA 4F17A 1Y57A 1FMKA 1WXUA 1KJWA 2ECZA 2JW4A 4LN2A 3LH5A 5I11A 2DBMA 3UA7A 2F2WA 2O9VA 2YUOA 1YNZA 2P4RA 1SSHA 4LNPA 4AG2C 2BZYA 1K0SA 1VYTA 2NUZA 4ORZA 1K1ZA 2CT3A 2KEAA 3VS4A 2ESWA 3NHNA 1HD3A 1VA7A 4D8DA 2JM9A 4JZ3A 4WCIA 5IHNA 3EG0A 1X2KA 4AFSC 2DJQA 2L2PA 1X69A 2ABLA 1WXTA 2DL5A 4JJDA 1EFNA 4OMQA 5HCKA 2NWMA 3EG1A 5IXFA 4KRTA 3H0FA 2KRNA 1U5SA 3SHWA 1CKBA 1UHFA 2GNCA 1WI7A 2RQWA 3VS6A 2CUBA 1NYGA 3H0HA 2CSIA 3REAB 2JXBA 4J9HA 2LMJA 2DL7A 2K79A 3TVTA 3EGUA 2J06A 1J3TA 2DL8A 1PHTA 1NG2A 5I22A 2D1XA 5IHIA 3REBB 3GBQA 3M0SA 1UE9A 4M4ZA 1PKSA 1SHFA 1WA7A 2CUDA 1AD5A 4DEYA 1CKAA 1E7OA 1TUCA 1ZSGA 3EG3A 2JTEA 2YUQA 1CSKA 1YCSB 1TUDA 3RBBB 1AZGB 1XOVA 2DL4A 1ABOA 4AFQC 5IXBA 1VYUA 2LQNA 2V1RA 1WIEA 1OOTA 4OMMA 2PZ1A 1QWFA 2EGAA 1JO8A 1MV0B 2J6FA 3THKA 2KBTA 1H8KA 2A36A 4GLMA 5FWBA 4LUEA 2KXDA 1SRMA 4Z89A 2EGCA 3M0TA 3I5RA 1QKXA 1K0XA 3TSZA 2KYBA 2FG0A 1SEMA 3TSWA 2ROTA 2J6OA 2RQTA 2LCSA 1ZX6A 2O88A 1ZUYA 2CH4A 4FSSA 2GTJA 4Z8AA 3SEMA 1UTIA 2LX7A 1UECA 1JEGA 2YDLA 4HCKA 3JV3A 2A28A 1GCQC 1K9AA 2L3QA 1T0HA 2F2VA 1Z9ZA 2GTOA 2RNAA 5L23A 2DNUA 1I1JA 4OMLA 3KFVA 1UHCA 1WLPB 4CC7A 3PVLA 2KRMA 3M0RA 1PRMC 4LUDA 1UFFA 2CT4A 4Z88A 2J7IA 4F16A 4CC4B 5EC7A 1SPKA 1PNJA 1WXBA 3NMZC 1YN8A 2AKLA 4AFZC 1M27C 2LJ1A 2CSQA 2SRCA 2L3SA 3I5SA 2LZ6B 4J9IA 1RI9A 2DA9A 2X3XD 1ABQA 3O5ZA 1X27A 2K2MA 1G83A 1ZLMA 1PKTA 2F2XA 1FYNA 3M0UA 1YWPA 1KFZA 2RPNA 4HVUA 4RTZA 2FPFA 2A08A 2RQRA 2KT1A 1T3SA 1ZUKA 4RTYA 2ENMA 5ECAA 2EGEA 3VS3A 1OPKA 2DLPA 2DRMA 2K7AA 1BU1A 1GCQA 2MIOA 1G2BA 2DL3A 4E6RA 1B07A 4K11A 3VS2A 4J9EA 3H0IA 3QWYA 2V1QA 3I9QA 1AWJA 4A63B 4JZ4A 5GJWB 3CQTA 3NPFA 2EYYA 4RTWA 1KSWA 1BBZA 2MOXA 1KIKA 2HSPA 1QKWA 1QWEA 1T3LA 2OAWA 1UJYA 4F14A 1BB9A 2EBPA 1Y0MA 1M3BA 2DVJA 1PRLC 2H8HA 3H41A 2DM1A 4IIMA 2FEIA 1GBRA 2RQUA 2VWFA 2B86A 1NYFA 4J9DA 1RLPC 1UJ0A 1A0NB 1LCKA 2FRYA 1X6BA 1JXMA 4JPBW 3M0QA 2W10A 1AZEA 2K3BA 2FPDA 3C0CA 1M3CA 1H3HA 4LE9A 2GGRA 2X3WD 4R0KA 1ZUUA 2DRKA 1TG0A 2OI3A 3ZL7C 3UF4A 1SRLA 3VS0A 2ROLA 1H92A 5FW9A 2D0NA 2GBQA 2EW3A 4AFUC 2RMOA 2E5KA 2QDLA 2D8JA 2XMFA 2PNIA 2KT8A 2D8HA 4CC3A 1VYVA 2G6FX 1S1NA 2JS2A 5IH2A 1JU5C 2BZ8A 4IIOA 2DBKA 2YUNA 3R6NA 1RLQC 1QLYA 3QWXX 2KR3A 2KROA 1QCFA 3NGPA 1K4US 2AK5A 1GCPA 2KGTA 2KNBB 2W0ZA 2YUPA 2OJ2A 1RUWA 2L3PA 1NEBA 4ESRA 2EYWA 2JS0A 1YP5A 1U06A 2DF6A 1N5ZA 4RTTA 2HBWA 1X2QA 1AWXA 1PWTA 1WX6A 2AZVA 1UGVA 3IQLA 4HVWA 1WFWA 4JJCA 2JT4A 2VKNA 2KE9A 4JJBA 4CC2A 3VRZA 1AEYA 3A98A 2C0IA 1GBQA 2KRSA 1JXOA 2O2OA 1NEGA 2LJ3A 3EG2A 2SEMA 2MCNA 3EHRA 1M30A 1HSQA 1NLOC 1UG1A 1IO6A 2EYZA 1WDXA 1OV3A 5FWCA 2JMCA 1W1FA 1WYXA 2M0YA 2O31A 3RNJA 1YWOA 4RTUA 2CREA 3VS7A 1W70A 2LJ0A 4D8KA 4RTXA 2FRWA 2RQVA 2AKKA 4OMPA 3UATA 3PE0A 2HEQA 1SHGA 2J05A 4RUGA 2C0OA 1V1CA 4ZNXA 1UDLA 1AVZC 1HJDA 2K9GA 2KXCA 1I0CA 4J9BA 2LQWA 3VRYA 2DMOA 2A37A 3M0PA 2L0AA 4Y92A 2HDAA 1M8MA 3UA6A 1GFDA 1NM7A 1U3OA 1Z9QA 2PTKA 3VS5A 1ZBJA 2FO0A 5IHKA 4AG1C 1I07A 4HXJA 1AWWA 1UUEA 1X43A 1JQQA 2CH4W 1X6GA 1ARKA 3FJ5A 1W6XA 2RF0A 1AWOA 1B3QA 2KYMA 2ED0A 1OPLA 4J9FA 2DILA 1GFCA 1GL5A 2I0NA 2BTTA 1OEBA 2DE0X 4J9GA 1MUZA 2EKHA 2FPEA 1K76A 2EYXA 2YT6A 2M51A 2EPDA 2JMAA 4OMOA 4X1VA 1M3AA 3VS1A 4GBQA 2GQIA 3ULRB 2LNHB 2ED1A 5GJVB 2AZSA 1E6HA 2C0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6K A;  3EHQ A;  4HVV A;  2JM8 A;  4OMN A;  2O9S A;  3I35 A;  2RN8 A;  2BZX A;  1BK2 A;  1GRI A;  2IIM A;  3U23 A;  2HCK A;  2K6D A;  2VVK A;  2EVR A;  4RTV A;  1AOJ A;  4DEX A;  1MV3 A;  2LP5 A;  1E6G A;  3PVQ A;  2YSQ A;  1NLP C;  4J9C A;  2DYB A;  2CDT A;  4QT7 A;  2DX1 A;  1T0J A;  4EIK A;  2EQI A;  4F17 A;  1Y57 A;  1FMK A;  1WXU A;  1KJW A;  2ECZ A;  2JW4 A;  4LN2 A;  3LH5 A;  5I11 A;  2DBM A;  3UA7 A;  2F2W A;  2O9V A;  2YUO A;  1YNZ A;  2P4R A;  1SSH A;  4LNP A;  4AG2 C;  2BZY A;  1K0S A;  1VYT A;  2NUZ A;  4ORZ A;  1K1Z A;  2CT3 A;  2KEA A;  3VS4 A;  2ESW A;  3NHN A;  1HD3 A;  1VA7 A;  4D8D A;  2JM9 A;  4JZ3 A;  4WCI A;  5IHN A;  3EG0 A;  1X2K A;  4AFS C;  2DJQ A;  2L2P A;  1X69 A;  2ABL A;  1WXT A;  2DL5 A;  4JJD A;  1EFN A;  4OMQ A;  5HCK A;  2NWM A;  3EG1 A;  5IXF A;  4KRT A;  3H0F A;  2KRN A;  1U5S A;  3SHW A;  1CKB A;  1UHF A;  2GNC A;  1WI7 A;  2RQW A;  3VS6 A;  2CUB A;  1NYG A;  3H0H A;  2CSI A;  3REA B;  2JXB A;  4J9H A;  2LMJ A;  2DL7 A;  2K79 A;  3TVT A;  3EGU A;  2J06 A;  1J3T A;  2DL8 A;  1PHT A;  1NG2 A;  5I22 A;  2D1X A;  5IHI A;  3REB B;  3GBQ A;  3M0S A;  1UE9 A;  4M4Z A;  1PKS A;  1SHF A;  1WA7 A;  2CUD A;  1AD5 A;  4DEY A;  1CKA A;  1E7O A;  1TUC A;  1ZSG A;  3EG3 A;  2JTE A;  2YUQ A;  1CSK A;  1YCS B;  1TUD A;  3RBB B;  1AZG B;  1XOV A;  2DL4 A;  1ABO A;  4AFQ C;  5IXB A;  1VYU A;  2LQN A;  2V1R A;  1WIE A;  1OOT A;  4OMM A;  2PZ1 A;  1QWF A;  2EGA A;  1JO8 A;  1MV0 B;  2J6F A;  3THK A;  2KBT A;  1H8K A;  2A36 A;  4GLM A;  5FWB A;  4LUE A;  2KXD A;  1SRM A;  4Z89 A;  2EGC A;  3M0T A;  3I5R A;  1QKX A;  1K0X A;  3TSZ A;  2KYB A;  2FG0 A;  1SEM A;  3TSW A;  2ROT A;  2J6O A;  2RQT A;  2LCS A;  1ZX6 A;  2O88 A;  1ZUY A;  2CH4 A;  4FSS A;  2GTJ A;  4Z8A A;  3SEM A;  1UTI A;  2LX7 A;  1UEC A;  1JEG A;  2YDL A;  4HCK A;  3JV3 A;  2A28 A;  1GCQ C;  1K9A A;  2L3Q A;  1T0H A;  2F2V A;  1Z9Z A;  2GTO A;  2RNA A;  5L23 A;  2DNU A;  1I1J A;  4OML A;  3KFV A;  1UHC A;  1WLP B;  4CC7 A;  3PVL A;  2KRM A;  3M0R A;  1PRM C;  4LUD A;  1UFF A;  2CT4 A;  4Z88 A;  2J7I A;  4F16 A;  4CC4 B;  5EC7 A;  1SPK A;  1PNJ A;  1WXB A;  3NMZ C;  1YN8 A;  2AKL A;  4AFZ C;  1M27 C;  2LJ1 A;  2CSQ A;  2SRC A;  2L3S A;  3I5S A;  2LZ6 B;  4J9I A;  1RI9 A;  2DA9 A;  2X3X D;  1ABQ A;  3O5Z A;  1X27 A;  2K2M A;  1G83 A;  1ZLM A;  1PKT A;  2F2X A;  1FYN A;  3M0U A;  1YWP A;  1KFZ A;  2RPN A;  4HVU A;  4RTZ A;  2FPF A;  2A08 A;  2RQR A;  2KT1 A;  1T3S A;  1ZUK A;  4RTY A;  2ENM A;  5ECA A;  2EGE A;  3VS3 A;  1OPK A;  2DLP A;  2DRM A;  2K7A A;  1BU1 A;  1GCQ A;  2MIO A;  1G2B A;  2DL3 A;  4E6R A;  1B07 A;  4K11 A;  3VS2 A;  4J9E A;  3H0I A;  3QWY A;  2V1Q A;  3I9Q A;  1AWJ A;  4A63 B;  4JZ4 A;  5GJW B;  3CQT A;  3NPF A;  2EYY A;  4RTW A;  1KSW A;  1BBZ A;  2MOX A;  1KIK A;  2HSP A;  1QKW A;  1QWE A;  1T3L A;  2OAW A;  1UJY A;  4F14 A;  1BB9 A;  2EBP A;  1Y0M A;  1M3B A;  2DVJ A;  1PRL C;  2H8H A;  3H41 A;  2DM1 A;  4IIM A;  2FEI A;  1GBR A;  2RQU A;  2VWF A;  2B86 A;  1NYF A;  4J9D A;  1RLP C;  1UJ0 A;  1A0N B;  1LCK A;  2FRY A;  1X6B A;  1JXM A;  4JPB W;  3M0Q A;  2W10 A;  1AZE A;  2K3B A;  2FPD A;  3C0C A;  1M3C A;  1H3H A;  4LE9 A;  2GGR A;  2X3W D;  4R0K A;  1ZUU A;  2DRK A;  1TG0 A;  2OI3 A;  3ZL7 C;  3UF4 A;  1SRL A;  3VS0 A;  2ROL A;  1H92 A;  5FW9 A;  2D0N A;  2GBQ A;  2EW3 A;  4AFU C;  2RMO A;  2E5K A;  2QDL A;  2D8J A;  2XMF A;  2PNI A;  2KT8 A;  2D8H A;  4CC3 A;  1VYV A;  2G6F X;  1S1N A;  2JS2 A;  5IH2 A;  1JU5 C;  2BZ8 A;  4IIO A;  2DBK A;  2YUN A;  3R6N A;  1RLQ C;  1QLY A;  3QWX X;  2KR3 A;  2KRO A;  1QCF A;  3NGP A;  1K4U S;  2AK5 A;  1GCP A;  2KGT A;  2KNB B;  2W0Z A;  2YUP A;  2OJ2 A;  1RUW A;  2L3P A;  1NEB A;  4ESR A;  2EYW A;  2JS0 A;  1YP5 A;  1U06 A;  2DF6 A;  1N5Z A;  4RTT A;  2HBW A;  1X2Q A;  1AWX A;  1PWT A;  1WX6 A;  2AZV A;  1UGV A;  3IQL A;  4HVW A;  1WFW A;  4JJC A;  2JT4 A;  2VKN A;  2KE9 A;  4JJB A;  4CC2 A;  3VRZ A;  1AEY A;  3A98 A;  2C0I A;  1GBQ A;  2KRS A;  1JXO A;  2O2O A;  1NEG A;  2LJ3 A;  3EG2 A;  2SEM A;  2MCN A;  3EHR A;  1M30 A;  1HSQ A;  1NLO C;  1UG1 A;  1IO6 A;  2EYZ A;  1WDX A;  1OV3 A;  5FWC A;  2JMC A;  1W1F A;  1WYX A;  2M0Y A;  2O31 A;  3RNJ A;  1YWO A;  4RTU A;  2CRE A;  3VS7 A;  1W70 A;  2LJ0 A;  4D8K A;  4RTX A;  2FRW A;  2RQV A;  2AKK A;  4OMP A;  3UAT A;  3PE0 A;  2HEQ A;  1SHG A;  2J05 A;  4RUG A;  2C0O A;  1V1C A;  4ZNX A;  1UDL A;  1AVZ C;  1HJD A;  2K9G A;  2KXC A;  1I0C A;  4J9B A;  2LQW A;  3VRY A;  2DMO A;  2A37 A;  3M0P A;  2L0A A;  4Y92 A;  2HDA A;  1M8M A;  3UA6 A;  1GFD A;  1NM7 A;  1U3O A;  1Z9Q A;  2PTK A;  3VS5 A;  1ZBJ A;  2FO0 A;  5IHK A;  4AG1 C;  1I07 A;  4HXJ A;  1AWW A;  1UUE A;  1X43 A;  1JQQ A;  2CH4 W;  1X6G A;  1ARK A;  3FJ5 A;  1W6X A;  2RF0 A;  1AWO A;  1B3Q A;  2KYM A;  2ED0 A;  1OPL A;  4J9F A;  2DIL A;  1GFC A;  1GL5 A;  2I0N A;  2BTT A;  1OEB A;  2DE0 X;  4J9G A;  1MUZ A;  2EKH A;  2FPE A;  1K76 A;  2EYX A;  2YT6 A;  2M51 A;  2EPD A;  2JMA A;  4OMO A;  4X1V A;  1M3A A;  3VS1 A;  4GBQ A;  2GQI A;  3ULR B;  2LNH B;  2ED1 A;  5GJV B;  2AZS A;  1E6H A;  2C0T A; 
#chains in the Genus database with same CATH topology
 2RHX A;  4MZP A;  2J6K A;  3OS2 A;  5IT9 E;  2CZ7 B;  4HVV A;  2CP7 A;  1NPR A;  1PC0 A;  4OMN A;  2HL3 A;  5KYU A;  2O9S A;  3OYM A;  2B8A A;  4M7D A;  2HCK A;  4M77 E;  1RAE B;  3V8L A;  2A0F B;  3CCE A;  1YJW Q;  2AHJ B;  2LP5 A;  1E6G A;  4BAC A;  3ZBD A;  3A5Z B;  4N4I A;  3OYH A;  3L1A A;  2XDD A;  3P8D A;  4O5V A;  1FXX A;  2K5F A;  2ECZ A;  4LN2 A;  3LH5 A;  4LDU A;  1D1A A;  4QQD A;  1P92 A;  2HNI A;  2F2W A;  5KE3 A;  1OU9 A;  3NTK A;  4OGE A;  2FZC B;  3OYB A;  2DTI A;  4C8Q F;  4ORZ A;  2DZ9 A;  3UPU A;  2KEA A;  3PMT A;  3CC7 T;  3NHN A;  2RHZ A;  1N6A A;  3L2Z A;  1VA7 A;  3I55 A;  1IGQ A;  5IHN A;  3EG0 A;  1U8R A;  3JCM b;  1X2K A;  1IRE B;  4JRI A;  2GF7 A;  3E9F A;  2DET A;  3JSC A;  1X69 A;  4ATO A;  1EFN A;  2IPO B;  5HCK A;  1YJN A;  2RM4 A;  3SHW A;  4C8Q E;  4XU0 A;  5HKC A;  1U1T A;  2O4X A;  2EWN A;  4LD9 K;  1KQS P;  5LJ5 g;  1YHQ Q;  2R58 A;  2CUB A;  4M75 G;  2WSF E;  4PJO G;  3LYI A;  3REA B;  4B9W A;  1SKU B;  2OTL T;  2QEX Q;  2DL7 A;  3QHS A;  1M2V B;  3CCV A;  1TOV A;  4JS4 A;  2D1X A;  1BI3 A;  2YRD A;  3C4S A;  1VQN A;  2QAS A;  3BDL A;  3MHX A;  2QQR A;  2DTO A;  2K5I A;  2E5Q A;  1WA7 A;  5KYW B;  1VQ9 T;  2QQB A;  4JJN K;  1ZSG A;  3RIR A;  1NJI C;  4IUT A;  1QCO A;  4R56 A;  4R55 A;  2RJF A;  3RBB B;  5GMK m;  1AZG B;  3OYL A;  1RAH B;  3MEA A;  4C0G A;  2X9H A;  2LQN A;  1R8O B;  5L8R E;  2V1R A;  1OOT A;  2XI9 A;  3HFO A;  1MV0 B;  2L89 A;  1Y96 A;  3I56 T;  2A36 A;  2MPX C;  3SB2 A;  2KXD A;  1SRM A;  4P5N A;  2BE9 B;  3VU3 C;  4Z89 A;  1QKX A;  4E7Z A;  1VQ4 Q;  2EFI A;  4C0D C;  2KYB A;  1TS9 A;  4TVR A;  2PVG B;  3FC3 A;  2J6O A;  2LCS A;  5GAN d;  1NPP A;  2MWP A;  4QQG A;  2GTJ A;  3RDV A;  1UTI A;  2XKO C;  1UEC A;  4MZT A;  2DXT A;  2PVO B;  2E6N A;  2E41 A;  1RAF B;  5L23 A;  4N4H A;  1I1J A;  2YWW A;  3KFV A;  1WLP B;  3N5B B;  4KUD K;  3QBY A;  3KUF A;  2E3I A;  1VQO A;  1PRM C;  2DYI A;  4LUD A;  2CKK A;  3OYD A;  1UFF A;  4PFZ A;  1K8A C;  4Z88 A;  3OQ5 A;  2PQW A;  1SPK A;  3V8K A;  2DD4 A;  2LDM A;  1QVF P;  2G3R A;  3VKI A;  2EJ9 A;  2KSS A;  2CSQ A;  2DIG A;  2L3S A;  2LC4 A;  1VQM A;  1QCN A;  1YIJ A;  1PKT A;  2HL5 C;  5CKB A;  3TCJ A;  2VGM A;  2NUT A;  3JCM W;  3UT1 A;  4RTY A;  3WVE B;  5GAM d;  1JJ2 A;  3QDR B;  1X6O A;  2OTJ T;  1KD1 U;  5DLQ E;  4WF2 A;  1BU1 A;  4XK8 E;  1BYM A;  3H6Z A;  4K11 A;  1QVF S;  3QWY A;  3OYI A;  2ZPG B;  3I9Q A;  4A63 B;  5GJW B;  1TXQ A;  1G8X A;  3OYA A;  2K5L A;  1U1S A;  2EAY A;  1KIK A;  1T3L A;  3JB9 G;  1PD1 A;  3OS5 A;  1RAA B;  3CCV Q;  4DBR A;  4F14 A;  5AYF A;  1YJ9 A;  3SWN B;  3PTA A;  5HY6 A;  2RQU A;  2VWF A;  1NYF A;  3G1J A;  1UJ0 A;  4FT4 A;  1K73 R;  5GAN 4;  1FMW A;  4JDS A;  1AZE A;  4KGX B;  1VQ8 A;  4QVZ A;  2KY9 A;  2QI2 A;  4LE9 A;  2GGR A;  5LJ3 e;  4R0K A;  3HTR A;  1OU8 A;  2RHU A;  1TWB A;  2OI3 A;  4DOV A;  2X35 A;  1VQK T;  1SRL A;  4F7U B;  2XDP A;  2QDL A;  1DJ7 B;  4Y28 E;  3G6E T;  2R5A A;  3H9N A;  4XU2 A;  3PIO A;  2NYS A;  4ELZ C;  2JS2 A;  2FL7 A;  4LD6 A;  4C5H A;  2RHI A;  2DBK A;  5GMK e;  2VUB A;  3OBY A;  3JCM f;  3OYF A;  1Y71 A;  2MF2 A;  1QCF A;  1K4U S;  1VQ7 T;  3PNW C;  2KGT A;  2W0Z A;  1YJW T;  4M7A G;  1NEB A;  4PJN A;  1KC8 U;  2XHC A;  4RTT A;  3CCU T;  1UGV A;  1VQ5 A;  4JUV A;  1VQL A;  4J7F A;  4KT0 E;  4E7J A;  3VRZ A;  3OY9 A;  1TTH B;  1GBQ A;  3OYC A;  4BE1 A;  4E7K A;  2V26 A;  3URG A;  4M78 C;  1NEG A;  3EG2 A;  2SEM A;  4VUB A;  2MCN A;  1M30 A;  1HSQ A;  1NLO C;  3S3M A;  2HSE B;  5KCH A;  2EYZ A;  1VQM Q;  1UGQ B;  2VC8 A;  4RTU A;  2ZPE B;  4FM4 B;  5GAN e;  1W4S A;  3NFC A;  5KCO A;  3HP9 A;  3E1S A;  1I0C A;  2Z0W A;  1ZQ1 A;  2LT1 A;  5CKF A;  4M77 C;  1MMG A;  3HRT A;  1KQ2 A;  3VRY A;  2DMO A;  1YHQ T;  1D3B B;  1N27 A;  5D6W A;  2NUP A;  4Y92 A;  5A2Q E;  1QP3 A;  1F1B B;  1LVK A;  2QEX T;  1N8R R;  4C92 D;  1QVP A;  1SG5 A;  4M78 A;  3CC2 A;  1AWW A;  1X43 A;  1JQQ A;  4M7A F;  3CCS A;  1ARK A;  1VQP Q;  4HKE A;  2RI5 A;  3DLL A;  2RB6 A;  1M9S A;  3CXC P;  1B3Q A;  2ED0 A;  4LDV A;  1D0Z A;  1OPL A;  3M4Y A;  4J9F A;  7AT1 B;  4FL6 A;  4J83 A;  2DIL A;  2BUD A;  3PFS A;  2R57 A;  3QYH B;  1OEB A;  2DE0 X;  3V7R A;  1SF9 A;  3CCJ A;  4RG8 A;  2FPE A;  2LQK A;  1EX4 A;  4RCB A;  2DER A;  2RO0 A;  4M77 A;  4NOY A;  8AT1 B;  4ZTF A;  3PT9 A;  4FYY B;  4N0A C;  5GAO l;  3X24 B;  4C8Q C;  4EMK B;  3HRU A;  1FX7 A;  3QII A;  3SFM A;  1UB4 A;  4GLK A;  2CP3 A;  1S72 Q;  3EHQ A;  5LJ5 f;  2JM8 A;  2EKO A;  1HXD A;  1VQ4 T;  2IIM A;  2VVK A;  2JZ2 A;  5J3B A;  3HL8 A;  3OYY A;  4HA8 A;  3CCR A;  4FIB A;  1JJ2 S;  4DEX A;  2VYT A;  4OB1 B;  2QXF A;  1NLP C;  4M77 D;  4HCZ A;  1W2B P;  4QT7 A;  1D09 B;  2ZPF B;  2EQI A;  1UGS B;  1Y57 A;  1WXU A;  1WQ7 A;  1V29 B;  4C0F A;  4BB7 A;  2GCX A;  3X28 B;  3UA7 A;  3JCM V;  2HMA A;  2RHY A;  2O9V A;  2YUO A;  1I4K 1;  1VQ5 Q;  5KYX A;  1VQL Q;  3MP8 A;  3TQ7 P;  4N0A A;  4AG2 C;  3J81 E;  4LDW A;  4C8Q A;  2NUZ A;  2JUF A;  2CT3 A;  2ESW A;  1M1K R;  2LNV A;  4XTW A;  2XIC A;  3M57 A;  2DFU A;  4JZ3 A;  4KH0 B;  4C5G A;  3EH2 A;  2K4Y A;  2ZAE A;  1OX9 A;  4E2F B;  4F7U E;  2ZZD A;  2D0Q B;  4OMQ A;  2DIQ A;  5C0M A;  2FZG B;  2NWM A;  4PLL A;  2K57 A;  3H0F A;  1V76 A;  1JB0 E;  1CKB A;  4ZGE B;  3KXT A;  2F5K A;  2RQW A;  1WI7 A;  3JCM g;  1Q82 R;  4C5E A;  4C0Z A;  5GAN 3;  4C8Q D;  3H0H A;  1K8A U;  3C12 A;  2IVW A;  1C1A A;  2JXB A;  3AHU A;  4J9H A;  3CCQ A;  3HFN A;  2K79 A;  1J3T A;  1PHT A;  2I2L A;  3HPW A;  5CAI A;  3GBQ A;  3M0S A;  5GAO q;  1UE9 A;  2QQA A;  3CMA Q;  4M75 B;  3CC2 Q;  4PJO B;  2VXF A;  3BY7 A;  4E7S A;  1CKA A;  1E7O A;  5FU6 B;  4EPC A;  2JTE A;  4IUQ A;  3O8V A;  1KC8 C;  4X9C A;  4BD3 A;  1ABO A;  5CKE A;  3CCL A;  1WIE A;  4OMM A;  1AT1 B;  2PZ1 A;  1QWF A;  4OF1 A;  2BE7 D;  3NTI A;  2EGA A;  3THK A;  4GLM A;  4PJM A;  3FB9 A;  1G3S A;  2QA4 A;  3QSU A;  3JCM h;  3CC4 A;  5LL6 S;  5GAO p;  2HQX A;  1YI2 A;  3SD4 A;  4Y91 A;  2ROT A;  2RQT A;  3OYJ A;  5CK9 A;  4J5Y A;  1ZUY A;  4CI0 C;  2LX7 A;  1LPL A;  3LX7 A;  4NS5 A;  3JV3 A;  5GMK i;  2QDY B;  5GAM f;  3CCR Q;  1K9A A;  1T0H A;  2GTO A;  3PGG A;  4OML A;  5IAY A;  1PD0 A;  2K3Y A;  1NZ9 A;  2KRM A;  2LVM A;  3ASK A;  1FMV A;  2QGF B;  3M0R A;  4QVC A;  3G4S T;  1ZA1 B;  3EFS A;  5I2M A;  1QQJ A;  2VV5 A;  3NTH A;  4EDU A;  1M90 R;  5EC7 A;  1BCM A;  4BI8 B;  5KYN A;  2LCL A;  2LJ1 A;  2SRC A;  5GAN 2;  1YIT A;  3CCM A;  3I5S A;  2LZ6 B;  1RI9 A;  3OS1 A;  5LJ3 d;  2K2M A;  5I21 A;  3G71 A;  1FYN A;  2E1H A;  2RJE A;  2FPF A;  2DVE A;  3L2R A;  2JTM A;  1MND A;  2ENM A;  1K9M R;  3VUB A;  5GAN 5;  3EGX B;  1OPK A;  1B34 B;  2DLP A;  1TUG B;  4FW1 A;  2PU9 B;  2FYK A;  4PFP A;  1HYO A;  4HCC A;  3EFO B;  2P84 A;  2MIO A;  4BY6 B;  1B07 A;  1BIA A;  2ZPH B;  4FYW B;  4M7D G;  2CS7 A;  2EQM A;  3H0I A;  1AWJ A;  5GAN 8;  4JZ4 A;  3RR6 A;  3NPF A;  1MNE A;  2MOX A;  3CD6 A;  1QKW A;  1QWE A;  3CCQ Q;  3WXM B;  4KUI A;  2OAW A;  1UJY A;  2EBP A;  5GAM j;  1M2O A;  5KYY B;  1PRL C;  2EQK A;  2CGH A;  2ZPI B;  2EJG A;  1VQP T;  1IHW A;  3ZEH A;  1G5V A;  1XJW B;  3GNF B;  5CVI A;  3MCA B;  1X6B A;  1JXM A;  2W10 A;  5CKH A;  2CP2 A;  3E9G A;  1UGR B;  2FPD A;  3FLG A;  3C0C A;  1BCO A;  3JCM Q;  1H3H A;  3VJP A;  2MMP A;  3QKJ A;  6AT1 B;  2DK3 A;  1ZUU A;  3C95 A;  4BUG A;  3RMQ A;  2C06 A;  4OVA A;  3RKX A;  3GF5 A;  1H92 A;  3VS0 A;  4DA4 A;  3V8J A;  2EW3 A;  4AFU C;  2RMO A;  4BDZ A;  2D8J A;  1M2V A;  3CCL Q;  2KT8 A;  2D9T A;  5LJ5 h;  5GAN 7;  2DXC A;  1BI0 A;  2DD5 A;  2RK2 A;  4IIO A;  4UC4 A;  1RLQ C;  1QLY A;  1UEB A;  1S72 T;  2KR3 A;  1IHV A;  4JLG A;  2KRO A;  4M75 F;  3NGP A;  5KYW A;  3GLX A;  1WHH A;  4PJO F;  3DLM A;  1GCP A;  3QZ5 B;  1YI2 Q;  3CCE Q;  2ZCF B;  2DXU A;  4M7D F;  2Y90 A;  2OJ2 A;  2EYW A;  3E2U A;  1U06 A;  2DF6 A;  3JCM P;  3CME T;  2HBW A;  1AWX A;  3MKD A;  2H3J A;  1VQ6 T;  3X26 B;  4MML A;  2VKN A;  2KE9 A;  4M75 E;  5GAN g;  1AEY A;  4KH1 B;  2DXB A;  4PJO E;  3MP1 A;  3AT1 B;  2RA2 A;  3CC7 A;  2KRS A;  1TU0 B;  3Q1J A;  2DZC A;  3DB4 A;  4NL2 A;  4M7A B;  2JN0 A;  2K3X A;  5FU7 B;  4CRI A;  2LJ3 A;  3I55 Q;  3EHR A;  2RJD A;  4J6W A;  4HT9 A;  3M58 A;  4OB2 B;  1IO6 A;  1OUL A;  3OMG A;  1OV3 A;  4L6V 5;  2BKD N;  4A4K A;  3QZ9 B;  2ATC B;  2M0Y A;  3VS7 A;  1W70 A;  1YJN Q;  4RTX A;  2AKK A;  4OMP A;  3PE0 A;  4O6J A;  1SHG A;  4RUG A;  1Y7X A;  4L5G A;  4ZNX A;  4FCY A;  4QQ6 A;  4ZN1 A;  1HJD A;  2DKG A;  4MDW A;  1KHC A;  3D7S B;  2DJZ A;  2OTL A;  2MK5 A;  2PVD B;  3M0P A;  1X75 C;  3EH1 A;  1M8M A;  1Q7Y R;  5A0D A;  5GAM g;  4XAX B;  2D6F A;  1ZBJ A;  2KQW A;  4ZGJ B;  2XG8 D;  2XDB A;  2DEQ A;  1VQN Q;  3TRE A;  5KH6 A;  3DKM A;  4IUV A;  3FJ5 A;  1W6X A;  1Q81 R;  3CMA T;  2KYM A;  2LCC A;  5DM7 R;  1D0X A;  2X4Y A;  1GFC A;  1GL5 A;  2EQJ A;  1Q86 R;  4J9G A;  2EKH A;  2KAF A;  5LJ5 e;  1NBE B;  1N8R C;  1M90 U;  2E4H A;  1RAD B;  4KGZ B;  3I56 A;  3VS1 A;  2KI7 A;  3OSS C;  2CP0 A;  2YRC A;  2ED1 A;  4M7A D;  5GJV B;  1E6H A;  1UG1 A;  5J26 A;  4NL3 A;  4X9D A;  4C92 C;  4DBH A;  2E70 A;  4Z02 A;  3I35 A;  3M53 A;  1BIB A;  2QAZ A;  1OI1 A;  2BZX A;  1K9M U;  3U23 A;  1RI0 A;  2K6D A;  4RTV A;  3M4G A;  1B7T A;  1AOJ A;  3FIF A;  4B6M A;  1M5Q 1;  2DPP B;  1MV3 A;  2MAM A;  1HK9 A;  2M1H A;  2DEU A;  3PVQ A;  2RH2 A;  2YSQ A;  4J9C A;  2CDT A;  4D6W A;  2X4J A;  3JB9 F;  2DX1 A;  4N4G A;  4FU6 A;  4EIK A;  3DB3 A;  1FMK A;  2JW4 A;  5I11 A;  4MZM A;  1FWZ A;  1I5O B;  1VQO Q;  4F7U A;  1YNZ A;  1MMD A;  2NLU A;  2P4R A;  1SSH A;  4E7L A;  4LNP A;  1K0S A;  5DLO A;  4JLI A;  2CZ6 B;  3M56 A;  1QP2 A;  3VYH B;  5CO7 A;  4C92 A;  2JM9 A;  1QVG A;  1RAB B;  2E3H A;  1KK7 A;  4AFS C;  5D7U A;  1YIJ Q;  2GFA A;  2ABL A;  2OTJ A;  4MMK A;  5IXF A;  4KRT A;  2KRN A;  3ME9 A;  1ZSZ B;  4QVD A;  3RKW A;  3VS6 A;  3T9N A;  3JCM J;  3S3N A;  1NYG A;  2RK1 A;  4XQ3 A;  4KUL A;  2IG0 A;  2LMJ A;  1TSF A;  1QMC A;  2COY A;  1RAC B;  3JCM X;  2M02 A;  3OBW A;  3HHT B;  3MO8 A;  5IHI A;  3REB B;  1ACM B;  1YJ9 Q;  4M4Z A;  1M8V A;  1PKS A;  3EG9 B;  1SHF A;  3JB9 I;  1Q82 C;  1AD5 A;  4DEY A;  1TUC A;  5I2S A;  1JJ2 P;  1XOV A;  1VQ8 Q;  4M7A E;  3M59 A;  1VQK A;  5IXB A;  1WHM A;  2LTO A;  3M54 A;  4C92 G;  1H64 1;  3INZ A;  3G6E A;  1D3B A;  2J6F A;  4EMK C;  4LUE A;  2WSC E;  1IXD A;  3FDR A;  3I5R A;  2WSE E;  1K0X A;  3TSZ A;  2A7Y A;  1VQ7 A;  3TSW A;  1OQK A;  2QYZ A;  4PK4 A;  2JNG A;  5LJ3 f;  2WAC A;  4FSS A;  9ATC B;  4E7H A;  4Z8A A;  4LDY A;  1YJW A;  2DTH A;  2YDL A;  1EZZ B;  3CCE T;  2A28 A;  3CBM A;  1GCQ C;  4HCB A;  4M78 G;  1YBY A;  3LWI A;  3CCU A;  1KQS A;  3CPF A;  1BI2 A;  2RNA A;  3X20 B;  4CC7 A;  3PVL A;  2X4W A;  2E12 A;  4FT2 A;  2YXY A;  4RKU E;  3H8Z A;  2E6Z A;  3OW2 A;  3JAM E;  2CT4 A;  3GIB A;  2J7I A;  1WHG A;  4OB0 B;  4CC4 B;  4EMK A;  4OGC A;  3NMZ C;  1K73 U;  2AKL A;  3LGF A;  1IZ6 A;  3MEW A;  4KGV B;  4J9I A;  3O5Z A;  1ABQ A;  1UGP B;  1JRI A;  3JCM d;  4M77 G;  3EGD B;  3I55 T;  1ZLM A;  4EMH A;  1Q86 U;  3M5A A;  2F2X A;  1M4Z A;  2MYS A;  4A4F A;  2KT1 A;  1T3S A;  1ZUK A;  3GP8 A;  4YTL A;  5ECA A;  2DRM A;  2OTJ Q;  2M16 A;  1YJN T;  3OYK A;  1R0B G;  1GCQ A;  1M90 C;  3LGL A;  4LXC A;  4BI3 A;  1YHQ A;  4E6R A;  3FRN A;  3V7S A;  4J9E A;  4E7I A;  2V1Q A;  2L8D A;  2QEX A;  4XTU A;  4RTW A;  3HRS A;  3L2W A;  1BBZ A;  5LJ3 j;  2HSP A;  4WTO B;  5CQX A;  3CCV T;  2RD1 A;  3L42 A;  5KYU B;  1QW1 A;  2YLB A;  1Y0M A;  4M75 C;  5GMK l;  1K9M C;  2RI2 A;  1RAI B;  1I5L A;  5GAN f;  2DVJ A;  2AIR B;  2H8H A;  3CCS Q;  1M1G A;  4PJJ A;  4M78 F;  1VQN T;  4PJO C;  3MEV A;  3RES A;  3SDZ A;  4M7D B;  2FEI A;  1GBR A;  5FU6 C;  5GAO r;  4J9D A;  1RLP C;  4F04 B;  5GMK j;  1LCK A;  2FRY A;  1QVG P;  4JPB W;  3M0Q A;  3MJX A;  4ZTJ A;  1IGU A;  4C8Q G;  4DBF A;  2HKQ B;  3JB9 J;  2K3B A;  4J6X A;  3CCJ Q;  1WJS A;  1D1C A;  2YHT A;  4FYX B;  2LRQ A;  2DRK A;  4J7I A;  3ZL7 C;  2JTF A;  2ROL A;  4PNO A;  2D0N A;  1VQK Q;  4DQ2 A;  1VIF A;  5IN1 A;  1KD1 R;  2EYQ A;  1VYV A;  4OMF B;  4AMC A;  5EG2 A;  5IH2 A;  1JU5 C;  3ER0 A;  3FEO A;  1VQ4 A;  1QVG S;  2L3R A;  1I8F A;  4M75 A;  3LLR A;  5GAO m;  4PJO A;  2AK5 A;  1YFN A;  4JS5 A;  1VQ7 Q;  1OYX A;  2XK0 A;  4A4G A;  4B9X A;  2L3P A;  3OYE A;  2P0P A;  2QQS A;  2O4X B;  1N8R U;  1N5Z A;  1PCX A;  2XU8 A;  4A54 A;  2HD0 A;  1X2Q A;  1PWT A;  1WX6 A;  2AZV A;  4PL6 A;  1WHK A;  3IQL A;  4JJC A;  1WFW A;  2EJF A;  2R5M A;  4JJB A;  4CC2 A;  3CCU Q;  5DY9 A;  3A98 A;  5GAN j;  3GPL A;  1N9R A;  5GAO n;  2CP6 A;  1VQO T;  4JRK A;  3P8B B;  1I81 A;  5HK0 A;  4M75 D;  5A0L A;  3OB9 A;  4FW2 A;  1Q95 G;  4ANJ A;  2O2O A;  4PJO D;  3UWN A;  3JCM c;  3A1P A;  3J80 E;  5LJ5 d;  2BIV A;  4M7D D;  3L2V A;  1JBM A;  3QJY A;  1TH7 A;  1VQM T;  2KK4 A;  2CZ0 B;  3WVD B;  5FWC A;  1W1F A;  1WYX A;  2O31 A;  5D6X A;  1YIJ T;  3E19 A;  2CRE A;  2QGG A;  2X4X A;  2LX9 A;  4PKC C;  4C5I A;  3UAT A;  2HEQ A;  2KVQ G;  2ZPB B;  2J05 A;  3A8M B;  2C0O A;  1V1C A;  1ZBX A;  1UDL A;  4BY6 C;  1D1B A;  2KXC A;  2LQW A;  3F70 A;  5LJ3 g;  2HKN A;  2A37 A;  2OAU A;  4II1 A;  3HSB A;  2JJ9 A;  2L0A A;  1Y96 B;  2HDA A;  3VV0 A;  3UA6 A;  5CCA A;  3G7Z A;  1KC8 R;  1GFD A;  1NM7 A;  4J6Y A;  1U3O A;  5CR2 A;  2E64 A;  2FO0 A;  2P4T A;  4AG1 C;  3OW2 P;  1ZHI A;  3A8L B;  2DAQ A;  3FJP A;  1WPY A;  4LDX A;  1YJ9 T;  2RF0 A;  2MWO A;  2GQV A;  2Y4X A;  1KQS S;  2I0N A;  2BTT A;  4PFO A;  3JCM e;  3EGX A;  1B34 A;  1MUZ A;  4X34 A;  1K76 A;  3EFO A;  4BE0 A;  1Q7Y C;  2O01 E;  1VQ8 T;  1M1K U;  2M51 A;  2EPD A;  4OMO A;  2FHD A;  2H3E B;  5HK3 A;  1OX8 A;  5C6S A;  3OW2 S;  1MMN A;  1Y07 A;  3EAE A;  4GBQ A;  2GQI A;  3ULR B;  2HBP A;  2V8K A;  2M9U A;  1K73 C;  1Q81 C;  5A0G A;  2QA4 Q;  4OB3 B;  4Q5W A;  3CC4 Q;  2RI3 A;  4XU1 A;  4C0D B;  3A8H B;  4BE2 A;  5LJ3 h;  1Q86 C;  2RN8 A;  5KYY A;  1Q82 U;  1BK2 A;  1GRI A;  2EVR A;  2NUT B;  3BFM A;  1KHI A;  2DYB A;  1T0J A;  1VUB A;  1MHN A;  4F17 A;  5GMK h;  1WQW A;  3G4S A;  1KJW A;  4QW2 A;  2A3L A;  2DBM A;  4V2S A;  3QUI A;  3OSV A;  1WHJ A;  1VQ5 T;  4M7D E;  1VQL T;  4J8O A;  4XTX A;  2M0O A;  5M9O A;  2VAS A;  2BZY A;  1X01 A;  1VYT A;  4M7A C;  1OZ2 A;  5FU7 C;  5FRM A;  1K1Z A;  1RAG B;  3VS4 A;  2OX7 A;  1HD3 A;  3MEU A;  4D8D A;  1YIT Q;  3CCM Q;  4WCI A;  3CXC A;  2E65 A;  2QK0 A;  2QTX A;  2DJQ A;  3G71 Q;  3JB9 D;  2L2P A;  3BDU A;  1WXT A;  2DL5 A;  4JJD A;  3EG1 A;  1U5S A;  3QDF A;  1UHF A;  2GNC A;  3L2U A;  3OMC A;  4ELY C;  2V8I A;  1WHL A;  2F69 A;  1NJI R;  3PMI A;  3M9Q A;  2CSI A;  1PG5 B;  1H3Z A;  3TVT A;  3EGU A;  2J06 A;  2LQ8 A;  4HT8 A;  2DL8 A;  3CD6 Q;  3OS0 A;  1NG2 A;  1VQ9 A;  5I22 A;  4M7A A;  3SWN C;  5GAN h;  3M55 A;  4L59 A;  2X51 A;  1M1F A;  1VQP A;  1C6V X;  3CC2 T;  2PUK B;  2CUD A;  3CCS T;  2F1L A;  1VIE A;  3EG3 A;  2YUQ A;  1CSK A;  1YCS B;  2MI6 A;  1W2B A;  1TUD A;  2FZK B;  3CEY A;  3EFR A;  3QG1 A;  3JRZ A;  8ATC B;  2K2V A;  2HZY A;  3OA6 A;  2DL4 A;  4AFQ C;  1R77 A;  3CCJ T;  1VYU A;  2HQE A;  4DOW A;  1JO8 A;  1BKB A;  4QKU A;  3RER A;  2KBT A;  1H8K A;  5FWB A;  3GOX A;  4XTY A;  1KQ1 A;  2EGC A;  3CBO A;  2PUO B;  3M0T A;  4A53 A;  1S72 A;  1WJR A;  3SWN A;  2CZ1 B;  3PIP A;  2FG0 A;  5CQY A;  1K8A R;  1LNX A;  1SEM A;  4C92 B;  1ZX6 A;  5GAM h;  2O88 A;  4RCC A;  2CH4 A;  3S6W A;  3LWH A;  3SEM A;  1JEG A;  1KG1 A;  3KBG A;  3CCR T;  1XNI A;  4HCK A;  3CME A;  2XD0 A;  1PM3 A;  1VQ6 A;  2L3Q A;  2F2V A;  1Z9Z A;  2DNU A;  2L5Q A;  1UHC A;  4RMO A;  4E47 A;  2NUP B;  3G4S Q;  4F16 A;  4IKF A;  4BDY A;  3CC7 Q;  3CBP A;  1PNJ A;  2ZGW A;  1WXB A;  1YN8 A;  4AFZ C;  3CPW A;  1SSF A;  4M78 B;  1M27 C;  3TU4 K;  2FB7 A;  1MMA A;  2DA9 A;  3QYG B;  2X3X D;  3GNG A;  1X27 A;  1G83 A;  3UDC A;  2JVV A;  4DBQ A;  1PSE A;  3M0U A;  1YWP A;  1KFZ A;  2RPN A;  4HVU A;  2COZ A;  4RTZ A;  2RQR A;  2A08 A;  2KMT A;  3C94 A;  2EGE A;  3P8H A;  1XQH A;  3VS3 A;  1ZSZ C;  2K7A A;  2XID A;  1GXI E;  3A8G B;  1M1K C;  2LT4 A;  1G2B A;  2DL3 A;  4EMG A;  3OYG A;  3TEE A;  1PSF A;  2OTL Q;  4M77 B;  1G3W A;  3VS2 A;  2DO3 A;  2CYZ B;  3CQT A;  2EYY A;  1KSW A;  5GAN 6;  1C0M A;  3R6O A;  3CCQ T;  4XU3 A;  2V8J A;  3RMS A;  1D0Y A;  1AHJ B;  4JRQ A;  1BB9 A;  4GY5 A;  1N9S A;  3CMA A;  1VQ9 Q;  1M3B A;  3H41 A;  2DM1 A;  3LH0 A;  4IIM A;  4F7U G;  4PJL A;  3LW5 E;  2B86 A;  2P0Q A;  1A0N B;  2HAX A;  5FLX E;  2VB6 A;  1ZA2 B;  5CIU A;  1ZSZ A;  1O75 A;  1M3C A;  3S3O A;  4JRP A;  2X3W D;  1TG0 A;  2Y4Y A;  3A8O B;  3UF4 A;  3I56 Q;  3JB9 H;  5FW9 A;  4FSX A;  2GBQ A;  3CCL T;  2E5K A;  5KYX B;  2XMF A;  5GAM e;  2RJC A;  2PNI A;  2D8H A;  4CC3 A;  2QQ9 A;  5FRO A;  4C8Q B;  2G6F X;  4M78 D;  1S1N A;  2E10 A;  1MGQ A;  4IUP A;  4OP0 A;  4MDX A;  2COW A;  2BZ8 A;  2QTV A;  2YRV A;  2YUN A;  3CXC S;  2QA4 T;  3R6N A;  2CP5 A;  1BI1 A;  3QWX X;  3CC4 T;  3EG9 A;  1VOM A;  3OYN A;  1YI2 T;  1WJQ A;  4RG2 A;  5CKD A;  2KNB B;  3V7C A;  2FVU A;  3MPU B;  2YUP A;  1NJI U;  3VUZ A;  1RUW A;  4ESR A;  2JS0 A;  4KBM B;  1Q7Y U;  1KD1 C;  1YP5 A;  4FYV B;  1EIF A;  5AT1 B;  2KDS A;  1G3T A;  3CME Q;  4HVW A;  1WGS A;  2EIF A;  2JT4 A;  4ZN3 A;  4AT1 B;  1IB8 A;  1VQ6 Q;  5D6Y A;  3QO3 A;  2C0I A;  1Q81 U;  1O9S A;  3MP6 A;  4F7U F;  1JXO A;  3QJ6 A;  2GFU A;  1OZ3 A;  1R0C B;  4BI4 A;  1YIT T;  4C92 F;  3CCM T;  1XTD A;  4ZGD B;  3J7A F;  1WDX A;  2JMC A;  1W2B S;  4IUR A;  3QXE B;  3RNJ A;  1YWO A;  3G71 T;  1YCY A;  2LJ0 A;  4D8K A;  2FRW A;  1G3Y A;  2RQV A;  4A4H A;  5FRN A;  5KE2 A;  1WZO A;  4ME7 A;  1LJO A;  1AVZ C;  2K9G A;  4IUU A;  4J9B A;  2QG9 B;  4XTZ A;  2VXE A;  3X25 B;  4C92 E;  3BW1 A;  3RKY A;  5LJ5 j;  2F5T X;  3MET A;  2AT1 B;  1Z9Q A;  2PTK A;  3VS5 A;  3L2Q A;  5IHK A;  3ZFJ A;  1NE8 A;  1I07 A;  3CD6 T;  4HXJ A;  1UUE A;  3QPH A;  1IRX A;  2CH4 W;  1X6G A;  4PLI A;  2VGN A;  3HKS A;  4M7D C;  2HQH A;  3CPW P;  3EGD A;  1LOJ A;  1AWO A;  5J39 A;  2EQU A;  3RUX A;  4XTV A;  4A4E A;  4M78 E;  2JOY A;  2EYX A;  2YT6 A;  2JMA A;  4X1V A;  3VYG A;  2P0K A;  4M77 F;  1M3A A;  3G6E Q;  2YLC A;  1QVF A;  1RL2 A;  1WNL A;  2LNH B;  3BE3 A;  3CPW S;  2AZS A;  2C0T A; 
#chains in the Genus database with same CATH homology
 2J6K A;  3EHQ A;  4HVV A;  2JM8 A;  4OMN A;  2O9S A;  3I35 A;  2RN8 A;  2BZX A;  1BK2 A;  1GRI A;  2IIM A;  3U23 A;  2HCK A;  2K6D A;  2VVK A;  2EVR A;  4RTV A;  1AOJ A;  4DEX A;  1MV3 A;  2LP5 A;  1E6G A;  3PVQ A;  2YSQ A;  1NLP C;  4J9C A;  2DYB A;  2CDT A;  4QT7 A;  2DX1 A;  1T0J A;  4EIK A;  2EQI A;  4F17 A;  1Y57 A;  1FMK A;  1WXU A;  1KJW A;  2ECZ A;  2JW4 A;  4LN2 A;  3LH5 A;  5I11 A;  2DBM A;  3UA7 A;  2F2W A;  2O9V A;  2YUO A;  1YNZ A;  2P4R A;  1SSH A;  4LNP A;  4AG2 C;  2BZY A;  1K0S A;  1VYT A;  2NUZ A;  4ORZ A;  1K1Z A;  2CT3 A;  2KEA A;  3VS4 A;  2ESW A;  3NHN A;  1HD3 A;  1VA7 A;  4D8D A;  2JM9 A;  4JZ3 A;  4WCI A;  5IHN A;  3EG0 A;  1X2K A;  4AFS C;  2DJQ A;  2L2P A;  1X69 A;  2ABL A;  1WXT A;  2DL5 A;  4JJD A;  1EFN A;  4OMQ A;  5HCK A;  2NWM A;  3EG1 A;  5IXF A;  4KRT A;  3H0F A;  2KRN A;  1U5S A;  3SHW A;  1CKB A;  1UHF A;  2GNC A;  1WI7 A;  2RQW A;  3VS6 A;  2CUB A;  1NYG A;  3H0H A;  2CSI A;  3REA B;  2JXB A;  4J9H A;  2LMJ A;  2DL7 A;  2K79 A;  3TVT A;  3EGU A;  2J06 A;  1J3T A;  2DL8 A;  1PHT A;  1NG2 A;  5I22 A;  2D1X A;  5IHI A;  3REB B;  3GBQ A;  3M0S A;  1UE9 A;  4M4Z A;  1PKS A;  1SHF A;  1WA7 A;  2CUD A;  1AD5 A;  4DEY A;  1CKA A;  1E7O A;  1TUC A;  1ZSG A;  3EG3 A;  2JTE A;  2YUQ A;  1CSK A;  1YCS B;  1TUD A;  3RBB B;  1AZG B;  1XOV A;  2DL4 A;  1ABO A;  4AFQ C;  5IXB A;  1VYU A;  2LQN A;  2V1R A;  1WIE A;  1OOT A;  4OMM A;  2PZ1 A;  1QWF A;  2EGA A;  1JO8 A;  1MV0 B;  2J6F A;  3THK A;  2KBT A;  1H8K A;  2A36 A;  4GLM A;  5FWB A;  4LUE A;  2KXD A;  1SRM A;  4Z89 A;  2EGC A;  3M0T A;  3I5R A;  1QKX A;  1K0X A;  3TSZ A;  2KYB A;  2FG0 A;  1SEM A;  3TSW A;  2ROT A;  2J6O A;  2RQT A;  2LCS A;  1ZX6 A;  2O88 A;  1ZUY A;  2CH4 A;  4FSS A;  2GTJ A;  4Z8A A;  3SEM A;  1UTI A;  2LX7 A;  1UEC A;  1JEG A;  2YDL A;  4HCK A;  3JV3 A;  2A28 A;  1GCQ C;  1K9A A;  2L3Q A;  1T0H A;  2F2V A;  1Z9Z A;  2GTO A;  2RNA A;  5L23 A;  2DNU A;  1I1J A;  4OML A;  3KFV A;  1UHC A;  1WLP B;  4CC7 A;  3PVL A;  2KRM A;  3M0R A;  1PRM C;  4LUD A;  1UFF A;  2CT4 A;  4Z88 A;  2J7I A;  4F16 A;  4CC4 B;  5EC7 A;  1SPK A;  1PNJ A;  1WXB A;  3NMZ C;  1YN8 A;  2AKL A;  4AFZ C;  1M27 C;  2LJ1 A;  2CSQ A;  2SRC A;  2L3S A;  3I5S A;  2LZ6 B;  4J9I A;  1RI9 A;  2DA9 A;  2X3X D;  1ABQ A;  3O5Z A;  1X27 A;  2K2M A;  1G83 A;  1ZLM A;  1PKT A;  2F2X A;  1FYN A;  3M0U A;  1YWP A;  1KFZ A;  2RPN A;  4HVU A;  4RTZ A;  2FPF A;  2A08 A;  2RQR A;  2KT1 A;  1T3S A;  1ZUK A;  4RTY A;  2ENM A;  5ECA A;  2EGE A;  3VS3 A;  1OPK A;  2DLP A;  2DRM A;  2K7A A;  1BU1 A;  1GCQ A;  2MIO A;  1G2B A;  2DL3 A;  4E6R A;  1B07 A;  4K11 A;  3VS2 A;  4J9E A;  3H0I A;  3QWY A;  2V1Q A;  3I9Q A;  1AWJ A;  4A63 B;  4JZ4 A;  5GJW B;  3CQT A;  3NPF A;  2EYY A;  4RTW A;  1KSW A;  1BBZ A;  2MOX A;  1KIK A;  2HSP A;  1QKW A;  1QWE A;  1T3L A;  2OAW A;  1UJY A;  4F14 A;  1BB9 A;  2EBP A;  1Y0M A;  1M3B A;  2DVJ A;  1PRL C;  2H8H A;  3H41 A;  2DM1 A;  4IIM A;  2FEI A;  1GBR A;  2RQU A;  2VWF A;  2B86 A;  1NYF A;  4J9D A;  1RLP C;  1UJ0 A;  1A0N B;  1LCK A;  2FRY A;  1X6B A;  1JXM A;  4JPB W;  3M0Q A;  2W10 A;  1AZE A;  2K3B A;  2FPD A;  3C0C A;  1M3C A;  1H3H A;  4LE9 A;  2GGR A;  2X3W D;  4R0K A;  1ZUU A;  2DRK A;  1TG0 A;  2OI3 A;  3ZL7 C;  3UF4 A;  1SRL A;  3VS0 A;  2ROL A;  1H92 A;  5FW9 A;  2D0N A;  2GBQ A;  2EW3 A;  4AFU C;  2RMO A;  2E5K A;  2QDL A;  2D8J A;  2XMF A;  2PNI A;  2KT8 A;  2D8H A;  4CC3 A;  1VYV A;  2G6F X;  1S1N A;  2JS2 A;  5IH2 A;  1JU5 C;  2BZ8 A;  4IIO A;  2DBK A;  2YUN A;  3R6N A;  1RLQ C;  1QLY A;  3QWX X;  2KR3 A;  2KRO A;  1QCF A;  3NGP A;  1K4U S;  2AK5 A;  1GCP A;  2KGT A;  2KNB B;  2W0Z A;  2YUP A;  2OJ2 A;  1RUW A;  2L3P A;  1NEB A;  4ESR A;  2EYW A;  2JS0 A;  1YP5 A;  1U06 A;  2DF6 A;  1N5Z A;  4RTT A;  2HBW A;  1X2Q A;  1AWX A;  1PWT A;  1WX6 A;  2AZV A;  1UGV A;  3IQL A;  4HVW A;  1WFW A;  4JJC A;  2JT4 A;  2VKN A;  2KE9 A;  4JJB A;  4CC2 A;  3VRZ A;  1AEY A;  3A98 A;  2C0I A;  1GBQ A;  2KRS A;  1JXO A;  2O2O A;  1NEG A;  2LJ3 A;  3EG2 A;  2SEM A;  2MCN A;  3EHR A;  1M30 A;  1HSQ A;  1NLO C;  1UG1 A;  1IO6 A;  2EYZ A;  1WDX A;  1OV3 A;  5FWC A;  2JMC A;  1W1F A;  1WYX A;  2M0Y A;  2O31 A;  3RNJ A;  1YWO A;  4RTU A;  2CRE A;  3VS7 A;  1W70 A;  2LJ0 A;  4D8K A;  4RTX A;  2FRW A;  2RQV A;  2AKK A;  4OMP A;  3UAT A;  3PE0 A;  2HEQ A;  1SHG A;  2J05 A;  4RUG A;  2C0O A;  1V1C A;  4ZNX A;  1UDL A;  1AVZ C;  1HJD A;  2K9G A;  2KXC A;  1I0C A;  4J9B A;  2LQW A;  3VRY A;  2DMO A;  2A37 A;  3M0P A;  2L0A A;  4Y92 A;  2HDA A;  1M8M A;  3UA6 A;  1GFD A;  1NM7 A;  1U3O A;  1Z9Q A;  2PTK A;  3VS5 A;  1ZBJ A;  2FO0 A;  5IHK A;  4AG1 C;  1I07 A;  4HXJ A;  1AWW A;  1UUE A;  1X43 A;  1JQQ A;  2CH4 W;  1X6G A;  1ARK A;  3FJ5 A;  1W6X A;  2RF0 A;  1AWO A;  1B3Q A;  2KYM A;  2ED0 A;  1OPL A;  4J9F A;  2DIL A;  1GFC A;  1GL5 A;  2I0N A;  2BTT A;  1OEB A;  2DE0 X;  4J9G A;  1MUZ A;  2EKH A;  2FPE A;  1K76 A;  2EYX A;  2YT6 A;  2M51 A;  2EPD A;  2JMA A;  4OMO A;  4X1V A;  1M3A A;  3VS1 A;  4GBQ A;  2GQI A;  3ULR B;  2LNH B;  2ED1 A;  5GJV B;  2AZS A;  1E6H A;  2C0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...