2FPEA

Conserved dimerization of the ib1 src-homology 3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords C-jun-amino-terminal kinase interacting protein 1
total genus 14
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpeA00
2JMCA 3EG1A 4F17A 2YDLA 2RN8A 1JXOA 3I5RA 1K1ZA 1NLPC 1T3SA 4CC7A 1M8MA 2JT4A 2KYBA 1ZUYA 1QKWA 1NYFA 4AFZC 2CDTA 2LCSA 4D8DA 1G2BA 2EYWA 2ED1A 2ENMA 2YUQA 2EVRA 2V1RA 2V1QA 2M51A 1U5SA 2L0AA 2RQTA 1UUEA 2IIMA 2L3PA 3EHQA 4RUGA 4JPBW 2K6DA 1YNZA 2EQIA 1AWJA 4RTXA 1VA7A 4RTTA 1SRLA 2KGTA 1YN8A 4OMLA 2E5KA 2OJ2A 2JMAA 1TUDA 2KE9A 5FW9A 3VRZA 1JXMA 2J6KA 2RMOA 1GCPA 1MUZA 4Z88A 1WDXA 2K9GA 1X6GA 4IIMA 4CC4B 3NPFA 2KRMA 4F16A 2DL4A 1AVZC 2CH4A 2CUDA 1K9AA 2RQRA 3ULRB 5GJVB 3TSZA 5ECAA 4GBQA 4D8KA 3CQTA 3UF4A 2HSPA 4AFUC 2YUNA 1SPKA 1WLPB 2KT8A 3QWXX 1YP5A 3UA7A 2GTOA 4RTUA 2XMFA 3VS5A 2DE0X 1NEGA 1X2QA 4M4ZA 1Z9ZA 4ESRA 2I0NA 1GBRA 1M3BA 2KRNA 1S1NA 2J06A 1U3OA 5FWBA 1M30A 2CUBA 2L3SA 1QKXA 2PTKA 1BBZA 2X3WD 4R0KA 2MIOA 1UE9A 1UGVA 1EFNA 2HBWA 2VWFA 2ABLA 2ED0A 2HCKA 2K3BA 1OOTA 1HSQA 3H0HA 5IXFA 2F2XA 1Y0MA 3O5ZA 2LZ6B 2C0TA 2DBMA 3M0TA 1J3TA 4IIOA 1K76A 4CC2A 1SHFA 4J9FA 2FO0A 1RLPC 2KEAA 2DF6A 4HVVA 3GBQA 1T3LA 5L23A 1K4US 3M0UA 1BB9A 5HCKA 1PKSA 3VS1A 1WXTA 1HJDA 4J9GA 1W1FA 4AG1C 2JM9A 2A08A 2FG0A 2HEQA 2DL5A 4RTZA 2RQWA 4HVWA 1KSWA 2O88A 2DMOA 1A0NB 2C0OA 3KFVA 2DA9A 1K0XA 2KXDA 1OV3A 1TUCA 2EPDA 1JQQA 1ZLMA 2AKKA 2KNBB 3SEMA 4AFQC 1UTIA 2DILA 3LH5A 2RQVA 3REBB 4OMMA 2JXBA 1GFDA 4GLMA 2K79A 1JO8A 1GCQA 1HD3A 2J05A 1MV0B 4OMPA 2L2PA 2K2MA 2EGCA 1MV3A 2LQWA 4AG2C 2DJQA 1Y57A 4F14A 3M0PA 2KR3A 4J9HA 1TG0A 2EW3A 2DYBA 2GBQA 3TVTA 2DRMA 2CSQA 4LN2A 1IO6A 1X69A 3THKA 2JM8A 2JW4A 1T0HA 1UHCA 4J9CA 1W70A 2M0YA 1V1CA 2O31A 4J9BA 2EBPA 1WA7A 2EKHA 1SSHA 2VKNA 2LJ1A 3EG2A 3M0QA 1UHFA 4QT7A 3M0SA 1WXBA 2A28A 4EIKA 2EGEA 2D0NA 1KFZA 1VYVA 4Z8AA 4ORZA 3PE0A 2YT6A 1AOJA 1PWTA 3NHNA 3C0CA 4J9EA 1VYTA 3NGPA 3A98A 1WFWA 3I5SA 3VRYA 4DEXA 2AZVA 2MCNA 2L3QA 3FJ5A 2O9SA 1E7OA 2ROLA 2QDLA 5IHNA 2OAWA 1BK2A 2W0ZA 2NWMA 1OPLA 3R6NA 1GL5A 2X3XD 1LCKA 2H8HA 2DRKA 1FYNA 1X43A 2FPEA 2SRCA 2RPNA 2LQNA 1WXUA 4HXJA 2LNHB 1RI9A 2AKLA 2CSIA 2DL7A 2ESWA 1PRLC 2RNAA 2FRYA 1AZGB 3VS3A 2FEIA 3RNJA 1UECA 2BZ8A 2FRWA 2O9VA 5GJWB 1X2KA 1E6GA 2GGRA 1UJ0A 3VS2A 1WX6A 3RBBB 3PVLA 4ZNXA 1XOVA 1QLYA 2A36A 4J9DA 1B3QA 2EYZA 1AWWA 2KRSA 2J7IA 1AZEA 1ABQA 1WI7A 1YWOA 4AFSC 2RF0A 2KBTA 3REAB 2W10A 1NLOC 4OMQA 2K7AA 1AD5A 1M3CA 1QWFA 2OI3A 3IQLA 1QWEA 2DBKA 1RLQC 1GBQA 3VS6A 4E6RA 2RQUA 3EG0A 3UATA 5IH2A 2DL3A 2BTTA 1WYXA 2LJ0A 4Y92A 1UJYA 3SHWA 2CREA 1PRMC 2JTEA 4K11A 1K0SA 2GTJA 1YCSB 3VS7A 2B86A 4Z89A 3H41A 2GQIA 2YUOA 2J6FA 2F2WA 1JEGA 3TSWA 1AWOA 1WIEA 1X27A 2YUPA 1CSKA 1GFCA 4HCKA 1H8KA 2J6OA 3ZL7C 1NEBA 2D1XA 4JZ3A 4RTWA 1VYUA 3EG3A 1G83A 2NUZA 3U23A 2DLPA 2AZSA 1NYGA 3EHRA 4A63B 1ZSGA 2ROTA 4HVUA 4LUDA 2MOXA 4RTYA 5EC7A 2DM1A 2JS2A 1ZUKA 5I11A 2BZXA 2FPDA 1NM7A 3VS4A 2YSQA 1ZBJA 1B07A 1UDLA 2KXCA 3H0IA 2SEMA 2LP5A 2VVKA 2KROA 1M27C 1PKTA 3I9QA 5FWCA 1X6BA 4OMNA 3VS0A 2DNUA 2GNCA 1ARKA 2LX7A 1H3HA 4JZ4A 1I1JA 2AK5A 3I35A 4LUEA 3M0RA 2KT1A 1OPKA 2F2VA 2CH4W 2EYYA 2PZ1A 2JS0A 3PVQA 3EGUA 2O2OA 4FSSA 1KIKA 1KJWA 4JJBA 1AEYA 2DVJA 1SHGA 1M3AA 2EYXA 2DX1A 1AWXA 2LMJA 4LNPA 4J9IA 3H0FA 4JJCA 2ECZA 1CKAA 5IHKA 1BU1A 3NMZC 2EGAA 1ABOA 2FPFA 4KRTA 1SRMA 4JJDA 1OEBA 3UA6A 4WCIA 1T0JA 2LJ3A 3QWYA 4CC3A 1YWPA 1GRIA 1PHTA 1SEMA 1PNJA 2P4RA 2A37A 4LE9A 4OMOA 1UFFA 2PNIA 1RUWA 4RTVA 1QCFA 5IHIA 1U06A 2DL8A 1UG1A 1ZX6A 1FMKA 1Z9QA 2HDAA 4DEYA 2G6FX 4X1VA 1ZUUA 2C0IA 1I0CA 3JV3A 2KYMA 2CT3A 5IXBA 2D8HA 1N5ZA 5I22A 1CKBA 1W6XA 2BZYA 1NG2A 2D8JA 2CT4A 1I07A 1JU5C 1GCQC 1H92A 1E6HA
chains in the Genus database with same CATH superfamily
3RKWA 3GPLA 3EG1A 4O6JA 1ACMB 2WSCE 2RN8A 2ZPIB 2DO3A 2YWWA 3O8VA 1UEBA 5GANj 2HZYA 4B9XA 3CC2A 2OTJA 4MZTA 3UT1A 3HTRA 2EYWA 3OYEA 1GXIE 1N9SA 1WHJA 2ENMA 4M77D 1IHWA 3E19A 2E6NA 1F1BB 1N6AA 2EVRA 3V8JA 5HK0A 4C8QC 3CMAT 2DEQA 2QTVA 1UUEA 2FB7A 4JPBW 2K6DA 2X9HA 2EQIA 3OS0A 5AYFA 2Y4YA 1M5Q1 3CCQQ 4RTTA 3GF5A 2KGTA 3HKSA 1YN8A 2DK3A 5GANe 3CMET 2RHIA 4DBRA 3JCMQ 4E47A 5GANg 3JCMW 1YHQQ 4RG8A 1MUZA 2DXBA 3SWNB 4PK4A 1WDXA 1WPYA 2E12A 3X28B 3QG1A 3EFOA 5CKFA 1BKBA 4IIMA 1MHNA 2RHUA 4HA8A 4J83A 2KRMA 1PCXA 2DL4A 1AVZC 2CUDA 2RO0A 5ECAA 4D8KA 1OZ2A 5I2MA 3AHUA 2A7YA 1VQPA 1SPKA 1WLPB 3CC7T 1WQWA 3V7CA 1YP5A 4RTUA 2DE0X 5IAYA 1X2QA 1GBRA 3L2VA 1PD1A 1MNDA 1U3OA 2CUBA 4BY6C 4R0KA 4J6XA 2PVDB 1P92A 3QZ9B 2HBWA 3CCJA 2ATCB 1VIFA 3HL8A 3MJXA 2HCKA 2E70A 2F2XA 1D3BB 1PSEA 1M2VA 3LLRA 2DERA 2DBMA 4MZPA 1VQ7Q 1UGQB 2V8KA 3MEUA 1XNIA 1SHFA 2Y90A 4NOYA 4PLLA 3QO3A 2L5QA 3LYIA 2KEAA 3PIPA 1KQ1A 2X4WA 3GBQA 1T3LA 3MO8A 1Q81R 4ATOA 1OU9A 1K4US 1V29B 2KI7A 2HMAA 3M0UA 5GAN2 1VQ9Q 1G3SA 4N4GA 1PKSA 1WXTA 2E3IA 4DOVA 1VQ8A 3CBPA 1HXDA 4XU0A 3A8MB 2DL5A 3H8ZA 2RQWA 4HVWA 3FLGA 3G71A 2C0OA 2IPOB 2DA9A 2QQBA 1MGQA 2MPXC 4OB1B 2KNBB 1VQ5Q 2ZZDA 1WHGA 1UTIA 3META 2ZCFB 1YIJQ 1Q7YC 3CD6Q 2WSFE 3CCLQ 2HQXA 4EMHA 2L8DA 1GCQA 1HD3A 2EKOA 4L5GA 4A4FA 1LVKA 2D9TA 2AIRB 2LCCA 1FX7A 1FMWA 1Q81U 4E7IA 2M1HA 3OYDA 1QMCA 1B34A 3M0PA 2HQEA 4J9HA 1TG0A 2QG9B 3TVTA 3JB9H 4HCBA 4JS4A 2KDSA 2JM8A 4M75E 3CCQT 4C92A 4IUVA 1MNEA 2YHTA 1V1CA 1BIAA 2PUOB 1BI2A 1TH7A 2EBPA 2EKHA 1QQJA 2YRVA 4A54A 4OB0B 2LJ1A 4JUVA 2H3EB 2MK5A 3M0QA 2RJFA 4EDUA 4EIKA 1KHIA 1KFZA 3PE0A 3M58A 2K3XA 5GMKe 2YRCA 2YT6A 1VQMQ 4J9EA 2R5MA 4A4HA 3NGPA 3A98A 3TEEA 2GFUA 3VRYA 4N0AC 2AZVA 2XICA 4LD6A 5IHNA 5A2QE 1QVFA 3A8HB 1BK2A 2W0ZA 2X4JA 1OPLA 3R6NA 1KC8U 1I4K1 4DBFA 4C92G 5FU6C 4C8QD 1YJNA 3CC7A 4HT8A 2DL7A 2ESWA 1KD1R 2OTJT 4M7DB 3M9QA 2FEIA 2BZ8A 1TSFA 2FRWA 2E1HA 2PQWA 2O9VA 5GJWB 2GGRA 2YRDA 5LJ5f 3J7AF 4J9DA 2VC8A 3T9NA 2EYZA 2VASA 1AZEA 4OP0A 1VQNQ 4ZN3A 3CCUA 4ZGDB 3OW2P 4C0DC 4M77A 5CKDA 2HSEB 3OW2A 4OMQA 2K7AA 3PIOA 2JOYA 3S3OA 3IQLA 2DBKA 1RLQC 4E6RA 3OYNA 5IH2A 2DL3A 2BTTA 2LJ0A 3OMCA 2CKKA 1UJYA 4K11A 2DETA 3VS7A 2DTIA 3OY9A 3JB9D 3H41A 2J6FA 3CBOA 1X01A 4JS5A 3V7RA 1X27A 5GAMj 4ELYC 1ZQ1A 2D1XA 2QAZA 1JJ2S 5L8RE 3F70A 2NUZA 3RESA 2JJ9A 2EIFA 2DLPA 4M75A 1NYGA 3JCMf 3I55T 3EHRA 1ZSGA 1RAAB 3M55A 5J26A 5EC7A 1PD0A 1EZZB 2CZ6B 4WTOB 1WHMA 2JS2A 1MMGA 2MWOA 4XTWA 1VQ8T 2YSQA 1B07A 1UDLA 3HRSA 1M1GA 4FT4A 2SEMA 5HY6A 2VVKA 3NTIA 2DPPB 2QGGA 1VQKA 5GAN6 3I9QA 2XU8A 4PLIA 4OMNA 4QQ6A 2BUDA 4E7SA 1AHJB 2ZPEB 1YJNT 3E9GA 2ZPFB 3M0RA 2AT1B 2ZPHB 1VQ6Q 2CH4W 1WQ7A 3LW5E 2JS0A 2OTJQ 1MMNA 2O4XB 4X9DA 2GQVA 1VQOT 4DQ2A 1KJWA 4LDVA 1SHGA 1IZ6A 3J81E 7AT1B 1M1KC 4XQ3A 5GAN8 3BDLA 2LMJA 4XTYA 5FU7B 3H0FA 2DFUA 1CKAA 5IHKA 1S72Q 4QVCA 2EGAA 2FPFA 2P0KA 4JJDA 1OEBA 2DEUA 3CCST 4M77C 3CXCP 2RK1A 2QYZA 2K5LA 1M90U 1G3YA 4PJOD 1YHQA 3FJPA 2O4XA 3MKDA 4LE9A 4OMOA 2FZGB 1QCFA 2DL8A 3BE3A 3NFCA 1IRXA 1YJ9Q 1FMKA 2HDAA 3OBWA 3LGFA 4DEYA 4BB7A 1IHVA 1VQ6A 3DLMA 2KYMA 2CT3A 1QVPA 4NL2A 2B8AA 1N5ZA 2CT4A 3OQ5A 1JU5C 4EMKB 2FVUA 3MEAA 5KYWA 2BE7D 5CKBA 2JMCA 3PFSA 3SDZA 4E7HA 3JCMJ 3HHTB 4FCYA 1JXOA 3I5RA 3OYGA 4CC7A 1LPLA 4ZGJB 2EFIA 4F7UA 2CDTA 2LCSA 5J39A 5DLOA 3OA6A 2EJ9A 3CCMT 1DJ7B 4BUGA 5DY9A 2A3LA 2V1QA 3JB9J 2L0AA 1OQKA 2RQTA 4QKUA 4C92C 4RUGA 4KGZB 2M0OA 3OS5A 3SWNA 2NUTB 2KVQG 3X26B 4AMCA 1Y07A 4OMLA 3NTKA 1G3TA 2JMAA 2KE9A 2RMOA 3M54A 1GCPA 4PJJA 4Y91A 4MZMA 1D1AA 5KYNA 4OGEA 1X6GA 5IT9E 3OYYA 3NPFA 1S72T 3MP6A 1K9AA 4KUIA 4JRPA 4FL6A 4QQDA 3BW1A 3R6OA 2LTOA 3CQTA 3UF4A 2HSPA 4AFUC 2HQHA 1WHHA 3CXCA 1M1FA 4FIBA 1D09B 2FL7A 2GTOA 3VS5A 1PG5B 2K4YA 1D0YA 3SB2A 1U1SA 4QVDA 4R55A 4M4ZA 2GCXA 1M3BA 2KRNA 1S1NA 2J06A 3H9NA 2L3SA 1QKXA 2X51A 5GMKm 2VV5A 5CKEA 2ED0A 1M8VA 2K3BA 1OOTA 1HSQA 5IXFA 4A4KA 4FYVB 5I2SA 2F69A 5GANf 2M9UA 5LJ5e 3VUZA 4BE0A 2QQSA 1RLPC 3EH2A 5CVIA 3CMAA 4EMKC 3M57A 3JB9F 1TTHB 4PJOE 1VQ6T 1HJDA 1W1FA 3JCMb 3M53A 4ANJA 4N0AA 4IUPA 3RIRA 1OV3A 1TUCA 2EPDA 2QDYB 2AKKA 3G71Q 4E7ZA 1VUBA 3SEMA 4AFQC 3M56A 4F7UF 2RQVA 4OMMA 3CBMA 4N4IA 1JO8A 4M7DF 3NTHA 3M4YA 3JCMg 1B7TA 2QA4Q 4BDYA 1MV3A 3GIBA 1PSFA 5C0MA 1KQ2A 4BACA 2JTMA 1Y57A 1G5VA 2QGFB 1VQOA 4EMGA 2EW3A 1N8RU 1WNLA 2DRMA 3OYCA 1I8FA 3CC4A 2CSQA 4LN2A 4ZN1A 2XI9A 1UHCA 2M0YA 2O31A 1UGRB 2CZ7B 4YTLA 9ATCB 2MF2A 2EAYA 1UB4A 2HAXA 3LGLA 4ZGEB 2RI5A 2XKOC 1VQKQ 4GY5A 1WXBA 1FWZA 2PUKB 2EGEA 2D0NA 1VYVA 1SG5A 2YLCA 2YLBA 1LJOA 1YI2Q 4BD3A 2VYTA 2KSSA 1JBMA 2O9SA 2ROLA 1BCMA 1VQ9T 2QDLA 2QQAA 1EIFA 1U8RA 2CZ1B 3RKYA 1NZ9A 5FRMA 3OYHA 1O75A 2X3XD 4XU3A 2DRKA 1KG1A 1FYNA 2SRCA 5GAOl 2RPNA 2LQNA 1RI9A 2QEXQ 2RNAA 3VS3A 3PT9A 1UECA 1WZOA 2VUBA 4FW1A 1X75C 1X2KA 1UJ0A 2DD4A 1QVGS 1R8OB 3SFMA 1QLYA 1RAFB 1B3QA 4VUBA 3X25B 1ABQA 3AT1B 5GAN4 4AFSC 4C92D 3G71T 5EG2A 1TOVA 2W10A 1AD5A 3G7ZA 2OI3A 4J5YA 1QWEA 4FM4B 4CI0C 2EYQA 3G4SQ 1M90R 2NUPB 3ZBDA 3BDUA 2DXCA 4IURA 4Y92A 3SHWA 2CREA 5CQYA 2MYSA 1K0SA 3OW2S 1OZ3A 1YCSB 2CGHA 2B86A 3KXTA 3DKMA 2MAMA 4Z89A 1WJSA 2YUOA 3MP1A 4ELZC 3L2RA 3L2UA 3ER0A 1K9MC 4MDXA 4N4HA 1C0MA 2R5AA 5KYYB 2J6OA 1NEBA 2EWNA 4JZ3A 4RTWA 1VYUA 1I81A 1WJRA 3CCEQ 2QA4T 3U23A 3QYGB 2KAFA 2LNVA 4B9WA 4XK8E 1I5OB 4LUDA 2PU9B 4RCBA 3M5AA 4MDWA 1NM7A 1OYXA 3MHXA 3CC4T 2QA4A 4DBQA 2P4TA 1X6OA 1NJIU 1RI0A 3MP8A 4XU2A 3G6EA 1M27C 4C5HA 5GAMe 3RDVA 4LDUA 4PJMA 5FWCA 2OTLT 4C5IA 4HCCA 2E6ZA 3OB9A 3VS0A 2GNCA 3VJPA 3DB4A 5CO7A 4JZ4A 1I1JA 2CP5A 1K9MU 2DYIA 4LUEA 3ZFJA 1M90C 1OPKA 4M75G 4IKFA 2PZ1A 5CKHA 2DZCA 3GOXA 1IREB 2RD1A 3EGUA 1BYMA 1K73U 2EYXA 1VQ8Q 3RR6A 2E5QA 1VQ9A 1MMAA 4J9IA 1WGSA 3A8OB 4M7AC 1BU1A 4BI4A 3C94A 1ABOA 1SRMA 1K9MR 4M75F 3VU3C 2DKGA 5CK9A 2HKNA 1ZSZA 3HP9A 3QWYA 4CC3A 2E10A 1GRIA 5KCOA 1SEMA 1YITA 4IUQA 3CPWS 3CCJQ 2X4XA 2A37A 1D1BA 5LL6S 2BE9B 5D6YA 1R77A 2NLUA 4FT2A 1UG1A 1ZX6A 2LDMA 3CXCS 2DTOA 2CS7A 1V76A 2COWA 3D7SB 1VOMA 2G6FX 2QQRA 4PJNA 3CPWP 5M9OA 1QW1A 4HKEA 1I0CA 1D0ZA 1Q82U 4M7DC 5IXBA 1K73C 2CP2A 2HKQB 1VQPQ 5I22A 1CKBA 1NG2A 1I07A 1Q86U 4B6MA 5LJ3e 1H92A 2AHJB 2OX7A 4PJOB 1PC0A 4JLGA 4F17A 2QASA 4M78G 5LJ3g 3GNFB 2EJFA 4J6WA 2C06A 1KHCA 2EQKA 1K1ZA 1NLPC 1T3SA 3CEYA 1YJ9T 1M8MA 2KYBA 1ZUYA 1QKWA 1NYFA 1YI2A 3TQ7P 4AFZC 2RJCA 4D8DA 5CCAA 1LOJA 1G2BA 4J7IA 4LXCA 3RUXA 2ED1A 2YUQA 3LWHA 1OULA 4LD9K 3CCVA 1RABB 1U5SA 2H3JA 2LC4A 4F7UB 2DAQA 5D7UA 2IIMA 4FYWB 2RJEA 1AWJA 1B34B 3QDFA 4E7KA 1R0BG 3UDCA 5CQXA 2E5KA 2OJ2A 5FW9A 1TUDA 3INZA 5GAOr 1JXMA 2BKDN 1M9SA 5KYWB 4Z88A 4PNOA 4Z02A 2CYZB 1Q7YU 2OTLQ 3VYHB 5HK3A 2K5FA 2E65A 3CCUQ 2A0FB 5GANh 2RQRA 2RHXA 3I55Q 5D6XA 4M77G 5GJVB 4GBQA 3V8LA 2YUNA 1Q81C 3QWXX 3VKIA 1VQ7A 1UGSB 3LH0A 3H6ZA 2JNGA 3CCLA 4XTXA 1JRIA 1XJWB 4PJOG 3OMGA 4E7JA 1BI0A 1NEGA 5HKCA 1KC8C 1AT1B 2RJDA 1TXQA 5GAOp 2M02A 1OX9A 3EAEA 1YITT 1M30A 2HL3A 4C8QF 5GAOq 3FC3A 2PTKA 3C12A 3QBYA 2EQMA 1ZHIA 1RADB 3OYAA 1YJNQ 1YJ9A 4M7AG 4V2SA 4M7AF 3I56A 3KUFA 5FROA 4KT0E 5I21A 1Q86R 3O5ZA 3OYIA 1OI1A 2C0TA 4RMOA 4F7UE 4FU6A 1J3TA 4DOWA 4IIOA 1K76A 4CC2A 3CCMQ 4XTUA 4RKUE 5A0DA 2DF6A 4HVVA 5L23A 3I55A 2V8IA 2RHYA 3EGDB 1BB9A 5HCKA 3C4SA 3EH1A 2JTFA 4M77F 2K5IA 4AG1C 2JM9A 3JCMP 2A08A 5LJ3f 3OS2A 2FG0A 3JSCA 2HEQA 5LJ3j 1Y96A 3C95A 4RTZA 1Y7XA 5GMKj 4M78A 2NUPA 4M7DG 1D3BA 2KY9A 2CP3A 2MMPA 3HSBA 5KCHA 2E3HA 1BIBA 3QJ6A 5GAN5 1YJWT 1FXXA 3JCMd 1N8RR 4FSXA 4M77B 4F7UG 3L2WA 1JB0E 4RG2A 2JXBA 2CZ0B 1VQ5T 1TWBA 1VQLA 4A4GA 4OMPA 3EFRA 1YIJT 2L2PA 2E4HA 1TS9A 2LQWA 1WHLA 4P5NA 3P8HA 5KE3A 4II1A 4RCCA 3QYHB 3FEOA 2ZAEA 2KR3A 3HFNA 5GMKl 2DYBA 2GBQA 4M7DD 3P8DA 3JB9G 3CCUT 1UGPB 1X69A 2DIQA 3MEVA 1M4ZA 1W70A 3N5BB 4OB3B 1W2BA 4J9BA 1WA7A 3JCMV 3CCRQ 2L89A 5GAMd 2VKNA 8ATCB 3EG2A 2ZPGB 1ZSZC 1UHFA 3M0SA 3PMTA 2A28A 2R58A 4M7AE 4Z8AA 1ZBXA 4ORZA 5KH6A 1IGUA 3V7SA 1AOJA 3NHNA 3C0CA 3RERA 3ASKA 1VQ4T 3I5SA 2ZGWA 2LVMA 2L3QA 3FJ5A 3EGXA 1E7OA 2PVOB 1VQMT 2OAWA 2QQ9A 4XTVA 1GL5A 3CCLT 3GP8A 2FPEA 4PL6A 3FRNA 1VQMA 4HXJA 1RACB 1QVGA 2EQUA 3CPFA 2CSIA 1TUGB 1VQKT 1FMVA 1PRLC 4LDWA 1AZGB 3G1JA 3RNJA 2I2LA 3RMSA 1WHKA 3VS2A 1M1KU 3OYFA 2JZ2A 3RBBB 5FLXE 3QIIA 3PVLA 4QVZA 1XOVA 3HPWA 1OX8A 1Q95G 5LJ5g 2R57A 2OAUA 4OGCA 3S6WA 2KRSA 1WI7A 4FW2A 1YWOA 2LRQA 3UPUA 1YJWQ 4KGVB 3REAB 1EX4A 4KH1B 1NLOC 3X20B 5GAMf 1QWFA 3VS6A 4NL3A 1GBQA 1VQNT 3UATA 5A0GA 3CCVT 1WYXA 2JTEA 1S72A 3SWNC 4PJOF 2GTJA 4QW2A 4JRIA 1VQLT 5IN1A 2F2WA 1JEGA 2FZCB 1VQ5A 3VYGA 1HYOA 3TSWA 3CD6A 1KK7A 1OU8A 1WIEA 5C6SA 2YUPA 1CSKA 1RAEB 1GFCA 1XQHA 4HCKA 3ZL7C 2CP0A 3FDRA 3JAME 1RAHB 2F5KA 3EG3A 2QEXA 2FHDA 3QPHA 2MI6A 4PJLA 3OYBA 2AZSA 3UWNA 1ZA1B 2LQ8A 4A63B 2MOXA 2XDDA 2DM1A 2M16A 4BY6B 4DA4A 5I11A 2BZXA 4JRQA 2EJGA 1ZBJA 1Y71A 3H0IA 2P84A 2QEXT 1RL2A 2LP5A 5CAIA 5KYXA 2PVGB 1PKTA 3JCMc 3OYJA 1K8AR 1N27A 1X6BA 4XU1A 2VB6A 1QP3A 2X35A 1ARKA 2LX7A 1H3HA 8AT1B 3TCJA 3PTAA 3WXMB 3I35A 2KT1A 1VQ4Q 4C0DB 2O2OA 4UC4A 4JLIA 1XTDA 4C5EA 4JJBA 1VQ7T 2DVJA 1IB8A 4CRIA 3X24B 1I5LA 2DX1A 4PFPA 5A0LA 1NJIR 4LNPA 1C1AA 3L1AA 1YCYA 3OSSC 2ECZA 4KRTA 2XDPA 5CIUA 2XHCA 3CMEQ 5KYYA 1G3WA 4WCIA 3CCMA 2LJ3A 1Y96B 1YHQT 4ZTJA 3KBGA 4F04B 2XG8D 1PNJA 2WSEE 4KULA 1H3ZA 2OTLA 3E1SA 1UFFA 2RI3A 1RUWA 3CCRT 2F5TX 4RTVA 2ZPBB 1KD1U 5IHIA 3CCQA 3QDRB 1HK9A 2Z0WA 1NE8A 2JVVA 1ZUUA 5KYUB 3Q1JA 2FYKA 4DBHA 2QTXA 5GAN3 1Q86C 1K8AC 1O9SA 3JCMh 3G6EQ 1W6XA 2BZYA 2D8JA 5GAOm 3CMAQ 1WJQA 3M4GA 5FWBA 3RMQA 1E6HA 5KYUA 3P8BB 3OYLA 2YDLA 2WACA 3S3NA 4C0ZA 2RB6A 3A8GB 4J7FA 2F1LA 2JT4A 4C8QB 1M1KR 4FYXB 1IXDA 3S3MA 3OYMA 3CCSQ 2V1RA 2M51A 4O5VA 3RKXA 4KUDK 2QXFA 3ME9A 2KQWA 2L3PA 3EHQA 5GAMh 1YNZA 4HT9A 4RTXA 1VA7A 1SRLA 2DVEA 2IVWA 1R0CB 2HBPA 2XK0A 1VIEA 3VRZA 2J6KA 5GAMg 2XDBA 4M7DE 2K9GA 2BIVA 1BI1A 4L59A 4XTZA 1RAGB 4CC4B 1N8RC 1TU0B 5D6WA 4F16A 2CH4A 2DIGA 1VQLQ 3ULRB 3CC2T 3TSZA 1YJWA 3ZEHA 4R56A 1QCNA 2GF7A 4BI8B 4PKCC 4ZTFA 2KT8A 2DZ9A 4C92F 3UA7A 2XMFA 3LX7A 4E7LA 3CCRA 3MEWA 4MMLA 4ESRA 1Z9ZA 1VQPT 2I0NA 4C5GA 2Y4XA 3OYKA 3MPUB 4PFOA 1BBZA 3EFOB 2X3WD 2MIOA 1UE9A 1M2OA 4JRKA 1UGVA 3PNWC 1EFNA 2VWFA 4C92E 1ZA2B 1Q82C 6AT1B 2ABLA 4C8QE 3JRZA 3H0HA 2HL5C 1Y0MA 2LZ6B 2RK2A 1BCOA 2NYSA 3G6ET 1Q7YR 3M0TA 3CPWA 5CR2A 3CMEA 2RI2A 3L2QA 3QXEB 4J9FA 2FO0A 2JUFA 3CD6T 4C0FA 4M75C 5GMKh 1KQSP 5LJ3h 3GLXA 2JN0A 2P0QA 3L2ZA 3VS1A 4Q5WA 3E2UA 4J9GA 3EGDA 3M59A 1G8XA 1YBYA 2V26A 5LJ5h 4M7AD 1KSWA 2O88A 2DMOA 1A0NB 1VQNA 1KQSS 3KFVA 2E64A 3QUIA 1YI2T 1K0XA 2KXDA 3BFMA 1JQQA 1ZLMA 2D0QB 2HD0A 3OS1A 2DILA 3LH5A 4EMKA 3REBB 1GFDA 4M75B 5DLQE 3VUBA 4GLMA 4OF1A 4BDZA 3QZ5B 2K79A 4LDXA 2V8JA 2COYA 1U1TA 2J05A 1MV0B 4JDSA 2XD0A 2K2MA 2DTHA 2EGCA 4C8QG 4AG2C 5FU7C 2K2VA 4WF2A 4C8QA 2DJQA 4F14A 4OMFB 3URGA 3A5ZB 3G4SA 1NBEB 2RM4A 5FRNA 3L42A 2VGMA 3JB9I 2D6FA 1BI3A 2LT1A 3I56Q 1IO6A 3THKA 2JW4A 1T0HA 4J9CA 3JCMX 1VQ4A 1JJ2A 4PJOC 1SSHA 4A53A 4QT7A 3OSVA 3FB9A 1N9RA 1W4SA 1PWTA 2RHZA 1VYTA 1WFWA 5GAN7 4M78B 4DEXA 2MCNA 2NUTA 4J6YA 4XAXB 2NWMA 2QI2A 1LCKA 2H8HA 1NPPA 1X43A 2EQJA 2DXUA 1QVGP 3LWIA 2VXEA 2LQKA 4M7DA 1QCOA 1WXUA 2LNHB 4FYYB 2AKLA 1D1CA 2FRYA 1QP2A 4MMKA 2XIDA 3QSUA 1C6VX 5LJ3d 4A4EA 1QVFP 1E6GA 1WX6A 1YIJA 2LX9A 4M78C 4ZNXA 2DXTA 5LJ5d 3VV0A 2A36A 1W2BS 2DJZA 4M78F 2X4YA 3E9FA 1AWWA 3QHSA 2J7IA 3BY7A 3G4ST 2RF0A 5GANd 1QVFS 4IUTA 3EG9B 4Y28E 2KBTA 4IUUA 1YITQ 3CC2Q 1D0XA 3HRTA 1M3CA 4HCZA 2CP6A 2RQUA 3EG0A 1W2BP 5DM7R 3CCEA 1Q82R 1KD1C 1PRMC 4M7AB 4OB2B 3TU4K 4C92B 4BE1A 2YXYA 4BI3A 4M77E 2GQIA 4X9CA 3JCMe 4L6V5 3EGXB 4KGXB 4M7AA 3CCET 1AWOA 2VGNA 3WVDB 3CCSA 4D6WA 2KMTA 3I56T 2FZKB 1KC8R 5J3BA 1H8KA 1M2VB 3QKJA 4J8OA 5AT1B 1YFNA 4PJOA 3MCAB 1G83A 4M75D 2E41A 2QK0A 5GAOn 1IGQA 3CC4Q 2ROTA 1K8AU 4HVUA 4RTYA 3QJYA 1VQOQ 3GNGA 4M78D 4ME7A 1H641 1ZUKA 4BE2A 3TREA 3J80E 2CP7A 2FPDA 3VS4A 1JJ2P 2KXCA 2HNIA 1K73R 2RA2A 2KROA 2LCLA 2O01E 3DB3A 3FIFA 3OBYA 4KH0B 2DNUA 3V8KA 2L3RA 2COZA 3HFOA 2AK5A 1PM3A 4M78E 2MWPA 2F2VA 2EYYA 4NS5A 2KK4A 3WVEB 3PVQA 1MMDA 4FSSA 1KIKA 4AT1B 3A8LB 3SD4A 1AEYA 1SKUB 1M3AA 2RH2A 3PMIA 1AWXA 5FU6B 2K57A 4JJCA 4TVRA 3PGGA 3NMZC 3CCVQ 3CCJT 5LJ5j 3UA6A 1RAIB 1T0JA 3CC7Q 4GLKA 4E2FB 1YWPA 1PHTA 4LDYA 2K3YA 2LT4A 1SF9A 2P4RA 1SSFA 1LNXA 3EFSA 2P0PA 3A1PA 2PNIA 3HRUA 1ZSZB 1U06A 2VXFA 1KQSA 3EG9A 4QQGA 1Z9QA 1NPRA 4PFZA 4X1VA 5KYXB 1NJIC 2C0IA 4EPCA 2DD5A 4X34A 3JV3A 4KBMB 4OVAA 4JJNK 5KE2A 5GMKi 2D8HA 3DLLA 2G3RA 4C0GA 1GCQC 2IG0A 2GFAA
chains in the Genus database with same CATH topology
2JMCA 3EG1A 4F17A 2YDLA 2RN8A 1JXOA 3I5RA 1K1ZA 1NLPC 1T3SA 4CC7A 1M8MA 2JT4A 2KYBA 1ZUYA 1QKWA 1NYFA 4AFZC 2CDTA 2LCSA 4D8DA 1G2BA 2EYWA 2ED1A 2ENMA 2YUQA 2EVRA 2V1RA 2V1QA 2M51A 1U5SA 2L0AA 2RQTA 1UUEA 2IIMA 2L3PA 3EHQA 4RUGA 4JPBW 2K6DA 1YNZA 2EQIA 1AWJA 4RTXA 1VA7A 4RTTA 1SRLA 2KGTA 1YN8A 4OMLA 2E5KA 2OJ2A 2JMAA 1TUDA 2KE9A 5FW9A 3VRZA 1JXMA 2J6KA 2RMOA 1GCPA 1MUZA 4Z88A 1WDXA 2K9GA 1X6GA 4IIMA 4CC4B 3NPFA 2KRMA 4F16A 2DL4A 1AVZC 2CH4A 2CUDA 1K9AA 2RQRA 3ULRB 5GJVB 3TSZA 5ECAA 4GBQA 4D8KA 3CQTA 3UF4A 2HSPA 4AFUC 2YUNA 1SPKA 1WLPB 2KT8A 3QWXX 1YP5A 3UA7A 2GTOA 4RTUA 2XMFA 3VS5A 2DE0X 1NEGA 1X2QA 4M4ZA 1Z9ZA 4ESRA 2I0NA 1GBRA 1M3BA 2KRNA 1S1NA 2J06A 1U3OA 5FWBA 1M30A 2CUBA 2L3SA 1QKXA 2PTKA 1BBZA 2X3WD 4R0KA 2MIOA 1UE9A 1UGVA 1EFNA 2HBWA 2VWFA 2ABLA 2ED0A 2HCKA 2K3BA 1OOTA 1HSQA 3H0HA 5IXFA 2F2XA 1Y0MA 3O5ZA 2LZ6B 2C0TA 2DBMA 3M0TA 1J3TA 4IIOA 1K76A 4CC2A 1SHFA 4J9FA 2FO0A 1RLPC 2KEAA 2DF6A 4HVVA 3GBQA 1T3LA 5L23A 1K4US 3M0UA 1BB9A 5HCKA 1PKSA 3VS1A 1WXTA 1HJDA 4J9GA 1W1FA 4AG1C 2JM9A 2A08A 2FG0A 2HEQA 2DL5A 4RTZA 2RQWA 4HVWA 1KSWA 2O88A 2DMOA 1A0NB 2C0OA 3KFVA 2DA9A 1K0XA 2KXDA 1OV3A 1TUCA 2EPDA 1JQQA 1ZLMA 2AKKA 2KNBB 3SEMA 4AFQC 1UTIA 2DILA 3LH5A 2RQVA 3REBB 4OMMA 2JXBA 1GFDA 4GLMA 2K79A 1JO8A 1GCQA 1HD3A 2J05A 1MV0B 4OMPA 2L2PA 2K2MA 2EGCA 1MV3A 2LQWA 4AG2C 2DJQA 1Y57A 4F14A 3M0PA 2KR3A 4J9HA 1TG0A 2EW3A 2DYBA 2GBQA 3TVTA 2DRMA 2CSQA 4LN2A 1IO6A 1X69A 3THKA 2JM8A 2JW4A 1T0HA 1UHCA 4J9CA 1W70A 2M0YA 1V1CA 2O31A 4J9BA 2EBPA 1WA7A 2EKHA 1SSHA 2VKNA 2LJ1A 3EG2A 3M0QA 1UHFA 4QT7A 3M0SA 1WXBA 2A28A 4EIKA 2EGEA 2D0NA 1KFZA 1VYVA 4Z8AA 4ORZA 3PE0A 2YT6A 1AOJA 1PWTA 3NHNA 3C0CA 4J9EA 1VYTA 3NGPA 3A98A 1WFWA 3I5SA 3VRYA 4DEXA 2AZVA 2MCNA 2L3QA 3FJ5A 2O9SA 1E7OA 2ROLA 2QDLA 5IHNA 2OAWA 1BK2A 2W0ZA 2NWMA 1OPLA 3R6NA 1GL5A 2X3XD 1LCKA 2H8HA 2DRKA 1FYNA 1X43A 2FPEA 2SRCA 2RPNA 2LQNA 1WXUA 4HXJA 2LNHB 1RI9A 2AKLA 2CSIA 2DL7A 2ESWA 1PRLC 2RNAA 2FRYA 1AZGB 3VS3A 2FEIA 3RNJA 1UECA 2BZ8A 2FRWA 2O9VA 5GJWB 1X2KA 1E6GA 2GGRA 1UJ0A 3VS2A 1WX6A 3RBBB 3PVLA 4ZNXA 1XOVA 1QLYA 2A36A 4J9DA 1B3QA 2EYZA 1AWWA 2KRSA 2J7IA 1AZEA 1ABQA 1WI7A 1YWOA 4AFSC 2RF0A 2KBTA 3REAB 2W10A 1NLOC 4OMQA 2K7AA 1AD5A 1M3CA 1QWFA 2OI3A 3IQLA 1QWEA 2DBKA 1RLQC 1GBQA 3VS6A 4E6RA 2RQUA 3EG0A 3UATA 5IH2A 2DL3A 2BTTA 1WYXA 2LJ0A 4Y92A 1UJYA 3SHWA 2CREA 1PRMC 2JTEA 4K11A 1K0SA 2GTJA 1YCSB 3VS7A 2B86A 4Z89A 3H41A 2GQIA 2YUOA 2J6FA 2F2WA 1JEGA 3TSWA 1AWOA 1WIEA 1X27A 2YUPA 1CSKA 1GFCA 4HCKA 1H8KA 2J6OA 3ZL7C 1NEBA 2D1XA 4JZ3A 4RTWA 1VYUA 3EG3A 1G83A 2NUZA 3U23A 2DLPA 2AZSA 1NYGA 3EHRA 4A63B 1ZSGA 2ROTA 4HVUA 4LUDA 2MOXA 4RTYA 5EC7A 2DM1A 2JS2A 1ZUKA 5I11A 2BZXA 2FPDA 1NM7A 3VS4A 2YSQA 1ZBJA 1B07A 1UDLA 2KXCA 3H0IA 2SEMA 2LP5A 2VVKA 2KROA 1M27C 1PKTA 3I9QA 5FWCA 1X6BA 4OMNA 3VS0A 2DNUA 2GNCA 1ARKA 2LX7A 1H3HA 4JZ4A 1I1JA 2AK5A 3I35A 4LUEA 3M0RA 2KT1A 1OPKA 2F2VA 2CH4W 2EYYA 2PZ1A 2JS0A 3PVQA 3EGUA 2O2OA 4FSSA 1KIKA 1KJWA 4JJBA 1AEYA 2DVJA 1SHGA 1M3AA 2EYXA 2DX1A 1AWXA 2LMJA 4LNPA 4J9IA 3H0FA 4JJCA 2ECZA 1CKAA 5IHKA 1BU1A 3NMZC 2EGAA 1ABOA 2FPFA 4KRTA 1SRMA 4JJDA 1OEBA 3UA6A 4WCIA 1T0JA 2LJ3A 3QWYA 4CC3A 1YWPA 1GRIA 1PHTA 1SEMA 1PNJA 2P4RA 2A37A 4LE9A 4OMOA 1UFFA 2PNIA 1RUWA 4RTVA 1QCFA 5IHIA 1U06A 2DL8A 1UG1A 1ZX6A 1FMKA 1Z9QA 2HDAA 4DEYA 2G6FX 4X1VA 1ZUUA 2C0IA 1I0CA 3JV3A 2KYMA 2CT3A 5IXBA 2D8HA 1N5ZA 5I22A 1CKBA 1W6XA 2BZYA 1NG2A 2D8JA 2CT4A 1I07A 1JU5C 1GCQC 1H92A 1E6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMC A;  3EG1 A;  4F17 A;  2YDL A;  2RN8 A;  1JXO A;  3I5R A;  1K1Z A;  1NLP C;  1T3S A;  4CC7 A;  1M8M A;  2JT4 A;  2KYB A;  1ZUY A;  1QKW A;  1NYF A;  4AFZ C;  2CDT A;  2LCS A;  4D8D A;  1G2B A;  2EYW A;  2ED1 A;  2ENM A;  2YUQ A;  2EVR A;  2V1R A;  2V1Q A;  2M51 A;  1U5S A;  2L0A A;  2RQT A;  1UUE A;  2IIM A;  2L3P A;  3EHQ A;  4RUG A;  4JPB W;  2K6D A;  1YNZ A;  2EQI A;  1AWJ A;  4RTX A;  1VA7 A;  4RTT A;  1SRL A;  2KGT A;  1YN8 A;  4OML A;  2E5K A;  2OJ2 A;  2JMA A;  1TUD A;  2KE9 A;  5FW9 A;  3VRZ A;  1JXM A;  2J6K A;  2RMO A;  1GCP A;  1MUZ A;  4Z88 A;  1WDX A;  2K9G A;  1X6G A;  4IIM A;  4CC4 B;  3NPF A;  2KRM A;  4F16 A;  2DL4 A;  1AVZ C;  2CH4 A;  2CUD A;  1K9A A;  2RQR A;  3ULR B;  5GJV B;  3TSZ A;  5ECA A;  4GBQ A;  4D8K A;  3CQT A;  3UF4 A;  2HSP A;  4AFU C;  2YUN A;  1SPK A;  1WLP B;  2KT8 A;  3QWX X;  1YP5 A;  3UA7 A;  2GTO A;  4RTU A;  2XMF A;  3VS5 A;  2DE0 X;  1NEG A;  1X2Q A;  4M4Z A;  1Z9Z A;  4ESR A;  2I0N A;  1GBR A;  1M3B A;  2KRN A;  1S1N A;  2J06 A;  1U3O A;  5FWB A;  1M30 A;  2CUB A;  2L3S A;  1QKX A;  2PTK A;  1BBZ A;  2X3W D;  4R0K A;  2MIO A;  1UE9 A;  1UGV A;  1EFN A;  2HBW A;  2VWF A;  2ABL A;  2ED0 A;  2HCK A;  2K3B A;  1OOT A;  1HSQ A;  3H0H A;  5IXF A;  2F2X A;  1Y0M A;  3O5Z A;  2LZ6 B;  2C0T A;  2DBM A;  3M0T A;  1J3T A;  4IIO A;  1K76 A;  4CC2 A;  1SHF A;  4J9F A;  2FO0 A;  1RLP C;  2KEA A;  2DF6 A;  4HVV A;  3GBQ A;  1T3L A;  5L23 A;  1K4U S;  3M0U A;  1BB9 A;  5HCK A;  1PKS A;  3VS1 A;  1WXT A;  1HJD A;  4J9G A;  1W1F A;  4AG1 C;  2JM9 A;  2A08 A;  2FG0 A;  2HEQ A;  2DL5 A;  4RTZ A;  2RQW A;  4HVW A;  1KSW A;  2O88 A;  2DMO A;  1A0N B;  2C0O A;  3KFV A;  2DA9 A;  1K0X A;  2KXD A;  1OV3 A;  1TUC A;  2EPD A;  1JQQ A;  1ZLM A;  2AKK A;  2KNB B;  3SEM A;  4AFQ C;  1UTI A;  2DIL A;  3LH5 A;  2RQV A;  3REB B;  4OMM A;  2JXB A;  1GFD A;  4GLM A;  2K79 A;  1JO8 A;  1GCQ A;  1HD3 A;  2J05 A;  1MV0 B;  4OMP A;  2L2P A;  2K2M A;  2EGC A;  1MV3 A;  2LQW A;  4AG2 C;  2DJQ A;  1Y57 A;  4F14 A;  3M0P A;  2KR3 A;  4J9H A;  1TG0 A;  2EW3 A;  2DYB A;  2GBQ A;  3TVT A;  2DRM A;  2CSQ A;  4LN2 A;  1IO6 A;  1X69 A;  3THK A;  2JM8 A;  2JW4 A;  1T0H A;  1UHC A;  4J9C A;  1W70 A;  2M0Y A;  1V1C A;  2O31 A;  4J9B A;  2EBP A;  1WA7 A;  2EKH A;  1SSH A;  2VKN A;  2LJ1 A;  3EG2 A;  3M0Q A;  1UHF A;  4QT7 A;  3M0S A;  1WXB A;  2A28 A;  4EIK A;  2EGE A;  2D0N A;  1KFZ A;  1VYV A;  4Z8A A;  4ORZ A;  3PE0 A;  2YT6 A;  1AOJ A;  1PWT A;  3NHN A;  3C0C A;  4J9E A;  1VYT A;  3NGP A;  3A98 A;  1WFW A;  3I5S A;  3VRY A;  4DEX A;  2AZV A;  2MCN A;  2L3Q A;  3FJ5 A;  2O9S A;  1E7O A;  2ROL A;  2QDL A;  5IHN A;  2OAW A;  1BK2 A;  2W0Z A;  2NWM A;  1OPL A;  3R6N A;  1GL5 A;  2X3X D;  1LCK A;  2H8H A;  2DRK A;  1FYN A;  1X43 A;  2FPE A;  2SRC A;  2RPN A;  2LQN A;  1WXU A;  4HXJ A;  2LNH B;  1RI9 A;  2AKL A;  2CSI A;  2DL7 A;  2ESW A;  1PRL C;  2RNA A;  2FRY A;  1AZG B;  3VS3 A;  2FEI A;  3RNJ A;  1UEC A;  2BZ8 A;  2FRW A;  2O9V A;  5GJW B;  1X2K A;  1E6G A;  2GGR A;  1UJ0 A;  3VS2 A;  1WX6 A;  3RBB B;  3PVL A;  4ZNX A;  1XOV A;  1QLY A;  2A36 A;  4J9D A;  1B3Q A;  2EYZ A;  1AWW A;  2KRS A;  2J7I A;  1AZE A;  1ABQ A;  1WI7 A;  1YWO A;  4AFS C;  2RF0 A;  2KBT A;  3REA B;  2W10 A;  1NLO C;  4OMQ A;  2K7A A;  1AD5 A;  1M3C A;  1QWF A;  2OI3 A;  3IQL A;  1QWE A;  2DBK A;  1RLQ C;  1GBQ A;  3VS6 A;  4E6R A;  2RQU A;  3EG0 A;  3UAT A;  5IH2 A;  2DL3 A;  2BTT A;  1WYX A;  2LJ0 A;  4Y92 A;  1UJY A;  3SHW A;  2CRE A;  1PRM C;  2JTE A;  4K11 A;  1K0S A;  2GTJ A;  1YCS B;  3VS7 A;  2B86 A;  4Z89 A;  3H41 A;  2GQI A;  2YUO A;  2J6F A;  2F2W A;  1JEG A;  3TSW A;  1AWO A;  1WIE A;  1X27 A;  2YUP A;  1CSK A;  1GFC A;  4HCK A;  1H8K A;  2J6O A;  3ZL7 C;  1NEB A;  2D1X A;  4JZ3 A;  4RTW A;  1VYU A;  3EG3 A;  1G83 A;  2NUZ A;  3U23 A;  2DLP A;  2AZS A;  1NYG A;  3EHR A;  4A63 B;  1ZSG A;  2ROT A;  4HVU A;  4LUD A;  2MOX A;  4RTY A;  5EC7 A;  2DM1 A;  2JS2 A;  1ZUK A;  5I11 A;  2BZX A;  2FPD A;  1NM7 A;  3VS4 A;  2YSQ A;  1ZBJ A;  1B07 A;  1UDL A;  2KXC A;  3H0I A;  2SEM A;  2LP5 A;  2VVK A;  2KRO A;  1M27 C;  1PKT A;  3I9Q A;  5FWC A;  1X6B A;  4OMN A;  3VS0 A;  2DNU A;  2GNC A;  1ARK A;  2LX7 A;  1H3H A;  4JZ4 A;  1I1J A;  2AK5 A;  3I35 A;  4LUE A;  3M0R A;  2KT1 A;  1OPK A;  2F2V A;  2CH4 W;  2EYY A;  2PZ1 A;  2JS0 A;  3PVQ A;  3EGU A;  2O2O A;  4FSS A;  1KIK A;  1KJW A;  4JJB A;  1AEY A;  2DVJ A;  1SHG A;  1M3A A;  2EYX A;  2DX1 A;  1AWX A;  2LMJ A;  4LNP A;  4J9I A;  3H0F A;  4JJC A;  2ECZ A;  1CKA A;  5IHK A;  1BU1 A;  3NMZ C;  2EGA A;  1ABO A;  2FPF A;  4KRT A;  1SRM A;  4JJD A;  1OEB A;  3UA6 A;  4WCI A;  1T0J A;  2LJ3 A;  3QWY A;  4CC3 A;  1YWP A;  1GRI A;  1PHT A;  1SEM A;  1PNJ A;  2P4R A;  2A37 A;  4LE9 A;  4OMO A;  1UFF A;  2PNI A;  1RUW A;  4RTV A;  1QCF A;  5IHI A;  1U06 A;  2DL8 A;  1UG1 A;  1ZX6 A;  1FMK A;  1Z9Q A;  2HDA A;  4DEY A;  2G6F X;  4X1V A;  1ZUU A;  2C0I A;  1I0C A;  3JV3 A;  2KYM A;  2CT3 A;  5IXB A;  2D8H A;  1N5Z A;  5I22 A;  1CKB A;  1W6X A;  2BZY A;  1NG2 A;  2D8J A;  2CT4 A;  1I07 A;  1JU5 C;  1GCQ C;  1H92 A;  1E6H A; 
#chains in the Genus database with same CATH topology
 3RKW A;  3GPL A;  3EG1 A;  4O6J A;  1ACM B;  2WSC E;  2RN8 A;  2ZPI B;  2DO3 A;  2YWW A;  3O8V A;  1UEB A;  5GAN j;  2HZY A;  4B9X A;  3CC2 A;  2OTJ A;  4MZT A;  3UT1 A;  3HTR A;  2EYW A;  3OYE A;  1GXI E;  1N9S A;  1WHJ A;  2ENM A;  4M77 D;  1IHW A;  3E19 A;  2E6N A;  1F1B B;  1N6A A;  2EVR A;  3V8J A;  5HK0 A;  4C8Q C;  3CMA T;  2DEQ A;  2QTV A;  1UUE A;  2FB7 A;  4JPB W;  2K6D A;  2X9H A;  2EQI A;  3OS0 A;  5AYF A;  2Y4Y A;  1M5Q 1;  3CCQ Q;  4RTT A;  3GF5 A;  2KGT A;  3HKS A;  1YN8 A;  2DK3 A;  5GAN e;  3CME T;  2RHI A;  4DBR A;  3JCM Q;  4E47 A;  5GAN g;  3JCM W;  1YHQ Q;  4RG8 A;  1MUZ A;  2DXB A;  3SWN B;  4PK4 A;  1WDX A;  1WPY A;  2E12 A;  3X28 B;  3QG1 A;  3EFO A;  5CKF A;  1BKB A;  4IIM A;  1MHN A;  2RHU A;  4HA8 A;  4J83 A;  2KRM A;  1PCX A;  2DL4 A;  1AVZ C;  2CUD A;  2RO0 A;  5ECA A;  4D8K A;  1OZ2 A;  5I2M A;  3AHU A;  2A7Y A;  1VQP A;  1SPK A;  1WLP B;  3CC7 T;  1WQW A;  3V7C A;  1YP5 A;  4RTU A;  2DE0 X;  5IAY A;  1X2Q A;  1GBR A;  3L2V A;  1PD1 A;  1MND A;  1U3O A;  2CUB A;  4BY6 C;  4R0K A;  4J6X A;  2PVD B;  1P92 A;  3QZ9 B;  2HBW A;  3CCJ A;  2ATC B;  1VIF A;  3HL8 A;  3MJX A;  2HCK A;  2E70 A;  2F2X A;  1D3B B;  1PSE A;  1M2V A;  3LLR A;  2DER A;  2DBM A;  4MZP A;  1VQ7 Q;  1UGQ B;  2V8K A;  3MEU A;  1XNI A;  1SHF A;  2Y90 A;  4NOY A;  4PLL A;  3QO3 A;  2L5Q A;  3LYI A;  2KEA A;  3PIP A;  1KQ1 A;  2X4W A;  3GBQ A;  1T3L A;  3MO8 A;  1Q81 R;  4ATO A;  1OU9 A;  1K4U S;  1V29 B;  2KI7 A;  2HMA A;  3M0U A;  5GAN 2;  1VQ9 Q;  1G3S A;  4N4G A;  1PKS A;  1WXT A;  2E3I A;  4DOV A;  1VQ8 A;  3CBP A;  1HXD A;  4XU0 A;  3A8M B;  2DL5 A;  3H8Z A;  2RQW A;  4HVW A;  3FLG A;  3G71 A;  2C0O A;  2IPO B;  2DA9 A;  2QQB A;  1MGQ A;  2MPX C;  4OB1 B;  2KNB B;  1VQ5 Q;  2ZZD A;  1WHG A;  1UTI A;  3MET A;  2ZCF B;  1YIJ Q;  1Q7Y C;  3CD6 Q;  2WSF E;  3CCL Q;  2HQX A;  4EMH A;  2L8D A;  1GCQ A;  1HD3 A;  2EKO A;  4L5G A;  4A4F A;  1LVK A;  2D9T A;  2AIR B;  2LCC A;  1FX7 A;  1FMW A;  1Q81 U;  4E7I A;  2M1H A;  3OYD A;  1QMC A;  1B34 A;  3M0P A;  2HQE A;  4J9H A;  1TG0 A;  2QG9 B;  3TVT A;  3JB9 H;  4HCB A;  4JS4 A;  2KDS A;  2JM8 A;  4M75 E;  3CCQ T;  4C92 A;  4IUV A;  1MNE A;  2YHT A;  1V1C A;  1BIA A;  2PUO B;  1BI2 A;  1TH7 A;  2EBP A;  2EKH A;  1QQJ A;  2YRV A;  4A54 A;  4OB0 B;  2LJ1 A;  4JUV A;  2H3E B;  2MK5 A;  3M0Q A;  2RJF A;  4EDU A;  4EIK A;  1KHI A;  1KFZ A;  3PE0 A;  3M58 A;  2K3X A;  5GMK e;  2YRC A;  2YT6 A;  1VQM Q;  4J9E A;  2R5M A;  4A4H A;  3NGP A;  3A98 A;  3TEE A;  2GFU A;  3VRY A;  4N0A C;  2AZV A;  2XIC A;  4LD6 A;  5IHN A;  5A2Q E;  1QVF A;  3A8H B;  1BK2 A;  2W0Z A;  2X4J A;  1OPL A;  3R6N A;  1KC8 U;  1I4K 1;  4DBF A;  4C92 G;  5FU6 C;  4C8Q D;  1YJN A;  3CC7 A;  4HT8 A;  2DL7 A;  2ESW A;  1KD1 R;  2OTJ T;  4M7D B;  3M9Q A;  2FEI A;  2BZ8 A;  1TSF A;  2FRW A;  2E1H A;  2PQW A;  2O9V A;  5GJW B;  2GGR A;  2YRD A;  5LJ5 f;  3J7A F;  4J9D A;  2VC8 A;  3T9N A;  2EYZ A;  2VAS A;  1AZE A;  4OP0 A;  1VQN Q;  4ZN3 A;  3CCU A;  4ZGD B;  3OW2 P;  4C0D C;  4M77 A;  5CKD A;  2HSE B;  3OW2 A;  4OMQ A;  2K7A A;  3PIO A;  2JOY A;  3S3O A;  3IQL A;  2DBK A;  1RLQ C;  4E6R A;  3OYN A;  5IH2 A;  2DL3 A;  2BTT A;  2LJ0 A;  3OMC A;  2CKK A;  1UJY A;  4K11 A;  2DET A;  3VS7 A;  2DTI A;  3OY9 A;  3JB9 D;  3H41 A;  2J6F A;  3CBO A;  1X01 A;  4JS5 A;  3V7R A;  1X27 A;  5GAM j;  4ELY C;  1ZQ1 A;  2D1X A;  2QAZ A;  1JJ2 S;  5L8R E;  3F70 A;  2NUZ A;  3RES A;  2JJ9 A;  2EIF A;  2DLP A;  4M75 A;  1NYG A;  3JCM f;  3I55 T;  3EHR A;  1ZSG A;  1RAA B;  3M55 A;  5J26 A;  5EC7 A;  1PD0 A;  1EZZ B;  2CZ6 B;  4WTO B;  1WHM A;  2JS2 A;  1MMG A;  2MWO A;  4XTW A;  1VQ8 T;  2YSQ A;  1B07 A;  1UDL A;  3HRS A;  1M1G A;  4FT4 A;  2SEM A;  5HY6 A;  2VVK A;  3NTI A;  2DPP B;  2QGG A;  1VQK A;  5GAN 6;  3I9Q A;  2XU8 A;  4PLI A;  4OMN A;  4QQ6 A;  2BUD A;  4E7S A;  1AHJ B;  2ZPE B;  1YJN T;  3E9G A;  2ZPF B;  3M0R A;  2AT1 B;  2ZPH B;  1VQ6 Q;  2CH4 W;  1WQ7 A;  3LW5 E;  2JS0 A;  2OTJ Q;  1MMN A;  2O4X B;  4X9D A;  2GQV A;  1VQO T;  4DQ2 A;  1KJW A;  4LDV A;  1SHG A;  1IZ6 A;  3J81 E;  7AT1 B;  1M1K C;  4XQ3 A;  5GAN 8;  3BDL A;  2LMJ A;  4XTY A;  5FU7 B;  3H0F A;  2DFU A;  1CKA A;  5IHK A;  1S72 Q;  4QVC A;  2EGA A;  2FPF A;  2P0K A;  4JJD A;  1OEB A;  2DEU A;  3CCS T;  4M77 C;  3CXC P;  2RK1 A;  2QYZ A;  2K5L A;  1M90 U;  1G3Y A;  4PJO D;  1YHQ A;  3FJP A;  2O4X A;  3MKD A;  4LE9 A;  4OMO A;  2FZG B;  1QCF A;  2DL8 A;  3BE3 A;  3NFC A;  1IRX A;  1YJ9 Q;  1FMK A;  2HDA A;  3OBW A;  3LGF A;  4DEY A;  4BB7 A;  1IHV A;  1VQ6 A;  3DLM A;  2KYM A;  2CT3 A;  1QVP A;  4NL2 A;  2B8A A;  1N5Z A;  2CT4 A;  3OQ5 A;  1JU5 C;  4EMK B;  2FVU A;  3MEA A;  5KYW A;  2BE7 D;  5CKB A;  2JMC A;  3PFS A;  3SDZ A;  4E7H A;  3JCM J;  3HHT B;  4FCY A;  1JXO A;  3I5R A;  3OYG A;  4CC7 A;  1LPL A;  4ZGJ B;  2EFI A;  4F7U A;  2CDT A;  2LCS A;  5J39 A;  5DLO A;  3OA6 A;  2EJ9 A;  3CCM T;  1DJ7 B;  4BUG A;  5DY9 A;  2A3L A;  2V1Q A;  3JB9 J;  2L0A A;  1OQK A;  2RQT A;  4QKU A;  4C92 C;  4RUG A;  4KGZ B;  2M0O A;  3OS5 A;  3SWN A;  2NUT B;  2KVQ G;  3X26 B;  4AMC A;  1Y07 A;  4OML A;  3NTK A;  1G3T A;  2JMA A;  2KE9 A;  2RMO A;  3M54 A;  1GCP A;  4PJJ A;  4Y91 A;  4MZM A;  1D1A A;  5KYN A;  4OGE A;  1X6G A;  5IT9 E;  3OYY A;  3NPF A;  1S72 T;  3MP6 A;  1K9A A;  4KUI A;  4JRP A;  4FL6 A;  4QQD A;  3BW1 A;  3R6O A;  2LTO A;  3CQT A;  3UF4 A;  2HSP A;  4AFU C;  2HQH A;  1WHH A;  3CXC A;  1M1F A;  4FIB A;  1D09 B;  2FL7 A;  2GTO A;  3VS5 A;  1PG5 B;  2K4Y A;  1D0Y A;  3SB2 A;  1U1S A;  4QVD A;  4R55 A;  4M4Z A;  2GCX A;  1M3B A;  2KRN A;  1S1N A;  2J06 A;  3H9N A;  2L3S A;  1QKX A;  2X51 A;  5GMK m;  2VV5 A;  5CKE A;  2ED0 A;  1M8V A;  2K3B A;  1OOT A;  1HSQ A;  5IXF A;  4A4K A;  4FYV B;  5I2S A;  2F69 A;  5GAN f;  2M9U A;  5LJ5 e;  3VUZ A;  4BE0 A;  2QQS A;  1RLP C;  3EH2 A;  5CVI A;  3CMA A;  4EMK C;  3M57 A;  3JB9 F;  1TTH B;  4PJO E;  1VQ6 T;  1HJD A;  1W1F A;  3JCM b;  3M53 A;  4ANJ A;  4N0A A;  4IUP A;  3RIR A;  1OV3 A;  1TUC A;  2EPD A;  2QDY B;  2AKK A;  3G71 Q;  4E7Z A;  1VUB A;  3SEM A;  4AFQ C;  3M56 A;  4F7U F;  2RQV A;  4OMM A;  3CBM A;  4N4I A;  1JO8 A;  4M7D F;  3NTH A;  3M4Y A;  3JCM g;  1B7T A;  2QA4 Q;  4BDY A;  1MV3 A;  3GIB A;  1PSF A;  5C0M A;  1KQ2 A;  4BAC A;  2JTM A;  1Y57 A;  1G5V A;  2QGF B;  1VQO A;  4EMG A;  2EW3 A;  1N8R U;  1WNL A;  2DRM A;  3OYC A;  1I8F A;  3CC4 A;  2CSQ A;  4LN2 A;  4ZN1 A;  2XI9 A;  1UHC A;  2M0Y A;  2O31 A;  1UGR B;  2CZ7 B;  4YTL A;  9ATC B;  2MF2 A;  2EAY A;  1UB4 A;  2HAX A;  3LGL A;  4ZGE B;  2RI5 A;  2XKO C;  1VQK Q;  4GY5 A;  1WXB A;  1FWZ A;  2PUK B;  2EGE A;  2D0N A;  1VYV A;  1SG5 A;  2YLC A;  2YLB A;  1LJO A;  1YI2 Q;  4BD3 A;  2VYT A;  2KSS A;  1JBM A;  2O9S A;  2ROL A;  1BCM A;  1VQ9 T;  2QDL A;  2QQA A;  1EIF A;  1U8R A;  2CZ1 B;  3RKY A;  1NZ9 A;  5FRM A;  3OYH A;  1O75 A;  2X3X D;  4XU3 A;  2DRK A;  1KG1 A;  1FYN A;  2SRC A;  5GAO l;  2RPN A;  2LQN A;  1RI9 A;  2QEX Q;  2RNA A;  3VS3 A;  3PT9 A;  1UEC A;  1WZO A;  2VUB A;  4FW1 A;  1X75 C;  1X2K A;  1UJ0 A;  2DD4 A;  1QVG S;  1R8O B;  3SFM A;  1QLY A;  1RAF B;  1B3Q A;  4VUB A;  3X25 B;  1ABQ A;  3AT1 B;  5GAN 4;  4AFS C;  4C92 D;  3G71 T;  5EG2 A;  1TOV A;  2W10 A;  1AD5 A;  3G7Z A;  2OI3 A;  4J5Y A;  1QWE A;  4FM4 B;  4CI0 C;  2EYQ A;  3G4S Q;  1M90 R;  2NUP B;  3ZBD A;  3BDU A;  2DXC A;  4IUR A;  4Y92 A;  3SHW A;  2CRE A;  5CQY A;  2MYS A;  1K0S A;  3OW2 S;  1OZ3 A;  1YCS B;  2CGH A;  2B86 A;  3KXT A;  3DKM A;  2MAM A;  4Z89 A;  1WJS A;  2YUO A;  3MP1 A;  4ELZ C;  3L2R A;  3L2U A;  3ER0 A;  1K9M C;  4MDX A;  4N4H A;  1C0M A;  2R5A A;  5KYY B;  2J6O A;  1NEB A;  2EWN A;  4JZ3 A;  4RTW A;  1VYU A;  1I81 A;  1WJR A;  3CCE Q;  2QA4 T;  3U23 A;  3QYG B;  2KAF A;  2LNV A;  4B9W A;  4XK8 E;  1I5O B;  4LUD A;  2PU9 B;  4RCB A;  3M5A A;  4MDW A;  1NM7 A;  1OYX A;  3MHX A;  3CC4 T;  2QA4 A;  4DBQ A;  2P4T A;  1X6O A;  1NJI U;  1RI0 A;  3MP8 A;  4XU2 A;  3G6E A;  1M27 C;  4C5H A;  5GAM e;  3RDV A;  4LDU A;  4PJM A;  5FWC A;  2OTL T;  4C5I A;  4HCC A;  2E6Z A;  3OB9 A;  3VS0 A;  2GNC A;  3VJP A;  3DB4 A;  5CO7 A;  4JZ4 A;  1I1J A;  2CP5 A;  1K9M U;  2DYI A;  4LUE A;  3ZFJ A;  1M90 C;  1OPK A;  4M75 G;  4IKF A;  2PZ1 A;  5CKH A;  2DZC A;  3GOX A;  1IRE B;  2RD1 A;  3EGU A;  1BYM A;  1K73 U;  2EYX A;  1VQ8 Q;  3RR6 A;  2E5Q A;  1VQ9 A;  1MMA A;  4J9I A;  1WGS A;  3A8O B;  4M7A C;  1BU1 A;  4BI4 A;  3C94 A;  1ABO A;  1SRM A;  1K9M R;  4M75 F;  3VU3 C;  2DKG A;  5CK9 A;  2HKN A;  1ZSZ A;  3HP9 A;  3QWY A;  4CC3 A;  2E10 A;  1GRI A;  5KCO A;  1SEM A;  1YIT A;  4IUQ A;  3CPW S;  3CCJ Q;  2X4X A;  2A37 A;  1D1B A;  5LL6 S;  2BE9 B;  5D6Y A;  1R77 A;  2NLU A;  4FT2 A;  1UG1 A;  1ZX6 A;  2LDM A;  3CXC S;  2DTO A;  2CS7 A;  1V76 A;  2COW A;  3D7S B;  1VOM A;  2G6F X;  2QQR A;  4PJN A;  3CPW P;  5M9O A;  1QW1 A;  4HKE A;  1I0C A;  1D0Z A;  1Q82 U;  4M7D C;  5IXB A;  1K73 C;  2CP2 A;  2HKQ B;  1VQP Q;  5I22 A;  1CKB A;  1NG2 A;  1I07 A;  1Q86 U;  4B6M A;  5LJ3 e;  1H92 A;  2AHJ B;  2OX7 A;  4PJO B;  1PC0 A;  4JLG A;  4F17 A;  2QAS A;  4M78 G;  5LJ3 g;  3GNF B;  2EJF A;  4J6W A;  2C06 A;  1KHC A;  2EQK A;  1K1Z A;  1NLP C;  1T3S A;  3CEY A;  1YJ9 T;  1M8M A;  2KYB A;  1ZUY A;  1QKW A;  1NYF A;  1YI2 A;  3TQ7 P;  4AFZ C;  2RJC A;  4D8D A;  5CCA A;  1LOJ A;  1G2B A;  4J7I A;  4LXC A;  3RUX A;  2ED1 A;  2YUQ A;  3LWH A;  1OUL A;  4LD9 K;  3CCV A;  1RAB B;  1U5S A;  2H3J A;  2LC4 A;  4F7U B;  2DAQ A;  5D7U A;  2IIM A;  4FYW B;  2RJE A;  1AWJ A;  1B34 B;  3QDF A;  4E7K A;  1R0B G;  3UDC A;  5CQX A;  2E5K A;  2OJ2 A;  5FW9 A;  1TUD A;  3INZ A;  5GAO r;  1JXM A;  2BKD N;  1M9S A;  5KYW B;  4Z88 A;  4PNO A;  4Z02 A;  2CYZ B;  1Q7Y U;  2OTL Q;  3VYH B;  5HK3 A;  2K5F A;  2E65 A;  3CCU Q;  2A0F B;  5GAN h;  2RQR A;  2RHX A;  3I55 Q;  5D6X A;  4M77 G;  5GJV B;  4GBQ A;  3V8L A;  2YUN A;  1Q81 C;  3QWX X;  3VKI A;  1VQ7 A;  1UGS B;  3LH0 A;  3H6Z A;  2JNG A;  3CCL A;  4XTX A;  1JRI A;  1XJW B;  4PJO G;  3OMG A;  4E7J A;  1BI0 A;  1NEG A;  5HKC A;  1KC8 C;  1AT1 B;  2RJD A;  1TXQ A;  5GAO p;  2M02 A;  1OX9 A;  3EAE A;  1YIT T;  1M30 A;  2HL3 A;  4C8Q F;  5GAO q;  3FC3 A;  2PTK A;  3C12 A;  3QBY A;  2EQM A;  1ZHI A;  1RAD B;  3OYA A;  1YJN Q;  1YJ9 A;  4M7A G;  4V2S A;  4M7A F;  3I56 A;  3KUF A;  5FRO A;  4KT0 E;  5I21 A;  1Q86 R;  3O5Z A;  3OYI A;  1OI1 A;  2C0T A;  4RMO A;  4F7U E;  4FU6 A;  1J3T A;  4DOW A;  4IIO A;  1K76 A;  4CC2 A;  3CCM Q;  4XTU A;  4RKU E;  5A0D A;  2DF6 A;  4HVV A;  5L23 A;  3I55 A;  2V8I A;  2RHY A;  3EGD B;  1BB9 A;  5HCK A;  3C4S A;  3EH1 A;  2JTF A;  4M77 F;  2K5I A;  4AG1 C;  2JM9 A;  3JCM P;  2A08 A;  5LJ3 f;  3OS2 A;  2FG0 A;  3JSC A;  2HEQ A;  5LJ3 j;  1Y96 A;  3C95 A;  4RTZ A;  1Y7X A;  5GMK j;  4M78 A;  2NUP A;  4M7D G;  1D3B A;  2KY9 A;  2CP3 A;  2MMP A;  3HSB A;  5KCH A;  2E3H A;  1BIB A;  3QJ6 A;  5GAN 5;  1YJW T;  1FXX A;  3JCM d;  1N8R R;  4FSX A;  4M77 B;  4F7U G;  3L2W A;  1JB0 E;  4RG2 A;  2JXB A;  2CZ0 B;  1VQ5 T;  1TWB A;  1VQL A;  4A4G A;  4OMP A;  3EFR A;  1YIJ T;  2L2P A;  2E4H A;  1TS9 A;  2LQW A;  1WHL A;  4P5N A;  3P8H A;  5KE3 A;  4II1 A;  4RCC A;  3QYH B;  3FEO A;  2ZAE A;  2KR3 A;  3HFN A;  5GMK l;  2DYB A;  2GBQ A;  4M7D D;  3P8D A;  3JB9 G;  3CCU T;  1UGP B;  1X69 A;  2DIQ A;  3MEV A;  1M4Z A;  1W70 A;  3N5B B;  4OB3 B;  1W2B A;  4J9B A;  1WA7 A;  3JCM V;  3CCR Q;  2L89 A;  5GAM d;  2VKN A;  8ATC B;  3EG2 A;  2ZPG B;  1ZSZ C;  1UHF A;  3M0S A;  3PMT A;  2A28 A;  2R58 A;  4M7A E;  4Z8A A;  1ZBX A;  4ORZ A;  5KH6 A;  1IGU A;  3V7S A;  1AOJ A;  3NHN A;  3C0C A;  3RER A;  3ASK A;  1VQ4 T;  3I5S A;  2ZGW A;  2LVM A;  2L3Q A;  3FJ5 A;  3EGX A;  1E7O A;  2PVO B;  1VQM T;  2OAW A;  2QQ9 A;  4XTV A;  1GL5 A;  3CCL T;  3GP8 A;  2FPE A;  4PL6 A;  3FRN A;  1VQM A;  4HXJ A;  1RAC B;  1QVG A;  2EQU A;  3CPF A;  2CSI A;  1TUG B;  1VQK T;  1FMV A;  1PRL C;  4LDW A;  1AZG B;  3G1J A;  3RNJ A;  2I2L A;  3RMS A;  1WHK A;  3VS2 A;  1M1K U;  3OYF A;  2JZ2 A;  3RBB B;  5FLX E;  3QII A;  3PVL A;  4QVZ A;  1XOV A;  3HPW A;  1OX8 A;  1Q95 G;  5LJ5 g;  2R57 A;  2OAU A;  4OGC A;  3S6W A;  2KRS A;  1WI7 A;  4FW2 A;  1YWO A;  2LRQ A;  3UPU A;  1YJW Q;  4KGV B;  3REA B;  1EX4 A;  4KH1 B;  1NLO C;  3X20 B;  5GAM f;  1QWF A;  3VS6 A;  4NL3 A;  1GBQ A;  1VQN T;  3UAT A;  5A0G A;  3CCV T;  1WYX A;  2JTE A;  1S72 A;  3SWN C;  4PJO F;  2GTJ A;  4QW2 A;  4JRI A;  1VQL T;  5IN1 A;  2F2W A;  1JEG A;  2FZC B;  1VQ5 A;  3VYG A;  1HYO A;  3TSW A;  3CD6 A;  1KK7 A;  1OU8 A;  1WIE A;  5C6S A;  2YUP A;  1CSK A;  1RAE B;  1GFC A;  1XQH A;  4HCK A;  3ZL7 C;  2CP0 A;  3FDR A;  3JAM E;  1RAH B;  2F5K A;  3EG3 A;  2QEX A;  2FHD A;  3QPH A;  2MI6 A;  4PJL A;  3OYB A;  2AZS A;  3UWN A;  1ZA1 B;  2LQ8 A;  4A63 B;  2MOX A;  2XDD A;  2DM1 A;  2M16 A;  4BY6 B;  4DA4 A;  5I11 A;  2BZX A;  4JRQ A;  2EJG A;  1ZBJ A;  1Y71 A;  3H0I A;  2P84 A;  2QEX T;  1RL2 A;  2LP5 A;  5CAI A;  5KYX A;  2PVG B;  1PKT A;  3JCM c;  3OYJ A;  1K8A R;  1N27 A;  1X6B A;  4XU1 A;  2VB6 A;  1QP3 A;  2X35 A;  1ARK A;  2LX7 A;  1H3H A;  8AT1 B;  3TCJ A;  3PTA A;  3WXM B;  3I35 A;  2KT1 A;  1VQ4 Q;  4C0D B;  2O2O A;  4UC4 A;  4JLI A;  1XTD A;  4C5E A;  4JJB A;  1VQ7 T;  2DVJ A;  1IB8 A;  4CRI A;  3X24 B;  1I5L A;  2DX1 A;  4PFP A;  5A0L A;  1NJI R;  4LNP A;  1C1A A;  3L1A A;  1YCY A;  3OSS C;  2ECZ A;  4KRT A;  2XDP A;  5CIU A;  2XHC A;  3CME Q;  5KYY A;  1G3W A;  4WCI A;  3CCM A;  2LJ3 A;  1Y96 B;  1YHQ T;  4ZTJ A;  3KBG A;  4F04 B;  2XG8 D;  1PNJ A;  2WSE E;  4KUL A;  1H3Z A;  2OTL A;  3E1S A;  1UFF A;  2RI3 A;  1RUW A;  3CCR T;  2F5T X;  4RTV A;  2ZPB B;  1KD1 U;  5IHI A;  3CCQ A;  3QDR B;  1HK9 A;  2Z0W A;  1NE8 A;  2JVV A;  1ZUU A;  5KYU B;  3Q1J A;  2FYK A;  4DBH A;  2QTX A;  5GAN 3;  1Q86 C;  1K8A C;  1O9S A;  3JCM h;  3G6E Q;  1W6X A;  2BZY A;  2D8J A;  5GAO m;  3CMA Q;  1WJQ A;  3M4G A;  5FWB A;  3RMQ A;  1E6H A;  5KYU A;  3P8B B;  3OYL A;  2YDL A;  2WAC A;  3S3N A;  4C0Z A;  2RB6 A;  3A8G B;  4J7F A;  2F1L A;  2JT4 A;  4C8Q B;  1M1K R;  4FYX B;  1IXD A;  3S3M A;  3OYM A;  3CCS Q;  2V1R A;  2M51 A;  4O5V A;  3RKX A;  4KUD K;  2QXF A;  3ME9 A;  2KQW A;  2L3P A;  3EHQ A;  5GAM h;  1YNZ A;  4HT9 A;  4RTX A;  1VA7 A;  1SRL A;  2DVE A;  2IVW A;  1R0C B;  2HBP A;  2XK0 A;  1VIE A;  3VRZ A;  2J6K A;  5GAM g;  2XDB A;  4M7D E;  2K9G A;  2BIV A;  1BI1 A;  4L59 A;  4XTZ A;  1RAG B;  4CC4 B;  1N8R C;  1TU0 B;  5D6W A;  4F16 A;  2CH4 A;  2DIG A;  1VQL Q;  3ULR B;  3CC2 T;  3TSZ A;  1YJW A;  3ZEH A;  4R56 A;  1QCN A;  2GF7 A;  4BI8 B;  4PKC C;  4ZTF A;  2KT8 A;  2DZ9 A;  4C92 F;  3UA7 A;  2XMF A;  3LX7 A;  4E7L A;  3CCR A;  3MEW A;  4MML A;  4ESR A;  1Z9Z A;  1VQP T;  2I0N A;  4C5G A;  2Y4X A;  3OYK A;  3MPU B;  4PFO A;  1BBZ A;  3EFO B;  2X3W D;  2MIO A;  1UE9 A;  1M2O A;  4JRK A;  1UGV A;  3PNW C;  1EFN A;  2VWF A;  4C92 E;  1ZA2 B;  1Q82 C;  6AT1 B;  2ABL A;  4C8Q E;  3JRZ A;  3H0H A;  2HL5 C;  1Y0M A;  2LZ6 B;  2RK2 A;  1BCO A;  2NYS A;  3G6E T;  1Q7Y R;  3M0T A;  3CPW A;  5CR2 A;  3CME A;  2RI2 A;  3L2Q A;  3QXE B;  4J9F A;  2FO0 A;  2JUF A;  3CD6 T;  4C0F A;  4M75 C;  5GMK h;  1KQS P;  5LJ3 h;  3GLX A;  2JN0 A;  2P0Q A;  3L2Z A;  3VS1 A;  4Q5W A;  3E2U A;  4J9G A;  3EGD A;  3M59 A;  1G8X A;  1YBY A;  2V26 A;  5LJ5 h;  4M7A D;  1KSW A;  2O88 A;  2DMO A;  1A0N B;  1VQN A;  1KQS S;  3KFV A;  2E64 A;  3QUI A;  1YI2 T;  1K0X A;  2KXD A;  3BFM A;  1JQQ A;  1ZLM A;  2D0Q B;  2HD0 A;  3OS1 A;  2DIL A;  3LH5 A;  4EMK A;  3REB B;  1GFD A;  4M75 B;  5DLQ E;  3VUB A;  4GLM A;  4OF1 A;  4BDZ A;  3QZ5 B;  2K79 A;  4LDX A;  2V8J A;  2COY A;  1U1T A;  2J05 A;  1MV0 B;  4JDS A;  2XD0 A;  2K2M A;  2DTH A;  2EGC A;  4C8Q G;  4AG2 C;  5FU7 C;  2K2V A;  4WF2 A;  4C8Q A;  2DJQ A;  4F14 A;  4OMF B;  3URG A;  3A5Z B;  3G4S A;  1NBE B;  2RM4 A;  5FRN A;  3L42 A;  2VGM A;  3JB9 I;  2D6F A;  1BI3 A;  2LT1 A;  3I56 Q;  1IO6 A;  3THK A;  2JW4 A;  1T0H A;  4J9C A;  3JCM X;  1VQ4 A;  1JJ2 A;  4PJO C;  1SSH A;  4A53 A;  4QT7 A;  3OSV A;  3FB9 A;  1N9R A;  1W4S A;  1PWT A;  2RHZ A;  1VYT A;  1WFW A;  5GAN 7;  4M78 B;  4DEX A;  2MCN A;  2NUT A;  4J6Y A;  4XAX B;  2NWM A;  2QI2 A;  1LCK A;  2H8H A;  1NPP A;  1X43 A;  2EQJ A;  2DXU A;  1QVG P;  3LWI A;  2VXE A;  2LQK A;  4M7D A;  1QCO A;  1WXU A;  2LNH B;  4FYY B;  2AKL A;  1D1C A;  2FRY A;  1QP2 A;  4MMK A;  2XID A;  3QSU A;  1C6V X;  5LJ3 d;  4A4E A;  1QVF P;  1E6G A;  1WX6 A;  1YIJ A;  2LX9 A;  4M78 C;  4ZNX A;  2DXT A;  5LJ5 d;  3VV0 A;  2A36 A;  1W2B S;  2DJZ A;  4M78 F;  2X4Y A;  3E9F A;  1AWW A;  3QHS A;  2J7I A;  3BY7 A;  3G4S T;  2RF0 A;  5GAN d;  1QVF S;  4IUT A;  3EG9 B;  4Y28 E;  2KBT A;  4IUU A;  1YIT Q;  3CC2 Q;  1D0X A;  3HRT A;  1M3C A;  4HCZ A;  2CP6 A;  2RQU A;  3EG0 A;  1W2B P;  5DM7 R;  3CCE A;  1Q82 R;  1KD1 C;  1PRM C;  4M7A B;  4OB2 B;  3TU4 K;  4C92 B;  4BE1 A;  2YXY A;  4BI3 A;  4M77 E;  2GQI A;  4X9C A;  3JCM e;  4L6V 5;  3EGX B;  4KGX B;  4M7A A;  3CCE T;  1AWO A;  2VGN A;  3WVD B;  3CCS A;  4D6W A;  2KMT A;  3I56 T;  2FZK B;  1KC8 R;  5J3B A;  1H8K A;  1M2V B;  3QKJ A;  4J8O A;  5AT1 B;  1YFN A;  4PJO A;  3MCA B;  1G83 A;  4M75 D;  2E41 A;  2QK0 A;  5GAO n;  1IGQ A;  3CC4 Q;  2ROT A;  1K8A U;  4HVU A;  4RTY A;  3QJY A;  1VQO Q;  3GNG A;  4M78 D;  4ME7 A;  1H64 1;  1ZUK A;  4BE2 A;  3TRE A;  3J80 E;  2CP7 A;  2FPD A;  3VS4 A;  1JJ2 P;  2KXC A;  2HNI A;  1K73 R;  2RA2 A;  2KRO A;  2LCL A;  2O01 E;  3DB3 A;  3FIF A;  3OBY A;  4KH0 B;  2DNU A;  3V8K A;  2L3R A;  2COZ A;  3HFO A;  2AK5 A;  1PM3 A;  4M78 E;  2MWP A;  2F2V A;  2EYY A;  4NS5 A;  2KK4 A;  3WVE B;  3PVQ A;  1MMD A;  4FSS A;  1KIK A;  4AT1 B;  3A8L B;  3SD4 A;  1AEY A;  1SKU B;  1M3A A;  2RH2 A;  3PMI A;  1AWX A;  5FU6 B;  2K57 A;  4JJC A;  4TVR A;  3PGG A;  3NMZ C;  3CCV Q;  3CCJ T;  5LJ5 j;  3UA6 A;  1RAI B;  1T0J A;  3CC7 Q;  4GLK A;  4E2F B;  1YWP A;  1PHT A;  4LDY A;  2K3Y A;  2LT4 A;  1SF9 A;  2P4R A;  1SSF A;  1LNX A;  3EFS A;  2P0P A;  3A1P A;  2PNI A;  3HRU A;  1ZSZ B;  1U06 A;  2VXF A;  1KQS A;  3EG9 A;  4QQG A;  1Z9Q A;  1NPR A;  4PFZ A;  4X1V A;  5KYX B;  1NJI C;  2C0I A;  4EPC A;  2DD5 A;  4X34 A;  3JV3 A;  4KBM B;  4OVA A;  4JJN K;  5KE2 A;  5GMK i;  2D8H A;  3DLL A;  2G3R A;  4C0G A;  1GCQ C;  2IG0 A;  2GFA A; 
#chains in the Genus database with same CATH homology
 2JMC A;  3EG1 A;  4F17 A;  2YDL A;  2RN8 A;  1JXO A;  3I5R A;  1K1Z A;  1NLP C;  1T3S A;  4CC7 A;  1M8M A;  2JT4 A;  2KYB A;  1ZUY A;  1QKW A;  1NYF A;  4AFZ C;  2CDT A;  2LCS A;  4D8D A;  1G2B A;  2EYW A;  2ED1 A;  2ENM A;  2YUQ A;  2EVR A;  2V1R A;  2V1Q A;  2M51 A;  1U5S A;  2L0A A;  2RQT A;  1UUE A;  2IIM A;  2L3P A;  3EHQ A;  4RUG A;  4JPB W;  2K6D A;  1YNZ A;  2EQI A;  1AWJ A;  4RTX A;  1VA7 A;  4RTT A;  1SRL A;  2KGT A;  1YN8 A;  4OML A;  2E5K A;  2OJ2 A;  2JMA A;  1TUD A;  2KE9 A;  5FW9 A;  3VRZ A;  1JXM A;  2J6K A;  2RMO A;  1GCP A;  1MUZ A;  4Z88 A;  1WDX A;  2K9G A;  1X6G A;  4IIM A;  4CC4 B;  3NPF A;  2KRM A;  4F16 A;  2DL4 A;  1AVZ C;  2CH4 A;  2CUD A;  1K9A A;  2RQR A;  3ULR B;  5GJV B;  3TSZ A;  5ECA A;  4GBQ A;  4D8K A;  3CQT A;  3UF4 A;  2HSP A;  4AFU C;  2YUN A;  1SPK A;  1WLP B;  2KT8 A;  3QWX X;  1YP5 A;  3UA7 A;  2GTO A;  4RTU A;  2XMF A;  3VS5 A;  2DE0 X;  1NEG A;  1X2Q A;  4M4Z A;  1Z9Z A;  4ESR A;  2I0N A;  1GBR A;  1M3B A;  2KRN A;  1S1N A;  2J06 A;  1U3O A;  5FWB A;  1M30 A;  2CUB A;  2L3S A;  1QKX A;  2PTK A;  1BBZ A;  2X3W D;  4R0K A;  2MIO A;  1UE9 A;  1UGV A;  1EFN A;  2HBW A;  2VWF A;  2ABL A;  2ED0 A;  2HCK A;  2K3B A;  1OOT A;  1HSQ A;  3H0H A;  5IXF A;  2F2X A;  1Y0M A;  3O5Z A;  2LZ6 B;  2C0T A;  2DBM A;  3M0T A;  1J3T A;  4IIO A;  1K76 A;  4CC2 A;  1SHF A;  4J9F A;  2FO0 A;  1RLP C;  2KEA A;  2DF6 A;  4HVV A;  3GBQ A;  1T3L A;  5L23 A;  1K4U S;  3M0U A;  1BB9 A;  5HCK A;  1PKS A;  3VS1 A;  1WXT A;  1HJD A;  4J9G A;  1W1F A;  4AG1 C;  2JM9 A;  2A08 A;  2FG0 A;  2HEQ A;  2DL5 A;  4RTZ A;  2RQW A;  4HVW A;  1KSW A;  2O88 A;  2DMO A;  1A0N B;  2C0O A;  3KFV A;  2DA9 A;  1K0X A;  2KXD A;  1OV3 A;  1TUC A;  2EPD A;  1JQQ A;  1ZLM A;  2AKK A;  2KNB B;  3SEM A;  4AFQ C;  1UTI A;  2DIL A;  3LH5 A;  2RQV A;  3REB B;  4OMM A;  2JXB A;  1GFD A;  4GLM A;  2K79 A;  1JO8 A;  1GCQ A;  1HD3 A;  2J05 A;  1MV0 B;  4OMP A;  2L2P A;  2K2M A;  2EGC A;  1MV3 A;  2LQW A;  4AG2 C;  2DJQ A;  1Y57 A;  4F14 A;  3M0P A;  2KR3 A;  4J9H A;  1TG0 A;  2EW3 A;  2DYB A;  2GBQ A;  3TVT A;  2DRM A;  2CSQ A;  4LN2 A;  1IO6 A;  1X69 A;  3THK A;  2JM8 A;  2JW4 A;  1T0H A;  1UHC A;  4J9C A;  1W70 A;  2M0Y A;  1V1C A;  2O31 A;  4J9B A;  2EBP A;  1WA7 A;  2EKH A;  1SSH A;  2VKN A;  2LJ1 A;  3EG2 A;  3M0Q A;  1UHF A;  4QT7 A;  3M0S A;  1WXB A;  2A28 A;  4EIK A;  2EGE A;  2D0N A;  1KFZ A;  1VYV A;  4Z8A A;  4ORZ A;  3PE0 A;  2YT6 A;  1AOJ A;  1PWT A;  3NHN A;  3C0C A;  4J9E A;  1VYT A;  3NGP A;  3A98 A;  1WFW A;  3I5S A;  3VRY A;  4DEX A;  2AZV A;  2MCN A;  2L3Q A;  3FJ5 A;  2O9S A;  1E7O A;  2ROL A;  2QDL A;  5IHN A;  2OAW A;  1BK2 A;  2W0Z A;  2NWM A;  1OPL A;  3R6N A;  1GL5 A;  2X3X D;  1LCK A;  2H8H A;  2DRK A;  1FYN A;  1X43 A;  2FPE A;  2SRC A;  2RPN A;  2LQN A;  1WXU A;  4HXJ A;  2LNH B;  1RI9 A;  2AKL A;  2CSI A;  2DL7 A;  2ESW A;  1PRL C;  2RNA A;  2FRY A;  1AZG B;  3VS3 A;  2FEI A;  3RNJ A;  1UEC A;  2BZ8 A;  2FRW A;  2O9V A;  5GJW B;  1X2K A;  1E6G A;  2GGR A;  1UJ0 A;  3VS2 A;  1WX6 A;  3RBB B;  3PVL A;  4ZNX A;  1XOV A;  1QLY A;  2A36 A;  4J9D A;  1B3Q A;  2EYZ A;  1AWW A;  2KRS A;  2J7I A;  1AZE A;  1ABQ A;  1WI7 A;  1YWO A;  4AFS C;  2RF0 A;  2KBT A;  3REA B;  2W10 A;  1NLO C;  4OMQ A;  2K7A A;  1AD5 A;  1M3C A;  1QWF A;  2OI3 A;  3IQL A;  1QWE A;  2DBK A;  1RLQ C;  1GBQ A;  3VS6 A;  4E6R A;  2RQU A;  3EG0 A;  3UAT A;  5IH2 A;  2DL3 A;  2BTT A;  1WYX A;  2LJ0 A;  4Y92 A;  1UJY A;  3SHW A;  2CRE A;  1PRM C;  2JTE A;  4K11 A;  1K0S A;  2GTJ A;  1YCS B;  3VS7 A;  2B86 A;  4Z89 A;  3H41 A;  2GQI A;  2YUO A;  2J6F A;  2F2W A;  1JEG A;  3TSW A;  1AWO A;  1WIE A;  1X27 A;  2YUP A;  1CSK A;  1GFC A;  4HCK A;  1H8K A;  2J6O A;  3ZL7 C;  1NEB A;  2D1X A;  4JZ3 A;  4RTW A;  1VYU A;  3EG3 A;  1G83 A;  2NUZ A;  3U23 A;  2DLP A;  2AZS A;  1NYG A;  3EHR A;  4A63 B;  1ZSG A;  2ROT A;  4HVU A;  4LUD A;  2MOX A;  4RTY A;  5EC7 A;  2DM1 A;  2JS2 A;  1ZUK A;  5I11 A;  2BZX A;  2FPD A;  1NM7 A;  3VS4 A;  2YSQ A;  1ZBJ A;  1B07 A;  1UDL A;  2KXC A;  3H0I A;  2SEM A;  2LP5 A;  2VVK A;  2KRO A;  1M27 C;  1PKT A;  3I9Q A;  5FWC A;  1X6B A;  4OMN A;  3VS0 A;  2DNU A;  2GNC A;  1ARK A;  2LX7 A;  1H3H A;  4JZ4 A;  1I1J A;  2AK5 A;  3I35 A;  4LUE A;  3M0R A;  2KT1 A;  1OPK A;  2F2V A;  2CH4 W;  2EYY A;  2PZ1 A;  2JS0 A;  3PVQ A;  3EGU A;  2O2O A;  4FSS A;  1KIK A;  1KJW A;  4JJB A;  1AEY A;  2DVJ A;  1SHG A;  1M3A A;  2EYX A;  2DX1 A;  1AWX A;  2LMJ A;  4LNP A;  4J9I A;  3H0F A;  4JJC A;  2ECZ A;  1CKA A;  5IHK A;  1BU1 A;  3NMZ C;  2EGA A;  1ABO A;  2FPF A;  4KRT A;  1SRM A;  4JJD A;  1OEB A;  3UA6 A;  4WCI A;  1T0J A;  2LJ3 A;  3QWY A;  4CC3 A;  1YWP A;  1GRI A;  1PHT A;  1SEM A;  1PNJ A;  2P4R A;  2A37 A;  4LE9 A;  4OMO A;  1UFF A;  2PNI A;  1RUW A;  4RTV A;  1QCF A;  5IHI A;  1U06 A;  2DL8 A;  1UG1 A;  1ZX6 A;  1FMK A;  1Z9Q A;  2HDA A;  4DEY A;  2G6F X;  4X1V A;  1ZUU A;  2C0I A;  1I0C A;  3JV3 A;  2KYM A;  2CT3 A;  5IXB A;  2D8H A;  1N5Z A;  5I22 A;  1CKB A;  1W6X A;  2BZY A;  1NG2 A;  2D8J A;  2CT4 A;  1I07 A;  1JU5 C;  1GCQ C;  1H92 A;  1E6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...