2FPEA

Conserved dimerization of the ib1 src-homology 3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
b'GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-jun-amino-terminal kinase interacting protein 1
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 14
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpeA00
2FPEA 1H92A 2ROTA 2GBQA 4WCIA 2JXBA 2E5KA 2RMOA 2ESWA 2DNUA 3C0CA 3ZL7C 2JTEA 1QKWA 2BTTA 1X6BA 1J3TA 1U5SA 1ZUUA 1W70A 3NPFA 2DL4A 2FRWA 2JS2A 2K3BA 4K11A 2CUDA 3VS4A 1QCFA 2FEIA 3UA6A 2HDAA 1K1ZA 1B07A 4HVUA 4F14A 2G6FX 2BZXA 1ZSGA 5FW9A 3NMZC 3UA7A 4Y92A 3VRYA 4ZNXA 2LJ0A 1GCPA 2K9GA 1HSQA 2OJ2A 1U3OA 3VRZA 2MCNA 1UHFA 4RTVA 4IIOA 2J05A 4QT7A 2KRMA 2RNAA 4A63B 4F17A 2KXCA 4KRTA 1SEMA 2YUQA 1UJ0A 1W6XA 1BBZA 2RQWA 1UHCA 2LJ3A 1ZUKA 4ORZA 1E6GA 5GJWB 1UFFA 2FRYA 4LE9A 5IHIA 2CREA 1CKBA 3EG3A 4CC3A 2YUPA 1I07A 5FWBA 4D8KA 2P4RA 4HCKA 1ZBJA 4FSSA 4AFSC 3LH5A 2DJQA 1MUZA 3SHWA 2ROLA 2A37A 1X6GA 1PNJA 5GJVB 2CT3A 4RTYA 2CDTA 2DL5A 2F2VA 1BU1A 4X1VA 2EQIA 4OMQA 1PKTA 3GBQA 1RI9A 2PZ1A 2LZ6B 2DVJA 2M0YA 2VVKA 1AWXA 1M30A 4LUDA 3H0FA 1YCSB 2EBPA 2EGEA 2AK5A 2J6FA 2JM8A 2EW3A 2JM9A 2EPDA 2LP5A 1WFWA 2K6DA 1PKSA 1JU5C 2DX1A 1SRMA 1A0NB 2LMJA 3IQLA 4AFQC 1NLOC 1T3LA 5IXFA 2KE9A 2J7IA 2LQWA 4Z88A 5ECAA 1WI7A 1ZLMA 1UUEA 1WIEA 2W10A 4Z8AA 1B3QA 4DEXA 1AOJA 1S1NA 2KEAA 1AWJA 2D0NA 1JEGA 2J6KA 4JJBA 1VYVA 3VS2A 1ABOA 1NM7A 1W1FA 3TVTA 1IO6A 3VS0A 1TUDA 1WA7A 1WXUA 2FPDA 4AFUC 2EVRA 2NWMA 3VS5A 1K0SA 2RPNA 1VYTA 2F2WA 4JJDA 1MV0B 2O9SA 2K2MA 2KROA 2GQIA 4CC2A 1GCQC 4M4ZA 2CH4A 2EGAA 2O31A 1I0CA 1JXOA 1ZX6A 2VWFA 3FJ5A 1UGVA 3M0UA 1WLPB 3M0SA 2L3SA 2GGRA 4JZ3A 4LN2A 1HD3A 2C0TA 2V1QA 3EG2A 2XMFA 5I22A 1PRMC 2O88A 3M0TA 3THKA 3I35A 1X69A 1GFCA 4RTWA 4F16A 1N5ZA 2KRNA 5IXBA 1QLYA 2SRCA 1H3HA 4J9BA 4J9IA 2QDLA 2DLPA 4EIKA 1SPKA 2D8JA 4D8DA 1QWFA 2EYXA 1AZGB 2D8HA 2JW4A 5IHKA 1UJYA 1X27A 2ED0A 1VA7A 1I1JA 2DYBA 1G2BA 3RNJA 3EHQA 4OMNA 3VS3A 4OMLA 2DL3A 1NLPC 1RUWA 2MIOA 1NEBA 1AZEA 4LUEA 2J6OA 2KYMA 4J9FA 4JZ4A 4RTTA 2LNHB 1XOVA 1KJWA 1E6HA 2KBTA 2B86A 4AG1C 2GTOA 2VKNA 2FO0A 3KFVA 2L0AA 4LNPA 3R6NA 4Z89A 2RQTA 2K79A 2DBMA 1FMKA 2YDLA 1PRLC 2L3PA 1AVZC 1MV3A 1GBQA 4J9CA 2HBWA 2NUZA 3VS6A 4JJCA 1Z9QA 2GTJA 1UDLA 2W0ZA 4HVVA 2V1RA 4JPBW 2A08A 2I0NA 1RLPC 1SHFA 1WXBA 1RLQC 3NHNA 3EHRA 1JQQA 1OOTA 4AFZC 2EYYA 2HSPA 2KGTA 3CQTA 4AG2C 3EG0A 2JS0A 1CSKA 2AKLA 2KT8A 2L3QA 1OPLA 2CUBA 1UECA 2AZSA 1JXMA 2PNIA 2O9VA 1NYFA 3UATA 3SEMA 2ED1A 3M0PA 1KSWA 1FYNA 2CSIA 4J9EA 4CC4B 3TSZA 2A28A 2KT1A 2DL8A 2F2XA 2ENMA 1YP5A 1K76A 1M3BA 2D1XA 3I5SA 4DEYA 1H8KA 1GRIA 1OPKA 4GBQA 2DL7A 2YT6A 3A98A 2C0IA 2C0OA 1PWTA 5L23A 2EYWA 4RTXA 2L2PA 3M0RA 1UE9A 2H8HA 1WXTA 3I5RA 1T3SA 2DM1A 2DE0X 2DRMA 2RQUA 2ABLA 3RBBB 2JT4A 3TSWA 3U23A 2JMAA 1YWPA 2J06A 3ULRB 3VS1A 3PVQA 3QWYA 4RTZA 2O2OA 1YWOA 2DA9A 1M27C 2KYBA 3REAB 1X2KA 2HEQA 4IIMA 1M3AA 1AEYA 4E6RA 2AZVA 1NEGA 3O5ZA 1TG0A 1SHGA 1K0XA 4RUGA 4OMOA 1TUCA 2FG0A 2YUNA 2KNBB 5HCKA 4J9GA 2SEMA 3H0IA 1ABQA 2BZYA 3REBB 1X43A 1BB9A 1YNZA 2OAWA 1GFDA 3EG1A 4HVWA 1GCQA 1M3CA 3H0HA 2BZ8A 1M8MA 3EGUA 2LX7A 2EKHA 1V1CA 2M51A 2JMCA 3JV3A 1NG2A 5IH2A 1Z9ZA 1OV3A 1KIKA 2GNCA 5I11A 2RN8A 1U06A 1T0HA 1K9AA 2DBKA 1ZUYA 1JO8A 1PHTA 1ARKA 1LCKA 1NYGA 1Y57A 1Y0MA 1E7OA 1K4US 1GBRA 2X3WD 1KFZA 1VYUA 2CSQA 1WYXA 4CC7A 2KRSA 4J9DA 3M0QA 1AWWA 3VS7A 5EC7A 2DRKA 2IIMA 3QWXX 4R0KA 2RF0A 2DF6A 3UF4A 2RQRA 4OMMA 4HXJA 1AD5A 2A36A 1WX6A 2MOXA 2K7AA 1EFNA 2EGCA 1SSHA 2LQNA 4ESRA 1QWEA 1YN8A 3PVLA 2YUOA 2HCKA 1UG1A 2X3XD 1BK2A 1T0JA 2PTKA 1GL5A 1G83A 3I9QA 3H41A 5FWCA 4GLMA 2KR3A 1WDXA 1CKAA 1QKXA 1UTIA 3NGPA 2CH4W 2EYZA 4J9HA 3PE0A 2CT4A 2AKKA 2YSQA 2ECZA 5IHNA 2FPFA 1HJDA 2KXDA 1X2QA 2LCSA 2OI3A 1AWOA 1SRLA 2RQVA 4OMPA 2DILA 4RTUA 2DMOA 1OEBA 2LJ1A
chains in the Genus database with same CATH superfamily
3CCVQ 4XQ3A 3JCMb 2ROTA 1YJNT 5I21A 4PJOA 5KYNA 2RMOA 2ESWA 3AT1B 1VQ6Q 2BTTA 2MF2A 1JB0E 3NPFA 2DJZA 4Q5WA 2JS2A 4MMKA 2QA4Q 2OAUA 2E6NA 4J6WA 2FEIA 3UA6A 3VS4A 4DOWA 5FLXE 4JRQA 2QQRA 4R55A 3C12A 1ZSGA 3NMZC 3L2VA 1VQ9T 4ZNXA 4M7DC 1X75C 5HK0A 3LLRA 5KE2A 4RG8A 4ZTFA 1I4K1 2IVWA 1UHFA 1OX9A 4IIOA 2J05A 1QVGS 2X4WA 4F17A 3VU3C 3G4SQ 4KRTA 5CQXA 1UJ0A 2JVVA 1YIJT 3CCRA 3E19A 1YITA 1BBZA 4M77G 1D0YA 2KSSA 2RQWA 4QQ6A 2LJ3A 4KUIA 4KH0B 4ORZA 1E6GA 3CCVA 1M8VA 1YJNQ 5IHIA 2RJDA 1CKBA 3LGFA 2O4XB 1VQ6A 1I07A 4C8QG 3MPUB 5A0GA 4PJJA 4D8KA 1UGRB 4E7ZA 4HCKA 1IGQA 2DAQA 4AFSC 2QA4A 1BI0A 4FCYA 1MUZA 1N8RU 5AT1B 1VQ9Q 1W2BA 2A37A 1X6GA 4DBRA 4N4GA 5CO7A 2QEXT 5IN1A 2PUKB 3QO3A 4BI4A 9ATCB 2DL5A 2F2VA 3VKIA 2A3LA 3CCMA 3G4SA 1PD1A 1YIJQ 4F7UG 8ATCB 2XD0A 1PKTA 3GBQA 3FB9A 4BY6C 2LZ6B 1AWXA 4YTLA 2MPXC 4LD9K 4LUDA 1YCSB 1BCOA 3L2WA 1YJNA 2JM8A 5GAN7 2K6DA 1JU5C 3OYYA 1KQ1A 4HCZA 1A0NB 1KHCA 3OBYA 5IXFA 1QP2A 2VXEA 1VQ7T 2PVDB 1WI7A 2V26A 3A8HB 3HTRA 1WIEA 2W10A 4M75B 4X34A 4XAXB 2KEAA 3FIFA 2D0NA 2DO3A 1JEGA 3JB9I 3OS1A 1WHKA 2COZA 5LJ5d 2XICA 1VQ9A 2JZ2A 3VS0A 1TUDA 1WA7A 1WXUA 2FPDA 2QEXQ 2YRCA 1KHIA 4EPCA 2ZCFB 4FYWB 3I55T 1K73R 3MCAB 2KROA 1ZHIA 4CC2A 3QYHB 4HT9A 1YIJA 4DBFA 4IUUA 4J6XA 3SDZA 2LC4A 2XMFA 2RHXA 3M0TA 1K8AU 4M7AE 1H641 2Y4XA 2EIFA 4FSXA 5GMKl 1VQ7Q 4RTWA 4BI3A 1MNEA 2KRNA 2YRVA 2QDLA 2M16A 2E6ZA 4EIKA 1OYXA 2P0QA 1VQ4T 2X4JA 3QBYA 3HFNA 1RI0A 4EMKB 1JJ2P 2QEXA 5CCAA 3HPWA 2CP2A 1LOJA 1I1JA 2DYBA 3I55Q 4OMNA 1QVFS 4OMLA 1NLPC 3ER0A 1UGQB 1OI1A 1NEBA 1QVGA 4PJOG 2RD1A 3JRZA 2QGFB 5CKHA 2CP7A 4J9FA 3GOXA 4GY5A 8AT1B 1FWZA 4M7AG 1SF9A 2KY9A 1KQSP 4PK4A 1PSEA 2FO0A 2K3YA 2ZPHB 2DBMA 4HA8A 3X28B 1WHJA 1G3TA 4OB3B 1I5LA 1VQ7A 4J9CA 2V8JA 3LX7A 2NUZA 3OS0A 4BE0A 2GTJA 2ZGWA 3OW2P 1HXDA 1VQ4Q 3M55A 4JPBW 1W4SA 2CP0A 3NHNA 1Y96A 4RKUE 4RCBA 3I55A 4C92C 2HSPA 1BI1A 1M90U 1IZ6A 4N0AA 1VQLT 1H3ZA 3HRSA 3L2ZA 2QASA 2CUBA 4LDUA 1LNXA 2DETA 3CCEQ 1NYFA 3SEMA 2ED1A 3DB4A 1FYNA 4VUBA 4C0DB 2A28A 1D0XA 1OX8A 1X01A 2DL8A 2ZPGB 4A53A 1M3BA 3I5SA 1D3BB 1H8KA 2CP5A 3OYIA 3VUZA 3FC3A 2JOYA 3D7SB 1X6OA 2L2PA 3JCMX 3DLLA 2DIQA 2ABLA 1NPPA 2HQEA 3RBBB 1BIBA 3TSWA 3U23A 1VQ4A 4BACA 3QWYA 3PIOA 4V2SA 3WVDB 3CEYA 3MEUA 1VOMA 1FX7A 1M27C 2KYBA 3J80E 3PT9A 2HEQA 1VQLQ 2AZVA 2CZ6B 3M54A 1NE8A 1NEGA 1UEBA 2E3IA 3O5ZA 4P5NA 4MDXA 3QHSA 3CCEA 2AT1B 2R57A 2KNBB 3H0IA 4EMHA 3I56T 1GFDA 4XU3A 1IRXA 1M3CA 1IGUA 3GP8A 2F69A 2DK3A 1S72T 1KIKA 4QQDA 1LVKA 4M78B 1JO8A 1LCKA 1Y0MA 2Y90A 1KFZA 2X3WD 1VYUA 2RJEA 1N8RR 2D0QB 2XDPA 3VS7A 4HCCA 5C0MA 3QWXX 3OYMA 4BE1A 3TU4K 2RJCA 2DF6A 1VQKT 1VQLA 4C8QC 3OYJA 1XQHA 4WTOB 5I2SA 2MOXA 1R0BG 2CYZB 3MEWA 2YRDA 4IUVA 5GAMj 2HKNA 3PVLA 5KYXB 1N6AA 3OYGA 2HCKA 2X3XD 3I56Q 1BK2A 5IT9E 1T0JA 2PTKA 3OYHA 2PVGB 3INZA 4A4EA 3OYDA 3SD4A 2VYTA 3NGPA 2CH4W 2EYZA 4J9HA 5CIUA 2CT4A 4PFZA 1S72Q 2AKKA 2YSQA 2ECZA 4BDZA 2KXDA 1IXDA 1X2QA 3QZ9B 1SRLA 4RTUA 1VQMQ 2FPEA 5GAMd 3CCUT 1SKUB 2HQXA 4BDYA 4FT4A 1RACB 5CVIA 4OP0A 1R0CB 1X6BA 1U5SA 1ZUUA 4MZTA 2RI5A 3OMCA 2D6FA 3EFSA 4FIBA 3GPLA 2RO0A 2G6FX 2BZXA 3URGA 1YI2T 3QG1A 3GLXA 3UA7A 3I56A 3VRYA 4E7KA 1K8AR 2F5KA 4M7DB 4FL6A 2NLUA 1GCPA 2VV5A 1HSQA 4J6YA 4C92E 1VQOT 2QG9B 3C95A 1S72A 4M7DD 2HL3A 2KXCA 4X9CA 5GANe 1DJ7B 1ZQ1A 1W2BS 1UHCA 3EGXB 1FMVA 3BDUA 3A8LB 1VQMA 4KGVB 3CCUQ 2HL5C 4A4KA 2E12A 3ASKA 3EG3A 4FM4B 5FWBA 2DKGA 3CCRT 3M53A 4FYVB 2P4RA 2LCLA 3OSSC 3CD6T 7AT1B 3LH5A 1IHVA 2DJQA 5CKDA 2HKQB 1YI2Q 4MMLA 3SHWA 2ROLA 4JRIA 3JCMe 1PNJA 5GJVB 1FMWA 2CDTA 2HAXA 4II1A 3V8KA 1VQOQ 2ATCB 1KG1A 1BU1A 2YLBA 1QVPA 2R5MA 4MZPA 5LL6S 3OYCA 4M75G 2DVJA 1MNDA 2M0YA 3JB9D 4M7AC 1Y71A 3CCUA 3ME9A 2EGEA 4ZGJB 2J6FA 2EW3A 4L6V5 2DTIA 1M90R 1PKSA 2RB6A 3SFMA 1Q7YC 3CCMT 4AFQC 1NLOC 1T3LA 3CCRQ 2LQWA 1C6VX 3BE3A 3CD6Q 1B3QA 3JCMg 1AOJA 1ZSZA 2VC8A 3NFCA 5GANf 1AWJA 5GMKe 2DD5A 1YI2A 4JJBA 4M77E 3OY9A 2AHJB 1YJWA 3QXEB 3TVTA 4ME7A 2F1LA 4AFUC 2M1HA 4JDSA 3OS5A 3VS5A 2RPNA 1VYTA 1MV0B 1VQOA 2LTOA 5GAOl 4C8QE 2EKOA 1Q95G 2GQIA 2WACA 3M4YA 5KYXA 4J83A 1AT1B 3EFOB 2VWFA 3FJ5A 2GGRA 4JZ3A 2E4HA 3PMTA 4LN2A 3JCMh 2E64A 2C0TA 3SWNA 3JCMf 4C0FA 1RAAB 3CCMQ 2P0KA 3OS2A 3WVEB 4JS4A 3CXCP 4OB2B 1I81A 4FW2A 2DXBA 4XK8E 3CD6A 4F7UE 5GAOq 1K8AC 4D8DA 4KT0E 3CC4T 6AT1B 4XTWA 1KD1U 2QYZA 1JRIA 3FLGA 1GXIE 4QVCA 1G2BA 3EHQA 2OTJA 3VS3A 4M7DF 1Y96B 2DL3A 1KQSA 1RUWA 3MEVA 1AZEA 2J6OA 5GAN8 2K5FA 4RTTA 4RCCA 3FRNA 4M7DA 2LRQA 3JB9J 1SSFA 2VUBA 2B86A 2KI7A 1TWBA 2GTOA 3EH2A 1IREB 5CAIA 3JSCA 1OZ3A 2VKNA 1VQPT 3R6NA 4Z89A 3OW2A 1Q7YU 2L3PA 1PM3A 3EGXA 2BKDN 2ZPEB 3VS6A 2IPOB 5KE3A 4E47A 3UT1A 3PFSA 1V76A 4HVVA 3CC4Q 1PD0A 1WHLA 2A08A 1PG5B 4KGXB 2EAYA 1RLPC 1RLQC 2RM4A 3X20B 2KGTA 2EQKA 4AG2C 3EG0A 1M5Q1 3MHXA 2L3QA 4NOYA 4C92D 3MP1A 2AZSA 1WGSA 1ZA2B 1O9SA 3JB9F 3UATA 3FEOA 3M0PA 1P92A 3OYFA 1G5VA 1M90C 4A4HA 2KT1A 1VQPQ 3BW1A 2ENMA 2MAMA 4B9XA 1K76A 2VASA 2B8AA 3R6OA 1BYMA 5GAN2 2DL7A 3A98A 2ZPFB 2C0IA 4B6MA 2C0OA 1PWTA 4QKUA 1BCMA 2KQWA 3M0RA 1UE9A 3S3OA 1T3SA 5GMKi 4NL3A 2Z0WA 4PJOE 2HNIA 2DM1A 4QVZA 2DRMA 2JT4A 1WZOA 1N27A 3L2QA 3CC4A 1YWPA 1TUGB 3PVQA 2XG8D 3A8MB 2LDMA 1M2VA 5CQYA 2LT4A 2LT1A 5J26A 1AEYA 3O8VA 3C94A 4M78G 2XHCA 5KYYB 1TG0A 1K0XA 2GFUA 4PFOA 5DM7R 2RHZA 2DEQA 1TUCA 2GF7A 1KC8U 2D9TA 2SEMA 1X43A 1PSFA 2OAWA 3BY7A 4HVWA 1OQKA 1VQPA 4C5IA 3EFOA 2EKHA 4E7SA 1Y7XA 1V1CA 2M51A 3JV3A 5GAOp 3RDVA 5FRNA 4NS5A 4ZGDB 3CCET 2VGNA 2O01E 1PHTA 1ARKA 1G8XA 1E7OA 4ANJA 2E10A 2X9HA 4J9DA 1TXQA 1AWWA 3E9GA 2FVUA 2IIMA 4R0KA 2EJGA 2VXFA 1PCXA 3RIRA 2QXFA 3UF4A 1EX4A 4HXJA 2A36A 1WX6A 4NL2A 2EGCA 2P4TA 3M57A 4C8QD 2NUTB 5DLOA 5CK9A 3E9FA 1M9SA 2M9UA 3JAME 1GL5A 1QQJA 3BDLA 1G83A 3I9QA 5FWCA 4KGZB 2KR3A 1UTIA 3PE0A 4EMGA 2K5LA 1G3YA 1HJDA 1D1AA 1AWOA 2HBPA 1M4ZA 2DILA 1VIEA 2QDYB 1OEBA 4PKCC 5FU7B 4M75C 1QP3A 1V29B 2RI3A 4WCIA 2JXBA 2COWA 2E5KA 3M59A 2DNUA 5GAOr 2DZ9A 2JTEA 1QKWA 4OGCA 3ZL7C 2RHUA 3RMQA 4RG2A 2XDBA 1W70A 3JB9H 4C92F 3JCMc 2K3BA 4K11A 5FRMA 1G3WA 3E1SA 3SB2A 4PJLA 2ZPBB 4J7FA 3VUBA 1N9SA 2RHIA 4HVUA 4C92A 4ZTJA 2EQJA 3A8GB 1VQ8T 4L5GA 2LJ0A 2PQWA 2K9GA 1LPLA 2CP3A 1U3OA 1MMAA 3VRZA 5LJ3e 4PJNA 4RTVA 2R5AA 2KRMA 4QQGA 2RNAA 4A63B 2HD0A 5GAN4 1D0ZA 1SEMA 3HFOA 2YUQA 1W6XA 5KYWB 2K2VA 4IKFA 1KD1R 1ZUKA 2RI2A 5GJWB 2MWPA 2FRYA 3PGGA 2YUPA 5GAN3 2NYSA 3S3NA 4EMKC 2DIGA 3N5BB 3QDFA 1WJSA 4M77C 1VQMT 3QSUA 2XKOC 3C4SA 1ZSZB 1VQ8Q 4RTYA 2XIDA 1D09B 1Q7YR 4BB7A 4D6WA 3QUIA 1XTDA 5KYYA 1VIFA 2KAFA 3PTAA 2JTMA 3OMGA 1WHGA 1ZBXA 4J7IA 2F5TX 4XTZA 5FU6C 3UPUA 1TOVA 3QDRB 4OMQA 2EQMA 1RI9A 1RAHB 2PZ1A 4OVAA 4ELZC 2VVKA 3QIIA 2DVEA 3H0FA 2EBPA 2JJ9A 1M1KC 4M7AB 3CPWP 2AK5A 4PJOD 2EPDA 2LP5A 2HMAA 4GLKA 3QJYA 3SWNB 1SRMA 4M7AD 5LJ3h 2LMJA 1C1AA 3IQLA 2KE9A 2HQHA 2OX7A 5CKFA 4Z88A 4KULA 2QGGA 5LJ3f 1UUEA 4C8QF 1RL2A 1S1NA 5CKBA 4OGEA 1VYVA 3F70A 3VS2A 1ABOA 1NM7A 1OU9A 1W1FA 4Y91A 1VQ8A 2QQBA 1IO6A 4C8QA 1MMDA 3NTKA 1Q81U 4C0DC 1YBYA 2F2WA 1D1CA 2JTFA 1JJ2S 2EYQA 1Q86U 2NUTA 1O75A 3MEAA 1GCQC 1C0MA 4IUQA 4M4ZA 5C6SA 2CH4A 2E3HA 2A0FB 1I0CA 1JXOA 1ZX6A 2YWWA 5GAN5 3CCQT 3LW5E 1UGVA 3M0UA 1YJWT 1WLPB 3M0SA 2L8DA 4XU0A 2HZYA 3OB9A 1HD3A 1YJ9Q 2DZCA 3DB3A 3PIPA 2V1QA 3EG2A 3ZEHA 1KQSS 2O88A 4FU6A 3VJPA 3I35A 3H6ZA 4E7HA 2GFAA 1U8RA 1X69A 2X51A 4F16A 1N5ZA 5IXBA 1QLYA 2SRCA 4J9IA 1MGQA 2DYIA 2K3XA 5A0DA 2DLPA 2D8JA 2CP6A 1QWFA 2EYXA 3M58A 4M75E 3OW2S 3V7SA 3G1JA 4LXCA 2ED0A 4A4FA 3L1AA 2MIOA 3L2RA 2DFUA 1I5OB 2I2LA 4QVDA 1QCOA 5CR2A 1M1FA 4QW2A 2KYMA 2JN0A 4JZ4A 3CCQQ 2LNHB 1XOVA 1KJWA 1E6HA 1YJWQ 1KD1C 3CMAT 4M78C 3OBWA 3OYAA 1MMGA 1YJ9A 2OTJT 5GANg 1M1KU 4LNPA 1NJIU 2RQTA 2K79A 5KYWA 3KXTA 3WXMB 1MV3A 4IURA 1GBQA 4PJOC 2WSEE 4XU2A 4BY6B 2P0PA 3TCJA 3VV0A 3A5ZB 1Z9QA 3ZFJA 4N4IA 3M9QA 2I0NA 3P8DA 1SHFA 1WXBA 1QVFP 3S6WA 2K57A 4C5EA 4JJNK 1JQQA 1M1GA 3MP6A 5GANh 1OOTA 2WSFE 3OSVA 1M2VB 3CQTA 2JS0A 2AKLA 4FYYB 3CMET 2QAZA 3FJPA 3CCQA 3CC2T 3CMAQ 1F1BB 4L59A 3OYNA 4DA4A 3QYGB 2O9VA 3CBOA 4OMFB 5J39A 3T9NA 4J9EA 4PJOF 4CC4B 5GANj 1B7TA 3RKYA 2OTJQ 1KQ2A 2F2XA 4M7AF 2CZ1B 1YP5A 2D1XA 3OA6A 4GBQA 2ZPIB 4CI0C 5LJ5e 2EYWA 2VB6A 3PMIA 1VUBA 5KYUA 3A8OB 4M7AA 1WXTA 3I5RA 2RH2A 2DE0X 4JRKA 2RQUA 4XU1A 5J3BA 2JMAA 1FXXA 4ZN1A 3ULRB 4RTZA 2O2OA 5GANd 1K9MU 5KH6A 1WPYA 3BFMA 4PNOA 3REAB 3EFRA 1JJ2A 5GAOn 4IIMA 2E41A 3CMEQ 3EGDB 3HRUA 3CC2Q 3UDCA 2DTHA 3CMAA 2OTLT 3P8BB 4OMOA 5DY9A 3LYIA 2FG0A 2YUNA 2MI6A 4J9GA 1ABQA 2BZYA 3REBB 1BB9A 1YNZA 2L3RA 3RKXA 5LJ5g 3H0HA 3E2UA 1M8MA 3EGUA 3AHUA 2JMCA 4IUPA 5IH2A 4PLLA 3CPWS 3TQ7P 4CRIA 3H9NA 1B34B 2QK0A 1U06A 2RN8A 5GMKh 3JCMd 1KC8C 3M4GA 2AIRB 1NYGA 1Y57A 3G6ET 1TS9A 4LDWA 1K4US 2K4YA 1WYXA 4WF2A 3M0QA 2E70A 1M2OA 2X4YA 4MZMA 5EC7A 2DRKA 2EFIA 5D6YA 2FL7A 3JCMP 1WJQA 5GMKj 4OMMA 5LJ5h 1AHJB 1AD5A 3CMEA 3VYHB 2K7AA 5LJ5f 1EFNA 3CC2A 4O5VA 2OTLQ 5M9OA 4N4HA 1Q82U 4ESRA 1YN8A 1SG5A 2JUFA 1OZ2A 5LJ5j 4C0ZA 3CCLT 2V8IA 4C92B 3LWIA 2G3RA 3V8LA 1VQ5T 1WDXA 1CKAA 1QKXA 4ZN3A 1U1TA 2L5QA 3GNFB 4BE2A 3HRTA 1VQNT 5IHNA 2FPFA 3H8ZA 1EZZB 3G6EQ 2LCSA 4OB1B 4M78E 2RQVA 4OMPA 2FZCB 2DMOA 4Y92A 4J8OA 2LJ1A 2XI9A 1Q81R 1H92A 2DXCA 3G71T 2GBQA 3OYKA 1Q86R 1YFNA 4OB0B 1PC0A 3C0CA 2RK2A 1RABB 4M75D 4BUGA 3V8JA 2CKKA 1MHNA 1J3TA 3QZ5B 2RA2A 3CCJT 1NZ9A 2P84A 1QMCA 2FZGB 2DL4A 2FRWA 3FDRA 2CUDA 3GIBA 3G7ZA 3CPFA 4AMCA 2CS7A 2OTLA 1QCFA 3ZBDA 2HDAA 2EQUA 1K1ZA 3LGLA 1B07A 4F14A 2EWNA 5FW9A 2BE9B 2XDDA 2X4XA 3CCLQ 4DQ2A 1HYOA 4ZGEB 4JLIA 1VQ5Q 2DPPB 2OJ2A 1YCYA 5HY6A 2MCNA 3CC7T 1QW1A 4QT7A 5GAOm 1VQNQ 4Z02A 4JRPA 3G6EA 3RR6A 4PL6A 1OU8A 4FW1A 3HKSA 2DXTA 1UFFA 3G71Q 4LE9A 2MMPA 2CREA 4XTYA 2E5QA 2LQKA 4CC3A 2K5IA 2COYA 3CCJQ 3LH0A 2ZAEA 3HSBA 2NUPB 4DBHA 3OYEA 1ZBJA 1WNLA 3HHTB 4FSSA 3HP9A 3EG9B 2M02A 4M77B 4N0AC 4LDXA 2BIVA 3EH1A 1M1KR 3MO8A 1NJIR 4M77D 4JUVA 4C5GA 4O6JA 3CCLA 3EGDA 2CT3A 2QTXA 4E2FB 4C8QB 1VQ5A 4FYXB 4M7DE 4EDUA 3CC7Q 1VQNA 3CPWA 3KUFA 1WJRA 4X1VA 1W2BP 2EQIA 4X9DA 5I2MA 5FU6B 2H3JA 4BD3A 2WSCE 3NTHA 3LWHA 2MYSA 1M30A 4R56A 2O4XA 2LCCA 3G71A 1B34A 2JM9A 4PLIA 1WFWA 2R58A 2DX1A 2BUDA 3CCJA 2EJFA 4HT8A 2J7IA 1IHWA 5ECAA 4F7UB 1ZLMA 5DLQE 2LVMA 4Z8AA 3CXCS 4HKEA 4DEXA 5HK3A 3J7AF 2J6KA 2RK1A 5HKCA 4M7DG 1TSFA 3RESA 4DOVA 3M56A 3TREA 2EVRA 3P8HA 2NWMA 1K0SA 4JJDA 2MWOA 2O9SA 2K2MA 2E65A 3CC7A 5GAMe 3RMSA 1I8FA 2EGAA 2E1HA 2O31A 1MMNA 1BI2A 2L3SA 4XTVA 1Q81C 4XTXA 2YLCA 4BI8B 4XTUA 1RAIB 2QQ9A 1K9MR 2M0OA 1Q86C 4OF1A 3META 2DD4A 5L8RE 2CZ0B 5I22A 1PRMC 4M75F 4KBMB 3OQ5A 1RADB 3THKA 4DBQA 1K73C 2RJFA 1GFCA 3M5AA 1WQ7A 2ZZDA 4PFPA 4M75A 3X24B 1ACMB 1H3HA 1WQWA 4J9BA 3V7CA 2CGHA 2QQSA 1SPKA 4ATOA 1AZGB 1WHMA 2D8HA 3HL8A 2JW4A 4A4GA 5IHKA 1UJYA 1X27A 4UC4A 5GMKm 3DLMA 1VA7A 5GAMg 2QQAA 3RNJA 4TVRA 3JB9G 1R77A 5IAYA 2DEUA 4LUEA 1D1BA 4A54A 2LX9A 2YHTA 2KBTA 2H3EB 4HCBA 2YXYA 4AG1C 5LJ3g 1HK9A 4LD6A 2GCXA 3Q1JA 1G3SA 1YHQT 1QVGP 2VGMA 4M78D 3KFVA 2L0AA 4B9WA 3CBPA 4C0GA 1FMKA 2YDLA 1PRLC 1TTHB 5GAMh 3CCST 1AVZC 2IG0A 1EIFA 1Y07A 2KVQG 4LDYA 4PJOB 4E7JA 1Q82R 2HBWA 1QVFA 4F04B 5GAMf 5KYUB 4JJCA 1YJ9T 2LNVA 1NJIC 1UDLA 1RAGB 3RKWA 2W0ZA 4M77F 2V1RA 4EMKA 2KK4A 2KDSA 3JCMV 2NUPA 1TH7A 4C5HA 2XU8A 3EHRA 3X25B 3RUXA 3EG9A 4M77A 4AFZC 2EYYA 1JBMA 1CSKA 1BIAA 5AYFA 3PNWC 2KT8A 2FHDA 5D6XA 4E7IA 5A0LA 1OPLA 3DKMA 1UECA 2DERA 2C06A 1JXMA 2PNIA 3RERA 5LJ3j 3L42A 1WHHA 1KSWA 5D6WA 2CSIA 3TSZA 1YHQQ 2DTOA 3MP8A 3EAEA 2Y4YA 2V8KA 5FU7C 3JCMJ 4MDWA 2FYKA 1BI3A 4RMOA 4DEYA 3J81E 1GRIA 1OPKA 3CCSQ 2YT6A 3VYGA 5L23A 4RTXA 3X26B 1K73U 4ELYC 2H8HA 3JCMQ 3A1PA 1VQKQ 3CXCA 4LDVA 4F7UF 3NTIA 4PJMA 5LJ3d 2J06A 3VS1A 2LQ8A 2HSEB 1RAEB 5A2QE 3JCMW 4JS5A 5FROA 4F7UA 3GNGA 3L2UA 1YWOA 4FT2A 2DA9A 5EG2A 1X2KA 1M3AA 1KC8R 4E6RA 2GQVA 3MJXA 1QCNA 2MK5A 1SHGA 2RHYA 4RUGA 1R8OB 1K9MC 5HCKA 2X35A 1YHQA 1ZA1B 2JNGA 3EG1A 1D3BA 1GCQA 1XNIA 3S3MA 1UB4A 2BZ8A 2LX7A 2PUOB 3CCSA 4J5YA 1IB8A 1NG2A 1Z9ZA 1OV3A 1TU0B 2GNCA 5I11A 1T0HA 1K9AA 5GAN6 2DBKA 1ZUYA 2A7YA 2EJ9A 1VQKA 5KCOA 4E7LA 2QI2A 1XJWB 1YITT 3KBGA 1RAFB 4JLGA 1GBRA 2CSQA 2PU9B 4CC7A 2KRSA 1NBEB 3CCVT 1U1SA 2BE7D 5D7UA 4Y28E 2PVOB 1ZSZC 4C92G 2RF0A 2L89A 1LJOA 4KUDK 1VQ6T 1UGPB 2RQRA 4AT1B 1BKBA 2QTVA 4IUTA 2DXUA 3MKDA 3OYLA 3UWNA 1NPRA 1KK7A 2QA4T 1SSHA 2KMTA 3GF5A 2LQNA 3CBMA 4KH1B 1QWEA 1N9RA 5KCHA 1N8RC 2YUOA 2FB7A 1UG1A 4M78F 3QKJA 3H41A 5CKEA 2FZKB 4GLMA 3QPHA 1UGSB 2CZ7B 1Q82C 4M78A 3SWNC 3G4ST 3TEEA 3OYBA 1YITQ 2OI3A 1OULA 2XK0A 3V7RA 3QJ6A
chains in the Genus database with same CATH topology
2FPEA 1H92A 2ROTA 2GBQA 4WCIA 2JXBA 2E5KA 2RMOA 2ESWA 2DNUA 3C0CA 3ZL7C 2JTEA 1QKWA 2BTTA 1X6BA 1J3TA 1U5SA 1ZUUA 1W70A 3NPFA 2DL4A 2FRWA 2JS2A 2K3BA 4K11A 2CUDA 3VS4A 1QCFA 2FEIA 3UA6A 2HDAA 1K1ZA 1B07A 4HVUA 4F14A 2G6FX 2BZXA 1ZSGA 5FW9A 3NMZC 3UA7A 4Y92A 3VRYA 4ZNXA 2LJ0A 1GCPA 2K9GA 1HSQA 2OJ2A 1U3OA 3VRZA 2MCNA 1UHFA 4RTVA 4IIOA 2J05A 4QT7A 2KRMA 2RNAA 4A63B 4F17A 2KXCA 4KRTA 1SEMA 2YUQA 1UJ0A 1W6XA 1BBZA 2RQWA 1UHCA 2LJ3A 1ZUKA 4ORZA 1E6GA 5GJWB 1UFFA 2FRYA 4LE9A 5IHIA 2CREA 1CKBA 3EG3A 4CC3A 2YUPA 1I07A 5FWBA 4D8KA 2P4RA 4HCKA 1ZBJA 4FSSA 4AFSC 3LH5A 2DJQA 1MUZA 3SHWA 2ROLA 2A37A 1X6GA 1PNJA 5GJVB 2CT3A 4RTYA 2CDTA 2DL5A 2F2VA 1BU1A 4X1VA 2EQIA 4OMQA 1PKTA 3GBQA 1RI9A 2PZ1A 2LZ6B 2DVJA 2M0YA 2VVKA 1AWXA 1M30A 4LUDA 3H0FA 1YCSB 2EBPA 2EGEA 2AK5A 2J6FA 2JM8A 2EW3A 2JM9A 2EPDA 2LP5A 1WFWA 2K6DA 1PKSA 1JU5C 2DX1A 1SRMA 1A0NB 2LMJA 3IQLA 4AFQC 1NLOC 1T3LA 5IXFA 2KE9A 2J7IA 2LQWA 4Z88A 5ECAA 1WI7A 1ZLMA 1UUEA 1WIEA 2W10A 4Z8AA 1B3QA 4DEXA 1AOJA 1S1NA 2KEAA 1AWJA 2D0NA 1JEGA 2J6KA 4JJBA 1VYVA 3VS2A 1ABOA 1NM7A 1W1FA 3TVTA 1IO6A 3VS0A 1TUDA 1WA7A 1WXUA 2FPDA 4AFUC 2EVRA 2NWMA 3VS5A 1K0SA 2RPNA 1VYTA 2F2WA 4JJDA 1MV0B 2O9SA 2K2MA 2KROA 2GQIA 4CC2A 1GCQC 4M4ZA 2CH4A 2EGAA 2O31A 1I0CA 1JXOA 1ZX6A 2VWFA 3FJ5A 1UGVA 3M0UA 1WLPB 3M0SA 2L3SA 2GGRA 4JZ3A 4LN2A 1HD3A 2C0TA 2V1QA 3EG2A 2XMFA 5I22A 1PRMC 2O88A 3M0TA 3THKA 3I35A 1X69A 1GFCA 4RTWA 4F16A 1N5ZA 2KRNA 5IXBA 1QLYA 2SRCA 1H3HA 4J9BA 4J9IA 2QDLA 2DLPA 4EIKA 1SPKA 2D8JA 4D8DA 1QWFA 2EYXA 1AZGB 2D8HA 2JW4A 5IHKA 1UJYA 1X27A 2ED0A 1VA7A 1I1JA 2DYBA 1G2BA 3RNJA 3EHQA 4OMNA 3VS3A 4OMLA 2DL3A 1NLPC 1RUWA 2MIOA 1NEBA 1AZEA 4LUEA 2J6OA 2KYMA 4J9FA 4JZ4A 4RTTA 2LNHB 1XOVA 1KJWA 1E6HA 2KBTA 2B86A 4AG1C 2GTOA 2VKNA 2FO0A 3KFVA 2L0AA 4LNPA 3R6NA 4Z89A 2RQTA 2K79A 2DBMA 1FMKA 2YDLA 1PRLC 2L3PA 1AVZC 1MV3A 1GBQA 4J9CA 2HBWA 2NUZA 3VS6A 4JJCA 1Z9QA 2GTJA 1UDLA 2W0ZA 4HVVA 2V1RA 4JPBW 2A08A 2I0NA 1RLPC 1SHFA 1WXBA 1RLQC 3NHNA 3EHRA 1JQQA 1OOTA 4AFZC 2EYYA 2HSPA 2KGTA 3CQTA 4AG2C 3EG0A 2JS0A 1CSKA 2AKLA 2KT8A 2L3QA 1OPLA 2CUBA 1UECA 2AZSA 1JXMA 2PNIA 2O9VA 1NYFA 3UATA 3SEMA 2ED1A 3M0PA 1KSWA 1FYNA 2CSIA 4J9EA 4CC4B 3TSZA 2A28A 2KT1A 2DL8A 2F2XA 2ENMA 1YP5A 1K76A 1M3BA 2D1XA 3I5SA 4DEYA 1H8KA 1GRIA 1OPKA 4GBQA 2DL7A 2YT6A 3A98A 2C0IA 2C0OA 1PWTA 5L23A 2EYWA 4RTXA 2L2PA 3M0RA 1UE9A 2H8HA 1WXTA 3I5RA 1T3SA 2DM1A 2DE0X 2DRMA 2RQUA 2ABLA 3RBBB 2JT4A 3TSWA 3U23A 2JMAA 1YWPA 2J06A 3ULRB 3VS1A 3PVQA 3QWYA 4RTZA 2O2OA 1YWOA 2DA9A 1M27C 2KYBA 3REAB 1X2KA 2HEQA 4IIMA 1M3AA 1AEYA 4E6RA 2AZVA 1NEGA 3O5ZA 1TG0A 1SHGA 1K0XA 4RUGA 4OMOA 1TUCA 2FG0A 2YUNA 2KNBB 5HCKA 4J9GA 2SEMA 3H0IA 1ABQA 2BZYA 3REBB 1X43A 1BB9A 1YNZA 2OAWA 1GFDA 3EG1A 4HVWA 1GCQA 1M3CA 3H0HA 2BZ8A 1M8MA 3EGUA 2LX7A 2EKHA 1V1CA 2M51A 2JMCA 3JV3A 1NG2A 5IH2A 1Z9ZA 1OV3A 1KIKA 2GNCA 5I11A 2RN8A 1U06A 1T0HA 1K9AA 2DBKA 1ZUYA 1JO8A 1PHTA 1ARKA 1LCKA 1NYGA 1Y57A 1Y0MA 1E7OA 1K4US 1GBRA 2X3WD 1KFZA 1VYUA 2CSQA 1WYXA 4CC7A 2KRSA 4J9DA 3M0QA 1AWWA 3VS7A 5EC7A 2DRKA 2IIMA 3QWXX 4R0KA 2RF0A 2DF6A 3UF4A 2RQRA 4OMMA 4HXJA 1AD5A 2A36A 1WX6A 2MOXA 2K7AA 1EFNA 2EGCA 1SSHA 2LQNA 4ESRA 1QWEA 1YN8A 3PVLA 2YUOA 2HCKA 1UG1A 2X3XD 1BK2A 1T0JA 2PTKA 1GL5A 1G83A 3I9QA 3H41A 5FWCA 4GLMA 2KR3A 1WDXA 1CKAA 1QKXA 1UTIA 3NGPA 2CH4W 2EYZA 4J9HA 3PE0A 2CT4A 2AKKA 2YSQA 2ECZA 5IHNA 2FPFA 1HJDA 2KXDA 1X2QA 2LCSA 2OI3A 1AWOA 1SRLA 2RQVA 4OMPA 2DILA 4RTUA 2DMOA 1OEBA 2LJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPE A;  1H92 A;  2ROT A;  2GBQ A;  4WCI A;  2JXB A;  2E5K A;  2RMO A;  2ESW A;  2DNU A;  3C0C A;  3ZL7 C;  2JTE A;  1QKW A;  2BTT A;  1X6B A;  1J3T A;  1U5S A;  1ZUU A;  1W70 A;  3NPF A;  2DL4 A;  2FRW A;  2JS2 A;  2K3B A;  4K11 A;  2CUD A;  3VS4 A;  1QCF A;  2FEI A;  3UA6 A;  2HDA A;  1K1Z A;  1B07 A;  4HVU A;  4F14 A;  2G6F X;  2BZX A;  1ZSG A;  5FW9 A;  3NMZ C;  3UA7 A;  4Y92 A;  3VRY A;  4ZNX A;  2LJ0 A;  1GCP A;  2K9G A;  1HSQ A;  2OJ2 A;  1U3O A;  3VRZ A;  2MCN A;  1UHF A;  4RTV A;  4IIO A;  2J05 A;  4QT7 A;  2KRM A;  2RNA A;  4A63 B;  4F17 A;  2KXC A;  4KRT A;  1SEM A;  2YUQ A;  1UJ0 A;  1W6X A;  1BBZ A;  2RQW A;  1UHC A;  2LJ3 A;  1ZUK A;  4ORZ A;  1E6G A;  5GJW B;  1UFF A;  2FRY A;  4LE9 A;  5IHI A;  2CRE A;  1CKB A;  3EG3 A;  4CC3 A;  2YUP A;  1I07 A;  5FWB A;  4D8K A;  2P4R A;  4HCK A;  1ZBJ A;  4FSS A;  4AFS C;  3LH5 A;  2DJQ A;  1MUZ A;  3SHW A;  2ROL A;  2A37 A;  1X6G A;  1PNJ A;  5GJV B;  2CT3 A;  4RTY A;  2CDT A;  2DL5 A;  2F2V A;  1BU1 A;  4X1V A;  2EQI A;  4OMQ A;  1PKT A;  3GBQ A;  1RI9 A;  2PZ1 A;  2LZ6 B;  2DVJ A;  2M0Y A;  2VVK A;  1AWX A;  1M30 A;  4LUD A;  3H0F A;  1YCS B;  2EBP A;  2EGE A;  2AK5 A;  2J6F A;  2JM8 A;  2EW3 A;  2JM9 A;  2EPD A;  2LP5 A;  1WFW A;  2K6D A;  1PKS A;  1JU5 C;  2DX1 A;  1SRM A;  1A0N B;  2LMJ A;  3IQL A;  4AFQ C;  1NLO C;  1T3L A;  5IXF A;  2KE9 A;  2J7I A;  2LQW A;  4Z88 A;  5ECA A;  1WI7 A;  1ZLM A;  1UUE A;  1WIE A;  2W10 A;  4Z8A A;  1B3Q A;  4DEX A;  1AOJ A;  1S1N A;  2KEA A;  1AWJ A;  2D0N A;  1JEG A;  2J6K A;  4JJB A;  1VYV A;  3VS2 A;  1ABO A;  1NM7 A;  1W1F A;  3TVT A;  1IO6 A;  3VS0 A;  1TUD A;  1WA7 A;  1WXU A;  2FPD A;  4AFU C;  2EVR A;  2NWM A;  3VS5 A;  1K0S A;  2RPN A;  1VYT A;  2F2W A;  4JJD A;  1MV0 B;  2O9S A;  2K2M A;  2KRO A;  2GQI A;  4CC2 A;  1GCQ C;  4M4Z A;  2CH4 A;  2EGA A;  2O31 A;  1I0C A;  1JXO A;  1ZX6 A;  2VWF A;  3FJ5 A;  1UGV A;  3M0U A;  1WLP B;  3M0S A;  2L3S A;  2GGR A;  4JZ3 A;  4LN2 A;  1HD3 A;  2C0T A;  2V1Q A;  3EG2 A;  2XMF A;  5I22 A;  1PRM C;  2O88 A;  3M0T A;  3THK A;  3I35 A;  1X69 A;  1GFC A;  4RTW A;  4F16 A;  1N5Z A;  2KRN A;  5IXB A;  1QLY A;  2SRC A;  1H3H A;  4J9B A;  4J9I A;  2QDL A;  2DLP A;  4EIK A;  1SPK A;  2D8J A;  4D8D A;  1QWF A;  2EYX A;  1AZG B;  2D8H A;  2JW4 A;  5IHK A;  1UJY A;  1X27 A;  2ED0 A;  1VA7 A;  1I1J A;  2DYB A;  1G2B A;  3RNJ A;  3EHQ A;  4OMN A;  3VS3 A;  4OML A;  2DL3 A;  1NLP C;  1RUW A;  2MIO A;  1NEB A;  1AZE A;  4LUE A;  2J6O A;  2KYM A;  4J9F A;  4JZ4 A;  4RTT A;  2LNH B;  1XOV A;  1KJW A;  1E6H A;  2KBT A;  2B86 A;  4AG1 C;  2GTO A;  2VKN A;  2FO0 A;  3KFV A;  2L0A A;  4LNP A;  3R6N A;  4Z89 A;  2RQT A;  2K79 A;  2DBM A;  1FMK A;  2YDL A;  1PRL C;  2L3P A;  1AVZ C;  1MV3 A;  1GBQ A;  4J9C A;  2HBW A;  2NUZ A;  3VS6 A;  4JJC A;  1Z9Q A;  2GTJ A;  1UDL A;  2W0Z A;  4HVV A;  2V1R A;  4JPB W;  2A08 A;  2I0N A;  1RLP C;  1SHF A;  1WXB A;  1RLQ C;  3NHN A;  3EHR A;  1JQQ A;  1OOT A;  4AFZ C;  2EYY A;  2HSP A;  2KGT A;  3CQT A;  4AG2 C;  3EG0 A;  2JS0 A;  1CSK A;  2AKL A;  2KT8 A;  2L3Q A;  1OPL A;  2CUB A;  1UEC A;  2AZS A;  1JXM A;  2PNI A;  2O9V A;  1NYF A;  3UAT A;  3SEM A;  2ED1 A;  3M0P A;  1KSW A;  1FYN A;  2CSI A;  4J9E A;  4CC4 B;  3TSZ A;  2A28 A;  2KT1 A;  2DL8 A;  2F2X A;  2ENM A;  1YP5 A;  1K76 A;  1M3B A;  2D1X A;  3I5S A;  4DEY A;  1H8K A;  1GRI A;  1OPK A;  4GBQ A;  2DL7 A;  2YT6 A;  3A98 A;  2C0I A;  2C0O A;  1PWT A;  5L23 A;  2EYW A;  4RTX A;  2L2P A;  3M0R A;  1UE9 A;  2H8H A;  1WXT A;  3I5R A;  1T3S A;  2DM1 A;  2DE0 X;  2DRM A;  2RQU A;  2ABL A;  3RBB B;  2JT4 A;  3TSW A;  3U23 A;  2JMA A;  1YWP A;  2J06 A;  3ULR B;  3VS1 A;  3PVQ A;  3QWY A;  4RTZ A;  2O2O A;  1YWO A;  2DA9 A;  1M27 C;  2KYB A;  3REA B;  1X2K A;  2HEQ A;  4IIM A;  1M3A A;  1AEY A;  4E6R A;  2AZV A;  1NEG A;  3O5Z A;  1TG0 A;  1SHG A;  1K0X A;  4RUG A;  4OMO A;  1TUC A;  2FG0 A;  2YUN A;  2KNB B;  5HCK A;  4J9G A;  2SEM A;  3H0I A;  1ABQ A;  2BZY A;  3REB B;  1X43 A;  1BB9 A;  1YNZ A;  2OAW A;  1GFD A;  3EG1 A;  4HVW A;  1GCQ A;  1M3C A;  3H0H A;  2BZ8 A;  1M8M A;  3EGU A;  2LX7 A;  2EKH A;  1V1C A;  2M51 A;  2JMC A;  3JV3 A;  1NG2 A;  5IH2 A;  1Z9Z A;  1OV3 A;  1KIK A;  2GNC A;  5I11 A;  2RN8 A;  1U06 A;  1T0H A;  1K9A A;  2DBK A;  1ZUY A;  1JO8 A;  1PHT A;  1ARK A;  1LCK A;  1NYG A;  1Y57 A;  1Y0M A;  1E7O A;  1K4U S;  1GBR A;  2X3W D;  1KFZ A;  1VYU A;  2CSQ A;  1WYX A;  4CC7 A;  2KRS A;  4J9D A;  3M0Q A;  1AWW A;  3VS7 A;  5EC7 A;  2DRK A;  2IIM A;  3QWX X;  4R0K A;  2RF0 A;  2DF6 A;  3UF4 A;  2RQR A;  4OMM A;  4HXJ A;  1AD5 A;  2A36 A;  1WX6 A;  2MOX A;  2K7A A;  1EFN A;  2EGC A;  1SSH A;  2LQN A;  4ESR A;  1QWE A;  1YN8 A;  3PVL A;  2YUO A;  2HCK A;  1UG1 A;  2X3X D;  1BK2 A;  1T0J A;  2PTK A;  1GL5 A;  1G83 A;  3I9Q A;  3H41 A;  5FWC A;  4GLM A;  2KR3 A;  1WDX A;  1CKA A;  1QKX A;  1UTI A;  3NGP A;  2CH4 W;  2EYZ A;  4J9H A;  3PE0 A;  2CT4 A;  2AKK A;  2YSQ A;  2ECZ A;  5IHN A;  2FPF A;  1HJD A;  2KXD A;  1X2Q A;  2LCS A;  2OI3 A;  1AWO A;  1SRL A;  2RQV A;  4OMP A;  2DIL A;  4RTU A;  2DMO A;  1OEB A;  2LJ1 A; 
#chains in the Genus database with same CATH topology
 3CCV Q;  4XQ3 A;  3JCM b;  2ROT A;  1YJN T;  5I21 A;  4PJO A;  5KYN A;  2RMO A;  2ESW A;  3AT1 B;  1VQ6 Q;  2BTT A;  2MF2 A;  1JB0 E;  3NPF A;  2DJZ A;  4Q5W A;  2JS2 A;  4MMK A;  2QA4 Q;  2OAU A;  2E6N A;  4J6W A;  2FEI A;  3UA6 A;  3VS4 A;  4DOW A;  5FLX E;  4JRQ A;  2QQR A;  4R55 A;  3C12 A;  1ZSG A;  3NMZ C;  3L2V A;  1VQ9 T;  4ZNX A;  4M7D C;  1X75 C;  5HK0 A;  3LLR A;  5KE2 A;  4RG8 A;  4ZTF A;  1I4K 1;  2IVW A;  1UHF A;  1OX9 A;  4IIO A;  2J05 A;  1QVG S;  2X4W A;  4F17 A;  3VU3 C;  3G4S Q;  4KRT A;  5CQX A;  1UJ0 A;  2JVV A;  1YIJ T;  3CCR A;  3E19 A;  1YIT A;  1BBZ A;  4M77 G;  1D0Y A;  2KSS A;  2RQW A;  4QQ6 A;  2LJ3 A;  4KUI A;  4KH0 B;  4ORZ A;  1E6G A;  3CCV A;  1M8V A;  1YJN Q;  5IHI A;  2RJD A;  1CKB A;  3LGF A;  2O4X B;  1VQ6 A;  1I07 A;  4C8Q G;  3MPU B;  5A0G A;  4PJJ A;  4D8K A;  1UGR B;  4E7Z A;  4HCK A;  1IGQ A;  2DAQ A;  4AFS C;  2QA4 A;  1BI0 A;  4FCY A;  1MUZ A;  1N8R U;  5AT1 B;  1VQ9 Q;  1W2B A;  2A37 A;  1X6G A;  4DBR A;  4N4G A;  5CO7 A;  2QEX T;  5IN1 A;  2PUK B;  3QO3 A;  4BI4 A;  9ATC B;  2DL5 A;  2F2V A;  3VKI A;  2A3L A;  3CCM A;  3G4S A;  1PD1 A;  1YIJ Q;  4F7U G;  8ATC B;  2XD0 A;  1PKT A;  3GBQ A;  3FB9 A;  4BY6 C;  2LZ6 B;  1AWX A;  4YTL A;  2MPX C;  4LD9 K;  4LUD A;  1YCS B;  1BCO A;  3L2W A;  1YJN A;  2JM8 A;  5GAN 7;  2K6D A;  1JU5 C;  3OYY A;  1KQ1 A;  4HCZ A;  1A0N B;  1KHC A;  3OBY A;  5IXF A;  1QP2 A;  2VXE A;  1VQ7 T;  2PVD B;  1WI7 A;  2V26 A;  3A8H B;  3HTR A;  1WIE A;  2W10 A;  4M75 B;  4X34 A;  4XAX B;  2KEA A;  3FIF A;  2D0N A;  2DO3 A;  1JEG A;  3JB9 I;  3OS1 A;  1WHK A;  2COZ A;  5LJ5 d;  2XIC A;  1VQ9 A;  2JZ2 A;  3VS0 A;  1TUD A;  1WA7 A;  1WXU A;  2FPD A;  2QEX Q;  2YRC A;  1KHI A;  4EPC A;  2ZCF B;  4FYW B;  3I55 T;  1K73 R;  3MCA B;  2KRO A;  1ZHI A;  4CC2 A;  3QYH B;  4HT9 A;  1YIJ A;  4DBF A;  4IUU A;  4J6X A;  3SDZ A;  2LC4 A;  2XMF A;  2RHX A;  3M0T A;  1K8A U;  4M7A E;  1H64 1;  2Y4X A;  2EIF A;  4FSX A;  5GMK l;  1VQ7 Q;  4RTW A;  4BI3 A;  1MNE A;  2KRN A;  2YRV A;  2QDL A;  2M16 A;  2E6Z A;  4EIK A;  1OYX A;  2P0Q A;  1VQ4 T;  2X4J A;  3QBY A;  3HFN A;  1RI0 A;  4EMK B;  1JJ2 P;  2QEX A;  5CCA A;  3HPW A;  2CP2 A;  1LOJ A;  1I1J A;  2DYB A;  3I55 Q;  4OMN A;  1QVF S;  4OML A;  1NLP C;  3ER0 A;  1UGQ B;  1OI1 A;  1NEB A;  1QVG A;  4PJO G;  2RD1 A;  3JRZ A;  2QGF B;  5CKH A;  2CP7 A;  4J9F A;  3GOX A;  4GY5 A;  8AT1 B;  1FWZ A;  4M7A G;  1SF9 A;  2KY9 A;  1KQS P;  4PK4 A;  1PSE A;  2FO0 A;  2K3Y A;  2ZPH B;  2DBM A;  4HA8 A;  3X28 B;  1WHJ A;  1G3T A;  4OB3 B;  1I5L A;  1VQ7 A;  4J9C A;  2V8J A;  3LX7 A;  2NUZ A;  3OS0 A;  4BE0 A;  2GTJ A;  2ZGW A;  3OW2 P;  1HXD A;  1VQ4 Q;  3M55 A;  4JPB W;  1W4S A;  2CP0 A;  3NHN A;  1Y96 A;  4RKU E;  4RCB A;  3I55 A;  4C92 C;  2HSP A;  1BI1 A;  1M90 U;  1IZ6 A;  4N0A A;  1VQL T;  1H3Z A;  3HRS A;  3L2Z A;  2QAS A;  2CUB A;  4LDU A;  1LNX A;  2DET A;  3CCE Q;  1NYF A;  3SEM A;  2ED1 A;  3DB4 A;  1FYN A;  4VUB A;  4C0D B;  2A28 A;  1D0X A;  1OX8 A;  1X01 A;  2DL8 A;  2ZPG B;  4A53 A;  1M3B A;  3I5S A;  1D3B B;  1H8K A;  2CP5 A;  3OYI A;  3VUZ A;  3FC3 A;  2JOY A;  3D7S B;  1X6O A;  2L2P A;  3JCM X;  3DLL A;  2DIQ A;  2ABL A;  1NPP A;  2HQE A;  3RBB B;  1BIB A;  3TSW A;  3U23 A;  1VQ4 A;  4BAC A;  3QWY A;  3PIO A;  4V2S A;  3WVD B;  3CEY A;  3MEU A;  1VOM A;  1FX7 A;  1M27 C;  2KYB A;  3J80 E;  3PT9 A;  2HEQ A;  1VQL Q;  2AZV A;  2CZ6 B;  3M54 A;  1NE8 A;  1NEG A;  1UEB A;  2E3I A;  3O5Z A;  4P5N A;  4MDX A;  3QHS A;  3CCE A;  2AT1 B;  2R57 A;  2KNB B;  3H0I A;  4EMH A;  3I56 T;  1GFD A;  4XU3 A;  1IRX A;  1M3C A;  1IGU A;  3GP8 A;  2F69 A;  2DK3 A;  1S72 T;  1KIK A;  4QQD A;  1LVK A;  4M78 B;  1JO8 A;  1LCK A;  1Y0M A;  2Y90 A;  1KFZ A;  2X3W D;  1VYU A;  2RJE A;  1N8R R;  2D0Q B;  2XDP A;  3VS7 A;  4HCC A;  5C0M A;  3QWX X;  3OYM A;  4BE1 A;  3TU4 K;  2RJC A;  2DF6 A;  1VQK T;  1VQL A;  4C8Q C;  3OYJ A;  1XQH A;  4WTO B;  5I2S A;  2MOX A;  1R0B G;  2CYZ B;  3MEW A;  2YRD A;  4IUV A;  5GAM j;  2HKN A;  3PVL A;  5KYX B;  1N6A A;  3OYG A;  2HCK A;  2X3X D;  3I56 Q;  1BK2 A;  5IT9 E;  1T0J A;  2PTK A;  3OYH A;  2PVG B;  3INZ A;  4A4E A;  3OYD A;  3SD4 A;  2VYT A;  3NGP A;  2CH4 W;  2EYZ A;  4J9H A;  5CIU A;  2CT4 A;  4PFZ A;  1S72 Q;  2AKK A;  2YSQ A;  2ECZ A;  4BDZ A;  2KXD A;  1IXD A;  1X2Q A;  3QZ9 B;  1SRL A;  4RTU A;  1VQM Q;  2FPE A;  5GAM d;  3CCU T;  1SKU B;  2HQX A;  4BDY A;  4FT4 A;  1RAC B;  5CVI A;  4OP0 A;  1R0C B;  1X6B A;  1U5S A;  1ZUU A;  4MZT A;  2RI5 A;  3OMC A;  2D6F A;  3EFS A;  4FIB A;  3GPL A;  2RO0 A;  2G6F X;  2BZX A;  3URG A;  1YI2 T;  3QG1 A;  3GLX A;  3UA7 A;  3I56 A;  3VRY A;  4E7K A;  1K8A R;  2F5K A;  4M7D B;  4FL6 A;  2NLU A;  1GCP A;  2VV5 A;  1HSQ A;  4J6Y A;  4C92 E;  1VQO T;  2QG9 B;  3C95 A;  1S72 A;  4M7D D;  2HL3 A;  2KXC A;  4X9C A;  5GAN e;  1DJ7 B;  1ZQ1 A;  1W2B S;  1UHC A;  3EGX B;  1FMV A;  3BDU A;  3A8L B;  1VQM A;  4KGV B;  3CCU Q;  2HL5 C;  4A4K A;  2E12 A;  3ASK A;  3EG3 A;  4FM4 B;  5FWB A;  2DKG A;  3CCR T;  3M53 A;  4FYV B;  2P4R A;  2LCL A;  3OSS C;  3CD6 T;  7AT1 B;  3LH5 A;  1IHV A;  2DJQ A;  5CKD A;  2HKQ B;  1YI2 Q;  4MML A;  3SHW A;  2ROL A;  4JRI A;  3JCM e;  1PNJ A;  5GJV B;  1FMW A;  2CDT A;  2HAX A;  4II1 A;  3V8K A;  1VQO Q;  2ATC B;  1KG1 A;  1BU1 A;  2YLB A;  1QVP A;  2R5M A;  4MZP A;  5LL6 S;  3OYC A;  4M75 G;  2DVJ A;  1MND A;  2M0Y A;  3JB9 D;  4M7A C;  1Y71 A;  3CCU A;  3ME9 A;  2EGE A;  4ZGJ B;  2J6F A;  2EW3 A;  4L6V 5;  2DTI A;  1M90 R;  1PKS A;  2RB6 A;  3SFM A;  1Q7Y C;  3CCM T;  4AFQ C;  1NLO C;  1T3L A;  3CCR Q;  2LQW A;  1C6V X;  3BE3 A;  3CD6 Q;  1B3Q A;  3JCM g;  1AOJ A;  1ZSZ A;  2VC8 A;  3NFC A;  5GAN f;  1AWJ A;  5GMK e;  2DD5 A;  1YI2 A;  4JJB A;  4M77 E;  3OY9 A;  2AHJ B;  1YJW A;  3QXE B;  3TVT A;  4ME7 A;  2F1L A;  4AFU C;  2M1H A;  4JDS A;  3OS5 A;  3VS5 A;  2RPN A;  1VYT A;  1MV0 B;  1VQO A;  2LTO A;  5GAO l;  4C8Q E;  2EKO A;  1Q95 G;  2GQI A;  2WAC A;  3M4Y A;  5KYX A;  4J83 A;  1AT1 B;  3EFO B;  2VWF A;  3FJ5 A;  2GGR A;  4JZ3 A;  2E4H A;  3PMT A;  4LN2 A;  3JCM h;  2E64 A;  2C0T A;  3SWN A;  3JCM f;  4C0F A;  1RAA B;  3CCM Q;  2P0K A;  3OS2 A;  3WVE B;  4JS4 A;  3CXC P;  4OB2 B;  1I81 A;  4FW2 A;  2DXB A;  4XK8 E;  3CD6 A;  4F7U E;  5GAO q;  1K8A C;  4D8D A;  4KT0 E;  3CC4 T;  6AT1 B;  4XTW A;  1KD1 U;  2QYZ A;  1JRI A;  3FLG A;  1GXI E;  4QVC A;  1G2B A;  3EHQ A;  2OTJ A;  3VS3 A;  4M7D F;  1Y96 B;  2DL3 A;  1KQS A;  1RUW A;  3MEV A;  1AZE A;  2J6O A;  5GAN 8;  2K5F A;  4RTT A;  4RCC A;  3FRN A;  4M7D A;  2LRQ A;  3JB9 J;  1SSF A;  2VUB A;  2B86 A;  2KI7 A;  1TWB A;  2GTO A;  3EH2 A;  1IRE B;  5CAI A;  3JSC A;  1OZ3 A;  2VKN A;  1VQP T;  3R6N A;  4Z89 A;  3OW2 A;  1Q7Y U;  2L3P A;  1PM3 A;  3EGX A;  2BKD N;  2ZPE B;  3VS6 A;  2IPO B;  5KE3 A;  4E47 A;  3UT1 A;  3PFS A;  1V76 A;  4HVV A;  3CC4 Q;  1PD0 A;  1WHL A;  2A08 A;  1PG5 B;  4KGX B;  2EAY A;  1RLP C;  1RLQ C;  2RM4 A;  3X20 B;  2KGT A;  2EQK A;  4AG2 C;  3EG0 A;  1M5Q 1;  3MHX A;  2L3Q A;  4NOY A;  4C92 D;  3MP1 A;  2AZS A;  1WGS A;  1ZA2 B;  1O9S A;  3JB9 F;  3UAT A;  3FEO A;  3M0P A;  1P92 A;  3OYF A;  1G5V A;  1M90 C;  4A4H A;  2KT1 A;  1VQP Q;  3BW1 A;  2ENM A;  2MAM A;  4B9X A;  1K76 A;  2VAS A;  2B8A A;  3R6O A;  1BYM A;  5GAN 2;  2DL7 A;  3A98 A;  2ZPF B;  2C0I A;  4B6M A;  2C0O A;  1PWT A;  4QKU A;  1BCM A;  2KQW A;  3M0R A;  1UE9 A;  3S3O A;  1T3S A;  5GMK i;  4NL3 A;  2Z0W A;  4PJO E;  2HNI A;  2DM1 A;  4QVZ A;  2DRM A;  2JT4 A;  1WZO A;  1N27 A;  3L2Q A;  3CC4 A;  1YWP A;  1TUG B;  3PVQ A;  2XG8 D;  3A8M B;  2LDM A;  1M2V A;  5CQY A;  2LT4 A;  2LT1 A;  5J26 A;  1AEY A;  3O8V A;  3C94 A;  4M78 G;  2XHC A;  5KYY B;  1TG0 A;  1K0X A;  2GFU A;  4PFO A;  5DM7 R;  2RHZ A;  2DEQ A;  1TUC A;  2GF7 A;  1KC8 U;  2D9T A;  2SEM A;  1X43 A;  1PSF A;  2OAW A;  3BY7 A;  4HVW A;  1OQK A;  1VQP A;  4C5I A;  3EFO A;  2EKH A;  4E7S A;  1Y7X A;  1V1C A;  2M51 A;  3JV3 A;  5GAO p;  3RDV A;  5FRN A;  4NS5 A;  4ZGD B;  3CCE T;  2VGN A;  2O01 E;  1PHT A;  1ARK A;  1G8X A;  1E7O A;  4ANJ A;  2E10 A;  2X9H A;  4J9D A;  1TXQ A;  1AWW A;  3E9G A;  2FVU A;  2IIM A;  4R0K A;  2EJG A;  2VXF A;  1PCX A;  3RIR A;  2QXF A;  3UF4 A;  1EX4 A;  4HXJ A;  2A36 A;  1WX6 A;  4NL2 A;  2EGC A;  2P4T A;  3M57 A;  4C8Q D;  2NUT B;  5DLO A;  5CK9 A;  3E9F A;  1M9S A;  2M9U A;  3JAM E;  1GL5 A;  1QQJ A;  3BDL A;  1G83 A;  3I9Q A;  5FWC A;  4KGZ B;  2KR3 A;  1UTI A;  3PE0 A;  4EMG A;  2K5L A;  1G3Y A;  1HJD A;  1D1A A;  1AWO A;  2HBP A;  1M4Z A;  2DIL A;  1VIE A;  2QDY B;  1OEB A;  4PKC C;  5FU7 B;  4M75 C;  1QP3 A;  1V29 B;  2RI3 A;  4WCI A;  2JXB A;  2COW A;  2E5K A;  3M59 A;  2DNU A;  5GAO r;  2DZ9 A;  2JTE A;  1QKW A;  4OGC A;  3ZL7 C;  2RHU A;  3RMQ A;  4RG2 A;  2XDB A;  1W70 A;  3JB9 H;  4C92 F;  3JCM c;  2K3B A;  4K11 A;  5FRM A;  1G3W A;  3E1S A;  3SB2 A;  4PJL A;  2ZPB B;  4J7F A;  3VUB A;  1N9S A;  2RHI A;  4HVU A;  4C92 A;  4ZTJ A;  2EQJ A;  3A8G B;  1VQ8 T;  4L5G A;  2LJ0 A;  2PQW A;  2K9G A;  1LPL A;  2CP3 A;  1U3O A;  1MMA A;  3VRZ A;  5LJ3 e;  4PJN A;  4RTV A;  2R5A A;  2KRM A;  4QQG A;  2RNA A;  4A63 B;  2HD0 A;  5GAN 4;  1D0Z A;  1SEM A;  3HFO A;  2YUQ A;  1W6X A;  5KYW B;  2K2V A;  4IKF A;  1KD1 R;  1ZUK A;  2RI2 A;  5GJW B;  2MWP A;  2FRY A;  3PGG A;  2YUP A;  5GAN 3;  2NYS A;  3S3N A;  4EMK C;  2DIG A;  3N5B B;  3QDF A;  1WJS A;  4M77 C;  1VQM T;  3QSU A;  2XKO C;  3C4S A;  1ZSZ B;  1VQ8 Q;  4RTY A;  2XID A;  1D09 B;  1Q7Y R;  4BB7 A;  4D6W A;  3QUI A;  1XTD A;  5KYY A;  1VIF A;  2KAF A;  3PTA A;  2JTM A;  3OMG A;  1WHG A;  1ZBX A;  4J7I A;  2F5T X;  4XTZ A;  5FU6 C;  3UPU A;  1TOV A;  3QDR B;  4OMQ A;  2EQM A;  1RI9 A;  1RAH B;  2PZ1 A;  4OVA A;  4ELZ C;  2VVK A;  3QII A;  2DVE A;  3H0F A;  2EBP A;  2JJ9 A;  1M1K C;  4M7A B;  3CPW P;  2AK5 A;  4PJO D;  2EPD A;  2LP5 A;  2HMA A;  4GLK A;  3QJY A;  3SWN B;  1SRM A;  4M7A D;  5LJ3 h;  2LMJ A;  1C1A A;  3IQL A;  2KE9 A;  2HQH A;  2OX7 A;  5CKF A;  4Z88 A;  4KUL A;  2QGG A;  5LJ3 f;  1UUE A;  4C8Q F;  1RL2 A;  1S1N A;  5CKB A;  4OGE A;  1VYV A;  3F70 A;  3VS2 A;  1ABO A;  1NM7 A;  1OU9 A;  1W1F A;  4Y91 A;  1VQ8 A;  2QQB A;  1IO6 A;  4C8Q A;  1MMD A;  3NTK A;  1Q81 U;  4C0D C;  1YBY A;  2F2W A;  1D1C A;  2JTF A;  1JJ2 S;  2EYQ A;  1Q86 U;  2NUT A;  1O75 A;  3MEA A;  1GCQ C;  1C0M A;  4IUQ A;  4M4Z A;  5C6S A;  2CH4 A;  2E3H A;  2A0F B;  1I0C A;  1JXO A;  1ZX6 A;  2YWW A;  5GAN 5;  3CCQ T;  3LW5 E;  1UGV A;  3M0U A;  1YJW T;  1WLP B;  3M0S A;  2L8D A;  4XU0 A;  2HZY A;  3OB9 A;  1HD3 A;  1YJ9 Q;  2DZC A;  3DB3 A;  3PIP A;  2V1Q A;  3EG2 A;  3ZEH A;  1KQS S;  2O88 A;  4FU6 A;  3VJP A;  3I35 A;  3H6Z A;  4E7H A;  2GFA A;  1U8R A;  1X69 A;  2X51 A;  4F16 A;  1N5Z A;  5IXB A;  1QLY A;  2SRC A;  4J9I A;  1MGQ A;  2DYI A;  2K3X A;  5A0D A;  2DLP A;  2D8J A;  2CP6 A;  1QWF A;  2EYX A;  3M58 A;  4M75 E;  3OW2 S;  3V7S A;  3G1J A;  4LXC A;  2ED0 A;  4A4F A;  3L1A A;  2MIO A;  3L2R A;  2DFU A;  1I5O B;  2I2L A;  4QVD A;  1QCO A;  5CR2 A;  1M1F A;  4QW2 A;  2KYM A;  2JN0 A;  4JZ4 A;  3CCQ Q;  2LNH B;  1XOV A;  1KJW A;  1E6H A;  1YJW Q;  1KD1 C;  3CMA T;  4M78 C;  3OBW A;  3OYA A;  1MMG A;  1YJ9 A;  2OTJ T;  5GAN g;  1M1K U;  4LNP A;  1NJI U;  2RQT A;  2K79 A;  5KYW A;  3KXT A;  3WXM B;  1MV3 A;  4IUR A;  1GBQ A;  4PJO C;  2WSE E;  4XU2 A;  4BY6 B;  2P0P A;  3TCJ A;  3VV0 A;  3A5Z B;  1Z9Q A;  3ZFJ A;  4N4I A;  3M9Q A;  2I0N A;  3P8D A;  1SHF A;  1WXB A;  1QVF P;  3S6W A;  2K57 A;  4C5E A;  4JJN K;  1JQQ A;  1M1G A;  3MP6 A;  5GAN h;  1OOT A;  2WSF E;  3OSV A;  1M2V B;  3CQT A;  2JS0 A;  2AKL A;  4FYY B;  3CME T;  2QAZ A;  3FJP A;  3CCQ A;  3CC2 T;  3CMA Q;  1F1B B;  4L59 A;  3OYN A;  4DA4 A;  3QYG B;  2O9V A;  3CBO A;  4OMF B;  5J39 A;  3T9N A;  4J9E A;  4PJO F;  4CC4 B;  5GAN j;  1B7T A;  3RKY A;  2OTJ Q;  1KQ2 A;  2F2X A;  4M7A F;  2CZ1 B;  1YP5 A;  2D1X A;  3OA6 A;  4GBQ A;  2ZPI B;  4CI0 C;  5LJ5 e;  2EYW A;  2VB6 A;  3PMI A;  1VUB A;  5KYU A;  3A8O B;  4M7A A;  1WXT A;  3I5R A;  2RH2 A;  2DE0 X;  4JRK A;  2RQU A;  4XU1 A;  5J3B A;  2JMA A;  1FXX A;  4ZN1 A;  3ULR B;  4RTZ A;  2O2O A;  5GAN d;  1K9M U;  5KH6 A;  1WPY A;  3BFM A;  4PNO A;  3REA B;  3EFR A;  1JJ2 A;  5GAO n;  4IIM A;  2E41 A;  3CME Q;  3EGD B;  3HRU A;  3CC2 Q;  3UDC A;  2DTH A;  3CMA A;  2OTL T;  3P8B B;  4OMO A;  5DY9 A;  3LYI A;  2FG0 A;  2YUN A;  2MI6 A;  4J9G A;  1ABQ A;  2BZY A;  3REB B;  1BB9 A;  1YNZ A;  2L3R A;  3RKX A;  5LJ5 g;  3H0H A;  3E2U A;  1M8M A;  3EGU A;  3AHU A;  2JMC A;  4IUP A;  5IH2 A;  4PLL A;  3CPW S;  3TQ7 P;  4CRI A;  3H9N A;  1B34 B;  2QK0 A;  1U06 A;  2RN8 A;  5GMK h;  3JCM d;  1KC8 C;  3M4G A;  2AIR B;  1NYG A;  1Y57 A;  3G6E T;  1TS9 A;  4LDW A;  1K4U S;  2K4Y A;  1WYX A;  4WF2 A;  3M0Q A;  2E70 A;  1M2O A;  2X4Y A;  4MZM A;  5EC7 A;  2DRK A;  2EFI A;  5D6Y A;  2FL7 A;  3JCM P;  1WJQ A;  5GMK j;  4OMM A;  5LJ5 h;  1AHJ B;  1AD5 A;  3CME A;  3VYH B;  2K7A A;  5LJ5 f;  1EFN A;  3CC2 A;  4O5V A;  2OTL Q;  5M9O A;  4N4H A;  1Q82 U;  4ESR A;  1YN8 A;  1SG5 A;  2JUF A;  1OZ2 A;  5LJ5 j;  4C0Z A;  3CCL T;  2V8I A;  4C92 B;  3LWI A;  2G3R A;  3V8L A;  1VQ5 T;  1WDX A;  1CKA A;  1QKX A;  4ZN3 A;  1U1T A;  2L5Q A;  3GNF B;  4BE2 A;  3HRT A;  1VQN T;  5IHN A;  2FPF A;  3H8Z A;  1EZZ B;  3G6E Q;  2LCS A;  4OB1 B;  4M78 E;  2RQV A;  4OMP A;  2FZC B;  2DMO A;  4Y92 A;  4J8O A;  2LJ1 A;  2XI9 A;  1Q81 R;  1H92 A;  2DXC A;  3G71 T;  2GBQ A;  3OYK A;  1Q86 R;  1YFN A;  4OB0 B;  1PC0 A;  3C0C A;  2RK2 A;  1RAB B;  4M75 D;  4BUG A;  3V8J A;  2CKK A;  1MHN A;  1J3T A;  3QZ5 B;  2RA2 A;  3CCJ T;  1NZ9 A;  2P84 A;  1QMC A;  2FZG B;  2DL4 A;  2FRW A;  3FDR A;  2CUD A;  3GIB A;  3G7Z A;  3CPF A;  4AMC A;  2CS7 A;  2OTL A;  1QCF A;  3ZBD A;  2HDA A;  2EQU A;  1K1Z A;  3LGL A;  1B07 A;  4F14 A;  2EWN A;  5FW9 A;  2BE9 B;  2XDD A;  2X4X A;  3CCL Q;  4DQ2 A;  1HYO A;  4ZGE B;  4JLI A;  1VQ5 Q;  2DPP B;  2OJ2 A;  1YCY A;  5HY6 A;  2MCN A;  3CC7 T;  1QW1 A;  4QT7 A;  5GAO m;  1VQN Q;  4Z02 A;  4JRP A;  3G6E A;  3RR6 A;  4PL6 A;  1OU8 A;  4FW1 A;  3HKS A;  2DXT A;  1UFF A;  3G71 Q;  4LE9 A;  2MMP A;  2CRE A;  4XTY A;  2E5Q A;  2LQK A;  4CC3 A;  2K5I A;  2COY A;  3CCJ Q;  3LH0 A;  2ZAE A;  3HSB A;  2NUP B;  4DBH A;  3OYE A;  1ZBJ A;  1WNL A;  3HHT B;  4FSS A;  3HP9 A;  3EG9 B;  2M02 A;  4M77 B;  4N0A C;  4LDX A;  2BIV A;  3EH1 A;  1M1K R;  3MO8 A;  1NJI R;  4M77 D;  4JUV A;  4C5G A;  4O6J A;  3CCL A;  3EGD A;  2CT3 A;  2QTX A;  4E2F B;  4C8Q B;  1VQ5 A;  4FYX B;  4M7D E;  4EDU A;  3CC7 Q;  1VQN A;  3CPW A;  3KUF A;  1WJR A;  4X1V A;  1W2B P;  2EQI A;  4X9D A;  5I2M A;  5FU6 B;  2H3J A;  4BD3 A;  2WSC E;  3NTH A;  3LWH A;  2MYS A;  1M30 A;  4R56 A;  2O4X A;  2LCC A;  3G71 A;  1B34 A;  2JM9 A;  4PLI A;  1WFW A;  2R58 A;  2DX1 A;  2BUD A;  3CCJ A;  2EJF A;  4HT8 A;  2J7I A;  1IHW A;  5ECA A;  4F7U B;  1ZLM A;  5DLQ E;  2LVM A;  4Z8A A;  3CXC S;  4HKE A;  4DEX A;  5HK3 A;  3J7A F;  2J6K A;  2RK1 A;  5HKC A;  4M7D G;  1TSF A;  3RES A;  4DOV A;  3M56 A;  3TRE A;  2EVR A;  3P8H A;  2NWM A;  1K0S A;  4JJD A;  2MWO A;  2O9S A;  2K2M A;  2E65 A;  3CC7 A;  5GAM e;  3RMS A;  1I8F A;  2EGA A;  2E1H A;  2O31 A;  1MMN A;  1BI2 A;  2L3S A;  4XTV A;  1Q81 C;  4XTX A;  2YLC A;  4BI8 B;  4XTU A;  1RAI B;  2QQ9 A;  1K9M R;  2M0O A;  1Q86 C;  4OF1 A;  3MET A;  2DD4 A;  5L8R E;  2CZ0 B;  5I22 A;  1PRM C;  4M75 F;  4KBM B;  3OQ5 A;  1RAD B;  3THK A;  4DBQ A;  1K73 C;  2RJF A;  1GFC A;  3M5A A;  1WQ7 A;  2ZZD A;  4PFP A;  4M75 A;  3X24 B;  1ACM B;  1H3H A;  1WQW A;  4J9B A;  3V7C A;  2CGH A;  2QQS A;  1SPK A;  4ATO A;  1AZG B;  1WHM A;  2D8H A;  3HL8 A;  2JW4 A;  4A4G A;  5IHK A;  1UJY A;  1X27 A;  4UC4 A;  5GMK m;  3DLM A;  1VA7 A;  5GAM g;  2QQA A;  3RNJ A;  4TVR A;  3JB9 G;  1R77 A;  5IAY A;  2DEU A;  4LUE A;  1D1B A;  4A54 A;  2LX9 A;  2YHT A;  2KBT A;  2H3E B;  4HCB A;  2YXY A;  4AG1 C;  5LJ3 g;  1HK9 A;  4LD6 A;  2GCX A;  3Q1J A;  1G3S A;  1YHQ T;  1QVG P;  2VGM A;  4M78 D;  3KFV A;  2L0A A;  4B9W A;  3CBP A;  4C0G A;  1FMK A;  2YDL A;  1PRL C;  1TTH B;  5GAM h;  3CCS T;  1AVZ C;  2IG0 A;  1EIF A;  1Y07 A;  2KVQ G;  4LDY A;  4PJO B;  4E7J A;  1Q82 R;  2HBW A;  1QVF A;  4F04 B;  5GAM f;  5KYU B;  4JJC A;  1YJ9 T;  2LNV A;  1NJI C;  1UDL A;  1RAG B;  3RKW A;  2W0Z A;  4M77 F;  2V1R A;  4EMK A;  2KK4 A;  2KDS A;  3JCM V;  2NUP A;  1TH7 A;  4C5H A;  2XU8 A;  3EHR A;  3X25 B;  3RUX A;  3EG9 A;  4M77 A;  4AFZ C;  2EYY A;  1JBM A;  1CSK A;  1BIA A;  5AYF A;  3PNW C;  2KT8 A;  2FHD A;  5D6X A;  4E7I A;  5A0L A;  1OPL A;  3DKM A;  1UEC A;  2DER A;  2C06 A;  1JXM A;  2PNI A;  3RER A;  5LJ3 j;  3L42 A;  1WHH A;  1KSW A;  5D6W A;  2CSI A;  3TSZ A;  1YHQ Q;  2DTO A;  3MP8 A;  3EAE A;  2Y4Y A;  2V8K A;  5FU7 C;  3JCM J;  4MDW A;  2FYK A;  1BI3 A;  4RMO A;  4DEY A;  3J81 E;  1GRI A;  1OPK A;  3CCS Q;  2YT6 A;  3VYG A;  5L23 A;  4RTX A;  3X26 B;  1K73 U;  4ELY C;  2H8H A;  3JCM Q;  3A1P A;  1VQK Q;  3CXC A;  4LDV A;  4F7U F;  3NTI A;  4PJM A;  5LJ3 d;  2J06 A;  3VS1 A;  2LQ8 A;  2HSE B;  1RAE B;  5A2Q E;  3JCM W;  4JS5 A;  5FRO A;  4F7U A;  3GNG A;  3L2U A;  1YWO A;  4FT2 A;  2DA9 A;  5EG2 A;  1X2K A;  1M3A A;  1KC8 R;  4E6R A;  2GQV A;  3MJX A;  1QCN A;  2MK5 A;  1SHG A;  2RHY A;  4RUG A;  1R8O B;  1K9M C;  5HCK A;  2X35 A;  1YHQ A;  1ZA1 B;  2JNG A;  3EG1 A;  1D3B A;  1GCQ A;  1XNI A;  3S3M A;  1UB4 A;  2BZ8 A;  2LX7 A;  2PUO B;  3CCS A;  4J5Y A;  1IB8 A;  1NG2 A;  1Z9Z A;  1OV3 A;  1TU0 B;  2GNC A;  5I11 A;  1T0H A;  1K9A A;  5GAN 6;  2DBK A;  1ZUY A;  2A7Y A;  2EJ9 A;  1VQK A;  5KCO A;  4E7L A;  2QI2 A;  1XJW B;  1YIT T;  3KBG A;  1RAF B;  4JLG A;  1GBR A;  2CSQ A;  2PU9 B;  4CC7 A;  2KRS A;  1NBE B;  3CCV T;  1U1S A;  2BE7 D;  5D7U A;  4Y28 E;  2PVO B;  1ZSZ C;  4C92 G;  2RF0 A;  2L89 A;  1LJO A;  4KUD K;  1VQ6 T;  1UGP B;  2RQR A;  4AT1 B;  1BKB A;  2QTV A;  4IUT A;  2DXU A;  3MKD A;  3OYL A;  3UWN A;  1NPR A;  1KK7 A;  2QA4 T;  1SSH A;  2KMT A;  3GF5 A;  2LQN A;  3CBM A;  4KH1 B;  1QWE A;  1N9R A;  5KCH A;  1N8R C;  2YUO A;  2FB7 A;  1UG1 A;  4M78 F;  3QKJ A;  3H41 A;  5CKE A;  2FZK B;  4GLM A;  3QPH A;  1UGS B;  2CZ7 B;  1Q82 C;  4M78 A;  3SWN C;  3G4S T;  3TEE A;  3OYB A;  1YIT Q;  2OI3 A;  1OUL A;  2XK0 A;  3V7R A;  3QJ6 A; 
#chains in the Genus database with same CATH homology
 2FPE A;  1H92 A;  2ROT A;  2GBQ A;  4WCI A;  2JXB A;  2E5K A;  2RMO A;  2ESW A;  2DNU A;  3C0C A;  3ZL7 C;  2JTE A;  1QKW A;  2BTT A;  1X6B A;  1J3T A;  1U5S A;  1ZUU A;  1W70 A;  3NPF A;  2DL4 A;  2FRW A;  2JS2 A;  2K3B A;  4K11 A;  2CUD A;  3VS4 A;  1QCF A;  2FEI A;  3UA6 A;  2HDA A;  1K1Z A;  1B07 A;  4HVU A;  4F14 A;  2G6F X;  2BZX A;  1ZSG A;  5FW9 A;  3NMZ C;  3UA7 A;  4Y92 A;  3VRY A;  4ZNX A;  2LJ0 A;  1GCP A;  2K9G A;  1HSQ A;  2OJ2 A;  1U3O A;  3VRZ A;  2MCN A;  1UHF A;  4RTV A;  4IIO A;  2J05 A;  4QT7 A;  2KRM A;  2RNA A;  4A63 B;  4F17 A;  2KXC A;  4KRT A;  1SEM A;  2YUQ A;  1UJ0 A;  1W6X A;  1BBZ A;  2RQW A;  1UHC A;  2LJ3 A;  1ZUK A;  4ORZ A;  1E6G A;  5GJW B;  1UFF A;  2FRY A;  4LE9 A;  5IHI A;  2CRE A;  1CKB A;  3EG3 A;  4CC3 A;  2YUP A;  1I07 A;  5FWB A;  4D8K A;  2P4R A;  4HCK A;  1ZBJ A;  4FSS A;  4AFS C;  3LH5 A;  2DJQ A;  1MUZ A;  3SHW A;  2ROL A;  2A37 A;  1X6G A;  1PNJ A;  5GJV B;  2CT3 A;  4RTY A;  2CDT A;  2DL5 A;  2F2V A;  1BU1 A;  4X1V A;  2EQI A;  4OMQ A;  1PKT A;  3GBQ A;  1RI9 A;  2PZ1 A;  2LZ6 B;  2DVJ A;  2M0Y A;  2VVK A;  1AWX A;  1M30 A;  4LUD A;  3H0F A;  1YCS B;  2EBP A;  2EGE A;  2AK5 A;  2J6F A;  2JM8 A;  2EW3 A;  2JM9 A;  2EPD A;  2LP5 A;  1WFW A;  2K6D A;  1PKS A;  1JU5 C;  2DX1 A;  1SRM A;  1A0N B;  2LMJ A;  3IQL A;  4AFQ C;  1NLO C;  1T3L A;  5IXF A;  2KE9 A;  2J7I A;  2LQW A;  4Z88 A;  5ECA A;  1WI7 A;  1ZLM A;  1UUE A;  1WIE A;  2W10 A;  4Z8A A;  1B3Q A;  4DEX A;  1AOJ A;  1S1N A;  2KEA A;  1AWJ A;  2D0N A;  1JEG A;  2J6K A;  4JJB A;  1VYV A;  3VS2 A;  1ABO A;  1NM7 A;  1W1F A;  3TVT A;  1IO6 A;  3VS0 A;  1TUD A;  1WA7 A;  1WXU A;  2FPD A;  4AFU C;  2EVR A;  2NWM A;  3VS5 A;  1K0S A;  2RPN A;  1VYT A;  2F2W A;  4JJD A;  1MV0 B;  2O9S A;  2K2M A;  2KRO A;  2GQI A;  4CC2 A;  1GCQ C;  4M4Z A;  2CH4 A;  2EGA A;  2O31 A;  1I0C A;  1JXO A;  1ZX6 A;  2VWF A;  3FJ5 A;  1UGV A;  3M0U A;  1WLP B;  3M0S A;  2L3S A;  2GGR A;  4JZ3 A;  4LN2 A;  1HD3 A;  2C0T A;  2V1Q A;  3EG2 A;  2XMF A;  5I22 A;  1PRM C;  2O88 A;  3M0T A;  3THK A;  3I35 A;  1X69 A;  1GFC A;  4RTW A;  4F16 A;  1N5Z A;  2KRN A;  5IXB A;  1QLY A;  2SRC A;  1H3H A;  4J9B A;  4J9I A;  2QDL A;  2DLP A;  4EIK A;  1SPK A;  2D8J A;  4D8D A;  1QWF A;  2EYX A;  1AZG B;  2D8H A;  2JW4 A;  5IHK A;  1UJY A;  1X27 A;  2ED0 A;  1VA7 A;  1I1J A;  2DYB A;  1G2B A;  3RNJ A;  3EHQ A;  4OMN A;  3VS3 A;  4OML A;  2DL3 A;  1NLP C;  1RUW A;  2MIO A;  1NEB A;  1AZE A;  4LUE A;  2J6O A;  2KYM A;  4J9F A;  4JZ4 A;  4RTT A;  2LNH B;  1XOV A;  1KJW A;  1E6H A;  2KBT A;  2B86 A;  4AG1 C;  2GTO A;  2VKN A;  2FO0 A;  3KFV A;  2L0A A;  4LNP A;  3R6N A;  4Z89 A;  2RQT A;  2K79 A;  2DBM A;  1FMK A;  2YDL A;  1PRL C;  2L3P A;  1AVZ C;  1MV3 A;  1GBQ A;  4J9C A;  2HBW A;  2NUZ A;  3VS6 A;  4JJC A;  1Z9Q A;  2GTJ A;  1UDL A;  2W0Z A;  4HVV A;  2V1R A;  4JPB W;  2A08 A;  2I0N A;  1RLP C;  1SHF A;  1WXB A;  1RLQ C;  3NHN A;  3EHR A;  1JQQ A;  1OOT A;  4AFZ C;  2EYY A;  2HSP A;  2KGT A;  3CQT A;  4AG2 C;  3EG0 A;  2JS0 A;  1CSK A;  2AKL A;  2KT8 A;  2L3Q A;  1OPL A;  2CUB A;  1UEC A;  2AZS A;  1JXM A;  2PNI A;  2O9V A;  1NYF A;  3UAT A;  3SEM A;  2ED1 A;  3M0P A;  1KSW A;  1FYN A;  2CSI A;  4J9E A;  4CC4 B;  3TSZ A;  2A28 A;  2KT1 A;  2DL8 A;  2F2X A;  2ENM A;  1YP5 A;  1K76 A;  1M3B A;  2D1X A;  3I5S A;  4DEY A;  1H8K A;  1GRI A;  1OPK A;  4GBQ A;  2DL7 A;  2YT6 A;  3A98 A;  2C0I A;  2C0O A;  1PWT A;  5L23 A;  2EYW A;  4RTX A;  2L2P A;  3M0R A;  1UE9 A;  2H8H A;  1WXT A;  3I5R A;  1T3S A;  2DM1 A;  2DE0 X;  2DRM A;  2RQU A;  2ABL A;  3RBB B;  2JT4 A;  3TSW A;  3U23 A;  2JMA A;  1YWP A;  2J06 A;  3ULR B;  3VS1 A;  3PVQ A;  3QWY A;  4RTZ A;  2O2O A;  1YWO A;  2DA9 A;  1M27 C;  2KYB A;  3REA B;  1X2K A;  2HEQ A;  4IIM A;  1M3A A;  1AEY A;  4E6R A;  2AZV A;  1NEG A;  3O5Z A;  1TG0 A;  1SHG A;  1K0X A;  4RUG A;  4OMO A;  1TUC A;  2FG0 A;  2YUN A;  2KNB B;  5HCK A;  4J9G A;  2SEM A;  3H0I A;  1ABQ A;  2BZY A;  3REB B;  1X43 A;  1BB9 A;  1YNZ A;  2OAW A;  1GFD A;  3EG1 A;  4HVW A;  1GCQ A;  1M3C A;  3H0H A;  2BZ8 A;  1M8M A;  3EGU A;  2LX7 A;  2EKH A;  1V1C A;  2M51 A;  2JMC A;  3JV3 A;  1NG2 A;  5IH2 A;  1Z9Z A;  1OV3 A;  1KIK A;  2GNC A;  5I11 A;  2RN8 A;  1U06 A;  1T0H A;  1K9A A;  2DBK A;  1ZUY A;  1JO8 A;  1PHT A;  1ARK A;  1LCK A;  1NYG A;  1Y57 A;  1Y0M A;  1E7O A;  1K4U S;  1GBR A;  2X3W D;  1KFZ A;  1VYU A;  2CSQ A;  1WYX A;  4CC7 A;  2KRS A;  4J9D A;  3M0Q A;  1AWW A;  3VS7 A;  5EC7 A;  2DRK A;  2IIM A;  3QWX X;  4R0K A;  2RF0 A;  2DF6 A;  3UF4 A;  2RQR A;  4OMM A;  4HXJ A;  1AD5 A;  2A36 A;  1WX6 A;  2MOX A;  2K7A A;  1EFN A;  2EGC A;  1SSH A;  2LQN A;  4ESR A;  1QWE A;  1YN8 A;  3PVL A;  2YUO A;  2HCK A;  1UG1 A;  2X3X D;  1BK2 A;  1T0J A;  2PTK A;  1GL5 A;  1G83 A;  3I9Q A;  3H41 A;  5FWC A;  4GLM A;  2KR3 A;  1WDX A;  1CKA A;  1QKX A;  1UTI A;  3NGP A;  2CH4 W;  2EYZ A;  4J9H A;  3PE0 A;  2CT4 A;  2AKK A;  2YSQ A;  2ECZ A;  5IHN A;  2FPF A;  1HJD A;  2KXD A;  1X2Q A;  2LCS A;  2OI3 A;  1AWO A;  1SRL A;  2RQV A;  4OMP A;  2DIL A;  4RTU A;  2DMO A;  1OEB A;  2LJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...