2FPEA

Conserved dimerization of the ib1 src-homology 3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords C-jun-amino-terminal kinase interacting protein 1
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
total genus 14
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpeA00
2AKKA 2J6FA 2XMFA 1UHFA 2YUNA 3VS4A 4HCKA 1AD5A 4DEXA 2FO0A 1JXOA 2L3SA 2BZ8A 2FRWA 4J9DA 2IIMA 1U3OA 1NM7A 1OPLA 2MIOA 2CT4A 1FYNA 2JT4A 2YUQA 5I11A 1H3HA 2HBWA 2D1XA 2W0ZA 1SPKA 2LMJA 4OMOA 4AFUC 4CC3A 3H0FA 3M0PA 4LUDA 2HDAA 1TG0A 5IH2A 2LNHB 1RLQC 1X2QA 1ZUYA 2L3QA 1EFNA 1NLPC 4FSSA 1IO6A 1T3SA 4GBQA 1VYTA 3QWXX 2ECZA 4JJCA 2NWMA 1LCKA 1BB9A 2X3WD 3FJ5A 1HD3A 1T0JA 3EG0A 3M0QA 2G6FX 3EG3A 4CC7A 2KR3A 2DL3A 2DJQA 2BTTA 4D8KA 2F2WA 1G83A 2DLPA 2LP5A 1AWWA 2FRYA 4J9CA 1W70A 3TSWA 2NUZA 1GCPA 1X6GA 2F2VA 1GFCA 2L0AA 3REAB 2JM9A 2EBPA 4LUEA 2O9VA 1S1NA 2HSPA 3QWYA 2ED0A 4Z8AA 3NPFA 4AG2C 2E5KA 1FMKA 4A63B 1K9AA 4M4ZA 4HXJA 2ED1A 1QKWA 2CREA 3LH5A 2MOXA 1K4US 1VYUA 3VS2A 1RLPC 3M0UA 2YDLA 2K2MA 3REBB 1PNJA 2GTOA 4J9EA 2KYBA 1WYXA 1UG1A 1MUZA 2C0IA 2KT8A 2V1QA 4RTZA 4RTWA 2D0NA 2LJ1A 2RQVA 2A28A 1OOTA 1E6GA 3UA7A 1UECA 2DL4A 1KJWA 3NGPA 1CSKA 3UATA 1PWTA 1K76A 2EQIA 1ZUUA 2J6KA 2JW4A 1Y0MA 3H0HA 2A36A 3VRYA 1RI9A 2JS2A 2KXDA 2HEQA 2DMOA 5EC7A 3SEMA 4JZ3A 1K0SA 1KFZA 5FW9A 1WFWA 5FWCA 2EYZA 2LZ6B 2A08A 1ZBJA 2P4RA 4RUGA 1OPKA 2DILA 3RNJA 2K7AA 2GNCA 1SSHA 1NEBA 1GBQA 3VS5A 4K11A 1AZEA 2JMCA 3TSZA 2BZXA 1WIEA 1UE9A 2BZYA 1M3AA 4Z89A 1W6XA 1AZGB 1OEBA 2KT1A 3EG1A 3VRZA 1GCQC 3RBBB 2X3XD 3EHQA 1X69A 3UA6A 4JJDA 3O5ZA 4RTUA 4E6RA 2KE9A 4JJBA 1M3CA 2EW3A 3H41A 2D8HA 2DL7A 4JZ4A 1SRMA 2KRSA 2K79A 4J9HA 4J9BA 2M0YA 2LQWA 3PVLA 3VS1A 4F14A 2DRMA 2CDTA 2O31A 1T3LA 1MV3A 4AFQC 1SHFA 2AK5A 2W10A 1U5SA 1PRMC 1CKAA 3VS0A 1K1ZA 1NYGA 5IXFA 1J3TA 2CSIA 2KROA 1YCSB 3CQTA 3VS7A 1BBZA 3TVTA 1WI7A 2RQRA 2J7IA 1T0HA 1V1CA 3NHNA 1PHTA 1H92A 2FPEA 1PKSA 3I5RA 4KRTA 2CUDA 2GQIA 4OMLA 2KXCA 1AVZC 3U23A 3GBQA 2K3BA 2B86A 1I0CA 2OI3A 2O9SA 4LNPA 4ZNXA 1W1FA 2GTJA 1TUCA 4J9GA 1HSQA 1AEYA 1WLPB 2YSQA 1A0NB 3NMZC 2YT6A 4OMNA 1NG2A 4LE9A 1ZSGA 1VA7A 1ZUKA 2JTEA 3EG2A 2L3PA 1ZLMA 3JV3A 5IXBA 1H8KA 2AZVA 1OV3A 2J6OA 1JXMA 1JU5C 2CH4W 2JXBA 2EVRA 3ULRB 1GRIA 1JO8A 1ZX6A 2AKLA 2EKHA 3SHWA 1YN8A 2LJ0A 2V1RA 2I0NA 4HVVA 3I35A 1CKBA 2EGEA 1N5ZA 2L2PA 2RNAA 2SEMA 1UGVA 2RQTA 2LCSA 4OMQA 2RQWA 3A98A 2QDLA 2PTKA 4X1VA 1Y57A 2JM8A 2LQNA 4RTXA 2DRKA 4AFSC 1I07A 2C0OA 1NLOC 2OAWA 4LN2A 1PRLC 2CSQA 2ENMA 2EYXA 5I22A 2ABLA 3M0SA 2F2XA 3C0CA 4D8DA 4ESRA 1B3QA 2KGTA 2RN8A 4J9IA 3I5SA 4CC4B 2DBMA 2CUBA 1HJDA 1KSWA 2KBTA 1M3BA 2LJ3A 2J05A 1Z9QA 1GCQA 4HVUA 5IHIA 2O88A 2KYMA 2MCNA 1SRLA 2KRNA 1MV0B 2FG0A 1UUEA 2VVKA 4AG1C 4Y92A 2PNIA 2H8HA 4F16A 4RTTA 2K9GA 5IHNA 2ROTA 4RTYA 1KIKA 4OMMA 2RPNA 2AZSA 1QWEA 4Z88A 4CC2A 1ARKA 2YUOA 2VWFA 5ECAA 1E7OA 4HVWA 1X6BA 1Z9ZA 2DVJA 4IIMA 1UHCA 1BU1A 1AWXA 2CH4A 3IQLA 1NEGA 2DNUA 3PVQA 1UJ0A 1M30A 5FWBA 1RUWA 5IHKA 5L23A 2A37A 2ESWA 1B07A 1XOVA 1WDXA 2D8JA 2DBKA 3VS6A 2C0TA 2EGCA 2GBQA 1WXUA 2RMOA 2DL8A 1AOJA 1WXBA 5GJWB 3VS3A 3ZL7C 1JEGA 4F17A 1YP5A 3R6NA 1QCFA 1SEMA 1WA7A 3H0IA 2YUPA 1UFFA 2J06A 1VYVA 3M0TA 2JS0A 4EIKA 4WCIA 5GJVB 1WX6A 2DE0X 2OJ2A 2SRCA 1X2KA 4JPBW 1YWOA 1QLYA 1YNZA 2DX1A 1GFDA 1K0XA 2KNBB 1PKTA 1GL5A 2FEIA 2RQUA 2DA9A 3KFVA 2EYWA 4QT7A 1UJYA 2HCKA 1YWPA 2KEAA 2LX7A 1JQQA 1ABOA 1QWFA 1QKXA 3UF4A 1I1JA 2FPDA 2EYYA 2DYBA 3EGUA 1TUDA 2EPDA 3PE0A 4J9FA 2K6DA 1WXTA 2EGAA 5HCKA 2PZ1A 2CT3A 2ROLA 1U06A 3EHRA 1AWOA 2GGRA 1GBRA 1E6HA 2DM1A 1ABQA 1M27C 2RF0A 4RTVA 2O2OA 2FPFA 4ORZA 1G2BA 1X43A 3THKA 2JMAA 4GLMA 3I9QA 1M8MA 3M0RA 4IIOA 1SHGA 1UDLA 2DF6A 2KRMA 1AWJA 1UTIA 2DL5A 4OMPA 1NYFA 1X27A 2VKNA 4R0KA 4AFZC 1BK2A 4DEYA 2M51A
chains in the Genus database with same CATH superfamily
2MAMA 2AKKA 2J6FA 4PJOD 4J5YA 2XMFA 1UHFA 1TTHB 2QEXT 1MMNA 1BI0A 3VS4A 4J9DA 2IIMA 3CCEQ 3E2UA 3J7AF 4EMKA 3CC2Q 1VQ8A 1VQPA 2JT4A 4E7JA 4A54A 2QGFB 3AT1B 2JNGA 3MP8A 1FWZA 1X75C 3NFCA 5GAMf 1TG0A 4ELZC 3HRSA 2FHDA 4M7DD 2L3QA 4XQ3A 1JRIA 1WNLA 5A0LA 3QO3A 5GANd 3CC4T 3QWXX 2ECZA 1W2BP 4PFZA 1WJSA 2X3WD 3FJ5A 2DEQA 2RH2A 3EG0A 3S3NA 1UB4A 4FU6A 4DOVA 2F2WA 2DLPA 1MHNA 2VXFA 2FRYA 3LGLA 1K8AR 4M78B 2NUZA 1VQ9A 3M5AA 1MMDA 1Q7YC 1NJIU 3PTAA 2JM9A 3VU3C 2LT1A 4ZN3A 1VQ6Q 1S1NA 2HSPA 1TXQA 4PK4A 4XK8E 4FT2A 1VQNT 4M7AA 3CCLT 4Z8AA 1VQ5A 2MI6A 4N4IA 4A63B 3E9GA 5CAIA 4HXJA 1QKWA 2QQRA 1FXXA 3QUIA 4XTXA 4M75F 1VYUA 2JN0A 1RLPC 3G4ST 2P84A 3GNFB 4CRIA 1VQ8Q 5GAMd 3A8GB 4FYVB 1VQPQ 3KXTA 3I55A 1UG1A 2R5MA 1QVPA 1M2VB 2C0IA 3ZFJA 4ANJA 3OYJA 2RQVA 4E7ZA 1AT1B 1HXDA 3M57A 2XI9A 3RUXA 4C92C 3KUFA 4OGCA 2A36A 3JCMh 3CCQA 2JS2A 3A1PA 4JZ3A 1P92A 1K0SA 2QASA 3EGDA 5GMKm 2KY9A 5FWCA 3OYHA 2FYKA 2EYZA 2LZ6B 4PJOG 4P5NA 3CCRT 1C6VX 2AIRB 3CD6A 3VS5A 1VQ9Q 1WIEA 1R8OB 4XTUA 4ATOA 1VQ4A 5KYWB 3VRZA 5FLXE 1OZ3A 1VQ5Q 1X69A 4E6RA 2E3HA 2E3IA 2FVUA 2KE9A 2QI2A 1ACMB 2KRSA 3M9QA 4NL3A 3BE3A 3FLGA 1VUBA 4JRPA 3CPWS 1SG5A 1Y7XA 1XJWB 5GAN5 2LQKA 3JCMP 3OYGA 3OYEA 1SHFA 4MDWA 3I55Q 3H6ZA 2XD0A 1J3TA 2CSIA 2KROA 2ZPEB 1JJ2S 3OY9A 1YCSB 1T0HA 1V1CA 2GCXA 1QCNA 4HCZA 1IHWA 3WVEB 1PKSA 3Q1JA 4N0AC 3OYIA 1YJ9A 3NTHA 1VQMA 4KRTA 1K73U 2PVDB 5I2MA 5GAN2 1OULA 3OYNA 3PMTA 2VV5A 2CZ0B 4ZNXA 2DD4A 4B9XA 4M78A 3G6EA 3EAEA 1HSQA 2YSQA 3HFOA 3OA6A 2K3YA 2L3PA 1ZLMA 2Y4YA 5LJ5g 1H8KA 1OV3A 3CMAT 3LW5E 1KHCA 3C95A 1KHIA 2QTXA 1GRIA 1O75A 1ZX6A 1VQ4Q 1WHKA 2EKHA 3SHWA 3CCJQ 2V1RA 3CPWA 3JB9I 3I35A 1CKBA 2EGEA 2RNAA 3HHTB 2SEMA 3G71T 2F5TX 2LCSA 4XU1A 1M90R 3CEYA 2PTKA 4X1VA 2HAXA 2JM8A 2LQNA 3JCMf 1JJ2A 1G8XA 2MMPA 3RDVA 4RMOA 2EFIA 3BY7A 1M2VA 4C92E 2OAWA 4M77C 1PRLC 4QW2A 2ABLA 2M1HA 3M0SA 4M75D 4J9IA 3OYLA 3I5SA 4CC4B 3QYGB 2KSSA 4C92G 1MNEA 2CGHA 3N5BB 2DXCA 1HJDA 2KBTA 4Z02A 1YJ9Q 1GCQA 3M56A 1YHQT 2RI3A 2BKDN 4M77D 1K9MU 4LD9K 1S72T 4BB7A 2H8HA 1XNIA 4F16A 4DBQA 3JCMe 4QQDA 2ROTA 5GAN3 3CCUT 2XDDA 1OU9A 4C0FA 1ARKA 3VYHB 1UGSB 2VWFA 1E7OA 4C5IA 4HVWA 4DQ2A 3M58A 1B34B 3ER0A 5KYWA 1AWXA 2HKNA 2DNUA 1UJ0A 5L23A 3L2ZA 1B07A 1XOVA 2ZZDA 3CCST 1GXIE 2LQ8A 3DKMA 3VV0A 5LJ5d 4B6MA 3VS3A 3L1AA 4MZPA 1PD1A 1Q7YR 2ATCB 4J6WA 1WA7A 3PMIA 1D0YA 2YUPA 1UFFA 1VQOA 2L3RA 4VUBA 2QDYB 3ME9A 4C5HA 3OYKA 1N9RA 2FZCB 3M54A 4IUPA 2DX1A 1GFDA 4HA8A 1PCXA 3JCMQ 4ELYC 1WHGA 2FEIA 2DA9A 2XKOC 5IAYA 3OYAA 2O4XB 4EPCA 2FL7A 2VYTA 2L5QA 3UF4A 2FPDA 3FEOA 4PJOB 2DYBA 1G5VA 4JLIA 1RABB 4EDUA 2DXTA 4X9DA 3P8HA 3X20B 3EH1A 3CCMT 3HSBA 3RKWA 1WXTA 2CP3A 2PZ1A 3HRUA 2M16A 1VQ7T 3PIPA 1AWOA 3VKIA 3J80E 5CKEA 4DBFA 3RMSA 2V8KA 1M27C 2O2OA 2ZPIB 3CC7A 2EWNA 1N8RU 2QQ9A 5CKDA 5GANh 2EJGA 1ZA1B 3M0RA 5A0GA 1M9SA 2DF6A 2ZCFB 4FW1A 1AWJA 1QVGP 1VQOQ 4Y28E 1Y96B 4AMCA 3QBYA 1U8RA 2GFUA 2QXFA 1IGQA 4QKUA 3JAME 4DEXA 2FO0A 3SWNC 5FU7C 3CCRA 3WVDB 1YJWA 2RJFA 1U1SA 2RK2A 1NBEB 2CT4A 2VUBA 3C12A 1B34A 1H3HA 5M9OA 2D1XA 1G3SA 4CC3A 3M0PA 4IUTA 2HDAA 1OQKA 3RKYA 4A4KA 4FYWB 2H3EB 4E2FB 2KK4A 1RLQC 1ZUYA 4FT4A 1EFNA 1NPRA 1KQSS 1T3SA 5GAMh 1IRXA 4E7IA 3RKXA 1WHLA 1BB9A 2WSFE 2DVEA 1EIFA 3GNGA 4ME7A 4C8QC 2DJQA 3LYIA 2BTTA 2LP5A 5DLOA 1AWWA 3CC7Q 2MK5A 1W70A 3TSWA 5HK0A 2F2VA 3E9FA 2DYIA 2PUOB 2FB7A 2EBPA 1D0XA 3QWYA 2MWOA 4AG2C 3DB4A 4J6XA 3FDRA 1I5LA 2PUKB 2QYZA 2D0QB 2EYQA 3LH5A 4RKUE 1I5OB 4C92B 1MGQA 2QTVA 2LCLA 3M0UA 2LC4A 2EKOA 2YRVA 3JCMX 3CCRQ 1YJWQ 1TS9A 1C1AA 3GF5A 4ZGEB 1WYXA 2H3JA 1KQSA 2OTLT 1NPPA 4PJOA 4M7AF 2WACA 2KT8A 2LT4A 1M5Q1 1UGPB 4PJNA 4R55A 1OOTA 2G3RA 4PJMA 1UECA 3NGPA 3H8ZA 1N9SA 1ZUUA 2JW4A 4MZMA 3VRYA 1RI9A 1V29B 4FW2A 2LVMA 2E65A 1KFZA 1VQKT 2RK1A 1TUGB 2P0QA 5KYXB 1C0MA 1YCYA 3OYFA 2K7AA 4M7DC 3OB9A 1UGRB 4FYXB 4K11A 5FU6C 1Y96A 4R56A 1AZEA 2QAZA 2MWPA 1NZ9A 1UE9A 1M3AA 2VXEA 2P0PA 4Z89A 1M4ZA 1AZGB 2X3XD 3EHQA 5GANe 1IZ6A 4JJDA 3O5ZA 4OP0A 3OS2A 5FRMA 3LH0A 3H41A 4JZ4A 2DL7A 5LJ3j 3LLRA 4J9HA 4O6JA 2XHCA 2NLUA 4J9BA 1I81A 1DJ7B 3EG9A 3GLXA 1RAFB 3PVLA 1HK9A 2HL5C 4F14A 4BE0A 1QVFS 1EZZB 3OBYA 3V7RA 1MV3A 2DD5A 2AK5A 1K1ZA 2NUPB 3CQTA 3PFSA 1BBZA 3CCSA 2J7IA 1BIAA 3BDUA 4N4HA 2FPEA 2LRQA 4C8QE 3EFSA 3I5RA 2CUDA 2GQIA 1AVZC 3U23A 3WXMB 2GFAA 2HBPA 2K3BA 2OI3A 1WHHA 5GAMe 1TUCA 3MO8A 2CZ6B 1D0ZA 5KYUB 4C8QG 1AEYA 1OI1A 2JJ9A 2YT6A 4OMNA 1YIJT 1ZSGA 3CCVT 2JTEA 1NJIC 2GQVA 3UPUA 1W2BS 2E6NA 1JU5C 1R0BG 2CH4W 2JXBA 2VC8A 2EJFA 4V2SA 4M77B 1YHQQ 3G7ZA 2AKLA 1RAGB 2D9TA 2LJ0A 2I0NA 4C92A 1S72Q 4OB3B 1QVFA 4M78F 2IPOB 4XU2A 1FMVA 2VASA 3CCUQ 5CKHA 2E10A 5LJ3g 4AFSC 2C06A 1PSFA 1RL2A 3HFNA 2XG8D 3H9NA 3S3OA 4PJOE 2CSQA 3CBMA 2EYXA 4A4EA 1KG1A 1SF9A 3C0CA 2M0OA 3OYYA 2RN8A 2EQKA 4DOWA 3KBGA 1VQ7A 3PT9A 2LDMA 3URGA 3CCSQ 2V26A 5LJ5h 3TQ7P 2DBMA 4M7AD 4RCBA 5LJ5j 2MYSA 2JTMA 2LJ3A 4XTZA 5C6SA 5CO7A 2O88A 2LCCA 3SDZA 2QQSA 4J8OA 1IGUA 1W2BA 1M1KU 4M7DE 4FYYB 5KYXA 4HCBA 3CCJA 1PD0A 4J83A 4RTTA 5A2QE 3OBWA 4HKEA 5KCHA 2PQWA 4OMMA 2YUOA 5ECAA 3FB9A 4M7DG 1YI2T 1Z9ZA 4IIMA 3VUZA 2HQEA 2QA4T 3MCAB 5FWBA 3GIBA 2DETA 2ESWA 1WPYA 1WDXA 4FCYA 4OB1B 2DBKA 2DERA 3BFMA 4N0AA 1Q81U 2CYZB 1IHVA 2CS7A 2HL3A 2GBQA 2RMOA 1XQHA 1LOJA 3ZL7C 4OF1A 4JDSA 4L5GA 1YP5A 2NUPA 2LX9A 1YJNT 1OYXA 3V7CA 1Q82U 5D6YA 3CCMQ 4KUDK 3OSVA 1D09B 2ZPGB 1VQ7Q 4C0DC 3M0TA 2M02A 1RAIB 5GJVB 1K73C 5LJ3d 1WX6A 2OJ2A 1KD1U 2SRCA 1X2KA 3CCET 1QLYA 3CC2T 2XDBA 2RJCA 1M2OA 1K0XA 1PG5B 3ASKA 3PNWC 2PU9B 1GL5A 1VQLA 5KYUA 2M9UA 3FJPA 1WGSA 4F04B 4M75C 1UJYA 2A7YA 3MP6A 4OGEA 1JQQA 4KBMB 4BUGA 3I56A 2O01E 3E19A 5DLQE 4E47A 1QCOA 1I1JA 4M77A 3MHXA 3EGUA 2IG0A 4BE1A 2X51A 1QP3A 1FX7A 5LJ5f 3OSSC 1U06A 1IREB 3SD4A 1D1BA 2RJEA 2GGRA 3JB9F 3INZA 2CKKA 2EQJA 2OTLA 4LDYA 2MPXC 1ABQA 3EGXB 2OTJT 9ATCB 1FMWA 1KC8U 2KQWA 4M78D 3ZBDA 3SWNB 1VQ6T 5FU7B 1M8MA 1RADB 1AHJB 3UWNA 1SHGA 1UDLA 5CIUA 4KH1B 2X4YA 3X26B 3L2WA 1BK2A 2CP0A 3A5ZB 1WZOA 1K9MC 1YBYA 2A0FB 4BY6C 1X01A 4RG2A 5GAN7 4HCKA 5HKCA 1AD5A 1ZBXA 5LJ5e 2L3SA 2FRWA 2WSCE 2K5FA 2QEXA 4DA4A 3L2QA 1VQLQ 1OPLA 1OX8A 2MIOA 1FYNA 1BKBA 2HZYA 3ZEHA 5J39A 2OAUA 2YLBA 4BACA 5I11A 3I56Q 1M8VA 2HBWA 2W0ZA 3QYHB 1SPKA 4OMOA 3H0FA 3OYCA 1PC0A 4X34A 4C8QB 5IH2A 2LNHB 1YFNA 1X2QA 1ZA2B 2ZAEA 3QZ9B 3HKSA 4ZGJB 1SSFA 4FSSA 1IO6A 2MF2A 3CBOA 2CP6A 4LXCA 3L2UA 1VYTA 2QQAA 1W4SA 3C4SA 2NWMA 1HD3A 1T0JA 1BYMA 4EMHA 3CC4A 2OTLQ 4CI0C 2G6FX 1NJIR 2DL3A 2R57A 2DFUA 1D3BB 3CXCP 4JRKA 4FL6A 3MKDA 2YLCA 1OX9A 1X6GA 2IVWA 3META 2DEUA 3JRZA 4MMKA 1BCMA 2YXYA 2O9VA 4XU0A 1K8AU 4M75E 1VQNA 1K9AA 2D6FA 3QIIA 3CCLA 4LD6A 2E1HA 2MOXA 4AT1B 4PFOA 5CKBA 1YIJA 2DZCA 2YDLA 3MEAA 2QEXQ 3M53A 2K2MA 3I55T 1WQ7A 1PNJA 2GTOA 4M75G 3G4SA 1RAHB 4IUQA 1VOMA 4BI3A 3CXCS 3X25B 4M77E 3UT1A 4PFPA 4E7KA 4RTZA 5KYNA 2D0NA 2RHUA 2A28A 3UA7A 1E6GA 3GP8A 1TSFA 3JB9J 3JCMV 4XTWA 1CSKA 2KAFA 4M7DB 1PWTA 3CCQT 4JS4A 3OMGA 1K76A 3V8KA 5FU6B 3H0HA 2YRCA 3A8OB 4M77G 2HMAA 3JB9H 3EGXA 4D6WA 3L2RA 2LTOA 2HEQA 2CZ1B 4PJOF 5EC7A 3DB3A 3SEMA 5C0MA 3CC4Q 5KCOA 1WFWA 1N8RC 3SWNA 4QVZA 1Y07A 3CD6T 3QJ6A 2X4JA 3JB9D 2P4RA 4RUGA 1OPKA 3RNJA 3M55A 2GNCA 1NEBA 1I8FA 1LVKA 2JMCA 2BZXA 4OB0B 2BZYA 2RA2A 1PM3A 1OEBA 3EG1A 3OS1A 3J81E 5KYYB 1M1FA 3SB2A 4JJBA 4XTYA 1VQNQ 5GAOq 1RAAB 3CCLQ 4BDYA 2L89A 2ZGWA 5GAOp 2VB6A 1YITT 1QVGS 2M0YA 2HKQB 1YIJQ 2KVQG 2QG9B 3RIRA 3BW1A 3OW2P 3VS1A 2XU8A 2CDTA 2O31A 1T3LA 4C8QA 3G4SQ 4L6V5 2K57A 2W10A 5DY9A 1U5SA 1PRMC 1NYGA 2E5QA 1K73R 5IXFA 4MDXA 4FM4B 3OYDA 1UEBA 4N4GA 3TVTA 4KGZB 2RQRA 2V8JA 1G3YA 2KI7A 3NHNA 1YJ9T 1VQMT 1ZSZC 1PHTA 2JVVA 1H92A 1OZ2A 4IUUA 4OMLA 2KXCA 1TOVA 3GBQA 3GPLA 3QXEB 3G6ET 2B86A 1VIEA 1D3BA 2O9SA 4MZTA 1W1FA 2RHIA 3OW2S 4J9GA 1QMCA 3CMET 1VA7A 1ZUKA 3EG2A 2J6OA 2KDSA 1JXMA 2O4XA 3EH2A 2AHJB 4QQ6A 2CZ7B 2EVRA 3V8LA 2E6ZA 3CMAA 1QVGA 2QGGA 4C0GA 4IURA 4KH0B 1YN8A 3RERA 4JS5A 3FRNA 4HVVA 2L2PA 2RQTA 2FZGB 3A98A 2QDLA 4F7UB 1Y57A 4RTXA 3G71A 3LX7A 5HK3A 2DRKA 2YRDA 1M1GA 1YI2Q 2R58A 3JSCA 3MPUB 2ENMA 1M90U 1F1BB 3HPWA 4LDXA 5GMKj 2DIGA 2DZ9A 1B3QA 2KGTA 5AYFA 1V76A 5HY6A 4C92F 4JRQA 4M7DA 3GOXA 1IB8A 5IN1A 1K9MR 2XDPA 2YHTA 2OTJA 2J05A 1Z9QA 3MEVA 4BD3A 1BIBA 1SRLA 2KRNA 4XTVA 1YHQA 4AG1C 5D7UA 3RR6A 2P4TA 5CKFA 3A8LB 2AT1B 2K9GA 1S72A 3UDCA 1BCOA 5LJ3h 1KIKA 2AZSA 1QWEA 2JOYA 2YWWA 2HD0A 3P8BB 1X6BA 3CCUA 2DVJA 1UHCA 3IQLA 1NEGA 5KYYA 1RUWA 5IHKA 3CMAQ 2A37A 4C0DB 2JTFA 4EMKC 1TWBA 3VJPA 2PVOB 3VS6A 2C0TA 2EGCA 3G71Q 5IT9E 1G3TA 1AOJA 4GY5A 4XAXB 4A4GA 4QVDA 1JEGA 3X24B 4F17A 5CR2A 2HQHA 1QCFA 3G1JA 1VQOT 1MNDA 4M75B 2NUTB 2F5KA 4A4FA 3LWIA 1ZQ1A 2DPPB 2HSEB 4ZTFA 2A3LA 2VGNA 1Q7YU 3PIOA 4EIKA 4WTOB 2RO0A 3QG1A 5GAN8 4JPBW 1QQJA 3OS5A 3X28B 2OTJQ 3EFRA 1PKTA 5GAN4 4PJJA 2RQUA 4FIBA 4J6YA 3TU4K 3TREA 2E4HA 2EYWA 4QT7A 2HCKA 4JLGA 1YWPA 2KEAA 2CP2A 5KE2A 1ABOA 1QWFA 3LWHA 2X4XA 3MEWA 1QKXA 4NS5A 4M7AC 5GAN6 3OQ5A 1U1TA 3PE0A 1X6OA 4JRIA 4BDZA 2DIQA 4MMLA 2PVGB 1Y71A 2EGAA 4F7UA 2ROLA 3CCMA 3EHRA 2HQXA 1N8RR 3QSUA 5CK9A 4TVRA 1E6HA 1RAEB 2DM1A 2ZPFB 3CC7T 2RF0A 1WQWA 4RTVA 5D6WA 4C5GA 2K5IA 2FPFA 4M77F 4ORZA 3THKA 1X43A 4BE2A 1UGQB 2B8AA 4BY6B 2COYA 1WJRA 4C5EA 3P8DA 3I9QA 2DTIA 5LJ3f 2RD1A 2KRMA 2DL5A 3NTIA 5GMKe 1X27A 3CPWP 4AFZC 1H641 4DEYA 2M51A 4IUVA 5CQXA 4C92D 1M1KC 1YJWT 3SFMA 1BI1A 2K5LA 3HL8A 3OS0A 2YUNA 1JXOA 8AT1B 2RB6A 2BZ8A 1JJ2P 5L8RE 1U3OA 1NM7A 4X9CA 3M4GA 5EG2A 3E1SA 2YUQA 5GAOl 4QVCA 1B7TA 4LDVA 2DTHA 2LMJA 4AFUC 4LUDA 5J26A 8ATCB 4PL6A 5CCAA 5LJ3e 1NLPC 2ZPBB 1YITA 3QPHA 4GBQA 1Q81C 4JJCA 2X4WA 1LCKA 2DTOA 3M0QA 3EG3A 4RCCA 4CC7A 2KR3A 2V8IA 3VYGA 2DJZA 1TU0B 4D8KA 1Q82C 1G83A 3TCJA 4JJNK 4J9CA 4M75A 2NUTA 2DO3A 3VUBA 1RACB 1GCPA 2RI2A 3OYBA 3CCQQ 1GFCA 2KMTA 2L0AA 3REAB 4A4HA 4LUEA 1KQ2A 1KD1C 3A8HB 3JCMg 2ED0A 3NPFA 5AT1B 1O9SA 7AT1B 2DAQA 2E5KA 1FMKA 3O8VA 2X35A 4M4ZA 3FC3A 2ED1A 5I21A 2CREA 1LJOA 3CD6Q 1K4US 1KQ1A 3VS2A 3CMEA 5FRNA 4M78C 4M7AE 3R6OA 3REBB 4E7LA 2EJ9A 4J9EA 3CPFA 2KYBA 4DBRA 4Q5WA 4GLKA 1MUZA 3QHSA 2V1QA 3S3MA 3D7SB 4RTWA 2LJ1A 1R77A 4M7AG 5KH6A 2DL4A 1KJWA 2EIFA 1WHJA 2F1LA 3UATA 2L8DA 4F7UE 1YITQ 2EQIA 2J6KA 1JB0E 1Y0MA 2KXDA 2DKGA 2DMOA 4YTLA 1I4K1 2K4YA 1KC8C 5FW9A 2RHZA 4F7UG 3RESA 2A08A 1Q86U 1ZBJA 2RHYA 2DILA 5GAOn 1VQKA 1SSHA 1VQMQ 1RI0A 2E70A 1GBQA 2XICA 1VQ8T 2BIVA 1VQPT 3TSZA 2EQMA 1W6XA 1Q86C 4KUIA 3DLLA 2KT1A 1GCQC 3RBBB 2JUFA 2QK0A 3JCMJ 3UA6A 4RTUA 1SKUB 1Q95G 3G6EQ 1R0CB 2VGMA 4B9WA 1M3CA 4EMGA 2EW3A 1NE8A 2COWA 2D8HA 2E12A 1SRMA 1ZSZB 1HYOA 2K79A 3CMEQ 4PKCC 4PLLA 5LL6S 2K3XA 2LQWA 2DRMA 3V7SA 4J7IA 3JCMd 4AFQC 4LDWA 3VS0A 1CKAA 2DXBA 4RG8A 4PNOA 5FROA 3VS7A 5KE3A 1WI7A 2QQBA 5CQYA 1VQ9T 3L2VA 4J7FA 3RMQA 3PGGA 2I2LA 1TH7A 4QQGA 1LPLA 1EX4A 1VQ5T 4C8QF 2EQUA 1I0CA 4UC4A 4LNPA 2GTJA 4HT9A 3M4YA 1WJQA 4HT8A 2Y4XA 2RHXA 4ZGDB 1WLPB 1A0NB 3NMZC 4NL2A 1NG2A 4LE9A 2K2VA 1VQKQ 3QJYA 3JV3A 5IXBA 2AZVA 5GAOr 3M59A 3CCVA 1K8AC 3ULRB 2CP7A 1JO8A 1OU8A 4M78E 3T9NA 2P0KA 2GF7A 4NOYA 1N5ZA 5GMKi 1UGVA 3LGFA 4OMQA 2BE7D 2RQWA 2BUDA 3DLMA 4ZN1A 3L42A 4M78G 1KK7A 3S6WA 1D1CA 1I07A 2C0OA 2NYSA 1NLOC 5GMKl 4C0ZA 2R5AA 4LN2A 4FSXA 5I22A 2DK3A 2F2XA 3JCMb 2LNVA 3EFOB 4D8DA 4ESRA 3OMCA 1MMGA 4II1A 4BI4A 3HTRA 4JUVA 3QDRB 4E7HA 2ZPHB 1M1KR 4BI8B 1VIFA 2E41A 2CUBA 4ZTJA 2RJDA 1KSWA 1M3BA 1BI3A 4HVUA 5IHIA 1VQ4T 2KYMA 3CCJT 2MCNA 1MV0B 4XU3A 5I2SA 2FG0A 1UUEA 5GANj 2VVKA 4Y92A 2PNIA 3MP1A 3V8JA 1KQSP 5IHNA 4M7DF 2CP5A 4EMKB 4RTYA 1G3WA 4Z88A 2RPNA 4CC2A 3CXCA 3HP9A 5A0DA 1BU1A 3C94A 2CH4A 2FZKB 6AT1B 3PVQA 3CCVQ 3NTKA 1Q81R 2E64A 1M30A 1YI2A 2X9HA 2HNIA 3EG9B 2QA4A 3QZ5B 1ZSZA 1H3ZA 2OX7A 2D8JA 2F69A 1Q82R 1WXUA 2DL8A 1WXBA 5GJWB 4KULA 5GAOm 3AHUA 4A53A 4DBHA 3BDLA 3R6NA 3JCMW 4LDUA 3FIFA 1SEMA 4PLIA 1KD1R 3TEEA 3H0IA 5GAMj 1YJNA 4OVAA 3HRTA 2J06A 1VYVA 1XTDA 2JS0A 5J3BA 4KGVB 2COZA 5CVIA 4WCIA 4WF2A 2DE0X 2WSEE 1QW1A 1ZHIA 3MJXA 1BI2A 4M7AB 1YWOA 1YNZA 1VQLT 5D6XA 5DM7R 2KNBB 1JBMA 3CCEA 3JCMc 4O5VA 3CC2A 1IXDA 3KFVA 3I56T 4HCCA 5GANg 3CBPA 2LX7A 1LNXA 2Y90A 4C8QD 4IKFA 2EYYA 3QKJA 4E7SA 1WHMA 1TUDA 2EPDA 4J9FA 2XIDA 3QDFA 2K6DA 4L59A 5GMKh 1D1AA 1PSEA 3A8MB 5HCKA 2CT3A 2QA4Q 1KC8R 2BE9B 1GBRA 4KT0E 4OB2B 2DXUA 5GANf 2XK0A 3JB9G 4Y91A 4PJOC 1M90C 1G2BA 3EFOA 3EGDB 3OYMA 3OW2A 2RI5A 2JMAA 4GLMA 2EAYA 1Q86R 1QP2A 4IIOA 1VQ6A 4PJLA 4F7UF 1UTIA 1YJNQ 2JZ2A 4OMPA 1MMAA 5GAMg 4OMFB 1N27A 1NYFA 2VKNA 4R0KA 3MEUA 1N6AA 2Z0WA 1QVFP 4KGXB 3F70A 2RM4A
chains in the Genus database with same CATH topology
2AKKA 2J6FA 2XMFA 1UHFA 2YUNA 3VS4A 4HCKA 1AD5A 4DEXA 2FO0A 1JXOA 2L3SA 2BZ8A 2FRWA 4J9DA 2IIMA 1U3OA 1NM7A 1OPLA 2MIOA 2CT4A 1FYNA 2JT4A 2YUQA 5I11A 1H3HA 2HBWA 2D1XA 2W0ZA 1SPKA 2LMJA 4OMOA 4AFUC 4CC3A 3H0FA 3M0PA 4LUDA 2HDAA 1TG0A 5IH2A 2LNHB 1RLQC 1X2QA 1ZUYA 2L3QA 1EFNA 1NLPC 4FSSA 1IO6A 1T3SA 4GBQA 1VYTA 3QWXX 2ECZA 4JJCA 2NWMA 1LCKA 1BB9A 2X3WD 3FJ5A 1HD3A 1T0JA 3EG0A 3M0QA 2G6FX 3EG3A 4CC7A 2KR3A 2DL3A 2DJQA 2BTTA 4D8KA 2F2WA 1G83A 2DLPA 2LP5A 1AWWA 2FRYA 4J9CA 1W70A 3TSWA 2NUZA 1GCPA 1X6GA 2F2VA 1GFCA 2L0AA 3REAB 2JM9A 2EBPA 4LUEA 2O9VA 1S1NA 2HSPA 3QWYA 2ED0A 4Z8AA 3NPFA 4AG2C 2E5KA 1FMKA 4A63B 1K9AA 4M4ZA 4HXJA 2ED1A 1QKWA 2CREA 3LH5A 2MOXA 1K4US 1VYUA 3VS2A 1RLPC 3M0UA 2YDLA 2K2MA 3REBB 1PNJA 2GTOA 4J9EA 2KYBA 1WYXA 1UG1A 1MUZA 2C0IA 2KT8A 2V1QA 4RTZA 4RTWA 2D0NA 2LJ1A 2RQVA 2A28A 1OOTA 1E6GA 3UA7A 1UECA 2DL4A 1KJWA 3NGPA 1CSKA 3UATA 1PWTA 1K76A 2EQIA 1ZUUA 2J6KA 2JW4A 1Y0MA 3H0HA 2A36A 3VRYA 1RI9A 2JS2A 2KXDA 2HEQA 2DMOA 5EC7A 3SEMA 4JZ3A 1K0SA 1KFZA 5FW9A 1WFWA 5FWCA 2EYZA 2LZ6B 2A08A 1ZBJA 2P4RA 4RUGA 1OPKA 2DILA 3RNJA 2K7AA 2GNCA 1SSHA 1NEBA 1GBQA 3VS5A 4K11A 1AZEA 2JMCA 3TSZA 2BZXA 1WIEA 1UE9A 2BZYA 1M3AA 4Z89A 1W6XA 1AZGB 1OEBA 2KT1A 3EG1A 3VRZA 1GCQC 3RBBB 2X3XD 3EHQA 1X69A 3UA6A 4JJDA 3O5ZA 4RTUA 4E6RA 2KE9A 4JJBA 1M3CA 2EW3A 3H41A 2D8HA 2DL7A 4JZ4A 1SRMA 2KRSA 2K79A 4J9HA 4J9BA 2M0YA 2LQWA 3PVLA 3VS1A 4F14A 2DRMA 2CDTA 2O31A 1T3LA 1MV3A 4AFQC 1SHFA 2AK5A 2W10A 1U5SA 1PRMC 1CKAA 3VS0A 1K1ZA 1NYGA 5IXFA 1J3TA 2CSIA 2KROA 1YCSB 3CQTA 3VS7A 1BBZA 3TVTA 1WI7A 2RQRA 2J7IA 1T0HA 1V1CA 3NHNA 1PHTA 1H92A 2FPEA 1PKSA 3I5RA 4KRTA 2CUDA 2GQIA 4OMLA 2KXCA 1AVZC 3U23A 3GBQA 2K3BA 2B86A 1I0CA 2OI3A 2O9SA 4LNPA 4ZNXA 1W1FA 2GTJA 1TUCA 4J9GA 1HSQA 1AEYA 1WLPB 2YSQA 1A0NB 3NMZC 2YT6A 4OMNA 1NG2A 4LE9A 1ZSGA 1VA7A 1ZUKA 2JTEA 3EG2A 2L3PA 1ZLMA 3JV3A 5IXBA 1H8KA 2AZVA 1OV3A 2J6OA 1JXMA 1JU5C 2CH4W 2JXBA 2EVRA 3ULRB 1GRIA 1JO8A 1ZX6A 2AKLA 2EKHA 3SHWA 1YN8A 2LJ0A 2V1RA 2I0NA 4HVVA 3I35A 1CKBA 2EGEA 1N5ZA 2L2PA 2RNAA 2SEMA 1UGVA 2RQTA 2LCSA 4OMQA 2RQWA 3A98A 2QDLA 2PTKA 4X1VA 1Y57A 2JM8A 2LQNA 4RTXA 2DRKA 4AFSC 1I07A 2C0OA 1NLOC 2OAWA 4LN2A 1PRLC 2CSQA 2ENMA 2EYXA 5I22A 2ABLA 3M0SA 2F2XA 3C0CA 4D8DA 4ESRA 1B3QA 2KGTA 2RN8A 4J9IA 3I5SA 4CC4B 2DBMA 2CUBA 1HJDA 1KSWA 2KBTA 1M3BA 2LJ3A 2J05A 1Z9QA 1GCQA 4HVUA 5IHIA 2O88A 2KYMA 2MCNA 1SRLA 2KRNA 1MV0B 2FG0A 1UUEA 2VVKA 4AG1C 4Y92A 2PNIA 2H8HA 4F16A 4RTTA 2K9GA 5IHNA 2ROTA 4RTYA 1KIKA 4OMMA 2RPNA 2AZSA 1QWEA 4Z88A 4CC2A 1ARKA 2YUOA 2VWFA 5ECAA 1E7OA 4HVWA 1X6BA 1Z9ZA 2DVJA 4IIMA 1UHCA 1BU1A 1AWXA 2CH4A 3IQLA 1NEGA 2DNUA 3PVQA 1UJ0A 1M30A 5FWBA 1RUWA 5IHKA 5L23A 2A37A 2ESWA 1B07A 1XOVA 1WDXA 2D8JA 2DBKA 3VS6A 2C0TA 2EGCA 2GBQA 1WXUA 2RMOA 2DL8A 1AOJA 1WXBA 5GJWB 3VS3A 3ZL7C 1JEGA 4F17A 1YP5A 3R6NA 1QCFA 1SEMA 1WA7A 3H0IA 2YUPA 1UFFA 2J06A 1VYVA 3M0TA 2JS0A 4EIKA 4WCIA 5GJVB 1WX6A 2DE0X 2OJ2A 2SRCA 1X2KA 4JPBW 1YWOA 1QLYA 1YNZA 2DX1A 1GFDA 1K0XA 2KNBB 1PKTA 1GL5A 2FEIA 2RQUA 2DA9A 3KFVA 2EYWA 4QT7A 1UJYA 2HCKA 1YWPA 2KEAA 2LX7A 1JQQA 1ABOA 1QWFA 1QKXA 3UF4A 1I1JA 2FPDA 2EYYA 2DYBA 3EGUA 1TUDA 2EPDA 3PE0A 4J9FA 2K6DA 1WXTA 2EGAA 5HCKA 2PZ1A 2CT3A 2ROLA 1U06A 3EHRA 1AWOA 2GGRA 1GBRA 1E6HA 2DM1A 1ABQA 1M27C 2RF0A 4RTVA 2O2OA 2FPFA 4ORZA 1G2BA 1X43A 3THKA 2JMAA 4GLMA 3I9QA 1M8MA 3M0RA 4IIOA 1SHGA 1UDLA 2DF6A 2KRMA 1AWJA 1UTIA 2DL5A 4OMPA 1NYFA 1X27A 2VKNA 4R0KA 4AFZC 1BK2A 4DEYA 2M51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKK A;  2J6F A;  2XMF A;  1UHF A;  2YUN A;  3VS4 A;  4HCK A;  1AD5 A;  4DEX A;  2FO0 A;  1JXO A;  2L3S A;  2BZ8 A;  2FRW A;  4J9D A;  2IIM A;  1U3O A;  1NM7 A;  1OPL A;  2MIO A;  2CT4 A;  1FYN A;  2JT4 A;  2YUQ A;  5I11 A;  1H3H A;  2HBW A;  2D1X A;  2W0Z A;  1SPK A;  2LMJ A;  4OMO A;  4AFU C;  4CC3 A;  3H0F A;  3M0P A;  4LUD A;  2HDA A;  1TG0 A;  5IH2 A;  2LNH B;  1RLQ C;  1X2Q A;  1ZUY A;  2L3Q A;  1EFN A;  1NLP C;  4FSS A;  1IO6 A;  1T3S A;  4GBQ A;  1VYT A;  3QWX X;  2ECZ A;  4JJC A;  2NWM A;  1LCK A;  1BB9 A;  2X3W D;  3FJ5 A;  1HD3 A;  1T0J A;  3EG0 A;  3M0Q A;  2G6F X;  3EG3 A;  4CC7 A;  2KR3 A;  2DL3 A;  2DJQ A;  2BTT A;  4D8K A;  2F2W A;  1G83 A;  2DLP A;  2LP5 A;  1AWW A;  2FRY A;  4J9C A;  1W70 A;  3TSW A;  2NUZ A;  1GCP A;  1X6G A;  2F2V A;  1GFC A;  2L0A A;  3REA B;  2JM9 A;  2EBP A;  4LUE A;  2O9V A;  1S1N A;  2HSP A;  3QWY A;  2ED0 A;  4Z8A A;  3NPF A;  4AG2 C;  2E5K A;  1FMK A;  4A63 B;  1K9A A;  4M4Z A;  4HXJ A;  2ED1 A;  1QKW A;  2CRE A;  3LH5 A;  2MOX A;  1K4U S;  1VYU A;  3VS2 A;  1RLP C;  3M0U A;  2YDL A;  2K2M A;  3REB B;  1PNJ A;  2GTO A;  4J9E A;  2KYB A;  1WYX A;  1UG1 A;  1MUZ A;  2C0I A;  2KT8 A;  2V1Q A;  4RTZ A;  4RTW A;  2D0N A;  2LJ1 A;  2RQV A;  2A28 A;  1OOT A;  1E6G A;  3UA7 A;  1UEC A;  2DL4 A;  1KJW A;  3NGP A;  1CSK A;  3UAT A;  1PWT A;  1K76 A;  2EQI A;  1ZUU A;  2J6K A;  2JW4 A;  1Y0M A;  3H0H A;  2A36 A;  3VRY A;  1RI9 A;  2JS2 A;  2KXD A;  2HEQ A;  2DMO A;  5EC7 A;  3SEM A;  4JZ3 A;  1K0S A;  1KFZ A;  5FW9 A;  1WFW A;  5FWC A;  2EYZ A;  2LZ6 B;  2A08 A;  1ZBJ A;  2P4R A;  4RUG A;  1OPK A;  2DIL A;  3RNJ A;  2K7A A;  2GNC A;  1SSH A;  1NEB A;  1GBQ A;  3VS5 A;  4K11 A;  1AZE A;  2JMC A;  3TSZ A;  2BZX A;  1WIE A;  1UE9 A;  2BZY A;  1M3A A;  4Z89 A;  1W6X A;  1AZG B;  1OEB A;  2KT1 A;  3EG1 A;  3VRZ A;  1GCQ C;  3RBB B;  2X3X D;  3EHQ A;  1X69 A;  3UA6 A;  4JJD A;  3O5Z A;  4RTU A;  4E6R A;  2KE9 A;  4JJB A;  1M3C A;  2EW3 A;  3H41 A;  2D8H A;  2DL7 A;  4JZ4 A;  1SRM A;  2KRS A;  2K79 A;  4J9H A;  4J9B A;  2M0Y A;  2LQW A;  3PVL A;  3VS1 A;  4F14 A;  2DRM A;  2CDT A;  2O31 A;  1T3L A;  1MV3 A;  4AFQ C;  1SHF A;  2AK5 A;  2W10 A;  1U5S A;  1PRM C;  1CKA A;  3VS0 A;  1K1Z A;  1NYG A;  5IXF A;  1J3T A;  2CSI A;  2KRO A;  1YCS B;  3CQT A;  3VS7 A;  1BBZ A;  3TVT A;  1WI7 A;  2RQR A;  2J7I A;  1T0H A;  1V1C A;  3NHN A;  1PHT A;  1H92 A;  2FPE A;  1PKS A;  3I5R A;  4KRT A;  2CUD A;  2GQI A;  4OML A;  2KXC A;  1AVZ C;  3U23 A;  3GBQ A;  2K3B A;  2B86 A;  1I0C A;  2OI3 A;  2O9S A;  4LNP A;  4ZNX A;  1W1F A;  2GTJ A;  1TUC A;  4J9G A;  1HSQ A;  1AEY A;  1WLP B;  2YSQ A;  1A0N B;  3NMZ C;  2YT6 A;  4OMN A;  1NG2 A;  4LE9 A;  1ZSG A;  1VA7 A;  1ZUK A;  2JTE A;  3EG2 A;  2L3P A;  1ZLM A;  3JV3 A;  5IXB A;  1H8K A;  2AZV A;  1OV3 A;  2J6O A;  1JXM A;  1JU5 C;  2CH4 W;  2JXB A;  2EVR A;  3ULR B;  1GRI A;  1JO8 A;  1ZX6 A;  2AKL A;  2EKH A;  3SHW A;  1YN8 A;  2LJ0 A;  2V1R A;  2I0N A;  4HVV A;  3I35 A;  1CKB A;  2EGE A;  1N5Z A;  2L2P A;  2RNA A;  2SEM A;  1UGV A;  2RQT A;  2LCS A;  4OMQ A;  2RQW A;  3A98 A;  2QDL A;  2PTK A;  4X1V A;  1Y57 A;  2JM8 A;  2LQN A;  4RTX A;  2DRK A;  4AFS C;  1I07 A;  2C0O A;  1NLO C;  2OAW A;  4LN2 A;  1PRL C;  2CSQ A;  2ENM A;  2EYX A;  5I22 A;  2ABL A;  3M0S A;  2F2X A;  3C0C A;  4D8D A;  4ESR A;  1B3Q A;  2KGT A;  2RN8 A;  4J9I A;  3I5S A;  4CC4 B;  2DBM A;  2CUB A;  1HJD A;  1KSW A;  2KBT A;  1M3B A;  2LJ3 A;  2J05 A;  1Z9Q A;  1GCQ A;  4HVU A;  5IHI A;  2O88 A;  2KYM A;  2MCN A;  1SRL A;  2KRN A;  1MV0 B;  2FG0 A;  1UUE A;  2VVK A;  4AG1 C;  4Y92 A;  2PNI A;  2H8H A;  4F16 A;  4RTT A;  2K9G A;  5IHN A;  2ROT A;  4RTY A;  1KIK A;  4OMM A;  2RPN A;  2AZS A;  1QWE A;  4Z88 A;  4CC2 A;  1ARK A;  2YUO A;  2VWF A;  5ECA A;  1E7O A;  4HVW A;  1X6B A;  1Z9Z A;  2DVJ A;  4IIM A;  1UHC A;  1BU1 A;  1AWX A;  2CH4 A;  3IQL A;  1NEG A;  2DNU A;  3PVQ A;  1UJ0 A;  1M30 A;  5FWB A;  1RUW A;  5IHK A;  5L23 A;  2A37 A;  2ESW A;  1B07 A;  1XOV A;  1WDX A;  2D8J A;  2DBK A;  3VS6 A;  2C0T A;  2EGC A;  2GBQ A;  1WXU A;  2RMO A;  2DL8 A;  1AOJ A;  1WXB A;  5GJW B;  3VS3 A;  3ZL7 C;  1JEG A;  4F17 A;  1YP5 A;  3R6N A;  1QCF A;  1SEM A;  1WA7 A;  3H0I A;  2YUP A;  1UFF A;  2J06 A;  1VYV A;  3M0T A;  2JS0 A;  4EIK A;  4WCI A;  5GJV B;  1WX6 A;  2DE0 X;  2OJ2 A;  2SRC A;  1X2K A;  4JPB W;  1YWO A;  1QLY A;  1YNZ A;  2DX1 A;  1GFD A;  1K0X A;  2KNB B;  1PKT A;  1GL5 A;  2FEI A;  2RQU A;  2DA9 A;  3KFV A;  2EYW A;  4QT7 A;  1UJY A;  2HCK A;  1YWP A;  2KEA A;  2LX7 A;  1JQQ A;  1ABO A;  1QWF A;  1QKX A;  3UF4 A;  1I1J A;  2FPD A;  2EYY A;  2DYB A;  3EGU A;  1TUD A;  2EPD A;  3PE0 A;  4J9F A;  2K6D A;  1WXT A;  2EGA A;  5HCK A;  2PZ1 A;  2CT3 A;  2ROL A;  1U06 A;  3EHR A;  1AWO A;  2GGR A;  1GBR A;  1E6H A;  2DM1 A;  1ABQ A;  1M27 C;  2RF0 A;  4RTV A;  2O2O A;  2FPF A;  4ORZ A;  1G2B A;  1X43 A;  3THK A;  2JMA A;  4GLM A;  3I9Q A;  1M8M A;  3M0R A;  4IIO A;  1SHG A;  1UDL A;  2DF6 A;  2KRM A;  1AWJ A;  1UTI A;  2DL5 A;  4OMP A;  1NYF A;  1X27 A;  2VKN A;  4R0K A;  4AFZ C;  1BK2 A;  4DEY A;  2M51 A; 
#chains in the Genus database with same CATH topology
 2MAM A;  2AKK A;  2J6F A;  4PJO D;  4J5Y A;  2XMF A;  1UHF A;  1TTH B;  2QEX T;  1MMN A;  1BI0 A;  3VS4 A;  4J9D A;  2IIM A;  3CCE Q;  3E2U A;  3J7A F;  4EMK A;  3CC2 Q;  1VQ8 A;  1VQP A;  2JT4 A;  4E7J A;  4A54 A;  2QGF B;  3AT1 B;  2JNG A;  3MP8 A;  1FWZ A;  1X75 C;  3NFC A;  5GAM f;  1TG0 A;  4ELZ C;  3HRS A;  2FHD A;  4M7D D;  2L3Q A;  4XQ3 A;  1JRI A;  1WNL A;  5A0L A;  3QO3 A;  5GAN d;  3CC4 T;  3QWX X;  2ECZ A;  1W2B P;  4PFZ A;  1WJS A;  2X3W D;  3FJ5 A;  2DEQ A;  2RH2 A;  3EG0 A;  3S3N A;  1UB4 A;  4FU6 A;  4DOV A;  2F2W A;  2DLP A;  1MHN A;  2VXF A;  2FRY A;  3LGL A;  1K8A R;  4M78 B;  2NUZ A;  1VQ9 A;  3M5A A;  1MMD A;  1Q7Y C;  1NJI U;  3PTA A;  2JM9 A;  3VU3 C;  2LT1 A;  4ZN3 A;  1VQ6 Q;  1S1N A;  2HSP A;  1TXQ A;  4PK4 A;  4XK8 E;  4FT2 A;  1VQN T;  4M7A A;  3CCL T;  4Z8A A;  1VQ5 A;  2MI6 A;  4N4I A;  4A63 B;  3E9G A;  5CAI A;  4HXJ A;  1QKW A;  2QQR A;  1FXX A;  3QUI A;  4XTX A;  4M75 F;  1VYU A;  2JN0 A;  1RLP C;  3G4S T;  2P84 A;  3GNF B;  4CRI A;  1VQ8 Q;  5GAM d;  3A8G B;  4FYV B;  1VQP Q;  3KXT A;  3I55 A;  1UG1 A;  2R5M A;  1QVP A;  1M2V B;  2C0I A;  3ZFJ A;  4ANJ A;  3OYJ A;  2RQV A;  4E7Z A;  1AT1 B;  1HXD A;  3M57 A;  2XI9 A;  3RUX A;  4C92 C;  3KUF A;  4OGC A;  2A36 A;  3JCM h;  3CCQ A;  2JS2 A;  3A1P A;  4JZ3 A;  1P92 A;  1K0S A;  2QAS A;  3EGD A;  5GMK m;  2KY9 A;  5FWC A;  3OYH A;  2FYK A;  2EYZ A;  2LZ6 B;  4PJO G;  4P5N A;  3CCR T;  1C6V X;  2AIR B;  3CD6 A;  3VS5 A;  1VQ9 Q;  1WIE A;  1R8O B;  4XTU A;  4ATO A;  1VQ4 A;  5KYW B;  3VRZ A;  5FLX E;  1OZ3 A;  1VQ5 Q;  1X69 A;  4E6R A;  2E3H A;  2E3I A;  2FVU A;  2KE9 A;  2QI2 A;  1ACM B;  2KRS A;  3M9Q A;  4NL3 A;  3BE3 A;  3FLG A;  1VUB A;  4JRP A;  3CPW S;  1SG5 A;  1Y7X A;  1XJW B;  5GAN 5;  2LQK A;  3JCM P;  3OYG A;  3OYE A;  1SHF A;  4MDW A;  3I55 Q;  3H6Z A;  2XD0 A;  1J3T A;  2CSI A;  2KRO A;  2ZPE B;  1JJ2 S;  3OY9 A;  1YCS B;  1T0H A;  1V1C A;  2GCX A;  1QCN A;  4HCZ A;  1IHW A;  3WVE B;  1PKS A;  3Q1J A;  4N0A C;  3OYI A;  1YJ9 A;  3NTH A;  1VQM A;  4KRT A;  1K73 U;  2PVD B;  5I2M A;  5GAN 2;  1OUL A;  3OYN A;  3PMT A;  2VV5 A;  2CZ0 B;  4ZNX A;  2DD4 A;  4B9X A;  4M78 A;  3G6E A;  3EAE A;  1HSQ A;  2YSQ A;  3HFO A;  3OA6 A;  2K3Y A;  2L3P A;  1ZLM A;  2Y4Y A;  5LJ5 g;  1H8K A;  1OV3 A;  3CMA T;  3LW5 E;  1KHC A;  3C95 A;  1KHI A;  2QTX A;  1GRI A;  1O75 A;  1ZX6 A;  1VQ4 Q;  1WHK A;  2EKH A;  3SHW A;  3CCJ Q;  2V1R A;  3CPW A;  3JB9 I;  3I35 A;  1CKB A;  2EGE A;  2RNA A;  3HHT B;  2SEM A;  3G71 T;  2F5T X;  2LCS A;  4XU1 A;  1M90 R;  3CEY A;  2PTK A;  4X1V A;  2HAX A;  2JM8 A;  2LQN A;  3JCM f;  1JJ2 A;  1G8X A;  2MMP A;  3RDV A;  4RMO A;  2EFI A;  3BY7 A;  1M2V A;  4C92 E;  2OAW A;  4M77 C;  1PRL C;  4QW2 A;  2ABL A;  2M1H A;  3M0S A;  4M75 D;  4J9I A;  3OYL A;  3I5S A;  4CC4 B;  3QYG B;  2KSS A;  4C92 G;  1MNE A;  2CGH A;  3N5B B;  2DXC A;  1HJD A;  2KBT A;  4Z02 A;  1YJ9 Q;  1GCQ A;  3M56 A;  1YHQ T;  2RI3 A;  2BKD N;  4M77 D;  1K9M U;  4LD9 K;  1S72 T;  4BB7 A;  2H8H A;  1XNI A;  4F16 A;  4DBQ A;  3JCM e;  4QQD A;  2ROT A;  5GAN 3;  3CCU T;  2XDD A;  1OU9 A;  4C0F A;  1ARK A;  3VYH B;  1UGS B;  2VWF A;  1E7O A;  4C5I A;  4HVW A;  4DQ2 A;  3M58 A;  1B34 B;  3ER0 A;  5KYW A;  1AWX A;  2HKN A;  2DNU A;  1UJ0 A;  5L23 A;  3L2Z A;  1B07 A;  1XOV A;  2ZZD A;  3CCS T;  1GXI E;  2LQ8 A;  3DKM A;  3VV0 A;  5LJ5 d;  4B6M A;  3VS3 A;  3L1A A;  4MZP A;  1PD1 A;  1Q7Y R;  2ATC B;  4J6W A;  1WA7 A;  3PMI A;  1D0Y A;  2YUP A;  1UFF A;  1VQO A;  2L3R A;  4VUB A;  2QDY B;  3ME9 A;  4C5H A;  3OYK A;  1N9R A;  2FZC B;  3M54 A;  4IUP A;  2DX1 A;  1GFD A;  4HA8 A;  1PCX A;  3JCM Q;  4ELY C;  1WHG A;  2FEI A;  2DA9 A;  2XKO C;  5IAY A;  3OYA A;  2O4X B;  4EPC A;  2FL7 A;  2VYT A;  2L5Q A;  3UF4 A;  2FPD A;  3FEO A;  4PJO B;  2DYB A;  1G5V A;  4JLI A;  1RAB B;  4EDU A;  2DXT A;  4X9D A;  3P8H A;  3X20 B;  3EH1 A;  3CCM T;  3HSB A;  3RKW A;  1WXT A;  2CP3 A;  2PZ1 A;  3HRU A;  2M16 A;  1VQ7 T;  3PIP A;  1AWO A;  3VKI A;  3J80 E;  5CKE A;  4DBF A;  3RMS A;  2V8K A;  1M27 C;  2O2O A;  2ZPI B;  3CC7 A;  2EWN A;  1N8R U;  2QQ9 A;  5CKD A;  5GAN h;  2EJG A;  1ZA1 B;  3M0R A;  5A0G A;  1M9S A;  2DF6 A;  2ZCF B;  4FW1 A;  1AWJ A;  1QVG P;  1VQO Q;  4Y28 E;  1Y96 B;  4AMC A;  3QBY A;  1U8R A;  2GFU A;  2QXF A;  1IGQ A;  4QKU A;  3JAM E;  4DEX A;  2FO0 A;  3SWN C;  5FU7 C;  3CCR A;  3WVD B;  1YJW A;  2RJF A;  1U1S A;  2RK2 A;  1NBE B;  2CT4 A;  2VUB A;  3C12 A;  1B34 A;  1H3H A;  5M9O A;  2D1X A;  1G3S A;  4CC3 A;  3M0P A;  4IUT A;  2HDA A;  1OQK A;  3RKY A;  4A4K A;  4FYW B;  2H3E B;  4E2F B;  2KK4 A;  1RLQ C;  1ZUY A;  4FT4 A;  1EFN A;  1NPR A;  1KQS S;  1T3S A;  5GAM h;  1IRX A;  4E7I A;  3RKX A;  1WHL A;  1BB9 A;  2WSF E;  2DVE A;  1EIF A;  3GNG A;  4ME7 A;  4C8Q C;  2DJQ A;  3LYI A;  2BTT A;  2LP5 A;  5DLO A;  1AWW A;  3CC7 Q;  2MK5 A;  1W70 A;  3TSW A;  5HK0 A;  2F2V A;  3E9F A;  2DYI A;  2PUO B;  2FB7 A;  2EBP A;  1D0X A;  3QWY A;  2MWO A;  4AG2 C;  3DB4 A;  4J6X A;  3FDR A;  1I5L A;  2PUK B;  2QYZ A;  2D0Q B;  2EYQ A;  3LH5 A;  4RKU E;  1I5O B;  4C92 B;  1MGQ A;  2QTV A;  2LCL A;  3M0U A;  2LC4 A;  2EKO A;  2YRV A;  3JCM X;  3CCR Q;  1YJW Q;  1TS9 A;  1C1A A;  3GF5 A;  4ZGE B;  1WYX A;  2H3J A;  1KQS A;  2OTL T;  1NPP A;  4PJO A;  4M7A F;  2WAC A;  2KT8 A;  2LT4 A;  1M5Q 1;  1UGP B;  4PJN A;  4R55 A;  1OOT A;  2G3R A;  4PJM A;  1UEC A;  3NGP A;  3H8Z A;  1N9S A;  1ZUU A;  2JW4 A;  4MZM A;  3VRY A;  1RI9 A;  1V29 B;  4FW2 A;  2LVM A;  2E65 A;  1KFZ A;  1VQK T;  2RK1 A;  1TUG B;  2P0Q A;  5KYX B;  1C0M A;  1YCY A;  3OYF A;  2K7A A;  4M7D C;  3OB9 A;  1UGR B;  4FYX B;  4K11 A;  5FU6 C;  1Y96 A;  4R56 A;  1AZE A;  2QAZ A;  2MWP A;  1NZ9 A;  1UE9 A;  1M3A A;  2VXE A;  2P0P A;  4Z89 A;  1M4Z A;  1AZG B;  2X3X D;  3EHQ A;  5GAN e;  1IZ6 A;  4JJD A;  3O5Z A;  4OP0 A;  3OS2 A;  5FRM A;  3LH0 A;  3H41 A;  4JZ4 A;  2DL7 A;  5LJ3 j;  3LLR A;  4J9H A;  4O6J A;  2XHC A;  2NLU A;  4J9B A;  1I81 A;  1DJ7 B;  3EG9 A;  3GLX A;  1RAF B;  3PVL A;  1HK9 A;  2HL5 C;  4F14 A;  4BE0 A;  1QVF S;  1EZZ B;  3OBY A;  3V7R A;  1MV3 A;  2DD5 A;  2AK5 A;  1K1Z A;  2NUP B;  3CQT A;  3PFS A;  1BBZ A;  3CCS A;  2J7I A;  1BIA A;  3BDU A;  4N4H A;  2FPE A;  2LRQ A;  4C8Q E;  3EFS A;  3I5R A;  2CUD A;  2GQI A;  1AVZ C;  3U23 A;  3WXM B;  2GFA A;  2HBP A;  2K3B A;  2OI3 A;  1WHH A;  5GAM e;  1TUC A;  3MO8 A;  2CZ6 B;  1D0Z A;  5KYU B;  4C8Q G;  1AEY A;  1OI1 A;  2JJ9 A;  2YT6 A;  4OMN A;  1YIJ T;  1ZSG A;  3CCV T;  2JTE A;  1NJI C;  2GQV A;  3UPU A;  1W2B S;  2E6N A;  1JU5 C;  1R0B G;  2CH4 W;  2JXB A;  2VC8 A;  2EJF A;  4V2S A;  4M77 B;  1YHQ Q;  3G7Z A;  2AKL A;  1RAG B;  2D9T A;  2LJ0 A;  2I0N A;  4C92 A;  1S72 Q;  4OB3 B;  1QVF A;  4M78 F;  2IPO B;  4XU2 A;  1FMV A;  2VAS A;  3CCU Q;  5CKH A;  2E10 A;  5LJ3 g;  4AFS C;  2C06 A;  1PSF A;  1RL2 A;  3HFN A;  2XG8 D;  3H9N A;  3S3O A;  4PJO E;  2CSQ A;  3CBM A;  2EYX A;  4A4E A;  1KG1 A;  1SF9 A;  3C0C A;  2M0O A;  3OYY A;  2RN8 A;  2EQK A;  4DOW A;  3KBG A;  1VQ7 A;  3PT9 A;  2LDM A;  3URG A;  3CCS Q;  2V26 A;  5LJ5 h;  3TQ7 P;  2DBM A;  4M7A D;  4RCB A;  5LJ5 j;  2MYS A;  2JTM A;  2LJ3 A;  4XTZ A;  5C6S A;  5CO7 A;  2O88 A;  2LCC A;  3SDZ A;  2QQS A;  4J8O A;  1IGU A;  1W2B A;  1M1K U;  4M7D E;  4FYY B;  5KYX A;  4HCB A;  3CCJ A;  1PD0 A;  4J83 A;  4RTT A;  5A2Q E;  3OBW A;  4HKE A;  5KCH A;  2PQW A;  4OMM A;  2YUO A;  5ECA A;  3FB9 A;  4M7D G;  1YI2 T;  1Z9Z A;  4IIM A;  3VUZ A;  2HQE A;  2QA4 T;  3MCA B;  5FWB A;  3GIB A;  2DET A;  2ESW A;  1WPY A;  1WDX A;  4FCY A;  4OB1 B;  2DBK A;  2DER A;  3BFM A;  4N0A A;  1Q81 U;  2CYZ B;  1IHV A;  2CS7 A;  2HL3 A;  2GBQ A;  2RMO A;  1XQH A;  1LOJ A;  3ZL7 C;  4OF1 A;  4JDS A;  4L5G A;  1YP5 A;  2NUP A;  2LX9 A;  1YJN T;  1OYX A;  3V7C A;  1Q82 U;  5D6Y A;  3CCM Q;  4KUD K;  3OSV A;  1D09 B;  2ZPG B;  1VQ7 Q;  4C0D C;  3M0T A;  2M02 A;  1RAI B;  5GJV B;  1K73 C;  5LJ3 d;  1WX6 A;  2OJ2 A;  1KD1 U;  2SRC A;  1X2K A;  3CCE T;  1QLY A;  3CC2 T;  2XDB A;  2RJC A;  1M2O A;  1K0X A;  1PG5 B;  3ASK A;  3PNW C;  2PU9 B;  1GL5 A;  1VQL A;  5KYU A;  2M9U A;  3FJP A;  1WGS A;  4F04 B;  4M75 C;  1UJY A;  2A7Y A;  3MP6 A;  4OGE A;  1JQQ A;  4KBM B;  4BUG A;  3I56 A;  2O01 E;  3E19 A;  5DLQ E;  4E47 A;  1QCO A;  1I1J A;  4M77 A;  3MHX A;  3EGU A;  2IG0 A;  4BE1 A;  2X51 A;  1QP3 A;  1FX7 A;  5LJ5 f;  3OSS C;  1U06 A;  1IRE B;  3SD4 A;  1D1B A;  2RJE A;  2GGR A;  3JB9 F;  3INZ A;  2CKK A;  2EQJ A;  2OTL A;  4LDY A;  2MPX C;  1ABQ A;  3EGX B;  2OTJ T;  9ATC B;  1FMW A;  1KC8 U;  2KQW A;  4M78 D;  3ZBD A;  3SWN B;  1VQ6 T;  5FU7 B;  1M8M A;  1RAD B;  1AHJ B;  3UWN A;  1SHG A;  1UDL A;  5CIU A;  4KH1 B;  2X4Y A;  3X26 B;  3L2W A;  1BK2 A;  2CP0 A;  3A5Z B;  1WZO A;  1K9M C;  1YBY A;  2A0F B;  4BY6 C;  1X01 A;  4RG2 A;  5GAN 7;  4HCK A;  5HKC A;  1AD5 A;  1ZBX A;  5LJ5 e;  2L3S A;  2FRW A;  2WSC E;  2K5F A;  2QEX A;  4DA4 A;  3L2Q A;  1VQL Q;  1OPL A;  1OX8 A;  2MIO A;  1FYN A;  1BKB A;  2HZY A;  3ZEH A;  5J39 A;  2OAU A;  2YLB A;  4BAC A;  5I11 A;  3I56 Q;  1M8V A;  2HBW A;  2W0Z A;  3QYH B;  1SPK A;  4OMO A;  3H0F A;  3OYC A;  1PC0 A;  4X34 A;  4C8Q B;  5IH2 A;  2LNH B;  1YFN A;  1X2Q A;  1ZA2 B;  2ZAE A;  3QZ9 B;  3HKS A;  4ZGJ B;  1SSF A;  4FSS A;  1IO6 A;  2MF2 A;  3CBO A;  2CP6 A;  4LXC A;  3L2U A;  1VYT A;  2QQA A;  1W4S A;  3C4S A;  2NWM A;  1HD3 A;  1T0J A;  1BYM A;  4EMH A;  3CC4 A;  2OTL Q;  4CI0 C;  2G6F X;  1NJI R;  2DL3 A;  2R57 A;  2DFU A;  1D3B B;  3CXC P;  4JRK A;  4FL6 A;  3MKD A;  2YLC A;  1OX9 A;  1X6G A;  2IVW A;  3MET A;  2DEU A;  3JRZ A;  4MMK A;  1BCM A;  2YXY A;  2O9V A;  4XU0 A;  1K8A U;  4M75 E;  1VQN A;  1K9A A;  2D6F A;  3QII A;  3CCL A;  4LD6 A;  2E1H A;  2MOX A;  4AT1 B;  4PFO A;  5CKB A;  1YIJ A;  2DZC A;  2YDL A;  3MEA A;  2QEX Q;  3M53 A;  2K2M A;  3I55 T;  1WQ7 A;  1PNJ A;  2GTO A;  4M75 G;  3G4S A;  1RAH B;  4IUQ A;  1VOM A;  4BI3 A;  3CXC S;  3X25 B;  4M77 E;  3UT1 A;  4PFP A;  4E7K A;  4RTZ A;  5KYN A;  2D0N A;  2RHU A;  2A28 A;  3UA7 A;  1E6G A;  3GP8 A;  1TSF A;  3JB9 J;  3JCM V;  4XTW A;  1CSK A;  2KAF A;  4M7D B;  1PWT A;  3CCQ T;  4JS4 A;  3OMG A;  1K76 A;  3V8K A;  5FU6 B;  3H0H A;  2YRC A;  3A8O B;  4M77 G;  2HMA A;  3JB9 H;  3EGX A;  4D6W A;  3L2R A;  2LTO A;  2HEQ A;  2CZ1 B;  4PJO F;  5EC7 A;  3DB3 A;  3SEM A;  5C0M A;  3CC4 Q;  5KCO A;  1WFW A;  1N8R C;  3SWN A;  4QVZ A;  1Y07 A;  3CD6 T;  3QJ6 A;  2X4J A;  3JB9 D;  2P4R A;  4RUG A;  1OPK A;  3RNJ A;  3M55 A;  2GNC A;  1NEB A;  1I8F A;  1LVK A;  2JMC A;  2BZX A;  4OB0 B;  2BZY A;  2RA2 A;  1PM3 A;  1OEB A;  3EG1 A;  3OS1 A;  3J81 E;  5KYY B;  1M1F A;  3SB2 A;  4JJB A;  4XTY A;  1VQN Q;  5GAO q;  1RAA B;  3CCL Q;  4BDY A;  2L89 A;  2ZGW A;  5GAO p;  2VB6 A;  1YIT T;  1QVG S;  2M0Y A;  2HKQ B;  1YIJ Q;  2KVQ G;  2QG9 B;  3RIR A;  3BW1 A;  3OW2 P;  3VS1 A;  2XU8 A;  2CDT A;  2O31 A;  1T3L A;  4C8Q A;  3G4S Q;  4L6V 5;  2K57 A;  2W10 A;  5DY9 A;  1U5S A;  1PRM C;  1NYG A;  2E5Q A;  1K73 R;  5IXF A;  4MDX A;  4FM4 B;  3OYD A;  1UEB A;  4N4G A;  3TVT A;  4KGZ B;  2RQR A;  2V8J A;  1G3Y A;  2KI7 A;  3NHN A;  1YJ9 T;  1VQM T;  1ZSZ C;  1PHT A;  2JVV A;  1H92 A;  1OZ2 A;  4IUU A;  4OML A;  2KXC A;  1TOV A;  3GBQ A;  3GPL A;  3QXE B;  3G6E T;  2B86 A;  1VIE A;  1D3B A;  2O9S A;  4MZT A;  1W1F A;  2RHI A;  3OW2 S;  4J9G A;  1QMC A;  3CME T;  1VA7 A;  1ZUK A;  3EG2 A;  2J6O A;  2KDS A;  1JXM A;  2O4X A;  3EH2 A;  2AHJ B;  4QQ6 A;  2CZ7 B;  2EVR A;  3V8L A;  2E6Z A;  3CMA A;  1QVG A;  2QGG A;  4C0G A;  4IUR A;  4KH0 B;  1YN8 A;  3RER A;  4JS5 A;  3FRN A;  4HVV A;  2L2P A;  2RQT A;  2FZG B;  3A98 A;  2QDL A;  4F7U B;  1Y57 A;  4RTX A;  3G71 A;  3LX7 A;  5HK3 A;  2DRK A;  2YRD A;  1M1G A;  1YI2 Q;  2R58 A;  3JSC A;  3MPU B;  2ENM A;  1M90 U;  1F1B B;  3HPW A;  4LDX A;  5GMK j;  2DIG A;  2DZ9 A;  1B3Q A;  2KGT A;  5AYF A;  1V76 A;  5HY6 A;  4C92 F;  4JRQ A;  4M7D A;  3GOX A;  1IB8 A;  5IN1 A;  1K9M R;  2XDP A;  2YHT A;  2OTJ A;  2J05 A;  1Z9Q A;  3MEV A;  4BD3 A;  1BIB A;  1SRL A;  2KRN A;  4XTV A;  1YHQ A;  4AG1 C;  5D7U A;  3RR6 A;  2P4T A;  5CKF A;  3A8L B;  2AT1 B;  2K9G A;  1S72 A;  3UDC A;  1BCO A;  5LJ3 h;  1KIK A;  2AZS A;  1QWE A;  2JOY A;  2YWW A;  2HD0 A;  3P8B B;  1X6B A;  3CCU A;  2DVJ A;  1UHC A;  3IQL A;  1NEG A;  5KYY A;  1RUW A;  5IHK A;  3CMA Q;  2A37 A;  4C0D B;  2JTF A;  4EMK C;  1TWB A;  3VJP A;  2PVO B;  3VS6 A;  2C0T A;  2EGC A;  3G71 Q;  5IT9 E;  1G3T A;  1AOJ A;  4GY5 A;  4XAX B;  4A4G A;  4QVD A;  1JEG A;  3X24 B;  4F17 A;  5CR2 A;  2HQH A;  1QCF A;  3G1J A;  1VQO T;  1MND A;  4M75 B;  2NUT B;  2F5K A;  4A4F A;  3LWI A;  1ZQ1 A;  2DPP B;  2HSE B;  4ZTF A;  2A3L A;  2VGN A;  1Q7Y U;  3PIO A;  4EIK A;  4WTO B;  2RO0 A;  3QG1 A;  5GAN 8;  4JPB W;  1QQJ A;  3OS5 A;  3X28 B;  2OTJ Q;  3EFR A;  1PKT A;  5GAN 4;  4PJJ A;  2RQU A;  4FIB A;  4J6Y A;  3TU4 K;  3TRE A;  2E4H A;  2EYW A;  4QT7 A;  2HCK A;  4JLG A;  1YWP A;  2KEA A;  2CP2 A;  5KE2 A;  1ABO A;  1QWF A;  3LWH A;  2X4X A;  3MEW A;  1QKX A;  4NS5 A;  4M7A C;  5GAN 6;  3OQ5 A;  1U1T A;  3PE0 A;  1X6O A;  4JRI A;  4BDZ A;  2DIQ A;  4MML A;  2PVG B;  1Y71 A;  2EGA A;  4F7U A;  2ROL A;  3CCM A;  3EHR A;  2HQX A;  1N8R R;  3QSU A;  5CK9 A;  4TVR A;  1E6H A;  1RAE B;  2DM1 A;  2ZPF B;  3CC7 T;  2RF0 A;  1WQW A;  4RTV A;  5D6W A;  4C5G A;  2K5I A;  2FPF A;  4M77 F;  4ORZ A;  3THK A;  1X43 A;  4BE2 A;  1UGQ B;  2B8A A;  4BY6 B;  2COY A;  1WJR A;  4C5E A;  3P8D A;  3I9Q A;  2DTI A;  5LJ3 f;  2RD1 A;  2KRM A;  2DL5 A;  3NTI A;  5GMK e;  1X27 A;  3CPW P;  4AFZ C;  1H64 1;  4DEY A;  2M51 A;  4IUV A;  5CQX A;  4C92 D;  1M1K C;  1YJW T;  3SFM A;  1BI1 A;  2K5L A;  3HL8 A;  3OS0 A;  2YUN A;  1JXO A;  8AT1 B;  2RB6 A;  2BZ8 A;  1JJ2 P;  5L8R E;  1U3O A;  1NM7 A;  4X9C A;  3M4G A;  5EG2 A;  3E1S A;  2YUQ A;  5GAO l;  4QVC A;  1B7T A;  4LDV A;  2DTH A;  2LMJ A;  4AFU C;  4LUD A;  5J26 A;  8ATC B;  4PL6 A;  5CCA A;  5LJ3 e;  1NLP C;  2ZPB B;  1YIT A;  3QPH A;  4GBQ A;  1Q81 C;  4JJC A;  2X4W A;  1LCK A;  2DTO A;  3M0Q A;  3EG3 A;  4RCC A;  4CC7 A;  2KR3 A;  2V8I A;  3VYG A;  2DJZ A;  1TU0 B;  4D8K A;  1Q82 C;  1G83 A;  3TCJ A;  4JJN K;  4J9C A;  4M75 A;  2NUT A;  2DO3 A;  3VUB A;  1RAC B;  1GCP A;  2RI2 A;  3OYB A;  3CCQ Q;  1GFC A;  2KMT A;  2L0A A;  3REA B;  4A4H A;  4LUE A;  1KQ2 A;  1KD1 C;  3A8H B;  3JCM g;  2ED0 A;  3NPF A;  5AT1 B;  1O9S A;  7AT1 B;  2DAQ A;  2E5K A;  1FMK A;  3O8V A;  2X35 A;  4M4Z A;  3FC3 A;  2ED1 A;  5I21 A;  2CRE A;  1LJO A;  3CD6 Q;  1K4U S;  1KQ1 A;  3VS2 A;  3CME A;  5FRN A;  4M78 C;  4M7A E;  3R6O A;  3REB B;  4E7L A;  2EJ9 A;  4J9E A;  3CPF A;  2KYB A;  4DBR A;  4Q5W A;  4GLK A;  1MUZ A;  3QHS A;  2V1Q A;  3S3M A;  3D7S B;  4RTW A;  2LJ1 A;  1R77 A;  4M7A G;  5KH6 A;  2DL4 A;  1KJW A;  2EIF A;  1WHJ A;  2F1L A;  3UAT A;  2L8D A;  4F7U E;  1YIT Q;  2EQI A;  2J6K A;  1JB0 E;  1Y0M A;  2KXD A;  2DKG A;  2DMO A;  4YTL A;  1I4K 1;  2K4Y A;  1KC8 C;  5FW9 A;  2RHZ A;  4F7U G;  3RES A;  2A08 A;  1Q86 U;  1ZBJ A;  2RHY A;  2DIL A;  5GAO n;  1VQK A;  1SSH A;  1VQM Q;  1RI0 A;  2E70 A;  1GBQ A;  2XIC A;  1VQ8 T;  2BIV A;  1VQP T;  3TSZ A;  2EQM A;  1W6X A;  1Q86 C;  4KUI A;  3DLL A;  2KT1 A;  1GCQ C;  3RBB B;  2JUF A;  2QK0 A;  3JCM J;  3UA6 A;  4RTU A;  1SKU B;  1Q95 G;  3G6E Q;  1R0C B;  2VGM A;  4B9W A;  1M3C A;  4EMG A;  2EW3 A;  1NE8 A;  2COW A;  2D8H A;  2E12 A;  1SRM A;  1ZSZ B;  1HYO A;  2K79 A;  3CME Q;  4PKC C;  4PLL A;  5LL6 S;  2K3X A;  2LQW A;  2DRM A;  3V7S A;  4J7I A;  3JCM d;  4AFQ C;  4LDW A;  3VS0 A;  1CKA A;  2DXB A;  4RG8 A;  4PNO A;  5FRO A;  3VS7 A;  5KE3 A;  1WI7 A;  2QQB A;  5CQY A;  1VQ9 T;  3L2V A;  4J7F A;  3RMQ A;  3PGG A;  2I2L A;  1TH7 A;  4QQG A;  1LPL A;  1EX4 A;  1VQ5 T;  4C8Q F;  2EQU A;  1I0C A;  4UC4 A;  4LNP A;  2GTJ A;  4HT9 A;  3M4Y A;  1WJQ A;  4HT8 A;  2Y4X A;  2RHX A;  4ZGD B;  1WLP B;  1A0N B;  3NMZ C;  4NL2 A;  1NG2 A;  4LE9 A;  2K2V A;  1VQK Q;  3QJY A;  3JV3 A;  5IXB A;  2AZV A;  5GAO r;  3M59 A;  3CCV A;  1K8A C;  3ULR B;  2CP7 A;  1JO8 A;  1OU8 A;  4M78 E;  3T9N A;  2P0K A;  2GF7 A;  4NOY A;  1N5Z A;  5GMK i;  1UGV A;  3LGF A;  4OMQ A;  2BE7 D;  2RQW A;  2BUD A;  3DLM A;  4ZN1 A;  3L42 A;  4M78 G;  1KK7 A;  3S6W A;  1D1C A;  1I07 A;  2C0O A;  2NYS A;  1NLO C;  5GMK l;  4C0Z A;  2R5A A;  4LN2 A;  4FSX A;  5I22 A;  2DK3 A;  2F2X A;  3JCM b;  2LNV A;  3EFO B;  4D8D A;  4ESR A;  3OMC A;  1MMG A;  4II1 A;  4BI4 A;  3HTR A;  4JUV A;  3QDR B;  4E7H A;  2ZPH B;  1M1K R;  4BI8 B;  1VIF A;  2E41 A;  2CUB A;  4ZTJ A;  2RJD A;  1KSW A;  1M3B A;  1BI3 A;  4HVU A;  5IHI A;  1VQ4 T;  2KYM A;  3CCJ T;  2MCN A;  1MV0 B;  4XU3 A;  5I2S A;  2FG0 A;  1UUE A;  5GAN j;  2VVK A;  4Y92 A;  2PNI A;  3MP1 A;  3V8J A;  1KQS P;  5IHN A;  4M7D F;  2CP5 A;  4EMK B;  4RTY A;  1G3W A;  4Z88 A;  2RPN A;  4CC2 A;  3CXC A;  3HP9 A;  5A0D A;  1BU1 A;  3C94 A;  2CH4 A;  2FZK B;  6AT1 B;  3PVQ A;  3CCV Q;  3NTK A;  1Q81 R;  2E64 A;  1M30 A;  1YI2 A;  2X9H A;  2HNI A;  3EG9 B;  2QA4 A;  3QZ5 B;  1ZSZ A;  1H3Z A;  2OX7 A;  2D8J A;  2F69 A;  1Q82 R;  1WXU A;  2DL8 A;  1WXB A;  5GJW B;  4KUL A;  5GAO m;  3AHU A;  4A53 A;  4DBH A;  3BDL A;  3R6N A;  3JCM W;  4LDU A;  3FIF A;  1SEM A;  4PLI A;  1KD1 R;  3TEE A;  3H0I A;  5GAM j;  1YJN A;  4OVA A;  3HRT A;  2J06 A;  1VYV A;  1XTD A;  2JS0 A;  5J3B A;  4KGV B;  2COZ A;  5CVI A;  4WCI A;  4WF2 A;  2DE0 X;  2WSE E;  1QW1 A;  1ZHI A;  3MJX A;  1BI2 A;  4M7A B;  1YWO A;  1YNZ A;  1VQL T;  5D6X A;  5DM7 R;  2KNB B;  1JBM A;  3CCE A;  3JCM c;  4O5V A;  3CC2 A;  1IXD A;  3KFV A;  3I56 T;  4HCC A;  5GAN g;  3CBP A;  2LX7 A;  1LNX A;  2Y90 A;  4C8Q D;  4IKF A;  2EYY A;  3QKJ A;  4E7S A;  1WHM A;  1TUD A;  2EPD A;  4J9F A;  2XID A;  3QDF A;  2K6D A;  4L59 A;  5GMK h;  1D1A A;  1PSE A;  3A8M B;  5HCK A;  2CT3 A;  2QA4 Q;  1KC8 R;  2BE9 B;  1GBR A;  4KT0 E;  4OB2 B;  2DXU A;  5GAN f;  2XK0 A;  3JB9 G;  4Y91 A;  4PJO C;  1M90 C;  1G2B A;  3EFO A;  3EGD B;  3OYM A;  3OW2 A;  2RI5 A;  2JMA A;  4GLM A;  2EAY A;  1Q86 R;  1QP2 A;  4IIO A;  1VQ6 A;  4PJL A;  4F7U F;  1UTI A;  1YJN Q;  2JZ2 A;  4OMP A;  1MMA A;  5GAM g;  4OMF B;  1N27 A;  1NYF A;  2VKN A;  4R0K A;  3MEU A;  1N6A A;  2Z0W A;  1QVF P;  4KGX B;  3F70 A;  2RM4 A; 
#chains in the Genus database with same CATH homology
 2AKK A;  2J6F A;  2XMF A;  1UHF A;  2YUN A;  3VS4 A;  4HCK A;  1AD5 A;  4DEX A;  2FO0 A;  1JXO A;  2L3S A;  2BZ8 A;  2FRW A;  4J9D A;  2IIM A;  1U3O A;  1NM7 A;  1OPL A;  2MIO A;  2CT4 A;  1FYN A;  2JT4 A;  2YUQ A;  5I11 A;  1H3H A;  2HBW A;  2D1X A;  2W0Z A;  1SPK A;  2LMJ A;  4OMO A;  4AFU C;  4CC3 A;  3H0F A;  3M0P A;  4LUD A;  2HDA A;  1TG0 A;  5IH2 A;  2LNH B;  1RLQ C;  1X2Q A;  1ZUY A;  2L3Q A;  1EFN A;  1NLP C;  4FSS A;  1IO6 A;  1T3S A;  4GBQ A;  1VYT A;  3QWX X;  2ECZ A;  4JJC A;  2NWM A;  1LCK A;  1BB9 A;  2X3W D;  3FJ5 A;  1HD3 A;  1T0J A;  3EG0 A;  3M0Q A;  2G6F X;  3EG3 A;  4CC7 A;  2KR3 A;  2DL3 A;  2DJQ A;  2BTT A;  4D8K A;  2F2W A;  1G83 A;  2DLP A;  2LP5 A;  1AWW A;  2FRY A;  4J9C A;  1W70 A;  3TSW A;  2NUZ A;  1GCP A;  1X6G A;  2F2V A;  1GFC A;  2L0A A;  3REA B;  2JM9 A;  2EBP A;  4LUE A;  2O9V A;  1S1N A;  2HSP A;  3QWY A;  2ED0 A;  4Z8A A;  3NPF A;  4AG2 C;  2E5K A;  1FMK A;  4A63 B;  1K9A A;  4M4Z A;  4HXJ A;  2ED1 A;  1QKW A;  2CRE A;  3LH5 A;  2MOX A;  1K4U S;  1VYU A;  3VS2 A;  1RLP C;  3M0U A;  2YDL A;  2K2M A;  3REB B;  1PNJ A;  2GTO A;  4J9E A;  2KYB A;  1WYX A;  1UG1 A;  1MUZ A;  2C0I A;  2KT8 A;  2V1Q A;  4RTZ A;  4RTW A;  2D0N A;  2LJ1 A;  2RQV A;  2A28 A;  1OOT A;  1E6G A;  3UA7 A;  1UEC A;  2DL4 A;  1KJW A;  3NGP A;  1CSK A;  3UAT A;  1PWT A;  1K76 A;  2EQI A;  1ZUU A;  2J6K A;  2JW4 A;  1Y0M A;  3H0H A;  2A36 A;  3VRY A;  1RI9 A;  2JS2 A;  2KXD A;  2HEQ A;  2DMO A;  5EC7 A;  3SEM A;  4JZ3 A;  1K0S A;  1KFZ A;  5FW9 A;  1WFW A;  5FWC A;  2EYZ A;  2LZ6 B;  2A08 A;  1ZBJ A;  2P4R A;  4RUG A;  1OPK A;  2DIL A;  3RNJ A;  2K7A A;  2GNC A;  1SSH A;  1NEB A;  1GBQ A;  3VS5 A;  4K11 A;  1AZE A;  2JMC A;  3TSZ A;  2BZX A;  1WIE A;  1UE9 A;  2BZY A;  1M3A A;  4Z89 A;  1W6X A;  1AZG B;  1OEB A;  2KT1 A;  3EG1 A;  3VRZ A;  1GCQ C;  3RBB B;  2X3X D;  3EHQ A;  1X69 A;  3UA6 A;  4JJD A;  3O5Z A;  4RTU A;  4E6R A;  2KE9 A;  4JJB A;  1M3C A;  2EW3 A;  3H41 A;  2D8H A;  2DL7 A;  4JZ4 A;  1SRM A;  2KRS A;  2K79 A;  4J9H A;  4J9B A;  2M0Y A;  2LQW A;  3PVL A;  3VS1 A;  4F14 A;  2DRM A;  2CDT A;  2O31 A;  1T3L A;  1MV3 A;  4AFQ C;  1SHF A;  2AK5 A;  2W10 A;  1U5S A;  1PRM C;  1CKA A;  3VS0 A;  1K1Z A;  1NYG A;  5IXF A;  1J3T A;  2CSI A;  2KRO A;  1YCS B;  3CQT A;  3VS7 A;  1BBZ A;  3TVT A;  1WI7 A;  2RQR A;  2J7I A;  1T0H A;  1V1C A;  3NHN A;  1PHT A;  1H92 A;  2FPE A;  1PKS A;  3I5R A;  4KRT A;  2CUD A;  2GQI A;  4OML A;  2KXC A;  1AVZ C;  3U23 A;  3GBQ A;  2K3B A;  2B86 A;  1I0C A;  2OI3 A;  2O9S A;  4LNP A;  4ZNX A;  1W1F A;  2GTJ A;  1TUC A;  4J9G A;  1HSQ A;  1AEY A;  1WLP B;  2YSQ A;  1A0N B;  3NMZ C;  2YT6 A;  4OMN A;  1NG2 A;  4LE9 A;  1ZSG A;  1VA7 A;  1ZUK A;  2JTE A;  3EG2 A;  2L3P A;  1ZLM A;  3JV3 A;  5IXB A;  1H8K A;  2AZV A;  1OV3 A;  2J6O A;  1JXM A;  1JU5 C;  2CH4 W;  2JXB A;  2EVR A;  3ULR B;  1GRI A;  1JO8 A;  1ZX6 A;  2AKL A;  2EKH A;  3SHW A;  1YN8 A;  2LJ0 A;  2V1R A;  2I0N A;  4HVV A;  3I35 A;  1CKB A;  2EGE A;  1N5Z A;  2L2P A;  2RNA A;  2SEM A;  1UGV A;  2RQT A;  2LCS A;  4OMQ A;  2RQW A;  3A98 A;  2QDL A;  2PTK A;  4X1V A;  1Y57 A;  2JM8 A;  2LQN A;  4RTX A;  2DRK A;  4AFS C;  1I07 A;  2C0O A;  1NLO C;  2OAW A;  4LN2 A;  1PRL C;  2CSQ A;  2ENM A;  2EYX A;  5I22 A;  2ABL A;  3M0S A;  2F2X A;  3C0C A;  4D8D A;  4ESR A;  1B3Q A;  2KGT A;  2RN8 A;  4J9I A;  3I5S A;  4CC4 B;  2DBM A;  2CUB A;  1HJD A;  1KSW A;  2KBT A;  1M3B A;  2LJ3 A;  2J05 A;  1Z9Q A;  1GCQ A;  4HVU A;  5IHI A;  2O88 A;  2KYM A;  2MCN A;  1SRL A;  2KRN A;  1MV0 B;  2FG0 A;  1UUE A;  2VVK A;  4AG1 C;  4Y92 A;  2PNI A;  2H8H A;  4F16 A;  4RTT A;  2K9G A;  5IHN A;  2ROT A;  4RTY A;  1KIK A;  4OMM A;  2RPN A;  2AZS A;  1QWE A;  4Z88 A;  4CC2 A;  1ARK A;  2YUO A;  2VWF A;  5ECA A;  1E7O A;  4HVW A;  1X6B A;  1Z9Z A;  2DVJ A;  4IIM A;  1UHC A;  1BU1 A;  1AWX A;  2CH4 A;  3IQL A;  1NEG A;  2DNU A;  3PVQ A;  1UJ0 A;  1M30 A;  5FWB A;  1RUW A;  5IHK A;  5L23 A;  2A37 A;  2ESW A;  1B07 A;  1XOV A;  1WDX A;  2D8J A;  2DBK A;  3VS6 A;  2C0T A;  2EGC A;  2GBQ A;  1WXU A;  2RMO A;  2DL8 A;  1AOJ A;  1WXB A;  5GJW B;  3VS3 A;  3ZL7 C;  1JEG A;  4F17 A;  1YP5 A;  3R6N A;  1QCF A;  1SEM A;  1WA7 A;  3H0I A;  2YUP A;  1UFF A;  2J06 A;  1VYV A;  3M0T A;  2JS0 A;  4EIK A;  4WCI A;  5GJV B;  1WX6 A;  2DE0 X;  2OJ2 A;  2SRC A;  1X2K A;  4JPB W;  1YWO A;  1QLY A;  1YNZ A;  2DX1 A;  1GFD A;  1K0X A;  2KNB B;  1PKT A;  1GL5 A;  2FEI A;  2RQU A;  2DA9 A;  3KFV A;  2EYW A;  4QT7 A;  1UJY A;  2HCK A;  1YWP A;  2KEA A;  2LX7 A;  1JQQ A;  1ABO A;  1QWF A;  1QKX A;  3UF4 A;  1I1J A;  2FPD A;  2EYY A;  2DYB A;  3EGU A;  1TUD A;  2EPD A;  3PE0 A;  4J9F A;  2K6D A;  1WXT A;  2EGA A;  5HCK A;  2PZ1 A;  2CT3 A;  2ROL A;  1U06 A;  3EHR A;  1AWO A;  2GGR A;  1GBR A;  1E6H A;  2DM1 A;  1ABQ A;  1M27 C;  2RF0 A;  4RTV A;  2O2O A;  2FPF A;  4ORZ A;  1G2B A;  1X43 A;  3THK A;  2JMA A;  4GLM A;  3I9Q A;  1M8M A;  3M0R A;  4IIO A;  1SHG A;  1UDL A;  2DF6 A;  2KRM A;  1AWJ A;  1UTI A;  2DL5 A;  4OMP A;  1NYF A;  1X27 A;  2VKN A;  4R0K A;  4AFZ C;  1BK2 A;  4DEY A;  2M51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...