4CC2A

Complex of human tuba c-terminal sh3 domain with human n-wasp proline- rich peptide - p212121
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords DYNAMIN-BINDING PROTEIN
total genus 12
structure length 63
sequence length 63
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc2A00
1VYVA 1NG2A 3EG0A 1PRLC 2DL3A 4RTYA 1OOTA 1KIKA 4Z89A 1UJYA 1QWFA 1WI7A 1WA7A 2D8HA 1AZGB 1GCQA 2DBMA 2X3XD 1SRMA 2PZ1A 3THKA 1MV3A 2DX1A 3CQTA 2KYMA 3EG1A 4D8KA 2AKLA 2LJ1A 2SEMA 1U06A 2LMJA 3I5SA 4AG1C 4LUEA 4OMLA 1GFDA 4JZ3A 1BBZA 5GJVB 1ZUKA 1WXBA 2DRMA 1J3TA 2LJ0A 1AZEA 4J9CA 3VRZA 1QKWA 3M0SA 1WIEA 1ZX6A 3SHWA 1PNJA 4ZNXA 4CC4B 2LX7A 2FG0A 2DL7A 4CC7A 3RBBB 2KBTA 1JXOA 4F17A 4J9IA 3UATA 1YCSB 2DILA 1N5ZA 1YWOA 2KGTA 3VRYA 4KRTA 1KFZA 4HVVA 1HD3A 2K3BA 3LH5A 2YSQA 5ECAA 2JMCA 1K9AA 2EVRA 1VYTA 1GL5A 1G2BA 1QKXA 1ZBJA 2K79A 1K0SA 2DE0X 4CC3A 2KEAA 2HEQA 2FO0A 2LJ3A 2GBQA 2L0AA 5IXBA 2ROLA 2DJQA 4J9BA 4K11A 1UGVA 2AK5A 1CSKA 2JXBA 3R6NA 4GBQA 4M4ZA 2K2MA 3M0UA 2CDTA 2KE9A 2EW3A 1ZUYA 2L3PA 4D8DA 4Z8AA 1AOJA 2JT4A 4AFSC 1A0NB 2CSQA 4RTXA 1AWJA 2W0ZA 4HVUA 1PKSA 1KSWA 1Y57A 1FYNA 1TG0A 4ORZA 1OPLA 2YUNA 2EQIA 1M30A 1X27A 1NYFA 4FSSA 4JZ4A 3H0HA 2FPFA 1NEBA 2KNBB 1JXMA 1AWOA 4RTTA 2DA9A 3C0CA 1NLPC 1SRLA 1B3QA 2F2WA 2RMOA 2O2OA 2VWFA 2O31A 3VS2A 2AZVA 1LCKA 2OAWA 2FEIA 2RQRA 2DBKA 2KT8A 2F2XA 2RNAA 4OMMA 1W1FA 1AD5A 2JW4A 1PKTA 2EYYA 2ENMA 2J6KA 2DMOA 4OMOA 1GRIA 3H0IA 2K7AA 3EG3A 2DL4A 2RQUA 2RPNA 2V1QA 3A98A 2EYZA 2RQVA 1FMKA 4A63B 5L23A 2VKNA 3H0FA 2JM9A 1Z9QA 2EGCA 1BB9A 1RLPC 3QWXX 3QWYA 2L2PA 4OMPA 2OI3A 4CC2A 1I07A 1ZSGA 1JQQA 1I0CA 2BZ8A 2HSPA 1MUZA 3M0TA 4HXJA 4F16A 2DF6A 1QLYA 2DYBA 1ABOA 1IO6A 4JJDA 2C0OA 2PNIA 1UG1A 1HSQA 1H3HA 2MOXA 3REBB 2JMAA 1NYGA 1UECA 2GQIA 1M3CA 3TSWA 2CH4W 2BZYA 2KRMA 3NHNA 2NUZA 1GCQC 2JS2A 3EHRA 1BU1A 2B86A 4AG2C 1WDXA 3U23A 4J9GA 2H8HA 2ECZA 4AFQC 1G83A 1YN8A 2MCNA 1K76A 2YUQA 2SRCA 1H8KA 1WYXA 1XOVA 2K9GA 1OEBA 1UHFA 1ZUUA 1I1JA 3EGUA 2W10A 4IIMA 5FWBA 4LUDA 3RNJA 1KJWA 1Z9ZA 2D0NA 2CT4A 4RTWA 1B07A 1K1ZA 2A08A 2KRSA 3M0QA 1WX6A 1QCFA 4JJBA 5IHNA 2CSIA 2EGEA 2G6FX 2HBWA 3VS5A 1WXUA 2C0TA 4HCKA 1GBQA 2JM8A 2KXDA 4WCIA 1AWWA 2F2VA 4QT7A 2E5KA 1T3SA 3EHQA 1UE9A 3ZL7C 2GTOA 1T0JA 4AFUC 1ARKA 2JTEA 1RUWA 2CREA 2HCKA 3UA6A 2CT3A 1SPKA 3JV3A 2J05A 3ULRB 4X1VA 3VS1A 4OMNA 2A28A 1TUDA 3UF4A 1SSHA 2NWMA 3VS3A 1M8MA 2AZSA 3VS0A 3PVLA 2LCSA 4J9HA 1M3BA 1JU5C 2J7IA 2LQNA 1CKBA 2GNCA 3VS4A 5HCKA 3PVQA 2DM1A 1SHGA 2KROA 3I9QA 3NMZC 4E6RA 1X2QA 2A36A 4Y92A 1UUEA 1K0XA 1UJ0A 2YUPA 2FRWA 1AEYA 1V1CA 2CH4A 1OV3A 1M3AA 3TSZA 2O88A 2FPDA 2C0IA 5I11A 2RF0A 2J6FA 4DEYA 1AWXA 3I5RA 3I35A 5FW9A 1AVZC 3PE0A 1U3OA 3KFVA 1YP5A 1VA7A 1RLQC 2XMFA 2P4RA 2EKHA 4LE9A 1E6GA 1PHTA 1JO8A 2ED1A 4GLMA 4EIKA 2IIMA 2CUBA 1NM7A 2BZXA 2LP5A 3TVTA 2LQWA 2LNHB 2VVKA 1ZLMA 3EG2A 3M0PA 5GJWB 1Y0MA 2MIOA 1NLOC 1M27C 2KR3A 4RTVA 4DEXA 2ABLA 1NEGA 2GGRA 1T3LA 2RQWA 1X2KA 4F14A 2KXCA 2K6DA 2M51A 2EGAA 3O5ZA 2I0NA 2CUDA 2YUOA 5FWCA 2M0YA 1K4US 3NGPA 4ESRA 1GBRA 1BK2A 2EPDA 1YNZA 5IHIA 4OMQA 4HVWA 5IH2A 1PWTA 3M0RA 5IHKA 4JJCA 2QDLA 4J9DA 2GTJA 1E6HA 3GBQA 4LNPA 1WXTA 4RTUA 1UFFA 1YWPA 1U5SA 1W6XA 4J9EA 4JPBW 2RQTA 2BTTA 3FJ5A 2AKKA 1VYUA 5IXFA 1X6BA 2HDAA 2FRYA 2PTKA 3UA7A 1OPKA 1PRMC 1X43A 2JS0A 2DRKA 3NPFA 2L3QA 2O9VA 1EFNA 3SEMA 3H41A 4LN2A 1WFWA 3IQLA 2DVJA 1JEGA 2KRNA 2EBPA 2D1XA 4RUGA 2ED0A 2O9SA 2YT6A 2D8JA 2KYBA 1RI9A 4RTZA 1X6GA 3VS7A 1W70A 1GCPA 1X69A 2ESWA 1TUCA 1UTIA 1ABQA 2A37A 1E7OA 2EYXA 2DL5A 2FPEA 2L3SA 1S1NA 1H92A 2J6OA 1UDLA 5EC7A 4AFZC 2DL8A 1UHCA 1CKAA 2DNUA 2V1RA 2YDLA 2J06A 2ROTA 3REAB 2EYWA 2LZ6B 1T0HA 2RN8A 4IIOA 1GFCA 4Z88A 1SEMA 3VS6A 4R0KA 1HJDA 1SHFA 1WLPB 2DLPA 2OJ2A 2KT1A 4J9FA 5I22A 1MV0B 2X3WD 1QWEA
chains in the Genus database with same CATH superfamily
4C92A 4RTYA 3A5ZB 1UJYA 1Q95G 2R57A 3VYHB 4M7AG 2G3RA 4RMOA 2PZ1A 3THKA 4FT2A 4M77F 2KYMA 4D8KA 3CCJT 1K73U 1WXBA 4WTOB 2BIVA 2DRMA 4PL6A 1I4K1 3FEOA 2LJ0A 1AZEA 1VQKT 3VRZA 1QKWA 3M0SA 4C92G 1KQSA 4ZNXA 2OTLA 3QUIA 1IGQA 3RBBB 3GLXA 6AT1B 1JXOA 3SDZA 4FYWB 2Z0WA 4LDUA 4A4GA 5LJ5j 3A8OB 2DILA 2AIRB 4M78F 2K2VA 3VUZA 4E7LA 1W2BA 1VQKA 1N5ZA 4DQ2A 4DBRA 4M75G 4KRTA 4HVVA 1HD3A 4FYXB 1Q81R 1LPLA 3L2RA 2YSQA 2GFUA 1K9AA 3BW1A 2NUTA 1QKXA 1ZBJA 1K0SA 2DE0X 2HEQA 2FO0A 4LDYA 4J9BA 4K11A 1UGVA 4QQ6A 5FU6C 4BUGA 2LCLA 5HK0A 3I56Q 2XD0A 2PVDB 3QG1A 1ACMB 2X35A 4D8DA 1RAEB 1AOJA 4AFSC 3G71T 1AWJA 2W0ZA 4EMGA 1W2BP 1C6VX 1JJ2P 5C6SA 1KSWA 2MYSA 3DKMA 4BY6B 1FYNA 4X9CA 1OPLA 5L8RE 2LRQA 2XK0A 4N0AC 3QDRB 1Y7XA 1C0MA 4FSSA 3CCLA 1NEBA 1JXMA 1H641 3ZBDA 4PJOD 3OW2S 2QEXT 2KDSA 4J6WA 2DA9A 4KGXB 4PJOG 1R77A 1SRLA 4M75D 5GAOr 4O5VA 2LC4A 2QTVA 3CC2A 2OAWA 2RQRA 1TXQA 2F2XA 2X4XA 1PG5B 2F5KA 3KBGA 1WQWA 3HFOA 2EAYA 4HCZA 2DMOA 2QGGA 3H0IA 1SKUB 1EIFA 3EG3A 2DYIA 2DL4A 3A98A 3JB9D 1FMKA 3M53A 4A63B 1X75C 2VKNA 3JCMP 3CXCP 1VQOT 3A8HB 3I55Q 5CKFA 4CC2A 1ZSGA 2BZ8A 2HSPA 3X20B 3OYKA 3PTAA 1PM3A 3FB9A 3M0TA 4EMKB 4F16A 2DF6A 1RADB 2XKOC 2E3IA 1IO6A 4HKEA 3QXEB 3E19A 3REBB 3E9FA 1U1TA 5LJ3d 3TU4K 4R56A 1UECA 2GQIA 1YHQT 2EIFA 1FXXA 3NHNA 5KYYA 1GCQC 3L1AA 4EMKA 3CCEQ 1BU1A 5LJ3g 1WDXA 3CCRQ 4C92D 3FLGA 2ZAEA 3U23A 4J9GA 1WHLA 2H8HA 5HKCA 4MDWA 2Y90A 2GQVA 2QA4A 4AFQC 1WYXA 1UHFA 5GAMj 1I1JA 1S72Q 1WZOA 4IIMA 1I8FA 3JCMh 2DEUA 3CD6Q 2A08A 2JN0A 4BDZA 2RO0A 2PUOB 2HBWA 1MMAA 2JUFA 2ZPFB 2KXDA 5FU6B 3X26B 2F2VA 1KHIA 2RJCA 3ME9A 1UE9A 2RHXA 4BDYA 2CREA 4J5YA 3CMAA 4FSXA 3DLLA 2J05A 2HKQB 1WJQA 2BE9B 2A28A 3UF4A 1X01A 2YRDA 3G71Q 5GAN4 3PVLA 2LCSA 4J9HA 1Q81U 3JAME 4JDSA 1RABB 1UB4A 1CKBA 1VQ9T 3PVQA 2DM1A 3WVDB 1W2BS 1VQ7T 3CMEA 4Y92A 1UUEA 5IN1A 2FRWA 3CCMQ 4PFZA 1G3TA 1OV3A 1V29B 2FPDA 1BI0A 1VOMA 2E12A 2LQKA 4HA8A 2C0IA 2EQUA 1TUGB 2JTFA 3CCVQ 3OW2P 5I11A 2CZ6B 2OTLT 2NUTB 2RF0A 1YIJA 1VQ5Q 4FYVB 1NJIC 5CKDA 3I35A 4E7ZA 1AVZC 3KFVA 1VQPT 1VIFA 1VA7A 1Q81C 1RLQC 1JB0E 2JTMA 1NPRA 4M7DC 3G4ST 2XDDA 3OYEA 3VV0A 4M75A 4OB2B 1JO8A 4GLMA 4UC4A 4M77B 2CUBA 1NM7A 3RMSA 3M0PA 4MMLA 5GJWB 1NLOC 5C0MA 7AT1B 2DO3A 1NEGA 2M51A 2EGAA 2YUOA 4AMCA 2M0YA 4ESRA 5J26A 4BI8B 2EPDA 1TTHB 4E7HA 3LGFA 3TREA 1PWTA 3EFRA 2PU9B 2R5AA 4M7AA 3QZ9B 2EJGA 2GTJA 3GBQA 2O4XB 2QYZA 4M78B 1Q7YR 2DTIA 3MCAB 4C92B 1U5SA 3OYJA 4DBHA 1W6XA 4J9EA 2QQ9A 3PIPA 3SB2A 5HY6A 2AKKA 2DTHA 2E5QA 3RKXA 1NJIU 2ZZDA 2HDAA 4FW1A 4C0DB 2PTKA 3UA7A 1BKBA 3LWHA 3CCLQ 5D7UA 2DRKA 3JB9F 5A0LA 1QP2A 1QMCA 3JCMW 2VB6A 4E7JA 1VQ7A 1K73R 5IAYA 1M90C 4JLIA 4RUGA 2O9SA 2YT6A 1VQOQ 2H3EB 1X6GA 3VS7A 1W70A 4NOYA 5KYXA 2A7YA 1YBYA 5CR2A 2M9UA 2FPEA 3R6OA 3V8JA 2M1HA 3OMCA 5KE3A 1UDLA 5KYUB 2DL8A 2KMTA 5A0DA 4B6MA 1YIJQ 1VQMA 4C8QG 1VQNA 4IIOA 4Z88A 3CCVA 1SEMA 2DLPA 1G8XA 1VQ9A 4HT8A 2OJ2A 1I81A 3TQ7P 2X4YA 3QYGB 3NFCA 3QIIA 4J9FA 2XI9A 4J83A 4BY6C 3OS5A 1PRLC 1VQ4T 1H3ZA 1OOTA 4XTVA 3S6WA 1RAFB 2IG0A 4XU2A 1WA7A 1C1AA 2OTLQ 1YI2A 2DBMA 1SRMA 2CP2A 3JCMJ 3OY9A 2DX1A 4C92F 3EG1A 3WVEB 2E1HA 3G6EQ 2LJ1A 4LDWA 3JCMf 1OU8A 4LUEA 4AG1C 1WJSA 1BBZA 1ZUKA 1SG5A 2K5FA 2YWWA 3PMTA 2VXEA 4M7AC 4PJOC 3CCUT 1QVFS 3D7SB 1WIEA 4JRIA 2XG8D 4OGCA 3CCUQ 3Q1JA 5GANh 3M56A 2R58A 2X4JA 2X51A 4DOVA 2KBTA 1SF9A 4F17A 3URGA 1JRIA 2RB6A 1MMDA 1YCSB 5CAIA 5FRMA 4F7UF 4N4IA 4XQ3A 2EQMA 1NE8A 3VRYA 4LDXA 1KFZA 5HK3A 3OYBA 2DZ9A 1D09B 2K3BA 3LH5A 3P8DA 2JMCA 4JRQA 2IPOB 3FRNA 1GL5A 2NLUA 3V7SA 2QA4Q 1G2BA 4CRIA 4FT4A 4MMKA 1ZQ1A 4KT0E 2GBQA 2OTJQ 1RACB 4YTLA 2AK5A 3DB4A 3WXMB 3R6NA 8AT1B 3GNGA 2QEXQ 1WHGA 3N5BB 4GBQA 3CMAT 1G3SA 1QVGS 3OBWA 8ATCB 4OB0B 4E7SA 2K2MA 2CDTA 2RHUA 2EW3A 3E2UA 1VQOA 3RDVA 2L3PA 1YJ9Q 2JT4A 3EH2A 1PKSA 2XIDA 3BFMA 1TG0A 2YUNA 3JCMd 3F70A 1BI3A 2EQIA 3H0HA 2FPFA 3FC3A 2KNBB 2COWA 3JB9I 4A4EA 5KYUA 1NLPC 2QXFA 1U8RA 1B3QA 4IKFA 3GF5A 2O31A 4BB7A 2VV5A 1LCKA 4EMKC 3X24B 4PJJA 2F1LA 3UT1A 2P84A 2KT8A 5CCAA 3VUBA 2EJFA 3ZFJA 2HAXA 4PFOA 2M02A 2J6KA 4KH0B 1AT1B 2JVVA 4GY5A 1GRIA 1FMVA 5LJ5f 2RPNA 2CGHA 4Z02A 1MNDA 2XU8A 2KY9A 3BDUA 2EYZA 2DERA 3H0FA 3CC4A 1K9MR 3P8BB 3G6EA 1N6AA 1RLPC 1K8AR 1PSEA 3DLMA 2WSCE 1UEBA 1M4ZA 3L2QA 1JQQA 1I0CA 3VJPA 3S3OA 1XTDA 1BCMA 2KQWA 4IUVA 3CD6T 1YJ9T 1VQ8T 1QLYA 3VU3C 2EFIA 1UG1A 2DJZA 3QHSA 3OS0A 1HSQA 4JJNK 4JS4A 1YHQA 5CKHA 2MF2A 1Y96B 3KUFA 2JMAA 4M7AB 2HBPA 1VQPQ 3TSWA 3MEUA 1K9MU 3EAEA 2NUZA 2Y4YA 4XTYA 1DJ7B 4AG2C 1Q86C 2KSSA 1PC0A 3I55T 3ZEHA 2ECZA 2VYTA 2ZGWA 5CO7A 2P0PA 5GAN7 2D9TA 2SRCA 1H8KA 3HTRA 1OEBA 1ZUUA 3OYIA 5KYWB 4C8QC 1VQ6T 2W10A 4QW2A 4NL3A 4Y91A 3INZA 1KJWA 2D0NA 2CT4A 2LDMA 5KCOA 1HXDA 4ANJA 2EQJA 5FLXE 4JJBA 3MHXA 3JCMQ 2L8DA 2G6FX 3HL8A 2ZPHB 3LX7A 2DXBA 3LWIA 1VQ6A 4BACA 2JM8A 3CC7Q 2F69A 4J7FA 4L59A 2E5KA 2RH2A 1M1GA 2A3LA 2QQAA 4RG2A 1KHCA 4AFUC 2JTEA 1RUWA 3G4SA 1Q7YC 2PVOB 3UA6A 4RCBA 1KQSS 4KUIA 4XU0A 1VQ4A 4X1VA 3VS1A 4OMNA 2FL7A 3MEAA 4OB3B 1KQ2A 2VC8A 1M8MA 1QVGP 2RJDA 2HQXA 4CI0C 2LQNA 4P5NA 3G6ET 3HKSA 4KUDK 5GAMe 5HCKA 2FB7A 4J8OA 2YLBA 2HQEA 1N8RU 1X2QA 1YJWT 2A36A 3JB9J 4PJOB 1UJ0A 2PQWA 3CCUA 1WQ7A 1KC8R 5DLQE 1YJWQ 1M3AA 4DBFA 2HZYA 1JJ2A 2RM4A 3V8KA 3MKDA 3P8HA 2GF7A 2HL5C 4DEYA 1AWXA 3QKJA 5LJ5h 2K57A 4M77G 4LDVA 5FW9A 3UDCA 5GMKj 1U3OA 4IUUA 5DM7R 4XTWA 3SFMA 4KBMB 1YP5A 2BE7D 2P4RA 2QAZA 3A8GB 5LJ3e 3CCRT 5LJ3j 3LGLA 5KH6A 3O8VA 5LL6S 4C92C 4EIKA 1G5VA 3UWNA 2IIMA 1UGPB 1M8VA 2BZXA 1VQ7Q 2ZPEB 2LNHB 3CC2Q 2QEXA 1M27C 9ATCB 2KR3A 1S72T 5LJ5d 2VGMA 2GGRA 4MZPA 3CCSQ 3I55A 5FWCA 3OA6A 3NTHA 3NGPA 1ZA1B 3HRUA 2E6NA 4HVWA 3OSVA 1IHWA 2MWPA 5IHKA 2DFUA 3QO3A 1QP3A 4M75B 5KE2A 2E41A 5CQYA 1UFFA 2GCXA 3C95A 1O9SA 3L2ZA 2BTTA 3RUXA 1Q86R 3EFSA 3DB3A 1VYUA 3CCJA 3C94A 2M0OA 5IXFA 1X6BA 2PVGB 1YIJT 1OPKA 1Q82U 3OSSC 2GFAA 3PGGA 3CC7A 2MI6A 3GNFB 3NPFA 3OYAA 1ZA2B 1EFNA 1Q7YU 3SEMA 3H41A 2RHZA 4R55A 1YJNA 1KC8C 1QQJA 3IQLA 1ZSZC 1NZ9A 1VQPA 1JEGA 5GMKh 1YITT 5KYXB 2D8JA 2KYBA 1X69A 2D0QB 1TUCA 1UTIA 3CCVT 4EDUA 2EYXA 2DL5A 2L3SA 1H92A 4N4HA 5EC7A 5DLOA 4MZMA 4AFZC 5D6YA 1VIEA 1VQ8Q 1UHCA 2V1RA 2YDLA 1TWBA 4HCCA 2M16A 3FIFA 2LZ6B 4A4KA 5FROA 1G3YA 3VS6A 4IURA 4R0KA 5GAMg 1HJDA 1UGSB 2R5MA 2YRCA 2HMAA 3S3MA 4LXCA 4FM4B 1TU0B 1MV0B 1PD0A 1M1KR 2X3WD 3S3NA 2OAUA 1NG2A 3EG0A 3OYCA 4E7IA 1KIKA 4Z89A 2HSEB 1QWFA 1WI7A 1BIBA 2D8HA 5A2QE 3T9NA 1GCQA 2CP3A 4M78D 4LD9K 4M75F 2QG9B 2ZPBB 1MV3A 2O01E 4PK4A 3QPHA 2AKLA 2SEMA 1U06A 2L3RA 2LMJA 3CC4Q 4JZ3A 1N9RA 4JUVA 1M1KU 3FJPA 3KXTA 1J3TA 4FYYB 3FDRA 4J9CA 1MNEA 4NL2A 1ZX6A 3PT9A 2PUKB 2EKOA 1PNJA 4DOWA 1KC8U 3L2WA 2LX7A 2FHDA 3HHTB 2DL7A 4M7DB 4CC7A 3J80E 3M57A 2ZPIB 1YJNT 2KAFA 3JCMV 1KD1C 2CZ7B 5ECAA 4FU6A 2EVRA 1VYTA 4PLIA 2K79A 1K9MC 2KEAA 1N9SA 2LJ3A 4XTXA 5IXBA 2RI3A 1TOVA 1CSKA 2DZCA 1W4SA 3I56A 4PFPA 4M4ZA 3CPWS 3EGXB 2HKNA 1ZUYA 4EMHA 3CCQA 4X9DA 2V26A 2CSQA 4RTXA 1M90U 2NUPA 3META 4O6JA 4FIBA 1Y57A 4ORZA 2BKDN 3PIOA 2RJEA 1M30A 1MMNA 1X27A 3CCET 3MJXA 3UPUA 4RCCA 4QVDA 4RTTA 3C0CA 2DXTA 1D1BA 3PNWC 2O2OA 1FWZA 3EG9A 3VS2A 2AZVA 2LTOA 3OS1A 2DBKA 2CYZB 4QQGA 4M75C 1M9SA 4EPCA 2JW4A 2XDPA 1PKTA 1OZ3A 2EYYA 3QYHB 2DVEA 4JLGA 1MHNA 4OMOA 2AT1B 5LJ5g 2K7AA 1YJNQ 1S72A 2MWOA 3CPFA 4PJMA 2CZ1B 2RQVA 3VYGA 1Z9QA 1BB9A 3QWXX 3RKWA 3QWYA 3QJYA 2L2PA 4OMPA 2OI3A 1I07A 3CCRA 5GAN8 2DTOA 4HXJA 3RERA 2NYSA 2QTXA 3M59A 1ABOA 4ME7A 4QQDA 2C0OA 3AT1B 4JJDA 4F7UA 4Y28E 5CK9A 4A53A 1H3HA 1M2OA 1YCYA 4M7DA 2MOXA 5GAMf 3G7ZA 1M3CA 1R0BG 2CZ0B 2K3XA 3HRSA 2CH4W 4DBQA 1BI1A 2KRMA 3JCMc 1VQ9Q 2JS2A 2QGFB 1K8AU 2CP6A 4PJNA 3HP9A 4BD3A 1K73C 2LT4A 2KI7A 3CCSA 2RK1A 1YN8A 4M7AE 1XOVA 2K9GA 3EGUA 3OQ5A 2K4YA 1QVGA 5FWBA 4BE2A 3RNJA 4RTWA 1K1ZA 1N27A 3M0QA 1UGRB 1WX6A 3M55A 1WHKA 1QCNA 1QCFA 5GMKi 2BUDA 2EGEA 2CKKA 5IT9E 2AHJB 3VS5A 2E3HA 1WXUA 4HCKA 4WCIA 1HYOA 3OBYA 1OYXA 1ZSZB 3M9QA 4OP0A 1OULA 4QT7A 2QASA 1T0JA 2WSEE 2YXYA 1ARKA 4OVAA 2P4TA 4PNOA 1BYMA 3TEEA 3JV3A 3ULRB 4HT9A 4E2FB 3HSBA 1HK9A 4Q5WA 1YJWA 2NWMA 3VS3A 1TS9A 1LVKA 1VQ6Q 3CPWP 1M3BA 3CCJQ 3X25B 5GANd 4ZN1A 3CC4T 3BY7A 2GNCA 2LNVA 4TVRA 1SHGA 2KROA 3EGXA 1NBEB 4M77E 2VUBA 1K0XA 3OYHA 2YUPA 4C8QB 1D3BB 2E6ZA 1GXIE 5GAN5 3CBMA 1AEYA 2DKGA 4A4HA 3MP1A 3TSZA 1VQ4Q 2XDBA 3CMAQ 1OQKA 1D1CA 4C5GA 3MPUB 4IUPA 1Y07A 1NJIR 2RD1A 4QKUA 1KD1U 3PE0A 1QVFP 5LJ5e 2EJ9A 1B7TA 2VXFA 3CCQQ 2YHTA 3QSUA 3CMEQ 4A4FA 2XMFA 4BE1A 2EKHA 2JJ9A 5GMKm 4M78E 2HQHA 5I21A 1E6GA 1PHTA 2ED1A 3HPWA 4RKUE 2P0QA 2LP5A 3G71A 4M7DD 2LQWA 1RAHB 5KYWA 1OX9A 2VVKA 4M7AF 5GAN6 1VQLQ 1AHJB 4DEXA 2ABLA 3JCMb 5GANg 3EH1A 1T3LA 1X2KA 4VUBA 4C0ZA 2K6DA 2KXCA 4F14A 3C12A 5GAMh 3O5ZA 3GOXA 2CUDA 3OMGA 1QVFA 2HNIA 2C06A 1BK2A 1YNZA 4M7DF 4F7UG 5IH2A 1M90R 2LVMA 4JJCA 2QDLA 4J9DA 3CCMA 1E6HA 2K3YA 3BDLA 1WXTA 3RIRA 2XHCA 1YWPA 2P0KA 1OX8A 2RQTA 4MZTA 3FJ5A 1IXDA 5EG2A 4C5IA 3JB9G 3RR6A 2ATCB 1WPYA 3CBPA 2FRYA 1RI0A 5A0GA 4C8QF 3CCQT 2E70A 1PRMC 2LX9A 2E64A 4KULA 2JS0A 1B34A 2O9VA 3G4SQ 3QDFA 3OYMA 3EFOA 4LN2A 1WFWA 1FMWA 5CIUA 3V7CA 2DIGA 4PJOA 2VASA 3LYIA 2CP0A 2I2LA 3CBOA 3M54A 3GP8A 2ED0A 3M5AA 3MEWA 4BI4A 3JB9H 1ZHIA 1RI9A 5GAOq 1U1SA 1G3WA 1GCPA 3V7RA 2ESWA 1ABQA 2A37A 1E7OA 3GPLA 2J6OA 1D0ZA 1F1BB 5M9OA 4PJOF 2ROTA 3H9NA 4QVZA 1IHVA 5KCHA 1T0HA 3CXCA 1WJRA 4JRPA 2K5LA 1VQLA 3M4GA 3EGDA 1TH7A 2QQSA 1YITQ 4XTUA 5I22A 2D6FA 4M7DG 1YJ9A 5CKBA 1OI1A 3A1PA 3QZ5B 1VYVA 1M1FA 5GAOl 2DL3A 3JSCA 1WHJA 1IGUA 2DAQA 1AZGB 4BI3A 4X34A 1VQ5T 2X3XD 2OTJA 3QJ6A 3CQTA 1IRXA 2V8KA 1VQNT 4XAXB 1VQ5A 4M7DE 3I5SA 4OMLA 1GFDA 3E9GA 5GJVB 1UGQB 3H8ZA 2FVUA 2V8IA 4XU3A 5GMKl 5GMKe 3RMQA 3SHWA 1RAGB 2YLCA 4PLLA 4L6V5 3OYDA 4CC4B 2FG0A 3A8MB 2WSFE 4PJLA 3AHUA 5CKEA 1EX4A 4NS5A 4J6XA 4J9IA 3UATA 2DETA 4A54A 2A0FB 4C8QE 3I56T 1YWOA 2KGTA 1I5OB 2QQBA 1KD1R 2DD4A 3MEVA 1IREB 1XQHA 2KVQG 2LCCA 2WACA 1RL2A 1WHMA 3X28B 4FL6A 4CC3A 1R8OB 4M77D 1N8RR 2L0AA 1MGQA 3OYLA 2ROLA 3GIBA 4XU1A 2QA4T 2DJQA 1MMGA 1VQ8A 1VQKQ 2X9HA 2JXBA 3CCEA 2CS7A 3MO8A 3A8LB 2FZKB 2X4WA 3M0UA 2KE9A 4N4GA 1IZ6A 4PJOE 1LNXA 4Z8AA 1A0NB 5AT1B 2RHIA 4HVUA 4E7KA 1YI2T 1QCOA 3JRZA 1O75A 1OU9A 2RA2A 1NPPA 4D6WA 1VQNQ 1PCXA 1KK7A 3PFSA 4JZ4A 1NYFA 4C0GA 1VQMQ 1AWOA 3RKYA 3PMIA 2QK0A 3OYFA 5LJ3h 5GANe 3J81E 2HD0A 4ZTFA 3OB9A 2F2WA 2RMOA 1VQLT 2VWFA 4OB1B 4WF2A 3CPWA 1M1KC 4HCBA 2FEIA 1M5Q1 3LLRA 4OMMA 2RNAA 1W1FA 1BIAA 4M78C 3ER0A 1AD5A 2E65A 5D6WA 4AT1B 3L2UA 4ELYC 2F5TX 1QW1A 2ENMA 2MPXC 1KG1A 4B9WA 5J3BA 3JCMg 2RQUA 3CC7T 2V1QA 2B8AA 3BE3A 5L23A 3JCMX 2OTJT 3SWNA 2RI5A 2RK2A 2JM9A 3CEYA 2LQ8A 2EGCA 4OGEA 5GANf 2FZCB 2QDYB 5LJ3f 1WHHA 3RESA 4L5GA 1MUZA 2RJFA 3OYGA 4QVCA 2DYBA 4M78A 2O4XA 2PNIA 4MDXA 2DXCA 1YI2Q 1RAAB 1Y96A 2HL3A 2JZ2A 5DY9A 3NTIA 3OW2A 1Q82R 4M7AD 1NYGA 1WNLA 2XICA 2JNGA 4BE0A 1YITA 2BZYA 4V2SA 4OMFB 3EHRA 2B86A 2ZCFB 4E47A 2YRVA 4C0DC 1PD1A 4C8QD 4M75E 4FCYA 4II1A 1G83A 2MCNA 1K76A 4JRKA 2YUQA 4ZTJA 3SWNB 4LUDA 3SD4A 4M77A 1Z9ZA 2IVWA 1B07A 2FZGB 4J7IA 2KRSA 1LJOA 1YHQQ 2DPPB 4N0AA 5GAOp 5GAMd 3E1SA 2DK3A 5D6XA 5IHNA 2CSIA 2E4HA 2DXUA 1LOJA 3ASKA 1ZBXA 1TSFA 2K5IA 2C0TA 5GANj 1GBQA 1AWWA 1D0XA 4ZGJB 4ATOA 3EGDB 1T3SA 3EHQA 3ZL7C 1D1AA 2GTOA 1BI2A 1M2VA 2HCKA 4RG8A 1KQ1A 1SPKA 1M2VB 2COYA 1Y71A 2CT3A 1TUDA 3OS2A 1SSHA 1R0CB 4JS5A 4ELZC 2L5QA 2AZSA 4OF1A 3VS0A 4IUTA 1JU5C 2J7IA 2MAMA 3VS4A 2V8JA 1RAIB 2EYQA 2RHYA 3I9QA 3NMZC 2QQRA 4C92E 4E6RA 4F04B 5FU7B 5GAOm 3SWNC 3MP6A 4KGZB 1I5LA 3OYNA 1V1CA 2CH4A 4XK8E 2O88A 1B34B 5I2MA 2FYKA 2J6FA 4ZGEB 3I5RA 4B9XA 1D0YA 3C4SA 4IUQA 3MP8A 4F7UE 4LE9A 3CCMT 3H6ZA 5I2SA 4PKCC 3CC2T 2MK5A 1EZZB 4J6YA 3LH0A 1Q82C 3TVTA 2EQKA 1ZLMA 3EG2A 1Y0MA 2MIOA 4RTVA 1OZ2A 2RQWA 2L89A 3LW5E 2I0NA 3OYYA 1K4US 2E10A 2QI2A 5FRNA 1GBRA 2DD5A 5KYYB 2COZA 5IHIA 4OMQA 1QVPA 4M78G 3NTKA 1PSFA 3M0RA 3M58A 2CP5A 4F7UB 4LNPA 4RTUA 4XTZA 3CD6A 4JPBW 2LT1A 2H3JA 4FW2A 4LD6A 1BCOA 1P92A 3G1JA 4GLKA 2CP7A 1VUBA 4C5EA 5GAOn 1XNIA 2EWNA 2OX7A 1XJWB 2MMPA 1JJ2S 4KH1B 1YFNA 1X43A 3M4YA 3JCMe 5FU7C 2L3QA 1X6OA 1FX7A 3HRTA 3TCJA 1D3BA 4C8QA 5GAN2 2DVJA 1WGSA 2KRNA 5CQXA 5J39A 2EBPA 1SSFA 4ZN3A 2D1XA 2DIQA 3HFNA 4RTZA 1JBMA 2RI2A 5KYNA 3J7AF 2KK4A 3EG9B 3V8LA 2DEQA 1K8AC 3CCST 1S1NA 2VGNA 3VKIA 4DA4A 3EFOB 1CKAA 2DNUA 3CCLT 2J06A 3REAB 1KQSP 2Y4XA 2EYWA 3CMET 3QBYA 2ZPGB 5CVIA 1V76A 2RN8A 1GFCA 4C5HA 5AYFA 1SHFA 4M77C 1WLPB 2JOYA 3L42A 4C0FA 3CXCS 2NUPB 1N8RC 1ZSZA 2KT1A 4KGVB 1IB8A 3L2VA 4ZGDB 1Q86U 1QWEA 1VQMT 5GAN3
chains in the Genus database with same CATH topology
1VYVA 1NG2A 3EG0A 1PRLC 2DL3A 4RTYA 1OOTA 1KIKA 4Z89A 1UJYA 1QWFA 1WI7A 1WA7A 2D8HA 1AZGB 1GCQA 2DBMA 2X3XD 1SRMA 2PZ1A 3THKA 1MV3A 2DX1A 3CQTA 2KYMA 3EG1A 4D8KA 2AKLA 2LJ1A 2SEMA 1U06A 2LMJA 3I5SA 4AG1C 4LUEA 4OMLA 1GFDA 4JZ3A 1BBZA 5GJVB 1ZUKA 1WXBA 2DRMA 1J3TA 2LJ0A 1AZEA 4J9CA 3VRZA 1QKWA 3M0SA 1WIEA 1ZX6A 3SHWA 1PNJA 4ZNXA 4CC4B 2LX7A 2FG0A 2DL7A 4CC7A 3RBBB 2KBTA 1JXOA 4F17A 4J9IA 3UATA 1YCSB 2DILA 1N5ZA 1YWOA 2KGTA 3VRYA 4KRTA 1KFZA 4HVVA 1HD3A 2K3BA 3LH5A 2YSQA 5ECAA 2JMCA 1K9AA 2EVRA 1VYTA 1GL5A 1G2BA 1QKXA 1ZBJA 2K79A 1K0SA 2DE0X 4CC3A 2KEAA 2HEQA 2FO0A 2LJ3A 2GBQA 2L0AA 5IXBA 2ROLA 2DJQA 4J9BA 4K11A 1UGVA 2AK5A 1CSKA 2JXBA 3R6NA 4GBQA 4M4ZA 2K2MA 3M0UA 2CDTA 2KE9A 2EW3A 1ZUYA 2L3PA 4D8DA 4Z8AA 1AOJA 2JT4A 4AFSC 1A0NB 2CSQA 4RTXA 1AWJA 2W0ZA 4HVUA 1PKSA 1KSWA 1Y57A 1FYNA 1TG0A 4ORZA 1OPLA 2YUNA 2EQIA 1M30A 1X27A 1NYFA 4FSSA 4JZ4A 3H0HA 2FPFA 1NEBA 2KNBB 1JXMA 1AWOA 4RTTA 2DA9A 3C0CA 1NLPC 1SRLA 1B3QA 2F2WA 2RMOA 2O2OA 2VWFA 2O31A 3VS2A 2AZVA 1LCKA 2OAWA 2FEIA 2RQRA 2DBKA 2KT8A 2F2XA 2RNAA 4OMMA 1W1FA 1AD5A 2JW4A 1PKTA 2EYYA 2ENMA 2J6KA 2DMOA 4OMOA 1GRIA 3H0IA 2K7AA 3EG3A 2DL4A 2RQUA 2RPNA 2V1QA 3A98A 2EYZA 2RQVA 1FMKA 4A63B 5L23A 2VKNA 3H0FA 2JM9A 1Z9QA 2EGCA 1BB9A 1RLPC 3QWXX 3QWYA 2L2PA 4OMPA 2OI3A 4CC2A 1I07A 1ZSGA 1JQQA 1I0CA 2BZ8A 2HSPA 1MUZA 3M0TA 4HXJA 4F16A 2DF6A 1QLYA 2DYBA 1ABOA 1IO6A 4JJDA 2C0OA 2PNIA 1UG1A 1HSQA 1H3HA 2MOXA 3REBB 2JMAA 1NYGA 1UECA 2GQIA 1M3CA 3TSWA 2CH4W 2BZYA 2KRMA 3NHNA 2NUZA 1GCQC 2JS2A 3EHRA 1BU1A 2B86A 4AG2C 1WDXA 3U23A 4J9GA 2H8HA 2ECZA 4AFQC 1G83A 1YN8A 2MCNA 1K76A 2YUQA 2SRCA 1H8KA 1WYXA 1XOVA 2K9GA 1OEBA 1UHFA 1ZUUA 1I1JA 3EGUA 2W10A 4IIMA 5FWBA 4LUDA 3RNJA 1KJWA 1Z9ZA 2D0NA 2CT4A 4RTWA 1B07A 1K1ZA 2A08A 2KRSA 3M0QA 1WX6A 1QCFA 4JJBA 5IHNA 2CSIA 2EGEA 2G6FX 2HBWA 3VS5A 1WXUA 2C0TA 4HCKA 1GBQA 2JM8A 2KXDA 4WCIA 1AWWA 2F2VA 4QT7A 2E5KA 1T3SA 3EHQA 1UE9A 3ZL7C 2GTOA 1T0JA 4AFUC 1ARKA 2JTEA 1RUWA 2CREA 2HCKA 3UA6A 2CT3A 1SPKA 3JV3A 2J05A 3ULRB 4X1VA 3VS1A 4OMNA 2A28A 1TUDA 3UF4A 1SSHA 2NWMA 3VS3A 1M8MA 2AZSA 3VS0A 3PVLA 2LCSA 4J9HA 1M3BA 1JU5C 2J7IA 2LQNA 1CKBA 2GNCA 3VS4A 5HCKA 3PVQA 2DM1A 1SHGA 2KROA 3I9QA 3NMZC 4E6RA 1X2QA 2A36A 4Y92A 1UUEA 1K0XA 1UJ0A 2YUPA 2FRWA 1AEYA 1V1CA 2CH4A 1OV3A 1M3AA 3TSZA 2O88A 2FPDA 2C0IA 5I11A 2RF0A 2J6FA 4DEYA 1AWXA 3I5RA 3I35A 5FW9A 1AVZC 3PE0A 1U3OA 3KFVA 1YP5A 1VA7A 1RLQC 2XMFA 2P4RA 2EKHA 4LE9A 1E6GA 1PHTA 1JO8A 2ED1A 4GLMA 4EIKA 2IIMA 2CUBA 1NM7A 2BZXA 2LP5A 3TVTA 2LQWA 2LNHB 2VVKA 1ZLMA 3EG2A 3M0PA 5GJWB 1Y0MA 2MIOA 1NLOC 1M27C 2KR3A 4RTVA 4DEXA 2ABLA 1NEGA 2GGRA 1T3LA 2RQWA 1X2KA 4F14A 2KXCA 2K6DA 2M51A 2EGAA 3O5ZA 2I0NA 2CUDA 2YUOA 5FWCA 2M0YA 1K4US 3NGPA 4ESRA 1GBRA 1BK2A 2EPDA 1YNZA 5IHIA 4OMQA 4HVWA 5IH2A 1PWTA 3M0RA 5IHKA 4JJCA 2QDLA 4J9DA 2GTJA 1E6HA 3GBQA 4LNPA 1WXTA 4RTUA 1UFFA 1YWPA 1U5SA 1W6XA 4J9EA 4JPBW 2RQTA 2BTTA 3FJ5A 2AKKA 1VYUA 5IXFA 1X6BA 2HDAA 2FRYA 2PTKA 3UA7A 1OPKA 1PRMC 1X43A 2JS0A 2DRKA 3NPFA 2L3QA 2O9VA 1EFNA 3SEMA 3H41A 4LN2A 1WFWA 3IQLA 2DVJA 1JEGA 2KRNA 2EBPA 2D1XA 4RUGA 2ED0A 2O9SA 2YT6A 2D8JA 2KYBA 1RI9A 4RTZA 1X6GA 3VS7A 1W70A 1GCPA 1X69A 2ESWA 1TUCA 1UTIA 1ABQA 2A37A 1E7OA 2EYXA 2DL5A 2FPEA 2L3SA 1S1NA 1H92A 2J6OA 1UDLA 5EC7A 4AFZC 2DL8A 1UHCA 1CKAA 2DNUA 2V1RA 2YDLA 2J06A 2ROTA 3REAB 2EYWA 2LZ6B 1T0HA 2RN8A 4IIOA 1GFCA 4Z88A 1SEMA 3VS6A 4R0KA 1HJDA 1SHFA 1WLPB 2DLPA 2OJ2A 2KT1A 4J9FA 5I22A 1MV0B 2X3WD 1QWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYV A;  1NG2 A;  3EG0 A;  1PRL C;  2DL3 A;  4RTY A;  1OOT A;  1KIK A;  4Z89 A;  1UJY A;  1QWF A;  1WI7 A;  1WA7 A;  2D8H A;  1AZG B;  1GCQ A;  2DBM A;  2X3X D;  1SRM A;  2PZ1 A;  3THK A;  1MV3 A;  2DX1 A;  3CQT A;  2KYM A;  3EG1 A;  4D8K A;  2AKL A;  2LJ1 A;  2SEM A;  1U06 A;  2LMJ A;  3I5S A;  4AG1 C;  4LUE A;  4OML A;  1GFD A;  4JZ3 A;  1BBZ A;  5GJV B;  1ZUK A;  1WXB A;  2DRM A;  1J3T A;  2LJ0 A;  1AZE A;  4J9C A;  3VRZ A;  1QKW A;  3M0S A;  1WIE A;  1ZX6 A;  3SHW A;  1PNJ A;  4ZNX A;  4CC4 B;  2LX7 A;  2FG0 A;  2DL7 A;  4CC7 A;  3RBB B;  2KBT A;  1JXO A;  4F17 A;  4J9I A;  3UAT A;  1YCS B;  2DIL A;  1N5Z A;  1YWO A;  2KGT A;  3VRY A;  4KRT A;  1KFZ A;  4HVV A;  1HD3 A;  2K3B A;  3LH5 A;  2YSQ A;  5ECA A;  2JMC A;  1K9A A;  2EVR A;  1VYT A;  1GL5 A;  1G2B A;  1QKX A;  1ZBJ A;  2K79 A;  1K0S A;  2DE0 X;  4CC3 A;  2KEA A;  2HEQ A;  2FO0 A;  2LJ3 A;  2GBQ A;  2L0A A;  5IXB A;  2ROL A;  2DJQ A;  4J9B A;  4K11 A;  1UGV A;  2AK5 A;  1CSK A;  2JXB A;  3R6N A;  4GBQ A;  4M4Z A;  2K2M A;  3M0U A;  2CDT A;  2KE9 A;  2EW3 A;  1ZUY A;  2L3P A;  4D8D A;  4Z8A A;  1AOJ A;  2JT4 A;  4AFS C;  1A0N B;  2CSQ A;  4RTX A;  1AWJ A;  2W0Z A;  4HVU A;  1PKS A;  1KSW A;  1Y57 A;  1FYN A;  1TG0 A;  4ORZ A;  1OPL A;  2YUN A;  2EQI A;  1M30 A;  1X27 A;  1NYF A;  4FSS A;  4JZ4 A;  3H0H A;  2FPF A;  1NEB A;  2KNB B;  1JXM A;  1AWO A;  4RTT A;  2DA9 A;  3C0C A;  1NLP C;  1SRL A;  1B3Q A;  2F2W A;  2RMO A;  2O2O A;  2VWF A;  2O31 A;  3VS2 A;  2AZV A;  1LCK A;  2OAW A;  2FEI A;  2RQR A;  2DBK A;  2KT8 A;  2F2X A;  2RNA A;  4OMM A;  1W1F A;  1AD5 A;  2JW4 A;  1PKT A;  2EYY A;  2ENM A;  2J6K A;  2DMO A;  4OMO A;  1GRI A;  3H0I A;  2K7A A;  3EG3 A;  2DL4 A;  2RQU A;  2RPN A;  2V1Q A;  3A98 A;  2EYZ A;  2RQV A;  1FMK A;  4A63 B;  5L23 A;  2VKN A;  3H0F A;  2JM9 A;  1Z9Q A;  2EGC A;  1BB9 A;  1RLP C;  3QWX X;  3QWY A;  2L2P A;  4OMP A;  2OI3 A;  4CC2 A;  1I07 A;  1ZSG A;  1JQQ A;  1I0C A;  2BZ8 A;  2HSP A;  1MUZ A;  3M0T A;  4HXJ A;  4F16 A;  2DF6 A;  1QLY A;  2DYB A;  1ABO A;  1IO6 A;  4JJD A;  2C0O A;  2PNI A;  1UG1 A;  1HSQ A;  1H3H A;  2MOX A;  3REB B;  2JMA A;  1NYG A;  1UEC A;  2GQI A;  1M3C A;  3TSW A;  2CH4 W;  2BZY A;  2KRM A;  3NHN A;  2NUZ A;  1GCQ C;  2JS2 A;  3EHR A;  1BU1 A;  2B86 A;  4AG2 C;  1WDX A;  3U23 A;  4J9G A;  2H8H A;  2ECZ A;  4AFQ C;  1G83 A;  1YN8 A;  2MCN A;  1K76 A;  2YUQ A;  2SRC A;  1H8K A;  1WYX A;  1XOV A;  2K9G A;  1OEB A;  1UHF A;  1ZUU A;  1I1J A;  3EGU A;  2W10 A;  4IIM A;  5FWB A;  4LUD A;  3RNJ A;  1KJW A;  1Z9Z A;  2D0N A;  2CT4 A;  4RTW A;  1B07 A;  1K1Z A;  2A08 A;  2KRS A;  3M0Q A;  1WX6 A;  1QCF A;  4JJB A;  5IHN A;  2CSI A;  2EGE A;  2G6F X;  2HBW A;  3VS5 A;  1WXU A;  2C0T A;  4HCK A;  1GBQ A;  2JM8 A;  2KXD A;  4WCI A;  1AWW A;  2F2V A;  4QT7 A;  2E5K A;  1T3S A;  3EHQ A;  1UE9 A;  3ZL7 C;  2GTO A;  1T0J A;  4AFU C;  1ARK A;  2JTE A;  1RUW A;  2CRE A;  2HCK A;  3UA6 A;  2CT3 A;  1SPK A;  3JV3 A;  2J05 A;  3ULR B;  4X1V A;  3VS1 A;  4OMN A;  2A28 A;  1TUD A;  3UF4 A;  1SSH A;  2NWM A;  3VS3 A;  1M8M A;  2AZS A;  3VS0 A;  3PVL A;  2LCS A;  4J9H A;  1M3B A;  1JU5 C;  2J7I A;  2LQN A;  1CKB A;  2GNC A;  3VS4 A;  5HCK A;  3PVQ A;  2DM1 A;  1SHG A;  2KRO A;  3I9Q A;  3NMZ C;  4E6R A;  1X2Q A;  2A36 A;  4Y92 A;  1UUE A;  1K0X A;  1UJ0 A;  2YUP A;  2FRW A;  1AEY A;  1V1C A;  2CH4 A;  1OV3 A;  1M3A A;  3TSZ A;  2O88 A;  2FPD A;  2C0I A;  5I11 A;  2RF0 A;  2J6F A;  4DEY A;  1AWX A;  3I5R A;  3I35 A;  5FW9 A;  1AVZ C;  3PE0 A;  1U3O A;  3KFV A;  1YP5 A;  1VA7 A;  1RLQ C;  2XMF A;  2P4R A;  2EKH A;  4LE9 A;  1E6G A;  1PHT A;  1JO8 A;  2ED1 A;  4GLM A;  4EIK A;  2IIM A;  2CUB A;  1NM7 A;  2BZX A;  2LP5 A;  3TVT A;  2LQW A;  2LNH B;  2VVK A;  1ZLM A;  3EG2 A;  3M0P A;  5GJW B;  1Y0M A;  2MIO A;  1NLO C;  1M27 C;  2KR3 A;  4RTV A;  4DEX A;  2ABL A;  1NEG A;  2GGR A;  1T3L A;  2RQW A;  1X2K A;  4F14 A;  2KXC A;  2K6D A;  2M51 A;  2EGA A;  3O5Z A;  2I0N A;  2CUD A;  2YUO A;  5FWC A;  2M0Y A;  1K4U S;  3NGP A;  4ESR A;  1GBR A;  1BK2 A;  2EPD A;  1YNZ A;  5IHI A;  4OMQ A;  4HVW A;  5IH2 A;  1PWT A;  3M0R A;  5IHK A;  4JJC A;  2QDL A;  4J9D A;  2GTJ A;  1E6H A;  3GBQ A;  4LNP A;  1WXT A;  4RTU A;  1UFF A;  1YWP A;  1U5S A;  1W6X A;  4J9E A;  4JPB W;  2RQT A;  2BTT A;  3FJ5 A;  2AKK A;  1VYU A;  5IXF A;  1X6B A;  2HDA A;  2FRY A;  2PTK A;  3UA7 A;  1OPK A;  1PRM C;  1X43 A;  2JS0 A;  2DRK A;  3NPF A;  2L3Q A;  2O9V A;  1EFN A;  3SEM A;  3H41 A;  4LN2 A;  1WFW A;  3IQL A;  2DVJ A;  1JEG A;  2KRN A;  2EBP A;  2D1X A;  4RUG A;  2ED0 A;  2O9S A;  2YT6 A;  2D8J A;  2KYB A;  1RI9 A;  4RTZ A;  1X6G A;  3VS7 A;  1W70 A;  1GCP A;  1X69 A;  2ESW A;  1TUC A;  1UTI A;  1ABQ A;  2A37 A;  1E7O A;  2EYX A;  2DL5 A;  2FPE A;  2L3S A;  1S1N A;  1H92 A;  2J6O A;  1UDL A;  5EC7 A;  4AFZ C;  2DL8 A;  1UHC A;  1CKA A;  2DNU A;  2V1R A;  2YDL A;  2J06 A;  2ROT A;  3REA B;  2EYW A;  2LZ6 B;  1T0H A;  2RN8 A;  4IIO A;  1GFC A;  4Z88 A;  1SEM A;  3VS6 A;  4R0K A;  1HJD A;  1SHF A;  1WLP B;  2DLP A;  2OJ2 A;  2KT1 A;  4J9F A;  5I22 A;  1MV0 B;  2X3W D;  1QWE A; 
#chains in the Genus database with same CATH topology
 4C92 A;  4RTY A;  3A5Z B;  1UJY A;  1Q95 G;  2R57 A;  3VYH B;  4M7A G;  2G3R A;  4RMO A;  2PZ1 A;  3THK A;  4FT2 A;  4M77 F;  2KYM A;  4D8K A;  3CCJ T;  1K73 U;  1WXB A;  4WTO B;  2BIV A;  2DRM A;  4PL6 A;  1I4K 1;  3FEO A;  2LJ0 A;  1AZE A;  1VQK T;  3VRZ A;  1QKW A;  3M0S A;  4C92 G;  1KQS A;  4ZNX A;  2OTL A;  3QUI A;  1IGQ A;  3RBB B;  3GLX A;  6AT1 B;  1JXO A;  3SDZ A;  4FYW B;  2Z0W A;  4LDU A;  4A4G A;  5LJ5 j;  3A8O B;  2DIL A;  2AIR B;  4M78 F;  2K2V A;  3VUZ A;  4E7L A;  1W2B A;  1VQK A;  1N5Z A;  4DQ2 A;  4DBR A;  4M75 G;  4KRT A;  4HVV A;  1HD3 A;  4FYX B;  1Q81 R;  1LPL A;  3L2R A;  2YSQ A;  2GFU A;  1K9A A;  3BW1 A;  2NUT A;  1QKX A;  1ZBJ A;  1K0S A;  2DE0 X;  2HEQ A;  2FO0 A;  4LDY A;  4J9B A;  4K11 A;  1UGV A;  4QQ6 A;  5FU6 C;  4BUG A;  2LCL A;  5HK0 A;  3I56 Q;  2XD0 A;  2PVD B;  3QG1 A;  1ACM B;  2X35 A;  4D8D A;  1RAE B;  1AOJ A;  4AFS C;  3G71 T;  1AWJ A;  2W0Z A;  4EMG A;  1W2B P;  1C6V X;  1JJ2 P;  5C6S A;  1KSW A;  2MYS A;  3DKM A;  4BY6 B;  1FYN A;  4X9C A;  1OPL A;  5L8R E;  2LRQ A;  2XK0 A;  4N0A C;  3QDR B;  1Y7X A;  1C0M A;  4FSS A;  3CCL A;  1NEB A;  1JXM A;  1H64 1;  3ZBD A;  4PJO D;  3OW2 S;  2QEX T;  2KDS A;  4J6W A;  2DA9 A;  4KGX B;  4PJO G;  1R77 A;  1SRL A;  4M75 D;  5GAO r;  4O5V A;  2LC4 A;  2QTV A;  3CC2 A;  2OAW A;  2RQR A;  1TXQ A;  2F2X A;  2X4X A;  1PG5 B;  2F5K A;  3KBG A;  1WQW A;  3HFO A;  2EAY A;  4HCZ A;  2DMO A;  2QGG A;  3H0I A;  1SKU B;  1EIF A;  3EG3 A;  2DYI A;  2DL4 A;  3A98 A;  3JB9 D;  1FMK A;  3M53 A;  4A63 B;  1X75 C;  2VKN A;  3JCM P;  3CXC P;  1VQO T;  3A8H B;  3I55 Q;  5CKF A;  4CC2 A;  1ZSG A;  2BZ8 A;  2HSP A;  3X20 B;  3OYK A;  3PTA A;  1PM3 A;  3FB9 A;  3M0T A;  4EMK B;  4F16 A;  2DF6 A;  1RAD B;  2XKO C;  2E3I A;  1IO6 A;  4HKE A;  3QXE B;  3E19 A;  3REB B;  3E9F A;  1U1T A;  5LJ3 d;  3TU4 K;  4R56 A;  1UEC A;  2GQI A;  1YHQ T;  2EIF A;  1FXX A;  3NHN A;  5KYY A;  1GCQ C;  3L1A A;  4EMK A;  3CCE Q;  1BU1 A;  5LJ3 g;  1WDX A;  3CCR Q;  4C92 D;  3FLG A;  2ZAE A;  3U23 A;  4J9G A;  1WHL A;  2H8H A;  5HKC A;  4MDW A;  2Y90 A;  2GQV A;  2QA4 A;  4AFQ C;  1WYX A;  1UHF A;  5GAM j;  1I1J A;  1S72 Q;  1WZO A;  4IIM A;  1I8F A;  3JCM h;  2DEU A;  3CD6 Q;  2A08 A;  2JN0 A;  4BDZ A;  2RO0 A;  2PUO B;  2HBW A;  1MMA A;  2JUF A;  2ZPF B;  2KXD A;  5FU6 B;  3X26 B;  2F2V A;  1KHI A;  2RJC A;  3ME9 A;  1UE9 A;  2RHX A;  4BDY A;  2CRE A;  4J5Y A;  3CMA A;  4FSX A;  3DLL A;  2J05 A;  2HKQ B;  1WJQ A;  2BE9 B;  2A28 A;  3UF4 A;  1X01 A;  2YRD A;  3G71 Q;  5GAN 4;  3PVL A;  2LCS A;  4J9H A;  1Q81 U;  3JAM E;  4JDS A;  1RAB B;  1UB4 A;  1CKB A;  1VQ9 T;  3PVQ A;  2DM1 A;  3WVD B;  1W2B S;  1VQ7 T;  3CME A;  4Y92 A;  1UUE A;  5IN1 A;  2FRW A;  3CCM Q;  4PFZ A;  1G3T A;  1OV3 A;  1V29 B;  2FPD A;  1BI0 A;  1VOM A;  2E12 A;  2LQK A;  4HA8 A;  2C0I A;  2EQU A;  1TUG B;  2JTF A;  3CCV Q;  3OW2 P;  5I11 A;  2CZ6 B;  2OTL T;  2NUT B;  2RF0 A;  1YIJ A;  1VQ5 Q;  4FYV B;  1NJI C;  5CKD A;  3I35 A;  4E7Z A;  1AVZ C;  3KFV A;  1VQP T;  1VIF A;  1VA7 A;  1Q81 C;  1RLQ C;  1JB0 E;  2JTM A;  1NPR A;  4M7D C;  3G4S T;  2XDD A;  3OYE A;  3VV0 A;  4M75 A;  4OB2 B;  1JO8 A;  4GLM A;  4UC4 A;  4M77 B;  2CUB A;  1NM7 A;  3RMS A;  3M0P A;  4MML A;  5GJW B;  1NLO C;  5C0M A;  7AT1 B;  2DO3 A;  1NEG A;  2M51 A;  2EGA A;  2YUO A;  4AMC A;  2M0Y A;  4ESR A;  5J26 A;  4BI8 B;  2EPD A;  1TTH B;  4E7H A;  3LGF A;  3TRE A;  1PWT A;  3EFR A;  2PU9 B;  2R5A A;  4M7A A;  3QZ9 B;  2EJG A;  2GTJ A;  3GBQ A;  2O4X B;  2QYZ A;  4M78 B;  1Q7Y R;  2DTI A;  3MCA B;  4C92 B;  1U5S A;  3OYJ A;  4DBH A;  1W6X A;  4J9E A;  2QQ9 A;  3PIP A;  3SB2 A;  5HY6 A;  2AKK A;  2DTH A;  2E5Q A;  3RKX A;  1NJI U;  2ZZD A;  2HDA A;  4FW1 A;  4C0D B;  2PTK A;  3UA7 A;  1BKB A;  3LWH A;  3CCL Q;  5D7U A;  2DRK A;  3JB9 F;  5A0L A;  1QP2 A;  1QMC A;  3JCM W;  2VB6 A;  4E7J A;  1VQ7 A;  1K73 R;  5IAY A;  1M90 C;  4JLI A;  4RUG A;  2O9S A;  2YT6 A;  1VQO Q;  2H3E B;  1X6G A;  3VS7 A;  1W70 A;  4NOY A;  5KYX A;  2A7Y A;  1YBY A;  5CR2 A;  2M9U A;  2FPE A;  3R6O A;  3V8J A;  2M1H A;  3OMC A;  5KE3 A;  1UDL A;  5KYU B;  2DL8 A;  2KMT A;  5A0D A;  4B6M A;  1YIJ Q;  1VQM A;  4C8Q G;  1VQN A;  4IIO A;  4Z88 A;  3CCV A;  1SEM A;  2DLP A;  1G8X A;  1VQ9 A;  4HT8 A;  2OJ2 A;  1I81 A;  3TQ7 P;  2X4Y A;  3QYG B;  3NFC A;  3QII A;  4J9F A;  2XI9 A;  4J83 A;  4BY6 C;  3OS5 A;  1PRL C;  1VQ4 T;  1H3Z A;  1OOT A;  4XTV A;  3S6W A;  1RAF B;  2IG0 A;  4XU2 A;  1WA7 A;  1C1A A;  2OTL Q;  1YI2 A;  2DBM A;  1SRM A;  2CP2 A;  3JCM J;  3OY9 A;  2DX1 A;  4C92 F;  3EG1 A;  3WVE B;  2E1H A;  3G6E Q;  2LJ1 A;  4LDW A;  3JCM f;  1OU8 A;  4LUE A;  4AG1 C;  1WJS A;  1BBZ A;  1ZUK A;  1SG5 A;  2K5F A;  2YWW A;  3PMT A;  2VXE A;  4M7A C;  4PJO C;  3CCU T;  1QVF S;  3D7S B;  1WIE A;  4JRI A;  2XG8 D;  4OGC A;  3CCU Q;  3Q1J A;  5GAN h;  3M56 A;  2R58 A;  2X4J A;  2X51 A;  4DOV A;  2KBT A;  1SF9 A;  4F17 A;  3URG A;  1JRI A;  2RB6 A;  1MMD A;  1YCS B;  5CAI A;  5FRM A;  4F7U F;  4N4I A;  4XQ3 A;  2EQM A;  1NE8 A;  3VRY A;  4LDX A;  1KFZ A;  5HK3 A;  3OYB A;  2DZ9 A;  1D09 B;  2K3B A;  3LH5 A;  3P8D A;  2JMC A;  4JRQ A;  2IPO B;  3FRN A;  1GL5 A;  2NLU A;  3V7S A;  2QA4 Q;  1G2B A;  4CRI A;  4FT4 A;  4MMK A;  1ZQ1 A;  4KT0 E;  2GBQ A;  2OTJ Q;  1RAC B;  4YTL A;  2AK5 A;  3DB4 A;  3WXM B;  3R6N A;  8AT1 B;  3GNG A;  2QEX Q;  1WHG A;  3N5B B;  4GBQ A;  3CMA T;  1G3S A;  1QVG S;  3OBW A;  8ATC B;  4OB0 B;  4E7S A;  2K2M A;  2CDT A;  2RHU A;  2EW3 A;  3E2U A;  1VQO A;  3RDV A;  2L3P A;  1YJ9 Q;  2JT4 A;  3EH2 A;  1PKS A;  2XID A;  3BFM A;  1TG0 A;  2YUN A;  3JCM d;  3F70 A;  1BI3 A;  2EQI A;  3H0H A;  2FPF A;  3FC3 A;  2KNB B;  2COW A;  3JB9 I;  4A4E A;  5KYU A;  1NLP C;  2QXF A;  1U8R A;  1B3Q A;  4IKF A;  3GF5 A;  2O31 A;  4BB7 A;  2VV5 A;  1LCK A;  4EMK C;  3X24 B;  4PJJ A;  2F1L A;  3UT1 A;  2P84 A;  2KT8 A;  5CCA A;  3VUB A;  2EJF A;  3ZFJ A;  2HAX A;  4PFO A;  2M02 A;  2J6K A;  4KH0 B;  1AT1 B;  2JVV A;  4GY5 A;  1GRI A;  1FMV A;  5LJ5 f;  2RPN A;  2CGH A;  4Z02 A;  1MND A;  2XU8 A;  2KY9 A;  3BDU A;  2EYZ A;  2DER A;  3H0F A;  3CC4 A;  1K9M R;  3P8B B;  3G6E A;  1N6A A;  1RLP C;  1K8A R;  1PSE A;  3DLM A;  2WSC E;  1UEB A;  1M4Z A;  3L2Q A;  1JQQ A;  1I0C A;  3VJP A;  3S3O A;  1XTD A;  1BCM A;  2KQW A;  4IUV A;  3CD6 T;  1YJ9 T;  1VQ8 T;  1QLY A;  3VU3 C;  2EFI A;  1UG1 A;  2DJZ A;  3QHS A;  3OS0 A;  1HSQ A;  4JJN K;  4JS4 A;  1YHQ A;  5CKH A;  2MF2 A;  1Y96 B;  3KUF A;  2JMA A;  4M7A B;  2HBP A;  1VQP Q;  3TSW A;  3MEU A;  1K9M U;  3EAE A;  2NUZ A;  2Y4Y A;  4XTY A;  1DJ7 B;  4AG2 C;  1Q86 C;  2KSS A;  1PC0 A;  3I55 T;  3ZEH A;  2ECZ A;  2VYT A;  2ZGW A;  5CO7 A;  2P0P A;  5GAN 7;  2D9T A;  2SRC A;  1H8K A;  3HTR A;  1OEB A;  1ZUU A;  3OYI A;  5KYW B;  4C8Q C;  1VQ6 T;  2W10 A;  4QW2 A;  4NL3 A;  4Y91 A;  3INZ A;  1KJW A;  2D0N A;  2CT4 A;  2LDM A;  5KCO A;  1HXD A;  4ANJ A;  2EQJ A;  5FLX E;  4JJB A;  3MHX A;  3JCM Q;  2L8D A;  2G6F X;  3HL8 A;  2ZPH B;  3LX7 A;  2DXB A;  3LWI A;  1VQ6 A;  4BAC A;  2JM8 A;  3CC7 Q;  2F69 A;  4J7F A;  4L59 A;  2E5K A;  2RH2 A;  1M1G A;  2A3L A;  2QQA A;  4RG2 A;  1KHC A;  4AFU C;  2JTE A;  1RUW A;  3G4S A;  1Q7Y C;  2PVO B;  3UA6 A;  4RCB A;  1KQS S;  4KUI A;  4XU0 A;  1VQ4 A;  4X1V A;  3VS1 A;  4OMN A;  2FL7 A;  3MEA A;  4OB3 B;  1KQ2 A;  2VC8 A;  1M8M A;  1QVG P;  2RJD A;  2HQX A;  4CI0 C;  2LQN A;  4P5N A;  3G6E T;  3HKS A;  4KUD K;  5GAM e;  5HCK A;  2FB7 A;  4J8O A;  2YLB A;  2HQE A;  1N8R U;  1X2Q A;  1YJW T;  2A36 A;  3JB9 J;  4PJO B;  1UJ0 A;  2PQW A;  3CCU A;  1WQ7 A;  1KC8 R;  5DLQ E;  1YJW Q;  1M3A A;  4DBF A;  2HZY A;  1JJ2 A;  2RM4 A;  3V8K A;  3MKD A;  3P8H A;  2GF7 A;  2HL5 C;  4DEY A;  1AWX A;  3QKJ A;  5LJ5 h;  2K57 A;  4M77 G;  4LDV A;  5FW9 A;  3UDC A;  5GMK j;  1U3O A;  4IUU A;  5DM7 R;  4XTW A;  3SFM A;  4KBM B;  1YP5 A;  2BE7 D;  2P4R A;  2QAZ A;  3A8G B;  5LJ3 e;  3CCR T;  5LJ3 j;  3LGL A;  5KH6 A;  3O8V A;  5LL6 S;  4C92 C;  4EIK A;  1G5V A;  3UWN A;  2IIM A;  1UGP B;  1M8V A;  2BZX A;  1VQ7 Q;  2ZPE B;  2LNH B;  3CC2 Q;  2QEX A;  1M27 C;  9ATC B;  2KR3 A;  1S72 T;  5LJ5 d;  2VGM A;  2GGR A;  4MZP A;  3CCS Q;  3I55 A;  5FWC A;  3OA6 A;  3NTH A;  3NGP A;  1ZA1 B;  3HRU A;  2E6N A;  4HVW A;  3OSV A;  1IHW A;  2MWP A;  5IHK A;  2DFU A;  3QO3 A;  1QP3 A;  4M75 B;  5KE2 A;  2E41 A;  5CQY A;  1UFF A;  2GCX A;  3C95 A;  1O9S A;  3L2Z A;  2BTT A;  3RUX A;  1Q86 R;  3EFS A;  3DB3 A;  1VYU A;  3CCJ A;  3C94 A;  2M0O A;  5IXF A;  1X6B A;  2PVG B;  1YIJ T;  1OPK A;  1Q82 U;  3OSS C;  2GFA A;  3PGG A;  3CC7 A;  2MI6 A;  3GNF B;  3NPF A;  3OYA A;  1ZA2 B;  1EFN A;  1Q7Y U;  3SEM A;  3H41 A;  2RHZ A;  4R55 A;  1YJN A;  1KC8 C;  1QQJ A;  3IQL A;  1ZSZ C;  1NZ9 A;  1VQP A;  1JEG A;  5GMK h;  1YIT T;  5KYX B;  2D8J A;  2KYB A;  1X69 A;  2D0Q B;  1TUC A;  1UTI A;  3CCV T;  4EDU A;  2EYX A;  2DL5 A;  2L3S A;  1H92 A;  4N4H A;  5EC7 A;  5DLO A;  4MZM A;  4AFZ C;  5D6Y A;  1VIE A;  1VQ8 Q;  1UHC A;  2V1R A;  2YDL A;  1TWB A;  4HCC A;  2M16 A;  3FIF A;  2LZ6 B;  4A4K A;  5FRO A;  1G3Y A;  3VS6 A;  4IUR A;  4R0K A;  5GAM g;  1HJD A;  1UGS B;  2R5M A;  2YRC A;  2HMA A;  3S3M A;  4LXC A;  4FM4 B;  1TU0 B;  1MV0 B;  1PD0 A;  1M1K R;  2X3W D;  3S3N A;  2OAU A;  1NG2 A;  3EG0 A;  3OYC A;  4E7I A;  1KIK A;  4Z89 A;  2HSE B;  1QWF A;  1WI7 A;  1BIB A;  2D8H A;  5A2Q E;  3T9N A;  1GCQ A;  2CP3 A;  4M78 D;  4LD9 K;  4M75 F;  2QG9 B;  2ZPB B;  1MV3 A;  2O01 E;  4PK4 A;  3QPH A;  2AKL A;  2SEM A;  1U06 A;  2L3R A;  2LMJ A;  3CC4 Q;  4JZ3 A;  1N9R A;  4JUV A;  1M1K U;  3FJP A;  3KXT A;  1J3T A;  4FYY B;  3FDR A;  4J9C A;  1MNE A;  4NL2 A;  1ZX6 A;  3PT9 A;  2PUK B;  2EKO A;  1PNJ A;  4DOW A;  1KC8 U;  3L2W A;  2LX7 A;  2FHD A;  3HHT B;  2DL7 A;  4M7D B;  4CC7 A;  3J80 E;  3M57 A;  2ZPI B;  1YJN T;  2KAF A;  3JCM V;  1KD1 C;  2CZ7 B;  5ECA A;  4FU6 A;  2EVR A;  1VYT A;  4PLI A;  2K79 A;  1K9M C;  2KEA A;  1N9S A;  2LJ3 A;  4XTX A;  5IXB A;  2RI3 A;  1TOV A;  1CSK A;  2DZC A;  1W4S A;  3I56 A;  4PFP A;  4M4Z A;  3CPW S;  3EGX B;  2HKN A;  1ZUY A;  4EMH A;  3CCQ A;  4X9D A;  2V26 A;  2CSQ A;  4RTX A;  1M90 U;  2NUP A;  3MET A;  4O6J A;  4FIB A;  1Y57 A;  4ORZ A;  2BKD N;  3PIO A;  2RJE A;  1M30 A;  1MMN A;  1X27 A;  3CCE T;  3MJX A;  3UPU A;  4RCC A;  4QVD A;  4RTT A;  3C0C A;  2DXT A;  1D1B A;  3PNW C;  2O2O A;  1FWZ A;  3EG9 A;  3VS2 A;  2AZV A;  2LTO A;  3OS1 A;  2DBK A;  2CYZ B;  4QQG A;  4M75 C;  1M9S A;  4EPC A;  2JW4 A;  2XDP A;  1PKT A;  1OZ3 A;  2EYY A;  3QYH B;  2DVE A;  4JLG A;  1MHN A;  4OMO A;  2AT1 B;  5LJ5 g;  2K7A A;  1YJN Q;  1S72 A;  2MWO A;  3CPF A;  4PJM A;  2CZ1 B;  2RQV A;  3VYG A;  1Z9Q A;  1BB9 A;  3QWX X;  3RKW A;  3QWY A;  3QJY A;  2L2P A;  4OMP A;  2OI3 A;  1I07 A;  3CCR A;  5GAN 8;  2DTO A;  4HXJ A;  3RER A;  2NYS A;  2QTX A;  3M59 A;  1ABO A;  4ME7 A;  4QQD A;  2C0O A;  3AT1 B;  4JJD A;  4F7U A;  4Y28 E;  5CK9 A;  4A53 A;  1H3H A;  1M2O A;  1YCY A;  4M7D A;  2MOX A;  5GAM f;  3G7Z A;  1M3C A;  1R0B G;  2CZ0 B;  2K3X A;  3HRS A;  2CH4 W;  4DBQ A;  1BI1 A;  2KRM A;  3JCM c;  1VQ9 Q;  2JS2 A;  2QGF B;  1K8A U;  2CP6 A;  4PJN A;  3HP9 A;  4BD3 A;  1K73 C;  2LT4 A;  2KI7 A;  3CCS A;  2RK1 A;  1YN8 A;  4M7A E;  1XOV A;  2K9G A;  3EGU A;  3OQ5 A;  2K4Y A;  1QVG A;  5FWB A;  4BE2 A;  3RNJ A;  4RTW A;  1K1Z A;  1N27 A;  3M0Q A;  1UGR B;  1WX6 A;  3M55 A;  1WHK A;  1QCN A;  1QCF A;  5GMK i;  2BUD A;  2EGE A;  2CKK A;  5IT9 E;  2AHJ B;  3VS5 A;  2E3H A;  1WXU A;  4HCK A;  4WCI A;  1HYO A;  3OBY A;  1OYX A;  1ZSZ B;  3M9Q A;  4OP0 A;  1OUL A;  4QT7 A;  2QAS A;  1T0J A;  2WSE E;  2YXY A;  1ARK A;  4OVA A;  2P4T A;  4PNO A;  1BYM A;  3TEE A;  3JV3 A;  3ULR B;  4HT9 A;  4E2F B;  3HSB A;  1HK9 A;  4Q5W A;  1YJW A;  2NWM A;  3VS3 A;  1TS9 A;  1LVK A;  1VQ6 Q;  3CPW P;  1M3B A;  3CCJ Q;  3X25 B;  5GAN d;  4ZN1 A;  3CC4 T;  3BY7 A;  2GNC A;  2LNV A;  4TVR A;  1SHG A;  2KRO A;  3EGX A;  1NBE B;  4M77 E;  2VUB A;  1K0X A;  3OYH A;  2YUP A;  4C8Q B;  1D3B B;  2E6Z A;  1GXI E;  5GAN 5;  3CBM A;  1AEY A;  2DKG A;  4A4H A;  3MP1 A;  3TSZ A;  1VQ4 Q;  2XDB A;  3CMA Q;  1OQK A;  1D1C A;  4C5G A;  3MPU B;  4IUP A;  1Y07 A;  1NJI R;  2RD1 A;  4QKU A;  1KD1 U;  3PE0 A;  1QVF P;  5LJ5 e;  2EJ9 A;  1B7T A;  2VXF A;  3CCQ Q;  2YHT A;  3QSU A;  3CME Q;  4A4F A;  2XMF A;  4BE1 A;  2EKH A;  2JJ9 A;  5GMK m;  4M78 E;  2HQH A;  5I21 A;  1E6G A;  1PHT A;  2ED1 A;  3HPW A;  4RKU E;  2P0Q A;  2LP5 A;  3G71 A;  4M7D D;  2LQW A;  1RAH B;  5KYW A;  1OX9 A;  2VVK A;  4M7A F;  5GAN 6;  1VQL Q;  1AHJ B;  4DEX A;  2ABL A;  3JCM b;  5GAN g;  3EH1 A;  1T3L A;  1X2K A;  4VUB A;  4C0Z A;  2K6D A;  2KXC A;  4F14 A;  3C12 A;  5GAM h;  3O5Z A;  3GOX A;  2CUD A;  3OMG A;  1QVF A;  2HNI A;  2C06 A;  1BK2 A;  1YNZ A;  4M7D F;  4F7U G;  5IH2 A;  1M90 R;  2LVM A;  4JJC A;  2QDL A;  4J9D A;  3CCM A;  1E6H A;  2K3Y A;  3BDL A;  1WXT A;  3RIR A;  2XHC A;  1YWP A;  2P0K A;  1OX8 A;  2RQT A;  4MZT A;  3FJ5 A;  1IXD A;  5EG2 A;  4C5I A;  3JB9 G;  3RR6 A;  2ATC B;  1WPY A;  3CBP A;  2FRY A;  1RI0 A;  5A0G A;  4C8Q F;  3CCQ T;  2E70 A;  1PRM C;  2LX9 A;  2E64 A;  4KUL A;  2JS0 A;  1B34 A;  2O9V A;  3G4S Q;  3QDF A;  3OYM A;  3EFO A;  4LN2 A;  1WFW A;  1FMW A;  5CIU A;  3V7C A;  2DIG A;  4PJO A;  2VAS A;  3LYI A;  2CP0 A;  2I2L A;  3CBO A;  3M54 A;  3GP8 A;  2ED0 A;  3M5A A;  3MEW A;  4BI4 A;  3JB9 H;  1ZHI A;  1RI9 A;  5GAO q;  1U1S A;  1G3W A;  1GCP A;  3V7R A;  2ESW A;  1ABQ A;  2A37 A;  1E7O A;  3GPL A;  2J6O A;  1D0Z A;  1F1B B;  5M9O A;  4PJO F;  2ROT A;  3H9N A;  4QVZ A;  1IHV A;  5KCH A;  1T0H A;  3CXC A;  1WJR A;  4JRP A;  2K5L A;  1VQL A;  3M4G A;  3EGD A;  1TH7 A;  2QQS A;  1YIT Q;  4XTU A;  5I22 A;  2D6F A;  4M7D G;  1YJ9 A;  5CKB A;  1OI1 A;  3A1P A;  3QZ5 B;  1VYV A;  1M1F A;  5GAO l;  2DL3 A;  3JSC A;  1WHJ A;  1IGU A;  2DAQ A;  1AZG B;  4BI3 A;  4X34 A;  1VQ5 T;  2X3X D;  2OTJ A;  3QJ6 A;  3CQT A;  1IRX A;  2V8K A;  1VQN T;  4XAX B;  1VQ5 A;  4M7D E;  3I5S A;  4OML A;  1GFD A;  3E9G A;  5GJV B;  1UGQ B;  3H8Z A;  2FVU A;  2V8I A;  4XU3 A;  5GMK l;  5GMK e;  3RMQ A;  3SHW A;  1RAG B;  2YLC A;  4PLL A;  4L6V 5;  3OYD A;  4CC4 B;  2FG0 A;  3A8M B;  2WSF E;  4PJL A;  3AHU A;  5CKE A;  1EX4 A;  4NS5 A;  4J6X A;  4J9I A;  3UAT A;  2DET A;  4A54 A;  2A0F B;  4C8Q E;  3I56 T;  1YWO A;  2KGT A;  1I5O B;  2QQB A;  1KD1 R;  2DD4 A;  3MEV A;  1IRE B;  1XQH A;  2KVQ G;  2LCC A;  2WAC A;  1RL2 A;  1WHM A;  3X28 B;  4FL6 A;  4CC3 A;  1R8O B;  4M77 D;  1N8R R;  2L0A A;  1MGQ A;  3OYL A;  2ROL A;  3GIB A;  4XU1 A;  2QA4 T;  2DJQ A;  1MMG A;  1VQ8 A;  1VQK Q;  2X9H A;  2JXB A;  3CCE A;  2CS7 A;  3MO8 A;  3A8L B;  2FZK B;  2X4W A;  3M0U A;  2KE9 A;  4N4G A;  1IZ6 A;  4PJO E;  1LNX A;  4Z8A A;  1A0N B;  5AT1 B;  2RHI A;  4HVU A;  4E7K A;  1YI2 T;  1QCO A;  3JRZ A;  1O75 A;  1OU9 A;  2RA2 A;  1NPP A;  4D6W A;  1VQN Q;  1PCX A;  1KK7 A;  3PFS A;  4JZ4 A;  1NYF A;  4C0G A;  1VQM Q;  1AWO A;  3RKY A;  3PMI A;  2QK0 A;  3OYF A;  5LJ3 h;  5GAN e;  3J81 E;  2HD0 A;  4ZTF A;  3OB9 A;  2F2W A;  2RMO A;  1VQL T;  2VWF A;  4OB1 B;  4WF2 A;  3CPW A;  1M1K C;  4HCB A;  2FEI A;  1M5Q 1;  3LLR A;  4OMM A;  2RNA A;  1W1F A;  1BIA A;  4M78 C;  3ER0 A;  1AD5 A;  2E65 A;  5D6W A;  4AT1 B;  3L2U A;  4ELY C;  2F5T X;  1QW1 A;  2ENM A;  2MPX C;  1KG1 A;  4B9W A;  5J3B A;  3JCM g;  2RQU A;  3CC7 T;  2V1Q A;  2B8A A;  3BE3 A;  5L23 A;  3JCM X;  2OTJ T;  3SWN A;  2RI5 A;  2RK2 A;  2JM9 A;  3CEY A;  2LQ8 A;  2EGC A;  4OGE A;  5GAN f;  2FZC B;  2QDY B;  5LJ3 f;  1WHH A;  3RES A;  4L5G A;  1MUZ A;  2RJF A;  3OYG A;  4QVC A;  2DYB A;  4M78 A;  2O4X A;  2PNI A;  4MDX A;  2DXC A;  1YI2 Q;  1RAA B;  1Y96 A;  2HL3 A;  2JZ2 A;  5DY9 A;  3NTI A;  3OW2 A;  1Q82 R;  4M7A D;  1NYG A;  1WNL A;  2XIC A;  2JNG A;  4BE0 A;  1YIT A;  2BZY A;  4V2S A;  4OMF B;  3EHR A;  2B86 A;  2ZCF B;  4E47 A;  2YRV A;  4C0D C;  1PD1 A;  4C8Q D;  4M75 E;  4FCY A;  4II1 A;  1G83 A;  2MCN A;  1K76 A;  4JRK A;  2YUQ A;  4ZTJ A;  3SWN B;  4LUD A;  3SD4 A;  4M77 A;  1Z9Z A;  2IVW A;  1B07 A;  2FZG B;  4J7I A;  2KRS A;  1LJO A;  1YHQ Q;  2DPP B;  4N0A A;  5GAO p;  5GAM d;  3E1S A;  2DK3 A;  5D6X A;  5IHN A;  2CSI A;  2E4H A;  2DXU A;  1LOJ A;  3ASK A;  1ZBX A;  1TSF A;  2K5I A;  2C0T A;  5GAN j;  1GBQ A;  1AWW A;  1D0X A;  4ZGJ B;  4ATO A;  3EGD B;  1T3S A;  3EHQ A;  3ZL7 C;  1D1A A;  2GTO A;  1BI2 A;  1M2V A;  2HCK A;  4RG8 A;  1KQ1 A;  1SPK A;  1M2V B;  2COY A;  1Y71 A;  2CT3 A;  1TUD A;  3OS2 A;  1SSH A;  1R0C B;  4JS5 A;  4ELZ C;  2L5Q A;  2AZS A;  4OF1 A;  3VS0 A;  4IUT A;  1JU5 C;  2J7I A;  2MAM A;  3VS4 A;  2V8J A;  1RAI B;  2EYQ A;  2RHY A;  3I9Q A;  3NMZ C;  2QQR A;  4C92 E;  4E6R A;  4F04 B;  5FU7 B;  5GAO m;  3SWN C;  3MP6 A;  4KGZ B;  1I5L A;  3OYN A;  1V1C A;  2CH4 A;  4XK8 E;  2O88 A;  1B34 B;  5I2M A;  2FYK A;  2J6F A;  4ZGE B;  3I5R A;  4B9X A;  1D0Y A;  3C4S A;  4IUQ A;  3MP8 A;  4F7U E;  4LE9 A;  3CCM T;  3H6Z A;  5I2S A;  4PKC C;  3CC2 T;  2MK5 A;  1EZZ B;  4J6Y A;  3LH0 A;  1Q82 C;  3TVT A;  2EQK A;  1ZLM A;  3EG2 A;  1Y0M A;  2MIO A;  4RTV A;  1OZ2 A;  2RQW A;  2L89 A;  3LW5 E;  2I0N A;  3OYY A;  1K4U S;  2E10 A;  2QI2 A;  5FRN A;  1GBR A;  2DD5 A;  5KYY B;  2COZ A;  5IHI A;  4OMQ A;  1QVP A;  4M78 G;  3NTK A;  1PSF A;  3M0R A;  3M58 A;  2CP5 A;  4F7U B;  4LNP A;  4RTU A;  4XTZ A;  3CD6 A;  4JPB W;  2LT1 A;  2H3J A;  4FW2 A;  4LD6 A;  1BCO A;  1P92 A;  3G1J A;  4GLK A;  2CP7 A;  1VUB A;  4C5E A;  5GAO n;  1XNI A;  2EWN A;  2OX7 A;  1XJW B;  2MMP A;  1JJ2 S;  4KH1 B;  1YFN A;  1X43 A;  3M4Y A;  3JCM e;  5FU7 C;  2L3Q A;  1X6O A;  1FX7 A;  3HRT A;  3TCJ A;  1D3B A;  4C8Q A;  5GAN 2;  2DVJ A;  1WGS A;  2KRN A;  5CQX A;  5J39 A;  2EBP A;  1SSF A;  4ZN3 A;  2D1X A;  2DIQ A;  3HFN A;  4RTZ A;  1JBM A;  2RI2 A;  5KYN A;  3J7A F;  2KK4 A;  3EG9 B;  3V8L A;  2DEQ A;  1K8A C;  3CCS T;  1S1N A;  2VGN A;  3VKI A;  4DA4 A;  3EFO B;  1CKA A;  2DNU A;  3CCL T;  2J06 A;  3REA B;  1KQS P;  2Y4X A;  2EYW A;  3CME T;  3QBY A;  2ZPG B;  5CVI A;  1V76 A;  2RN8 A;  1GFC A;  4C5H A;  5AYF A;  1SHF A;  4M77 C;  1WLP B;  2JOY A;  3L42 A;  4C0F A;  3CXC S;  2NUP B;  1N8R C;  1ZSZ A;  2KT1 A;  4KGV B;  1IB8 A;  3L2V A;  4ZGD B;  1Q86 U;  1QWE A;  1VQM T;  5GAN 3; 
#chains in the Genus database with same CATH homology
 1VYV A;  1NG2 A;  3EG0 A;  1PRL C;  2DL3 A;  4RTY A;  1OOT A;  1KIK A;  4Z89 A;  1UJY A;  1QWF A;  1WI7 A;  1WA7 A;  2D8H A;  1AZG B;  1GCQ A;  2DBM A;  2X3X D;  1SRM A;  2PZ1 A;  3THK A;  1MV3 A;  2DX1 A;  3CQT A;  2KYM A;  3EG1 A;  4D8K A;  2AKL A;  2LJ1 A;  2SEM A;  1U06 A;  2LMJ A;  3I5S A;  4AG1 C;  4LUE A;  4OML A;  1GFD A;  4JZ3 A;  1BBZ A;  5GJV B;  1ZUK A;  1WXB A;  2DRM A;  1J3T A;  2LJ0 A;  1AZE A;  4J9C A;  3VRZ A;  1QKW A;  3M0S A;  1WIE A;  1ZX6 A;  3SHW A;  1PNJ A;  4ZNX A;  4CC4 B;  2LX7 A;  2FG0 A;  2DL7 A;  4CC7 A;  3RBB B;  2KBT A;  1JXO A;  4F17 A;  4J9I A;  3UAT A;  1YCS B;  2DIL A;  1N5Z A;  1YWO A;  2KGT A;  3VRY A;  4KRT A;  1KFZ A;  4HVV A;  1HD3 A;  2K3B A;  3LH5 A;  2YSQ A;  5ECA A;  2JMC A;  1K9A A;  2EVR A;  1VYT A;  1GL5 A;  1G2B A;  1QKX A;  1ZBJ A;  2K79 A;  1K0S A;  2DE0 X;  4CC3 A;  2KEA A;  2HEQ A;  2FO0 A;  2LJ3 A;  2GBQ A;  2L0A A;  5IXB A;  2ROL A;  2DJQ A;  4J9B A;  4K11 A;  1UGV A;  2AK5 A;  1CSK A;  2JXB A;  3R6N A;  4GBQ A;  4M4Z A;  2K2M A;  3M0U A;  2CDT A;  2KE9 A;  2EW3 A;  1ZUY A;  2L3P A;  4D8D A;  4Z8A A;  1AOJ A;  2JT4 A;  4AFS C;  1A0N B;  2CSQ A;  4RTX A;  1AWJ A;  2W0Z A;  4HVU A;  1PKS A;  1KSW A;  1Y57 A;  1FYN A;  1TG0 A;  4ORZ A;  1OPL A;  2YUN A;  2EQI A;  1M30 A;  1X27 A;  1NYF A;  4FSS A;  4JZ4 A;  3H0H A;  2FPF A;  1NEB A;  2KNB B;  1JXM A;  1AWO A;  4RTT A;  2DA9 A;  3C0C A;  1NLP C;  1SRL A;  1B3Q A;  2F2W A;  2RMO A;  2O2O A;  2VWF A;  2O31 A;  3VS2 A;  2AZV A;  1LCK A;  2OAW A;  2FEI A;  2RQR A;  2DBK A;  2KT8 A;  2F2X A;  2RNA A;  4OMM A;  1W1F A;  1AD5 A;  2JW4 A;  1PKT A;  2EYY A;  2ENM A;  2J6K A;  2DMO A;  4OMO A;  1GRI A;  3H0I A;  2K7A A;  3EG3 A;  2DL4 A;  2RQU A;  2RPN A;  2V1Q A;  3A98 A;  2EYZ A;  2RQV A;  1FMK A;  4A63 B;  5L23 A;  2VKN A;  3H0F A;  2JM9 A;  1Z9Q A;  2EGC A;  1BB9 A;  1RLP C;  3QWX X;  3QWY A;  2L2P A;  4OMP A;  2OI3 A;  4CC2 A;  1I07 A;  1ZSG A;  1JQQ A;  1I0C A;  2BZ8 A;  2HSP A;  1MUZ A;  3M0T A;  4HXJ A;  4F16 A;  2DF6 A;  1QLY A;  2DYB A;  1ABO A;  1IO6 A;  4JJD A;  2C0O A;  2PNI A;  1UG1 A;  1HSQ A;  1H3H A;  2MOX A;  3REB B;  2JMA A;  1NYG A;  1UEC A;  2GQI A;  1M3C A;  3TSW A;  2CH4 W;  2BZY A;  2KRM A;  3NHN A;  2NUZ A;  1GCQ C;  2JS2 A;  3EHR A;  1BU1 A;  2B86 A;  4AG2 C;  1WDX A;  3U23 A;  4J9G A;  2H8H A;  2ECZ A;  4AFQ C;  1G83 A;  1YN8 A;  2MCN A;  1K76 A;  2YUQ A;  2SRC A;  1H8K A;  1WYX A;  1XOV A;  2K9G A;  1OEB A;  1UHF A;  1ZUU A;  1I1J A;  3EGU A;  2W10 A;  4IIM A;  5FWB A;  4LUD A;  3RNJ A;  1KJW A;  1Z9Z A;  2D0N A;  2CT4 A;  4RTW A;  1B07 A;  1K1Z A;  2A08 A;  2KRS A;  3M0Q A;  1WX6 A;  1QCF A;  4JJB A;  5IHN A;  2CSI A;  2EGE A;  2G6F X;  2HBW A;  3VS5 A;  1WXU A;  2C0T A;  4HCK A;  1GBQ A;  2JM8 A;  2KXD A;  4WCI A;  1AWW A;  2F2V A;  4QT7 A;  2E5K A;  1T3S A;  3EHQ A;  1UE9 A;  3ZL7 C;  2GTO A;  1T0J A;  4AFU C;  1ARK A;  2JTE A;  1RUW A;  2CRE A;  2HCK A;  3UA6 A;  2CT3 A;  1SPK A;  3JV3 A;  2J05 A;  3ULR B;  4X1V A;  3VS1 A;  4OMN A;  2A28 A;  1TUD A;  3UF4 A;  1SSH A;  2NWM A;  3VS3 A;  1M8M A;  2AZS A;  3VS0 A;  3PVL A;  2LCS A;  4J9H A;  1M3B A;  1JU5 C;  2J7I A;  2LQN A;  1CKB A;  2GNC A;  3VS4 A;  5HCK A;  3PVQ A;  2DM1 A;  1SHG A;  2KRO A;  3I9Q A;  3NMZ C;  4E6R A;  1X2Q A;  2A36 A;  4Y92 A;  1UUE A;  1K0X A;  1UJ0 A;  2YUP A;  2FRW A;  1AEY A;  1V1C A;  2CH4 A;  1OV3 A;  1M3A A;  3TSZ A;  2O88 A;  2FPD A;  2C0I A;  5I11 A;  2RF0 A;  2J6F A;  4DEY A;  1AWX A;  3I5R A;  3I35 A;  5FW9 A;  1AVZ C;  3PE0 A;  1U3O A;  3KFV A;  1YP5 A;  1VA7 A;  1RLQ C;  2XMF A;  2P4R A;  2EKH A;  4LE9 A;  1E6G A;  1PHT A;  1JO8 A;  2ED1 A;  4GLM A;  4EIK A;  2IIM A;  2CUB A;  1NM7 A;  2BZX A;  2LP5 A;  3TVT A;  2LQW A;  2LNH B;  2VVK A;  1ZLM A;  3EG2 A;  3M0P A;  5GJW B;  1Y0M A;  2MIO A;  1NLO C;  1M27 C;  2KR3 A;  4RTV A;  4DEX A;  2ABL A;  1NEG A;  2GGR A;  1T3L A;  2RQW A;  1X2K A;  4F14 A;  2KXC A;  2K6D A;  2M51 A;  2EGA A;  3O5Z A;  2I0N A;  2CUD A;  2YUO A;  5FWC A;  2M0Y A;  1K4U S;  3NGP A;  4ESR A;  1GBR A;  1BK2 A;  2EPD A;  1YNZ A;  5IHI A;  4OMQ A;  4HVW A;  5IH2 A;  1PWT A;  3M0R A;  5IHK A;  4JJC A;  2QDL A;  4J9D A;  2GTJ A;  1E6H A;  3GBQ A;  4LNP A;  1WXT A;  4RTU A;  1UFF A;  1YWP A;  1U5S A;  1W6X A;  4J9E A;  4JPB W;  2RQT A;  2BTT A;  3FJ5 A;  2AKK A;  1VYU A;  5IXF A;  1X6B A;  2HDA A;  2FRY A;  2PTK A;  3UA7 A;  1OPK A;  1PRM C;  1X43 A;  2JS0 A;  2DRK A;  3NPF A;  2L3Q A;  2O9V A;  1EFN A;  3SEM A;  3H41 A;  4LN2 A;  1WFW A;  3IQL A;  2DVJ A;  1JEG A;  2KRN A;  2EBP A;  2D1X A;  4RUG A;  2ED0 A;  2O9S A;  2YT6 A;  2D8J A;  2KYB A;  1RI9 A;  4RTZ A;  1X6G A;  3VS7 A;  1W70 A;  1GCP A;  1X69 A;  2ESW A;  1TUC A;  1UTI A;  1ABQ A;  2A37 A;  1E7O A;  2EYX A;  2DL5 A;  2FPE A;  2L3S A;  1S1N A;  1H92 A;  2J6O A;  1UDL A;  5EC7 A;  4AFZ C;  2DL8 A;  1UHC A;  1CKA A;  2DNU A;  2V1R A;  2YDL A;  2J06 A;  2ROT A;  3REA B;  2EYW A;  2LZ6 B;  1T0H A;  2RN8 A;  4IIO A;  1GFC A;  4Z88 A;  1SEM A;  3VS6 A;  4R0K A;  1HJD A;  1SHF A;  1WLP B;  2DLP A;  2OJ2 A;  2KT1 A;  4J9F A;  5I22 A;  1MV0 B;  2X3W D;  1QWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...