4CC2A

Complex of human tuba c-terminal sh3 domain with human n-wasp proline- rich peptide - p212121
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DYNAMIN-BINDING PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 12
structure length 63
sequence length 63
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc2A00
2LP5A 1VYUA 4RTTA 1E6HA 1M27C 2ENMA 2LX7A 4LN2A 3RBBB 2O9VA 3VS6A 1PKTA 2DF6A 2EBPA 1GCQA 2BZXA 1UJ0A 2JXBA 3H0IA 4OMNA 1GCQC 2DL3A 2DNUA 3I5RA 4DEXA 1T0HA 3CQTA 4J9CA 2EVRA 4CC2A 4RTXA 1U06A 2D1XA 2IIMA 3KFVA 3M0SA 4CC4B 4R0KA 2RQUA 1B07A 3VS5A 1SRMA 2BZ8A 3A98A 1NG2A 1TUCA 5FWCA 3EHQA 2DM1A 1WFWA 3REBB 4F17A 2DLPA 2FG0A 3VS3A 2DL5A 1VA7A 4J9FA 1CKAA 2J6FA 1ABOA 5FWBA 4RTWA 1H92A 1VYTA 1HSQA 4QT7A 1XOVA 3PVLA 3UA7A 1YP5A 2PNIA 1JQQA 3ZL7C 1B3QA 2KR3A 2LJ0A 4J9HA 2EGEA 1K0XA 3LH5A 1ABQA 2J7IA 1GCPA 1W70A 2B86A 2LCSA 1JXOA 1H3HA 2YDLA 2V1QA 1X69A 1HD3A 2SRCA 1VYVA 3H0HA 2OI3A 4HCKA 2DE0X 2FPFA 2CUBA 2GTJA 2GBQA 1YWPA 1AVZC 5I22A 3M0PA 2G6FX 2ESWA 2DYBA 5EC7A 2KYMA 2RPNA 1PWTA 1AD5A 1UFFA 1NEBA 1SSHA 2C0IA 1YWOA 3I9QA 2LMJA 5I11A 4Z88A 1YCSB 2X3XD 1X27A 1X6BA 2M0YA 4FSSA 2A36A 2RQTA 4X1VA 1G2BA 1KSWA 2GQIA 2LQNA 2EYYA 5IH2A 2VWFA 2KRSA 1WLPB 1UGVA 4RUGA 1M3CA 1X2QA 1T3LA 2O31A 2PTKA 2NUZA 1BBZA 3THKA 2CUDA 2EYZA 3PE0A 2EKHA 2EYWA 2D0NA 2RF0A 1WX6A 5IXFA 1WXBA 2DBKA 1QLYA 2KEAA 4JJBA 1ZBJA 1WIEA 1S1NA 1AZEA 2X3WD 4EIKA 1I1JA 2GNCA 1Y57A 2D8JA 1PHTA 1TUDA 4Y92A 3EG2A 1G83A 1MV0B 4HVUA 3H41A 2A08A 2JW4A 3NMZC 1J3TA 2HBWA 2BTTA 2K7AA 3UA6A 1QWFA 4GBQA 2DA9A 2JMCA 3NPFA 1QKWA 2CSQA 2W10A 2RQRA 2HCKA 1SEMA 2JM8A 2E5KA 2JTEA 2C0OA 5ECAA 3QWYA 1AWOA 1M30A 1EFNA 2AZVA 4CC7A 3EHRA 3M0RA 2ED0A 1RLQC 4J9DA 1UJYA 1X6GA 5FW9A 2CSIA 4ESRA 1X43A 2KGTA 1ZSGA 2CH4W 4HVVA 4J9EA 2FPEA 4F16A 2LNHB 1N5ZA 4OMMA 2QDLA 4JZ4A 1A0NB 2JM9A 1OV3A 1PKSA 2ED1A 1BK2A 1QKXA 1AWWA 4ZNXA 2JS0A 1HJDA 3RNJA 1NLPC 2H8HA 2LJ1A 2YT6A 2DMOA 2RN8A 2L3PA 2YUPA 1MV3A 1K1ZA 1Z9ZA 2KRMA 1NYFA 2HSPA 2L0AA 1GBRA 2FO0A 2JT4A 2DL8A 2K6DA 1LCKA 1AZGB 4JJCA 2DL7A 2DILA 2P4RA 2EW3A 1ZUUA 2FEIA 1UTIA 2DVJA 1U3OA 3VRYA 2EGAA 4D8DA 1YN8A 1K4US 1UDLA 4Z89A 2KBTA 3REAB 3M0UA 4OMPA 3EG0A 1KFZA 4LUEA 1JEGA 1AWJA 4JZ3A 2RQWA 1JO8A 4AFZC 1K9AA 2YUOA 2MCNA 4J9IA 1E6GA 1PRLC 1GL5A 1AOJA 2EYXA 3GBQA 1M8MA 5GJVB 4RTVA 1AEYA 3O5ZA 1U5SA 3UF4A 1SHGA 3EGUA 1I07A 2ROLA 2A37A 2L3SA 2CDTA 1WA7A 1ZX6A 1NEGA 2M51A 1W1FA 4HXJA 1W6XA 3U23A 4D8KA 2J05A 2L3QA 3VS1A 4ORZA 4JJDA 3VS0A 3NHNA 2SEMA 2BZYA 3C0CA 2ROTA 2VVKA 1CKBA 2DX1A 3ULRB 2CH4A 3TSWA 1I0CA 2EPDA 4OMLA 1ZLMA 5IXBA 2J6OA 4LE9A 4WCIA 1GFCA 4F14A 2JS2A 2V1RA 1OPLA 2D8HA 1UUEA 4JPBW 1V1CA 2YUQA 5GJWB 2YSQA 1MUZA 2FRYA 4AG2C 2O88A 1OOTA 1E7OA 2KE9A 1FYNA 3IQLA 1RI9A 2OAWA 4K11A 1K0SA 1UE9A 2NWMA 4RTYA 1NLOC 1WXUA 1ARKA 2KXCA 1CSKA 1UHCA 3I35A 2RNAA 2XMFA 3R6NA 1ZUKA 2A28A 1WXTA 5IHIA 3VRZA 2O2OA 2DJQA 2DBMA 1TG0A 3SHWA 1KIKA 2KROA 2F2XA 4AFQC 1NYGA 2J6KA 1OEBA 1JU5C 2OJ2A 4IIMA 2KYBA 4M4ZA 2DRKA 4AFUC 2F2WA 1BU1A 3VS2A 1GFDA 2C0TA 5IHNA 1FMKA 4AFSC 4OMQA 2DRMA 2MOXA 5L23A 2DL4A 4AG1C 2CT4A 2YUNA 2AKLA 3SEMA 4E6RA 1RLPC 2EQIA 2K2MA 3EG3A 2JMAA 2GGRA 4OMOA 1UECA 2W0ZA 1OPKA 1T3SA 1WYXA 1PRMC 3H0FA 4J9BA 2KT1A 1RUWA 1SHFA 1M3BA 1WDXA 1H8KA 1SPKA 1X2KA 1AWXA 1PNJA 2KXDA 1GBQA 1UHFA 2F2VA 1IO6A 1YNZA 1QCFA 3M0TA 1KJWA 2O9SA 2CT3A 2ABLA 3TSZA 2VKNA 3EG1A 4J9GA 1GRIA 2AKKA 2RMOA 2I0NA 4Z8AA 3UATA 2KNBB 4HVWA 2KRNA 4KRTA 4DEYA 5IHKA 1Y0MA 2MIOA 2LJ3A 2HDAA 3TVTA 2EGCA 2GTOA 4LNPA 3I5SA 3FJ5A 4A63B 2L2PA 1BB9A 3NGPA 2K79A 4RTUA 5HCKA 2J06A 4IIOA 2K3BA 3JV3A 1ZUYA 1WI7A 2CREA 2FRWA 2ECZA 1QWEA 2HEQA 2K9GA 3QWXX 4RTZA 2LQWA 1JXMA 2KT8A 1M3AA 3VS4A 2LZ6B 4LUDA 3M0QA 1T0JA 4CC3A 3VS7A 1Z9QA 2RQVA 4GLMA 1K76A 3PVQA 2AK5A 1NM7A 2FPDA 2AZSA 1SRLA 1UG1A 2PZ1A
chains in the Genus database with same CATH superfamily
1VYUA 1JRIA 1M27C 3PTAA 1O9SA 2LX7A 3A8OB 1PKTA 4XK8E 3MPUB 3BDUA 1VQKT 2PVGB 5GAOq 3V7RA 4DEXA 4J9CA 2EVRA 4PJLA 4CC2A 4GLKA 4C0DC 3KFVA 3M0SA 4R0KA 3C4SA 3CCEQ 3EGXA 1SRMA 3A98A 3JCMe 3EHQA 1WFWA 2VC8A 3REBB 1NBEB 2MI6A 2OTJA 2DLPA 2FG0A 2DL5A 4PNOA 3S3NA 3JB9H 3FB9A 3CCUQ 3QZ9B 4RTWA 5I2MA 1HSQA 1XOVA 3PVLA 1UGRB 3NTKA 3CMAA 2HL3A 1M9SA 3Q1JA 1WZOA 3S6WA 2HSEB 3ZL7C 3CC7T 1K73U 4FW2A 1AT1B 2VXEA 1X6OA 2LJ0A 4E2FB 1Q81C 3LH5A 2OTLA 1ABQA 2XDBA 1GCPA 2XICA 2B86A 3OS2A 2QGGA 2QI2A 2JTMA 3CBOA 2YDLA 4HA8A 1X69A 1PCXA 2KY9A 2SRCA 2OI3A 3G4SQ 5A2QE 4DQ2A 2CUBA 4RKUE 2GBQA 4M7DD 4Y28E 3M0PA 5FU7B 2QQ9A 3P8HA 4M7AC 2PQWA 2I2LA 2VGNA 1FWZA 1YWOA 1YJNA 4Z88A 4Z02A 1JBMA 2XDDA 1X27A 4M78B 1K9MR 1G2BA 2IVWA 1ZBXA 2KRSA 4ATOA 1WLPB 3CD6Q 1Y96A 1M2OA 4RUGA 3LYIA 4B9XA 3RDVA 4HCCA 5LJ3f 2O31A 4M75B 2P0PA 5FRMA 1VQ4Q 4IUVA 3THKA 2PUKB 2EYZA 3WVEB 3JB9J 2D0NA 2RF0A 1WX6A 1D09B 5IXFA 2DBKA 4KULA 3C95A 4PLIA 3VUZA 4QKUA 4IUQA 4EIKA 3RESA 2PVOB 1PHTA 4Y92A 4E7ZA 1G83A 2X4WA 2RA2A 1MV0B 1J3TA 4KGVB 4C92F 1G3WA 4C92E 1PG5B 2DA9A 3NPFA 2FVUA 3MP1A 4KBMB 4BI8B 1TH7A 3RMSA 5HK0A 4J6XA 2HCKA 3HRTA 3RR6A 3L2VA 4NL2A 2K5IA 2E5KA 4JS5A 2JTEA 3FJPA 2GFAA 4JJNK 3QDFA 2AZVA 2M1HA 1Q82R 3CC7Q 3OYHA 2ED0A 2DEUA 3VYGA 1X6GA 2DIQA 1KQSA 2CP6A 1VQOT 2RD1A 3H6ZA 1ZSGA 5DY9A 1LVKA 2FPEA 2NYSA 5DM7R 4X9DA 4XTUA 3OYFA 4HT8A 1Y07A 3TCJA 3KUFA 4C0ZA 1OV3A 1PKSA 4EDUA 1YJWQ 1AWWA 4ZNXA 1ZSZB 2JS0A 3RNJA 1HJDA 4EMGA 4N0AC 3P8DA 2DMOA 3C12A 2KRMA 4C8QD 2JT4A 3OYLA 2X4JA 2K6DA 2DL7A 1EX4A 5GAOm 3BE3A 3GOXA 2X51A 2DVJA 5KH6A 1QVGA 1U3OA 3DKMA 3DLLA 2GFUA 1VQ8T 2EGAA 4DA4A 5A0DA 3A8LB 3M53A 2YHTA 2RK1A 2KSSA 2KBTA 2QGFB 3M0UA 2VASA 4M7DB 3GF5A 2XG8D 1JEGA 3CCLQ 4R55A 5FU6B 4FYWB 4J9IA 1K8AR 4GY5A 1AOJA 1BI1A 3GBQA 3G71Q 3FIFA 1B34A 3O5ZA 3UF4A 2D6FA 2O4XB 2DD5A 1UGQB 1I07A 2RI5A 2OX7A 2L3SA 4FT4A 3LH0A 4N4IA 4LXCA 3MCAB 4M7DA 2J05A 2L3QA 3QPHA 3OYCA 2OTJT 4M78C 4ZGDB 3OYNA 1M1KU 3C0CA 5I21A 1PD0A 4XTXA 2NUPA 2K3YA 3TSWA 1I0CA 1WHKA 3CC2T 1MMGA 1I81A 2JS2A 4JPBW 5GMKi 2YSQA 1PSEA 1P92A 1YI2T 5J26A 1N9RA 2E10A 4K11A 2BE7D 2RI2A 3CXCA 2OTLT 1WXUA 5C6SA 1ARKA 4EMKA 2QG9B 2KK4A 4VUBA 3OYIA 3P8BB 4F7UA 5HKCA 4M7AD 1FX7A 5IHIA 1O75A 3EG9B 3OSSC 3VKIA 3HSBA 5KYXB 1IGUA 4KGZB 2E70A 3F70A 1KIKA 1R77A 2F2XA 4B9WA 2K57A 1NYGA 1EIFA 2AT1B 2OJ2A 4IIMA 3CD6A 2DRKA 3EAEA 3OSVA 3L2ZA 2VB6A 4E7JA 4PJOB 2QEXQ 4KUDK 3URGA 3JAME 4DBQA 5CK9A 1R0BG 5L23A 1RAHB 2JZ2A 2DL4A 5GANd 1VQ8Q 2YUNA 3HRSA 2AKLA 3RKYA 2EQIA 2K2MA 3JB9F 3EG3A 2JMAA 2GGRA 1RABB 1T3SA 1WYXA 3EH2A 1RADB 2Z0WA 1VQNA 1PRMC 4X34A 2Y90A 4PJNA 2DFUA 1Q95G 5GANf 5CKBA 1SSFA 1X2KA 4C8QB 5GAMd 3OS5A 4E7KA 2K5LA 3G6EQ 2KXDA 5GAOl 3OQ5A 4BE0A 3CCJQ 1KJWA 3QUIA 2K3XA 5GANg 2CT3A 2ABLA 3TSZA 1M1FA 1ZSZC 4J9GA 3CC4A 4CI0C 4E7HA 1LNXA 4XTZA 3UATA 2KNBB 4HVWA 4II1A 4JDSA 3INZA 3CPWA 1VUBA 5J39A 5KE3A 2LJ3A 1IHWA 2HDAA 2EGCA 1VQMQ 2YWWA 3SWNA 2R5AA 1M2VA 2LQKA 3NGPA 2XD0A 3LW5E 4IIOA 2LRQA 1KQSP 3A8GB 2DXCA 1ZUYA 4N4HA 2MYSA 1QWEA 4A53A 3CC2Q 4A4HA 2KT8A 3R6OA 4LUDA 2QQAA 3ZBDA 2IG0A 2LX9A 4QVCA 1YI2Q 3OYMA 1Z9QA 2RQVA 1NE8A 1NM7A 1VQ5T 5FU6C 4ZTJA 1YJ9A 4WTOB 3V7CA 1UG1A 2LP5A 1IZ6A 2AHJB 1WQWA 1OI1A 1IXDA 4LN2A 1PC0A 4DOVA 3VS6A 2DF6A 4C92D 2EBPA 2JN0A 2BZXA 3I55A 2FB7A 2XU8A 3H0IA 5GAN4 2DL3A 1QVGP 3OA6A 1T0HA 4LDWA 1TS9A 1QCNA 3NTIA 2IIMA 4C0FA 4JRKA 4FL6A 3OYEA 4J6WA 5KYUA 1Q81U 1QVGS 2DM1A 2KDSA 4ELYC 2X4XA 2VUBA 4BE1A 3CCLA 2NUTA 4F17A 1I5OB 5GMKm 5LJ5d 1H92A 1ZA1B 4M7AB 2VV5A 4C5HA 2PNIA 3JCMf 2QA4A 5I2SA 3L2WA 2KR3A 4J9HA 2BE9B 2EQKA 3JCMg 3A5ZB 3RUXA 1W70A 3JCMX 4C0GA 4RMOA 1MMDA 2LCSA 4MZMA 1JXOA 1H3HA 2V1QA 5GAMe 3QJ6A 1ZA2B 3PGGA 4KGXB 2LT4A 3L42A 2CGHA 2DE0X 3SD4A 3JCMP 2DXTA 2GTJA 4M7AA 1Q86C 4FM4B 1YWPA 2LCLA 5C0MA 4WF2A 5I22A 2ESWA 2RHXA 1YHQT 4PJOC 4OB0B 4QQGA 2DD4A 1NEBA 2K4YA 2P0QA 5I11A 2ZPHB 4AT1B 3CXCP 3L1AA 1M1KR 3M9QA 5GAN6 3WVDB 4M77F 1U1TA 2EIFA 3HL8A 3OS0A 4M77E 4RG2A 2VWFA 3CCRT 3CXCS 4RCCA 3CCMA 4C8QC 2RJEA 2PTKA 3O8VA 2X4YA 1S72Q 2NUZA 1NJIR 2XIDA 3GLXA 2L5QA 3UWNA 2CP5A 3LGLA 1YITT 3VYHB 4XU2A 2KEAA 5GAOr 4E7LA 4NOYA 1N8RC 2X3WD 2DKGA 2GCXA 3H9NA 3V8KA 3QYGB 2GNCA 3A8MB 1D3BB 1K8AU 5IAYA 1MHNA 3H41A 2JW4A 3NMZC 1VQLA 1VQ9A 3ER0A 9ATCB 1TOVA 3I56A 2CSQA 2FZCB 3A8HB 3M56A 4M77C 3AT1B 1W4SA 4C92B 5LJ3j 2HAXA 2JUFA 5IT9E 3QWYA 1AWOA 4HCZA 5LJ5e 4CC7A 3CCST 4MDXA 4QW2A 1TUGB 3M0RA 1RLQC 2LC4A 3ZFJA 2LCCA 1X43A 2KGTA 4HVVA 4HT9A 3CPWP 4J9EA 4ELZC 3CMEA 1KD1R 4QQDA 2LNHB 1N5ZA 1VQPA 4OMMA 3CC4T 5GMKl 2LQ8A 2RH2A 1TTHB 2BIVA 2ED1A 3CPWS 1BK2A 3JCMb 1RAFB 5KE2A 3V8JA 1WHJA 5CKFA 2YRVA 2D9TA 4LDXA 2L3PA 1W2BA 1Z9ZA 3UPUA 3TU4K 1YHQQ 1WNLA 3JB9D 1YIJT 2R5MA 3SB2A 2EW3A 1XQHA 3ME9A 1G3SA 3T9NA 3CCQA 5CQYA 5GAN5 2FHDA 4J83A 1YN8A 2KQWA 2RHUA 2Y4YA 3CBMA 5CIUA 4Z89A 1BI3A 3CCRQ 4ZN1A 4JS4A 1VOMA 3N5BB 3QKJA 2AIRB 4LUEA 1M90C 4JZ3A 4PFZA 1JO8A 3VUBA 4AFZC 1K9AA 3CCVA 3QZ5B 4FW1A 5CCAA 5LJ3h 2XK0A 2MCNA 1YITQ 1PRLC 3VV0A 2WSEE 3I55T 1I5LA 3MKDA 2QXFA 3J81E 1AEYA 3GP8A 3X25B 3EGUA 3PMIA 1VQ6T 8AT1B 1NEGA 1VQKQ 2A7YA 1TU0B 1VQ7A 3U23A 4M78A 4D8KA 4ORZA 1Q81R 3LX7A 3VS0A 3X28B 2COWA 2M16A 3HP9A 3OW2A 2SEMA 1TXQA 5KYWB 2VVKA 4E7IA 2DX1A 2EPDA 2R58A 4M75A 4OMLA 2J6OA 5FROA 4WCIA 1GFCA 2V1RA 1OPLA 4BI3A 2FRYA 3CCSQ 2E65A 1MMNA 2ZPIB 1RI0A 3ZEHA 2OAWA 1OYXA 2E4HA 2MF2A 2ATCB 3EFOB 2KXCA 3I35A 3R6NA 1N9SA 1QQJA 5GAOn 1WXTA 2CS7A 3JCMW 4PJOD 2RHZA 1RAGB 1WJSA 2DPPB 4PFPA 1D1CA 2LDMA 2VGMA 4DOWA 2E41A 4FIBA 3SHWA 1RAIB 1RAEB 4AFQC 5KYNA 2E3IA 1OEBA 3BDLA 2KYBA 3QBYA 1FMVA 4AFUC 1YIJQ 2ZPEB 2F2WA 1GFDA 3VS2A 1FMKA 4XQ3A 5GMKj 3X26B 2GF7A 4OB3B 4ZGEB 4C92C 2DZ9A 2ZPFB 3OBWA 2M0OA 4C5GA 1RLPC 5EG2A 1SKUB 2RM4A 4JUVA 2EYQA 1RUWA 1M3BA 1WDXA 4PLLA 2HL5C 1H8KA 1SPKA 2XKOC 1UHFA 2F2VA 1ZSZA 2HQXA 1JB0E 5A0LA 2CP7A 3EG1A 5CR2A 1GRIA 6AT1B 1K73C 4M75G 2E64A 4KH0B 3LWIA 1F1BB 3CCEA 1VQ6Q 3VJPA 5LJ3e 1M4ZA 2KRNA 2CP0A 1KC8U 4DEYA 2EJFA 3TVTA 3DB4A 4M77D 4LNPA 3I5SA 3WXMB 5M9OA 1OZ3A 1BI2A 3E1SA 3CCUA 1NPPA 5AT1B 2CREA 3A1PA 1WHHA 2V8IA 2ECZA 3TREA 4RTZA 4ANJA 2EQUA 1JXMA 1WHLA 1M3AA 3VS4A 5GANj 1T0JA 2M9UA 5GMKh 1KHCA 4GLMA 2E12A 4QQ6A 2YLCA 3MEAA 3PVQA 3CMAT 4QVZA 1BCMA 4OMFB 4RTTA 5FLXE 1W2BP 1VQPT 2O4XA 1IB8A 2ENMA 3G4SA 2O9VA 5KYYB 1X75C 2EFIA 3HKSA 1NJIU 5AYFA 1VQOQ 4RCBA 1UJ0A 2JXBA 4J7IA 1W2BS 2DXUA 4LDVA 4OMNA 1GCQC 2DNUA 2DAQA 3I5RA 3PFSA 1UGPB 3S3MA 4RTXA 1U06A 2D1XA 3HHTB 4CC4B 4E47A 1B07A 4OGCA 2BZ8A 1TUCA 5FWCA 2QTXA 4JRPA 1Q7YC 3VS3A 2RB6A 1KG1A 1ABOA 1YJNT 3QYHB 2MWPA 3EGDB 1JQQA 4FYVB 1VQ4A 4B6MA 1OULA 2DTOA 5KCHA 1B3QA 1HK9A 3CCVT 3PNWC 4O6JA 1QVFA 1BIBA 3EG9A 5KYXA 1QVPA 3GPLA 4P5NA 1BKBA 2J7IA 3HPWA 2V8JA 1R0CB 3OYKA 2HZYA 3M59A 2RO0A 4M7DG 5J3BA 3H0HA 3OW2P 1QCOA 1EZZB 4HCKA 4QVDA 1IREB 1KD1U 2FPFA 2VXFA 1KK7A 3S3OA 2RJFA 4PJOA 4JRIA 4M7DF 2CYZB 3G1JA 2ZZDA 2DYBA 3QDRB 4M7DE 5EC7A 2RPNA 4LD6A 3OW2S 1D0XA 2CKKA 4BUGA 1PWTA 1AD5A 2KI7A 5GAMf 3CBPA 3I9QA 1R8OB 1QP2A 3M5AA 4J7FA 2X3XD 2Y4XA 3KXTA 3BFMA 1N8RU 1X6BA 2JTFA 1G3TA 5GAMg 2A36A 2RQTA 3TQ7P 1UGSB 3CC7A 2GQIA 2OTJQ 2G3RA 4ZTFA 4C8QA 2HD0A 2IPOB 1UGVA 2EAYA 4F7UG 1X2QA 5CQXA 3CMAQ 1UB4A 2YLBA 1B7TA 4M77B 5FRNA 4F7UF 1MNDA 1KQSS 1YJWA 1V29B 2JNGA 1OU8A 1QLYA 5CVIA 4F7UE 1ZBJA 1WIEA 2X35A 1XJWB 3V8LA 2OTLQ 5GAN2 1I1JA 1OX8A 4IUUA 3UDCA 3QSUA 1D1AA 3OMCA 3LWHA 4KH1B 3X20B 1QWFA 2K2VA 1IHVA 4O5VA 3D7SB 4GBQA 3MEWA 1QKWA 4BD3A 4DBHA 4XAXB 1SEMA 4BI4A 1ZHIA 1YJNQ 2E3HA 2HKNA 4A4EA 4PJJA 1M30A 1LPLA 4IUPA 2RHYA 3HTRA 4EMKC 1UJYA 3FC3A 3JCMh 1PD1A 3G71A 2CH4W 3JRZA 1M1GA 2QDLA 1JJ2A 4JZ4A 7AT1B 2HQHA 1M8VA 1WPYA 2DXBA 5LJ5f 2KMTA 2E6ZA 1QKXA 1ZQ1A 4C8QG 2H8HA 1TSFA 2LJ1A 2DJZA 2YT6A 5GAOp 3TEEA 2RN8A 4HCBA 1M90U 2YUPA 1MV3A 1K1ZA 5LJ5g 1NYFA 1KC8R 2HSPA 2C06A 2FO0A 4FYXB 4PKCC 2QYZA 3CCUT 4JJCA 3CEYA 2DILA 2EQMA 1U1SA 1ZUUA 4MDWA 1KQ1A 1UTIA 3QG1A 1YCYA 4D8DA 1KQ2A 1V76A 1K4US 2L89A 1UDLA 3REAB 1YBYA 5D7UA 4MMLA 3E2UA 2QTVA 3LGFA 2RQWA 1WJRA 4DBRA 4FT2A 3G4ST 4AMCA 1E6GA 1GL5A 1VQ5Q 1NPRA 2A3LA 4RTVA 1N6AA 1XNIA 1SHGA 4L6V5 1QMCA 2ROLA 5CO7A 1WA7A 2DO3A 2HBPA 2QQSA 1BYMA 2QEXA 4HXJA 4JLGA 3SWNC 2NLUA 3CPFA 4XU3A 3VS1A 1VQ8A 3C94A 2F69A 3E19A 3NHNA 1MMAA 1QVFP 1CKBA 3CD6T 3PIOA 4NS5A 2CH4A 1D0ZA 4EPCA 3HRUA 1ZLMA 2COYA 2HNIA 4F14A 1HYOA 1Q86R 2D8HA 1UUEA 2DTHA 1V1CA 2YUQA 5GJWB 1QVFS 4AG2C 1OOTA 4BE2A 3G6EA 4V2SA 2KE9A 1FYNA 2MWOA 3IQLA 3HFNA 1RI9A 1K0SA 3CCJA 2NWMA 4A54A 3J7AF 1VQNT 4M7AG 1UHCA 1D3BA 2RNAA 2XMFA 4IURA 1ZUKA 2GQVA 2A28A 3MEUA 3MO8A 5GAN7 2CZ0B 4M7AF 1K9MC 2DJQA 2E5QA 3FDRA 3HFOA 3M58A 3RKXA 3RMQA 3JB9I 4M7AE 4X9CA 1VQMA 3E9GA 4L5GA 2FL7A 2MPXC 3MEVA 2J6KA 4N0AA 2CZ6B 4LD9K 4JRQA 1BU1A 3QXEB 4C92A 1X01A 5IHNA 3GNGA 4AFSC 3CC2A 4OMQA 2MOXA 2CP3A 2DZCA 4AG1C 1N8RR 2CT4A 3SEMA 1H641 1YI2A 2A0FB 4OMOA 4J8OA 2W0ZA 2QQBA 3PT9A 3JCMQ 1OPKA 1Y71A 1C1AA 5D6YA 3H0FA 2PU9B 2KVQG 3OYAA 2R57A 2WACA 3QO3A 4PJMA 1FMWA 3DLMA 4OGEA 1AWXA 1PNJA 2L3RA 3MP8A 1U8RA 1WHMA 1YJWT 1Y96B 4BACA 2HKQB 2VYTA 1YJ9T 2VKNA 3FRNA 2LNVA 4JLIA 2AKKA 3M55A 2COZA 3META 2V8KA 3OYJA 4XTWA 5LJ3d 3G7ZA 1Q82C 5IHKA 1Y0MA 2MIOA 2F5KA 4PK4A 1VIEA 2GTOA 1FXXA 2CZ1B 2ZCFB 1G5VA 4OP0A 4A63B 2H3JA 3L2RA 2MAMA 2J06A 2K3BA 2BUDA 1WI7A 1BCOA 3E9FA 2HEQA 2K9GA 3QWXX 4LDUA 2LQWA 3CCLT 3QJYA 1JJ2P 2DETA 2LZ6B 3M0QA 5LJ3g 1MGQA 2AK5A 3OMGA 2FPDA 5L8RE 3G71T 5LL6S 2AZSA 1SRLA 5DLOA 1JJ2S 1VQNQ 2PZ1A 2QA4T 1GXIE 4C92G 3JCMJ 1E6HA 1Q7YU 2WSFE 4UC4A 3RBBB 1GCQA 5D6XA 2YRCA 2ZAEA 4A4KA 3CQTA 2QQRA 3CC4Q 1M90R 5KYWA 2D0QB 2RQUA 4FYYB 3VS5A 2LT1A 3UT1A 1NG2A 1WQ7A 2QAZA 4BB7A 1K8AC 1VA7A 4J9FA 2KAFA 1CKAA 2EJGA 2J6FA 5FWBA 1D0YA 2RJDA 1VYTA 4QT7A 1Y7XA 3UA7A 1YP5A 3EFOA 4N4GA 1VQ5A 1HXDA 1S72A 3J80E 3AHUA 3OY9A 2JJ9A 2EGEA 1WJQA 1K0XA 3CCMT 4IKFA 2EQJA 1YJ9Q 4OB1B 4M78G 1HD3A 2E6NA 3M4YA 2O01E 2WSCE 1VYVA 3OS1A 5CKDA 4CRIA 4M78F 1OU9A 3JCMc 3BY7A 1AVZC 3I55Q 2QEXT 2G6FX 3BW1A 1B34B 4M78E 2XHCA 2MMPA 2KYMA 3NFCA 3QIIA 1PSFA 3JSCA 1UFFA 1SSHA 2C0IA 2LMJA 1YCSB 8ATCB 1VQLT 4M75F 1VQ9T 1IRXA 4ME7A 3OYYA 3SDZA 2M0YA 4FSSA 4M75E 1MNEA 4A4GA 3I56T 4X1VA 1KSWA 1UEBA 2LQNA 2EYYA 4MZTA 5IH2A 3G6ET 3EFSA 3PIPA 1M3CA 2NUPB 3CCJT 1T3LA 3MHXA 4BY6B 1BBZA 4J5YA 1BIAA 2LTOA 2CUDA 4IUTA 2QA4Q 3PE0A 2EKHA 2EYWA 3VU3C 5FU7C 1WXBA 3M57A 4JJBA 1S1NA 1AZEA 3H8ZA 3RERA 3CMET 2ZPGB 4EMKB 1Y57A 3ASKA 2D8JA 1VQMT 1SG5A 1YHQA 1TUDA 3EG2A 4F7UB 5GAMj 2DYIA 4HVUA 4BDZA 2A08A 2EKOA 2HBWA 2BTTA 2K7AA 3UA6A 3OYGA 2JMCA 1VIFA 4M75C 2W10A 3OBYA 2RQRA 3CCRA 2JM8A 4F04B 1K73R 1YFNA 2RI3A 1DJ7B 2C0OA 5ECAA 3CCQT 1EFNA 1YITA 2P84A 2H3EB 3EHRA 4LDYA 5KYYA 2RHIA 4J9DA 2DK3A 5FW9A 3NTHA 2CSIA 4ESRA 1Q86U 3CCMQ 2FZKB 2L8DA 4L59A 2X9HA 4F16A 2JVVA 3SFMA 4C5IA 5KCOA 4PL6A 2DTIA 1A0NB 2JM9A 4OF1A 4XU1A 5CAIA 1VQKA 1NLPC 5GANh 2V26A 1BI0A 3JB9G 2JOYA 5HK3A 1G8XA 2ZGWA 2DERA 1D1BA 1AHJB 2L0AA 1GBRA 2DL8A 3MJXA 1LCKA 1AZGB 2DEQA 5A0GA 2P4RA 1LJOA 4OB2B 4NL3A 3OYDA 1VQLQ 4FCYA 1VQ7T 2FEIA 1VQ9Q 3EGDA 4BDYA 3MP6A 5GAMh 1SF9A 2P4TA 4XU0A 3VRYA 3M54A 2FYKA 3I56Q 3CCSA 2EWNA 4MZPA 2DIGA 3SWNB 1M2VB 5GAN3 2YRDA 5D6WA 4OMPA 3EG0A 1KFZA 2QDYB 1AWJA 3FEOA 2YUOA 3JCMV 2LVMA 1NZ9A 4A4FA 5LJ5j 3PMTA 1Q7YR 2F5TX 3V7SA 2EYXA 3DB3A 3FLGA 1M8MA 1M5Q1 5GJVB 3CMEQ 1I8FA 1U5SA 2XDPA 4KT0E 1VQPQ 1YIJA 5CKEA 2A37A 5GMKe 2CDTA 4Q5WA 1ZX6A 2M51A 1W1FA 1W6XA 2EJ9A 4MMKA 4C0DB 4FU6A 2MK5A 4JJDA 1IGQA 4M7DC 3M4GA 2BZYA 2ROTA 3ULRB 5KYUB 1OX9A 1K9MU 3KBGA 4EMHA 1KC8C 5IXBA 1S72T 4LE9A 4J6YA 1H3ZA 4M77A 2NUTB 4HKEA 3CCQQ 1PM3A 1MUZA 3OB9A 4BY6C 2O88A 3GIBA 3RIRA 1E7OA 4R56A 1UE9A 2QK0A 4RTYA 1NLOC 1CSKA 1C0MA 2RK2A 4PJOG 4XTVA 1ACMB 1M1KC 3CCVQ 4ZGJB 1VQ6A 2E1HA 5DLQE 5IN1A 1C6VX 4RG8A 2HMAA 3VRZA 4PJOF 4PFOA 3QHSA 2O2OA 2F1LA 2CZ7B 4PJOE 2DBMA 2M02A 3JCMd 1TG0A 1WGSA 5LJ5h 2KROA 1RAAB 1JU5C 4DBFA 2DVEA 3CCET 4M4ZA 1QP3A 1NJIC 2PUOB 2P0KA 2C0TA 3X24B 1OQKA 2DRMA 1VQ7Q 1QW1A 5GANe 2OAUA 4C8QF 2RJCA 4E6RA 4Y91A 1KHIA 1UECA 4C8QE 3L2QA 1Q82U 1RACB 4J9BA 2KT1A 2YXYA 1SHFA 4KUIA 2CP2A 4YTLA 2B8AA 1GBQA 1VQOA 4ZN3A 1IO6A 1YNZA 4M78D 1QCFA 3M0TA 1OZ2A 4OVAA 2O9SA 2K5FA 1RL2A 5GAN8 1I4K1 4D6WA 4E7SA 2RMOA 2I0NA 4M77G 4Z8AA 5HY6A 4M75D 1WHGA 2XI9A 4FSXA 4KRTA 2HQEA 3FJ5A 3RKWA 2L2PA 1BB9A 1TWBA 1LOJA 3OYBA 2K79A 1KD1C 2PVDB 4RTUA 4XTYA 5HCKA 3JV3A 2FRWA 4TVRA 1XTDA 3LLRA 1G3YA 1N27A 2BKDN 4CC3A 3GNFB 3VS7A 3L2UA 2FZGB 3EGXB 1K76A 3EH1A 2QASA 4C5EA 3EFRA 2ZPBB 1VQ4T 5CKHA
chains in the Genus database with same CATH topology
2LP5A 1VYUA 4RTTA 1E6HA 1M27C 2ENMA 2LX7A 4LN2A 3RBBB 2O9VA 3VS6A 1PKTA 2DF6A 2EBPA 1GCQA 2BZXA 1UJ0A 2JXBA 3H0IA 4OMNA 1GCQC 2DL3A 2DNUA 3I5RA 4DEXA 1T0HA 3CQTA 4J9CA 2EVRA 4CC2A 4RTXA 1U06A 2D1XA 2IIMA 3KFVA 3M0SA 4CC4B 4R0KA 2RQUA 1B07A 3VS5A 1SRMA 2BZ8A 3A98A 1NG2A 1TUCA 5FWCA 3EHQA 2DM1A 1WFWA 3REBB 4F17A 2DLPA 2FG0A 3VS3A 2DL5A 1VA7A 4J9FA 1CKAA 2J6FA 1ABOA 5FWBA 4RTWA 1H92A 1VYTA 1HSQA 4QT7A 1XOVA 3PVLA 3UA7A 1YP5A 2PNIA 1JQQA 3ZL7C 1B3QA 2KR3A 2LJ0A 4J9HA 2EGEA 1K0XA 3LH5A 1ABQA 2J7IA 1GCPA 1W70A 2B86A 2LCSA 1JXOA 1H3HA 2YDLA 2V1QA 1X69A 1HD3A 2SRCA 1VYVA 3H0HA 2OI3A 4HCKA 2DE0X 2FPFA 2CUBA 2GTJA 2GBQA 1YWPA 1AVZC 5I22A 3M0PA 2G6FX 2ESWA 2DYBA 5EC7A 2KYMA 2RPNA 1PWTA 1AD5A 1UFFA 1NEBA 1SSHA 2C0IA 1YWOA 3I9QA 2LMJA 5I11A 4Z88A 1YCSB 2X3XD 1X27A 1X6BA 2M0YA 4FSSA 2A36A 2RQTA 4X1VA 1G2BA 1KSWA 2GQIA 2LQNA 2EYYA 5IH2A 2VWFA 2KRSA 1WLPB 1UGVA 4RUGA 1M3CA 1X2QA 1T3LA 2O31A 2PTKA 2NUZA 1BBZA 3THKA 2CUDA 2EYZA 3PE0A 2EKHA 2EYWA 2D0NA 2RF0A 1WX6A 5IXFA 1WXBA 2DBKA 1QLYA 2KEAA 4JJBA 1ZBJA 1WIEA 1S1NA 1AZEA 2X3WD 4EIKA 1I1JA 2GNCA 1Y57A 2D8JA 1PHTA 1TUDA 4Y92A 3EG2A 1G83A 1MV0B 4HVUA 3H41A 2A08A 2JW4A 3NMZC 1J3TA 2HBWA 2BTTA 2K7AA 3UA6A 1QWFA 4GBQA 2DA9A 2JMCA 3NPFA 1QKWA 2CSQA 2W10A 2RQRA 2HCKA 1SEMA 2JM8A 2E5KA 2JTEA 2C0OA 5ECAA 3QWYA 1AWOA 1M30A 1EFNA 2AZVA 4CC7A 3EHRA 3M0RA 2ED0A 1RLQC 4J9DA 1UJYA 1X6GA 5FW9A 2CSIA 4ESRA 1X43A 2KGTA 1ZSGA 2CH4W 4HVVA 4J9EA 2FPEA 4F16A 2LNHB 1N5ZA 4OMMA 2QDLA 4JZ4A 1A0NB 2JM9A 1OV3A 1PKSA 2ED1A 1BK2A 1QKXA 1AWWA 4ZNXA 2JS0A 1HJDA 3RNJA 1NLPC 2H8HA 2LJ1A 2YT6A 2DMOA 2RN8A 2L3PA 2YUPA 1MV3A 1K1ZA 1Z9ZA 2KRMA 1NYFA 2HSPA 2L0AA 1GBRA 2FO0A 2JT4A 2DL8A 2K6DA 1LCKA 1AZGB 4JJCA 2DL7A 2DILA 2P4RA 2EW3A 1ZUUA 2FEIA 1UTIA 2DVJA 1U3OA 3VRYA 2EGAA 4D8DA 1YN8A 1K4US 1UDLA 4Z89A 2KBTA 3REAB 3M0UA 4OMPA 3EG0A 1KFZA 4LUEA 1JEGA 1AWJA 4JZ3A 2RQWA 1JO8A 4AFZC 1K9AA 2YUOA 2MCNA 4J9IA 1E6GA 1PRLC 1GL5A 1AOJA 2EYXA 3GBQA 1M8MA 5GJVB 4RTVA 1AEYA 3O5ZA 1U5SA 3UF4A 1SHGA 3EGUA 1I07A 2ROLA 2A37A 2L3SA 2CDTA 1WA7A 1ZX6A 1NEGA 2M51A 1W1FA 4HXJA 1W6XA 3U23A 4D8KA 2J05A 2L3QA 3VS1A 4ORZA 4JJDA 3VS0A 3NHNA 2SEMA 2BZYA 3C0CA 2ROTA 2VVKA 1CKBA 2DX1A 3ULRB 2CH4A 3TSWA 1I0CA 2EPDA 4OMLA 1ZLMA 5IXBA 2J6OA 4LE9A 4WCIA 1GFCA 4F14A 2JS2A 2V1RA 1OPLA 2D8HA 1UUEA 4JPBW 1V1CA 2YUQA 5GJWB 2YSQA 1MUZA 2FRYA 4AG2C 2O88A 1OOTA 1E7OA 2KE9A 1FYNA 3IQLA 1RI9A 2OAWA 4K11A 1K0SA 1UE9A 2NWMA 4RTYA 1NLOC 1WXUA 1ARKA 2KXCA 1CSKA 1UHCA 3I35A 2RNAA 2XMFA 3R6NA 1ZUKA 2A28A 1WXTA 5IHIA 3VRZA 2O2OA 2DJQA 2DBMA 1TG0A 3SHWA 1KIKA 2KROA 2F2XA 4AFQC 1NYGA 2J6KA 1OEBA 1JU5C 2OJ2A 4IIMA 2KYBA 4M4ZA 2DRKA 4AFUC 2F2WA 1BU1A 3VS2A 1GFDA 2C0TA 5IHNA 1FMKA 4AFSC 4OMQA 2DRMA 2MOXA 5L23A 2DL4A 4AG1C 2CT4A 2YUNA 2AKLA 3SEMA 4E6RA 1RLPC 2EQIA 2K2MA 3EG3A 2JMAA 2GGRA 4OMOA 1UECA 2W0ZA 1OPKA 1T3SA 1WYXA 1PRMC 3H0FA 4J9BA 2KT1A 1RUWA 1SHFA 1M3BA 1WDXA 1H8KA 1SPKA 1X2KA 1AWXA 1PNJA 2KXDA 1GBQA 1UHFA 2F2VA 1IO6A 1YNZA 1QCFA 3M0TA 1KJWA 2O9SA 2CT3A 2ABLA 3TSZA 2VKNA 3EG1A 4J9GA 1GRIA 2AKKA 2RMOA 2I0NA 4Z8AA 3UATA 2KNBB 4HVWA 2KRNA 4KRTA 4DEYA 5IHKA 1Y0MA 2MIOA 2LJ3A 2HDAA 3TVTA 2EGCA 2GTOA 4LNPA 3I5SA 3FJ5A 4A63B 2L2PA 1BB9A 3NGPA 2K79A 4RTUA 5HCKA 2J06A 4IIOA 2K3BA 3JV3A 1ZUYA 1WI7A 2CREA 2FRWA 2ECZA 1QWEA 2HEQA 2K9GA 3QWXX 4RTZA 2LQWA 1JXMA 2KT8A 1M3AA 3VS4A 2LZ6B 4LUDA 3M0QA 1T0JA 4CC3A 3VS7A 1Z9QA 2RQVA 4GLMA 1K76A 3PVQA 2AK5A 1NM7A 2FPDA 2AZSA 1SRLA 1UG1A 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP5 A;  1VYU A;  4RTT A;  1E6H A;  1M27 C;  2ENM A;  2LX7 A;  4LN2 A;  3RBB B;  2O9V A;  3VS6 A;  1PKT A;  2DF6 A;  2EBP A;  1GCQ A;  2BZX A;  1UJ0 A;  2JXB A;  3H0I A;  4OMN A;  1GCQ C;  2DL3 A;  2DNU A;  3I5R A;  4DEX A;  1T0H A;  3CQT A;  4J9C A;  2EVR A;  4CC2 A;  4RTX A;  1U06 A;  2D1X A;  2IIM A;  3KFV A;  3M0S A;  4CC4 B;  4R0K A;  2RQU A;  1B07 A;  3VS5 A;  1SRM A;  2BZ8 A;  3A98 A;  1NG2 A;  1TUC A;  5FWC A;  3EHQ A;  2DM1 A;  1WFW A;  3REB B;  4F17 A;  2DLP A;  2FG0 A;  3VS3 A;  2DL5 A;  1VA7 A;  4J9F A;  1CKA A;  2J6F A;  1ABO A;  5FWB A;  4RTW A;  1H92 A;  1VYT A;  1HSQ A;  4QT7 A;  1XOV A;  3PVL A;  3UA7 A;  1YP5 A;  2PNI A;  1JQQ A;  3ZL7 C;  1B3Q A;  2KR3 A;  2LJ0 A;  4J9H A;  2EGE A;  1K0X A;  3LH5 A;  1ABQ A;  2J7I A;  1GCP A;  1W70 A;  2B86 A;  2LCS A;  1JXO A;  1H3H A;  2YDL A;  2V1Q A;  1X69 A;  1HD3 A;  2SRC A;  1VYV A;  3H0H A;  2OI3 A;  4HCK A;  2DE0 X;  2FPF A;  2CUB A;  2GTJ A;  2GBQ A;  1YWP A;  1AVZ C;  5I22 A;  3M0P A;  2G6F X;  2ESW A;  2DYB A;  5EC7 A;  2KYM A;  2RPN A;  1PWT A;  1AD5 A;  1UFF A;  1NEB A;  1SSH A;  2C0I A;  1YWO A;  3I9Q A;  2LMJ A;  5I11 A;  4Z88 A;  1YCS B;  2X3X D;  1X27 A;  1X6B A;  2M0Y A;  4FSS A;  2A36 A;  2RQT A;  4X1V A;  1G2B A;  1KSW A;  2GQI A;  2LQN A;  2EYY A;  5IH2 A;  2VWF A;  2KRS A;  1WLP B;  1UGV A;  4RUG A;  1M3C A;  1X2Q A;  1T3L A;  2O31 A;  2PTK A;  2NUZ A;  1BBZ A;  3THK A;  2CUD A;  2EYZ A;  3PE0 A;  2EKH A;  2EYW A;  2D0N A;  2RF0 A;  1WX6 A;  5IXF A;  1WXB A;  2DBK A;  1QLY A;  2KEA A;  4JJB A;  1ZBJ A;  1WIE A;  1S1N A;  1AZE A;  2X3W D;  4EIK A;  1I1J A;  2GNC A;  1Y57 A;  2D8J A;  1PHT A;  1TUD A;  4Y92 A;  3EG2 A;  1G83 A;  1MV0 B;  4HVU A;  3H41 A;  2A08 A;  2JW4 A;  3NMZ C;  1J3T A;  2HBW A;  2BTT A;  2K7A A;  3UA6 A;  1QWF A;  4GBQ A;  2DA9 A;  2JMC A;  3NPF A;  1QKW A;  2CSQ A;  2W10 A;  2RQR A;  2HCK A;  1SEM A;  2JM8 A;  2E5K A;  2JTE A;  2C0O A;  5ECA A;  3QWY A;  1AWO A;  1M30 A;  1EFN A;  2AZV A;  4CC7 A;  3EHR A;  3M0R A;  2ED0 A;  1RLQ C;  4J9D A;  1UJY A;  1X6G A;  5FW9 A;  2CSI A;  4ESR A;  1X43 A;  2KGT A;  1ZSG A;  2CH4 W;  4HVV A;  4J9E A;  2FPE A;  4F16 A;  2LNH B;  1N5Z A;  4OMM A;  2QDL A;  4JZ4 A;  1A0N B;  2JM9 A;  1OV3 A;  1PKS A;  2ED1 A;  1BK2 A;  1QKX A;  1AWW A;  4ZNX A;  2JS0 A;  1HJD A;  3RNJ A;  1NLP C;  2H8H A;  2LJ1 A;  2YT6 A;  2DMO A;  2RN8 A;  2L3P A;  2YUP A;  1MV3 A;  1K1Z A;  1Z9Z A;  2KRM A;  1NYF A;  2HSP A;  2L0A A;  1GBR A;  2FO0 A;  2JT4 A;  2DL8 A;  2K6D A;  1LCK A;  1AZG B;  4JJC A;  2DL7 A;  2DIL A;  2P4R A;  2EW3 A;  1ZUU A;  2FEI A;  1UTI A;  2DVJ A;  1U3O A;  3VRY A;  2EGA A;  4D8D A;  1YN8 A;  1K4U S;  1UDL A;  4Z89 A;  2KBT A;  3REA B;  3M0U A;  4OMP A;  3EG0 A;  1KFZ A;  4LUE A;  1JEG A;  1AWJ A;  4JZ3 A;  2RQW A;  1JO8 A;  4AFZ C;  1K9A A;  2YUO A;  2MCN A;  4J9I A;  1E6G A;  1PRL C;  1GL5 A;  1AOJ A;  2EYX A;  3GBQ A;  1M8M A;  5GJV B;  4RTV A;  1AEY A;  3O5Z A;  1U5S A;  3UF4 A;  1SHG A;  3EGU A;  1I07 A;  2ROL A;  2A37 A;  2L3S A;  2CDT A;  1WA7 A;  1ZX6 A;  1NEG A;  2M51 A;  1W1F A;  4HXJ A;  1W6X A;  3U23 A;  4D8K A;  2J05 A;  2L3Q A;  3VS1 A;  4ORZ A;  4JJD A;  3VS0 A;  3NHN A;  2SEM A;  2BZY A;  3C0C A;  2ROT A;  2VVK A;  1CKB A;  2DX1 A;  3ULR B;  2CH4 A;  3TSW A;  1I0C A;  2EPD A;  4OML A;  1ZLM A;  5IXB A;  2J6O A;  4LE9 A;  4WCI A;  1GFC A;  4F14 A;  2JS2 A;  2V1R A;  1OPL A;  2D8H A;  1UUE A;  4JPB W;  1V1C A;  2YUQ A;  5GJW B;  2YSQ A;  1MUZ A;  2FRY A;  4AG2 C;  2O88 A;  1OOT A;  1E7O A;  2KE9 A;  1FYN A;  3IQL A;  1RI9 A;  2OAW A;  4K11 A;  1K0S A;  1UE9 A;  2NWM A;  4RTY A;  1NLO C;  1WXU A;  1ARK A;  2KXC A;  1CSK A;  1UHC A;  3I35 A;  2RNA A;  2XMF A;  3R6N A;  1ZUK A;  2A28 A;  1WXT A;  5IHI A;  3VRZ A;  2O2O A;  2DJQ A;  2DBM A;  1TG0 A;  3SHW A;  1KIK A;  2KRO A;  2F2X A;  4AFQ C;  1NYG A;  2J6K A;  1OEB A;  1JU5 C;  2OJ2 A;  4IIM A;  2KYB A;  4M4Z A;  2DRK A;  4AFU C;  2F2W A;  1BU1 A;  3VS2 A;  1GFD A;  2C0T A;  5IHN A;  1FMK A;  4AFS C;  4OMQ A;  2DRM A;  2MOX A;  5L23 A;  2DL4 A;  4AG1 C;  2CT4 A;  2YUN A;  2AKL A;  3SEM A;  4E6R A;  1RLP C;  2EQI A;  2K2M A;  3EG3 A;  2JMA A;  2GGR A;  4OMO A;  1UEC A;  2W0Z A;  1OPK A;  1T3S A;  1WYX A;  1PRM C;  3H0F A;  4J9B A;  2KT1 A;  1RUW A;  1SHF A;  1M3B A;  1WDX A;  1H8K A;  1SPK A;  1X2K A;  1AWX A;  1PNJ A;  2KXD A;  1GBQ A;  1UHF A;  2F2V A;  1IO6 A;  1YNZ A;  1QCF A;  3M0T A;  1KJW A;  2O9S A;  2CT3 A;  2ABL A;  3TSZ A;  2VKN A;  3EG1 A;  4J9G A;  1GRI A;  2AKK A;  2RMO A;  2I0N A;  4Z8A A;  3UAT A;  2KNB B;  4HVW A;  2KRN A;  4KRT A;  4DEY A;  5IHK A;  1Y0M A;  2MIO A;  2LJ3 A;  2HDA A;  3TVT A;  2EGC A;  2GTO A;  4LNP A;  3I5S A;  3FJ5 A;  4A63 B;  2L2P A;  1BB9 A;  3NGP A;  2K79 A;  4RTU A;  5HCK A;  2J06 A;  4IIO A;  2K3B A;  3JV3 A;  1ZUY A;  1WI7 A;  2CRE A;  2FRW A;  2ECZ A;  1QWE A;  2HEQ A;  2K9G A;  3QWX X;  4RTZ A;  2LQW A;  1JXM A;  2KT8 A;  1M3A A;  3VS4 A;  2LZ6 B;  4LUD A;  3M0Q A;  1T0J A;  4CC3 A;  3VS7 A;  1Z9Q A;  2RQV A;  4GLM A;  1K76 A;  3PVQ A;  2AK5 A;  1NM7 A;  2FPD A;  2AZS A;  1SRL A;  1UG1 A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 1VYU A;  1JRI A;  1M27 C;  3PTA A;  1O9S A;  2LX7 A;  3A8O B;  1PKT A;  4XK8 E;  3MPU B;  3BDU A;  1VQK T;  2PVG B;  5GAO q;  3V7R A;  4DEX A;  4J9C A;  2EVR A;  4PJL A;  4CC2 A;  4GLK A;  4C0D C;  3KFV A;  3M0S A;  4R0K A;  3C4S A;  3CCE Q;  3EGX A;  1SRM A;  3A98 A;  3JCM e;  3EHQ A;  1WFW A;  2VC8 A;  3REB B;  1NBE B;  2MI6 A;  2OTJ A;  2DLP A;  2FG0 A;  2DL5 A;  4PNO A;  3S3N A;  3JB9 H;  3FB9 A;  3CCU Q;  3QZ9 B;  4RTW A;  5I2M A;  1HSQ A;  1XOV A;  3PVL A;  1UGR B;  3NTK A;  3CMA A;  2HL3 A;  1M9S A;  3Q1J A;  1WZO A;  3S6W A;  2HSE B;  3ZL7 C;  3CC7 T;  1K73 U;  4FW2 A;  1AT1 B;  2VXE A;  1X6O A;  2LJ0 A;  4E2F B;  1Q81 C;  3LH5 A;  2OTL A;  1ABQ A;  2XDB A;  1GCP A;  2XIC A;  2B86 A;  3OS2 A;  2QGG A;  2QI2 A;  2JTM A;  3CBO A;  2YDL A;  4HA8 A;  1X69 A;  1PCX A;  2KY9 A;  2SRC A;  2OI3 A;  3G4S Q;  5A2Q E;  4DQ2 A;  2CUB A;  4RKU E;  2GBQ A;  4M7D D;  4Y28 E;  3M0P A;  5FU7 B;  2QQ9 A;  3P8H A;  4M7A C;  2PQW A;  2I2L A;  2VGN A;  1FWZ A;  1YWO A;  1YJN A;  4Z88 A;  4Z02 A;  1JBM A;  2XDD A;  1X27 A;  4M78 B;  1K9M R;  1G2B A;  2IVW A;  1ZBX A;  2KRS A;  4ATO A;  1WLP B;  3CD6 Q;  1Y96 A;  1M2O A;  4RUG A;  3LYI A;  4B9X A;  3RDV A;  4HCC A;  5LJ3 f;  2O31 A;  4M75 B;  2P0P A;  5FRM A;  1VQ4 Q;  4IUV A;  3THK A;  2PUK B;  2EYZ A;  3WVE B;  3JB9 J;  2D0N A;  2RF0 A;  1WX6 A;  1D09 B;  5IXF A;  2DBK A;  4KUL A;  3C95 A;  4PLI A;  3VUZ A;  4QKU A;  4IUQ A;  4EIK A;  3RES A;  2PVO B;  1PHT A;  4Y92 A;  4E7Z A;  1G83 A;  2X4W A;  2RA2 A;  1MV0 B;  1J3T A;  4KGV B;  4C92 F;  1G3W A;  4C92 E;  1PG5 B;  2DA9 A;  3NPF A;  2FVU A;  3MP1 A;  4KBM B;  4BI8 B;  1TH7 A;  3RMS A;  5HK0 A;  4J6X A;  2HCK A;  3HRT A;  3RR6 A;  3L2V A;  4NL2 A;  2K5I A;  2E5K A;  4JS5 A;  2JTE A;  3FJP A;  2GFA A;  4JJN K;  3QDF A;  2AZV A;  2M1H A;  1Q82 R;  3CC7 Q;  3OYH A;  2ED0 A;  2DEU A;  3VYG A;  1X6G A;  2DIQ A;  1KQS A;  2CP6 A;  1VQO T;  2RD1 A;  3H6Z A;  1ZSG A;  5DY9 A;  1LVK A;  2FPE A;  2NYS A;  5DM7 R;  4X9D A;  4XTU A;  3OYF A;  4HT8 A;  1Y07 A;  3TCJ A;  3KUF A;  4C0Z A;  1OV3 A;  1PKS A;  4EDU A;  1YJW Q;  1AWW A;  4ZNX A;  1ZSZ B;  2JS0 A;  3RNJ A;  1HJD A;  4EMG A;  4N0A C;  3P8D A;  2DMO A;  3C12 A;  2KRM A;  4C8Q D;  2JT4 A;  3OYL A;  2X4J A;  2K6D A;  2DL7 A;  1EX4 A;  5GAO m;  3BE3 A;  3GOX A;  2X51 A;  2DVJ A;  5KH6 A;  1QVG A;  1U3O A;  3DKM A;  3DLL A;  2GFU A;  1VQ8 T;  2EGA A;  4DA4 A;  5A0D A;  3A8L B;  3M53 A;  2YHT A;  2RK1 A;  2KSS A;  2KBT A;  2QGF B;  3M0U A;  2VAS A;  4M7D B;  3GF5 A;  2XG8 D;  1JEG A;  3CCL Q;  4R55 A;  5FU6 B;  4FYW B;  4J9I A;  1K8A R;  4GY5 A;  1AOJ A;  1BI1 A;  3GBQ A;  3G71 Q;  3FIF A;  1B34 A;  3O5Z A;  3UF4 A;  2D6F A;  2O4X B;  2DD5 A;  1UGQ B;  1I07 A;  2RI5 A;  2OX7 A;  2L3S A;  4FT4 A;  3LH0 A;  4N4I A;  4LXC A;  3MCA B;  4M7D A;  2J05 A;  2L3Q A;  3QPH A;  3OYC A;  2OTJ T;  4M78 C;  4ZGD B;  3OYN A;  1M1K U;  3C0C A;  5I21 A;  1PD0 A;  4XTX A;  2NUP A;  2K3Y A;  3TSW A;  1I0C A;  1WHK A;  3CC2 T;  1MMG A;  1I81 A;  2JS2 A;  4JPB W;  5GMK i;  2YSQ A;  1PSE A;  1P92 A;  1YI2 T;  5J26 A;  1N9R A;  2E10 A;  4K11 A;  2BE7 D;  2RI2 A;  3CXC A;  2OTL T;  1WXU A;  5C6S A;  1ARK A;  4EMK A;  2QG9 B;  2KK4 A;  4VUB A;  3OYI A;  3P8B B;  4F7U A;  5HKC A;  4M7A D;  1FX7 A;  5IHI A;  1O75 A;  3EG9 B;  3OSS C;  3VKI A;  3HSB A;  5KYX B;  1IGU A;  4KGZ B;  2E70 A;  3F70 A;  1KIK A;  1R77 A;  2F2X A;  4B9W A;  2K57 A;  1NYG A;  1EIF A;  2AT1 B;  2OJ2 A;  4IIM A;  3CD6 A;  2DRK A;  3EAE A;  3OSV A;  3L2Z A;  2VB6 A;  4E7J A;  4PJO B;  2QEX Q;  4KUD K;  3URG A;  3JAM E;  4DBQ A;  5CK9 A;  1R0B G;  5L23 A;  1RAH B;  2JZ2 A;  2DL4 A;  5GAN d;  1VQ8 Q;  2YUN A;  3HRS A;  2AKL A;  3RKY A;  2EQI A;  2K2M A;  3JB9 F;  3EG3 A;  2JMA A;  2GGR A;  1RAB B;  1T3S A;  1WYX A;  3EH2 A;  1RAD B;  2Z0W A;  1VQN A;  1PRM C;  4X34 A;  2Y90 A;  4PJN A;  2DFU A;  1Q95 G;  5GAN f;  5CKB A;  1SSF A;  1X2K A;  4C8Q B;  5GAM d;  3OS5 A;  4E7K A;  2K5L A;  3G6E Q;  2KXD A;  5GAO l;  3OQ5 A;  4BE0 A;  3CCJ Q;  1KJW A;  3QUI A;  2K3X A;  5GAN g;  2CT3 A;  2ABL A;  3TSZ A;  1M1F A;  1ZSZ C;  4J9G A;  3CC4 A;  4CI0 C;  4E7H A;  1LNX A;  4XTZ A;  3UAT A;  2KNB B;  4HVW A;  4II1 A;  4JDS A;  3INZ A;  3CPW A;  1VUB A;  5J39 A;  5KE3 A;  2LJ3 A;  1IHW A;  2HDA A;  2EGC A;  1VQM Q;  2YWW A;  3SWN A;  2R5A A;  1M2V A;  2LQK A;  3NGP A;  2XD0 A;  3LW5 E;  4IIO A;  2LRQ A;  1KQS P;  3A8G B;  2DXC A;  1ZUY A;  4N4H A;  2MYS A;  1QWE A;  4A53 A;  3CC2 Q;  4A4H A;  2KT8 A;  3R6O A;  4LUD A;  2QQA A;  3ZBD A;  2IG0 A;  2LX9 A;  4QVC A;  1YI2 Q;  3OYM A;  1Z9Q A;  2RQV A;  1NE8 A;  1NM7 A;  1VQ5 T;  5FU6 C;  4ZTJ A;  1YJ9 A;  4WTO B;  3V7C A;  1UG1 A;  2LP5 A;  1IZ6 A;  2AHJ B;  1WQW A;  1OI1 A;  1IXD A;  4LN2 A;  1PC0 A;  4DOV A;  3VS6 A;  2DF6 A;  4C92 D;  2EBP A;  2JN0 A;  2BZX A;  3I55 A;  2FB7 A;  2XU8 A;  3H0I A;  5GAN 4;  2DL3 A;  1QVG P;  3OA6 A;  1T0H A;  4LDW A;  1TS9 A;  1QCN A;  3NTI A;  2IIM A;  4C0F A;  4JRK A;  4FL6 A;  3OYE A;  4J6W A;  5KYU A;  1Q81 U;  1QVG S;  2DM1 A;  2KDS A;  4ELY C;  2X4X A;  2VUB A;  4BE1 A;  3CCL A;  2NUT A;  4F17 A;  1I5O B;  5GMK m;  5LJ5 d;  1H92 A;  1ZA1 B;  4M7A B;  2VV5 A;  4C5H A;  2PNI A;  3JCM f;  2QA4 A;  5I2S A;  3L2W A;  2KR3 A;  4J9H A;  2BE9 B;  2EQK A;  3JCM g;  3A5Z B;  3RUX A;  1W70 A;  3JCM X;  4C0G A;  4RMO A;  1MMD A;  2LCS A;  4MZM A;  1JXO A;  1H3H A;  2V1Q A;  5GAM e;  3QJ6 A;  1ZA2 B;  3PGG A;  4KGX B;  2LT4 A;  3L42 A;  2CGH A;  2DE0 X;  3SD4 A;  3JCM P;  2DXT A;  2GTJ A;  4M7A A;  1Q86 C;  4FM4 B;  1YWP A;  2LCL A;  5C0M A;  4WF2 A;  5I22 A;  2ESW A;  2RHX A;  1YHQ T;  4PJO C;  4OB0 B;  4QQG A;  2DD4 A;  1NEB A;  2K4Y A;  2P0Q A;  5I11 A;  2ZPH B;  4AT1 B;  3CXC P;  3L1A A;  1M1K R;  3M9Q A;  5GAN 6;  3WVD B;  4M77 F;  1U1T A;  2EIF A;  3HL8 A;  3OS0 A;  4M77 E;  4RG2 A;  2VWF A;  3CCR T;  3CXC S;  4RCC A;  3CCM A;  4C8Q C;  2RJE A;  2PTK A;  3O8V A;  2X4Y A;  1S72 Q;  2NUZ A;  1NJI R;  2XID A;  3GLX A;  2L5Q A;  3UWN A;  2CP5 A;  3LGL A;  1YIT T;  3VYH B;  4XU2 A;  2KEA A;  5GAO r;  4E7L A;  4NOY A;  1N8R C;  2X3W D;  2DKG A;  2GCX A;  3H9N A;  3V8K A;  3QYG B;  2GNC A;  3A8M B;  1D3B B;  1K8A U;  5IAY A;  1MHN A;  3H41 A;  2JW4 A;  3NMZ C;  1VQL A;  1VQ9 A;  3ER0 A;  9ATC B;  1TOV A;  3I56 A;  2CSQ A;  2FZC B;  3A8H B;  3M56 A;  4M77 C;  3AT1 B;  1W4S A;  4C92 B;  5LJ3 j;  2HAX A;  2JUF A;  5IT9 E;  3QWY A;  1AWO A;  4HCZ A;  5LJ5 e;  4CC7 A;  3CCS T;  4MDX A;  4QW2 A;  1TUG B;  3M0R A;  1RLQ C;  2LC4 A;  3ZFJ A;  2LCC A;  1X43 A;  2KGT A;  4HVV A;  4HT9 A;  3CPW P;  4J9E A;  4ELZ C;  3CME A;  1KD1 R;  4QQD A;  2LNH B;  1N5Z A;  1VQP A;  4OMM A;  3CC4 T;  5GMK l;  2LQ8 A;  2RH2 A;  1TTH B;  2BIV A;  2ED1 A;  3CPW S;  1BK2 A;  3JCM b;  1RAF B;  5KE2 A;  3V8J A;  1WHJ A;  5CKF A;  2YRV A;  2D9T A;  4LDX A;  2L3P A;  1W2B A;  1Z9Z A;  3UPU A;  3TU4 K;  1YHQ Q;  1WNL A;  3JB9 D;  1YIJ T;  2R5M A;  3SB2 A;  2EW3 A;  1XQH A;  3ME9 A;  1G3S A;  3T9N A;  3CCQ A;  5CQY A;  5GAN 5;  2FHD A;  4J83 A;  1YN8 A;  2KQW A;  2RHU A;  2Y4Y A;  3CBM A;  5CIU A;  4Z89 A;  1BI3 A;  3CCR Q;  4ZN1 A;  4JS4 A;  1VOM A;  3N5B B;  3QKJ A;  2AIR B;  4LUE A;  1M90 C;  4JZ3 A;  4PFZ A;  1JO8 A;  3VUB A;  4AFZ C;  1K9A A;  3CCV A;  3QZ5 B;  4FW1 A;  5CCA A;  5LJ3 h;  2XK0 A;  2MCN A;  1YIT Q;  1PRL C;  3VV0 A;  2WSE E;  3I55 T;  1I5L A;  3MKD A;  2QXF A;  3J81 E;  1AEY A;  3GP8 A;  3X25 B;  3EGU A;  3PMI A;  1VQ6 T;  8AT1 B;  1NEG A;  1VQK Q;  2A7Y A;  1TU0 B;  1VQ7 A;  3U23 A;  4M78 A;  4D8K A;  4ORZ A;  1Q81 R;  3LX7 A;  3VS0 A;  3X28 B;  2COW A;  2M16 A;  3HP9 A;  3OW2 A;  2SEM A;  1TXQ A;  5KYW B;  2VVK A;  4E7I A;  2DX1 A;  2EPD A;  2R58 A;  4M75 A;  4OML A;  2J6O A;  5FRO A;  4WCI A;  1GFC A;  2V1R A;  1OPL A;  4BI3 A;  2FRY A;  3CCS Q;  2E65 A;  1MMN A;  2ZPI B;  1RI0 A;  3ZEH A;  2OAW A;  1OYX A;  2E4H A;  2MF2 A;  2ATC B;  3EFO B;  2KXC A;  3I35 A;  3R6N A;  1N9S A;  1QQJ A;  5GAO n;  1WXT A;  2CS7 A;  3JCM W;  4PJO D;  2RHZ A;  1RAG B;  1WJS A;  2DPP B;  4PFP A;  1D1C A;  2LDM A;  2VGM A;  4DOW A;  2E41 A;  4FIB A;  3SHW A;  1RAI B;  1RAE B;  4AFQ C;  5KYN A;  2E3I A;  1OEB A;  3BDL A;  2KYB A;  3QBY A;  1FMV A;  4AFU C;  1YIJ Q;  2ZPE B;  2F2W A;  1GFD A;  3VS2 A;  1FMK A;  4XQ3 A;  5GMK j;  3X26 B;  2GF7 A;  4OB3 B;  4ZGE B;  4C92 C;  2DZ9 A;  2ZPF B;  3OBW A;  2M0O A;  4C5G A;  1RLP C;  5EG2 A;  1SKU B;  2RM4 A;  4JUV A;  2EYQ A;  1RUW A;  1M3B A;  1WDX A;  4PLL A;  2HL5 C;  1H8K A;  1SPK A;  2XKO C;  1UHF A;  2F2V A;  1ZSZ A;  2HQX A;  1JB0 E;  5A0L A;  2CP7 A;  3EG1 A;  5CR2 A;  1GRI A;  6AT1 B;  1K73 C;  4M75 G;  2E64 A;  4KH0 B;  3LWI A;  1F1B B;  3CCE A;  1VQ6 Q;  3VJP A;  5LJ3 e;  1M4Z A;  2KRN A;  2CP0 A;  1KC8 U;  4DEY A;  2EJF A;  3TVT A;  3DB4 A;  4M77 D;  4LNP A;  3I5S A;  3WXM B;  5M9O A;  1OZ3 A;  1BI2 A;  3E1S A;  3CCU A;  1NPP A;  5AT1 B;  2CRE A;  3A1P A;  1WHH A;  2V8I A;  2ECZ A;  3TRE A;  4RTZ A;  4ANJ A;  2EQU A;  1JXM A;  1WHL A;  1M3A A;  3VS4 A;  5GAN j;  1T0J A;  2M9U A;  5GMK h;  1KHC A;  4GLM A;  2E12 A;  4QQ6 A;  2YLC A;  3MEA A;  3PVQ A;  3CMA T;  4QVZ A;  1BCM A;  4OMF B;  4RTT A;  5FLX E;  1W2B P;  1VQP T;  2O4X A;  1IB8 A;  2ENM A;  3G4S A;  2O9V A;  5KYY B;  1X75 C;  2EFI A;  3HKS A;  1NJI U;  5AYF A;  1VQO Q;  4RCB A;  1UJ0 A;  2JXB A;  4J7I A;  1W2B S;  2DXU A;  4LDV A;  4OMN A;  1GCQ C;  2DNU A;  2DAQ A;  3I5R A;  3PFS A;  1UGP B;  3S3M A;  4RTX A;  1U06 A;  2D1X A;  3HHT B;  4CC4 B;  4E47 A;  1B07 A;  4OGC A;  2BZ8 A;  1TUC A;  5FWC A;  2QTX A;  4JRP A;  1Q7Y C;  3VS3 A;  2RB6 A;  1KG1 A;  1ABO A;  1YJN T;  3QYH B;  2MWP A;  3EGD B;  1JQQ A;  4FYV B;  1VQ4 A;  4B6M A;  1OUL A;  2DTO A;  5KCH A;  1B3Q A;  1HK9 A;  3CCV T;  3PNW C;  4O6J A;  1QVF A;  1BIB A;  3EG9 A;  5KYX A;  1QVP A;  3GPL A;  4P5N A;  1BKB A;  2J7I A;  3HPW A;  2V8J A;  1R0C B;  3OYK A;  2HZY A;  3M59 A;  2RO0 A;  4M7D G;  5J3B A;  3H0H A;  3OW2 P;  1QCO A;  1EZZ B;  4HCK A;  4QVD A;  1IRE B;  1KD1 U;  2FPF A;  2VXF A;  1KK7 A;  3S3O A;  2RJF A;  4PJO A;  4JRI A;  4M7D F;  2CYZ B;  3G1J A;  2ZZD A;  2DYB A;  3QDR B;  4M7D E;  5EC7 A;  2RPN A;  4LD6 A;  3OW2 S;  1D0X A;  2CKK A;  4BUG A;  1PWT A;  1AD5 A;  2KI7 A;  5GAM f;  3CBP A;  3I9Q A;  1R8O B;  1QP2 A;  3M5A A;  4J7F A;  2X3X D;  2Y4X A;  3KXT A;  3BFM A;  1N8R U;  1X6B A;  2JTF A;  1G3T A;  5GAM g;  2A36 A;  2RQT A;  3TQ7 P;  1UGS B;  3CC7 A;  2GQI A;  2OTJ Q;  2G3R A;  4ZTF A;  4C8Q A;  2HD0 A;  2IPO B;  1UGV A;  2EAY A;  4F7U G;  1X2Q A;  5CQX A;  3CMA Q;  1UB4 A;  2YLB A;  1B7T A;  4M77 B;  5FRN A;  4F7U F;  1MND A;  1KQS S;  1YJW A;  1V29 B;  2JNG A;  1OU8 A;  1QLY A;  5CVI A;  4F7U E;  1ZBJ A;  1WIE A;  2X35 A;  1XJW B;  3V8L A;  2OTL Q;  5GAN 2;  1I1J A;  1OX8 A;  4IUU A;  3UDC A;  3QSU A;  1D1A A;  3OMC A;  3LWH A;  4KH1 B;  3X20 B;  1QWF A;  2K2V A;  1IHV A;  4O5V A;  3D7S B;  4GBQ A;  3MEW A;  1QKW A;  4BD3 A;  4DBH A;  4XAX B;  1SEM A;  4BI4 A;  1ZHI A;  1YJN Q;  2E3H A;  2HKN A;  4A4E A;  4PJJ A;  1M30 A;  1LPL A;  4IUP A;  2RHY A;  3HTR A;  4EMK C;  1UJY A;  3FC3 A;  3JCM h;  1PD1 A;  3G71 A;  2CH4 W;  3JRZ A;  1M1G A;  2QDL A;  1JJ2 A;  4JZ4 A;  7AT1 B;  2HQH A;  1M8V A;  1WPY A;  2DXB A;  5LJ5 f;  2KMT A;  2E6Z A;  1QKX A;  1ZQ1 A;  4C8Q G;  2H8H A;  1TSF A;  2LJ1 A;  2DJZ A;  2YT6 A;  5GAO p;  3TEE A;  2RN8 A;  4HCB A;  1M90 U;  2YUP A;  1MV3 A;  1K1Z A;  5LJ5 g;  1NYF A;  1KC8 R;  2HSP A;  2C06 A;  2FO0 A;  4FYX B;  4PKC C;  2QYZ A;  3CCU T;  4JJC A;  3CEY A;  2DIL A;  2EQM A;  1U1S A;  1ZUU A;  4MDW A;  1KQ1 A;  1UTI A;  3QG1 A;  1YCY A;  4D8D A;  1KQ2 A;  1V76 A;  1K4U S;  2L89 A;  1UDL A;  3REA B;  1YBY A;  5D7U A;  4MML A;  3E2U A;  2QTV A;  3LGF A;  2RQW A;  1WJR A;  4DBR A;  4FT2 A;  3G4S T;  4AMC A;  1E6G A;  1GL5 A;  1VQ5 Q;  1NPR A;  2A3L A;  4RTV A;  1N6A A;  1XNI A;  1SHG A;  4L6V 5;  1QMC A;  2ROL A;  5CO7 A;  1WA7 A;  2DO3 A;  2HBP A;  2QQS A;  1BYM A;  2QEX A;  4HXJ A;  4JLG A;  3SWN C;  2NLU A;  3CPF A;  4XU3 A;  3VS1 A;  1VQ8 A;  3C94 A;  2F69 A;  3E19 A;  3NHN A;  1MMA A;  1QVF P;  1CKB A;  3CD6 T;  3PIO A;  4NS5 A;  2CH4 A;  1D0Z A;  4EPC A;  3HRU A;  1ZLM A;  2COY A;  2HNI A;  4F14 A;  1HYO A;  1Q86 R;  2D8H A;  1UUE A;  2DTH A;  1V1C A;  2YUQ A;  5GJW B;  1QVF S;  4AG2 C;  1OOT A;  4BE2 A;  3G6E A;  4V2S A;  2KE9 A;  1FYN A;  2MWO A;  3IQL A;  3HFN A;  1RI9 A;  1K0S A;  3CCJ A;  2NWM A;  4A54 A;  3J7A F;  1VQN T;  4M7A G;  1UHC A;  1D3B A;  2RNA A;  2XMF A;  4IUR A;  1ZUK A;  2GQV A;  2A28 A;  3MEU A;  3MO8 A;  5GAN 7;  2CZ0 B;  4M7A F;  1K9M C;  2DJQ A;  2E5Q A;  3FDR A;  3HFO A;  3M58 A;  3RKX A;  3RMQ A;  3JB9 I;  4M7A E;  4X9C A;  1VQM A;  3E9G A;  4L5G A;  2FL7 A;  2MPX C;  3MEV A;  2J6K A;  4N0A A;  2CZ6 B;  4LD9 K;  4JRQ A;  1BU1 A;  3QXE B;  4C92 A;  1X01 A;  5IHN A;  3GNG A;  4AFS C;  3CC2 A;  4OMQ A;  2MOX A;  2CP3 A;  2DZC A;  4AG1 C;  1N8R R;  2CT4 A;  3SEM A;  1H64 1;  1YI2 A;  2A0F B;  4OMO A;  4J8O A;  2W0Z A;  2QQB A;  3PT9 A;  3JCM Q;  1OPK A;  1Y71 A;  1C1A A;  5D6Y A;  3H0F A;  2PU9 B;  2KVQ G;  3OYA A;  2R57 A;  2WAC A;  3QO3 A;  4PJM A;  1FMW A;  3DLM A;  4OGE A;  1AWX A;  1PNJ A;  2L3R A;  3MP8 A;  1U8R A;  1WHM A;  1YJW T;  1Y96 B;  4BAC A;  2HKQ B;  2VYT A;  1YJ9 T;  2VKN A;  3FRN A;  2LNV A;  4JLI A;  2AKK A;  3M55 A;  2COZ A;  3MET A;  2V8K A;  3OYJ A;  4XTW A;  5LJ3 d;  3G7Z A;  1Q82 C;  5IHK A;  1Y0M A;  2MIO A;  2F5K A;  4PK4 A;  1VIE A;  2GTO A;  1FXX A;  2CZ1 B;  2ZCF B;  1G5V A;  4OP0 A;  4A63 B;  2H3J A;  3L2R A;  2MAM A;  2J06 A;  2K3B A;  2BUD A;  1WI7 A;  1BCO A;  3E9F A;  2HEQ A;  2K9G A;  3QWX X;  4LDU A;  2LQW A;  3CCL T;  3QJY A;  1JJ2 P;  2DET A;  2LZ6 B;  3M0Q A;  5LJ3 g;  1MGQ A;  2AK5 A;  3OMG A;  2FPD A;  5L8R E;  3G71 T;  5LL6 S;  2AZS A;  1SRL A;  5DLO A;  1JJ2 S;  1VQN Q;  2PZ1 A;  2QA4 T;  1GXI E;  4C92 G;  3JCM J;  1E6H A;  1Q7Y U;  2WSF E;  4UC4 A;  3RBB B;  1GCQ A;  5D6X A;  2YRC A;  2ZAE A;  4A4K A;  3CQT A;  2QQR A;  3CC4 Q;  1M90 R;  5KYW A;  2D0Q B;  2RQU A;  4FYY B;  3VS5 A;  2LT1 A;  3UT1 A;  1NG2 A;  1WQ7 A;  2QAZ A;  4BB7 A;  1K8A C;  1VA7 A;  4J9F A;  2KAF A;  1CKA A;  2EJG A;  2J6F A;  5FWB A;  1D0Y A;  2RJD A;  1VYT A;  4QT7 A;  1Y7X A;  3UA7 A;  1YP5 A;  3EFO A;  4N4G A;  1VQ5 A;  1HXD A;  1S72 A;  3J80 E;  3AHU A;  3OY9 A;  2JJ9 A;  2EGE A;  1WJQ A;  1K0X A;  3CCM T;  4IKF A;  2EQJ A;  1YJ9 Q;  4OB1 B;  4M78 G;  1HD3 A;  2E6N A;  3M4Y A;  2O01 E;  2WSC E;  1VYV A;  3OS1 A;  5CKD A;  4CRI A;  4M78 F;  1OU9 A;  3JCM c;  3BY7 A;  1AVZ C;  3I55 Q;  2QEX T;  2G6F X;  3BW1 A;  1B34 B;  4M78 E;  2XHC A;  2MMP A;  2KYM A;  3NFC A;  3QII A;  1PSF A;  3JSC A;  1UFF A;  1SSH A;  2C0I A;  2LMJ A;  1YCS B;  8ATC B;  1VQL T;  4M75 F;  1VQ9 T;  1IRX A;  4ME7 A;  3OYY A;  3SDZ A;  2M0Y A;  4FSS A;  4M75 E;  1MNE A;  4A4G A;  3I56 T;  4X1V A;  1KSW A;  1UEB A;  2LQN A;  2EYY A;  4MZT A;  5IH2 A;  3G6E T;  3EFS A;  3PIP A;  1M3C A;  2NUP B;  3CCJ T;  1T3L A;  3MHX A;  4BY6 B;  1BBZ A;  4J5Y A;  1BIA A;  2LTO A;  2CUD A;  4IUT A;  2QA4 Q;  3PE0 A;  2EKH A;  2EYW A;  3VU3 C;  5FU7 C;  1WXB A;  3M57 A;  4JJB A;  1S1N A;  1AZE A;  3H8Z A;  3RER A;  3CME T;  2ZPG B;  4EMK B;  1Y57 A;  3ASK A;  2D8J A;  1VQM T;  1SG5 A;  1YHQ A;  1TUD A;  3EG2 A;  4F7U B;  5GAM j;  2DYI A;  4HVU A;  4BDZ A;  2A08 A;  2EKO A;  2HBW A;  2BTT A;  2K7A A;  3UA6 A;  3OYG A;  2JMC A;  1VIF A;  4M75 C;  2W10 A;  3OBY A;  2RQR A;  3CCR A;  2JM8 A;  4F04 B;  1K73 R;  1YFN A;  2RI3 A;  1DJ7 B;  2C0O A;  5ECA A;  3CCQ T;  1EFN A;  1YIT A;  2P84 A;  2H3E B;  3EHR A;  4LDY A;  5KYY A;  2RHI A;  4J9D A;  2DK3 A;  5FW9 A;  3NTH A;  2CSI A;  4ESR A;  1Q86 U;  3CCM Q;  2FZK B;  2L8D A;  4L59 A;  2X9H A;  4F16 A;  2JVV A;  3SFM A;  4C5I A;  5KCO A;  4PL6 A;  2DTI A;  1A0N B;  2JM9 A;  4OF1 A;  4XU1 A;  5CAI A;  1VQK A;  1NLP C;  5GAN h;  2V26 A;  1BI0 A;  3JB9 G;  2JOY A;  5HK3 A;  1G8X A;  2ZGW A;  2DER A;  1D1B A;  1AHJ B;  2L0A A;  1GBR A;  2DL8 A;  3MJX A;  1LCK A;  1AZG B;  2DEQ A;  5A0G A;  2P4R A;  1LJO A;  4OB2 B;  4NL3 A;  3OYD A;  1VQL Q;  4FCY A;  1VQ7 T;  2FEI A;  1VQ9 Q;  3EGD A;  4BDY A;  3MP6 A;  5GAM h;  1SF9 A;  2P4T A;  4XU0 A;  3VRY A;  3M54 A;  2FYK A;  3I56 Q;  3CCS A;  2EWN A;  4MZP A;  2DIG A;  3SWN B;  1M2V B;  5GAN 3;  2YRD A;  5D6W A;  4OMP A;  3EG0 A;  1KFZ A;  2QDY B;  1AWJ A;  3FEO A;  2YUO A;  3JCM V;  2LVM A;  1NZ9 A;  4A4F A;  5LJ5 j;  3PMT A;  1Q7Y R;  2F5T X;  3V7S A;  2EYX A;  3DB3 A;  3FLG A;  1M8M A;  1M5Q 1;  5GJV B;  3CME Q;  1I8F A;  1U5S A;  2XDP A;  4KT0 E;  1VQP Q;  1YIJ A;  5CKE A;  2A37 A;  5GMK e;  2CDT A;  4Q5W A;  1ZX6 A;  2M51 A;  1W1F A;  1W6X A;  2EJ9 A;  4MMK A;  4C0D B;  4FU6 A;  2MK5 A;  4JJD A;  1IGQ A;  4M7D C;  3M4G A;  2BZY A;  2ROT A;  3ULR B;  5KYU B;  1OX9 A;  1K9M U;  3KBG A;  4EMH A;  1KC8 C;  5IXB A;  1S72 T;  4LE9 A;  4J6Y A;  1H3Z A;  4M77 A;  2NUT B;  4HKE A;  3CCQ Q;  1PM3 A;  1MUZ A;  3OB9 A;  4BY6 C;  2O88 A;  3GIB A;  3RIR A;  1E7O A;  4R56 A;  1UE9 A;  2QK0 A;  4RTY A;  1NLO C;  1CSK A;  1C0M A;  2RK2 A;  4PJO G;  4XTV A;  1ACM B;  1M1K C;  3CCV Q;  4ZGJ B;  1VQ6 A;  2E1H A;  5DLQ E;  5IN1 A;  1C6V X;  4RG8 A;  2HMA A;  3VRZ A;  4PJO F;  4PFO A;  3QHS A;  2O2O A;  2F1L A;  2CZ7 B;  4PJO E;  2DBM A;  2M02 A;  3JCM d;  1TG0 A;  1WGS A;  5LJ5 h;  2KRO A;  1RAA B;  1JU5 C;  4DBF A;  2DVE A;  3CCE T;  4M4Z A;  1QP3 A;  1NJI C;  2PUO B;  2P0K A;  2C0T A;  3X24 B;  1OQK A;  2DRM A;  1VQ7 Q;  1QW1 A;  5GAN e;  2OAU A;  4C8Q F;  2RJC A;  4E6R A;  4Y91 A;  1KHI A;  1UEC A;  4C8Q E;  3L2Q A;  1Q82 U;  1RAC B;  4J9B A;  2KT1 A;  2YXY A;  1SHF A;  4KUI A;  2CP2 A;  4YTL A;  2B8A A;  1GBQ A;  1VQO A;  4ZN3 A;  1IO6 A;  1YNZ A;  4M78 D;  1QCF A;  3M0T A;  1OZ2 A;  4OVA A;  2O9S A;  2K5F A;  1RL2 A;  5GAN 8;  1I4K 1;  4D6W A;  4E7S A;  2RMO A;  2I0N A;  4M77 G;  4Z8A A;  5HY6 A;  4M75 D;  1WHG A;  2XI9 A;  4FSX A;  4KRT A;  2HQE A;  3FJ5 A;  3RKW A;  2L2P A;  1BB9 A;  1TWB A;  1LOJ A;  3OYB A;  2K79 A;  1KD1 C;  2PVD B;  4RTU A;  4XTY A;  5HCK A;  3JV3 A;  2FRW A;  4TVR A;  1XTD A;  3LLR A;  1G3Y A;  1N27 A;  2BKD N;  4CC3 A;  3GNF B;  3VS7 A;  3L2U A;  2FZG B;  3EGX B;  1K76 A;  3EH1 A;  2QAS A;  4C5E A;  3EFR A;  2ZPB B;  1VQ4 T;  5CKH A; 
#chains in the Genus database with same CATH homology
 2LP5 A;  1VYU A;  4RTT A;  1E6H A;  1M27 C;  2ENM A;  2LX7 A;  4LN2 A;  3RBB B;  2O9V A;  3VS6 A;  1PKT A;  2DF6 A;  2EBP A;  1GCQ A;  2BZX A;  1UJ0 A;  2JXB A;  3H0I A;  4OMN A;  1GCQ C;  2DL3 A;  2DNU A;  3I5R A;  4DEX A;  1T0H A;  3CQT A;  4J9C A;  2EVR A;  4CC2 A;  4RTX A;  1U06 A;  2D1X A;  2IIM A;  3KFV A;  3M0S A;  4CC4 B;  4R0K A;  2RQU A;  1B07 A;  3VS5 A;  1SRM A;  2BZ8 A;  3A98 A;  1NG2 A;  1TUC A;  5FWC A;  3EHQ A;  2DM1 A;  1WFW A;  3REB B;  4F17 A;  2DLP A;  2FG0 A;  3VS3 A;  2DL5 A;  1VA7 A;  4J9F A;  1CKA A;  2J6F A;  1ABO A;  5FWB A;  4RTW A;  1H92 A;  1VYT A;  1HSQ A;  4QT7 A;  1XOV A;  3PVL A;  3UA7 A;  1YP5 A;  2PNI A;  1JQQ A;  3ZL7 C;  1B3Q A;  2KR3 A;  2LJ0 A;  4J9H A;  2EGE A;  1K0X A;  3LH5 A;  1ABQ A;  2J7I A;  1GCP A;  1W70 A;  2B86 A;  2LCS A;  1JXO A;  1H3H A;  2YDL A;  2V1Q A;  1X69 A;  1HD3 A;  2SRC A;  1VYV A;  3H0H A;  2OI3 A;  4HCK A;  2DE0 X;  2FPF A;  2CUB A;  2GTJ A;  2GBQ A;  1YWP A;  1AVZ C;  5I22 A;  3M0P A;  2G6F X;  2ESW A;  2DYB A;  5EC7 A;  2KYM A;  2RPN A;  1PWT A;  1AD5 A;  1UFF A;  1NEB A;  1SSH A;  2C0I A;  1YWO A;  3I9Q A;  2LMJ A;  5I11 A;  4Z88 A;  1YCS B;  2X3X D;  1X27 A;  1X6B A;  2M0Y A;  4FSS A;  2A36 A;  2RQT A;  4X1V A;  1G2B A;  1KSW A;  2GQI A;  2LQN A;  2EYY A;  5IH2 A;  2VWF A;  2KRS A;  1WLP B;  1UGV A;  4RUG A;  1M3C A;  1X2Q A;  1T3L A;  2O31 A;  2PTK A;  2NUZ A;  1BBZ A;  3THK A;  2CUD A;  2EYZ A;  3PE0 A;  2EKH A;  2EYW A;  2D0N A;  2RF0 A;  1WX6 A;  5IXF A;  1WXB A;  2DBK A;  1QLY A;  2KEA A;  4JJB A;  1ZBJ A;  1WIE A;  1S1N A;  1AZE A;  2X3W D;  4EIK A;  1I1J A;  2GNC A;  1Y57 A;  2D8J A;  1PHT A;  1TUD A;  4Y92 A;  3EG2 A;  1G83 A;  1MV0 B;  4HVU A;  3H41 A;  2A08 A;  2JW4 A;  3NMZ C;  1J3T A;  2HBW A;  2BTT A;  2K7A A;  3UA6 A;  1QWF A;  4GBQ A;  2DA9 A;  2JMC A;  3NPF A;  1QKW A;  2CSQ A;  2W10 A;  2RQR A;  2HCK A;  1SEM A;  2JM8 A;  2E5K A;  2JTE A;  2C0O A;  5ECA A;  3QWY A;  1AWO A;  1M30 A;  1EFN A;  2AZV A;  4CC7 A;  3EHR A;  3M0R A;  2ED0 A;  1RLQ C;  4J9D A;  1UJY A;  1X6G A;  5FW9 A;  2CSI A;  4ESR A;  1X43 A;  2KGT A;  1ZSG A;  2CH4 W;  4HVV A;  4J9E A;  2FPE A;  4F16 A;  2LNH B;  1N5Z A;  4OMM A;  2QDL A;  4JZ4 A;  1A0N B;  2JM9 A;  1OV3 A;  1PKS A;  2ED1 A;  1BK2 A;  1QKX A;  1AWW A;  4ZNX A;  2JS0 A;  1HJD A;  3RNJ A;  1NLP C;  2H8H A;  2LJ1 A;  2YT6 A;  2DMO A;  2RN8 A;  2L3P A;  2YUP A;  1MV3 A;  1K1Z A;  1Z9Z A;  2KRM A;  1NYF A;  2HSP A;  2L0A A;  1GBR A;  2FO0 A;  2JT4 A;  2DL8 A;  2K6D A;  1LCK A;  1AZG B;  4JJC A;  2DL7 A;  2DIL A;  2P4R A;  2EW3 A;  1ZUU A;  2FEI A;  1UTI A;  2DVJ A;  1U3O A;  3VRY A;  2EGA A;  4D8D A;  1YN8 A;  1K4U S;  1UDL A;  4Z89 A;  2KBT A;  3REA B;  3M0U A;  4OMP A;  3EG0 A;  1KFZ A;  4LUE A;  1JEG A;  1AWJ A;  4JZ3 A;  2RQW A;  1JO8 A;  4AFZ C;  1K9A A;  2YUO A;  2MCN A;  4J9I A;  1E6G A;  1PRL C;  1GL5 A;  1AOJ A;  2EYX A;  3GBQ A;  1M8M A;  5GJV B;  4RTV A;  1AEY A;  3O5Z A;  1U5S A;  3UF4 A;  1SHG A;  3EGU A;  1I07 A;  2ROL A;  2A37 A;  2L3S A;  2CDT A;  1WA7 A;  1ZX6 A;  1NEG A;  2M51 A;  1W1F A;  4HXJ A;  1W6X A;  3U23 A;  4D8K A;  2J05 A;  2L3Q A;  3VS1 A;  4ORZ A;  4JJD A;  3VS0 A;  3NHN A;  2SEM A;  2BZY A;  3C0C A;  2ROT A;  2VVK A;  1CKB A;  2DX1 A;  3ULR B;  2CH4 A;  3TSW A;  1I0C A;  2EPD A;  4OML A;  1ZLM A;  5IXB A;  2J6O A;  4LE9 A;  4WCI A;  1GFC A;  4F14 A;  2JS2 A;  2V1R A;  1OPL A;  2D8H A;  1UUE A;  4JPB W;  1V1C A;  2YUQ A;  5GJW B;  2YSQ A;  1MUZ A;  2FRY A;  4AG2 C;  2O88 A;  1OOT A;  1E7O A;  2KE9 A;  1FYN A;  3IQL A;  1RI9 A;  2OAW A;  4K11 A;  1K0S A;  1UE9 A;  2NWM A;  4RTY A;  1NLO C;  1WXU A;  1ARK A;  2KXC A;  1CSK A;  1UHC A;  3I35 A;  2RNA A;  2XMF A;  3R6N A;  1ZUK A;  2A28 A;  1WXT A;  5IHI A;  3VRZ A;  2O2O A;  2DJQ A;  2DBM A;  1TG0 A;  3SHW A;  1KIK A;  2KRO A;  2F2X A;  4AFQ C;  1NYG A;  2J6K A;  1OEB A;  1JU5 C;  2OJ2 A;  4IIM A;  2KYB A;  4M4Z A;  2DRK A;  4AFU C;  2F2W A;  1BU1 A;  3VS2 A;  1GFD A;  2C0T A;  5IHN A;  1FMK A;  4AFS C;  4OMQ A;  2DRM A;  2MOX A;  5L23 A;  2DL4 A;  4AG1 C;  2CT4 A;  2YUN A;  2AKL A;  3SEM A;  4E6R A;  1RLP C;  2EQI A;  2K2M A;  3EG3 A;  2JMA A;  2GGR A;  4OMO A;  1UEC A;  2W0Z A;  1OPK A;  1T3S A;  1WYX A;  1PRM C;  3H0F A;  4J9B A;  2KT1 A;  1RUW A;  1SHF A;  1M3B A;  1WDX A;  1H8K A;  1SPK A;  1X2K A;  1AWX A;  1PNJ A;  2KXD A;  1GBQ A;  1UHF A;  2F2V A;  1IO6 A;  1YNZ A;  1QCF A;  3M0T A;  1KJW A;  2O9S A;  2CT3 A;  2ABL A;  3TSZ A;  2VKN A;  3EG1 A;  4J9G A;  1GRI A;  2AKK A;  2RMO A;  2I0N A;  4Z8A A;  3UAT A;  2KNB B;  4HVW A;  2KRN A;  4KRT A;  4DEY A;  5IHK A;  1Y0M A;  2MIO A;  2LJ3 A;  2HDA A;  3TVT A;  2EGC A;  2GTO A;  4LNP A;  3I5S A;  3FJ5 A;  4A63 B;  2L2P A;  1BB9 A;  3NGP A;  2K79 A;  4RTU A;  5HCK A;  2J06 A;  4IIO A;  2K3B A;  3JV3 A;  1ZUY A;  1WI7 A;  2CRE A;  2FRW A;  2ECZ A;  1QWE A;  2HEQ A;  2K9G A;  3QWX X;  4RTZ A;  2LQW A;  1JXM A;  2KT8 A;  1M3A A;  3VS4 A;  2LZ6 B;  4LUD A;  3M0Q A;  1T0J A;  4CC3 A;  3VS7 A;  1Z9Q A;  2RQV A;  4GLM A;  1K76 A;  3PVQ A;  2AK5 A;  1NM7 A;  2FPD A;  2AZS A;  1SRL A;  1UG1 A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...