4CC2A

Complex of human tuba c-terminal sh3 domain with human n-wasp proline- rich peptide - p212121
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords DYNAMIN-BINDING PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 63
sequence length 63
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc2A00
2DVJA 2A36A 1BK2A 2AK5A 5IH2A 2PNIA 1GBQA 4ZNXA 1JEGA 3EG1A 2H8HA 1S1NA 4HVVA 1CSKA 1KJWA 3JV3A 2KT1A 1AWWA 1YN8A 2HCKA 2JMAA 1WYXA 1UG1A 1I0CA 1HJDA 2KRNA 2C0TA 4D8DA 2YDLA 2K3BA 3I35A 3TSZA 1K0XA 3UA7A 2DA9A 4CC2A 1M27C 1WLPB 2ROLA 2ED0A 3CQTA 2AKKA 1HD3A 2AKLA 2KT8A 1N5ZA 1X69A 1UTIA 1SHGA 2YUQA 4OMQA 4AG2C 1WXTA 2CDTA 2DILA 2W10A 2JXBA 1QWFA 1UHCA 2RQUA 2V1RA 1TUDA 3SHWA 2ESWA 1ZLMA 2FEIA 2O31A 4J9BA 1GFDA 2K2MA 3IQLA 3H0IA 2C0OA 2HDAA 1JO8A 3TVTA 1VA7A 1PKSA 2EQIA 4DEYA 3M0SA 2MCNA 2PTKA 4HXJA 1AEYA 2EKHA 2P4RA 2CT3A 2CSQA 1OV3A 1JXMA 1MUZA 1AWJA 2GBQA 4Z8AA 2LZ6B 2K79A 2LJ0A 2KXCA 2RQTA 2L3PA 1GRIA 1ZUKA 1AD5A 2XMFA 1AVZC 1FYNA 1PNJA 4ORZA 2CT4A 3VS7A 5I11A 2F2VA 2RN8A 1X6GA 1CKAA 2HBWA 1Z9QA 2HSPA 2JS0A 3M0QA 4J9CA 2DF6A 2FRYA 3KFVA 2IIMA 4JPBW 4OMMA 3U23A 1AWXA 2A08A 2SEMA 1ABOA 1GFCA 4RTTA 4RTZA 2EGAA 1RUWA 2I0NA 1U5SA 1BU1A 2LQWA 1KSWA 2E5KA 4X1VA 4AFQC 1QCFA 1NG2A 5ECAA 4AFZC 1K4US 4M4ZA 4KRTA 4OMPA 3M0TA 1UUEA 2KRMA 2LQNA 5EC7A 5IXFA 1NYGA 1E7OA 2BZXA 3M0PA 2DMOA 2GTOA 1MV0B 2AZVA 1U06A 2YUPA 1YP5A 4J9GA 4F14A 2DBKA 1X2KA 1GBRA 2NWMA 1WIEA 3GBQA 2KGTA 2RQRA 2KRSA 1WXUA 4RTYA 3VS1A 1QLYA 1ZBJA 2FG0A 2J6OA 3NGPA 1J3TA 4J9HA 2X3WD 4AFUC 2ABLA 4LE9A 1AZEA 1K1ZA 2EYXA 1ZX6A 2L3SA 1V1CA 1AZGB 2RPNA 1OOTA 2KNBB 1QKWA 2A37A 1WXBA 2L3QA 4D8KA 1G83A 4IIOA 3VS3A 4E6RA 2D1XA 3UATA 4ESRA 2M51A 1MV3A 3LH5A 4LNPA 3EGUA 5GJVB 4CC3A 2SRCA 1IO6A 2KR3A 2F2WA 2FO0A 2VVKA 3VS2A 2DL5A 1PHTA 4GBQA 1NEBA 2KYMA 1VYVA 1YNZA 3UF4A 1KIKA 1K0SA 3EHRA 1T0JA 2DM1A 2LJ3A 1K76A 1B3QA 3VS4A 1A0NB 1ZSGA 1K9AA 4CC4B 2DYBA 1BB9A 1TG0A 3QWXX 2MOXA 2NUZA 1W1FA 1GCQA 1UFFA 2J05A 1NYFA 3PE0A 3I9QA 1CKBA 1VYTA 2CSIA 4JJDA 1W6XA 1ZUUA 2FPEA 1GL5A 2J6FA 3RBBB 1I07A 2JMCA 2RQWA 2YT6A 1YWPA 1WA7A 5FW9A 3TSWA 4RTUA 4RTXA 1WDXA 4HVWA 5FWBA 1WX6A 3EG0A 1UE9A 2ED1A 2EVRA 4OMLA 2FPDA 4OMNA 2KBTA 2LCSA 2LJ1A 3ZL7C 3RNJA 4JJCA 1RLPC 2A28A 1KFZA 4AFSC 2FRWA 4JZ3A 2DRKA 1RI9A 2MIOA 4IIMA 1FMKA 1H92A 1QWEA 2DL3A 1OPLA 1UHFA 2LP5A 1NM7A 2KEAA 2DBMA 2GGRA 4R0KA 5IXBA 2GQIA 1SRMA 2C0IA 2D0NA 1AOJA 1EFNA 2BZ8A 4LN2A 1M3AA 4F17A 5L23A 1YCSB 1OEBA 2AZSA 4QT7A 2DRMA 1AWOA 2HEQA 1UJYA 4EIKA 2O2OA 1PRMC 2JTEA 2L0AA 2VKNA 1M8MA 1E6HA 2FPFA 3NPFA 1PRLC 3VRYA 2RNAA 2EGEA 1UECA 2DL7A 3EHQA 2BTTA 1XOVA 5IHKA 2DL4A 1M30A 1SHFA 1E6GA 4J9IA 2ENMA 2YUOA 3I5RA 2JT4A 2EPDA 1SRLA 2B86A 4RTVA 1GCPA 2RF0A 3M0UA 1LCKA 2QDLA 3PVLA 2O9VA 3M0RA 1JXOA 2VWFA 4K11A 3REBB 2EGCA 3NMZC 3SEMA 1UGVA 1UJ0A 5IHNA 2W0ZA 3EG3A 3C0CA 1SEMA 3REAB 2CH4A 2CREA 4Z89A 1NLOC 4F16A 5IHIA 2J06A 2CUDA 2DE0X 2ECZA 3VS5A 1PKTA 1ABQA 2CH4W 2DJQA 1ARKA 2GNCA 2JW4A 3O5ZA 3R6NA 2O9SA 2CUBA 2V1QA 2LMJA 4CC7A 2M0YA 3UA6A 5GJWB 4AG1C 1Y0MA 2D8HA 4J9DA 1X27A 3VRZA 2EYYA 1JQQA 3H0HA 1JU5C 2LX7A 4J9EA 2KXDA 2X3XD 3H41A 3I5SA 1X6BA 3ULRB 4HCKA 2EYZA 2K7AA 2PZ1A 5FWCA 3VS6A 4FSSA 4DEXA 1OPKA 2J6KA 3EG2A 3THKA 2LNHB 1U3OA 2G6FX 2OAWA 2O88A 1SPKA 1ZUYA 2GTJA 1G2BA 1RLQC 2OJ2A 2YUNA 1Y57A 5I22A 2DNUA 3NHNA 5HCKA 1M3BA 2KYBA 1B07A 1W70A 1QKXA 4LUDA 2BZYA 4OMOA 1GCQC 3QWYA 2JM9A 2JM8A 1T0HA 1NEGA 1NLPC 1I1JA 4RTWA 2EYWA 4Y92A 1HSQA 1YWOA 3VS0A 2RQVA 4JZ4A 4WCIA 2D8JA 2K9GA 1WFWA 1H8KA 2J7IA 1WI7A 1X2QA 2DLPA 4J9FA 2JS2A 2KROA 2ROTA 3FJ5A 4GLMA 1TUCA 1SSHA 2L2PA 1UDLA 3PVQA 2F2XA 2KE9A 1BBZA 3A98A 4HVUA 2DX1A 2YSQA 2EBPA 2RMOA 1M3CA 1VYUA 4Z88A 2EW3A 4JJBA 1H3HA 1Z9ZA 4LUEA 1T3SA 1X43A 2DL8A 3H0FA 4A63B 2K6DA 2OI3A 4RUGA 1T3LA 1PWTA
chains in the Genus database with same CATH superfamily
3HL8A 4E7ZA 2A36A 4C5GA 2FB7A 3JB9D 2LT4A 4C0DB 2EJ9A 2NUPB 2M1HA 4M77B 2DZ9A 1JRIA 2CP0A 1KJWA 1VQ4A 5J3BA 1KQSP 2JMAA 1I0CA 3CPWP 1K0XA 5CR2A 4A4FA 4CC2A 5HK3A 1M27C 1WLPB 1YHQT 2ED0A 3RIRA 1TUGB 3TEEA 3PGGA 2P0QA 4OMQA 1BI1A 1WHKA 2RQUA 2V1RA 1NJIR 2ESWA 5D6WA 4CI0C 2K2MA 4N4IA 2E4HA 3CC7T 2C0OA 1JO8A 3I56Q 4BDZA 1X01A 1M1FA 1N9SA 1AEYA 4DOWA 2CSQA 2MAMA 1JXMA 1AWJA 2XDBA 2DTHA 4Z02A 4J6YA 3RMQA 1ACMB 2K79A 4IUPA 1ZSZB 3CCMA 3EGXA 1BKBA 4OP0A 1Q82U 4M77A 2CT4A 2VASA 5KYUA 1U1SA 5KCOA 2HKNA 1CKAA 2HBWA 3JCMb 3CMEQ 3PMTA 2XI9A 2NUTA 2FRYA 3C95A 3KFVA 4FU6A 3P8DA 3LWIA 1D0XA 4X9DA 2SEMA 2Y4YA 1Y96B 2F5TX 1ABOA 7AT1B 1GFCA 4E7KA 4RTZA 2EGAA 1RUWA 5C0MA 1NPPA 2BKDN 4VUBA 4OB1B 2LQWA 4WTOB 4PFPA 2AHJB 1QCFA 3LWHA 1S72A 3S6WA 5EG2A 2DD4A 4AFZC 4C0DC 2QASA 4M77C 2HBPA 5AYFA 4M77G 4PFOA 3PIPA 1VQ8T 3RKXA 5EC7A 5IXFA 2LRQA 1VQOQ 2K5FA 1K9MR 2CP6A 1I5OB 2YUPA 4LDWA 4LDXA 1EX4A 4PNOA 4F14A 2DBKA 2A3LA 1QVPA 1W4SA 2RHZA 3LGFA 5GAOm 4RTYA 4ATOA 3C12A 2Z0WA 1J3TA 2RJCA 2Y90A 4LE9A 4XAXB 2EYXA 3RKWA 2X4YA 1V1CA 1AZGB 1OOTA 2KNBB 4E7HA 4LXCA 5KYXA 3CD6Q 3RKYA 1OU9A 4F7UB 4D8KA 2PVOB 4A4KA 3OYBA 1G83A 2CKKA 1KQ1A 3ZBDA 1TXQA 3EH2A 3HRSA 2CZ0B 2RHYA 4HCBA 1ZSZC 5GAOq 3QYGB 1IO6A 2E64A 2KR3A 4XU1A 2DL5A 4XTWA 1VYVA 4C92F 1G3TA 2LC4A 4PJLA 1D1CA 4BUGA 3EFOA 3CBPA 2D9TA 4V2SA 2OAUA 2E5QA 1KIKA 3EHRA 4NL2A 1JB0E 2LJ3A 5AT1B 3CXCP 1B3QA 3VS4A 2KAFA 1K9AA 2DYBA 3KUFA 1RL2A 2NUZA 2EWNA 3C4SA 4M75E 1NYFA 2XD0A 2D0QB 4FT2A 2VGMA 5DM7R 1W6XA 1Q81R 5DLQE 1OYXA 4WF2A 1PSFA 2FVUA 2OTJT 3RBBB 3P8HA 2K4YA 5KE3A 3CC2Q 4M7DD 3UDCA 3TSWA 3OMGA 5LJ5f 4RTUA 1OQKA 4N0AA 3JCMJ 1YIJQ 3CCEA 2ED1A 2MI6A 5GAMe 2EAYA 2QQRA 5GAN7 3RNJA 2BIVA 3QDFA 4F04B 4EMKB 1PD1A 1QMCA 3M57A 3EGDA 2LX9A 4HA8A 4HT8A 3OB9A 5HKCA 2PQWA 3J81E 1VQPT 1QWEA 1OPLA 3MP6A 3OYYA 1XQHA 2KEAA 1SKUB 4F7UG 2DBMA 1VQ5A 3DLLA 1M2VB 4O6JA 2RJDA 5IXBA 2C0IA 2D0NA 4E47A 3NTKA 3TQ7P 1AOJA 1EFNA 1TS9A 2BZ8A 4F17A 5L23A 1YCSB 4QT7A 5D7UA 3CCVQ 2QEXA 2R5AA 3DLMA 2O2OA 3WXMB 2L5QA 5FLXE 5I2SA 2VB6A 2FPFA 1C6VX 2DL7A 1VQLT 3EHQA 5CO7A 3CCLT 3G71A 2DL4A 1Y71A 1HK9A 4C8QE 1SHFA 2HZYA 5GAOr 4ELZC 3I5RA 1DJ7B 2JT4A 4BI8B 5J39A 3UWNA 4B9WA 1GCPA 3TCJA 2RF0A 3M0UA 4EDUA 3JCMg 3NFCA 1KG1A 1JXOA 3LX7A 3CCJT 5GAN4 3REBB 1SF9A 3NMZC 1UGVA 4KGXB 2W0ZA 3EG3A 3C0CA 3JB9H 4M75B 4F16A 3CCLA 1VQ9A 3X24B 5GAOn 2DE0X 1VQKT 1M8VA 2PUOB 1Q86C 3QG1A 4CRIA 2DJQA 2XICA 1M9SA 1OULA 2O9SA 5CKHA 2LMJA 3UA6A 2RO0A 4UC4A 2K3YA 4AG1C 3JCMh 3CCJA 3OYKA 4X34A 1JQQA 3G6ET 3H0HA 1JU5C 4EMKC 2LX7A 3A1PA 4J9EA 1VQ6Q 3MHXA 1QVFA 3A8LB 3I5SA 3C94A 4HCKA 2LVMA 1IB8A 3J80E 4J5YA 1VQKA 5A2QE 4DEXA 1OPKA 3MEVA 5CKEA 4L59A 3QDRB 1YJ9A 4PFZA 2QA4T 3JCMP 2E3IA 3NHNA 5LJ3e 1M3BA 2MPXC 1W70A 2BZYA 3G6EA 4XK8E 3OYHA 4BE1A 2B8AA 1YHQQ 4ZGDB 4M75A 1VQ7Q 2ZPBB 2MWOA 4L5GA 3LW5E 1HSQA 1O75A 2V8KA 2RQVA 1VQMT 1H8KA 1WI7A 4J9FA 2KROA 2ROTA 3DB3A 4PLLA 4C8QB 2HSEB 4JUVA 3OYAA 3CC7Q 1WZOA 1TUCA 2R57A 2X51A 4PJOF 2PU9B 4MZTA 3JCMc 3UT1A 5IN1A 4QQGA 4QW2A 2EBPA 3CCQQ 4NOYA 4JJBA 3OYJA 1H3HA 4M75C 4DOVA 4L6V5 1PC0A 2DETA 4M75G 4FL6A 4RUGA 5LL6S 3D7SB 1YI2T 1ZA2B 2DKGA 1G3YA 5IH2A 2WSEE 2CZ7B 4E7JA 1JEGA 3EG1A 2H8HA 2L89A 4ZN3A 2QQBA 4HVVA 1CSKA 2LNVA 2KT1A 1HJDA 2KQWA 2KRNA 1D0ZA 4OGEA 3TSZA 2P84A 2CP3A 2QAZA 2ROLA 4M7AF 2QQAA 2AKKA 2AKLA 1N5ZA 2YXYA 1ZA1B 2P0KA 2CDTA 3M9QA 2IPOB 1EZZB 1Q82R 4C8QA 3RESA 3SHWA 2O31A 2P0PA 1GFDA 1K9MC 1VQ8Q 2VGNA 3JCMd 2AT1B 3H0IA 3H6ZA 2HDAA 3TVTA 1BCOA 1VA7A 1PKSA 2EQIA 2RHUA 3A5ZB 1QCOA 4QVZA 2PTKA 2P4RA 2DVEA 2M16A 3CC4T 3JCMX 3GPLA 2KXCA 1KHCA 2RQTA 2L3PA 1GRIA 2RHXA 3VKIA 2XMFA 1IXDA 1RABB 5I11A 2F2VA 5I2MA 4C8QG 5CCAA 1YITT 1Z9QA 3MPUB 3CBMA 4LDUA 1B7TA 1I8FA 2OTLA 1R0BG 3I55A 4DQ2A 2MWPA 3VYHB 2I0NA 3QZ5B 1U5SA 2XU8A 1BU1A 1KSWA 1Q7YU 3BE3A 1WHGA 1OZ3A 2LCLA 3GNGA 3DKMA 1HXDA 4M78C 5A0LA 1K4US 4C92E 1RADB 4M4ZA 3VYGA 2XDDA 2RHIA 2KRMA 2ZZDA 1NYGA 2RI2A 2ZAEA 3M5AA 4PKCC 4M78F 1YP5A 3BW1A 3M54A 3ASKA 1C1AA 3GBQA 2P4TA 1M2OA 2KGTA 2RQRA 1RAHB 3VS1A 4MDWA 2HNIA 3FJPA 3NGPA 3EGXB 1AT1B 1Q81C 1VQNA 3L2WA 2ABLA 4KULA 1TSFA 2RPNA 3L42A 1FXXA 2OTJQ 5KYUB 2A37A 2JVVA 1WXBA 2L3QA 5CQXA 3URGA 2E6NA 1D0YA 4IIOA 1TH7A 2NUTB 2CZ6B 4P5NA 4ESRA 3E2UA 5A0GA 3LH5A 1BI0A 3TREA 4LNPA 4YTLA 3CCMT 2COZA 1N8RU 4AT1B 2SRCA 3BDUA 3VS2A 1VUBA 4GBQA 1X6OA 1VQPQ 5GMKl 3V7RA 2COYA 5DLOA 2YWWA 3OYMA 4J7FA 1UB4A 3HSBA 1T0JA 3VUZA 1K73U 3L2RA 3ZFJA 1K76A 5GMKi 1S72T 4ZGJB 3I9QA 4PJOD 1WQ7A 1YJNA 2XG8D 2GFAA 2DXCA 4JJDA 1ZUUA 1VQLQ 3JAME 4JRKA 2J6FA 3MP1A 5KYXB 3FIFA 2CGHA 3H8ZA 4IUVA 5GAMg 3JRZA 2WSFE 1M1KU 1WDXA 4HVWA 1QVGS 3OYNA 2EVRA 1MGQA 3QUIA 1M4ZA 4JJCA 2A28A 5GAOp 5KYNA 4BD3A 2DRKA 2MIOA 4IIMA 3E19A 3ER0A 4IURA 1N27A 2DL3A 4M7AD 3EFOB 1UHFA 4XU3A 2HAXA 5GAMh 3AHUA 4J8OA 2ZPHB 3MEUA 4M77F 3PT9A 2AZSA 1WJSA 1TOVA 1AWOA 1UJYA 4QKUA 2L0AA 4C92A 1E6HA 1ZQ1A 2DTOA 2KK4A 2DFUA 2V26A 3CMAA 2BTTA 4OB3B 3PMIA 2YRDA 2E1HA 1YJWT 1M30A 1E6GA 2JN0A 2ENMA 2K57A 2EKOA 3JCMW 2EJFA 2QA4Q 4J6WA 2KMTA 3NTIA 1KC8U 2XIDA 3HHTB 1LCKA 2QDLA 2WACA 2VWFA 2EGCA 3OS2A 2LTOA 2E70A 1UGRB 1UJ0A 3Q1JA 3UPUA 3JCMQ 4Y28E 4Z89A 3EGDB 3QSUA 3CCUT 3V8LA 4C92G 1OI1A 1YJWA 3G4SQ 1VQMQ 3VS5A 4XQ3A 2CH4W 3CCSA 5D6XA 5GMKe 3L2VA 3O5ZA 3A8GB 2RB6A 4CC7A 2M0YA 5GJWB 2VUBA 3CCET 2D8HA 4J9DA 1X27A 3JCMf 2EYYA 2E12A 2ZCFB 1LPLA 2DYIA 4LDVA 2ZPIB 1G3WA 2X3XD 3CCUA 2BE7D 2EYZA 4M78D 1YI2Q 1OX8A 2GFUA 2V8IA 5FWCA 4ELYC 1RAFB 3VS6A 4FSSA 2J6KA 3EG2A 5LJ3g 3THKA 1TTHB 1VQ5T 3KBGA 1NJIU 2O88A 1SSFA 1ZUYA 2GTJA 2R5MA 3E1SA 5DY9A 1K8AU 5I22A 3OW2A 2EFIA 1IZ6A 2JNGA 2QEXT 2CS7A 4M7AE 4XU2A 1NEGA 1NLPC 2OX7A 4KUIA 4FIBA 4PJMA 4Y92A 3HKSA 4XU0A 1Q82C 1QW1A 2PUKB 4C5IA 3G1JA 4WCIA 3QBYA 5GAMd 3LH0A 3G71T 3H9NA 5LJ3h 3MKDA 4FCYA 2D8JA 2K9GA 3A8OB 5C6SA 2MF2A 1IHWA 4BE2A 4LDYA 4N0AC 4BI3A 1TU0B 3X28B 2DK3A 2L2PA 4F7UF 1BIBA 2F2XA 1M90U 3V8JA 4OB0B 4HVUA 2BUDA 4PLIA 2RMOA 3X25B 3CC4Q 1VYUA 4Z88A 1H3ZA 3HP9A 2DL8A 2K6DA 2MMPA 1VQ9T 1PWTA 3L2ZA 4KUDK 2DVJA 1BK2A 2AK5A 3QHSA 3CCRQ 2ATCB 5CAIA 3RDVA 2PNIA 1GBQA 4XTXA 4FYXB 4JLIA 3AT1B 4AMCA 1QVFP 1YITQ 1OU8A 3JV3A 1AWWA 2HCKA 5GAMj 1WYXA 1MMGA 1UG1A 4DBHA 2C0TA 1B34B 3INZA 2K3BA 3I56A 3SDZA 2DA9A 4QVDA 4NL3A 2O4XB 3FDRA 2KT8A 4MMKA 4A4GA 2IG0A 3FLGA 2W10A 2JZ2A 2DXUA 2JXBA 1YJ9T 3VU3C 2GQVA 4J9BA 1VQ4Q 3IQLA 3JB9G 3CMEA 1NE8A 3WVDB 2XDPA 4DEYA 3M0SA 5KCHA 2MCNA 3OYLA 1VQOT 2EKHA 2CT3A 4M7DE 1OV3A 2M02A 4RCCA 2LJ0A 2RJEA 3META 4M77D 8AT1B 1KD1U 1Q7YR 3EG9A 5GANe 3OYFA 1RAAB 4B6MA 4ORZA 3VS7A 2EQKA 2RN8A 1X6GA 1B34A 2DZCA 1HYOA 8ATCB 3OW2S 2JS0A 2QK0A 3M0QA 2DIGA 1VQOA 2YRCA 2DF6A 1NZ9A 4JPBW 4LD6A 4OMMA 3U23A 5GANd 1AWXA 2O4XA 1R8OB 1I5LA 2H3JA 4BACA 3CCMQ 3GIBA 5LJ3d 4AFQC 2MK5A 2K5LA 4ZN1A 3VUBA 3BFMA 1PSEA 4FYVB 1Q95G 4KRTA 5GAN3 5D6YA 3M0TA 1UUEA 2QGFB 3CD6A 2E6ZA 4MZMA 2DMOA 3V7SA 1OZ2A 4O5VA 1U06A 4M7AA 2X4JA 5KYYB 2HQXA 2YHTA 1X2KA 3PFSA 1GBRA 3R6OA 1S72Q 2QG9B 1QLYA 2JOYA 1ZBJA 2J6OA 4Q5WA 1N8RR 4J9HA 2EQUA 5FROA 2LQ8A 2X3WD 4AFUC 1AZEA 1K1ZA 4XTUA 3M4YA 4M75F 5LJ3j 1QKWA 1V29B 4JS5A 5GAN6 5KYWA 3VS3A 4E6RA 1F1BB 2D1XA 4QQ6A 1K73R 1D3BB 2VV5A 1QCNA 4X9CA 3OMCA 5KE2A 3OS5A 4DA4A 3OQ5A 4M7AG 1MV3A 1MNEA 1LJOA 4M7DB 5GJVB 5J26A 1YIJT 3RUXA 3P8BB 3BDLA 5CKDA 3EAEA 3E9GA 1PCXA 2VVKA 2K5IA 1MMAA 4EMGA 4ZGEB 2KYMA 4DBFA 2E41A 1YNZA 3OSSC 1QVGP 3UF4A 3SWNA 4D6WA 4KT0E 1ZBXA 2ZPFB 5KYYA 4J7IA 1JJ2A 5FRMA 2EIFA 1QVFS 3CC2A 2OTLT 3I55T 2DM1A 4Y91A 3GOXA 2G3RA 1M1KR 1ZHIA 3RERA 1A0NB 1YIJA 4CC4B 4OGCA 2QGGA 1D1BA 1BB9A 5FU6B 2MOXA 5LJ5e 1GCQA 3E9FA 5A0DA 3CEYA 4C8QC 5M9OA 4EMHA 1XNIA 1VYTA 2CSIA 2F5KA 1O9SA 1I07A 2JMCA 2YT6A 1YWPA 3L1AA 2V8JA 1WA7A 1D3BA 5FW9A 4A4HA 3M59A 4C8QF 2YRVA 4M7DA 3LLRA 3HRTA 2QTXA 3EG0A 3S3NA 4A4EA 2JTFA 1UE9A 3OYCA 1EIFA 2QQSA 4ME7A 4OMLA 4OMNA 3X20B 1G5VA 2KBTA 5FU7B 1WHLA 3CCVA 1VQNT 2R58A 2RK1A 1RLPC 1RAGB 1KK7A 2FRWA 1IREB 1FMKA 2CZ1B 5GAN2 3TU4K 1KQ2A 1D1AA 5CIUA 5GAMf 1IGUA 2GQIA 1SRMA 3CCEQ 4M7DC 3FEOA 4JLGA 3EH1A 1VOMA 4M7DG 2DRMA 2RA2A 4C5HA 4EIKA 2HL5C 3OSVA 4R55A 2JTEA 1M8MA 3NPFA 1W2BA 3VRYA 2RNAA 1XTDA 3MP8A 3OS0A 4ZTJA 1VIFA 2L8DA 5CKBA 2FZGB 4IUQA 3OYEA 4RG8A 1VQ5Q 4IKFA 4J9IA 1GXIE 3OY9A 4QQDA 2YUOA 1M5Q1 3N5BB 4N4HA 2DERA 2EPDA 4NS5A 3LGLA 2Y4XA 1N9RA 4MDXA 2FHDA 3CPFA 3QKJA 4IUTA 5FU6C 2I2LA 2XK0A 2QEXQ 3M0RA 4KGZB 4K11A 2EJGA 4J83A 3PTAA 2L3RA 1YJNT 1VQ6A 4HKEA 4II1A 2CREA 2RD1A 1VQ7T 4OF1A 1RAEB 3G71Q 3X26B 2CUDA 4C0FA 2ECZA 1LVKA 2XHCA 1ABQA 1JJ2S 2E10A 4C0GA 4RG2A 2GNCA 2JW4A 4FSXA 3R6NA 5CQYA 1U1TA 1UEBA 4PK4A 4F7UE 1K8AR 1Y0MA 1M1GA 3VRZA 5FU7C 3JB9I 1YHQA 3M56A 3H41A 1VQ7A 3ULRB 1X6BA 4C92B 5GMKh 3CCLQ 3CCQT 1KQSA 1VQ9Q 2K7AA 5GMKm 1WJRA 3CPWA 3A8MB 6AT1B 2DIQA 3OYGA 4FW2A 4KH1B 1U3OA 2G6FX 2NUPA 4B9XA 4KH0B 1SPKA 1X75C 2LQKA 2YUNA 1Y57A 3CCJQ 4OMFB 5HCKA 3CC7A 2RM4A 2KYBA 1MMDA 4BI4A 4JRPA 4M75D 4OMOA 1M90R 1PM3A 1T0HA 5GANf 1I1JA 3CCQA 2F69A 3JB9J 5GAOl 1UGQB 2VYTA 3HPWA 1YWOA 1VQKQ 3CMAT 3VS0A 2ZPGB 4PL6A 3QJYA 2GF7A 3PIOA 3M55A 5LJ3f 2J7IA 1YJ9Q 1MMNA 2JS2A 2EYQA 3QZ9B 1SSHA 2DJZA 3G6EQ 3FC3A 3PVQA 3MCAB 2KE9A 1BBZA 2PVDB 1WPYA 1RACB 2YSQA 2A7YA 3GNFB 3QJ6A 1Q7YC 1W2BS 1Z9ZA 1T3SA 1X43A 1P92A 3QIIA 3H0FA 2RJFA 1ZSZA 2ZGWA 1T3LA 4RCBA 2QYZA 3EFSA 2EQMA 2HQHA 3CCST 4ZNXA 1Y7XA 3MEWA 1Q86U 3L2QA 1S1NA 4KBMB 1VQ8A 1YN8A 3ME9A 2E65A 4D8DA 2YDLA 1PG5B 3I35A 3ZEHA 1Y96A 4PJJA 4GLKA 4BDYA 2HKQB 3UA7A 4C92C 1NPRA 3QO3A 1WHJA 3CQTA 1MNDA 2COWA 1HD3A 1YFNA 1X69A 4HCZA 4DBQA 1UTIA 1SHGA 2YUQA 4AG2C 4C8QD 1KD1R 4N4GA 5CVIA 1WXTA 2DILA 4C5EA 3OW2P 1WQWA 1QWFA 1UHCA 5L8RE 2DEQA 1TUDA 1ZLMA 2FEIA 4PJOE 2WSCE 4JRQA 3OS1A 3MO8A 2IVWA 3F70A 3SD4A 4HXJA 4FW1A 5GANg 2GBQA 4Z8AA 1MUZA 3L2UA 2LZ6B 3VV0A 3QPHA 3S3MA 1N8RC 1KQSS 2A0FB 3CPWS 2X4XA 4JJNK 1ZUKA 4E7IA 4JS4A 1AD5A 4BE0A 1AVZC 1FYNA 1PNJA 4FM4B 5HY6A 2ZPEB 2FZKB 4TVRA 4F7UA 2DAQA 2HSPA 4J9CA 1K73C 3GF5A 2IIMA 2FYKA 2A08A 5GANh 4RTTA 2JTMA 2E5KA 4X1VA 4OVAA 1NG2A 5ECAA 1H641 2NYSA 5GMKj 2DEUA 3CXCA 1V76A 2YLCA 4OMPA 5KH6A 2LQNA 5FRNA 2OTJA 4FYWB 1E7OA 2BZXA 3M0PA 3I56T 2GTOA 1TWBA 1M1KC 2OTLQ 1MV0B 3I55Q 2AZVA 4XTVA 3O8VA 2EQJA 4FYYB 4FT4A 1WHHA 4J9GA 3CBOA 2NWMA 1WIEA 1BYMA 2KRSA 1WXUA 2KI7A 2FG0A 2VXEA 5CK9A 1BI2A 4HT9A 1BI3A 3EG9B 5IAYA 1ZX6A 2L3SA 1PD0A 2DTIA 2DPPB 2X9HA 1VQPA 2JUFA 3CMET 4E7SA 1K9MU 1I4K1 4PJOB 3QYHB 1U8RA 3UATA 1R0CB 3FB9A 2M51A 3EGUA 4CC3A 2VXFA 4GY5A 2BE9B 2KDSA 2MYSA 1VQNQ 3JSCA 4EMKA 2F2WA 2FO0A 3OBWA 1PHTA 2M9UA 1UGSB 1VIEA 1NEBA 2QTVA 1VQLA 2LDMA 4M78E 1SG5A 1YBYA 1M2VA 1K0SA 1KC8C 5LJ5g 3V8KA 4R56A 4M7AB 3HFNA 1N6AA 3JB9F 1ZSGA 1FWZA 2LCCA 9ATCB 2RI3A 1WHMA 1TG0A 1Y07A 2DXBA 3QWXX 3GP8A 1YCYA 1W1FA 1UFFA 2J05A 4MZPA 3PE0A 1CKBA 2RK2A 2DD5A 2HQEA 3S3OA 1OX9A 2FPEA 4PJOA 1GL5A 3CD6T 2RQWA 3OA6A 4LD9K 5KYWB 4HCCA 5LJ5h 2PVGB 1WJQA 3SB2A 4RTXA 3M58A 5FWBA 3T9NA 1WX6A 3HFOA 4RKUE 4DBRA 3OBYA 2FPDA 1JBMA 2O01E 2D6FA 2LCSA 2LJ1A 3ZL7C 1YJNQ 1RAIB 4XTZA 3CXCS 1KFZA 5GAN8 4AFSC 1Q81U 4JZ3A 1RI9A 2H3EB 3M4GA 3M53A 1H92A 4PJOC 1FMWA 3SWNB 1NJIC 4PJOG 2LP5A 1NM7A 2QQ9A 3OYDA 1LOJA 3G4ST 2VC8A 3PNWC 1K8AC 2GGRA 4PJNA 1G8XA 4R0KA 1QQJA 2RI5A 4A54A 4JRIA 4KGVB 2QA4A 3RMSA 1IHVA 2FL7A 1M3AA 4LN2A 2HD0A 4OB2B 2DO3A 5GANj 1OEBA 3EFRA 4C92D 1WGSA 4E7LA 2YLBA 2HEQA 2K2VA 4J6XA 4BY6B 1JJ2P 1PRMC 1MHNA 2KVQG 2VKNA 4ZTFA 1PRLC 2EGEA 1UECA 5I21A 2JJ9A 2LT1A 1G3SA 1XOVA 5IHKA 3G4SA 1VQMA 3VJPA 3J7AF 5HK0A 4M78B 3CC2T 2K3XA 4M7AC 1XJWB 4RTVA 1WNLA 1SRLA 2B86A 3GLXA 1M90C 1AHJB 2XKOC 2AIRB 3PVLA 4JDSA 2O9VA 3KXTA 3SEMA 4ANJA 1UGPB 2QXFA 5IHNA 3WVEB 2QDYB 1QP3A 1SEMA 3BY7A 3REAB 2CH4A 3JCMe 3HTRA 1NLOC 3CMAQ 5IHIA 3NTHA 2J06A 1YI2A 2X4WA 2CP5A 1R77A 4M77E 3DB4A 1PKTA 3MJXA 5GAN5 1BCMA 2F1LA 1ARKA 2CUBA 2V1QA 2C06A 2M0OA 3HRUA 2FZCB 2RH2A 3CCVT 4RMOA 1C0MA 1FMVA 3SFMA 3MEAA 2KXDA 5IT9E 3V7CA 2PZ1A 3A8HB 3SWNC 1YJWQ 1IGQA 3JCMV 4M78A 5LJ5d 3CCSQ 2LNHB 2DXTA 2X35A 4C0ZA 3CCRT 2CP2A 2OAWA 4QVCA 2KSSA 2HL3A 1G2BA 1RLQC 2OJ2A 1W2BP 4E2FB 1BIAA 2CYZB 2DNUA 5CKFA 3QXEB 4EPCA 1B07A 1QKXA 4LUDA 1GCQC 3QWYA 2JM9A 2JM8A 4BY6C 3CCUQ 3CC4A 1KD1C 4MMLA 4RTWA 2EYWA 1RI0A 1QVGA 1I81A 1LNXA 4JZ4A 3FRNA 1WFWA 3CCRA 1X2QA 3OYIA 2DLPA 3FJ5A 4IUUA 4M78G 3LYIA 2NLUA 1KC8R 1Q86R 4GLMA 2QI2A 1KHIA 1YITA 1VQ4T 4XTYA 1UDLA 5LJ5j 2KY9A 3G7ZA 1IRXA 4BB7A 1D09B 3A98A 2DX1A 1NBEB 1M3CA 4A53A 2EW3A 3RR6A 1VQ6T 4LUEA 1QP2A 2HMAA 2E3HA 4A63B 2CP7A 2OI3A 4M7DF 1FX7A 2GCXA
chains in the Genus database with same CATH topology
2DVJA 2A36A 1BK2A 2AK5A 5IH2A 2PNIA 1GBQA 4ZNXA 1JEGA 3EG1A 2H8HA 1S1NA 4HVVA 1CSKA 1KJWA 3JV3A 2KT1A 1AWWA 1YN8A 2HCKA 2JMAA 1WYXA 1UG1A 1I0CA 1HJDA 2KRNA 2C0TA 4D8DA 2YDLA 2K3BA 3I35A 3TSZA 1K0XA 3UA7A 2DA9A 4CC2A 1M27C 1WLPB 2ROLA 2ED0A 3CQTA 2AKKA 1HD3A 2AKLA 2KT8A 1N5ZA 1X69A 1UTIA 1SHGA 2YUQA 4OMQA 4AG2C 1WXTA 2CDTA 2DILA 2W10A 2JXBA 1QWFA 1UHCA 2RQUA 2V1RA 1TUDA 3SHWA 2ESWA 1ZLMA 2FEIA 2O31A 4J9BA 1GFDA 2K2MA 3IQLA 3H0IA 2C0OA 2HDAA 1JO8A 3TVTA 1VA7A 1PKSA 2EQIA 4DEYA 3M0SA 2MCNA 2PTKA 4HXJA 1AEYA 2EKHA 2P4RA 2CT3A 2CSQA 1OV3A 1JXMA 1MUZA 1AWJA 2GBQA 4Z8AA 2LZ6B 2K79A 2LJ0A 2KXCA 2RQTA 2L3PA 1GRIA 1ZUKA 1AD5A 2XMFA 1AVZC 1FYNA 1PNJA 4ORZA 2CT4A 3VS7A 5I11A 2F2VA 2RN8A 1X6GA 1CKAA 2HBWA 1Z9QA 2HSPA 2JS0A 3M0QA 4J9CA 2DF6A 2FRYA 3KFVA 2IIMA 4JPBW 4OMMA 3U23A 1AWXA 2A08A 2SEMA 1ABOA 1GFCA 4RTTA 4RTZA 2EGAA 1RUWA 2I0NA 1U5SA 1BU1A 2LQWA 1KSWA 2E5KA 4X1VA 4AFQC 1QCFA 1NG2A 5ECAA 4AFZC 1K4US 4M4ZA 4KRTA 4OMPA 3M0TA 1UUEA 2KRMA 2LQNA 5EC7A 5IXFA 1NYGA 1E7OA 2BZXA 3M0PA 2DMOA 2GTOA 1MV0B 2AZVA 1U06A 2YUPA 1YP5A 4J9GA 4F14A 2DBKA 1X2KA 1GBRA 2NWMA 1WIEA 3GBQA 2KGTA 2RQRA 2KRSA 1WXUA 4RTYA 3VS1A 1QLYA 1ZBJA 2FG0A 2J6OA 3NGPA 1J3TA 4J9HA 2X3WD 4AFUC 2ABLA 4LE9A 1AZEA 1K1ZA 2EYXA 1ZX6A 2L3SA 1V1CA 1AZGB 2RPNA 1OOTA 2KNBB 1QKWA 2A37A 1WXBA 2L3QA 4D8KA 1G83A 4IIOA 3VS3A 4E6RA 2D1XA 3UATA 4ESRA 2M51A 1MV3A 3LH5A 4LNPA 3EGUA 5GJVB 4CC3A 2SRCA 1IO6A 2KR3A 2F2WA 2FO0A 2VVKA 3VS2A 2DL5A 1PHTA 4GBQA 1NEBA 2KYMA 1VYVA 1YNZA 3UF4A 1KIKA 1K0SA 3EHRA 1T0JA 2DM1A 2LJ3A 1K76A 1B3QA 3VS4A 1A0NB 1ZSGA 1K9AA 4CC4B 2DYBA 1BB9A 1TG0A 3QWXX 2MOXA 2NUZA 1W1FA 1GCQA 1UFFA 2J05A 1NYFA 3PE0A 3I9QA 1CKBA 1VYTA 2CSIA 4JJDA 1W6XA 1ZUUA 2FPEA 1GL5A 2J6FA 3RBBB 1I07A 2JMCA 2RQWA 2YT6A 1YWPA 1WA7A 5FW9A 3TSWA 4RTUA 4RTXA 1WDXA 4HVWA 5FWBA 1WX6A 3EG0A 1UE9A 2ED1A 2EVRA 4OMLA 2FPDA 4OMNA 2KBTA 2LCSA 2LJ1A 3ZL7C 3RNJA 4JJCA 1RLPC 2A28A 1KFZA 4AFSC 2FRWA 4JZ3A 2DRKA 1RI9A 2MIOA 4IIMA 1FMKA 1H92A 1QWEA 2DL3A 1OPLA 1UHFA 2LP5A 1NM7A 2KEAA 2DBMA 2GGRA 4R0KA 5IXBA 2GQIA 1SRMA 2C0IA 2D0NA 1AOJA 1EFNA 2BZ8A 4LN2A 1M3AA 4F17A 5L23A 1YCSB 1OEBA 2AZSA 4QT7A 2DRMA 1AWOA 2HEQA 1UJYA 4EIKA 2O2OA 1PRMC 2JTEA 2L0AA 2VKNA 1M8MA 1E6HA 2FPFA 3NPFA 1PRLC 3VRYA 2RNAA 2EGEA 1UECA 2DL7A 3EHQA 2BTTA 1XOVA 5IHKA 2DL4A 1M30A 1SHFA 1E6GA 4J9IA 2ENMA 2YUOA 3I5RA 2JT4A 2EPDA 1SRLA 2B86A 4RTVA 1GCPA 2RF0A 3M0UA 1LCKA 2QDLA 3PVLA 2O9VA 3M0RA 1JXOA 2VWFA 4K11A 3REBB 2EGCA 3NMZC 3SEMA 1UGVA 1UJ0A 5IHNA 2W0ZA 3EG3A 3C0CA 1SEMA 3REAB 2CH4A 2CREA 4Z89A 1NLOC 4F16A 5IHIA 2J06A 2CUDA 2DE0X 2ECZA 3VS5A 1PKTA 1ABQA 2CH4W 2DJQA 1ARKA 2GNCA 2JW4A 3O5ZA 3R6NA 2O9SA 2CUBA 2V1QA 2LMJA 4CC7A 2M0YA 3UA6A 5GJWB 4AG1C 1Y0MA 2D8HA 4J9DA 1X27A 3VRZA 2EYYA 1JQQA 3H0HA 1JU5C 2LX7A 4J9EA 2KXDA 2X3XD 3H41A 3I5SA 1X6BA 3ULRB 4HCKA 2EYZA 2K7AA 2PZ1A 5FWCA 3VS6A 4FSSA 4DEXA 1OPKA 2J6KA 3EG2A 3THKA 2LNHB 1U3OA 2G6FX 2OAWA 2O88A 1SPKA 1ZUYA 2GTJA 1G2BA 1RLQC 2OJ2A 2YUNA 1Y57A 5I22A 2DNUA 3NHNA 5HCKA 1M3BA 2KYBA 1B07A 1W70A 1QKXA 4LUDA 2BZYA 4OMOA 1GCQC 3QWYA 2JM9A 2JM8A 1T0HA 1NEGA 1NLPC 1I1JA 4RTWA 2EYWA 4Y92A 1HSQA 1YWOA 3VS0A 2RQVA 4JZ4A 4WCIA 2D8JA 2K9GA 1WFWA 1H8KA 2J7IA 1WI7A 1X2QA 2DLPA 4J9FA 2JS2A 2KROA 2ROTA 3FJ5A 4GLMA 1TUCA 1SSHA 2L2PA 1UDLA 3PVQA 2F2XA 2KE9A 1BBZA 3A98A 4HVUA 2DX1A 2YSQA 2EBPA 2RMOA 1M3CA 1VYUA 4Z88A 2EW3A 4JJBA 1H3HA 1Z9ZA 4LUEA 1T3SA 1X43A 2DL8A 3H0FA 4A63B 2K6DA 2OI3A 4RUGA 1T3LA 1PWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVJ A;  2A36 A;  1BK2 A;  2AK5 A;  5IH2 A;  2PNI A;  1GBQ A;  4ZNX A;  1JEG A;  3EG1 A;  2H8H A;  1S1N A;  4HVV A;  1CSK A;  1KJW A;  3JV3 A;  2KT1 A;  1AWW A;  1YN8 A;  2HCK A;  2JMA A;  1WYX A;  1UG1 A;  1I0C A;  1HJD A;  2KRN A;  2C0T A;  4D8D A;  2YDL A;  2K3B A;  3I35 A;  3TSZ A;  1K0X A;  3UA7 A;  2DA9 A;  4CC2 A;  1M27 C;  1WLP B;  2ROL A;  2ED0 A;  3CQT A;  2AKK A;  1HD3 A;  2AKL A;  2KT8 A;  1N5Z A;  1X69 A;  1UTI A;  1SHG A;  2YUQ A;  4OMQ A;  4AG2 C;  1WXT A;  2CDT A;  2DIL A;  2W10 A;  2JXB A;  1QWF A;  1UHC A;  2RQU A;  2V1R A;  1TUD A;  3SHW A;  2ESW A;  1ZLM A;  2FEI A;  2O31 A;  4J9B A;  1GFD A;  2K2M A;  3IQL A;  3H0I A;  2C0O A;  2HDA A;  1JO8 A;  3TVT A;  1VA7 A;  1PKS A;  2EQI A;  4DEY A;  3M0S A;  2MCN A;  2PTK A;  4HXJ A;  1AEY A;  2EKH A;  2P4R A;  2CT3 A;  2CSQ A;  1OV3 A;  1JXM A;  1MUZ A;  1AWJ A;  2GBQ A;  4Z8A A;  2LZ6 B;  2K79 A;  2LJ0 A;  2KXC A;  2RQT A;  2L3P A;  1GRI A;  1ZUK A;  1AD5 A;  2XMF A;  1AVZ C;  1FYN A;  1PNJ A;  4ORZ A;  2CT4 A;  3VS7 A;  5I11 A;  2F2V A;  2RN8 A;  1X6G A;  1CKA A;  2HBW A;  1Z9Q A;  2HSP A;  2JS0 A;  3M0Q A;  4J9C A;  2DF6 A;  2FRY A;  3KFV A;  2IIM A;  4JPB W;  4OMM A;  3U23 A;  1AWX A;  2A08 A;  2SEM A;  1ABO A;  1GFC A;  4RTT A;  4RTZ A;  2EGA A;  1RUW A;  2I0N A;  1U5S A;  1BU1 A;  2LQW A;  1KSW A;  2E5K A;  4X1V A;  4AFQ C;  1QCF A;  1NG2 A;  5ECA A;  4AFZ C;  1K4U S;  4M4Z A;  4KRT A;  4OMP A;  3M0T A;  1UUE A;  2KRM A;  2LQN A;  5EC7 A;  5IXF A;  1NYG A;  1E7O A;  2BZX A;  3M0P A;  2DMO A;  2GTO A;  1MV0 B;  2AZV A;  1U06 A;  2YUP A;  1YP5 A;  4J9G A;  4F14 A;  2DBK A;  1X2K A;  1GBR A;  2NWM A;  1WIE A;  3GBQ A;  2KGT A;  2RQR A;  2KRS A;  1WXU A;  4RTY A;  3VS1 A;  1QLY A;  1ZBJ A;  2FG0 A;  2J6O A;  3NGP A;  1J3T A;  4J9H A;  2X3W D;  4AFU C;  2ABL A;  4LE9 A;  1AZE A;  1K1Z A;  2EYX A;  1ZX6 A;  2L3S A;  1V1C A;  1AZG B;  2RPN A;  1OOT A;  2KNB B;  1QKW A;  2A37 A;  1WXB A;  2L3Q A;  4D8K A;  1G83 A;  4IIO A;  3VS3 A;  4E6R A;  2D1X A;  3UAT A;  4ESR A;  2M51 A;  1MV3 A;  3LH5 A;  4LNP A;  3EGU A;  5GJV B;  4CC3 A;  2SRC A;  1IO6 A;  2KR3 A;  2F2W A;  2FO0 A;  2VVK A;  3VS2 A;  2DL5 A;  1PHT A;  4GBQ A;  1NEB A;  2KYM A;  1VYV A;  1YNZ A;  3UF4 A;  1KIK A;  1K0S A;  3EHR A;  1T0J A;  2DM1 A;  2LJ3 A;  1K76 A;  1B3Q A;  3VS4 A;  1A0N B;  1ZSG A;  1K9A A;  4CC4 B;  2DYB A;  1BB9 A;  1TG0 A;  3QWX X;  2MOX A;  2NUZ A;  1W1F A;  1GCQ A;  1UFF A;  2J05 A;  1NYF A;  3PE0 A;  3I9Q A;  1CKB A;  1VYT A;  2CSI A;  4JJD A;  1W6X A;  1ZUU A;  2FPE A;  1GL5 A;  2J6F A;  3RBB B;  1I07 A;  2JMC A;  2RQW A;  2YT6 A;  1YWP A;  1WA7 A;  5FW9 A;  3TSW A;  4RTU A;  4RTX A;  1WDX A;  4HVW A;  5FWB A;  1WX6 A;  3EG0 A;  1UE9 A;  2ED1 A;  2EVR A;  4OML A;  2FPD A;  4OMN A;  2KBT A;  2LCS A;  2LJ1 A;  3ZL7 C;  3RNJ A;  4JJC A;  1RLP C;  2A28 A;  1KFZ A;  4AFS C;  2FRW A;  4JZ3 A;  2DRK A;  1RI9 A;  2MIO A;  4IIM A;  1FMK A;  1H92 A;  1QWE A;  2DL3 A;  1OPL A;  1UHF A;  2LP5 A;  1NM7 A;  2KEA A;  2DBM A;  2GGR A;  4R0K A;  5IXB A;  2GQI A;  1SRM A;  2C0I A;  2D0N A;  1AOJ A;  1EFN A;  2BZ8 A;  4LN2 A;  1M3A A;  4F17 A;  5L23 A;  1YCS B;  1OEB A;  2AZS A;  4QT7 A;  2DRM A;  1AWO A;  2HEQ A;  1UJY A;  4EIK A;  2O2O A;  1PRM C;  2JTE A;  2L0A A;  2VKN A;  1M8M A;  1E6H A;  2FPF A;  3NPF A;  1PRL C;  3VRY A;  2RNA A;  2EGE A;  1UEC A;  2DL7 A;  3EHQ A;  2BTT A;  1XOV A;  5IHK A;  2DL4 A;  1M30 A;  1SHF A;  1E6G A;  4J9I A;  2ENM A;  2YUO A;  3I5R A;  2JT4 A;  2EPD A;  1SRL A;  2B86 A;  4RTV A;  1GCP A;  2RF0 A;  3M0U A;  1LCK A;  2QDL A;  3PVL A;  2O9V A;  3M0R A;  1JXO A;  2VWF A;  4K11 A;  3REB B;  2EGC A;  3NMZ C;  3SEM A;  1UGV A;  1UJ0 A;  5IHN A;  2W0Z A;  3EG3 A;  3C0C A;  1SEM A;  3REA B;  2CH4 A;  2CRE A;  4Z89 A;  1NLO C;  4F16 A;  5IHI A;  2J06 A;  2CUD A;  2DE0 X;  2ECZ A;  3VS5 A;  1PKT A;  1ABQ A;  2CH4 W;  2DJQ A;  1ARK A;  2GNC A;  2JW4 A;  3O5Z A;  3R6N A;  2O9S A;  2CUB A;  2V1Q A;  2LMJ A;  4CC7 A;  2M0Y A;  3UA6 A;  5GJW B;  4AG1 C;  1Y0M A;  2D8H A;  4J9D A;  1X27 A;  3VRZ A;  2EYY A;  1JQQ A;  3H0H A;  1JU5 C;  2LX7 A;  4J9E A;  2KXD A;  2X3X D;  3H41 A;  3I5S A;  1X6B A;  3ULR B;  4HCK A;  2EYZ A;  2K7A A;  2PZ1 A;  5FWC A;  3VS6 A;  4FSS A;  4DEX A;  1OPK A;  2J6K A;  3EG2 A;  3THK A;  2LNH B;  1U3O A;  2G6F X;  2OAW A;  2O88 A;  1SPK A;  1ZUY A;  2GTJ A;  1G2B A;  1RLQ C;  2OJ2 A;  2YUN A;  1Y57 A;  5I22 A;  2DNU A;  3NHN A;  5HCK A;  1M3B A;  2KYB A;  1B07 A;  1W70 A;  1QKX A;  4LUD A;  2BZY A;  4OMO A;  1GCQ C;  3QWY A;  2JM9 A;  2JM8 A;  1T0H A;  1NEG A;  1NLP C;  1I1J A;  4RTW A;  2EYW A;  4Y92 A;  1HSQ A;  1YWO A;  3VS0 A;  2RQV A;  4JZ4 A;  4WCI A;  2D8J A;  2K9G A;  1WFW A;  1H8K A;  2J7I A;  1WI7 A;  1X2Q A;  2DLP A;  4J9F A;  2JS2 A;  2KRO A;  2ROT A;  3FJ5 A;  4GLM A;  1TUC A;  1SSH A;  2L2P A;  1UDL A;  3PVQ A;  2F2X A;  2KE9 A;  1BBZ A;  3A98 A;  4HVU A;  2DX1 A;  2YSQ A;  2EBP A;  2RMO A;  1M3C A;  1VYU A;  4Z88 A;  2EW3 A;  4JJB A;  1H3H A;  1Z9Z A;  4LUE A;  1T3S A;  1X43 A;  2DL8 A;  3H0F A;  4A63 B;  2K6D A;  2OI3 A;  4RUG A;  1T3L A;  1PWT A; 
#chains in the Genus database with same CATH topology
 3HL8 A;  4E7Z A;  2A36 A;  4C5G A;  2FB7 A;  3JB9 D;  2LT4 A;  4C0D B;  2EJ9 A;  2NUP B;  2M1H A;  4M77 B;  2DZ9 A;  1JRI A;  2CP0 A;  1KJW A;  1VQ4 A;  5J3B A;  1KQS P;  2JMA A;  1I0C A;  3CPW P;  1K0X A;  5CR2 A;  4A4F A;  4CC2 A;  5HK3 A;  1M27 C;  1WLP B;  1YHQ T;  2ED0 A;  3RIR A;  1TUG B;  3TEE A;  3PGG A;  2P0Q A;  4OMQ A;  1BI1 A;  1WHK A;  2RQU A;  2V1R A;  1NJI R;  2ESW A;  5D6W A;  4CI0 C;  2K2M A;  4N4I A;  2E4H A;  3CC7 T;  2C0O A;  1JO8 A;  3I56 Q;  4BDZ A;  1X01 A;  1M1F A;  1N9S A;  1AEY A;  4DOW A;  2CSQ A;  2MAM A;  1JXM A;  1AWJ A;  2XDB A;  2DTH A;  4Z02 A;  4J6Y A;  3RMQ A;  1ACM B;  2K79 A;  4IUP A;  1ZSZ B;  3CCM A;  3EGX A;  1BKB A;  4OP0 A;  1Q82 U;  4M77 A;  2CT4 A;  2VAS A;  5KYU A;  1U1S A;  5KCO A;  2HKN A;  1CKA A;  2HBW A;  3JCM b;  3CME Q;  3PMT A;  2XI9 A;  2NUT A;  2FRY A;  3C95 A;  3KFV A;  4FU6 A;  3P8D A;  3LWI A;  1D0X A;  4X9D A;  2SEM A;  2Y4Y A;  1Y96 B;  2F5T X;  1ABO A;  7AT1 B;  1GFC A;  4E7K A;  4RTZ A;  2EGA A;  1RUW A;  5C0M A;  1NPP A;  2BKD N;  4VUB A;  4OB1 B;  2LQW A;  4WTO B;  4PFP A;  2AHJ B;  1QCF A;  3LWH A;  1S72 A;  3S6W A;  5EG2 A;  2DD4 A;  4AFZ C;  4C0D C;  2QAS A;  4M77 C;  2HBP A;  5AYF A;  4M77 G;  4PFO A;  3PIP A;  1VQ8 T;  3RKX A;  5EC7 A;  5IXF A;  2LRQ A;  1VQO Q;  2K5F A;  1K9M R;  2CP6 A;  1I5O B;  2YUP A;  4LDW A;  4LDX A;  1EX4 A;  4PNO A;  4F14 A;  2DBK A;  2A3L A;  1QVP A;  1W4S A;  2RHZ A;  3LGF A;  5GAO m;  4RTY A;  4ATO A;  3C12 A;  2Z0W A;  1J3T A;  2RJC A;  2Y90 A;  4LE9 A;  4XAX B;  2EYX A;  3RKW A;  2X4Y A;  1V1C A;  1AZG B;  1OOT A;  2KNB B;  4E7H A;  4LXC A;  5KYX A;  3CD6 Q;  3RKY A;  1OU9 A;  4F7U B;  4D8K A;  2PVO B;  4A4K A;  3OYB A;  1G83 A;  2CKK A;  1KQ1 A;  3ZBD A;  1TXQ A;  3EH2 A;  3HRS A;  2CZ0 B;  2RHY A;  4HCB A;  1ZSZ C;  5GAO q;  3QYG B;  1IO6 A;  2E64 A;  2KR3 A;  4XU1 A;  2DL5 A;  4XTW A;  1VYV A;  4C92 F;  1G3T A;  2LC4 A;  4PJL A;  1D1C A;  4BUG A;  3EFO A;  3CBP A;  2D9T A;  4V2S A;  2OAU A;  2E5Q A;  1KIK A;  3EHR A;  4NL2 A;  1JB0 E;  2LJ3 A;  5AT1 B;  3CXC P;  1B3Q A;  3VS4 A;  2KAF A;  1K9A A;  2DYB A;  3KUF A;  1RL2 A;  2NUZ A;  2EWN A;  3C4S A;  4M75 E;  1NYF A;  2XD0 A;  2D0Q B;  4FT2 A;  2VGM A;  5DM7 R;  1W6X A;  1Q81 R;  5DLQ E;  1OYX A;  4WF2 A;  1PSF A;  2FVU A;  2OTJ T;  3RBB B;  3P8H A;  2K4Y A;  5KE3 A;  3CC2 Q;  4M7D D;  3UDC A;  3TSW A;  3OMG A;  5LJ5 f;  4RTU A;  1OQK A;  4N0A A;  3JCM J;  1YIJ Q;  3CCE A;  2ED1 A;  2MI6 A;  5GAM e;  2EAY A;  2QQR A;  5GAN 7;  3RNJ A;  2BIV A;  3QDF A;  4F04 B;  4EMK B;  1PD1 A;  1QMC A;  3M57 A;  3EGD A;  2LX9 A;  4HA8 A;  4HT8 A;  3OB9 A;  5HKC A;  2PQW A;  3J81 E;  1VQP T;  1QWE A;  1OPL A;  3MP6 A;  3OYY A;  1XQH A;  2KEA A;  1SKU B;  4F7U G;  2DBM A;  1VQ5 A;  3DLL A;  1M2V B;  4O6J A;  2RJD A;  5IXB A;  2C0I A;  2D0N A;  4E47 A;  3NTK A;  3TQ7 P;  1AOJ A;  1EFN A;  1TS9 A;  2BZ8 A;  4F17 A;  5L23 A;  1YCS B;  4QT7 A;  5D7U A;  3CCV Q;  2QEX A;  2R5A A;  3DLM A;  2O2O A;  3WXM B;  2L5Q A;  5FLX E;  5I2S A;  2VB6 A;  2FPF A;  1C6V X;  2DL7 A;  1VQL T;  3EHQ A;  5CO7 A;  3CCL T;  3G71 A;  2DL4 A;  1Y71 A;  1HK9 A;  4C8Q E;  1SHF A;  2HZY A;  5GAO r;  4ELZ C;  3I5R A;  1DJ7 B;  2JT4 A;  4BI8 B;  5J39 A;  3UWN A;  4B9W A;  1GCP A;  3TCJ A;  2RF0 A;  3M0U A;  4EDU A;  3JCM g;  3NFC A;  1KG1 A;  1JXO A;  3LX7 A;  3CCJ T;  5GAN 4;  3REB B;  1SF9 A;  3NMZ C;  1UGV A;  4KGX B;  2W0Z A;  3EG3 A;  3C0C A;  3JB9 H;  4M75 B;  4F16 A;  3CCL A;  1VQ9 A;  3X24 B;  5GAO n;  2DE0 X;  1VQK T;  1M8V A;  2PUO B;  1Q86 C;  3QG1 A;  4CRI A;  2DJQ A;  2XIC A;  1M9S A;  1OUL A;  2O9S A;  5CKH A;  2LMJ A;  3UA6 A;  2RO0 A;  4UC4 A;  2K3Y A;  4AG1 C;  3JCM h;  3CCJ A;  3OYK A;  4X34 A;  1JQQ A;  3G6E T;  3H0H A;  1JU5 C;  4EMK C;  2LX7 A;  3A1P A;  4J9E A;  1VQ6 Q;  3MHX A;  1QVF A;  3A8L B;  3I5S A;  3C94 A;  4HCK A;  2LVM A;  1IB8 A;  3J80 E;  4J5Y A;  1VQK A;  5A2Q E;  4DEX A;  1OPK A;  3MEV A;  5CKE A;  4L59 A;  3QDR B;  1YJ9 A;  4PFZ A;  2QA4 T;  3JCM P;  2E3I A;  3NHN A;  5LJ3 e;  1M3B A;  2MPX C;  1W70 A;  2BZY A;  3G6E A;  4XK8 E;  3OYH A;  4BE1 A;  2B8A A;  1YHQ Q;  4ZGD B;  4M75 A;  1VQ7 Q;  2ZPB B;  2MWO A;  4L5G A;  3LW5 E;  1HSQ A;  1O75 A;  2V8K A;  2RQV A;  1VQM T;  1H8K A;  1WI7 A;  4J9F A;  2KRO A;  2ROT A;  3DB3 A;  4PLL A;  4C8Q B;  2HSE B;  4JUV A;  3OYA A;  3CC7 Q;  1WZO A;  1TUC A;  2R57 A;  2X51 A;  4PJO F;  2PU9 B;  4MZT A;  3JCM c;  3UT1 A;  5IN1 A;  4QQG A;  4QW2 A;  2EBP A;  3CCQ Q;  4NOY A;  4JJB A;  3OYJ A;  1H3H A;  4M75 C;  4DOV A;  4L6V 5;  1PC0 A;  2DET A;  4M75 G;  4FL6 A;  4RUG A;  5LL6 S;  3D7S B;  1YI2 T;  1ZA2 B;  2DKG A;  1G3Y A;  5IH2 A;  2WSE E;  2CZ7 B;  4E7J A;  1JEG A;  3EG1 A;  2H8H A;  2L89 A;  4ZN3 A;  2QQB A;  4HVV A;  1CSK A;  2LNV A;  2KT1 A;  1HJD A;  2KQW A;  2KRN A;  1D0Z A;  4OGE A;  3TSZ A;  2P84 A;  2CP3 A;  2QAZ A;  2ROL A;  4M7A F;  2QQA A;  2AKK A;  2AKL A;  1N5Z A;  2YXY A;  1ZA1 B;  2P0K A;  2CDT A;  3M9Q A;  2IPO B;  1EZZ B;  1Q82 R;  4C8Q A;  3RES A;  3SHW A;  2O31 A;  2P0P A;  1GFD A;  1K9M C;  1VQ8 Q;  2VGN A;  3JCM d;  2AT1 B;  3H0I A;  3H6Z A;  2HDA A;  3TVT A;  1BCO A;  1VA7 A;  1PKS A;  2EQI A;  2RHU A;  3A5Z B;  1QCO A;  4QVZ A;  2PTK A;  2P4R A;  2DVE A;  2M16 A;  3CC4 T;  3JCM X;  3GPL A;  2KXC A;  1KHC A;  2RQT A;  2L3P A;  1GRI A;  2RHX A;  3VKI A;  2XMF A;  1IXD A;  1RAB B;  5I11 A;  2F2V A;  5I2M A;  4C8Q G;  5CCA A;  1YIT T;  1Z9Q A;  3MPU B;  3CBM A;  4LDU A;  1B7T A;  1I8F A;  2OTL A;  1R0B G;  3I55 A;  4DQ2 A;  2MWP A;  3VYH B;  2I0N A;  3QZ5 B;  1U5S A;  2XU8 A;  1BU1 A;  1KSW A;  1Q7Y U;  3BE3 A;  1WHG A;  1OZ3 A;  2LCL A;  3GNG A;  3DKM A;  1HXD A;  4M78 C;  5A0L A;  1K4U S;  4C92 E;  1RAD B;  4M4Z A;  3VYG A;  2XDD A;  2RHI A;  2KRM A;  2ZZD A;  1NYG A;  2RI2 A;  2ZAE A;  3M5A A;  4PKC C;  4M78 F;  1YP5 A;  3BW1 A;  3M54 A;  3ASK A;  1C1A A;  3GBQ A;  2P4T A;  1M2O A;  2KGT A;  2RQR A;  1RAH B;  3VS1 A;  4MDW A;  2HNI A;  3FJP A;  3NGP A;  3EGX B;  1AT1 B;  1Q81 C;  1VQN A;  3L2W A;  2ABL A;  4KUL A;  1TSF A;  2RPN A;  3L42 A;  1FXX A;  2OTJ Q;  5KYU B;  2A37 A;  2JVV A;  1WXB A;  2L3Q A;  5CQX A;  3URG A;  2E6N A;  1D0Y A;  4IIO A;  1TH7 A;  2NUT B;  2CZ6 B;  4P5N A;  4ESR A;  3E2U A;  5A0G A;  3LH5 A;  1BI0 A;  3TRE A;  4LNP A;  4YTL A;  3CCM T;  2COZ A;  1N8R U;  4AT1 B;  2SRC A;  3BDU A;  3VS2 A;  1VUB A;  4GBQ A;  1X6O A;  1VQP Q;  5GMK l;  3V7R A;  2COY A;  5DLO A;  2YWW A;  3OYM A;  4J7F A;  1UB4 A;  3HSB A;  1T0J A;  3VUZ A;  1K73 U;  3L2R A;  3ZFJ A;  1K76 A;  5GMK i;  1S72 T;  4ZGJ B;  3I9Q A;  4PJO D;  1WQ7 A;  1YJN A;  2XG8 D;  2GFA A;  2DXC A;  4JJD A;  1ZUU A;  1VQL Q;  3JAM E;  4JRK A;  2J6F A;  3MP1 A;  5KYX B;  3FIF A;  2CGH A;  3H8Z A;  4IUV A;  5GAM g;  3JRZ A;  2WSF E;  1M1K U;  1WDX A;  4HVW A;  1QVG S;  3OYN A;  2EVR A;  1MGQ A;  3QUI A;  1M4Z A;  4JJC A;  2A28 A;  5GAO p;  5KYN A;  4BD3 A;  2DRK A;  2MIO A;  4IIM A;  3E19 A;  3ER0 A;  4IUR A;  1N27 A;  2DL3 A;  4M7A D;  3EFO B;  1UHF A;  4XU3 A;  2HAX A;  5GAM h;  3AHU A;  4J8O A;  2ZPH B;  3MEU A;  4M77 F;  3PT9 A;  2AZS A;  1WJS A;  1TOV A;  1AWO A;  1UJY A;  4QKU A;  2L0A A;  4C92 A;  1E6H A;  1ZQ1 A;  2DTO A;  2KK4 A;  2DFU A;  2V26 A;  3CMA A;  2BTT A;  4OB3 B;  3PMI A;  2YRD A;  2E1H A;  1YJW T;  1M30 A;  1E6G A;  2JN0 A;  2ENM A;  2K57 A;  2EKO A;  3JCM W;  2EJF A;  2QA4 Q;  4J6W A;  2KMT A;  3NTI A;  1KC8 U;  2XID A;  3HHT B;  1LCK A;  2QDL A;  2WAC A;  2VWF A;  2EGC A;  3OS2 A;  2LTO A;  2E70 A;  1UGR B;  1UJ0 A;  3Q1J A;  3UPU A;  3JCM Q;  4Y28 E;  4Z89 A;  3EGD B;  3QSU A;  3CCU T;  3V8L A;  4C92 G;  1OI1 A;  1YJW A;  3G4S Q;  1VQM Q;  3VS5 A;  4XQ3 A;  2CH4 W;  3CCS A;  5D6X A;  5GMK e;  3L2V A;  3O5Z A;  3A8G B;  2RB6 A;  4CC7 A;  2M0Y A;  5GJW B;  2VUB A;  3CCE T;  2D8H A;  4J9D A;  1X27 A;  3JCM f;  2EYY A;  2E12 A;  2ZCF B;  1LPL A;  2DYI A;  4LDV A;  2ZPI B;  1G3W A;  2X3X D;  3CCU A;  2BE7 D;  2EYZ A;  4M78 D;  1YI2 Q;  1OX8 A;  2GFU A;  2V8I A;  5FWC A;  4ELY C;  1RAF B;  3VS6 A;  4FSS A;  2J6K A;  3EG2 A;  5LJ3 g;  3THK A;  1TTH B;  1VQ5 T;  3KBG A;  1NJI U;  2O88 A;  1SSF A;  1ZUY A;  2GTJ A;  2R5M A;  3E1S A;  5DY9 A;  1K8A U;  5I22 A;  3OW2 A;  2EFI A;  1IZ6 A;  2JNG A;  2QEX T;  2CS7 A;  4M7A E;  4XU2 A;  1NEG A;  1NLP C;  2OX7 A;  4KUI A;  4FIB A;  4PJM A;  4Y92 A;  3HKS A;  4XU0 A;  1Q82 C;  1QW1 A;  2PUK B;  4C5I A;  3G1J A;  4WCI A;  3QBY A;  5GAM d;  3LH0 A;  3G71 T;  3H9N A;  5LJ3 h;  3MKD A;  4FCY A;  2D8J A;  2K9G A;  3A8O B;  5C6S A;  2MF2 A;  1IHW A;  4BE2 A;  4LDY A;  4N0A C;  4BI3 A;  1TU0 B;  3X28 B;  2DK3 A;  2L2P A;  4F7U F;  1BIB A;  2F2X A;  1M90 U;  3V8J A;  4OB0 B;  4HVU A;  2BUD A;  4PLI A;  2RMO A;  3X25 B;  3CC4 Q;  1VYU A;  4Z88 A;  1H3Z A;  3HP9 A;  2DL8 A;  2K6D A;  2MMP A;  1VQ9 T;  1PWT A;  3L2Z A;  4KUD K;  2DVJ A;  1BK2 A;  2AK5 A;  3QHS A;  3CCR Q;  2ATC B;  5CAI A;  3RDV A;  2PNI A;  1GBQ A;  4XTX A;  4FYX B;  4JLI A;  3AT1 B;  4AMC A;  1QVF P;  1YIT Q;  1OU8 A;  3JV3 A;  1AWW A;  2HCK A;  5GAM j;  1WYX A;  1MMG A;  1UG1 A;  4DBH A;  2C0T A;  1B34 B;  3INZ A;  2K3B A;  3I56 A;  3SDZ A;  2DA9 A;  4QVD A;  4NL3 A;  2O4X B;  3FDR A;  2KT8 A;  4MMK A;  4A4G A;  2IG0 A;  3FLG A;  2W10 A;  2JZ2 A;  2DXU A;  2JXB A;  1YJ9 T;  3VU3 C;  2GQV A;  4J9B A;  1VQ4 Q;  3IQL A;  3JB9 G;  3CME A;  1NE8 A;  3WVD B;  2XDP A;  4DEY A;  3M0S A;  5KCH A;  2MCN A;  3OYL A;  1VQO T;  2EKH A;  2CT3 A;  4M7D E;  1OV3 A;  2M02 A;  4RCC A;  2LJ0 A;  2RJE A;  3MET A;  4M77 D;  8AT1 B;  1KD1 U;  1Q7Y R;  3EG9 A;  5GAN e;  3OYF A;  1RAA B;  4B6M A;  4ORZ A;  3VS7 A;  2EQK A;  2RN8 A;  1X6G A;  1B34 A;  2DZC A;  1HYO A;  8ATC B;  3OW2 S;  2JS0 A;  2QK0 A;  3M0Q A;  2DIG A;  1VQO A;  2YRC A;  2DF6 A;  1NZ9 A;  4JPB W;  4LD6 A;  4OMM A;  3U23 A;  5GAN d;  1AWX A;  2O4X A;  1R8O B;  1I5L A;  2H3J A;  4BAC A;  3CCM Q;  3GIB A;  5LJ3 d;  4AFQ C;  2MK5 A;  2K5L A;  4ZN1 A;  3VUB A;  3BFM A;  1PSE A;  4FYV B;  1Q95 G;  4KRT A;  5GAN 3;  5D6Y A;  3M0T A;  1UUE A;  2QGF B;  3CD6 A;  2E6Z A;  4MZM A;  2DMO A;  3V7S A;  1OZ2 A;  4O5V A;  1U06 A;  4M7A A;  2X4J A;  5KYY B;  2HQX A;  2YHT A;  1X2K A;  3PFS A;  1GBR A;  3R6O A;  1S72 Q;  2QG9 B;  1QLY A;  2JOY A;  1ZBJ A;  2J6O A;  4Q5W A;  1N8R R;  4J9H A;  2EQU A;  5FRO A;  2LQ8 A;  2X3W D;  4AFU C;  1AZE A;  1K1Z A;  4XTU A;  3M4Y A;  4M75 F;  5LJ3 j;  1QKW A;  1V29 B;  4JS5 A;  5GAN 6;  5KYW A;  3VS3 A;  4E6R A;  1F1B B;  2D1X A;  4QQ6 A;  1K73 R;  1D3B B;  2VV5 A;  1QCN A;  4X9C A;  3OMC A;  5KE2 A;  3OS5 A;  4DA4 A;  3OQ5 A;  4M7A G;  1MV3 A;  1MNE A;  1LJO A;  4M7D B;  5GJV B;  5J26 A;  1YIJ T;  3RUX A;  3P8B B;  3BDL A;  5CKD A;  3EAE A;  3E9G A;  1PCX A;  2VVK A;  2K5I A;  1MMA A;  4EMG A;  4ZGE B;  2KYM A;  4DBF A;  2E41 A;  1YNZ A;  3OSS C;  1QVG P;  3UF4 A;  3SWN A;  4D6W A;  4KT0 E;  1ZBX A;  2ZPF B;  5KYY A;  4J7I A;  1JJ2 A;  5FRM A;  2EIF A;  1QVF S;  3CC2 A;  2OTL T;  3I55 T;  2DM1 A;  4Y91 A;  3GOX A;  2G3R A;  1M1K R;  1ZHI A;  3RER A;  1A0N B;  1YIJ A;  4CC4 B;  4OGC A;  2QGG A;  1D1B A;  1BB9 A;  5FU6 B;  2MOX A;  5LJ5 e;  1GCQ A;  3E9F A;  5A0D A;  3CEY A;  4C8Q C;  5M9O A;  4EMH A;  1XNI A;  1VYT A;  2CSI A;  2F5K A;  1O9S A;  1I07 A;  2JMC A;  2YT6 A;  1YWP A;  3L1A A;  2V8J A;  1WA7 A;  1D3B A;  5FW9 A;  4A4H A;  3M59 A;  4C8Q F;  2YRV A;  4M7D A;  3LLR A;  3HRT A;  2QTX A;  3EG0 A;  3S3N A;  4A4E A;  2JTF A;  1UE9 A;  3OYC A;  1EIF A;  2QQS A;  4ME7 A;  4OML A;  4OMN A;  3X20 B;  1G5V A;  2KBT A;  5FU7 B;  1WHL A;  3CCV A;  1VQN T;  2R58 A;  2RK1 A;  1RLP C;  1RAG B;  1KK7 A;  2FRW A;  1IRE B;  1FMK A;  2CZ1 B;  5GAN 2;  3TU4 K;  1KQ2 A;  1D1A A;  5CIU A;  5GAM f;  1IGU A;  2GQI A;  1SRM A;  3CCE Q;  4M7D C;  3FEO A;  4JLG A;  3EH1 A;  1VOM A;  4M7D G;  2DRM A;  2RA2 A;  4C5H A;  4EIK A;  2HL5 C;  3OSV A;  4R55 A;  2JTE A;  1M8M A;  3NPF A;  1W2B A;  3VRY A;  2RNA A;  1XTD A;  3MP8 A;  3OS0 A;  4ZTJ A;  1VIF A;  2L8D A;  5CKB A;  2FZG B;  4IUQ A;  3OYE A;  4RG8 A;  1VQ5 Q;  4IKF A;  4J9I A;  1GXI E;  3OY9 A;  4QQD A;  2YUO A;  1M5Q 1;  3N5B B;  4N4H A;  2DER A;  2EPD A;  4NS5 A;  3LGL A;  2Y4X A;  1N9R A;  4MDX A;  2FHD A;  3CPF A;  3QKJ A;  4IUT A;  5FU6 C;  2I2L A;  2XK0 A;  2QEX Q;  3M0R A;  4KGZ B;  4K11 A;  2EJG A;  4J83 A;  3PTA A;  2L3R A;  1YJN T;  1VQ6 A;  4HKE A;  4II1 A;  2CRE A;  2RD1 A;  1VQ7 T;  4OF1 A;  1RAE B;  3G71 Q;  3X26 B;  2CUD A;  4C0F A;  2ECZ A;  1LVK A;  2XHC A;  1ABQ A;  1JJ2 S;  2E10 A;  4C0G A;  4RG2 A;  2GNC A;  2JW4 A;  4FSX A;  3R6N A;  5CQY A;  1U1T A;  1UEB A;  4PK4 A;  4F7U E;  1K8A R;  1Y0M A;  1M1G A;  3VRZ A;  5FU7 C;  3JB9 I;  1YHQ A;  3M56 A;  3H41 A;  1VQ7 A;  3ULR B;  1X6B A;  4C92 B;  5GMK h;  3CCL Q;  3CCQ T;  1KQS A;  1VQ9 Q;  2K7A A;  5GMK m;  1WJR A;  3CPW A;  3A8M B;  6AT1 B;  2DIQ A;  3OYG A;  4FW2 A;  4KH1 B;  1U3O A;  2G6F X;  2NUP A;  4B9X A;  4KH0 B;  1SPK A;  1X75 C;  2LQK A;  2YUN A;  1Y57 A;  3CCJ Q;  4OMF B;  5HCK A;  3CC7 A;  2RM4 A;  2KYB A;  1MMD A;  4BI4 A;  4JRP A;  4M75 D;  4OMO A;  1M90 R;  1PM3 A;  1T0H A;  5GAN f;  1I1J A;  3CCQ A;  2F69 A;  3JB9 J;  5GAO l;  1UGQ B;  2VYT A;  3HPW A;  1YWO A;  1VQK Q;  3CMA T;  3VS0 A;  2ZPG B;  4PL6 A;  3QJY A;  2GF7 A;  3PIO A;  3M55 A;  5LJ3 f;  2J7I A;  1YJ9 Q;  1MMN A;  2JS2 A;  2EYQ A;  3QZ9 B;  1SSH A;  2DJZ A;  3G6E Q;  3FC3 A;  3PVQ A;  3MCA B;  2KE9 A;  1BBZ A;  2PVD B;  1WPY A;  1RAC B;  2YSQ A;  2A7Y A;  3GNF B;  3QJ6 A;  1Q7Y C;  1W2B S;  1Z9Z A;  1T3S A;  1X43 A;  1P92 A;  3QII A;  3H0F A;  2RJF A;  1ZSZ A;  2ZGW A;  1T3L A;  4RCB A;  2QYZ A;  3EFS A;  2EQM A;  2HQH A;  3CCS T;  4ZNX A;  1Y7X A;  3MEW A;  1Q86 U;  3L2Q A;  1S1N A;  4KBM B;  1VQ8 A;  1YN8 A;  3ME9 A;  2E65 A;  4D8D A;  2YDL A;  1PG5 B;  3I35 A;  3ZEH A;  1Y96 A;  4PJJ A;  4GLK A;  4BDY A;  2HKQ B;  3UA7 A;  4C92 C;  1NPR A;  3QO3 A;  1WHJ A;  3CQT A;  1MND A;  2COW A;  1HD3 A;  1YFN A;  1X69 A;  4HCZ A;  4DBQ A;  1UTI A;  1SHG A;  2YUQ A;  4AG2 C;  4C8Q D;  1KD1 R;  4N4G A;  5CVI A;  1WXT A;  2DIL A;  4C5E A;  3OW2 P;  1WQW A;  1QWF A;  1UHC A;  5L8R E;  2DEQ A;  1TUD A;  1ZLM A;  2FEI A;  4PJO E;  2WSC E;  4JRQ A;  3OS1 A;  3MO8 A;  2IVW A;  3F70 A;  3SD4 A;  4HXJ A;  4FW1 A;  5GAN g;  2GBQ A;  4Z8A A;  1MUZ A;  3L2U A;  2LZ6 B;  3VV0 A;  3QPH A;  3S3M A;  1N8R C;  1KQS S;  2A0F B;  3CPW S;  2X4X A;  4JJN K;  1ZUK A;  4E7I A;  4JS4 A;  1AD5 A;  4BE0 A;  1AVZ C;  1FYN A;  1PNJ A;  4FM4 B;  5HY6 A;  2ZPE B;  2FZK B;  4TVR A;  4F7U A;  2DAQ A;  2HSP A;  4J9C A;  1K73 C;  3GF5 A;  2IIM A;  2FYK A;  2A08 A;  5GAN h;  4RTT A;  2JTM A;  2E5K A;  4X1V A;  4OVA A;  1NG2 A;  5ECA A;  1H64 1;  2NYS A;  5GMK j;  2DEU A;  3CXC A;  1V76 A;  2YLC A;  4OMP A;  5KH6 A;  2LQN A;  5FRN A;  2OTJ A;  4FYW B;  1E7O A;  2BZX A;  3M0P A;  3I56 T;  2GTO A;  1TWB A;  1M1K C;  2OTL Q;  1MV0 B;  3I55 Q;  2AZV A;  4XTV A;  3O8V A;  2EQJ A;  4FYY B;  4FT4 A;  1WHH A;  4J9G A;  3CBO A;  2NWM A;  1WIE A;  1BYM A;  2KRS A;  1WXU A;  2KI7 A;  2FG0 A;  2VXE A;  5CK9 A;  1BI2 A;  4HT9 A;  1BI3 A;  3EG9 B;  5IAY A;  1ZX6 A;  2L3S A;  1PD0 A;  2DTI A;  2DPP B;  2X9H A;  1VQP A;  2JUF A;  3CME T;  4E7S A;  1K9M U;  1I4K 1;  4PJO B;  3QYH B;  1U8R A;  3UAT A;  1R0C B;  3FB9 A;  2M51 A;  3EGU A;  4CC3 A;  2VXF A;  4GY5 A;  2BE9 B;  2KDS A;  2MYS A;  1VQN Q;  3JSC A;  4EMK A;  2F2W A;  2FO0 A;  3OBW A;  1PHT A;  2M9U A;  1UGS B;  1VIE A;  1NEB A;  2QTV A;  1VQL A;  2LDM A;  4M78 E;  1SG5 A;  1YBY A;  1M2V A;  1K0S A;  1KC8 C;  5LJ5 g;  3V8K A;  4R56 A;  4M7A B;  3HFN A;  1N6A A;  3JB9 F;  1ZSG A;  1FWZ A;  2LCC A;  9ATC B;  2RI3 A;  1WHM A;  1TG0 A;  1Y07 A;  2DXB A;  3QWX X;  3GP8 A;  1YCY A;  1W1F A;  1UFF A;  2J05 A;  4MZP A;  3PE0 A;  1CKB A;  2RK2 A;  2DD5 A;  2HQE A;  3S3O A;  1OX9 A;  2FPE A;  4PJO A;  1GL5 A;  3CD6 T;  2RQW A;  3OA6 A;  4LD9 K;  5KYW B;  4HCC A;  5LJ5 h;  2PVG B;  1WJQ A;  3SB2 A;  4RTX A;  3M58 A;  5FWB A;  3T9N A;  1WX6 A;  3HFO A;  4RKU E;  4DBR A;  3OBY A;  2FPD A;  1JBM A;  2O01 E;  2D6F A;  2LCS A;  2LJ1 A;  3ZL7 C;  1YJN Q;  1RAI B;  4XTZ A;  3CXC S;  1KFZ A;  5GAN 8;  4AFS C;  1Q81 U;  4JZ3 A;  1RI9 A;  2H3E B;  3M4G A;  3M53 A;  1H92 A;  4PJO C;  1FMW A;  3SWN B;  1NJI C;  4PJO G;  2LP5 A;  1NM7 A;  2QQ9 A;  3OYD A;  1LOJ A;  3G4S T;  2VC8 A;  3PNW C;  1K8A C;  2GGR A;  4PJN A;  1G8X A;  4R0K A;  1QQJ A;  2RI5 A;  4A54 A;  4JRI A;  4KGV B;  2QA4 A;  3RMS A;  1IHV A;  2FL7 A;  1M3A A;  4LN2 A;  2HD0 A;  4OB2 B;  2DO3 A;  5GAN j;  1OEB A;  3EFR A;  4C92 D;  1WGS A;  4E7L A;  2YLB A;  2HEQ A;  2K2V A;  4J6X A;  4BY6 B;  1JJ2 P;  1PRM C;  1MHN A;  2KVQ G;  2VKN A;  4ZTF A;  1PRL C;  2EGE A;  1UEC A;  5I21 A;  2JJ9 A;  2LT1 A;  1G3S A;  1XOV A;  5IHK A;  3G4S A;  1VQM A;  3VJP A;  3J7A F;  5HK0 A;  4M78 B;  3CC2 T;  2K3X A;  4M7A C;  1XJW B;  4RTV A;  1WNL A;  1SRL A;  2B86 A;  3GLX A;  1M90 C;  1AHJ B;  2XKO C;  2AIR B;  3PVL A;  4JDS A;  2O9V A;  3KXT A;  3SEM A;  4ANJ A;  1UGP B;  2QXF A;  5IHN A;  3WVE B;  2QDY B;  1QP3 A;  1SEM A;  3BY7 A;  3REA B;  2CH4 A;  3JCM e;  3HTR A;  1NLO C;  3CMA Q;  5IHI A;  3NTH A;  2J06 A;  1YI2 A;  2X4W A;  2CP5 A;  1R77 A;  4M77 E;  3DB4 A;  1PKT A;  3MJX A;  5GAN 5;  1BCM A;  2F1L A;  1ARK A;  2CUB A;  2V1Q A;  2C06 A;  2M0O A;  3HRU A;  2FZC B;  2RH2 A;  3CCV T;  4RMO A;  1C0M A;  1FMV A;  3SFM A;  3MEA A;  2KXD A;  5IT9 E;  3V7C A;  2PZ1 A;  3A8H B;  3SWN C;  1YJW Q;  1IGQ A;  3JCM V;  4M78 A;  5LJ5 d;  3CCS Q;  2LNH B;  2DXT A;  2X35 A;  4C0Z A;  3CCR T;  2CP2 A;  2OAW A;  4QVC A;  2KSS A;  2HL3 A;  1G2B A;  1RLQ C;  2OJ2 A;  1W2B P;  4E2F B;  1BIA A;  2CYZ B;  2DNU A;  5CKF A;  3QXE B;  4EPC A;  1B07 A;  1QKX A;  4LUD A;  1GCQ C;  3QWY A;  2JM9 A;  2JM8 A;  4BY6 C;  3CCU Q;  3CC4 A;  1KD1 C;  4MML A;  4RTW A;  2EYW A;  1RI0 A;  1QVG A;  1I81 A;  1LNX A;  4JZ4 A;  3FRN A;  1WFW A;  3CCR A;  1X2Q A;  3OYI A;  2DLP A;  3FJ5 A;  4IUU A;  4M78 G;  3LYI A;  2NLU A;  1KC8 R;  1Q86 R;  4GLM A;  2QI2 A;  1KHI A;  1YIT A;  1VQ4 T;  4XTY A;  1UDL A;  5LJ5 j;  2KY9 A;  3G7Z A;  1IRX A;  4BB7 A;  1D09 B;  3A98 A;  2DX1 A;  1NBE B;  1M3C A;  4A53 A;  2EW3 A;  3RR6 A;  1VQ6 T;  4LUE A;  1QP2 A;  2HMA A;  2E3H A;  4A63 B;  2CP7 A;  2OI3 A;  4M7D F;  1FX7 A;  2GCX A; 
#chains in the Genus database with same CATH homology
 2DVJ A;  2A36 A;  1BK2 A;  2AK5 A;  5IH2 A;  2PNI A;  1GBQ A;  4ZNX A;  1JEG A;  3EG1 A;  2H8H A;  1S1N A;  4HVV A;  1CSK A;  1KJW A;  3JV3 A;  2KT1 A;  1AWW A;  1YN8 A;  2HCK A;  2JMA A;  1WYX A;  1UG1 A;  1I0C A;  1HJD A;  2KRN A;  2C0T A;  4D8D A;  2YDL A;  2K3B A;  3I35 A;  3TSZ A;  1K0X A;  3UA7 A;  2DA9 A;  4CC2 A;  1M27 C;  1WLP B;  2ROL A;  2ED0 A;  3CQT A;  2AKK A;  1HD3 A;  2AKL A;  2KT8 A;  1N5Z A;  1X69 A;  1UTI A;  1SHG A;  2YUQ A;  4OMQ A;  4AG2 C;  1WXT A;  2CDT A;  2DIL A;  2W10 A;  2JXB A;  1QWF A;  1UHC A;  2RQU A;  2V1R A;  1TUD A;  3SHW A;  2ESW A;  1ZLM A;  2FEI A;  2O31 A;  4J9B A;  1GFD A;  2K2M A;  3IQL A;  3H0I A;  2C0O A;  2HDA A;  1JO8 A;  3TVT A;  1VA7 A;  1PKS A;  2EQI A;  4DEY A;  3M0S A;  2MCN A;  2PTK A;  4HXJ A;  1AEY A;  2EKH A;  2P4R A;  2CT3 A;  2CSQ A;  1OV3 A;  1JXM A;  1MUZ A;  1AWJ A;  2GBQ A;  4Z8A A;  2LZ6 B;  2K79 A;  2LJ0 A;  2KXC A;  2RQT A;  2L3P A;  1GRI A;  1ZUK A;  1AD5 A;  2XMF A;  1AVZ C;  1FYN A;  1PNJ A;  4ORZ A;  2CT4 A;  3VS7 A;  5I11 A;  2F2V A;  2RN8 A;  1X6G A;  1CKA A;  2HBW A;  1Z9Q A;  2HSP A;  2JS0 A;  3M0Q A;  4J9C A;  2DF6 A;  2FRY A;  3KFV A;  2IIM A;  4JPB W;  4OMM A;  3U23 A;  1AWX A;  2A08 A;  2SEM A;  1ABO A;  1GFC A;  4RTT A;  4RTZ A;  2EGA A;  1RUW A;  2I0N A;  1U5S A;  1BU1 A;  2LQW A;  1KSW A;  2E5K A;  4X1V A;  4AFQ C;  1QCF A;  1NG2 A;  5ECA A;  4AFZ C;  1K4U S;  4M4Z A;  4KRT A;  4OMP A;  3M0T A;  1UUE A;  2KRM A;  2LQN A;  5EC7 A;  5IXF A;  1NYG A;  1E7O A;  2BZX A;  3M0P A;  2DMO A;  2GTO A;  1MV0 B;  2AZV A;  1U06 A;  2YUP A;  1YP5 A;  4J9G A;  4F14 A;  2DBK A;  1X2K A;  1GBR A;  2NWM A;  1WIE A;  3GBQ A;  2KGT A;  2RQR A;  2KRS A;  1WXU A;  4RTY A;  3VS1 A;  1QLY A;  1ZBJ A;  2FG0 A;  2J6O A;  3NGP A;  1J3T A;  4J9H A;  2X3W D;  4AFU C;  2ABL A;  4LE9 A;  1AZE A;  1K1Z A;  2EYX A;  1ZX6 A;  2L3S A;  1V1C A;  1AZG B;  2RPN A;  1OOT A;  2KNB B;  1QKW A;  2A37 A;  1WXB A;  2L3Q A;  4D8K A;  1G83 A;  4IIO A;  3VS3 A;  4E6R A;  2D1X A;  3UAT A;  4ESR A;  2M51 A;  1MV3 A;  3LH5 A;  4LNP A;  3EGU A;  5GJV B;  4CC3 A;  2SRC A;  1IO6 A;  2KR3 A;  2F2W A;  2FO0 A;  2VVK A;  3VS2 A;  2DL5 A;  1PHT A;  4GBQ A;  1NEB A;  2KYM A;  1VYV A;  1YNZ A;  3UF4 A;  1KIK A;  1K0S A;  3EHR A;  1T0J A;  2DM1 A;  2LJ3 A;  1K76 A;  1B3Q A;  3VS4 A;  1A0N B;  1ZSG A;  1K9A A;  4CC4 B;  2DYB A;  1BB9 A;  1TG0 A;  3QWX X;  2MOX A;  2NUZ A;  1W1F A;  1GCQ A;  1UFF A;  2J05 A;  1NYF A;  3PE0 A;  3I9Q A;  1CKB A;  1VYT A;  2CSI A;  4JJD A;  1W6X A;  1ZUU A;  2FPE A;  1GL5 A;  2J6F A;  3RBB B;  1I07 A;  2JMC A;  2RQW A;  2YT6 A;  1YWP A;  1WA7 A;  5FW9 A;  3TSW A;  4RTU A;  4RTX A;  1WDX A;  4HVW A;  5FWB A;  1WX6 A;  3EG0 A;  1UE9 A;  2ED1 A;  2EVR A;  4OML A;  2FPD A;  4OMN A;  2KBT A;  2LCS A;  2LJ1 A;  3ZL7 C;  3RNJ A;  4JJC A;  1RLP C;  2A28 A;  1KFZ A;  4AFS C;  2FRW A;  4JZ3 A;  2DRK A;  1RI9 A;  2MIO A;  4IIM A;  1FMK A;  1H92 A;  1QWE A;  2DL3 A;  1OPL A;  1UHF A;  2LP5 A;  1NM7 A;  2KEA A;  2DBM A;  2GGR A;  4R0K A;  5IXB A;  2GQI A;  1SRM A;  2C0I A;  2D0N A;  1AOJ A;  1EFN A;  2BZ8 A;  4LN2 A;  1M3A A;  4F17 A;  5L23 A;  1YCS B;  1OEB A;  2AZS A;  4QT7 A;  2DRM A;  1AWO A;  2HEQ A;  1UJY A;  4EIK A;  2O2O A;  1PRM C;  2JTE A;  2L0A A;  2VKN A;  1M8M A;  1E6H A;  2FPF A;  3NPF A;  1PRL C;  3VRY A;  2RNA A;  2EGE A;  1UEC A;  2DL7 A;  3EHQ A;  2BTT A;  1XOV A;  5IHK A;  2DL4 A;  1M30 A;  1SHF A;  1E6G A;  4J9I A;  2ENM A;  2YUO A;  3I5R A;  2JT4 A;  2EPD A;  1SRL A;  2B86 A;  4RTV A;  1GCP A;  2RF0 A;  3M0U A;  1LCK A;  2QDL A;  3PVL A;  2O9V A;  3M0R A;  1JXO A;  2VWF A;  4K11 A;  3REB B;  2EGC A;  3NMZ C;  3SEM A;  1UGV A;  1UJ0 A;  5IHN A;  2W0Z A;  3EG3 A;  3C0C A;  1SEM A;  3REA B;  2CH4 A;  2CRE A;  4Z89 A;  1NLO C;  4F16 A;  5IHI A;  2J06 A;  2CUD A;  2DE0 X;  2ECZ A;  3VS5 A;  1PKT A;  1ABQ A;  2CH4 W;  2DJQ A;  1ARK A;  2GNC A;  2JW4 A;  3O5Z A;  3R6N A;  2O9S A;  2CUB A;  2V1Q A;  2LMJ A;  4CC7 A;  2M0Y A;  3UA6 A;  5GJW B;  4AG1 C;  1Y0M A;  2D8H A;  4J9D A;  1X27 A;  3VRZ A;  2EYY A;  1JQQ A;  3H0H A;  1JU5 C;  2LX7 A;  4J9E A;  2KXD A;  2X3X D;  3H41 A;  3I5S A;  1X6B A;  3ULR B;  4HCK A;  2EYZ A;  2K7A A;  2PZ1 A;  5FWC A;  3VS6 A;  4FSS A;  4DEX A;  1OPK A;  2J6K A;  3EG2 A;  3THK A;  2LNH B;  1U3O A;  2G6F X;  2OAW A;  2O88 A;  1SPK A;  1ZUY A;  2GTJ A;  1G2B A;  1RLQ C;  2OJ2 A;  2YUN A;  1Y57 A;  5I22 A;  2DNU A;  3NHN A;  5HCK A;  1M3B A;  2KYB A;  1B07 A;  1W70 A;  1QKX A;  4LUD A;  2BZY A;  4OMO A;  1GCQ C;  3QWY A;  2JM9 A;  2JM8 A;  1T0H A;  1NEG A;  1NLP C;  1I1J A;  4RTW A;  2EYW A;  4Y92 A;  1HSQ A;  1YWO A;  3VS0 A;  2RQV A;  4JZ4 A;  4WCI A;  2D8J A;  2K9G A;  1WFW A;  1H8K A;  2J7I A;  1WI7 A;  1X2Q A;  2DLP A;  4J9F A;  2JS2 A;  2KRO A;  2ROT A;  3FJ5 A;  4GLM A;  1TUC A;  1SSH A;  2L2P A;  1UDL A;  3PVQ A;  2F2X A;  2KE9 A;  1BBZ A;  3A98 A;  4HVU A;  2DX1 A;  2YSQ A;  2EBP A;  2RMO A;  1M3C A;  1VYU A;  4Z88 A;  2EW3 A;  4JJB A;  1H3H A;  1Z9Z A;  4LUE A;  1T3S A;  1X43 A;  2DL8 A;  3H0F A;  4A63 B;  2K6D A;  2OI3 A;  4RUG A;  1T3L A;  1PWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...