4CC2A

Complex of human tuba c-terminal sh3 domain with human n-wasp proline- rich peptide - p212121
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
b'NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DYNAMIN-BINDING PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 12
structure length 63
sequence length 63
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc2A00
1GFCA 2RMOA 2FRWA 2V1QA 2J6KA 1AD5A 4JZ3A 1N5ZA 1SPKA 4RTXA 1V1CA 1AZEA 1JXOA 1K0SA 1SSHA 2L3QA 2DL7A 1KSWA 1X69A 3REBB 2HCKA 2JS2A 3GBQA 2OI3A 1RLPC 4GBQA 3JV3A 1AEYA 1HSQA 1PRMC 1A0NB 1NLPC 1S1NA 3CQTA 1W1FA 2EBPA 2EW3A 1QWEA 2DA9A 4DEYA 1YNZA 4HCKA 4F14A 2RPNA 2DL5A 1MV3A 3NPFA 4HVWA 2KT1A 4OMMA 2X3WD 2JTEA 1QKXA 1K9AA 2DJQA 2A36A 5IHKA 2JMAA 4J9EA 5FWBA 2YT6A 2K2MA 4CC2A 1UG1A 3PE0A 2F2WA 1TUCA 2AKKA 2H8HA 3M0RA 2DBKA 5L23A 3EHQA 2VWFA 2RQUA 2LJ3A 3QWXX 1RI9A 1WX6A 2C0TA 4JZ4A 4OMLA 4E6RA 1Y57A 4A63B 1EFNA 1GRIA 1UE9A 1K0XA 4GLMA 3VS5A 1AVZC 4JJBA 4CC4B 2PNIA 3EGUA 2ED1A 1KJWA 3PVQA 2L2PA 1ZUKA 1BB9A 2O9SA 3VS7A 3TVTA 1UJYA 4DEXA 2LQNA 1ABQA 1UJ0A 2NWMA 2C0OA 1ZBJA 2F2XA 1U06A 1I1JA 4HXJA 1B3QA 4CC3A 1LCKA 2C0IA 5IH2A 4J9IA 1NEBA 1ZSGA 2ECZA 1K1ZA 1YWOA 1X6GA 2BZYA 1NYFA 1X2KA 3VS6A 2P4RA 1GFDA 2HSPA 2D0NA 1OPLA 5ECAA 1SRMA 2J06A 2JM8A 2IIMA 2K79A 1RLQC 4JJDA 2CREA 1B07A 1VA7A 1AWWA 2MCNA 4Z89A 2RQWA 2KT8A 3VRZA 3UATA 1FMKA 1M27C 4J9GA 1ZUYA 1GCPA 1AZGB 2KR3A 4JPBW 1W6XA 2GQIA 2LX7A 3THKA 2F2VA 5GJWB 2DLPA 3UF4A 4CC7A 1GBRA 2GTOA 2EGEA 2M51A 1J3TA 4JJCA 1ZX6A 1PWTA 2YUOA 1WIEA 2BZXA 2FPFA 1Y0MA 2EPDA 2YSQA 2CSIA 1U3OA 1WI7A 2RF0A 2E5KA 4WCIA 2A37A 1YCSB 1QLYA 2ABLA 1SHGA 1T0JA 1JO8A 1UUEA 1YP5A 1TG0A 2EYXA 1SEMA 2DMOA 2ENMA 2L3PA 3A98A 3U23A 4OMOA 1T0HA 3NHNA 2YUQA 1KIKA 2MOXA 3H0IA 1NLOC 2DL4A 4OMQA 2J7IA 4IIMA 1T3LA 2GTJA 1W70A 2DYBA 1ZUUA 1WA7A 1PNJA 4J9HA 1CSKA 2KROA 2O2OA 4AFZC 3H0FA 2ED0A 2DF6A 2LQWA 3VS3A 2G6FX 2J05A 2OAWA 2W0ZA 1AWXA 2J6FA 1M30A 4Z88A 4HVUA 1E6HA 1KFZA 1ZLMA 3M0PA 1MV0B 2KRSA 2MIOA 1X27A 1G2BA 2VKNA 4ZNXA 3M0UA 2EKHA 3I5SA 2KEAA 2FPDA 5IHNA 2GNCA 2PZ1A 1GL5A 2D1XA 3I9QA 1VYVA 1QCFA 2VVKA 1ARKA 1WXBA 2ROTA 1HJDA 2DRMA 1UHFA 3M0TA 1OOTA 1H8KA 1NEGA 4F17A 2YUPA 1NM7A 3EG1A 5IXFA 2YDLA 2SEMA 2EGCA 3NMZC 2KYBA 2DM1A 2KXCA 1Z9QA 1PKTA 5HCKA 1Z9ZA 3EG3A 1CKBA 4Y92A 2KYMA 3SEMA 4OMPA 1UFFA 2KGTA 2OJ2A 2DVJA 4LUEA 3I35A 1OPKA 2KRNA 1JEGA 2LMJA 5FWCA 4LN2A 2ROLA 3LH5A 2D8JA 3VS1A 1GBQA 2LP5A 3R6NA 1OV3A 1WYXA 2K9GA 2CDTA 3UA6A 2FO0A 4J9FA 3TSWA 2CT3A 3RBBB 4RTZA 3SHWA 1H92A 4HVVA 3VRYA 4KRTA 3C0CA 1SRLA 2BZ8A 3ULRB 2AZVA 2RQRA 5FW9A 2B86A 2DX1A 4RTWA 1PKSA 1H3HA 2AZSA 2LJ1A 2KRMA 2K6DA 2LNHB 2EYZA 2DBMA 2JS0A 4IIOA 3NGPA 1UTIA 2FEIA 4AFUC 2FRYA 4X1VA 4QT7A 2KNBB 1NG2A 2O9VA 3VS2A 5I11A 2O88A 2W10A 3M0QA 2EGAA 4RUGA 2JXBA 2A08A 3H41A 2EQIA 2EYYA 1FYNA 3QWYA 3TSZA 2J6OA 1M3BA 2HBWA 1YWPA 4ORZA 1AWOA 3EG2A 3FJ5A 4RTUA 1UECA 1M8MA 2A28A 2YUNA 1CKAA 3O5ZA 1E7OA 5IXBA 4J9DA 4D8KA 2RQTA 1K76A 1PRLC 2HEQA 2EVRA 2GBQA 4D8DA 1X6BA 2LJ0A 1BK2A 2EYWA 1RUWA 1JXMA 1QKWA 3ZL7C 2DNUA 1TUDA 3IQLA 2I0NA 1QWFA 3EG0A 4LE9A 2ESWA 1VYTA 2K3BA 1HD3A 1VYUA 1JU5C 2HDAA 4K11A 2FG0A 3RNJA 2JT4A 1WDXA 2JM9A 2DL8A 4LNPA 1GCQC 2L3SA 2X3XD 1GCQA 1WLPB 2RNAA 3VS0A 1U5SA 3PVLA 1I0CA 1SHFA 1BU1A 2DILA 2JMCA 2LZ6B 2AK5A 1WXTA 2O31A 1XOVA 2GGRA 1X2QA 3M0SA 2KXDA 4AG1C 1X43A 2LCSA 2CUDA 5I22A 3I5RA 3KFVA 1WXUA 4J9BA 4RTYA 4EIKA 1T3SA 2CH4A 2QDLA 1UDLA 5EC7A 1NYGA 2CT4A 2DE0X 2RN8A 2RQVA 2JW4A 2CUBA 1UHCA 3REAB 2SRCA 4AG2C 2V1RA 4F16A 2DRKA 3EHRA 2M0YA 2K7AA 1OEBA 2KBTA 1M3CA 2CSQA 4RTTA 1UGVA 4Z8AA 2CH4W 2KE9A 1AWJA 2NUZA 4LUDA 2AKLA 5IHIA 2D8HA 2BTTA 4AFSC 1YN8A 2XMFA 1MUZA 2PTKA 4R0KA 1ABOA 4RTVA 4J9CA 1BBZA 4FSSA 2L0AA 1E6GA 3VS4A 1JQQA 1WFWA 1PHTA 4M4ZA 3H0HA 2DL3A 4ESRA 1K4US 1I07A 1G83A 1AOJA 4AFQC 3UA7A 1IO6A 4OMNA 5GJVB 1M3AA 2FPEA
chains in the Genus database with same CATH superfamily
2DPPB 4E7IA 1UGQB 4JZ3A 4RG8A 1YI2Q 3V7CA 5GAN8 3REBB 2QA4A 1M90C 2OI3A 4GBQA 4Y91A 3OY9A 4WF2A 1PSEA 3L2QA 1M90U 3PTAA 1S1NA 4BY6C 5D7UA 3G71Q 7AT1B 2NUTB 3WXMB 2RPNA 5GAMg 3NPFA 4XAXB 3MKDA 1QKXA 4BE0A 3MP8A 1K9AA 4KUDK 3OYLA 3TREA 2A36A 2GCXA 2JMAA 4J9EA 4UC4A 4JRKA 4A4KA 1OQKA 1ZSZA 1KHCA 1WQ7A 2AKKA 5GANf 5LJ5e 3CMEQ 3CCLQ 2OTLT 2X4YA 3CC4Q 1RAHB 3EHQA 1TXQA 2VWFA 2RQUA 2LJ3A 3CPWS 1D09B 4B9WA 4EDUA 4EPCA 5GANd 2CP0A 3MCAB 3X28B 3EGUA 3EFRA 4F04B 1YJWA 1BB9A 3CBOA 3HKSA 4PFOA 1DJ7B 2XI9A 4DEXA 4KULA 1ABQA 3E9FA 1UJ0A 4ZTJA 1VQKT 1U06A 2FYKA 4J7IA 1KQSA 4HXJA 1LCKA 4C5EA 3CCMT 2DXCA 3GF5A 3S6WA 2ECZA 4M77D 4E47A 4F7UG 1VQ9A 1YWOA 5L8RE 1X6GA 3DKMA 3P8DA 5LJ5j 3VS6A 2P4RA 2QTVA 4PJOB 1XJWB 2CZ0B 1OPLA 4N4GA 5ECAA 3H6ZA 2J06A 3OYDA 4RCCA 4HA8A 1QVFP 4JJDA 1VA7A 1K9MC 4R55A 4JS4A 3CCVQ 2KT8A 3OS2A 5CKBA 3URGA 1K9MU 4A4EA 1M27C 2JUFA 3PGGA 1X01A 4M7DB 3QJ6A 2GQVA 1H641 2GTOA 2F69A 2CS7A 1J3TA 3RIRA 3FIFA 2PUOB 2FPFA 1Y0MA 3UPUA 2JTFA 2QEXA 2CSIA 3L2RA 2F5TX 2GFUA 1SHGA 2A7YA 2QI2A 2VASA 1T0JA 1YJ9T 1JO8A 1YP5A 2EYXA 4QW2A 1WNLA 2L3PA 3CD6T 2P0KA 1VQ5A 3FRNA 3NHNA 3UWNA 5M9OA 1ZSZB 3CCEA 1WQWA 3H0IA 4C0ZA 4FYVB 1NLOC 2DL4A 4XTXA 2EIFA 2JOYA 4IIMA 2DYIA 5DLOA 2MPXC 2CGHA 2YXYA 3QZ5B 3A8MB 1ZUUA 2ZPIB 1I4K1 1WA7A 1CSKA 4PJOF 4FYWB 2KDSA 2O2OA 3KUFA 3CC7A 2ED0A 2JJ9A 3VS3A 2D6FA 5FU7B 2J05A 2OAWA 1D0ZA 3NTIA 4HVUA 4M75A 1KFZA 2DVEA 4BD3A 4L59A 1LNXA 1HXDA 1U1TA 1WHGA 1X27A 1XQHA 1TWBA 3BDLA 5GMKm 2MWOA 3M59A 3LX7A 4OVAA 1FX7A 2FZKB 1UB4A 2ROTA 4MZTA 3MEUA 3EH2A 5I2MA 4JRIA 4VUBA 3M0TA 3C4SA 1OOTA 1VQ6Q 3G4ST 5IXFA 1G3YA 2RJCA 3CCRQ 2YDLA 4MZMA 1UGPB 1QP3A 2DKGA 2EGCA 3OB9A 2KXCA 5FU6B 1VQ8A 5HCKA 4HCZA 2RJFA 1TH7A 3SEMA 4RKUE 5LJ3e 5DM7R 3QG1A 1UFFA 3MP1A 4FL6A 1MMGA 1VQLT 2OJ2A 4DBHA 1C1AA 3I35A 2QA4T 1D1BA 5GAOq 1Y07A 5GMKl 2E4HA 3MEAA 4L6V5 3GIBA 2D8JA 4A4HA 2LP5A 1O75A 1OV3A 2LNVA 4X9CA 3UA6A 3CCQA 4E7LA 3SHWA 2CYZB 4BDZA 4HVVA 2Y90A 4KRTA 2QQSA 2HL3A 1RAGB 3CC2A 3OSVA 2D0QB 3M5AA 2QG9B 2E3IA 1PKSA 1H3HA 1IZ6A 2LNHB 5GMKj 2EYZA 2JS0A 4IIOA 4LDVA 3CCJT 1VQNQ 1S72A 1UTIA 5CKHA 1TS9A 2FRYA 4TVRA 1WHLA 1WHMA 5LJ3j 2KNBB 1NG2A 3VS2A 1Q81R 3OW2A 3RKYA 3PT9A 2A08A 3H41A 4FT2A 4M75B 2K5IA 1YJNA 4FW1A 4E2FB 3C12A 3QXEB 1ACMB 2VV5A 2A28A 2YUNA 2I2LA 3JB9F 3O5ZA 3X25B 2EFIA 3QKJA 5IXBA 2FL7A 3H9NA 2M9UA 2RQTA 2GBQA 4PFZA 5GAMj 1IB8A 3V7SA 3OYCA 4J8OA 2CP6A 2EJFA 1VOMA 3IQLA 2I0NA 1SKUB 1QWFA 3M4GA 1VYTA 5GAMh 1JU5C 5CQYA 3KBGA 5GANh 4C8QD 3RNJA 2K3XA 2DO3A 2PVOB 1PD0A 2RB6A 4MZPA 1YHQT 1GCQA 1LVKA 4LXCA 3VS0A 1I0CA 2CZ6B 4JRQA 2DILA 3EH1A 2LZ6B 3L2WA 1IREB 5KYNA 2PVGB 3M0SA 3C94A 3NTHA 4JDSA 2EJGA 4M75F 2CUDA 3KFVA 2QEXT 3CXCA 1C0MA 3BFMA 4EIKA 2DD4A 3V8LA 2E6ZA 2XHCA 2DD5A 5LJ5g 3M57A 3QIIA 3MP6A 1VQOQ 1Q82C 1M9SA 3ZEHA 1KHIA 3CMAT 2ZPEB 2CUBA 3RERA 4E7ZA 1PC0A 4F7UA 3OYBA 2LQ8A 2OTLA 3CBPA 3OMGA 2KE9A 4OB2B 1Y7XA 5LL6S 4J83A 2EAYA 4ME7A 5HK3A 1EX4A 1G3SA 2AKLA 2DXUA 3CC7T 2BTTA 3EGXB 2XMFA 1MUZA 1VQMQ 3G6ET 1TUGB 1Q86R 1ZBXA 2ZPBB 2RHXA 2L8DA 2OX7A 2E5QA 3OYNA 4PJOC 2HKQB 3VKIA 4FM4B 1G83A 2FVUA 3LH0A 4C92G 1VQKA 1N8RU 2QYZA 1GFCA 4FU6A 2V1QA 5KYUB 1BI0A 3CCMQ 2O01E 3OBWA 3OW2P 4NOYA 1JXOA 3CCMA 3EAEA 1K0SA 3R6OA 3GBQA 3JB9H 1RLPC 2DEQA 3HHTB 3CEYA 1PRMC 1W4SA 2X51A 5GAOr 2XG8D 1A0NB 1VQ8T 2E64A 3CQTA 4IUPA 1W1FA 2EBPA 5IT9E 1QWEA 3M56A 2AIRB 2LC4A 1YNZA 5C0MA 4Y28E 4HCKA 1BYMA 1MV3A 3I56T 3EFSA 1TU0B 4OMMA 2X3WD 1QVGA 2XDDA 2LCLA 2YLCA 3DLMA 2BE9B 5FWBA 4Q5WA 1ZSZC 2YT6A 2K2MA 1Q7YC 2DIQA 1Q7YU 3A5ZB 1TUCA 1OYXA 5A2QE 4ZGJB 2AHJB 3J81E 3QJYA 3DB4A 3QWXX 1G8XA 1YJ9A 1WX6A 3CD6Q 2C0TA 5FU7C 3CCUA 4ZTFA 4E6RA 5CKDA 2M0OA 1RL2A 2QDYB 1EFNA 1MMDA 4C5HA 1SSFA 2PNIA 3PVQA 1ZUKA 1V29B 2RD1A 1M90R 3VS7A 2IG0A 4DQ2A 2YRDA 3CXCP 4OP0A 1ZBJA 4ZGEB 3L2VA 4IURA 2AT1B 2PU9B 4KBMB 3BY7A 3GPLA 3GP8A 2RI5A 3INZA 1YJNT 1ZSGA 3HPWA 1K1ZA 2XD0A 2BZYA 5FU6C 2X4WA 1OZ2A 2NYSA 1SRMA 1G5VA 2DETA 2K79A 3JCMf 1RLQC 1B07A 3I55T 1OULA 3G4SQ 2RQWA 3MHXA 3VRZA 1YIJA 3UATA 1FMKA 3GNGA 3PFSA 4M7AG 2LX9A 4J9GA 5LJ3g 2XDPA 1U1SA 2LX7A 5GJWB 2DLPA 2IVWA 3JCMd 1RAFB 2M51A 3CBMA 1ZX6A 3X20B 3OYKA 4F7UF 1VQ7T 1W2BA 2YSQA 1LPLA 4JUVA 2ZPHB 2QA4Q 2RF0A 1VQLA 1BCOA 4C92D 1QLYA 2ABLA 5LJ3f 4DOVA 3RMSA 5GAOp 2NUPA 1SEMA 2DMOA 3VV0A 3OYIA 4C5IA 1T0HA 3HFOA 2YUQA 3CCSA 1KIKA 4XTWA 5CR2A 3TU4K 2J7IA 4M77E 1KQ2A 4C0GA 2VYTA 3VUZA 4M78G 4J9HA 4X34A 1RADB 1WGSA 2DF6A 8ATCB 4M75C 1QVGP 2W0ZA 3M53A 3CCJA 3P8BB 3E2UA 5GAN5 5GAMf 4E7JA 1K9MR 1ZLMA 3TEEA 2KRSA 4ELYC 5KE2A 1NJIC 2QQRA 1JJ2A 2HQHA 2M1HA 4ZNXA 3M0UA 2QGFB 2EKHA 1TSFA 1MNDA 2KEAA 3OYYA 5CO7A 3I9QA 2VVKA 1ARKA 5GAMd 1YJWQ 1IXDA 4C0DC 1H8KA 2YUPA 1NM7A 3EG1A 1K73C 2DZCA 1N6AA 2KYBA 1WJSA 3LGFA 1Z9ZA 1CKBA 2KYMA 3FEOA 4OMPA 3OMCA 1VQ9Q 4J7FA 4M77C 2DXBA 1WJQA 3BDUA 2DVJA 2QGGA 1JEGA 1D1CA 1MMAA 2KAFA 1RAIB 5CIUA 5FWCA 2ROLA 3P8HA 1QQJA 2QQBA 5I2SA 3EGDA 2EQMA 3R6NA 2K9GA 5LJ5h 4NL3A 3VUBA 1YHQA 1B7TA 1GXIE 4ANJA 2FO0A 4J9FA 3TSWA 3OA6A 3VYGA 4A54A 4RTZA 2XICA 1H92A 4LD9K 1OU8A 2NUPB 5GAOn 4JLGA 2AZVA 2RQRA 5FW9A 2DXTA 2DX1A 2E12A 4BI4A 4PL6A 2AZSA 4BUGA 2KRMA 1HK9A 2K6DA 2QEXQ 4M7AD 1RABB 2DZ9A 5DLQE 1TOVA 4KGXB 1UGSB 3JRZA 2ZZDA 4C92A 4X1VA 3G7ZA 1QW1A 3CMAA 2O88A 4XU0A 1VQ5Q 2W10A 3VYHB 3M0QA 2LT4A 3CCUT 1WHHA 4JJNK 3CCEQ 4A4GA 2EQIA 4FYXB 4QQGA 5GMKi 1FYNA 3TSZA 2HBWA 3FJ5A 5DY9A 3TQ7P 4C5GA 5IN1A 4P5NA 4RTUA 3CC7Q 1CKAA 3X24B 1QCOA 3E9GA 9ATCB 1X6OA 1R0BG 4D8KA 1K76A 1PRLC 4F7UE 3G6EA 3RUXA 2KK4A 3RR6A 4IUTA 4C8QG 4M78D 1ZQ1A 4FIBA 3OBYA 2OAUA 1VYUA 3JCMV 2HDAA 1K8AC 3MO8A 1F1BB 2HSEB 4HT8A 5AT1B 2R57A 1GCQC 2L3SA 3FJPA 2RNAA 1U5SA 1YIJT 3PVLA 2DAQA 1WXTA 1VQ8Q 2GGRA 1X2QA 1I81A 4J6WA 4AG1C 1EIFA 2R5AA 1X43A 3EGDB 5I22A 3I5RA 1N9RA 3AT1B 1KC8C 3I56A 1BIBA 4OB3B 1VQ4T 1JRIA 4J9BA 4N4HA 3VJPA 1QVFS 2V8JA 4M77A 1KQSP 1T3SA 2CH4A 1RAEB 5CVIA 1NYGA 2CT4A 2RQVA 1VQPT 1PD1A 2JW4A 4FT4A 3REAB 2XK0A 3CCQQ 3CCST 5AYFA 3OSSC 2M0YA 2EJ9A 1MGQA 2KBTA 4BI3A 1YI2T 3CC2Q 4PLLA 4RTTA 3JCMh 4Z8AA 3G1JA 2CZ1B 5IHIA 3OYEA 2MI6A 4C8QE 2BIVA 1YN8A 3S3OA 4M7AA 3WVDB 4A53A 1S72Q 1ABOA 4J5YA 4RTVA 3M58A 4FSSA 1Q95G 3G71T 5CKFA 1WFWA 2FB7A 5GMKh 2DL3A 1K4US 3L1AA 2GF7A 4QVCA 5FRMA 2XKOC 2NLUA 1WJRA 2RMOA 5LJ3h 4PJOG 5FLXE 2FRWA 5GANe 2DTOA 2K5LA 1YJNQ 3M4YA 1G3TA 2J6KA 1BIAA 1H3ZA 2WSFE 4RTXA 1AZEA 2O4XA 2DL7A 1KSWA 1X69A 3X26B 3CMET 3CCLT 3CC4T 1HSQA 1Q82R 4EMGA 1VIEA 2LVMA 2RK1A 2P0PA 4M7DG 2EW3A 1I5OB 2RI2A 1BI1A 2RJDA 2R58A 3I55A 2DL5A 4DBRA 2COWA 3JCMc 4HVWA 4C0DB 1V76A 2QASA 2DJZA 2QXFA 4NL2A 4KH1B 4HCCA 5IHKA 3D7SB 1KK7A 1YFNA 2P4TA 5CKEA 4CC2A 3QPHA 1VQ7A 1UG1A 1PSFA 3OS1A 2H8HA 3M0RA 2DBKA 5L23A 2F5KA 4M77B 4IUVA 5J39A 4L5GA 1KQ1A 4MMKA 1N8RR 4OGCA 1KQSS 3HRSA 1M4ZA 1GRIA 4AT1B 4GLMA 3VS5A 1AVZC 4CC4B 5EG2A 2ED1A 1KJWA 4FYYB 2O9SA 1M5Q1 3QHSA 2Z0WA 5GAN2 2RHZA 3TVTA 2DFUA 3OYGA 3S3NA 3OYAA 1Q82U 2NWMA 2C0OA 3CPWA 2F2XA 4QQ6A 3GOXA 2L5QA 2CP5A 4M7AB 1B3QA 1M1KC 3QZ9B 2OTLQ 4PJJA 5IH2A 1IGQA 1M2OA 1NEBA 1HYOA 2WSEE 5LJ5f 5HK0A 1X2KA 1JBMA 3SDZA 2HSPA 2D9TA 1M2VA 4WTOB 4O6JA 1Q7YR 3VU3C 3OS0A 2OTJA 2KSSA 3E1SA 2P84A 2MCNA 3L2UA 2LRQA 1TTHB 5LJ5d 5GAN3 1AZGB 4M77F 1VQKQ 2GQIA 3THKA 3UF4A 1OZ3A 1GBRA 3JSCA 5GAN6 3JB9G 1WIEA 3HFNA 5IAYA 3F70A 1FWZA 4RG2A 1YCSB 1VIFA 2EQKA 2RK2A 4IUQA 4LDXA 4PJOD 2ENMA 3A98A 2RHYA 3U23A 3QDRB 4M7AF 1NZ9A 2EQUA 2MOXA 4OMQA 2DIGA 2GTJA 4M7DD 1PNJA 5FRNA 2VGNA 1VQ6T 3CCRT 3H0FA 2E41A 2LQWA 4C8QA 2X9HA 5CQXA 3AHUA 1AWXA 2J6FA 2RJEA 4J6YA 4XU3A 1E6HA 4XTYA 4FW2A 1YJ9Q 4M75G 2XU8A 1IRXA 4MDXA 1G2BA 2KVQG 2E3HA 2VKNA 3I5SA 3CCUQ 2FPDA 5IHNA 2GNCA 2PZ1A 2Y4YA 1GL5A 3JCMX 3FLGA 1VYVA 1KD1C 4PJLA 2DERA 1Q86C 5KCOA 1KD1U 1MHNA 4F7UB 1NE8A 4C92E 1UHFA 1NEGA 4F17A 3M55A 1B34A 2SEMA 4ZN1A 4JLIA 4JRPA 3NMZC 3QDFA 2DM1A 1M2VB 2HQEA 2K57A 1ZA2B 4HT9A 2KI7A 3BW1A 3MPUB 4Y92A 2M02A 2GFAA 2KGTA 4D6WA 3A8GB 2CP2A 1VQNT 2LMJA 2BE7D 4QQDA 4QVDA 4LN2A 3LH5A 5D6YA 2BUDA 2QAZA 1WYXA 1NPPA 2CDTA 5KYXA 1YIJQ 4GLKA 3META 2PVDB 3NTKA 4PNOA 2PQWA 1NJIR 4EMKA 1XNIA 4Z02A 3VRYA 5HKCA 1IHWA 3C0CA 1SRLA 3OW2S 3ULRB 3QSUA 2B86A 2LJ1A 1BI3A 2V8IA 4ZGDB 2X35A 1VQLQ 3NGPA 3OQ5A 4C92C 1VQ4A 4OGEA 4AFUC 1JB0E 4EMHA 1YITA 5J26A 1K73R 2O9VA 3JB9D 2K4YA 5D6WA 1M1FA 5CAIA 1VQPA 2EGAA 3CCSQ 4C8QB 2VGMA 4RUGA 1FXXA 4PK4A 2EYYA 5LJ3d 2J6OA 1YWPA 4ORZA 3V8KA 2FHDA 3EG2A 1YI2A 4FCYA 3T9NA 3J7AF 4LDWA 2HL5C 2HNIA 4M7DA 1E7OA 1RI0A 4J9DA 3CCJQ 4B6MA 2HEQA 2EVRA 4D8DA 5A0DA 2DEUA 3NFCA 3G71A 2LJ0A 3RMQA 2WSCE 2EYWA 3EG9A 1LOJA 4B9XA 1JXMA 5GANg 1QKWA 1Y71A 3ZL7C 1NJIU 2DNUA 1TUDA 1B34B 2JN0A 3EG0A 2ESWA 2K3BA 2MK5A 4K11A 1BCMA 1SF9A 1VQOT 5KYWA 2JT4A 1WDXA 4CI0C 2JM9A 4M7AE 3RDVA 2DL8A 4M75D 2OTJT 3CXCS 2L89A 2YWWA 3ME9A 2KMTA 4R56A 3JCMP 1SHFA 1BU1A 3A8HB 3CMEA 3CCLA 1WHJA 2JMCA 2AK5A 4RMOA 3CC4A 1OI1A 3RKWA 1K73U 2QQ9A 2O31A 2VC8A 2RA2A 2COYA 4KGVB 1U8RA 2RO0A 4OMFB 4C8QF 2LCSA 5KYXB 1QCNA 2MWPA 1VQMT 1WXUA 4RTYA 4EMKB 2E70A 3ZFJA 3ER0A 1UDLA 5EC7A 2DE0X 2RN8A 3HSBA 1OX9A 1YHQQ 4AG2C 1D1AA 2V1RA 4KGZB 1NPRA 2DRKA 2YRVA 4M78E 3A1PA 3EHRA 2LQKA 2K7AA 1OEBA 2CSQA 1UGVA 2CH4W 1AWJA 4QVZA 4LUDA 2ZAEA 1ZHIA 1K8AR 4M7AC 3ZBDA 4R0KA 3L2ZA 4J9CA 2L0AA 1E6GA 3CCVA 1PHTA 3CMAQ 3H0HA 1W2BP 2EWNA 1D3BA 3UA7A 1IO6A 4OMNA 1M3AA 2FPEA 3HRTA 2JNGA 4PKCC 2DK3A 4KUIA 1AD5A 3FC3A 1N5ZA 1SPKA 1V1CA 2G3RA 3EG9B 1SSHA 2H3JA 2L3QA 1KC8R 1I5LA 2HCKA 2JS2A 1QVGS 1X75C 4KH0B 3JV3A 1OU9A 2CZ7B 1AEYA 1WPYA 3PNWC 4J6XA 1NLPC 3G6EQ 5KYWB 2FZGB 3HRUA 1LJOA 4XU1A 2KQWA 2DTHA 2DA9A 4DEYA 4M78C 3RKXA 3JB9J 1FMVA 4F14A 1AT1B 2F1LA 2RHIA 5GAOm 2HBPA 1R8OB 3TCJA 4N0AC 2KT1A 2JTEA 2HKNA 2DJQA 1N9SA 2HMAA 1BKBA 2QQAA 3N5BB 1K8AU 1JJ2P 4C0FA 3PE0A 2F2WA 2DTIA 2RH2A 2EQJA 1RAAB 2HAXA 4M7DF 1RI9A 3JCMe 1Y96A 4JZ4A 1D0YA 4OMLA 2E6NA 4XK8E 1Y57A 4PLIA 4A63B 2MMPA 1PCXA 1UE9A 1K0XA 4DBQA 3I56Q 1PG5B 2H3EB 4JJBA 5A0GA 1QVPA 2L2PA 5GAOl 4DOWA 1KC8U 3O8VA 4PJNA 1YITT 4PJMA 2PUKB 2M16A 1VQ6A 1UJYA 3CCRA 2LQNA 5GMKe 1N27A 3OS5A 1M8VA 3JB9I 1I1JA 2HD0A 2LCCA 4CC3A 5GAN7 3FB9A 2C0IA 3QUIA 5CK9A 4J9IA 4C92B 3GNFB 1NYFA 2JZ2A 2LTOA 1GFDA 3A8LB 2KY9A 1D3BB 2B8AA 2D0NA 2JM8A 1SG5A 2IIMA 2V8KA 5FROA 1XTDA 3GLXA 1W2BS 2CREA 1AWWA 4Z89A 2K5FA 3L42A 4PFPA 2CP7A 1ZUYA 1GCPA 2KR3A 1AHJB 3JCMb 4JPBW 1QMCA 1W6XA 4E7SA 2F2VA 4CC7A 1P92A 2QK0A 3HP9A 2EGEA 4JJCA 5GAMe 1PWTA 2YUOA 2BZXA 4BY6B 2EPDA 3WVEB 1I8FA 4HCBA 1U3OA 2E1HA 1WI7A 2RM4A 2COZA 3LLRA 2E5KA 4WCIA 1FMWA 2A37A 1VQNA 3OYFA 1RACB 2JTMA 3QBYA 2A0FB 1UUEA 1TG0A 5CCAA 3EGXA 3I55Q 4OMOA 4FSXA 3SWNC 4AMCA 2VXEA 1M1KR 3DB3A 2RHUA 1KG1A 1YJWT 4YTLA 2K2VA 4M78A 1JJ2S 1T3LA 3PMTA 4C92F 3Q1JA 1W70A 5GAN4 2DYBA 2VXFA 4N0AA 4C8QC 2KROA 1Y96B 4AFZC 4ATOA 3V8JA 1VQ7Q 2G6FX 4XTUA 1M30A 4XTVA 4Z88A 5KYUA 5KCHA 3PIPA 3M0PA 1MV0B 5GANj 2MIOA 3A8OB 3BE3A 3OYMA 2V26A 1VQ9T 4IUUA 4ELZC 1O9SA 2D1XA 1QCFA 1PM3A 2YLBA 2RI3A 1WXBA 6AT1B 1HJDA 3SFMA 1R77A 3C95A 2DRMA 4BB7A 4OF1A 4ZN3A 2X4JA 2IPOB 3V7RA 3CCVT 4N4IA 4PJOE 1Q81C 1Q81U 1Z9QA 4HKEA 1PKTA 3JCMW 2ZPFB 3E19A 4BI8B 2MF2A 3EG3A 1VUBA 1M1KU 5KYYA 3DLLA 4LUEA 2EYQA 1OPKA 2CP3A 2QTXA 4M7DE 3ASKA 2KRNA 1VQOA 2OTJQ 3EFOA 3VS1A 1GBQA 5D6XA 1VQ5T 3LW5E 4OB0B 4DBFA 2X4XA 3CCET 2YRCA 4EMKC 2O4XB 2CT3A 3RBBB 4NS5A 2BKDN 3OYJA 4LDYA 2BZ8A 4BDYA 4XTZA 4RTWA 4JS5A 1IGUA 1IHVA 1KD1R 1QP2A 2DBMA 4KT0E 1VQMA 2XIDA 4M78B 2FEIA 4CRIA 1YCYA 1D0XA 4QT7A 1UEBA 3SD4A 2VUBA 1NBEB 1BI2A 4QKUA 2LDMA 5I11A 1N8RC 2P0QA 5KE3A 3M54A 4XU2A 4MMLA 2XDBA 2JXBA 2EKOA 4RCBA 3SWNA 3QWYA 1M3BA 3J80E 1AWOA 4M7DC 4LDUA 3FDRA 3QYHB 1UECA 4BACA 1M8MA 4GY5A 2LT1A 3LWHA 4OB1B 3QO3A 1X6BA 3OYHA 1BK2A 1RUWA 2CKKA 1C6VX 1OX8A 4O5VA 5HY6A 4BE1A 3CPFA 1R0CB 3JAME 4II1A 4XQ3A 4LE9A 1HD3A 8AT1B 3JCMQ 1WZOA 4E7HA 2FG0A 2JVVA 2WACA 3LYIA 4LNPA 1YBYA 2NUTA 1Q86U 2X3XD 1WLPB 2HQXA 4M78F 5KYYB 3CCQT 2MYSA 3MJXA 2HZYA 3CC2T 4V2SA 1XOVA 5I21A 3CD6A 2KXDA 3SB2A 3EFOB 2VB6A 2E10A 1EZZB 1MMNA 3PMIA 5KH6A 3CPWP 1M1GA 5C6SA 1S72T 2Y4XA 3MEVA 4IKFA 2K3YA 2QDLA 1UGRB 4LD6A 2A3LA 3S3MA 4M77G 3LGLA 2E65A 1ZA1B 5A0LA 1UHCA 2SRCA 2ZGWA 3JCMg 4DA4A 4MDWA 3QYGB 4F16A 3HL8A 2L3RA 3LWIA 2C06A 3UT1A 3M9QA 3PIOA 3JCMJ 1M3CA 1G3WA 1QVFA 2YHTA 2MAMA 2NUZA 1MNEA 3MEWA 4E7KA 3UDCA 2FZCB 2D8HA 4AFSC 2ZPGB 2ZCFB 3RESA 4BE2A 4A4FA 4M75E 2PTKA 3KXTA 3HTRA 1VQ4Q 1BBZA 1YITQ 2ATCB 3SWNB 3VS4A 1JQQA 3G4SA 4X9DA 4M4ZA 2R5MA 1WHKA 4ESRA 1VQPQ 1I07A 1AOJA 3H8ZA 5J3BA 4AFQC 4PJOA 5GJVB
chains in the Genus database with same CATH topology
1GFCA 2RMOA 2FRWA 2V1QA 2J6KA 1AD5A 4JZ3A 1N5ZA 1SPKA 4RTXA 1V1CA 1AZEA 1JXOA 1K0SA 1SSHA 2L3QA 2DL7A 1KSWA 1X69A 3REBB 2HCKA 2JS2A 3GBQA 2OI3A 1RLPC 4GBQA 3JV3A 1AEYA 1HSQA 1PRMC 1A0NB 1NLPC 1S1NA 3CQTA 1W1FA 2EBPA 2EW3A 1QWEA 2DA9A 4DEYA 1YNZA 4HCKA 4F14A 2RPNA 2DL5A 1MV3A 3NPFA 4HVWA 2KT1A 4OMMA 2X3WD 2JTEA 1QKXA 1K9AA 2DJQA 2A36A 5IHKA 2JMAA 4J9EA 5FWBA 2YT6A 2K2MA 4CC2A 1UG1A 3PE0A 2F2WA 1TUCA 2AKKA 2H8HA 3M0RA 2DBKA 5L23A 3EHQA 2VWFA 2RQUA 2LJ3A 3QWXX 1RI9A 1WX6A 2C0TA 4JZ4A 4OMLA 4E6RA 1Y57A 4A63B 1EFNA 1GRIA 1UE9A 1K0XA 4GLMA 3VS5A 1AVZC 4JJBA 4CC4B 2PNIA 3EGUA 2ED1A 1KJWA 3PVQA 2L2PA 1ZUKA 1BB9A 2O9SA 3VS7A 3TVTA 1UJYA 4DEXA 2LQNA 1ABQA 1UJ0A 2NWMA 2C0OA 1ZBJA 2F2XA 1U06A 1I1JA 4HXJA 1B3QA 4CC3A 1LCKA 2C0IA 5IH2A 4J9IA 1NEBA 1ZSGA 2ECZA 1K1ZA 1YWOA 1X6GA 2BZYA 1NYFA 1X2KA 3VS6A 2P4RA 1GFDA 2HSPA 2D0NA 1OPLA 5ECAA 1SRMA 2J06A 2JM8A 2IIMA 2K79A 1RLQC 4JJDA 2CREA 1B07A 1VA7A 1AWWA 2MCNA 4Z89A 2RQWA 2KT8A 3VRZA 3UATA 1FMKA 1M27C 4J9GA 1ZUYA 1GCPA 1AZGB 2KR3A 4JPBW 1W6XA 2GQIA 2LX7A 3THKA 2F2VA 5GJWB 2DLPA 3UF4A 4CC7A 1GBRA 2GTOA 2EGEA 2M51A 1J3TA 4JJCA 1ZX6A 1PWTA 2YUOA 1WIEA 2BZXA 2FPFA 1Y0MA 2EPDA 2YSQA 2CSIA 1U3OA 1WI7A 2RF0A 2E5KA 4WCIA 2A37A 1YCSB 1QLYA 2ABLA 1SHGA 1T0JA 1JO8A 1UUEA 1YP5A 1TG0A 2EYXA 1SEMA 2DMOA 2ENMA 2L3PA 3A98A 3U23A 4OMOA 1T0HA 3NHNA 2YUQA 1KIKA 2MOXA 3H0IA 1NLOC 2DL4A 4OMQA 2J7IA 4IIMA 1T3LA 2GTJA 1W70A 2DYBA 1ZUUA 1WA7A 1PNJA 4J9HA 1CSKA 2KROA 2O2OA 4AFZC 3H0FA 2ED0A 2DF6A 2LQWA 3VS3A 2G6FX 2J05A 2OAWA 2W0ZA 1AWXA 2J6FA 1M30A 4Z88A 4HVUA 1E6HA 1KFZA 1ZLMA 3M0PA 1MV0B 2KRSA 2MIOA 1X27A 1G2BA 2VKNA 4ZNXA 3M0UA 2EKHA 3I5SA 2KEAA 2FPDA 5IHNA 2GNCA 2PZ1A 1GL5A 2D1XA 3I9QA 1VYVA 1QCFA 2VVKA 1ARKA 1WXBA 2ROTA 1HJDA 2DRMA 1UHFA 3M0TA 1OOTA 1H8KA 1NEGA 4F17A 2YUPA 1NM7A 3EG1A 5IXFA 2YDLA 2SEMA 2EGCA 3NMZC 2KYBA 2DM1A 2KXCA 1Z9QA 1PKTA 5HCKA 1Z9ZA 3EG3A 1CKBA 4Y92A 2KYMA 3SEMA 4OMPA 1UFFA 2KGTA 2OJ2A 2DVJA 4LUEA 3I35A 1OPKA 2KRNA 1JEGA 2LMJA 5FWCA 4LN2A 2ROLA 3LH5A 2D8JA 3VS1A 1GBQA 2LP5A 3R6NA 1OV3A 1WYXA 2K9GA 2CDTA 3UA6A 2FO0A 4J9FA 3TSWA 2CT3A 3RBBB 4RTZA 3SHWA 1H92A 4HVVA 3VRYA 4KRTA 3C0CA 1SRLA 2BZ8A 3ULRB 2AZVA 2RQRA 5FW9A 2B86A 2DX1A 4RTWA 1PKSA 1H3HA 2AZSA 2LJ1A 2KRMA 2K6DA 2LNHB 2EYZA 2DBMA 2JS0A 4IIOA 3NGPA 1UTIA 2FEIA 4AFUC 2FRYA 4X1VA 4QT7A 2KNBB 1NG2A 2O9VA 3VS2A 5I11A 2O88A 2W10A 3M0QA 2EGAA 4RUGA 2JXBA 2A08A 3H41A 2EQIA 2EYYA 1FYNA 3QWYA 3TSZA 2J6OA 1M3BA 2HBWA 1YWPA 4ORZA 1AWOA 3EG2A 3FJ5A 4RTUA 1UECA 1M8MA 2A28A 2YUNA 1CKAA 3O5ZA 1E7OA 5IXBA 4J9DA 4D8KA 2RQTA 1K76A 1PRLC 2HEQA 2EVRA 2GBQA 4D8DA 1X6BA 2LJ0A 1BK2A 2EYWA 1RUWA 1JXMA 1QKWA 3ZL7C 2DNUA 1TUDA 3IQLA 2I0NA 1QWFA 3EG0A 4LE9A 2ESWA 1VYTA 2K3BA 1HD3A 1VYUA 1JU5C 2HDAA 4K11A 2FG0A 3RNJA 2JT4A 1WDXA 2JM9A 2DL8A 4LNPA 1GCQC 2L3SA 2X3XD 1GCQA 1WLPB 2RNAA 3VS0A 1U5SA 3PVLA 1I0CA 1SHFA 1BU1A 2DILA 2JMCA 2LZ6B 2AK5A 1WXTA 2O31A 1XOVA 2GGRA 1X2QA 3M0SA 2KXDA 4AG1C 1X43A 2LCSA 2CUDA 5I22A 3I5RA 3KFVA 1WXUA 4J9BA 4RTYA 4EIKA 1T3SA 2CH4A 2QDLA 1UDLA 5EC7A 1NYGA 2CT4A 2DE0X 2RN8A 2RQVA 2JW4A 2CUBA 1UHCA 3REAB 2SRCA 4AG2C 2V1RA 4F16A 2DRKA 3EHRA 2M0YA 2K7AA 1OEBA 2KBTA 1M3CA 2CSQA 4RTTA 1UGVA 4Z8AA 2CH4W 2KE9A 1AWJA 2NUZA 4LUDA 2AKLA 5IHIA 2D8HA 2BTTA 4AFSC 1YN8A 2XMFA 1MUZA 2PTKA 4R0KA 1ABOA 4RTVA 4J9CA 1BBZA 4FSSA 2L0AA 1E6GA 3VS4A 1JQQA 1WFWA 1PHTA 4M4ZA 3H0HA 2DL3A 4ESRA 1K4US 1I07A 1G83A 1AOJA 4AFQC 3UA7A 1IO6A 4OMNA 5GJVB 1M3AA 2FPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFC A;  2RMO A;  2FRW A;  2V1Q A;  2J6K A;  1AD5 A;  4JZ3 A;  1N5Z A;  1SPK A;  4RTX A;  1V1C A;  1AZE A;  1JXO A;  1K0S A;  1SSH A;  2L3Q A;  2DL7 A;  1KSW A;  1X69 A;  3REB B;  2HCK A;  2JS2 A;  3GBQ A;  2OI3 A;  1RLP C;  4GBQ A;  3JV3 A;  1AEY A;  1HSQ A;  1PRM C;  1A0N B;  1NLP C;  1S1N A;  3CQT A;  1W1F A;  2EBP A;  2EW3 A;  1QWE A;  2DA9 A;  4DEY A;  1YNZ A;  4HCK A;  4F14 A;  2RPN A;  2DL5 A;  1MV3 A;  3NPF A;  4HVW A;  2KT1 A;  4OMM A;  2X3W D;  2JTE A;  1QKX A;  1K9A A;  2DJQ A;  2A36 A;  5IHK A;  2JMA A;  4J9E A;  5FWB A;  2YT6 A;  2K2M A;  4CC2 A;  1UG1 A;  3PE0 A;  2F2W A;  1TUC A;  2AKK A;  2H8H A;  3M0R A;  2DBK A;  5L23 A;  3EHQ A;  2VWF A;  2RQU A;  2LJ3 A;  3QWX X;  1RI9 A;  1WX6 A;  2C0T A;  4JZ4 A;  4OML A;  4E6R A;  1Y57 A;  4A63 B;  1EFN A;  1GRI A;  1UE9 A;  1K0X A;  4GLM A;  3VS5 A;  1AVZ C;  4JJB A;  4CC4 B;  2PNI A;  3EGU A;  2ED1 A;  1KJW A;  3PVQ A;  2L2P A;  1ZUK A;  1BB9 A;  2O9S A;  3VS7 A;  3TVT A;  1UJY A;  4DEX A;  2LQN A;  1ABQ A;  1UJ0 A;  2NWM A;  2C0O A;  1ZBJ A;  2F2X A;  1U06 A;  1I1J A;  4HXJ A;  1B3Q A;  4CC3 A;  1LCK A;  2C0I A;  5IH2 A;  4J9I A;  1NEB A;  1ZSG A;  2ECZ A;  1K1Z A;  1YWO A;  1X6G A;  2BZY A;  1NYF A;  1X2K A;  3VS6 A;  2P4R A;  1GFD A;  2HSP A;  2D0N A;  1OPL A;  5ECA A;  1SRM A;  2J06 A;  2JM8 A;  2IIM A;  2K79 A;  1RLQ C;  4JJD A;  2CRE A;  1B07 A;  1VA7 A;  1AWW A;  2MCN A;  4Z89 A;  2RQW A;  2KT8 A;  3VRZ A;  3UAT A;  1FMK A;  1M27 C;  4J9G A;  1ZUY A;  1GCP A;  1AZG B;  2KR3 A;  4JPB W;  1W6X A;  2GQI A;  2LX7 A;  3THK A;  2F2V A;  5GJW B;  2DLP A;  3UF4 A;  4CC7 A;  1GBR A;  2GTO A;  2EGE A;  2M51 A;  1J3T A;  4JJC A;  1ZX6 A;  1PWT A;  2YUO A;  1WIE A;  2BZX A;  2FPF A;  1Y0M A;  2EPD A;  2YSQ A;  2CSI A;  1U3O A;  1WI7 A;  2RF0 A;  2E5K A;  4WCI A;  2A37 A;  1YCS B;  1QLY A;  2ABL A;  1SHG A;  1T0J A;  1JO8 A;  1UUE A;  1YP5 A;  1TG0 A;  2EYX A;  1SEM A;  2DMO A;  2ENM A;  2L3P A;  3A98 A;  3U23 A;  4OMO A;  1T0H A;  3NHN A;  2YUQ A;  1KIK A;  2MOX A;  3H0I A;  1NLO C;  2DL4 A;  4OMQ A;  2J7I A;  4IIM A;  1T3L A;  2GTJ A;  1W70 A;  2DYB A;  1ZUU A;  1WA7 A;  1PNJ A;  4J9H A;  1CSK A;  2KRO A;  2O2O A;  4AFZ C;  3H0F A;  2ED0 A;  2DF6 A;  2LQW A;  3VS3 A;  2G6F X;  2J05 A;  2OAW A;  2W0Z A;  1AWX A;  2J6F A;  1M30 A;  4Z88 A;  4HVU A;  1E6H A;  1KFZ A;  1ZLM A;  3M0P A;  1MV0 B;  2KRS A;  2MIO A;  1X27 A;  1G2B A;  2VKN A;  4ZNX A;  3M0U A;  2EKH A;  3I5S A;  2KEA A;  2FPD A;  5IHN A;  2GNC A;  2PZ1 A;  1GL5 A;  2D1X A;  3I9Q A;  1VYV A;  1QCF A;  2VVK A;  1ARK A;  1WXB A;  2ROT A;  1HJD A;  2DRM A;  1UHF A;  3M0T A;  1OOT A;  1H8K A;  1NEG A;  4F17 A;  2YUP A;  1NM7 A;  3EG1 A;  5IXF A;  2YDL A;  2SEM A;  2EGC A;  3NMZ C;  2KYB A;  2DM1 A;  2KXC A;  1Z9Q A;  1PKT A;  5HCK A;  1Z9Z A;  3EG3 A;  1CKB A;  4Y92 A;  2KYM A;  3SEM A;  4OMP A;  1UFF A;  2KGT A;  2OJ2 A;  2DVJ A;  4LUE A;  3I35 A;  1OPK A;  2KRN A;  1JEG A;  2LMJ A;  5FWC A;  4LN2 A;  2ROL A;  3LH5 A;  2D8J A;  3VS1 A;  1GBQ A;  2LP5 A;  3R6N A;  1OV3 A;  1WYX A;  2K9G A;  2CDT A;  3UA6 A;  2FO0 A;  4J9F A;  3TSW A;  2CT3 A;  3RBB B;  4RTZ A;  3SHW A;  1H92 A;  4HVV A;  3VRY A;  4KRT A;  3C0C A;  1SRL A;  2BZ8 A;  3ULR B;  2AZV A;  2RQR A;  5FW9 A;  2B86 A;  2DX1 A;  4RTW A;  1PKS A;  1H3H A;  2AZS A;  2LJ1 A;  2KRM A;  2K6D A;  2LNH B;  2EYZ A;  2DBM A;  2JS0 A;  4IIO A;  3NGP A;  1UTI A;  2FEI A;  4AFU C;  2FRY A;  4X1V A;  4QT7 A;  2KNB B;  1NG2 A;  2O9V A;  3VS2 A;  5I11 A;  2O88 A;  2W10 A;  3M0Q A;  2EGA A;  4RUG A;  2JXB A;  2A08 A;  3H41 A;  2EQI A;  2EYY A;  1FYN A;  3QWY A;  3TSZ A;  2J6O A;  1M3B A;  2HBW A;  1YWP A;  4ORZ A;  1AWO A;  3EG2 A;  3FJ5 A;  4RTU A;  1UEC A;  1M8M A;  2A28 A;  2YUN A;  1CKA A;  3O5Z A;  1E7O A;  5IXB A;  4J9D A;  4D8K A;  2RQT A;  1K76 A;  1PRL C;  2HEQ A;  2EVR A;  2GBQ A;  4D8D A;  1X6B A;  2LJ0 A;  1BK2 A;  2EYW A;  1RUW A;  1JXM A;  1QKW A;  3ZL7 C;  2DNU A;  1TUD A;  3IQL A;  2I0N A;  1QWF A;  3EG0 A;  4LE9 A;  2ESW A;  1VYT A;  2K3B A;  1HD3 A;  1VYU A;  1JU5 C;  2HDA A;  4K11 A;  2FG0 A;  3RNJ A;  2JT4 A;  1WDX A;  2JM9 A;  2DL8 A;  4LNP A;  1GCQ C;  2L3S A;  2X3X D;  1GCQ A;  1WLP B;  2RNA A;  3VS0 A;  1U5S A;  3PVL A;  1I0C A;  1SHF A;  1BU1 A;  2DIL A;  2JMC A;  2LZ6 B;  2AK5 A;  1WXT A;  2O31 A;  1XOV A;  2GGR A;  1X2Q A;  3M0S A;  2KXD A;  4AG1 C;  1X43 A;  2LCS A;  2CUD A;  5I22 A;  3I5R A;  3KFV A;  1WXU A;  4J9B A;  4RTY A;  4EIK A;  1T3S A;  2CH4 A;  2QDL A;  1UDL A;  5EC7 A;  1NYG A;  2CT4 A;  2DE0 X;  2RN8 A;  2RQV A;  2JW4 A;  2CUB A;  1UHC A;  3REA B;  2SRC A;  4AG2 C;  2V1R A;  4F16 A;  2DRK A;  3EHR A;  2M0Y A;  2K7A A;  1OEB A;  2KBT A;  1M3C A;  2CSQ A;  4RTT A;  1UGV A;  4Z8A A;  2CH4 W;  2KE9 A;  1AWJ A;  2NUZ A;  4LUD A;  2AKL A;  5IHI A;  2D8H A;  2BTT A;  4AFS C;  1YN8 A;  2XMF A;  1MUZ A;  2PTK A;  4R0K A;  1ABO A;  4RTV A;  4J9C A;  1BBZ A;  4FSS A;  2L0A A;  1E6G A;  3VS4 A;  1JQQ A;  1WFW A;  1PHT A;  4M4Z A;  3H0H A;  2DL3 A;  4ESR A;  1K4U S;  1I07 A;  1G83 A;  1AOJ A;  4AFQ C;  3UA7 A;  1IO6 A;  4OMN A;  5GJV B;  1M3A A;  2FPE A; 
#chains in the Genus database with same CATH topology
 2DPP B;  4E7I A;  1UGQ B;  4JZ3 A;  4RG8 A;  1YI2 Q;  3V7C A;  5GAN 8;  3REB B;  2QA4 A;  1M90 C;  2OI3 A;  4GBQ A;  4Y91 A;  3OY9 A;  4WF2 A;  1PSE A;  3L2Q A;  1M90 U;  3PTA A;  1S1N A;  4BY6 C;  5D7U A;  3G71 Q;  7AT1 B;  2NUT B;  3WXM B;  2RPN A;  5GAM g;  3NPF A;  4XAX B;  3MKD A;  1QKX A;  4BE0 A;  3MP8 A;  1K9A A;  4KUD K;  3OYL A;  3TRE A;  2A36 A;  2GCX A;  2JMA A;  4J9E A;  4UC4 A;  4JRK A;  4A4K A;  1OQK A;  1ZSZ A;  1KHC A;  1WQ7 A;  2AKK A;  5GAN f;  5LJ5 e;  3CME Q;  3CCL Q;  2OTL T;  2X4Y A;  3CC4 Q;  1RAH B;  3EHQ A;  1TXQ A;  2VWF A;  2RQU A;  2LJ3 A;  3CPW S;  1D09 B;  4B9W A;  4EDU A;  4EPC A;  5GAN d;  2CP0 A;  3MCA B;  3X28 B;  3EGU A;  3EFR A;  4F04 B;  1YJW A;  1BB9 A;  3CBO A;  3HKS A;  4PFO A;  1DJ7 B;  2XI9 A;  4DEX A;  4KUL A;  1ABQ A;  3E9F A;  1UJ0 A;  4ZTJ A;  1VQK T;  1U06 A;  2FYK A;  4J7I A;  1KQS A;  4HXJ A;  1LCK A;  4C5E A;  3CCM T;  2DXC A;  3GF5 A;  3S6W A;  2ECZ A;  4M77 D;  4E47 A;  4F7U G;  1VQ9 A;  1YWO A;  5L8R E;  1X6G A;  3DKM A;  3P8D A;  5LJ5 j;  3VS6 A;  2P4R A;  2QTV A;  4PJO B;  1XJW B;  2CZ0 B;  1OPL A;  4N4G A;  5ECA A;  3H6Z A;  2J06 A;  3OYD A;  4RCC A;  4HA8 A;  1QVF P;  4JJD A;  1VA7 A;  1K9M C;  4R55 A;  4JS4 A;  3CCV Q;  2KT8 A;  3OS2 A;  5CKB A;  3URG A;  1K9M U;  4A4E A;  1M27 C;  2JUF A;  3PGG A;  1X01 A;  4M7D B;  3QJ6 A;  2GQV A;  1H64 1;  2GTO A;  2F69 A;  2CS7 A;  1J3T A;  3RIR A;  3FIF A;  2PUO B;  2FPF A;  1Y0M A;  3UPU A;  2JTF A;  2QEX A;  2CSI A;  3L2R A;  2F5T X;  2GFU A;  1SHG A;  2A7Y A;  2QI2 A;  2VAS A;  1T0J A;  1YJ9 T;  1JO8 A;  1YP5 A;  2EYX A;  4QW2 A;  1WNL A;  2L3P A;  3CD6 T;  2P0K A;  1VQ5 A;  3FRN A;  3NHN A;  3UWN A;  5M9O A;  1ZSZ B;  3CCE A;  1WQW A;  3H0I A;  4C0Z A;  4FYV B;  1NLO C;  2DL4 A;  4XTX A;  2EIF A;  2JOY A;  4IIM A;  2DYI A;  5DLO A;  2MPX C;  2CGH A;  2YXY A;  3QZ5 B;  3A8M B;  1ZUU A;  2ZPI B;  1I4K 1;  1WA7 A;  1CSK A;  4PJO F;  4FYW B;  2KDS A;  2O2O A;  3KUF A;  3CC7 A;  2ED0 A;  2JJ9 A;  3VS3 A;  2D6F A;  5FU7 B;  2J05 A;  2OAW A;  1D0Z A;  3NTI A;  4HVU A;  4M75 A;  1KFZ A;  2DVE A;  4BD3 A;  4L59 A;  1LNX A;  1HXD A;  1U1T A;  1WHG A;  1X27 A;  1XQH A;  1TWB A;  3BDL A;  5GMK m;  2MWO A;  3M59 A;  3LX7 A;  4OVA A;  1FX7 A;  2FZK B;  1UB4 A;  2ROT A;  4MZT A;  3MEU A;  3EH2 A;  5I2M A;  4JRI A;  4VUB A;  3M0T A;  3C4S A;  1OOT A;  1VQ6 Q;  3G4S T;  5IXF A;  1G3Y A;  2RJC A;  3CCR Q;  2YDL A;  4MZM A;  1UGP B;  1QP3 A;  2DKG A;  2EGC A;  3OB9 A;  2KXC A;  5FU6 B;  1VQ8 A;  5HCK A;  4HCZ A;  2RJF A;  1TH7 A;  3SEM A;  4RKU E;  5LJ3 e;  5DM7 R;  3QG1 A;  1UFF A;  3MP1 A;  4FL6 A;  1MMG A;  1VQL T;  2OJ2 A;  4DBH A;  1C1A A;  3I35 A;  2QA4 T;  1D1B A;  5GAO q;  1Y07 A;  5GMK l;  2E4H A;  3MEA A;  4L6V 5;  3GIB A;  2D8J A;  4A4H A;  2LP5 A;  1O75 A;  1OV3 A;  2LNV A;  4X9C A;  3UA6 A;  3CCQ A;  4E7L A;  3SHW A;  2CYZ B;  4BDZ A;  4HVV A;  2Y90 A;  4KRT A;  2QQS A;  2HL3 A;  1RAG B;  3CC2 A;  3OSV A;  2D0Q B;  3M5A A;  2QG9 B;  2E3I A;  1PKS A;  1H3H A;  1IZ6 A;  2LNH B;  5GMK j;  2EYZ A;  2JS0 A;  4IIO A;  4LDV A;  3CCJ T;  1VQN Q;  1S72 A;  1UTI A;  5CKH A;  1TS9 A;  2FRY A;  4TVR A;  1WHL A;  1WHM A;  5LJ3 j;  2KNB B;  1NG2 A;  3VS2 A;  1Q81 R;  3OW2 A;  3RKY A;  3PT9 A;  2A08 A;  3H41 A;  4FT2 A;  4M75 B;  2K5I A;  1YJN A;  4FW1 A;  4E2F B;  3C12 A;  3QXE B;  1ACM B;  2VV5 A;  2A28 A;  2YUN A;  2I2L A;  3JB9 F;  3O5Z A;  3X25 B;  2EFI A;  3QKJ A;  5IXB A;  2FL7 A;  3H9N A;  2M9U A;  2RQT A;  2GBQ A;  4PFZ A;  5GAM j;  1IB8 A;  3V7S A;  3OYC A;  4J8O A;  2CP6 A;  2EJF A;  1VOM A;  3IQL A;  2I0N A;  1SKU B;  1QWF A;  3M4G A;  1VYT A;  5GAM h;  1JU5 C;  5CQY A;  3KBG A;  5GAN h;  4C8Q D;  3RNJ A;  2K3X A;  2DO3 A;  2PVO B;  1PD0 A;  2RB6 A;  4MZP A;  1YHQ T;  1GCQ A;  1LVK A;  4LXC A;  3VS0 A;  1I0C A;  2CZ6 B;  4JRQ A;  2DIL A;  3EH1 A;  2LZ6 B;  3L2W A;  1IRE B;  5KYN A;  2PVG B;  3M0S A;  3C94 A;  3NTH A;  4JDS A;  2EJG A;  4M75 F;  2CUD A;  3KFV A;  2QEX T;  3CXC A;  1C0M A;  3BFM A;  4EIK A;  2DD4 A;  3V8L A;  2E6Z A;  2XHC A;  2DD5 A;  5LJ5 g;  3M57 A;  3QII A;  3MP6 A;  1VQO Q;  1Q82 C;  1M9S A;  3ZEH A;  1KHI A;  3CMA T;  2ZPE B;  2CUB A;  3RER A;  4E7Z A;  1PC0 A;  4F7U A;  3OYB A;  2LQ8 A;  2OTL A;  3CBP A;  3OMG A;  2KE9 A;  4OB2 B;  1Y7X A;  5LL6 S;  4J83 A;  2EAY A;  4ME7 A;  5HK3 A;  1EX4 A;  1G3S A;  2AKL A;  2DXU A;  3CC7 T;  2BTT A;  3EGX B;  2XMF A;  1MUZ A;  1VQM Q;  3G6E T;  1TUG B;  1Q86 R;  1ZBX A;  2ZPB B;  2RHX A;  2L8D A;  2OX7 A;  2E5Q A;  3OYN A;  4PJO C;  2HKQ B;  3VKI A;  4FM4 B;  1G83 A;  2FVU A;  3LH0 A;  4C92 G;  1VQK A;  1N8R U;  2QYZ A;  1GFC A;  4FU6 A;  2V1Q A;  5KYU B;  1BI0 A;  3CCM Q;  2O01 E;  3OBW A;  3OW2 P;  4NOY A;  1JXO A;  3CCM A;  3EAE A;  1K0S A;  3R6O A;  3GBQ A;  3JB9 H;  1RLP C;  2DEQ A;  3HHT B;  3CEY A;  1PRM C;  1W4S A;  2X51 A;  5GAO r;  2XG8 D;  1A0N B;  1VQ8 T;  2E64 A;  3CQT A;  4IUP A;  1W1F A;  2EBP A;  5IT9 E;  1QWE A;  3M56 A;  2AIR B;  2LC4 A;  1YNZ A;  5C0M A;  4Y28 E;  4HCK A;  1BYM A;  1MV3 A;  3I56 T;  3EFS A;  1TU0 B;  4OMM A;  2X3W D;  1QVG A;  2XDD A;  2LCL A;  2YLC A;  3DLM A;  2BE9 B;  5FWB A;  4Q5W A;  1ZSZ C;  2YT6 A;  2K2M A;  1Q7Y C;  2DIQ A;  1Q7Y U;  3A5Z B;  1TUC A;  1OYX A;  5A2Q E;  4ZGJ B;  2AHJ B;  3J81 E;  3QJY A;  3DB4 A;  3QWX X;  1G8X A;  1YJ9 A;  1WX6 A;  3CD6 Q;  2C0T A;  5FU7 C;  3CCU A;  4ZTF A;  4E6R A;  5CKD A;  2M0O A;  1RL2 A;  2QDY B;  1EFN A;  1MMD A;  4C5H A;  1SSF A;  2PNI A;  3PVQ A;  1ZUK A;  1V29 B;  2RD1 A;  1M90 R;  3VS7 A;  2IG0 A;  4DQ2 A;  2YRD A;  3CXC P;  4OP0 A;  1ZBJ A;  4ZGE B;  3L2V A;  4IUR A;  2AT1 B;  2PU9 B;  4KBM B;  3BY7 A;  3GPL A;  3GP8 A;  2RI5 A;  3INZ A;  1YJN T;  1ZSG A;  3HPW A;  1K1Z A;  2XD0 A;  2BZY A;  5FU6 C;  2X4W A;  1OZ2 A;  2NYS A;  1SRM A;  1G5V A;  2DET A;  2K79 A;  3JCM f;  1RLQ C;  1B07 A;  3I55 T;  1OUL A;  3G4S Q;  2RQW A;  3MHX A;  3VRZ A;  1YIJ A;  3UAT A;  1FMK A;  3GNG A;  3PFS A;  4M7A G;  2LX9 A;  4J9G A;  5LJ3 g;  2XDP A;  1U1S A;  2LX7 A;  5GJW B;  2DLP A;  2IVW A;  3JCM d;  1RAF B;  2M51 A;  3CBM A;  1ZX6 A;  3X20 B;  3OYK A;  4F7U F;  1VQ7 T;  1W2B A;  2YSQ A;  1LPL A;  4JUV A;  2ZPH B;  2QA4 Q;  2RF0 A;  1VQL A;  1BCO A;  4C92 D;  1QLY A;  2ABL A;  5LJ3 f;  4DOV A;  3RMS A;  5GAO p;  2NUP A;  1SEM A;  2DMO A;  3VV0 A;  3OYI A;  4C5I A;  1T0H A;  3HFO A;  2YUQ A;  3CCS A;  1KIK A;  4XTW A;  5CR2 A;  3TU4 K;  2J7I A;  4M77 E;  1KQ2 A;  4C0G A;  2VYT A;  3VUZ A;  4M78 G;  4J9H A;  4X34 A;  1RAD B;  1WGS A;  2DF6 A;  8ATC B;  4M75 C;  1QVG P;  2W0Z A;  3M53 A;  3CCJ A;  3P8B B;  3E2U A;  5GAN 5;  5GAM f;  4E7J A;  1K9M R;  1ZLM A;  3TEE A;  2KRS A;  4ELY C;  5KE2 A;  1NJI C;  2QQR A;  1JJ2 A;  2HQH A;  2M1H A;  4ZNX A;  3M0U A;  2QGF B;  2EKH A;  1TSF A;  1MND A;  2KEA A;  3OYY A;  5CO7 A;  3I9Q A;  2VVK A;  1ARK A;  5GAM d;  1YJW Q;  1IXD A;  4C0D C;  1H8K A;  2YUP A;  1NM7 A;  3EG1 A;  1K73 C;  2DZC A;  1N6A A;  2KYB A;  1WJS A;  3LGF A;  1Z9Z A;  1CKB A;  2KYM A;  3FEO A;  4OMP A;  3OMC A;  1VQ9 Q;  4J7F A;  4M77 C;  2DXB A;  1WJQ A;  3BDU A;  2DVJ A;  2QGG A;  1JEG A;  1D1C A;  1MMA A;  2KAF A;  1RAI B;  5CIU A;  5FWC A;  2ROL A;  3P8H A;  1QQJ A;  2QQB A;  5I2S A;  3EGD A;  2EQM A;  3R6N A;  2K9G A;  5LJ5 h;  4NL3 A;  3VUB A;  1YHQ A;  1B7T A;  1GXI E;  4ANJ A;  2FO0 A;  4J9F A;  3TSW A;  3OA6 A;  3VYG A;  4A54 A;  4RTZ A;  2XIC A;  1H92 A;  4LD9 K;  1OU8 A;  2NUP B;  5GAO n;  4JLG A;  2AZV A;  2RQR A;  5FW9 A;  2DXT A;  2DX1 A;  2E12 A;  4BI4 A;  4PL6 A;  2AZS A;  4BUG A;  2KRM A;  1HK9 A;  2K6D A;  2QEX Q;  4M7A D;  1RAB B;  2DZ9 A;  5DLQ E;  1TOV A;  4KGX B;  1UGS B;  3JRZ A;  2ZZD A;  4C92 A;  4X1V A;  3G7Z A;  1QW1 A;  3CMA A;  2O88 A;  4XU0 A;  1VQ5 Q;  2W10 A;  3VYH B;  3M0Q A;  2LT4 A;  3CCU T;  1WHH A;  4JJN K;  3CCE Q;  4A4G A;  2EQI A;  4FYX B;  4QQG A;  5GMK i;  1FYN A;  3TSZ A;  2HBW A;  3FJ5 A;  5DY9 A;  3TQ7 P;  4C5G A;  5IN1 A;  4P5N A;  4RTU A;  3CC7 Q;  1CKA A;  3X24 B;  1QCO A;  3E9G A;  9ATC B;  1X6O A;  1R0B G;  4D8K A;  1K76 A;  1PRL C;  4F7U E;  3G6E A;  3RUX A;  2KK4 A;  3RR6 A;  4IUT A;  4C8Q G;  4M78 D;  1ZQ1 A;  4FIB A;  3OBY A;  2OAU A;  1VYU A;  3JCM V;  2HDA A;  1K8A C;  3MO8 A;  1F1B B;  2HSE B;  4HT8 A;  5AT1 B;  2R57 A;  1GCQ C;  2L3S A;  3FJP A;  2RNA A;  1U5S A;  1YIJ T;  3PVL A;  2DAQ A;  1WXT A;  1VQ8 Q;  2GGR A;  1X2Q A;  1I81 A;  4J6W A;  4AG1 C;  1EIF A;  2R5A A;  1X43 A;  3EGD B;  5I22 A;  3I5R A;  1N9R A;  3AT1 B;  1KC8 C;  3I56 A;  1BIB A;  4OB3 B;  1VQ4 T;  1JRI A;  4J9B A;  4N4H A;  3VJP A;  1QVF S;  2V8J A;  4M77 A;  1KQS P;  1T3S A;  2CH4 A;  1RAE B;  5CVI A;  1NYG A;  2CT4 A;  2RQV A;  1VQP T;  1PD1 A;  2JW4 A;  4FT4 A;  3REA B;  2XK0 A;  3CCQ Q;  3CCS T;  5AYF A;  3OSS C;  2M0Y A;  2EJ9 A;  1MGQ A;  2KBT A;  4BI3 A;  1YI2 T;  3CC2 Q;  4PLL A;  4RTT A;  3JCM h;  4Z8A A;  3G1J A;  2CZ1 B;  5IHI A;  3OYE A;  2MI6 A;  4C8Q E;  2BIV A;  1YN8 A;  3S3O A;  4M7A A;  3WVD B;  4A53 A;  1S72 Q;  1ABO A;  4J5Y A;  4RTV A;  3M58 A;  4FSS A;  1Q95 G;  3G71 T;  5CKF A;  1WFW A;  2FB7 A;  5GMK h;  2DL3 A;  1K4U S;  3L1A A;  2GF7 A;  4QVC A;  5FRM A;  2XKO C;  2NLU A;  1WJR A;  2RMO A;  5LJ3 h;  4PJO G;  5FLX E;  2FRW A;  5GAN e;  2DTO A;  2K5L A;  1YJN Q;  3M4Y A;  1G3T A;  2J6K A;  1BIA A;  1H3Z A;  2WSF E;  4RTX A;  1AZE A;  2O4X A;  2DL7 A;  1KSW A;  1X69 A;  3X26 B;  3CME T;  3CCL T;  3CC4 T;  1HSQ A;  1Q82 R;  4EMG A;  1VIE A;  2LVM A;  2RK1 A;  2P0P A;  4M7D G;  2EW3 A;  1I5O B;  2RI2 A;  1BI1 A;  2RJD A;  2R58 A;  3I55 A;  2DL5 A;  4DBR A;  2COW A;  3JCM c;  4HVW A;  4C0D B;  1V76 A;  2QAS A;  2DJZ A;  2QXF A;  4NL2 A;  4KH1 B;  4HCC A;  5IHK A;  3D7S B;  1KK7 A;  1YFN A;  2P4T A;  5CKE A;  4CC2 A;  3QPH A;  1VQ7 A;  1UG1 A;  1PSF A;  3OS1 A;  2H8H A;  3M0R A;  2DBK A;  5L23 A;  2F5K A;  4M77 B;  4IUV A;  5J39 A;  4L5G A;  1KQ1 A;  4MMK A;  1N8R R;  4OGC A;  1KQS S;  3HRS A;  1M4Z A;  1GRI A;  4AT1 B;  4GLM A;  3VS5 A;  1AVZ C;  4CC4 B;  5EG2 A;  2ED1 A;  1KJW A;  4FYY B;  2O9S A;  1M5Q 1;  3QHS A;  2Z0W A;  5GAN 2;  2RHZ A;  3TVT A;  2DFU A;  3OYG A;  3S3N A;  3OYA A;  1Q82 U;  2NWM A;  2C0O A;  3CPW A;  2F2X A;  4QQ6 A;  3GOX A;  2L5Q A;  2CP5 A;  4M7A B;  1B3Q A;  1M1K C;  3QZ9 B;  2OTL Q;  4PJJ A;  5IH2 A;  1IGQ A;  1M2O A;  1NEB A;  1HYO A;  2WSE E;  5LJ5 f;  5HK0 A;  1X2K A;  1JBM A;  3SDZ A;  2HSP A;  2D9T A;  1M2V A;  4WTO B;  4O6J A;  1Q7Y R;  3VU3 C;  3OS0 A;  2OTJ A;  2KSS A;  3E1S A;  2P84 A;  2MCN A;  3L2U A;  2LRQ A;  1TTH B;  5LJ5 d;  5GAN 3;  1AZG B;  4M77 F;  1VQK Q;  2GQI A;  3THK A;  3UF4 A;  1OZ3 A;  1GBR A;  3JSC A;  5GAN 6;  3JB9 G;  1WIE A;  3HFN A;  5IAY A;  3F70 A;  1FWZ A;  4RG2 A;  1YCS B;  1VIF A;  2EQK A;  2RK2 A;  4IUQ A;  4LDX A;  4PJO D;  2ENM A;  3A98 A;  2RHY A;  3U23 A;  3QDR B;  4M7A F;  1NZ9 A;  2EQU A;  2MOX A;  4OMQ A;  2DIG A;  2GTJ A;  4M7D D;  1PNJ A;  5FRN A;  2VGN A;  1VQ6 T;  3CCR T;  3H0F A;  2E41 A;  2LQW A;  4C8Q A;  2X9H A;  5CQX A;  3AHU A;  1AWX A;  2J6F A;  2RJE A;  4J6Y A;  4XU3 A;  1E6H A;  4XTY A;  4FW2 A;  1YJ9 Q;  4M75 G;  2XU8 A;  1IRX A;  4MDX A;  1G2B A;  2KVQ G;  2E3H A;  2VKN A;  3I5S A;  3CCU Q;  2FPD A;  5IHN A;  2GNC A;  2PZ1 A;  2Y4Y A;  1GL5 A;  3JCM X;  3FLG A;  1VYV A;  1KD1 C;  4PJL A;  2DER A;  1Q86 C;  5KCO A;  1KD1 U;  1MHN A;  4F7U B;  1NE8 A;  4C92 E;  1UHF A;  1NEG A;  4F17 A;  3M55 A;  1B34 A;  2SEM A;  4ZN1 A;  4JLI A;  4JRP A;  3NMZ C;  3QDF A;  2DM1 A;  1M2V B;  2HQE A;  2K57 A;  1ZA2 B;  4HT9 A;  2KI7 A;  3BW1 A;  3MPU B;  4Y92 A;  2M02 A;  2GFA A;  2KGT A;  4D6W A;  3A8G B;  2CP2 A;  1VQN T;  2LMJ A;  2BE7 D;  4QQD A;  4QVD A;  4LN2 A;  3LH5 A;  5D6Y A;  2BUD A;  2QAZ A;  1WYX A;  1NPP A;  2CDT A;  5KYX A;  1YIJ Q;  4GLK A;  3MET A;  2PVD B;  3NTK A;  4PNO A;  2PQW A;  1NJI R;  4EMK A;  1XNI A;  4Z02 A;  3VRY A;  5HKC A;  1IHW A;  3C0C A;  1SRL A;  3OW2 S;  3ULR B;  3QSU A;  2B86 A;  2LJ1 A;  1BI3 A;  2V8I A;  4ZGD B;  2X35 A;  1VQL Q;  3NGP A;  3OQ5 A;  4C92 C;  1VQ4 A;  4OGE A;  4AFU C;  1JB0 E;  4EMH A;  1YIT A;  5J26 A;  1K73 R;  2O9V A;  3JB9 D;  2K4Y A;  5D6W A;  1M1F A;  5CAI A;  1VQP A;  2EGA A;  3CCS Q;  4C8Q B;  2VGM A;  4RUG A;  1FXX A;  4PK4 A;  2EYY A;  5LJ3 d;  2J6O A;  1YWP A;  4ORZ A;  3V8K A;  2FHD A;  3EG2 A;  1YI2 A;  4FCY A;  3T9N A;  3J7A F;  4LDW A;  2HL5 C;  2HNI A;  4M7D A;  1E7O A;  1RI0 A;  4J9D A;  3CCJ Q;  4B6M A;  2HEQ A;  2EVR A;  4D8D A;  5A0D A;  2DEU A;  3NFC A;  3G71 A;  2LJ0 A;  3RMQ A;  2WSC E;  2EYW A;  3EG9 A;  1LOJ A;  4B9X A;  1JXM A;  5GAN g;  1QKW A;  1Y71 A;  3ZL7 C;  1NJI U;  2DNU A;  1TUD A;  1B34 B;  2JN0 A;  3EG0 A;  2ESW A;  2K3B A;  2MK5 A;  4K11 A;  1BCM A;  1SF9 A;  1VQO T;  5KYW A;  2JT4 A;  1WDX A;  4CI0 C;  2JM9 A;  4M7A E;  3RDV A;  2DL8 A;  4M75 D;  2OTJ T;  3CXC S;  2L89 A;  2YWW A;  3ME9 A;  2KMT A;  4R56 A;  3JCM P;  1SHF A;  1BU1 A;  3A8H B;  3CME A;  3CCL A;  1WHJ A;  2JMC A;  2AK5 A;  4RMO A;  3CC4 A;  1OI1 A;  3RKW A;  1K73 U;  2QQ9 A;  2O31 A;  2VC8 A;  2RA2 A;  2COY A;  4KGV B;  1U8R A;  2RO0 A;  4OMF B;  4C8Q F;  2LCS A;  5KYX B;  1QCN A;  2MWP A;  1VQM T;  1WXU A;  4RTY A;  4EMK B;  2E70 A;  3ZFJ A;  3ER0 A;  1UDL A;  5EC7 A;  2DE0 X;  2RN8 A;  3HSB A;  1OX9 A;  1YHQ Q;  4AG2 C;  1D1A A;  2V1R A;  4KGZ B;  1NPR A;  2DRK A;  2YRV A;  4M78 E;  3A1P A;  3EHR A;  2LQK A;  2K7A A;  1OEB A;  2CSQ A;  1UGV A;  2CH4 W;  1AWJ A;  4QVZ A;  4LUD A;  2ZAE A;  1ZHI A;  1K8A R;  4M7A C;  3ZBD A;  4R0K A;  3L2Z A;  4J9C A;  2L0A A;  1E6G A;  3CCV A;  1PHT A;  3CMA Q;  3H0H A;  1W2B P;  2EWN A;  1D3B A;  3UA7 A;  1IO6 A;  4OMN A;  1M3A A;  2FPE A;  3HRT A;  2JNG A;  4PKC C;  2DK3 A;  4KUI A;  1AD5 A;  3FC3 A;  1N5Z A;  1SPK A;  1V1C A;  2G3R A;  3EG9 B;  1SSH A;  2H3J A;  2L3Q A;  1KC8 R;  1I5L A;  2HCK A;  2JS2 A;  1QVG S;  1X75 C;  4KH0 B;  3JV3 A;  1OU9 A;  2CZ7 B;  1AEY A;  1WPY A;  3PNW C;  4J6X A;  1NLP C;  3G6E Q;  5KYW B;  2FZG B;  3HRU A;  1LJO A;  4XU1 A;  2KQW A;  2DTH A;  2DA9 A;  4DEY A;  4M78 C;  3RKX A;  3JB9 J;  1FMV A;  4F14 A;  1AT1 B;  2F1L A;  2RHI A;  5GAO m;  2HBP A;  1R8O B;  3TCJ A;  4N0A C;  2KT1 A;  2JTE A;  2HKN A;  2DJQ A;  1N9S A;  2HMA A;  1BKB A;  2QQA A;  3N5B B;  1K8A U;  1JJ2 P;  4C0F A;  3PE0 A;  2F2W A;  2DTI A;  2RH2 A;  2EQJ A;  1RAA B;  2HAX A;  4M7D F;  1RI9 A;  3JCM e;  1Y96 A;  4JZ4 A;  1D0Y A;  4OML A;  2E6N A;  4XK8 E;  1Y57 A;  4PLI A;  4A63 B;  2MMP A;  1PCX A;  1UE9 A;  1K0X A;  4DBQ A;  3I56 Q;  1PG5 B;  2H3E B;  4JJB A;  5A0G A;  1QVP A;  2L2P A;  5GAO l;  4DOW A;  1KC8 U;  3O8V A;  4PJN A;  1YIT T;  4PJM A;  2PUK B;  2M16 A;  1VQ6 A;  1UJY A;  3CCR A;  2LQN A;  5GMK e;  1N27 A;  3OS5 A;  1M8V A;  3JB9 I;  1I1J A;  2HD0 A;  2LCC A;  4CC3 A;  5GAN 7;  3FB9 A;  2C0I A;  3QUI A;  5CK9 A;  4J9I A;  4C92 B;  3GNF B;  1NYF A;  2JZ2 A;  2LTO A;  1GFD A;  3A8L B;  2KY9 A;  1D3B B;  2B8A A;  2D0N A;  2JM8 A;  1SG5 A;  2IIM A;  2V8K A;  5FRO A;  1XTD A;  3GLX A;  1W2B S;  2CRE A;  1AWW A;  4Z89 A;  2K5F A;  3L42 A;  4PFP A;  2CP7 A;  1ZUY A;  1GCP A;  2KR3 A;  1AHJ B;  3JCM b;  4JPB W;  1QMC A;  1W6X A;  4E7S A;  2F2V A;  4CC7 A;  1P92 A;  2QK0 A;  3HP9 A;  2EGE A;  4JJC A;  5GAM e;  1PWT A;  2YUO A;  2BZX A;  4BY6 B;  2EPD A;  3WVE B;  1I8F A;  4HCB A;  1U3O A;  2E1H A;  1WI7 A;  2RM4 A;  2COZ A;  3LLR A;  2E5K A;  4WCI A;  1FMW A;  2A37 A;  1VQN A;  3OYF A;  1RAC B;  2JTM A;  3QBY A;  2A0F B;  1UUE A;  1TG0 A;  5CCA A;  3EGX A;  3I55 Q;  4OMO A;  4FSX A;  3SWN C;  4AMC A;  2VXE A;  1M1K R;  3DB3 A;  2RHU A;  1KG1 A;  1YJW T;  4YTL A;  2K2V A;  4M78 A;  1JJ2 S;  1T3L A;  3PMT A;  4C92 F;  3Q1J A;  1W70 A;  5GAN 4;  2DYB A;  2VXF A;  4N0A A;  4C8Q C;  2KRO A;  1Y96 B;  4AFZ C;  4ATO A;  3V8J A;  1VQ7 Q;  2G6F X;  4XTU A;  1M30 A;  4XTV A;  4Z88 A;  5KYU A;  5KCH A;  3PIP A;  3M0P A;  1MV0 B;  5GAN j;  2MIO A;  3A8O B;  3BE3 A;  3OYM A;  2V26 A;  1VQ9 T;  4IUU A;  4ELZ C;  1O9S A;  2D1X A;  1QCF A;  1PM3 A;  2YLB A;  2RI3 A;  1WXB A;  6AT1 B;  1HJD A;  3SFM A;  1R77 A;  3C95 A;  2DRM A;  4BB7 A;  4OF1 A;  4ZN3 A;  2X4J A;  2IPO B;  3V7R A;  3CCV T;  4N4I A;  4PJO E;  1Q81 C;  1Q81 U;  1Z9Q A;  4HKE A;  1PKT A;  3JCM W;  2ZPF B;  3E19 A;  4BI8 B;  2MF2 A;  3EG3 A;  1VUB A;  1M1K U;  5KYY A;  3DLL A;  4LUE A;  2EYQ A;  1OPK A;  2CP3 A;  2QTX A;  4M7D E;  3ASK A;  2KRN A;  1VQO A;  2OTJ Q;  3EFO A;  3VS1 A;  1GBQ A;  5D6X A;  1VQ5 T;  3LW5 E;  4OB0 B;  4DBF A;  2X4X A;  3CCE T;  2YRC A;  4EMK C;  2O4X B;  2CT3 A;  3RBB B;  4NS5 A;  2BKD N;  3OYJ A;  4LDY A;  2BZ8 A;  4BDY A;  4XTZ A;  4RTW A;  4JS5 A;  1IGU A;  1IHV A;  1KD1 R;  1QP2 A;  2DBM A;  4KT0 E;  1VQM A;  2XID A;  4M78 B;  2FEI A;  4CRI A;  1YCY A;  1D0X A;  4QT7 A;  1UEB A;  3SD4 A;  2VUB A;  1NBE B;  1BI2 A;  4QKU A;  2LDM A;  5I11 A;  1N8R C;  2P0Q A;  5KE3 A;  3M54 A;  4XU2 A;  4MML A;  2XDB A;  2JXB A;  2EKO A;  4RCB A;  3SWN A;  3QWY A;  1M3B A;  3J80 E;  1AWO A;  4M7D C;  4LDU A;  3FDR A;  3QYH B;  1UEC A;  4BAC A;  1M8M A;  4GY5 A;  2LT1 A;  3LWH A;  4OB1 B;  3QO3 A;  1X6B A;  3OYH A;  1BK2 A;  1RUW A;  2CKK A;  1C6V X;  1OX8 A;  4O5V A;  5HY6 A;  4BE1 A;  3CPF A;  1R0C B;  3JAM E;  4II1 A;  4XQ3 A;  4LE9 A;  1HD3 A;  8AT1 B;  3JCM Q;  1WZO A;  4E7H A;  2FG0 A;  2JVV A;  2WAC A;  3LYI A;  4LNP A;  1YBY A;  2NUT A;  1Q86 U;  2X3X D;  1WLP B;  2HQX A;  4M78 F;  5KYY B;  3CCQ T;  2MYS A;  3MJX A;  2HZY A;  3CC2 T;  4V2S A;  1XOV A;  5I21 A;  3CD6 A;  2KXD A;  3SB2 A;  3EFO B;  2VB6 A;  2E10 A;  1EZZ B;  1MMN A;  3PMI A;  5KH6 A;  3CPW P;  1M1G A;  5C6S A;  1S72 T;  2Y4X A;  3MEV A;  4IKF A;  2K3Y A;  2QDL A;  1UGR B;  4LD6 A;  2A3L A;  3S3M A;  4M77 G;  3LGL A;  2E65 A;  1ZA1 B;  5A0L A;  1UHC A;  2SRC A;  2ZGW A;  3JCM g;  4DA4 A;  4MDW A;  3QYG B;  4F16 A;  3HL8 A;  2L3R A;  3LWI A;  2C06 A;  3UT1 A;  3M9Q A;  3PIO A;  3JCM J;  1M3C A;  1G3W A;  1QVF A;  2YHT A;  2MAM A;  2NUZ A;  1MNE A;  3MEW A;  4E7K A;  3UDC A;  2FZC B;  2D8H A;  4AFS C;  2ZPG B;  2ZCF B;  3RES A;  4BE2 A;  4A4F A;  4M75 E;  2PTK A;  3KXT A;  3HTR A;  1VQ4 Q;  1BBZ A;  1YIT Q;  2ATC B;  3SWN B;  3VS4 A;  1JQQ A;  3G4S A;  4X9D A;  4M4Z A;  2R5M A;  1WHK A;  4ESR A;  1VQP Q;  1I07 A;  1AOJ A;  3H8Z A;  5J3B A;  4AFQ C;  4PJO A;  5GJV B; 
#chains in the Genus database with same CATH homology
 1GFC A;  2RMO A;  2FRW A;  2V1Q A;  2J6K A;  1AD5 A;  4JZ3 A;  1N5Z A;  1SPK A;  4RTX A;  1V1C A;  1AZE A;  1JXO A;  1K0S A;  1SSH A;  2L3Q A;  2DL7 A;  1KSW A;  1X69 A;  3REB B;  2HCK A;  2JS2 A;  3GBQ A;  2OI3 A;  1RLP C;  4GBQ A;  3JV3 A;  1AEY A;  1HSQ A;  1PRM C;  1A0N B;  1NLP C;  1S1N A;  3CQT A;  1W1F A;  2EBP A;  2EW3 A;  1QWE A;  2DA9 A;  4DEY A;  1YNZ A;  4HCK A;  4F14 A;  2RPN A;  2DL5 A;  1MV3 A;  3NPF A;  4HVW A;  2KT1 A;  4OMM A;  2X3W D;  2JTE A;  1QKX A;  1K9A A;  2DJQ A;  2A36 A;  5IHK A;  2JMA A;  4J9E A;  5FWB A;  2YT6 A;  2K2M A;  4CC2 A;  1UG1 A;  3PE0 A;  2F2W A;  1TUC A;  2AKK A;  2H8H A;  3M0R A;  2DBK A;  5L23 A;  3EHQ A;  2VWF A;  2RQU A;  2LJ3 A;  3QWX X;  1RI9 A;  1WX6 A;  2C0T A;  4JZ4 A;  4OML A;  4E6R A;  1Y57 A;  4A63 B;  1EFN A;  1GRI A;  1UE9 A;  1K0X A;  4GLM A;  3VS5 A;  1AVZ C;  4JJB A;  4CC4 B;  2PNI A;  3EGU A;  2ED1 A;  1KJW A;  3PVQ A;  2L2P A;  1ZUK A;  1BB9 A;  2O9S A;  3VS7 A;  3TVT A;  1UJY A;  4DEX A;  2LQN A;  1ABQ A;  1UJ0 A;  2NWM A;  2C0O A;  1ZBJ A;  2F2X A;  1U06 A;  1I1J A;  4HXJ A;  1B3Q A;  4CC3 A;  1LCK A;  2C0I A;  5IH2 A;  4J9I A;  1NEB A;  1ZSG A;  2ECZ A;  1K1Z A;  1YWO A;  1X6G A;  2BZY A;  1NYF A;  1X2K A;  3VS6 A;  2P4R A;  1GFD A;  2HSP A;  2D0N A;  1OPL A;  5ECA A;  1SRM A;  2J06 A;  2JM8 A;  2IIM A;  2K79 A;  1RLQ C;  4JJD A;  2CRE A;  1B07 A;  1VA7 A;  1AWW A;  2MCN A;  4Z89 A;  2RQW A;  2KT8 A;  3VRZ A;  3UAT A;  1FMK A;  1M27 C;  4J9G A;  1ZUY A;  1GCP A;  1AZG B;  2KR3 A;  4JPB W;  1W6X A;  2GQI A;  2LX7 A;  3THK A;  2F2V A;  5GJW B;  2DLP A;  3UF4 A;  4CC7 A;  1GBR A;  2GTO A;  2EGE A;  2M51 A;  1J3T A;  4JJC A;  1ZX6 A;  1PWT A;  2YUO A;  1WIE A;  2BZX A;  2FPF A;  1Y0M A;  2EPD A;  2YSQ A;  2CSI A;  1U3O A;  1WI7 A;  2RF0 A;  2E5K A;  4WCI A;  2A37 A;  1YCS B;  1QLY A;  2ABL A;  1SHG A;  1T0J A;  1JO8 A;  1UUE A;  1YP5 A;  1TG0 A;  2EYX A;  1SEM A;  2DMO A;  2ENM A;  2L3P A;  3A98 A;  3U23 A;  4OMO A;  1T0H A;  3NHN A;  2YUQ A;  1KIK A;  2MOX A;  3H0I A;  1NLO C;  2DL4 A;  4OMQ A;  2J7I A;  4IIM A;  1T3L A;  2GTJ A;  1W70 A;  2DYB A;  1ZUU A;  1WA7 A;  1PNJ A;  4J9H A;  1CSK A;  2KRO A;  2O2O A;  4AFZ C;  3H0F A;  2ED0 A;  2DF6 A;  2LQW A;  3VS3 A;  2G6F X;  2J05 A;  2OAW A;  2W0Z A;  1AWX A;  2J6F A;  1M30 A;  4Z88 A;  4HVU A;  1E6H A;  1KFZ A;  1ZLM A;  3M0P A;  1MV0 B;  2KRS A;  2MIO A;  1X27 A;  1G2B A;  2VKN A;  4ZNX A;  3M0U A;  2EKH A;  3I5S A;  2KEA A;  2FPD A;  5IHN A;  2GNC A;  2PZ1 A;  1GL5 A;  2D1X A;  3I9Q A;  1VYV A;  1QCF A;  2VVK A;  1ARK A;  1WXB A;  2ROT A;  1HJD A;  2DRM A;  1UHF A;  3M0T A;  1OOT A;  1H8K A;  1NEG A;  4F17 A;  2YUP A;  1NM7 A;  3EG1 A;  5IXF A;  2YDL A;  2SEM A;  2EGC A;  3NMZ C;  2KYB A;  2DM1 A;  2KXC A;  1Z9Q A;  1PKT A;  5HCK A;  1Z9Z A;  3EG3 A;  1CKB A;  4Y92 A;  2KYM A;  3SEM A;  4OMP A;  1UFF A;  2KGT A;  2OJ2 A;  2DVJ A;  4LUE A;  3I35 A;  1OPK A;  2KRN A;  1JEG A;  2LMJ A;  5FWC A;  4LN2 A;  2ROL A;  3LH5 A;  2D8J A;  3VS1 A;  1GBQ A;  2LP5 A;  3R6N A;  1OV3 A;  1WYX A;  2K9G A;  2CDT A;  3UA6 A;  2FO0 A;  4J9F A;  3TSW A;  2CT3 A;  3RBB B;  4RTZ A;  3SHW A;  1H92 A;  4HVV A;  3VRY A;  4KRT A;  3C0C A;  1SRL A;  2BZ8 A;  3ULR B;  2AZV A;  2RQR A;  5FW9 A;  2B86 A;  2DX1 A;  4RTW A;  1PKS A;  1H3H A;  2AZS A;  2LJ1 A;  2KRM A;  2K6D A;  2LNH B;  2EYZ A;  2DBM A;  2JS0 A;  4IIO A;  3NGP A;  1UTI A;  2FEI A;  4AFU C;  2FRY A;  4X1V A;  4QT7 A;  2KNB B;  1NG2 A;  2O9V A;  3VS2 A;  5I11 A;  2O88 A;  2W10 A;  3M0Q A;  2EGA A;  4RUG A;  2JXB A;  2A08 A;  3H41 A;  2EQI A;  2EYY A;  1FYN A;  3QWY A;  3TSZ A;  2J6O A;  1M3B A;  2HBW A;  1YWP A;  4ORZ A;  1AWO A;  3EG2 A;  3FJ5 A;  4RTU A;  1UEC A;  1M8M A;  2A28 A;  2YUN A;  1CKA A;  3O5Z A;  1E7O A;  5IXB A;  4J9D A;  4D8K A;  2RQT A;  1K76 A;  1PRL C;  2HEQ A;  2EVR A;  2GBQ A;  4D8D A;  1X6B A;  2LJ0 A;  1BK2 A;  2EYW A;  1RUW A;  1JXM A;  1QKW A;  3ZL7 C;  2DNU A;  1TUD A;  3IQL A;  2I0N A;  1QWF A;  3EG0 A;  4LE9 A;  2ESW A;  1VYT A;  2K3B A;  1HD3 A;  1VYU A;  1JU5 C;  2HDA A;  4K11 A;  2FG0 A;  3RNJ A;  2JT4 A;  1WDX A;  2JM9 A;  2DL8 A;  4LNP A;  1GCQ C;  2L3S A;  2X3X D;  1GCQ A;  1WLP B;  2RNA A;  3VS0 A;  1U5S A;  3PVL A;  1I0C A;  1SHF A;  1BU1 A;  2DIL A;  2JMC A;  2LZ6 B;  2AK5 A;  1WXT A;  2O31 A;  1XOV A;  2GGR A;  1X2Q A;  3M0S A;  2KXD A;  4AG1 C;  1X43 A;  2LCS A;  2CUD A;  5I22 A;  3I5R A;  3KFV A;  1WXU A;  4J9B A;  4RTY A;  4EIK A;  1T3S A;  2CH4 A;  2QDL A;  1UDL A;  5EC7 A;  1NYG A;  2CT4 A;  2DE0 X;  2RN8 A;  2RQV A;  2JW4 A;  2CUB A;  1UHC A;  3REA B;  2SRC A;  4AG2 C;  2V1R A;  4F16 A;  2DRK A;  3EHR A;  2M0Y A;  2K7A A;  1OEB A;  2KBT A;  1M3C A;  2CSQ A;  4RTT A;  1UGV A;  4Z8A A;  2CH4 W;  2KE9 A;  1AWJ A;  2NUZ A;  4LUD A;  2AKL A;  5IHI A;  2D8H A;  2BTT A;  4AFS C;  1YN8 A;  2XMF A;  1MUZ A;  2PTK A;  4R0K A;  1ABO A;  4RTV A;  4J9C A;  1BBZ A;  4FSS A;  2L0A A;  1E6G A;  3VS4 A;  1JQQ A;  1WFW A;  1PHT A;  4M4Z A;  3H0H A;  2DL3 A;  4ESR A;  1K4U S;  1I07 A;  1G83 A;  1AOJ A;  4AFQ C;  3UA7 A;  1IO6 A;  4OMN A;  5GJV B;  1M3A A;  2FPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...