2Y4XA

Structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa pa01
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
KPDETRVKQFLEGFNIETFEMVGTLSNAQGTFALVKGAGGVHRVRVGDYLGRNDGKVVGISEGKIDVIEIVPDGEGNWLERPRSLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords PILP PROTEIN
publication title Structure of a Domain from the Type Iv Pilus Biogenesis Lipoprotein Pilp
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2y4xA00
2IVWA 2LC4A 2LNVA 3OSSC 2Y4XA 2Y4YA
chains in the Genus database with same CATH superfamily
4OMFB 1X6OA 1QP2A 2E70A 1AOJA 4PFPA 3I55A 3TSWA 9ATCB 4RG8A 3CMET 2GTOA 2JNGA 1K1ZA 1B07A 2BZYA 2AKKA 2K3YA 5AT1B 4D6WA 2H3EB 3CXCP 3O8VA 2CREA 4L5GA 2RJCA 3CC4A 2EYYA 2KSSA 5GAMj 2NUTB 3EG3A 1PCXA 2DERA 1D0XA 1AZEA 3U23A 2YHTA 5IXBA 5GAOq 4OMQA 4PJOC 1BB9A 4BD3A 2BUDA 3VS5A 3HRTA 5FU6C 2BTTA 3NFCA 3FJPA 4J6XA 1YCSB 3CBOA 2CZ7B 4KGXB 1UTIA 3PTAA 4AFUC 3DKMA 5HCKA 4C8QB 2RM4A 2OAWA 1KQSS 1KQ2A 3JB9I 4E2FB 2O01E 5KYYA 2DRKA 5GMKi 3OQ5A 1OV3A 4JUVA 1MV0B 1I5OB 2XDBA 4K11A 5LJ3e 2D9TA 2K5FA 1WI7A 3CPWS 4KH1B 1M2VB 4BE2A 5KYUB 1TUDA 2EVRA 3MPUB 4L6V5 2CP2A 4Z89A 5LJ5g 2M51A 3OYCA 4M7AE 5KE2A 2E5QA 5KYXA 1SSHA 2GBQA 2RHZA 3C0CA 2M9UA 1BI2A 3OA6A 2DAQA 2L89A 2V8JA 3NMZC 4QT7A 5I11A 2YRCA 4HVWA 1KD1U 2YWWA 4B6MA 5GJVB 3LW5E 4JJBA 1EFNA 3CC7Q 3VS4A 1I1JA 3A8OB 2G3RA 2KQWA 5L8RE 4FIBA 4DEXA 4J7IA 3VS2A 2DTHA 4P5NA 3OYJA 3CCQT 1N8RU 3L2WA 2KYBA 1VQLT 2L3SA 5IT9E 1D0ZA 1CKBA 1VUBA 1NJIU 3HKSA 3CMEA 2W0ZA 6AT1B 1WLPB 3CC2A 3L2UA 1OULA 1M9SA 1U1TA 2CP7A 4M78G 1PM3A 4CC2A 4A53A 1TH7A 4EMGA 1Q82C 1K73U 5CQYA 1M1KC 2GNCA 4NL2A 1JJ2P 1ZSZC 2ROLA 4MZMA 4A4EA 2ABLA 2FYKA 3CCEQ 5IN1A 3UA6A 2D0QB 2EQJA 1QVGP 3CD6T 3M57A 1B3QA 4QVDA 4F7UB 1K0XA 2QTVA 4XAXB 3LH5A 3CCVT 4XTVA 2HBPA 1JQQA 1VQ4A 3CXCS 2KY9A 4PFOA 3JAME 3ZFJA 3OS0A 1UJYA 1KC8U 1GBQA 1HD3A 3QHSA 1K9AA 2Z0WA 1K9MC 3META 4JRKA 5GAN6 5CQXA 2F1LA 3CCQQ 1S72A 3AHUA 4LD9K 1FWZA 2A7YA 1VQLQ 1GFDA 5FW9A 3JCMe 4R56A 2BKDN 1YFNA 3MEWA 4AMCA 2K7AA 1O75A 3OW2A 2QK0A 1YP5A 2JM8A 3MEUA 4RCCA 3V7RA 2FHDA 2EQKA 2ECZA 4OVAA 4EDUA 4C92B 4AG2C 1BIBA 1X69A 3X20B 1ABQA 1LPLA 4ORZA 3OYGA 3H41A 1IB8A 4AFSC 5GANf 5A2QE 3EFOB 3MO8A 2RHYA 3HFOA 3PVQA 5FRMA 3A1PA 4XTZA 3CCRT 2PVOB 5AYFA 1I8FA 2O4XA 1FYNA 3VKIA 4JRPA 1YI2T 3LGLA 4R0KA 2RQWA 2DD4A 3RKWA 1OZ2A 3PNWC 4C5IA 1WA7A 2QQAA 3VYHB 1M5Q1 4PKCC 2M02A 3CMAT 2PTKA 2L3RA 2FEIA 2RF0A 1PC0A 1Q86C 4M7DC 4BACA 3MP6A 4FYVB 5GMKh 1X6BA 5LJ3j 1YHQQ 3BE3A 1GRIA 2EFIA 1KHCA 4M75C 4F17A 1UJ0A 5A0LA 4J6WA 5EG2A 2QASA 3X26B 2COYA 2BZ8A 4C5EA 2RJEA 3NPFA 4M7AG 3CD6A 1UGPB 2DKGA 2Y4XA 2YRDA 2QEXT 3CCUA 3CCVA 7AT1B 1VQ6Q 3OY9A 1M4ZA 2DX1A 4HVUA 4N4HA 4TVRA 3CCRQ 3O5ZA 3QUIA 2QAZA 3RR6A 1WIEA 3QWYA 1JJ2S 4FCYA 4E7LA 2D8JA 4DOWA 2IG0A 4DBHA 3CCLT 3UATA 3CMAQ 2E6NA 3DB4A 3MKDA 1T0JA 1QVGS 4M7AD 5FWCA 3EG0A 3T9NA 2P4TA 3EG9A 2V26A 1VQMT 2COWA 1GCQA 2RN8A 3JB9H 3E9GA 3JCMg 1SSFA 1AWJA 1WZOA 4IURA 4OP0A 4FSSA 2Y90A 2ATCB 5GAOr 1OQKA 5DY9A 2E64A 3CCRA 3EGUA 3KFVA 3R6NA 2RHIA 4C8QC 4DEYA 3OW2S 2QEXQ 2R5AA 1M3AA 5LJ5h 1YI2A 3OBWA 4B9WA 5FU7B 3UT1A 1W2BA 3LLRA 3CMAA 2ED1A 3RUXA 3SB2A 3L2ZA 4ANJA 2J7IA 4V2SA 2VUBA 1M3CA 2ZPFB 4E7ZA 2X35A 4LDWA 4OB0B 2CP0A 1D1AA 1MV3A 3QO3A 3UF4A 5KYXB 1VYUA 2F2XA 4Z02A 4AT1B 2E10A 2J6FA 1KSWA 1NLPC 1ZUUA 4MZPA 1UE9A 3OYIA 4M78A 3G6EA 2RQRA 3URGA 3J80E 1LOJA 2PVDB 1VQMQ 2LVMA 4EMKB 1BKBA 1VQNA 2KR3A 2QEXA 2J6OA 2HNIA 2V1QA 3QBYA 3P8BB 1Q82R 1M1KR 2A08A 2KMTA 5CKHA 1I0CA 4LUDA 1ZA2B 2P0QA 1WDXA 1JBMA 1M30A 3EFRA 3G4SA 4PJOG 1YWOA 2LQNA 1TSFA 1Q7YC 4UC4A 2XICA 5A0DA 2VXEA 2XD0A 2K3XA 4MDWA 3CCLA 2LJ0A 3ZBDA 2GTJA 2F5TX 3J81E 1FMKA 3M4GA 1O9SA 2J6KA 1S1NA 2MAMA 5IXFA 1VQ7T 1A0NB 4X34A 2VV5A 4J9HA 4QKUA 3UA7A 4J9DA 2NUPB 1K9MR 4M78F 4DOVA 3GNFB 1NE8A 4DBRA 4M75E 2HQEA 1ZBXA 4JLGA 1VQ5Q 1X01A 3OYDA 2EKHA 2KYMA 1KIKA 1I07A 1N5ZA 3KBGA 5LJ3d 5GANd 1LCKA 1Q95G 1H641 1UGRB 3HRUA 1Q81C 1G3YA 3A98A 2KBTA 1UFFA 5KCHA 1SHFA 2EYWA 2LJ1A 3I55T 2JN0A 2QXFA 5CAIA 2VC8A 1MGQA 1TG0A 2DVJA 2P84A 2OJ2A 4C92C 1KQSP 1WXUA 1QLYA 1HXDA 1HSQA 4JJCA 4RG2A 3CC4T 4E6RA 1TWBA 2KT8A 1TXQA 1YNZA 2RB6A 2YUPA 3SWNB 3JB9D 4IIMA 1QVFA 1Q86R 2KT1A 3CPWP 3G71A 3EH1A 1D1BA 1YIJT 4E47A 2MWPA 2QQRA 4M7AA 1PWTA 2RQUA 3QYGB 2MPXC 4BUGA 5CKDA 1ZHIA 1GXIE 4AFQC 2ED0A 1RACB 2EYZA 1KFZA 2B8AA 4C8QE 4F16A 1YJ9A 1SPKA 3OYFA 4F04B 1ZA1B 2GFUA 3TQ7P 3I55Q 1V1CA 2OI3A 5HK0A 4N0AA 3FLGA 1UHFA 1VQ7A 1YN8A 2RPNA 1G83A 2C0OA 3MEAA 4Y91A 1E6GA 1ARKA 2GFAA 3OYKA 2QYZA 2DD5A 3BW1A 2FPEA 2G6FX 1U5SA 3CC4Q 2CH4W 2EQMA 4PJJA 1QCNA 1IHWA 3JRZA 3X24B 1NLOC 2GGRA 4XU0A 2KGTA 4RTYA 3TSZA 1V29B 3V8LA 2VGMA 2YLCA 4M7AF 4OB2B 1OX8A 5GAOp 2EJFA 4M77G 4OGEA 1YWPA 3OS2A 3LX7A 4PK4A 3ER0A 5J26A 4ATOA 1UB4A 1RI9A 3G7ZA 2DZ9A 2PQWA 1VQKA 3CC2T 4DBQA 4AG1C 1UGSB 1SG5A 2CH4A 3JCMW 1OOTA 1JXMA 5D7UA 1TU0B 3EH2A 4A4FA 2CDTA 3H0IA 2WSEE 1ZX6A 2I0NA 3M54A 3BDUA 1NG2A 1J3TA 1I5LA 4JJDA 2KDSA 2BIVA 3L2VA 1IRXA 4CRIA 1ZBJA 4M7DG 1YIJA 2DL3A 1UDLA 2QGFB 4M75G 2QI2A 1M8MA 5FU7C 1VQ4T 2LQ8A 3M0PA 3QG1A 1MMGA 3V7SA 3S6WA 2OTLT 1OYXA 4FM4B 1QWFA 3FRNA 2CGHA 1B34A 2DXCA 1NBEB 1S72T 1RUWA 3QJ6A 4GBQA 4OMLA 1G3SA 1AD5A 5EC7A 1QVFS 3I56T 2EYQA 2DXTA 3CMEQ 5GANe 2GQVA 1KHIA 3C4SA 3H8ZA 3CC2Q 2K5IA 5CR2A 1D09B 2YUQA 1M8VA 4WCIA 3GBQA 1BYMA 2HL3A 3PT9A 4BDYA 4M75D 2DXBA 5KYWA 4FU6A 4KH0B 2MMPA 1Q7YR 1WX6A 4EMKC 2XKOC 3JV3A 1AVZC 2L8DA 4ELYC 3OYBA 1G8XA 4GLKA 4XTUA 2DL5A 3TCJA 1MNDA 4JPBW 4J9BA 2NLUA 3H0FA 2H3JA 4Z8AA 3E19A 1JXOA 3SFMA 1BCMA 1OPKA 4IUUA 5LJ5f 4C0GA 2WSFE 3NGPA 4J9EA 1IZ6A 1RAEB 3L1AA 2RQTA 2YUNA 1FX7A 2QA4A 1VQ4Q 2EKOA 1N27A 1U06A 3OBYA 1T3SA 2OTLQ 3EGDA 1KD1C 3HHTB 1KJWA 4PJOF 1S72Q 1M2OA 1TUCA 4JZ4A 3EHQA 1D3BA 3JSCA 4C8QG 1Z9QA 3M4YA 3I56Q 3CBPA 2LRQA 1M1KU 1YJWT 3VRZA 1RABB 3DB3A 1Y57A 1X2QA 2F2VA 3BFMA 4NOYA 2LTOA 1BCOA 2XIDA 2CT4A 3MP8A 1PRMC 1W70A 3VJPA 1NJIC 2M0OA 4ZGEB 4ZGDB 2VGNA 2OTJA 1K8AU 1WXBA 1YJNA 3EGXB 1AWWA 1VQ9T 3QSUA 1PD1A 1PHTA 4RTTA 3L2QA 1RAHB 1R77A 2YRVA 3CCUT 4OMNA 3I5SA 2A0FB 2A28A 1K73C 2DYIA 1PKSA 2K4YA 4J6YA 4M78D 4A4KA 4C8QD 1UUEA 2FB7A 2OTLA 1H3HA 2JOYA 2EYXA 2CKKA 4E7HA 2XHCA 2MIOA 1OU8A 4IUTA 4C5GA 2XDPA 3M59A 2E3IA 5GAOn 1ZSZA 4RMOA 1NEGA 3LH0A 1LNXA 3JB9F 3I56A 2SEMA 1NYFA 3HP9A 4ZN3A 3OW2P 1HK9A 3N5BB 1WJQA 4O6JA 2CP6A 3TU4K 1Y96A 3LWHA 3ME9A 2DL8A 4M77C 3CQTA 4LDXA 4LUEA 3MEVA 3SWNC 5KH6A 2DLPA 2E65A 2QDYB 2E5KA 4RTZA 1W1FA 1R8OB 2DK3A 4LDYA 5LJ3g 5GANg 3SD4A 1UHCA 1Y07A 1I4K1 2D0NA 1WYXA 2LP5A 4PJOE 1VQ9Q 3CD6Q 4CC7A 4IKFA 1QCFA 1NEBA 1UG1A 4CC4B 3CCUQ 2QQ9A 3CCVQ 1VQPT 5IH2A 2CZ1B 2QQBA 3HTRA 1AHJB 3OYEA 3M0UA 4BI3A 3JCMc 3OYMA 1Q86U 3EHRA 5D6XA 1WHJA 5GAMh 1WQWA 3OYLA 2DXUA 5GANj 2LDMA 1WFWA 1EIFA 1YJWA 4LD6A 2JMAA 2ZPIB 3OYHA 3G6ET 2GQIA 3M0RA 1IGQA 1YBYA 1W4SA 1G2BA 4FSXA 4RTWA 5CCAA 1WHGA 4KUIA 2M16A 1VQ9A 1RI0A 3GNGA 1VQNT 2O9SA 1OEBA 4KGZB 1KQ1A 4BI8B 5GAN4 4C92G 2DRMA 2L3PA 4PFZA 1NPPA 1F1BB 4M75A 2HAXA 1YI2Q 4LE9A 3FIFA 3G4ST 3OS1A 3V8KA 1JRIA 4IUVA 1TS9A 2HZYA 3VYGA 4A63B 5CK9A 2K6DA 1RAIB 3S3MA 2MK5A 2EAYA 2HMAA 3S3NA 1WHKA 2PNIA 3RMSA 2X4WA 4FL6A 1MMAA 1XJWB 2CUBA 2E41A 4J8OA 1QWEA 1V76A 3G6EQ 4J9GA 2IVWA 4PNOA 3UWNA 3VUBA 3F70A 2RO0A 2ROTA 2RMOA 3M58A 3ZEHA 1K76A 2QGGA 4ZN1A 5GMKm 1VQNQ 3REBB 2FZKB 2X4XA 1VA7A 2F69A 4JS5A 5DM7R 4M7DF 3VS6A 1SKUB 2K79A 1B34B 5KYYB 2X3WD 2NUTA 2X4YA 4M75F 1W2BP 1BK2A 3X25B 1VQPA 1R0CB 5GMKl 2EQIA 3M5AA 2IIMA 4HA8A 1WHMA 4OF1A 4J9CA 3G4SQ 5FU6B 5IAYA 2DL7A 1IHVA 2AKLA 2LQKA 2DO3A 3CCLQ 1PRLC 3QZ9B 1PSFA 2NYSA 5KYWB 2COZA 1MHNA 5GAN3 4C8QA 2K5LA 5GAN2 1BBZA 4LDUA 4BY6B 3M0SA 5CIUA 2RJFA 1M27C 4M77E 4XU3A 1WJRA 1VIEA 3HPWA 2KK4A 2JZ2A 5IHNA 3G71T 1M2VA 1CKAA 1AT1B 4PLIA 2VB6A 5KCOA 4F14A 1QKWA 4JZ3A 2CZ0B 4EIKA 2YT6A 2XU8A 2ZGWA 2JXBA 1Q7YU 3RKXA 1AWOA 3VS7A 4HT9A 2HCKA 1YJ9T 4XTYA 1SHGA 4KBMB 1M3BA 2F2WA 3E2UA 4EPCA 2J05A 2RD1A 3L42A 1K73R 4QW2A 2EGCA 4FYWB 4QVCA 2YUOA 2NWMA 2CSQA 4JRQA 4C8QF 4M7DE 2LC4A 5HK3A 2WACA 4QQDA 1XQHA 1CSKA 3D7SB 3CCMT 4XU2A 2KNBB 4PJOD 1X75C 5LL6S 2JJ9A 2EQUA 2DFUA 2QDLA 2DF6A 3PMIA 3QPHA 5GMKe 2MWOA 2YDLA 3G71Q 1WXTA 2PZ1A 5CKFA 4J83A 3PVLA 3DLMA 3REAB 3EFSA 1M90C 5LJ3h 4WF2A 1NYGA 2K2MA 4MMLA 1VQ8A 4OMPA 5DLQE 1W6XA 1YJ9Q 1VQKT 2RA2A 4C5HA 1GBRA 4HKEA 2EGEA 4LDVA 4KT0E 2RHXA 2X9HA 3MP1A 2EW3A 1VQ7Q 4HT8A 3AT1B 3VS0A 4ELZC 5HKCA 3PMTA 5GAN8 1W2BS 2JW4A 2KXCA 1QVFP 2J06A 1WNLA 1U8RA 1K0SA 3CCMQ 2RK1A 2O4XB 4E7IA 1UGVA 2KE9A 2MF2A 5D6YA 2JT4A 3RBBB 2O88A 4FT2A 3DLLA 2JTEA 3VRYA 4FW2A 2L0AA 2K2VA 5CVIA 1GFCA 4MZTA 1ZLMA 2AT1B 3EFOA 2KVQG 2L3QA 1H92A 1VQKQ 2P4RA 2X4JA 1ZQ1A 2VVKA 4X9DA 3CCSA 4LNPA 4X9CA 2FZCB 1SEMA 3IQLA 3OS5A 3CCMA 4FW1A 3V8JA 2HKNA 5IHKA 3ZL7C 1D0YA 1OPLA 3EG1A 2PUOB 5A0GA 1XTDA 2FPDA 2DA9A 4E7JA 3MHXA 2E1HA 4KUDK 1YIJQ 2NUZA 1G5VA 1QP3A 4PL6A 3NTIA 3JCMh 2KROA 4J5YA 2QA4T 4C92F 1EX4A 2HSPA 3RMQA 4A4HA 3JCMX 4C0FA 3S3OA 4PLLA 2YLBA 3JCMQ 5GAMf 4HXJA 2DIQA 1OX9A 3EG9B 4JS4A 2M1HA 2PUKB 1NZ9A 2E4HA 3KUFA 2RHUA 2PU9B 2LX9A 1KK7A 1JEGA 1X6GA 4M77D 2R58A 2DPPB 4HVVA 1G3TA 3M53A 2OTJT 2K9GA 2JS0A 3RIRA 4C0ZA 3NHNA 1PD0A 4BI4A 3VU3C 2LNHB 3CXCA 1YJNT 4KGVB 3P8HA 2DVEA 4IUQA 3CBMA 4XTWA 3JCMb 2LJ3A 3M0TA 1H3ZA 3V7CA 4F7UE 5GMKj 4XU1A 5KE3A 1P92A 4D8DA 3GOXA 2ZAEA 2HKQB 4IIOA 3JCMP 3H9NA 2FPFA 2F5KA 3TREA 2BE7D 2QA4Q 3CC7T 2DBMA 4PJOA 3BDLA 3VUZA 2EBPA 1GCPA 2ZPBB 2DIGA 4M78B 2DYBA 4M7DD 1C6VX 4FT4A 3QYHB 3FDRA 4DQ2A 1LJOA 2DBKA 4BY6C 2ZZDA 3CEYA 1IXDA 4PJLA 1ZUYA 4B9XA 1C0MA 3NTHA 2CZ6B 1ABOA 4C92E 5C0MA 3FC3A 4HCBA 2V1RA 1C1AA 4ME7A 5FRNA 2ENMA 2P0KA 2FL7A 2OTJQ 1N6AA 2A37A 1FMWA 1UEBA 3E1SA 3CCJT 1YJNQ 2DL4A 3CCET 1T3LA 2DJQA 4C0DB 1D1CA 5L23A 3THKA 1OZ3A 1HJDA 1M1FA 2HEQA 2HBWA 2CP3A 4QQ6A 3P8DA 2X3XD 3QXEB 1VYVA 2KRMA 4EMKA 3RERA 3I35A 2CT3A 4FYXB 3VV0A 3A8LB 1I81A 3TEEA 2AK5A 1E7OA 5CO7A 3M55A 1Q82U 4OMMA 1PNJA 1HYOA 2QG9B 1N8RC 2O9VA 3EG2A 5LJ5j 1Q81R 4M4ZA 4YTLA 1M90R 2B86A 2GF7A 2KRSA 2FVUA 2DE0X 2FRWA 2JM9A 1ACMB 3HRSA 4N4GA 5J3BA 1TTHB 1JJ2A 3CCJQ 1K9MU 2NUPA 2LCLA 3E9FA 5GJWB 4EMHA 5J39A 1SF9A 2P0PA 3OYAA 1JB0E 2RI2A 1K8AC 4CC3A 3CC7A 2XI9A 4ESRA 3SEMA 1QVGA 2AZVA 3OB9A 1N9RA 1Y7XA 4ZNXA 1RAGB 2AHJB 4ZGJB 2D1XA 5FWBA 1QVPA 1KC8C 1NM7A 8AT1B 5M9OA 3QJYA 4N4IA 2EWNA 2XDDA 1YJWQ 2CSIA 2ZPGB 2XG8D 2X51A 1YHQT 1XOVA 5HY6A 4M7AB 2RNAA 2LT1A 3H0HA 3CCJA 2HD0A 4NL3A 3CCEA 1VIFA 5GAOm 2HQHA 2MYSA 2W10A 4AFZC 4DBFA 3WVEB 1PKTA 4KRTA 3HL8A 4M77A 5GAOl 3WXMB 1VQ6T 5LJ3f 3LGFA 4F7UG 3SWNA 1OI1A 5DLOA 4QVZA 2KEAA 3CCQA 5GAMd 1VQLA 3RNJA 1G3WA 2XK0A 2QQSA 3ASKA 3GIBA 2CUDA 4PJMA 4JRIA 2EGAA 1WHHA 4OGCA 2DTOA 4HCZA 4JLIA 1ZUKA 3VS1A 2PVGB 4II1A 2C06A 3EAEA 2VXFA 3GF5A 3GLXA 3L2RA 4M7DA 1U3OA 1EZZB 1FMVA 4GY5A 2V8KA 4OMOA 3M0QA 2DEQA 4D8KA 3INZA 4J9FA 3JCMJ 4L59A 4M77F 5IHIA 3OYNA 2JMCA 5I2MA 2DETA 2E3HA 4E7SA 1VQPQ 1MMDA 4BE0A 4HCCA 3OMGA 1BI1A 2ZPEB 3UDCA 1QQJA 1FXXA 1WHLA 1GCQC 2JUFA 2QTXA 3QZ5B 4J9IA 2M0YA 2FZGB 3QWXX 2I2LA 1WQ7A 2DTIA 4C92D 2EJGA 1YITT 4XK8E 4BE1A 1YHQA 4CI0C 3KXTA 4LN2A 1JU5C 3PFSA 5ECAA 2DNUA 3OMCA 3G1JA 2L5QA 1BU1A 2LT4A 3TVTA 2D6FA 2DJZA 3A8GB 4XTXA 2KI7A 2CS7A 4R55A 2FG0A 5I21A 5LJ5d 3JCMf 2A3LA 1TOVA 3WVDB 3MJXA 4MMKA 1VQ6A 4PJOB 2ESWA 5I2SA 1RAAB 4GLMA 3JB9J 3MCAB 5CKEA 2HQXA 1VQOT 1E6HA 1BIAA 4M78C 1VQ8T 3FJ5A 3PGGA 4ZTJA 2JTFA 3FEOA 3LWIA 2MCNA 1QMCA 2MI6A 3X28B 1IREB 1AWXA 3JCMV 2LCCA 1Y71A 3NTKA 1ZSGA 2YXYA 2BE9B 3QKJA 1KD1R 2EPDA 1YITQ 2JTMA 3C12A 3HFNA 3R6OA 3I5RA 1IO6A 1OU9A 1WJSA 2HDAA 4C0DC 1QW1A 2OAUA 2KRNA 2RJDA 1U1SA 2KXDA 5KYUA 4Y28E 1N8RR 4Y92A 3M9QA 4OB3B 1VQ5T 2C0IA 1NJIR 3EGDB 3OYYA 3A5ZB 2V8IA 4Q5WA 1X2KA 4RTVA 2JVVA 1D3BB 1PSEA 1VQOQ 3A8MB 1VQ8Q 1K4US 1Z9ZA 3QIIA 4X1VA 2O2OA 1UECA 1XNIA 2FRYA 4BDZA 2GCXA 3C95A 2RH2A 1YITA 1B7TA 5I22A 3CCST 1K8AR 3A8HB 1N9SA 2RK2A 3QDRB 2XMFA 1VYTA 5KYNA 3PE0A 4IUPA 5GAN7 2A36A 1KG1A 1MMNA 2LMJA 5GAMe 3CPFA 4WTOB 1RADB 1VQMA 1KC8R 4O5VA 1SRMA 4J7FA 3GP8A 2RI5A 1Q81U 1ZSZB 1DJ7B 2VASA 4PJNA 4NS5A 1M90U 4RTXA 4RUGA 5GANh 1AZGB 1VQOA 5FLXE 1QKXA 2RI3A 3BY7A 4QQGA 3EGXA 2LZ6B 1WGSA 1Y96B 4A54A 4F7UA 2FO0A 4DA4A 8ATCB 1YCYA 4JDSA 4ZTFA 2EIFA 3HSBA 3JB9G 5CKBA 2E6ZA 3M56A 1AEYA 3OSVA 2CYZB 4M7AC 1M1GA 2YSQA 2H8HA 3CCSQ 2DEUA 3C94A 4BB7A 1BI3A 1TUGB 2R5MA 1PG5B 2WSCE 1MUZA 1WPYA 2Y4YA 1IGUA 2JS2A 1R0BG 2DM1A 3UPUA 3FB9A 5D6WA 5C6SA 2LNVA 1KQSA 2VWFA 1JO8A 3I9QA 3RDVA 4M77B 2CP5A 1VQ5A 2HSEB 4RCBA 1NPRA 2DMOA 4Z88A 2LCSA 4C92A 4N0AC 2HL5C 2LX7A 1SRLA 2OX7A 2AIRB 1Y0MA 1H8KA 4XQ3A 4E7KA 3CPWA 2O31A 4KULA 2K57A 2MOXA 5FROA 2R57A 1X43A 1MNEA 3Q1JA 4OB1B 4F7UF 5LJ5e 3SHWA 1T0HA 4M78E 2RQVA 4HCKA 2DILA 2EJ9A 1LVKA 1BI0A 2K3BA 2E12A 1UGQB 1RAFB 1RLPC 3OSSC 5GAN5 2D8HA 2KAFA 1GL5A 3QDFA 4M7DB 2VKNA 4JJNK 3PIOA 3RESA 4M75B 4LXCA 3RKYA 2VYTA 1VOMA 1QCOA 2SRCA 4RTUA 3GPLA 1X27A 1RLQC 3H6ZA 2C0TA 2LQWA 3JCMd 2ZCFB 4MDXA 3PIPA 2ZPHB 5GAMg 4VUBA 3J7AF 2BZXA 2DZCA 3SDZA 4FYYB 2L2PA 3VS3A 1RL2A 3ULRB 3LYIA 4RKUE 2AZSA 2IPOB 4A4GA
chains in the Genus database with same CATH topology
4OMFB 1X6OA 5CK9A 1QP2A 2E70A 1ZBXA 3S3MA 4JLGA 3HRSA 2EAYA 4N4GA 3I55A 3S3NA 5J3BA 1X01A 1JJ2A 3OYDA 4RG8A 3RMSA 3CMET 1K9MU 2JNGA 2LCLA 2X4WA 4FL6A 3KBGA 4M75E 3E9FA 5J39A 4EMHA 5LJ3d 2P0PA 5GANd 2K3YA 3OYAA 1JB0E 2RI2A 1K8AC 4D6WA 2E41A 3CC7A 2XI9A 3O8VA 4J8OA 1QVGA 1H641 1UGRB 3OB9A 3UWNA 1N9RA 2IVWA 4PNOA 4L5GA 1Y7XA 3HRUA 3VUBA 1Q81C 1G3YA 2RJCA 5KCHA 3CC4A 2KSSA 3F70A 2AHJB 4ZGJB 5GAMj 2RO0A 3I55T 2YHTA 2JN0A 1QVPA 2QXFA 3M58A 5CAIA 5GAOq 4PJOC 4BD3A 1KC8C 3ZEHA 4ZN1A 5GMKm 5M9OA 2BUDA 3QJYA 4N4IA 2EWNA 2VC8A 2X4XA 2XDDA 3HRTA 5FU6C 2F69A 4JS5A 1MGQA 3NFCA 5DM7R 4M7DF 3FJPA 4J6XA 2ZPGB 1B34B 2XG8D 3CBOA 2CZ7B 2X4YA 4C92C 4M75F 1VQPA 3X25B 1YHQT 1XOVA 1HXDA 5GMKl 3PTAA 3M5AA 5HY6A 4RG2A 4M7AB 3CC4T 3DKMA 4HA8A 4OF1A 4C8QB 2LT1A 2RM4A 5FU6B 1KQSS 3CCJA 2HD0A 2RB6A 5IAYA 1KQ2A 3JB9I 3SWNB 4NL3A 3CCEA 3JB9D 2O01E 1VIFA 5GAOm 2LQKA 2DO3A 1QVFA 3QZ9B 1PSFA 5GMKi 3G71A 3OQ5A 4JUVA 3WVEB 1YIJT 4E47A 2MWPA 2QQRA 1MHNA 4M7AA 3HL8A 2XDBA 3QYGB 4BUGA 5GAN3 4M77A 4C8QA 1ZHIA 5CKDA 2D9TA 3WXMB 5LJ3e 2K5FA 5GAOl 3CPWS 1VQ6T 1GXIE 2K5LA 4BE2A 5LJ3f 3LGFA 5GAN2 4F7UG 3SWNA 4LDUA 4BY6B 4L6V5 5LJ5g 3OYCA 5CIUA 2RJFA 4M7AE 1OI1A 5DLOA 5KE2A 2E5QA 4QVZA 2B8AA 4M77E 4XU3A 4C8QE 1WJRA 2RHZA 1VIEA 3HPWA 1YJ9A 2KK4A 2M9UA 2JZ2A 3OYFA 1BI2A 3OA6A 3CCQA 2DAQA 3G71T 2L89A 2V8JA 5GAMd 2GFUA 1VQLA 1G3WA 5HK0A 2XK0A 4N0AA 3FLGA 2QQSA 3ASKA 4PLIA 5KCOA 1KD1U 1VQ7A 3GIBA 4JRIA 2CZ0B 3LW5E 2XU8A 2ZGWA 4OGCA 1Q7YU 3MEAA 2DTOA 4HCZA 4JLIA 4Y91A 3A8OB 2G3RA 2KQWA 5L8RE 3RKXA 2PVGB 2GFAA 3OYKA 4HT9A 4FIBA 4II1A 2C06A 2DD5A 3EAEA 4J7IA 3BW1A 1YJ9T 2DTHA 2VXFA 4XTYA 4P5NA 3OYJA 2EQMA 3GF5A 3GLXA 3CCQT 4KBMB 1N8RU 3L2WA 3JRZA 1VQLT 3L2RA 3X24B 4EPCA 5IT9E 4M7DA 2RD1A 4XU0A 1VUBA 3L42A 1NJIU 3HKSA 3CMEA 1V29B 4QW2A 4QVCA 4GY5A 3V8LA 2V8KA 3CC2A 3L2UA 2VGMA 2YLCA 4M7AF 1M9SA 1U1TA 2DEQA 4OB2B 3INZA 5GAOp 4JRQA 4L59A 3JCMJ 4M77F 4M78G 4C8QF 2EJFA 2LC4A 4M77G 5HK3A 5I2MA 4A53A 3OYNA 4M7DE 1TH7A 2WACA 4QQDA 4OGEA 4EMGA 1XQHA 3OS2A 4BE0A 4HCCA 3OMGA 1Q82C 1K73U 1BI1A 2ZPEB 3LX7A 5CQYA 3UDCA 3CCMT 1M1KC 4XU2A 1FXXA 4PJOD 1X75C 3ER0A 4NL2A 5LL6S 2JUFA 4MZMA 2QTXA 2EQUA 5J26A 3QZ5B 2FYKA 4A4EA 4ATOA 5IN1A 2D0QB 1UB4A 3G7ZA 2DZ9A 2PQWA 3PMIA 1VQKA 3QPHA 3CC2T 5GMKe 2MWOA 1UGSB 2EQJA 2I2LA 1WQ7A 1YJNT 2DTIA 4C92D 2EJGA 3CD6T 3M57A 5CKFA 1YITT 4QVDA 4F7UB 4J83A 4XK8E 4BE1A 3JCMW 1YHQA 4CI0C 3DLMA 4XAXB 3KXTA 3CCVT 4XTVA 2HBPA 3PFSA 1VQ4A 3EFSA 4A4FA 3CXCS 1M90C 2KY9A 5LJ3h 3OMCA 2WSEE 3JAME 4WF2A 3ZFJA 3OS0A 1KC8U 3M54A 2L5QA 4MMLA 3QHSA 2LT4A 3BDUA 1VQ8A 1I5LA 1K9MC 2KDSA 3META 5DLQE 4JRKA 5GAN6 2BIVA 2D6FA 2DJZA 5CQXA 3A8GB 3L2VA 1VQKT 2RA2A 4C5HA 4XTXA 1S72A 4CRIA 2CS7A 3AHUA 4R55A 4LD9K 1FWZA 2A7YA 4HKEA 1YIJA 4M7DG 3JCMe 5I21A 4R56A 2BKDN 4LDVA 4KT0E 2RHXA 3MP1A 5LJ5d 3MEWA 2A3LA 4M75G 3JCMf 3WVDB 4HT8A 4MMKA 1VQ6A 4PJOB 4ELZC 1O75A 3OW2A 2QI2A 5FU7C 5HKCA 5I2SA 3PMTA 3MEUA 4RCCA 5GAN8 1VQ4T 3V7RA 2LQ8A 3JB9J 3MCAB 5CKEA 2HQXA 3QG1A 3V7SA 1VQOT 1BIAA 1W2BS 4M78C 1VQ8T 3S6WA 2OTLT 1OYXA 4FM4B 3FRNA 2FHDA 2EQKA 2CGHA 3PGGA 1B34A 4ZTJA 2DXCA 1WNLA 2JTFA 4OVAA 4C92B 4EDUA 1U8RA 1BIBA 1S72T 2RK1A 3FEOA 3QJ6A 1G3SA 2O4XB 3X20B 3LWIA 4E7IA 2MI6A 1QVFS 3X28B 1IREB 2EYQA 2DXTA 3OYGA 3I56T 5GANe 2MF2A 3JCMV 2GQVA 1KHIA 2LCCA 3C4SA 1Y71A 3H8ZA 5D6YA 2K5IA 5GANf 5A2QE 3NTKA 3MO8A 2RHYA 5CR2A 3HFOA 3QKJA 4FT2A 5FRMA 1M8VA 3DLLA 4XTZA 3CCRT 1BYMA 2PVOB 3PT9A 5AYFA 2JTMA 4M75D 2DXBA 4BDYA 4FU6A 1I8FA 2O4XA 2MMPA 3C12A 3HFNA 2K2VA 3R6OA 3VKIA 4JRPA 1YI2T 4EMKC 2XKOC 1WJSA 4C0DC 1QW1A 5CVIA 2OAUA 3LGLA 2RJDA 2DD4A 3RKWA 1OZ2A 1U1SA 4MZTA 3PNWC 4C5IA 4Y28E 2QQAA 2L8DA 2KVQG 1M5Q1 4PKCC 3VYHB 4ELYC 3OYBA 4GLKA 3CMAT 4XTUA 3TCJA 3M9QA 2L3RA 4OB3B 2X4JA 1ZQ1A 2NLUA 1VQ5T 2H3JA 3OYYA 3E19A 1Q86C 4X9DA 3SFMA 4M7DC 4BACA 3A5ZB 3MP6A 2V8IA 4IUUA 4Q5WA 5LJ5f 3CCSA 4X9CA 5GMKh 4C0GA 5LJ3j 2WSFE 2EFIA 1KHCA 4M75C 1IZ6A 3OS5A 2JVVA 3L1AA 1D3BB 1FX7A 1PSEA 3CCMA 2QA4A 2EKOA 3V8JA 5A0LA 1N27A 4J6WA 5EG2A 3A8MB 3OBYA 3X26B 2PUOB 5A0GA 1KD1C 3HHTB 3QIIA 1XTDA 4C5EA 4PJOF 2RJEA 4E7JA 1XNIA 3MHXA 4BDZA 2E1HA 2GCXA 4KUDK 4M7AG 3C95A 3CD6A 2RH2A 1D3BA 3JSCA 1UGPB 4C8QG 1YITA 3M4YA 2DKGA 3CCST 2Y4XA 3CBPA 1QP3A 4PL6A 2QEXT 1G5VA 2LRQA 3CCUA 1M1KU 3NTIA 3CCVA 3A8HB 1YJWT 1N9SA 3OY9A 2RK2A 1M4ZA 3JCMh 3QDRB 3DB3A 4J5YA 2QA4T 3BFMA 4C92F 4NOYA 3RMQA 4A4HA 2LTOA 2XIDA 4IUPA 3JCMX 4N4HA 4TVRA 4C0FA 3MP8A 5GAN7 3S3OA 3VJPA 1KG1A 1NJIC 4PLLA 2M0OA 3QUIA 4ZGEB 4ZGDB 2VGNA 2YLBA 5GAMe 3JCMQ 3CPFA 2OTJA 1K8AU 1VQMA 5GAMf 1JJ2S 4O5VA 4J7FA 2DIQA 1YJNA 4E7LA 3GP8A 4DOWA 1VQ9T 3QSUA 2IG0A 3L2QA 2M1HA 4JS4A 2PUKB 2RI5A 3CCLT 1Q81U 1NZ9A 2YRVA 3KUFA 2RHUA 2E6NA 1DJ7B 2PU9B 3CCUT 4NS5A 2LX9A 1M90U 3DB4A 1K73C 1QVGS 4M7AD 2K4YA 5GANh 4J6YA 1VQOA 4M78D 5FLXE 4A4KA 2RI3A 3BY7A 4M77D 2R58A 4C8QD 2FB7A 2DPPB 2OTLA 2JOYA 4QQGA 2CKKA 3T9NA 4E7HA 2P4TA 1G3TA 2XHCA 3M53A 1WGSA 1Y96B 4IUTA 4A54A 2OTJT 4F7UA 4C5GA 2XDPA 3M59A 4DA4A 3RIRA 4C0ZA 5GAOn 1VQMT 4BI4A 3JB9H 3VU3C 3E9GA 3JCMg 4RMOA 3CXCA 3LH0A 1YCYA 2DVEA 1LNXA 3P8HA 4IUQA 2EIFA 4JDSA 4ZTFA 3HSBA 3JB9F 3I56A 3JB9G 3CBMA 1SSFA 3HP9A 4IURA 4ZN3A 4OP0A 1HK9A 4XTWA 5CKBA 3JCMb 2E6ZA 3N5BB 2Y90A 1H3ZA 3V7CA 1WJQA 3M56A 4O6JA 4F7UE 4XU1A 5KE3A 5GMKj 5GAOr 3OSVA 3TU4K 1P92A 2CYZB 5DY9A 1Y96A 2E64A 3LWHA 3CCRA 3GOXA 4M7AC 1M1GA 3ME9A 2RHIA 4M77C 4C8QC 3C94A 3OW2S 4BB7A 2R5AA 3JCMP 1BI3A 5LJ5h 1YI2A 4LDXA 2R5MA 2WSCE 3MEVA 2F5KA 3SWNC 5KH6A 2E65A 3TREA 1WPYA 2Y4YA 2QDYB 3OBWA 4B9WA 3CC7T 3UPUA 3FB9A 5D6WA 5C6SA 4PJOA 2LNVA 5FU7B 1R8OB 2DK3A 1KQSA 3UT1A 4LDYA 5LJ3g 5GANg 3BDLA 1W2BA 3LLRA 3VUZA 3CMAA 3SD4A 1Y07A 1I4K1 2ZPBB 3RUXA 2DIGA 4M78B 3SB2A 4M77B 3L2ZA 1VQ5A 4M7DD 4RCBA 1NPRA 4FT4A 3QYHB 3FDRA 4V2SA 2VUBA 4DQ2A 4C92A 4PJOE 1LJOA 4N0AC 2ZPFB 4IKFA 2X35A 4LDWA 4BY6C 4OB0B 2ZZDA 3CEYA 4XQ3A 2QQ9A 4E7KA 3QO3A 3CPWA 4KULA 2K57A 4Z02A 4B9XA 5FROA 2R57A 2E10A 4MZPA 3NTHA 2CZ6B 3OYIA 4M78A 3G6EA 4C92E 5C0MA 1VQPT 3URGA 3J80E 3FC3A 3Q1JA 4OB1B 4HCBA 4ME7A 2CZ1B 2QQBA 5FRNA 4F7UF 1AHJB 2P0KA 2FL7A 3OYEA 1LOJA 4BI3A 1N6AA 2PVDB 3JCMc 3OYMA 1Q86U 2LVMA 1UEBA 5D6XA 5LJ5e 3E1SA 3CCJT 4EMKB 5GAMh 1BKBA 1WQWA 4M78E 3CCET 1VQNA 4C0DB 3OYLA 2QEXA 2DXUA 5GANj 2LDMA 1OZ3A 1EIFA 1YJWA 1M1FA 2EJ9A 4LD6A 1BI0A 2HNIA 3QBYA 2ZPIB 3OYHA 4QQ6A 2E12A 1UGQB 3P8BB 3P8DA 3OSSC 5GAN5 2KAFA 3QXEB 3G6ET 2KMTA 5CKHA 1YBYA 4EMKA 4M7DB 3RERA 2P0QA 1W4SA 4JJNK 1JBMA 4FSXA 5CCAA 3RESA 3EFRA 3VV0A 3A8LB 3PIOA 4KUIA 4PJOG 3G4SA 4M75B 1Q7YC 2M16A 4UC4A 2XICA 1I81A 5A0DA 1VQ9A 1RI0A 2VXEA 3GNGA 2VYTA 3RKYA 3TEEA 2K3XA 2XD0A 1VQNT 5CO7A 4MDWA 3CCLA 3M55A 3ZBDA 1Q82U 2F5TX 3J81E 3GPLA 1KQ1A 1N8RC 3M4GA 4BI8B 5GAN4 4C92G 1O9SA 5LJ5j 2MAMA 1NPPA 3H6ZA 4YTLA 1VQ7T 4X34A 3JCMd 2VV5A 2ZCFB 4MDXA 4M75A 3PIPA 2ZPHB 5GAMg 4VUBA 3J7AF 2HAXA 2GF7A 2DZCA 3SDZA 3FIFA 4M78F 4DOVA 3G4ST 3OS1A 1RL2A 3GNFB 1NE8A 3V8KA 1JRIA 3LYIA 4RKUE 4A4GA 2FVUA 4IUVA 3VYGA 2HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVW A;  2LC4 A;  2LNV A;  3OSS C;  2Y4X A;  2Y4Y A; 
#chains in the Genus database with same CATH topology
 4OMF B;  1X6O A;  1QP2 A;  2E70 A;  1AOJ A;  4PFP A;  3I55 A;  3TSW A;  9ATC B;  4RG8 A;  3CME T;  2GTO A;  2JNG A;  1K1Z A;  1B07 A;  2BZY A;  2AKK A;  2K3Y A;  5AT1 B;  4D6W A;  2H3E B;  3CXC P;  3O8V A;  2CRE A;  4L5G A;  2RJC A;  3CC4 A;  2EYY A;  2KSS A;  5GAM j;  2NUT B;  3EG3 A;  1PCX A;  2DER A;  1D0X A;  1AZE A;  3U23 A;  2YHT A;  5IXB A;  5GAO q;  4OMQ A;  4PJO C;  1BB9 A;  4BD3 A;  2BUD A;  3VS5 A;  3HRT A;  5FU6 C;  2BTT A;  3NFC A;  3FJP A;  4J6X A;  1YCS B;  3CBO A;  2CZ7 B;  4KGX B;  1UTI A;  3PTA A;  4AFU C;  3DKM A;  5HCK A;  4C8Q B;  2RM4 A;  2OAW A;  1KQS S;  1KQ2 A;  3JB9 I;  4E2F B;  2O01 E;  5KYY A;  2DRK A;  5GMK i;  3OQ5 A;  1OV3 A;  4JUV A;  1MV0 B;  1I5O B;  2XDB A;  4K11 A;  5LJ3 e;  2D9T A;  2K5F A;  1WI7 A;  3CPW S;  4KH1 B;  1M2V B;  4BE2 A;  5KYU B;  1TUD A;  2EVR A;  3MPU B;  4L6V 5;  2CP2 A;  4Z89 A;  5LJ5 g;  2M51 A;  3OYC A;  4M7A E;  5KE2 A;  2E5Q A;  5KYX A;  1SSH A;  2GBQ A;  2RHZ A;  3C0C A;  2M9U A;  1BI2 A;  3OA6 A;  2DAQ A;  2L89 A;  2V8J A;  3NMZ C;  4QT7 A;  5I11 A;  2YRC A;  4HVW A;  1KD1 U;  2YWW A;  4B6M A;  5GJV B;  3LW5 E;  4JJB A;  1EFN A;  3CC7 Q;  3VS4 A;  1I1J A;  3A8O B;  2G3R A;  2KQW A;  5L8R E;  4FIB A;  4DEX A;  4J7I A;  3VS2 A;  2DTH A;  4P5N A;  3OYJ A;  3CCQ T;  1N8R U;  3L2W A;  2KYB A;  1VQL T;  2L3S A;  5IT9 E;  1D0Z A;  1CKB A;  1VUB A;  1NJI U;  3HKS A;  3CME A;  2W0Z A;  6AT1 B;  1WLP B;  3CC2 A;  3L2U A;  1OUL A;  1M9S A;  1U1T A;  2CP7 A;  4M78 G;  1PM3 A;  4CC2 A;  4A53 A;  1TH7 A;  4EMG A;  1Q82 C;  1K73 U;  5CQY A;  1M1K C;  2GNC A;  4NL2 A;  1JJ2 P;  1ZSZ C;  2ROL A;  4MZM A;  4A4E A;  2ABL A;  2FYK A;  3CCE Q;  5IN1 A;  3UA6 A;  2D0Q B;  2EQJ A;  1QVG P;  3CD6 T;  3M57 A;  1B3Q A;  4QVD A;  4F7U B;  1K0X A;  2QTV A;  4XAX B;  3LH5 A;  3CCV T;  4XTV A;  2HBP A;  1JQQ A;  1VQ4 A;  3CXC S;  2KY9 A;  4PFO A;  3JAM E;  3ZFJ A;  3OS0 A;  1UJY A;  1KC8 U;  1GBQ A;  1HD3 A;  3QHS A;  1K9A A;  2Z0W A;  1K9M C;  3MET A;  4JRK A;  5GAN 6;  5CQX A;  2F1L A;  3CCQ Q;  1S72 A;  3AHU A;  4LD9 K;  1FWZ A;  2A7Y A;  1VQL Q;  1GFD A;  5FW9 A;  3JCM e;  4R56 A;  2BKD N;  1YFN A;  3MEW A;  4AMC A;  2K7A A;  1O75 A;  3OW2 A;  2QK0 A;  1YP5 A;  2JM8 A;  3MEU A;  4RCC A;  3V7R A;  2FHD A;  2EQK A;  2ECZ A;  4OVA A;  4EDU A;  4C92 B;  4AG2 C;  1BIB A;  1X69 A;  3X20 B;  1ABQ A;  1LPL A;  4ORZ A;  3OYG A;  3H41 A;  1IB8 A;  4AFS C;  5GAN f;  5A2Q E;  3EFO B;  3MO8 A;  2RHY A;  3HFO A;  3PVQ A;  5FRM A;  3A1P A;  4XTZ A;  3CCR T;  2PVO B;  5AYF A;  1I8F A;  2O4X A;  1FYN A;  3VKI A;  4JRP A;  1YI2 T;  3LGL A;  4R0K A;  2RQW A;  2DD4 A;  3RKW A;  1OZ2 A;  3PNW C;  4C5I A;  1WA7 A;  2QQA A;  3VYH B;  1M5Q 1;  4PKC C;  2M02 A;  3CMA T;  2PTK A;  2L3R A;  2FEI A;  2RF0 A;  1PC0 A;  1Q86 C;  4M7D C;  4BAC A;  3MP6 A;  4FYV B;  5GMK h;  1X6B A;  5LJ3 j;  1YHQ Q;  3BE3 A;  1GRI A;  2EFI A;  1KHC A;  4M75 C;  4F17 A;  1UJ0 A;  5A0L A;  4J6W A;  5EG2 A;  2QAS A;  3X26 B;  2COY A;  2BZ8 A;  4C5E A;  2RJE A;  3NPF A;  4M7A G;  3CD6 A;  1UGP B;  2DKG A;  2Y4X A;  2YRD A;  2QEX T;  3CCU A;  3CCV A;  7AT1 B;  1VQ6 Q;  3OY9 A;  1M4Z A;  2DX1 A;  4HVU A;  4N4H A;  4TVR A;  3CCR Q;  3O5Z A;  3QUI A;  2QAZ A;  3RR6 A;  1WIE A;  3QWY A;  1JJ2 S;  4FCY A;  4E7L A;  2D8J A;  4DOW A;  2IG0 A;  4DBH A;  3CCL T;  3UAT A;  3CMA Q;  2E6N A;  3DB4 A;  3MKD A;  1T0J A;  1QVG S;  4M7A D;  5FWC A;  3EG0 A;  3T9N A;  2P4T A;  3EG9 A;  2V26 A;  1VQM T;  2COW A;  1GCQ A;  2RN8 A;  3JB9 H;  3E9G A;  3JCM g;  1SSF A;  1AWJ A;  1WZO A;  4IUR A;  4OP0 A;  4FSS A;  2Y90 A;  2ATC B;  5GAO r;  1OQK A;  5DY9 A;  2E64 A;  3CCR A;  3EGU A;  3KFV A;  3R6N A;  2RHI A;  4C8Q C;  4DEY A;  3OW2 S;  2QEX Q;  2R5A A;  1M3A A;  5LJ5 h;  1YI2 A;  3OBW A;  4B9W A;  5FU7 B;  3UT1 A;  1W2B A;  3LLR A;  3CMA A;  2ED1 A;  3RUX A;  3SB2 A;  3L2Z A;  4ANJ A;  2J7I A;  4V2S A;  2VUB A;  1M3C A;  2ZPF B;  4E7Z A;  2X35 A;  4LDW A;  4OB0 B;  2CP0 A;  1D1A A;  1MV3 A;  3QO3 A;  3UF4 A;  5KYX B;  1VYU A;  2F2X A;  4Z02 A;  4AT1 B;  2E10 A;  2J6F A;  1KSW A;  1NLP C;  1ZUU A;  4MZP A;  1UE9 A;  3OYI A;  4M78 A;  3G6E A;  2RQR A;  3URG A;  3J80 E;  1LOJ A;  2PVD B;  1VQM Q;  2LVM A;  4EMK B;  1BKB A;  1VQN A;  2KR3 A;  2QEX A;  2J6O A;  2HNI A;  2V1Q A;  3QBY A;  3P8B B;  1Q82 R;  1M1K R;  2A08 A;  2KMT A;  5CKH A;  1I0C A;  4LUD A;  1ZA2 B;  2P0Q A;  1WDX A;  1JBM A;  1M30 A;  3EFR A;  3G4S A;  4PJO G;  1YWO A;  2LQN A;  1TSF A;  1Q7Y C;  4UC4 A;  2XIC A;  5A0D A;  2VXE A;  2XD0 A;  2K3X A;  4MDW A;  3CCL A;  2LJ0 A;  3ZBD A;  2GTJ A;  2F5T X;  3J81 E;  1FMK A;  3M4G A;  1O9S A;  2J6K A;  1S1N A;  2MAM A;  5IXF A;  1VQ7 T;  1A0N B;  4X34 A;  2VV5 A;  4J9H A;  4QKU A;  3UA7 A;  4J9D A;  2NUP B;  1K9M R;  4M78 F;  4DOV A;  3GNF B;  1NE8 A;  4DBR A;  4M75 E;  2HQE A;  1ZBX A;  4JLG A;  1VQ5 Q;  1X01 A;  3OYD A;  2EKH A;  2KYM A;  1KIK A;  1I07 A;  1N5Z A;  3KBG A;  5LJ3 d;  5GAN d;  1LCK A;  1Q95 G;  1H64 1;  1UGR B;  3HRU A;  1Q81 C;  1G3Y A;  3A98 A;  2KBT A;  1UFF A;  5KCH A;  1SHF A;  2EYW A;  2LJ1 A;  3I55 T;  2JN0 A;  2QXF A;  5CAI A;  2VC8 A;  1MGQ A;  1TG0 A;  2DVJ A;  2P84 A;  2OJ2 A;  4C92 C;  1KQS P;  1WXU A;  1QLY A;  1HXD A;  1HSQ A;  4JJC A;  4RG2 A;  3CC4 T;  4E6R A;  1TWB A;  2KT8 A;  1TXQ A;  1YNZ A;  2RB6 A;  2YUP A;  3SWN B;  3JB9 D;  4IIM A;  1QVF A;  1Q86 R;  2KT1 A;  3CPW P;  3G71 A;  3EH1 A;  1D1B A;  1YIJ T;  4E47 A;  2MWP A;  2QQR A;  4M7A A;  1PWT A;  2RQU A;  3QYG B;  2MPX C;  4BUG A;  5CKD A;  1ZHI A;  1GXI E;  4AFQ C;  2ED0 A;  1RAC B;  2EYZ A;  1KFZ A;  2B8A A;  4C8Q E;  4F16 A;  1YJ9 A;  1SPK A;  3OYF A;  4F04 B;  1ZA1 B;  2GFU A;  3TQ7 P;  3I55 Q;  1V1C A;  2OI3 A;  5HK0 A;  4N0A A;  3FLG A;  1UHF A;  1VQ7 A;  1YN8 A;  2RPN A;  1G83 A;  2C0O A;  3MEA A;  4Y91 A;  1E6G A;  1ARK A;  2GFA A;  3OYK A;  2QYZ A;  2DD5 A;  3BW1 A;  2FPE A;  2G6F X;  1U5S A;  3CC4 Q;  2CH4 W;  2EQM A;  4PJJ A;  1QCN A;  1IHW A;  3JRZ A;  3X24 B;  1NLO C;  2GGR A;  4XU0 A;  2KGT A;  4RTY A;  3TSZ A;  1V29 B;  3V8L A;  2VGM A;  2YLC A;  4M7A F;  4OB2 B;  1OX8 A;  5GAO p;  2EJF A;  4M77 G;  4OGE A;  1YWP A;  3OS2 A;  3LX7 A;  4PK4 A;  3ER0 A;  5J26 A;  4ATO A;  1UB4 A;  1RI9 A;  3G7Z A;  2DZ9 A;  2PQW A;  1VQK A;  3CC2 T;  4DBQ A;  4AG1 C;  1UGS B;  1SG5 A;  2CH4 A;  3JCM W;  1OOT A;  1JXM A;  5D7U A;  1TU0 B;  3EH2 A;  4A4F A;  2CDT A;  3H0I A;  2WSE E;  1ZX6 A;  2I0N A;  3M54 A;  3BDU A;  1NG2 A;  1J3T A;  1I5L A;  4JJD A;  2KDS A;  2BIV A;  3L2V A;  1IRX A;  4CRI A;  1ZBJ A;  4M7D G;  1YIJ A;  2DL3 A;  1UDL A;  2QGF B;  4M75 G;  2QI2 A;  1M8M A;  5FU7 C;  1VQ4 T;  2LQ8 A;  3M0P A;  3QG1 A;  1MMG A;  3V7S A;  3S6W A;  2OTL T;  1OYX A;  4FM4 B;  1QWF A;  3FRN A;  2CGH A;  1B34 A;  2DXC A;  1NBE B;  1S72 T;  1RUW A;  3QJ6 A;  4GBQ A;  4OML A;  1G3S A;  1AD5 A;  5EC7 A;  1QVF S;  3I56 T;  2EYQ A;  2DXT A;  3CME Q;  5GAN e;  2GQV A;  1KHI A;  3C4S A;  3H8Z A;  3CC2 Q;  2K5I A;  5CR2 A;  1D09 B;  2YUQ A;  1M8V A;  4WCI A;  3GBQ A;  1BYM A;  2HL3 A;  3PT9 A;  4BDY A;  4M75 D;  2DXB A;  5KYW A;  4FU6 A;  4KH0 B;  2MMP A;  1Q7Y R;  1WX6 A;  4EMK C;  2XKO C;  3JV3 A;  1AVZ C;  2L8D A;  4ELY C;  3OYB A;  1G8X A;  4GLK A;  4XTU A;  2DL5 A;  3TCJ A;  1MND A;  4JPB W;  4J9B A;  2NLU A;  3H0F A;  2H3J A;  4Z8A A;  3E19 A;  1JXO A;  3SFM A;  1BCM A;  1OPK A;  4IUU A;  5LJ5 f;  4C0G A;  2WSF E;  3NGP A;  4J9E A;  1IZ6 A;  1RAE B;  3L1A A;  2RQT A;  2YUN A;  1FX7 A;  2QA4 A;  1VQ4 Q;  2EKO A;  1N27 A;  1U06 A;  3OBY A;  1T3S A;  2OTL Q;  3EGD A;  1KD1 C;  3HHT B;  1KJW A;  4PJO F;  1S72 Q;  1M2O A;  1TUC A;  4JZ4 A;  3EHQ A;  1D3B A;  3JSC A;  4C8Q G;  1Z9Q A;  3M4Y A;  3I56 Q;  3CBP A;  2LRQ A;  1M1K U;  1YJW T;  3VRZ A;  1RAB B;  3DB3 A;  1Y57 A;  1X2Q A;  2F2V A;  3BFM A;  4NOY A;  2LTO A;  1BCO A;  2XID A;  2CT4 A;  3MP8 A;  1PRM C;  1W70 A;  3VJP A;  1NJI C;  2M0O A;  4ZGE B;  4ZGD B;  2VGN A;  2OTJ A;  1K8A U;  1WXB A;  1YJN A;  3EGX B;  1AWW A;  1VQ9 T;  3QSU A;  1PD1 A;  1PHT A;  4RTT A;  3L2Q A;  1RAH B;  1R77 A;  2YRV A;  3CCU T;  4OMN A;  3I5S A;  2A0F B;  2A28 A;  1K73 C;  2DYI A;  1PKS A;  2K4Y A;  4J6Y A;  4M78 D;  4A4K A;  4C8Q D;  1UUE A;  2FB7 A;  2OTL A;  1H3H A;  2JOY A;  2EYX A;  2CKK A;  4E7H A;  2XHC A;  2MIO A;  1OU8 A;  4IUT A;  4C5G A;  2XDP A;  3M59 A;  2E3I A;  5GAO n;  1ZSZ A;  4RMO A;  1NEG A;  3LH0 A;  1LNX A;  3JB9 F;  3I56 A;  2SEM A;  1NYF A;  3HP9 A;  4ZN3 A;  3OW2 P;  1HK9 A;  3N5B B;  1WJQ A;  4O6J A;  2CP6 A;  3TU4 K;  1Y96 A;  3LWH A;  3ME9 A;  2DL8 A;  4M77 C;  3CQT A;  4LDX A;  4LUE A;  3MEV A;  3SWN C;  5KH6 A;  2DLP A;  2E65 A;  2QDY B;  2E5K A;  4RTZ A;  1W1F A;  1R8O B;  2DK3 A;  4LDY A;  5LJ3 g;  5GAN g;  3SD4 A;  1UHC A;  1Y07 A;  1I4K 1;  2D0N A;  1WYX A;  2LP5 A;  4PJO E;  1VQ9 Q;  3CD6 Q;  4CC7 A;  4IKF A;  1QCF A;  1NEB A;  1UG1 A;  4CC4 B;  3CCU Q;  2QQ9 A;  3CCV Q;  1VQP T;  5IH2 A;  2CZ1 B;  2QQB A;  3HTR A;  1AHJ B;  3OYE A;  3M0U A;  4BI3 A;  3JCM c;  3OYM A;  1Q86 U;  3EHR A;  5D6X A;  1WHJ A;  5GAM h;  1WQW A;  3OYL A;  2DXU A;  5GAN j;  2LDM A;  1WFW A;  1EIF A;  1YJW A;  4LD6 A;  2JMA A;  2ZPI B;  3OYH A;  3G6E T;  2GQI A;  3M0R A;  1IGQ A;  1YBY A;  1W4S A;  1G2B A;  4FSX A;  4RTW A;  5CCA A;  1WHG A;  4KUI A;  2M16 A;  1VQ9 A;  1RI0 A;  3GNG A;  1VQN T;  2O9S A;  1OEB A;  4KGZ B;  1KQ1 A;  4BI8 B;  5GAN 4;  4C92 G;  2DRM A;  2L3P A;  4PFZ A;  1NPP A;  1F1B B;  4M75 A;  2HAX A;  1YI2 Q;  4LE9 A;  3FIF A;  3G4S T;  3OS1 A;  3V8K A;  1JRI A;  4IUV A;  1TS9 A;  2HZY A;  3VYG A;  4A63 B;  5CK9 A;  2K6D A;  1RAI B;  3S3M A;  2MK5 A;  2EAY A;  2HMA A;  3S3N A;  1WHK A;  2PNI A;  3RMS A;  2X4W A;  4FL6 A;  1MMA A;  1XJW B;  2CUB A;  2E41 A;  4J8O A;  1QWE A;  1V76 A;  3G6E Q;  4J9G A;  2IVW A;  4PNO A;  3UWN A;  3VUB A;  3F70 A;  2RO0 A;  2ROT A;  2RMO A;  3M58 A;  3ZEH A;  1K76 A;  2QGG A;  4ZN1 A;  5GMK m;  1VQN Q;  3REB B;  2FZK B;  2X4X A;  1VA7 A;  2F69 A;  4JS5 A;  5DM7 R;  4M7D F;  3VS6 A;  1SKU B;  2K79 A;  1B34 B;  5KYY B;  2X3W D;  2NUT A;  2X4Y A;  4M75 F;  1W2B P;  1BK2 A;  3X25 B;  1VQP A;  1R0C B;  5GMK l;  2EQI A;  3M5A A;  2IIM A;  4HA8 A;  1WHM A;  4OF1 A;  4J9C A;  3G4S Q;  5FU6 B;  5IAY A;  2DL7 A;  1IHV A;  2AKL A;  2LQK A;  2DO3 A;  3CCL Q;  1PRL C;  3QZ9 B;  1PSF A;  2NYS A;  5KYW B;  2COZ A;  1MHN A;  5GAN 3;  4C8Q A;  2K5L A;  5GAN 2;  1BBZ A;  4LDU A;  4BY6 B;  3M0S A;  5CIU A;  2RJF A;  1M27 C;  4M77 E;  4XU3 A;  1WJR A;  1VIE A;  3HPW A;  2KK4 A;  2JZ2 A;  5IHN A;  3G71 T;  1M2V A;  1CKA A;  1AT1 B;  4PLI A;  2VB6 A;  5KCO A;  4F14 A;  1QKW A;  4JZ3 A;  2CZ0 B;  4EIK A;  2YT6 A;  2XU8 A;  2ZGW A;  2JXB A;  1Q7Y U;  3RKX A;  1AWO A;  3VS7 A;  4HT9 A;  2HCK A;  1YJ9 T;  4XTY A;  1SHG A;  4KBM B;  1M3B A;  2F2W A;  3E2U A;  4EPC A;  2J05 A;  2RD1 A;  3L42 A;  1K73 R;  4QW2 A;  2EGC A;  4FYW B;  4QVC A;  2YUO A;  2NWM A;  2CSQ A;  4JRQ A;  4C8Q F;  4M7D E;  2LC4 A;  5HK3 A;  2WAC A;  4QQD A;  1XQH A;  1CSK A;  3D7S B;  3CCM T;  4XU2 A;  2KNB B;  4PJO D;  1X75 C;  5LL6 S;  2JJ9 A;  2EQU A;  2DFU A;  2QDL A;  2DF6 A;  3PMI A;  3QPH A;  5GMK e;  2MWO A;  2YDL A;  3G71 Q;  1WXT A;  2PZ1 A;  5CKF A;  4J83 A;  3PVL A;  3DLM A;  3REA B;  3EFS A;  1M90 C;  5LJ3 h;  4WF2 A;  1NYG A;  2K2M A;  4MML A;  1VQ8 A;  4OMP A;  5DLQ E;  1W6X A;  1YJ9 Q;  1VQK T;  2RA2 A;  4C5H A;  1GBR A;  4HKE A;  2EGE A;  4LDV A;  4KT0 E;  2RHX A;  2X9H A;  3MP1 A;  2EW3 A;  1VQ7 Q;  4HT8 A;  3AT1 B;  3VS0 A;  4ELZ C;  5HKC A;  3PMT A;  5GAN 8;  1W2B S;  2JW4 A;  2KXC A;  1QVF P;  2J06 A;  1WNL A;  1U8R A;  1K0S A;  3CCM Q;  2RK1 A;  2O4X B;  4E7I A;  1UGV A;  2KE9 A;  2MF2 A;  5D6Y A;  2JT4 A;  3RBB B;  2O88 A;  4FT2 A;  3DLL A;  2JTE A;  3VRY A;  4FW2 A;  2L0A A;  2K2V A;  5CVI A;  1GFC A;  4MZT A;  1ZLM A;  2AT1 B;  3EFO A;  2KVQ G;  2L3Q A;  1H92 A;  1VQK Q;  2P4R A;  2X4J A;  1ZQ1 A;  2VVK A;  4X9D A;  3CCS A;  4LNP A;  4X9C A;  2FZC B;  1SEM A;  3IQL A;  3OS5 A;  3CCM A;  4FW1 A;  3V8J A;  2HKN A;  5IHK A;  3ZL7 C;  1D0Y A;  1OPL A;  3EG1 A;  2PUO B;  5A0G A;  1XTD A;  2FPD A;  2DA9 A;  4E7J A;  3MHX A;  2E1H A;  4KUD K;  1YIJ Q;  2NUZ A;  1G5V A;  1QP3 A;  4PL6 A;  3NTI A;  3JCM h;  2KRO A;  4J5Y A;  2QA4 T;  4C92 F;  1EX4 A;  2HSP A;  3RMQ A;  4A4H A;  3JCM X;  4C0F A;  3S3O A;  4PLL A;  2YLB A;  3JCM Q;  5GAM f;  4HXJ A;  2DIQ A;  1OX9 A;  3EG9 B;  4JS4 A;  2M1H A;  2PUK B;  1NZ9 A;  2E4H A;  3KUF A;  2RHU A;  2PU9 B;  2LX9 A;  1KK7 A;  1JEG A;  1X6G A;  4M77 D;  2R58 A;  2DPP B;  4HVV A;  1G3T A;  3M53 A;  2OTJ T;  2K9G A;  2JS0 A;  3RIR A;  4C0Z A;  3NHN A;  1PD0 A;  4BI4 A;  3VU3 C;  2LNH B;  3CXC A;  1YJN T;  4KGV B;  3P8H A;  2DVE A;  4IUQ A;  3CBM A;  4XTW A;  3JCM b;  2LJ3 A;  3M0T A;  1H3Z A;  3V7C A;  4F7U E;  5GMK j;  4XU1 A;  5KE3 A;  1P92 A;  4D8D A;  3GOX A;  2ZAE A;  2HKQ B;  4IIO A;  3JCM P;  3H9N A;  2FPF A;  2F5K A;  3TRE A;  2BE7 D;  2QA4 Q;  3CC7 T;  2DBM A;  4PJO A;  3BDL A;  3VUZ A;  2EBP A;  1GCP A;  2ZPB B;  2DIG A;  4M78 B;  2DYB A;  4M7D D;  1C6V X;  4FT4 A;  3QYH B;  3FDR A;  4DQ2 A;  1LJO A;  2DBK A;  4BY6 C;  2ZZD A;  3CEY A;  1IXD A;  4PJL A;  1ZUY A;  4B9X A;  1C0M A;  3NTH A;  2CZ6 B;  1ABO A;  4C92 E;  5C0M A;  3FC3 A;  4HCB A;  2V1R A;  1C1A A;  4ME7 A;  5FRN A;  2ENM A;  2P0K A;  2FL7 A;  2OTJ Q;  1N6A A;  2A37 A;  1FMW A;  1UEB A;  3E1S A;  3CCJ T;  1YJN Q;  2DL4 A;  3CCE T;  1T3L A;  2DJQ A;  4C0D B;  1D1C A;  5L23 A;  3THK A;  1OZ3 A;  1HJD A;  1M1F A;  2HEQ A;  2HBW A;  2CP3 A;  4QQ6 A;  3P8D A;  2X3X D;  3QXE B;  1VYV A;  2KRM A;  4EMK A;  3RER A;  3I35 A;  2CT3 A;  4FYX B;  3VV0 A;  3A8L B;  1I81 A;  3TEE A;  2AK5 A;  1E7O A;  5CO7 A;  3M55 A;  1Q82 U;  4OMM A;  1PNJ A;  1HYO A;  2QG9 B;  1N8R C;  2O9V A;  3EG2 A;  5LJ5 j;  1Q81 R;  4M4Z A;  4YTL A;  1M90 R;  2B86 A;  2GF7 A;  2KRS A;  2FVU A;  2DE0 X;  2FRW A;  2JM9 A;  1ACM B;  3HRS A;  4N4G A;  5J3B A;  1TTH B;  1JJ2 A;  3CCJ Q;  1K9M U;  2NUP A;  2LCL A;  3E9F A;  5GJW B;  4EMH A;  5J39 A;  1SF9 A;  2P0P A;  3OYA A;  1JB0 E;  2RI2 A;  1K8A C;  4CC3 A;  3CC7 A;  2XI9 A;  4ESR A;  3SEM A;  1QVG A;  2AZV A;  3OB9 A;  1N9R A;  1Y7X A;  4ZNX A;  1RAG B;  2AHJ B;  4ZGJ B;  2D1X A;  5FWB A;  1QVP A;  1KC8 C;  1NM7 A;  8AT1 B;  5M9O A;  3QJY A;  4N4I A;  2EWN A;  2XDD A;  1YJW Q;  2CSI A;  2ZPG B;  2XG8 D;  2X51 A;  1YHQ T;  1XOV A;  5HY6 A;  4M7A B;  2RNA A;  2LT1 A;  3H0H A;  3CCJ A;  2HD0 A;  4NL3 A;  3CCE A;  1VIF A;  5GAO m;  2HQH A;  2MYS A;  2W10 A;  4AFZ C;  4DBF A;  3WVE B;  1PKT A;  4KRT A;  3HL8 A;  4M77 A;  5GAO l;  3WXM B;  1VQ6 T;  5LJ3 f;  3LGF A;  4F7U G;  3SWN A;  1OI1 A;  5DLO A;  4QVZ A;  2KEA A;  3CCQ A;  5GAM d;  1VQL A;  3RNJ A;  1G3W A;  2XK0 A;  2QQS A;  3ASK A;  3GIB A;  2CUD A;  4PJM A;  4JRI A;  2EGA A;  1WHH A;  4OGC A;  2DTO A;  4HCZ A;  4JLI A;  1ZUK A;  3VS1 A;  2PVG B;  4II1 A;  2C06 A;  3EAE A;  2VXF A;  3GF5 A;  3GLX A;  3L2R A;  4M7D A;  1U3O A;  1EZZ B;  1FMV A;  4GY5 A;  2V8K A;  4OMO A;  3M0Q A;  2DEQ A;  4D8K A;  3INZ A;  4J9F A;  3JCM J;  4L59 A;  4M77 F;  5IHI A;  3OYN A;  2JMC A;  5I2M A;  2DET A;  2E3H A;  4E7S A;  1VQP Q;  1MMD A;  4BE0 A;  4HCC A;  3OMG A;  1BI1 A;  2ZPE B;  3UDC A;  1QQJ A;  1FXX A;  1WHL A;  1GCQ C;  2JUF A;  2QTX A;  3QZ5 B;  4J9I A;  2M0Y A;  2FZG B;  3QWX X;  2I2L A;  1WQ7 A;  2DTI A;  4C92 D;  2EJG A;  1YIT T;  4XK8 E;  4BE1 A;  1YHQ A;  4CI0 C;  3KXT A;  4LN2 A;  1JU5 C;  3PFS A;  5ECA A;  2DNU A;  3OMC A;  3G1J A;  2L5Q A;  1BU1 A;  2LT4 A;  3TVT A;  2D6F A;  2DJZ A;  3A8G B;  4XTX A;  2KI7 A;  2CS7 A;  4R55 A;  2FG0 A;  5I21 A;  5LJ5 d;  3JCM f;  2A3L A;  1TOV A;  3WVD B;  3MJX A;  4MMK A;  1VQ6 A;  4PJO B;  2ESW A;  5I2S A;  1RAA B;  4GLM A;  3JB9 J;  3MCA B;  5CKE A;  2HQX A;  1VQO T;  1E6H A;  1BIA A;  4M78 C;  1VQ8 T;  3FJ5 A;  3PGG A;  4ZTJ A;  2JTF A;  3FEO A;  3LWI A;  2MCN A;  1QMC A;  2MI6 A;  3X28 B;  1IRE B;  1AWX A;  3JCM V;  2LCC A;  1Y71 A;  3NTK A;  1ZSG A;  2YXY A;  2BE9 B;  3QKJ A;  1KD1 R;  2EPD A;  1YIT Q;  2JTM A;  3C12 A;  3HFN A;  3R6O A;  3I5R A;  1IO6 A;  1OU9 A;  1WJS A;  2HDA A;  4C0D C;  1QW1 A;  2OAU A;  2KRN A;  2RJD A;  1U1S A;  2KXD A;  5KYU A;  4Y28 E;  1N8R R;  4Y92 A;  3M9Q A;  4OB3 B;  1VQ5 T;  2C0I A;  1NJI R;  3EGD B;  3OYY A;  3A5Z B;  2V8I A;  4Q5W A;  1X2K A;  4RTV A;  2JVV A;  1D3B B;  1PSE A;  1VQO Q;  3A8M B;  1VQ8 Q;  1K4U S;  1Z9Z A;  3QII A;  4X1V A;  2O2O A;  1UEC A;  1XNI A;  2FRY A;  4BDZ A;  2GCX A;  3C95 A;  2RH2 A;  1YIT A;  1B7T A;  5I22 A;  3CCS T;  1K8A R;  3A8H B;  1N9S A;  2RK2 A;  3QDR B;  2XMF A;  1VYT A;  5KYN A;  3PE0 A;  4IUP A;  5GAN 7;  2A36 A;  1KG1 A;  1MMN A;  2LMJ A;  5GAM e;  3CPF A;  4WTO B;  1RAD B;  1VQM A;  1KC8 R;  4O5V A;  1SRM A;  4J7F A;  3GP8 A;  2RI5 A;  1Q81 U;  1ZSZ B;  1DJ7 B;  2VAS A;  4PJN A;  4NS5 A;  1M90 U;  4RTX A;  4RUG A;  5GAN h;  1AZG B;  1VQO A;  5FLX E;  1QKX A;  2RI3 A;  3BY7 A;  4QQG A;  3EGX A;  2LZ6 B;  1WGS A;  1Y96 B;  4A54 A;  4F7U A;  2FO0 A;  4DA4 A;  8ATC B;  1YCY A;  4JDS A;  4ZTF A;  2EIF A;  3HSB A;  3JB9 G;  5CKB A;  2E6Z A;  3M56 A;  1AEY A;  3OSV A;  2CYZ B;  4M7A C;  1M1G A;  2YSQ A;  2H8H A;  3CCS Q;  2DEU A;  3C94 A;  4BB7 A;  1BI3 A;  1TUG B;  2R5M A;  1PG5 B;  2WSC E;  1MUZ A;  1WPY A;  2Y4Y A;  1IGU A;  2JS2 A;  1R0B G;  2DM1 A;  3UPU A;  3FB9 A;  5D6W A;  5C6S A;  2LNV A;  1KQS A;  2VWF A;  1JO8 A;  3I9Q A;  3RDV A;  4M77 B;  2CP5 A;  1VQ5 A;  2HSE B;  4RCB A;  1NPR A;  2DMO A;  4Z88 A;  2LCS A;  4C92 A;  4N0A C;  2HL5 C;  2LX7 A;  1SRL A;  2OX7 A;  2AIR B;  1Y0M A;  1H8K A;  4XQ3 A;  4E7K A;  3CPW A;  2O31 A;  4KUL A;  2K57 A;  2MOX A;  5FRO A;  2R57 A;  1X43 A;  1MNE A;  3Q1J A;  4OB1 B;  4F7U F;  5LJ5 e;  3SHW A;  1T0H A;  4M78 E;  2RQV A;  4HCK A;  2DIL A;  2EJ9 A;  1LVK A;  1BI0 A;  2K3B A;  2E12 A;  1UGQ B;  1RAF B;  1RLP C;  3OSS C;  5GAN 5;  2D8H A;  2KAF A;  1GL5 A;  3QDF A;  4M7D B;  2VKN A;  4JJN K;  3PIO A;  3RES A;  4M75 B;  4LXC A;  3RKY A;  2VYT A;  1VOM A;  1QCO A;  2SRC A;  4RTU A;  3GPL A;  1X27 A;  1RLQ C;  3H6Z A;  2C0T A;  2LQW A;  3JCM d;  2ZCF B;  4MDX A;  3PIP A;  2ZPH B;  5GAM g;  4VUB A;  3J7A F;  2BZX A;  2DZC A;  3SDZ A;  4FYY B;  2L2P A;  3VS3 A;  1RL2 A;  3ULR B;  3LYI A;  4RKU E;  2AZS A;  2IPO B;  4A4G A; 
#chains in the Genus database with same CATH homology
 4OMF B;  1X6O A;  5CK9 A;  1QP2 A;  2E70 A;  1ZBX A;  3S3M A;  4JLG A;  3HRS A;  2EAY A;  4N4G A;  3I55 A;  3S3N A;  5J3B A;  1X01 A;  1JJ2 A;  3OYD A;  4RG8 A;  3RMS A;  3CME T;  1K9M U;  2JNG A;  2LCL A;  2X4W A;  4FL6 A;  3KBG A;  4M75 E;  3E9F A;  5J39 A;  4EMH A;  5LJ3 d;  2P0P A;  5GAN d;  2K3Y A;  3OYA A;  1JB0 E;  2RI2 A;  1K8A C;  4D6W A;  2E41 A;  3CC7 A;  2XI9 A;  3O8V A;  4J8O A;  1QVG A;  1H64 1;  1UGR B;  3OB9 A;  3UWN A;  1N9R A;  2IVW A;  4PNO A;  4L5G A;  1Y7X A;  3HRU A;  3VUB A;  1Q81 C;  1G3Y A;  2RJC A;  5KCH A;  3CC4 A;  2KSS A;  3F70 A;  2AHJ B;  4ZGJ B;  5GAM j;  2RO0 A;  3I55 T;  2YHT A;  2JN0 A;  1QVP A;  2QXF A;  3M58 A;  5CAI A;  5GAO q;  4PJO C;  4BD3 A;  1KC8 C;  3ZEH A;  4ZN1 A;  5GMK m;  5M9O A;  2BUD A;  3QJY A;  4N4I A;  2EWN A;  2VC8 A;  2X4X A;  2XDD A;  3HRT A;  5FU6 C;  2F69 A;  4JS5 A;  1MGQ A;  3NFC A;  5DM7 R;  4M7D F;  3FJP A;  4J6X A;  2ZPG B;  1B34 B;  2XG8 D;  3CBO A;  2CZ7 B;  2X4Y A;  4C92 C;  4M75 F;  1VQP A;  3X25 B;  1YHQ T;  1XOV A;  1HXD A;  5GMK l;  3PTA A;  3M5A A;  5HY6 A;  4RG2 A;  4M7A B;  3CC4 T;  3DKM A;  4HA8 A;  4OF1 A;  4C8Q B;  2LT1 A;  2RM4 A;  5FU6 B;  1KQS S;  3CCJ A;  2HD0 A;  2RB6 A;  5IAY A;  1KQ2 A;  3JB9 I;  3SWN B;  4NL3 A;  3CCE A;  3JB9 D;  2O01 E;  1VIF A;  5GAO m;  2LQK A;  2DO3 A;  1QVF A;  3QZ9 B;  1PSF A;  5GMK i;  3G71 A;  3OQ5 A;  4JUV A;  3WVE B;  1YIJ T;  4E47 A;  2MWP A;  2QQR A;  1MHN A;  4M7A A;  3HL8 A;  2XDB A;  3QYG B;  4BUG A;  5GAN 3;  4M77 A;  4C8Q A;  1ZHI A;  5CKD A;  2D9T A;  3WXM B;  5LJ3 e;  2K5F A;  5GAO l;  3CPW S;  1VQ6 T;  1GXI E;  2K5L A;  4BE2 A;  5LJ3 f;  3LGF A;  5GAN 2;  4F7U G;  3SWN A;  4LDU A;  4BY6 B;  4L6V 5;  5LJ5 g;  3OYC A;  5CIU A;  2RJF A;  4M7A E;  1OI1 A;  5DLO A;  5KE2 A;  2E5Q A;  4QVZ A;  2B8A A;  4M77 E;  4XU3 A;  4C8Q E;  1WJR A;  2RHZ A;  1VIE A;  3HPW A;  1YJ9 A;  2KK4 A;  2M9U A;  2JZ2 A;  3OYF A;  1BI2 A;  3OA6 A;  3CCQ A;  2DAQ A;  3G71 T;  2L89 A;  2V8J A;  5GAM d;  2GFU A;  1VQL A;  1G3W A;  5HK0 A;  2XK0 A;  4N0A A;  3FLG A;  2QQS A;  3ASK A;  4PLI A;  5KCO A;  1KD1 U;  1VQ7 A;  3GIB A;  4JRI A;  2CZ0 B;  3LW5 E;  2XU8 A;  2ZGW A;  4OGC A;  1Q7Y U;  3MEA A;  2DTO A;  4HCZ A;  4JLI A;  4Y91 A;  3A8O B;  2G3R A;  2KQW A;  5L8R E;  3RKX A;  2PVG B;  2GFA A;  3OYK A;  4HT9 A;  4FIB A;  4II1 A;  2C06 A;  2DD5 A;  3EAE A;  4J7I A;  3BW1 A;  1YJ9 T;  2DTH A;  2VXF A;  4XTY A;  4P5N A;  3OYJ A;  2EQM A;  3GF5 A;  3GLX A;  3CCQ T;  4KBM B;  1N8R U;  3L2W A;  3JRZ A;  1VQL T;  3L2R A;  3X24 B;  4EPC A;  5IT9 E;  4M7D A;  2RD1 A;  4XU0 A;  1VUB A;  3L42 A;  1NJI U;  3HKS A;  3CME A;  1V29 B;  4QW2 A;  4QVC A;  4GY5 A;  3V8L A;  2V8K A;  3CC2 A;  3L2U A;  2VGM A;  2YLC A;  4M7A F;  1M9S A;  1U1T A;  2DEQ A;  4OB2 B;  3INZ A;  5GAO p;  4JRQ A;  4L59 A;  3JCM J;  4M77 F;  4M78 G;  4C8Q F;  2EJF A;  2LC4 A;  4M77 G;  5HK3 A;  5I2M A;  4A53 A;  3OYN A;  4M7D E;  1TH7 A;  2WAC A;  4QQD A;  4OGE A;  4EMG A;  1XQH A;  3OS2 A;  4BE0 A;  4HCC A;  3OMG A;  1Q82 C;  1K73 U;  1BI1 A;  2ZPE B;  3LX7 A;  5CQY A;  3UDC A;  3CCM T;  1M1K C;  4XU2 A;  1FXX A;  4PJO D;  1X75 C;  3ER0 A;  4NL2 A;  5LL6 S;  2JUF A;  4MZM A;  2QTX A;  2EQU A;  5J26 A;  3QZ5 B;  2FYK A;  4A4E A;  4ATO A;  5IN1 A;  2D0Q B;  1UB4 A;  3G7Z A;  2DZ9 A;  2PQW A;  3PMI A;  1VQK A;  3QPH A;  3CC2 T;  5GMK e;  2MWO A;  1UGS B;  2EQJ A;  2I2L A;  1WQ7 A;  1YJN T;  2DTI A;  4C92 D;  2EJG A;  3CD6 T;  3M57 A;  5CKF A;  1YIT T;  4QVD A;  4F7U B;  4J83 A;  4XK8 E;  4BE1 A;  3JCM W;  1YHQ A;  4CI0 C;  3DLM A;  4XAX B;  3KXT A;  3CCV T;  4XTV A;  2HBP A;  3PFS A;  1VQ4 A;  3EFS A;  4A4F A;  3CXC S;  1M90 C;  2KY9 A;  5LJ3 h;  3OMC A;  2WSE E;  3JAM E;  4WF2 A;  3ZFJ A;  3OS0 A;  1KC8 U;  3M54 A;  2L5Q A;  4MML A;  3QHS A;  2LT4 A;  3BDU A;  1VQ8 A;  1I5L A;  1K9M C;  2KDS A;  3MET A;  5DLQ E;  4JRK A;  5GAN 6;  2BIV A;  2D6F A;  2DJZ A;  5CQX A;  3A8G B;  3L2V A;  1VQK T;  2RA2 A;  4C5H A;  4XTX A;  1S72 A;  4CRI A;  2CS7 A;  3AHU A;  4R55 A;  4LD9 K;  1FWZ A;  2A7Y A;  4HKE A;  1YIJ A;  4M7D G;  3JCM e;  5I21 A;  4R56 A;  2BKD N;  4LDV A;  4KT0 E;  2RHX A;  3MP1 A;  5LJ5 d;  3MEW A;  2A3L A;  4M75 G;  3JCM f;  3WVD B;  4HT8 A;  4MMK A;  1VQ6 A;  4PJO B;  4ELZ C;  1O75 A;  3OW2 A;  2QI2 A;  5FU7 C;  5HKC A;  5I2S A;  3PMT A;  3MEU A;  4RCC A;  5GAN 8;  1VQ4 T;  3V7R A;  2LQ8 A;  3JB9 J;  3MCA B;  5CKE A;  2HQX A;  3QG1 A;  3V7S A;  1VQO T;  1BIA A;  1W2B S;  4M78 C;  1VQ8 T;  3S6W A;  2OTL T;  1OYX A;  4FM4 B;  3FRN A;  2FHD A;  2EQK A;  2CGH A;  3PGG A;  1B34 A;  4ZTJ A;  2DXC A;  1WNL A;  2JTF A;  4OVA A;  4C92 B;  4EDU A;  1U8R A;  1BIB A;  1S72 T;  2RK1 A;  3FEO A;  3QJ6 A;  1G3S A;  2O4X B;  3X20 B;  3LWI A;  4E7I A;  2MI6 A;  1QVF S;  3X28 B;  1IRE B;  2EYQ A;  2DXT A;  3OYG A;  3I56 T;  5GAN e;  2MF2 A;  3JCM V;  2GQV A;  1KHI A;  2LCC A;  3C4S A;  1Y71 A;  3H8Z A;  5D6Y A;  2K5I A;  5GAN f;  5A2Q E;  3NTK A;  3MO8 A;  2RHY A;  5CR2 A;  3HFO A;  3QKJ A;  4FT2 A;  5FRM A;  1M8V A;  3DLL A;  4XTZ A;  3CCR T;  1BYM A;  2PVO B;  3PT9 A;  5AYF A;  2JTM A;  4M75 D;  2DXB A;  4BDY A;  4FU6 A;  1I8F A;  2O4X A;  2MMP A;  3C12 A;  3HFN A;  2K2V A;  3R6O A;  3VKI A;  4JRP A;  1YI2 T;  4EMK C;  2XKO C;  1WJS A;  4C0D C;  1QW1 A;  5CVI A;  2OAU A;  3LGL A;  2RJD A;  2DD4 A;  3RKW A;  1OZ2 A;  1U1S A;  4MZT A;  3PNW C;  4C5I A;  4Y28 E;  2QQA A;  2L8D A;  2KVQ G;  1M5Q 1;  4PKC C;  3VYH B;  4ELY C;  3OYB A;  4GLK A;  3CMA T;  4XTU A;  3TCJ A;  3M9Q A;  2L3R A;  4OB3 B;  2X4J A;  1ZQ1 A;  2NLU A;  1VQ5 T;  2H3J A;  3OYY A;  3E19 A;  1Q86 C;  4X9D A;  3SFM A;  4M7D C;  4BAC A;  3A5Z B;  3MP6 A;  2V8I A;  4IUU A;  4Q5W A;  5LJ5 f;  3CCS A;  4X9C A;  5GMK h;  4C0G A;  5LJ3 j;  2WSF E;  2EFI A;  1KHC A;  4M75 C;  1IZ6 A;  3OS5 A;  2JVV A;  3L1A A;  1D3B B;  1FX7 A;  1PSE A;  3CCM A;  2QA4 A;  2EKO A;  3V8J A;  5A0L A;  1N27 A;  4J6W A;  5EG2 A;  3A8M B;  3OBY A;  3X26 B;  2PUO B;  5A0G A;  1KD1 C;  3HHT B;  3QII A;  1XTD A;  4C5E A;  4PJO F;  2RJE A;  4E7J A;  1XNI A;  3MHX A;  4BDZ A;  2E1H A;  2GCX A;  4KUD K;  4M7A G;  3C95 A;  3CD6 A;  2RH2 A;  1D3B A;  3JSC A;  1UGP B;  4C8Q G;  1YIT A;  3M4Y A;  2DKG A;  3CCS T;  2Y4X A;  3CBP A;  1QP3 A;  4PL6 A;  2QEX T;  1G5V A;  2LRQ A;  3CCU A;  1M1K U;  3NTI A;  3CCV A;  3A8H B;  1YJW T;  1N9S A;  3OY9 A;  2RK2 A;  1M4Z A;  3JCM h;  3QDR B;  3DB3 A;  4J5Y A;  2QA4 T;  3BFM A;  4C92 F;  4NOY A;  3RMQ A;  4A4H A;  2LTO A;  2XID A;  4IUP A;  3JCM X;  4N4H A;  4TVR A;  4C0F A;  3MP8 A;  5GAN 7;  3S3O A;  3VJP A;  1KG1 A;  1NJI C;  4PLL A;  2M0O A;  3QUI A;  4ZGE B;  4ZGD B;  2VGN A;  2YLB A;  5GAM e;  3JCM Q;  3CPF A;  2OTJ A;  1K8A U;  1VQM A;  5GAM f;  1JJ2 S;  4O5V A;  4J7F A;  2DIQ A;  1YJN A;  4E7L A;  3GP8 A;  4DOW A;  1VQ9 T;  3QSU A;  2IG0 A;  3L2Q A;  2M1H A;  4JS4 A;  2PUK B;  2RI5 A;  3CCL T;  1Q81 U;  1NZ9 A;  2YRV A;  3KUF A;  2RHU A;  2E6N A;  1DJ7 B;  2PU9 B;  3CCU T;  4NS5 A;  2LX9 A;  1M90 U;  3DB4 A;  1K73 C;  1QVG S;  4M7A D;  2K4Y A;  5GAN h;  4J6Y A;  1VQO A;  4M78 D;  5FLX E;  4A4K A;  2RI3 A;  3BY7 A;  4M77 D;  2R58 A;  4C8Q D;  2FB7 A;  2DPP B;  2OTL A;  2JOY A;  4QQG A;  2CKK A;  3T9N A;  4E7H A;  2P4T A;  1G3T A;  2XHC A;  3M53 A;  1WGS A;  1Y96 B;  4IUT A;  4A54 A;  2OTJ T;  4F7U A;  4C5G A;  2XDP A;  3M59 A;  4DA4 A;  3RIR A;  4C0Z A;  5GAO n;  1VQM T;  4BI4 A;  3JB9 H;  3VU3 C;  3E9G A;  3JCM g;  4RMO A;  3CXC A;  3LH0 A;  1YCY A;  2DVE A;  1LNX A;  3P8H A;  4IUQ A;  2EIF A;  4JDS A;  4ZTF A;  3HSB A;  3JB9 F;  3I56 A;  3JB9 G;  3CBM A;  1SSF A;  3HP9 A;  4IUR A;  4ZN3 A;  4OP0 A;  1HK9 A;  4XTW A;  5CKB A;  3JCM b;  2E6Z A;  3N5B B;  2Y90 A;  1H3Z A;  3V7C A;  1WJQ A;  3M56 A;  4O6J A;  4F7U E;  4XU1 A;  5KE3 A;  5GMK j;  5GAO r;  3OSV A;  3TU4 K;  1P92 A;  2CYZ B;  5DY9 A;  1Y96 A;  2E64 A;  3LWH A;  3CCR A;  3GOX A;  4M7A C;  1M1G A;  3ME9 A;  2RHI A;  4M77 C;  4C8Q C;  3C94 A;  3OW2 S;  4BB7 A;  2R5A A;  3JCM P;  1BI3 A;  5LJ5 h;  1YI2 A;  4LDX A;  2R5M A;  2WSC E;  3MEV A;  2F5K A;  3SWN C;  5KH6 A;  2E65 A;  3TRE A;  1WPY A;  2Y4Y A;  2QDY B;  3OBW A;  4B9W A;  3CC7 T;  3UPU A;  3FB9 A;  5D6W A;  5C6S A;  4PJO A;  2LNV A;  5FU7 B;  1R8O B;  2DK3 A;  1KQS A;  3UT1 A;  4LDY A;  5LJ3 g;  5GAN g;  3BDL A;  1W2B A;  3LLR A;  3VUZ A;  3CMA A;  3SD4 A;  1Y07 A;  1I4K 1;  2ZPB B;  3RUX A;  2DIG A;  4M78 B;  3SB2 A;  4M77 B;  3L2Z A;  1VQ5 A;  4M7D D;  4RCB A;  1NPR A;  4FT4 A;  3QYH B;  3FDR A;  4V2S A;  2VUB A;  4DQ2 A;  4C92 A;  4PJO E;  1LJO A;  4N0A C;  2ZPF B;  4IKF A;  2X35 A;  4LDW A;  4BY6 C;  4OB0 B;  2ZZD A;  3CEY A;  4XQ3 A;  2QQ9 A;  4E7K A;  3QO3 A;  3CPW A;  4KUL A;  2K57 A;  4Z02 A;  4B9X A;  5FRO A;  2R57 A;  2E10 A;  4MZP A;  3NTH A;  2CZ6 B;  3OYI A;  4M78 A;  3G6E A;  4C92 E;  5C0M A;  1VQP T;  3URG A;  3J80 E;  3FC3 A;  3Q1J A;  4OB1 B;  4HCB A;  4ME7 A;  2CZ1 B;  2QQB A;  5FRN A;  4F7U F;  1AHJ B;  2P0K A;  2FL7 A;  3OYE A;  1LOJ A;  4BI3 A;  1N6A A;  2PVD B;  3JCM c;  3OYM A;  1Q86 U;  2LVM A;  1UEB A;  5D6X A;  5LJ5 e;  3E1S A;  3CCJ T;  4EMK B;  5GAM h;  1BKB A;  1WQW A;  4M78 E;  3CCE T;  1VQN A;  4C0D B;  3OYL A;  2QEX A;  2DXU A;  5GAN j;  2LDM A;  1OZ3 A;  1EIF A;  1YJW A;  1M1F A;  2EJ9 A;  4LD6 A;  1BI0 A;  2HNI A;  3QBY A;  2ZPI B;  3OYH A;  4QQ6 A;  2E12 A;  1UGQ B;  3P8B B;  3P8D A;  3OSS C;  5GAN 5;  2KAF A;  3QXE B;  3G6E T;  2KMT A;  5CKH A;  1YBY A;  4EMK A;  4M7D B;  3RER A;  2P0Q A;  1W4S A;  4JJN K;  1JBM A;  4FSX A;  5CCA A;  3RES A;  3EFR A;  3VV0 A;  3A8L B;  3PIO A;  4KUI A;  4PJO G;  3G4S A;  4M75 B;  1Q7Y C;  2M16 A;  4UC4 A;  2XIC A;  1I81 A;  5A0D A;  1VQ9 A;  1RI0 A;  2VXE A;  3GNG A;  2VYT A;  3RKY A;  3TEE A;  2K3X A;  2XD0 A;  1VQN T;  5CO7 A;  4MDW A;  3CCL A;  3M55 A;  3ZBD A;  1Q82 U;  2F5T X;  3J81 E;  3GPL A;  1KQ1 A;  1N8R C;  3M4G A;  4BI8 B;  5GAN 4;  4C92 G;  1O9S A;  5LJ5 j;  2MAM A;  1NPP A;  3H6Z A;  4YTL A;  1VQ7 T;  4X34 A;  3JCM d;  2VV5 A;  2ZCF B;  4MDX A;  4M75 A;  3PIP A;  2ZPH B;  5GAM g;  4VUB A;  3J7A F;  2HAX A;  2GF7 A;  2DZC A;  3SDZ A;  3FIF A;  4M78 F;  4DOV A;  3G4S T;  3OS1 A;  1RL2 A;  3GNF B;  1NE8 A;  3V8K A;  1JRI A;  3LYI A;  4RKU E;  4A4G A;  2FVU A;  4IUV A;  3VYG A;  2HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...