2Y4XA

Structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa pa01
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
KPDETRVKQFLEGFNIETFEMVGTLSNAQGTFALVKGAGGVHRVRVGDYLGRNDGKVVGISEGKIDVIEIVPDGEGNWLERPRSLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PILP PROTEIN
publication title Structure of a Domain from the Type Iv Pilus Biogenesis Lipoprotein Pilp
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Biosynthetic protein
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2y4xA00
2IVWA 2LC4A 3OSSC 2Y4YA 2Y4XA 2LNVA
chains in the Genus database with same CATH superfamily
3CCUT 3G6ET 1UB4A 4BE0A 4ZN1A 2GQVA 3G71A 2DZ9A 2ZCFB 4II1A 2IIMA 4OMNA 4J83A 3QWYA 4C8QE 4OMMA 3EG3A 3TQ7P 1YHQQ 2M0OA 4YTLA 3G4ST 5KH6A 1OI1A 3MEVA 4RTYA 1Y7XA 3OBYA 4F7UF 4AFQC 3CC7A 3I5RA 2YRCA 1ZBJA 2FL7A 5FROA 4C92G 3V8KA 2PUKB 4RKUE 3CPFA 3CCUA 1VQ6A 2QAZA 3CCSQ 2JVVA 4V2SA 1VQOQ 3CCEQ 2WSCE 1YP5A 1X27A 2CREA 3JCMd 1H641 4LDXA 5D6YA 2AT1B 5AT1B 4JRKA 1X69A 2BKDN 3PMIA 1G3WA 2D0NA 4M7AE 4OGEA 1IZ6A 3G4SA 1Z9QA 2DIQA 3OW2S 2ESWA 1WFWA 3JCMW 2ED0A 1TSFA 2YXYA 2QA4Q 3CCQT 3VRYA 2QQ9A 3CMAT 4XTYA 2I0NA 3OYIA 3HSBA 2P0QA 2EJGA 1QVFS 1ZX6A 2GFUA 2ZPHB 4PFPA 3RERA 1NM7A 2XDDA 2EJ9A 5FU6B 4QQ6A 4XU3A 1WHJA 4N0AC 3CEYA 2ENMA 4M7DG 1VQ7Q 1UDLA 3OQ5A 1UEBA 4JJBA 3O5ZA 2JOYA 3LGFA 3RUXA 3RKWA 2EQUA 4M75C 2RB6A 4F7UA 1N9SA 3EGUA 3CCMT 3D7SB 3PNWC 3QIIA 2DEUA 5CKBA 2DVEA 1K9MR 2EQMA 4A53A 2COYA 3DLMA 1XQHA 5LJ3g 4XTZA 2M51A 3FJPA 3UF4A 4PJOG 2DL7A 1I07A 5GAMg 4OB0B 3CBOA 2EYWA 4IIOA 1BCOA 2O2OA 2K3XA 2AZVA 3BFMA 4E7IA 3I56T 2G3RA 1M90R 3GOXA 3JCMc 4DBQA 2RN8A 1M2OA 3SB2A 1BKBA 1QLYA 2E4HA 2JT4A 1WNLA 2XHCA 4J8OA 3VS0A 3P8BB 1M27C 2IVWA 1I5LA 1PWTA 3I5SA 3HRTA 2YRVA 3JCMP 2FPEA 2AHJB 1G3SA 2CH4W 3CCMA 1M30A 1R0BG 4C0GA 3H8ZA 1K9MU 3UT1A 5GAN8 2LT4A 1LOJA 4O5VA 1XTDA 2RK2A 4L5GA 1OULA 4E7SA 2YLBA 3S3OA 1KQSA 1TXQA 2FPDA 4DBFA 2R58A 1OZ3A 2RQWA 1IRXA 3J7AF 1MMDA 2EAYA 1VQ8Q 3CPWS 1M90U 5GANj 3VS6A 4NOYA 5IN1A 3CXCS 1KQSP 5KCOA 3LGLA 3HL8A 2NWMA 1TUDA 3HPWA 2FRYA 2DFUA 4M75A 3CCJQ 4FT4A 3VS5A 3CCVQ 2KK4A 1OPKA 1PM3A 3GLXA 2HKQB 3I9QA 3OYMA 1VQ9T 4FW2A 2KQWA 1WHLA 3E9FA 1WPYA 2R5MA 1K76A 2YRDA 2K3BA 2QXFA 4PKCC 3CCLQ 3JB9I 1M2VA 3C94A 1X6BA 1KFZA 2HQEA 4C92C 4IUPA 3LH5A 1E6GA 1QMCA 3H0IA 1UTIA 2DZCA 1WQ7A 3CMEA 1D09B 3GF5A 2IPOB 1WZOA 3HP9A 1QVPA 1K8AC 2C0TA 5IH2A 3X24B 2EJFA 4RG2A 1VQMT 2HKNA 1BB9A 3OYCA 1G3TA 4TVRA 4JRQA 2X35A 1SPKA 4C5IA 2G6FX 5LJ5d 1VQ9A 3OW2A 3EAEA 3ER0A 4M75B 2YHTA 3Q1JA 1U1SA 2FG0A 3A8OB 5LJ3h 4J9GA 1BCMA 1AWOA 1NE8A 4HVVA 1UHCA 1OZ2A 1QVFA 4J9EA 2D8JA 2E1HA 2HSPA 3OW2P 3L42A 1RACB 3E19A 1PC0A 1YJ9A 3I55Q 2DF6A 3CC4Q 2DL3A 4M7DC 2RHIA 5IHKA 1QVFP 1M2VB 5IXFA 3DB4A 1H3ZA 1KHIA 1CKAA 4KH1B 2HSEB 4HT8A 1ZA1B 4PJJA 1SF9A 3JCMg 2LQ8A 2L2PA 1OEBA 4FM4B 4JUVA 2LCCA 4MDWA 3SFMA 1HYOA 1O75A 1K73R 1JJ2S 2EYQA 3SWNC 5J39A 4PJOC 4LE9A 1QP3A 2DX1A 1X01A 3MEAA 4C5GA 2OTJT 5CK9A 3REBB 2CZ6B 2DTOA 1UGRB 2BTTA 2DO3A 1M3BA 3NTKA 1Q7YR 4NL2A 1SKUB 1TU0B 5GAN4 4E7ZA 2LT1A 3QDFA 2NLUA 1VQ4T 1ZSZC 1JEGA 2E3IA 4OB2B 5GMKl 2XU8A 4A4GA 2KXDA 1H3HA 2DKGA 2JTFA 2YSQA 3OMGA 1Y57A 2DA9A 2RQRA 4M77C 1Y71A 2CUBA 3QXEB 1VQKA 2LQNA 1OV3A 2XKOC 3PIPA 5FRMA 4M77F 5GANe 1LCKA 1VQPT 2WSFE 2A7YA 2RI5A 3ULRB 1QCFA 2WSEE 4RTXA 2JZ2A 2YDLA 3CPWA 1Q7YU 4FYWB 1LVKA 4BE2A 3CXCA 4Q5WA 1NEBA 4OMFB 4E47A 2H8HA 4HCCA 1YJNT 1U06A 4RMOA 4C92B 3CPWP 2ECZA 5CR2A 1KQ1A 3OYEA 3E2UA 3IQLA 1RADB 3CXCP 4PJMA 2NUTA 2FZGB 1YJWT 2EQIA 4BD3A 5DY9A 2L3QA 2QYZA 2E10A 1U8RA 3R6OA 4MZMA 1YJ9Q 2LZ6B 2DL5A 2E5KA 4GLKA 1QKWA 3SD4A 3SWNA 2DM1A 8ATCB 4ATOA 4PJOA 2GBQA 4A4HA 4AFSC 4XTVA 3CC2A 2E3HA 1W4SA 3JV3A 3SEMA 1SRMA 1OYXA 2F5TX 1ZUYA 1C0MA 5ECAA 1U3OA 2FZKB 1YJNA 4E6RA 3OS5A 1NYFA 2HQHA 3C4SA 2RMOA 4M7DB 2HCKA 3JCMh 1PSEA 4M77A 5GAOl 1YJWA 1UGSB 4C8QG 1MNDA 5DLOA 2L3SA 1WX6A 3CCST 1M3AA 2DETA 3GIBA 2NUTB 3OYDA 2KE9A 5KE2A 4BB7A 3CCET 3REAB 3TVTA 1LJOA 4WCIA 3M58A 3NTHA 2EKOA 3SWNB 1KSWA 4PJOB 2EFIA 4PLLA 1UJYA 1YIJQ 4QW2A 2VXFA 2LX7A 1BI1A 3BY7A 3A8HB 1K9AA 1BI2A 1PRLC 2D9TA 4ZNXA 1UE9A 1AOJA 2J7IA 2DXTA 3KFVA 4M4ZA 2RJCA 1GL5A 1W1FA 4NS5A 2OTLQ 4J9FA 2D0QB 2CS7A 2X4JA 1ZSZB 3P8HA 2AIRB 4CC4B 4XTWA 1JJ2A 2E41A 4M7AG 4FSSA 4B9XA 2A08A 1VQ7T 1J3TA 4M77D 2VC8A 4FYYB 4DA4A 2CP7A 2YWWA 1VQNT 1YBYA 3JB9F 1WQWA 1QCNA 1NG2A 2DIGA 2LRQA 1AWWA 1JJ2P 2W10A 3JRZA 1VQLA 3GNFB 1Y0MA 4MDXA 4UC4A 1PCXA 2MIOA 3UWNA 4B9WA 3P8DA 4AMCA 2RHXA 5GANd 4JZ4A 5KYYB 4XK8E 4F7UE 3QZ5B 3VV0A 2KDSA 3AHUA 2DK3A 3OB9A 3LH0A 3FC3A 1GBQA 3RBBB 3CC2Q 1LPLA 2XDBA 4IUTA 4GY5A 2KI7A 4QKUA 3UPUA 5HKCA 3MPUB 1RAIB 2O9SA 1CSKA 1VQNA 3LX7A 2FB7A 3S6WA 1OPLA 3MJXA 5CQXA 2CP6A 4AT1B 3ZFJA 2QDLA 4E7HA 4QVDA 4LUEA 2QEXA 1VA7A 2E65A 4ELZC 1VIFA 4KGXB 1Q82C 5IHIA 1G3YA 1ABOA 2HBPA 4MZPA 1NLPC 2PQWA 5FLXE 3C95A 2XDPA 1D0YA 3V7RA 2VKNA 2LMJA 2YUQA 1TWBA 1VQ8T 2QQBA 4KULA 1CKBA 3MO8A 3G6EA 1K0XA 4R56A 4KUDK 4X1VA 3TCJA 2L0AA 2F2WA 2RK1A 3CCJT 2DE0X 5GJVB 3PMTA 4E2FB 2DEQA 2XI9A 1EIFA 4OVAA 3L2UA 4DBHA 2DNUA 3EFRA 2ZPBB 3X20B 2EQKA 3CCRT 1NPRA 1U1TA 3PT9A 3M0SA 2DL4A 1Y96B 1N27A 2V26A 4HXJA 5LL6S 2EGCA 1K1ZA 2RHUA 1PKSA 1ZBXA 1HXDA 1C6VX 2VGMA 4D8KA 1X43A 2BZ8A 4IUVA 4J6WA 1GXIE 1RABB 5LJ5h 4X9DA 1I8FA 2KBTA 4C0DB 4N4IA 5LJ3f 1MUZA 2X4WA 5KCHA 5GAMf 2RF0A 3PTAA 1ABQA 2E70A 2FVUA 4FU6A 2FHDA 3JB9D 3EFSA 3L2RA 3BW1A 1T3LA 1K9MC 1N5ZA 2LVMA 1VQ5T 3TREA 1M1KC 2DJQA 2F2XA 3QYGB 1QWFA 4QT7A 1AWXA 2VVKA 1M1GA 3CCRA 5I2SA 1KG1A 2MF2A 3PVLA 2MCNA 4M75F 3URGA 3QJYA 4D6WA 3JB9J 1DJ7B 4QQDA 3NHNA 4MMKA 1M90C 3G71Q 3CCQA 3CC4T 3M56A 3CMAA 2X4XA 4M7AC 2E64A 1IREB 4EMKB 2F69A 2FO0A 3M5AA 1HD3A 3QPHA 4A54A 1TUGB 2QEXQ 2A0FB 2EVRA 2OAWA 4AG1C 1NLOC 2J05A 2DXUA 3TEEA 3VS4A 2DBMA 1WHHA 4B6MA 1OQKA 3F70A 3VS7A 2ZGWA 3JCMX 3CC7Q 1VQ5A 4XU0A 1X2KA 4M78C 1ZLMA 1SG5A 1I81A 1ZHIA 4LNPA 3EG9B 2DTIA 2CDTA 4PLIA 2X9HA 3FLGA 3A98A 4KGZB 3M0PA 4J7FA 4L6V5 2RD1A 1E7OA 3CCUQ 2HDAA 2KNBB 1PNJA 4M78F 3G6EQ 1VQ6Q 3LWIA 2HBWA 4WTOB 5KE3A 2WACA 3FJ5A 3VS2A 5EC7A 2DRMA 4JJDA 2XIDA 2HD0A 4PFZA 3VS1A 3VS3A 5CVIA 4CI0C 1QVGS 1O9SA 3I56A 4BDYA 1KQ2A 1IGQA 4N0AA 5HCKA 2CP3A 5GMKm 4OMPA 3NFCA 3G4SQ 4IURA 1I0CA 1Q81R 2GTJA 2J06A 2JM8A 5J26A 5A0GA 4CC7A 2KAFA 1S1NA 3TSZA 1MV0B 4EMHA 4IKFA 3HRUA 5I2MA 4DEXA 4X9CA 1V1CA 4D8DA 5GANg 4FL6A 4BE1A 1M8MA 4Z89A 1WIEA 3S3NA 1AWJA 1KD1R 1JU5C 2EYXA 1GCQC 3FRNA 2GCXA 1JXOA 3EGDA 3TSWA 5KYUB 3JCMJ 2V1RA 1N8RC 2BE7D 3OYFA 1ACMB 4X34A 1JXMA 2L3RA 2GTOA 3OYBA 1TOVA 2MMPA 4HVWA 2VASA 2ROLA 3QJ6A 4C8QB 2LCSA 3R6NA 2K5LA 3L1AA 2D6FA 3L2VA 3O8VA 3QBYA 2GNCA 5CKEA 5J3BA 4C92F 1YITT 2FEIA 3SDZA 3M57A 2J6KA 2QG9B 1N6AA 3OBWA 1Q81U 1WJQA 3CD6T 2AKKA 1XNIA 5CO7A 5GAOq 2MK5A 2YUNA 4M78A 3A1PA 3PGGA 1YI2T 4RTUA 4ZTJA 2XD0A 3CMAQ 2F2VA 4KGVB 2K79A 2BE9B 1JB0E 4M75D 2VXEA 3M54A 3JCMQ 4IIMA 3WXMB 3JCMf 5KYNA 1KD1U 2LJ0A 2PVOB 5GAMh 3G7ZA 2K2MA 1NZ9A 2YT6A 2F5KA 5CKHA 3MP8A 3V8JA 2KYBA 4FW1A 4BI3A 3VUBA 3LYIA 1WDXA 2CT3A 2QGGA 1UHFA 3CCMQ 3EGDB 4DQ2A 5GMKh 1QW1A 1HSQA 4M7AB 2BZXA 2J6FA 2QQSA 2RO0A 1WLPB 3MHXA 5GAOm 1QWEA 1VQMA 1G8XA 5GAN6 3HRSA 3ASKA 3CD6A 4M7DF 2KROA 2P4RA 4E7JA 4A63B 4JRIA 1IB8A 1K4US 2RPNA 2LDMA 4BACA 2JW4A 4M77E 1NJIR 3I56Q 3H6ZA 1Q7YC 3UATA 4M78B 1GCQA 2CZ7B 2BIVA 1UGVA 5HK3A 3H0FA 4LD6A 4C92A 4DBRA 3RESA 4PJOF 4FIBA 2A3LA 3WVDB 2KY9A 4A4FA 2JM9A 4O6JA 2W0ZA 2K7AA 2QGFB 2KR3A 2DXCA 7AT1B 3JB9G 1BBZA 2ZAEA 5IHNA 1S72T 1W2BS 5I21A 2DD4A 4GBQA 1FWZA 3VYHB 1PRMC 2JNGA 5FU7C 2GQIA 1QCOA 4PJLA 1BIBA 5A0DA 2DL8A 4DOVA 1ZA2B 1A0NB 4QQGA 3BDUA 1KC8C 3RIRA 1K73U 3FB9A 1NJIU 5L23A 1Z9ZA 3CMEQ 2X3WD 4AFZC 2RQTA 1WHGA 3NTIA 4OMLA 3KXTA 2OTJA 1VIEA 3VU3C 1UECA 8AT1B 1QVGA 4C5HA 4BI4A 1TUCA 2QASA 2DYBA 3I35A 4EDUA 5C6SA 3OYKA 3QUIA 3HTRA 2FZCB 4M7DA 1TTHB 4K11A 1GFCA 4C92D 1VQ9Q 2RI2A 4ANJA 1VQ4A 1R0CB 1X6OA 3OYLA 1PD0A 5IAYA 1WJSA 3OSVA 4DEYA 2OX7A 2YLCA 3DLLA 1I1JA 1RI0A 1R8OB 1D0XA 3WVEB 2GGRA 4F7UG 2EYZA 2J6OA 2IG0A 1F1BB 4EIKA 1VQPA 2DVJA 1HJDA 2K5IA 3LLRA 1VQMQ 1AZEA 1YHQT 2ZZDA 1YWOA 1JBMA 2VYTA 3X26B 1ZSZA 2FYKA 4P5NA 2MYSA 1WHKA 2P0PA 4MZTA 2ZPEB 4LN2A 4M7DD 2EIFA 2RJDA 1T0HA 5D6XA 4OP0A 3EH1A 3QWXX 4PK4A 1FXXA 1VQOT 2HNIA 4RCCA 2M16A 3OYGA 1RAGB 5EG2A 1VYTA 1UJ0A 1D1CA 1YN8A 2KT8A 5KYYA 1FMVA 2DLPA 1ZUUA 5KYWA 1WXUA 5LJ5f 2Y4YA 2H3EB 4AFUC 2XMFA 1YHQA 4C0ZA 4PJOD 4ZGJB 4Y28E 4KBMB 1VQKQ 2DBKA 1G83A 2JXBA 4LDVA 5A0LA 3EGXB 2QA4T 1V29B 4Z8AA 2M02A 2VGNA 1ARKA 4WF2A 4C0DC 2OTJQ 1FYNA 2B8AA 2RHYA 5CAIA 2KSSA 1IO6A 2LNHB 5DM7R 1G5VA 4M75G 4CC2A 1JO8A 3CCSA 2LTOA 5FU7B 1VQOA 4J9IA 5LJ5j 3RMSA 2K2VA 3OYAA 3CCEA 1U5SA 5M9OA 4LDYA 4JJCA 4PL6A 2O31A 5GMKi 3MP1A 1RI9A 1D1BA 2K3YA 4JS4A 4LD9K 1UG1A 4CRIA 2YUPA 3N5BB 2Y4XA 1W2BA 2AZSA 2E6ZA 4AG2C 3M0QA 3GPLA 2CUDA 2DXBA 5KYWB 2PVGB 1M8VA 1RL2A 1W6XA 3OMCA 3EHRA 3G71T 3M4GA 1FMKA 4EMKC 2X4YA 1EX4A 4MMLA 5I22A 1VUBA 1IHWA 3M0RA 3U23A 2OJ2A 4OMOA 5IT9E 2V8JA 1HK9A 2JMAA 3DB3A 4RUGA 2C0IA 2E12A 3RMQA 1VQ7A 2OAUA 5CQYA 1YJNQ 2RA2A 3KBGA 4Z88A 2QI2A 4NL3A 1Q86R 1SHFA 4RCBA 1WI7A 1SEMA 1XJWB 1GFDA 1Y96A 2YUOA 4KT0E 1FX7A 3OYYA 4ORZA 3C12A 4PFOA 5DLQE 1YJWQ 2JS2A 2ED1A 1VQ6T 2LP5A 9ATCB 2ZPFB 4XAXB 1MNEA 5IXBA 1TH7A 1PKTA 2PU9B 2KRNA 1I4K1 3ME9A 1SSHA 4F17A 2XG8D 3M53A 5HK0A 2KT1A 1B34B 4HCKA 2RH2A 1D1AA 1VYVA 1M5Q1 1XOVA 2LJ1A 2KRSA 4OB1B 4BUGA 1Q86U 4BY6C 1WGSA 3JCMV 1Q82R 5CKDA 3CCVT 2HEQA 3RKXA 5AYFA 2LQKA 2HQXA 2CSIA 2RQUA 4M75E 4QVZA 2KYMA 3L2WA 2C0OA 4XTUA 2QDYB 1UGQB 1YCSB 1UUEA 1WXBA 3ZBDA 2DPPB 2CP0A 2E6NA 3CCLT 4EMGA 4ZN3A 4EMKA 1PHTA 1TS9A 1RUWA 3QZ9B 3EG1A 4C8QC 1KHCA 4BDZA 1VQ8A 3BDLA 1VQLQ 3C0CA 3GBQA 4XU2A 4ME7A 4RTVA 4ZTFA 4C8QF 3T9NA 2EWNA 3SHWA 2JTEA 2MWOA 3EG9A 3CCJA 5FWCA 3M0TA 2DAQA 2PUOB 3RDVA 1Q82U 4L59A 3CCVA 5GAN3 1PD1A 2D8HA 4F14A 5GAOp 2P84A 1MMNA 3LW5E 2COZA 2A28A 3H0HA 1H8KA 2CP5A 2MAMA 4M78E 3OY9A 1RAHB 4Z02A 5LJ5e 2V8KA 3CCLA 2VUBA 4OB3B 2MOXA 1B7TA 5LJ3j 2JMCA 4JPBW 1M1FA 1VQNQ 2V8IA 3I55T 5GAMj 2Z0WA 2V1QA 4F16A 4J9DA 4LDWA 4IUQA 3RNJA 1GCPA 2B86A 4RTZA 1M1KR 4M7AF 1ZQ1A 2VB6A 3J80E 5GMKj 3CBMA 2K9GA 3V7SA 5C0MA 4J5YA 2QQRA 4R55A 4J6YA 2LX9A 2DYIA 3HFNA 4ZGDB 2VV5A 1GBRA 3A8GB 1T3SA 1PG5B 3FEOA 4JS5A 4XU1A 3OYHA 1VYUA 1V76A 4FYXB 5KYUA 1AVZC 3E1SA 1MHNA 1C1AA 3EH2A 2K6DA 1SSFA 2CZ1B 1M3CA 4C8QA 2QQAA 3PFSA 4Y91A 3UA6A 3OS1A 2R57A 5GANf 3I55A 3CC4A 1RLPC 3M9QA 1B07A 1BU1A 2GFAA 1W70A 4M77G 3RR6A 1JQQA 2EYYA 3QYHB 4C92E 1Q81C 1AT1B 4R0KA 1NYGA 1NEGA 4A4KA 1M1KU 1KK7A 4F7UB 2HL3A 1NBEB 3BE3A 4FT2A 3FDRA 3VYGA 3GNGA 2EQJA 3QO3A 2SRCA 1KD1C 2DMOA 4BY6B 3OA6A 3CMET 1IXDA 2EPDA 4RTWA 4ELYC 4JLIA 2NUPA 3UDCA 2ATCB 5FW9A 2ROTA 4HKEA 1IHVA 3VKIA 4M7AA 1B3QA 3V8LA 2O88A 2EGEA 3HHTB 3MKDA 4C8QD 3L2ZA 5GAN5 1E6HA 1Y07A 4KUIA 1D3BA 2LQWA 5KYXA 3CCRQ 3HFOA 1T0JA 4M7DE 4VUBA 2CH4A 4JRPA 3E9GA 3FIFA 1IGUA 1YJ9T 3CCQQ 1G2BA 4KH0B 3JB9H 1ZUKA 3THKA 2VWFA 1YWPA 1N8RR 5CCAA 3L2QA 3V7CA 2A36A 2DTHA 2L89A 4QVCA 1AEYA 4PJOE 2HAXA 3DKMA 2LC4A 2SEMA 4A4EA 1AZGB 3EG2A 1K8AR 5CIUA 2NUPB 1VQ5Q 3NMZC 3A8MB 2C06A 2M9UA 4HA8A 5D7UA 1OU9A 2R5AA 1YITA 2DJZA 2FRWA 4M7AD 2L8DA 4C5EA 1I5OB 4C0FA 5L8RE 3A8LB 3JAME 4LXCA 1K73C 1NJIC 5LJ3e 1YNZA 1D3BB 3VRZA 2ZPIB 3X28B 5GAMe 2O01E 5KYXB 2RJEA 1YI2A 3QHSA 2RNAA 1LNXA 2I2LA 4J6XA 2DRKA 1N8RU 5A2QE 1ZSGA 4M78D 2BUDA 2PNIA 5GMKe 2X51A 2JS0A 1YIJT 3CQTA 3HKSA 4XQ3A 3QDRB 2JUFA 2HL5C 3MEWA 1K8AU 1FMWA 4CC3A 3PVQA 1VQKT 1JRIA 5I11A 2A37A 3OS2A 2OTLT 3ZL7C 2X3XD 3S3MA 4PJNA 2EBPA 1H92A 4HT9A 5GANh 3CBPA 1BIAA 2XICA 2M0YA 4F04B 3INZA 4HCZA 4N4GA 2DILA 2MWPA 2NYSA 3TU4K 5GAOr 1Q95G 2L5QA 1QP2A 1YIJA 6AT1B 2PTKA 4DOWA 2K4YA 2KEAA 2DD5A 1BYMA 4ZGEB 3NPFA 3EG0A 2PVDB 2RHZA 1MMGA 1S72A 1QVGP 3CC2T 2OTLA 4E7LA 2EW3A 1KC8R 1AHJB 4FSXA 4KRTA 3VJPA 2QTXA 2O9VA 2K5FA 3ZEHA 4FCYA 2GF7A 2CP2A 2QK0A 2AKLA 2EGAA 3H41A 1KIKA 4HVUA 2JTMA 4JDSA 2ABLA 3META 4PNOA 1NPPA 2QTVA 2KVQG 3A5ZB 2OI3A 5GJWB 1MGQA 2NUZA 1YITQ 2Y90A 3M59A 4OF1A 1MMAA 4BI8B 3EGXA 3EFOA 3CD6Q 2P4TA 2ZPGB 2RJFA 4OMQA 2HZYA 3OYJA 3QKJA 4LDUA 4OGCA 4RG8A 1YI2Q 1MV3A 2XK0A 1K0SA 1SHGA 3LWHA 2CKKA 3OYNA 4JJNK 2F1LA 2BZYA 1KC8U 1WJRA 2PZ1A 2O4XA 5GAN2 5GAN7 4LUDA 5FWBA 3PIOA 2MPXC 3OS0A 1BK2A 1QKXA 3VUZA 1BI0A 3UA7A 2M1HA 4XTXA 1WXTA 1OU8A 3OSSC 5LJ3d 3GP8A 5GAMd 2MI6A 1GRIA 3KUFA 2P0KA 1EZZB 1OX9A 1WA7A 1X2QA 2HMAA 4RTTA 3QG1A 1D0ZA 2D1XA 5D6WA 2RM4A 2KGTA 3JCMe 1EFNA 3M0UA 1PSFA 4HCBA 2CT4A 1TG0A 2AK5A 1P92A 2L3PA 2LNVA 2CYZB 4IUUA 1UFFA 3EFOB 2JN0A 1WYXA 3H9NA 2H3JA 1VQLT 3MP6A 1KJWA 3EHQA 3MCAB 1UGPB 1RAAB 1RLQC 2RI3A 1RAFB 3PE0A 4FYVB 2DERA 1OOTA 4JZ3A 2LCLA 4J7IA 1M4ZA 3JSCA 2E5QA 2O4XB 1S72Q 1WHMA 4J9BA 2KMTA 1X6GA 2JJ9A 1VQ4Q 2CSQA 5FU6C 1QQJA 1YCYA 3AT1B 2EKHA 2KRMA 5LJ5g 3J81E 3G1JA 2LJ3A 4EPCA 1R77A 3NGPA 4M77B 1B34A 2QA4A 4JLGA 1N9RA 5FRNA 2K57A 2KXCA 3JCMb 2CZ0B 1VQPQ 1W2BP 4E7KA 4N4HA 3M55A 2QEXT 5HY6A 1AD5A 2COWA 1Q86C 4M78G 5GAOn 3RKYA 2FPFA 3MEUA 1YFNA 3M4YA 4Y92A 2RQVA 3QSUA 4J9HA 1VOMA 1OX8A 1BI3A 4J9CA 3CC7T 1RAEB 1X75C 5CKFA 3X25B 4ESRA 2CGHA 1SRLA 1M9SA 4GLMA 1KQSS
chains in the Genus database with same CATH topology
3CBMA 4BI3A 1OYXA 3CCUT 2F5TX 3V7SA 3VUBA 3G6ET 5C0MA 3LYIA 4J5YA 1UB4A 2QQRA 4DQ2A 5GMKh 4ZN1A 1QW1A 4BE0A 4R55A 4J6YA 4M7AB 2LX9A 2QQSA 3HFNA 2GQVA 4ZGDB 2RO0A 3G71A 3MHXA 2VV5A 2DZ9A 5GAOm 2ZCFB 4II1A 3A8GB 1VQMA 3FEOA 4JS5A 5GAN6 3HRSA 3ASKA 3CD6A 4XU1A 3OYHA 4M7DF 1YJNA 3E1SA 4E7JA 4J83A 1MHNA 4JRIA 3OS5A 4C8QE 1SSFA 2CZ1B 2LDMA 4BACA 4C8QA 4M77E 2QQAA 3PFSA 3C4SA 2M0OA 4Y91A 4YTLA 4M7DB 3OS1A 2R57A 3JCMh 5GANf 3I55A 1PSEA 4M77A 5GAOl 3G4ST 1UGSB 1OI1A 3M9QA 3H6ZA 3MEVA 4C8QG 5KH6A 1Y7XA 1Q7YC 3OBYA 4M78B 4F7UF 5DLOA 2GFAA 3CCST 2CZ7B 4M77G 2BIVA 3CC7A 5HK3A 1Q86U 3QYHB 3GIBA 4C92E 1Q81C 3OYDA 5KE2A 4LD6A 4C92A 4BB7A 2FL7A 3CCET 3RESA 4PJOF 4A4KA 4FIBA 2A3LA 5FROA 3WVDB 1M1KU 2KY9A 4F7UB 4A4FA 4FT2A 1LJOA 4O6JA 3V8KA 2PUKB 4RKUE 4C92G 3CPFA 3FDRA 3M58A 3VYGA 3NTHA 3CCUA 2EKOA 1VQ6A 2DXCA 3JB9G 3GNGA 2EQJA 2JVVA 3SWNB 3QO3A 1S72T 1W2BS 4V2SA 4PJOB 2EFIA 4PLLA 5I21A 4QW2A 2DD4A 2VXFA 1FWZA 1KD1C 4BY6B 3OA6A 3VYHB 2JNGA 2WSCE 5FU7C 1BI1A 3BY7A 3CMET 3A8HB 4ELYC 1BIBA 5A0DA 1BI2A 3JCMd 1H641 4LDXA 4DOVA 5D6YA 4JLIA 3UDCA 2D9TA 4JRKA 4QQGA 3BDUA 2DXTA 1KC8C 2BKDN 2RJCA 3PMIA 1G3WA 4NS5A 3RIRA 1K73U 3FB9A 4M7AE 2D0QB 1NJIU 4OGEA 1IZ6A 3G4SA 4HKEA 2CS7A 2X4JA 3VKIA 4M7AA 2DIQA 3V8LA 3OW2S 3P8HA 3JCMW 4XTWA 1JJ2A 3NTIA 2OTJA 3HHTB 2E41A 3KXTA 4M7AG 1VIEA 3VU3C 3CC4A 4C8QD 4B9XA 3CCQT 2QQ9A 3L2ZA 1QVGA 5GAN5 1VQ7T 3CMAT 4XTYA 1Y07A 4KUIA 1D3BA 4C5HA 4BI4A 3OYIA 3HSBA 4M77D 2VC8A 2P0QA 4EDUA 2EJGA 5C6SA 3OYKA 3HFOA 4DA4A 1QVFS 1VQNT 1YBYA 3QUIA 2GFUA 2ZPHB 4VUBA 3JB9F 3RERA 4M7DE 1WQWA 2XDDA 2DIGA 2LRQA 2EJ9A 4JRPA 5FU6B 4M7DA 4QQ6A 3JRZA 4XU3A 1VQLA 3E9GA 3GNFB 4N0AC 3FIFA 1YJ9T 3CEYA 4C92D 4MDXA 4UC4A 4M7DG 2RI2A 1VQ4A 4B9WA 3UWNA 3OQ5A 1UEBA 1X6OA 3OYLA 3P8DA 3JB9H 2JOYA 2RHXA 5GANd 3LGFA 3RUXA 3RKWA 4XK8E 4F7UE 2EQUA 3QZ5B 4M75C 1WJSA 3OSVA 2KDSA 3VV0A 2DK3A 5CCAA 3V7CA 2RB6A 3L2QA 3OB9A 3AHUA 2YLCA 4F7UA 3DLLA 1N9SA 1RI0A 2DTHA 3LH0A 1R8OB 3FC3A 3WVEB 3CCMT 2L89A 3PNWC 3QIIA 1VQ7A 5CKBA 4QVCA 2DVEA 4F7UG 4PJOE 2EQMA 2HAXA 3DKMA 4A53A 2XDBA 2LC4A 4IUTA 3DLMA 2IG0A 4A4EA 4GY5A 1XQHA 5CIUA 5LJ3g 1VQPA 4XTZA 3FJPA 4PJOG 3UPUA 2K5IA 5GAMg 3A8MB 2C06A 2M9UA 3CBOA 4HA8A 4OB0B 3LLRA 5HKCA 2R5AA 2K3XA 1YITA 2DJZA 1YHQT 2ZZDA 4M7AD 1BYMA 3BFMA 4E7IA 2L8DA 3I56T 3LX7A 2FB7A 3S6WA 1VQNA 4C5EA 4C0FA 1JBMA 5L8RE 2G3RA 2VYTA 5CQXA 3A8LB 3JAME 3JCMc 3GOXA 1K73C 3X26B 1NJIC 5LJ3e 3SB2A 1BKBA 2FYKA 1D3BB 3ZFJA 1WNLA 2XHCA 2ZPIB 4P5NA 3X28B 2O01E 5GAMe 2RJEA 1YI2A 3QHSA 4J8OA 4E7HA 2P0PA 4QVDA 2QEXA 3P8BB 2E65A 4MZTA 2IVWA 1I5LA 4ELZC 1VIFA 2ZPEB 1Q82C 1LNXA 2OTJT 2I2LA 4M7DD 3HRTA 4J6XA 2EIFA 2RJDA 1G3YA 2YRVA 1N8RU 3JCMP 5A2QE 5D6XA 2HBPA 4MZPA 2PQWA 5FLXE 3C95A 4OP0A 2AHJB 1G3SA 2XDPA 4M78D 2BUDA 3CCMA 3V7RA 1FXXA 1VQOT 5GMKe 2HNIA 3H8ZA 4C0GA 1K9MU 4RCCA 1YIJT 2M16A 3HKSA 4XQ3A 3OYGA 1VQ8T 2QQBA 3QDRB 2JUFA 3UT1A 4KULA 3MEWA 5GAN8 5EG2A 1KQ2A 2LT4A 1K8AU 1LOJA 4O5VA 1VQKT 1XTDA 2RK2A 4L5GA 3MO8A 2YLBA 3S3OA 3G6EA 1KQSA 5LJ5f 4R56A 1JRIA 2R58A 4KUDK 1OZ3A 2Y4YA 3J7AF 4PJOD 3OS2A 1YHQA 4C0ZA 3TCJA 2EAYA 2OTLT 3CCJT 2RK1A 4ZGJB 3CPWS 3PMTA 4Y28E 4KBMB 1M90U 2DEQA 2XI9A 1EIFA 4OVAA 3L2UA 4NOYA 5GANj 5IN1A 3CXCS 3S3MA 3EFRA 4LDVA 2ZPBB 3X20B 5A0LA 2QA4T 5KCOA 1V29B 4HT9A 2EQKA 3LGLA 3HL8A 5GANh 3CBPA 1BIAA 2XICA 2VGNA 3HPWA 4WF2A 3CCRT 1NPRA 1U1TA 3INZA 4M75A 4C0DC 3PT9A 4HCZA 4N4GA 4FT4A 2B8AA 2MWPA 1Y96B 1N27A 2RHYA 5CAIA 2KSSA 5DM7R 3TU4K 1G5VA 4M75G 5GAOr 2KK4A 3CCSA 5LL6S 2LTOA 5FU7B 1VQOA 2L5QA 3GLXA 1VQ9T 1QP2A 3RMSA 5LJ5j 2K2VA 3OYMA 1YIJA 2RHUA 1ZBXA 3OYAA 1HXDA 2KQWA 2VGMA 4IUVA 4J6WA 3E9FA 3CCEA 5M9OA 4LDYA 4DOWA 1GXIE 1WPYA 2K4YA 2R5MA 5LJ5h 4X9DA 2DD5A 4PL6A 1I8FA 2QXFA 4PKCC 4ZGEB 5GMKi 4C0DB 3MP1A 4N4IA 5LJ3f 3JB9I 2K3YA 4JS4A 2PVDB 3C94A 4LD9K 2RHZA 2X4WA 5KCHA 5GAMf 3PTAA 1S72A 2HQEA 2E70A 2FVUA 4C92C 4IUPA 4FU6A 4CRIA 3CC2T 2OTLA 3N5BB 4E7LA 2FHDA 2Y4XA 3EFSA 3L2RA 3JB9D 1AHJB 3BW1A 4FSXA 2E6ZA 1W2BA 2DZCA 3VJPA 1WQ7A 2QTXA 1K9MC 3CMEA 2K5FA 3ZEHA 2LVMA 3GPLA 2DXBA 3GF5A 1VQ5T 2PVGB 3TREA 1M8VA 2GF7A 1RL2A 3HP9A 1M1KC 3OMCA 1QVPA 1K8AC 3QYGB 3G71T 3M4GA 3X24B 2EJFA 4RG2A 1VQMT 1M1GA 4EMKC 3OYCA 2X4YA 3CCRA 5I2SA 1KG1A 4MMLA 2MF2A 3URGA 4M75F 1G3TA 2JTMA 4JDSA 4TVRA 3META 1VUBA 4JRQA 2X35A 4PNOA 3QJYA 1NPPA 2KVQG 3A5ZB 4D6WA 1MGQA 4C5IA 5IT9E 2V8JA 1HK9A 1DJ7B 3JB9J 2Y90A 3DB3A 4QQDA 5LJ5d 3M59A 4MMKA 3OW2A 2E12A 3EAEA 1M90C 1VQ9A 3ER0A 3CCQA 4M75B 3RMQA 2YHTA 3CC4T 3M56A 4OF1A 4BI8B 3Q1JA 3CMAA 1YJWA 1U1SA 2X4XA 3A8OB 2OAUA 5LJ3h 5CQYA 4M7AC 2P4TA 2RA2A 2ZPGB 2E64A 3KBGA 2RJFA 1IREB 4EMKB 2F69A 2QI2A 3M5AA 4NL3A 3QPHA 4A54A 4RCBA 1NE8A 3OYJA 3QKJA 4LDUA 4OGCA 4RG8A 1OZ2A 1QVFA 1Y96A 2E1HA 2XK0A 3L42A 3E19A 4KT0E 1FX7A 1YJ9A 3OYYA 3LWHA 2CKKA 2DXUA 3C12A 3TEEA 3OYNA 4JJNK 5DLQE 1KC8U 1VQ6T 2ZPFB 3F70A 4XAXB 2ZGWA 4M7DC 2RHIA 1WJRA 3JCMX 1VQ5A 3DB4A 1H3ZA 2O4XA 4XU0A 5GAN2 1TH7A 5GAN7 2PU9B 4M78C 1KHIA 1I81A 1ZHIA 1I4K1 2DTIA 3PIOA 3ME9A 3OS0A 4PLIA 4HT8A 3FLGA 3VUZA 2XG8D 4J7FA 4L6V5 1BI0A 3JCMg 3M53A 2M1HA 2RD1A 4XTXA 5HK0A 2LQ8A 4M78F 1B34B 3OSSC 3LWIA 5LJ3d 3GP8A 4FM4B 4JUVA 2LCCA 4MDWA 5KE3A 2WACA 3SFMA 1O75A 2RH2A 5GAMd 2MI6A 1M5Q1 1JJ2S 2EYQA 3KUFA 2XIDA 2HD0A 3SWNC 5J39A 4PJOC 2P0KA 1XOVA 1QP3A 5CVIA 4CI0C 1QVGS 1X01A 3QG1A 1O9SA 3MEAA 4C5GA 3I56A 4OB1B 5D6WA 2RM4A 5CK9A 4BDYA 4BUGA 2CZ6B 2DTOA 1WGSA 1PSFA 3JCMV 4BY6C 4N0AA 5CKDA 3JCMe 3CCVT 4HCBA 1UGRB 5GMKm 2DO3A 3NFCA 3NTKA 1P92A 4NL2A 3RKXA 5AYFA 2LNVA 2HQXA 2CYZB 2LQKA 4IUUA 4IURA 4M75E 4QVZA 3L2WA 5GAN4 5IAYA 4XTUA 2JN0A 2QDYB 1UGQB 2H3JA 2LT1A 1VQLT 3MP6A 5J26A 5A0GA 2NLUA 2KAFA 3ZBDA 2DPPB 3MCAB 1UGPB 2E6NA 2RI3A 4EMGA 3CCLT 1VQ4T 4EMHA 4OB2B 4ZN3A 5GMKl 3HRUA 2XU8A 5I2MA 4A4GA 4X9CA 4EMKA 5GANg 4IKFA 2LCLA 3QZ9B 4FL6A 4BE1A 2DKGA 4C8QC 2JTFA 4J7IA 1KHCA 3OMGA 1M4ZA 4BDZA 1VQ8A 3JSCA 3S3NA 2E5QA 3BDLA 4M77C 1Y71A 2O4XB 3QXEB 4XU2A 1VQKA 4ME7A 4ZTFA 2KMTA 3FRNA 2GCXA 4C8QF 2XKOC 5FU6C 3PIPA 3T9NA 5FRMA 3JCMJ 1N8RC 4M77F 5GANe 1YCYA 2EWNA 1VQPT 2WSFE 2A7YA 2RI5A 3OYFA 2MWOA 4X34A 3OYBA 2L3RA 3CCJA 5LJ5g 2MMPA 2WSEE 2DAQA 3J81E 2PUOB 3QJ6A 4C8QB 1Q82U 4L59A 3CCVA 5GAN3 2JZ2A 2K5LA 3L1AA 2D6FA 4EPCA 3L2VA 3O8VA 4M77B 3CPWA 3QBYA 5J3BA 5CKEA 4C92F 1YITT 1Q7YU 1B34A 3SDZA 3M57A 5GAOp 2QA4A 4JLGA 4BE2A 1N9RA 3LW5E 3CXCA 5FRNA 4Q5WA 2K57A 4OMFB 4E47A 1N6AA 4HCCA 3JCMb 2CZ0B 2MAMA 3OBWA 1Q81U 1WJQA 3CD6T 4M78E 1YJNT 3OY9A 1XNIA 5CO7A 4Z02A 4E7KA 4N4HA 5LJ5e 5GAOq 4RMOA 4C92B 4M78A 2V8KA 3M55A 3CCLA 3PGGA 1YI2T 5CR2A 2VUBA 4ZTJA 4OB3B 1KQ1A 2QEXT 3OYEA 2XD0A 5HY6A 5LJ3j 4M78G 5GAOn 1Q86C 3RKYA 3MEUA 1M1FA 1JB0E 2V8IA 3M4YA 4M75D 3I55T 2VXEA 5GAMj 1YJWT 4BD3A 3M54A 5DY9A 3JCMQ 3QSUA 3WXMB 2E10A 1U8RA 3R6OA 3JCMf 4LDWA 1BI3A 4MZMA 1KD1U 2PVOB 4IUQA 3CC7T 5GAMh 4GLKA 1X75C 3SD4A 3SWNA 3G7ZA 4ATOA 4PJOA 5CKFA 4A4HA 1NZ9A 3X25B 2F5KA 5CKHA 2CGHA 3MP8A 4M7AF 4XTVA 1ZQ1A 1M9SA 3V8JA 3J80E 3CC2A 1KQSS 5GMKj 1W4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVW A;  2LC4 A;  3OSS C;  2Y4Y A;  2Y4X A;  2LNV A; 
#chains in the Genus database with same CATH topology
 3CCU T;  3G6E T;  1UB4 A;  4BE0 A;  4ZN1 A;  2GQV A;  3G71 A;  2DZ9 A;  2ZCF B;  4II1 A;  2IIM A;  4OMN A;  4J83 A;  3QWY A;  4C8Q E;  4OMM A;  3EG3 A;  3TQ7 P;  1YHQ Q;  2M0O A;  4YTL A;  3G4S T;  5KH6 A;  1OI1 A;  3MEV A;  4RTY A;  1Y7X A;  3OBY A;  4F7U F;  4AFQ C;  3CC7 A;  3I5R A;  2YRC A;  1ZBJ A;  2FL7 A;  5FRO A;  4C92 G;  3V8K A;  2PUK B;  4RKU E;  3CPF A;  3CCU A;  1VQ6 A;  2QAZ A;  3CCS Q;  2JVV A;  4V2S A;  1VQO Q;  3CCE Q;  2WSC E;  1YP5 A;  1X27 A;  2CRE A;  3JCM d;  1H64 1;  4LDX A;  5D6Y A;  2AT1 B;  5AT1 B;  4JRK A;  1X69 A;  2BKD N;  3PMI A;  1G3W A;  2D0N A;  4M7A E;  4OGE A;  1IZ6 A;  3G4S A;  1Z9Q A;  2DIQ A;  3OW2 S;  2ESW A;  1WFW A;  3JCM W;  2ED0 A;  1TSF A;  2YXY A;  2QA4 Q;  3CCQ T;  3VRY A;  2QQ9 A;  3CMA T;  4XTY A;  2I0N A;  3OYI A;  3HSB A;  2P0Q A;  2EJG A;  1QVF S;  1ZX6 A;  2GFU A;  2ZPH B;  4PFP A;  3RER A;  1NM7 A;  2XDD A;  2EJ9 A;  5FU6 B;  4QQ6 A;  4XU3 A;  1WHJ A;  4N0A C;  3CEY A;  2ENM A;  4M7D G;  1VQ7 Q;  1UDL A;  3OQ5 A;  1UEB A;  4JJB A;  3O5Z A;  2JOY A;  3LGF A;  3RUX A;  3RKW A;  2EQU A;  4M75 C;  2RB6 A;  4F7U A;  1N9S A;  3EGU A;  3CCM T;  3D7S B;  3PNW C;  3QII A;  2DEU A;  5CKB A;  2DVE A;  1K9M R;  2EQM A;  4A53 A;  2COY A;  3DLM A;  1XQH A;  5LJ3 g;  4XTZ A;  2M51 A;  3FJP A;  3UF4 A;  4PJO G;  2DL7 A;  1I07 A;  5GAM g;  4OB0 B;  3CBO A;  2EYW A;  4IIO A;  1BCO A;  2O2O A;  2K3X A;  2AZV A;  3BFM A;  4E7I A;  3I56 T;  2G3R A;  1M90 R;  3GOX A;  3JCM c;  4DBQ A;  2RN8 A;  1M2O A;  3SB2 A;  1BKB A;  1QLY A;  2E4H A;  2JT4 A;  1WNL A;  2XHC A;  4J8O A;  3VS0 A;  3P8B B;  1M27 C;  2IVW A;  1I5L A;  1PWT A;  3I5S A;  3HRT A;  2YRV A;  3JCM P;  2FPE A;  2AHJ B;  1G3S A;  2CH4 W;  3CCM A;  1M30 A;  1R0B G;  4C0G A;  3H8Z A;  1K9M U;  3UT1 A;  5GAN 8;  2LT4 A;  1LOJ A;  4O5V A;  1XTD A;  2RK2 A;  4L5G A;  1OUL A;  4E7S A;  2YLB A;  3S3O A;  1KQS A;  1TXQ A;  2FPD A;  4DBF A;  2R58 A;  1OZ3 A;  2RQW A;  1IRX A;  3J7A F;  1MMD A;  2EAY A;  1VQ8 Q;  3CPW S;  1M90 U;  5GAN j;  3VS6 A;  4NOY A;  5IN1 A;  3CXC S;  1KQS P;  5KCO A;  3LGL A;  3HL8 A;  2NWM A;  1TUD A;  3HPW A;  2FRY A;  2DFU A;  4M75 A;  3CCJ Q;  4FT4 A;  3VS5 A;  3CCV Q;  2KK4 A;  1OPK A;  1PM3 A;  3GLX A;  2HKQ B;  3I9Q A;  3OYM A;  1VQ9 T;  4FW2 A;  2KQW A;  1WHL A;  3E9F A;  1WPY A;  2R5M A;  1K76 A;  2YRD A;  2K3B A;  2QXF A;  4PKC C;  3CCL Q;  3JB9 I;  1M2V A;  3C94 A;  1X6B A;  1KFZ A;  2HQE A;  4C92 C;  4IUP A;  3LH5 A;  1E6G A;  1QMC A;  3H0I A;  1UTI A;  2DZC A;  1WQ7 A;  3CME A;  1D09 B;  3GF5 A;  2IPO B;  1WZO A;  3HP9 A;  1QVP A;  1K8A C;  2C0T A;  5IH2 A;  3X24 B;  2EJF A;  4RG2 A;  1VQM T;  2HKN A;  1BB9 A;  3OYC A;  1G3T A;  4TVR A;  4JRQ A;  2X35 A;  1SPK A;  4C5I A;  2G6F X;  5LJ5 d;  1VQ9 A;  3OW2 A;  3EAE A;  3ER0 A;  4M75 B;  2YHT A;  3Q1J A;  1U1S A;  2FG0 A;  3A8O B;  5LJ3 h;  4J9G A;  1BCM A;  1AWO A;  1NE8 A;  4HVV A;  1UHC A;  1OZ2 A;  1QVF A;  4J9E A;  2D8J A;  2E1H A;  2HSP A;  3OW2 P;  3L42 A;  1RAC B;  3E19 A;  1PC0 A;  1YJ9 A;  3I55 Q;  2DF6 A;  3CC4 Q;  2DL3 A;  4M7D C;  2RHI A;  5IHK A;  1QVF P;  1M2V B;  5IXF A;  3DB4 A;  1H3Z A;  1KHI A;  1CKA A;  4KH1 B;  2HSE B;  4HT8 A;  1ZA1 B;  4PJJ A;  1SF9 A;  3JCM g;  2LQ8 A;  2L2P A;  1OEB A;  4FM4 B;  4JUV A;  2LCC A;  4MDW A;  3SFM A;  1HYO A;  1O75 A;  1K73 R;  1JJ2 S;  2EYQ A;  3SWN C;  5J39 A;  4PJO C;  4LE9 A;  1QP3 A;  2DX1 A;  1X01 A;  3MEA A;  4C5G A;  2OTJ T;  5CK9 A;  3REB B;  2CZ6 B;  2DTO A;  1UGR B;  2BTT A;  2DO3 A;  1M3B A;  3NTK A;  1Q7Y R;  4NL2 A;  1SKU B;  1TU0 B;  5GAN 4;  4E7Z A;  2LT1 A;  3QDF A;  2NLU A;  1VQ4 T;  1ZSZ C;  1JEG A;  2E3I A;  4OB2 B;  5GMK l;  2XU8 A;  4A4G A;  2KXD A;  1H3H A;  2DKG A;  2JTF A;  2YSQ A;  3OMG A;  1Y57 A;  2DA9 A;  2RQR A;  4M77 C;  1Y71 A;  2CUB A;  3QXE B;  1VQK A;  2LQN A;  1OV3 A;  2XKO C;  3PIP A;  5FRM A;  4M77 F;  5GAN e;  1LCK A;  1VQP T;  2WSF E;  2A7Y A;  2RI5 A;  3ULR B;  1QCF A;  2WSE E;  4RTX A;  2JZ2 A;  2YDL A;  3CPW A;  1Q7Y U;  4FYW B;  1LVK A;  4BE2 A;  3CXC A;  4Q5W A;  1NEB A;  4OMF B;  4E47 A;  2H8H A;  4HCC A;  1YJN T;  1U06 A;  4RMO A;  4C92 B;  3CPW P;  2ECZ A;  5CR2 A;  1KQ1 A;  3OYE A;  3E2U A;  3IQL A;  1RAD B;  3CXC P;  4PJM A;  2NUT A;  2FZG B;  1YJW T;  2EQI A;  4BD3 A;  5DY9 A;  2L3Q A;  2QYZ A;  2E10 A;  1U8R A;  3R6O A;  4MZM A;  1YJ9 Q;  2LZ6 B;  2DL5 A;  2E5K A;  4GLK A;  1QKW A;  3SD4 A;  3SWN A;  2DM1 A;  8ATC B;  4ATO A;  4PJO A;  2GBQ A;  4A4H A;  4AFS C;  4XTV A;  3CC2 A;  2E3H A;  1W4S A;  3JV3 A;  3SEM A;  1SRM A;  1OYX A;  2F5T X;  1ZUY A;  1C0M A;  5ECA A;  1U3O A;  2FZK B;  1YJN A;  4E6R A;  3OS5 A;  1NYF A;  2HQH A;  3C4S A;  2RMO A;  4M7D B;  2HCK A;  3JCM h;  1PSE A;  4M77 A;  5GAO l;  1YJW A;  1UGS B;  4C8Q G;  1MND A;  5DLO A;  2L3S A;  1WX6 A;  3CCS T;  1M3A A;  2DET A;  3GIB A;  2NUT B;  3OYD A;  2KE9 A;  5KE2 A;  4BB7 A;  3CCE T;  3REA B;  3TVT A;  1LJO A;  4WCI A;  3M58 A;  3NTH A;  2EKO A;  3SWN B;  1KSW A;  4PJO B;  2EFI A;  4PLL A;  1UJY A;  1YIJ Q;  4QW2 A;  2VXF A;  2LX7 A;  1BI1 A;  3BY7 A;  3A8H B;  1K9A A;  1BI2 A;  1PRL C;  2D9T A;  4ZNX A;  1UE9 A;  1AOJ A;  2J7I A;  2DXT A;  3KFV A;  4M4Z A;  2RJC A;  1GL5 A;  1W1F A;  4NS5 A;  2OTL Q;  4J9F A;  2D0Q B;  2CS7 A;  2X4J A;  1ZSZ B;  3P8H A;  2AIR B;  4CC4 B;  4XTW A;  1JJ2 A;  2E41 A;  4M7A G;  4FSS A;  4B9X A;  2A08 A;  1VQ7 T;  1J3T A;  4M77 D;  2VC8 A;  4FYY B;  4DA4 A;  2CP7 A;  2YWW A;  1VQN T;  1YBY A;  3JB9 F;  1WQW A;  1QCN A;  1NG2 A;  2DIG A;  2LRQ A;  1AWW A;  1JJ2 P;  2W10 A;  3JRZ A;  1VQL A;  3GNF B;  1Y0M A;  4MDX A;  4UC4 A;  1PCX A;  2MIO A;  3UWN A;  4B9W A;  3P8D A;  4AMC A;  2RHX A;  5GAN d;  4JZ4 A;  5KYY B;  4XK8 E;  4F7U E;  3QZ5 B;  3VV0 A;  2KDS A;  3AHU A;  2DK3 A;  3OB9 A;  3LH0 A;  3FC3 A;  1GBQ A;  3RBB B;  3CC2 Q;  1LPL A;  2XDB A;  4IUT A;  4GY5 A;  2KI7 A;  4QKU A;  3UPU A;  5HKC A;  3MPU B;  1RAI B;  2O9S A;  1CSK A;  1VQN A;  3LX7 A;  2FB7 A;  3S6W A;  1OPL A;  3MJX A;  5CQX A;  2CP6 A;  4AT1 B;  3ZFJ A;  2QDL A;  4E7H A;  4QVD A;  4LUE A;  2QEX A;  1VA7 A;  2E65 A;  4ELZ C;  1VIF A;  4KGX B;  1Q82 C;  5IHI A;  1G3Y A;  1ABO A;  2HBP A;  4MZP A;  1NLP C;  2PQW A;  5FLX E;  3C95 A;  2XDP A;  1D0Y A;  3V7R A;  2VKN A;  2LMJ A;  2YUQ A;  1TWB A;  1VQ8 T;  2QQB A;  4KUL A;  1CKB A;  3MO8 A;  3G6E A;  1K0X A;  4R56 A;  4KUD K;  4X1V A;  3TCJ A;  2L0A A;  2F2W A;  2RK1 A;  3CCJ T;  2DE0 X;  5GJV B;  3PMT A;  4E2F B;  2DEQ A;  2XI9 A;  1EIF A;  4OVA A;  3L2U A;  4DBH A;  2DNU A;  3EFR A;  2ZPB B;  3X20 B;  2EQK A;  3CCR T;  1NPR A;  1U1T A;  3PT9 A;  3M0S A;  2DL4 A;  1Y96 B;  1N27 A;  2V26 A;  4HXJ A;  5LL6 S;  2EGC A;  1K1Z A;  2RHU A;  1PKS A;  1ZBX A;  1HXD A;  1C6V X;  2VGM A;  4D8K A;  1X43 A;  2BZ8 A;  4IUV A;  4J6W A;  1GXI E;  1RAB B;  5LJ5 h;  4X9D A;  1I8F A;  2KBT A;  4C0D B;  4N4I A;  5LJ3 f;  1MUZ A;  2X4W A;  5KCH A;  5GAM f;  2RF0 A;  3PTA A;  1ABQ A;  2E70 A;  2FVU A;  4FU6 A;  2FHD A;  3JB9 D;  3EFS A;  3L2R A;  3BW1 A;  1T3L A;  1K9M C;  1N5Z A;  2LVM A;  1VQ5 T;  3TRE A;  1M1K C;  2DJQ A;  2F2X A;  3QYG B;  1QWF A;  4QT7 A;  1AWX A;  2VVK A;  1M1G A;  3CCR A;  5I2S A;  1KG1 A;  2MF2 A;  3PVL A;  2MCN A;  4M75 F;  3URG A;  3QJY A;  4D6W A;  3JB9 J;  1DJ7 B;  4QQD A;  3NHN A;  4MMK A;  1M90 C;  3G71 Q;  3CCQ A;  3CC4 T;  3M56 A;  3CMA A;  2X4X A;  4M7A C;  2E64 A;  1IRE B;  4EMK B;  2F69 A;  2FO0 A;  3M5A A;  1HD3 A;  3QPH A;  4A54 A;  1TUG B;  2QEX Q;  2A0F B;  2EVR A;  2OAW A;  4AG1 C;  1NLO C;  2J05 A;  2DXU A;  3TEE A;  3VS4 A;  2DBM A;  1WHH A;  4B6M A;  1OQK A;  3F70 A;  3VS7 A;  2ZGW A;  3JCM X;  3CC7 Q;  1VQ5 A;  4XU0 A;  1X2K A;  4M78 C;  1ZLM A;  1SG5 A;  1I81 A;  1ZHI A;  4LNP A;  3EG9 B;  2DTI A;  2CDT A;  4PLI A;  2X9H A;  3FLG A;  3A98 A;  4KGZ B;  3M0P A;  4J7F A;  4L6V 5;  2RD1 A;  1E7O A;  3CCU Q;  2HDA A;  2KNB B;  1PNJ A;  4M78 F;  3G6E Q;  1VQ6 Q;  3LWI A;  2HBW A;  4WTO B;  5KE3 A;  2WAC A;  3FJ5 A;  3VS2 A;  5EC7 A;  2DRM A;  4JJD A;  2XID A;  2HD0 A;  4PFZ A;  3VS1 A;  3VS3 A;  5CVI A;  4CI0 C;  1QVG S;  1O9S A;  3I56 A;  4BDY A;  1KQ2 A;  1IGQ A;  4N0A A;  5HCK A;  2CP3 A;  5GMK m;  4OMP A;  3NFC A;  3G4S Q;  4IUR A;  1I0C A;  1Q81 R;  2GTJ A;  2J06 A;  2JM8 A;  5J26 A;  5A0G A;  4CC7 A;  2KAF A;  1S1N A;  3TSZ A;  1MV0 B;  4EMH A;  4IKF A;  3HRU A;  5I2M A;  4DEX A;  4X9C A;  1V1C A;  4D8D A;  5GAN g;  4FL6 A;  4BE1 A;  1M8M A;  4Z89 A;  1WIE A;  3S3N A;  1AWJ A;  1KD1 R;  1JU5 C;  2EYX A;  1GCQ C;  3FRN A;  2GCX A;  1JXO A;  3EGD A;  3TSW A;  5KYU B;  3JCM J;  2V1R A;  1N8R C;  2BE7 D;  3OYF A;  1ACM B;  4X34 A;  1JXM A;  2L3R A;  2GTO A;  3OYB A;  1TOV A;  2MMP A;  4HVW A;  2VAS A;  2ROL A;  3QJ6 A;  4C8Q B;  2LCS A;  3R6N A;  2K5L A;  3L1A A;  2D6F A;  3L2V A;  3O8V A;  3QBY A;  2GNC A;  5CKE A;  5J3B A;  4C92 F;  1YIT T;  2FEI A;  3SDZ A;  3M57 A;  2J6K A;  2QG9 B;  1N6A A;  3OBW A;  1Q81 U;  1WJQ A;  3CD6 T;  2AKK A;  1XNI A;  5CO7 A;  5GAO q;  2MK5 A;  2YUN A;  4M78 A;  3A1P A;  3PGG A;  1YI2 T;  4RTU A;  4ZTJ A;  2XD0 A;  3CMA Q;  2F2V A;  4KGV B;  2K79 A;  2BE9 B;  1JB0 E;  4M75 D;  2VXE A;  3M54 A;  3JCM Q;  4IIM A;  3WXM B;  3JCM f;  5KYN A;  1KD1 U;  2LJ0 A;  2PVO B;  5GAM h;  3G7Z A;  2K2M A;  1NZ9 A;  2YT6 A;  2F5K A;  5CKH A;  3MP8 A;  3V8J A;  2KYB A;  4FW1 A;  4BI3 A;  3VUB A;  3LYI A;  1WDX A;  2CT3 A;  2QGG A;  1UHF A;  3CCM Q;  3EGD B;  4DQ2 A;  5GMK h;  1QW1 A;  1HSQ A;  4M7A B;  2BZX A;  2J6F A;  2QQS A;  2RO0 A;  1WLP B;  3MHX A;  5GAO m;  1QWE A;  1VQM A;  1G8X A;  5GAN 6;  3HRS A;  3ASK A;  3CD6 A;  4M7D F;  2KRO A;  2P4R A;  4E7J A;  4A63 B;  4JRI A;  1IB8 A;  1K4U S;  2RPN A;  2LDM A;  4BAC A;  2JW4 A;  4M77 E;  1NJI R;  3I56 Q;  3H6Z A;  1Q7Y C;  3UAT A;  4M78 B;  1GCQ A;  2CZ7 B;  2BIV A;  1UGV A;  5HK3 A;  3H0F A;  4LD6 A;  4C92 A;  4DBR A;  3RES A;  4PJO F;  4FIB A;  2A3L A;  3WVD B;  2KY9 A;  4A4F A;  2JM9 A;  4O6J A;  2W0Z A;  2K7A A;  2QGF B;  2KR3 A;  2DXC A;  7AT1 B;  3JB9 G;  1BBZ A;  2ZAE A;  5IHN A;  1S72 T;  1W2B S;  5I21 A;  2DD4 A;  4GBQ A;  1FWZ A;  3VYH B;  1PRM C;  2JNG A;  5FU7 C;  2GQI A;  1QCO A;  4PJL A;  1BIB A;  5A0D A;  2DL8 A;  4DOV A;  1ZA2 B;  1A0N B;  4QQG A;  3BDU A;  1KC8 C;  3RIR A;  1K73 U;  3FB9 A;  1NJI U;  5L23 A;  1Z9Z A;  3CME Q;  2X3W D;  4AFZ C;  2RQT A;  1WHG A;  3NTI A;  4OML A;  3KXT A;  2OTJ A;  1VIE A;  3VU3 C;  1UEC A;  8AT1 B;  1QVG A;  4C5H A;  4BI4 A;  1TUC A;  2QAS A;  2DYB A;  3I35 A;  4EDU A;  5C6S A;  3OYK A;  3QUI A;  3HTR A;  2FZC B;  4M7D A;  1TTH B;  4K11 A;  1GFC A;  4C92 D;  1VQ9 Q;  2RI2 A;  4ANJ A;  1VQ4 A;  1R0C B;  1X6O A;  3OYL A;  1PD0 A;  5IAY A;  1WJS A;  3OSV A;  4DEY A;  2OX7 A;  2YLC A;  3DLL A;  1I1J A;  1RI0 A;  1R8O B;  1D0X A;  3WVE B;  2GGR A;  4F7U G;  2EYZ A;  2J6O A;  2IG0 A;  1F1B B;  4EIK A;  1VQP A;  2DVJ A;  1HJD A;  2K5I A;  3LLR A;  1VQM Q;  1AZE A;  1YHQ T;  2ZZD A;  1YWO A;  1JBM A;  2VYT A;  3X26 B;  1ZSZ A;  2FYK A;  4P5N A;  2MYS A;  1WHK A;  2P0P A;  4MZT A;  2ZPE B;  4LN2 A;  4M7D D;  2EIF A;  2RJD A;  1T0H A;  5D6X A;  4OP0 A;  3EH1 A;  3QWX X;  4PK4 A;  1FXX A;  1VQO T;  2HNI A;  4RCC A;  2M16 A;  3OYG A;  1RAG B;  5EG2 A;  1VYT A;  1UJ0 A;  1D1C A;  1YN8 A;  2KT8 A;  5KYY A;  1FMV A;  2DLP A;  1ZUU A;  5KYW A;  1WXU A;  5LJ5 f;  2Y4Y A;  2H3E B;  4AFU C;  2XMF A;  1YHQ A;  4C0Z A;  4PJO D;  4ZGJ B;  4Y28 E;  4KBM B;  1VQK Q;  2DBK A;  1G83 A;  2JXB A;  4LDV A;  5A0L A;  3EGX B;  2QA4 T;  1V29 B;  4Z8A A;  2M02 A;  2VGN A;  1ARK A;  4WF2 A;  4C0D C;  2OTJ Q;  1FYN A;  2B8A A;  2RHY A;  5CAI A;  2KSS A;  1IO6 A;  2LNH B;  5DM7 R;  1G5V A;  4M75 G;  4CC2 A;  1JO8 A;  3CCS A;  2LTO A;  5FU7 B;  1VQO A;  4J9I A;  5LJ5 j;  3RMS A;  2K2V A;  3OYA A;  3CCE A;  1U5S A;  5M9O A;  4LDY A;  4JJC A;  4PL6 A;  2O31 A;  5GMK i;  3MP1 A;  1RI9 A;  1D1B A;  2K3Y A;  4JS4 A;  4LD9 K;  1UG1 A;  4CRI A;  2YUP A;  3N5B B;  2Y4X A;  1W2B A;  2AZS A;  2E6Z A;  4AG2 C;  3M0Q A;  3GPL A;  2CUD A;  2DXB A;  5KYW B;  2PVG B;  1M8V A;  1RL2 A;  1W6X A;  3OMC A;  3EHR A;  3G71 T;  3M4G A;  1FMK A;  4EMK C;  2X4Y A;  1EX4 A;  4MML A;  5I22 A;  1VUB A;  1IHW A;  3M0R A;  3U23 A;  2OJ2 A;  4OMO A;  5IT9 E;  2V8J A;  1HK9 A;  2JMA A;  3DB3 A;  4RUG A;  2C0I A;  2E12 A;  3RMQ A;  1VQ7 A;  2OAU A;  5CQY A;  1YJN Q;  2RA2 A;  3KBG A;  4Z88 A;  2QI2 A;  4NL3 A;  1Q86 R;  1SHF A;  4RCB A;  1WI7 A;  1SEM A;  1XJW B;  1GFD A;  1Y96 A;  2YUO A;  4KT0 E;  1FX7 A;  3OYY A;  4ORZ A;  3C12 A;  4PFO A;  5DLQ E;  1YJW Q;  2JS2 A;  2ED1 A;  1VQ6 T;  2LP5 A;  9ATC B;  2ZPF B;  4XAX B;  1MNE A;  5IXB A;  1TH7 A;  1PKT A;  2PU9 B;  2KRN A;  1I4K 1;  3ME9 A;  1SSH A;  4F17 A;  2XG8 D;  3M53 A;  5HK0 A;  2KT1 A;  1B34 B;  4HCK A;  2RH2 A;  1D1A A;  1VYV A;  1M5Q 1;  1XOV A;  2LJ1 A;  2KRS A;  4OB1 B;  4BUG A;  1Q86 U;  4BY6 C;  1WGS A;  3JCM V;  1Q82 R;  5CKD A;  3CCV T;  2HEQ A;  3RKX A;  5AYF A;  2LQK A;  2HQX A;  2CSI A;  2RQU A;  4M75 E;  4QVZ A;  2KYM A;  3L2W A;  2C0O A;  4XTU A;  2QDY B;  1UGQ B;  1YCS B;  1UUE A;  1WXB A;  3ZBD A;  2DPP B;  2CP0 A;  2E6N A;  3CCL T;  4EMG A;  4ZN3 A;  4EMK A;  1PHT A;  1TS9 A;  1RUW A;  3QZ9 B;  3EG1 A;  4C8Q C;  1KHC A;  4BDZ A;  1VQ8 A;  3BDL A;  1VQL Q;  3C0C A;  3GBQ A;  4XU2 A;  4ME7 A;  4RTV A;  4ZTF A;  4C8Q F;  3T9N A;  2EWN A;  3SHW A;  2JTE A;  2MWO A;  3EG9 A;  3CCJ A;  5FWC A;  3M0T A;  2DAQ A;  2PUO B;  3RDV A;  1Q82 U;  4L59 A;  3CCV A;  5GAN 3;  1PD1 A;  2D8H A;  4F14 A;  5GAO p;  2P84 A;  1MMN A;  3LW5 E;  2COZ A;  2A28 A;  3H0H A;  1H8K A;  2CP5 A;  2MAM A;  4M78 E;  3OY9 A;  1RAH B;  4Z02 A;  5LJ5 e;  2V8K A;  3CCL A;  2VUB A;  4OB3 B;  2MOX A;  1B7T A;  5LJ3 j;  2JMC A;  4JPB W;  1M1F A;  1VQN Q;  2V8I A;  3I55 T;  5GAM j;  2Z0W A;  2V1Q A;  4F16 A;  4J9D A;  4LDW A;  4IUQ A;  3RNJ A;  1GCP A;  2B86 A;  4RTZ A;  1M1K R;  4M7A F;  1ZQ1 A;  2VB6 A;  3J80 E;  5GMK j;  3CBM A;  2K9G A;  3V7S A;  5C0M A;  4J5Y A;  2QQR A;  4R55 A;  4J6Y A;  2LX9 A;  2DYI A;  3HFN A;  4ZGD B;  2VV5 A;  1GBR A;  3A8G B;  1T3S A;  1PG5 B;  3FEO A;  4JS5 A;  4XU1 A;  3OYH A;  1VYU A;  1V76 A;  4FYX B;  5KYU A;  1AVZ C;  3E1S A;  1MHN A;  1C1A A;  3EH2 A;  2K6D A;  1SSF A;  2CZ1 B;  1M3C A;  4C8Q A;  2QQA A;  3PFS A;  4Y91 A;  3UA6 A;  3OS1 A;  2R57 A;  5GAN f;  3I55 A;  3CC4 A;  1RLP C;  3M9Q A;  1B07 A;  1BU1 A;  2GFA A;  1W70 A;  4M77 G;  3RR6 A;  1JQQ A;  2EYY A;  3QYH B;  4C92 E;  1Q81 C;  1AT1 B;  4R0K A;  1NYG A;  1NEG A;  4A4K A;  1M1K U;  1KK7 A;  4F7U B;  2HL3 A;  1NBE B;  3BE3 A;  4FT2 A;  3FDR A;  3VYG A;  3GNG A;  2EQJ A;  3QO3 A;  2SRC A;  1KD1 C;  2DMO A;  4BY6 B;  3OA6 A;  3CME T;  1IXD A;  2EPD A;  4RTW A;  4ELY C;  4JLI A;  2NUP A;  3UDC A;  2ATC B;  5FW9 A;  2ROT A;  4HKE A;  1IHV A;  3VKI A;  4M7A A;  1B3Q A;  3V8L A;  2O88 A;  2EGE A;  3HHT B;  3MKD A;  4C8Q D;  3L2Z A;  5GAN 5;  1E6H A;  1Y07 A;  4KUI A;  1D3B A;  2LQW A;  5KYX A;  3CCR Q;  3HFO A;  1T0J A;  4M7D E;  4VUB A;  2CH4 A;  4JRP A;  3E9G A;  3FIF A;  1IGU A;  1YJ9 T;  3CCQ Q;  1G2B A;  4KH0 B;  3JB9 H;  1ZUK A;  3THK A;  2VWF A;  1YWP A;  1N8R R;  5CCA A;  3L2Q A;  3V7C A;  2A36 A;  2DTH A;  2L89 A;  4QVC A;  1AEY A;  4PJO E;  2HAX A;  3DKM A;  2LC4 A;  2SEM A;  4A4E A;  1AZG B;  3EG2 A;  1K8A R;  5CIU A;  2NUP B;  1VQ5 Q;  3NMZ C;  3A8M B;  2C06 A;  2M9U A;  4HA8 A;  5D7U A;  1OU9 A;  2R5A A;  1YIT A;  2DJZ A;  2FRW A;  4M7A D;  2L8D A;  4C5E A;  1I5O B;  4C0F A;  5L8R E;  3A8L B;  3JAM E;  4LXC A;  1K73 C;  1NJI C;  5LJ3 e;  1YNZ A;  1D3B B;  3VRZ A;  2ZPI B;  3X28 B;  5GAM e;  2O01 E;  5KYX B;  2RJE A;  1YI2 A;  3QHS A;  2RNA A;  1LNX A;  2I2L A;  4J6X A;  2DRK A;  1N8R U;  5A2Q E;  1ZSG A;  4M78 D;  2BUD A;  2PNI A;  5GMK e;  2X51 A;  2JS0 A;  1YIJ T;  3CQT A;  3HKS A;  4XQ3 A;  3QDR B;  2JUF A;  2HL5 C;  3MEW A;  1K8A U;  1FMW A;  4CC3 A;  3PVQ A;  1VQK T;  1JRI A;  5I11 A;  2A37 A;  3OS2 A;  2OTL T;  3ZL7 C;  2X3X D;  3S3M A;  4PJN A;  2EBP A;  1H92 A;  4HT9 A;  5GAN h;  3CBP A;  1BIA A;  2XIC A;  2M0Y A;  4F04 B;  3INZ A;  4HCZ A;  4N4G A;  2DIL A;  2MWP A;  2NYS A;  3TU4 K;  5GAO r;  1Q95 G;  2L5Q A;  1QP2 A;  1YIJ A;  6AT1 B;  2PTK A;  4DOW A;  2K4Y A;  2KEA A;  2DD5 A;  1BYM A;  4ZGE B;  3NPF A;  3EG0 A;  2PVD B;  2RHZ A;  1MMG A;  1S72 A;  1QVG P;  3CC2 T;  2OTL A;  4E7L A;  2EW3 A;  1KC8 R;  1AHJ B;  4FSX A;  4KRT A;  3VJP A;  2QTX A;  2O9V A;  2K5F A;  3ZEH A;  4FCY A;  2GF7 A;  2CP2 A;  2QK0 A;  2AKL A;  2EGA A;  3H41 A;  1KIK A;  4HVU A;  2JTM A;  4JDS A;  2ABL A;  3MET A;  4PNO A;  1NPP A;  2QTV A;  2KVQ G;  3A5Z B;  2OI3 A;  5GJW B;  1MGQ A;  2NUZ A;  1YIT Q;  2Y90 A;  3M59 A;  4OF1 A;  1MMA A;  4BI8 B;  3EGX A;  3EFO A;  3CD6 Q;  2P4T A;  2ZPG B;  2RJF A;  4OMQ A;  2HZY A;  3OYJ A;  3QKJ A;  4LDU A;  4OGC A;  4RG8 A;  1YI2 Q;  1MV3 A;  2XK0 A;  1K0S A;  1SHG A;  3LWH A;  2CKK A;  3OYN A;  4JJN K;  2F1L A;  2BZY A;  1KC8 U;  1WJR A;  2PZ1 A;  2O4X A;  5GAN 2;  5GAN 7;  4LUD A;  5FWB A;  3PIO A;  2MPX C;  3OS0 A;  1BK2 A;  1QKX A;  3VUZ A;  1BI0 A;  3UA7 A;  2M1H A;  4XTX A;  1WXT A;  1OU8 A;  3OSS C;  5LJ3 d;  3GP8 A;  5GAM d;  2MI6 A;  1GRI A;  3KUF A;  2P0K A;  1EZZ B;  1OX9 A;  1WA7 A;  1X2Q A;  2HMA A;  4RTT A;  3QG1 A;  1D0Z A;  2D1X A;  5D6W A;  2RM4 A;  2KGT A;  3JCM e;  1EFN A;  3M0U A;  1PSF A;  4HCB A;  2CT4 A;  1TG0 A;  2AK5 A;  1P92 A;  2L3P A;  2LNV A;  2CYZ B;  4IUU A;  1UFF A;  3EFO B;  2JN0 A;  1WYX A;  3H9N A;  2H3J A;  1VQL T;  3MP6 A;  1KJW A;  3EHQ A;  3MCA B;  1UGP B;  1RAA B;  1RLQ C;  2RI3 A;  1RAF B;  3PE0 A;  4FYV B;  2DER A;  1OOT A;  4JZ3 A;  2LCL A;  4J7I A;  1M4Z A;  3JSC A;  2E5Q A;  2O4X B;  1S72 Q;  1WHM A;  4J9B A;  2KMT A;  1X6G A;  2JJ9 A;  1VQ4 Q;  2CSQ A;  5FU6 C;  1QQJ A;  1YCY A;  3AT1 B;  2EKH A;  2KRM A;  5LJ5 g;  3J81 E;  3G1J A;  2LJ3 A;  4EPC A;  1R77 A;  3NGP A;  4M77 B;  1B34 A;  2QA4 A;  4JLG A;  1N9R A;  5FRN A;  2K57 A;  2KXC A;  3JCM b;  2CZ0 B;  1VQP Q;  1W2B P;  4E7K A;  4N4H A;  3M55 A;  2QEX T;  5HY6 A;  1AD5 A;  2COW A;  1Q86 C;  4M78 G;  5GAO n;  3RKY A;  2FPF A;  3MEU A;  1YFN A;  3M4Y A;  4Y92 A;  2RQV A;  3QSU A;  4J9H A;  1VOM A;  1OX8 A;  1BI3 A;  4J9C A;  3CC7 T;  1RAE B;  1X75 C;  5CKF A;  3X25 B;  4ESR A;  2CGH A;  1SRL A;  1M9S A;  4GLM A;  1KQS S; 
#chains in the Genus database with same CATH homology
 3CBM A;  4BI3 A;  1OYX A;  3CCU T;  2F5T X;  3V7S A;  3VUB A;  3G6E T;  5C0M A;  3LYI A;  4J5Y A;  1UB4 A;  2QQR A;  4DQ2 A;  5GMK h;  4ZN1 A;  1QW1 A;  4BE0 A;  4R55 A;  4J6Y A;  4M7A B;  2LX9 A;  2QQS A;  3HFN A;  2GQV A;  4ZGD B;  2RO0 A;  3G71 A;  3MHX A;  2VV5 A;  2DZ9 A;  5GAO m;  2ZCF B;  4II1 A;  3A8G B;  1VQM A;  3FEO A;  4JS5 A;  5GAN 6;  3HRS A;  3ASK A;  3CD6 A;  4XU1 A;  3OYH A;  4M7D F;  1YJN A;  3E1S A;  4E7J A;  4J83 A;  1MHN A;  4JRI A;  3OS5 A;  4C8Q E;  1SSF A;  2CZ1 B;  2LDM A;  4BAC A;  4C8Q A;  4M77 E;  2QQA A;  3PFS A;  3C4S A;  2M0O A;  4Y91 A;  4YTL A;  4M7D B;  3OS1 A;  2R57 A;  3JCM h;  5GAN f;  3I55 A;  1PSE A;  4M77 A;  5GAO l;  3G4S T;  1UGS B;  1OI1 A;  3M9Q A;  3H6Z A;  3MEV A;  4C8Q G;  5KH6 A;  1Y7X A;  1Q7Y C;  3OBY A;  4M78 B;  4F7U F;  5DLO A;  2GFA A;  3CCS T;  2CZ7 B;  4M77 G;  2BIV A;  3CC7 A;  5HK3 A;  1Q86 U;  3QYH B;  3GIB A;  4C92 E;  1Q81 C;  3OYD A;  5KE2 A;  4LD6 A;  4C92 A;  4BB7 A;  2FL7 A;  3CCE T;  3RES A;  4PJO F;  4A4K A;  4FIB A;  2A3L A;  5FRO A;  3WVD B;  1M1K U;  2KY9 A;  4F7U B;  4A4F A;  4FT2 A;  1LJO A;  4O6J A;  3V8K A;  2PUK B;  4RKU E;  4C92 G;  3CPF A;  3FDR A;  3M58 A;  3VYG A;  3NTH A;  3CCU A;  2EKO A;  1VQ6 A;  2DXC A;  3JB9 G;  3GNG A;  2EQJ A;  2JVV A;  3SWN B;  3QO3 A;  1S72 T;  1W2B S;  4V2S A;  4PJO B;  2EFI A;  4PLL A;  5I21 A;  4QW2 A;  2DD4 A;  2VXF A;  1FWZ A;  1KD1 C;  4BY6 B;  3OA6 A;  3VYH B;  2JNG A;  2WSC E;  5FU7 C;  1BI1 A;  3BY7 A;  3CME T;  3A8H B;  4ELY C;  1BIB A;  5A0D A;  1BI2 A;  3JCM d;  1H64 1;  4LDX A;  4DOV A;  5D6Y A;  4JLI A;  3UDC A;  2D9T A;  4JRK A;  4QQG A;  3BDU A;  2DXT A;  1KC8 C;  2BKD N;  2RJC A;  3PMI A;  1G3W A;  4NS5 A;  3RIR A;  1K73 U;  3FB9 A;  4M7A E;  2D0Q B;  1NJI U;  4OGE A;  1IZ6 A;  3G4S A;  4HKE A;  2CS7 A;  2X4J A;  3VKI A;  4M7A A;  2DIQ A;  3V8L A;  3OW2 S;  3P8H A;  3JCM W;  4XTW A;  1JJ2 A;  3NTI A;  2OTJ A;  3HHT B;  2E41 A;  3KXT A;  4M7A G;  1VIE A;  3VU3 C;  3CC4 A;  4C8Q D;  4B9X A;  3CCQ T;  2QQ9 A;  3L2Z A;  1QVG A;  5GAN 5;  1VQ7 T;  3CMA T;  4XTY A;  1Y07 A;  4KUI A;  1D3B A;  4C5H A;  4BI4 A;  3OYI A;  3HSB A;  4M77 D;  2VC8 A;  2P0Q A;  4EDU A;  2EJG A;  5C6S A;  3OYK A;  3HFO A;  4DA4 A;  1QVF S;  1VQN T;  1YBY A;  3QUI A;  2GFU A;  2ZPH B;  4VUB A;  3JB9 F;  3RER A;  4M7D E;  1WQW A;  2XDD A;  2DIG A;  2LRQ A;  2EJ9 A;  4JRP A;  5FU6 B;  4M7D A;  4QQ6 A;  3JRZ A;  4XU3 A;  1VQL A;  3E9G A;  3GNF B;  4N0A C;  3FIF A;  1YJ9 T;  3CEY A;  4C92 D;  4MDX A;  4UC4 A;  4M7D G;  2RI2 A;  1VQ4 A;  4B9W A;  3UWN A;  3OQ5 A;  1UEB A;  1X6O A;  3OYL A;  3P8D A;  3JB9 H;  2JOY A;  2RHX A;  5GAN d;  3LGF A;  3RUX A;  3RKW A;  4XK8 E;  4F7U E;  2EQU A;  3QZ5 B;  4M75 C;  1WJS A;  3OSV A;  2KDS A;  3VV0 A;  2DK3 A;  5CCA A;  3V7C A;  2RB6 A;  3L2Q A;  3OB9 A;  3AHU A;  2YLC A;  4F7U A;  3DLL A;  1N9S A;  1RI0 A;  2DTH A;  3LH0 A;  1R8O B;  3FC3 A;  3WVE B;  3CCM T;  2L89 A;  3PNW C;  3QII A;  1VQ7 A;  5CKB A;  4QVC A;  2DVE A;  4F7U G;  4PJO E;  2EQM A;  2HAX A;  3DKM A;  4A53 A;  2XDB A;  2LC4 A;  4IUT A;  3DLM A;  2IG0 A;  4A4E A;  4GY5 A;  1XQH A;  5CIU A;  5LJ3 g;  1VQP A;  4XTZ A;  3FJP A;  4PJO G;  3UPU A;  2K5I A;  5GAM g;  3A8M B;  2C06 A;  2M9U A;  3CBO A;  4HA8 A;  4OB0 B;  3LLR A;  5HKC A;  2R5A A;  2K3X A;  1YIT A;  2DJZ A;  1YHQ T;  2ZZD A;  4M7A D;  1BYM A;  3BFM A;  4E7I A;  2L8D A;  3I56 T;  3LX7 A;  2FB7 A;  3S6W A;  1VQN A;  4C5E A;  4C0F A;  1JBM A;  5L8R E;  2G3R A;  2VYT A;  5CQX A;  3A8L B;  3JAM E;  3JCM c;  3GOX A;  1K73 C;  3X26 B;  1NJI C;  5LJ3 e;  3SB2 A;  1BKB A;  2FYK A;  1D3B B;  3ZFJ A;  1WNL A;  2XHC A;  2ZPI B;  4P5N A;  3X28 B;  2O01 E;  5GAM e;  2RJE A;  1YI2 A;  3QHS A;  4J8O A;  4E7H A;  2P0P A;  4QVD A;  2QEX A;  3P8B B;  2E65 A;  4MZT A;  2IVW A;  1I5L A;  4ELZ C;  1VIF A;  2ZPE B;  1Q82 C;  1LNX A;  2OTJ T;  2I2L A;  4M7D D;  3HRT A;  4J6X A;  2EIF A;  2RJD A;  1G3Y A;  2YRV A;  1N8R U;  3JCM P;  5A2Q E;  5D6X A;  2HBP A;  4MZP A;  2PQW A;  5FLX E;  3C95 A;  4OP0 A;  2AHJ B;  1G3S A;  2XDP A;  4M78 D;  2BUD A;  3CCM A;  3V7R A;  1FXX A;  1VQO T;  5GMK e;  2HNI A;  3H8Z A;  4C0G A;  1K9M U;  4RCC A;  1YIJ T;  2M16 A;  3HKS A;  4XQ3 A;  3OYG A;  1VQ8 T;  2QQB A;  3QDR B;  2JUF A;  3UT1 A;  4KUL A;  3MEW A;  5GAN 8;  5EG2 A;  1KQ2 A;  2LT4 A;  1K8A U;  1LOJ A;  4O5V A;  1VQK T;  1XTD A;  2RK2 A;  4L5G A;  3MO8 A;  2YLB A;  3S3O A;  3G6E A;  1KQS A;  5LJ5 f;  4R56 A;  1JRI A;  2R58 A;  4KUD K;  1OZ3 A;  2Y4Y A;  3J7A F;  4PJO D;  3OS2 A;  1YHQ A;  4C0Z A;  3TCJ A;  2EAY A;  2OTL T;  3CCJ T;  2RK1 A;  4ZGJ B;  3CPW S;  3PMT A;  4Y28 E;  4KBM B;  1M90 U;  2DEQ A;  2XI9 A;  1EIF A;  4OVA A;  3L2U A;  4NOY A;  5GAN j;  5IN1 A;  3CXC S;  3S3M A;  3EFR A;  4LDV A;  2ZPB B;  3X20 B;  5A0L A;  2QA4 T;  5KCO A;  1V29 B;  4HT9 A;  2EQK A;  3LGL A;  3HL8 A;  5GAN h;  3CBP A;  1BIA A;  2XIC A;  2VGN A;  3HPW A;  4WF2 A;  3CCR T;  1NPR A;  1U1T A;  3INZ A;  4M75 A;  4C0D C;  3PT9 A;  4HCZ A;  4N4G A;  4FT4 A;  2B8A A;  2MWP A;  1Y96 B;  1N27 A;  2RHY A;  5CAI A;  2KSS A;  5DM7 R;  3TU4 K;  1G5V A;  4M75 G;  5GAO r;  2KK4 A;  3CCS A;  5LL6 S;  2LTO A;  5FU7 B;  1VQO A;  2L5Q A;  3GLX A;  1VQ9 T;  1QP2 A;  3RMS A;  5LJ5 j;  2K2V A;  3OYM A;  1YIJ A;  2RHU A;  1ZBX A;  3OYA A;  1HXD A;  2KQW A;  2VGM A;  4IUV A;  4J6W A;  3E9F A;  3CCE A;  5M9O A;  4LDY A;  4DOW A;  1GXI E;  1WPY A;  2K4Y A;  2R5M A;  5LJ5 h;  4X9D A;  2DD5 A;  4PL6 A;  1I8F A;  2QXF A;  4PKC C;  4ZGE B;  5GMK i;  4C0D B;  3MP1 A;  4N4I A;  5LJ3 f;  3JB9 I;  2K3Y A;  4JS4 A;  2PVD B;  3C94 A;  4LD9 K;  2RHZ A;  2X4W A;  5KCH A;  5GAM f;  3PTA A;  1S72 A;  2HQE A;  2E70 A;  2FVU A;  4C92 C;  4IUP A;  4FU6 A;  4CRI A;  3CC2 T;  2OTL A;  3N5B B;  4E7L A;  2FHD A;  2Y4X A;  3EFS A;  3L2R A;  3JB9 D;  1AHJ B;  3BW1 A;  4FSX A;  2E6Z A;  1W2B A;  2DZC A;  3VJP A;  1WQ7 A;  2QTX A;  1K9M C;  3CME A;  2K5F A;  3ZEH A;  2LVM A;  3GPL A;  2DXB A;  3GF5 A;  1VQ5 T;  2PVG B;  3TRE A;  1M8V A;  2GF7 A;  1RL2 A;  3HP9 A;  1M1K C;  3OMC A;  1QVP A;  1K8A C;  3QYG B;  3G71 T;  3M4G A;  3X24 B;  2EJF A;  4RG2 A;  1VQM T;  1M1G A;  4EMK C;  3OYC A;  2X4Y A;  3CCR A;  5I2S A;  1KG1 A;  4MML A;  2MF2 A;  3URG A;  4M75 F;  1G3T A;  2JTM A;  4JDS A;  4TVR A;  3MET A;  1VUB A;  4JRQ A;  2X35 A;  4PNO A;  3QJY A;  1NPP A;  2KVQ G;  3A5Z B;  4D6W A;  1MGQ A;  4C5I A;  5IT9 E;  2V8J A;  1HK9 A;  1DJ7 B;  3JB9 J;  2Y90 A;  3DB3 A;  4QQD A;  5LJ5 d;  3M59 A;  4MMK A;  3OW2 A;  2E12 A;  3EAE A;  1M90 C;  1VQ9 A;  3ER0 A;  3CCQ A;  4M75 B;  3RMQ A;  2YHT A;  3CC4 T;  3M56 A;  4OF1 A;  4BI8 B;  3Q1J A;  3CMA A;  1YJW A;  1U1S A;  2X4X A;  3A8O B;  2OAU A;  5LJ3 h;  5CQY A;  4M7A C;  2P4T A;  2RA2 A;  2ZPG B;  2E64 A;  3KBG A;  2RJF A;  1IRE B;  4EMK B;  2F69 A;  2QI2 A;  3M5A A;  4NL3 A;  3QPH A;  4A54 A;  4RCB A;  1NE8 A;  3OYJ A;  3QKJ A;  4LDU A;  4OGC A;  4RG8 A;  1OZ2 A;  1QVF A;  1Y96 A;  2E1H A;  2XK0 A;  3L42 A;  3E19 A;  4KT0 E;  1FX7 A;  1YJ9 A;  3OYY A;  3LWH A;  2CKK A;  2DXU A;  3C12 A;  3TEE A;  3OYN A;  4JJN K;  5DLQ E;  1KC8 U;  1VQ6 T;  2ZPF B;  3F70 A;  4XAX B;  2ZGW A;  4M7D C;  2RHI A;  1WJR A;  3JCM X;  1VQ5 A;  3DB4 A;  1H3Z A;  2O4X A;  4XU0 A;  5GAN 2;  1TH7 A;  5GAN 7;  2PU9 B;  4M78 C;  1KHI A;  1I81 A;  1ZHI A;  1I4K 1;  2DTI A;  3PIO A;  3ME9 A;  3OS0 A;  4PLI A;  4HT8 A;  3FLG A;  3VUZ A;  2XG8 D;  4J7F A;  4L6V 5;  1BI0 A;  3JCM g;  3M53 A;  2M1H A;  2RD1 A;  4XTX A;  5HK0 A;  2LQ8 A;  4M78 F;  1B34 B;  3OSS C;  3LWI A;  5LJ3 d;  3GP8 A;  4FM4 B;  4JUV A;  2LCC A;  4MDW A;  5KE3 A;  2WAC A;  3SFM A;  1O75 A;  2RH2 A;  5GAM d;  2MI6 A;  1M5Q 1;  1JJ2 S;  2EYQ A;  3KUF A;  2XID A;  2HD0 A;  3SWN C;  5J39 A;  4PJO C;  2P0K A;  1XOV A;  1QP3 A;  5CVI A;  4CI0 C;  1QVG S;  1X01 A;  3QG1 A;  1O9S A;  3MEA A;  4C5G A;  3I56 A;  4OB1 B;  5D6W A;  2RM4 A;  5CK9 A;  4BDY A;  4BUG A;  2CZ6 B;  2DTO A;  1WGS A;  1PSF A;  3JCM V;  4BY6 C;  4N0A A;  5CKD A;  3JCM e;  3CCV T;  4HCB A;  1UGR B;  5GMK m;  2DO3 A;  3NFC A;  3NTK A;  1P92 A;  4NL2 A;  3RKX A;  5AYF A;  2LNV A;  2HQX A;  2CYZ B;  2LQK A;  4IUU A;  4IUR A;  4M75 E;  4QVZ A;  3L2W A;  5GAN 4;  5IAY A;  4XTU A;  2JN0 A;  2QDY B;  1UGQ B;  2H3J A;  2LT1 A;  1VQL T;  3MP6 A;  5J26 A;  5A0G A;  2NLU A;  2KAF A;  3ZBD A;  2DPP B;  3MCA B;  1UGP B;  2E6N A;  2RI3 A;  4EMG A;  3CCL T;  1VQ4 T;  4EMH A;  4OB2 B;  4ZN3 A;  5GMK l;  3HRU A;  2XU8 A;  5I2M A;  4A4G A;  4X9C A;  4EMK A;  5GAN g;  4IKF A;  2LCL A;  3QZ9 B;  4FL6 A;  4BE1 A;  2DKG A;  4C8Q C;  2JTF A;  4J7I A;  1KHC A;  3OMG A;  1M4Z A;  4BDZ A;  1VQ8 A;  3JSC A;  3S3N A;  2E5Q A;  3BDL A;  4M77 C;  1Y71 A;  2O4X B;  3QXE B;  4XU2 A;  1VQK A;  4ME7 A;  4ZTF A;  2KMT A;  3FRN A;  2GCX A;  4C8Q F;  2XKO C;  5FU6 C;  3PIP A;  3T9N A;  5FRM A;  3JCM J;  1N8R C;  4M77 F;  5GAN e;  1YCY A;  2EWN A;  1VQP T;  2WSF E;  2A7Y A;  2RI5 A;  3OYF A;  2MWO A;  4X34 A;  3OYB A;  2L3R A;  3CCJ A;  5LJ5 g;  2MMP A;  2WSE E;  2DAQ A;  3J81 E;  2PUO B;  3QJ6 A;  4C8Q B;  1Q82 U;  4L59 A;  3CCV A;  5GAN 3;  2JZ2 A;  2K5L A;  3L1A A;  2D6F A;  4EPC A;  3L2V A;  3O8V A;  4M77 B;  3CPW A;  3QBY A;  5J3B A;  5CKE A;  4C92 F;  1YIT T;  1Q7Y U;  1B34 A;  3SDZ A;  3M57 A;  5GAO p;  2QA4 A;  4JLG A;  4BE2 A;  1N9R A;  3LW5 E;  3CXC A;  5FRN A;  4Q5W A;  2K57 A;  4OMF B;  4E47 A;  1N6A A;  4HCC A;  3JCM b;  2CZ0 B;  2MAM A;  3OBW A;  1Q81 U;  1WJQ A;  3CD6 T;  4M78 E;  1YJN T;  3OY9 A;  1XNI A;  5CO7 A;  4Z02 A;  4E7K A;  4N4H A;  5LJ5 e;  5GAO q;  4RMO A;  4C92 B;  4M78 A;  2V8K A;  3M55 A;  3CCL A;  3PGG A;  1YI2 T;  5CR2 A;  2VUB A;  4ZTJ A;  4OB3 B;  1KQ1 A;  2QEX T;  3OYE A;  2XD0 A;  5HY6 A;  5LJ3 j;  4M78 G;  5GAO n;  1Q86 C;  3RKY A;  3MEU A;  1M1F A;  1JB0 E;  2V8I A;  3M4Y A;  4M75 D;  3I55 T;  2VXE A;  5GAM j;  1YJW T;  4BD3 A;  3M54 A;  5DY9 A;  3JCM Q;  3QSU A;  3WXM B;  2E10 A;  1U8R A;  3R6O A;  3JCM f;  4LDW A;  1BI3 A;  4MZM A;  1KD1 U;  2PVO B;  4IUQ A;  3CC7 T;  5GAM h;  4GLK A;  1X75 C;  3SD4 A;  3SWN A;  3G7Z A;  4ATO A;  4PJO A;  5CKF A;  4A4H A;  1NZ9 A;  3X25 B;  2F5K A;  5CKH A;  2CGH A;  3MP8 A;  4M7A F;  4XTV A;  1ZQ1 A;  1M9S A;  3V8J A;  3J80 E;  3CC2 A;  1KQS S;  5GMK j;  1W4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...