4FW1A

Crystal structure of two-domain rsv integrase covalently linked with dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
210
Chain Sequence
PRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGRPKAIKTDNGDAFTSKSTREWLARWGIAHTTGAMVCRANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHKERGENTKTPIQKHWRPTVLTEGPPVKIRIETGEWEKGWNVLVWGRGYAAVKNRDTDKVIWVPSRKVKPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A possible role for the asymmetric C-terminal domain dimer of Rous sarcoma virus integrase in viral DNA binding.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
total genus 71
structure length 210
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 4fw1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4fw1A01
4DSEA 1UWBA 4ZTJA 3IAYA 3O4QA 4HUEA 1HNIA 3PY8A 2D0BA 4CF1A 3L8BA 3G10A 4OGCA 3VQEA 1D9FA 2G8VA 4YFUA 4KTWA 1EETA 1DLOA 3CFOA 4CHYA 4CEZA 4UQGA 4FCYA 3O3FA 4CEAA 2DFEA 3AA3A 3KLIA 4H4MA 4Y1DA 4BWMA 2IGIA 1VSDA 1TL1A 1FXXA 1C6VX 1EXQA 3KKSA 5CZ2A 1DTTA 4FK0A 1U04A 4RG8A 3MAQA 4E7JA 3AO3A 1VSIA 4I7FA 2QXFA 4M3ZA 4CEQA 4CK2A 1T03A 4CJFA 4F8RA 3WNGA 3OYHA 4W5TA 3RRHA 4AHRA 5J2NA 4FJJA 4DTOA 1TAUA 3TANA 1HNVA 3K5LA 4B9VA 1RT2A 2ITGA 4CJVA 4FJIA 2Z1IA 2KW4A 5E41A 1IO2A 2YKMA 1TKXA 4IKFA 3NFAA 4DTXA 2EHGA 1UAXA 3PX0A 2RPIA 1WSHA 3NF8A 4O4GA 1QSSA 3DRRA 3SV3A 3SQ1A 3TAMA 4OPKA 2FC0A 5T7BA 3TAQA 2HNZA 1BL3A 4Z4IA 1ASUA 2DFHA 4FLUA 1IG9A 4JS5A 3HP6A 1WSEA 2G8UA 2HVHA 3V9XA 5KI6A 4CHNA 4Z4GA 4EZ6A 2A1RA 3KK1A 4FLXA 3L2VA 1F21A 3OYBA 3DLBA 3MEEA 2G8WA 3RMCA 3S3NA 1BHLA 1RT7A 4FJ7A 4KHQA 3V9WA 2Y1JA 1J53A 1TGOA 2XY8A 3LP0A 1SKWA 4HCCA 2VG7A 1ZBUA 4M42A 5HRRA 2DTUA 4DLEA 2B4JA 3ZT1A 4DMNA 2PY5A 4CGFA 4C8KA 2EX3A 1RDDA 3ZSVA 3KLFA 4EZ9A 3HPGA 4KREA 1MU2A 1VSKA 2OA8A 3LZIA 3FFIA 1FKOA 2HHTA 1YT3A 4EP4A 3K5NA 1ZBIA 1C6VA 3ULDA 5HRSA 2KFZA 2G8FA 3VQ5A 4OKKA 2X6NA 4B8AB 2RN2A 3OYJA 1U47A 1BIUA 4IFYA 5DMRA 4B9MA 3LP3A 3ZSYA 4CFAA 4CEDA 3PO5A 1Q8IA 3K5OA 4FYDA 2VWKA 3AVNA 4KTQA 4CJKA 4CCHA 1BI4B 3CQ8A 2FBVA 4Z4HA 3G0ZA 1BCMA 1I3AA 1TAQA 4PY5A 1WN7A 4CF2A 2G8HA 3LP2A 3LPUA 1RTHA 3HK2A 4K8XA 4Z4EA 1RBTA 4BE0A 4DLGA 2VG6A 3QO9A 3B6PA 3HL8A 4LSNA 3ZT0A 4HCBA 4DFMA 3SV4A 3I0RA 3K58A 4EP5A 4CEFA 5JS2A 4DU1A 2HHWA 3OYNA 3HXMA 1T8EA 1JLGA 4W5RA 3V1QA 3M8RA 3CM5A 3ZSQA 3SYZA 3AVGA 1KRPA 4NCBA 1TK0A 3LP1A 3I0SA 1NK0A 4FJLA 3DRSA 3HYFA 3M8QA 4LH4A 4LY7A 2OZSA 4CHPA 4CE9A 3VQ4A 4CHOA 3DI6A 3ZSZA 4M3XA 1C1AA 4OKJA 4BDPA 3ZT3A 4QOZB 4HHTA 1CZ9A 1G15A 1NK4A 3OYFA 4B9NA 4KFBA 2E4LA 5FRNA 4FZZA 1CXUA 1RBUA 1XC9A 1YTUA 4FJKA 3VA0A 2OPPA 4ELVA 2KZZA 2Y1IA 3C95A 4E3SA 1KLNA 3QERA 3P83D 3KK3A 3NH1A 2ZD1A 5C25A 4CJRA 3DLHA 4KAZA 3IS9A 1JLFA 4IFVA 1NJXA 3M8PA 4ELTA 1SL1A 4CGDA 3QINA 3SJJA 1RTIA 3AA2A 4OGEA 4XIUA 4Q0BA 3DYAA 2XY7A 2XY5A 4AHTA 3S3OA 3O3HA 3RMDA 3SQ4A 1IHVA 1J9AA 1LV5A 4FJGA 4PUOA 3OYGA 3HPOA 2ZQBA 2BE2A 2E6LA 4CEEA 3SUPA 3TABA 3QIPA 1LW2A 2P1JA 4F3OA 1W0HA 1EKEA 5J1EA 4LH5A 4I2QA 3F9KA 1YTAA 1TK5A 4IBNA 2XHBA 3L2WA 4KHYA 3OJSA 3PX4A 4L8RB 2HVIA 5C42A 2HHVA 1LWFA 4LD0A 4O0IA 1TKDA 3VQBA 2BGGA 1BISA 4B9SA 3OYDA 3QEPA 4RW9A 1JLQA 5J2PA 1SUQA 4KB0A 1ZBLA 1JXBA 3ISNC 1NK7A 4NCAA 1YVUA 4JS4A 3VQCA 3MECA 1EP4A 1ASWA 4DG1A 4B9UA 4FK4A 4JRQA 4CK1A 3D0PA 2PZSA 1KTQA 4CERA 3KLEA 4FLVA 1NKBA 3HPHA 4FZXC 4M3WA 2GV9A 1LW0A 4J2AA 3MEDA 4HUFA 1WSFA 1RILA 2Z1HA 1S1XA 1Y97A 2FBTA 1L5UA 4DSKA 4Z4FA 4FLZA 3AA4A 3KLHA 4E89A 1SL2A 1D5AA 2HHXA 2KZMA 4MQ3A 4OVLA 1JLBA 4ICLA 2YHBA 3PX6A 4CEBA 1C0TA 3SNNA 2ETJA 3ZSWA 4CGHA 1WAFA 2X74A 4CGGA 3HM9A 2D0AA 2HNDA 3SUOA 3VQ7A 3ZSXA 3KD1E 3AA5X 2RKIA 5HP1A 3WNEA 1JXEA 3QIOA 4NYFA 3AV9A 3TR8A 5K14A 4WE1A 1N6QA 1S1UA 1TKTA 3LAKA 3V9SA 3OVNA 4FK2A 2BANA 3VQPA 3NGYA 1L3VA 3OYKA 3JYTA 2YNGA 3DLRA 3OYIA 2Z1GA 1QHTA 4FW1A 4JRPA 1HQUA 2GBZA 1ITGA 2O4GA 3V6DA 1KVCA 4CJQA 4J2DA 4DF8A 4FXDA 2VWJA 4IG3A 1C1BA 1K6YA 3VQQA 3QESA 5FRMA 4OKEA 3AVJA 4H8KA 4AH9A 3BGRA 2KFNA 1VSFA 3MEGA 1HQEA 3LDSA 3SI6A 1S1WA 3OYMA 3T3FA 4C8LA 3TAGA 3LWMA 3OS2A 3HJFA 3PV8A 2WONA 2R7YA 5KGWA 3HSTB 4FLWA 3KLGA 3OY9A 4CJ5A 3AVLA 2G8KA 4CGJA 1GOAA 3AVAA 4F4KA 4BWJA 1NK8A 4CJ4A 1ZBHA 4E1NA 3HVTA 4KB1A 1SL0A 4FJ5A 3ALYA 3HT3A 1FKPA 4DS5A 5I3UA 2W42A 1HJRA 4M3UA 1IHWA 4F2SA 4CFBA 5CYMA 1WSJA 1VSHA 1X9MA 4ELUA 4M3YA 4DU4A 1W9HA 1HYVA 1RDCA 3HVRA 3NHGA 2KTQA 5HLFA 5JS1A 5EU7A 4Z4CA 3TAPA 5KGXA 3NCIA 2VG5A 4KV8A 3EY1A 3A2FA 2A1SA 3SQ0A 3KKRA 2RF2A 1A5WA 1JLAA 3NBPA 1IKYA 3L2QA 3TWHA 4M41A 4N5SA 2DFFA 1XHZA 3MXJA 3KTQA 5HBMA 1S9GA 2B6AA 3NDKA 4CK3A 1XHXA 3QLHA 4CHQA 1NJZA 3KJVA 3NGIA 2F8TA 4AHVA 1LAVA 2ZE2A 3U3GA 4KPYA 2YNFA 1RTJA 2IS3A 4J2EA 3EYZA 4DTSA 3D45A 1JL2A 2F96A 3U6FA 3AVBA 4N56A 1NK9A 1RT3A 2D0CA 4ID5A 3VQAA 1RT5A 1UA0A 4GVMA 4C8OA 5D3GA 4LSLA 1QSLA 3LALA 3QNOA 1NKCA 3V9UA 2FBYA 4M3TA 3ZSRA 4DTUA 5J2QA 2PYLA 1KFSA 3TI0A 4O0JA 1LWCA 3VQ9A 5D7UA 3PO4A 3NE6A 4W5QA 3KD5E 4CJPA 3PUFA 1QQCA 4OPJA 1BGXT 1B9FA 3AVKA 1REVA 4HVJA 1WLJA 3T1AA 4NYNA 2QK9A 1FK9A 1HYSA 1GOBA 2IAJA 3OYAA 1EX4A 2LSNA 3IG1A 3OJUA 4Z0UA 1KCFA 4OJRA 5HROA 1BQNA 2YV0X 4C8MA 3O3GA 3KK2A 1RBVA 2OZMA 1QE1A 1VSEA 4B8CA 1D9DA 1BI4A 3L2RA 3ZT2A 2D5RA 3CYMA 4CIGA 4RW6A 3AO1A 3DMJA 3SQ2A 3I8DA 1QSYA 1TL3A 4DFKA 4E19A 3AVHA 1C0MA 1WNSA 1VSMA 2X78A 1TK8A 2GUIA 1J5OA 1NJWA 2QKKA 2QKBA 3THVA 1VRUA 3MXMA 2PYJA 4Q5VA 5KTQA 4G1QA 1NJYA 1Z26A 3WNFA 3NH0A 4PA1A 3OS1A 1J54A 3QEXA 4DSIA 1S6PA 3AVMA 4NCGA 3IRXA 3C6TA 1WSGA 4O44A 4CESA 3RMAA 4FZYA 4RW7A 1U48A 2AJQA 4CGIA 4GW6A 4KHUA 1ZYQA 3K2PA 3P5JA 4CFCA 4FVMA 3VQ8A 1VRTA 2YNHA 2E6MA 3RRGA 4R5PA 4F2RA 3SPZA 4YNQA 1B9DA 3DRPA 1JKHA 4FW2A 4AHCA 2Z1JA 3P1GA 1HRHA 1TKZA 4KI6A 1CZBA 3K57A 3NGZA 4E7LA 2P5GA 1D8YA 4FJXA 1DTQA 3E01A 3SPYA 4DWIA 5DK5A 3K59A 3RWUA 2JLEA 1UA1A 3BDPA 2XY6A 1NKEA 4O5BA 1SKSA 3ASMA 4MFBA 1KLMA 4KKOA 3ZSOA 1TVRA 1Z25A 1U4BA 4FJ9A 3V1RA 4M3RA 3DLKA 2HNYA 1LWEA 3NF6A 3TAEA 3OYEA 1RNHA 1ZBFA 1Q9XA 3DOKA 1A5XA 3V9ZA 4DQQA 1KSPA 2P51A 3V4IA 2XRIA 4E0DA 1TV6A 4AHUA 3M8SA 4BE1A 2OYQA 2NUBA 4O55A 4CEOA 3TARA 1RTDA 1T7PA 3RR7A 3LPTA 1XWLA 4DSLA 2FBXA 1XI1A 4OLBA 1WSIA 4DS4A 1ASVA 4FM2A 3WNHA 3HO1A 4E7KA 3HP9A 1UOCA 1VK0A 4BACA 3DLEA 4CF8A 2OPSA 3C6UA 4HUGA 1RBSA 4FJ8A 1Q9YA 4PQUA 3CFRA 4DTMA 3C94A 4DQRA 4DU3A 3SCXA 1A5VA 3K5MA 4CJEA 1RBRA 4TSXA 4CJWA 4AILC 4PWDA 1O1WA 3QETA 4KI4A 2HHUA 2IOCA 3AO4A 4DQPA 3CG7A 4CJTA 1B92A 1BCOA 4CF9A 4HTUA 1RT6A 1X9WA 3NH2A 2I5JA 4DTRA 4IG0A 3VN5A 5SWMA 3NAEA 3EZ5A 3AO5A 4Y1CA 1IH7A 4N47A 4DQSA 4DTJA 4KHSA 4CJ3A 1SV5A 1SKRA 2P5OA 5HRNA 3DM2A 4RW8A 1LAWA 3V81A 1IKWA 1IKVA 1BIZA 1NK6A 4FJNA 1I39A 5FDLA 1KFDA 4F3TA 4FJMA 4DQIA 5I42A 4ID1A 3ITHA 2IC3A 2OPRA 3TAFA 3L2UA 1JL1A 2G8IA 4DF4A 1QMCA 1S6QA 4QAGA 5SZTA 4KO0A 2WOMA 4E7IA 4FM1A 1T05A 2X6SA 2Q3SA 4CJSA 4CIEA 4DTNA 2KQ2A 3AVFA 5HRPA 4QCLA 3CM6A 3LANA 1QS4A 4CJLA 3CFPA 4B9TA 4FJHA 4KRFA 3VQ6A 2DY4A 1X9SA 5CYQA 2HHQA 4CIFA 3DLGA 3OS0A 3KIOA 3LWLA 3B6OA 3NF7A 4FM0A 5KRTA 1U45A 3T19A 3OYLA 1CXQA 4KTZA 1L3TA 4KHNA 4BE2A 4I9QA 1NK5A 4CECA 3OYCA 5CY4A 1RDBA 3LZJA 1JLEA 3VA3A 4B3OA 1HMVA 5C24A 2HMIA 4I9LA 4IDKA 1RT4A 3SUNA 3ZT4A 4N41A 4I2PA 1L3SA 1S9EA 1C1CA 1X1PA 2IDOA 3L3VA 5FROA 3RMBA 1R0AA 3AVIA 3S9HA 3U3YA 1WAJA 3RTVA 3QNNA 1RT1A 3VQDA 1KVAA 3QEVA 1RDAA 4N76A 1HYZA 4JLHA 2B5JA 2HB5A 5KRSA 2YKNA 4DTPA 1VSJA 1JLCA 3JSMA 3QEWA 3ZCMA 2JGUA 3AVCA 3NF9A 3F73A 4J2BA 2O4IA 2XO7A 5J2MA 1IKXA 4B08A 3LAMA 4W5OA 4FLTA 1S1VA 3SUQA 3O4NA 2BDPA 4CHZA 3H08A 4E1MA 4W5NA 1KVBA 3QEIA 4FLYA 1NOYA 1QTMA 3UIQA 3DOLA 4M45A 4ZTFA 1CLQA 4DFPA 1S5JA 1HPZA 4AHSA 4ZHRA 1VSLA 4E7HA 4BDZA 3V1OA 4CF0A 4CJUA 2ATQA 4GMJB 4C8NA 1GOCA 4BDYA 4RW4A 4OLAA 1BQMA 3MXIA 2HW3A 4DSJA 3RR8A 4CFDA 2HHSA 1C0UA 3SZ2A 4DSFA 2YNIA 3AO2A 4KHWA 2F8SA 1NOZA 3L3UA 2OPQA 1RCHA 4H4OA 4DFJA 2YHAA 4B9LA 5CZ1A 1N5YA 3S3MA 4K8ZA 1L3UA 1S1TA 1U49A
chains in the Genus database with same CATH superfamily
4DSEA 4ZTJA 2D9TA 3O4QA 2JUFA 4HUEA 1NEGA 1D9FA 1LOJA 5GMKm 1M8VA 4UQGA 4M75A 4CHYA 5EOYA 3FEOA 3O3FA 3AA3A 3KLIA 4Y1DA 1PCXA 3VS5A 5GAOq 5GAMh 2KT1A 1TL1A 1UHCA 2CP2A 2D1XA 2BUDA 1EXQA 3KKSA 5CZ2A 1U04A 5I2MA 2GUPA 5BN9A 1GXIE 4RTYA 5LJ3e 2JMCA 5KQ8A 2KRNA 3EGXA 3WNGA 3EG9A 4W5TA 2QASA 4FJJA 2DVEA 4Z89A 3TTDA 4N4HA 4JJBA 1R0CB 2F7TA 3SWNB 2UYTA 2Z1IA 4FJIA 4I6MA 2YKMA 3ID8A 2A5XA 1Z9QA 5KPRA 3CEYA 2EHGA 4C23A 1UAXA 4WTOB 5KYNA 3G6EA 4O4GA 2A37A 2KR3A 3SV3A 3O1BA 2OTLN 4IUTA 2FC0A 3TAQA 4DR4K 4Z4IA 3MHXA 1KIKA 3A8HB 4RKUE 4H0OA 2X51A 2EBPA 1ZSZB 5LJWA 5KI6A 4Z4GA 2RA2A 2FSNA 2LT1A 1GRIA 1VQMA 4EZ6A 1YF5L 3L2VA 3PSFA 2QAZA 2XKOC 2MYSA 3D6RA 2DE0X 2Q0UA 3CC7N 4NO7A 4FJ7A 4KHQA 2A7YA 4HCCA 1SKWA 3LP0A 2LX9A 1QZ6A 5AQTA 1ZBUA 3UA6A 1S72N 1K73U 2VWFA 4YHHK 5HRRA 1TYQB 4DLEA 2LQNA 3ZT1A 2PY5A 4BR5A 3KLFA 4GV9A 1MU2A 1JJ2M 5GAHP 4H0VB 2LZ6B 4AT1B 3BY7A 4XTXA 3H41A 2HHTA 1YT3A 4JKAA 2F1LA 3RDVA 4E47A 3P4IA 2KFZA 2X6NA 2RN2A 3BDUA 4L3QA 4XEIA 2X4XA 1VOMA 5J3BA 1BIUA 5DMRA 4N4GA 3RVCA 4CEDA 1G8XA 1G3WA 3RMQA 3AVNA 5KYWB 4CCHA 4KTQA 2GBQA 4DCHA 1BI4B 3CQ8A 1I0CA 4PJOC 3SD4A 1VQ8T 4BVOA 4JLIA 1TAQA 1VQ4T 4PY5A 1YJ9A 4CF2A 8ATCB 3ZETB 3Q7BA 1RI9A 4PJOA 1G83A 2R5MA 4MDXA 4NXNK 3KBGA 2DEUA 2QTVA 2WTUA 3META 1NJIC 1KXPA 5AQOA 5AQLA 2M9UA 4HCBA 2EWSA 2UUAK 4KUIA 4PJLA 3SV4A 2A0FB 2HBJA 4MLHA 1YJWA 2EQMA 3A8MB 2LQ8A 2VV5A 4W5RA 4QVCA 3V1QA 5LJ5h 2LX7A 1E7OA 4HXJA 5GANj 3AVGA 3I56A 4IUUA 3CCUN 1NK0A 4FJLA 4RMOA 3M8QA 1EZZB 5KE3A 1YJNA 3NGPA 1VQ6A 4WYBA 4OKJA 4BDPA 2BIVA 4QOZB 1N6AA 1IJJA 3H8ZA 4WCIA 1VQ9T 1ZC6A 4N0AC 4A4EA 2QI2A 5FLXE 1YIJN 4DV6K 2RJCA 4NB4A 1YTUA 4FL6A 4N0AA 3X26B 2P9NA 1BI0A 3NMUA 1KLNA 3BF3A 5FPDA 2UXCK 2O8FB 3KK3A 2PQWA 3DLHA 1K73O 4IDHA 3G6EQ 3IS9A 4IFVA 1QVFP 4B3TK 1SL1A 1R77A 2ED0A 2C0OA 3DYAA 2RHUA 2Y90A 3S3OA 3O3HA 3QO3A 1WA7A 5HCKA 1IHVA 1BKBA 2D0QB 2HBPA 2ROTA 3OYGA 2OX7A 2R58A 4M77B 3URGA 4PJOE 2AP1A 2BE2A 3QIPA 4CEEA 2RB6A 1Y71A 3CCVA 4I2QA 5BPLA 5IT9O 1N33K 3PT9A 4KHYA 1NJIU 3M0SA 3JCMX 4CW7B 3HSCA 4F9OA 5C42A 5MLCQ 4LD0A 3M4GA 1B07A 4RCCA 1WZOA 5GANf 3CCRQ 3O8MA 3SMSA 4E7SA 2XK0A 3RKXA 3RERA 5AQMA 4P5NA 1D1AA 1UEBA 4HCZA 2CSIA 3CXCP 1WHLA 3JCMP 1EP4A 3MEAA 4CK1A 4FLVA 1BK2A 2OANA 2M0OA 3HPHA 1M2VB 1LW0A 1ZXOA 1L5UA 3OA9A 4C8OA 4Z4FA 2KZMA 4FLZA 2OTLT 2HHXA 3LDOA 2FB7A 5JICA 3RUXA 3CCJA 1Q95G 5AQGA 4YOWA 1U06A 1YJ9Q 3ZSWA 5M1OA 4CGHA 1H3ZA 1WAFA 3WEEB 1TUDA 2CGJA 2DK3A 1OZ2A 1X3NA 2RKIA 4H03B 5GMKj 3QIOA 3VEOA 4EFHA 5BRDA 1Q82R 4WE1A 1N6QA 1S1UA 1TKTA 3CC7T 4FK2A 1L3VA 3JYTA 2O8BA 1ZUUA 1PD0A 2HD0A 3JCMf 1YJWQ 1S72T 4LDUA 1HQUA 4GY2B 4J9IA 1QVGS 1K0XA 4CJQA 4J2DA 1S22A 2VWJA 3VYHB 3I56Q 1C1BA 1K6YA 3KWIA 3VQQA 4BQZA 4J6WA 3VETA 2ZM6K 1PG5B 2AZVA 4J9FA 4AH9A 3P8BB 3QFPA 1UHFA 2Q0RA 5LJ3h 4FSVA 4A2BA 5HOOA 1HQEA 4R0KA 1S1WA 1VQ6Q 4XQ3A 1MWMA 3A5LC 3EHQA 2P9LA 3T3FA 3NFCA 3HJFA 3PV8A 2CYZB 3LGLA 3BP8A 2O8DA 2NUPA 5KGWA 3ZYYX 1MMAA 4JJDA 3QDRB 5FU6B 3SAGA 1AT1B 2QWOA 1IGUA 3QB0A 5B8HA 4BWJA 1ZBHA 4Y0WA 1NJIO 4JK7A 3ALYA 5BPNA 1GLAG 3CJ1A 1FJGK 1G2BA 1UECA 3QG1A 1IHWA 3KXTA 3E66A 3L4QA 3A8LB 5EG2A 1WSJA 2G6FX 1TUYA 2WSCE 4BRGA 2MIOA 4DU4A 3PVLA 1RDCA 1B7TA 3RKWA 5EU7A 8AT1B 2BDPA 2JNGA 4IOAL 4Z4CA 4FWLA 3NCIA 4KV8A 2RHIA 4J9CA 4M75G 5DLOA 2DIGA 5CIUA 3N4QA 1A5WA 4K43A 3CCVQ 3CCUT 1KSWA 2XDDA 3NBPA 4M7DC 4M41A 4BC3A 3H1QA 2A42A 2EJFA 3KTQA 1T6CA 5HBMA 1Q7YC 2JMAA 3C6AA 1XHXA 2G3RA 3I8BA 4M7DA 1X69A 1I5OB 4J8FA 2D8JA 2QA4N 4HVVA 3JB9D 1RFQA 1SS6A 4KPYA 1QQMA 2D0PA 4M77F 2QM1A 5GINA 5AQNA 3EYZA 1HNWK 3SEMA 1UUEA 3S6WA 3TEEA 5C0YA 1O13A 2LNHB 1UA0A 1SEMA 2K2VA 1QVPA 5D3GA 1W70A 4FWKA 3LALA 4H0XB 4LSLA 1AWJA 5CR4A 4WF9L 4H5RA 2BKDN 2BTTA 5KE2A 5ELZA 4M3TA 4DTUA 3M5AA 1LCUA 2HQXA 5A2QO 1VQPQ 3HFOA 2KYBA 4W5QA 3CCJQ 3FZHA 4EHTA 4IOCL 3THKA 5A0LA 4HVJA 2XDBA 1LNXA 1XMQK 4NYNA 4CZHA 1YWOA 3OYAA 2LSNA 5LL6Z 4RTZA 3OJUA 2LRQA 2E70A 1KCFA 4OJRA 1N8RR 3NVMA 2KI7A 5IHNA 2OZMA 2CP7A 3L2RA 3WQUA 3ZT2A 3CJAA 2PTKA 3M0TA 4DEXA 5CCAA 1TL3A 3ZEUB 4DFKA 3AVHA 2MI6A 3UKUB 2V8IA 3JCMQ 2X78A 3I5RA 2NRXA 3ZX0A 2QKKA 5AFUH 2QTDA 1BU1A 4JI4K 1TWBA 2LQKA 1TXQA 4M7DE 3C6HA 1Z26A 5M1QA 4PLLA 4JDSA 1YBYA 4PA1A 2Q36A 1D1BA 2JM9A 1X01A 3EAEA 4EIKA 3C6TA 4O44A 4CESA 1AD5A 4RW7A 3AAPA 4BC2A 1U48A 3CMEN 2A36A 4EMGA 2ABLA 2L3PA 2IIMA 1K8AR 1GLDG 3D2FB 3GDQA 3P5JA 2YNHA 1YIJA 3RRGA 4F2RA 3F5TA 3CD6T 1JKHA 3THYA 5AQHA 1OQKA 1HRHA 5D6YA 3K57A 4E7LA 3E1YA 2P5GA 4DV4K 1DTQA 2FZKB 3SPYA 3CQYA 2DTHA 3ID6A 5DK5A 2O8CB 1D3BA 2GWJA 1NKEA 5KYYB 1KFZA 4M7AB 2GX9A 1BA0A 1K9MR 2EAYA 3THXA 2JTMA 1E4FT 2X4WA 1Z25A 2F5KA 1U4BA 4JHDA 2EFIA 2MK5A 2QQ9A 2KE9A 1MMNA 2ASOA 4BRLA 3AAQA 4BR2A 1RL2A 3NF6A 2KK4A 5M1PA 2FVUA 1NG9A 1ZBFA 1MMGA 3CCLT 3EO3A 3O08A 4IFEA 2D6FA 3EL2A 3OW2P 4MLEA 4O55A 4CEOA 1RTDA 4DR7K 1BA1A 2YLCA 2ZGZA 2B86A 4JI5K 4K25A 3SDZA 1WSIA 1B3QA 5C2DA 4OLBA 3KZBA 2NRRA 3HRTA 3DLEA 4DV7K 2DXUA 3X24B 3CFRA 2P9UB 2D0NA 3QYGB 2J4RA 1VYVA 4BI8B 3K5MA 2DXBA 3OA6A 5EC7A 4F7UF 2IOCA 5GAMg 3H46O 1OYXA 4DR3K 2RM4A 3WXKA 2COWA 1RADB 1UGPB 4JKHA 4HTUA 2JJ9A 4FYWB 3OTOK 4IG0A 4H0YB 2QW9A 4DQSA 1IH7A 4K0KK 3L4IA 4RW8A 4FJNA 1IKWA 2MMPA 1IKVA 1BIZA 4CI6A 2E65A 1LJOA 4ZGJB 3VV0A 5FDLA 4F3TA 3DJCA 2EGEA 2QA4T 1Q82C 1K8KA 5I42A 2QWQA 4PHTX 1SG5A 3MP6A 2O88A 5FPEA 1IREB 3REAB 2RI2A 3X20B 1Z05A 5GAOl 3MN7A 1T05A 3MP8A 2X6SA 4CJSA 1JXOA 2NWMA 4FWRA 4DTNA 4JKGB 5HRPA 1I94K 1ATNA 3CM6A 4CJLA 4OMLA 4B9TA 4KRFA 3VQ6A 5LMUK 1WXTA 1X9SA 1H92A 3LWIA 3O9SA 5FWCA 3UA7A 1HYOA 3OS0A 3LWLA 1RGIA 3NF7A 2CH6A 5KRTA 4FM0A 4LDXA 2ZZDA 5CKDA 1PC0A 1U45A 1L3TA 4HWIA 4BE2A 2XIDA 5GAMf 4I9QA 1NK5A 3OYCA 3LZJA 3OHRA 3VA3A 2MWPA 2QQAA 4I9LA 4PL8A 3TTFA 1ZA1B 4MMLA 3ZT4A 1BIAA 2Q97A 1E3MA 5ADXH 1UB4A 2HAXA 1S9EA 2MAMA 1QZ5A 2BZXA 1V29B 3CC4A 4BRKA 4DQ8A 3RTVA 4AM6A 3VQDA 3DLLA 3QEVA 4YTLA 5IXBA 2QQSA 2V1QA 2HB5A 4JJCA 5J26A 5KRSA 4ISFA 3JSMA 1UJYA 2K3YA 1G3SA 2DIQA 3F73A 4J2BA 4ELZC 3TU4K 4YORA 2XO7A 2O4IA 3WT0A 2J6OA 5A0DA 2NRVA 4JK9A 3X25B 3SUQA 4ELYC 3H08A 1HUXA 4H0PA 4X62K 1NOYA 1QTMA 3UIQA 4KBOA 3DOLA 3OMCA 4LUEA 1IBKK 2QEXN 4C5EA 5CKEA 1CKBA 4M7AF 3G6EN 4BDZA 5CHIA 2I2LA 4RTTA 3CBOA 2ATQA 1YITA 3CMET 4OMMA 3IFRA 1Q82U 5L8RE 3MXIA 4LUDA 5I22A 4MZPA 1C0UA 4DSFA 1NWKA 5DY9A 4II1A 2X9HA 1YAGA 4KRTA 3WQTA 3GPLA 1PSEA 2DTOA 5IH2A 3A8GB 5LJ5g 1Z9ZA 1NLPC 3RBBB 3VS2A 4C8QB 4OPAA 4C5HA 4K8ZA 1S1TA 4DKWA 2RHZA 5GMKi 4PJNA 5I2SA 2P9SB 4CF1A 5I21A 3H45C 3ULEB 2EWNA 2FYKA 4EHUA 1WYXA 2YWWA 2YHXA 3LLRA 3CFOA 4YFUA 2P0QA 2CZ7B 4QQGA 3CJ7A 4CEAA 1GBRA 2CZ0B 2FPEA 1NGCA 1FXXA 3EFSA 3OMGA 4B3RK 3W3DA 1C6VX 2CP0A 2L0AA 4M78B 2P9KB 3MWTA 4RG8A 5E84A 2LMJA 4BRPA 1Y57A 3MAQA 2ZPIB 2NUTA 1QCFA 4M3ZA 2YXYA 4CEQA 4CK2A 4F8RA 2WACA 3RRHA 4AHRA 4LFBK 3EGDB 1WHJA 1O9SA 2JOYA 1UGSB 1N8RC 1RT2A 4CJVA 1M5Q1 4CZLA 3JAME 1IO2A 3LH0A 5LL6S 3NFAA 1YJ9N 2IVWA 4DV5K 3NF8A 1JBMA 3N5BB 5GAOn 5GAOr 4OPKA 4C5IA 5LJ5f 1BL3A 3JRZA 3MCPA 2DFHA 3HI0A 4FLUA 3HP6A 2G8UA 2YRDA 2H3EB 4BRFA 4CHNA 2DILA 2LNVA 3J81E 1YJWN 2DL7A 5AYFA 5C10A 3S3NA 1BHLA 1RT7A 3P31A 4L59A 3VUBA 3V9WA 3I56N 1TGOA 4M75D 1H1VA 3X28B 2VKNA 4C92C 4MO4A 2V51B 3CC4Q 1VQ6N 3CC2A 1EO1A 4DV1K 3I5SA 1I07A 4CZGA 4XTVA 1Q82O 5HKCA 1X6GA 4C92A 5CO7A 1KC8R 5LJ5e 5AQXA 2O01E 4EP4A 1ZBIA 3GNGA 1C6VA 3J7AP 3DXKB 4JD2A 3VGMA 1KQSM 4JPBW 4Y92A 4BR0A 1Y96B 1KHCA 3LP3A 2MPXC 1ZBSA 4CFAA 4X66K 4ANJA 2VWKA 3P8DA 1K9MC 4A5BA 4J6YA 3CCQN 4DHYA 3A5NC 2P84A 5KCHA 3RESA 3G0ZA 1BCMA 5D6WA 1I3AA 1XUPO 1YITQ 5GADP 1RAHB 2R57A 4E7ZA 2RQWA 4CZIA 4JI8K 4HTLA 1QVGP 2IVPA 1N8RU 3VERA 5BR9A 2BH1A 2M51A 3HK2A 4IEIA 3K9JA 2BZ8A 5FPMA 3R8EA 2EKOA 4BE0A 1OH8A 4A2AA 3HL8A 1XQHA 3B6PA 5KCOA 3EKSA 4DFMA 3CCVN 3I0RA 3K58A 3PNWC 3EG1A 3MEWA 3SAFA 4DU1A 5GAOp 1ACMB 2L3QA 1T8EA 3CM5A 4XU0A 3ZSQA 4NCBA 5LJ3g 4JV5K 2LCCA 5KYXA 1IG8A 2JWLA 3I0SA 1TK0A 5CKBA 2ROLA 4LH4A 4LY7A 3OSSC 1ZQ1A 3CCRN 4BRAA 3VQ4A 2QWRA 3QWXX 2HMPA 4BI3A 1XC3A 2DA9A 5CAIA 4J5YA 4YDUC 3QBYA 4WFBL 1JCEA 4C8QF 1G15A 1K8AU 2X4JA 3ENHA 2IPOB 1AWOA 2W41A 5AQPA 4YDUA 3VS0A 4WF2A 5FRNA 2EIFA 4CFCA 1CXUA 2DL3A 3VU3C 2E6NA 2NYSA 4FJKA 4PJMA 5CQYA 3FJ5A 3G6ET 2OPPA 1E6HA 4UC4A 3C95A 4H5NA 2KROA 2HMAA 2RJEA 1VQPN 3CCJN 2HCKA 3L42A 3JCMb 4KAZA 1ZLMA 1LVKA 1QQJA 4M78F 3UKRA 5M9OA 4PJOD 4LFAK 1BIBA 1JLFA 3U9DA 3U23A 3M8PA 1NJXA 3KK7A 4CBUA 1VQMT 2XG8D 2RQUA 3AA2A 1W2BM 1K9MU 2YUOA 2XY7A 1SF9A 2XY5A 5GAGP 3VS7A 2IIRA 1J9AA 3CJCA 5M1KA 2FPDA 4PUOA 4YOUA 5LJ3f 1K73C 2E6LA 2B8AA 2QTXA 2P1JA 4F3OA 1GLBG 1W0HA 2H3JA 3KFVA 3F9KA 1YTAA 3GG4A 1RAIB 4JRIA 4GKJK 2KT8A 2WFBA 4M75C 1NG2A 3P38A 3DLMA 3PX4A 1U2VA 4LF5K 3VGLA 4BY6B 1TKDA 3VQBA 2XDPA 3CC2Q 1D0XA 3KHYA 3I55A 3H3NO 4B9SA 3BW1A 3OYDA 2KRMA 1JLQA 4OMQA 2GQVA 3H3OB 5J2PA 1N8RO 1JXBA 4NCAA 1PNJA 3EG3A 2LDMA 2NUZA 1YVUA 4M7AG 4WQ4C 2HZYA 2YI1A 1ZBXA 1M90R 1SPKA 2GF7A 4FK4A 2AKLA 4B9WA 1KTQA 3TSWA 4WQ4A 2RQTA 1SSHA 1YJ9T 3C0CA 2RJDA 4IEEA 2Z1HA 5F0XA 4JKEA 2VGNA 2QEXA 2YHBA 4ICLA 4JEPA 3THWA 2KXCA 3OYYA 4Z8AA 3SNNA 3INZA 3WXJA 1X9JA 2J05A 4BRDA 3PFSA 4C1NK 3VQ7A 4O6JA 4OB3B 1YJWT 3T1HK 4NYFA 1AOJA 1FMKA 1WQWA 4F04B 1AEYA 4JI2K 1ZX6A 2O9VA 1K8AO 3BFMA 3V9SA 2X4YA 2BANA 1OI1A 1BWFO 3I56T 3OYKA 1OU8A 3OYIA 4O5VA 3JCMW 3LDPA 4ISGA 2V7YA 3A98A 4FW1A 2IVOA 2GBZA 2O4GA 4FSXA 1YJNT 3JB9H 1DKGD 2LJ0A 1VQ6T 1S3XA 3QESA 3VRZA 4H8KA 5C0MA 3BGRA 2KFNA 4GY5A 2NRHA 3G1JA 2I7PA 1VSFA 3MEGA 4EMKC 2QGFB 3CCRA 4PLIA 1UE9A 2XI9A 1K9MO 1NGFA 3FZFA 4M75E 2R7YA 2LJ3A 4EMKA 4FLWA 3AVLA 2G8KA 4DBHA 4QVDA 2EQJA 2LCSA 3I33A 3MN5A 4CGJA 3AVAA 2DERA 4FO0A 2K5FA 2FLOA 4E1NA 3HVTA 1T3LA 3GOXA 5IT9E 2VWBA 4KB1A 1BUPA 2IVNA 5GMKl 3FRNA 4LDVA 1FKPA 4O8KA 4X64K 5I3UA 3VEYA 1BDGA 4QVZA 4CFBA 1G3TA 3DAWA 1YCSB 4ELUA 1NGAA 4M3YA 2DXTA 4HA8A 1T3VA 1KAZA 3NHGA 2KTQA 3SWNC 3M0RA 4X34A 3CCVT 2EW3A 3V7SA 1NEBA 1WXBA 4GVEA 2CGLA 2VG5A 2A1SA 3SQ0A 3KKRA 3SWNA 2MF2A 3NTKA 3L2QA 2ZAEA 4N5SA 2DFFA 3MXJA 4M3WA 1QVFM 1S9GA 2B6AA 2NZTA 4OVAA 4CK3A 3QLHA 4JI0K 1NJZA 1TS9A 2F8TA 4ZGEB 5FWBA 4AHVA 1LAVA 3U3GA 3I55Q 2YNFA 1RAEB 1ZSZA 1RTJA 3E9OA 3D45A 4NL2A 3S41A 2F96A 4JZ4A 4JKBA 1NPPA 1P8ZA 2F5TX 2PVDB 1WGSA 2EPDA 4K11A 1ZA2B 1RT3A 3AHUA 5I9EB 5GANd 5C15A 4GVMA 2PVGB 1JJ2P 2AA4A 1HJDA 5AQUA 1M8MA 4BREA 1AZGB 2EYYA 5EY4A 3CCJT 3QNOA 3DWLA 4NS5A 1NKCA 5EVZA 1J3TA 1J6ZA 1TYQA 2ATCB 2PYLA 2C0TA 1KFSA 1Q86R 3U9ZA 2ED1A 5D7UA 3VQ9A 3M54A 2QEXQ 4XU2A 3KD5E 2K5LA 1VQLA 4A53A 1QQCA 3CCQA 4BRHA 3TU5A 4OPJA 4DA4A 4Y91A 4FWMA 3CXCM 3U4LA 1MDUB 2QK9A 1FK9A 1MV0B 2IG0A 1B34B 1HYSA 3UE5A 2P9IB 1EX4A 5HK0A 5CE3A 4XAXB 3IG1A 2CP6A 4CI0C 2GWKA 3CJ9A 3JB9I 3QFUA 5KYWA 2YHYA 1QE1A 1VSEA 3HTVA 4B8CA 1BI4A 1CZAN 2ENMA 1KHIA 3CBMA 4C92G 1DGKN 4M7DD 3AO1A 3I8DA 3DXMB 4C8QG 3SQ2A 2QYZA 4E19A 3ZETA 2HF4A 2E10A 5C6SA 3JCMd 2GUIA 1NJWA 1TK8A 1J5OA 1JJ2A 3THVA 2DYBA 2MCNA 2DF6A 3CCSA 3T9NA 2RH2A 1KD1R 4Q5VA 5KTQA 1GLJO 4D8DA 3NH0A 4CZKA 3QSUA 2CGHA 1WSGA 4FZYA 4M78G 1VHXA 4LF7K 2VB6A 4WFNL 5AQVA 4BRNA 1YI2N 4KHUA 3K2PA 2YUPA 2QGGA 3VQ8A 1VRTA 2E6MA 2JZ2A 1ZHIA 4R5PA 1X2KA 3BEXA 3SPZA 4DV2K 4A63B 4ILGB 1I81A 2YUNA 2Z1JA 4GV6A 1VQPA 4RTVA 2CH4A 2C0IA 3NGZA 3OQ5A 3J8AA 1HNZK 2DBKA 2A41A 3E01A 4DWIA 3OBYA 1XNRK 3RWUA 1KC8U 1UA1A 4XH4A 1WHMA 2FRYA 5FU7B 2KVQG 3WXMB 4O5BA 3ASMA 1X43A 3ZSOA 1N9SA 1WX6A 2HNIA 1TVRA 3VENA 2OI3A 4RTUA 2BE9B 1EWRA 3O5BA 4B3MK 5TKWA 2O8FA 2EJGA 1HK9A 2Q1NA 4KH6A 3V1RA 3QJ6A 3DLKA 2HNYA 4FPAA 1RNHA 1N32K 4M7XA 3VTHA 3DOKA 1XMOK 5BRFA 1HNXK 4DQQA 5A2QE 2E20A 2Y4XA 1T6DA 1JEGA 4BE1A 2OYQA 3SBGA 1U6ZA 1T7PA 3RR7A 2Z0WA 4M77A 5KYUB 1M9SA 3LPTA 1D0YA 1XWLA 2Q31A 2CDTA 4DS4A 2Q2RA 4PNOA 3V7RA 3F2KA 2HKNA 3WNHA 1VK0A 1I1JA 2OPSA 1AZEA 2ITMA 1RI0A 3SLCA 4BRIA 4DQRA 2GTOA 1NGBA 4DU3A 2I7NA 3SCXA 3H1VX 4CJEA 5AT1B 1WJQA 1M90C 1VQLQ 3CCQQ 3LDQA 4IIOA 3QICA 3AO4A 4DQPA 3CC4N 3CG7A 1BCOA 4ME7A 1JU5C 1RT6A 1M3CA 1A0NB 2HDAA 3D7SB 1M2VA 3QMLA 3NAEA 2YX6A 4DTJA 4N47A 1KAYA 1MA9B 1YFNA 3R6MA 3TVTA 2OCEA 3PE0A 2ZF5O 5HRNA 1SRMA 1EQYA 3MX5A 1I39A 1YCYA 1UDLA 1NMDA 3ITHA 2DRKA 2IC3A 3WEEA 3L2UA 1GFDA 4BD3A 3D2EB 4DF4A 1QMCA 2KY9A 4KULA 2WOMA 1HKGA 3CCSQ 1OX9A 4PKIA 1YITN 3ZBDA 4B1VA 1KC8O 2KQ2A 4BVPA 1PKSA 1YIJT 3LANA 4FJHA 1NM1A 3EE9A 4F7UB 2RO0A 2HHQA 4CIFA 3DLGA 3KIOA 1LCKA 3OYLA 2R5AA 3H9NA 4CECA 1OH6A 5FU6C 2P4TA 5C24A 1HSQA 5E26A 3PIPL 3SUNA 2PBDA 1GLFO 4N41A 3UWNA 3L6QA 2EVRA 2FSKA 4BROA 1L3SA 2EYZA 1QCNA 1VQ5A 2DJQA 5CK9A 1KK7A 3U3YA 4R55A 1WAJA 4OB2B 2L3RA 2P9PB 1KVAA 4N76A 1M90U 2K6DA 4MZMA 3CPWM 1WI7A 4DOVA 2JGUA 3NF9A 5J2MA 4B08A 4B1YB 3VRYA 5GMKe 1MNEA 3LAMA 1S1VA 1M2OA 3MDQA 3VGKA 4KBMB 1ATSA 4BGAA 4CVNE 3HHTB 4A4GA 2QXLA 1QKWA 3EH1A 4M45A 5GJWB 4PL7A 4ZHRA 1BO5O 4AMCA 4E7HA 3R3LA 4FU6A 3V1OA 4KGZB 3LM9A 4PL6A 4OLAA 1NYGA 1H8KA 2F69A 2D0OA 1BQMA 4FL9A 4IZ9A 4H5TA 2HW3A 3SZ2A 1EFNA 1JCGA 2YNIA 4KHWA 2F8SA 2FG0A 4JLGA 3O6WA 1SAZA 3VF2A 3ZX2A 2FPFA 2OPQA 3C7NB 1OOTA 3AGRA 2YHAA 3V8JA 5JLHA 4DV0K 4B9LA 3EGUA 3SMPA 2DD5A 3M9QA 2GFUA 1TTHB 3S3MA 1VUBA 3OW2M 1L3UA 2DJZA 1J5EK 1UWBA 2A6AA 4V19S 1WHHA 2D0BA 3L8BA 3G10A 4OGCA 1D4XA 3CC2N 3DB3A 4FCYA 1EETA 4FIBA 3FZMA 4CEZA 1ABOA 1E6GA 4H4MA 4IURA 3G71A 1Q86C 2IGIA 1VSDA 4AQYK 5F2RA 4H5VA 4E7JA 4M7YA 3EFOB 4I7FA 4KH5A 3UT1A 2QXFA 2HQEA 3SJHA 2XICA 3JCMV 2E5QA 1T03A 3M0QA 3PIOL 2I0NA 3OYHA 2E88A 4KH1B 1TAUA 3Q1JA 4L6V5 1SSFA 3K5LA 4B9VA 3K0SA 2ITGA 1PM3A 3BY5A 4BRQA 4OF1A 2VYPA 1U1SA 1HD3A 3VF4A 3QXEB 1WSHA 3PX0A 1QSSA 3NVKA 4C0ZA 3SQ1A 3TAMA 3EG0A 5T7BA 2WC9A 2FSJA 1YHQA 2HHHK 3T69A 3MKDA 1M90O 1IG9A 1WSEA 2HVHA 3P8HA 4FM4B 5GAMj 1HJOA 3OBWA 1X3MA 3ZEUA 1YWPA 3O80A 4MDWA 3NTIA 4PKHA 1YI2A 5AQZA 2FL7A 1M1FA 3UKUA 1Z6RA 3OYBA 3KK1A 4FLXA 5IXFA 3DLBA 3CETA 3MEUA 1BYMA 3MEEA 2G8WA 3CC4T 2RHXA 2XY8A 2PVOB 1XJWB 3CCEN 1TG0A 4M42A 1OKJA 3VF6A 3NPFA 2DTUA 4OMPA 1JJ2S 4RG2A 5GAMd 1VQ5Q 2B4JA 4CGFA 4C8KA 2EX3A 4LF8K 4EZ9A 2GTDA 2OA8A 3D2FA 3FFIA 1FKOA 1D0ZA 2A28A 4BQLA 1RABB 2DX1A 5HRSA 2G8FA 4AFUC 5CR2A 4LE9A 2O4XB 3VQ5A 4B8AB 4ATOA 1MWKA 3OYJA 3ASKA 1U47A 2RPNA 1GCQC 1Q86U 2E1ZA 4B9MA 1YITT 4M7AC 1OVQA 1UGQB 1GL5A 3PO5A 1EWQA 1VQNN 2VASA 2O8CA 2E3HA 1GCQA 4J7IA 2FBVA 1NGJA 5KYYA 4Z4HA 1VIFA 4M7AA 1GLEG 4FWNA 1PSFA 3VEVA 2KKZA 2J6KA 4X9DA 3GP8A 2FF3B 2OJ2A 3QHSA 3LP2A 3G7ZA 1IXDA 3IUCA 2KBTA 4F17A 2E2OA 4Z4EA 1WHGA 3UF4A 3ZT0A 4DEYA 5GAN2 4LFCK 3K9KA 2D1KA 4CEFA 5JS2A 4EP5A 2HHWA 1UGRB 2AZSA 1JLGA 5JMVA 2F2VA 3M8RA 3SYZA 1KRPA 2LT4A 4BRMA 1R8OB 2EYQA 2HKQB 1SKUB 1KD1U 3DRSA 3HYFA 2CT3A 2DRMA 3I55N 4XTZA 2HBWA 1CSKA 4C92D 3QUIA 3JCMh 3DI6A 3G71Q 2P0PA 4OP0A 4U67L 1C1AA 5AJ3K 4B1UB 3ZT3A 4FT4A 3JB9F 3O9UA 3HSBA 1CZ9A 1WBDA 1VQ7A 2P9UA 1N36K 1U1TA 2E6ZA 1OEBA 2E4LA 1D09B 5ECAA 5GAN6 4M77G 1QQOA 1HX1A 2CKKA 1XC9A 2O31A 1NLOC 3CMAN 4FLTA 3VA0A 2KZZA 1NGDA 5AQYA 6AT1B 4E3SA 1U3OA 5HY6A 3NTHA 3QERA 3NH1A 2ZD1A 5C25A 4CJRA 1WLPB 2E4HA 2LP5A 5LJ5j 3M57A 2E41A 4ELTA 2GFAA 1YNZA 1IBMK 3SJJA 2YSQA 4ORZA 1RTIA 1TUGB 3PTAA 1YHQQ 3QINA 4M7AE 4Q0BA 4AHTA 3HM8A 1K0SA 3RMDA 3SQ4A 2DTIA 4JN4A 1LV5A 4IJNA 4FYXB 1YI2Q 2VXFA 3TABA 1ARKA 1AWWA 2BTFA 1W1FA 1X6OA 1LW2A 5AZIB 1EKEA 4CD3A 1Q86O 5J1EA 1RLPC 4OMNA 3CC2T 3BF1A 2XHBA 4JKGA 3TQ7P 4A62A 5CKFA 4LDWA 4ESRA 2O8EB 5EX5A 2BGGA 1BISA 5CQXA 5GMKh 1RACB 1T3SA 3GL1A 1PKTA 1NE8A 3QEPA 4RW9A 4KB0A 1SUQA 4MZTA 2E2PA 3RMSA 1ZBLA 1RUWA 2XU8A 3ISNC 1NK7A 5GIOA 1OH7A 3FIFA 3O9RA 3VQCA 4RWTA 2DNUA 2FXUA 1ASWA 3MECA 4B9UA 3BZCA 4JRQA 3R9PA 2A3LA 1VQKA 2WSFE 5M1NA 2PZSA 2COYA 4FT2A 4HUFA 1WSFA 2KGTA 4IUQA 4DSKA 4CC3A 4AM7A 3AA4A 3KLHA 4E89A 1BBZA 3FZKA 1N5ZA 1KD1O 3TCJA 4CEBA 5KPTA 1OH5A 4D8KA 3GBTA 2ETJA 4ZGDB 3JB9J 3Q7CA 1C0GA 2X74A 2RK2A 3HM9A 3MCAB 3KD1E 3SUOA 1BOTO 3AA5X 5HP1A 2XMFA 3HTRA 3TR8A 3RSEB 2AKKA 2CP3A 3W0LA 3LAKA 3OVNA 2DVJA 2A3ZA 2J06A 3NGYA 2YNGA 2DBMA 2KRSA 2JTEA 1QKXA 2M1HA 3M53A 4JRPA 1BU6O 4C0DB 2RHKA 3V6DA 1Y0MA 2QDYB 4DF8A 1XNIA 4DOWA 4IG3A 2YHWA 5AQFA 2KDSA 2E1YA 1QVGM 4RCBA 1K8AC 3AVJA 5IN1A 3LDSA 1MHNA 4OB1B 1UG1A 4C8QC 3G25A 3SI6A 2UUBK 3OYMA 4FWSA 3TAGA 3SK3A 3LWMA 3OS2A 1K76A 1QLYA 2K3BA 1VQ7Q 1YVNA 1PRLC 2WONA 4QKUA 2DO3A 4C8QA 3HSTB 4A5AA 1SRLA 2DZCA 2GNCA 1MUZA 3SFMA 4A61A 3OY9A 4CJ5A 2GEMA 5IHKA 2BUPA 2FF6A 2P9SA 1IO6A 2P4RA 1GOAA 2K3XA 3VS6A 3ULEA 4F4KA 1NK8A 4CJ4A 4M78C 1WXUA 3QWYA 3RNJA 3PGGA 5AZJB 1VQLN 4BC5A 4IWVA 4DS5A 1BI2A 2HL3A 3HRSA 4M78A 3QBWA 4JNEA 2P9KA 4F2SA 5CYMA 3TREA 1WDXA 2PU9B 1VSHA 2DKGA 1X9MA 2VVKA 3ER0A 3LWHA 3A5OC 1WQ7A 5LJ3j 4EIAA 3HVRA 5JS1A 1OU9A 5HLFA 3DB4A 3RR6A 1AVZC 4PFZA 3TAPA 3EGDA 4F7UG 2EKHA 3CHWA 2RF2A 1JLAA 3TWHA 3CCMA 3EFRA 1XHZA 2LVMA 3AGKA 4FWPA 2GCXA 3ENOA 5J39A 1R0BG 5LJ3d 2RHYA 3M0UA 2DPNA 4C0FA 3NGIA 3CCSN 3CCEA 4LDYA 2WUSA 4CD1A 4J83A 2IS3A 3J7YP 4J2EA 4DTSA 1Q81O 2W6LA 1JRIA 2CP5A 1RAFB 3AVBA 4N56A 4E2FB 1QHAA 1GCPA 1VQ4N 3EN9A 2PZ1A 3VQAA 1NM7A 3ZFJA 4M75B 3HOTA 1M1GA 4C92E 2DYIA 2LC4A 4J9DA 1VQKQ 3UB5A 2QEXT 4C8QE 1VA7A 1WBBA 3F9MA 2FBYA 3J80O 3ENBA 2RNAA 3TI0A 1VQOA 4HCKA 4O0JA 1HKCA 3PO4A 4GKKK 1NZ9A 3G4SA 1VQNA 2P0KA 3EGXB 4CJPA 3EG9B 4V2SA 1BGXT 1B9FA 3MO8A 3AVKA 1X27A 3I9QA 3T1AA 1E4GT 3DXKA 2W0ZA 3TSZA 4MDBA 3QZ5B 5D6XA 1BI3A 4M78E 1SZ2A 4I6MB 1GLCG 3UDCA 4AFZC 1X2QA 1Y96A 2DLPA 2K79A 5HROA 2YV0X 2E64A 1M4ZA 4IJAA 3O3GA 2YRCA 3KK2A 5LMNK 1WB9A 1H641 1HXDA 3CYMA 4CIGA 1LPLA 3JB9G 3DMJA 2YCHA 3HRGA 3CCRT 4H5WA 5TKYA 1WNSA 2RQRA 1VSMA 3M0PA 2DL8A 2PUOB 4F14A 1VRUA 2A40A 1PD1A 3FR0A 4IOXA 3MXMA 1WJRA 2ZPBB 4G1QA 3WNFA 1NJYA 1O75A 2DEQA 3WXIA 3UATA 1ESVA 1H3HA 3AVMA 1XNQK 1WOQA 3IRXA 2AK5A 4JI6K 2M02A 1P92A 1ZYQA 2EQUA 1MGQA 2CH4W 3C12A 4O8UA 3PSIA 2DPPB 5AFUA 1QCOA 1B9DA 3CMAA 4FW2A 4AHCA 2GQIA 1SQKA 5LY3A 3F70A 2QQBA 4DR5K 4KI6A 1JQQA 4C0GA 1D8YA 3E19A 3J7AF 4FJXA 4CZEA 3VUZA 1YXQA 3FLCO 3EEQA 1I8FA 1SKSA 1TSFA 2EQIA 1W2BP 3FB9A 4WQ5C 3SBTA 2ZJPL 3CCMQ 4PJOB 1OVYA 3MEVA 4M3RA 1LWEA 4BR7A 3EKUA 3TAEA 1Q9XA 4WQ5A 2UUCK 1UJ0A 4E0DA 2XRIA 3CCEQ 5GJVB 1WNLA 4AHUA 2HSTA 3M8SA 1NYFA 4L5GA 2NUBA 4JKFA 3M59A 2DL4A 2O2OA 3SB2A 2OTJA 1OX8A 1IBLK 1VYUA 3VEZA 1XI1A 3L2ZA 3GOIA 2YT6A 1QP3A 4BY6C 1ASVA 3E9LA 1Q7YR 3MWPA 1M1KO 3HO1A 1NU0A 2W40A 4LC9B 3HP9A 1UOCA 4CF8A 3T1YK 1VQLT 3C6UA 1Y7XA 3CCQT 1RBSA 2K2MA 4B1WB 2BE7D 2VUBA 2NLXA 3C94A 3VESA 1Q9YA 4PQUA 1VQOQ 1A5VA 1OPLA 3G4SQ 1VQNQ 1RBRA 4TSXA 4CJ7A 4CJWA 1O1WA 2HHUA 2FO0A 4CRIA 1VQ5N 2KEAA 2EGCA 1W2BA 2P9NB 4M75F 3QDFA 4J9BA 2VXEA 4IIMA 4CJTA 5JVGL 1ATRA 3IMXA 5HL7L 2LJ1A 4DTRA 2I5JA 2CREA 4NL3A 3VN5A 2RF0A 2VYTA 1LOTB 4M4ZA 5FW9A 4Y1CA 5SWMA 2W6KA 3EZ5A 1QQNA 4KHSA 4YOVA 1SV5A 2P5OA 2HBLA 1WIEA 2ZCFB 2L8DA 4FPBA 3V81A 5EXWA 4IXCA 1NBEB 3CCST 3QIIA 4DQIA 4KH4A 1KQ2A 4ID1A 5BR8K 1ZSZC 4CZJA 2G8IA 1JL1A 3UPUA 4QAGA 4M77D 3CIPA 4EAHD 4CBXA 4FWQA 4CIEA 2ZPEB 1VIEA 4QCLA 5H1SQ 1NGIA 2E8AA 4IUVA 1QS4A 3FE1A 2E2NA 2DY4A 1JO8A 5LJVA 4JRKA 2A08A 4LF4K 1VQPT 4BC4A 3T19A 1CXQA 3O9TA 3CMAQ 2V8JA 1KC8C 4B3OA 1RDBA 1JLEA 1EIFA 3HBTA 2HMIA 4IDKA 1RT4A 4DUYK 4PK4A 4I2PA 4HVWA 3FJPA 1C1CA 4LD9K 3RMBA 3G71N 3AVIA 3QDKA 3RIRA 3O9QA 1RT1A 3HOSA 4BR4A 3IQLA 3O5ZA 1X75C 3LH5A 1HYZA 2B5JA 4JLHA 4DTPA 1VSJA 1JLCA 5GANg 2F9TA 5AQKA 1PHTA 3VYGA 2FEIA 1NNEA 4FOIA 2NRZA 5ADXA 3SAHA 1SHFA 3O4NA 2DL5A 2ASMA 4E1MA 3QEIA 4FLYA 3M3ZA 3JV3A 4DR6K 1CLQA 2O8BB 3E1SA 1QWFA 1HPZA 1VSLA 2YUQA 4CF0A 1F1BB 4C1NI 1ABQA 4MMKA 2OTJQ 4C8NA 4BDYA 4GMJB 1GOCA 3VPZA 1XTDA 4JK8A 1YHQN 4PJOF 3RR8A 2ZWHA 3AO2A 4CC7A 1VQ8A 1NOZA 3LW5E 3D7EO 4YY3K 1VQ4A 1RCHA 4X1VA 1VQMQ 2E2QA 2J6FA 2P9LB 3ATUA 3MN6A 1FMWA 4WFAL 2ZJQL 2RQVA 2CS7A 2ZGYA 2KMTA 2NUPB 3V8KA 2O8DB 1N5YA 2YLBA 3PMTA 4ZN3A 1U49A 1G5VA 3IAYA 3HFNA 4IO8A 2KQWA 3JCMg 1HNIA 5KH6A 3PY8A 5JVHL 4UY8O 3VQEA 2YJEA 4KTWA 1DLOA 2DMOA 2DFEA 4BWMA 1RDWX 3CF5L 4DV3K 2QG9B 4RUGA 1DTTA 4FK0A 3AO3A 1VSIA 2DAQA 2V1RA 4B9QA 5C12A 4YOXA 1OULA 2FHDA 2RJFA 3JCMc 1QVFA 4DBQA 1MNDA 1QWEA 4CJFA 1XOVA 3T7ZA 2QK0A 3M4YA 5J2NA 2F4VK 1VQ9A 4ZNXA 4DTOA 5F1XA 3TANA 4XU3A 1HNVA 2XD0A 2WBNA 1B34A 4DUZK 4M77C 2P9IA 2KW4A 5E41A 3QZ9B 4IKFA 1ZSGA 1TKXA 1V76A 3A0IX 4DTXA 3CD6N 2L5QA 2RPIA 3DRRA 3EH2A 5GIPA 2YJFA 5GANe 7AT1B 4XK8E 2HNZA 4A59A 1ZBJA 2AHJB 4AG2C 4M7DB 1ASUA 1V4SA 4YOTA 3IDHA 4JS5A 2NNWA 4DR2K 2QQRA 3DXMA 3V9XA 5FLXO 3TTCA 4R79A 1FWZA 4X9CA 4Z88A 3M56A 1U8RA 3HKSA 1F21A 3HRUA 2HL5C 4PKGA 2PAVA 2XHCA 1VQ5T 3RMCA 4ZN1A 2Y1JA 3H0FA 1J53A 4OO1J 3PVQA 2VG7A 3CXCA 1NGGA 2BZYA 3E9PA 1X6BA 2EQKA 3VS3A 1YJNQ 3VEWA 4DMNA 3CCLN 1RDDA 3ZSVA 2HSPA 4KHPK 4OB0B 3HPGA 4KREA 4NOYA 1VSKA 4DBFA 3LZIA 4QQDA 5DM7R 1VQ7N 1OV3A 2FZCB 1Q81R 4NXMK 4U7BA 1KQSS 2K57A 4Q5WA 3K5NA 5DM6L 3ULDA 4Z94A 4E6RA 4OKKA 1YN8A 1NPRA 1KJWA 5CKHA 4IFYA 3CPEA 3JCMe 5FU7C 3ZSYA 3J7ZO 1Q8IA 3K5OA 4FYDA 3LM2A 1WHKA 4QS8A 4PKCC 4CJKA 3WUHA 4VUBA 4BB7A 4N4IA 2W10A 4WCEL 2EJ9A 1WN7A 2G8HA 4BGBA 1M27C 4CC4B 2X3WD 3CQXA 4DBRA 2OTLA 4KH0B 3LPUA 1RTHA 4K8XA 1VQ8Q 3MP1A 4M77E 1AHJB 3VJPA 1VQ4Q 2ASPA 3M1FA 5AR0A 1WJSA 1RBTA 1R59O 4DLGA 2VG6A 2RI5A 4FYYB 3QO9A 4LSNA 5HK3A 4BR9A 5AQSA 4XTUA 3QBXA 2MWOA 4NLBA 3OYNA 4AF1A 3HXMA 4GLMA 2LCLA 3CC7A 3G71T 5KYUA 3LP1A 5DM7L 1S72A 2OZSA 1DJ7B 1GLLO 1GFCA 4CHPA 4CE9A 3THYB 2E5LK 3BZKA 4CHOA 4M3XA 3ZSZA 4FVUA 3ME9A 3DLLL 5BN8A 4HHTA 5IWAK 1NK4A 3OYFA 2L89A 4FWOA 4B9NA 4PJJA 1BI1A 3MPUB 4KFBA 1VQKN 4FZZA 1D3BB 1RBUA 2EYXA 2JWKA 4JKDA 2D8HA 2F2WA 1VQ9Q 2V7ZA 4ELVA 3THXB 4M7AD 2Y1IA 4JHDB 1YHQT 3P83D 3C65A 2UU9K 4AG1C 4CZMA 1DEJA 1VAZA 4IO9L 1W2BS 1HR0K 4B9XA 1Q18A 2CGKA 4QS9A 1K4US 1RAGB 4CGDA 1YI2T 4OGEA 4XIUA 5I11A 2KAFA 2FRWA 2RN8A 1S1NA 4FJGA 3HPOA 2ZQBA 3D2EA 3CBPA 2E5KA 4XH5A 3SUPA 1ZUKA 4JJNK 4IUPA 4LH5A 1NLVA 3WXLA 1TK5A 4IBNA 1NGEA 3L2WA 2K5IA 2ZPGB 3EHRA 4LNPA 3H6EA 2AIRB 3OJSA 4L8RB 2HVIA 2HHVA 4M7DF 1W97L 2VC8A 4HKEA 1LWFA 4O0IA 3LX7A 3CCUA 4F7UA 1WFWA 2SEMA 4J9GA 1N34K 1Q7YU 3V8LA 4BY9C 5GAEP 4D6WA 3CI5A 3GNFB 2JW4A 4JS4A 4ILHA 2ZPFB 4TVRA 2HOEA 3ULRB 4YOYA 4DG1A 4K42A 4KT0E 3VKIA 1JCFA 3A5MC 3JXUA 1M1KR 4CERA 3KLEA 3D0PA 1NKBA 3PMIA 4PJOG 4FZXC 4F16A 2GV9A 5KPZA 4J2AA 3MEDA 2DETA 3JSCA 3JCMJ 3CPWP 1RILA 1S1XA 1Y97A 2FBTA 4FOEA 5DLQE 3WVEB 4H0TB 1SL2A 1D5AA 2ECZA 1G99A 3FDRA 2F9WA 1JLBA 2P9PA 4MQ3A 4OVLA 3PX6A 1C0TA 1QW1A 4HVUA 4E1JA 4QT7A 1K8KB 4CGGA 5GAOm 3M6GA 2OTLQ 2D0AA 2HNDA 4KI4A 3ZSXA 3WNEA 1JXEA 5M1FA 3AV9A 5K14A 2QWPA 4A4HA 1DT9A 1V4TA 3VQPA 1RDUA 1KD1C 3CERA 3DLRA 1JB0E 3CCMN 2Z1GA 1QHTA 2NRTA 3AT1B 4XH1A 2E1HA 4LXCA 3GIBA 1ITGA 4C5GA 4HT9A 3CC7Q 1KVCA 4FXDA 4K41A 2VQFK 3I35A 3H6ZA 5FRMA 3MMVA 4OKEA 2K4YA 4AFQC 1S72Q 1VQ7T 5KQDA 4BG8A 1NGHA 4A57A 3C7NA 4C8LA 4F7UE 3CPWA 1G3YA 3E9GA 3E9FA 2KSSA 3P39A 2O9SA 4OMFB 1HKBA 3EE8A 3KLGA 2V8KA 3OB9A 1NBWA 2YDLA 4Y28E 2DD4A 4A4KA 2AT1B 5GANh 3FZLA 4ISEA 1VQON 5JLFA 3G4SN 1SL0A 4FJ5A 2HBMA 3VOVA 2V52B 4B3SK 5BRHA 3HT3A 4GNIA 1C0FA 2W42A 1HJRA 4M3UA 1NMNA 3C0BA 3TPQA 3CD6A 3JS6A 3EFOA 4GV3A 1W9HA 5GAN8 2OAUA 3OSVA 1Q7YO 3FC3A 4R56A 3CPFA 3GE1A 4O5FA 2RE2A 3EZWA 4OPHA 4J6XA 5KGXA 3EY1A 2H3GX 3A2FA 3OW2A 1QVFS 1IKYA 4XTWA 2CZ6B 2A1RA 3BUZB 1OPKA 3VTIA 3NDKA 3GLXA 1TU0B 2HEQA 4CHQA 1YUWA 3KJVA 3CCUQ 5L23A 2ZE2A 2SRCA 3TSPA 1K73R 1FYNA 1W6XA 4C8QD 3CCLA 1V1CA 3BE3A 1VQKT 1JL2A 2EYWA 3QPHA 2ZJRL 3A8OB 3U6FA 4FYVB 1CKAA 1NK9A 4LF6K 1OZ3A 2D0CA 4ID5A 5FPNA 4B1ZA 4J7FA 1RT5A 4JI7K 2PUKB 3AY9A 1QSLA 1N27A 2JVVA 1YIJQ 2NLUA 3V9UA 2HF3A 3ZSRA 5J2QA 1Q81C 3H0HA 1TOVA 4M78D 3VS4A 2NUTB 1LWCA 1T44A 3NE6A 3PIPA 2RMOA 3EG2A 3CXCS 3O1WA 3PUFA 2KNBB 1REVA 1WLJA 4J9EA 1P90A 4KGXB 3BDLA 1GOBA 2O4XA 2IAJA 2Y4YA 4RTXA 3HZ6A 4OX9K 2KYMA 4Z0UA 1RLQC 4FJ8A 1YP5A 1BQNA 4C8MA 3WVDB 1RBVA 1D9DA 2F2XA 5LJ5d 4J8OA 2COZA 2D5RA 3AARA 2JN0A 2D4WA 4BG9A 4RW6A 1XQSC 3LL3A 3U8XA 1QSYA 5GAMe 4RCHA 2KXDA 4B6MA 1C0MA 3RKYA 3KVGA 1M3AA 2GGRA 1JXMA 2JM8A 2QKBA 3A5ZB 2E12A 3L0QA 2OAWA 4ILJA 2OTJN 2PYJA 2QA4A 4MDAA 1I4K1 3VMFB 3ZEHA 1FX7A 3OS1A 4DB3A 1J54A 3QEXA 4DSIA 1S6PA 4NCGA 2AJQA 3RMAA 3QJYA 1GBQA 2DM1A 4CGIA 1VQMN 4GW6A 5BREA 4J9HA 4JAXA 4FVMA 2WSEE 2H8HA 1KAXA 1TUUA 2QWNA 2ESWA 2HQHA 4C92B 3A1PA 1VYTA 2ZGWA 4YNQA 4EMHA 3DRPA 2DFUA 3QYHB 2KHOA 3MX2A 5C2FA 4JD2B 1IV0A 3HPWA 3ATVA 3P1GA 1TKZA 1HPMA 1CZBA 3FLGA 1K9AA 3CD6Q 3GBQA 3K59A 2X3XD 1Q81U 2JLEA 1IZ6A 3R6OA 3BDPA 3CCMT 2VQEK 2XY6A 1TH7A 4JKCA 4BUGA 4M7DG 4MFBA 1KLMA 1AWXA 4KKOA 3VEXA 2V26A 5GAN3 1KQ1A 1Y64A 3V7CA 4RTWA 3N4PA 1W7AA 4FJ9A 3CCET 2ZPHB 3PIOA 3B8AX 2RD1A 2GTJA 4CC2A 3REBB 3OYEA 3J80E 1A5XA 3C4SA 4CZFA 3V9ZA 2JTFA 2P51A 3V4IA 1KSPA 3IKMA 1TV6A 1NJIR 4AFSC 3TARA 4LF9K 3M58A 3CCLQ 5KYXB 3MK6A 4DSLA 5GAN7 2FBXA 2X35A 4JZ3A 5AZIA 3NMZC 5CVIA 5AQQA 1FW6A 3FFKB 4FM2A 4MO5A 1VQOT 1W4SA 4E7KA 3CQTA 3G4ST 4FSSA 1FMVA 2DZ9A 3CMEA 4BACA 1VQNT 1BG3A 4HUGA 4DR1K 2O8EA 2YRVA 4DTMA 1WPYA 4XTYA 1PWTA 1RAAB 2QWLA 2KLAA 3LDLA 4HT8A 5AQJA 3TSQA 3ZLJA 2JXBA 4AILC 4PWDA 1M3BA 3QETA 2UXDK 1M1KC 1I5LA 3DKMA 1YJNN 5GAN4 1B92A 4CF9A 4PFOA 1X9WA 4EDUA 3NH2A 2C06A 4RTFD 1BB9A 1K1ZA 3UKRB 3H0IA 5GAN5 4JYAK 4X65K 3AO5A 2PNIA 4EPCA 1WUAA 3R1XA 1IGQA 4QS7A 4CJ3A 1SKRA 2JS2A 3SHWA 4M63C 3DM2A 5AQWA 1LAWA 1NK6A 4JUVA 4BI4A 4XU1A 3KWGA 3KUFA 1KG1A 4NLCA 2CZ1B 1PRMC 1T0JA 1KFDA 3I55T 4FJMA 5AQRA 4A4FA 3ZL7C 3MN9A 2OPRA 3TSUA 3TAFA 2CH5A 1MMDA 1S6QA 1ZUYA 2RK1A 3FGUA 3M5RA 2YHTA 4E7IA 4KO0A 3RSEA 5SZTA 3ZX3A 4FM1A 4C0DC 2Q3SA 2QA4Q 3OS5A 3MJXA 3AVFA 1U2VB 3CFPA 1HLUA 1VQ8N 1ILYA 2VCPA 4BRCA 3CMAT 5CYQA 3B6OA 2CSQA 4PFPA 5AQIA 2FZGB 2M16A 2QDLA 2VGMA 4KTZA 3LYIA 4KHNA 4LD6A 1M30A 1D1CA 4GLKA 2CUDA 5CY4A 3R6NA 1N9RA 2K9GA 1HMVA 2DXCA 1KQSP 3JAMO 2JT4A 2M0YA 3A8YA 4QQ6A 2GELA 5A0GA 4CBWA 2CT4A 2E3IA 2IDOA 3L3VA 1X1PA 4A54A 5FROA 3E2UA 1R0AA 5BPMA 3S9HA 3QNNA 4LN2A 4C92F 3CPWS 1RDAA 3THWB 2J7IA 2L2PA 2YKNA 2QWMA 1M1KU 3J81O 3QEWA 3ZCMA 3AVCA 1UGVA 3NHNA 5AZJA 1SHGA 1IB8A 1IKXA 2JS0A 2UXBK 4W5OA 5IHIA 1VQ9N 3O4WA 4CHZA 2CUBA 4W5NA 1QVGA 1KVBA 2OTJT 1UFFA 2MOXA 3PLAA 4ZTFA 4DFPA 9ATCB 1IRXA 1S5JA 2PFUA 4AHSA 3M55A 4JI1K 3LGFA 1U5SA 3LDNA 4CJUA 2L3SA 1TUCA 5IAYA 4Z02A 4RW4A 1Y07A 2G8VA 3O8VA 4DSJA 4CFDA 2EGAA 2HHSA 3VS1A 1KQSA 2LQWA 3L3UA 4KUDK 4B1XB 3QKJA 4KGVB 2HSEB 1UTIA 3CMEQ 1QP2A 1T0HA 3GF5A 2NRWA 4H4OA 4DFJA 4G9ZA 1MV3A 2LTOA 3OW2S 3L1AA 3CJBA 2K7AA 4GBQA 4DQ2A 5CZ1A 2HBKA 4JI3K 4QW2A 4OMOA 4EMKB 2RI3A 1HYVA
chains in the Genus database with same CATH topology
4DSEA 1UWBA 4ZTJA 3IAYA 3O4QA 4HUEA 1HNIA 3PY8A 2D0BA 4CF1A 3L8BA 3G10A 4OGCA 3VQEA 1D9FA 2G8VA 4YFUA 4KTWA 1EETA 1DLOA 3CFOA 4CHYA 4CEZA 4UQGA 4FCYA 3O3FA 4CEAA 2DFEA 3AA3A 3KLIA 4H4MA 4Y1DA 4BWMA 2IGIA 1VSDA 1TL1A 1FXXA 1C6VX 1EXQA 3KKSA 5CZ2A 1DTTA 4FK0A 1U04A 4RG8A 3MAQA 4E7JA 3AO3A 1VSIA 4I7FA 2QXFA 4M3ZA 4CEQA 4CK2A 1T03A 4CJFA 4F8RA 3WNGA 3OYHA 4W5TA 3RRHA 4AHRA 5J2NA 4FJJA 4DTOA 1TAUA 3TANA 1HNVA 3K5LA 4B9VA 1RT2A 2ITGA 4CJVA 4FJIA 2Z1IA 2KW4A 5E41A 1IO2A 2YKMA 1TKXA 4IKFA 3NFAA 4DTXA 2EHGA 1UAXA 3PX0A 2RPIA 1WSHA 3NF8A 4O4GA 1QSSA 3DRRA 3SV3A 3SQ1A 3TAMA 4OPKA 2FC0A 5T7BA 3TAQA 2HNZA 1BL3A 4Z4IA 1ASUA 2DFHA 4FLUA 1IG9A 4JS5A 3HP6A 1WSEA 2G8UA 2HVHA 3V9XA 5KI6A 4CHNA 4Z4GA 4EZ6A 2A1RA 3KK1A 4FLXA 3L2VA 1F21A 3OYBA 3DLBA 3MEEA 2G8WA 3RMCA 3S3NA 1BHLA 1RT7A 4FJ7A 4KHQA 3V9WA 2Y1JA 1J53A 1TGOA 2XY8A 3LP0A 1SKWA 4HCCA 2VG7A 1ZBUA 4M42A 5HRRA 2DTUA 4DLEA 2B4JA 3ZT1A 4DMNA 2PY5A 4CGFA 4C8KA 2EX3A 1RDDA 3ZSVA 3KLFA 4EZ9A 3HPGA 4KREA 1MU2A 1VSKA 2OA8A 3LZIA 3FFIA 1FKOA 2HHTA 1YT3A 4EP4A 3K5NA 1ZBIA 1C6VA 3ULDA 5HRSA 2KFZA 2G8FA 3VQ5A 4OKKA 2X6NA 4B8AB 2RN2A 3OYJA 1U47A 1BIUA 4IFYA 5DMRA 4B9MA 3LP3A 3ZSYA 4CFAA 4CEDA 3PO5A 1Q8IA 3K5OA 4FYDA 2VWKA 3AVNA 4KTQA 4CJKA 4CCHA 1BI4B 3CQ8A 2FBVA 4Z4HA 3G0ZA 1BCMA 1I3AA 1TAQA 4PY5A 1WN7A 4CF2A 2G8HA 3LP2A 3LPUA 1RTHA 3HK2A 4K8XA 4Z4EA 1RBTA 4BE0A 4DLGA 2VG6A 3QO9A 3B6PA 3HL8A 4LSNA 3ZT0A 4HCBA 4DFMA 3SV4A 3I0RA 3K58A 4EP5A 4CEFA 5JS2A 4DU1A 2HHWA 3OYNA 3HXMA 1T8EA 1JLGA 4W5RA 3V1QA 3M8RA 3CM5A 3ZSQA 3SYZA 3AVGA 1KRPA 4NCBA 1TK0A 3LP1A 3I0SA 1NK0A 4FJLA 3DRSA 3HYFA 3M8QA 4LH4A 4LY7A 2OZSA 4CHPA 4CE9A 3VQ4A 4CHOA 3DI6A 3ZSZA 4M3XA 1C1AA 4OKJA 4BDPA 3ZT3A 4QOZB 4HHTA 1CZ9A 1G15A 1NK4A 3OYFA 4B9NA 4KFBA 2E4LA 5FRNA 4FZZA 1CXUA 1RBUA 1XC9A 1YTUA 4FJKA 3VA0A 2OPPA 4ELVA 2KZZA 2Y1IA 3C95A 4E3SA 1KLNA 3QERA 3P83D 3KK3A 3NH1A 2ZD1A 5C25A 4CJRA 3DLHA 4KAZA 3IS9A 1JLFA 4IFVA 1NJXA 3M8PA 4ELTA 1SL1A 4CGDA 3QINA 3SJJA 1RTIA 3AA2A 4OGEA 4XIUA 4Q0BA 3DYAA 2XY7A 2XY5A 4AHTA 3S3OA 3O3HA 3RMDA 3SQ4A 1IHVA 1J9AA 1LV5A 4FJGA 4PUOA 3OYGA 3HPOA 2ZQBA 2BE2A 2E6LA 4CEEA 3SUPA 3TABA 3QIPA 1LW2A 2P1JA 4F3OA 1W0HA 1EKEA 5J1EA 4LH5A 4I2QA 3F9KA 1YTAA 1TK5A 4IBNA 2XHBA 3L2WA 4KHYA 3OJSA 3PX4A 4L8RB 2HVIA 5C42A 2HHVA 1LWFA 4LD0A 4O0IA 1TKDA 3VQBA 2BGGA 1BISA 4B9SA 3OYDA 3QEPA 4RW9A 1JLQA 5J2PA 1SUQA 4KB0A 1ZBLA 1JXBA 3ISNC 1NK7A 4NCAA 1YVUA 4JS4A 3VQCA 3MECA 1EP4A 1ASWA 4DG1A 4B9UA 4FK4A 4JRQA 4CK1A 3D0PA 2PZSA 1KTQA 4CERA 3KLEA 4FLVA 1NKBA 3HPHA 4FZXC 4M3WA 2GV9A 1LW0A 4J2AA 3MEDA 4HUFA 1WSFA 1RILA 2Z1HA 1S1XA 1Y97A 2FBTA 1L5UA 4DSKA 4Z4FA 4FLZA 3AA4A 3KLHA 4E89A 1SL2A 1D5AA 2HHXA 2KZMA 4MQ3A 4OVLA 1JLBA 4ICLA 2YHBA 3PX6A 4CEBA 1C0TA 3SNNA 2ETJA 3ZSWA 4CGHA 1WAFA 2X74A 4CGGA 3HM9A 2D0AA 2HNDA 3SUOA 3VQ7A 3ZSXA 3KD1E 3AA5X 2RKIA 5HP1A 3WNEA 1JXEA 3QIOA 4NYFA 3AV9A 3TR8A 5K14A 4WE1A 1N6QA 1S1UA 1TKTA 3LAKA 3V9SA 3OVNA 4FK2A 2BANA 3VQPA 3NGYA 1L3VA 3OYKA 3JYTA 2YNGA 3DLRA 3OYIA 2Z1GA 1QHTA 4FW1A 4JRPA 1HQUA 2GBZA 1ITGA 2O4GA 3V6DA 1KVCA 4CJQA 4J2DA 4DF8A 4FXDA 2VWJA 4IG3A 1C1BA 1K6YA 3VQQA 3QESA 5FRMA 4OKEA 3AVJA 4H8KA 4AH9A 3BGRA 2KFNA 1VSFA 3MEGA 1HQEA 3LDSA 3SI6A 1S1WA 3OYMA 3T3FA 4C8LA 3TAGA 3LWMA 3OS2A 3HJFA 3PV8A 2WONA 2R7YA 5KGWA 3HSTB 4FLWA 3KLGA 3OY9A 4CJ5A 3AVLA 2G8KA 4CGJA 1GOAA 3AVAA 4F4KA 4BWJA 1NK8A 4CJ4A 1ZBHA 4E1NA 3HVTA 4KB1A 1SL0A 4FJ5A 3ALYA 3HT3A 1FKPA 4DS5A 5I3UA 2W42A 1HJRA 4M3UA 1IHWA 4F2SA 4CFBA 5CYMA 1WSJA 1VSHA 1X9MA 4ELUA 4M3YA 4DU4A 1W9HA 1HYVA 1RDCA 3HVRA 3NHGA 2KTQA 5HLFA 5JS1A 5EU7A 4Z4CA 3TAPA 5KGXA 3NCIA 2VG5A 4KV8A 3EY1A 3A2FA 2A1SA 3SQ0A 3KKRA 2RF2A 1A5WA 1JLAA 3NBPA 1IKYA 3L2QA 3TWHA 4M41A 4N5SA 2DFFA 1XHZA 3MXJA 3KTQA 5HBMA 1S9GA 2B6AA 3NDKA 4CK3A 1XHXA 3QLHA 4CHQA 1NJZA 3KJVA 3NGIA 2F8TA 4AHVA 1LAVA 2ZE2A 3U3GA 4KPYA 2YNFA 1RTJA 2IS3A 4J2EA 3EYZA 4DTSA 3D45A 1JL2A 2F96A 3U6FA 3AVBA 4N56A 1NK9A 1RT3A 2D0CA 4ID5A 3VQAA 1RT5A 1UA0A 4GVMA 4C8OA 5D3GA 4LSLA 1QSLA 3LALA 3QNOA 1NKCA 3V9UA 2FBYA 4M3TA 3ZSRA 4DTUA 5J2QA 2PYLA 1KFSA 3TI0A 4O0JA 1LWCA 3VQ9A 5D7UA 3PO4A 3NE6A 4W5QA 3KD5E 4CJPA 3PUFA 1QQCA 4OPJA 1BGXT 1B9FA 3AVKA 1REVA 4HVJA 1WLJA 3T1AA 4NYNA 2QK9A 1FK9A 1HYSA 1GOBA 2IAJA 3OYAA 1EX4A 2LSNA 3IG1A 3OJUA 4Z0UA 1KCFA 4OJRA 5HROA 1BQNA 2YV0X 4C8MA 3O3GA 3KK2A 1RBVA 2OZMA 1QE1A 1VSEA 4B8CA 1D9DA 1BI4A 3L2RA 3ZT2A 2D5RA 3CYMA 4CIGA 4RW6A 3AO1A 3DMJA 3SQ2A 3I8DA 1QSYA 1TL3A 4DFKA 4E19A 3AVHA 1C0MA 1WNSA 1VSMA 2X78A 1TK8A 2GUIA 1J5OA 1NJWA 2QKKA 2QKBA 3THVA 1VRUA 3MXMA 2PYJA 4Q5VA 5KTQA 4G1QA 1NJYA 1Z26A 3WNFA 3NH0A 4PA1A 3OS1A 1J54A 3QEXA 4DSIA 1S6PA 3AVMA 4NCGA 3IRXA 3C6TA 1WSGA 4O44A 4CESA 3RMAA 4FZYA 4RW7A 1U48A 2AJQA 4CGIA 4GW6A 4KHUA 1ZYQA 3K2PA 3P5JA 4CFCA 4FVMA 3VQ8A 1VRTA 2YNHA 2E6MA 3RRGA 4R5PA 4F2RA 3SPZA 4YNQA 1B9DA 3DRPA 1JKHA 4FW2A 4AHCA 2Z1JA 3P1GA 1HRHA 1TKZA 4KI6A 1CZBA 3K57A 3NGZA 4E7LA 2P5GA 1D8YA 4FJXA 1DTQA 3E01A 3SPYA 4DWIA 5DK5A 3K59A 3RWUA 2JLEA 1UA1A 3BDPA 2XY6A 1NKEA 4O5BA 1SKSA 3ASMA 4MFBA 1KLMA 4KKOA 3ZSOA 1TVRA 1Z25A 1U4BA 4FJ9A 3V1RA 4M3RA 3DLKA 2HNYA 1LWEA 3NF6A 3TAEA 3OYEA 1RNHA 1ZBFA 1Q9XA 3DOKA 1A5XA 3V9ZA 4DQQA 1KSPA 2P51A 3V4IA 2XRIA 4E0DA 1TV6A 4AHUA 3M8SA 4BE1A 2OYQA 2NUBA 4O55A 4CEOA 3TARA 1RTDA 1T7PA 3RR7A 3LPTA 1XWLA 4DSLA 2FBXA 1XI1A 4OLBA 1WSIA 4DS4A 1ASVA 4FM2A 3WNHA 3HO1A 4E7KA 3HP9A 1UOCA 1VK0A 4BACA 3DLEA 4CF8A 2OPSA 3C6UA 4HUGA 1RBSA 4FJ8A 1Q9YA 4PQUA 3CFRA 4DTMA 3C94A 4DQRA 4DU3A 3SCXA 1A5VA 3K5MA 4CJEA 1RBRA 4TSXA 4CJWA 4AILC 4PWDA 1O1WA 3QETA 4KI4A 2HHUA 2IOCA 3AO4A 4DQPA 3CG7A 4CJTA 1B92A 1BCOA 4CF9A 4HTUA 1RT6A 1X9WA 3NH2A 2I5JA 4DTRA 4IG0A 3VN5A 5SWMA 3NAEA 3EZ5A 3AO5A 4Y1CA 1IH7A 4N47A 4DQSA 4DTJA 4KHSA 4CJ3A 1SV5A 1SKRA 2P5OA 5HRNA 3DM2A 4RW8A 1LAWA 3V81A 1IKWA 1IKVA 1BIZA 1NK6A 4FJNA 1I39A 5FDLA 1KFDA 4F3TA 4FJMA 4DQIA 5I42A 4ID1A 3ITHA 2IC3A 2OPRA 3TAFA 3L2UA 1JL1A 2G8IA 4DF4A 1QMCA 1S6QA 4QAGA 5SZTA 4KO0A 2WOMA 4E7IA 4FM1A 1T05A 2X6SA 2Q3SA 4CJSA 4CIEA 4DTNA 2KQ2A 3AVFA 5HRPA 4QCLA 3CM6A 3LANA 1QS4A 4CJLA 3CFPA 4B9TA 4FJHA 4KRFA 3VQ6A 2DY4A 1X9SA 5CYQA 2HHQA 4CIFA 3DLGA 3OS0A 3KIOA 3LWLA 3B6OA 3NF7A 4FM0A 5KRTA 1U45A 3T19A 3OYLA 1CXQA 4KTZA 1L3TA 4KHNA 4BE2A 4I9QA 1NK5A 4CECA 3OYCA 5CY4A 1RDBA 3LZJA 1JLEA 3VA3A 4B3OA 1HMVA 5C24A 2HMIA 4I9LA 4IDKA 1RT4A 3SUNA 3ZT4A 4N41A 4I2PA 1L3SA 1S9EA 1C1CA 1X1PA 2IDOA 3L3VA 5FROA 3RMBA 1R0AA 3AVIA 3S9HA 3U3YA 1WAJA 3RTVA 3QNNA 1RT1A 3VQDA 1KVAA 3QEVA 1RDAA 4N76A 1HYZA 4JLHA 2B5JA 2HB5A 5KRSA 2YKNA 4DTPA 1VSJA 1JLCA 3JSMA 3QEWA 3ZCMA 2JGUA 3AVCA 3NF9A 3F73A 4J2BA 2O4IA 2XO7A 5J2MA 1IKXA 4B08A 3LAMA 4W5OA 4FLTA 1S1VA 3SUQA 3O4NA 2BDPA 4CHZA 3H08A 4E1MA 4W5NA 1KVBA 3QEIA 4FLYA 1NOYA 1QTMA 3UIQA 3DOLA 4M45A 4ZTFA 1CLQA 4DFPA 1S5JA 1HPZA 4AHSA 4ZHRA 1VSLA 4E7HA 4BDZA 3V1OA 4CF0A 4CJUA 2ATQA 4GMJB 4C8NA 1GOCA 4BDYA 4RW4A 4OLAA 1BQMA 3MXIA 2HW3A 4DSJA 3RR8A 4CFDA 2HHSA 1C0UA 3SZ2A 4DSFA 2YNIA 3AO2A 4KHWA 2F8SA 1NOZA 3L3UA 2OPQA 1RCHA 4H4OA 4DFJA 2YHAA 4B9LA 5CZ1A