4FW1A

Crystal structure of two-domain rsv integrase covalently linked with dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
210
Chain Sequence
PRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGRPKAIKTDNGDAFTSKSTREWLARWGIAHTTGAMVCRANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHKERGENTKTPIQKHWRPTVLTEGPPVKIRIETGEWEKGWNVLVWGRGYAAVKNRDTDKVIWVPSRKVKPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A possible role for the asymmetric C-terminal domain dimer of Rous sarcoma virus integrase in viral DNA binding.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
molecule keywords Integrase
total genus 71
structure length 210
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 4fw1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4fw1A01
2B5JA 3DOKA 1BL3A 1C0TA 3ZSQA 2HMIA 2XHBA 4RG8A 1DLOA 4N41A 1U4BA 2O4IA 4OGCA 3ZT1A 3V9XA 4DF8A 1J54A 1HRHA 3S9HA 4M3XA 1HQUA 2B4JA 3LZIA 3RTVA 1S1UA 5HRSA 4DQSA 4DFKA 3PV8A 4Z4GA 3DRPA 4O0IA 1KRPA 1T7PA 3P1GA 1KCFA 1RDCA 3SQ0A 1RDDA 1QQCA 1WN7A 4DS5A 2GV9A 3PX6A 3RR8A 4LH4A 3C6UA 3CFRA 1O1WA 1LW2A 2Y1JA 1UWBA 1NKBA 1RBTA 3VA0A 4KHUA 1IG9A 4ZHRA 1HYZA 2A1SA 3AA4A 1U47A 4PUOA 4B08A 3OYJA 1WSIA 1WSJA 2YHAA 1HJRA 2P1JA 3AVBA 3MECA 1VRUA 2XY6A 3S3MA 4FJKA 3AV9A 3K5NA 1XI1A 4CJTA 4M3WA 1RT1A 2Q3SA 4BWMA 3DLHA 4FCYA 4KPYA 1ITGA 4CF1A 3KLHA 1JLAA 3K5LA 1EXQA 3OYIA 1RBUA 3NBPA 1Z26A 4CJQA 1C0UA 4DLGA 1JLGA 5HP1A 1KFSA 4IFVA 3OYKA 4CEOA 1IO2A 1JLBA 3NFAA 4BDZA 4F4KA 1KTQA 1U45A 4CEBA 3K58A 1RTIA 2G8WA 1UOCA 4KHYA 1NKEA 3QETA 4FYDA 1TAQA 4JS5A 4FLXA 3OYCA 3V1QA 1HYSA 1BI4B 5C42A 3SUNA 4HUGA 4CGIA 4ZTJA 2HHVA 4Z4CA 3HYFA 2HHWA 4DU1A 1NK5A 2G8FA 1R0AA 2YNGA 3LDSA 4DTUA 2BDPA 3I0SA 5K14A 4IFYA 5KI6A 4CJKA 2AJQA 3A2FA 2ETJA 2KQ2A 1L3VA 1IHVA 5KGWA 2PYJA 4F3OA 2EX3A 3DLGA 3QO9A 1VSJA 1TL3A 5HBMA 3NGYA 1X9MA 5J2PA 3AO3A 3EZ5A 3K57A 1ZBFA 3WNHA 1IH7A 3OVNA 4DLEA 2HB5A 3NHGA 1T8EA 1WSEA 3EY1A 5C24A 1KSPA 1NJXA 3LZJA 3VQCA 4DTMA 4FLVA 1C1AA 2VWJA 4B3OA 5J2NA 1FK9A 4CEQA 5I42A 1RBVA 5CY4A 3AVLA 5J1EA 4HTUA 1GOBA 3SQ2A 4R5PA 4NCAA 3K2PA 3AA3A 3QNOA 1LWEA 3ZCMA 1XWLA 1BIUA 2RF2A 3TAQA 4I9LA 2VWKA 3JYTA 3DLBA 5JS1A 2X6SA 4EZ6A 2DFFA 3OYHA 3TAFA 2BE2A 3HO1A 1RBRA 4AILC 5HRRA 2Z1HA 4FJNA 1BHLA 1B9DA 3IRXA 3B6PA 4OKJA 3VA3A 4FZXC 5I3UA 4HCCA 4HUEA 1WNSA 3KD1E 3HPOA 1ZBLA 3PX4A 1RT6A 2OYQA 4KHQA 4CJWA 2OPQA 3DM2A 4AHRA 1RTJA 2Z1JA 4CJUA 3V81A 4FVMA 4CEFA 4Z4HA 5HLFA 4G1QA 1QE1A 4F2SA 4AHTA 1TK0A 4HUFA 1BI4A 4DU3A 4M3ZA 1KVAA 4FW2A 3LWLA 1FXXA 4N56A 1D9FA 4KTQA 4C8OA 3K59A 3U3YA 3RMBA 4BE2A 3M8QA 3CFPA 4CJVA 2ITGA 3O3HA 2HVIA 4KB1A 4FXDA 3P5JA 3TANA 2HNDA 3VQ5A 1FKOA 4I2PA 1QTMA 1SL2A 1C0MA 3KLEA 3ZSYA 3F73A 3U6FA 1U48A 1QSSA 3QERA 4OLBA 4CHQA 4FM1A 4FLYA 1BCMA 4FLUA 1Z25A 4FW1A 2OPPA 1MU2A 2FBXA 3VQAA 4YFUA 1GOAA 2XY5A 4DG1A 2IDOA 4ID1A 3OYDA 4J2EA 1JL1A 4PA1A 1HNIA 3CM5A 3TWHA 1RBSA 3OYAA 3S3OA 1LV5A 1JXBA 1U49A 4M41A 3OYLA 4M45A 1TK8A 4Z4FA 3LAKA 3M8PA 1F21A 2F96A 4N47A 3O3FA 3AVJA 3NGIA 1VSFA 1VK0A 3S3NA 1DTQA 4CCHA 3V9SA 1RT5A 1LWCA 4DSEA 4W5TA 3HJFA 4M3UA 1KFDA 1SKSA 4IG0A 3EYZA 3KK2A 4M3TA 1CXUA 4KKOA 5HROA 3OYEA 2IGIA 3OS0A 4FLTA 5J2MA 3OY9A 3HL8A 1Q9YA 4CIEA 1TKXA 1I3AA 4FM2A 1EETA 4CHOA 2OPRA 4FJ8A 3HP6A 4O4GA 3I0RA 4DSKA 3SUPA 2FBTA 3RMCA 3ISNC 4CGHA 4EP5A 3V6DA 2QKKA 4CJ3A 5CZ2A 3OS1A 5DMRA 4IDKA 3I8DA 2ZE2A 4C8LA 5CYQA 3G10A 4CEZA 3SV3A 2PY5A 4ID5A 2GUIA 5HRNA 1TAUA 2LSNA 2P5GA 1L3TA 3TR8A 4BACA 2G8UA 3AA5X 4CHZA 3L2WA 1EX4A 4CF9A 3M8RA 4I2QA 1D9DA 4K8XA 3V9ZA 4AHUA 2HW3A 3NF6A 3L8BA 2XRIA 5KRTA 2QK9A 2FBVA 1LAVA 2HNYA 4ELVA 4LD0A 1L3SA 1WAFA 1WSGA 3HSTB 3SCXA 2F8SA 4CK1A 3MXMA 2QKBA 3PO5A 2QXFA 4FJXA 4BWJA 4CGGA 2IC3A 3DLRA 5D3GA 3AO1A 1HPZA 1NOZA 1S5JA 3LPUA 4ELUA 3VQQA 2BGGA 4CF8A 1VSDA 3SPZA 1TKZA 1QMCA 5SWMA 5DK5A 4OLAA 1RT7A 1SL1A 4W5NA 1J9AA 4GVMA 1KVCA 2VG7A 2KZZA 1TL1A 2G8VA 4F2RA 2WOMA 5T7BA 3MXIA 1KLMA 4NYNA 1BGXT 4B9MA 5KTQA 3KIOA 4CEAA 4J2DA 4KREA 2P51A 1J53A 2YKMA 2G8HA 4EZ9A 3VQ7A 4DQQA 3VQ6A 3ULDA 2XO7A 1VRTA 3CQ8A 2G8IA 1NK8A 1TVRA 3V4IA 2Y1IA 3ALYA 4B8AB 4LSLA 4K8ZA 4FJ7A 1RT2A 4CJRA 2HVHA 1ASUA 3CM6A 4N5SA 5FDLA 3HXMA 3NAEA 1KVBA 4ZTFA 1JKHA 4H4MA 1W9HA 3FFIA 3VQ9A 5KRSA 4DS4A 1LWFA 3O4NA 1NK7A 2PYLA 4DSIA 2YV0X 1SL0A 1YT3A 1JL2A 3V1OA 4GW6A 4QAGA 4IKFA 1S6QA 2DFEA 1TKTA 2DFHA 1FKPA 2IS3A 4Z0UA 3HK2A 3DMJA 4RW7A 1UA1A 4O0JA 4RW4A 1REVA 5SZTA 4DFMA 1UA0A 3KK3A 3BDPA 4DTRA 4FK4A 1CZ9A 1S9GA 2E4LA 1HNVA 4C8MA 1RTDA 1ZBIA 4HCBA 4FZZA 5D7UA 4E3SA 4C8NA 2YNHA 2ZQBA 4XIUA 3NF7A 3L2UA 4E1MA 3KK1A 1BIZA 3V1RA 4DTJA 3WNEA 2RKIA 1S1VA 5J2QA 3CYMA 3RWUA 4J2AA 3L2VA 4Z4EA 2PZSA 4CJEA 2R7YA 1QS4A 1RILA 2VG6A 4DTSA 1WLJA 2XY7A 4OKEA 1VSKA 2A1RA 3WNFA 2P5OA 4C8KA 4IBNA 3SJJA 2XY8A 3NF8A 2B6AA 1CZBA 1JLCA 3NCIA 1GOCA 4DTOA 4AH9A 1RTHA 2FC0A 1X1PA 2VG5A 3T1AA 3VQDA 3AA2A 4CIFA 5KGXA 4Q5VA 4E7IA 2HNZA 1D5AA 1TV6A 3DRSA 4B9UA 4DSLA 2KTQA 3QEIA 3HVTA 3NF9A 3B6OA 3VQEA 1ZBHA 4NYFA 4FJMA 4O55A 3SQ4A 1S6PA 1CLQA 3D45A 4PY5A 4LY7A 4TSXA 1KLNA 4KO0A 2GBZA 2ZD1A 4HHTA 4KFBA 4CK3A 1TK5A 3ZSZA 2EHGA 3AVKA 2D0BA 3RMAA 3PY8A 4M3RA 4NCBA 2NUBA 4B9SA 1WAJA 2F8TA 3QESA 3V9WA 1Y97A 5FROA 4O5BA 1YTAA 3DLEA 4DFPA 1C1CA 3AVFA 4CJFA 3QEWA 3PO4A 3KLFA 3QIOA 1NJYA 1N5YA 4F8RA 3TAPA 1UAXA 3ITHA 3T19A 3AVAA 3L3UA 4EP4A 4KTZA 3C94A 3T3FA 1XHZA 2OA8A 2YNFA 2Z1IA 4DTPA 4E19A 4UQGA 5JS2A 4FJGA 3SQ1A 1B92A 4DF4A 1IHWA 2FBYA 2X6NA 3KKRA 3U3GA 1NK0A 2ATQA 4DQIA 4FJHA 3SYZA 4OKKA 1QHTA 1YTUA 1HYVA 4I9QA 2HHXA 4OJRA 4MQ3A 3ZSXA 4BE0A 1NOYA 1W0HA 2KFZA 4DTNA 2HHTA 2KFNA 4I7FA 2RN2A 1JLQA 3MEEA 4Y1DA 2OZMA 4FLWA 3LP1A 3MEDA 5HRPA 4CERA 1NK9A 4J2BA 4CEDA 3HM9A 1Q9XA 3C6TA 4W5RA 4AHSA 4CJLA 4JRPA 3VN5A 4FJLA 3AVIA 3L3VA 4CJSA 4E0DA 1T03A 4KHWA 3MEGA 2OPSA 2HHUA 3SUQA 4Y1CA 4DMNA 1LW0A 3VQBA 3HPGA 4E7KA 4WE1A 1NKCA 3ZT4A 1DTTA 3NGZA 1B9FA 4FJIA 1I39A 1SV5A 4CJ4A 4NCGA 4CFBA 2BANA 4CJ5A 1BCOA 4CJPA 4H8KA 3QINA 4BE1A 3JSMA 1T05A 1VSMA 1K6YA 2YNIA 3LWMA 3NH0A 1JXEA 4RW8A 4W5QA 4H4OA 3AO2A 1NK4A 4KHSA 3LAMA 4DQRA 4E7LA 3O3GA 4PWDA 3MXJA 3RR7A 1IKWA 1S9EA 1VSIA 4CE9A 4CFCA 1X9WA 3DOLA 2KZMA 3TAMA 4OPKA 1JLFA 4DTXA 1WSHA 3NDKA 4JLHA 3RRHA 4FJ5A 1JLEA 3OJSA 4DSJA 3DRRA 3VQ4A 4DSFA 4YNQA 1IKXA 3G0ZA 4B8CA 3LPTA 2Z1GA 4FM0A 4CIGA 4DWIA 4KAZA 4N76A 4HVJA 4B9NA 3ZSOA 3F9KA 3NH1A 3KJVA 2D0CA 4M42A 2I5JA 3AVNA 4OVLA 5FRNA 4CESA 1BQMA 3WNGA 4KHNA 1C1BA 3L2QA 3IS9A 4MFBA 3QLHA 3HVRA 3SV4A 1BQNA 3QEPA 3QIPA 1EP4A 4BDPA 4FJ9A 1D8YA 1HMVA 3ZSVA 3THVA 3VQPA 3TABA 4QCLA 1YVUA 1RT4A 3DYAA 3AVHA 3OYBA 3ZSWA 3QEVA 3RRGA 3NH2A 2HHSA 4KI4A 1IKVA 3KLGA 1LAWA 4Q0BA 2X78A 1J5OA 1WSFA 4ELTA 1EKEA 2RPIA 3QEXA 5FRMA 4E89A 3O4QA 3AVMA 3AO4A 1A5VA 4CGFA 1S1WA 4CECA 4CFAA 3TARA 1RDAA 1TGOA 2O4GA 3ZT0A 3M8SA 2D0AA 3SUOA 1QSLA 4OPJA 3IG1A 3HP9A 4FJJA 3PUFA 4O44A 3OJUA 4CEEA 3SI6A 3C95A 2KW4A 4KB0A 1SKWA 1L3UA 4FK2A 4CFDA 1VSHA 3HT3A 3DLKA 4LH5A 1C6VX 3OYFA 4B9TA 1L5UA 4FLZA 3K5MA 3QNNA 2OZSA 4Z4IA 3NE6A 1ASVA 4E7HA 2WONA 4KTWA 3SNNA 2HHQA 2W42A 1A5WA 1BISA 4AHCA 4B9VA 4CF2A 3OS2A 3V9UA 4BDYA 3IAYA 3AVCA 4CHYA 2E6MA 4JS4A 1A5XA 3ASMA 1NJWA 3RMDA 2IAJA 4B9LA 4KRFA 4M3YA 4FZYA 1VSLA 3OYMA 3OYNA 4L8RB 5CYMA 4KI6A 5CZ1A 4AHVA 3L2RA 3VQ8A 3MAQA 1Q8IA 1RT3A 1IKYA 3CFOA 4LSNA 4E7JA 1U04A 3ZSRA 3KD5E 3PX0A 4PQUA 3K5OA 3AO5A 4GMJB 2DY4A 2G8KA 1RCHA 4CF0A 1HQEA 3E01A 3H08A 1S1TA 4JRQA 4QOZB 2YHBA 3DI6A 4KV8A 1QSYA 1NJZA 2D5RA 4ICLA 2IOCA 4DFJA 4CHPA 4IG3A 3OYGA 3SZ2A 1ZBUA 4RW9A 1ZYQA 1XC9A 3KLIA 1RNHA 5EU7A 4DU4A 1SUQA 5C25A 2E6LA 3BGRA 4W5OA 2X74A 1X9SA 1SKRA 4F3TA 1S1XA 3P83D 3CG7A 1C6VA 3KTQA 3ZT2A 3AVGA 1CXQA 1RDBA 3TI0A 5E41A 3SPYA 2DTUA 3HPHA 2YKNA 1TKDA 3TAEA 1XHXA 3ZT3A 1G15A 3LP2A 4OGEA 3UIQA 4FK0A 3KKSA 2JLEA 1ASWA 3LP0A 1VSEA 4CGDA 3LALA 4CK2A 4CHNA 3D0PA 4E1NA 4RW6A 4CGJA 1NK6A 2JGUA 4DQPA 1N6QA 3LP3A 3TAGA 3LANA
chains in the Genus database with same CATH superfamily
5ADXA 3EGXA 2O31A 4X64K 5CHIA 3CQYA 2O88A 2GEMA 1T3LA 2A0FB 4XEIA 1U4BA 3V9XA 3M1FA 5LJ5e 5GANe 3R3LA 2QWQA 2HSPA 1RDWX 3LZIA 3RTVA 1S1UA 1K0XA 3VENA 2A42A 3MKDA 4O0IA 2ZJPL 3QICA 1RDCA 5IN1A 1WN7A 3H3NO 1JQQA 2J7IA 4YTLA 1NLOC 4PNOA 4PKIA 2X4XA 1N8RR 2YX6A 2F5TX 4AG2C 4ZHRA 5IHKA 4BB7A 2Q1NA 3JCMc 3ZX3A 4PUOA 4EMKA 3S3MA 2YHAA 3MECA 2E10A 3VS3A 4PLIA 1XI1A 2FHDA 3VTIA 1GLFO 3O9QA 4AF1A 4FCYA 2LX7A 5LJ3d 2XDBA 1ZUUA 4CF1A 2A40A 1JLAA 2D0QB 4ORZA 4XTZA 1EXQA 3NMUA 1D0YA 1NGJA 3QB0A 5LMUK 3JCMQ 2HAXA 1JLBA 5GAEP 4FIBA 4B3TK 3QYGB 4LFAK 4CEBA 3K58A 1WQWA 5AQHA 1FMWA 3F2KA 5LJ3f 4KGZB 1VQ6T 2LQ8A 3UDCA 3SUNA 2X51A 4M75C 5I22A 2RHIA 4OB0B 4E47A 2HHWA 2G8FA 2FL7A 2M16A 2BDPA 4DEYA 5K14A 2RB6A 4IZ9A 2KQ2A 5KGWA 2J4RA 3HI0A 2EX3A 1NJIO 3LDPA 3FB9A 3EG3A 3VV0A 3CCMA 1NM7A 1TL3A 3KK7A 3NGYA 5GJVB 3AO3A 5HBMA 5DLQE 4BR9A 1KFZA 1G3SA 5KQ8A 3OVNA 3EZ5A 3K57A 1KQSM 1VQ4T 2FPEA 2OTLT 2GWJA 3EY1A 2LCCA 1NJXA 3LZJA 4XTYA 2CT4A 4DTMA 1OPKA 4FLVA 2YJFA 2JTMA 4YOVA 2ATCB 3DLMA 2KY9A 2ED1A 5CY4A 2FF6A 4A4HA 3CHWA 4HTUA 1HNWK 2CH4W 1OZ3A 2SRCA 2IG0A 4NLCA 2YUNA 3ZCMA 3EG9A 3JYTA 2L3PA 2NYSA 1Q7YR 1GLJO 3BDUA 3OYHA 1OU8A 1RBRA 5FU6C 2ZZDA 2RI2A 2Z1HA 4H0XB 4FJNA 5GMKl 4DR6K 2A7YA 1EO1A 3OA6A 1IBMK 3B6PA 5I3UA 3MPUB 3E19A 1CZAN 1V4TA 4E6RA 5I9EB 4QVCA 3KD1E 5F1XA 1B07A 1GCPA 3O8MA 4CJWA 2KGTA 2OPQA 4PJMA 1FMKA 2Z1JA 4CJUA 3X26B 4FVMA 4FSVA 5AQQA 2E3HA 3QZ9B 4G1QA 4JI7K 4AFUC 1GLDG 5KH6A 3LWLA 1WHKA 1FXXA 4C8OA 3K59A 3U3YA 3ATUA 1VHXA 4BE2A 1ILYA 3M8QA 4YDUC 4CJVA 4Y28E 3GF5A 2ROLA 4B9WA 2NUTB 4KB1A 1PC0A 1T3VA 1FKOA 3A1PA 4I2PA 5C6SA 4DHYA 1SL2A 4XU2A 4PJOA 3O5ZA 4CZLA 1C0MA 4OMMA 3META 1U48A 3J7ZO 1UTIA 4PFZA 4PJOG 2CH4A 3CC2T 4FLYA 5LJVA 1E4FT 3FLCO 4FW1A 1WLPB 2FBXA 3T1HK 1GOAA 2XY5A 1M1GA 2UXDK 4PJJA 2IDOA 4C1NI 4J2EA 1JL1A 4F7UG 2RE2A 4M7DC 1HNIA 5GMKe 2P9IB 4JD2B 1UJ0A 2OTLN 1JXBA 2GF7A 5GAN2 1I94K 4M41A 1TK8A 2EBPA 1WA7A 3LAKA 3M8PA 4B3MK 3AVJA 3NGIA 2Q2RA 1VK0A 1I07A 5GAMj 2JN0A 3QBWA 2RO0A 1LWCA 1BB9A 2RMOA 3QWYA 4C8QC 4M7AD 2K5FA 1TG0A 4RTXA 2W40A 4JJCA 3MHXA 4W5TA 1BBZA 2JS2A 4BI4A 3UA7A 2AHJB 1UGPB 3OYEA 4LC9B 4OVAA 3PFSA 2HSEB 2DEUA 4H5VA 4FYWB 1Q9YA 3CCJQ 3ASKA 3DXMB 1X43A 2HDAA 2QQSA 1I3AA 2KYBA 1BKBA 2OPRA 4HKEA 4YOXA 3I0RA 4IO8A 4DEXA 2FBTA 2RQVA 1WXUA 3V6DA 2KROA 3OS1A 1ZSGA 5CZ2A 2KDSA 3MO8A 4C8LA 3A8MB 1H8KA 3BP8A 3O4WA 4CEZA 3SV3A 3TPQA 3R6MA 5HRNA 3ZETA 2D6FA 1R59O 3FR0A 2ECZA 3LM9A 4JN4A 1VUBA 5M1QA 2G8UA 3AA5X 1XC3A 4CHZA 1EX4A 2DXTA 4YOUA 3M8RA 2FVUA 3V9ZA 3NF6A 1S22A 2UUBK 3L8BA 1YWPA 5KRTA 1ZSZB 2FBVA 2EQMA 1LAVA 2HNYA 1S1NA 4GY5A 3TU4K 4ELVA 4M75E 4RCCA 1WAFA 4I6MA 3HSTB 4ILJA 2DJQA 4WQ4C 2F8SA 4B1UB 5CE3A 1QVPA 3OSVA 1SAZA 5M1KA 3MXMA 2NUPB 4M7AC 4FJXA 4BWJA 2XHCA 3THYB 4X65K 1HPZA 4A57A 4GV3A 1S5JA 1ZQ1A 2IPOB 1NKCA 2O4XB 4DQ8A 4EHUA 1QMCA 2EKHA 3P8HA 3SD4A 1RT7A 4CZJA 5GADP 1YFNA 4H5NA 2EWNA 3NTHA 1KVCA 3EKSA 3BUZB 1T3SA 1CKBA 2DF6A 2P9NA 3VS0A 4F2RA 5T7BA 1HSQA 1HNZK 1KLMA 4NYNA 4BC4A 5KYXB 3LWIA 4A4FA 2E1YA 3KIOA 3VEOA 3CCLN 3QPHA 4K42A 3SAGA 1ABQA 3CCQQ 5A2QO 2JM9A 3IQLA 4MMKA 1NM1A 2YKMA 2G8HA 4EZ9A 3CC7A 3O9UA 3SLCA 1G5VA 5M1FA 4XH4A 1NK8A 4QQGA 3ALYA 4CJRA 2CP2A 3CM6A 4A4KA 3HXMA 2QWOA 4WFAL 4H4MA 3VF6A 1WFWA 1LWFA 3CPWM 5BPNA 4CZMA 1M90O 1YT3A 3L0QA 3M0QA 1PKSA 3DB4A 2L3SA 3LH0A 4IO9L 2QWNA 2IS3A 3FC3A 2VQFK 1VQ4A 4Z0UA 3HK2A 2L3QA 3I55A 4O0JA 4FK4A 4DTRA 3EEQA 2DMOA 1HNVA 3WXKA 3WXMB 4HCBA 3HKSA 1M2VB 4FZZA 5FWCA 2ZQBA 2P0PA 4RCHA 3A5OC 3VOVA 4E1MA 4D6WA 4J9FA 2RKIA 4JI2K 3MCPA 5KPZA 3V8LA 2Y90A 4BC5A 4CJEA 1GCQC 2FYKA 4IEIA 4DTSA 3INZA 4OKEA 1Y7XA 2P5OA 5CKEA 3WNFA 5J26A 2ZAEA 2XY8A 3NF8A 2B6AA 1KSWA 2EVRA 1P90A 2QWLA 1X1PA 1GFCA 4Q5VA 3IAYA 3AA2A 3G4SA 1OULA 1QZ6A 4X66K 2DL3A 2YWWA 4KUIA 1VQMA 3B6OA 2VQEK 4BRCA 1TUGB 3QBXA 3UKUB 4JLIA 1X9JA 4ISFA 3LLRA 4O55A 1S6PA 4AMCA 1CLQA 4GBQA 2HMPA 1X75C 3WVEB 1YIJT 3ENBA 4MZMA 2BZYA 4TSXA 5GAN8 4CD3A 3CBOA 3TEEA 4C5HA 2EYWA 3D2EB 3CJ1A 4BVOA 5D6XA 1QCFA 3J80E 4M75D 3ZSZA 1C0FA 4NS5A 2D0BA 2E64A 1ATRA 1RDUA 2W41A 2ZPFB 4M3RA 3UKRA 4NCBA 2NUBA 4B9SA 5IAYA 1MWKA 1WAJA 3QESA 1TUYA 2KEAA 3EHQA 2LMJA 3CXCA 1Y97A 3QWXX 5LJ5g 2D4WA 4O5BA 1C1CA 4CJFA 2E2OA 4M7DF 1N5YA 1NWKA 3T19A 1VQ8T 4EP4A 4B3RK 4KTZA 3C94A 5AQXA 1M2VA 1XHZA 2Z1IA 2EKOA 4Q5WA 1K8AO 2OA8A 5DLOA 5GAMd 1B92A 2XK0A 1IHWA 1VQPT 3L1AA 3CMAQ 2D0PA 3U3GA 1N8RC 4ZN3A 4BC2A 4DQIA 3SYZA 1YTUA 2E5LK 4M4ZA 1YITA 1GXIE 1ATSA 4BE0A 1W0HA 2NLUA 4DTNA 4IUPA 4DBHA 2HHTA 2OAWA 2PU9B 4M75G 4LF9K 4I7FA 2DILA 1WOQA 3CXCS 3MEEA 2OZMA 5HKCA 3LP1A 5HRPA 1NK9A 4CEDA 3KXTA 1SPKA 4JRPA 2FLOA 3C6TA 4W5RA 3VN5A 1Q9XA 3L3VA 4CJSA 2OPSA 2X35A 3G71Q 1M90R 4DMNA 2ZJQL 4E7KA 1TXQA 2SEMA 1QKXA 2RF0A 3ZT4A 1DTTA 3NGZA 5LJ5j 4H0PA 1W6XA 1KD1O 2BZ8A 3A8OB 5M9OA 4PL8A 4IUQA 5GAOr 4YORA 2J06A 4ELZC 4M7YA 4CJPA 1BCOA 4NXNK 3TCJA 1RLPC 1M3AA 3I9QA 2K5IA 3HTRA 4BE1A 3D2EA 3QINA 4RG2A 1YHQN 3U4LA 2OTJQ 1KIKA 3CCEQ 2BTFA 3DLLL 5KQDA 2D8HA 1RL2A 1KG1A 1NGBA 1JXEA 1JJ2S 3NFCA 3MP8A 4J8OA 4KHSA 4DQRA 2OTJN 1ZSZA 3J7AF 4RTTA 1M2OA 1VQLA 4IOAL 4CE9A 4CFCA 4AG1C 4WFBL 3TAMA 4F7UA 4PKCC 4RTUA 2KLAA 5TKWA 1WSHA 3NDKA 4FJ5A 1K8KA 5BN8A 3MDQA 4PL6A 3VS7A 4DSFA 1AHJB 2GELA 3VF2A 3N5BB 1TU0B 3UWNA 4HVJA 3CMEQ 3ZSOA 3KJVA 2D0CA 1WUAA 5FRNA 4M42A 2QGGA 2EGAA 5BPLA 1TH7A 2ZPIB 3EG9B 4C92B 3V7SA 3E9OA 3RUXA 1BQNA 2P9NB 3QIPA 5LL6Z 3CCSQ 1Q86U 3THVA 2PNIA 3JCMe 3OYBA 4OMLA 2I7NA 1IKVA 4M77E 3SWNA 1K73R 3QEXA 3UPUA 3MCAB 2DXBA 1D1CA 2IIRA 4JJNK 2QDLA 1S1WA 1RDAA 2X3XD 2QG9B 2XMFA 2L0AA 4KGXB 3P38A 1M4ZA 1VQOT 3HP9A 5M1OA 3VMFB 4O44A 1IV0A 5C0MA 3OJUA 4CEEA 3CMAT 4BR4A 1RAFB 3LDLA 3SI6A 4KB0A 1L3UA 4CFDA 2RQRA 4BC3A 5MLCQ 3FZKA 4DR3K 4ELYC 3OYFA 1VQ8Q 4DOVA 3JCMV 1Q95G 5GAOm 1JU5C 2E3IA 4B9TA 4M7DG 4Z4IA 4DR2K 4EAHD 4FWSA 3NE6A 1E6HA 3JCMh 3L4QA 4A5AA 1QVFM 3MN9A 1AZGB 1I5OB 2L8DA 5AQKA 1KHCA 1Y96B 1BISA 4AHCA 4B9VA 3RERA 3OS2A 2HQXA 4D8KA 1KQSS 4BDYA 2IAJA 3M3ZA 3I8BA 4O8KA 4M3YA 4HWIA 1M90U 3A8GB 2F5KA 3BFMA 2WSCE 4LXCA 3OYMA 3OYNA 1K8KB 4L8RB 4KI6A 4QS8A 1NE8A 4NL2A 4R0KA 4CZHA 3M0PA 3MAQA 1QHAA 3AAPA 1VQ6Q 1WHLA 3K5OA 3AO5A 4GMJB 2DY4A 1AWJA 1RCHA 4CBWA 2DL5A 3LGFA 2G8KA 4JRQA 1QSYA 1NJZA 3IUCA 1PSFA 3QXEB 1SS6A 4BREA 2HD0A 5AQOA 3VGMA 4ANJA 1B34B 4DFJA 3MWPA 4RW9A 1JEGA 2YRDA 1HD3A 1UHCA 2DYIA 4B6MA 2VYPA 3KLIA 4N4HA 1SUQA 2DBKA 1JXMA 1ZLMA 2E6LA 2Q97A 1S72Q 2X74A 4MDAA 2W6LA 4U67L 1SKRA 1VQON 2J6FA 3CG7A 3EKUA 2DPPB 3JAMO 3SPYA 5CAIA 2EQIA 4PJNA 2YKNA 2DTHA 1X69A 3CJ7A 3TAEA 3D7SB 2F2WA 4E2FB 3LP2A 4OGEA 3UIQA 4DV3K 2CP3A 1ZBHA 1SHGA 3LALA 3D0PA 4CGJA 4UY8O 3VS1A 2XIDA 2FF3B 4Y0WA 3DKMA 4JKGB 4HTLA 5FLXO 3TAGA 1N6QA 1KXPA 2B5JA 4FM4B 3DOKA 2LP5A 2V8KA 4DA4A 3JCMg 3JAME 5A0GA 1C0TA 1FMVA 3QDRB 3CI5A 3E66A 2XHBA 3O1WA 1VQ8A 3RVCA 3ZEHA 3EN9A 2Z0WA 3V8KA 3ZT1A 2O4IA 2PUKB 2UXBK 3MX5A 4BVPA 5BREA 1J54A 5C10A 1Q7YO 3S9HA 1HQUA 4I6MB 4DFKA 5HRSA 4DQSA 4J9DA 4BRNA 1KRPA 1T7PA 3SBTA 2L2PA 1KCFA 5F0XA 3BE3A 4DS5A 2DE0X 4LH4A 3C6UA 2WUSA 3M9QA 3THYA 1UWBA 2E2NA 2EYYA 2Y1JA 1RBTA 3UE5A 1IG9A 4ILGB 2HBMA 3K9JA 3AA4A 2DA9A 4B08A 3SEMA 3ZBDA 1A0NB 1NGIA 4CZKA 2XY6A 2OTJT 4FJKA 3FIFA 2DLPA 4JKCA 4CJTA 4L5GA 2Q3SA 3EFOA 2KR3A 1T0JA 4JJDA 4RKUE 3C0CA 3I33A 2LVMA 2HF4A 2JNGA 5GANf 3K5LA 1KQ1A 1RBUA 4QVDA 3NBPA 2KHOA 3NHNA 1Z26A 4CJQA 3QFPA 1C0UA 4BDZA 3OS5A 3NFAA 3M6GA 4JKHA 1KTQA 4F4KA 2RA2A 1U45A 4KHYA 2ZCFB 5A0LA 2CKKA 2D1XA 3R8EA 4DBQA 3V1QA 4FLXA 1HYSA 3I55N 5EX5A 4CGIA 2QA4A 4F7UE 3E1YA 3HYFA 3K0SA 4A63B 3AARA 1KK7A 2K2VA 3EGXB 1L3VA 1IHVA 4HT8A 3D6RA 3VEWA 5AZIA 3ZYYX 1LCUA 3MEWA 3QO9A 1VSJA 4JI3K 3QDFA 4DV2K 5C12A 1W2BM 1M1FA 1ZBFA 3WNHA 1IH7A 1T8EA 4BR0A 4DLEA 4G9ZA 2PVOB 5C24A 4QT7A 4AFZC 1YJ9A 2R5MA 3VQCA 4B1WB 2MI6A 3VYGA 5GAN5 2GTJA 2KRSA 2VWJA 5J2NA 1H92A 1KLNA 3EG2A 5I42A 5E84A 1WIEA 4AT1B 1RBVA 4H5WA 1GOBA 3PMTA 4NCAA 4QQDA 4ESRA 3K2PA 1JRIA 4RTYA 2NRVA 1XWLA 1BIUA 4MZTA 4BRPA 2P9LA 4OMNA 4I9LA 3TAQA 4LF6K 2X6SA 2DFFA 5GAN3 1NPPA 5AT1B 4L6V5 3TAFA 1WYXA 3M0SA 2X3WD 4AILC 3AAQA 3HBTA 1YIJQ 2GBQA 4JI8K 4IUTA 2RHKA 2EJFA 4F16A 4OKJA 1YJWN 4HCCA 1RAIB 4EIAA 4FZXC 1YITQ 3J81O 4AM6A 1BIBA 1VQOA 3REBB 3HPOA 1RT6A 2DAQA 1IGUA 2I7PA 2ITMA 4M77A 4ZGDB 4KH4A 3TU5A 4A59A 4F2SA 3CCLQ 4CEFA 4Z4HA 3G6EA 3CC2N 4DR4K 6AT1B 5ECAA 4HUFA 4KH1B 4XU3A 1EZZB 1YAGA 4FW2A 2DNUA 3M58A 4OO1J 4OB1B 3CFPA 3EL2A 3O3HA 1MGQA 4YHHK 2FPFA 4OX9K 1PM3A 3VQ5A 3KZBA 3C0BA 3THXB 4FOEA 4MMLA 2E5QA 3CPFA 3A8YA 4A2AA 5GAGP 3OBYA 4KH0B 3VKIA 4FM1A 2COYA 5AYFA 2P4RA 1BCMA 4BUGA 2E8AA 5DM7R 4BGAA 2EYZA 2K9GA 4FLUA 1VQMN 2K4YA 4PL7A 2O8CA 5AQZA 3WT0A 4LFCK 3L42A 1Q7YU 1I8FA 2O9SA 2E1HA 2RI5A 2RQTA 2EGCA 1LV5A 1U49A 3BY5A 2DYBA 4N47A 1AD5A 2DIGA 1F21A 3CCVN 1J3TA 2QTDA 1HXDA 3QFUA 4B3SK 1K73C 1OPLA 1VSFA 3T7ZA 5LL6S 4RMOA 3ZX0A 1VQNQ 2GWKA 2EFIA 4PHTX 5JLFA 4M3UA 1KFDA 1SKSA 4IG0A 3KK2A 2O01E 4KKOA 3QZ5B 3CCVQ 1MV0B 2CP6A 1N32K 3HL8A 1RUWA 3VRZA 4FM2A 2HBLA 3CCSA 1VQNN 1O9SA 1PKTA 1AWXA 7AT1B 3CCRA 4F14A 3SUPA 2HCKA 1K9MU 4QS9A 4GLMA 3RMCA 2QKKA 1QVGS 2M1HA 2HBWA 2QA4N 2ZE2A 1NGGA 4C8QF 2P9SB 1QZ5A 3G10A 3CCUA 4DKWA 2QEXT 2DZ9A 2VYTA 2ASMA 1ZUYA 2HKNA 1VA7A 3ULEB 2OTLQ 4JK7A 1Q81R 2E2PA 1BDGA 4K8XA 4PKGA 4C8QE 2IVPA 2PVGB 3MEVA 4PJOB 4FYYB 2BUPA 4EMGA 2CGJA 2CZ7B 3E1SA 2H8HA 4R55A 4LD0A 1QVFS 1L3SA 4BI3A 4F7UB 4BROA 4OMPA 3CCMT 1GLCG 2QXFA 1D0XA 4LDUA 4CGGA 3KWGA 2IC3A 3DLRA 5D3GA 2OTJA 3QO3A 1YI2A 5AQLA 3LPUA 3JCMf 3C65A 3VQQA 3SPZA 1VSDA 3FZLA 4FWNA 4X9CA 1UE9A 3CCQA 5CO7A 2KZZA 1I1JA 4CC3A 4BRDA 4B9MA 2CS7A 1BGXT 1YCYA 3M5AA 4K43A 2RM4A 3JB9I 5AQTA 4J2DA 4B1VA 4JI1K 2W6KA 2P51A 4BRIA 2EQKA 4DBFA 1W70A 4J9HA 2LCSA 4M7DB 2CUBA 2R58A 4EMHA 2G8IA 4FT2A 1VQ5A 3V4IA 4K8ZA 4FJ7A 4NLBA 3QYHB 2KRMA 4N5SA 4C92C 1NGEA 2UUAK 3M0TA 2HBKA 2EYXA 4M78F 1YITN 2PYLA 2LT1A 3CPWS 2C0TA 2YV0X 1SL0A 1MDUB 4KH6A 2VWBA 2MOXA 4OF1A 4FO0A 1M8MA 1DEJA 1S6QA 3WQUA 2DFHA 3BW1A 3RSEA 1FKPA 5AZIB 1N8RO 3DMJA 2MMPA 4HVVA 4QKUA 2O8EA 1OOTA 1XNRK 4C8MA 1YBYA 2FB7A 3FZMA 3P4IA 4A54A 1RTDA 1Y57A 1ZBIA 5D7UA 2MWPA 2K79A 1OVYA 1ZC6A 4C8NA 1H641 1EQYA 2V1RA 3NF7A 4JHDA 3L2UA 4N4GA 1G3WA 3V1RA 4DTJA 2R5AA 3CYMA 4J2AA 5HK3A 1KD1C 1K9MO 1P92A 3G71A 1RILA 2YI1A 4FWMA 3CCET 3OB9A 1WLJA 2RJFA 2RHYA 5CKHA 5IHNA 3CJBA 2V26A 1VQKA 3J8AA 4IBNA 4BI8B 2WSFE 1BIAA 1M1KC 3X28B 3A5LC 4JV5K 1JLCA 1GOCA 4DTOA 4KAZA 1CSKA 2VG5A 1SSHA 1U06A 4E7IA 3JCMW 1Q81U 4B9UA 2KTQA 2MCNA 1D5AA 1TV6A 3DRSA 5FPNA 4DSLA 3J80O 4FWKA 3H46O 5TKYA 2BE9B 5C0YA 2DKGA 5HY6A 2J05A 1PD0A 1KAZA 4EMKC 3MN6A 3MWTA 4H5TA 4CD1A 4KO0A 5LJ5f 3GDQA 1PRMC 1VQKQ 4JEPA 3O8VA 3P31A 1E7OA 2ZD1A 3OW2S 1KQ2A 4HA8A 2E1ZA 4HHTA 4LE9A 1TK5A 2NNWA 3RMAA 1ZA1B 3ZEUA 3PY8A 1PWTA 5AQUA 2JWKA 2CH5A 2PFUA 2F8TA 3RSEB 3G6EN 2MF2A 3THXA 1BA0A 5FROA 1YJ9Q 3RR6A 1YTAA 4OPAA 3CCMN 4DFPA 3AVFA 3PO4A 1JO8A 3H8ZA 3VEXA 3KLFA 2M51A 3J7AP 3TAPA 2OCEA 5A0DA 1VQ4Q 5AQIA 3OHRA 5AQNA 4M75A 4E19A 2YT6A 3LM2A 2EWSA 4FJGA 4MLHA 1ESVA 2FBYA 1G3TA 1GFDA 4OP0A 1Q82R 1KAYA 3CETA 1VQ7Q 2NRXA 1VQ4N 1AOJA 4XQ3A 3UA6A 2ATQA 4CBXA 4CC4B 1QQMA 1N9RA 1MMAA 1QHTA 1PRLC 4PLLA 4OJRA 3I56T 1NOYA 2P0KA 2HHHK 3HRUA 5EOYA 1YIJN 1VQ9N 3G4SQ 4IXCA 3ULRB 5GAN4 1WHHA 1JLQA 3D2FA 5GANd 1SG5A 4FLWA 4J2BA 4CC7A 4LDWA 5GIOA 4CJLA 2HHXA 4FT4A 2Y4XA 5FLXE 4YOWA 5GAOp 4WCIA 1ARKA 2CGLA 3VQBA 1BI3A 4FJIA 2JVVA 3TSWA 1U8RA 1B9FA 2CUDA 1I39A 1D3BA 2K3YA 2M0YA 1SV5A 1U2VB 3MN5A 4YOYA 4NCGA 2BANA 4H8KA 3HPWA 3E2UA 3FZFA 4GKJK 1T6CA 1YHQA 1XNIA 2A3LA 4DR5K 1TOVA 3X20B 3ULEA 2YNIA 3LWMA 2UXCK 1VQNA 4DV4K 3NVMA 2LJ0A 4RW8A 1O75A 4H4OA 3AO2A 2DM1A 3LAMA 4FWOA 2CZ6B 3O3GA 4PWDA 3MXJA 1U5SA 3RR7A 1S9EA 3SMPA 1Q7YC 1K8AU 3DOLA 1XQHA 2KZMA 1XUPO 4OPKA 3H41A 4JDSA 4KH5A 3RRHA 1SF9A 1IJJA 1JLEA 4CJ7A 4DSJA 1Y0MA 2AK5A 3CBPA 3VQ4A 4CZGA 2AKLA 1IKXA 3G0ZA 2OTLA 4FM0A 4FL6A 4M7XA 3NH1A 3TSQA 1XC9A 4RTFD 2YRVA 3VS5A 4CI0C 1BQMA 2ZPEB 1YJNT 4C1NK 1NGHA 3HVRA 3SV4A 3QEPA 4O5VA 2BTTA 4BDPA 2NRZA 1D8YA 2CDTA 4ZGJB 3CCJA 3ZX2A 5I21A 3G25A 2YRCA 3DYAA 2YHTA 2YLCA 4M7AF 3E9FA 3NH2A 4HCZA 3ENOA 3KLGA 1EWRA 1BO5O 2LQKA 1QVGA 1S72A 4M7DA 4BY9C 1JCEA 1EKEA 1NEGA 5FRMA 2DBMA 2VUBA 1K9AA 3G4ST 3DJCA 2P0QA 2RJCA 3AO4A 1RAGB 5L8RE 2DPNA 3TARA 1HJDA 2O4GA 2QEXN 4OPJA 3LGLA 3IG1A 3RIRA 4NL3A 3PUFA 4PK4A 2ZJRL 1EWQA 2YUQA 3CC7N 3C95A 3VERA 4C8QA 2Q31A 1VSHA 3A0IX 2KRNA 3G7ZA 3O9SA 1KC8O 2F4VK 4XK8E 1NYGA 2QWPA 2OZSA 1L5UA 4FLZA 3K5MA 4KGVB 1ASVA 4E7HA 2L89A 5HCKA 3A5ZB 1A5WA 2W42A 2HHQA 1NLPC 1QQJA 4CF2A 3M5RA 4CVNE 2E6MA 2M9UA 5AFUH 5LJWA 4FYXB 3U23A 4HT9A 3O80A 4KRFA 4O5FA 5CYMA 4BRAA 2O8DB 4JD2A 3THKA 4JI4K 3RKWA 3H6EA 4HXJA 4BRKA 4KRTA 1VQPA 4WQ5C 5CR4A 5H1SQ 1S1TA 5IXBA 2LX9A 3DI6A 4KV8A 1K73U 2D5RA 1T6DA 3CCLA 4L59A 3UF4A 1NYFA 3OYGA 3SZ2A 1ZYQA 4IJNA 1G8XA 1ZA2B 2KK4A 2DRMA 2YCHA 2DVJA 1U6ZA 2O2OA 5BPMA 3WVDB 2NRHA 3HRTA 1QVFA 3EG1A 4X62K 2K3BA 1K8AR 2YHWA 5E41A 1HKCA 2DTUA 3HPHA 3OQ5A 3O1BA 3JB9G 1G15A 1R0CB 5FU7C 4CGDA 2JLEA 3LP0A 4PJOF 4K0KK 3AHUA 4CK2A 4MO4A 4CHNA 1NK6A 4E1NA 4A2BA 4DV0K 1GL5A 5EXWA 1UUEA 2FZKB 2KE9A 2LZ6B 3HFOA 2JGUA 2CYZB 5GAMg 2A3ZA 2HOEA 1OZ2A 3M0RA 3LYIA 4LFBK 4JRIA 3CXCP 4N41A 4QW2A 1V1CA 5BRDA 3U9ZA 2A28A 2A5XA 4C92D 1BOTO 2B4JA 3W3DA 3PV8A 1VQ9A 5JVGL 3DRPA 1YXQA 1YN8A 2MYSA 3FRNA 3P1GA 1KQSP 4C0FA 1SHFA 1RDDA 1QQCA 3M4YA 4CRIA 4A61A 3OTOK 3CMAN 3CCRQ 3I56A 1X6OA 3GE1A 3PX6A 1LW2A 1NJIC 2F1LA 3VA0A 4KHUA 4C5EA 3JB9F 2G3RA 1JBMA 3H0FA 2A1SA 2P9KB 1U47A 1OX8A 1WSJA 4DR1K 1HJRA 2P1JA 2ZPHB 5AQYA 1JXOA 1ZBJA 1QLYA 4K11A 1RT1A 4BWMA 4JI0K 2RN8A 1WGSA 2DL7A 4KPYA 1HK9A 2AKKA 3KLHA 4IOXA 5GIPA 3PMIA 2K57A 1G99A 4C0DB 4M78B 1IG8A 4DLGA 2H3GX 4ILHA 5GANh 1KFSA 3OYKA 1PSEA 3OW2P 4CEOA 2ZGZA 3HHTB 2RHXA 5BR8K 5JVHL 1WPYA 2PVDB 5IT9E 1OH8A 2CT3A 3U8XA 1NKEA 4FYDA 1GCQA 3N4PA 1TAQA 4JS5A 3A5MC 3OYCA 4LF8K 1OH6A 3FEOA 5C42A 1J5EK 4BRGA 4ZTJA 3SHWA 2J6OA 1JCFA 4JK8A 3DXKA 2EGEA 4DU1A 1R0AA 3E9GA 2BKDN 5AJ3K 1QCOA 4CJKA 3M56A 5KI6A 3OMGA 2VCPA 2ETJA 5CK9A 1LVKA 1PCXA 4HVUA 3CMAA 1FW6A 2D9TA 3DLGA 3PIPL 2KT1A 1AVZC 2HB5A 1W4SA 3VETA 4Z88A 2RQWA 3WQTA 1KSPA 1NG2A 4B3OA 3PT9A 3UB5A 1FK9A 4CEQA 2P9IA 1IZ6A 5C15A 4CZEA 1HKGA 2COZA 3AVLA 1NJIU 2Q36A 5E26A 4C5GA 3QNOA 2RF2A 3WUHA 5IHIA 3SJHA 1X3NA 2QK0A 2MAMA 2BE2A 3EFOB 1JB0E 1VIEA 3A8LB 4KUDK 3HO1A 2RH2A 1J6ZA 4M7AG 1B9DA 1QKWA 4DOWA 5GANg 4EHTA 5GAHP 3SAHA 1ZBXA 3EH2A 3VA3A 1W2BS 2DERA 4M78A 1VQMQ 1WNSA 4H5RA 1ZBLA 1FWZA 2AZVA 3PX4A 1VQKN 1V4SA 2OYQA 1IO6A 3DM2A 1RTJA 2JT4A 2JUFA 1M1KO 4M3WA 1M3CA 1QE1A 4J7IA 5KCOA 4AHTA 4B1ZA 4DU3A 4M3ZA 4RTVA 3JSCA 4KTQA 4M7AB 3RMBA 4J83A 4E1JA 1YIJA 4C0ZA 2ITGA 2HVIA 4V2SA 1CKAA 3L2ZA 1YJ9N 3ZEUB 3VEVA 3JCMb 1WBDA 2HNDA 1QTMA 3RKYA 1AZEA 1GBRA 1N36K 1X6BA 3VS6A 2E6NA 3TTDA 4CZFA 3KLEA 3ZSYA 5C2DA 3F73A 3U6FA 1NMDA 2A08A 1NGDA 1T44A 4JI5K 3CMEA 4Y92A 1ATNA 1PG5B 3IDHA 1Z25A 1MU2A 4YFUA 3RBBB 3VQAA 5L23A 3CCQN 3OYDA 1I0CA 5BR9A 3URGA 2LNVA 3CM5A 3TWHA 1SKUB 1TTHB 2QTXA 3KUFA 1QQOA 1N8RU 3OYLA 3RDVA 3EE9A 1HX1A 1AT1B 3HTVA 2EPDA 2DL8A 5GMKi 3CPEA 3CCLT 5HK0A 5AQPA 2C06A 5AZJA 2X4YA 3O3FA 4KBOA 3S3NA 3GL1A 3ZFJA 4B9QA 4DU4A 4CCHA 3V9SA 1YITT 4N4IA 4DSEA 4JKAA 3QUIA 2E4HA 3HJFA 3FZHA 4M3TA 1UGQB 3GG4A 4O8UA 3C6HA 2GFAA 3QJYA 1CXUA 1VQLN 5HROA 3THWB 1EFNA 3OS0A 5J2MA 1RAEB 3OY9A 4GV9A 3E9PA 5LJ3h 2P9PB 4CIEA 3BZCA 1XMOK 1TKXA 3ATVA 5EY4A 2FRWA 1YI2Q 2JTEA 2MWOA 1EIFA 1EETA 1OKJA 1OU9A 2ASOA 3HP6A 2HBPA 4FJ8A 1DT9A 4DUZK 2DX1A 3ISNC 3VEYA 4D8DA 4EP5A 2RNAA 3I8DA 4CBUA 1VQPQ 5CYQA 2H3JA 4N0AA 2P5GA 2QI2A 4WF2A 4BACA 2ZWHA 1I81A 3L2WA 2V1QA 2GQIA 4CF9A 5CQYA 4I2QA 3RKXA 4F17A 2WC9A 4AHUA 2KSSA 2QK9A 3A5NC 4Y91A 4M7AE 2NLXA 1M8VA 1M90C 2JM8A 3QDKA 3CCUQ 3SCXA 1X2KA 4M77G 2O8CB 5KPRA 1PD1A 1VQLT 3PO5A 3KVGA 3CD6N 4FPAA 1W2BP 4M63C 3UATA 1Z9QA 1Y64A 2BGGA 1TKZA 4Z89A 3G1JA 5FPDA 2BH1A 5DK5A 3CD6Q 3T69A 2ZF5O 4W5NA 4GVMA 1UJYA 3TSUA 2G8VA 3PLAA 2WOMA 3MXIA 3I56N 4CEAA 4KREA 1UEBA 1RFQA 4JRKA 4HCKA 3CPWA 2RQUA 3QBYA 3THWA 2XD0A 2EQUA 4FWQA 3VQ7A 3SWNB 2LDMA 1VQ6A 2IVWA 3ULDA 1DKGD 5IXFA 3CQ8A 1AWWA 2Y1IA 3H9NA 1JJ2M 3JV3A 4LSLA 3VRYA 1RT2A 2HVHA 9ATCB 2F2XA 1MV3A 2IVOA 5FDLA 3BEXA 3NAEA 5GAN6 5GAOn 3CC4N 2A37A 2FEIA 2QQAA 1VQNT 4MO5A 1NK7A 2DTOA 5A2QE 3WEEB 3SQ0A 3PNWC 3G6ET 1S72N 1HR0K 1YJNQ 4DSIA 3AT1B 4R56A 3Q7CA 3V1OA 4R79A 4GW6A 1TKTA 2E6ZA 3CCRN 1RACB 2O8FA 1P8ZA 5IWAK 1UA1A 1NGFA 1REVA 5SZTA 2XKOC 4DFMA 3KK3A 1UA0A 3BDPA 1Y96A 4FYVB 3CMEN 1CZ9A 1S9GA 2E4LA 1YCSB 1Z9ZA 4XIUA 3M0UA 4IWVA 4H0VB 3KHYA 2DD4A 4M7DD 2LC4A 3EAEA 3I5SA 3R6OA 1LNXA 1BIZA 3KK1A 3WNEA 5J2QA 1S1VA 2CSQA 1F1BB 2GTOA 3L2VA 1D1AA 1Q18A 2R7YA 5GAOq 1QS4A 1XNQK 1VAZA 2C0OA 2X4WA 2VG6A 3A98A 3LW5E 2XY7A 1TYQA 3MN7A 4XTVA 1BWFO 1VSKA 2A1RA 1YWOA 4C8KA 4B1XB 1M27C 3B8AX 3SJJA 2F9WA 1S72T 1HUXA 1CZBA 1B34A 3NCIA 3CCEN 3TREA 2FC0A 4AH9A 5HP1A 3G4SN 2HNZA 3HOTA 1U3OA 4TVRA 3QEIA 1RABB 2GFUA 3HVTA 1LPLA 4M78G 2RJEA 2RJDA 4FJMA 1QP3A 3I35A 5LJ3e 3SQ4A 1D3BB 5KE3A 2YJEA 4LY7A 5ELZA 3GIBA 3M59A 4LUEA 5CIUA 1XTDA 5KYNA 1WXBA 1S3XA 3EGDB 2GBZA 2JJ9A 2UU9K 3DAWA 3PIPA 5KYWB 4IDHA 4PFOA 4KFBA 4CK3A 4M77F 3I56Q 1WI7A 2H3EB 3CC2A 2NRTA 3CCUT 4B1YB 3V9WA 3O9RA 5JMVA 1VQ7T 1K1ZA 2FXUA 4GV6A 4J5YA 4J9GA 3QIOA 1NJYA 1VYTA 1NEBA 4F8RA 2HBJA 1ZUKA 1UAXA 4CZIA 3ITHA 1VOMA 1YNZA 2X9HA 3H0IA 3L3UA 4PJLA 3T3FA 4DTPA 2DETA 2VGMA 3LH5A 3E9LA 5JS2A 4UQGA 1QCNA 1WHJA 2YUPA 3HZ6A 4DF4A 2X6NA 3SQ1A 2LTOA 3KKRA 4C8QG 1YI2N 2DXUA 1IREB 2CZ0B 5LMNK 2XU8A 2JZ2A 4OKKA 1HPMA 1HYVA 4I9QA 5LY3A 2YSQA 3ZSXA 3V7CA 4KT0E 1YI2T 3EFRA 1E4GT 1X27A 1VYUA 2DXCA 1NPRA 1HKBA 5EG2A 4PKHA 1I4K1 3CQTA 2GQVA 4YDUA 2K3XA 4CERA 3WXIA 3ER0A 4FJLA 4E0DA 1UHFA 2HHUA 1T03A 3M57A 3SUQA 3GBQA 3DB3A 4Y1CA 1G3YA 3M55A 4PJOC 3TVTA 2CZ1B 1TSFA 1LW0A 2WACA 4C0GA 2P9PA 3HPGA 4F9OA 3SAFA 4X9DA 3O4QA 2I2LA 2UUCK 5AQWA 1W1FA 4CJ4A 4CFBA 3VESA 4CJ5A 2ROTA 2YXYA 3HRGA 4ATOA 2A36A 4NXMK 3JSMA 2AIRB 2LQWA 2BUDA 2PAVA 2AP1A 2QWRA 3M54A 1GLAG 1VSMA 1T05A 1GRIA 3VU3C 4C0DC 3NH0A 1WJQA 3QG1A 4H0TB 4DUYK 1NG9A 5CR2A 4E7LA 1Q82U 2KXDA 2CP7A 4M77C 1IKWA 1BA1A 5DY9A 2CGKA 2RD1A 5FU6B 3FGUA 2F7TA 3RESA 4MDBA 3C7NA 3HRSA 4JLHA 1GBQA 2G6FX 1KD1R 1M1KR 3DRRA 1NU0A 5JLHA 2OANA 2HL3A 1YUWA 4OB3B 2Z1GA 1OV3A 3LPTA 4B8CA 1LOJA 2ABLA 2QQBA 2FSKA 2O4XA 1BK2A 3F9KA 2JMCA 2I5JA 4OVLA 2FZGB 4CESA 3WNGA 3VPZA 1C1BA 3NMZC 1FX7A 4FJ9A 4XAXB 4LDVA 3G71T 1HMVA 3ZSVA 4M78D 1NZ9A 3VQPA 3TABA 2ZPGB 3JCMP 4QCLA 3BF3A 3QEVA 3AVHA 3ZSWA 3RRGA 4P5NA 3CPWP 3CC4A 4KI4A 1J5OA 1WSFA 4ELTA 4E89A 1OQKA 5CKFA 2KQWA 3Q7BA 2COWA 4C23A 4CECA 1TGOA 3ZT0A 4KBMB 4CFAA 3GLXA 2D0AA 3M8SA 4WQ4A 4M7DE 2ZPBB 1WBBA 2M02A 4BRHA 4M7AA 2KW4A 3CCUN 1SKWA 4FK2A 2DIQA 3HT3A 3DLKA 1YF5L 4FPBA 3I55T 3LL3A 4BRQA 1SQKA 2OX7A 4PFPA 5HOOA 4J7FA 2JOYA 4BD3A 1I5LA 3SMSA 4C92E 2ZM6K 3SNNA 3JXUA 3T9NA 3V9UA 5GAMf 5AQFA 3AVCA 2NZTA 4CHYA 3CJ9A 1A5XA 1O13A 3KBGA 3HSBA 3ASMA 1MMGA 4H0OA 4BQZA 5ADXH 3RMDA 1NJWA 4B9LA 1VSLA 4EFHA 2EJGA 1QQNA 5CZ1A 5AR0A 3FJ5A 3L2RA 4AHVA 2V8JA 3VQ8A 1YHQQ 4IFEA 1RT3A 1IKYA 3LDQA 4JAXA 4LSNA 3ZSRA 3KD5E 3UT1A 1G2BA 4J9IA 4RWTA 3I55Q 4MLEA 3T1YK 1NNEA 1HJOA 4CF0A 3E01A 3H08A 2QEXQ 4KHPK 2D1KA 3TTFA 1UGVA 5BRHA 4B9XA 3AGRA 2M0OA 2EJ9A 1ZBUA 3H1VX 5GMKh 1RNHA 1X9SA 5AQJA 2JMAA 3HOSA 3BGRA 5AQVA 3P83D 4BG8A 1LOTB 1C6VA 4QS7A 3VJPA 1H1VA 3AVGA 3CCVT 3TI0A 1X9MA 5FPEA 2DZCA 3EH1A 3RMQA 1TKDA 5GAOl 1N6AA 5CKBA 5D6YA 1XHXA 3ZT3A 2GNCA 4FK0A 1KD1U 3KKSA 3EGDA 3CCST 3JCMJ 4DV7K 1E3MA 1XJWB 3V8JA 2DD5A 3VUZA 4FSSA 4MDXA 3DXKB 3CCRT 2ENMA 1Q86C 3F70A 3LP3A 3LANA 4DV6K 1BL3A 1QP2A 4RUGA 4CW7B 3CMET 3EG0A 2E65A 3ZSQA 2HMIA 1VQ8N 5KCHA 2QEXA 4RG8A 3ME9A 1DLOA 1PNJA 3U9DA 4OGCA 4GKKK 1V29B 4BY6B 4DF8A 2V7YA 2MK5A 2OJ2A 1HRHA 1WJRA 4M3XA 3JS6A 4Z4GA 4FWPA 5EVZA 2WSEE 5CKDA 4M75B 2BZXA 2NUPA 2XI9A 4XH1A 2GV9A 1QWEA 1KAXA 3RR8A 1M30A 4PJOD 3CFRA 1O1WA 4EDUA 4XU0A 3VS4A 3QMLA 1NKBA 3KWIA 1WJSA 2UYTA 1HYZA 3OYJA 3QIIA 1WSIA 2YHXA 3AVBA 2PTKA 1VRUA 2CREA 3AV9A 3K5NA 1SRLA 4C92F 2QM1A 4J6YA 3DLHA 2K7AA 3D2FB 1ITGA 1GLBG 3CCQT 4IUUA 3OYIA 4JKFA 2K5LA 2RK1A 2YHYA 3IFRA 1N5ZA 2JXBA 1JLGA 1BYMA 5FW9A 1BI2A 4IFVA 1IO2A 2O8BB 1U1TA 2RK2A 4AFSC 1RAAB 4IIOA 1RTIA 2G8WA 3VYHB 1UOCA 3QETA 3QSUA 2L3RA 2AA4A 1LCKA 1YJNN 1UGSB 1M5Q1 3QKJA 1BI4B 1NGCA 3NTIA 2FRYA 4HUGA 3R9PA 2YLBA 3CBMA 1VQ5T 2HHVA 4OMFB 2D0NA 4Z4CA 3CC4Q 5GAMh 4HVWA 1NK5A 1YJWA 3MJXA 2Q0RA 4MZPA 2YNGA 4BRLA 3LDSA 4DTUA 1W97L 3I0SA 4IFYA 2AJQA 2FSJA 3A2FA 3O08A 1NBEB 4OPHA 3J7YP 2PYJA 2ED0A 3NGPA 4F3OA 3PTAA 4DCHA 1Q81C 5KYYB 1N27A 5J2PA 2O8EB 4II1A 3G71N 3NHGA 5CVIA 1WSEA 3SFMA 5FU7B 4DQ2A 3FE1A 3R6NA 1C1AA 1XQSC 4BR7A 4K25A 1H3ZA 2JW4A 3AY9A 3M4GA 5J1EA 3SQ2A 2KXCA 8ATCB 1JJ2P 2KYMA 4R5PA 3QJ6A 2JS0A 1K9MC 3AA3A 4K41A 2LJ3A 1LWEA 5KPTA 2D8JA 2IVNA 4LN2A 2VWKA 4JK9A 1VQ7N 2QA4Q 3DLBA 5JS1A 4EZ6A 2B8AA 2EYQA 2QAZA 3CC4T 2XDPA 2RPNA 1TUCA 1VQ5Q 5AQGA 3PSFA 3CC7T 3RNJA 3P8DA 5HRRA 3PSIA 1BHLA 5M1PA 2KKZA 3VF4A 3LWHA 1ACMB 1M3BA 3O6WA 1K4US 4Z94A 3IRXA 3MX2A 3EFSA 4HUEA 5I2SA 2HL5C 3CQXA 1BI1A 1RI0A 1ZSZC 2GTDA 1XOVA 4KHQA 5KYUA 1WX6A 3DLLA 5AQMA 4LD9K 1X01A 4AHRA 3V81A 5HLFA 1IBLK 4J9BA 3WXLA 1Z05A 1TK0A 4Z8AA 1BI4A 3MP1A 4DB3A 4QQ6A 1IGQA 3TSZA 1KVAA 4N56A 2DRKA 1D9FA 2HQHA 1GLEG 4A53A 3EE8A 4RTZA 4A62A 2KMTA 4C8QB 1BUPA 3D7EO 4OMQA 4FWRA 2CH6A 3UKRB 2PZ1A 1UG1A 4U7BA 2XG8D 4FXDA 3P5JA 3TANA 2IIMA 4C8QD 3CC2Q 1WB9A 4LDXA 5LJ5d 3JB9H 3OA9A 1QSSA 4OLBA 5KYYA 4O6JA 3QERA 2QGFB 4CHQA 3H6ZA 3PVQA 1BU6O 2OPPA 1R8OB 2VKNA 4JLGA 4JI6K 3O9TA 4DG1A 5BN9A 5FWBA 4ID1A 5C2FA 4PA1A 2W0ZA 1UDLA 3CXCM 3SWNC 2O8DA 4RCBA 3OYAA 3H0HA 3S3OA 1RBSA 1X3MA 1WHMA 3EGUA 5GMKm 4J6WA 3GPLA 2GGRA 4M45A 2E5KA 4UC4A 2RHZA 2F96A 4Z4FA 4ISGA 5AQSA 2VGNA 2PUOB 1BG3A 1D1BA 2KBTA 1C0GA 1DTQA 1G83A 2DVEA 4J9CA 4AFQC 2VXFA 1RT5A 3VS2A 1VQMT 1MHNA 3NPFA 4W5OA 1X2QA 3HM8A 3EYZA 3VTHA 4LF5K 2KAFA 2FSNA 1ZHIA 1KC8R 2IGIA 1QW1A 1KJWA 2GUPA 4FLTA 1X6GA 3KFVA 4M75F 3DWLA 1Y07A 1RI9A 2BE7D 2JWLA 3EO3A 2MPXC 4BY6C 4XU1A 5D6WA 4CHOA 4EIKA 1E6GA 2HNIA 4E7SA 2EAYA 4O4GA 1Q82O 1HNXK 1HYOA 2JTFA 4DSKA 4JPBW 4OB2B 4CGHA 1UGRB 4CJ3A 4JKBA 4GLKA 5LJ3g 5DMRA 4IDKA 2J6KA 1OYXA 3C4SA 5LJ5h 2PY5A 4ID5A 2GUIA 3SBGA 5BRFA 2CP5A 1VQ7A 2LSNA 1TAUA 1L3TA 1ABOA 1IXDA 3TR8A 4FU6A 1TUUA 2K2MA 1D9DA 2FO0A 5IT9O 1YHQT 3K9KA 2HW3A 2O8FB 4FWLA 2XRIA 1Y71A 2ASPA 2MIOA 3CJAA 3NVKA 3MEAA 1RLQC 1UB4A 2HQEA 1YP5A 2L5QA 4IUVA 1OI1A 1KC8C 1WSGA 4WF9L 1DGKN 1K8AC 1D09B 4YOTA 4CK1A 2QKBA 1KQSA 4WYBA 1V76A 3AO1A 1NOZA 4ELUA 3PVLA 1D0ZA 1OEBA 4CF8A 3A8HB 1KHIA 2P9KA 1N33K 5SWMA 2VWFA 4OLAA 1TYQB 1SL1A 2DK3A 2LCLA 1J9AA 2E20A 3LDOA 2VG7A 3VGKA 1OX9A 1TWBA 1TL1A 3CIPA 3ENHA 3IMXA 1Q82C 5J3BA 4CC2A 5KTQA 1VQOQ 4H0YB 1YJNA 8AT1B 1BI0A 2D0OA 3SDZA 1J53A 1W7AA 2LJ1A 4DQQA 3VQ6A 3CCJT 2XO7A 1IB8A 3ID6A 2ESWA 3OW2A 1MA9B 1VRTA 2O8BA 1JCGA 1TVRA 4F7UF 1VQ5N 2QQ9A 4B8AB 4WQ5A 5DM6L 1ASUA 4JZ3A 4IJAA 1OH5A 2C0IA 2ZGWA 4ZTFA 1KVBA 1JKHA 3CJCA 1VIFA 1W9HA 3FFIA 3MMVA 3VQ9A 4BQLA 5KRSA 4DS4A 3O4NA 5KYWA 1MNEA 1N34K 1JL2A 4KULA 3EHRA 5M1NA 1Z6RA 4OMOA 2XDDA 2WFBA 1B3QA 2HMAA 4IKFA 4QAGA 5AFUA 2DFEA 1MUZA 1SSFA 2R57A 3H1QA 4J8FA 3CD6A 2KNBB 1AEYA 1RGIA 4RW7A 2DJZA 4RW4A 5LJ3j 2DEQA 4XH5A 2Y4YA 4JJBA 2VV5A 4JYAK 4E3SA 3BF1A 1KC8U 2E2QA 2YNHA 1PHTA 4GNIA 2KI7A 4JKDA 2OAUA 2HEQA 4IURA 3RWUA 4C5IA 4Z4EA 2PZSA 5I11A 1JJ2A 3H45C 3P39A 4LDYA 3S41A 1VQ6N 3PGGA 4WTOB 2YUOA 1FYNA 4JNEA 2F2VA 3AGKA 2P9UA 1RTHA 1WHGA 3T1AA 4CIFA 3VQDA 5KGXA 2AT1B 2QDYB 3S6WA 5HL7L 2VC8A 3RMSA 4AM7A 3NTKA 4X34A 3NF9A 4ISEA 3VQEA 2GCXA 4NYFA 4BRFA 2EIFA 3CCSN 2KVQG 4BGBA 4M77B 3D45A 4PY5A 4XTWA 4LF7K 1OH7A 2E41A 1B7TA 3OYYA 1K9MR 4BRMA 3OW2M 4JKGA 1U1SA 3CCMQ 2EHGA 3AVKA 2NUTA 3EZWA 4A4EA 2CGHA 4PJOE 4LF4K 3C12A 3F5TA 2HZYA 3C6AA 2A41A 1H3HA 3JB9D 1R0BG 2DL4A 3CERA 2V7ZA 3WXJA 3JRZA 3DLEA 1QWFA 2DO3A 3QEWA 4ZNXA 2WTUA 3M53A 3W0LA 4E7ZA 1TS9A 3HFNA 3X25B 3AVAA 4NOYA 1XMQK 4IIMA 2YNFA 3JCMd 3C7NB 4GVEA 3P8BB 5F2RA 4BR5A 5DM7L 2LQNA 3L6QA 4VUBA 3MK6A 1VQ9T 2E88A 1NK0A 4NO7A 1NLVA 4FJHA 2QW9A 4X1VA 2NRRA 3TSPA 1YJWQ 4MQ3A 1OVQA 2NUZA 4JKEA 5AZJB 2HSTA 1K73O 2KFZA 2PBDA 4MDWA 5J39A 2KFNA 4H03B 1D4XA 2RN2A 2I0NA 4C92G 4Y1DA 3SB2A 2P9UB 2P4TA 3MEDA 1YVNA 3HM9A 4AHSA 3FFKB 4KHWA 3FLGA 3CCVA 3AVIA 3VEZA 1WXTA 1SEMA 4AQYK 3MEGA 1Q86R 3SK3A 1K0SA 3DXMA 4L3QA 4F04B 4WE1A 1UFFA 2X4JA 2KT8A 3J81E 3F9MA 3CCJN 5JICA 2EQJA 2V52B 3I5RA 2P9SA 1IBKK 3ZLJA 3N4QA 3BY7A 4DV1K 4DR7K 1K6YA 2E12A 5B8HA 1M9SA 3OMCA 2NRWA 2VB6A 4W5QA 4M78C 3GP8A 1NK4A 1VYVA 3GBTA 4ME7A 4XTXA 1WZOA 4NB4A 4WFNL 4QVZA 2VXEA 2HKQB 4J6XA 1MMDA 2LNHB 1VSIA 2WBNA 1X9WA 2DFUA 2LT4A 2PQWA 3IKMA 3GOIA 3VGLA 2QYZA 3X24B 2QTVA 4EPCA 1JLFA 4DTXA 2GX9A 2RHUA 3H3OB 1WQ7A 3OJSA 3PE0A 3GOXA 1MMNA 1DJ7B 4XTUA 5GAN7 2VVKA 2QXLA 1RADB 5GINA 1W2BA 4YNQA 4DWIA 1LJOA 2P84A 4CIGA 4N76A 1MWMA 4B9NA 1Q86O 5KE2A 3O5BA 3AVNA 1MNDA 5CCAA 4LD6A 2P9LB 3L2QA 4DV5K 4KHNA 4M77D 3G6EQ 3IS9A 1WNLA 4MFBA 3QLHA 5GANj 1WDXA 4RTWA 1EP4A 2QQRA 5KYXA 2BIVA 3R1XA 1YVUA 1SRMA 1RT4A 2HHSA 2QASA 3HSCA 3V7RA 3BDLA 2YDLA 1LAWA 4Q0BA 2W10A 3GNGA 2X78A 3CC7Q 5GMKj 1GLLO 5GJWB 2NWMA 2RPIA 3PIOL 1BU1A 1ZX6A 1QVFP 3TTCA 4M78E 2QA4T 1RAHB 3MP6A 5CQXA 5KYUB 3JB9J 1A5VA 5IH2A 3AVMA 2RI3A 5FPMA 4CGFA 1YJWT 1U2VA 3CEYA 4IOCL 2AZSA 3SUOA 1QSLA 1AWOA 4FJJA 4FOIA 4Z02A 3Q1JA 2Q0UA 1VQ9Q 3REAB 3VUBA 3WEEA 2FPDA 3CD6T 4A5BA 3LDNA 1C6VX 4LH5A 1QVGM 4DBRA 1UECA 2V8IA 4LNPA 3QNNA 2K6DA 3GNFB 1FJGK 3QHSA 4IEEA 1YJ9T 4FVUA 1M1KU 2CSIA 1NMNA 1VQLQ 2HF3A 1ZXOA 2WONA 3ID8A 4KTWA 2E70A 2VASA 4JS4A 2LRQA 3TQ7P 2F9TA 3CF5L 4FZYA 4JHDB 2EW3A 2A6AA 3CCEA 4JZ4A 4J9EA 1NJIR 1NGAA 4YY3K 4N0AC 1ZBSA 2OI3A 1Q8IA 3CFOA 1IRXA 3JCMX 1T0HA 1VQKT 4E7JA 3L4IA 1U04A 2FZCB 2QWMA 5EC7A 3PX0A 3PIOA 4PQUA 1N9SA 2CP0A 2F69A 4EMKB 4FSXA 4A4GA 1VQPN 4ZN1A 1NBWA 1HQEA 4C92A 5AQRA 4QOZB 3ZL7C 2YHBA 2XICA 3OBWA 4ICLA 2IOCA 1Q81O 4CHPA 4IG3A 2B86A 3MEUA 4BG9A 1TUDA 1K76A 5EU7A 5C25A 5GAMe 2O9VA 1QVGP 5I2MA 4V19S 4F3TA 2FG0A 1S1XA 2DTIA 4JUVA 3KTQA 4LUDA 3OSSC 3ZT2A 3UKUA 1CXQA 1RDBA 2V51B 4FL9A 4WCEL 1HLUA 1R77A 1ASWA 1VSEA 1SZ2A 4ZGEB 3FJPA 2ZGYA 4RW6A 3BZKA 4GY2B 4BR2A 4CI6A 4DQPA 3ZETB 3LX7A 3FDRA
chains in the Genus database with same CATH topology
2B5JA 3DOKA 1BL3A 1C0TA 3ZSQA 2HMIA 2XHBA 4RG8A 1DLOA 4N41A 1U4BA 2O4IA 4OGCA 3ZT1A 3V9XA 4DF8A 1J54A 1HRHA 3S9HA 4M3XA 1HQUA 2B4JA 3LZIA 3RTVA 1S1UA 5HRSA 4DQSA 4DFKA 3PV8A 4Z4GA 3DRPA 4O0IA 1KRPA 1T7PA 3P1GA 1KCFA 1RDCA 3SQ0A 1RDDA 1QQCA 1WN7A 4DS5A 2GV9A 3PX6A 3RR8A 4LH4A 3C6UA 3CFRA 1O1WA 1LW2A 2Y1JA 1UWBA 1NKBA 1RBTA 3VA0A 4KHUA 1IG9A 4ZHRA 1HYZA 2A1SA 3AA4A 1U47A 4PUOA 4B08A 3OYJA 1WSIA 1WSJA 2YHAA 1HJRA 2P1JA 3AVBA 3MECA 1VRUA 2XY6A 3S3MA 4FJKA 3AV9A 3K5NA 1XI1A 4CJTA 4M3WA 1RT1A 2Q3SA 4BWMA 3DLHA 4FCYA 4KPYA 1ITGA 4CF1A 3KLHA 1JLAA 3K5LA 1EXQA 3OYIA 1RBUA 3NBPA 1Z26A 4CJQA 1C0UA 4DLGA 1JLGA 5HP1A 1KFSA 4IFVA 3OYKA 4CEOA 1IO2A 1JLBA 3NFAA 4BDZA 4F4KA 1KTQA 1U45A 4CEBA 3K58A 1RTIA 2G8WA 1UOCA 4KHYA 1NKEA 3QETA 4FYDA 1TAQA 4JS5A 4FLXA 3OYCA 3V1QA 1HYSA 1BI4B 5C42A 3SUNA 4HUGA 4CGIA 4ZTJA 2HHVA 4Z4CA 3HYFA 2HHWA 4DU1A 1NK5A 2G8FA 1R0AA 2YNGA 3LDSA 4DTUA 2BDPA 3I0SA 5K14A 4IFYA 5KI6A 4CJKA 2AJQA 3A2FA 2ETJA 2KQ2A 1L3VA 1IHVA 5KGWA 2PYJA 4F3OA 2EX3A 3DLGA 3QO9A 1VSJA 1TL3A 5HBMA 3NGYA 1X9MA 5J2PA 3AO3A 3EZ5A 3K57A 1ZBFA 3WNHA 1IH7A 3OVNA 4DLEA 2HB5A 3NHGA 1T8EA 1WSEA 3EY1A 5C24A 1KSPA 1NJXA 3LZJA 3VQCA 4DTMA 4FLVA 1C1AA 2VWJA 4B3OA 5J2NA 1FK9A 4CEQA 5I42A 1RBVA 5CY4A 3AVLA 5J1EA 4HTUA 1GOBA 3SQ2A 4R5PA 4NCAA 3K2PA 3AA3A 3QNOA 1LWEA 3ZCMA 1XWLA 1BIUA 2RF2A 3TAQA 4I9LA 2VWKA 3JYTA 3DLBA 5JS1A 2X6SA 4EZ6A 2DFFA 3OYHA 3TAFA 2BE2A 3HO1A 1RBRA 4AILC 5HRRA 2Z1HA 4FJNA 1BHLA 1B9DA 3IRXA 3B6PA 4OKJA 3VA3A 4FZXC 5I3UA 4HCCA 4HUEA 1WNSA 3KD1E 3HPOA 1ZBLA 3PX4A 1RT6A 2OYQA 4KHQA 4CJWA 2OPQA 3DM2A 4AHRA 1RTJA 2Z1JA 4CJUA 3V81A 4FVMA 4CEFA 4Z4HA 5HLFA 4G1QA 1QE1A 4F2SA 4AHTA 1TK0A 4HUFA 1BI4A 4DU3A 4M3ZA 1KVAA 4FW2A 3LWLA 1FXXA 4N56A 1D9FA 4KTQA 4C8OA 3K59A 3U3YA 3RMBA 4BE2A 3M8QA 3CFPA 4CJVA 2ITGA 3O3HA 2HVIA 4KB1A 4FXDA 3P5JA 3TANA 2HNDA 3VQ5A 1FKOA 4I2PA 1QTMA 1SL2A 1C0MA 3KLEA 3ZSYA 3F73A 3U6FA 1U48A 1QSSA 3QERA 4OLBA 4CHQA 4FM1A 4FLYA 1BCMA 4FLUA 1Z25A 4FW1A 2OPPA 1MU2A 2FBXA 3VQAA 4YFUA 1GOAA 2XY5A 4DG1A 2IDOA 4ID1A 3OYDA 4J2EA 1JL1A 4PA1A 1HNIA 3CM5A 3TWHA 1RBSA 3OYAA 3S3OA 1LV5A 1JXBA 1U49A 4M41A 3OYLA 4M45A 1TK8A 4Z4FA 3LAKA 3M8PA 1F21A 2F96A 4N47A 3O3FA 3AVJA 3NGIA 1VSFA 1VK0A 3S3NA 1DTQA 4CCHA 3V9SA 1RT5A 1LWCA 4DSEA 4W5TA 3HJFA 4M3UA 1KFDA 1SKSA 4IG0A 3EYZA 3KK2A 4M3TA 1CXUA 4KKOA 5HROA 3OYEA 2IGIA 3OS0A 4FLTA 5J2MA 3OY9A 3HL8A 1Q9YA 4CIEA 1TKXA 1I3AA 4FM2A 1EETA 4CHOA 2OPRA 4FJ8A 3HP6A 4O4GA 3I0RA 4DSKA 3SUPA 2FBTA 3RMCA 3ISNC 4CGHA 4EP5A 3V6DA 2QKKA 4CJ3A 5CZ2A 3OS1A 5DMRA 4IDKA 3I8DA 2ZE2A 4C8LA 5CYQA 3G10A 4CEZA 3SV3A 2PY5A 4ID5A 2GUIA 5HRNA 1TAUA 2LSNA 2P5GA 1L3TA 3TR8A 4BACA 2G8UA 3AA5X 4CHZA 3L2WA 1EX4A 4CF9A 3M8RA 4I2QA 1D9DA 4K8XA 3V9ZA 4AHUA 2HW3A 3NF6A 3L8BA 2XRIA 5KRTA 2QK9A 2FBVA 1LAVA 2HNYA 4ELVA 4LD0A 1L3SA 1WAFA 1WSGA 3HSTB 3SCXA 2F8SA 4CK1A 3MXMA 2QKBA 3PO5A 2QXFA 4FJXA 4BWJA 4CGGA 2IC3A 3DLRA 5D3GA 3AO1A 1HPZA 1NOZA 1S5JA 3LPUA 4ELUA 3VQQA 2BGGA 4CF8A 1VSDA 3SPZA 1TKZA 1QMCA 5SWMA 5DK5A 4OLAA 1RT7A 1SL1A 4W5NA 1J9AA 4GVMA 1KVCA 2VG7A 2KZZA 1TL1A 2G8VA 4F2RA 2WOMA 5T7BA 3MXIA 1KLMA 4NYNA 1BGXT 4B9MA 5KTQA 3KIOA 4CEAA 4J2DA 4KREA 2P51A 1J53A 2YKMA 2G8HA 4EZ9A 3VQ7A 4DQQA 3VQ6A 3ULDA 2XO7A 1VRTA 3CQ8A 2G8IA 1NK8A 1TVRA 3V4IA 2Y1IA 3ALYA 4B8AB 4LSLA 4K8ZA 4FJ7A 1RT2A 4CJRA 2HVHA 1ASUA 3CM6A 4N5SA 5FDLA 3HXMA 3NAEA 1KVBA 4ZTFA 1JKHA 4H4MA 1W9HA 3FFIA 3VQ9A 5KRSA 4DS4A 1LWFA 3O4NA 1NK7A 2PYLA 4DSIA 2YV0X 1SL0A 1YT3A 1JL2A 3V1OA 4GW6A 4QAGA 4IKFA 1S6QA 2DFEA 1TKTA 2DFHA 1FKPA 2IS3A 4Z0UA 3HK2A 3DMJA 4RW7A 1UA1A 4O0JA 4RW4A 1REVA 5SZTA 4DFMA 1UA0A 3KK3A 3BDPA 4DTRA 4FK4A 1CZ9A 1S9GA 2E4LA 1HNVA 4C8MA 1RTDA 1ZBIA 4HCBA 4FZZA 5D7UA 4E3SA 4C8NA 2YNHA 2ZQBA 4XIUA 3NF7A 3L2UA 4E1MA 3KK1A 1BIZA 3V1RA 4DTJA 3WNEA 2RKIA 1S1VA 5J2QA 3CYMA 3RWUA 4J2AA 3L2VA 4Z4EA 2PZSA 4CJEA 2R7YA 1QS4A 1RILA 2VG6A 4DTSA 1WLJA 2XY7A 4OKEA 1VSKA 2A1RA 3WNFA 2P5OA 4C8KA 4IBNA 3SJJA 2XY8A 3NF8A 2B6AA 1CZBA 1JLCA 3NCIA 1GOCA 4DTOA 4AH9A 1RTHA 2FC0A 1X1PA 2VG5A 3T1AA 3VQDA 3AA2A 4CIFA 5KGXA 4Q5VA 4E7IA 2HNZA 1D5AA 1TV6A 3DRSA 4B9UA 4DSLA 2KTQA 3QEIA 3HVTA 3NF9A 3B6OA 3VQEA 1ZBHA 4NYFA 4FJMA 4O55A 3SQ4A 1S6PA 1CLQA 3D45A 4PY5A 4LY7A 4TSXA 1KLNA 4KO0A 2GBZA 2ZD1A 4HHTA 4KFBA 4CK3A 1TK5A 3ZSZA 2EHGA 3AVKA 2D0BA 3RMAA 3PY8A 4M3RA 4NCBA 2NUBA 4B9SA 1WAJA 2F8TA 3QESA 3V9WA 1Y97A 5FROA 4O5BA 1YTAA 3DLEA 4DFPA 1C1CA 3AVFA 4CJFA 3QEWA 3PO4A 3KLFA 3QIOA 1NJYA 1N5YA 4F8RA 3TAPA 1UAXA 3ITHA 3T19A 3AVAA 3L3UA 4EP4A 4KTZA 3C94A 3T3FA 1XHZA 2OA8A 2YNFA 2Z1IA 4DTPA 4E19A 4UQGA 5JS2A 4FJGA 3SQ1A 1B92A 4DF4A 1IHWA 2FBYA 2X6NA 3KKRA 3U3GA 1NK0A 2ATQA 4DQIA 4FJHA 3SYZA 4OKKA 1QHTA 1YTUA 1HYVA 4I9QA 2HHXA 4OJRA 4MQ3A 3ZSXA 4BE0A 1NOYA 1W0HA 2KFZA 4DTNA 2HHTA 2KFNA 4I7FA 2RN2A 1JLQA 3MEEA 4Y1DA 2OZMA 4FLWA 3LP1A 3MEDA 5HRPA 4CERA 1NK9A 4J2BA 4CEDA 3HM9A 1Q9XA 3C6TA 4W5RA 4AHSA 4CJLA 4JRPA 3VN5A 4FJLA 3AVIA 3L3VA 4CJSA 4E0DA 1T03A 4KHWA 3MEGA 2OPSA 2HHUA 3SUQA 4Y1CA 4DMNA 1LW0A 3VQBA 3HPGA 4E7KA 4WE1A 1NKCA 3ZT4A 1DTTA 3NGZA 1B9FA 4FJIA 1I39A 1SV5A 4CJ4A 4NCGA 4CFBA 2BANA 4CJ5A 1BCOA 4CJPA 4H8KA 3QINA 4BE1A 3JSMA 1T05A 1VSMA 1K6YA 2YNIA 3LWMA 3NH0A 1JXEA 4RW8A 4W5QA 4H4OA 3AO2A 1NK4A 4KHSA 3LAMA 4DQRA 4E7LA 3O3GA 4PWDA 3MXJA 3RR7A 1IKWA 1S9EA 1VSIA 4CE9A 4CFCA 1X9WA 3DOLA 2KZMA 3TAMA 4OPKA 1JLFA 4DTXA 1WSHA 3NDKA 4JLHA 3RRHA 4FJ5A 1JLEA 3OJSA 4DSJA 3DRRA 3VQ4A 4DSFA 4YNQA 1IKXA 3G0ZA 4B8CA 3LPTA 2Z1GA 4FM0A 4CIGA 4DWIA 4KAZA 4N76A 4HVJA 4B9NA 3ZSOA 3F9KA 3NH1A 3KJVA 2D0CA 4M42A 2I5JA 3AVNA 4OVLA 5FRNA 4CESA 1BQMA 3WNGA 4KHNA 1C1BA 3L2QA 3IS9A 4MFBA 3QLHA 3HVRA 3SV4A 1BQNA 3QEPA 3QIPA 1EP4A 4BDPA 4FJ9A 1D8YA 1HMVA 3ZSVA 3THVA 3VQPA 3TABA 4QCLA 1YVUA 1RT4A 3DYAA 3AVHA 3OYBA 3ZSWA 3QEVA 3RRGA 3NH2A 2HHSA 4KI4A 1IKVA 3KLGA 1LAWA 4Q0BA 2X78A 1J5OA 1WSFA 4ELTA 1EKEA 2RPIA 3QEXA 5FRMA 4E89A 3O4QA 3AVMA 3AO4A 1A5VA 4CGFA 1S1WA 4CECA 4CFAA 3TARA 1RDAA 1TGOA 2O4GA 3ZT0A 3M8SA 2D0AA 3SUOA 1QSLA 4OPJA 3IG1A 3HP9A 4FJJA 3PUFA 4O44A 3OJUA 4CEEA 3SI6A 3C95A 2KW4A 4KB0A 1SKWA 1L3UA 4FK2A 4CFDA 1VSHA 3HT3A 3DLKA 4LH5A 1C6VX 3OYFA 4B9TA 1L5UA 4FLZA 3K5MA 3QNNA 2OZSA 4Z4IA 3NE6A 1ASVA 4E7HA 2WONA 4KTWA 3SNNA 2HHQA 2W42A 1A5WA 1BISA 4AHCA 4B9VA 4CF2A 3OS2A 3V9UA 4BDYA 3IAYA 3AVCA 4CHYA 2E6MA 4JS4A 1A5XA 3ASMA 1NJWA 3RMDA 2IAJA 4B9LA 4KRFA 4M3YA 4FZYA 1VSLA 3OYMA 3OYNA 4L8RB 5CYMA 4KI6A 5CZ1A 4AHVA 3L2RA 3VQ8A 3MAQA 1Q8IA 1RT3A 1IKYA 3CFOA 4LSNA 4E7JA 1U04A 3ZSRA 3KD5E 3PX0A 4PQUA 3K5OA 3AO5A 4GMJB 2DY4A 2G8KA 1RCHA 4CF0A 1HQEA 3E01A 3H08A 1S1TA 4JRQA 4QOZB 2YHBA 3DI6A 4KV8A 1QSYA 1NJZA 2D5RA 4ICLA 2IOCA 4DFJA 4CHPA 4IG3A 3OYGA 3SZ2A 1ZBUA 4RW9A 1ZYQA 1XC9A 3KLIA 1RNHA 5EU7A 4DU4A 1SUQA 5C25A 2E6LA 3BGRA 4W5OA 2X74A 1X9SA 1SKRA 4F3TA 1S1XA 3P83D 3CG7A 1C6VA 3KTQA 3ZT2A 3AVGA 1CXQA 1RDBA 3TI0A 5E41A 3SPYA 2DTUA 3HPHA 2YKNA 1TKDA 3TAEA 1XHXA 3ZT3A 1G15A 3LP2A 4OGEA 3UIQA 4FK0A 3KKSA 2JLEA 1ASWA 3LP0A 1VSEA 4CGDA 3LALA 4CK2A 4CHNA 3D0PA 4E1NA 4RW6A 4CGJA 1NK6A