4FW1A

Crystal structure of two-domain rsv integrase covalently linked with dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
210
Chain Sequence
b'PRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGRPKAIKTDNGDAFTSKSTREWLARWGIAHTTGAMVCRANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHKERGENTKTPIQKHWRPTVLTEGPPVKIRIETGEWEKGWNVLVWGRGYAAVKNRDTDKVIWVPSRKVKPDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A possible role for the asymmetric C-terminal domain dimer of Rous sarcoma virus integrase in viral DNA binding.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
total genus 71
structure length 210
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 4fw1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4fw1A01
3K5LA 2RKIA 4Z4HA 4Z4GA 4OLAA 4CJSA 4IG3A 3D45A 1NOYA 3M8SA 4AHUA 1BI4A 3I0SA 1TL3A 4E89A 3CFPA 3QNOA 4DF8A 4C8KA 4DTMA 4EZ6A 1QSLA 4F8RA 4K8ZA 3C94A 1FXXA 1FKPA 4F3OA 1WAJA 4CGIA 4Z0UA 3WNEA 4CJTA 2IOCA 4DTPA 3QESA 1ZBLA 3AA4A 3AVBA 1TVRA 1X1PA 4FVMA 2HNYA 4DSFA 4HUFA 4CJUA 3L2VA 1U47A 3HK2A 1CLQA 4AHCA 1KTQA 3HJFA 1RT2A 1LWEA 4PWDA 1XC9A 4M3ZA 4JRPA 2FBTA 3MEGA 3KD5E 2BGGA 2AJQA 1NJYA 3ULDA 1ASUA 2RN2A 2QKBA 1WSIA 4CHYA 1LW0A 5KGXA 4NCAA 1S6PA 3FFIA 3VQ4A 3PX0A 1C0UA 4W5RA 3MXIA 5HROA 2Z1IA 4FK2A 4N41A 3LPUA 3AVHA 3ISNC 3I0RA 2YNHA 1IKVA 1VSMA 1NKCA 3KTQA 3DMJA 4AILC 2PYJA 3SI6A 3WNHA 4DTNA 4BWJA 2IC3A 3ZSYA 3HPOA 1TL1A 1B9DA 2EHGA 4I9QA 1LWFA 1ITGA 1HPZA 4MQ3A 4CIGA 4DFPA 3DLEA 4J2DA 2IGIA 1RCHA 3OYLA 4CGFA 3ZT3A 1VSFA 1TK5A 4FJIA 2Q3SA 5SWMA 1NK7A 2HB5A 4BDYA 1WSEA 4UQGA 3L2QA 4OGCA 2Z1HA 1ASVA 1IKYA 3O3FA 3DLRA 1S1VA 3VQ9A 3NH1A 3OJSA 3S3NA 1J54A 4ZTFA 1KVBA 2GUIA 1TAQA 2D0BA 4CHPA 1SKRA 1JXEA 1NOZA 3BGRA 5KRTA 2A1SA 1KRPA 3OS2A 4O44A 3LAMA 2P51A 4CERA 2ETJA 3IS9A 2BANA 2QKKA 1S1TA 5HRRA 1JL2A 2B6AA 3NAEA 4CGGA 4F4KA 4YFUA 3VQAA 3SUQA 1ASWA 3QIOA 2DFEA 3DOKA 2XHBA 1RT7A 4CHNA 2DY4A 1KVAA 3AA3A 3M8QA 1MU2A 3CM5A 4FLTA 1O1WA 4CEQA 4RW6A 4M42A 1XWLA 3OYMA 4KV8A 1ZBUA 2BE2A 4H4OA 3OYIA 4ZTJA 3AA5X 4G1QA 4FLVA 3AO1A 4AH9A 1BIZA 1Q8IA 4JS4A 4I2PA 1IO2A 1S1UA 5HRSA 4DTRA 1J53A 4CFCA 2FBYA 4DU4A 3V1QA 1TKDA 3AVAA 4HUEA 2E6LA 3AO4A 3KJVA 5KGWA 3B6PA 2P5GA 2OPRA 4FJ9A 4RW7A 4CGHA 2IDOA 4DTSA 1SKWA 3HO1A 2XY8A 1C1CA 1RBSA 3SV4A 4CK1A 2OA8A 5FROA 1GOBA 1JLGA 4HHTA 3NDKA 4C8LA 4KHWA 5KRSA 3VA0A 2G8IA 4KPYA 5CZ1A 2IS3A 4LY7A 4FYDA 3DYAA 1BQNA 3BDPA 3HM9A 4DTXA 1WSFA 3ZSXA 3VQEA 4E3SA 3TI0A 1B92A 1DTQA 3LALA 5HP1A 4E19A 3SV3A 1VSEA 3NH0A 4DTJA 3AVMA 1CXUA 1NJZA 4I2QA 4AHVA 4CGJA 2Z1GA 1DLOA 2VWKA 3KD1E 2KQ2A 1C1BA 5HRNA 1RNHA 2P5OA 3S9HA 3LZJA 4BACA 4ID5A 1J5OA 3PO5A 4DSKA 4FLZA 2GBZA 3QETA 4DF4A 1UA1A 3VN5A 1B9FA 3TWHA 1RT5A 4DSIA 1N6QA 4LH5A 4KI6A 4PUOA 4CHZA 4KAZA 1VRUA 3V9ZA 1U04A 3AVGA 3LZIA 3E01A 4C8MA 1EETA 2HNDA 4ZHRA 2KFNA 4FJMA 3OYFA 4FXDA 1YTAA 4OKJA 5DMRA 3QEWA 3TAGA 3THVA 1BGXT 1I39A 4DG1A 3DLHA 2VG5A 3CG7A 4CF9A 1LW2A 4DLEA 1BI4B 4N5SA 3K57A 1L3TA 4ICLA 4HUGA 3KK2A 2OYQA 4BE1A 1QQCA 2Z1JA 1KCFA 2OPSA 4M45A 1TAUA 4B9MA 3U3GA 2YV0X 4KHQA 3DI6A 1HMVA 4DQPA 2X74A 4KFBA 1UAXA 4BE0A 4Y1CA 4RG8A 1QSYA 4Z4CA 4B8CA 4NYFA 4DMNA 3OYKA 1X9SA 4CJFA 4FLXA 4AHSA 2G8FA 1HYZA 4H8KA 3K5MA 4O0IA 1QE1A 4K8XA 4J2EA 4CEFA 5D7UA 4DS5A 4W5TA 2DFFA 3NF7A 1RT6A 3IG1A 3U6FA 3HPHA 1S1XA 5CYQA 3VQPA 1VSJA 3AA2A 4B9VA 3LAKA 3NGIA 3PV8A 4CESA 2PZSA 1BL3A 1X9WA 1RDBA 4DU1A 1SKSA 1ZBFA 3T1AA 1WNSA 1HNIA 2W42A 4DU3A 5HLFA 4FJJA 4BE2A 5FRMA 5C25A 1RDCA 2PY5A 4CEOA 3T19A 4E7KA 3P1GA 2OZSA 3S3OA 3QEXA 1BIUA 4IFVA 3KK3A 3AVIA 1C1AA 3HYFA 5C42A 3T3FA 1T8EA 1FKOA 1KFDA 1EP4A 4YNQA 1NK9A 4I9LA 3RWUA 4FJKA 5HBMA 5EU7A 2BDPA 3DM2A 1HJRA 1Q9XA 3SUNA 1NJWA 1Q9YA 3KLEA 3CM6A 3AO3A 4DS4A 3RMDA 1NK5A 4CE9A 4EP4A 4E7LA 2HMIA 2LSNA 4KB1A 4Z4IA 1RBRA 3G10A 1A5XA 3HL8A 1RT3A 1JLFA 3ZSOA 3PX4A 1K6YA 3PUFA 3V1OA 1L3UA 3MEEA 1CXQA 1BHLA 3ZSRA 3NGYA 1HQUA 3OY9A 2G8UA 1UOCA 3OYCA 4OGEA 4L8RB 2FC0A 4CF2A 5KTQA 4GW6A 4CJWA 1D9FA 4IKFA 3IRXA 2P1JA 4CJ4A 5I3UA 1GOAA 1U45A 2KTQA 3MECA 4DSJA 3AVLA 4FJGA 3SCXA 3AO2A 4W5NA 4CFAA 4NCBA 4CCHA 1G15A 3WNGA 4CHQA 5J2QA 4Q0BA 2O4IA 3G0ZA 1RT1A 3D0PA 3M8PA 3A2FA 4C8NA 1TKXA 1X9MA 4M41A 3VQ5A 1RBVA 4CEDA 4CIEA 3NBPA 3QEVA 4M3TA 1VSIA 3C95A 1KLMA 5CYMA 4HCBA 4W5QA 2HHQA 3SZ2A 3QEPA 4DTUA 1CZ9A 2HVIA 5JS1A 3UIQA 4KI4A 2D0AA 3LANA 4DLGA 3RRHA 3RMCA 4J2AA 3JYTA 3AVFA 3OS0A 4FM1A 4DWIA 4OLBA 4Z4FA 3V6DA 3OYEA 1RTHA 3KLIA 1NK0A 3KLHA 3AVJA 4DQSA 4M3YA 5FRNA 1Z25A 5FDLA 3CFRA 5CZ2A 1WLJA 1W0HA 3HSTB 3RMBA 5D3GA 3EY1A 1YVUA 4CJPA 5K14A 3O3HA 3OYNA 4FZXC 3ZT0A 4PY5A 4DFJA 3HP9A 1JXBA 4XIUA 3V9XA 4CHOA 3RMAA 2E6MA 1SUQA 4KTWA 3KLGA 3KKSA 1KSPA 3NE6A 2KFZA 3SPYA 4DSLA 3OYJA 3DRPA 5DK5A 3V9WA 2YNIA 1SV5A 4E1MA 4RW8A 1LAWA 1UA0A 3NGZA 4LH4A 2WOMA 3DLKA 5HRPA 1YT3A 2HHXA 4KHNA 2RF2A 4CJEA 4FK0A 1S9EA 2VWJA 1W9HA 2X6NA 5C24A 4CEBA 3AO5A 3TANA 3O4NA 2XO7A 4Q5VA 3TR8A 4RW4A 4CJLA 3V9SA 1S6QA 4N47A 1TK0A 3NCIA 3F9KA 3OYBA 4NCGA 1TGOA 1VSDA 3LP3A 4FLYA 3H08A 4I7FA 2IAJA 3HXMA 3OYAA 3K59A 4JRQA 4FLWA 4B9TA 3ZSWA 4DTOA 4CJ3A 1QSSA 3OYHA 4CEZA 2NUBA 2XY5A 4LD0A 4WE1A 3SQ1A 4KREA 3KLFA 4DFMA 3HVRA 1A5WA 4F2SA 1UWBA 4CGDA 4BWMA 1HQEA 1RTIA 2GV9A 1XI1A 3TARA 1U4BA 1NK8A 2KZZA 3NF6A 1TKZA 1KFSA 1QS4A 4AHRA 1L3SA 2RPIA 3ITHA 3ALYA 1WSJA 3MXJA 4O55A 4BDZA 2WONA 1D8YA 3ZT1A 4E0DA 3VQCA 5T7BA 4CJ5A 1JLAA 4JLHA 1SL1A 4FJ8A 1YTUA 1WN7A 1SL0A 2XY6A 1RTDA 2YHAA 3PY8A 3L8BA 4DQRA 5J2MA 4B9UA 3HP6A 2OZMA 4LSLA 3O3GA 4PQUA 3VQQA 3OYDA 4NYNA 1VSKA 1RBTA 1HYVA 4TSXA 3F73A 3QEIA 1L5UA 1RILA 3LWMA 1GOCA 1TV6A 2YKMA 3RR7A 2HHUA 5SZTA 4EP5A 1CZBA 2O4GA 3ZSVA 3HT3A 1NK6A 3QERA 1ZBHA 2HHSA 4B9SA 2ATQA 2B5JA 4CJVA 3NHGA 3WNFA 4E7HA 3SUOA 3PO4A 4ELTA 3NH2A 4B9NA 4OVLA 3NFAA 4CFBA 1VRTA 1WSHA 1EKEA 3K2PA 2ZQBA 2QXFA 2XY7A 4MFBA 4FJHA 3CQ8A 2VG6A 4KB0A 4FW2A 1L3VA 2HW3A 3KIOA 4IFYA 4M3UA 2VG7A 4FZZA 4FM0A 3C6TA 4GVMA 1RDDA 1IKXA 1JLBA 2G8VA 4DSEA 3RR8A 2DTUA 1RTJA 4CEEA 5J2PA 3TAEA 3SPZA 3L2RA 1Z26A 1BQMA 1RBUA 1BISA 2HHTA 3L2UA 4IDKA 3ASMA 2FBVA 2D0CA 3L3VA 4CJKA 1JL1A 5J2NA 1DTTA 1LWCA 4FM2A 1BCOA 3DRRA 4AHTA 1QHTA 4OPJA 3AVKA 3L3UA 4DQQA 3IAYA 3KK1A 4HCCA 1EX4A 4E7IA 1C6VA 1C0TA 2Y1IA 1JLQA 4OJRA 4PA1A 5E41A 1C6VX 2KW4A 3LP0A 3NF8A 3LWLA 4FK4A 1TK8A 2DFHA 1D9DA 3ZSQA 2HHVA 1REVA 4CEAA 4CK3A 2PYLA 1LAVA 3HVTA 1TKTA 2OPPA 3DLGA 3M8RA 3TABA 4FJXA 4CJQA 3K58A 3PX6A 3EYZA 4Z4EA 3QINA 3KKRA 5KI6A 4R5PA 3U3YA 3SQ0A 4FW1A 3NF9A 4IBNA 1JKHA 3OJUA 2Y1JA 4FJNA 1I3AA 1F21A 4C8OA 4M3WA 1S9GA 3C6UA 3AVNA 5J1EA 2A1RA 2HVHA 2F96A 2QK9A 4F2RA 4FZYA 4QCLA 3VQBA 3HPGA 4LSNA 3I8DA 4HTUA 1S1WA 2KZMA 4CF1A 3K5OA 4KTZA 3K5NA 3OVNA 2F8TA 2R7YA 1NKBA 3V81A 1FK9A 4B8AB 4HVJA 4N76A 1BCMA 3LPTA 2JLEA 3LP1A 3P83D 3SNNA 1SL2A 3MEDA 2B4JA 1HRHA 2YNFA 2YNGA 3AV9A 4FCYA 4M3XA 3TAMA 4RW9A 4M3RA 4F3TA 1JLCA 1IHWA 2D5RA 3EZ5A 4FLUA 3VA3A 3SQ2A 1IHVA 4H4MA 4OPKA 5CY4A 3RTVA 2G8WA 2XRIA 3DOLA 4IG0A 4CF8A 1VSHA 1S5JA 3ZSZA 3LP2A 4CFDA 4KRFA 4Y1DA 3VQ8A 1IG9A 1R0AA 3DRSA 4B08A 3TAPA 2F8SA 4ID1A 3L2WA 1KVCA 1HNVA 3AVCA 3SUPA 4FJLA 4KHYA 1VK0A 1LV5A 4O0JA 1C0MA 2HNZA 4J2BA 3VQDA 4BDPA 3DLBA 3CFOA 2YHBA 4EZ9A 3B6OA 2E4LA 1IKWA 4N56A 1N5YA 4JS5A 3MAQA 1U49A 3V4IA 3V1RA 1RDAA 4DFKA 3O4QA 3TAQA 1XHZA 3LDSA 2G8KA 3P5JA 4CECA 3ZT2A 1NK4A 1T03A 2ZD1A 2JGUA 3VQ7A 1WAFA 1RT4A 1U48A 3ZCMA 2OPQA 4OKEA 4ELUA 4QAGA 1EXQA 4GMJB 1J9AA 3OYGA 3TAFA 3MXMA 2EX3A 2X6SA 4CJRA 4W5OA 2G8HA 4FJ5A 4CF0A 5I42A 1NJXA 4DQIA 3OS1A 1T05A 3S3MA 1ZBIA 3VQ6A 4KTQA 4ELVA 1QMCA 1Y97A 1WSGA 4O4GA 3ZT4A 2ZE2A 4KKOA 1QTMA 1JLEA 4E7JA 3CYMA 3SJJA 1KLNA 2X78A 3QIPA 4KO0A 4B9LA 3QO9A 4O5BA 3V9UA 4E1NA 3JSMA 1ZYQA 4KHSA 3SQ4A 4B3OA 1IH7A 2ITGA 4CIFA 4KHUA 3QNNA 2FBXA 3QLHA 4OKKA 4QOZB 1HYSA 1NKEA 1XHXA 2I5JA 4CK2A 1A5VA 3SYZA 4FJ7A 1D5AA 5JS2A 1T7PA 3RRGA 2HHWA 1VSLA 2YKNA
chains in the Genus database with same CATH superfamily
2DXUA 2X9HA 1QVGS 2OTLA 2VWFA 4IZ9A 3QXEB 3MP8A 1QCOA 2PBDA 1Z9ZA 1WX6A 3CBMA 1AEYA 4EZ6A 2O9VA 2BZ8A 3VTIA 5KYUB 1QSLA 5GAOm 3C94A 2W10A 3BZKA 4QQ6A 4CGIA 3G4SN 2CKKA 1WIEA 4Z0UA 4EAHD 9ATCB 1YIJA 4DTPA 3QESA 1ZBLA 3AA4A 3ATVA 4FM4B 4DSFA 4EFHA 4ZN3A 4J7IA 4AHCA 4B1ZA 1RT2A 4F14A 1Z9QA 3AAQA 3BY5A 2Y4XA 3MWPA 2EWSA 2JMCA 3MEGA 2DPNA 1MDUB 3VPZA 4B9QA 2C0OA 1ASUA 2RN2A 3EGDB 1WSIA 4CHYA 3TTCA 5AYFA 2F2XA 2RQRA 1WHLA 2L0AA 1NLOC 3FFIA 4PHTX 2UXBK 4PNOA 1C0UA 4BC5A 4FT4A 4B1UB 4CZJA 4FO0A 3CBOA 5C6SA 1Y07A 2JUFA 3AVHA 2YNHA 2PQWA 1VQ9Q 1VSMA 2E20A 1NKCA 3CCSQ 4L59A 2PYJA 3NPFA 3LH5A 3V7CA 4R79A 4BQZA 3BF1A 4FSVA 1B9DA 1LWFA 3WQUA 1QVFA 3NMZC 4B3SK 3CC7Q 4CIGA 3G6EN 4H03B 4DFPA 1ESVA 1O9SA 5DM6L 1RCHA 1U6ZA 5FLXE 4KHPK 1VYUA 1VQ8A 3CC2Q 2PFUA 3DXKB 1ZUYA 2UU9K 2Q3SA 5SWMA 4FJIA 4ORZA 4BDYA 2EJ9A 1WSEA 3L2QA 4M7XA 4MMLA 5CAIA 4FYXB 1QVFS 4DV2K 4NLCA 3L0QA 1X3NA 3HRUA 3IQLA 2HOEA 2GUIA 1SKRA 1G2BA 1NOZA 2A1SA 3URGA 4C92D 4O44A 2FSKA 2G6FX 3QHSA 3PLAA 1WHKA 2D1KA 2KGTA 4BRDA 2OTLN 2ED0A 5CR2A 2DFEA 1YBYA 3QDRB 1RT7A 2AZVA 1T6DA 3DOKA 1VQNN 4J9DA 3AA3A 4BRIA 1ZX6A 4FLTA 5IT9O 4RW6A 3JB9D 4M42A 1QCFA 3OYMA 2F2VA 3D2FB 2BE2A 3BZCA 2UUBK 4ZTJA 1MMNA 4XU0A 3AA5X 1TYQB 2O8FB 2L3SA 4YDUC 3DLMA 3PT9A 2FZCB 5KYWB 3GBTA 1KQ1A 5AFUA 1YIJN 4FVUA 4JKEA 4E7SA 4YOUA 2FBYA 3K9KA 2RQVA 4M7AD 1VQLA 4LDUA 4ME7A 3AVAA 5KGWA 1M90R 1NBEB 2DD4A 8AT1B 2P5GA 4IOCL 4IXCA 5GAMf 1IG8A 3CJAA 4JDSA 1N8RR 1RBSA 3SV4A 2OA8A 4C8LA 3UKRB 4HHTA 3WXIA 5ECAA 5KRSA 2QWLA 1VQ4T 3MKDA 1TTHB 3C0CA 1M1KU 2AKLA 1I07A 4FYDA 1R59O 1B7TA 1BQNA 3DYAA 1QWEA 1U1TA 1YJWQ 5CIUA 1JU5C 1YITQ 4ILGB 4A2AA 3NTKA 1EZZB 4B9XA 1DTQA 3LALA 5HP1A 2KT8A 2L3PA 1YJ9Q 2CUDA 1ZQ1A 3FB9A 1GFCA 4RTUA 5GAN3 3CCUT 2Z1GA 1DLOA 1VQ8N 1BU1A 2V52B 1IBMK 3RIRA 3A1PA 1NGEA 1RAIB 5GIOA 4FYWB 4DSKA 4FLZA 1D0ZA 3FZHA 1U06A 3CCMT 1TWBA 3EGXA 1UA1A 1PSFA 3DB3A 1B9FA 1WXBA 3TWHA 2MF2A 5KQDA 4M77D 1T3LA 2QQSA 4A4FA 4JKGA 3M0QA 4B3TK 4C8MA 4DHYA 3OYFA 4FXDA 1YTAA 3QEWA 2RNAA 3JCMW 2Q0UA 1LW2A 5LJ3g 1HK9A 1MV0B 2F7TA 1SAZA 3MJXA 2E2PA 3RVCA 3CD6T 3KK2A 2QQRA 1G3TA 1QQCA 5AZJA 1TAUA 1I5LA 3IFRA 4KHQA 1IJJA 1HMVA 2V26A 3GL1A 1E4FT 3CMAQ 2EKOA 4B8CA 4NYFA 3OYKA 4DMNA 2BTTA 3V8LA 3K5MA 2QGGA 2YT6A 4HCZA 3NTHA 2DBMA 2BIVA 2RMOA 2YLBA 4GKKK 4BC2A 1S1XA 2VUBA 3EHRA 1W2BP 1VQLN 1JXMA 3NGIA 4YTLA 2NRHA 3EE9A 3PV8A 2LJ1A 3DLLA 4JEPA 4CESA 5FPDA 4KGVB 2O8DA 1ZBFA 1I81A 4BE2A 2HF3A 3F2KA 4CEOA 2EBPA 2X4YA 3TQ7P 2P9PB 2JTEA 5EC7A 5AQYA 3AVIA 2QK0A 5KYUA 3ZBDA 2MK5A 2O8EA 2DFUA 4O5VA 1EP4A 3ATUA 4I9LA 4YDUA 4DUZK 4DR1K 1S22A 4JV5K 4NB4A 5EU7A 1HJRA 1IB8A 2QASA 1ZC6A 1RABB 5CKEA 3SUNA 3KLEA 2HQXA 2D4WA 3RMDA 4DOWA 4II1A 4ILHA 4F7UE 3CCUA 4Z4IA 4JI7K 3I56Q 3ZSOA 4N0AA 1RT3A 4E7ZA 1BUPA 1NU0A 3NMUA 5LJ3e 3V1OA 4J9FA 1QWFA 1VQ6T 2RHYA 2BTFA 1ZSZC 2ZPBB 2L3RA 5FPMA 3OY9A 4BY6C 5BPNA 1WB9A 1UOCA 4JI0K 3OYCA 1K8KA 3E9OA 4L8RB 3X20B 1X01A 3FEOA 4K25A 1RGIA 1GOAA 2MAMA 4OMNA 2MI6A 4GBQA 4OMMA 4A4KA 1HJDA 2D0PA 4XH1A 1DJ7B 4CC4B 1VQKT 1VA7A 3NVMA 1Y64A 1K73O 2LQ8A 4CCHA 3CD6A 5J2QA 4Q0BA 2O4IA 2XI9A 4ZN1A 4OMPA 5FU6B 2I7PA 4MDWA 5DM7L 3C65A 3DXKA 1M30A 3A2FA 4M41A 3VQ5A 2QQBA 1M9SA 2CGJA 3C95A 2E1ZA 1K9MO 3BUZB 3ZEHA 2YRDA 1CZ9A 4BG8A 2MCNA 4PL7A 5C12A 1HD3A 2RA2A 3EG2A 3OSVA 4C8QC 1KQ2A 4J2AA 2QG9B 3AVFA 4J9IA 4OLBA 5CKBA 1RTHA 2FXUA 3KLHA 2FRWA 4DQSA 4B6MA 5FDLA 2QQ9A 4Y92A 3I8BA 1YI2T 4CJPA 5GAOq 3WVDB 1WQWA 5K14A 5L8RE 5IHNA 3ULRB 3P8HA 2E4HA 2ENMA 3RMAA 3WUHA 1WJSA 4A5BA 1JXOA 1SG5A 5I2SA 1IXDA 1SUQA 3EE8A 1R0CB 5M1PA 3NE6A 3SPYA 3D2FA 3OYJA 4DEYA 3DRPA 3R9PA 2CH5A 1TYQA 3S41A 4R56A 2O8FA 2A7YA 4Z8AA 2NUZA 5KYWA 1BA0A 3VRZA 2ASMA 1NG2A 3NGZA 1NGBA 5HRPA 1NYFA 5IXBA 4DR2K 2GX9A 1VOMA 4FIBA 2LT4A 3M58A 1S9EA 2DERA 4X64K 2E5QA 4L6V5 2C06A 2VWJA 2FPEA 2Y90A 1D1CA 1VQ4Q 2RJCA 3V9SA 2QA4T 4A4EA 2DETA 4N47A 1TK0A 1SQKA 1W7AA 1NGFA 4E47A 3RNJA 4NCGA 3CCVQ 3H0FA 1N32K 2HBPA 3UKRA 2YUPA 2LZ6B 3CMET 3H08A 3OYAA 3HXMA 1DT9A 2CDTA 2L2PA 3ZSWA 5I2MA 5JLFA 4DTOA 1QSSA 3KXTA 2OTJQ 2A3ZA 2GWKA 4KREA 4DFMA 3HVRA 1UWBA 3QDKA 1FWZA 2RI3A 4BWMA 1RTIA 2J4RA 3E9GA 2FF3B 3ZETB 3TARA 3NF6A 2IIMA 1KFSA 1QS4A 1AVZC 4M7DD 1WSJA 4ISEA 5KCHA 4N4GA 5AQQA 3SHWA 2WONA 1D8YA 2HBMA 3ZL7C 4GY5A 3O6WA 3EEQA 2EGCA 2A36A 2ZPHB 4DKWA 1SL1A 1KAYA 3IKMA 2V7ZA 2HSTA 4B3RK 2YHAA 1QKXA 3F70A 3HP6A 3O3GA 3UWNA 1VQ7A 3N5BB 4K43A 4NYNA 1E6HA 3QEIA 3GE1A 4M63C 3ASKA 2YKMA 1VQMT 5SZTA 2L8DA 1ZBHA 1NK6A 1V4SA 3QERA 1Y96B 2RF0A 3PIOA 3QICA 4CJVA 2V7YA 3SUOA 1HSQA 1BDGA 3MHXA 4EMKB 4MMKA 2HHHK 2R57A 4EPCA 3UF4A 2QM1A 5BPLA 3VGKA 4GV3A 3CQTA 2QXFA 1OQKA 2NRWA 4MFBA 2XY7A 2F5KA 4M3UA 2HBLA 5AJ3K 4FZZA 2P9LB 3VMFB 2DF6A 4YORA 3LDOA 2DNUA 1RTJA 3CPWM 3FR0A 1DGKN 1BI3A 1S72A 2QEXA 1BOTO 1GLEG 5GIPA 5IWAK 1BISA 3L2UA 3RDVA 2ZPGB 3ASMA 2D0CA 4IDKA 3JAMO 4BDPA 1JL1A 4FM2A 1BCOA 4F7UF 4HCCA 2QGFB 3AVKA 1YF5L 3EKSA 3TSPA 4FU6A 1M90U 1C6VA 2P9PA 4OJRA 3VESA 3HZ6A 1OPLA 4J5YA 4ELYC 1A0NB 4CI0C 3LP0A 3NF8A 4FK4A 3VRYA 2DFHA 1D3BB 1N8RU 4A57A 2CZ0B 2PYLA 2QTVA 3HVTA 5KPZA 1TKTA 5D6YA 2YRVA 3FLCO 3M8RA 3DLLL 4IUUA 3HFOA 3AGKA 5GINA 4RCCA 3O8VA 3H6EA 5AR0A 3EYZA 1VQ6Q 3QINA 1V4TA 3U3YA 2NRRA 3OJUA 1QVGM 4FJNA 2Y1JA 1UB4A 5CO7A 1HJOA 2HBKA 5KYYB 4VUBA 2F96A 4F16A 4F2RA 4FZYA 4QCLA 4LSNA 4PKHA 2KZMA 1LPLA 2DD5A 3K5OA 1U2VA 2E1HA 3OVNA 3K5NA 2R7YA 2F8TA 2IVOA 4WCEL 1FK9A 4B8AB 1BCMA 4JJDA 5LJ5f 1SL2A 3CCQQ 3JCMf 2DX1A 5CVIA 2B4JA 4DV4K 4FCYA 1VQ7N 4K8XA 5GAEP 4M3XA 2COYA 2VYTA 2D5RA 2K6DA 1C0FA 1VQMA 3ZX3A 2VWBA 4IOAL 2NUTB 2CH4W 4EMKC 2CT3A 4CFDA 1VQ5N 4Y1DA 1IG9A 3CC4A 3TAPA 1NMNA 4RTXA 4JUVA 4BD3A 3QUIA 2RM4A 2A40A 4J9BA 2DMOA 2D8JA 3PVLA 4FWKA 2DTIA 3O4WA 5HK0A 2HNZA 4O0JA 1YI2Q 3EG9A 1U5SA 2CT4A 5FLXO 4QT7A 1UJYA 4C0DC 4M75D 3THYB 2GNCA 3O5ZA 1S72N 1N5YA 4JS5A 2KSSA 2QEXN 2NUPB 1RDAA 4F7UB 5C2FA 1K73R 3P5JA 5EX5A 2JGUA 5FWBA 1RT4A 2OPQA 2D0QB 2FSNA 4Q5WA 4KRTA 3PSIA 3J7YP 1J9AA 4J8OA 5LJ3d 4HKEA 2O9SA 3MXMA 4A62A 1UECA 1K9MR 5GMKj 4QKUA 2QA4Q 1WLPB 4MO5A 1NJXA 3QPHA 2DE0X 3VQ6A 3VKIA 3THWA 4FWNA 1QMCA 1Y97A 4H5VA 5LL6Z 3JXUA 4ELVA 4KTQA 3PVQA 3CMEQ 3O08A 3CHWA 2GQVA 1N8RC 1B34B 2QWOA 5AQIA 3J80E 4E1NA 3JSMA 4LF7K 1TUGB 2RN8A 1JRIA 2VVKA 4CIFA 5KQ8A 1HYOA 1NGDA 2FBXA 3G71T 2QWRA 4EIKA 3QLHA 3H3OB 3RR6A 4OKKA 3L4QA 2J6OA 4CK2A 2MPXC 4FJ7A 2F2WA 2YUQA 2NRTA 1X43A 1ATNA 1T7PA 1VSLA 3TVTA 2RKIA 4Z4HA 4CJSA 1NOYA 3A5MC 3ZETA 2ZPFB 5A0LA 1ILYA 1NWKA 3AY9A 4DF8A 1QP2A 5HCKA 2JT4A 3JV3A 4BR5A 4K8ZA 2E6NA 2DZ9A 4F3OA 3OMGA 3CC4N 2X51A 2JTFA 4JZ4A 2IOCA 3LL3A 5CKDA 4CJ7A 4EMHA 4FVMA 2MMPA 4BRHA 2HNYA 2MWOA 5EXWA 1BIAA 3VGLA 1CLQA 2GBQA 4PJOF 1KTQA 3CCST 1NM7A 1LWEA 3E9PA 5AZIB 4PWDA 4JRPA 2FBTA 2AJQA 1U8RA 5GAN8 2P9SB 3EFOA 4ANJA 1KAZA 2KKZA 2P9UB 3KWIA 5KGXA 4AM7A 5HOOA 1UEBA 4NCAA 3AT1B 4W5RA 4FYYB 1NPRA 3C7NB 3CC2T 2Z1IA 2M02A 1QKWA 4EMKA 1N5ZA 2YUOA 5AQKA 4DQ2A 5FU7B 2KAFA 1OPKA 2I0NA 4WFBL 3WNHA 1ZSGA 4BWJA 2J6KA 3FIFA 2EQJA 1SZ2A 3HPOA 1UG1A 2EHGA 4I9QA 2A08A 4NLBA 1UHFA 2LCLA 4C92E 2YSQA 3ZLJA 4J2DA 1AWXA 3VS7A 4Y0WA 1OU8A 3OA6A 3CCRT 1VSFA 4CGFA 2SRCA 4LDWA 4H5TA 3G7ZA 2HB5A 4OGCA 2Z1HA 3C4SA 1Y57A 4ZTFA 3S3NA 1S1VA 1VQOT 1J54A 4XH4A 4E6RA 1WA7A 1KVBA 4H5WA 1TAQA 5HK3A 3FJ5A 4CHPA 4AQYK 2DBKA 5M1FA 1RI9A 5GMKh 2ETJA 2PNIA 1D3BA 3QG1A 3MP6A 2DKGA 2QQAA 4X1VA 2BANA 1JL2A 2B6AA 3VEZA 2QKKA 2IVWA 4CGGA 4YHHK 4M7AE 3SUQA 1ASWA 2GWJA 1PD0A 4BR2A 1AT1B 2W40A 4DOVA 2LCSA 1MU2A 2E5LK 1O1WA 3A5ZB 2EIFA 3JS6A 5KYYA 4G1QA 1LCUA 5E84A 2KVQG 3Q7CA 1BIZA 1IO2A 5HRSA 1J53A 4DU4A 1VQ9A 3V1QA 1TKDA 3CCSA 2DVEA 3CCEQ 2CZ1B 2E6LA 4PFZA 3S6WA 2OPRA 4FJ9A 4RW7A 2KDSA 3CCJN 1SKWA 1YJ9T 2RHUA 5FW9A 3CC7A 1G99A 2DL4A 4CK1A 3HBTA 2VC8A 2LQWA 2K3XA 3VA0A 2G8IA 2P9NB 3CC2A 2ASOA 5CZ1A 1ZBJA 3U4LA 4CC2A 3GLXA 3REBB 3B8AX 4ATOA 3REAB 2KXCA 3HM9A 4DTXA 4M77E 3ZSXA 3VQEA 3A8LB 1TUUA 4E3SA 2M0YA 5IXFA 4LE9A 1B92A 3F5TA 3CPWS 1ACMB 2UUCK 3IMXA 4DTJA 4YY3K 1E4GT 1J6ZA 3AVMA 4DEXA 4CGJA 3RERA 3HOTA 1TG0A 2M1HA 1FYNA 2VWKA 3THYA 1M3BA 5A0GA 1C1BA 1GLDG 5HRNA 4RG2A 2O4XB 5AQXA 3S9HA 1TU0B 2D0NA 3LZJA 3DWLA 3HPWA 1J5OA 2DIGA 1OZ2A 1IGUA 3PFSA 3V7SA 4M78F 3VN5A 1RT5A 1N6QA 4F7UA 4LH5A 3PMTA 1NGJA 4CHZA 2E64A 1HX1A 1VRUA 2O8BB 4H0TB 1U04A 3E01A 5BRFA 1GLCG 1IBKK 4FJMA 2GTJA 2KFNA 3R6NA 4OKJA 1TUYA 3THVA 3FC3A 1NJIO 2VG5A 2CGLA 5AQMA 3DKMA 1BI4B 3K57A 3T1HK 2X4WA 4B9MA 2YV0X 2WC9A 4GVEA 5M1KA 1IGQA 4BE0A 1QSYA 1BU6O 4WCIA 3G71Q 3P8DA 1BO5O 1B34A 1PRLC 4IURA 3V7RA 3MCPA 3IG1A 3SMPA 4XU1A 3QWXX 5EG2A 3VQPA 2DL8A 1VQ9N 4PJOC 3LAKA 2JWLA 1YJWA 1XJWB 2VASA 4RTTA 2ZCFB 1YITA 5ADXA 1JCGA 4H5NA 1BL3A 1SKSA 1RDBA 4DU1A 4OMLA 3T1AA 1WNSA 1HNIA 2LCCA 3CJCA 2K5LA 3TPQA 3CC7N 1RDCA 2PY5A 3HOSA 4IFVA 3KK3A 1YHQT 3I56T 2NWMA 5HL7L 3HYFA 3CJ7A 4PKIA 2DXCA 4JNEA 3PNWC 4K11A 1RDUA 2BDPA 3EZWA 4LF6K 2GELA 1KD1O 4A5AA 2ZF5O 4DS4A 5AZIA 4CE9A 1WOQA 4PJOG 4JKDA 2HMIA 4KB1A 3QBWA 1GCQC 3G4SQ 2P9SA 4C92F 1G3SA 4J9CA 3D2EB 3PX4A 2KT1A 4B9LA 1EFNA 3NHNA 2P9UA 3G1JA 4A4HA 3NFCA 1H8KA 1ZA2B 3NGYA 3K0SA 2G8UA 4M78B 3VS4A 4CJWA 3IRXA 3CMAA 1NYGA 3JB9F 2MWPA 3CCRQ 5GAOl 3AVLA 2CS7A 2DPPB 3I9QA 3SCXA 2LT1A 3AO2A 3BP8A 1K73U 4NCBA 1X69A 1MWKA 4BRMA 2OX7A 2A41A 1X2QA 2EYWA 1VQOQ 1RT1A 3GBQA 3D0PA 1D1BA 2QWMA 4C8NA 4M7AF 1X9MA 4M3TA 5CK9A 2JN0A 1K9MU 4HCBA 5CYMA 2LNHB 4BB7A 2RQTA 5M1OA 4B1VA 4W5QA 1OVQA 2HHQA 3QEPA 3KFVA 2VXFA 2HVIA 1CKAA 1S3XA 1VUBA 5AFUH 2KI7A 3SJHA 3RRHA 3RMCA 1KQSA 4J83A 3JYTA 3H41A 3OS0A 5F1XA 4FM1A 3MWTA 3V6DA 3KLIA 1NK0A 5FRNA 1Z25A 4K42A 1SHFA 4DV7K 2MIOA 3WXLA 1YJWN 4M7YA 1WLJA 3R8EA 4CD3A 1YITN 1W0HA 2DYIA 2FVUA 3A8HB 4N0AC 3HSTB 3RMBA 5D3GA 4BRNA 4IUVA 1E3MA 3HP9A 4BI3A 4IJAA 4BQLA 4XIUA 3V9XA 1GLAG 1WBDA 4JN4A 1H1VA 2E3IA 1N9SA 3I56A 4DSLA 1SEMA 3V9WA 3C12A 3CCVT 1WXUA 3O5BA 3R6MA 3ZX2A 1UGRB 1GLJO 1VQNQ 3L6QA 1UA0A 5AT1B 4LD6A 1K0XA 2PVGB 4LH4A 1I5OB 2K3BA 2HHXA 4AF1A 4KHNA 2RF2A 2OTJT 4M77F 4PJOA 2X6NA 4CEBA 3TANA 4Z02A 3RMQA 3AO5A 3MX2A 3O4NA 1FMVA 3ZFJA 4RTZA 4C8QD 5JLHA 2HSPA 4C92B 3O9UA 3SAFA 1TGOA 1VSDA 3IDHA 3UB5A 2ZPIB 5KH6A 4MZMA 4I7FA 2DZCA 2IAJA 3D7EO 3H45C 1YJNT 4M78C 2P9NA 3CBPA 2A28A 4CJ3A 2KXDA 4CRIA 3OYHA 2PVOB 3OS5A 3QO3A 2L3QA 4PLIA 3CMAN 3SQ1A 3KLFA 1A5WA 2XD0A 2DA9A 2E2NA 1PRMC 1TKZA 3SK3A 2GFUA 1GLBG 3MXJA 3LX7A 3P39A 2VGMA 5GMKm 1CSKA 4PJMA 1GCQA 2CH6A 4CBXA 3M59A 4M7AB 2W6LA 2F8SA 2O4XA 3PMIA 2IIRA 2QYZA 3SBTA 2YWWA 3MPUB 3NTIA 1K73C 1QHAA 3JCMP 2FPFA 4M78G 4DR7K 2CH4A 2RK2A 4M4ZA 1LCKA 2CP7A 1VSKA 1RBTA 4TSXA 3F73A 1L5UA 1K9MC 5IH2A 1RILA 1EO1A 1GOCA 2H8HA 1N33K 4OB3B 4QS7A 3LH0A 3DJCA 3ZSVA 3HT3A 1OH7A 4E7HA 3UDCA 4C5HA 4OVLA 3NFAA 4CFBA 1RAFB 4C0GA 1VQ4A 3PGGA 1EKEA 2AA4A 3LDLA 5GAN7 4KB0A 3CCVA 3KIOA 4IFYA 3A8YA 2VG7A 1WNLA 2O8CB 1P90A 3FFKB 4RCHA 4FWOA 4GVMA 4KBOA 2DTUA 1ZHIA 5MLCQ 3FZFA 4JKFA 2EVRA 2OTJA 3TAEA 4IUPA 4M77B 5DM7R 4J8FA 6AT1B 1Z26A 2HHTA 3VJPA 1YHQQ 3J81E 5J2NA 4JLGA 2FBVA 4HTLA 3EGDA 1LWCA 2JWKA 3DRRA 1DKGD 5HY6A 1UGSB 2CP2A 3JCMV 2P9KB 3CCLT 4E7IA 3CCMA 4EMGA 3CPWP 2YI1A 2XICA 2HF4A 1C0TA 2Y1IA 2DL5A 1JLQA 4PL6A 1C6VX 1M8VA 2KW4A 5JVGL 1D9DA 1JO8A 3ZSQA 1WJRA 1REVA 4CEAA 2OPPA 4JI6K 4LN2A 3DLGA 4QVCA 4I6MB 4FJXA 4DV3K 4Z4EA 3CCQT 2NRZA 1OV3A 4FW1A 3LWHA 4C0ZA 1RAAB 4C8OA 3D2EA 3MMVA 3HRSA 3QFPA 5E26A 3UKUB 4OPHA 4Z89A 1X9JA 3BEXA 3HPGA 3I8DA 2Q0RA 4XK8E 1S1WA 1NGGA 5GAGP 2HCKA 4CF1A 4M78A 2LRQA 3OBYA 1QVGP 4H0YB 1NKBA 3V81A 1N27A 4HVJA 3C6HA 3LP1A 3LPTA 3SNNA 1HXDA 2JMAA 2XMFA 5GMKe 3MEDA 2WACA 2LTOA 4AM6A 2CYZB 4IUQA 3JB9G 4BRGA 1JLCA 1IHWA 3SQ2A 4M75E 2P0QA 1J5EK 4GV9A 4OPKA 1F1BB 2YHYA 2CP0A 3DOLA 4IG0A 1KD1R 3HSCA 4CF8A 1WPYA 2OAWA 5GAN6 3LP2A 2E65A 3LYIA 4O5FA 3ZYYX 3VQ8A 3VEWA 1VQ4N 1D0YA 1YP5A 3E1YA 3MP1A 4M7AG 3KWGA 5GANf 5KPRA 4PJNA 4ZGDB 4A59A 2G3RA 3AVCA 3SUPA 3OW2M 4KHYA 5C0YA 4CI6A 1SRLA 2PAVA 2ZGYA 3KVGA 5M1QA 1NNEA 2HQHA 4J2BA 3PIPL 5CCAA 1WDXA 1XMOK 2R5MA 3SAHA 5GJWB 2JVVA 3DLHA 4N56A 4BC4A 1SHGA 5BR9A 5CR4A 4WQ5A 3TTFA 3CCUN 1MWMA 2GUPA 3H3NO 4MO4A 4D8KA 1GLLO 3TI0A 1GXIE 4DFKA 3O4QA 3WXJA 1SSHA 1VQ6A 1NLVA 1BB9A 4RTFD 3ZT2A 3LGFA 1NK4A 1T03A 2QAZA 3CCMN 1QZ5A 2ED1A 3VQ7A 1WAFA 1I0CA 2R58A 3ZCMA 5BRDA 4ELUA 4IO9L 1X9SA 2ASPA 3C6AA 2ZJPL 2EX3A 4CJRA 4RMOA 4BRKA 4FJ5A 2F69A 2NLXA 3UATA 3H6ZA 1RLQC 4FWLA 4DQIA 1VQKA 1QVFP 3S3MA 3R3LA 1GCPA 1MMDA 2JNGA 4LDXA 2DRMA 3CD6N 2VV5A 1CKBA 3CCQA 4O4GA 3X25B 4DBHA 4M77G 5FU6C 4KKOA 1YJNQ 1SSFA 4LUEA 3ZT4A 1AZEA 2LC4A 3CYMA 4JK7A 3ZX0A 4C92A 2HL3A 3EH2A 3I55T 3VS6A 4Z94A 3VS5A 1M2OA 4KHSA 3J7AP 4B3OA 1IO6A 5GAOn 2DTOA 4BR0A 2LNVA 1BBZA 2RHZA 2I5JA 3SYZA 2V1RA 3ID6A 4GY2B 5JS2A 3RRGA 1JJ2M 4DV6K 2G8HA 3QZ5B 5C10A 3K5LA 4OLAA 2CP5A 4BC3A 4LDVA 1SPKA 1YI2A 3QNOA 2DVJA 4E89A 4LNPA 4N4IA 4C8KA 4DTMA 5F2RA 3K9JA 2WSFE 2C0TA 4JJBA 1FKPA 4M7AA 2NRXA 1WAJA 4LUDA 1Q82O 4CJTA 4A54A 2ABLA 3ULEB 3BW1A 1K8AO 1MHNA 1PSEA 1IRXA 1X1PA 2GQIA 1U47A 1Q81O 3HK2A 3L2VA 4CJUA 3CERA 4DV1K 2XHCA 3PSFA 3ENHA 4IFEA 2EYXA 5AQSA 1XC9A 4WYBA 2QTXA 3HKSA 3KD5E 4CBWA 3O8MA 5D6XA 2LMJA 1RFQA 2LVMA 4KT0E 1LW0A 2NLUA 3BE3A 2QA4A 3UPUA 3JCMh 1S6PA 4BREA 5AQUA 3QYGB 2A3LA 3MXIA 1VQPT 5HROA 4FK2A 1VQ6N 2Q97A 1TSFA 4N41A 1XQHA 3ISNC 2HEQA 3CMEA 3KTQA 2VB6A 1PM3A 3DMJA 3P31A 4TVRA 4CZMA 3SI6A 1P92A 1NLPC 2FG0A 4DTNA 3MDQA 4XTYA 2FL7A 1TL1A 2D9TA 4PJLA 1HPZA 1ZBXA 2O8CA 3DLEA 4BR4A 3VYGA 3L42A 1U1SA 2P4RA 3OYLA 4JZ3A 2IGIA 1VQKN 2NZTA 3CCLQ 3RSEB 4M77A 2K9GA 2LDMA 4J6XA 3GNGA 2JOYA 1AHJB 1YCYA 2B8AA 1IKYA 1ASVA 3O3FA 3DLRA 3VQ9A 3OJSA 3NH1A 4DV0K 1NPPA 1YXQA 3JCMX 2P9KA 5GAMe 4PFOA 2XDPA 5CQXA 3BGRA 2NYSA 3H46O 4IOXA 2HSEB 3OS2A 2RJEA 5KRTA 1KRPA 4HWIA 2CSIA 5HRRA 3NAEA 3FZKA 4F4KA 2GFAA 5AQWA 3VQAA 4YFUA 1JB0E 1KG1A 3EN9A 4RTVA 3QIOA 4I6MA 3W3DA 2GTOA 3SJJA 2DY4A 2CP6A 2PTKA 3CCET 2DYBA 1KVAA 3G25A 3HI0A 3TSQA 1YI2N 4BGBA 1GRIA 4CEQA 1XWLA 3OYIA 1ZBUA 4M75F 4H4OA 4LC9B 4GKJK 4FLVA 3UKUA 3AO1A 4JS4A 4A61A 1S1UA 3HTVA 4DTRA 3KHYA 1OU9A 1GBQA 2PUKB 3AO4A 3KJVA 3B6PA 1HNXK 4DTSA 5C2DA 4A4GA 2JS0A 1C1CA 2E88A 3RUXA 5M9OA 2QA4N 5FROA 1GOBA 3CEYA 2KY9A 1FMKA 1NEBA 2IVPA 3N4QA 2UYTA 4X34A 3CQXA 4V19S 1EIFA 2K3YA 2IS3A 1AOJA 1Q7YO 4E2FB 4LY7A 2V8IA 3CMEN 2ECZA 2GGRA 4MLEA 3BDPA 1UFFA 5F0XA 3CPFA 1WSFA 3TREA 2YHTA 4QQDA 4C0FA 1WHMA 1VSEA 3NH0A 3SD4A 1D09B 2HDAA 4ELZC 3VERA 3HHTB 4C23A 1VQ5Q 2JJ9A 1G8XA 1TUCA 1W70A 3X24B 4B1YB 2O31A 4RWTA 3KD1E 2P5OA 1M3CA 4CZLA 5TKYA 3QETA 4DF4A 4KULA 4YOVA 5A0DA 4BVOA 4AFQC 3AVGA 4FPBA 4RKUE 4FOEA 3LZIA 4K41A 1BI2A 1YFNA 4ZHRA 5DMRA 1WFWA 1X6GA 4DG1A 3JRZA 3VF6A 2AK5A 4NXNK 1MV3A 4DLEA 2KRSA 2COWA 2RI2A 4BE1A 3FE1A 2EYQA 3I55Q 4J9EA 1VQMN 5M1NA 5FPNA 3MCAB 4BRLA 1S1NA 1NGIA 2X74A 3LDQA 3MN6A 1KK7A 4Y1CA 1KQSM 2BH1A 4M75B 3GPLA 4FLXA 5DLOA 3H1QA 4AHSA 4H8KA 2G8FA 2CGHA 4J2EA 4CZGA 2DFFA 3OMCA 2QDLA 3RBBB 3D7SB 4KUDK 3HPHA 2YJFA 4K0KK 1VSJA 4B9VA 4D6WA 3OW2A 3A8GB 2DILA 3A5OC 2X3XD 4QVZA 3VTHA 2W42A 5HLFA 1R0BG 5FRMA 2AP1A 5C25A 4DR5K 5KYNA 1YUWA 3T19A 2JM8A 3P1GA 4IEEA 3WT0A 4CZIA 4MDXA 5JMVA 1Y96A 1H92A 3EG3A 3M6GA 3G4ST 4KH6A 4A63B 1DEJA 3VU3C 3L2ZA 3T3FA 3OW2S 4L3QA 2UUAK 1FKOA 1KFDA 4YNQA 3RWUA 1QQJA 1XNQK 4FJKA 1G83A 3ULEA 3F9MA 1YWPA 1TUDA 3DM2A 2DEUA 1KC8O 1K76A 1KD1U 1Q9YA 1NJWA 2VXEA 2P9LA 1PWTA 3CM6A 1HNWK 3SWNB 4HT8A 4EP4A 4E7LA 2CZ7B 2EQMA 1VQPQ 2E70A 1YN8A 4EIAA 4KH4A 1K6YA 3PUFA 4PJOD 1BHLA 2EFIA 3ER0A 3ZSRA 1HQUA 2K5FA 1PD1A 4DA4A 3O9TA 4OGEA 3M56A 4F7UG 1M90O 4JYAK 2M51A 2FC0A 2EAYA 3HSBA 4GW6A 5I3UA 1VAZA 2P1JA 4O0IA 1UDLA 2OYQA 4WF2A 3G71A 4OB2B 2KTQA 4DSJA 4DQ8A 3G6ET 4U67L 4FJGA 1Q82R 3GOIA 1ABOA 2E1YA 1XTDA 4XU2A 2J7IA 1K8AR 2COZA 2E12A 1Q81R 4OF1A 3WNGA 4CHQA 2W41A 1WHHA 3G0ZA 2FLOA 3JCMb 5D6WA 3M8PA 4DB3A 4U7BA 1JJ2A 2XG8D 5LL6S 1NJIC 4CIEA 2WFBA 2YKNA 4C5GA 1OH6A 4RTYA 5GADP 2X35A 2X4XA 3SZ2A 5GAHP 1LOJA 3MEUA 1I1JA 1BYMA 2BUPA 4MDAA 4KI4A 2ROTA 4DLGA 1JJ2S 5LJ3f 1QQMA 1ZA1B 3OYEA 2OTLT 4PJJA 1YVNA 1Y7XA 1VQNT 5CZ2A 3J81O 1HPMA 3HTRA 5KCOA 3M5RA 4C1NK 4JPBW 4DFJA 1JXBA 3X28B 2E41A 3V8KA 4C8QE 4CHOA 4JI8K 4BY9C 4KTWA 4DR3K 4XTVA 1KSPA 2KFZA 2V1QA 3G4SA 2NUTA 2J05A 3QBYA 2HBJA 1YIJT 4JAXA 5DK5A 1WHGA 1SF9A 1QZ6A 5GAMj 5FU7C 1WBBA 3DAWA 5ELZA 2VKNA 3P4IA 1FX7A 5AQLA 1SV5A 3JCMJ 4E1MA 1X2KA 1LAWA 2H3JA 1V1CA 1ARKA 2WOMA 1YT3A 4CZHA 2E2QA 4CJEA 2RPNA 2KRMA 2XO7A 3CCRA 1ZUUA 2LQNA 2KLAA 4RW4A 3TR8A 4CJLA 1S6QA 3NCIA 2E6ZA 2WBNA 1PKSA 3EGXB 3UT1A 2XDDA 2NUPA 3WVEB 1QQOA 2QXLA 3F9KA 3SDZA 3LP3A 2RD1A 5JVHL 1BIBA 1KD1C 2OANA 4FLWA 4B9TA 1VQOA 3A8MB 3VOVA 2QWQA 4CZKA 4IIOA 3L4IA 4CEZA 3RKYA 4WE1A 5IAYA 3CCJQ 3G71N 4OB0B 3WXMB 3WEEB 1LJOA 1NK8A 1Q86O 5GAMd 3JCMg 4AHRA 1VQ8T 1L3SA 1T3SA 4KH0B 2FZGB 3H8ZA 5GAOp 4BDZA 1H3ZA 3TU5A 4E0DA 3VQCA 4DCHA 4DUYK 1KHIA 4XAXB 5BR8K 2W6KA 4FJ8A 5BPMA 4LFBK 3O80A 1WN7A 2P9IB 4LF9K 1SL0A 3MEWA 3MEAA 1AWJA 2RI5A 4OMOA 1RTDA 2KBTA 3TTDA 3L8BA 4DQRA 1FMWA 4JRIA 4NOYA 4DBFA 5J2MA 2OZMA 1FJGK 4PQUA 1Q7YR 4IUTA 2ITMA 1OYXA 5I21A 3VQQA 3CCSN 1BG3A 2PVDB 5H1SQ 3H1VX 2O8DB 4XTUA 3ZEUB 4M78D 1TV6A 5A2QE 1VQNA 3JCMQ 1AWWA 2O2OA 5ADXH 1CZBA 2HHSA 2YHXA 1YJ9A 1J3TA 2DJZA 4FOIA 5I9EB 2ATQA 2B5JA 3NHGA 4YOXA 4B9SA 1UGQB 2CREA 4ELTA 2O8EB 2RB6A 2I2LA 1CZAN 3CC2N 5AQHA 4QQGA 2ZQBA 4V2SA 2EPDA 3OYYA 4IWVA 4M75A 2NRVA 4FT2A 4JJCA 2VG6A 3OHRA 3CQ8A 2HW3A 1AWOA 2QTDA 5FPEA 1RACB 4A53A 1M4ZA 4J9HA 1VQLT 1HKCA 1UHCA 2G8VA 4DSEA 3RR8A 1D1AA 3OBWA 3UA7A 4CEEA 2DL7A 4OMFB 1BWFO 3DXMB 3M3ZA 3CCRN 4BG9A 1ZBIA 2HMPA 4NL2A 1X27A 4CJKA 5LJ5e 1DTTA 3WQTA 3IAYA 4OPJA 3JCMe 1QHTA 5CKHA 1WYXA 3L3UA 2ZJQL 4DQQA 1K8KB 3VEYA 3M57A 1EX4A 3C7NA 5GAMh 1UE9A 2LX9A 3CETA 4ILJA 1VQON 2DAQA 1XQSC 1OVYA 5J26A 4MZTA 5E41A 5GJVB 4EHTA 1TK8A 1G3YA 1XOVA 3QDFA 2HHVA 5CE3A 4RTWA 4WFNL 3O1BA 4CK3A 3SFMA 1OH8A 5B8HA 3TABA 3K58A 3PIPA 3KZBA 1EWQA 3KKRA 3LM9A 4JKBA 2RHXA 3SWNA 1GFDA 4IBNA 5AQOA 2KYBA 3BFMA 2YCHA 4M3WA 2K79A 1S9GA 3C6UA 3AVNA 1UJ0A 5J1EA 2HVHA 2HL5C 3M0SA 2DLPA 2QK9A 3V8JA 3O9QA 2P4TA 2D1XA 3G6EQ 3LM2A 7AT1B 1NGAA 4IDHA 1RAHB 3VUBA 2K57A 2DO3A 4N76A 1W97L 2D6FA 2I7NA 4GLKA 4MDBA 4DBQA 1HRHA 2YNGA 3TAMA 4RCBA 1Y71A 4F3TA 4B9WA 2P84A 3EZ5A 3VA3A 4LD9K 4MLHA 3QFUA 3T7ZA 1IHVA 1QCNA 4H4MA 4H0XB 3CXCM 1YJ9N 1KQSS 3CJBA 2DXTA 4X65K 1VSHA 1S5JA 3T69A 1OH5A 3VEOA 1UGVA 1YHQA 3TSZA 1Z6RA 4B08A 4ID1A 5DY9A 4C8QF 3L2WA 1KVCA 1HNVA 4FJLA 2OTLQ 4J6WA 1VK0A 1B3QA 1WXTA 3VQDA 1MMAA 3CFOA 2QDYB 1TS9A 2E4LA 4R0KA 5GANj 4JD2B 3FLGA 2X4JA 3MAQA 1U49A 2EKHA 3M54A 2DL3A 3M55A 4KH1B 3OW2P 2VYPA 3RESA 4O8KA 5AQVA 2LJ3A 1YIJQ 4M7DE 1N34K 1WGSA 4BI4A 3QMLA 2R5AA 1XHZA 4CECA 3VEXA 4HCKA 3TSUA 2ZD1A 1Q95G 4C5EA 1U48A 1HUXA 4AFSC 2M9UA 4QAGA 4GMJB 1AD5A 1XC3A 3EL2A 2MOXA 3R1XA 3A0IX 5I42A 2F9TA 2RH2A 5HKCA 4AG2C 2J6FA 2XK0A 3OS1A 3AHUA 3THXB 2NNWA 1UTIA 1I94K 2ZAEA 1WSGA 2ZE2A 1QTMA 2GF7A 2LP5A 1K9AA 1KHCA 1ZUKA 2MYSA 1JLEA 1QQNA 2X78A 1NZ9A 1ZSZB 3QIPA 4OP0A 3QO9A 4O5BA 4YOYA 1B07A 4BY6B 4E1JA 5GANd 3THWB 5GMKi 5GAN5 2VCPA 4JHDB 4BROA 3FJPA 1K1ZA 1IH7A 2ITGA 3JCMc 4QOZB 5J3BA 2O8BA 2RK1A 1ZXOA 1VQ8Q 3LDNA 3A5LC 2QW9A 2V8KA 1D5AA 1VYTA 2Q2RA 2JZ2A 4WQ5C 3VEVA 4BUGA 1EQYA 1OZ3A 4Z4GA 1IV0A 4Y91A 2FEIA 3D45A 4IG3A 3WEEA 3M8SA 1NGCA 2KR3A 2JM9A 2CGKA 1BI4A 4AHUA 2CSQA 2YRCA 3I0SA 1UGPB 1W1FA 2HKQB 3PTAA 1TL3A 4IEIA 3CFPA 4F8RA 3VF4A 3TSWA 1FXXA 1Q82U 1JJ2P 1NMDA 2ZWHA 4CC7A 1E6GA 1YHQN 1SS6A 3I56N 3WNEA 3IUCA 1K8AU 3VENA 2P9IA 1Q81U 4C8QB 3E1SA 3AVBA 5GAN2 1TVRA 5KPTA 4HUFA 2ZJRL 4L5GA 2RHKA 3HJFA 2J06A 4X9DA 4JK9A 1XNIA 4OMQA 4M3ZA 2BGGA 4JJNK 4BGAA 1NJYA 2JTMA 4Y28E 3ULDA 4ZNXA 2F1LA 3GF5A 2QKBA 4XTZA 3ZEUA 1W4SA 5KE2A 1NJIR 3J80O 3VQ4A 3PX0A 4C92C 3I35A 3AAPA 3E66A 5AQPA 4CW7B 4CZEA 1Q86R 4J7FA 2BKDN 2Z0WA 3LPUA 3I0RA 1IKVA 3QBXA 2ROLA 1VQLQ 1U3OA 3HRTA 2F5TX 1YJNA 4AILC 5GMKl 5C0MA 1EWRA 1IBLK 2IC3A 3QKJA 1XUPO 3MK6A 3ZSYA 4EZ9A 1RUWA 3SMSA 1M27C 1ITGA 3CJ1A 3N4PA 1FW6A 4MQ3A 5GANh 3ENBA 3EGUA 1VHXA 1M1KC 3FDRA 1M1FA 3MO8A 3ZT3A 2AKKA 2YJEA 5AQNA 1TK5A 2KMTA 2BZYA 4PL8A 1NK7A 3DXMA 1RADB 4UQGA 3CIPA 4QW2A 4X66K 4JLIA 1OI1A 4M7AC 2YXYA 1X3MA 4IJNA 4C92G 1U2VB 4OO1J 1RDWX 3QB0A 2K2MA 2D0BA 3LDPA 2CUBA 1O75A 2EJFA 1Y0MA 1JXEA 4BRPA 2LX7A 4CERA 3LAMA 2P51A 2XIDA 3IS9A 4AFZC 4ZGEB 1YWOA 2FSJA 1S1TA 3CF5L 2JW4A 1JBMA 5KE3A 4OX9K 4JKCA 3GP8A 2H3GX 2XHBA 4HT9A 2IPOB 2F9WA 1WHJA 4H0PA 3WXKA 4CHNA 2EWNA 4FSXA 3M8QA 4BRCA 4AFUC 3CM5A 3RMSA 5LJ5j 1PKTA 1N36K 4KV8A 4HVWA 3QZ9B 4JI3K 5JICA 1GLFO 1ZBSA 4AH9A 1Q8IA 4I2PA 3CCVN 1M8MA 3EG9B 1HNZK 1N6AA 4CFCA 4WFAL 2UXCK 1QW1A 1VQ7T 4NL3A 4HUEA 1KC8R 2OTJN 1Q82C 5AQZA 4HXJA 4M77C 5I22A 2A5XA 4CGHA 2IDOA 2E5KA 4G9ZA 1K8AC 1YCSB 2XY8A 3U8XA 5BRHA 3HO1A 2LQKA 1Q81C 3BY7A 3C0BA 3SBGA 4KHWA 1M3AA 1JLGA 3NDKA 2OAUA 2EW3A 2PU9B 1VQ5T 5BN8A 3JSCA 2PUOB 2UXDK 1Q7YU 4RUGA 3CCLA 4KH5A 5GAOr 4KPYA 2DJQA 4UY8O 1M1KO 4M7DF 2HKNA 3J7ZO 3M4YA 3VETA 1YJNN 4XTXA 1JEGA 5LJ5d 3JCMd 4WQ4C 1WUAA 4E19A 4C8QG 1RI0A 3E2UA 3SV3A 3TCJA 4J9GA 3P8BB 1LVKA 1S72T 1CXUA 2EYYA 4I2QA 4AHVA 1NJZA 2QEXT 4H0VB 2AZSA 2KYMA 1LNXA 2KQ2A 1E7OA 1LOTB 4D8DA 3ENOA 1RNHA 4JD2A 4JI4K 4PK4A 3KBGA 3SEMA 2DRKA 2JXBA 4O6JA 3SB2A 4CC3A 4BACA 1ATRA 4ID5A 3PO5A 3RKXA 2GBZA 3FZLA 1R77A 2KEAA 4DSIA 4KI6A 4PUOA 3NGPA 4KAZA 5AQTA 3V9ZA 1KLNA 3OB9A 3EAEA 1EETA 3CCUQ 2HNDA 2E8AA 2Q36A 2XU8A 3TAGA 1KJWA 1M2VB 1BGXT 1I39A 1T0HA 5IN1A 2KE9A 3EH1A 3CG7A 3KK7A 2A37A 1QVPA 4CF9A 1M1GA 3JB9H 1L3TA 2B86A 4AMCA 3LLRA 1NE8A 4ICLA 2AIRB 1HKBA 3AGRA 4BRFA 3CCMQ 2Z1JA 4HUGA 3THXA 1KCFA 2OPSA 4M45A 3U3GA 1G5VA 3DI6A 1WQ7A 5GAMg 4DQPA 4KFBA 3QYHB 1UAXA 1PHTA 8ATCB 4RG8A 5EY4A 4PFPA 4Z4CA 1W2BM 2JS2A 4CJFA 5J39A 1ZSZA 2YLCA 3CXCA 1HYZA 5EOYA 2DXBA 2HMAA 1K0SA 2FHDA 3LGLA 1QE1A 4CEFA 5D7UA 4F04B 3I5SA 3AARA 4W5TA 3NF7A 3HM8A 4DS5A 4MZPA 1RT6A 4JHDA 3BDLA 3U6FA 4OVAA 3CD6Q 5CYQA 4JK8A 3AA2A 3EFOB 1KQSP 4GLMA 2SEMA 1V29B 1TH7A 3CXCS 3X26B 2PZSA 1X9WA 5BN9A 2BE7D 4FL6A 4DU3A 1I4K1 1XMQK 4FJJA 5LJ5h 1X6BA 3U9ZA 2OZSA 4E7KA 1BI0A 3S3OA 3FRNA 3M5AA 4LXCA 1VQ5A 3CC4T 5IT9E 1BIUA 3QEXA 3CCLN 1C1AA 5C42A 1T8EA 4PJOE 2M16A 4B1XB 1RAEB 4M7DB 1NK9A 4JI5K 1IZ6A 4JI1K 2VGNA 3VS0A 5HBMA 2O01E 2P0KA 4C8QA 2DM1A 3L1AA 1Q9XA 2HAXA 4BRAA 4C0DB 5GAN4 3AO3A 1NK5A 1Q7YC 2LSNA 2OI3A 1PC0A 2V8JA 1RBRA 3G10A 1N9RA 3EG1A 3HL8A 5CQYA 1A5XA 1JLFA 3CCQN 3VGMA 1OEBA 3TEEA 3JB9J 1L3UA 1GBRA 2QI2A 3MEEA 3UE5A 1RLPC 2ZPEB 1CXQA 3EG0A 1KAXA 2KQWA 2RJFA 4O8UA 2CP3A 3I55A 2L5QA 1KFZA 2A42A 2KNBB 5L23A 3E9LA 4LFAK 4WTOB 4CF2A 5KTQA 2ESWA 4IKFA 3GIBA 1D9FA 4UC4A 4CJ4A 4HVVA 2HZYA 1U45A 2DEQA 4PKCC 2A6AA 3MECA 2VQFK 4WQ4A 5A2QO 1KSWA 3M9QA 4H0OA 4W5NA 4CFAA 4F9OA 1YNZA 2IG0A 1MGQA 1PCXA 1G15A 3V4IA 1O13A 3A98A 1YAGA 3A5NC 1TKXA 1PG5B 4CEDA 1RBVA 4CVNE 1MNDA 3NBPA 3QEVA 3W0LA 1VSIA 2EJGA 1KLMA 1NEGA 2GCXA 1V76A 2C0IA 2HNIA 3M0TA 4XEIA 3CQYA 3O1WA 4FWSA 3O9RA 1RL2A 4F17A 4JRKA 3FZMA 3SLCA 3UIQA 5JS1A 1VQKQ 2D0AA 3LANA 5LJVA 3T1YK 4DWIA 4Z4FA 2OJ2A 2RQWA 2E10A 3MN7A 4M3YA 3AVJA 3EFRA 1P8ZA 3CFRA 2DK3A 3EY1A 1R8OB 1YVUA 2KHOA 4OPAA 3O3HA 3OYNA 3GNFB 3ZT0A 3HRGA 4FZXC 4PY5A 5LJ3j 3EKUA 4XH5A 4WF9L 2E6MA 1I8FA 1VQPA 2K4YA 3VYHB 3KLGA 3KKSA 3M4GA 3A8OB 1VQ7Q 4M7DC 2YNIA 1JQQA 3EHQA 4KUIA 1WJQA 3E9FA 4EDUA 2FF6A 4NO7A 4GNIA 3BF3A 4RW8A 4NXMK 3DLKA 3H9NA 4C1NI 3OA9A 4FK0A 2ZGWA 1W9HA 2RJDA 4LDYA 4FPAA 4X9CA 5C24A 2ATCB 2EYZA 3CCJT 3O9SA 5FWCA 4Q5VA 4J6YA 3J7AF 5AQJA 1Z05A 4X62K 4B3MK 4DR6K 3OYBA 4DR4K 4FLYA 5AQGA 2E3HA 3K59A 4FYVB 2FB7A 4JRQA 2O88A 3VF2A 5KYXB 4JKAA 3I55N 3I33A 3ME9A 5LMUK 1QVFM 3M0UA 1BI1A 2P0PA 2NUBA 4N4HA 1S72Q 4LD0A 2XY5A 1NJIU 3D6RA 4M7DG 2QEXQ 4DV5K 4F2SA 4CBUA 4CGDA 5CHIA 1BK2A 4FWQA 1HQEA 2GV9A 1XI1A 1Q86U 1U4BA 2KZZA 2EQIA 4ESRA 1BKBA 3META 4ZGJB 2H3EB 1M90C 2RPIA 2V51B 1D4XA 3THKA 2WUSA 3ALYA 3ITHA 4M78E 3INZA 4BI8B 4O55A 3CCEA 2E2OA 4QS8A 5LMNK 3ZT1A 3U9DA 3U23A 5T7BA 4CJ5A 3T9NA 1JLAA 4JLHA 1H641 3OQ5A 1YTUA 3Q1JA 1UUEA 3LW5E 4BVPA 4IO8A 2QWNA 2FO0A 2IVNA 4FL9A 1QLYA 2XY6A 4LFCK 3PY8A 4JI2K 5GANg 1D0XA 1ABQA 2XKOC 4B9UA 4FWRA 4LSLA 4A2BA 2HQEA 4KGXB 3OYDA 1M1KR 3MN9A 1HYVA 1M2VA 1OULA 1XNRK 3LWMA 3RR7A 2HHUA 2FRYA 1NGHA 2DIQA 2FPDA 1QP3A 3QJ6A 4EP5A 1GL5A 2O4GA 3MN5A 4CZFA 4N5SA 1SKUB 3J8AA 1MNEA 4FSSA 3PO4A 1NM1A 2RE2A 4ISGA 3WNFA 3NH2A 4B9NA 4PLLA 3OSSC 1VQPN 3MEVA 1VRTA 1WSHA 1T44A 2Q31A 3EO3A 3K2PA 5BREA 2A0FB 4FJHA 3CPEA 4YOWA 3ID8A 4FW2A 1L3VA 2WSCE 3NVKA 3FGUA 3OTOK 4FM0A 1VQ9T 4KGZB 1VQMQ 3C6TA 2RHIA 2EGAA 4QVDA 1IKXA 2BE9B 3VS2A 1JLBA 5IHKA 1RDDA 3CI5A 3M0RA 3VS3A 1OX8A 5J2PA 3PE0A 2OCEA 4DBRA 3SPZA 3L2RA 3CCJA 1BQMA 1RBUA 3CC7T 3CC4Q 2YUNA 4NS5A 5LJ3h 3L3VA 1T6CA 4DTUA 4AHTA 1VIEA 3EFSA 2AHJB 3KK1A 2Q1NA 1KC8U 1HLUA 2D0OA 4PA1A 1NBWA 1G3WA 2XDBA 1VYVA 2ZGZA 4FWPA 3LWLA 1IREB 1SRMA 4M7DA 1N8RO 2K2VA 1VIFA 3H0HA 1LAVA 1NG9A 4XQ3A 1BA1A 4CJQA 3PX6A 1OKJA 2M0OA 5GANe 5KI6A 1X6OA 3VS1A 3M53A 4AG1C 3LWIA 3NF9A 4R5PA 3PIOL 1JKHA 3SQ0A 1PNJA 1I3AA 1F21A 3CCEN 3Q7BA 4HA8A 2BZXA 1MA9B 3RSEA 2A1RA 2FYKA 2K7AA 3GOXA 2RO0A 3M1FA 4M75C 3VQBA 1JCFA 4XTWA 1Q86C 4HTUA 3KUFA 5C15A 2GTDA 4KTZA 4B1WB 4P5NA 1W2BA 1Q18A 4ISFA 5AQFA 4LF5K 2JLEA 3P83D 1MUZA 4EHUA 3MX5A 2YNFA 3AV9A 2KRNA 4RW9A 1WI7A 2ZM6K 4HVUA 4M3RA 4FLUA 3HFNA 5DLQE 2YDLA 1H3HA 5CY4A 3RTVA 2BUDA 2ZZDA 1W2BS 2XRIA 2G8WA 4FWMA 2EQKA 2W0ZA 3P38A 4OB1B 5EVZA 2DTHA 3ZSZA 3DB4A 4XU3A 3QSUA 2QWPA 5LY3A 4KRFA 2PZ1A 4BRQA 3SAGA 4C5IA 3DRSA 1R0AA 3QJYA 2CZ6B 4GV6A 4AT1B 3M0PA 4H5RA 4M75G 2VQEK 3CXCP 1LV5A 2YHWA 4KBMB 1HKGA 4QS9A 1ZLMA 1C0MA 3BDUA 1T3VA 1WZOA 2L89A 1M5Q1 4PJOB 4BR7A 4LF8K 1YJWT 1K4US 3DLBA 1YITT 2KROA 1C0GA 1KXPA 2YHBA 3R6OA 1X75C 3SWNC 5I11A 1IKWA 3B6OA 2GEMA 4LF4K 1TOVA 2RQUA 3V1RA 2Y4YA 4YOTA 1HR0K 3CPWA 1OOTA 3TAQA 2EQUA 3VV0A 3LDSA 2G8KA 1KIKA 5LJWA 3GG4A 4JKGB 3TU4K 3UA6A 2HBWA 3QWYA 4CD1A 4PKGA 3GDQA 3H0IA 4OKEA 1JCEA 2LJ0A 3VUZA 3OYGA 1EXQA 1OX9A 3TAFA 2X6SA 4W5OA 4JKHA 1TXQA 4R55A 4CF0A 3QIIA 1MMGA 3G6EA 5LJ5g 3CJ9A 1T05A 1KC8C 5AZJB 1W6XA 2WSEE 2YX6A 3RKWA 4E7JA 1T0JA 3I5RA 2AT1B 2HD0A 2KK4A 5CKFA 3JAME 4KO0A 2WTUA 3V9UA 2F4VK 2EGEA 1ZYQA 1QVGA 3SQ4A 3JB9I 2X3WD 2FZKB 4KHUA 4BR9A 5KYXA 2D8HA 3CMAT 3QNNA 3E19A 1HYSA 1RAGB 1NKEA 4IIMA 1XHXA 5AQRA 1A5VA 1ATSA 1AZGB 5IHIA 5TKWA 2HHWA 2K5IA 4Z88A
chains in the Genus database with same CATH topology
3K5LA 2RKIA 4Z4HA 4Z4GA 4OLAA 4CJSA 4IG3A 3D45A 1NOYA 3M8SA 4AHUA 1BI4A 3I0SA 1TL3A 4E89A 3CFPA 3QNOA 4DF8A 4C8KA 4DTMA 4EZ6A 1QSLA 4F8RA 4K8ZA 3C94A 1FXXA 1FKPA 4F3OA 1WAJA 4CGIA 4Z0UA 3WNEA 4CJTA 2IOCA 4DTPA 3QESA 1ZBLA 3AA4A 3AVBA 1TVRA 1X1PA 4FVMA 2HNYA 4DSFA 4HUFA 4CJUA 3L2VA 1U47A 3HK2A 1CLQA 4AHCA 1KTQA 3HJFA 1RT2A 1LWEA 4PWDA 1XC9A 4M3ZA 4JRPA 2FBTA 3MEGA 3KD5E 2BGGA 2AJQA 1NJYA 3ULDA 1ASUA 2RN2A 2QKBA 1WSIA 4CHYA 1LW0A 5KGXA 4NCAA 1S6PA 3FFIA 3VQ4A 3PX0A 1C0UA 4W5RA 3MXIA 5HROA 2Z1IA 4FK2A 4N41A 3LPUA 3AVHA 3ISNC 3I0RA 2YNHA 1IKVA 1VSMA 1NKCA 3KTQA 3DMJA 4AILC 2PYJA 3SI6A 3WNHA 4DTNA 4BWJA 2IC3A 3ZSYA 3HPOA 1TL1A 1B9DA 2EHGA 4I9QA 1LWFA 1ITGA 1HPZA 4MQ3A 4CIGA 4DFPA 3DLEA 4J2DA 2IGIA 1RCHA 3OYLA 4CGFA 3ZT3A 1VSFA 1TK5A 4FJIA 2Q3SA 5SWMA 1NK7A 2HB5A 4BDYA 1WSEA 4UQGA 3L2QA 4OGCA 2Z1HA 1ASVA 1IKYA 3O3FA 3DLRA 1S1VA 3VQ9A 3NH1A 3OJSA 3S3NA 1J54A 4ZTFA 1KVBA 2GUIA 1TAQA 2D0BA 4CHPA 1SKRA 1JXEA 1NOZA 3BGRA 5KRTA 2A1SA 1KRPA 3OS2A 4O44A 3LAMA 2P51A 4CERA 2ETJA 3IS9A 2BANA 2QKKA 1S1TA 5HRRA 1JL2A 2B6AA 3NAEA 4CGGA 4F4KA 4YFUA 3VQAA 3SUQA 1ASWA 3QIOA 2DFEA 3DOKA 2XHBA 1RT7A 4CHNA 2DY4A 1KVAA 3AA3A 3M8QA 1MU2A 3CM5A 4FLTA 1O1WA 4CEQA 4RW6A 4M42A 1XWLA 3OYMA 4KV8A 1ZBUA 2BE2A 4H4OA 3OYIA 4ZTJA 3AA5X 4G1QA 4FLVA 3AO1A 4AH9A 1BIZA 1Q8IA 4JS4A 4I2PA 1IO2A 1S1UA 5HRSA 4DTRA 1J53A 4CFCA 2FBYA 4DU4A 3V1QA 1TKDA 3AVAA 4HUEA 2E6LA 3AO4A 3KJVA 5KGWA 3B6PA 2P5GA 2OPRA 4FJ9A 4RW7A 4CGHA 2IDOA 4DTSA 1SKWA 3HO1A 2XY8A 1C1CA 1RBSA 3SV4A 4CK1A 2OA8A 5FROA 1GOBA 1JLGA 4HHTA 3NDKA 4C8LA 4KHWA 5KRSA 3VA0A 2G8IA 4KPYA 5CZ1A 2IS3A 4LY7A 4FYDA 3DYAA 1BQNA 3BDPA 3HM9A 4DTXA 1WSFA 3ZSXA 3VQEA 4E3SA 3TI0A 1B92A 1DTQA 3LALA 5HP1A 4E19A 3SV3A 1VSEA 3NH0A 4DTJA 3AVMA 1CXUA 1NJZA 4I2QA 4AHVA 4CGJA 2Z1GA 1DLOA 2VWKA 3KD1E 2KQ2A 1C1BA 5HRNA 1RNHA 2P5OA 3S9HA 3LZJA 4BACA 4ID5A 1J5OA 3PO5A 4DSKA 4FLZA 2GBZA 3QETA 4DF4A 1UA1A 3VN5A 1B9FA 3TWHA 1RT5A 4DSIA 1N6QA 4LH5A 4KI6A 4PUOA 4CHZA 4KAZA 1VRUA 3V9ZA 1U04A 3AVGA 3LZIA 3E01A 4C8MA 1EETA 2HNDA 4ZHRA 2KFNA 4FJMA 3OYFA 4FXDA 1YTAA 4OKJA 5DMRA 3QEWA 3TAGA 3THVA 1BGXT 1I39A 4DG1A 3DLHA 2VG5A 3CG7A 4CF9A 1LW2A 4DLEA 1BI4B 4N5SA 3K57A 1L3TA 4ICLA 4HUGA 3KK2A 2OYQA 4BE1A 1QQCA 2Z1JA 1KCFA 2OPSA 4M45A 1TAUA 4B9MA 3U3GA 2YV0X 4KHQA 3DI6A 1HMVA 4DQPA 2X74A 4KFBA 1UAXA 4BE0A 4Y1CA 4RG8A 1QSYA 4Z4CA 4B8CA 4NYFA 4DMNA 3OYKA 1X9SA 4CJFA 4FLXA 4AHSA 2G8FA 1HYZA 4H8KA 3K5MA 4O0IA 1QE1A 4K8XA 4J2EA 4CEFA 5D7UA 4DS5A 4W5TA 2DFFA 3NF7A 1RT6A 3IG1A 3U6FA 3HPHA 1S1XA 5CYQA 3VQPA 1VSJA 3AA2A 4B9VA 3LAKA 3NGIA 3PV8A 4CESA 2PZSA 1BL3A 1X9WA 1RDBA 4DU1A 1SKSA 1ZBFA 3T1AA 1WNSA 1HNIA 2W42A 4DU3A 5HLFA 4FJJA 4BE2A 5FRMA 5C25A 1RDCA 2PY5A 4CEOA 3T19A 4E7KA 3P1GA 2OZSA 3S3OA 3QEXA 1BIUA 4IFVA 3KK3A 3AVIA 1C1AA 3HYFA 5C42A 3T3FA 1T8EA 1FKOA 1KFDA 1EP4A 4YNQA 1NK9A 4I9LA 3RWUA 4FJKA 5HBMA 5EU7A 2BDPA 3DM2A 1HJRA 1Q9XA 3SUNA 1NJWA 1Q9YA 3KLEA 3CM6A 3AO3A 4DS4A 3RMDA 1NK5A 4CE9A 4EP4A 4E7LA 2HMIA 2LSNA 4KB1A 4Z4IA 1RBRA 3G10A 1A5XA 3HL8A 1RT3A 1JLFA 3ZSOA 3PX4A 1K6YA 3PUFA 3V1OA 1L3UA 3MEEA 1CXQA 1BHLA 3ZSRA 3NGYA 1HQUA 3OY9A 2G8UA 1UOCA 3OYCA 4OGEA 4L8RB 2FC0A 4CF2A 5KTQA 4GW6A 4CJWA 1D9FA 4IKFA 3IRXA 2P1JA 4CJ4A 5I3UA 1GOAA 1U45A 2KTQA 3MECA 4DSJA 3AVLA 4FJGA 3SCXA 3AO2A 4W5NA 4CFAA 4NCBA 4CCHA 1G15A 3WNGA 4CHQA 5J2QA 4Q0BA 2O4IA 3G0ZA 1RT1A 3D0PA 3M8PA 3A2FA 4C8NA 1TKXA 1X9MA 4M41A 3VQ5A 1RBVA 4CEDA 4CIEA 3NBPA 3QEVA 4M3TA 1VSIA 3C95A 1KLMA 5CYMA 4HCBA 4W5QA 2HHQA 3SZ2A 3QEPA 4DTUA 1CZ9A 2HVIA 5JS1A 3UIQA 4KI4A 2D0AA 3LANA 4DLGA 3RRHA 3RMCA 4J2AA 3JYTA 3AVFA 3OS0A 4FM1A 4DWIA 4OLBA 4Z4FA 3V6DA 3OYEA 1RTHA 3KLIA 1NK0A 3KLHA 3AVJA 4DQSA 4M3YA 5FRNA 1Z25A 5FDLA 3CFRA 5CZ2A 1WLJA 1W0HA 3HSTB 3RMBA 5D3GA 3EY1A 1YVUA 4CJPA 5K14A 3O3HA 3OYNA 4FZXC 3ZT0A 4PY5A 4DFJA 3HP9A 1JXBA 4XIUA 3V9XA 4CHOA 3RMAA 2E6MA 1SUQA 4KTWA 3KLGA 3KKSA 1KSPA 3NE6A 2KFZA 3SPYA 4DSLA 3OYJA 3DRPA 5DK5A 3V9WA 2YNIA 1SV5A 4E1MA 4RW8A 1LAWA 1UA0A 3NGZA 4LH4A 2WOMA 3DLKA 5HRPA 1YT3A 2HHXA 4KHNA 2RF2A 4CJEA 4FK0A 1S9EA 2VWJA 1W9HA 2X6NA 5C24A 4CEBA 3AO5A 3TANA 3O4NA 2XO7A 4Q5VA 3TR8A 4RW4A 4CJLA 3V9SA 1S6QA 4N47A 1TK0A 3NCIA 3F9KA 3OYBA 4NCGA 1TGOA 1VSDA 3LP3A 4FLYA 3H08A 4I7FA 2IAJA 3HXMA 3OYAA 3K59A 4JRQA 4FLWA 4B9TA 3ZSWA 4DTOA 4CJ3A 1QSSA 3OYHA 4CEZA 2NUBA 2XY5A 4LD0A 4WE1A 3SQ1A 4KREA 3KLFA 4DFMA 3HVRA 1A5WA 4F2SA 1UWBA 4CGDA 4BWMA 1HQEA 1RTIA 2GV9A 1XI1A 3TARA 1U4BA 1NK8A 2KZZA 3NF6A 1TKZA 1KFSA 1QS4A 4AHRA 1L3SA 2RPIA 3ITHA 3ALYA 1WSJA 3MXJA 4O55A 4BDZA 2WONA 1D8YA 3ZT1A 4E0DA 3VQCA 5T7BA 4CJ5A 1JLAA 4JLHA 1SL1A 4FJ8A 1YTUA 1WN7A 1SL0A 2XY6A 1RTDA 2YHAA 3PY8A 3L8BA 4DQRA 5J2MA 4B9UA 3HP6A 2OZMA 4LSLA 3O3GA 4PQUA 3VQQA 3OYDA 4NYNA 1VSKA 1RBTA 1HYVA 4TSXA 3F73A 3QEIA 1L5UA 1RILA 3LWMA 1GOCA 1TV6A 2YKMA 3RR7A 2HHUA 5SZTA 4EP5A 1CZBA 2O4GA 3ZSVA 3HT3A 1NK6A 3QERA 1ZBHA 2HHSA 4B9SA 2ATQA 2B5JA 4CJVA 3NHGA 3WNFA 4E7HA 3SUOA 3PO4A 4ELTA 3NH2A 4B9NA 4OVLA 3NFAA 4CFBA 1VRTA 1WSHA 1EKEA 3K2PA 2ZQBA 2QXFA 2XY7A 4MFBA 4FJHA 3CQ8A 2VG6A 4KB0A 4FW2A 1L3VA 2HW3A 3KIOA 4IFYA 4M3UA 2VG7A 4FZZA 4FM0A 3C6TA 4GVMA 1RDDA 1IKXA 1JLBA 2G8VA 4DSEA 3RR8A 2DTUA 1RTJA 4CEEA 5J2PA 3TAEA 3SPZA 3L2RA 1Z26A 1BQMA 1RBUA 1BISA 2HHTA 3L2UA 4IDKA 3ASMA 2FBVA 2D0CA 3L3VA 4CJKA 1JL1A 5J2NA 1DTTA 1LWCA 4FM2A 1BCOA 3DRRA 4AHTA 1QHTA 4OPJA 3AVKA 3L3UA 4DQQA 3IAYA 3KK1A 4HCCA 1EX4A 4E7IA 1C6VA 1C0TA 2Y1IA 1JLQA 4OJRA 4PA1A 5E41A 1C6VX 2KW4A 3LP0A 3NF8A 3LWLA 4FK4A 1TK8A 2DFHA 1D9DA 3ZSQA 2HHVA 1REVA 4CEAA 4CK3A 2PYLA 1LAVA 3HVTA 1TKTA 2OPPA 3DLGA 3M8RA 3TABA 4FJXA 4CJQA 3K58A 3PX6A 3EYZA 4Z4EA 3QINA 3KKRA 5KI6A 4R5PA 3U3YA 3SQ0A 4FW1A 3NF9A 4IBNA 1JKHA 3OJUA 2Y1JA 4FJNA 1I3AA 1F21A 4C8OA 4M3WA 1S9GA 3C6UA 3AVNA 5J1EA 2A1RA 2HVHA 2F96A 2QK9A 4F2RA 4FZYA 4QCLA 3VQBA 3HPGA 4LSNA 3I8DA 4HTUA 1S1WA 2KZMA 4CF1A 3K5OA 4KTZA 3K5NA 3OVNA 2F8TA 2R7YA 1NKBA 3V81A 1FK9A 4B8AB 4HVJA 4N76A 1BCMA 3LPTA 2JLEA 3LP1A 3P83D 3SNNA 1SL2A 3MEDA 2B4JA 1HRHA 2YNFA 2YNGA 3AV9A 4FCYA 4M3XA 3TAMA 4RW9A 4M3RA 4F3TA 1JLCA 1IHWA 2D5RA 3EZ5A 4FLUA 3VA3A 3SQ2A 1IHVA 4H4MA 4OPKA 5CY4A 3RTVA 2G8WA 2XRIA 3DOLA 4IG0A 4CF8A 1VSHA 1S5JA 3ZSZA 3LP2A 4CFDA 4KRFA 4Y1DA 3VQ8A 1IG9A 1R0AA 3DRSA 4B08A 3TAPA 2F8SA 4ID1A 3L2WA 1KVCA 1HNVA 3AVCA 3SUPA 4FJLA 4KHYA 1VK0A 1LV5A 4O0JA 1C0MA 2HNZA 4J2BA 3VQDA 4BDPA 3DLBA 3CFOA 2YHBA 4EZ9A 3B6OA 2E4LA 1IKWA 4N56A 1N5YA 4JS5A 3MAQA 1U49A 3V4IA 3V1RA 1RDAA 4DFKA 3O4QA 3TAQA 1XHZA 3LDSA 2G8KA 3P5JA 4CECA 3ZT2A 1NK4A 1T03A 2ZD1A 2JGUA 3VQ7A 1WAFA 1RT4A 1U48A 3ZCMA 2OPQA 4OKEA 4ELUA 4QAGA 1EXQA 4GMJB 1J9AA 3OYGA 3TAFA 3MXMA 2EX3A 2X6SA 4CJRA 4W5OA 2G8HA 4FJ5A 4CF0A 5I42A 1NJXA 4DQIA 3OS1A 1T05A 3S3MA 1ZBIA 3VQ6A 4KTQA 4ELVA 1QMCA 1Y97A 1WSGA 4O4GA 3ZT4A 2ZE2A 4KKOA 1QTMA 1JLEA 4E7JA 3CYMA 3SJJA 1KLNA 2X78A 3QIPA 4KO0A 4B9LA 3QO9A 4O5BA 3V9UA 4E1NA 3JSMA 1ZYQA 4KHSA 3SQ4A 4B3OA 1IH7A 2ITGA 4CIFA 4KHUA 3QNNA 2FBXA 3QLHA 4OKKA 4QOZB 1HYSA 1NKEA 1XHXA 2I5JA 4CK2A 1A5VA 3SYZA 4FJ7A 1D5AA