4FW1A

Crystal structure of two-domain rsv integrase covalently linked with dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
210
Chain Sequence
PRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGRPKAIKTDNGDAFTSKSTREWLARWGIAHTTGAMVCRANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHKERGENTKTPIQKHWRPTVLTEGPPVKIRIETGEWEKGWNVLVWGRGYAAVKNRDTDKVIWVPSRKVKPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Integrase
publication title A possible role for the asymmetric C-terminal domain dimer of Rous sarcoma virus integrase in viral DNA binding.
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 71
structure length 210
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 4fw1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4fw1A01
1TK5A 3ISNC 3MEEA 4DSLA 4LY7A 4OLAA 2JGUA 3RWUA 3LP3A 3VA0A 4FJMA 4FK2A 2YV0X 2BANA 4I2QA 1WSHA 1BI4B 3OY9A 3V9SA 1RT5A 5SWMA 3NGYA 1VSKA 1S1VA 2RPIA 5E41A 3AVAA 1VSFA 2X6SA 4OGCA 4BWJA 3K58A 4E3SA 3T3FA 3WNFA 1HQUA 3V81A 3NF8A 1KLNA 3ZT1A 2IC3A 4CHOA 2FBXA 1VSMA 5HLFA 3K5NA 1TK0A 1RILA 3B6PA 3TAPA 4KPYA 2FBYA 4FLWA 4PQUA 1D9FA 1ASUA 4NYNA 5HBMA 3O3GA 3OYGA 4OPJA 1EP4A 4J2DA 4FJIA 3L2UA 4IBNA 3V1QA 3SQ4A 2X74A 3HP6A 2OZSA 3O4QA 3OYIA 2G8UA 4BDPA 3KD5E 4CJKA 3V6DA 1KVCA 4B9NA 3MXIA 4CF8A 1C0UA 4B8AB 3I0SA 4CIGA 4WE1A 4OGEA 4LSLA 1KCFA 3CM6A 3LALA 1J9AA 4CEDA 3LP1A 3HXMA 4CF9A 3RRGA 3DI6A 5HP1A 4FW1A 1KFDA 2Y1JA 2ZQBA 4FJXA 5FRNA 2G8WA 4N5SA 1U49A 3AVGA 4CJEA 4AILC 3RMCA 1SKRA 4I9QA 3OYMA 2XRIA 4YFUA 4Z4CA 3NDKA 2KZZA 3JYTA 3HSTB 3OYHA 1KLMA 4M42A 2XY8A 3OS0A 5KRTA 4RW6A 2G8IA 4FJ8A 1RBVA 4KTWA 4CEQA 3QEVA 4XIUA 2G8HA 4CF0A 5KI6A 1IO2A 3K57A 1JXEA 3OYLA 3S3OA 4OPKA 1BIUA 4FM0A 3V4IA 2YHAA 1RTHA 1D5AA 3K59A 1QE1A 4CIFA 3KIOA 2HNDA 1L3SA 2XY6A 3AVCA 4FJLA 3M8PA 4CHYA 3MEGA 3L2WA 4DLGA 3QLHA 1UWBA 2VG6A 4B9LA 3ZSZA 1TK8A 3HO1A 1HYVA 3KLGA 3TR8A 3AO1A 1LAVA 4KAZA 5I3UA 3HVRA 3U3GA 4L8RB 1LV5A 4CEEA 5DK5A 3OYJA 4KHYA 4CEZA 1KVAA 3V9UA 1U4BA 2HNZA 3SQ0A 4Y1CA 2Q3SA 1T05A 4HCCA 3QNNA 1C6VX 1IKYA 4CGHA 2Z1HA 1BI4A 4NYFA 4O44A 2D5RA 4AHSA 2O4IA 3C6TA 5J2PA 3DLKA 3PX6A 1SUQA 1YVUA 3NAEA 4DU3A 4DTMA 1RT2A 3DYAA 1KRPA 2HHTA 1TVRA 2QKBA 5K14A 4ZTJA 3AVBA 1RBRA 3DOKA 3ZCMA 3RRHA 1A5WA 3L3VA 2E6LA 1NK8A 4DFJA 2EHGA 1HNIA 2O4GA 2VWKA 3MXMA 4FJ7A 3AVJA 3NF6A 4ID5A 4DTPA 1VK0A 2DFHA 3SUNA 4AHTA 1ASVA 1ZBUA 2YHBA 2HNYA 2IGIA 2NUBA 1CLQA 4CJTA 4HUFA 1W9HA 3AVFA 4Z0UA 5EU7A 3NGIA 1QTMA 2HVHA 3TAEA 1KVBA 4KHWA 1NOZA 1QSLA 1RT7A 2LSNA 3QEXA 4DQIA 5JS1A 1HNVA 4FYDA 3IG1A 4CESA 2GV9A 4AHRA 3KLHA 1U45A 5T7BA 1GOAA 1I39A 4W5QA 4JRQA 1IG9A 3LP2A 3OYNA 2HVIA 1WAFA 2I5JA 1JLQA 5HRPA 2XY5A 3AA3A 4C8KA 1FKPA 4FJJA 3KLEA 1ITGA 3C6UA 3VN5A 1C1BA 3ZSOA 3VQ4A 3ZSWA 4Z4FA 3U6FA 1TAUA 4CFBA 3AV9A 3C94A 4IFVA 1A5XA 1L3TA 3OYKA 4J2EA 1HYZA 4KKOA 4H8KA 4DTNA 3V1RA 4Q5VA 3TAQA 3QINA 4PWDA 4CHZA 4GMJB 5HRRA 1JKHA 3TAFA 4M3RA 5KTQA 1NJXA 2PY5A 4MQ3A 3DLEA 1DTQA 4DQPA 2Z1IA 1TKDA 4ZTFA 1HJRA 4CIEA 5J2MA 4DSIA 1LWFA 4E7HA 2G8KA 2XHBA 2RN2A 1NK9A 3OS1A 3MXJA 4CJUA 1IKWA 4M3TA 3KKRA 1N6QA 4ELTA 3ZSXA 1HPZA 3AVKA 4IKFA 4RW4A 3KK3A 1RT3A 4C8NA 4KHSA 1EETA 3NFAA 3AO2A 5CY4A 5CYMA 4DTOA 1RT4A 5J2NA 4FZZA 4CJRA 4DS4A 4K8ZA 3AVLA 3CM5A 4CGFA 2QKKA 1SKSA 4BE0A 3HP9A 1YT3A 4IG3A 2HHUA 4I7FA 3H08A 4HTUA 3MAQA 4PA1A 1QSSA 1IHWA 3M8SA 1BQMA 1D8YA 1EKEA 2KTQA 3QIPA 3ALYA 1C0TA 5HRNA 1J54A 1FK9A 1N5YA 1RT1A 1HYSA 4E19A 3HL8A 3OYCA 1S1XA 3DM2A 4F2RA 4KV8A 1JLCA 3RMBA 2YNIA 3F9KA 2E6MA 2VG7A 4CJFA 4FLXA 3FFIA 4CF2A 4O4GA 4B9SA 1HQEA 5FROA 3IS9A 3AO4A 5JS2A 5C25A 3HPOA 4C8LA 3PV8A 2DY4A 3VQBA 4M3ZA 2IAJA 4N56A 1LAWA 1C1AA 1D9DA 3HK2A 2HHWA 2KFZA 1NK0A 3M8QA 1IKXA 3EYZA 4FLTA 3SYZA 1WSGA 4B9MA 2G8VA 2PYJA 4O0JA 4CJWA 3A2FA 2FBTA 4R5PA 1LWCA 1MU2A 5D3GA 3HJFA 4ELUA 2AJQA 4I2PA 2A1SA 4DU1A 5FRMA 4UQGA 4E7JA 3HYFA 4CJVA 4OKEA 2EX3A 3TAGA 3DRPA 4W5NA 4FLZA 2BGGA 5C42A 2VWJA 4H4OA 3IAYA 1B92A 1QS4A 4AH9A 1YTAA 4DG1A 2PZSA 3AA5X 3SCXA 1WAJA 3OYAA 4FJ9A 4AHCA 4OJRA 5CZ2A 4DSFA 1T8EA 3G10A 2DFEA 2HHVA 3RMAA 1TGOA 1BQNA 3DRRA 3NGZA 4CCHA 1CZBA 3KK2A 4LSNA 3ZSVA 4DSJA 3WNGA 2P5OA 1RTIA 3CFRA 3CFOA 1T03A 4KI6A 3DLRA 1HMVA 1WNSA 1IKVA 3I8DA 1X9SA 4CJ5A 3NCIA 1TL1A 1X9WA 4B3OA 3SUOA 3KJVA 1S1TA 2WOMA 4HCBA 1RBUA 4ICLA 3SUPA 3TAMA 4YNQA 4PUOA 1RDCA 4IG0A 4CJSA 1J53A 3NF9A 1XI1A 4F3OA 4KTQA 3CQ8A 1CXQA 3OYBA 3HPHA 4CE9A 4CJ4A 4C8MA 4JS4A 3K5OA 4CEFA 5J2QA 4E89A 1NJWA 1GOBA 4NCGA 4OKJA 3IRXA 4DF4A 4E7KA 3S3MA 1NK7A 3L2RA 2HW3A 1QHTA 5KGXA 3RR8A 2HHQA 1KTQA 2ATQA 3PX4A 4LH4A 4BWMA 5HROA 1TKTA 3SNNA 1Q9YA 4PY5A 1VSLA 2IS3A 3AVMA 2VG5A 4RW8A 3SUQA 4FK0A 1Z26A 2B5JA 3E01A 4DFPA 2FBVA 4IFYA 2B6AA 4ELVA 3NE6A 4FJGA 1JLFA 4E1MA 2QXFA 4CEBA 3VQQA 4F8RA 1RDAA 2X78A 4CHNA 3PO4A 1Y97A 3EY1A 2GUIA 4B9VA 4DU4A 3DLHA 3PY8A 3O3FA 2QK9A 2JLEA 1KSPA 4KFBA 3NH2A 3SJJA 2PYLA 4FK4A 1BISA 3ZSQA 4BE2A 4DWIA 1W0HA 4FXDA 1ZYQA 4QAGA 3LWMA 1BCMA 4O5BA 2KW4A 4KHQA 3MEDA 1LW2A 3OYDA 4FLVA 1NKEA 1ZBLA 3QEPA 2GBZA 4B08A 3V9WA 4DTRA 3TABA 1WSFA 3ZSRA 4LH5A 3AA4A 2WONA 3VQAA 4N41A 3PX0A 3TI0A 2W42A 5I42A 3ITHA 3LPUA 3RTVA 2IDOA 4RG8A 1JL1A 1RTDA 4FJNA 1J5OA 1EX4A 4CEAA 4M3XA 1WN7A 2IOCA 2B4JA 5C24A 4W5RA 2HMIA 1BHLA 5CYQA 4JS5A 1QQCA 3VQ9A 4KHNA 3HVTA 1SL1A 1NJYA 2G8FA 2Y1IA 1S9GA 3QIOA 4AHUA 1XC9A 3DLBA 2ZD1A 1NKCA 1C6VA 3JSMA 3SV4A 4KHUA 1QMCA 1XHXA 4DTSA 1SV5A 4I9LA 1SKWA 3DRSA 1NKBA 3T19A 4H4MA 1HRHA 5KRSA 3RR7A 1FKOA 4DQSA 3MECA 1U47A 3HM9A 1JXBA 1S5JA 1ZBHA 1IH7A 4F4KA 4FW2A 3L8BA 2HB5A 1L3UA 4F3TA 2HHSA 1Q9XA 4HVJA 4CEOA 3D0PA 1RBSA 1LW0A 1TAQA 4FZXC 4LD0A 2RF2A 2DTUA 4CK2A 1S1UA 2YKMA 2D0AA 4JLHA 3KLFA 3M8RA 4HUGA 1T7PA 4Q0BA 1JLAA 4C8OA 3OYEA 3OYFA 3LWLA 3LAKA 4J2AA 3V9XA 1CZ9A 2F8TA 1QSYA 1ASWA 3RMDA 1VRUA 3P5JA 4KRFA 1BGXT 3NH0A 4FZYA 3VA3A 3LP0A 3QERA 4FCYA 1Q8IA 1DLOA 1RTJA 4G1QA 3O3HA 3KK1A 4B9TA 4DTXA 4CGIA 4CGGA 1F21A 4M3YA 1G15A 4Y1DA 2D0BA 4Z4GA 2OPPA 3HT3A 1RDBA 3QEIA 4KI4A 3AO3A 2OYQA 1TL3A 4CECA 1NK4A 3KD1E 2XY7A 4CGDA 4FM1A 3VQ5A 1WSEA 1B9FA 1KFSA 4QCLA 4FVMA 2RKIA 1VSDA 4IDKA 1UOCA 1RNHA 1VSHA 4DQRA 1ZBFA 2HHXA 3K5MA 2OPQA 4ID1A 2P1JA 1WSJA 1U48A 4Z4HA 2OPRA 3SQ2A 3EZ5A 3QEWA 3AA2A 1CXUA 3BDPA 4F2SA 3ASMA 4FJKA 3AVNA 4KREA 1SL2A 1B9DA 1K6YA 1Z25A 4MFBA 3SQ1A 2Z1JA 2XO7A 4RW9A 4TSXA 1VSJA 3ZT4A 1UA0A 1X9MA 4CERA 4Z4IA 4CFAA 1I3AA 5DMRA 3NF7A 1XHZA 4M41A 1S6PA 1S9EA 4DQQA 4FLUA 4E7LA 4BACA 3B6OA 3LPTA 4DFKA 3QETA 4KB1A 3WNHA 1VSIA 3VQDA 3V9ZA 3LANA 4CHPA 3CFPA 3V1OA 4B9UA 3O4NA 3F73A 3L2QA 2ITGA 4DFMA 4FJ5A 4GW6A 1C0MA 1GOCA 3AVHA 1UA1A 1NOYA 2KQ2A 3PO5A 2OPSA 2P51A 4OLBA 2YKNA 3AO5A 3P83D 4ZHRA 1RDDA 4CK3A 4BE1A 4CJPA 3TARA 1ZBIA 4DTUA 4CJLA 4CJ3A 3P1GA 2BE2A 3NBPA 4M45A 3ZT2A 1RBTA 3AVIA 3NHGA 4FLYA 3SV3A 3S9HA 4CGJA 3S3NA 4QOZB 4W5OA 4M3UA 4CK1A 1UAXA 1VSEA 1REVA 1U04A 5J1EA 5KGWA 1R0AA 2F96A 4Z4EA 5HRSA 3OVNA 4RW7A 5D7UA 4EZ9A 2OA8A 4CFCA 3LZIA 3TANA 1YTUA 2X6NA 2ETJA 4HUEA 1TKXA 3K2PA 1LWEA 4FM2A 3T1AA 1JLEA 3C95A 2OZMA 4DS5A 5SZTA 5CZ1A 3ZSYA 3SZ2A 2BDPA 3VQ7A 1S6QA 4JRPA 3VQCA 1RCHA 3PUFA 4BDZA 4GVMA 4E0DA 3VQEA 1DTTA 1JLBA 2D0CA 4CJQA 1BCOA 2E4LA 4B8CA 4E7IA 3SPZA 2KZMA 3D45A 3OJUA 1EXQA 4DMNA 4O55A 4N76A 3G0ZA 4E1NA 1JLGA 1O1WA 2YNHA 3VQPA 3U3YA 1XWLA 3LZJA 1SL0A 3KTQA 3I0RA 3ZT3A 3CYMA 1A5VA 2ZE2A 2KFNA 2DFFA 4HHTA 2YNFA 3QO9A 3TWHA 3OS2A 2P5GA 1WLJA 3CG7A 4EZ6A 2Z1GA 2A1RA 3UIQA 1JL2A 4DTJA 1NJZA 1FXXA 4DSEA 3DMJA 4EP4A 1TKZA 3NH1A 3BGRA 4K8XA 3LDSA 1RT6A 1X1PA 3QESA 3SI6A 1L5UA 4M3WA 4DF8A 1L3VA 3KLIA 4CHQA 1BL3A 4NCAA 4OVLA 4EP5A 4KB0A 3DOLA 3THVA 1BIZA 2YNGA 3SPYA 2FC0A 3KKSA 1NK5A 3VQ6A 4BDYA 3L3UA 1VRTA 4CFDA 2R7YA 4KO0A 4J2BA 1TV6A 3OJSA 3ULDA 3LAMA 3WNEA 1C1CA 1NK6A 4NCBA 1S1WA 1WSIA 1IHVA 3QNOA 3VQ8A 5FDLA 4KTZA 4FJHA 4N47A 4O0IA 3ZT0A 3L2VA 3K5LA 4DLEA 4DSKA 2F8SA 3HPGA 4CF1A 4OKKA 3DLGA 4AHVA 4W5TA
chains in the Genus database with same CATH superfamily
1ABOA 4DSLA 2RI5A 3EG0A 4LY7A 3RWUA 2CGHA 4OMQA 1QVFP 3W0LA 3G6EN 4F7UA 3MP6A 1RFQA 3OSSC 4H5NA 4ME7A 2P4RA 2YJEA 4BQZA 2BANA 1RAIB 1KQSA 4FVUA 4BR7A 2DL3A 2AKLA 1GRIA 3V9SA 5A0DA 3C0CA 2RPIA 1JJ2S 3PIOA 3QBXA 1GLDG 3BDLA 3WNFA 3V81A 4CRIA 5KPRA 2EIFA 1VSMA 5HLFA 4MDWA 1TK0A 1RILA 3TAPA 2JVVA 1GBRA 1X6OA 4PQUA 3RKXA 3CJ9A 4NYNA 4NL2A 3S6WA 1CKAA 4L5GA 3QMLA 1YJ9A 3S41A 4OPHA 1U1TA 1KSWA 3L2UA 1DEJA 2A5XA 3V1QA 4FJIA 2OZSA 1U5SA 4BDPA 2RK2A 2L2PA 3WEEA 3ER0A 1IGQA 3VTHA 5LJWA 2GFAA 4CF8A 1QWEA 1C0UA 3MXIA 3ZX3A 4OGEA 1VQNT 5CKHA 1RAEB 2X3WD 3QDFA 1QVFS 4LDUA 5HP1A 2EWSA 1NMDA 1QHAA 1KFDA 2F2XA 3A5NC 5GAMd 1BA1A 4BG8A 5ADXH 3THYB 4N5SA 4AILC 2E4HA 1S72A 2RHIA 1GLFO 3RMCA 3VEYA 3C12A 3V7RA 4YFUA 4ELYC 5GJVB 2HQEA 3M0SA 3HSTB 3OS0A 2BIVA 4WF9L 4J6WA 4C8QC 2G8IA 4F16A 4JKDA 4CEQA 1X6GA 1SKUB 4JKBA 1AD5A 2QG9B 4XIUA 4FYXB 2KQWA 2DILA 3CBPA 3VS1A 3WVEB 3ME9A 5IXBA 3VF2A 5C10A 3J7AP 3S3OA 3T7ZA 2C0IA 3INZA 2RH2A 2UXCK 3BUZB 1J3TA 3QFPA 1ZUUA 3KIOA 5AQGA 2KY9A 2XY6A 3WT0A 3CC4A 3M8PA 1BI0A 2RHXA 4IIOA 3VEOA 2CZ6B 3KUFA 1VQOQ 3HOSA 4B9LA 3P38A 2F2VA 4Z94A 5CVIA 1HYVA 1VQ9T 5I3UA 1T3VA 1RUWA 2V8JA 3HVRA 1I07A 1WHGA 3OYJA 2OTLN 2F69A 2EQUA 1KVAA 3O5BA 5A2QE 3QB0A 1T05A 3H0HA 2M16A 3CCMT 4FYYB 4AHSA 2D5RA 1SUQA 3E66A 5AQTA 5DY9A 1NGIA 2W6KA 3NAEA 4DTMA 1RT2A 3A5OC 3CCUQ 2QKBA 2K3XA 3AVBA 3RRHA 1HPMA 1A5WA 4K41A 3VTIA 2E6LA 5BRDA 5IN1A 2O4GA 1JCFA 3NF6A 3LDPA 4DHYA 2RK1A 4KGVB 4FSXA 1VQPA 2OCEA 5DM7L 1VQ7T 1BDGA 1ZBUA 2IGIA 3M0TA 3AARA 4HUFA 1W9HA 2J6OA 5FWBA 3O9RA 3NGIA 3OMCA 1KVBA 1HD3A 1K73U 3CHWA 3CJCA 3TAEA 2KNBB 4IXCA 2AK5A 2DRMA 1U8RA 3JCMe 4C1NI 4FYDA 3IG1A 4DV6K 1UGPB 3I56A 3TSQA 2GV9A 4D8KA 3KLHA 4ISEA 4JRQA 3ASKA 1IG9A 3J80E 5KQ8A 2JMAA 1WAFA 2I5JA 4ESRA 3JB9F 3H9NA 4PL7A 1VYVA 2O88A 1AZEA 1FKPA 4H0TB 1UUEA 3RBBB 3FRNA 3ZSOA 1RI0A 1UG1A 1MMNA 3DXMB 2HKNA 5DM7R 3U6FA 1YHQN 1ZLMA 1Q7YO 4Z4FA 1TAUA 4CD3A 3AV9A 4C92A 3C94A 4C0DC 3VS7A 4IFVA 4EIAA 1PHTA 3QWXX 3OYKA 3OA6A 3TAQA 5HRRA 2FLOA 2ITMA 3LDNA 4MQ3A 2LJ3A 1N33K 2E12A 1TKDA 5AQFA 5DLOA 1FX7A 3WXKA 5C12A 4E7HA 1LWFA 2G8KA 2XHBA 4JRKA 3MXJA 1JB0E 3QJYA 1S3XA 3KKRA 2RJCA 4N4IA 4BC4A 5LMUK 3CMEQ 1JQQA 3WVDB 3PMIA 2XU8A 4ILJA 3R6NA 1M1GA 3A8GB 2AT1B 1HNZK 4C8NA 4KHSA 1TUCA 2NYSA 1EETA 3NFAA 3A8OB 1NG9A 2SEMA 3CJ1A 2GELA 4JKEA 4DTOA 1RT4A 4DS4A 3AGRA 3DJCA 3G6EA 3CM5A 2QWLA 1PRLC 4IG3A 4EMKB 4HTLA 5KYWA 3H08A 1JRIA 1UE9A 1QSSA 3RR6A 4M7XA 2YUOA 1BQMA 1D8YA 2X9HA 3QIPA 3QBYA 3E9LA 4V2SA 1M2VB 4CC4B 4IJAA 2X4WA 1OKJA 1FK9A 2FO0A 4QT7A 4VUBA 3NMZC 4EDUA 4O5VA 2C0TA 4U7BA 1JLCA 2YNIA 4MO4A 1YJWA 3CMAA 3H45C 2P9PB 5F2RA 3FFIA 4CF2A 5LY3A 4FLXA 4C8LA 1I1JA 3ZEUB 3TSPA 4C0ZA 1OX8A 3QFUA 2NUTB 3QHSA 5FU6B 1D9DA 3PE0A 3REAB 3CCJA 3M8QA 2K5IA 1IKXA 3EYZA 3CCQA 2ZM6K 1RAFB 1QW1A 3SYZA 2PU9B 2G8VA 3QJ6A 1VQ8N 1U2VB 1LOTB 3A2FA 5D3GA 2YRVA 1QCOA 4NS5A 1MU2A 1KQSS 3PMTA 4ELUA 4BRQA 2A7YA 1EWQA 5C42A 2VWJA 2VQFK 4FYWB 1QS4A 1QQOA 4MDBA 2HSPA 3G6EQ 4DG1A 3DB3A 3OYAA 4JI6K 1T3SA 4Y0WA 1T8EA 3SAGA 4J6YA 4OO1J 1BQNA 1YJ9T 3ZSVA 1N32K 2QASA 3CFOA 5JLHA 5KE2A 1AT1B 5M9OA 1IKVA 1R8OB 1WNSA 5A2QO 2ZJQL 3OW2M 3LWHA 4NL3A 4F7UB 1VQKN 5AQYA 2EJFA 3SFMA 2KEAA 4B3OA 4B9QA 1S1TA 4BRFA 4BC5A 4H0OA 4XTXA 4LD6A 1Z05A 2DXTA 2H3JA 2K7AA 3EG9B 4CE9A 2LMJA 4C8MA 2WC9A 3F5TA 2O8FA 1U1SA 4HT9A 4RTUA 1GOBA 4DF4A 2E8AA 5GAN2 4OMNA 4E7KA 3L2RA 1SRLA 1VOMA 2HW3A 2WBNA 1ILYA 4PJOE 5KGXA 3RR8A 2HHQA 3CCUT 2ATQA 2MI6A 3B8AX 4BWMA 3SNNA 5LJ3h 5GINA 3AVMA 2B86A 1ZQ1A 2VG5A 1GLCG 1Z26A 4JPBW 5CAIA 4DFPA 2DETA 4IFYA 2B6AA 3NE6A 4FJGA 3H3NO 3M53A 4PLLA 1BYMA 2OTLA 2PBDA 3VQQA 4CEBA 2E5KA 4CHNA 3CC7N 3PO4A 1Y97A 4K42A 4HXJA 3O3FA 1GLEG 2WSFE 1OULA 3P8BB 1WXBA 3CC4T 4LD9K 1M1KC 3LL3A 1M90C 3BE3A 4IUVA 5JMVA 1LW2A 3A5ZB 1NGBA 3JB9H 2BTTA 3QWYA 2DA9A 4PHTX 2AP1A 4B08A 4BRMA 1KC8U 3NPFA 3AA4A 5AFUA 2QGGA 2E2PA 4WFNL 3CCSN 1RDUA 5GANg 2JWKA 2H3EB 2HQHA 4FOEA 2JN0A 3EE8A 1T6CA 2IDOA 4RG8A 3ITHA 3LPUA 3O9UA 2RJEA 4CEAA 4M3XA 3EHQA 1RACB 2IOCA 5C24A 4YOWA 4JZ3A 2CP0A 4FWMA 4KHNA 4PJOA 3KXTA 1NJYA 4B9XA 2G8FA 2Y4YA 4M7AD 1S9GA 4AHUA 3OW2P 2Y1IA 2YLBA 2ZD1A 1XC9A 2GFUA 3DLBA 3SV4A 2DIGA 3VRYA 5AQSA 4DTSA 1SKWA 4I9LA 1PNJA 2PZ1A 3EZWA 1NKBA 5KRSA 4M7DE 1FKOA 3ZETB 1VQPT 5CQYA 1JXBA 3F2KA 3MX2A 4C5EA 1K73R 3V7SA 5ELZA 4C5HA 2O8EA 3D2EB 1N34K 1D09B 3M1FA 1D3BA 3SWNA 1P92A 1WQWA 5AYFA 2ROTA 1YHQA 2HHSA 2RJDA 2DPNA 4QVZA 3JCMh 3GBQA 4A5BA 4BRNA 4FZXC 2NLXA 4CK2A 1T7PA 2YKMA 1TU0B 4JLHA 2EQIA 2CH4A 1OI1A 2DNUA 3OYFA 2BZ8A 2GWKA 4DV3K 4J2AA 2KAFA 2CP2A 2L8DA 5GAOl 1ASWA 4BVOA 5BR9A 3P5JA 4PJOF 2XHCA 4FZYA 3QERA 2QQSA 3CC2Q 2P9LA 1XC3A 1Q8IA 3VJPA 1VQ6A 3KK1A 2BZYA 4B9TA 2D0NA 4CGGA 4M3YA 4HVUA 1G15A 4Y1DA 2D0BA 4JNEA 1BI2A 3OW2S 2Q2RA 3M6GA 3TTFA 2E64A 2YRDA 5IHKA 3KD1E 3TTCA 4CZIA 5EXWA 5AZJA 2QA4N 1D0YA 4E7SA 2M0OA 1IO6A 5LJ3j 4M7DA 1V76A 1RNHA 1WYXA 5FPMA 4FL6A 3K5MA 3UKRB 2F7TA 3EZ5A 3JCMX 1KAYA 1JCEA 3DXKA 5GMKh 2D9TA 2KT1A 1K6YA 1E6HA 1X6BA 1KXPA 4MFBA 1KQ2A 2Z1JA 2XO7A 3ZT4A 2YUNA 1BB9A 4CERA 4M77B 1X3NA 1X9JA 3HRUA 2DIQA 2E5QA 4E7LA 1K0XA 3BP8A 3LPTA 3PNWC 3G6ET 4KB1A 2O8BA 3GF5A 5LJ5d 2W6LA 1LOJA 1BK2A 4AFQC 3CI5A 2FG0A 4DFMA 2EYZA 4ZN3A 1GOCA 3AVHA 2P9UB 1VQ8A 3AO5A 3VRZA 3NGPA 3JS6A 4JKFA 1EIFA 1RDDA 2YT6A 3CBOA 4M7DF 4CJ3A 1QKWA 3NBPA 3ZT2A 2F4VK 3NHGA 3SV3A 1YJWT 3CMAT 2E3IA 5H1SQ 3S9HA 2PTKA 4IUTA 1Q95G 4QOZB 1KD1U 4W5OA 3T1HK 1EFNA 5GAN4 1UAXA 1VSEA 2IVPA 4RTFD 3C7NA 4IOCL 1R0AA 4LC9B 1ZXOA 3EFRA 4ZN1A 4CFCA 5CK9A 2YJFA 3CCQT 2A3LA 1AWWA 2ETJA 4HUEA 5L8RE 4AFUC 1LWEA 3H1QA 9ATCB 3C95A 4JI0K 2JTMA 5CZ1A 1XQSC 3ZSYA 3MN7A 3PUFA 3BW1A 4A59A 2LX7A 3ID8A 3O8VA 2DTHA 1DTTA 1VQKA 2D0CA 3O08A 2JTFA 1BCOA 4YTLA 4PNOA 4BG9A 2VQEK 4CZKA 1ZHIA 3A5MC 4O55A 4DMNA 4MZMA 4QS7A 2KXDA 4N76A 2I7PA 2EYQA 1O1WA 3CCEN 1XWLA 3LZJA 3KTQA 3U23A 3FZKA 1WB9A 2FPDA 1UDLA 4M77D 4AG2C 2CH4W 2XIDA 3OS2A 1Q82O 1QZ5A 4C5GA 3CG7A 3VEZA 2Z1GA 2A1RA 2AZVA 3SJHA 3IFRA 3JCMP 1K9MO 4DTJA 2ZPBB 1FXXA 2E41A 3V7CA 4CC3A 1KD1O 3NH1A 3BGRA 3GBTA 3H3OB 4K8XA 3KK7A 3MP8A 3JCMb 3AY9A 3R6MA 4JKCA 4K25A 5JLFA 1OPLA 2V1QA 4FWNA 3LDSA 1X1PA 1NNEA 3SI6A 2HBPA 5GAHP 1G3YA 1VIEA 2HZYA 2HL5C 4M78E 4CHQA 4X64K 3G71Q 1BIAA 4M4ZA 3CCVQ 3CIPA 4OVLA 4EP5A 4F9OA 2EWNA 2CDTA 2ED1A 2NRTA 3VQ6A 2QYZA 4J2BA 4YOVA 3OJSA 2MCNA 5GMKj 3ZL7C 2V7ZA 4DV1K 1QWFA 3WNEA 1RADB 4BRIA 4NCBA 4AF1A 3QNOA 1QVFA 1VQ4Q 5KYXA 2OTLT 2HKQB 5GJWB 3FB9A 5EX5A 1UFFA 4JV5K 4GNIA 2BUDA 3CCSA 4DLEA 2F8SA 2CGLA 3HPGA 5GANf 3FZHA 3CPWM 1DJ7B 5AFUH 4Y91A 4AHVA 3RMQA 3FFKB 3ISNC 1TK5A 3HM8A 3L6QA 2JGUA 1YWOA 4Z02A 1FYNA 3FE1A 4L6V5 2JT4A 3FEOA 2K3BA 1KC8R 4DBRA 2OX7A 5GAOr 1EZZB 3LW5E 4Z89A 1HUXA 4FK2A 3I5SA 2D8JA 4L3QA 1NLPC 1WSHA 4C8QB 1NM1A 5D6XA 3OY9A 3TCJA 1RT5A 4KGXB 4M78A 2ED0A 3GLXA 1HJOA 3H0IA 1NU0A 4FPAA 4OGCA 4E3SA 3T3FA 2BE7D 2X4YA 1K0SA 3VYGA 1NJIU 1ATNA 4IDHA 1KLNA 1ZUYA 2Q0UA 4KBMB 2MWOA 1BG3A 2FBXA 2IC3A 3ZT1A 4CHOA 1FWZA 4HKEA 3RMSA 4BD3A 3UKUA 3K5NA 4H0YB 1S72N 4FLWA 2ZGWA 1WFWA 2XDPA 5I21A 1BWFO 2CSQA 1ASUA 3O3GA 3EGXB 1W6XA 1KAXA 1OU8A 4OPJA 1JO8A 3MCPA 4J2DA 1Y57A 4DA4A 3VERA 3VV0A 2X74A 3BDUA 3I35A 3CCSQ 2ZGYA 2G8UA 3KD5E 3PSFA 2DVEA 2H8HA 4B9NA 1VQNQ 2F9WA 4H0VB 4O8UA 2RQRA 5GAN5 3I0SA 4CIGA 4WE1A 4GKJK 4O6JA 1MHNA 4DKWA 2XKOC 1YHQT 3LALA 4CEDA 3HXMA 4LDVA 1SAZA 5IAYA 3RSEA 4CF9A 3RRGA 1LCKA 2HD0A 3DI6A 2YX6A 4RCBA 4M78F 1EWRA 2ZQBA 4YORA 2Y1JA 3HRTA 3ZYYX 2P0KA 2FHDA 3AVGA 4CJEA 2QA4A 4JKHA 3NDKA 4RW6A 2V52B 1MA9B 4KH6A 1VQ6T 3VS4A 4KTWA 2BZXA 2ABLA 3CPWP 1JCGA 4O8KA 4C8QD 4B9WA 4LFAK 2C0OA 2DL7A 1KQ1A 3A8HB 2P9NB 4CF0A 1M1KU 3C6AA 5EOYA 1BIUA 4OPKA 4FM0A 2YHAA 1RTHA 2SRCA 3GNGA 2BTFA 1QE1A 4CIFA 3DWLA 2HNDA 4A2AA 3TVTA 1HJDA 4CHYA 3OBWA 3SEMA 1VQ9Q 3ZSZA 1TK8A 5GAOn 4ZGDB 3KLGA 4KH5A 3TR8A 1LAVA 3E9GA 2NLUA 2YSQA 1TTHB 2R5MA 1Q7YU 3J7AF 3U3GA 4JI8K 4CEEA 1VQPN 2UXBK 5DK5A 4A63B 4C0DB 3CCMQ 2LQNA 1C6VX 1R59O 4PJNA 3RKYA 1BI4A 5KYYA 4NYFA 2J06A 4O44A 2O4IA 2XDBA 3DLKA 2IVOA 4DQ8A 3I56N 3PX6A 2AHJB 4WFBL 2CUBA 2DX1A 3DYAA 1KRPA 3WXLA 1VQ8T 1TVRA 2HHTA 3SK3A 1RBRA 3DOKA 4C92C 2YUPA 2ROLA 3QPHA 4LUDA 2V7YA 3J81O 4FJ7A 3DLMA 4ID5A 5C6SA 3AAQA 1QKXA 2A36A 2DBKA 1OU9A 1OH6A 1CKBA 4OB0B 4M75G 2B8AA 3SUNA 2Q31A 1ASVA 1G3WA 2HNYA 3M57A 2NUBA 4IOXA 4HCZA 4BGBA 4CJTA 3AVFA 4Z0UA 3CCEA 1NOZA 3KVGA 2XMFA 1QSLA 2LSNA 3QEXA 4DQIA 1MMDA 3P8HA 1HNVA 1I4K1 2Q1NA 2ZJRL 4Y28E 4CESA 1UJYA 1ZBXA 3TSZA 4J9EA 2AIRB 6AT1B 5CR2A 3AGKA 4W5QA 1U45A 1RL2A 3OYNA 3FDRA 3THWA 4X62K 2E2OA 1VQKT 2O8BB 5HRPA 1YP5A 2XY5A 4RMOA 1ITGA 4I6MA 5FLXO 1TYQB 3C6UA 5M1KA 3VN5A 1C1BA 2O8DB 1G3SA 3IMXA 4GLKA 4Z8AA 3TSWA 2P9SA 2DJZA 4M7AE 1G3TA 2ZPEB 4D6WA 1SS6A 1NZ9A 2PVOB 3FIFA 2RI2A 3A98A 1K8AC 1W7AA 1KAZA 1H1VA 4J2EA 2E65A 1HYZA 1BU6O 1QP3A 2IIRA 4WQ4A 3V1RA 5GANe 4Q5VA 2CGKA 3QINA 3G4SN 4DTNA 2QK0A 2PY5A 3I55N 2XICA 4YDUA 2QTDA 4AMCA 1WX6A 4RTWA 4PJOG 4DSIA 3ZFJA 1QVPA 1H641 4RTVA 5J3BA 3VEXA 2RN2A 2E1ZA 4DR7K 4WTOB 2ASPA 2RHZA 2RHUA 4ELTA 1GFDA 1WJQA 4O5FA 2O4XB 1WUAA 3H8ZA 1YJWN 3CMAN 2QAZA 4IKFA 3M0QA 5JICA 1UGQB 2L89A 3TU5A 3L1AA 3GNFB 2YXYA 2DL8A 4GV6A 3AO2A 5GAGP 1F1BB 3CCJN 1XNRK 1XNQK 4CJRA 2LCSA 2KRMA 4CGFA 3CCQN 4TVRA 1ZSGA 4BE0A 2E70A 1YT3A 1XUPO 3WXIA 2EAYA 4IEEA 4I7FA 5KYUA 4HTUA 4J8OA 3MAQA 1IHWA 4X66K 4J83A 4PKCC 1P8ZA 4KUDK 1QCNA 1C0TA 3VEVA 4FWQA 1KIKA 1IG8A 3CCST 3M5RA 1W2BM 1RT1A 5CHIA 1N9RA 1HKBA 1G2BA 1S1XA 3VUZA 3PIPA 1U6ZA 2LRQA 2ASMA 5JVGL 4CJFA 4IO9L 1KHCA 3L4IA 5CO7A 2RJFA 4ZGEB 4O4GA 1LPLA 1NEGA 4XH5A 5C25A 4MDXA 2D1KA 3PV8A 3VQBA 2FZGB 2LNVA 4N56A 4M3ZA 1LAWA 1C1AA 4BREA 1NGEA 3MX5A 1PKTA 1NLVA 4LF7K 3VYHB 1Z6RA 4FLTA 3M58A 1BI3A 3G1JA 2RHYA 3VENA 5AQRA 2PFUA 3VEWA 4CI0C 4CJWA 4R5PA 1NJIR 1LWCA 3HJFA 2AJQA 4M7DG 4E7JA 3QDKA 4CJVA 3TAGA 4GLMA 2F2WA 3V8LA 3THXB 4W5NA 3ZX2A 4FLZA 4H4OA 1OX9A 3ZEHA 2JOYA 4AH9A 2HSEB 3J8AA 2FB7A 1CSKA 4M7AF 5GADP 3SCXA 2PAVA 4GKKK 4FJ9A 4DSFA 1N8RC 2DFEA 1YJ9Q 3G10A 2DL4A 4CCHA 4X34A 1NPPA 4BB7A 3KK2A 3WNGA 5AQWA 4WCEL 4KI6A 4R0KA 3CFRA 2LCLA 1HMVA 3I8DA 1X9SA 3PTAA 1YAGA 5M1QA 4CJ5A 1TL1A 3F70A 2VC8A 4J6XA 2CP6A 4HCBA 4CI6A 4ICLA 3SUPA 3TAMA 4PUOA 1RDCA 4IG0A 4CJSA 1J53A 4A4KA 3CQ8A 1CXQA 3EO3A 5J39A 2A42A 1S72Q 2QGFB 3H6ZA 4CJ4A 4WYBA 4ANJA 4CEFA 5J2QA 1G83A 2QA4T 1ESVA 4E89A 4RKUE 4JK9A 3K9KA 4CZEA 2ESWA 4C0GA 4BVPA 1IZ6A 2VVKA 1K1ZA 2EYYA 3VF6A 3WQUA 3O9SA 2XD0A 1BUPA 1MNEA 1W2BP 4CZFA 3G25A 1T0JA 4PJLA 2QTVA 1M1KR 4PJOC 2GEMA 4XEIA 3ULEA 4NB4A 4XK8E 1WHKA 2P9IA 1M90R 3M4GA 4ELVA 2FBVA 4PJMA 1FMWA 4EMHA 4F8RA 4DR1K 1V4TA 3BEXA 2K79A 4B9VA 4DU4A 3PY8A 2DO3A 3JCMV 3CC4Q 4OMMA 2VCPA 2JLEA 3O9TA 4KFBA 4FK4A 1WNLA 4DV0K 4RTZA 2GTDA 4JKGB 4DWIA 3CQXA 4FXDA 1X75C 1IBKK 1K8KB 1BCMA 1AWXA 1QQJA 3SWNC 1Q7YR 4O5BA 4II1A 3EFOA 1I0CA 5AZIA 3TABA 1WSFA 2KGTA 1AVZC 2VV5A 4PK4A 2HHHK 1VQMA 4N41A 3OW2A 3F9MA 1RTDA 2M51A 1JL1A 1Q82C 3VETA 1EX4A 4JD2A 2D0OA 4QKUA 2HMIA 1BHLA 1K9MC 3RNJA 1QQCA 3HVTA 1NM7A 4IUUA 3DB4A 1VYUA 4RTTA 2P9KB 4HWIA 2V8IA 3MP1A 3HHTB 1NKCA 1WBDA 5AQLA 4XTZA 3I5RA 2EFIA 2E20A 2NRXA 5FPEA 3D6RA 1VQPQ 4FWLA 4JHDB 4DQSA 2JW4A 1VQ6N 3OTOK 1ZBHA 4F4KA 1K73O 2VB6A 4FW2A 3BFMA 2V26A 3CCET 4BR5A 2VASA 2HB5A 4LN2A 4NLBA 2RMOA 1Q9XA 4N0AA 5AT1B 3I56Q 4E7ZA 4BUGA 4LD0A 2DTUA 2KDSA 2BE9B 1LNXA 4JUVA 2D0AA 3EHRA 3PFSA 4BY9C 4Q0BA 3G4SA 3DLLL 2E3HA 3LWLA 3QYGB 3LAKA 3V9XA 1CZ9A 3ATVA 1QSYA 2F8TA 1S1NA 4J7FA 1M3CA 3I55A 5KYYB 4KRFA 5LJ3d 1BGXT 4MLHA 3VPZA 3NH0A 1M2OA 3VA3A 5HKCA 4IURA 2NUPA 4FCYA 2PUOB 1DLOA 4G1QA 2E6NA 3CCRN 2LVMA 5J26A 4G9ZA 1XNIA 2R5AA 2LQ8A 4C5IA 2EYWA 2OPPA 1RDBA 3JCMc 3D2FB 4EHTA 3CF5L 3QEIA 5GANh 4M78G 2A0FB 5AQNA 3GL1A 4CECA 5GAOm 3VQ5A 1WSEA 4DEXA 2RM4A 3LYIA 1B9FA 3EL2A 1KFSA 4FVMA 2ZPHB 5CR4A 5E26A 3BY7A 1VSDA 5AQXA 1UOCA 1VSHA 2OPQA 2C06A 4CZJA 3LDQA 3GPLA 1U48A 2QXLA 2OPRA 3E9PA 5M1NA 4J9DA 3BDPA 5IWAK 3PSIA 4FJKA 4M75E 3MDQA 2KSSA 2EGAA 2X3XD 1B9DA 3I33A 1Z25A 1SL2A 4RW9A 3ATUA 2YWWA 2GF7A 2IPOB 1X9MA 1XHZA 2EVRA 1WZOA 3NF7A 4M41A 2CT3A 1YJNN 2VYPA 7AT1B 3QIIA 3WNHA 1BO5O 1MGQA 1WDXA 3VQDA 4JI3K 3D7EO 3CFPA 4B9UA 3V1OA 4MZPA 2QWOA 3MEVA 2NZTA 4FT2A 3L2QA 2ITGA 4JJBA 1C0MA 3OMGA 1Q81U 3Q7CA 1UA1A 1N36K 2YDLA 3HTVA 3PO5A 2DJQA 4CK3A 4BE1A 1BKBA 2KRNA 4CJLA 2CP5A 1YJWQ 3CMAQ 4M45A 2K6DA 1Q18A 2F1LA 4H0PA 4CGJA 2JJ9A 3G7ZA 5GAMg 4M3UA 4CK1A 1REVA 1Q86U 3JCMd 3CCJQ 3CCLA 4KH1B 2F96A 5HRSA 4EZ9A 5D7UA 1YITN 2W0ZA 3CCQQ 1S72T 3CD6A 3CXCM 3QZ5B 1GLAG 4C1NK 3OB9A 1TKXA 1PSEA 2EJ9A 1UECA 3HI0A 1ATSA 1RDWX 4M75A 3SZ2A 1IBMK 2DZCA 1KG1A 4DV5K 3P4IA 2COYA 4BRAA 1JLBA 2M1HA 4CJQA 4DV4K 4B8CA 3SPZA 3D45A 4BC3A 3OJUA 2DYBA 1NWKA 5HK0A 1HNXK 3G0ZA 3VF4A 1M8MA 1JLGA 3WEEB 3JRZA 4B1YB 4E1NA 3LH0A 2V8KA 2HBMA 1BBZA 4B1ZA 1A5VA 2ZE2A 1PM3A 5GAN6 5GAN3 2KFNA 3BY5A 4HHTA 5KCOA 4LF6K 4GBQA 4KH0B 2P5GA 4LDXA 2G6FX 3KBGA 4MMLA 1SF9A 2KR3A 5A0GA 4MLEA 2ZWHA 3VS5A 5BRFA 2AKKA 1Q86O 1GCQA 2QEXN 4M75F 1L5UA 1QCFA 5GANj 4PKHA 2GNCA 1T0HA 2QWPA 3KLIA 4JK7A 1WQ7A 1BL3A 1JBMA 4UY8O 3N5BB 4A4EA 4UC4A 2UUCK 4M78C 2Q97A 3WXMB 2YNGA 2LJ0A 2FC0A 2VYTA 1T3LA 2KVQG 5I2MA 3NVMA 4BRKA 1VRTA 5JVHL 1UJ0A 3SAFA 3UA7A 2ZPGB 3CPFA 3MWTA 1C1CA 1S1WA 2OTLQ 2KYBA 2W10A 5C2FA 3L2VA 2X35A 3ZT0A 3K5LA 1HXDA 3EFSA 3HFNA 3TSUA 3TREA 3CXCP 2HBJA 4DR5K 3L42A 3HKSA 2DY4A 4XTVA 3QUIA 3NHNA 5CKEA 3MEEA 1QVGM 4OLAA 1RI9A 4PL8A 3I56T 2DLPA 3MMVA 2CREA 1B34A 1ZA1B 3ENHA 4IFEA 1KC8O 3LP3A 3U9DA 3VA0A 2YV0X 2VXFA 3JB9J 2HL3A 5IXFA 1SHGA 4BGAA 2FPEA 1VQMT 3NGYA 1VSKA 1S1VA 1YI2A 5E41A 4PL6A 4M7YA 1VSFA 5EC7A 2X6SA 4BWJA 1OV3A 1IREB 2QTXA 2L3PA 3RKWA 1N8RU 3NF8A 2OJ2A 2UU9K 5GAN8 1BU1A 1TG0A 4K11A 4KRTA 2P9IB 1D0ZA 4DV7K 3B6PA 3A8MB 4KPYA 3JAMO 2YHTA 3NVKA 4Q5WA 5HBMA 2P4TA 4WF2A 1EP4A 5TKWA 4AFZC 2K2MA 4IBNA 5I9EB 3T69A 3SQ4A 3HP6A 2FZCB 4DOVA 2EKOA 5HCKA 3CXCS 3OS5A 3O4QA 3V6DA 1KVCA 2CUDA 4BY6C 1E4GT 3H6EA 4B8AB 1YHQQ 5GMKl 3JCMW 3VU3C 1KCFA 3I9QA 3CCRA 3BZCA 3CM6A 3OA9A 2OTJN 4AG1C 4M7AG 1D4XA 5C2DA 3TTDA 3CPWA 3G4ST 4FJXA 4BRGA 1ZSZA 3UA6A 5FRNA 4PKGA 2G8WA 1SKRA 4A53A 3OYMA 3I55T 3A8LB 1G99A 1GL5A 1WHMA 4C92B 2BH1A 2FEIA 1VQ6Q 2L3SA 3WUHA 5KRTA 4FJ8A 1RBVA 4ILGB 3JB9D 1BOTO 2G8HA 4NXNK 1QVGP 2L0AA 2J6KA 2I2LA 4YOTA 3K57A 1YIJN 3M56A 4KGZB 5L23A 3CC7A 3OYLA 4K43A 3V4IA 1VQLA 3K59A 2E10A 3HFOA 3CCJT 1YJNA 4IJNA 1L3SA 4FJLA 1LCUA 2GX9A 3L2WA 1Y96A 3QLHA 4R55A 2WUSA 4WFAL 3HZ6A 2Y90A 3HO1A 3AO1A 4JDSA 1M9SA 2V1RA 2K4YA 5C0YA 3P31A 2FSJA 1NLOC 2EPDA 2LC4A 5KYWB 1X01A 2MMPA 4KHYA 4CEZA 2FL7A 5AQVA 2WSEE 5GAMf 5AQZA 3SBTA 1OH5A 2NUPB 2HAXA 4Y1CA 4B3TK 4HCCA 1Q81R 2E1YA 1TUUA 1YITA 2VUBA 1QZ6A 3C6TA 1VQ8Q 1YVUA 3VS3A 4WQ5A 3CJ7A 1AWOA 5K14A 3EG1A 3QYHB 1XQHA 3ZCMA 3EGDA 1NK8A 2A41A 4DFJA 2LT1A 4WQ4C 4C92D 4A4FA 3AVJA 2A08A 1Q86R 2FZKB 2DFHA 1N9SA 4OP0A 4PFOA 4H03B 1YF5L 3CCLT 4YDUC 3MWPA 3MPUB 2OI3A 4AHTA 4ZGJB 5KPZA 3ZBDA 1LVKA 4E2FB 2YHXA 3LDLA 1QTMA 1RAHB 2EQMA 3J81E 3L0QA 1RT7A 4Y92A 3JV3A 4JN4A 1X27A 2K9GA 2D6FA 2OAUA 1K8AR 1I39A 1VQKQ 4ORZA 1JLQA 2XDDA 1NGFA 4RCHA 3AA3A 4C8KA 4FJJA 3CPEA 2QEXA 1VHXA 1W97L 3THYA 2HBKA 5KYNA 1OVYA 3O80A 2Y4XA 5KE3A 2K3YA 4EAHD 3UF4A 1I8FA 2RA2A 1A5XA 4EIKA 1G8XA 3N4QA 4H8KA 5FLXE 3IQLA 4CHZA 4GMJB 4FPBA 3TAFA 5EVZA 5KTQA 1NJXA 3DLEA 1DTQA 5GIOA 2O8FB 4CBXA 5J2MA 1TOVA 1XOVA 5IHIA 2ZF5O 4JJDA 1NEBA 2DRKA 5FW9A 1NK9A 4JJNK 4LF8K 5HY6A 1N6QA 3ZSXA 1OEBA 1HPZA 1VQ5N 4DQ2A 3AVKA 2O31A 4M77G 1ZA2B 4DEYA 4XTUA 1RT3A 3R8EA 5BN8A 4B1WB 3JCMJ 2GCXA 5CYMA 4FZZA 5J2NA 4K8ZA 2RN8A 4FWSA 3AVLA 1TUDA 3HP9A 1VUBA 3HPWA 1K73C 2HF4A 3LDOA 4PA1A 2EJGA 3M8SA 1EKEA 1VQON 2KLAA 4BRCA 4NLCA 5HRNA 4EPCA 2FPFA 3E9OA 1HYSA 4E19A 3LGFA 1BA0A 3HL8A 1IB8A 3LGLA 3PVLA 3OYCA 4HCKA 4JI1K 4OB1B 1WIEA 4KV8A 5AQJA 3RMBA 1PCXA 3F9KA 2E6MA 5KH6A 2JZ2A 2X51A 2YRCA 4B9SA 5FROA 4RUGA 1HQEA 3AO4A 2RD1A 3IS9A 1QQNA 5JS2A 4ISFA 4RTXA 2IAJA 4FWKA 1NBEB 1W4SA 3WXJA 3HK2A 2KFZA 1OH7A 1K4US 3MJXA 3FLCO 3EKUA 1RLQC 5HK3A 1WSGA 4B9MA 1OVQA 2DEQA 1X2KA 3KZBA 2HBLA 3MN6A 4PJOB 1N8RR 1I81A 2FBTA 2L3QA 1NJIO 1BIBA 3E2UA 4XU0A 3U8XA 4A2BA 5FRMA 2D8HA 2IG0A 4UQGA 2VGMA 3HYFA 4MMKA 2EX3A 2KMTA 1N27A 2CP7A 2BGGA 2GQVA 4LF9K 1B92A 2OTJA 1M90U 3AA5X 5FPDA 1M1FA 4OJRA 5CZ2A 2O8EB 4YY3K 3RMAA 4FYVB 1TGOA 3DRRA 3NGZA 1JJ2M 4DSJA 1D3BB 3SWNB 4LSNA 2NNWA 2ZPFB 1T03A 5EG2A 4ISGA 1VIFA 3DXMA 2A37A 1EO1A 2WTUA 1QP2A 2ZJPL 1UGRB 3NCIA 1X9WA 3CCRT 3KJVA 3L2ZA 2WOMA 4HVWA 2ENMA 5KQDA 4YNQA 3BZKA 5BR8K 4XU2A 4DR6K 3ID6A 3R3LA 1XI1A 4KTQA 1YIJA 1W2BA 5LJ5g 5CIUA 2PVDB 3OYBA 3VS2A 3UDCA 2QA4Q 1VQ7A 2D4WA 1MNDA 2P9LB 4JS4A 2DK3A 3K5OA 1YNZA 4IOAL 1NGDA 2COWA 3KFVA 3IRXA 3Q7BA 4NCGA 3S3MA 4OKJA 5GAMe 4OPAA 2Q0RA 1NYGA 2IVWA 3CPWS 4FO0A 1NK7A 5GMKi 3GOIA 3A8YA 1Q9YA 1TKTA 5AZJB 1M1KO 4J9GA 5GAN7 3DLLA 1VSLA 2IS3A 3SUQA 1M90O 1JXOA 4M7DB 1VQMN 2FF3B 3EE9A 2DAQA 4PJOD 1RAAB 2LQKA 2QXFA 5MLCQ 1TSFA 2X78A 1UHCA 2GUIA 1YJNT 3DXKB 4DBQA 4EMKA 2CKKA 2QK9A 1KSPA 2PYLA 3M5AA 1NGHA 1BISA 4LDYA 1ZYQA 1M2VA 4QAGA 1YVNA 3LWMA 3MN9A 4KHQA 4OVAA 3MEDA 1NKEA 4IO8A 1ZBLA 4N0AC 4F7UE 2OAWA 3QEPA 2GBZA 1ZSZB 3V9WA 4JK8A 1K9AA 1SSHA 2P9PA 5FU7C 1GBQA 4LH5A 3TPQA 2WONA 2JXBA 3KWGA 3ZEUA 2KKZA 3VQAA 3HRSA 5M1PA 3TI0A 2UUBK 2W42A 2GGRA 5AQQA 2DD4A 4FJNA 1J5OA 5CKBA 1YITT 2QQRA 1JJ2P 3A0IX 2QQ9A 5CYQA 1SSFA 4JS5A 1U2VA 4J9IA 2V51B 3VQ9A 4U67L 1SL1A 2HBWA 4FU6A 4QW2A 3QG1A 3QIOA 2DPPB 4EMGA 3H46O 2J6FA 3C7NB 3JSMA 4J9FA 1QMCA 4XTYA 1XHXA 2MWPA 3DRSA 4JI2K 1QQMA 3T19A 5DLQE 1NMNA 1GLLO 3PLAA 3MECA 4EHUA 2DEUA 3HM9A 1IH7A 3MN5A 3CCEQ 1W1FA 4QQDA 2RPNA 1L3UA 4F3TA 1IXDA 5ECAA 4LNPA 2VKNA 3TQ7P 2HMAA 4CEOA 3D0PA 2EGCA 1S1UA 2DERA 3M8RA 1NGJA 1JLAA 2HMPA 4C8OA 1E6GA 4J9CA 2QQAA 5I2SA 1SPKA 1Z9ZA 3EG3A 1N6AA 2YHYA 2R57A 3MEAA 1Y07A 2GTJA 2GUPA 5CCAA 2JTEA 2QEXT 4LE9A 3LP0A 4M7AA 3EG9A 1OH8A 3E1YA 1DKGD 3CBMA 1RTJA 3O3HA 4DTXA 3EGDB 4CGIA 2F5KA 3O1BA 4DCHA 4MO5A 3CJBA 3EAEA 1VQ5A 1PC0A 1KC8C 4ILHA 3HT3A 4LF5K 4A61A 4KI4A 1XMOK 3AO3A 2ZCFB 4JEPA 2HOEA 4B3MK 2PNIA 1UB4A 2DYIA 1PRMC 4FSVA 1O9SA 1MMAA 3META 4B3SK 4QCLA 5E84A 3C65A 5AQIA 4DQRA 2YUQA 1WXUA 1ZBFA 2HHXA 1U06A 3L4QA 4CZHA 4V19S 4OMOA 1WSJA 4Z4HA 2G3RA 4F7UF 5IH2A 1VQOA 1CXUA 2CH5A 1Y64A 4F2SA 3AVNA 1M27C 4OX9K 1VA7A 4TSXA 1VSJA 4M75C 3X28B 2BUPA 4H5VA 4F17A 2COZA 4Z4IA 4CFAA 1I3AA 5DMRA 3U4LA 3CCLN 1HNWK 1S9EA 4DQQA 1M3AA 5KYXB 1UGSB 4BACA 3CD6N 1VSIA 2AA4A 2W40A 2KT8A 3P8DA 3LANA 4CHPA 3V9ZA 1IBLK 1UGVA 2DXUA 1NGGA 4AM7A 3O4NA 3F73A 1GCPA 3SB2A 1NOYA 5BPLA 1UHFA 1Y71A 4OLBA 2YKNA 3P83D 5LJVA 1YFNA 1AEYA 4ZHRA 3TARA 3CCUA 4CJPA 2PVGB 1ZBIA 1VQ5Q 4DTUA 3P1GA 3QO3A 2O2OA 1TS9A 2BE2A 5LJ3e 4GV3A 3AVIA 4FLYA 3MKDA 5J1EA 4M78B 4JYAK 4RW7A 3ENBA 1V4SA 3RVCA 1GCQC 2OA8A 3LZIA 1HX1A 4CZLA 3TEEA 4YOXA 3V8KA 1YTUA 1E7OA 3K2PA 5FWCA 3VGLA 3ZETA 2CS7A 2VWFA 4QVDA 4FM2A 4QS8A 3SD4A 1JLEA 2OZMA 4DS5A 5SZTA 2BDPA 3UKUB 4BROA 4BDZA 2MPXC 2E1HA 3THKA 1RCHA 3D2EA 5EY4A 2DE0X 3H41A 3VQ7A 4GVMA 3VQEA 4JI5K 1LJOA 1JEGA 2NUZA 4AT1B 2E4LA 4E7IA 2LZ6B 5AJ3K 4M77E 2KZMA 3NTKA 2OTJT 2AZSA 2RI3A 3U3YA 5M1OA 5GANd 1SEMA 3LM9A 1FMVA 5LJ5f 3GDQA 5IT9O 4FL9A 1KQSM 2GQIA 2YNFA 1PD0A 3RSEB 4C92E 3TWHA 3FR0A 2W41A 1V1CA 2XK0A 4GY2B 2DMOA 1G5VA 1ZC6A 3DMJA 1OYXA 3QXEB 2ZGZA 1TKZA 2HQXA 1RLPC 3IDHA 1YIJT 3QESA 4M3WA 2JWLA 3ENOA 4H0XB 3VGKA 1L3VA 2JM8A 3CC2N 4XAXB 4ATOA 2RQTA 3EH2A 2DM1A 3CMEA 3DOLA 5GAMh 3UKRA 2O9VA 1W2BS 1BIZA 1KD1C 2QI2A 4M78D 2R58A 4CFDA 2R7YA 3CXCA 4KO0A 3O4WA 3ULDA 3JXUA 4CW7B 2JMCA 4KUIA 4M77A 4DR4K 4BY6B 4LDWA 1YI2N 3EN9A 5FDLA 4KTZA 5BPNA 4N47A 4O0IA 3O9QA 4FJHA 4M7DC 2DKGA 2JM9A 4OKKA 3ULRB 4CC2A 1NYFA 2D0QB 4GY5A 4HT8A 3DLGA 4W5TA 4LFCK 4R56A 1IJJA 1E4FT 2P9UA 2QW9A 3FJ5A 2HCKA 4IWVA 2O8CA 3BF1A 4KBOA 1FW6A 4FJMA 2LP5A 5B8HA 2DVJA 4I2QA 2MAMA 4DV2K 3I8BA 4FIBA 4DUYK 1VQMQ 1BI4B 3GE1A 2CZ0B 2CT4A 5BRHA 5SWMA 1ZSZC 3D7SB 4BI8B 1MV3A 3AVAA 2KYMA 3K58A 4F04B 5GMKe 1HQUA 2MYSA 4M77F 3VUBA 1RAGB 3X25B 1KQSP 3QICA 1V29B 3CQYA 3H1VX 5AQOA 3HTRA 2FBYA 4B3RK 3SHWA 4RCCA 5F1XA 2HNIA 3WQTA 3OYGA 2FYKA 3RESA 1D9FA 5HOOA 4C92F 3LH5A 2DXCA 3NFCA 1P90A 3TU4K 2FSNA 1WPYA 3JSCA 3QDRB 3OYIA 1SHFA 2DF6A 4BRHA 4CJKA 2MIOA 3JAME 3A5LC 2DTIA 5D6WA 3CETA 2K57A 5F0XA 3A1PA 2KK4A 1PWTA 2D1XA 4LSLA 1U3OA 2QWRA 3SBGA 1J9AA 3THWB 3LP1A 1X43A 3AAPA 4IUPA 4AM6A 2HF3A 4FW1A 5AQUA 1VQLN 1CZAN 4AFSC 3G4SQ 4I6MB 5A0LA 4JLGA 2DXBA 4DR2K 3I55Q 3V8JA 3GIBA 2FRYA 2JNGA 3OYYA 2P9SB 1U49A 4J9HA 1QVGA 4I9QA 2XRIA 2RO0A 4Z4CA 4C8QE 2KZZA 1I5OB 3JYTA 3OYHA 4CVNE 1WHJA 5KCHA 1KLMA 2XY8A 4M42A 5GMKm 1S22A 1FMKA 1M30A 3QEVA 3X20B 1M4ZA 2KRSA 3JB9I 2YHWA 4WQ5C 4ELZC 1VQ5T 1XMQK 5KI6A 1IO2A 5GAMj 2LDMA 1NBWA 3LX7A 1JXEA 1ARKA 3SMPA 2LTOA 2E6ZA 4FWOA 3C0BA 4RTYA 1XTDA 4E1JA 1D5AA 2RE2A 1VYTA 4FWPA 3OHRA 1ACMB 3G71N 2EQJA 3CCVN 4DBHA 3CQTA 1NJIC 2E88A 3AVCA 3M3ZA 3RIRA 3MEGA 4DLGA 2Z0WA 1UWBA 2VG6A 3OQ5A 3O8MA 4A5AA 1X69A 3PIOL 1VQOT 4KAZA 1C0FA 3T1YK 1MWKA 4IUQA 4L8RB 3SMSA 1K8AU 4NO7A 1LV5A 1GLBG 3HBTA 3UATA 5KYUB 5FPNA 3AHUA 1VQ4N 2QQBA 3V9UA 1U4BA 2HNZA 3SQ0A 1NPRA 2Q3SA 2YLCA 4M7AB 1TH7A 3QNNA 1Q81O 3CERA 2P84A 4C8QA 1IKYA 2Z1HA 4CGHA 1WBBA 2NWMA 4QQ6A 4IEIA 5J2PA 1HR0K 4BRLA 1UTIA 1KFZA 2CP3A 1W70A 5CKFA 4DU3A 4LFBK 4ZTJA 1MUZA 5LJ5e 4RWTA 2L5QA 3L3VA 4MDAA 1BI1A 1NE8A 4HA8A 2EHGA 1HNIA 2VWKA 3PIPL 3MXMA 1T44A 4DTPA 4N4GA 4A57A 3MCAB 3URGA 3CCLQ 2PQWA 1VK0A 3KHYA 5KPTA 3CD6Q 2YHBA 5I22A 3FZLA 1MDUB 4B6MA 3J80O 1CLQA 2F9TA 3ZLJA 3EGXA 2DD5A 5EU7A 2HVHA 4IZ9A 3OBYA 4KHWA 2NRHA 2RNAA 3UPUA 5JS1A 3R1XA 1M3BA 4D8DA 3C6HA 4EFHA 2EYXA 4AHRA 5AQHA 5T7BA 1GOAA 4PFPA 1D1AA 1K8AO 1I94K 3LP2A 2HVIA 4C8QF 2JS0A 5BN9A 3HRGA 2DTOA 2VXEA 1AHJB 1H92A 1R0CB 2IVNA 3FC3A 2YI1A 4JI4K 3JCMQ 2LX9A 1WI7A 2BKDN 3KLEA 3KWIA 5LL6Z 3VQ4A 3ZSWA 2M0YA 2RQVA 1VQNN 3M0RA 3UT1A 1B3QA 3CC2A 4HVVA 1Q7YC 4CFBA 2UYTA 4FWRA 4NXMK 1L3TA 4C0FA 3K9JA 4B1VA 4KKOA 4PWDA 2QWNA 2NRZA 3VS6A 1JKHA 4M3RA 1O75A 4CBUA 1YN8A 3FLGA 4FT4A 3GG4A 2Z1IA 2P9NA 2EKHA 4ZTFA 1HJRA 4CIEA 3O5ZA 2HSTA 4LF4K 4A4GA 2M9UA 8ATCB 3OS1A 5AQPA 1IKWA 4CJUA 4M3TA 2K5FA 2KI7A 3RDVA 2GTOA 4QS9A 5BPMA 3QKJA 3CMET 4MZTA 4FM4B 4RW4A 3ULEB 3KK3A 2QM1A 4F14A 2HEQA 1NGAA 5CY4A 4OMLA 3PVQA 3M59A 2CZ1B 2QKKA 4BR0A 1SKSA 1T6DA 2HHUA 3BF3A 1GLJO 3EG2A 2KTQA 4BI3A 3ALYA 1YBYA 3X24B 4F7UG 1J54A 1VQ9N 1OPKA 4J8FA 4XH4A 1R77A 1N5YA 3MEUA 5DM6L 2KBTA 2CSIA 1Y0MA 1Y7XA 1R0BG 1Z9QA 3EFOB 3DM2A 5AZIB 2E5LK 4F2RA 4JI7K 4OB3B 2VG7A 4KT0E 3OSVA 1NGCA 4DQPA 4FSSA 2RF0A 3HPOA 2O01E 4CZGA 2HHWA 1KJWA 4B1UB 3CCMN 1NK0A 2M02A 2RQWA 1M5Q1 5LJ3g 2FXUA 4JD2B 3IKMA 1WHHA 5I11A 1J6ZA 1YI2Q 1YWPA 2PYJA 1RGIA 2ZPIB 4O0JA 1N8RO 3EEQA 4A54A 4I2PA 2A1SA 4DU1A 1K76A 2A6AA 4OKEA 1EQYA 3DRPA 2DL5A 2ZZDA 3HSBA 4KHPK 4JLIA 3H0FA 2L3RA 1VQ7N 3IAYA 1YTAA 5GAOp 2PZSA 3E9FA 3LLRA 1M8VA 4JJCA 1WAJA 1X2QA 2DZ9A 3R9PA 4AHCA 2HHVA 3HOTA 2A28A 3UE5A 3QBWA 1CZBA 2LCCA 1IGUA 4H5RA 2P5OA 3C4SA 1RTIA 2CZ7B 1TYQA 2J4RA 4X65K 2O8DA 3DLRA 1WLPB 4EMKC 1HK9A 2DBMA 2CH6A 1SG5A 5FU7B 2Q36A 2O8CB 3CCRQ 1Q82U 4H5WA 3J7YP 2ATCB 3M54A 2HDAA 3SUOA 1RABB 1KHIA 1K9MU 1DT9A 1RBUA 1IRXA 3NMUA 2K2VA 3N4PA 3NF9A 4F3OA 2KROA 1TUYA 4KH4A 2FRWA 2GBQA 3HPHA 1D1CA 2QWQA 5CE3A 1NJWA 2X4JA 2XG8D 3M0UA 1ZBSA 5M1FA 1YCSB 2LJ1A 5TKYA 4IIMA 5FU6C 2LNHB 3G71A 3CCVA 2ASOA 2A40A 3MHXA 1B7TA 1X3MA 1HSQA 1QHTA 3NTIA 1JXMA 4PLIA 1TUGB 1KTQA 2I7NA 3K0SA 2O4XA 3FJPA 1QVGS 4LH4A 4J5YA 3PX4A 5CQXA 5HROA 2UUAK 1MV0B 4DB3A 4BC2A 3VMFB 4PY5A 1HLUA 3EKSA 3CC7Q 4RW8A 2LT4A 4CJ7A 4FK0A 1NG2A 2B5JA 3E01A 4J7IA 3JCMg 4FOIA 2YCHA 1VQLQ 1JLFA 1D1BA 1GXIE 3CJAA 4CD1A 3VKIA 4E1MA 1YJNQ 1RDAA 1VQ4A 3EY1A 3CD6T 3DLHA 4DOWA 3SJJA 3NH2A 3ZSQA 4BE2A 1W0HA 1PKSA 1MWMA 2GWJA 4BI4A 2KW4A 3VS0A 3OYDA 4FLVA 4CBWA 3GP8A 1JJ2A 5C0MA 1ZX6A 3JB9G 4DUZK 3FGUA 2I0NA 4DTRA 1FJGK 5D6YA 3ZSRA 1ZUKA 2NRWA 3RERA 3PX0A 4OB2B 5I42A 4GVEA 1PD1A 4A4HA 2EGEA 2EW3A 3M0PA 5IHNA 1YITQ 3VGMA 3RTVA 4BR2A 1C0GA 1WN7A 2B4JA 4W5RA 1D0XA 5GIPA 2ZAEA 4M7AC 2FF6A 2P0PA 4XTWA 3UB5A 1N5ZA 2QDYB 2P0QA 4PKIA 5LJ5h 4CC7A 3CEYA 3MO8A 3QZ9B 1C6VA 4CZMA 5BREA 3M9QA 2OANA 4KHUA 4RG2A 4BR9A 1SV5A 3THXA 2FSKA 1PG5B 4H4MA 1HRHA 4X9DA 4YOUA 3E19A 3RR7A 1U47A 2ECZA 3AT1B 2DFUA 1S5JA 5HL7L 3IUCA 4M75B 8AT1B 1OOTA 3LWIA 3L8BA 4J9BA 1O13A 1VQNA 3PT9A 5LL6S 1H3ZA 4HVJA 1RBSA 1ZBJA 1LW0A 1TAQA 3RUXA 2RF2A 3GOXA 3KLFA 2XI9A 4HUGA 4BRDA 1I5LA 4BQLA 3OYEA 1AOJA 4E6RA 4C23A 4C92G 1AWJA 1YJ9N 2RHKA 1QLYA 3RMDA 1VRUA 2VWBA 2QEXQ 1PSFA 5LMNK 4OMFB 2KE9A 2CGJA 5C15A 3CC2T 4DBFA 1F21A 1YUWA 4Z4GA 1HYOA 3O6WA 5ADXA 3EGUA 5AR0A 2D0PA 2OYQA 1TL3A 3SAHA 1NK4A 2XY7A 4CGDA 4FM1A 3O1WA 3MEWA 3SLCA 4OF1A 2O9SA 2RKIA 3M4YA 2VGNA 4IDKA 3R6OA 4ID1A 1KK7A 2P1JA 3SQ2A 4E47A 1YI2T 3CCUN 2UXDK 1JU5C 3M55A 1VAZA 3AA2A 1HKGA 3QEWA 3ASMA 1WOQA 4KREA 4KULA 4PJJA 1VQ9A 5AQMA 3SQ1A 1UA0A 1J5EK 2EQKA 3LM2A 2IIMA 2WSCE 4JKGA 1MMGA 4DR3K 2CYZB 2E2QA 4JKAA 1K8KA 4P5NA 1B07A 3NTHA 1S6PA 4M75D 4FLUA 4LUEA 3PGGA 1H3HA 3B6OA 4NOYA 4DFKA 3QETA 3EH1A 2A3ZA 2J7IA 2K5LA 1IV0A 2MF2A 1H8KA 3CC4N 1WJRA 1E3MA 3CCMA 1SRMA 4L59A 2KHOA 1WXTA 4FJ5A 4K0KK 4GW6A 5LJ3f 2EBPA 1TXQA 2KQ2A 2OPSA 2P51A 3SDZA 1B34B 2F5TX 2MOXA 4N4HA 1WA7A 2FVUA 1RBTA 4QQGA 3S3NA 4JRIA 2RB6A 3FZMA 2LQWA 3DKMA 4YOYA 2KXCA 2P9KA 4AQYK 3Q1JA 1U04A 5KGWA 5LJ5j 2QWMA 3MK6A 3OVNA 4Z4EA 2H3GX 3U9ZA 2NRVA 4YHHK 4WCIA 3TANA 1YCYA 4QVCA 4JAXA 2X6NA 4JHDA 3DAWA 1WHLA 3T1AA 4M63C 1QVFM 1S6QA 4JRPA 2JS2A 4X1VA 3VQCA 2QDLA 4A62A 1OZ2A 3VESA 4E0DA 1WGSA 1SQKA 4GV9A 1UEBA 2OTJQ 2PUKB 3CC7T 4LXCA 1AZGB 3X26B 2WFBA 3REBB 1EXQA 2JUFA 1VQLT 4M77C 3VQPA 4R79A 2WACA 2YNHA 3CMEN 1ATRA 1SL0A 3I0RA 3HSCA 3ZT3A 1OZ3A 5AQKA 3CYMA 3T9NA 2DFFA 3QO9A 4OMPA 3E1SA 1Q82R 1WLJA 4EZ6A 1TWBA 3UIQA 2J05A 1JL2A 4H5TA 1NJZA 1K9MR 4C8QG 4DSEA 4ZNXA 4PFZA 4EP4A 1KD1R 3D2FA 5IT9E 3QSUA 1YIJQ 1Q81C 1VQ7Q 1A0NB 1RT6A 3VOVA 2NUTA 1ABQA 4DF8A 3JCMf 3W3DA 3UWNA 4Z88A 4BR4A 4JZ4A 4NCAA 3P39A 4X9CA 3FZFA 4KB0A 5GAOq 3G71T 1DGKN 3CCVT 1OQKA 3THVA 3SPYA 4B1XB 3KKSA 1NK5A 4BDYA 4XH1A 1HKCA 3L3UA 1Q86C 4BRPA 5GAEP 2X4XA 1TV6A 2MK5A 1YXQA 4XQ3A 3LAMA 1NK6A 3ZX0A 2E2NA 1WSIA 2NRRA 1IHVA 3VQ8A 1WJSA 1Y96B 2RQUA 1VQ4T 4XU3A 4XU1A 1XJWB 3J7ZO 4DSKA 5CKDA 1GFCA 4CF1A 1SZ2A 4M7DD
chains in the Genus database with same CATH topology
1TK5A 3ISNC 3MEEA 4DSLA 4LY7A 4OLAA 2JGUA 3RWUA 3LP3A 3VA0A 4FJMA 4FK2A 2YV0X 2BANA 4I2QA 1WSHA 1BI4B 3OY9A 3V9SA 1RT5A 5SWMA 3NGYA 1VSKA 1S1VA 2RPIA 5E41A 3AVAA 1VSFA 2X6SA 4OGCA 4BWJA 3K58A 4E3SA 3T3FA 3WNFA 1HQUA 3V81A 3NF8A 1KLNA 3ZT1A 2IC3A 4CHOA 2FBXA 1VSMA 5HLFA 3K5NA 1TK0A 1RILA 3B6PA 3TAPA 4KPYA 2FBYA 4FLWA 4PQUA 1D9FA 1ASUA 4NYNA 5HBMA 3O3GA 3OYGA 4OPJA 1EP4A 4J2DA 4FJIA 3L2UA 4IBNA 3V1QA 3SQ4A 2X74A 3HP6A 2OZSA 3O4QA 3OYIA 2G8UA 4BDPA 3KD5E 4CJKA 3V6DA 1KVCA 4B9NA 3MXIA 4CF8A 1C0UA 4B8AB 3I0SA 4CIGA 4WE1A 4OGEA 4LSLA 1KCFA 3CM6A 3LALA 1J9AA 4CEDA 3LP1A 3HXMA 4CF9A 3RRGA 3DI6A 5HP1A 4FW1A 1KFDA 2Y1JA 2ZQBA 4FJXA 5FRNA 2G8WA 4N5SA 1U49A 3AVGA 4CJEA 4AILC 3RMCA 1SKRA 4I9QA 3OYMA 2XRIA 4YFUA 4Z4CA 3NDKA 2KZZA 3JYTA 3HSTB 3OYHA 1KLMA 4M42A 2XY8A 3OS0A 5KRTA 4RW6A 2G8IA 4FJ8A 1RBVA 4KTWA 4CEQA 3QEVA 4XIUA 2G8HA 4CF0A 5KI6A 1IO2A 3K57A 1JXEA 3OYLA 3S3OA 4OPKA 1BIUA 4FM0A 3V4IA 2YHAA 1RTHA 1D5AA 3K59A 1QE1A 4CIFA 3KIOA 2HNDA 1L3SA 2XY6A 3AVCA 4FJLA 3M8PA 4CHYA 3MEGA 3L2WA 4DLGA 3QLHA 1UWBA 2VG6A 4B9LA 3ZSZA 1TK8A 3HO1A 1HYVA 3KLGA 3TR8A 3AO1A 1LAVA 4KAZA 5I3UA 3HVRA 3U3GA 4L8RB 1LV5A 4CEEA 5DK5A 3OYJA 4KHYA 4CEZA 1KVAA 3V9UA 1U4BA 2HNZA 3SQ0A 4Y1CA 2Q3SA 1T05A 4HCCA 3QNNA 1C6VX 1IKYA 4CGHA 2Z1HA 1BI4A 4NYFA 4O44A 2D5RA 4AHSA 2O4IA 3C6TA 5J2PA 3DLKA 3PX6A 1SUQA 1YVUA 3NAEA 4DU3A 4DTMA 1RT2A 3DYAA 1KRPA 2HHTA 1TVRA 2QKBA 5K14A 4ZTJA 3AVBA 1RBRA 3DOKA 3ZCMA 3RRHA 1A5WA 3L3VA 2E6LA 1NK8A 4DFJA 2EHGA 1HNIA 2O4GA 2VWKA 3MXMA 4FJ7A 3AVJA 3NF6A 4ID5A 4DTPA 1VK0A 2DFHA 3SUNA 4AHTA 1ASVA 1ZBUA 2YHBA 2HNYA 2IGIA 2NUBA 1CLQA 4CJTA 4HUFA 1W9HA 3AVFA 4Z0UA 5EU7A 3NGIA 1QTMA 2HVHA 3TAEA 1KVBA 4KHWA 1NOZA 1QSLA 1RT7A 2LSNA 3QEXA 4DQIA 5JS1A 1HNVA 4FYDA 3IG1A 4CESA 2GV9A 4AHRA 3KLHA 1U45A 5T7BA 1GOAA 1I39A 4W5QA 4JRQA 1IG9A 3LP2A 3OYNA 2HVIA 1WAFA 2I5JA 1JLQA 5HRPA 2XY5A 3AA3A 4C8KA 1FKPA 4FJJA 3KLEA 1ITGA 3C6UA 3VN5A 1C1BA 3ZSOA 3VQ4A 3ZSWA 4Z4FA 3U6FA 1TAUA 4CFBA 3AV9A 3C94A 4IFVA 1A5XA 1L3TA 3OYKA 4J2EA 1HYZA 4KKOA 4H8KA 4DTNA 3V1RA 4Q5VA 3TAQA 3QINA 4PWDA 4CHZA 4GMJB 5HRRA 1JKHA 3TAFA 4M3RA 5KTQA 1NJXA 2PY5A 4MQ3A 3DLEA 1DTQA 4DQPA 2Z1IA 1TKDA 4ZTFA 1HJRA 4CIEA 5J2MA 4DSIA 1LWFA 4E7HA 2G8KA 2XHBA 2RN2A 1NK9A 3OS1A 3MXJA 4CJUA 1IKWA 4M3TA 3KKRA 1N6QA 4ELTA 3ZSXA 1HPZA 3AVKA 4IKFA 4RW4A 3KK3A 1RT3A 4C8NA 4KHSA 1EETA 3NFAA 3AO2A 5CY4A 5CYMA 4DTOA 1RT4A 5J2NA 4FZZA 4CJRA 4DS4A 4K8ZA 3AVLA 3CM5A 4CGFA 2QKKA 1SKSA 4BE0A 3HP9A 1YT3A 4IG3A 2HHUA 4I7FA 3H08A 4HTUA 3MAQA 4PA1A 1QSSA 1IHWA 3M8SA 1BQMA 1D8YA 1EKEA 2KTQA 3QIPA 3ALYA 1C0TA 5HRNA 1J54A 1FK9A 1N5YA 1RT1A 1HYSA 4E19A 3HL8A 3OYCA 1S1XA 3DM2A 4F2RA 4KV8A 1JLCA 3RMBA 2YNIA 3F9KA 2E6MA 2VG7A 4CJFA 4FLXA 3FFIA 4CF2A 4O4GA 4B9SA 1HQEA 5FROA 3IS9A 3AO4A 5JS2A 5C25A 3HPOA 4C8LA 3PV8A 2DY4A 3VQBA 4M3ZA 2IAJA 4N56A 1LAWA 1C1AA 1D9DA 3HK2A 2HHWA 2KFZA 1NK0A 3M8QA 1IKXA 3EYZA 4FLTA 3SYZA 1WSGA 4B9MA 2G8VA 2PYJA 4O0JA 4CJWA 3A2FA 2FBTA 4R5PA 1LWCA 1MU2A 5D3GA 3HJFA 4ELUA 2AJQA 4I2PA 2A1SA 4DU1A 5FRMA 4UQGA 4E7JA 3HYFA 4CJVA 4OKEA 2EX3A 3TAGA 3DRPA 4W5NA 4FLZA 2BGGA 5C42A 2VWJA 4H4OA 3IAYA 1B92A 1QS4A 4AH9A 1YTAA 4DG1A 2PZSA 3AA5X 3SCXA 1WAJA 3OYAA 4FJ9A 4AHCA 4OJRA 5CZ2A 4DSFA 1T8EA 3G10A 2DFEA 2HHVA 3RMAA 1TGOA 1BQNA 3DRRA 3NGZA 4CCHA 1CZBA 3KK2A 4LSNA 3ZSVA 4DSJA 3WNGA 2P5OA 1RTIA 3CFRA 3CFOA 1T03A 4KI6A 3DLRA 1HMVA 1WNSA 1IKVA 3I8DA 1X9SA 4CJ5A 3NCIA 1TL1A 1X9WA 4B3OA 3SUOA 3KJVA 1S1TA 2WOMA 4HCBA 1RBUA 4ICLA 3SUPA 3TAMA 4YNQA 4PUOA 1RDCA 4IG0A 4CJSA 1J53A 3NF9A 1XI1A 4F3OA 4KTQA 3CQ8A 1CXQA 3OYBA 3HPHA 4CE9A 4CJ4A 4C8MA 4JS4A 3K5OA 4CEFA 5J2QA 4E89A 1NJWA 1GOBA 4NCGA 4OKJA 3IRXA 4DF4A 4E7KA 3S3MA 1NK7A 3L2RA 2HW3A 1QHTA 5KGXA 3RR8A 2HHQA 1KTQA 2ATQA 3PX4A 4LH4A 4BWMA 5HROA 1TKTA 3SNNA 1Q9YA 4PY5A 1VSLA 2IS3A 3AVMA 2VG5A 4RW8A 3SUQA 4FK0A 1Z26A 2B5JA 3E01A 4DFPA 2FBVA 4IFYA 2B6AA 4ELVA 3NE6A 4FJGA 1JLFA 4E1MA 2QXFA 4CEBA 3VQQA 4F8RA 1RDAA 2X78A 4CHNA 3PO4A 1Y97A 3EY1A 2GUIA 4B9VA 4DU4A 3DLHA 3PY8A 3O3FA 2QK9A 2JLEA 1KSPA 4KFBA 3NH2A 3SJJA 2PYLA 4FK4A 1BISA 3ZSQA 4BE2A 4DWIA 1W0HA 4FXDA 1ZYQA 4QAGA 3LWMA 1BCMA 4O5BA 2KW4A 4KHQA 3MEDA 1LW2A 3OYDA 4FLVA 1NKEA 1ZBLA 3QEPA 2GBZA 4B08A 3V9WA 4DTRA 3TABA 1WSFA 3ZSRA 4LH5A 3AA4A 2WONA 3VQAA 4N41A 3PX0A 3TI0A 2W42A 5I42A 3ITHA 3LPUA 3RTVA 2IDOA 4RG8A 1JL1A 1RTDA 4FJNA 1J5OA 1EX4A 4CEAA 4M3XA 1WN7A 2IOCA 2B4JA 5C24A 4W5RA 2HMIA 1BHLA 5CYQA 4JS5A 1QQCA 3VQ9A 4KHNA 3HVTA 1SL1A 1NJYA 2G8FA 2Y1IA 1S9GA 3QIOA 4AHUA 1XC9A 3DLBA 2ZD1A 1NKCA 1C6VA 3JSMA 3SV4A 4KHUA 1QMCA 1XHXA 4DTSA 1SV5A 4I9LA 1SKWA 3DRSA 1NKBA 3T19A 4H4MA 1HRHA 5KRSA 3RR7A 1FKOA 4DQSA 3MECA 1U47A 3HM9A 1JXBA 1S5JA 1ZBHA 1IH7A 4F4KA 4FW2A 3L8BA 2HB5A 1L3UA 4F3TA 2HHSA 1Q9XA 4HVJA 4CEOA 3D0PA 1RBSA 1LW0A 1TAQA 4FZXC 4LD0A 2RF2A 2DTUA 4CK2A 1S1UA 2YKMA 2D0AA 4JLHA 3KLFA 3M8RA 4HUGA 1T7PA 4Q0BA 1JLAA 4C8OA 3OYEA 3OYFA 3LWLA 3LAKA 4J2AA 3V9XA 1CZ9A 2F8TA 1QSYA 1ASWA 3RMDA 1VRUA 3P5JA 4KRFA 1BGXT 3NH0A 4FZYA 3VA3A 3LP0A 3QERA 4FCYA 1Q8IA 1DLOA 1RTJA 4G1QA 3O3HA 3KK1A 4B9TA 4DTXA 4CGIA 4CGGA 1F21A 4M3YA 1G15A 4Y1DA 2D0BA 4Z4GA 2OPPA 3HT3A 1RDBA 3QEIA 4KI4A 3AO3A 2OYQA 1TL3A 4CECA 1NK4A 3KD1E 2XY7A 4CGDA 4FM1A 3VQ5A 1WSEA 1B9FA 1KFSA 4QCLA 4FVMA 2RKIA 1VSDA 4IDKA 1UOCA 1RNHA 1VSHA 4DQRA 1ZBFA 2HHXA 3K5MA 2OPQA 4ID1A 2P1JA 1WSJA 1U48A 4Z4HA 2OPRA 3SQ2A 3EZ5A 3QEWA 3AA2A 1CXUA 3BDPA 4F2SA 3ASMA 4FJKA 3AVNA 4KREA 1SL2A 1B9DA 1K6YA 1Z25A 4MFBA 3SQ1A 2Z1JA 2XO7A 4RW9A 4TSXA 1VSJA 3ZT4A 1UA0A 1X9MA 4CERA 4Z4IA 4CFAA 1I3AA 5DMRA 3NF7A 1XHZA 4M41A 1S6PA 1S9EA 4DQQA 4FLUA 4E7LA 4BACA 3B6OA 3LPTA 4DFKA 3QETA 4KB1A 3WNHA 1VSIA 3VQDA 3V9ZA 3LANA 4CHPA 3CFPA 3V1OA 4B9UA 3O4NA 3F73A 3L2QA 2ITGA 4DFMA 4FJ5A 4GW6A 1C0MA 1GOCA 3AVHA 1UA1A 1NOYA 2KQ2A 3PO5A 2OPSA 2P51A 4OLBA 2YKNA 3AO5A 3P83D 4ZHRA 1RDDA 4CK3A 4BE1A 4CJPA 3TARA 1ZBIA 4DTUA 4CJLA 4CJ3A 3P1GA 2BE2A 3NBPA 4M45A 3ZT2A 1RBTA 3AVIA 3NHGA 4FLYA 3SV3A 3S9HA 4CGJA 3S3NA 4QOZB 4W5OA 4M3UA 4CK1A 1UAXA 1VSEA 1REVA 1U04A 5J1EA 5KGWA 1R0AA 2F96A 4Z4EA 5HRSA 3OVNA 4RW7A 5D7UA 4EZ9A 2OA8A 4CFCA 3LZIA 3TANA 1YTUA 2X6NA 2ETJA 4HUEA 1TKXA 3K2PA 1LWEA 4FM2A 3T1AA 1JLEA 3C95A 2OZMA 4DS5A 5SZTA 5CZ1A 3ZSYA 3SZ2A 2BDPA 3VQ7A 1S6QA 4JRPA 3VQCA 1RCHA 3PUFA 4BDZA 4GVMA 4E0DA 3VQEA 1DTTA 1JLBA 2D0CA 4CJQA 1BCOA 2E4LA 4B8CA 4E7IA 3SPZA 2KZMA 3D45A 3OJUA 1EXQA 4DMNA 4O55A 4N76A 3G0ZA 4E1NA 1JLGA 1O1WA 2YNHA 3VQPA 3U3YA 1XWLA 3LZJA 1SL0A 3KTQA 3I0RA 3ZT3A 3CYMA 1A5VA 2ZE2A 2KFNA 2DFFA 4HHTA 2YNFA 3QO9A 3TWHA 3OS2A 2P5GA 1WLJA 3CG7A 4EZ6A 2Z1GA 2A1RA 3UIQA 1JL2A 4DTJA 1NJZA 1FXXA 4DSEA 3DMJA 4EP4A 1TKZA 3NH1A 3BGRA 4K8XA 3LDSA 1RT6A 1X1PA 3QESA 3SI6A 1L5UA 4M3WA 4DF8A 1L3VA 3KLIA 4CHQA 1BL3A 4NCAA 4OVLA 4EP5A 4KB0A 3DOLA 3THVA 1BIZA 2YNGA 3SPYA 2FC0A 3KKSA 1NK5A 3VQ6A 4BDYA 3L3UA 1VRTA 4CFDA 2R7YA 4KO0A 4J2BA 1TV6A 3OJSA 3ULDA 3LAMA 3WNEA 1C1CA 1NK6A 4NCBA 1S1WA 1WSIA 1IHVA 3QNOA 3VQ8A 5FDLA 4KTZA 4FJHA 4N47A 4O0IA 3ZT0A 3L2VA 3K5LA 4DLEA 4DSKA 2F8SA