4FW1A

Crystal structure of two-domain rsv integrase covalently linked with dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
210
Chain Sequence
PRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGRPKAIKTDNGDAFTSKSTREWLARWGIAHTTGAMVCRANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHKERGENTKTPIQKHWRPTVLTEGPPVKIRIETGEWEKGWNVLVWGRGYAAVKNRDTDKVIWVPSRKVKPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A possible role for the asymmetric C-terminal domain dimer of Rous sarcoma virus integrase in viral DNA binding.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
molecule keywords Integrase
total genus 71
structure length 210
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 4fw1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4fw1A01
3P1GA 4HCCA 4E1NA 2BANA 3WNEA 2OZMA 4DSIA 2G8WA 1YTUA 1U4BA 3PUFA 3V6DA 2VG5A 3LP2A 4HUEA 3SYZA 1TKTA 3TI0A 4J2DA 4DMNA 1GOAA 1REVA 1C1CA 4CJ4A 1NK7A 1RCHA 3V1QA 3EY1A 1YTAA 4I7FA 4BE1A 1KCFA 3KKRA 4IG0A 4M41A 4ZTFA 1QS4A 5J2PA 1KFSA 5HRRA 2KFNA 3DI6A 1W9HA 3MXJA 1WAJA 3M8QA 4M3RA 4AH9A 2KZZA 4O0IA 5C24A 1SV5A 1R0AA 2KTQA 3RMCA 4DFMA 1D8YA 4C8KA 4CERA 2HHUA 1S1UA 3AVKA 4O5BA 3ZSWA 5CZ2A 1WNSA 3OYIA 3QIPA 1X9WA 5J1EA 1QSLA 3F73A 3AO1A 3UIQA 3L8BA 4UQGA 3HPGA 4MQ3A 2XHBA 3OYJA 5KRSA 2XY8A 1B92A 1RT4A 3K5MA 4FZYA 1C0MA 3ASMA 3ZSRA 4M3YA 1VSEA 3DRSA 1BQMA 4BE0A 4DTNA 4KKOA 3AVFA 4RW6A 3IAYA 4B9NA 3F9KA 2PZSA 1JLBA 3VQPA 3LZIA 4M45A 1NJYA 3ULDA 2RF2A 1L3VA 4JRQA 4J2EA 3WNGA 3G0ZA 4IFVA 3HSTB 5CYMA 1YT3A 2FBYA 3CFOA 4E7JA 3KLHA 3M8RA 1QE1A 3SCXA 2HHWA 2ITGA 2GBZA 3B6OA 1Q9XA 2HMIA 4PQUA 4C8OA 1ITGA 4B9UA 3V9WA 3NH2A 4DF8A 3PV8A 4NYNA 4W5TA 4W5RA 5EU7A 1NKEA 1S6QA 1XWLA 4CIEA 1BIZA 4CEOA 4QOZB 2FBTA 4FW1A 3OYAA 1JLGA 3K5OA 3LPUA 3LZJA 4RW9A 4ELUA 2KQ2A 1ASWA 1DTQA 3NF6A 4R5PA 3OJSA 3KJVA 3QEXA 4CJSA 2OPRA 2X74A 1ZBUA 4OGCA 3HJFA 1KRPA 3DYAA 2OPPA 2YNGA 3U6FA 2G8FA 4M3UA 3BDPA 2Z1GA 3G10A 3MEDA 4IG3A 4DQIA 4FJXA 3ALYA 3DLKA 3SPZA 4CEFA 1TAUA 3HL8A 4KRFA 1L3TA 1J5OA 4CF0A 1LW2A 4KAZA 1RBRA 4KREA 1IKYA 3EZ5A 4E7HA 4Z4FA 3SJJA 3AVGA 4CJUA 3LDSA 4EZ9A 3AO5A 3V9XA 1KVCA 3LALA 1RBTA 4FLXA 2X6NA 3AA5X 1SKSA 1BISA 4BDPA 1C0TA 4B9VA 2KZMA 1CZ9A 3DLGA 4B8AB 1RDBA 4KHYA 1VRUA 2HHXA 3HVRA 4W5NA 4B9LA 4CEAA 5C42A 4FM0A 4DSKA 2YNFA 4DQPA 1C6VX 2IOCA 3VA0A 3U3GA 1A5VA 4B9MA 2XY7A 3MXIA 1CZBA 4NCGA 3ZT0A 3ZSQA 1RT6A 4C8LA 5I42A 4M3XA 3HVTA 3MXMA 1T8EA 2YNHA 1S9GA 1QMCA 4E7KA 2BGGA 3CYMA 2QXFA 1HNIA 5CY4A 3KTQA 1RILA 2P5OA 3H08A 3ZT2A 5HRPA 3O3FA 3HP6A 3K5NA 3KIOA 4G1QA 3ZSOA 3NGYA 3QEVA 2DFFA 1VRTA 4CF1A 5DK5A 3AVBA 1WN7A 4CJKA 3HT3A 1KFDA 3L2UA 3K59A 4QAGA 3RR8A 3QEWA 4B9TA 3QNOA 3S9HA 3O4QA 1XHXA 1T03A 3OYDA 1KLNA 1UWBA 1WSEA 2OPQA 3SPYA 4C8MA 2YNIA 1CLQA 5HROA 1HNVA 1B9DA 4CK2A 4E0DA 4E7LA 3SQ1A 2A1RA 2HNDA 1TKXA 3V9ZA 3AVNA 3QNNA 3THVA 2HHTA 3ITHA 3D45A 3LAKA 1U45A 4RW4A 1RTJA 4F4KA 3AVIA 1WSIA 2P5GA 1I3AA 4KV8A 3VQEA 4FLWA 4DTSA 4B9SA 4CFDA 2D0BA 4Z4CA 3NE6A 1S1VA 3L3VA 1BHLA 4CF9A 2G8HA 4FJIA 4OJRA 4FK4A 3OYCA 4IDKA 4OLAA 1SUQA 3VQ5A 1G15A 4AHVA 4CIGA 1BL3A 1CXUA 3OYMA 3JYTA 4CJVA 1C1BA 3K58A 2B6AA 4FLYA 2XY5A 4NCBA 2P1JA 2OA8A 3DMJA 4FJ8A 4CHPA 3HPHA 3DLEA 3LANA 1EP4A 1I39A 4HHTA 3TANA 5JS1A 3MEGA 4HUGA 3A2FA 2FC0A 3O3GA 4B3OA 4W5OA 2IC3A 3KK1A 1NK9A 1JKHA 4QCLA 4FJJA 3PO5A 1ZBIA 1QHTA 1QQCA 3AA4A 3NFAA 4IFYA 3HM9A 1NK4A 1RT5A 4FVMA 1HJRA 4I9LA 4BWJA 3SV3A 4CHQA 1XI1A 1BIUA 1WAFA 4B8CA 1LWEA 3DLHA 1BQNA 3VQCA 1IKWA 3NHGA 3L2RA 2OPSA 4DWIA 3QINA 2HHVA 1KVAA 1WSJA 1JLFA 1HRHA 2E6MA 3OYKA 4BDYA 4FCYA 4E3SA 3L2VA 3ZSZA 4AILC 3ZSVA 2KFZA 1D5AA 5KI6A 4CK3A 4DTOA 4I9QA 4N76A 2ATQA 1Y97A 4KI4A 1LAWA 3K2PA 2RPIA 3LPTA 3OVNA 1QSYA 3JSMA 4PY5A 2BDPA 5J2MA 2OZSA 4BDZA 3ISNC 2QKKA 1HYSA 4DLGA 2P51A 3KLFA 3TAQA 2RN2A 3KLEA 4AHRA 3AV9A 3PO4A 3LWMA 4DSLA 1WSFA 2YV0X 1HMVA 4O55A 3V1RA 1RT2A 1L3UA 3L3UA 4DSJA 3C6TA 4DG1A 3LP1A 1IHVA 4KHWA 4CGJA 3HO1A 4LSLA 4AHTA 1LW0A 1KTQA 4OKJA 4CF8A 1U47A 4FK2A 1S1XA 3ZT1A 3ZCMA 4M42A 1T05A 2R7YA 2FBXA 4IBNA 3PY8A 3CFPA 4FLUA 4MFBA 1JXBA 4O4GA 4CGHA 1TV6A 1XC9A 4RW8A 2IDOA 2X78A 3V9UA 4DQQA 4CFAA 4M3ZA 2IGIA 1TVRA 4F3TA 2DTUA 4FJ5A 3QLHA 1TGOA 1Q9YA 3KKSA 5CYQA 3V81A 1IHWA 3HYFA 3AVAA 3I0RA 3SV4A 3CM5A 1LWCA 5SWMA 4FJ9A 3AO4A 5FDLA 1X1PA 1RDCA 5J2QA 3AO2A 4DF4A 2B4JA 5FROA 2HW3A 3T3FA 3S3NA 1TL3A 1RT1A 2HB5A 4Y1CA 1JL2A 1WSGA 4EP5A 1RT7A 3OJUA 4J2BA 3SI6A 2HNZA 3OYFA 2Z1JA 3V9SA 4ELTA 2OYQA 2F96A 4DU4A 1EETA 1HQEA 1S6PA 2B5JA 3SQ2A 5I3UA 1U49A 3CM6A 3RRHA 1RDDA 5FRMA 4OVLA 1U04A 2O4GA 1NKBA 4JS4A 5J2NA 1A5WA 3NH0A 4KHNA 4ZHRA 1IKXA 1J53A 4Z0UA 2G8IA 4JS5A 1RBVA 2VG7A 3SQ4A 4LD0A 4FM1A 1Z25A 2W42A 4N56A 1SKRA 3TAMA 1NJXA 1A5XA 2I5JA 3PX0A 1CXQA 5HP1A 1NJWA 1Z26A 1JL1A 3BGRA 4KB1A 1VSFA 1BCMA 4H8KA 1RT3A 3IS9A 3VQAA 1GOCA 1L5UA 2VWKA 3SQ0A 1KSPA 3DM2A 3NAEA 4Z4GA 3TWHA 1VSHA 5E41A 5CZ1A 1NK5A 4NCAA 3SUPA 3AVCA 1QSSA 4ID5A 1FKPA 1RBUA 4CGIA 4ZTJA 1X9MA 1TK8A 3AVLA 4FJHA 1UA0A 2ZD1A 4CJQA 3O3HA 4FW2A 1ZYQA 1D9FA 2HVHA 1RTIA 1C1AA 3OYBA 4CHNA 4AHUA 2NUBA 4CJLA 3NF9A 3KK3A 3SUNA 1JXEA 3K57A 3VA3A 5SZTA 4CIFA 4CEEA 4Q5VA 4IKFA 2Y1IA 2EHGA 1K6YA 4LH5A 1L3SA 2IAJA 3IRXA 4JLHA 4Z4HA 3I8DA 1N6QA 2E6LA 1NK6A 1YVUA 5HRSA 1KVBA 3ZSYA 1TK0A 3DLRA 4YNQA 3RTVA 3KK2A 2G8KA 1LAVA 4FM2A 3QEPA 4KTWA 3NCIA 4BE2A 3WNHA 3DRRA 4I2QA 1NKCA 2DFHA 4CCHA 1RTDA 3NDKA 2WOMA 3QERA 2D0CA 4CEQA 4FLTA 2KW4A 4CJPA 3LP0A 4DTUA 3ZSXA 1JLQA 3NF8A 3MECA 4FLVA 3E01A 3QIOA 4O0JA 3M8SA 3QO9A 3L2QA 4BWMA 4KHQA 3EYZA 3SNNA 1NOZA 4FXDA 1EX4A 1WSHA 3C6UA 4CEZA 1J9AA 3OYGA 3CQ8A 1NK8A 4H4MA 1ZBHA 4PWDA 3VQ7A 3RMBA 4GW6A 1J54A 4KPYA 5KTQA 3KLIA 4XIUA 1N5YA 4PUOA 4DFKA 4Z4EA 1VSKA 4LH4A 1ASUA 4CESA 4HUFA 2Y1JA 1UOCA 2PYLA 2XRIA 2WONA 3P83D 4F3OA 3ZT3A 4ELVA 1JLCA 2D0AA 4KFBA 4OPJA 4KI6A 1LWFA 4N41A 4K8ZA 3QETA 4K8XA 3T19A 3ZT4A 4OKKA 4CF2A 5HRNA 1RDAA 3IG1A 4CJFA 4I2PA 1DTTA 3U3YA 3VQDA 4YFUA 1Q8IA 2FBVA 4CJEA 1TKDA 4FJ7A 4NYFA 2QK9A 2DY4A 2GUIA 3AVHA 2RKIA 5HBMA 4M3TA 2HVIA 1VK0A 3PX6A 1TKZA 3MAQA 3HK2A 2O4IA 2XO7A 2X6SA 3KLGA 3SZ2A 3FFIA 4CJWA 5FRNA 4FYDA 1SL2A 4Y1DA 1S1WA 1BGXT 1ZBLA 1HYVA 2JGUA 2VWJA 1VSIA 3L2WA 3OS2A 4CJRA 3V1OA 4FLZA 3KD5E 2Q3SA 3VQBA 3B6PA 4FJMA 4FJNA 2LSNA 4CHYA 4L8RB 4N47A 3VN5A 3CFRA 3OYNA 3TARA 1D9DA 1BI4A 4DSFA 4N5SA 5KRTA 1XHZA 1TAQA 4Q0BA 4C8NA 1C6VA 1HQUA 2HNYA 2Z1HA 3HP9A 5DMRA 4CFCA 4CE9A 5KGXA 3RMDA 4W5QA 4DU3A 4DTXA 1C0UA 4E7IA 2G8UA 3TAPA 4WE1A 4GMJB 1MU2A 4EP4A 3HPOA 2D5RA 4DTJA 3AA3A 4JRPA 3OY9A 2HHSA 3VQQA 1DLOA 4AHCA 4CJ5A 4DTMA 2HHQA 3C94A 4DQRA 4DQSA 3VQ9A 1FKOA 4E1MA 3NGIA 1SL1A 3LP3A 4KO0A 4OKEA 2DFEA 1IKVA 3RR7A 4CK1A 3NF7A 1VSJA 4KHSA 4TSXA 3SUOA 3P5JA 4CJ3A 4CJTA 4HCBA 3DLBA 2QKBA 4RG8A 3RRGA 4F8RA 4O44A 3CG7A 3T1AA 1SL0A 1RNHA 1JLEA 3DOLA 4KTQA 1F21A 4CHOA 3C95A 5C25A 4DLEA 1ZBFA 4FJGA 4CGGA 5KGWA 2JLEA 1S9EA 3M8PA 4FZXC 3I0SA 2EX3A 1S1TA 3AA2A 1RTHA 4DFJA 3TAEA 3NGZA 1O1WA 3VQ8A 3KD1E 4HTUA 4KB0A 1UA1A 4OLBA 1BI4B 4LY7A 1IO2A 3NH1A 4DTPA 1NJZA 4CGFA 4DFPA 1NOYA 4Z4IA 4OGEA 3OYEA 4CECA 1HYZA 3LWLA 3O4NA 1U48A 3AO3A 2ZE2A 2E4LA 2ZQBA 4J2AA 4ID1A 2YKNA 2AJQA 3S3OA 1JLAA 4PA1A 2YHBA 3NBPA 4LSNA 4ICLA 4OPKA 3PX4A 2YHAA 1UAXA 5JS2A 1FK9A 3TAFA 4HVJA 1NK0A 2PY5A 2PYJA 5T7BA 4EZ6A 4KHUA 4FZZA 4KTZA 1S5JA 3OYLA 3TAGA 4AHSA 1T7PA 4M3WA 1ASVA 1BCOA 4E89A 3MEEA 2VG6A 1IG9A 4B08A 4FJLA 1WLJA 1EXQA 1EKEA 2IS3A 1GOBA 3OS0A 4DS4A 4E19A 2ETJA 1HPZA 2XY6A 2BE2A 5D3GA 3QEIA 4F2SA 2F8SA 4DTRA 3WNFA 4FJKA 4CGDA 5K14A 3TR8A 1IH7A 3D0PA 1QTMA 1KLMA 3DRPA 1TK5A 4F2RA 3HXMA 3SUQA 5D7UA 1TL1A 3QESA 4DSEA 1LV5A 4CFBA 3RMAA 2G8VA 3OS1A 4DS5A 3OYHA 3TABA 3LAMA 4H4OA 4CEBA 3VQ4A 4FK0A 3S3MA 2A1SA 1B9FA 4DU1A 3AVMA 4CHZA 1SKWA 4GVMA 2F8TA 3VQ6A 1FXXA 3K5LA 2YKMA 1VSDA 1VSMA 3AVJA 3V4IA 1W0HA 4CEDA 2Z1IA 4RW7A 4BACA 2GV9A 1RBSA 5HLFA 1X9SA 1VSLA 3RWUA 3DOKA
chains in the Genus database with same CATH superfamily
4HCCA 1VAZA 2HL3A 1RAAB 4AMCA 4EMKB 4XTZA 3VEWA 3HI0A 3EE8A 1VQ7T 3CCEQ 4DBFA 3WNEA 3CC7Q 4QQDA 2HZYA 3T1HK 2O8EA 1QWFA 4LDUA 4ZGEB 4DOWA 3CCLN 2E1ZA 2COWA 5KYNA 4B1ZA 3LH0A 4AFUC 3GP8A 1R59O 2GFUA 4OB3B 3VF4A 3EO3A 1KFSA 1F1BB 2CDTA 3ATUA 3E1SA 4HVVA 2GUPA 3WEEB 2KYBA 2NRZA 2A0FB 2J05A 2J4RA 5LJ3j 5C24A 2F5TX 4PK4A 4E7SA 2E6NA 1GLAG 1OV3A 1MV0B 3EH1A 4M78A 2NRVA 3SJHA 3OYIA 3G6EQ 4AG1C 3AVKA 5CZ2A 1X9WA 1UGQB 1U2VB 3AO1A 2K4YA 4IDHA 2MPXC 5LJ3h 1YJ9T 4UQGA 2QEXA 3ZX0A 2XY8A 1B92A 2E2NA 4BRDA 1C0MA 3ASMA 3ZSRA 2OX7A 4K0KK 1VSEA 3DXMA 1VQLA 4KKOA 3WVEB 4RW6A 4GV6A 2PZSA 4HCZA 3LZIA 5JLHA 1WA7A 1XNIA 4B9LA 1L3VA 4DBRA 1VQ9T 5J39A 3QSUA 3MPUB 3O6WA 1B7TA 4P5NA 5CYMA 4M77F 5LJWA 1Q81O 2HF4A 3THXB 1QE1A 3QICA 3LLRA 3SCXA 2HAXA 2HHWA 4WQ4A 3HFNA 3JB9F 2HMIA 4M7DD 1V1CA 5CQXA 4M78F 3V9WA 3PV8A 2VWFA 4NYNA 4W5RA 1KHCA 3TSWA 1XWLA 4H0XB 1BIZA 3BY7A 2FBTA 4FW1A 2H3EB 3K5OA 2NNWA 3U4LA 3LZJA 4RW9A 4ELUA 1RI0A 4ILGB 1MMDA 2SRCA 3NF6A 4FWPA 4M77D 2OPRA 2X74A 4U67L 2KKZA 3DYAA 3J81E 1HUXA 1E3MA 2Z1GA 2VGMA 3UF4A 4A2AA 5HY6A 4DQIA 3ALYA 1YJNA 4YOTA 2DVEA 5IHNA 3SAGA 5CVIA 4C8QC 2QAZA 4CC7A 2PTKA 1HPMA 3EZ5A 4JLIA 4WCEL 3SJJA 3QDFA 2JWLA 5GAOn 3AO5A 3V9XA 1R0CB 3L6QA 3SEMA 3EGUA 2O8CA 2W10A 3L1AA 1U1SA 2KR3A 3HRTA 4RCCA 4TVRA 5GMKe 3PSFA 4BC3A 4BRCA 5GANd 3DLGA 4DV2K 4HVUA 2GNCA 2WBNA 2Q1NA 4AG2C 3L0QA 2K5LA 4JDSA 2DYBA 4J9DA 4CEAA 1C6VX 2RHUA 2P9PB 3QYHB 4M7AC 4JYAK 1I81A 3CEYA 5C6SA 1TUDA 1RT6A 4KH0B 4JNEA 5AQYA 4IIOA 2ZJQL 1XMQK 5GMKi 1VQOT 3PVLA 3OW2A 4LDVA 3MXMA 2DILA 3EFSA 3QBWA 3I35A 3CYMA 2QXFA 1UECA 1XJWB 1H3ZA 5CY4A 2FEIA 1ATNA 2QWNA 2P5OA 2DTHA 5GAMg 3ZT2A 2OAUA 3X24B 1CKAA 4ZGJB 3KIOA 4WYBA 2HHHK 3VS2A 2DFFA 4MDAA 2LCLA 1KFDA 1W1FA 1K76A 3RR8A 3EZWA 1VQLN 4JAXA 2EVRA 1JU5C 3CCQQ 3O4QA 1XHXA 2Q0UA 1GLJO 1UWBA 3J81O 2QEXT 1T0JA 4M78D 1CLQA 4MDWA 1KQSA 1OZ2A 4CK2A 1UUEA 2DPPB 2HBJA 1N36K 3SQ1A 2XD0A 2A1RA 3EKUA 1Z9ZA 3S6WA 3G71T 1Y96B 2UXCK 1B34B 1T3SA 3AVNA 3BEXA 3THVA 3ITHA 1X6BA 1CSKA 1MUZA 1M90U 4RW4A 1M9SA 3AVIA 1YUWA 1U45A 4AFQC 1E4GT 1YIJT 2D0BA 3HRGA 2HKQB 4Z4CA 3K0SA 3CCLA 1S1VA 2QWRA 2KT8A 2CP3A 2G8HA 2CP7A 2GGRA 3OYCA 3DAWA 3IQLA 4J83A 4RTTA 4A5BA 2XY5A 3K58A 4IO9L 1RAEB 4LDXA 1ZBSA 1IO6A 4YDUC 4CJVA 3CJBA 3JYTA 2P1JA 3WXLA 3RKWA 2OA8A 2LTOA 3DMJA 3LANA 1BUPA 4HHTA 2DAQA 2BH1A 3HM8A 2NRHA 4B3OA 2KHOA 4W5OA 2EQMA 4DB3A 1SQKA 4QCLA 3QZ9B 3PO5A 1VQ8N 2EW3A 1KAZA 1QHTA 4CD1A 4JEPA 1BI2A 3HM9A 4LD6A 1RT5A 1Z05A 4PJOB 4ORZA 4FVMA 4BWJA 1BI3A 3LGLA 4J9BA 2QA4T 2MWOA 4HA8A 3SV3A 3A8GB 1IBKK 3VQCA 4F9OA 4DWIA 3L2RA 1M5Q1 3F70A 2HHVA 2B86A 1R77A 2KLAA 4E3SA 3RSEB 1PM3A 5F2RA 3VYHB 2KMTA 4GY5A 2YLCA 1CZAN 1M1KO 4CK3A 1AT1B 4N76A 2JWKA 3I5SA 3OVNA 2DK3A 3VF2A 1I0CA 2KROA 1M1GA 1FMWA 1T3LA 2F1LA 3O8VA 3TPQA 1BU6O 4EAHD 4DLGA 4LN2A 2QKKA 3TAQA 3OYYA 3KLEA 3AV9A 3VTHA 1K9AA 3MEVA 3GOIA 3R9PA 1NJIR 4DSLA 1UEBA 2YV0X 2I0NA 2ROLA 1HMVA 2P9LB 3LDOA 4AQYK 1RT2A 3L3UA 4DSJA 3V7CA 4KHWA 3HO1A 3MCAB 3PSIA 4C0ZA 1DKGD 2Q0RA 4FK2A 3TTDA 1UGVA 1JCFA 2Q31A 3ZT1A 3ZCMA 1T05A 3KWGA 4IBNA 3PY8A 4ISGA 4FLUA 2DL3A 1JXBA 4JHDA 1TV6A 3VF6A 4CGHA 5HK0A 2VUBA 1JJ2P 1G3WA 2VYTA 2RA2A 1ATRA 3CI5A 4FWQA 3CPWM 3V9UA 2E6ZA 3QIIA 3FZLA 1FWZA 4R56A 3CF5L 1RADB 5HK3A 4KGVB 4PJOA 3AHUA 3HYFA 1LWCA 5A2QO 5SWMA 3MP8A 4X34A 2RMOA 3E9LA 2B4JA 5FROA 4NB4A 3LW5E 1OVQA 4A63B 1JL2A 3D2EA 1TYQB 3SI6A 3OYFA 1HQEA 3SQ2A 1WHHA 5I3UA 1U49A 3VYGA 3CM6A 1K9MU 5FRMA 1U04A 2A40A 5KPRA 3CCLT 3D2FB 3E2UA 1VQNQ 3VS3A 3PLAA 4FU6A 3OBWA 4BRPA 1Z25A 3UT1A 4M75A 4FM1A 5TKWA 1SKRA 5AZIB 4JI3K 1RAHB 1YXQA 2C0IA 3BGRA 4M7AB 4FSVA 1RT3A 1X9JA 3VQAA 4Z4GA 3THKA 1VQ5T 2YHXA 1VSHA 2JS2A 2P9SB 2IVOA 4NXNK 1B34A 4BY6B 3CCSQ 4ZTJA 4CGIA 4GY2B 2LC4A 1NLPC 3UWNA 3O3HA 1RTIA 5IT9E 2ECZA 2NUBA 2QASA 1D0XA 4LUEA 3PMTA 3SUNA 3CBPA 5KYWB 4J9GA 4B1XB 4CIFA 4CEEA 2NUTA 1JCEA 4LH5A 1ABQA 1L3SA 4WCIA 1SS6A 3BDLA 3QG1A 3SHWA 4Z89A 1OQKA 1TS9A 1TK0A 5CKHA 4XH4A 1IB8A 4BI4A 3ZYYX 1GCQA 5CKFA 2XI9A 1Q7YC 3KK2A 2ASPA 5GAMj 1LAVA 2EQKA 2VQFK 3OW2M 2I7PA 3VS1A 1NGHA 4KTWA 3NCIA 3QEPA 2DYIA 4I2QA 5KYYA 4CCHA 1RTDA 1H92A 2RQTA 2KW4A 3BFMA 1KJWA 4DR7K 5AQWA 2AIRB 3EGXB 2YLBA 2ED1A 3NF8A 4FPAA 4VUBA 2WACA 3QO9A 4O0JA 5AQTA 4BWMA 1VQ7Q 3CCET 3KWIA 1VQMN 4A53A 3A8OB 1DT9A 1WSHA 4PWDA 3CPWP 1NK8A 3PMIA 1ZBHA 3X20B 5FLXE 5IHIA 1KIKA 1QCOA 4B3SK 4KPYA 4XIUA 4Z4EA 4CESA 1G5VA 2X51A 2IIMA 2W6LA 1BO5O 3UA6A 1N9RA 3VRZA 3FZHA 4KFBA 4DR3K 4KI6A 3M54A 1LWFA 2FRWA 1I94K 4K8XA 4EDUA 4IJNA 5AR0A 4BY9C 3CCMT 3H0HA 2DD4A 1RDAA 3VPZA 3ER0A 3G6ET 3OW2S 2QK9A 1Q8IA 1NMNA 4FJ7A 3TREA 2DY4A 4M3TA 4ISFA 5LL6S 2ZJRL 3H6EA 5IXFA 3MAQA 3BDUA 2CS7A 4MO5A 3KLGA 5LJ5h 4Y1DA 2L8DA 3JS6A 2FPFA 1ZBLA 1NJIO 2JGUA 1KFZA 2VWJA 3OS2A 3V1OA 3KD5E 2VYPA 2FZCB 2HBMA 4PHTX 2WSEE 3CCEA 5KYUB 4IO8A 1VQ9Q 2YUOA 1KK7A 2E1HA 4M75G 1MDUB 4EHUA 3CFRA 3OYNA 1D9DA 3RESA 4F7UE 1SZ2A 1XHZA 2RK1A 1TAQA 1EZZB 1U6ZA 2CYZB 1N9SA 1C6VA 2Z1HA 4FT4A 5EXWA 4CZKA 5KGXA 3O9UA 1VQKN 1MNDA 3HHTB 4LDYA 4WE1A 4GMJB 3INZA 3K9JA 4DTJA 3AA3A 4Y92A 3M57A 3OY9A 4JRPA 5TKYA 1DLOA 4DQ8A 4X9CA 2HHQA 3HRUA 3SLCA 4O8UA 3U8XA 4M75B 2PVGB 5EY4A 4E1MA 4V19S 3LP3A 4NLCA 4MLEA 2DXCA 2Y4XA 4J8OA 4M77A 2DL8A 4AFZC 1JJ2S 1IKVA 1UB4A 4CK1A 1I07A 3A8HB 3KZBA 3SUOA 3CC7T 2EYWA 4V2SA 3AGRA 4F17A 4CJ3A 4CJTA 4KH4A 3P39A 4NL3A 3DLBA 3PGGA 2DZ9A 3FE1A 3M6GA 3T1AA 4H0PA 1RNHA 3G4SN 1JLEA 3DOLA 3O9SA 1F21A 4KTQA 5C25A 3CCUT 1B3QA 4RTXA 3I55T 2NRRA 2YXYA 4M75D 3VJPA 1S9EA 3M8PA 2ASOA 1PKTA 3T7ZA 3CCVQ 5GIOA 2CSIA 4XU3A 2F5KA 5AYFA 1RTHA 3TAEA 3UKRB 2X4WA 3KD1E 4KB0A 1HKBA 4A61A 1YCSB 4EIKA 2LZ6B 4FPBA 2FF3B 4LY7A 1IO2A 1YJNN 4DFPA 4DBQA 1N8RU 2VKNA 4CC4B 2CH6A 2W6KA 2CP0A 1OX9A 4KGXB 2E4LA 2Y90A 3E19A 6AT1B 2FZGB 2HBWA 4C8QG 2ITMA 1Q81R 2NLUA 1BIBA 2K57A 5ELZA 4EMKA 4PA1A 2YHBA 2CUBA 4A2BA 4X65K 3GL1A 3THYA 1RGIA 4H5VA 2PU9B 1YJWN 2YHAA 5AQXA 4EZ6A 1FK9A 2D4WA 3TAFA 5IXBA 4DV3K 1YITT 1QZ5A 4RWTA 2WSFE 5T7BA 2EGEA 3CC7A 3IKMA 1NGJA 4MO4A 3A98A 4WFBL 1M90R 1NZ9A 4EFHA 3I56Q 1ZUUA 2VG6A 1C0FA 4B08A 3MK6A 4BG9A 1YJWT 3TQ7P 3F5TA 2ZM6K 2IS3A 4DS4A 4FT2A 3OS0A 4RTUA 2BIVA 4JI0K 3MP1A 3O1WA 2XY6A 1V4TA 2O8DB 2OTLT 5D3GA 1YP5A 1WQ7A 3QEIA 3EHQA 3R6MA 2F8SA 3VS4A 3WNFA 3TTCA 4FJKA 2RQUA 3QDRB 4B3RK 2CREA 3OTOK 2E3IA 4DV6K 3D0PA 4PJOC 2PAVA 1TK5A 4LXCA 4QVZA 3HXMA 4DSEA 2EGAA 1W2BS 4CFBA 3OS1A 4DEYA 2AKLA 1M1KC 5LL6Z 3VS5A 3J7AF 4CZFA 4CEBA 4A54A 1X2KA 2HDAA 2K9GA 3A5OC 4HTLA 2LQNA 2ZPFB 1SKWA 1NEBA 4GVMA 3VEVA 3K5LA 2F8TA 2XDBA 1VSDA 2HBPA 3V4IA 2NUPB 4BACA 4PKGA 3WXMB 3VKIA 3M1FA 5GAHP 1S3XA 2HCKA 3P1GA 2A08A 1UHCA 1VYVA 1YIJQ 4PJNA 5FWBA 1SRLA 1I1JA 2ZZDA 5GJWB 2CGLA 3CC7N 1U4BA 3KUFA 1JXOA 3PUFA 1BI1A 1PRLC 3LP2A 1NYGA 4Z8AA 4IOXA 4H5RA 4PLIA 4J2DA 1REVA 3THXA 1C1CA 1RDUA 4N4HA 4CJ4A 4BGAA 3V1QA 1YTAA 4I7FA 5BRFA 2ENMA 1WLPB 4LF6K 5J2PA 2KBTA 3FB9A 1SRMA 1ZSZC 3M55A 1IGUA 4OMLA 4BRQA 1SSHA 2E5LK 4AH9A 2KZZA 2PFUA 3CCJT 2KTQA 3DLLA 4DV4K 4E2FB 3RMCA 2Q36A 3OA6A 3QFPA 4CERA 2HMAA 3M0SA 5DM7R 1WNSA 1ZC6A 1WDXA 3QIPA 4II1A 4O5BA 3F73A 2XU8A 1VQOQ 3WXKA 4MQ3A 4I6MB 4B9WA 3K5MA 4FZYA 2RJDA 4FYYB 4KH6A 1KD1C 1QLYA 4MMLA 1X27A 2O8FB 2YHWA 1AEYA 3CQTA 3IAYA 5IH2A 3T1YK 1NJYA 2RF2A 4C92D 2EJGA 2DFUA 2XMFA 2FBYA 2C0OA 3L42A 5BR8K 3CCQT 3M8RA 1K9MO 3REAB 2VWBA 2QEXQ 2OCEA 3E9PA 2JZ2A 3M4YA 3CJCA 2XG8D 1WHJA 3O9TA 4F04B 4C5IA 4W5TA 2IIRA 2JN0A 4QT7A 2K6DA 1JLGA 1YITA 3TU5A 1WXUA 2DIGA 2W41A 1G3YA 1X69A 1P92A 4CC3A 3JCMh 3OJSA 2YRVA 4R5PA 2ZPBB 3KJVA 3THWB 2FPDA 5LJ5e 2R5MA 3ULEA 3HJFA 4OGCA 2HF3A 2G8FA 2YNGA 1K1ZA 1LVKA 3G10A 1QVFA 2DRKA 4IG3A 2RNAA 4Z02A 2LX7A 1TAUA 4UY8O 3HL8A 4IEEA 3HRSA 4KRFA 1KD1U 4C23A 3BY5A 3RMQA 1J5OA 1LW2A 3KK7A 3O9QA 4PJLA 3JAMO 3LDSA 1GCQC 1BDGA 4M7DC 4OB1B 3M0UA 1KVCA 3VS7A 4OB2B 4BUGA 1NE8A 4RG2A 5GMKh 1C0TA 1RAGB 2A3LA 4FWSA 3CCRT 2KZMA 5JVHL 1Q7YO 3LH5A 4K25A 2CP5A 2LT4A 5EG2A 4H0VB 4JN4A 4B8AB 1VRUA 4BR5A 2JTEA 3B8AX 2HHXA 4W5NA 4IUVA 5C42A 2IOCA 2RHXA 3VA0A 5GANj 1A5VA 3MDQA 4YTLA 4RTVA 3I56A 3CXCS 1XUPO 1VQ4T 3CCLQ 3TSZA 2M51A 3ZT0A 3EHRA 2RQVA 3ZSQA 2P9IB 2KSSA 1K9MR 3HVTA 4JKEA 1S9GA 3M4GA 4E7KA 3DWLA 5M1FA 1HNIA 3CCMA 4YDUA 3KTQA 3E9GA 5FLXO 5HRPA 2E10A 2F2XA 3PTAA 1D1BA 2IVNA 1WX6A 5AT1B 4F7UB 1Y64A 2JUFA 5DK5A 3AVBA 2GQVA 3EKSA 1NG2A 1QVGS 3QZ5B 4B9TA 1DEJA 5CR2A 1TUGB 3OYDA 4OMNA 2EQUA 3MCPA 2YDLA 1WSEA 2OPQA 4O8KA 4FVUA 5HROA 4D8KA 4C92F 1B9DA 2HQEA 4PJOG 3RKXA 3EL2A 4JKFA 3V9ZA 1PSFA 4B3TK 3AAQA 3A0IX 3QNNA 1QQNA 3CMET 1QZ6A 3D45A 1RTJA 4F4KA 1WSIA 3KFVA 1QKXA 1K8AO 5I21A 3O9RA 4KV8A 4FLWA 4DTSA 3M0QA 4B9SA 2KK4A 4C92B 5AQNA 2YT6A 1IV0A 3L3VA 2JJ9A 4IZ9A 3VUBA 4OJRA 4OLAA 1SUQA 1G15A 3CMEN 2RK2A 4K11A 1BL3A 1CXUA 4BGBA 4FLYA 2F2VA 3TTFA 4NCBA 1MNEA 2G6FX 3CPWS 1VQNA 3CCQN 1EP4A 2J06A 2RO0A 1K0SA 4M77B 3RERA 3VGMA 4HUGA 2HSEB 1W97L 2QEXN 2FC0A 4PJOE 3O3GA 3KK1A 2CSQA 2IC3A 4ZGDB 1JKHA 2P9KB 1VQLT 4M7AA 2EYYA 1YVNA 3AA4A 3NFAA 2DEQA 1DJ7B 1M3CA 4M78B 3RUXA 3C7NA 3CJ7A 1BIUA 3UE5A 4IOCL 2F9TA 3NHGA 2OPSA 2ZF5O 4A4GA 2L3QA 1KVAA 1WSJA 4FWMA 2DMOA 3CXCA 1AVZC 4PNOA 5KCOA 3OYKA 1Q82C 2E6MA 4OMMA 3L2VA 1XTDA 4H0TB 3CCMQ 3URGA 3PIPA 3IUCA 4OF1A 5KI6A 3I55N 1OU8A 1NLOC 1UJ0A 2DVJA 1Y97A 3VGLA 2YRCA 1J6ZA 3J8AA 3OMCA 4ZN1A 1X3NA 1MMAA 3D7SB 4JKHA 5AQHA 1HYSA 2NRWA 5ADXA 2ZGZA 1EWRA 3DJCA 1TG0A 4MMKA 3MEWA 1ZUYA 4C8QA 2DO3A 5BR9A 5AQPA 4O55A 1QVGA 2Q2RA 3WQUA 2VVKA 3CETA 1G2BA 3P8BB 1OU9A 1ATSA 2RB6A 1KTQA 2OI3A 4CF8A 2X4XA 3MN5A 2YUPA 2KE9A 4AT1B 2UYTA 3SMSA 2ASMA 4BVOA 3CFPA 4FIBA 3FR0A 2CGJA 4MFBA 2O8CB 1HYOA 1VQPT 4JKBA 1A0NB 3ENOA 2PUKB 3EG3A 3EG9A 2X78A 1Q86U 3CJ1A 4DQQA 4M3ZA 2IGIA 2D0NA 1TSFA 1TVRA 4F3TA 4R0KA 1VQMA 2QXLA 2E64A 3P38A 3C7NB 4FSXA 3V81A 1JXMA 3JCMe 3AVAA 5GAN4 3CM5A 3ENHA 4D8DA 4FJ9A 2F9WA 5FDLA 1X1PA 1IXDA 2LQ8A 5IN1A 3F9MA 2AP1A 4ZNXA 5GAN6 5GMKj 3THYB 2HW3A 3S3NA 1TL3A 3BZKA 1RT1A 2HB5A 1G3TA 1WSGA 2H8HA 3CQYA 2RQRA 9ATCB 3QMLA 1N8RC 4EP5A 3OJUA 1ZA1B 3EGXA 2HNZA 1U8RA 2Z1JA 2BTTA 4DU4A 3CJAA 4LFCK 4M75E 1N33K 2NZTA 1MWMA 1HNWK 1Q81C 2VGNA 2W0ZA 1RDDA 2KDSA 4ESRA 3E9OA 4OVLA 3JCMJ 5B8HA 5GADP 2O4GA 4X64K 2RF0A 5FU7B 4IUPA 1YHQT 5J2NA 2QG9B 2PZ1A 3J7YP 1NKBA 1J53A 3HBTA 3UDCA 3A8MB 1RBVA 2VG7A 3C65A 4B9XA 3ZLJA 2RHYA 4LD0A 1E7OA 5BPLA 4N56A 2DL4A 1EFNA 2KYMA 2KT1A 2MYSA 4LUDA 1A5XA 2I5JA 4H8KA 1BCMA 2LJ3A 3IS9A 1L5UA 1YJ9N 3M56A 1UGRB 1GLBG 3HOTA 4LF5K 3J80O 2RN8A 1VQOA 3AT1B 1VQ7A 2QA4A 1QSSA 4ID5A 3R8EA 2ATCB 1RBUA 4BRAA 1EWQA 4FJHA 4L5GA 2RJEA 1UA0A 4KBOA 8AT1B 5EOYA 4FW2A 1ZYQA 1NPRA 1C1AA 3GNGA 5J26A 3JCMQ 5GANg 3KK3A 4A4KA 2O88A 4NO7A 3K57A 3CC4Q 3CC2N 2DF6A 4Q5VA 1W4SA 2Y1IA 1OKJA 2D1KA 3IRXA 4XH5A 3UA7A 3P8HA 2XHCA 1FX7A 3ZSYA 3DLRA 2UUAK 2P9NA 2EKHA 3OB9A 4CBUA 4FM2A 3CC4A 3DKMA 3UPUA 3CMAA 3G71A 3LDQA 4FYXB 2DFHA 2QWMA 2IPOB 4HXJA 2CGKA 2P9PA 2E4HA 3GPLA 4OMFB 3BF3A 4CEQA 4FLTA 4DTUA 2K79A 2F69A 1JLQA 2YRDA 3MECA 2CUDA 5GAOq 3CCUQ 3V7SA 3D2EB 4C0DB 3E01A 3L2QA 1AZGB 4C0GA 1WQWA 3FC3A 2Y4YA 1W2BP 1G3SA 3PT9A 1K8KA 4JK8A 3EYZA 4KHQA 1NOZA 4FXDA 3CCVT 3G4SA 4CEZA 3A1PA 2QA4N 3TVTA 1R8OB 4H4MA 5KYXA 1Q86O 3VQ7A 5H1SQ 3M5RA 3VUZA 5KPZA 3L2ZA 1GBRA 1XQHA 5KTQA 1VSKA 4LH4A 2K3BA 1UOCA 3P83D 2QWLA 4F3OA 1JLCA 2M9UA 2LCCA 1GL5A 2V1QA 4JJNK 3QETA 4K8ZA 3T19A 1QP3A 3CC2T 1K73R 4OKKA 4HT9A 1QVFM 4CJFA 3ZEUA 4I2PA 1DTTA 1U1TA 4OPAA 4JI4K 3VQDA 3U3YA 2FBVA 4CJEA 4NYFA 2YWWA 3CCSA 2GUIA 2E12A 1RI9A 1PWTA 2X4YA 1PD1A 4D6WA 1VA7A 3NFCA 2O4IA 4XTWA 4NL2A 1AWWA 2X6SA 4FYDA 3I56T 1I5OB 1Q86R 1MMNA 4BI3A 1BGXT 4LF8K 5CQYA 1GFCA 4YHHK 1VSIA 4XU2A 5LJ3d 5GAMf 5GAOm 1M27C 2RJCA 3L2WA 4PJJA 1M8VA 4X9DA 4FLZA 2L5QA 2OTLQ 4HVWA 4FJMA 4FJNA 2LSNA 2B8AA 4OB0B 4O5FA 3GBQA 4HT8A 4N47A 5KE3A 3JCMb 3EN9A 4OPHA 5JICA 4N5SA 2EIFA 5DMRA 2HNYA 3PIPL 3HP9A 1YITQ 4M7AF 2ESWA 4DCHA 4DU3A 1C0UA 4E7IA 1K0XA 3IDHA 1BBZA 3EGDA 3CERA 3KHYA 1MU2A 3HPOA 3DXKA 1YI2A 2BZXA 4AHCA 4DTMA 3NVKA 3H1QA 2DTOA 3DB3A 1FKOA 2GTJA 2M0OA 1KQ2A 3RR7A 4A4FA 3CCUA 2COZA 1VQ4A 1VSJA 2L0AA 3MWPA 3AAPA 4FOEA 3G1JA 3ATVA 4O6JA 4GLKA 5EC7A 4C8QE 3G4ST 3ZETA 2QKBA 4RTYA 3ZETB 2DL5A 1BYMA 4O44A 3CG7A 4F8RA 4H5TA 5HKCA 4KBMB 3JCMf 2QDYB 1U5SA 2DEUA 1OOTA 4CGGA 2XICA 3GDQA 1T6CA 4FZXC 2FRYA 4AM7A 2QQRA 2RI3A 1S1TA 3AA2A 1M1KU 4DFJA 5I9EB 2LJ0A 3NVMA 3VEZA 3HSBA 3CC2A 4OLBA 1BI4B 2LRQA 3CCSN 3NH1A 1K8AC 4Z4IA 1HSQA 3OYEA 3SMPA 1HYZA 4J2AA 1UDLA 2KQWA 1VQ8T 2YHTA 3RDVA 1XQSC 2ZQBA 1QVGM 3SD4A 2R58A 5AQUA 2QQBA 4M78G 1JLAA 4BI8B 4C1NK 1UGPB 3PX4A 3CCVA 1LCKA 4FZZA 2PY5A 2AKKA 4A59A 2DERA 1TUUA 2W40A 1N5ZA 2IVWA 1RUWA 4DOVA 4DR5K 4M77E 1W6XA 3I56N 2LQWA 1QWEA 4RKUE 2EAYA 1GOBA 1WGSA 4DV1K 4IXCA 2BE2A 3PIOL 4A57A 1ZLMA 3G6EA 3ME9A 1AWJA 3M0TA 1X2QA 4F2SA 2YUNA 4N0AC 4Y91A 2RJFA 1YBYA 1S22A 3TR8A 1QTMA 5GJVB 1KLMA 3DRPA 3G71N 3QB0A 3SUQA 5D7UA 5AQVA 4XAXB 5GAN7 3QESA 1M90C 1KC8R 5FWCA 1AOJA 1PC0A 2NUZA 1V4SA 3LAMA 4H4OA 5CR4A 1Y57A 2RHZA 1SHGA 3BF1A 1Z9QA 3I9QA 2WSCE 1H1VA 3AVMA 1RDWX 3MWTA 1FXXA 2YKMA 4PKHA 4CJ7A 3AARA 1NWKA 3EE9A 4WF9L 1ZSZB 4K42A 1NK0A 1VSLA 4FYVB 3DOKA 3CMAQ 2A6AA 2DTIA 1WHGA 2EGCA 4E1NA 2ZJPL 2BANA 4L3QA 4BRKA 4DSIA 4PL7A 4M7AG 2G8WA 1PKSA 3FZFA 4MZMA 4NXMK 1D09B 2G3RA 2C0TA 2JOYA 5IAYA 1OH8A 5GANf 3V6DA 3SYZA 1ARKA 1TKTA 1E6HA 1M2VA 2FO0A 1KHIA 1E4FT 1RCHA 4BE1A 4ZTFA 2O9SA 3U23A 3CCRQ 2FF6A 3KKRA 4IG0A 4M41A 2MIOA 2QTXA 2DE0X 1Y71A 4JI8K 2RI5A 4JKCA 3MEUA 1M30A 3ZBDA 2KFNA 1PD0A 1WAJA 4M3RA 1GCPA 5KPTA 1R0AA 3JCMP 4YY3K 4QVCA 3RR6A 1BWFO 1D8YA 4HWIA 2L89A 3CBMA 4DA4A 5GAN8 3CCRN 1I5LA 2MOXA 5BRDA 5J1EA 4CI0C 3L8BA 3HPGA 3OYJA 5KRSA 2K5FA 1ZBJA 1VQKQ 5CO7A 1KXPA 3N4QA 3O1BA 4IIMA 2Q97A 4O5VA 4PL8A 4M3YA 2OTJA 3DRSA 4BE0A 4QKUA 3SWNB 3H1VX 3NMUA 3L4QA 3C6AA 2I2LA 2BE7D 3F9KA 1JLBA 2BUDA 4WFAL 1VQ9N 4B9NA 4M45A 2CZ6B 2DNUA 2L2PA 3PNWC 3ULDA 4JKDA 3WT0A 1WZOA 4JRQA 3WNGA 1VQ4Q 3VESA 3G0ZA 1TYQA 3HSTB 1YT3A 3A5LC 1WFWA 1BIAA 1HJDA 2GBZA 5LJ3e 2HSPA 1Q9XA 4C8QF 1OYXA 1X3MA 4PQUA 3MX5A 1TH7A 3H3OB 1ITGA 1WB9A 3NH2A 1I4K1 3D2FA 1Y7XA 5GIPA 4CZMA 2E5KA 1QQMA 5EU7A 1GXIE 4X62K 4CIEA 1H8KA 2QQ9A 4KGZB 4EMHA 4CEOA 3OYAA 4JUVA 4QOZB 2NUPA 4YOYA 1KQSM 1ASWA 3FFKB 3QEXA 4Q5WA 2RHKA 1ZBUA 4IFEA 5CIUA 1KRPA 2OPPA 1I8FA 3M59A 1OH5A 4KT0E 1HK9A 4CZLA 5CKBA 4FJXA 3DLKA 4DF4A 3GLXA 4ISEA 4R79A 5A0LA 4MDXA 1MA9B 3RNJA 4KREA 2QYZA 1IKYA 1JB0E 4E47A 4Z88A 2VC8A 4EZ9A 1VQLQ 4QS8A 1UJYA 1M1FA 4ATOA 1Y0MA 2ZAEA 2XIDA 1RBTA 4GKKK 3OMGA 3AA5X 3I55A 1VQPN 1CZ9A 3M9QA 4H03B 3SAHA 4KHYA 1BB9A 4IUQA 3RBBB 1JBMA 4JZ3A 1M3AA 3JXUA 1JJ2A 1WHMA 3C12A 4LNPA 5C2FA 3H9NA 2XY7A 1Y07A 1KG1A 1ZX6A 3ENBA 2LP5A 4WTOB 1CZBA 3ULRB 3LDLA 4HCKA 4MDBA 4DV0K 5I42A 3PE0A 3JV3A 1XMOK 1NG9A 1BA0A 2FB7A 4WF2A 2KXDA 3I33A 2DRMA 1M90O 1ZHIA 1RILA 3H08A 3HP6A 3O3FA 3K5NA 2E5QA 1K8AR 4G1QA 4FO0A 5GAOr 2PNIA 1ZA2B 3UKRA 3NGYA 1VRTA 3U9ZA 4CF1A 4CJKA 1WN7A 3HT3A 1QVPA 1NGIA 1JQQA 4QAGA 3QEWA 3H0FA 5CAIA 3QNOA 3ZX2A 4CD3A 1T03A 1VYTA 1KLNA 4J7FA 4HKEA 4GVEA 5AQQA 1KC8O 4C8MA 1Q82U 1XOVA 4J9FA 1HNVA 2YI1A 4E0DA 3VENA 2GEMA 3EFRA 1VQNN 3FGUA 4ZN3A 1LOJA 1AD5A 4IWVA 1QCFA 3LAKA 3EG0A 3J7AP 2P5GA 3VQEA 3ID8A 2VB6A 3SWNA 7AT1B 3PIOA 1QHAA 2L3SA 1YI2T 4C92G 4FJIA 1BHLA 1KQ1A 1XNRK 4QS9A 4RMOA 2DX1A 3OYMA 1GLCG 1C1BA 3CJ9A 4JPBW 4RCHA 5AFUA 2JMCA 1QCNA 4EMGA 4CHPA 3TANA 3DLEA 4FJ8A 3OW2P 1I39A 5JS1A 3MEGA 1VQ6N 3A2FA 4XTVA 2J6KA 1BI0A 5GAEP 1NGAA 1YCYA 4N4GA 3ZFJA 5LY3A 3MN7A 4IUUA 1ZBIA 1Y96A 2WC9A 1QQCA 2YJEA 4YORA 1S72T 5C0MA 1HJRA 2E70A 1LWEA 3DLHA 3X28B 1BQNA 3A5NC 4DV7K 5GAOp 4L6V5 1HR0K 3QINA 2ZPHB 1YF5L 4XTUA 4M7DB 4BY6C 3CCQA 3BZCA 4GV3A 3O5ZA 1HRHA 4BDYA 2QQAA 4FCYA 3VEYA 3MHXA 2BE9B 3CC2Q 1TUYA 2CZ1B 2K2MA 5A0DA 1ESVA 2KFZA 1KQSP 1WIEA 4BQZA 1FYNA 1QQOA 4DTOA 5DY9A 1K73O 4I9QA 1T0HA 2ATQA 3K2PA 2DIQA 1AWOA 2RPIA 1W2BM 1QSYA 2OTJQ 4H0YB 3JSMA 2BDPA 3TSQA 1NBEB 1YIJA 1HLUA 5J2MA 1IBMK 2OZSA 2QQSA 2MAMA 4BDZA 1G99A 3QKJA 3KLFA 1YJ9Q 4JK9A 2F7TA 2O8BA 1N32K 2LMJA 4L59A 5F0XA 1YNZA 2A37A 4XU0A 3QUIA 4F7UF 1BK2A 4OX9K 3C6TA 1IGQA 3LP1A 4MZTA 5AZJA 5LJ3f 4LSLA 1Q82O 1LW0A 5GAMh 2D0OA 1HKGA 4OKJA 1OH6A 1S1XA 3CC4N 3OHRA 3L4IA 1VQMT 3Q1JA 4PFOA 3CCEN 4GNIA 2R7YA 4C1NI 5LJ5j 4O4GA 4F7UG 1XC9A 4RW8A 2CT3A 3JRZA 3REBB 2IDOA 1VQ5N 4LFBK 2LCSA 4CI6A 1VQKA 1NNEA 5GINA 3CC4T 2O31A 2DTUA 2K2VA 1MMGA 2D1XA 3R3LA 1TXQA 3G25A 1Q9YA 2YCHA 2BUPA 1SAZA 3DB4A 2KGTA 4LD9K 3SV4A 4PJMA 2EJ9A 2O8DA 2VV5A 1OPLA 1NEGA 3R6OA 2LNHB 4IURA 1GLFO 1WYXA 4PJOF 3ZEHA 3AO2A 1WJRA 4BC5A 4FOIA 4LC9B 2CH4A 3OQ5A 4Y1CA 1K8AU 4J2BA 5L23A 1RT7A 2DA9A 2E2OA 3T9NA 3QBYA 2EQJA 5FPMA 1VQ4N 1H3HA 4CBXA 4PJOD 3V9SA 3BE3A 2OYQA 1EETA 4M77C 2EBPA 2Z0WA 2IVPA 2OTLN 3R6NA 3RRHA 3JB9J 4QQGA 4A4EA 3M5AA 2HQXA 4JS4A 2JTFA 1A5WA 2NRTA 4E7ZA 2P9NB 4FWKA 4Z0UA 4ZHRA 3KBGA 4M78C 3NH0A 4JS5A 2G8IA 3H6ZA 3MMVA 5DLQE 3JCMW 1YJWQ 3OA9A 1PRMC 2LX9A 1X6OA 5F1XA 4X66K 2D8JA 3JAME 3D6RA 2W42A 3C0BA 4DR2K 2EFIA 4JJBA 3PX0A 1CXQA 4J7IA 4B1WB 1JL1A 4KB1A 4KRTA 2HNIA 2KNBB 1KC8U 5KQ8A 1KSPA 3VS0A 3SQ0A 2DETA 5AQIA 3DM2A 3RVCA 3UB5A 3NAEA 2EYXA 3IMXA 5E41A 5CZ1A 1N8RO 3SUPA 5JLFA 1FMVA 2FZKB 2QWPA 2EPDA 2OAWA 2P4RA 2A7YA 1FKPA 4M7XA 4N4IA 1WJQA 4PFPA 1X01A 3IFRA 3Q7BA 2GTOA 3AVLA 3A5MC 4CJQA 1D9FA 1VQ6A 1D0ZA 3OYBA 2P9UA 5FPDA 4CHNA 4AHUA 5M1NA 1HNZK 3NF9A 5BRHA 2YUQA 5M1KA 3VA3A 5SZTA 4GV9A 4IKFA 3EG2A 1K6YA 3CD6N 2DZCA 2KEAA 5L8RE 4J6XA 3TCJA 4Z4HA 3I8DA 2E6LA 4RTZA 3JCMc 4RUGA 1YVUA 2HD0A 3CCUN 1KVBA 1NK6A 2ED0A 3PFSA 4YNQA 5IT9O 2QI2A 2G8KA 1N6AA 3FEOA 2JM9A 4U7BA 2L3PA 1BU1A 2JXBA 2GELA 2HL5C 2LJ1A 5ADXH 4DHYA 3DRRA 4B3MK 1NKCA 2EQIA 2E8AA 3QO3A 3DLLL 4F14A 5GAOl 3ZSXA 2ABLA 2RD1A 4E1JA 3G71Q 1YWOA 4B6MA 3SNNA 3VRYA 3C6UA 2O01E 3OYGA 3OSSC 2A5XA 4GW6A 3NMZC 5AZJB 4JI1K 1N5YA 4PUOA 2AT1B 4A5AA 5J3BA 4ELYC 2DPNA 4HUFA 3JB9I 1OPKA 2XRIA 3META 3QXEB 2GX9A 1T3VA 1IJJA 1VQ8Q 4OPJA 4XH1A 5GAMe 3VTIA 1JRIA 2J7IA 5KYYB 3LDNA 2LT1A 5HRNA 3IG1A 1Z6RA 2P0PA 3FDRA 3EG1A 1TKDA 2A28A 3O08A 1WI7A 3AVHA 5HBMA 5FPNA 3X25B 5BPNA 1OULA 3PX6A 4JRIA 2A36A 3VV0A 2DL7A 5LJ3g 3SFMA 5GAGP 3FFIA 1RLPC 1ZUKA 1SL2A 3H41A 4JI7K 1HYVA 3QYGB 3VEXA 2Q3SA 1EQYA 1IBLK 1RABB 4CHYA 4L8RB 3VN5A 3V8KA 1BI4A 5KRTA 4KH1B 4BRLA 1HQUA 2QTVA 5M1QA 4IOAL 4CFCA 3SDZA 5BN8A 4AFSC 3RMDA 2V26A 2COYA 3QJYA 1KD1O 3C6HA 2G8UA 4LFAK 2QK0A 1NJIU 2GQIA 2D5RA 4AF1A 4JZ4A 5AQRA 1D4XA 2HHSA 3VQQA 2FSNA 3MJXA 1M4ZA 5KYWA 1NGFA 1S72N 1OEBA 3C94A 4OMOA 1QVFS 5AQGA 3VEOA 2JS0A 2OANA 3K9KA 4YOVA 3QFUA 3NGIA 1PCXA 1SL1A 1N27A 5C0YA 2DFEA 2DXTA 1UGSB 5FW9A 2C06A 1YAGA 2JNGA 2X9HA 4KHSA 2VASA 3DXKB 4BR0A 4XTYA 4I6MA 4NLBA 4F16A 3NTHA 3VETA 1HKCA 1SL0A 4C5HA 3JCMd 3C95A 2VXEA 2D6FA 1WUAA 1O9SA 5KGWA 3LDPA 1QQJA 5FPEA 4KUIA 1QP2A 2X35A 4DQ2A 2WTUA 5LJ5g 3NGZA 1O1WA 3CMAT 1SG5A 4ME7A 4J6WA 5CCAA 3R1XA 5GAMd 2MI6A 3LX7A 1NJZA 4CGFA 3X26B 2QWOA 2ZPGB 4OGEA 4JJDA 1VQ9A 2HBKA 3O80A 1M2VB 1YJNT 4BRNA 1ZQ1A 4CECA 5D6YA 3O4NA 3LWLA 1U48A 1LJOA 2ZE2A 3FZKA 1W7AA 2OTJN 3LGFA 1SKUB 3OSVA 3H0IA 1NPPA 4QVDA 1K9MC 3M0PA 2E3HA 2E20A 2YKNA 4ID1A 3S3OA 3CPFA 3CQXA 4LSNA 4ICLA 4OPKA 1ABOA 2AZVA 4C8QD 1AHJB 5JS2A 3H3NO 2ZGYA 4HVJA 2PYJA 4KHUA 1SHFA 3HSCA 3OYLA 3HKSA 3F2KA 5AQSA 3MEEA 4M75C 2J6OA 1IG9A 2JM8A 4PLLA 1WLJA 1EXQA 3MEAA 2SEMA 3KVGA 2M16A 3Q7CA 4R55A 1OI1A 3TSPA 3E9FA 4E19A 1HPZA 1TWBA 2V8KA 2YSQA 4DTRA 3LYIA 1WXBA 4CGDA 5K14A 4JI2K 4LDWA 3SBGA 4JLGA 1K8KB 2L3RA 3NTKA 2XKOC 1NM7A 1KAYA 1TL1A 1HNXK 3RMAA 4DS5A 4LF9K 4YOUA 1VOMA 2KXCA 5I2SA 2O8BB 3G7ZA 1WHLA 3VQ4A 4FK0A 5FU7C 5GAN5 2YX6A 3JCMV 4DU1A 5AQJA 4CHZA 3ZL7C 1VUBA 2H3GX 2HBLA 1VSMA 3AVJA 3M58A 4RW7A 4M75F 2KAFA 2GV9A 2D9TA 1RBSA 3S41A 5JMVA 5HLFA 4C0FA 2EWNA 2AA4A 1X9SA 1O13A 3RWUA 3JCMX 1B07A 1U06A 4A4HA 2HSTA 4BQLA 2BZYA 3CD6Q 2OZMA 2P9LA 3P4IA 3QWYA 3UKUB 1YTUA 2GF7A 4BROA 5M9OA 2VG5A 4HUEA 2RE2A 1IREB 3TI0A 3GOXA 3GNFB 1GOAA 4DMNA 1NK7A 2M02A 2HQHA 3EY1A 3HFOA 4RTWA 1KCFA 3SAFA 1QS4A 2BZ8A 1RAFB 2KVQG 3E1YA 4B9QA 4MZPA 5HRRA 3DI6A 1W9HA 3MXJA 3M8QA 2EJFA 4BRGA 4O0IA 1SV5A 1N34K 4BR4A 4DFMA 4C8KA 3DXMB 4CC2A 4IJAA 1S72Q 1S1UA 3ZSWA 2HHUA 4M7DA 1NGCA 3UIQA 4JKAA 4PKCC 1MGQA 5A2QE 2XHBA 1RT4A 2DXBA 5DM7L 1JCGA 4PFZA 1BQMA 4DTNA 3FRNA 3HPWA 3AVFA 4H5WA 4PL6A 3HOSA 3NPFA 3VQPA 3FJ5A 2FSKA 4CW7B 1UTIA 5BN9A 4YOWA 1XC3A 4J2EA 4UC4A 5JVGL 4QW2A 4IFVA 2RI2A 4J6YA 3A5ZB 3CFOA 4E7JA 3KLHA 1VQPQ 3W0LA 1D1AA 3GE1A 2ITGA 3B6OA 2R57A 1ILYA 2CP6A 2CZ7B 2LDMA 4C8OA 4DR6K 4B9UA 4DF8A 3FZMA 1JJ2M 3FJPA 5AZIA 4CZGA 1NKEA 1S6QA 1Q86C 2WUSA 1PNJA 3LPUA 3CCJA 1BA1A 4BC2A 1EIFA 1X43A 2KQ2A 2ZWHA 2E65A 4ELZC 4ANJA 2O8EB 1DTQA 5AQLA 2WFBA 4DUYK 4CJSA 1WBDA 4JHDB 2NLXA 3E66A 4M3UA 4MLHA 3U6FA 1TTHB 3BDPA 4DEXA 3MEDA 1XNQK 1DGKN 1NGEA 3SPZA 4OMQA 4CEFA 4FM4B 1L3TA 5BREA 4CF0A 4BG8A 4LF4K 2A41A 4KAZA 1RBRA 1YHQQ 4E7HA 4Z4FA 2CP2A 4JI5K 3AVGA 4CJUA 3WVDB 1NU0A 1Q81U 2ZGWA 1MHNA 3LALA 2RH2A 3EFOB 4XEIA 5D6WA 1YI2Q 4FLXA 3ASKA 2X6NA 1SKSA 1BISA 4BDPA 3AGKA 4B9VA 4J9IA 1OZ3A 3CIPA 2QWQA 3QHSA 1YJWA 2KRSA 5I22A 1VQ6T 1RDBA 4DR4K 3HVRA 1TUCA 1YWPA 4DSKA 4FM0A 2YNFA 2QM1A 4DQPA 4DUZK 2H3JA 3U3GA 3I55Q 4B9MA 2DKGA 5IHKA 2A42A 5CK9A 4JI6K 2O4XB 3MXIA 1KC8C 4NCGA 2PUOB 4M7YA 1PG5B 1V29B 2FPEA 5D6XA 1VQ5A 4C8LA 4M3XA 1WBBA 3GG4A 1T8EA 2YNHA 1QMCA 2BGGA 4WQ4C 1VQON 3MN9A 2YHYA 2FYKA 4M7DF 3FLCO 4JKGB 2JVVA 3GIBA 3RIRA 5KCHA 2PVOB 5LJ5f 2FLOA 3ZSOA 4XQ3A 3QEVA 2HKNA 4AM6A 1J3TA 2P4TA 1GLEG 3L2UA 3K59A 4OO1J 3AY9A 5GAN3 4M7DG 2NRXA 2V7ZA 5LMNK 3S9HA 5AQKA 2OTJT 3SPYA 3HTVA 1KSWA 2EWSA 1NGBA 2YNIA 1WJSA 3KXTA 2VCPA 4CVNE 4E7LA 2NUTB 5LMUK 2HNDA 3CCRA 2O8FA 1TKXA 2V1RA 2IG0A 2P9KA 2HHTA 1G8XA 4B1VA 3CMAN 3N5BB 2J6FA 3CBOA 4GLMA 4M7AE 1D1CA 1I3AA 4M77G 1RACB 4CFDA 2V8IA 5C2DA 3NE6A 2P84A 5FU6C 4CF9A 1TOVA 4FK4A 4IDKA 2UXDK 3VQ5A 4BC4A 4AHVA 3EEQA 1VQMQ 1VQ7N 4CIGA 1ZXOA 5C12A 2V52B 2B6AA 1UHFA 1NYFA 2R5AA 2CT4A 2V8JA 4KULA 4CRIA 1S72A 4J9HA 3JCMg 3HPHA 4K41A 1EO1A 5MLCQ 1N8RR 1GLLO 4C92C 1E6GA 1LCUA 1BKBA 3H8ZA 1NK9A 2KRNA 3C0CA 4CZJA 2GFAA 2FL7A 1K73U 1KD1R 3O5BA 4FJJA 2UU9K 1ACMB 4PKIA 1UE9A 4IFYA 3BW1A 4JKGA 4I9LA 1NK4A 1FJGK 1XI1A 4CHQA 4XU1A 2XDDA 1NM1A 1WAFA 4B8CA 1IKWA 2FG0A 2DBMA 3M0RA 1JLFA 2HOEA 4LF7K 4C5GA 5AQFA 5AQZA 1J5EK 3ZSZA 3QJ6A 1UG1A 4AILC 4BR7A 2BKDN 1MWKA 3BUZB 3ZSVA 1D5AA 5KQDA 4C5EA 1IG8A 3EAEA 3CCJQ 4J8FA 4KI4A 1LAWA 2QGGA 3EG9B 3MP6A 3LPTA 4PY5A 3VERA 1WOQA 1P8ZA 1BOTO 2AZSA 2OJ2A 3ZEUB 1QVFP 3ISNC 3RKYA 2P51A 3I8BA 1ZSZA 2XDPA 2RN2A 3PO4A 4AHRA 3JB9D 2D0QB 3WXJA 3HZ6A 2CZ0B 3D7EO 3LWMA 2BTFA 4J9EA 1WSFA 3CCJN 1PHTA 3V1RA 1L3UA 4J9CA 4KHPK 4DG1A 2O9VA 1IHVA 4ILJA 4CGJA 1YN8A 4LE9A 3M3ZA 4AHTA 1RL2A 5CE3A 2ZPEB 1U47A 4FSSA 2PQWA 2HMPA 1X6GA 3G4SQ 1FW6A 3WXIA 1D3BB 2LNVA 1K73C 4M42A 2FBXA 2O4XA 1GRIA 1ZBXA 4EIAA 3SBTA 8ATCB 4CFAA 1IRXA 1AZEA 1Q82R 2K5IA 4FJ5A 3QLHA 1TGOA 3H45C 2RM4A 5GANh 1VYUA 3KKSA 5CYQA 3ZX3A 1WNLA 1IHWA 2LVMA 4M7DE 3I0RA 1QKWA 2JW4A 2JTMA 1JO8A 3SWNC 5KYXB 3QBXA 3AO4A 4B1YB 2PVDB 3A8LB 3LWHA 1RDCA 5M1OA 3NHNA 5J2QA 5C15A 2GCXA 2JT4A 3T3FA 4BRFA 4YOXA 3GF5A 1HXDA 1G83A 2AHJB 3WUHA 5KH6A 4ELTA 1MV3A 2F96A 1VIEA 2B5JA 1S6PA 3JSCA 4NS5A 4BRMA 1T44A 5HOOA 2GWJA 3VMFB 3JB9H 1HJOA 4NOYA 2E2PA 4KHNA 2F4VK 1IKXA 5HCKA 2QA4Q 5E26A 3QDKA 4DV5K 3SQ4A 2UUBK 2E41A 1S1NA 1GLDG 4JJCA 1W2BA 1U2VA 3TAMA 4B1UB 2DBKA 1NJXA 5HP1A 1NJWA 1SPKA 1U3OA 1Z26A 4J5YA 4KH5A 5HL7L 1VSFA 3T69A 4EMKC 1GOCA 2VWKA 4BRHA 2CKKA 5GMKl 2E88A 4Y28E 1R0BG 3TWHA 4NCAA 3QPHA 1YHQA 2FSJA 4CZEA 4H0OA 1NK5A 3FLGA 3AVCA 2MF2A 5M1PA 1X9MA 1TK8A 4M78E 3I5RA 4JD2A 4BREA 2E1YA 3MN6A 2ZD1A 3PVQA 4CZIA 3EGDB 5KYUA 1V76A 3GBTA 4XTXA 4CJLA 5AQOA 1VQ8A 4OP0A 1JXEA 4FWLA 2GWKA 4BR2A 4C92A 2EHGA 2DJZA 2IAJA 1YIJN 4JLHA 2YJFA 1N6QA 2EYQA 5HRSA 1TU0B 2KI7A 3G6EN 3RTVA 5CKEA 4WQ5C 3NGPA 1M3BA 2EYZA 2K3XA 5A0GA 3CMEA 3MO8A 5KE2A 4BE2A 5BPMA 5IWAK 4C92E 2X4JA 3WNHA 3CXCP 4EHTA 2WOMA 3NDKA 2D0CA 3QERA 1YI2N 4X1VA 5I11A 3LP0A 4CJPA 1FMKA 2P9IA 1W70A 3UKUA 4N0AA 1RLQC 3QIOA 3M8SA 4FLVA 1SEMA 3CD6A 4BD3A 2KY9A 1VIFA 3SK3A 3CMEQ 2DLPA 2MCNA 3EFOA 1P90A 1VQNT 1EX4A 2DJQA 4WQ5A 4XK8E 1J9AA 2GTDA 3CQ8A 1VHXA 5C10A 3RMBA 1J54A 1NJIC 3KLIA 3TSUA 1VQKT 4DFKA 1ASUA 2Y1JA 2V51B 2PYLA 2E2QA 3TU4K 1LNXA 2WONA 3A8YA 1SF9A 1C0GA 1WHKA 3ZT3A 1OVYA 4ELVA 2D0AA 1QVGP 5CHIA 1RFQA 4RTFD 2RQWA 3MKDA 3LL3A 4N41A 2M1HA 2P0QA 4JRKA 3ZT4A 4CF2A 4E6RA 3EH2A 2OTLA 4YFUA 3QWXX 2RKIA 4FWOA 1BG3A 2HVIA 3V8LA 2GBQA 1VK0A 1TKZA 3HK2A 3VU3C 2QDLA 2V7YA 3MX2A 2NWMA 1Q7YU 2LQKA 5AQMA 2XO7A 3SZ2A 5FRNA 4CJWA 4DKWA 1S1WA 1YJNQ 3THWA 4C8QB 2K3YA 2QW9A 4CJRA 3WQTA 1VQ5Q 3H46O 3VQBA 2DXUA 3B6PA 2FHDA 3OBYA 2P9UB 3CCVN 2D8HA 3CCST 3BP8A 3TARA 1WPYA 4DSFA 2M0YA 1CKBA 3RSEA 4Q0BA 1UFFA 4FL6A 4C8NA 2FVUA 2CH5A 3OS5A 1QSLA 2KRMA 4EPCA 3TEEA 2A3ZA 4CE9A 4W5QA 4DTXA 4OMPA 2K7AA 3TAPA 4CBWA 3VS6A 1OX8A 2VQEK 1Q7YR 4BR9A 4EP4A 5CKDA 3LM9A 2UUCK 1O75A 1IZ6A 4CJ5A 1NLVA 5AJ3K 4DQRA 4DQSA 3M53A 2P9SA 3VQ9A 2HEQA 2O2OA 5GAN2 4KO0A 4OKEA 4DR1K 1H641 1LPLA 3SB2A 4BB7A 5I2MA 1NGGA 3C4SA 4Z94A 2PBDA 4G9ZA 2X3XD 3CD6T 3NF7A 1GBQA 2DD5A 4OVAA 4FWNA 4TSXA 3W3DA 5LJVA 1OH7A 3CPEA 3P5JA 1NMDA 4HCBA 4FWRA 1KAXA 3LM2A 2XK0A 1YJ9A 3DLMA 4RG8A 4BVPA 1LOTB 3RRGA 4FYWB 1HD3A 4IEIA 3CCMN 2AK5A 4JD2B 4CHOA 1YITN 4DLEA 1ZBFA 4FJGA 1M8MA 1RAIB 5DLOA 2JLEA 1GFDA 1X75C 3VGKA 1AWXA 2FXUA 2JMAA 2P0KA 2EX3A 3I0SA 4F7UA 4K43A 4GBQA 3FIFA 5E84A 2CGHA 3VQ8A 1WXTA 4QQ6A 3V7RA 4HTUA 2D0PA 3LWIA 5EX5A 1UA1A 3RMSA 2X3WD 4C0DC 4DTPA 1NOYA 1KQSS 2ZPIB 4KUDK 1M2OA 1HX1A 1VQ6Q 5AFUH 5EVZA 4WFNL 1VQPA 3AO3A 2I7NA 3JB9G 2EKOA 5ECAA 2AJQA 1YHQN 5GANe 3NBPA 3UATA 3U9DA 4A62A 4CZHA 1UAXA 1T6DA 1K4US 1NGDA 4FL9A 3WEEA 2UXBK 2RHIA 3O8MA 5FU6B 4KTZA 1S5JA 1M1KR 3TAGA 4AHSA 1T7PA 4M3WA 1ASVA 1BCOA 2DM1A 2QTDA 1ZSGA 4E89A 4IUTA 4H5NA 2CH4W 2MMPA 4FJLA 4M63C 2VXFA 4DBHA 3V8JA 1EKEA 1D0YA 5DM6L 2ETJA 4JV5K 3ID6A 3N4PA 1YFNA 3HTRA 3CXCM 1Q95G 3CPWA 2MK5A 4JK7A 3J7ZO 1IH7A 3CHWA 1Q18A 4F2RA 1D3BA 4M4ZA 5LJ5d 1JEGA 4RCBA 4BRIA 1LV5A 2G8VA 2ROTA 4ILHA 3VOVA 3P8DA 3OYHA 3TABA 4GKJK 2QGFB 2ZCFB 3NTIA 1NBWA 3S3MA 2A1SA 1B9FA 2RPNA 3VQ6A 1SSFA 2NYSA 3J80E 3P31A 3O4WA 1W0HA 2F2WA 4M7AD 1PSEA 2MWPA 2Z1IA 4QS7A 4Y0WA 4CEDA 1QW1A 2HVHA 5GMKm 3ULEB
chains in the Genus database with same CATH topology
3P1GA 4HCCA 4E1NA 2BANA 3WNEA 2OZMA 4DSIA 2G8WA 1YTUA 1U4BA 3PUFA 3V6DA 2VG5A 3LP2A 4HUEA 3SYZA 1TKTA 3TI0A 4J2DA 4DMNA 1GOAA 1REVA 1C1CA 4CJ4A 1NK7A 1RCHA 3V1QA 3EY1A 1YTAA 4I7FA 4BE1A 1KCFA 3KKRA 4IG0A 4M41A 4ZTFA 1QS4A 5J2PA 1KFSA 5HRRA 2KFNA 3DI6A 1W9HA 3MXJA 1WAJA 3M8QA 4M3RA 4AH9A 2KZZA 4O0IA 5C24A 1SV5A 1R0AA 2KTQA 3RMCA 4DFMA 1D8YA 4C8KA 4CERA 2HHUA 1S1UA 3AVKA 4O5BA 3ZSWA 5CZ2A 1WNSA 3OYIA 3QIPA 1X9WA 5J1EA 1QSLA 3F73A 3AO1A 3UIQA 3L8BA 4UQGA 3HPGA 4MQ3A 2XHBA 3OYJA 5KRSA 2XY8A 1B92A 1RT4A 3K5MA 4FZYA 1C0MA 3ASMA 3ZSRA 4M3YA 1VSEA 3DRSA 1BQMA 4BE0A 4DTNA 4KKOA 3AVFA 4RW6A 3IAYA 4B9NA 3F9KA 2PZSA 1JLBA 3VQPA 3LZIA 4M45A 1NJYA 3ULDA 2RF2A 1L3VA 4JRQA 4J2EA 3WNGA 3G0ZA 4IFVA 3HSTB 5CYMA 1YT3A 2FBYA 3CFOA 4E7JA 3KLHA 3M8RA 1QE1A 3SCXA 2HHWA 2ITGA 2GBZA 3B6OA 1Q9XA 2HMIA 4PQUA 4C8OA 1ITGA 4B9UA 3V9WA 3NH2A 4DF8A 3PV8A 4NYNA 4W5TA 4W5RA 5EU7A 1NKEA 1S6QA 1XWLA 4CIEA 1BIZA 4CEOA 4QOZB 2FBTA 4FW1A 3OYAA 1JLGA 3K5OA 3LPUA 3LZJA 4RW9A 4ELUA 2KQ2A 1ASWA 1DTQA 3NF6A 4R5PA 3OJSA 3KJVA 3QEXA 4CJSA 2OPRA 2X74A 1ZBUA 4OGCA 3HJFA 1KRPA 3DYAA 2OPPA 2YNGA 3U6FA 2G8FA 4M3UA 3BDPA 2Z1GA 3G10A 3MEDA 4IG3A 4DQIA 4FJXA 3ALYA 3DLKA 3SPZA 4CEFA 1TAUA 3HL8A 4KRFA 1L3TA 1J5OA 4CF0A 1LW2A 4KAZA 1RBRA 4KREA 1IKYA 3EZ5A 4E7HA 4Z4FA 3SJJA 3AVGA 4CJUA 3LDSA 4EZ9A 3AO5A 3V9XA 1KVCA 3LALA 1RBTA 4FLXA 2X6NA 3AA5X 1SKSA 1BISA 4BDPA 1C0TA 4B9VA 2KZMA 1CZ9A 3DLGA 4B8AB 1RDBA 4KHYA 1VRUA 2HHXA 3HVRA 4W5NA 4B9LA 4CEAA 5C42A 4FM0A 4DSKA 2YNFA 4DQPA 1C6VX 2IOCA 3VA0A 3U3GA 1A5VA 4B9MA 2XY7A 3MXIA 1CZBA 4NCGA 3ZT0A 3ZSQA 1RT6A 4C8LA 5I42A 4M3XA 3HVTA 3MXMA 1T8EA 2YNHA 1S9GA 1QMCA 4E7KA 2BGGA 3CYMA 2QXFA 1HNIA 5CY4A 3KTQA 1RILA 2P5OA 3H08A 3ZT2A 5HRPA 3O3FA 3HP6A 3K5NA 3KIOA 4G1QA 3ZSOA 3NGYA 3QEVA 2DFFA 1VRTA 4CF1A 5DK5A 3AVBA 1WN7A 4CJKA 3HT3A 1KFDA 3L2UA 3K59A 4QAGA 3RR8A 3QEWA 4B9TA 3QNOA 3S9HA 3O4QA 1XHXA 1T03A 3OYDA 1KLNA 1UWBA 1WSEA 2OPQA 3SPYA 4C8MA 2YNIA 1CLQA 5HROA 1HNVA 1B9DA 4CK2A 4E0DA 4E7LA 3SQ1A 2A1RA 2HNDA 1TKXA 3V9ZA 3AVNA 3QNNA 3THVA 2HHTA 3ITHA 3D45A 3LAKA 1U45A 4RW4A 1RTJA 4F4KA 3AVIA 1WSIA 2P5GA 1I3AA 4KV8A 3VQEA 4FLWA 4DTSA 4B9SA 4CFDA 2D0BA 4Z4CA 3NE6A 1S1VA 3L3VA 1BHLA 4CF9A 2G8HA 4FJIA 4OJRA 4FK4A 3OYCA 4IDKA 4OLAA 1SUQA 3VQ5A 1G15A 4AHVA 4CIGA 1BL3A 1CXUA 3OYMA 3JYTA 4CJVA 1C1BA 3K58A 2B6AA 4FLYA 2XY5A 4NCBA 2P1JA 2OA8A 3DMJA 4FJ8A 4CHPA 3HPHA 3DLEA 3LANA 1EP4A 1I39A 4HHTA 3TANA 5JS1A 3MEGA 4HUGA 3A2FA 2FC0A 3O3GA 4B3OA 4W5OA 2IC3A 3KK1A 1NK9A 1JKHA 4QCLA 4FJJA 3PO5A 1ZBIA 1QHTA 1QQCA 3AA4A 3NFAA 4IFYA 3HM9A 1NK4A 1RT5A 4FVMA 1HJRA 4I9LA 4BWJA 3SV3A 4CHQA 1XI1A 1BIUA 1WAFA 4B8CA 1LWEA 3DLHA 1BQNA 3VQCA 1IKWA 3NHGA 3L2RA 2OPSA 4DWIA 3QINA 2HHVA 1KVAA 1WSJA 1JLFA 1HRHA 2E6MA 3OYKA 4BDYA 4FCYA 4E3SA 3L2VA 3ZSZA 4AILC 3ZSVA 2KFZA 1D5AA 5KI6A 4CK3A 4DTOA 4I9QA 4N76A 2ATQA 1Y97A 4KI4A 1LAWA 3K2PA 2RPIA 3LPTA 3OVNA 1QSYA 3JSMA 4PY5A 2BDPA 5J2MA 2OZSA 4BDZA 3ISNC 2QKKA 1HYSA 4DLGA 2P51A 3KLFA 3TAQA 2RN2A 3KLEA 4AHRA 3AV9A 3PO4A 3LWMA 4DSLA 1WSFA 2YV0X 1HMVA 4O55A 3V1RA 1RT2A 1L3UA 3L3UA 4DSJA 3C6TA 4DG1A 3LP1A 1IHVA 4KHWA 4CGJA 3HO1A 4LSLA 4AHTA 1LW0A 1KTQA 4OKJA 4CF8A 1U47A 4FK2A 1S1XA 3ZT1A 3ZCMA 4M42A 1T05A 2R7YA 2FBXA 4IBNA 3PY8A 3CFPA 4FLUA 4MFBA 1JXBA 4O4GA 4CGHA 1TV6A 1XC9A 4RW8A 2IDOA 2X78A 3V9UA 4DQQA 4CFAA 4M3ZA 2IGIA 1TVRA 4F3TA 2DTUA 4FJ5A 3QLHA 1TGOA 1Q9YA 3KKSA 5CYQA 3V81A 1IHWA 3HYFA 3AVAA 3I0RA 3SV4A 3CM5A 1LWCA 5SWMA 4FJ9A 3AO4A 5FDLA 1X1PA 1RDCA 5J2QA 3AO2A 4DF4A 2B4JA 5FROA 2HW3A 3T3FA 3S3NA 1TL3A 1RT1A 2HB5A 4Y1CA 1JL2A 1WSGA 4EP5A 1RT7A 3OJUA 4J2BA 3SI6A 2HNZA 3OYFA 2Z1JA 3V9SA 4ELTA 2OYQA 2F96A 4DU4A 1EETA 1HQEA 1S6PA 2B5JA 3SQ2A 5I3UA 1U49A 3CM6A 3RRHA 1RDDA 5FRMA 4OVLA 1U04A 2O4GA 1NKBA 4JS4A 5J2NA 1A5WA 3NH0A 4KHNA 4ZHRA 1IKXA 1J53A 4Z0UA 2G8IA 4JS5A 1RBVA 2VG7A 3SQ4A 4LD0A 4FM1A 1Z25A 2W42A 4N56A 1SKRA 3TAMA 1NJXA 1A5XA 2I5JA 3PX0A 1CXQA 5HP1A 1NJWA 1Z26A 1JL1A 3BGRA 4KB1A 1VSFA 1BCMA 4H8KA 1RT3A 3IS9A 3VQAA 1GOCA 1L5UA 2VWKA 3SQ0A 1KSPA 3DM2A 3NAEA 4Z4GA 3TWHA 1VSHA 5E41A 5CZ1A 1NK5A 4NCAA 3SUPA 3AVCA 1QSSA 4ID5A 1FKPA 1RBUA 4CGIA 4ZTJA 1X9MA 1TK8A 3AVLA 4FJHA 1UA0A 2ZD1A 4CJQA 3O3HA 4FW2A 1ZYQA 1D9FA 2HVHA 1RTIA 1C1AA 3OYBA 4CHNA 4AHUA 2NUBA 4CJLA 3NF9A 3KK3A 3SUNA 1JXEA 3K57A 3VA3A 5SZTA 4CIFA 4CEEA 4Q5VA 4IKFA 2Y1IA 2EHGA 1K6YA 4LH5A 1L3SA 2IAJA 3IRXA 4JLHA 4Z4HA 3I8DA 1N6QA 2E6LA 1NK6A 1YVUA 5HRSA 1KVBA 3ZSYA 1TK0A 3DLRA 4YNQA 3RTVA 3KK2A 2G8KA 1LAVA 4FM2A 3QEPA 4KTWA 3NCIA 4BE2A 3WNHA 3DRRA 4I2QA 1NKCA 2DFHA 4CCHA 1RTDA 3NDKA 2WOMA 3QERA 2D0CA 4CEQA 4FLTA 2KW4A 4CJPA 3LP0A 4DTUA 3ZSXA 1JLQA 3NF8A 3MECA 4FLVA 3E01A 3QIOA 4O0JA 3M8SA 3QO9A 3L2QA 4BWMA 4KHQA 3EYZA 3SNNA 1NOZA 4FXDA 1EX4A 1WSHA 3C6UA 4CEZA 1J9AA 3OYGA 3CQ8A 1NK8A 4H4MA 1ZBHA 4PWDA 3VQ7A 3RMBA 4GW6A 1J54A 4KPYA 5KTQA 3KLIA 4XIUA 1N5YA 4PUOA 4DFKA 4Z4EA 1VSKA 4LH4A 1ASUA 4CESA 4HUFA 2Y1JA 1UOCA 2PYLA 2XRIA 2WONA 3P83D 4F3OA 3ZT3A 4ELVA 1JLCA 2D0AA 4KFBA 4OPJA 4KI6A 1LWFA 4N41A 4K8ZA 3QETA 4K8XA 3T19A 3ZT4A 4OKKA 4CF2A 5HRNA 1RDAA 3IG1A 4CJFA 4I2PA 1DTTA 3U3YA 3VQDA 4YFUA 1Q8IA 2FBVA 4CJEA 1TKDA 4FJ7A 4NYFA 2QK9A 2DY4A 2GUIA 3AVHA 2RKIA 5HBMA 4M3TA 2HVIA 1VK0A 3PX6A 1TKZA 3MAQA 3HK2A 2O4IA 2XO7A 2X6SA 3KLGA 3SZ2A 3FFIA 4CJWA 5FRNA 4FYDA 1SL2A 4Y1DA 1S1WA 1BGXT 1ZBLA 1HYVA 2JGUA 2VWJA 1VSIA 3L2WA 3OS2A 4CJRA 3V1OA 4FLZA 3KD5E 2Q3SA 3VQBA 3B6PA 4FJMA 4FJNA 2LSNA 4CHYA 4L8RB 4N47A 3VN5A 3CFRA 3OYNA 3TARA 1D9DA 1BI4A 4DSFA 4N5SA 5KRTA 1XHZA 1TAQA 4Q0BA 4C8NA 1C6VA 1HQUA 2HNYA 2Z1HA 3HP9A 5DMRA 4CFCA 4CE9A 5KGXA 3RMDA 4W5QA 4DU3A 4DTXA 1C0UA 4E7IA 2G8UA 3TAPA 4WE1A 4GMJB 1MU2A 4EP4A 3HPOA 2D5RA 4DTJA 3AA3A 4JRPA 3OY9A 2HHSA 3VQQA 1DLOA 4AHCA 4CJ5A 4DTMA 2HHQA 3C94A 4DQRA 4DQSA 3VQ9A 1FKOA 4E1MA 3NGIA 1SL1A 3LP3A 4KO0A 4OKEA 2DFEA 1IKVA 3RR7A 4CK1A 3NF7A 1VSJA 4KHSA 4TSXA 3SUOA 3P5JA 4CJ3A 4CJTA 4HCBA 3DLBA 2QKBA 4RG8A 3RRGA 4F8RA 4O44A 3CG7A 3T1AA 1SL0A 1RNHA 1JLEA 3DOLA 4KTQA 1F21A 4CHOA 3C95A 5C25A 4DLEA 1ZBFA 4FJGA 4CGGA 5KGWA 2JLEA 1S9EA 3M8PA 4FZXC 3I0SA 2EX3A 1S1TA 3AA2A 1RTHA 4DFJA 3TAEA 3NGZA 1O1WA 3VQ8A 3KD1E 4HTUA 4KB0A 1UA1A 4OLBA 1BI4B 4LY7A 1IO2A 3NH1A 4DTPA 1NJZA 4CGFA 4DFPA 1NOYA 4Z4IA 4OGEA 3OYEA 4CECA 1HYZA 3LWLA 3O4NA 1U48A 3AO3A 2ZE2A 2E4LA 2ZQBA 4J2AA 4ID1A 2YKNA 2AJQA 3S3OA 1JLAA 4PA1A 2YHBA 3NBPA 4LSNA 4ICLA 4OPKA 3PX4A 2YHAA 1UAXA 5JS2A 1FK9A 3TAFA 4HVJA 1NK0A 2PY5A 2PYJA 5T7BA 4EZ6A 4KHUA 4FZZA 4KTZA 1S5JA 3OYLA 3TAGA 4AHSA 1T7PA 4M3WA 1ASVA 1BCOA 4E89A 3MEEA 2VG6A 1IG9A 4B08A 4FJLA 1WLJA 1EXQA 1EKEA 2IS3A 1GOBA 3OS0A 4DS4A 4E19A 2ETJA 1HPZA 2XY6A 2BE2A 5D3GA 3QEIA 4F2SA 2F8SA 4DTRA 3WNFA 4FJKA 4CGDA 5K14A 3TR8A 1IH7A 3D0PA 1QTMA 1KLMA 3DRPA 1TK5A 4F2RA 3HXMA 3SUQA 5D7UA 1TL1A 3QESA 4DSEA 1LV5A 4CFBA 3RMAA 2G8VA 3OS1A 4DS5A 3OYHA 3TABA 3LAMA 4H4OA 4CEBA 3VQ4A 4FK0A 3S3MA 2A1SA 1B9FA 4DU1A 3AVMA 4CHZA 1SKWA 4GVMA 2F8TA 3VQ6A 1FXXA 3K5LA 2YKMA 1VSDA 1VSMA 3AVJA 3V4IA 1W0HA 4CEDA 2Z1IA 4RW7A 4BACA 2GV9A