4FW1A

Crystal structure of two-domain rsv integrase covalently linked with dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
210
Chain Sequence
PRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAVQHHWATAIAVLGRPKAIKTDNGDAFTSKSTREWLARWGIAHTTGAMVCRANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHKERGENTKTPIQKHWRPTVLTEGPPVKIRIETGEWEKGWNVLVWGRGYAAVKNRDTDKVIWVPSRKVKPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A possible role for the asymmetric C-terminal domain dimer of Rous sarcoma virus integrase in viral DNA binding.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
total genus 71
structure length 210
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 4fw1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4fw1A01
2EHGA 4R5PA 4NYNA 2HNZA 1FKOA 3AO2A 1N5YA 4B9UA 3RWUA 3V6DA 1ITGA 4KB0A 1S1XA 4M41A 4MFBA 4IG3A 2YHBA 3RRHA 4FXDA 1HYZA 3TWHA 5C25A 3JYTA 1T05A 3HO1A 2Z1HA 3C95A 4FW1A 3PX6A 3AVMA 4CE9A 2P1JA 4I9LA 3T3FA 1WSIA 2X6SA 5FROA 1BI4B 4N47A 4LD0A 2JLEA 1ZBFA 1CZBA 1RTHA 1HNIA 3KLIA 4CHQA 4CIEA 4E7KA 3EYZA 3CM6A 3K2PA 1ZYQA 3DRPA 2FC0A 3L2WA 4DTXA 5KRSA 5T7BA 3TI0A 4FK4A 3LAKA 3QEXA 2NUBA 3UIQA 1NKCA 1ASVA 2Y1JA 4OPJA 3V1RA 4Q0BA 1I3AA 4C8KA 1MU2A 3I8DA 4FLTA 2QXFA 3VQ8A 1S5JA 3KKSA 4CGDA 3V81A 3MEGA 4IKFA 3F9KA 3NAEA 4JRPA 3U6FA 2DY4A 3WNEA 4FLYA 3TAFA 2VG5A 4JRQA 3DLRA 5KTQA 3WNGA 4DTOA 1SL1A 1RDBA 4CERA 4FJ9A 4FJ5A 1Q9XA 4KI4A 3VQ9A 1NOYA 4DWIA 1S1WA 1C1CA 3EZ5A 1T03A 3HK2A 1X9MA 1Q8IA 3KKRA 4KB1A 4HHTA 4I2QA 4CF9A 4FJ8A 1BIZA 4DU3A 3OY9A 2HHUA 4I7FA 4KHUA 4CJQA 4DS5A 4HCCA 4J2EA 3CM5A 2QKKA 4I2PA 4KREA 4K8XA 4JS4A 2AJQA 1QSLA 3ZSRA 1TK5A 4DTNA 3TAGA 3OJUA 2PYJA 4FLZA 4AHCA 4CHNA 3DYAA 3NH2A 1QTMA 4B08A 4CJEA 3QEPA 1D9DA 1XWLA 1WSEA 5HRRA 2KTQA 1C1AA 2X74A 3AO4A 1JLAA 2Q3SA 3I0SA 1LWFA 4M42A 1QE1A 3BGRA 4CF2A 3M8SA 4Y1CA 1RBVA 3L2QA 4N56A 1A5WA 3TANA 1NK4A 3CG7A 5FRMA 3M8RA 4F3TA 2XY8A 2BDPA 4LH5A 3HVRA 2G8KA 3LDSA 2HB5A 4B9TA 4C8NA 4AHUA 4DQQA 3P5JA 3NH0A 2KZZA 4HTUA 4DSFA 4KFBA 3SQ2A 2QKBA 1JXBA 2D0CA 1RBRA 4FM0A 1NK9A 3OYMA 3HP9A 4MQ3A 4Z4HA 4C8OA 3CFRA 2HNYA 1T8EA 4JS5A 1S9EA 3NGYA 1DTQA 4DFKA 4GMJB 1BQMA 3U3YA 4K8ZA 4BE0A 4ELTA 4Y1DA 4XIUA 4H4MA 1SV5A 3D0PA 3U3GA 2HHSA 1TVRA 4FJNA 1VSIA 3OS0A 4M3TA 2KZMA 3KLGA 1RDDA 3PV8A 1TL1A 3V9SA 4FJHA 1HRHA 5HP1A 3OYCA 3QERA 3E01A 3VQ4A 1YVUA 2VG6A 3QIOA 4CECA 4ELUA 1WAFA 4EP4A 3ZSXA 4DTSA 4J2DA 4CHOA 4E7LA 3LALA 4ELVA 1S6QA 3VN5A 5CYQA 4FLUA 1VK0A 4PQUA 1NK6A 5I3UA 3TR8A 1NJXA 2OA8A 2OPSA 3VQCA 2KFZA 3DLHA 3NF8A 1TAUA 1IKXA 3V1QA 5KGWA 3V9XA 1XI1A 4FJMA 3DLGA 2YHAA 4CJWA 2FBYA 3PO4A 3OVNA 4DQPA 3P1GA 1KVAA 1HYVA 4CJTA 4HVJA 1NOZA 3NGZA 5EU7A 1LAWA 2P5GA 2PY5A 4KTQA 4NCBA 1NKBA 4Z4IA 1NK5A 3LZJA 4PWDA 5I42A 5C24A 3KD5E 4IDKA 4KHQA 1BIUA 2G8IA 3V1OA 4BE1A 4CJLA 4F2SA 3AO3A 2G8HA 1VSEA 3SUPA 3TARA 4FK2A 5D3GA 1U48A 3CYMA 4HUEA 3RMAA 3AVLA 2PZSA 1JLBA 4FJXA 1IH7A 3C6TA 4W5RA 1B9DA 4J2AA 3OJSA 3QESA 2BANA 3DRRA 1CZ9A 4CFAA 3O3FA 4OPKA 3VA0A 3QNNA 3K5OA 1HNVA 3C6UA 5JS2A 3RTVA 1RT1A 1A5XA 2R7YA 2HMIA 3B6PA 1GOAA 2B6AA 2E4LA 1JLCA 3T1AA 4FJGA 1XHXA 3LWMA 1QHTA 1SKRA 2F8TA 4Z4FA 1L3UA 4CF0A 4E3SA 3RMBA 2HHWA 4CEOA 3L3UA 3HL8A 5FRNA 3HM9A 4CEBA 4B3OA 4CEZA 1TKTA 3HYFA 2KFNA 1WSGA 3SQ0A 1J53A 1BQNA 1EX4A 1VSFA 1BGXT 3SV4A 1XHZA 1XC9A 4KRFA 1N6QA 1KRPA 4DSKA 4DTUA 2IAJA 3T19A 2DTUA 3PX0A 1RT6A 1ASUA 4FJIA 1LW2A 4CJUA 1RBUA 4KI6A 3TABA 2IGIA 1TKXA 5K14A 4CEDA 3TAQA 1RT7A 1BISA 2YKMA 1IHVA 1UWBA 4EP5A 4KAZA 3BDPA 4FZZA 1JL1A 3AA5X 4F2RA 3SYZA 4HCBA 4OKJA 3SQ1A 2HHQA 4B9MA 3NDKA 1J54A 3K58A 2W42A 5HRNA 2G8VA 4BE2A 4DTJA 2KW4A 2XY7A 2Z1IA 1I39A 4CCHA 3ZSVA 3WNFA 3ZCMA 2DFHA 2BE2A 3S3MA 2DFEA 3LP3A 2WONA 4CGIA 3SV3A 4LSNA 1RNHA 2ETJA 3DMJA 3DRSA 4TSXA 4KO0A 4BDZA 4DFPA 3LPTA 3ZT2A 4ZTJA 4M3UA 3SUNA 1HMVA 2ZQBA 3OYDA 4CK2A 2D0BA 1X1PA 4O4GA 3OYGA 4DTRA 1TKDA 2E6MA 1B92A 4C8LA 3HVTA 1LWCA 1U49A 4CEEA 1SL0A 4DSEA 3QINA 3MEEA 4UQGA 1CXUA 4O0IA 5CZ1A 1Y97A 2XRIA 3QLHA 4FJJA 3S3OA 4I9QA 4QCLA 3S9HA 4YFUA 1DTTA 3HPHA 4GW6A 4E7JA 3KK2A 2VWJA 3I0RA 4J2BA 3TAPA 1GOBA 3AA4A 2F8SA 3PY8A 4KHYA 1J9AA 3HXMA 3QEIA 4DQSA 3AA2A 5KGXA 1X9SA 4FCYA 3OYBA 1VSDA 1ASWA 5DMRA 1R0AA 2OYQA 1C0MA 3VQPA 2RKIA 3NF9A 1UA1A 3DLKA 3B6OA 4KV8A 2FBVA 1DLOA 2FBTA 2OPQA 1VSLA 4C8MA 1B9FA 1ZBUA 3OYAA 3C94A 3PUFA 2X78A 4ID1A 1WAJA 3D45A 3SPZA 2ZD1A 1KFSA 4CIGA 3K5LA 1HQEA 3AO1A 4CESA 4PUOA 4F4KA 1JLEA 2G8FA 2YKNA 2Y1IA 1UOCA 1VSJA 1TV6A 4IFYA 2QK9A 1Z25A 4CJSA 3SI6A 4W5QA 4OKKA 3VQ6A 2IDOA 4E89A 4CEAA 4CEQA 4B9VA 3QETA 4DSJA 3KTQA 1CLQA 1JLGA 3VQ5A 1D8YA 3IG1A 1W0HA 4AH9A 4KHNA 4DG1A 2XHBA 1FKPA 3AV9A 4CHPA 4DF8A 4GVMA 1RT4A 3OYLA 4B9NA 4F8RA 4E7IA 1JL2A 3ZSOA 2XY6A 1KVCA 2ZE2A 1QQCA 3SPYA 2OZSA 3ZT3A 4FJLA 2FBXA 3IS9A 3NFAA 3TAEA 4CJVA 3K5NA 4Q5VA 2B5JA 1F21A 2ITGA 3MXIA 1RILA 2YV0X 3LWLA 3THVA 1BI4A 2HW3A 4OVLA 3SUOA 5J2PA 4CJKA 3NGIA 3ZT1A 3DOLA 4E1MA 3OYEA 4N76A 1ZBIA 1RBTA 4B8AB 3K57A 1IG9A 3L8BA 3LPUA 4OGCA 4OLBA 1RT2A 4PY5A 3LP1A 4WE1A 2Z1GA 1HPZA 1LAVA 3AVNA 4O55A 1LV5A 3O4NA 4IG0A 1IHWA 4CEFA 1RTJA 3OYKA 2IS3A 4CK3A 4FVMA 3M8QA 1FXXA 2G8WA 3RR8A 3ULDA 3AVIA 1T7PA 4DS4A 1ZBLA 3CQ8A 2O4IA 3KLEA 4E1NA 3OS1A 3AA3A 1NK8A 4CJ5A 3IAYA 1L3VA 1S1VA 4BACA 1SUQA 1C0TA 1IKYA 1S1TA 3ZSYA 1IKVA 4CFCA 4O5BA 4ID5A 3O4QA 4JLHA 2HHVA 3KD1E 1EXQA 1WSHA 4O0JA 3SNNA 3NH1A 3V4IA 1JXEA 3FFIA 3TAMA 4CF1A 3AVKA 2F96A 2LSNA 3MEDA 3OYHA 4DU1A 3HT3A 4QOZB 1U4BA 1UAXA 3AVJA 3ISNC 4CHYA 3AVBA 4RW8A 1YTAA 1NK7A 1VSHA 4FLXA 4FJKA 2D5RA 1KLMA 2GUIA 3MXJA 4CJ4A 1U47A 1C6VX 3V9WA 1NJWA 1L3TA 1RTDA 1C0UA 1HJRA 4DMNA 4DQIA 3LP0A 3P83D 3ZSWA 4IFVA 4BWMA 3MAQA 4CJFA 1K6YA 2IOCA 1S1UA 5SWMA 1S6PA 3SCXA 1G15A 4BDYA 3AVHA 1BCMA 4DTMA 3VQEA 1RBSA 4CJPA 3VQ7A 4CF8A 3AO5A 2HNDA 3ZSZA 1KFDA 1WSJA 4B8CA 4Z4CA 4DLGA 3A2FA 3AVAA 4DLEA 3H08A 4LY7A 4ZHRA 2ATQA 2BGGA 2IC3A 1RT3A 3JSMA 5KI6A 4Z4GA 2D0AA 2HHTA 2GV9A 4Z0UA 2JGUA 4FM2A 3DOKA 3ZT0A 4OJRA 3AVGA 3QEWA 3KK1A 3SJJA 1J5OA 3KLFA 4BWJA 4CFBA 3K59A 3WNHA 3SUQA 4Z4EA 4CGFA 3OYNA 3PO5A 1WLJA 5J2MA 1QS4A 4CGHA 4KHWA 1TKZA 4AHRA 1QMCA 3G10A 4N41A 1NK0A 4E19A 1KLNA 4M3YA 3IRXA 4B9LA 2OPPA 3LZIA 3SZ2A 4EZ9A 1X9WA 3VA3A 1BHLA 2PYLA 1RDCA 1KTQA 1RCHA 2RPIA 4DFJA 1RDAA 4OKEA 4FLVA 3MXMA 1WNSA 3RRGA 3LAMA 1YTUA 1BCOA 1ZBHA 4FYDA 3OYFA 1WSFA 2YNHA 4CJRA 4FM1A 4H8KA 4EZ6A 3NHGA 5HRSA 5FDLA 3K5MA 1L3SA 4L8RB 3O3HA 3CFPA 4OLAA 2OZMA 3VQBA 1CXQA 4CFDA 4KTZA 3ITHA 1BL3A 3SQ4A 1L5UA 3RMDA 3O3GA 3LP2A 1KCFA 1UA0A 3KIOA 1Z26A 3NCIA 3L2VA 3S3NA 4HUGA 3RR7A 2WOMA 3CFOA 3OS2A 2RF2A 1SKSA 2OPRA 1W9HA 1KSPA 1EP4A 2I5JA 2KQ2A 4PA1A 4M45A 2XY5A 1C1BA 1EETA 1TGOA 3L2RA 3KK3A 4DSLA 3KLHA 3KJVA 5DK5A 4FLWA 1U04A 4AHVA 3HSTB 4NCGA 4FZXC 1QSSA 3DI6A 2X6NA 3OYIA 4E7HA 2EX3A 4CIFA 1TK8A 1HYSA 4DFMA 2HVIA 1S9GA 2YNFA 1Q9YA 4FK0A 3ALYA 3NF6A 5J2NA 1SL2A 1YT3A 1VRTA 4O44A 4KHSA 4YNQA 3VQQA 3V9UA 3HPGA 2O4GA 3G0ZA 4CK1A 1O1WA 2XO7A 4RW6A 3QNOA 3AVCA 3ZSQA 4DSIA 1VSMA 4NCAA 2RN2A 3V9ZA 2YNGA 4F3OA 2E6LA 2DFFA 1EKEA 1TL3A 5HROA 5SZTA 1VRUA 1TAQA 4KKOA 5HLFA 4H4OA 4M3WA 3NBPA 1RT5A 4CGJA 4RW4A 4CHZA 3OYJA 2G8UA 3L2UA 4CJ3A 4B9SA 4KPYA 5HRPA 1NJYA 1NJZA 4HUFA 4DU4A 1A5VA 1RTIA 5E41A 4W5OA 4AILC 3VQDA 1FK9A 4DQRA 4DF4A 1LWEA 3L3VA 3EY1A 3NE6A 4OGEA 4AHTA 1JKHA 1SKWA 3HPOA 1WN7A 1KVBA 3F73A 2VG7A 3DLEA 3QO9A 4LSLA 1GOCA 4RW9A 5HBMA 3AVFA 3PX4A 2A1RA 1LW0A 4N5SA 4QAGA 1IO2A 4RW7A 1JLFA 1C6VA 5CYMA 4M3ZA 3RMCA 4W5NA 1TK0A 3DM2A 1JLQA 2P5OA 4DTPA 3M8PA 4FJ7A 4W5TA 4FZYA 2HVHA 5D7UA 2YNIA 3MECA 4IBNA 2B4JA 4M3XA 1NKEA 2P51A 2A1SA 5JS1A 2HHXA 5KRTA 4NYFA 2GBZA 4ICLA 4CGGA 3QEVA 2VWKA 4LH4A 3LANA 1D9FA 5CZ2A 5CY4A 4E0DA 2Z1JA 3ZT4A 4RG8A 1IKWA 1HQUA 4AHSA 3NF7A 3HP6A 5J1EA 3QIPA 1QSYA 3ASMA 4KTWA 4FW2A 4M3RA 4BDPA 5C42A 3DLBA 5J2QA 1REVA 1VSKA 4G1QA 1D5AA 4ZTFA 3VQAA 3HJFA 1U45A
chains in the Genus database with same CATH superfamily
2G3RA 4ZNXA 3QSUA 4KB0A 2E4HA 1X69A 4H5VA 2YWWA 1OU9A 2MIOA 1GLAG 4J9EA 4LF6K 4TVRA 2O31A 3KK7A 3TWHA 2DFUA 4KGXB 1RL2A 4LN2A 1Y96B 3TTCA 2VXEA 2YCHA 3AVMA 3CJAA 1CSKA 4CE9A 2EIFA 4C1NI 4FYWB 3CCLA 1WSIA 3EGDA 4BI8B 2KVQG 1ZBFA 2RHYA 3M0QA 4IURA 4PKHA 2DPPB 2P9NB 2F2WA 1QVGA 3CM6A 1ZYQA 1X9JA 4PJJA 4C92C 2FC0A 3OBYA 4GKKK 5KRSA 2UUCK 5D6XA 3DLMA 1SZ2A 5HK0A 2L0AA 3QDFA 4C8QE 3MWTA 4Q0BA 3WXMB 1MU2A 3G6EA 4FLTA 3EH1A 3VQ8A 1S5JA 5AZIA 1G2BA 4CZJA 1DEJA 5LJ5h 2R57A 4JRPA 1NJIU 3U6FA 2JUFA 3HSBA 4DCHA 1VQ9N 1VQ7N 5M9OA 1I0CA 2CH4A 4WQ4A 1T3LA 5BN9A 5KTQA 1SL1A 2E1HA 3H41A 4FJ9A 4X62K 4FJ5A 5GIOA 5A0LA 2IVNA 1IV0A 2X4JA 1BU6O 3EZ5A 4RTUA 4BRQA 4ZGDB 3OW2P 3JCMX 1IGQA 3OY9A 2LVMA 2K7AA 2MOXA 1VQKQ 2DYBA 2HMPA 4I7FA 4M7YA 4QW2A 1Q7YO 1V4SA 4LUDA 3CM5A 4I2PA 4K8XA 4JI7K 1TK5A 2AKLA 4M78G 3TSWA 3MX5A 4CHNA 3CXCM 4FLZA 2V7YA 1QTMA 2KFNA 1OX9A 5KYXA 2QA4T 2EWSA 1HYOA 2X74A 3L2QA 4XAXB 1VQPQ 3SLCA 1NK4A 4J6YA 4M7AC 1PRLC 3CG7A 3CD6A 1NBEB 2BDPA 3BF3A 3WXJA 1UHFA 4PL7A 3Q7CA 4KFBA 1RDUA 1NLOC 2X3WD 2D0CA 3P38A 2W6KA 3T69A 2A28A 3BP8A 2NUTB 4J9GA 3VYHB 3U3YA 4GMJB 1M3BA 4K8ZA 3RKWA 4CD3A 3ZEHA 3VUBA 4XIUA 1VIEA 2QG9B 3J81E 3M5RA 4H4MA 1TUUA 3H6EA 5FPMA 3ID8A 2DEQA 2QA4A 4RTTA 1YFNA 2HZYA 4H03B 3PV8A 3NMUA 1N8RC 1HRHA 3WEEA 4RG2A 2DXUA 3FR0A 4KH4A 3U8XA 3CCEQ 4ATOA 2QWMA 1S6QA 3VN5A 5AQIA 7AT1B 1YITT 2Q1NA 4XTXA 1KG1A 3VEVA 5I3UA 2HOEA 1VQMA 4BRDA 3VQCA 4HTLA 4BC2A 1TAUA 5GAN2 1NGFA 1R77A 1IKXA 3VOVA 4DV4K 1NLPC 1QKXA 3VENA 4A54A 2HBKA 1RADB 1QHAA 3CCVA 3CBPA 3OVNA 2C0TA 3CJ7A 3H6ZA 4CJTA 3KWIA 3NGZA 1NOZA 1UGPB 4QT7A 2P5GA 2KBTA 1D0XA 1XQHA 3KUFA 4KTQA 1NK5A 4M75F 4KHQA 5AQMA 1MMNA 3PIPL 2OI3A 1OX8A 3JCMQ 3SFMA 1GLJO 3E9FA 2DD5A 5D3GA 4M78F 4C5IA 3ZX3A 2PZSA 3AVLA 1UJYA 2M9UA 5IXBA 1VOMA 2X9HA 4LDVA 5DM7R 2A40A 1YITA 1B9DA 4NOYA 4A4GA 3MP1A 3TSPA 1YI2N 3HRSA 3NFCA 3DRRA 4CFAA 3BE3A 2JN0A 2KR3A 1HNVA 5JS2A 3RTVA 1IXDA 2IVWA 3PSIA 1GOAA 2E4LA 1VQLA 3T1AA 5AFUA 1Z9ZA 4E6RA 2RA2A 2JTEA 4C92D 5KYYB 3G4ST 3CC4A 2EKHA 3NPFA 5AQXA 1I94K 1SKRA 1GBRA 2MWPA 2F2VA 2F8TA 1Q82U 2KXDA 4U7BA 1IZ6A 4LDUA 4ILGB 1UUEA 1ZBSA 5FRNA 1SKUB 3HL8A 3O9SA 4B3OA 1QW1A 3PMIA 5KYWA 1MMAA 1YIJT 4CEZA 1VA7A 3TU4K 1HX1A 2E88A 3D2EA 1BQNA 1EX4A 1XHZA 2GEMA 3LGLA 3O9RA 2M0YA 4XK8E 1KRPA 4ME7A 1TWBA 5LJ5j 5GAMd 1RT6A 1SQKA 2Q31A 3FGUA 4MDBA 4O8KA 4FJIA 5HKCA 4IOCL 4CEDA 2UXBK 3TAQA 1RT7A 3M0PA 3M1FA 2DD4A 1IHVA 1BK2A 5KYUB 4CZEA 2QEXA 2EBPA 2A3ZA 1JU5C 3SYZA 3SQ1A 3NDKA 2MI6A 4IEIA 2R58A 1J54A 2QWOA 4MLEA 5HY6A 3K58A 2W42A 1VQNQ 2JM9A 3HI0A 2G8VA 4F7UF 3CD6Q 2KW4A 5E26A 2HQEA 2Z1IA 2FEIA 2VGMA 1I39A 4CCHA 1M9SA 1KQSP 3VTIA 2DFHA 1YJWA 1G3SA 1FMKA 3QIIA 2J05A 2RHUA 3LP3A 4IOXA 1BB9A 3SV3A 2XKOC 1NGBA 4DFPA 4ZTJA 4BDZA 4C92G 2ETJA 5CO7A 4M3UA 1T8EA 4QVCA 2ZQBA 2RQUA 3I8BA 2D0BA 1X1PA 1R8OB 2RQRA 4M7AD 4O4GA 4A62A 3HVTA 5GAOm 4JZ4A 2QWRA 2CP3A 4NO7A 3CCJN 1U49A 1WUAA 4UQGA 4XQ3A 4ELZC 4O0IA 3OW2S 4PFZA 2E70A 3S3OA 5AQTA 4A4EA 1EQYA 4NS5A 3QMLA 5AQKA 1RI9A 2IIRA 2DNUA 4GW6A 5BN8A 3LWHA 4E7JA 4LDXA 1K9AA 3CPEA 3EGDB 5LJ5f 5AQJA 2ZAEA 1M2VA 4I6MA 2BKDN 3T1YK 4DR7K 1MV3A 1PD0A 3JCMV 5FLXE 5AFUH 1X9SA 4FCYA 1EWRA 4J83A 4DR1K 1R0AA 2AZVA 1C0MA 3A5MC 3CCUQ 5GIPA 3NF9A 2PUOB 4KV8A 3EN9A 3CHWA 1DLOA 4PL8A 4KBOA 2JW4A 2RHZA 3TVTA 2CZ1B 3CCQQ 4M77F 5I2MA 1G3WA 2E5QA 3VS1A 5LJ5g 5GANj 1YJ9T 1Q7YU 2EJGA 1KFSA 4CIGA 3AO1A 3VV0A 1E6GA 3J7YP 2G8FA 3J7ZO 5EG2A 4M7AG 3GL1A 2HHHK 4JI5K 1VHXA 2OTJQ 1Z25A 4WYBA 4YOYA 2QK9A 2K9GA 2J4RA 2LZ6B 3UWNA 4DSJA 3SWNA 3KTQA 2YJFA 2DTOA 5I11A 3H8ZA 3IG1A 1K9MR 1CLQA 4FPBA 4DOWA 2UU9K 3BDLA 3VRYA 1YF5L 4BD3A 4CHPA 1QP2A 3MEUA 1RT4A 5JVHL 4A4FA 5J3BA 5A2QO 4QQGA 1T0JA 5GMKe 1QQCA 3ZT3A 3THYB 3ENHA 5LL6Z 1VQLQ 3TAEA 3G71A 5KH6A 4L6V5 5AQQA 1RAFB 1Y07A 5KYXB 3PIOA 3K5NA 1F21A 1YJ9A 2YHWA 3MXIA 1GCPA 2DVEA 5LJ3h 3OMGA 1BI4A 2HW3A 1KD1O 2W6LA 1K9MO 2AA4A 2O4XA 2K2MA 3QICA 2H3EB 5J2PA 4CJKA 3NGIA 2KHOA 3ENBA 4WFBL 4OB1B 3FJ5A 1ZBIA 1RBTA 3K57A 1MWKA 1IG9A 4C0GA 1EFNA 1Y71A 3RR6A 5AT1B 3CF5L 3M0TA 3JCMh 1S72A 1HPZA 3SB2A 3TREA 2NLUA 1IHWA 1U1TA 3VJPA 1OZ2A 1WA7A 3L42A 2QASA 4M4ZA 1NBWA 2P9SA 2G8WA 2JXBA 4JYAK 5KE3A 4K43A 4YDUA 2M1HA 4E7SA 3ZX0A 4B1ZA 1ZBLA 4E1NA 1WXBA 1NK8A 2I7NA 3F9MA 1BIBA 5CAIA 3CMAT 2D8JA 1SUQA 3A5LC 1NGJA 4EDUA 2VYPA 2DE0X 3WEEB 1NG2A 4JHDA 4ID5A 4O5BA 5GINA 4FK0A 5KCOA 5AQUA 1NGGA 1MGQA 3H1QA 4N4GA 3CMEA 3OYHA 2GQVA 2Q36A 3CJCA 3D6RA 3W3DA 4QOZB 4CHYA 4JI8K 2QAZA 1NK7A 1YI2Q 1JJ2M 1KLMA 4X34A 5M1PA 1U47A 3FC3A 1NJWA 1C0UA 1HJRA 4DMNA 1PKTA 3P83D 2CZ0B 2KQWA 1VQ5Q 1K6YA 2IOCA 3PNWC 3QWXX 4XU2A 1S6PA 5I22A 4C23A 5SWMA 1PKSA 1XNIA 2L3PA 1BCMA 3CMAA 4DTMA 3VERA 3VQEA 1N27A 1Q81C 1RBSA 4CJPA 2LQKA 2E41A 1MV0B 1X75C 3HRUA 3B8AX 3MN5A 4PKGA 4WQ4C 3ZSZA 1K8KA 3A2FA 2W41A 1KC8C 2YUNA 2IC3A 4Z4GA 2HHTA 1VQ4A 3O9QA 3DOKA 1RAIB 4OJRA 1QQMA 3AVGA 4JN4A 3DLLA 3QEWA 3KK1A 3SJJA 1QQNA 1SRMA 4LFCK 3CBMA 4BWJA 3K59A 2E12A 1SG5A 3VKIA 3CCMQ 1WXTA 4NXMK 3P4IA 4DV1K 2IIMA 1KQSS 1WLJA 5J2MA 2A41A 1JCFA 5E84A 4CGHA 4KHWA 4CZIA 3IQLA 1U2VA 4D6WA 1KQ1A 1GL5A 2MPXC 4E19A 3C12A 5D6WA 2VVKA 2W40A 4EZ9A 4DR4K 5GMKh 4AFSC 3VF2A 4DFJA 1RDAA 2DL5A 3MXMA 2UUAK 4O6JA 2CSQA 3LAMA 1BCOA 4FYDA 5KYWB 4L59A 3OYFA 5GAOr 1WSFA 5C12A 4OF1A 4HVUA 5BPMA 4FM1A 3D2EB 3SAFA 3IKMA 5GAHP 4ZN3A 1H92A 4BC3A 4CFDA 1BI0A 2GELA 4ILJA 2DILA 2DM1A 1LVKA 2EVRA 2OTLA 1BL3A 2RI3A 4XTZA 1X2KA 1DKGD 3L2VA 3CCJQ 1IBKK 5GAEP 3OS2A 2ABLA 3EHQA 2L3QA 2KAFA 4C8QG 3R1XA 2XY5A 2A42A 3CJ9A 1M90C 3UA7A 3KK3A 3RUXA 3KJVA 3HSTB 3TU5A 3VEWA 2DEUA 4FZXC 3TSQA 2JZ2A 4A63B 4WQ5A 2Y4YA 2F7TA 4CIFA 3QDRB 4FSVA 2BUDA 4LDYA 2YNFA 3MO8A 3ALYA 4HVVA 2LC4A 1QVFA 3VQQA 3CPWA 3DXKA 2YUQA 3OSSC 1O1WA 2LJ3A 3QNOA 3AVCA 2V26A 2K57A 1I5OB 2D0OA 2NRTA 1VQ6A 1TL3A 1B07A 4BRKA 4HCKA 1VRUA 5HLFA 2ITMA 4FIBA 3ATVA 2GCXA 4CGJA 4DHYA 3CC2T 2Z0WA 5HRPA 2O9VA 5IXFA 2B8AA 2XG8D 3QJ6A 2OJ2A 1RTIA 5E41A 1YUWA 1H3HA 1LWEA 4I6MB 3EY1A 2HQHA 1LOTB 2CP2A 4JKHA 2WUSA 3AGKA 2FRWA 1WN7A 4JI1K 3QO9A 2ESWA 4RW9A 1GOCA 5BREA 5M1FA 3MHXA 1LW0A 2QDYB 1MUZA 3QUIA 1XOVA 1IO2A 4AM7A 3RMCA 1TK0A 3QO3A 4DOVA 4XU3A 4YORA 1KSWA 3UT1A 2H8HA 4RTWA 3P31A 1UTIA 1WQ7A 4W5TA 2HVHA 2MAMA 5D7UA 2YNIA 4JK9A 5JS1A 1ZA1B 4M7DF 5KRTA 4CGGA 1D1CA 2VWKA 5AJ3K 3CC2A 3V7CA 2P9IA 5CZ2A 1N8RR 2VQFK 2WFBA 3ZT4A 4RG8A 3RMSA 4CZHA 4K0KK 5LJ3f 1RABB 1E4GT 3QIPA 3CCSA 1IGUA 1N36K 1WHMA 4C8QF 3SWNB 3L6QA 1VYVA 3H45C 1KD1U 1HD3A 2EYQA 2GFUA 4L5GA 3CXCP 1K9MU 3HBTA 5F0XA 1QWEA 1U06A 3VQAA 1VQON 1U45A 2CT3A 3VGKA 3RWUA 4HKEA 1FKOA 2HNZA 2DRMA 4FL6A 5C2DA 3FZHA 2LQWA 1ZBJA 3JCMf 3EGXA 1AZEA 4B1WB 1N8RO 4QS8A 2VWFA 4FXDA 5C25A 5EY4A 2P0PA 4OO1J 4IUVA 3HO1A 4R55A 4FW1A 3PX6A 5LJ3g 2DK3A 3T3FA 1M3AA 2X6SA 1PD1A 4EAHD 1BI4B 2XDPA 2O4XB 2Q97A 4GY5A 3MEAA 5GMKl 2PVOB 1HNIA 2NZTA 4LD6A 4NLCA 4CHQA 2QTVA 2F5KA 4CIEA 2BZYA 1QVGM 3TPQA 3M6GA 4DTXA 1YCSB 3JCMg 3P8HA 3LAKA 1BU1A 2NUBA 2K3XA 3JS6A 3KZBA 2Y1JA 5M1QA 5DM7L 1I3AA 3KKSA 3I56N 1YHQQ 2CZ7B 3EG9A 5GMKj 3F9KA 4H0PA 3WNEA 3S6WA 2FHDA 3DLRA 3QJYA 3J8AA 1OV3A 4JAXA 2OX7A 3Q1JA 4WCEL 1Q9XA 4JHDB 3EHRA 1NOYA 2GWKA 1NGEA 1C1CA 4BR7A 1C0FA 4JJNK 3HK2A 4E47A 4YY3K 1X9MA 1T6CA 4CF9A 4FJ8A 2KEAA 1BIZA 4DU3A 2HHUA 4CJQA 1G83A 3E9PA 4BC4A 4KREA 4FWPA 2AJQA 4J6XA 1QSLA 2YUOA 4PLIA 3H0FA 4C0ZA 3OJUA 3TAGA 1I8FA 1R0CB 2HNIA 4B08A 4CJEA 3EH2A 1WBBA 5M1NA 2KTQA 1C1AA 3AO4A 2Q3SA 2RM4A 4CI6A 4M42A 1QE1A 4CF2A 3X25B 5CHIA 1T0HA 1BI2A 1Q18A 1VQPT 4PJOF 4RMOA 4LD9K 5FRMA 1A5WA 1RBVA 4N56A 3TANA 4F3TA 1NE8A 2E5LK 4LH5A 1WJQA 2RJEA 1K8KB 2KZZA 3P5JA 4CC2A 3NH0A 4HTUA 4DSFA 2QKBA 2L8DA 4FM0A 3VRZA 3O1WA 3OYMA 3HP9A 4Z4HA 3SWNC 4C8OA 1B3QA 2RO0A 1VQKA 3NGYA 1DTQA 2IVOA 4ELTA 3CCRT 1PSFA 3ULRB 1YJNN 5GAOq 4DQ8A 3NMZC 2HHSA 1MMGA 3X20B 3TSZA 1JO8A 4M3TA 3J80E 1RDDA 1U2VB 1YJNT 1TL1A 4C5HA 1WJRA 3V9SA 1D1BA 2CDTA 2EQUA 4F16A 1M1GA 1WHHA 3OYCA 1K8AU 2QWLA 4CRIA 4FO0A 2NUPA 3E01A 1VQPA 4ELUA 1K73U 1WAFA 5IH2A 3DXMA 3ZSXA 3FZMA 3I5SA 4DTSA 3LALA 4GBQA 1RGIA 1UB4A 4ELVA 4YHHK 5GMKi 4PQUA 1OPKA 1E6HA 1V76A 3TR8A 1NJXA 1ZA2B 1YP5A 2BTTA 3A1PA 1Q86U 3QFPA 4BQLA 2OA8A 3DLHA 1SS6A 3NF8A 3V1QA 4JEPA 4CZGA 4WFAL 1XI1A 1ZSZA 3GNFB 3DLGA 2YHAA 3U9ZA 5CCAA 5C6SA 3ULEB 1N34K 5CE3A 1VAZA 3CCLN 3EG3A 1LAWA 4Z4IA 4YDUC 5I42A 3O1BA 3QB0A 1BIUA 4CJLA 1IBLK 3AO3A 2G8HA 2RK2A 1VSEA 3TARA 4FK2A 1HLUA 3VEXA 1U48A 3HM8A 1U8RA 3CCEA 1AHJB 2VCPA 2JM8A 1OI1A 2A0FB 3ZETA 2DXBA 4J2AA 2HBWA 2BANA 1WNLA 1M2OA 2CH5A 2QQRA 5GAOn 3G6ET 3C6UA 1RT1A 2F4VK 3OQ5A 2NUZA 4A5AA 2HMIA 2ATCB 2GTDA 2CGLA 3A8YA 2ROTA 1JLCA 4R0KA 4FJGA 3A8MB 4ZGEB 3LWMA 4LF9K 2E2PA 3CXCS 4CF0A 3CBOA 4AM6A 2EGAA 3CERA 3L3UA 1QCNA 2Q2RA 4C1NK 3RSEA 4J5YA 1K4US 1TKTA 3UA6A 1YNZA 3HYFA 3UE5A 3WXIA 1XNRK 4BGAA 4BB7A 4J7IA 3NAEA 1BGXT 1XC9A 4KRFA 4NB4A 5JLHA 3LM2A 2LX7A 4Y91A 3T19A 3SEMA 4AG1C 2DL4A 1ASUA 4LE9A 5EC7A 3PTAA 1LW2A 1VQOQ 2IGIA 3TABA 3I9QA 3X26B 4OVAA 5BR9A 1ACMB 5M1KA 3C0CA 1NMNA 3BDPA 1QQOA 3J81O 3VPZA 4HCBA 4A5BA 4QQ6A 4KGVB 1NGAA 1NNEA 1WQWA 4GLMA 3K9KA 3O08A 2VV5A 3BFMA 4B9MA 4LF5K 1RAEB 4LDWA 1HUXA 1AWXA 1VQNT 4JI4K 3CD6T 3OTOK 3GOXA 2P9IB 2QDLA 5LJ5d 3BY7A 4ISGA 4FWKA 1QVFP 1OYXA 3IMXA 3INZA 3MEVA 3S3MA 4O8UA 2DFEA 3E2UA 2FSKA 5ADXA 4X64K 5FU6B 1QLYA 2L3RA 1RNHA 3DRSA 3DMJA 3JCMc 2FVUA 4PKCC 4KO0A 3ZT2A 1NYGA 1HMVA 3HZ6A 4CK2A 3AGRA 1TKDA 2A6AA 1B92A 4XU0A 2QA4N 1LWCA 2D0QB 4O5VA 5AR0A 3THYA 4DSEA 2ZF5O 1Y97A 4FJJA 2ZJPL 2CH4W 3EGXB 3I55Q 3I56Q 2JWKA 4B1VA 5AQWA 5BPNA 4LF8K 2VASA 3S9HA 3HPHA 3KK2A 3I0RA 2DIGA 1VQNA 3TAPA 1GOBA 2X4WA 3AA4A 3PY8A 1Q81R 1OPLA 1J9AA 3A5NC 3HXMA 4DQSA 2DKGA 2K5FA 1MMDA 4WQ5C 1EZZB 2D0NA 3OYBA 1VSDA 2HMAA 2D4WA 1KC8R 1VQMT 2RKIA 2EQKA 4JKEA 2UXCK 3DLKA 4DV2K 2FBVA 2OPQA 1VSLA 5GAMe 1W2BA 1OOTA 3CCVT 1ZBUA 3OYAA 2DJZA 5L23A 1Q95G 4IUTA 3AAQA 3LDNA 4JK8A 1Q81O 3EG9B 3CQXA 4CESA 4E7ZA 1P8ZA 3SJHA 1HNZK 3CC7Q 3JB9H 2YKNA 1VQ8Q 2KGTA 1IG8A 3LYIA 1N9RA 1TV6A 1TTHB 3SI6A 1YITN 1UEBA 4E89A 3BEXA 4CEAA 4WFNL 3UPUA 3QETA 1O13A 4L3QA 1U3OA 5AQRA 3VQ5A 4UY8O 1JJ2P 3A5ZB 4DG1A 2XHBA 1UHCA 2CP7A 1FKPA 3AV9A 4LFBK 3CCUA 5GANd 1NJIC 2RMOA 1D1AA 4B9NA 4E7IA 3ZSOA 4KUDK 1KVCA 3ZEUA 4FT2A 5BPLA 3CC4N 4KRTA 3VU3C 3NVKA 2FBXA 2COWA 1SEMA 1BIAA 1VQLT 5ADXH 4R79A 3CCQA 2K6DA 1JXMA 3SAGA 2DBMA 1GRIA 2F69A 3CC4T 2V51B 5KE2A 2YV0X 1N6AA 3THVA 3SUOA 2P9UA 1JEGA 1XJWB 1M90R 1PRMC 3OYEA 2OTJA 5AQFA 4DR2K 1X3MA 4ZN1A 4FYYB 1AWJA 1RT2A 3MN7A 5FU6C 2V7ZA 2JOYA 1H641 4IG0A 4LFAK 3OYKA 1RTJA 3VTHA 2QEXN 1NEGA 3WXLA 1FXXA 2SEMA 1B34A 2Q0UA 2FF6A 3G4SN 2RQWA 3CQ8A 2O4IA 2GF7A 1M90O 2QEXT 5FWBA 3AA3A 3G25A 3KWGA 2GTOA 1NU0A 1NGIA 2V8IA 4DUYK 3GF5A 3QFUA 1ABOA 3QG1A 4J9BA 1IKYA 1YIJN 2NUPB 2QWQA 3LDQA 3DXMB 1H8KA 4BRHA 3SNNA 1YJWT 4KH0B 3AVKA 5FLXO 4LNPA 5BRHA 3MEDA 1MWMA 4CJ7A 4DU1A 2GGRA 5D6YA 1FMVA 4JLGA 2DMOA 5LJ3e 2HD0A 2LTOA 2MK5A 1GLCG 2GUIA 4FPAA 4CJ4A 1ZSZB 1C6VX 1L3TA 3MN6A 1WGSA 3LP0A 3EFSA 3K9JA 4IFVA 3MP6A 1S1NA 5L8RE 2Q0RA 1VQ5T 2OAUA 2W0ZA 1S1UA 1G15A 2YJEA 4CVNE 4BDYA 4GLKA 3AVHA 3HOTA 4KUIA 2K3YA 3JCMe 5GAMh 2E8AA 1BG3A 3VQ7A 4BR5A 2WTUA 4B8CA 3V7RA 3ZBDA 3IUCA 3H08A 4BRPA 4B1UB 2HBPA 3C7NA 3TSUA 2GV9A 3TEEA 1HKGA 1GXIE 2JGUA 1Z6RA 4FM4B 8ATCB 5TKYA 3EG0A 4QS9A 1YCYA 1ATRA 3ZETB 2X35A 4CFBA 2P0QA 3WNHA 1UGQB 3CCMT 2X51A 3SUQA 1HNXK 4GV6A 4PLLA 3OA6A 3OYNA 1YI2A 2KYBA 1RAGB 1QVFS 5BR8K 2QWPA 1QS4A 4J6WA 1TKZA 5CQYA 4AHRA 2RB6A 3G10A 1TSFA 4N41A 4OMLA 2LCLA 1VQ5A 1O9SA 1NK0A 1X9WA 1VQ7Q 1VQ9Q 2K79A 4AMCA 1BHLA 2NRRA 3VA3A 3QYGB 1RDCA 4KH1B 4FLVA 2CKKA 4M75A 2NLXA 3RSEB 2AT1B 3I35A 2P9PA 3K5MA 4M78A 1RLPC 4DV3K 3V7SA 4QKUA 5EX5A 3CFPA 3O9TA 3G71N 5B8HA 5CKEA 3SQ4A 2DZCA 1L5UA 3RMDA 3CCMA 3O3GA 4MDXA 2EYYA 1AWOA 1YJ9N 3NCIA 1HXDA 4HUGA 2WOMA 3G71T 2UUBK 1HSQA 1PC0A 2ED1A 1KSPA 4PA1A 2KQ2A 4KGZB 4XTYA 2BE7D 2P4TA 1EETA 2E65A 3L2RA 1TGOA 4DSLA 2PZ1A 3KLHA 4AHVA 4KTZA 2IVPA 2UYTA 3DWLA 3MP8A 2X6NA 4E7HA 2EX3A 1HYSA 4FWSA 2KT1A 1S9GA 4AF1A 4XEIA 2X4XA 1YT3A 4O44A 1KK7A 3WXKA 4KHSA 3V9UA 1S72T 3HPGA 2VYTA 4CK1A 1QVFM 3CPWM 1GFDA 4RW6A 4FWMA 2LX9A 3BW1A 1ZX6A 2ZGZA 1VSMA 4HXJA 2RN2A 4HCZA 4YOWA 1OH5A 2YNGA 2OCEA 4F3OA 2PTKA 1ZSZC 2J6KA 5HROA 4KKOA 4KBMB 3CCJA 3PSFA 5C10A 4M3WA 1IJJA 1JJ2S 3OYJA 4RW4A 5AQNA 2R5MA 4C92F 2M02A 4CJ3A 4B9SA 1NJYA 2F9WA 4DU4A 4BR9A 2EYZA 2YLBA 2GX9A 1QVGP 4AILC 4DF4A 3VQDA 1FK9A 2JTFA 3H0HA 4J9IA 3L4IA 1I07A 4CZMA 5JVGL 4F7UA 3CMET 1KVBA 2VG7A 3F73A 1J3TA 4WCIA 2XU8A 5LL6S 4U67L 1JLFA 3R8EA 4W5NA 2HF4A 4Y92A 2P5OA 4DTPA 3M8PA 4FJ7A 3CMAN 4FZYA 1SRLA 2B4JA 1SHGA 3C0BA 1SHFA 1LJOA 1X43A 2FG0A 1X6GA 2RQTA 4BR0A 3NTKA 1W70A 1BWFO 2GBZA 4ICLA 3M5AA 4J9HA 5I2SA 3EE8A 1VQ4N 2P9LA 2WACA 1NWKA 5CY4A 1B7TA 2YUPA 1PG5B 2DXCA 1HQUA 4IFEA 4AHSA 5LMNK 3E9LA 1VQ4T 4FW2A 3VYGA 3H46O 3DLBA 4J9DA 1TH7A 4J8OA 4RUGA 1VSKA 5IT9E 4G1QA 2O01E 3WUHA 5I9EB 4B3SK 3VS7A 3FIFA 5CKBA 1Q7YC 2EHGA 2E2QA 3AO2A 1N5YA 4B9UA 3GLXA 3V6DA 4M7AF 1ITGA 1S1XA 3DAWA 4MFBA 4IG3A 3ZEUB 3O80A 1D0YA 3RRHA 3V8KA 3G4SQ 3KBGA 5HOOA 2XDBA 2Z1HA 3C95A 3PGGA 1MNDA 3LL3A 4I9LA 5KPRA 4IIOA 5KCHA 2NYSA 4M77A 4M75E 2F2XA 5AQSA 6AT1B 2P9UB 1YIJQ 3Q7BA 1DT9A 2QXLA 2J06A 1M90U 4E7KA 1UGVA 3K2PA 4GNIA 3DRPA 5CK9A 2OTLN 5T7BA 1W2BP 4FK4A 3UIQA 2CH6A 3E1YA 2FPFA 2ZPHB 4OPJA 4Y0WA 1ZXOA 4C8KA 3H9NA 2OTLT 1HPMA 3I8DA 3QHSA 4LUEA 1B34B 1YHQT 5JMVA 4IOAL 1WYXA 3RESA 2DY4A 3REBB 4FLYA 4JRQA 2EJ9A 3OS5A 4B6MA 1RDBA 4CERA 3QBYA 3RDVA 4KI4A 2J6OA 3VQ9A 4DV0K 2VKNA 2A5XA 1S1WA 5GAGP 1T03A 2NRWA 1M8VA 4KB1A 4I2QA 5GAMf 4J9FA 4ZGJB 4PHTX 1C0GA 4KHUA 4JJCA 1XQSC 1QCFA 1VQ6N 3MWPA 3PIPA 5FPEA 3HHTB 4DV7K 2YHYA 1HKCA 4E1JA 4DTNA 1VQ6T 4AHCA 3WT0A 3NH2A 3WQTA 1I4K1 4K25A 5IN1A 2LJ0A 1YHQA 3MN9A 3K0SA 1FMWA 5HRRA 5A0DA 2KRSA 1JLAA 1GLLO 3M8SA 4Y1CA 1BI1A 5GAMg 3PVLA 3M8RA 2K3BA 4K41A 4F7UE 2G8KA 1LCUA 3PT9A 2HB5A 2KT8A 4DQQA 4AHUA 4B9TA 5AQOA 3SQ2A 2DZ9A 3C7NB 1NK9A 3VS5A 2DRKA 2BE9B 5LJVA 3BDUA 1W1FA 3CFRA 4B9QA 1JRIA 2HEQA 1E7OA 3QKJA 3HKSA 4FU6A 4QVZA 4DFKA 2GUPA 1BQMA 4CBUA 4Y1DA 5LJ3j 2QGFB 1SV5A 3VEYA 3U3GA 1QZ6A 1TVRA 3AARA 2XI9A 3RBBB 4HT8A 3C6AA 4FJNA 3CC2N 4MDWA 3OS0A 5IAYA 3ENOA 3ZFJA 1LNXA 2AK5A 2DLPA 2PUKB 1QZ5A 4QS7A 2BTFA 3VQ4A 2VB6A 4CECA 1QP3A 4EP4A 2PU9B 4J2DA 2PBDA 4CHOA 4E7LA 1M4ZA 3E9GA 4M75B 3FLCO 3CCST 3LLRA 3OMCA 5CYQA 4FLUA 3BUZB 4QVDA 1NK6A 3OW2A 4BY6B 2P9PB 2JS0A 5CKHA 4PKIA 5IWAK 2GNCA 1Y7XA 1K1ZA 2D9TA 2L5QA 4M78B 5KYNA 1AT1B 3R6OA 4BREA 4CJWA 2MWOA 2RF0A 1QVGS 2QI2A 2XIDA 3P8DA 1OH8A 3W0LA 3WVEB 1KVAA 5LJWA 4HVJA 3R6MA 3C6HA 5EU7A 4MZPA 1RAHB 2PY5A 4NCBA 2XK0A 4M77E 1NKBA 5IHKA 4O5FA 2ASPA 3KD5E 5J26A 4IDKA 3E1SA 4JPBW 2P9KA 5H1SQ 2G8IA 4XH1A 3URGA 3V1OA 4BE1A 4F2SA 4XH5A 1T6DA 3SUPA 2XICA 2JMCA 3CYMA 4HUEA 2GQIA 3JB9D 5DY9A 1BBZA 2EAYA 2JJ9A 3OYYA 2Y90A 4W5RA 8AT1B 1WHLA 3OJSA 3O3FA 2J7IA 1CZ9A 4F9OA 2M0OA 3D7EO 4Q5WA 3K5OA 2L3SA 3LH5A 1NJIR 1A5XA 3SHWA 2R7YA 3EO3A 3EG1A 3MPUB 2O8CA 3RIRA 2JTMA 4KH5A 1XHXA 4B3MK 1ARKA 2RQVA 1L3UA 3HTVA 1GLBG 1MNEA 1KIKA 3JCMb 3HM9A 4AG2C 4GV3A 4DBFA 3JCMJ 3GDQA 1WSGA 2X4YA 3MCAB 3JAME 1VSFA 3KXTA 4F7UB 1HR0K 2W10A 4DSKA 2IAJA 5JICA 4WF9L 2A36A 4DEYA 3HFNA 4CJUA 1RBUA 3M57A 3JV3A 1WHKA 1TKXA 3GBQA 4C0FA 5K14A 2VGNA 1BISA 3JB9J 2E1YA 2HSEB 5AZJA 4FZZA 4Y28E 4OKJA 2HHQA 3EFOA 2EQMA 4F14A 4BR4A 1W2BS 2XD0A 5AQZA 3J80O 1X01A 3O5ZA 4OMPA 4BE2A 4BRAA 2PVDB 2XY7A 2K5IA 4H0YB 4BI4A 4OP0A 1JQQA 1NMDA 2P9LB 3M58A 1WBDA 4PFOA 2CP6A 3ZCMA 1VQKN 1M27C 2KXCA 3LH0A 2YSQA 4A61A 2KK4A 2FRYA 4M75C 2WONA 4CGIA 4LSNA 2I2LA 4TSXA 1UDLA 1VQKT 3NVMA 4BY6C 3SUNA 4C8LA 3FB9A 3OYGA 4M78C 1VYUA 5EXWA 4CEEA 4MMKA 1VQOA 2QQBA 3SK3A 1BOTO 1SL0A 3QINA 2BH1A 2XRIA 2YT6A 4DV5K 1VQPN 4QCLA 3HOSA 1WFWA 4JKCA 2VUBA 1IO6A 4DEXA 1ATNA 1N32K 3V8LA 3FEOA 4YOTA 2VWJA 2KY9A 3MJXA 4M77B 3CIPA 5TKWA 2F8SA 1KD1C 4MZTA 4WTOB 4KHYA 4M7DA 4BRMA 3QEIA 1WHJA 5FPDA 5KGXA 5IHNA 3NTIA 1EO1A 1BYMA 2ZPFB 1ASWA 1VUBA 1BA1A 2R5AA 3VQPA 4D8KA 4MO5A 1KHIA 3B6OA 3CCRN 2C0OA 2VWBA 3H1VX 2FBTA 4M7XA 4C8QA 1ZLMA 2E10A 3A5OC 1B9FA 1K0SA 4BRGA 1W2BM 3PUFA 2X78A 4FWLA 3HFOA 1WAJA 3SPZA 1Y0MA 2ZD1A 3I56A 1D0ZA 3I55A 1M1KC 4PUOA 1AVZC 4AFQC 3FZFA 1JLEA 3CC7T 3CCEN 3ZLJA 5DLOA 1UOCA 2YHTA 3I5RA 1VSJA 1F1BB 1BA0A 2K5LA 3AHUA 4W5QA 2QM1A 2IPOB 2IDOA 2YRDA 2ZWHA 4B9VA 2PQWA 3CCET 1KQSA 5GJVB 5ECAA 1JLGA 2FSNA 5JLFA 1W0HA 4KHNA 4ISEA 3M54A 4JK7A 1JBMA 4RCCA 4FVUA 1VYTA 4DF8A 4GVMA 3OYLA 3TQ7P 3DKMA 3FFKB 4F8RA 1HKBA 3BZCA 2CP0A 3L2ZA 1JL2A 4ORZA 2XY6A 3SPYA 4FJLA 4JLIA 3EZWA 4JKGA 1DJ7B 3IS9A 4Q5VA 2I7PA 2B5JA 4FWNA 1UGSB 2FZCB 4RTYA 1RILA 3T9NA 3REAB 1J6ZA 3CC7A 4H5NA 3ZT1A 1WZOA 4F17A 1VQ8A 3DOLA 4KH6A 4E1MA 2O8BA 2DA9A 4N76A 1GLDG 2EQIA 4B8AB 1SKSA 3UKRA 5AQLA 1X6BA 3M53A 3OBWA 5IHIA 1M8MA 2COZA 1AZGB 5A0GA 3GIBA 3LPUA 3LP1A 4OLBA 2Z1GA 3G6EN 1LV5A 5DM6L 3O4NA 4CEFA 2HQXA 1YVNA 2IS3A 4CK3A 1ZHIA 4FVMA 3M8QA 3RR8A 5KQ8A 3ULDA 2O8FA 1T7PA 4DS4A 1NGHA 4OB2B 3OS1A 4BVOA 4CJ5A 3IAYA 3DB3A 1MDUB 4IWVA 1L3VA 2B86A 4BACA 2UXDK 4N0AA 2DXTA 1S1TA 3ZSYA 2CUDA 2ZGWA 2HAXA 4XU1A 3VS2A 3O4QA 4JLHA 4M77C 1EXQA 4O0JA 2ZM6K 4BRIA 3E9OA 4MO4A 4FL9A 1JXEA 4PJOA 3FFIA 3TAMA 4CF1A 1I81A 4LF7K 2F96A 1RUWA 2QYZA 2LSNA 2ZPIB 3HT3A 4JJBA 4EIKA 1UAXA 2P84A 1UG1A 3A8HB 3AVJA 2EYXA 3AVBA 3ISNC 1YTAA 4MLHA 2HDAA 4PNOA 2KLAA 3H3NO 1VSHA 3PMTA 1Z9QA 3QXEB 2D5RA 3MDQA 4AFZC 5GANe 1K8AC 4DKWA 3V9WA 3EEQA 1RTDA 4DQIA 1G3YA 3U23A 4H5TA 2D1XA 1K73C 4BWMA 3MAQA 4CJFA 2FPDA 1VQNN 4M75D 5KPZA 4NL3A 3O8MA 3L4QA 3CD6N 4BVPA 1XUPO 3ME9A 3JCMW 2JT4A 3M56A 4CW7B 4M7DE 2P9KB 4CF8A 3AO5A 1OZ3A 2I0NA 4M78D 1WSJA 1Q86C 2H3JA 4DR3K 3S41A 4DLEA 1K76A 4ZHRA 2ATQA 2BGGA 3JSMA 1RT3A 1N8RU 1NYFA 3O5BA 3CPWP 3M55A 3PIOL 1WB9A 1GCQA 3ZT0A 3D7SB 3KFVA 1ILYA 4HT9A 5C2FA 1J5OA 1NEBA 3QPHA 3HSCA 3VETA 2HKNA 4YTLA 4CC4B 1Q7YR 3VF6A 1H3ZA 4RWTA 4A2AA 4DQ2A 1QMCA 1TUDA 2O8CB 4QQDA 1VIFA 3QWYA 1OULA 2KYMA 3IRXA 3LZIA 3SZ2A 2D6FA 1VQ9T 1VQ7T 3M3ZA 4BGBA 2D1KA 2PYLA 3OSVA 3C4SA 1NM1A 2V52B 4OKEA 1Q9YA 3L0QA 1VQMN 1ZBHA 3CCUN 4XTWA 4CJRA 4H8KA 3UB5A 1OVQA 3PFSA 4PJNA 3LDPA 4BRCA 4M75G 1E4FT 4FSXA 1L3SA 2ED0A 2L2PA 3CCUT 4K11A 3CCVN 3O3HA 4HA8A 3VQBA 1QWFA 4JV5K 3ITHA 4B1YB 3CCQN 1OH7A 1NPRA 3MMVA 5GJWB 3ER0A 5FU7B 1KCFA 3RKXA 1Z26A 3KIOA 3E66A 4JD2A 3RR7A 3CFOA 1YWOA 1SF9A 1G3TA 2DETA 3M0RA 2RF2A 5AZJB 2H3GX 1IRXA 3CCQT 1W9HA 2OPRA 5BRFA 1EP4A 2I5JA 1FJGK 3UDCA 5GAN8 4CBWA 2RHKA 1C1BA 3EFOB 2OTJN 5DK5A 1M30A 4X9CA 3KVGA 1QKWA 4NCGA 1KC8O 4GV9A 4H0OA 4A59A 1VQ7A 1VQ9A 3LDOA 2LMJA 3DI6A 2HVIA 2OTJT 3SBTA 1KXPA 4DFMA 1GBQA 3EG2A 3NF6A 5EOYA 5FPNA 1SL2A 2ZPEB 5GAN7 4YNQA 2QTXA 1SSFA 3M0SA 3EGUA 2O4GA 3F5TA 1S22A 1XMQK 2HBMA 1SSHA 3CCRQ 3BY5A 3T7ZA 2EGCA 4CD1A 1VQLN 3V9ZA 1ZUYA 2RD1A 2ROLA 4NCAA 2RK1A 2E3HA 2JWLA 3DJCA 1EKEA 1OU8A 5SZTA 2RJFA 3PE0A 3GP8A 1YJNQ 3NBPA 3M9QA 3DLLL 4CHZA 2QWNA 1T3SA 3L2UA 4KPYA 2KI7A 2A7YA 1NJZA 1A5VA 2O9SA 2YRVA 5GANh 4PJOE 1OKJA 3CQYA 4W5OA 4DQRA 5C0MA 2KRMA 4OGEA 4WF2A 4M7DB 5GAN3 5CVIA 2CGJA 4GY2B 3HPOA 3IFRA 2FO0A 3PX4A 4OB3B 3AVFA 4FT4A 2A1RA 3H3OB 2ASMA 4H0XB 1RFQA 4RW7A 4F7UG 1C6VA 5CYMA 4M3ZA 5F1XA 4NL2A 3DM2A 4B9XA 1KFZA 4RCBA 4M77D 4C8QB 3GE1A 2K4YA 2HCKA 1M5Q1 3MECA 4M3XA 1NKEA 2P51A 1YAGA 2A1SA 3FZKA 5DLQE 2AZSA 2QQAA 3CCLQ 1UFFA 3M4YA 1D9FA 3JRZA 3VS3A 4HWIA 4GKJK 3AY9A 3P39A 4BRNA 2A37A 4CZFA 3X24B 3LWIA 3CJBA 1YJWN 4E0DA 2PVGB 1IKWA 3G1JA 1LOJA 5J1EA 4ESRA 2SRCA 4IDHA 4KTWA 4M3RA 2E6ZA 5C42A 4RTVA 5J2QA 1D5AA 4J7FA 3G6EQ 3HJFA 2QW9A 4R5PA 4NYNA 1NPPA 1YI2T 3FJPA 2E2OA 4M41A 2EKOA 4CC7A 2DERA 4YOVA 5FU7C 2YHBA 1VQ5N 1HYZA 4JKGB 4JNEA 3JYTA 4V19S 1JB0E 1T05A 1BUPA 2E3IA 3SQ0A 1CKBA 2MCNA 3VUZA 2P1JA 3EAEA 5FROA 2E20A 3JSCA 4FOIA 4N47A 4LD0A 1K0XA 2JLEA 1CZBA 1RTHA 4K42A 3EFRA 3KLIA 5AQGA 2O8BB 2DTHA 3TTDA 2P0KA 4M77G 2NWMA 2VXFA 4M63C 3GNGA 4V2SA 2FXUA 3VS4A 4EFHA 3EYZA 3UKRB 1TUYA 2NRXA 2RN8A 3L2WA 3O4WA 4PJMA 3CCMN 4IEEA 2LQ8A 3TI0A 4H5WA 3QEXA 1NKCA 1ASVA 3V1RA 2CZ6B 3V8JA 1EIFA 3THWA 2QXFA 4DA4A 2WBNA 4XH4A 4OMMA 5LMUK 1XTDA 4CGDA 3V81A 3AAPA 3MEGA 4IKFA 2O8FB 2RHXA 2XDDA 2CREA 4KULA 3CPWS 2Y4XA 4FWRA 1WI7A 3HRGA 3VEOA 2RHIA 3G4SA 3TAFA 4B3TK 2VG5A 4X1VA 4DBRA 2ENMA 1WDXA 4DTOA 3WNGA 2PNIA 2WC9A 1MA9B 9ATCB 1ZSGA 3I33A 2RJCA 1KAZA 2F1LA 4DWIA 2AHJB 5GAN4 4F04B 1YIJA 3AT1B 1D09B 3H0IA 1N5ZA 1Q8IA 3KKRA 4M7DC 4PJOB 1PCXA 4HHTA 4B3RK 2BUPA 1UGRB 1NGDA 3J7AP 4DS5A 3M0UA 4HCCA 4Z94A 1Y64A 4J2EA 2QKKA 2KROA 2ZZDA 2DVJA 1W4SA 1RAAB 3SBGA 4JS4A 3CXCA 1CZAN 1R59O 2XMFA 2HBLA 3ZSRA 1PM3A 2PYJA 2DF6A 1Q82C 4C8QC 1DGKN 3DYAA 3QEPA 2LP5A 2QA4Q 1D9DA 1XWLA 3CCJT 1NGCA 1WSEA 4AT1B 3I0SA 3IDHA 1LWFA 3QZ5B 3BGRA 3VEZA 4VUBA 5GAN5 2XY8A 4MDAA 2A08A 2BIVA 2V1QA 3A98A 3HVRA 5GAOl 3QDKA 2E64A 3LDSA 1WPYA 4C8NA 2ZPBB 2VQEK 1S72N 1JXBA 1VQMQ 2EFIA 1RBRA 3X28B 2EW3A 2AP1A 4A57A 4ISFA 4MQ3A 2YRCA 1TOVA 2HNYA 3CEYA 2HSTA 4JS5A 3SMSA 1S9EA 1GLFO 3WVDB 5IT9O 3CCVQ 3VGLA 2OANA 2O8EA 4BE0A 1HNWK 4JI2K 2E5KA 5AZIB 5KQDA 4DBHA 3D0PA 3LX7A 2CGHA 4H0TB 4C0DB 1VSIA 2KZMA 3KLGA 3META 4LC9B 4IIMA 4FJHA 5HP1A 3U4LA 2RNAA 4BROA 1U6ZA 2CUBA 3QERA 3JCMP 4R56A 1TYQA 1YVUA 2VG6A 3VS0A 3QIOA 2M16A 1AWWA 3FE1A 3FLGA 3CMEN 2LT4A 4EMKA 5EVZA 2HSPA 2LT1A 4G9ZA 2RI2A 2MMPA 4IUUA 1KD1R 1YITQ 2DIQA 1Q81U 1VK0A 1FW6A 2FPEA 5LJ3d 3ASKA 2OPSA 1T44A 2KFZA 3E19A 3OW2M 4C5GA 3DB4A 3V9XA 1KJWA 5KGWA 1KC8U 2LNVA 4FJMA 4Z89A 2V8KA 3N4PA 5AQVA 1TXQA 4A4KA 2FBYA 3FDRA 3WQUA 3PO4A 1WX6A 4DQPA 3PVQA 3P1GA 5I21A 1HYVA 1FYNA 4JD2B 2LQNA 2QGGA 3CC4Q 2QQSA 1HJDA 3JCMd 4BRFA 3F70A 4PWDA 3LZJA 2EWNA 4Z02A 5C24A 2COYA 3JB9I 4GVEA 4DV6K 1AD5A 2EQJA 2RPNA 1M1KR 5FWCA 4N0AC 3LM9A 3SAHA 2WSEE 1W97L 1D3BA 2FSJA 3RMAA 1Z05A 2WSFE 1JLBA 2D8HA 2DO3A 4FJXA 1IH7A 3C6TA 1YWPA 3O8VA 5CKDA 5GANf 4PJOC 5C15A 4JDSA 2CT4A 3QESA 1J5EK 4OPKA 3F2KA 1A0NB 3VA0A 3QNNA 2NRHA 1OQKA 5AQPA 5HCKA 3B6PA 4B1XB 4BRLA 2QEXQ 2B6AA 1M1KO 2O8DA 5GAMj 4X65K 3P8BB 2GWJA 3SMPA 5LY3A 2OAWA 1X3NA 2JS2A 1QHTA 2DAQA 4Z4FA 4OMQA 3KHYA 4E3SA 3RMBA 2HHWA 1WIEA 1LPLA 4CEOA 2BZ8A 2CP5A 4CZKA 1YBYA 5GANg 4CEBA 1X2QA 1YJWQ 2YDLA 1U4BA 2GFAA 3ZYYX 4EMHA 1YN8A 2FZGB 1V1CA 3FZLA 1G8XA 4M78E 2AKKA 4FSSA 3CQTA 1J53A 3RERA 4FYVB 1RDWX 3SV4A 1X27A 1N6QA 2ASOA 4OPAA 4DTUA 2DTUA 1GCQC 3PX0A 2MF2A 5A2QE 4KI6A 1YHQN 1EWQA 3UF4A 3EKUA 1FWZA 4X9DA 4AFUC 4IJNA 3R6NA 4JKBA 1KQ2A 2YKMA 4EP5A 1UWBA 4KAZA 3NTHA 2QTDA 4FWQA 1JL1A 2HBJA 3AA5X 3LGFA 4M7DD 4F2RA 1Y57A 3LW5E 4C0DC 1ZC6A 3BZKA 3GG4A 2DPNA 4JI3K 1M1FA 5HRNA 4DTJA 4JKDA 2YXYA 4N4IA 3T1HK 4X66K 4C92A 3ZSVA 1TU0B 3WNFA 4C8QD 2BE2A 3D2FA 4HVWA 1NZ9A 4IO8A 1V4TA 3THXA 4BY9C 2KE9A 4XTUA 1XNQK 3LPTA 3OYDA 4KT0E 4DTRA 2E6MA 2NRVA 3M59A 2PAVA 4YOUA 2M51A 2QQ9A 3L1AA 4BI3A 4IZ9A 3VGMA 3MEEA 1PWTA 1CXUA 5ELZA 5CZ1A 5GAOp 2D0PA 3GOIA 3QLHA 1K8AR 4ILHA 4IUQA 1D4XA 4OMFB 4I9QA 4C5EA 4FWOA 1GFCA 1K73R 1DTTA 4EMGA 1YXQA 4JKAA 4YFUA 1H1VA 2EJFA 4J2BA 1GLEG 3GPLA 3ATUA 1G5VA 4OPHA 4BUGA 3AA2A 1Q86R 1PHTA 2YHXA 2KSSA 4UC4A 5DMRA 2OYQA 4M7DG 5KPTA 1UA1A 1K8AO 5CQXA 4J9CA 1K73O 4C8MA 4NXNK 1WOQA 3VESA 3JXUA 3THWB 3HPWA 3G71Q 2LRQA 3C94A 1BO5O 2YX6A 4ID1A 3D45A 3UKUA 2X3XD 4ANJA 1YJ9Q 4LF4K 2FZKB 3K5LA 4M7AA 1OEBA 1HQEA 1Q86O 4F4KA 3OA9A 1WLPB 1XC3A 4JRKA 4Z88A 1N9SA 2Y1IA 4IFYA 3CCSN 4CJSA 2EPDA 4OKKA 3VQ6A 4JI0K 5C0YA 2DX1A 4CEQA 1P92A 4AQYK 1S3XA 1ZQ1A 2C0IA 1D8YA 1S72Q 4AH9A 1UECA 1RI0A 1NLVA 1KQSM 5AQHA 3JAMO 2IG0A 1AEYA 3BF1A 4DB3A 3LDLA 2ZE2A 2OZSA 1KAYA 2DL8A 4DBQA 2F5TX 1ATSA 2FL7A 3NFAA 3O9UA 4CJVA 4E2FB 2XHCA 1Y96A 2CS7A 2KRNA 3OHRA 3O6WA 2ITGA 4PJOD 4BQZA 4Z8AA 4D8DA 3LWLA 2NRZA 4N4HA 4JKFA 4OVLA 4OMNA 1M2VB 4J8FA 3MK6A 2P9NA 2O2OA 1NM7A 3A8LB 2YI1A 2QK0A 1FX7A 2ZCFB 2P4RA 3FRNA 3CMEQ 4H0VB 3L8BA 1UJ0A 4OGCA 2ZJQL 4PY5A 4WE1A 4JUVA 1LAVA 3AVNA 4O55A 1G99A 3A0IX 4A53A 5CR2A 2FLOA 2CSIA 2E6NA 3EE9A 2DJQA 1M3CA 4B9WA 2EGEA 2G6FX 2E1ZA 5GMKm 3AVIA 3NHNA 2O8EB 5MLCQ 3KLEA 5HL7L 3VMFB 3MX2A 3CMAQ 1S1VA 1IB8A 3A8OB 4RTFD 3MCPA 1C0TA 4PFPA 4A4HA 3N4QA 2DL3A 4C92E 1KHCA 1IKVA 4CFCA 2A3LA 3RMQA 1TYQB 2HKQB 2HHVA 4LXCA 1PSEA 3KD1E 1WSHA 1KAXA 1VQ4Q 3NH1A 1JXOA 4JI6K 3R9PA 5CIUA 4EMKB 4MZMA 2JVVA 3V4IA 1CKAA 3TTFA 1ABQA 1NJIO 1P90A 1TG0A 4FYXB 2FB7A 4PJOG 4RW8A 1JJ2A 1ZUUA 4FLXA 4PJLA 4FJKA 1UE9A 3MXJA 1VQOT 2KMTA 1R0BG 2J6FA 4JZ3A 3G7ZA 1QCOA 2RI5A 3ZSWA 5GAN6 3JB9G 4RTZA 4P5NA 3SCXA 1O75A 1PNJA 4CI0C 3CPFA 2RE2A 1HK9A 2DBKA 1KFDA 2HNDA 5CKFA 2HF3A 4Z4CA 5BRDA 4DLGA 3ULEA 1MHNA 1M1KU 3AVAA 2ECZA 4IXCA 4LY7A 2NNWA 4EHUA 1D3BB 1WJSA 2C06A 3J7AF 2D0AA 2PFUA 4Z0UA 5KI6A 4CC3A 1LCKA 2WSCE 4FM2A 2NUTA 5F2RA 4BR2A 3ZL7C 1RACB 2JMAA 3MKDA 3KLFA 2OTLQ 2HL3A 4Z4EA 4CGFA 3I55N 2P9SB 3PO5A 1IBMK 2LNHB 4M7AE 1ESVA 3VF4A 1BI3A 1RLQC 4NLBA 2O8DB 3I56T 3I55T 2O88A 1OH6A 3EL2A 2RJDA 3SD4A 1SAZA 4BG8A 1KLNA 1ZBXA 3U9DA 4B9LA 2FF3B 2OPPA 4M3YA 4FOEA 4II1A 1TUGB 4PL6A 4CZLA 1VQ8N 2ZGYA 3TCJA 1KTQA 1RCHA 2RPIA 3RRGA 1K9MC 1WNSA 3QBWA 4A2BA 2GTJA 1YTUA 2VC8A 2YNHA 2LCCA 4XTVA 1ZUKA 4EZ6A 3N5BB 1U1SA 3NHGA 5HRSA 5FDLA 4L8RB 4OX9K 5GADP 4OLAA 2LJ1A 2OZMA 3THKA 2KNBB 1CXQA 1TUCA 4MMLA 4YOXA 2K2VA 1W7AA 1E3MA 4PK4A 2DTIA 1VQ6Q 3LP2A 1UA0A 3S3NA 1HJOA 1OVYA 4JRIA 4EPCA 3CI5A 3CC7N 5CR4A 4M45A 3CJ1A 2FYKA 2ZJRL 3C65A 2RH2A 2MYSA 4FLWA 3ZX2A 1U04A 1XMOK 4BC5A 2L89A 1VQ8T 4DUZK 4RCHA 3OB9A 1QVPA 1QSSA 2KDSA 4RTXA 2JNGA 2YLCA 3OYIA 1I5LA 3R3LA 1TK8A 4BG9A 3RKYA 1SPKA 1U5SA 4C92B 3JB9F 4IO9L 4EMKC 5LJ5e 3D2FB 3QBXA 5J2NA 1VRTA 3EKSA 1BKBA 3THXB 2ZPGB 3G0ZA 4DR6K 2E2NA 2XO7A 4H5RA 2CYZB 2DYIA 3ZSQA 4IJAA 3CETA 4DSIA 3A8GB 1NG9A 3PLAA 4ELYC 4EIAA 2AIRB 2E6LA 2DL7A 2DFFA 5AQYA 1TAQA 4EHTA 4H4OA 2F9TA 5KYYA 4OB0B 3QZ9B 3VS6A 2CGKA 1Q82R 1RT5A 2G8UA 3CC2Q 1QQJA 4HUFA 1WHGA 1JCEA 1AOJA 5M1OA 1JCGA 1TS9A 3L3VA 3NE6A 2V8JA 4AHTA 2EYWA 3CCSQ 1JKHA 1SKWA 2BZXA 3RNJA 2LDMA 3MEWA 4LSLA 3DLEA 5HBMA 2HL5C 4DR5K 1N33K 4KHPK 3M4GA 3HRTA 2V1RA 3UATA 2LCSA 4QAGA 4N5SA 1Q82O 1IREB 1T3VA 3QYHB 1JLQA 1V29B 3CCRA 4CBXA 4RKUE 5KYUA 3RVCA 4IBNA 5AYFA 5J39A 3UKUB 1I1JA 1WXUA 5FW9A 1YJNA 3CCLT 2HHXA 4M7AB 4NYFA 4JJDA 3SDZA 3QEVA 4LH4A 3LANA 3GBTA 2Z1JA 1BDGA 2KKZA 4OMOA 3NF7A 1X6OA 3HP6A 1QSYA 3ID6A 3ASMA 4IUPA 4BDPA 3NGPA 1REVA 1W6XA 2GBQA 4ZTFA 3DXKB 3HTRA 5HK3A
chains in the Genus database with same CATH topology
2EHGA 4R5PA 4NYNA 2HNZA 1FKOA 3AO2A 1N5YA 4B9UA 3RWUA 3V6DA 1ITGA 4KB0A 1S1XA 4M41A 4MFBA 4IG3A 2YHBA 3RRHA 4FXDA 1HYZA 3TWHA 5C25A 3JYTA 1T05A 3HO1A 2Z1HA 3C95A 4FW1A 3PX6A 3AVMA 4CE9A 2P1JA 4I9LA 3T3FA 1WSIA 2X6SA 5FROA 1BI4B 4N47A 4LD0A 2JLEA 1ZBFA 1CZBA 1RTHA 1HNIA 3KLIA 4CHQA 4CIEA 4E7KA 3EYZA 3CM6A 3K2PA 1ZYQA 3DRPA 2FC0A 3L2WA 4DTXA 5KRSA 5T7BA 3TI0A 4FK4A 3LAKA 3QEXA 2NUBA 3UIQA 1NKCA 1ASVA 2Y1JA 4OPJA 3V1RA 4Q0BA 1I3AA 4C8KA 1MU2A 3I8DA 4FLTA 2QXFA 3VQ8A 1S5JA 3KKSA 4CGDA 3V81A 3MEGA 4IKFA 3F9KA 3NAEA 4JRPA 3U6FA 2DY4A 3WNEA 4FLYA 3TAFA 2VG5A 4JRQA 3DLRA 5KTQA 3WNGA 4DTOA 1SL1A 1RDBA 4CERA 4FJ9A 4FJ5A 1Q9XA 4KI4A 3VQ9A 1NOYA 4DWIA 1S1WA 1C1CA 3EZ5A 1T03A 3HK2A 1X9MA 1Q8IA 3KKRA 4KB1A 4HHTA 4I2QA 4CF9A 4FJ8A 1BIZA 4DU3A 3OY9A 2HHUA 4I7FA 4KHUA 4CJQA 4DS5A 4HCCA 4J2EA 3CM5A 2QKKA 4I2PA 4KREA 4K8XA 4JS4A 2AJQA 1QSLA 3ZSRA 1TK5A 4DTNA 3TAGA 3OJUA 2PYJA 4FLZA 4AHCA 4CHNA 3DYAA 3NH2A 1QTMA 4B08A 4CJEA 3QEPA 1D9DA 1XWLA 1WSEA 5HRRA 2KTQA 1C1AA 2X74A 3AO4A 1JLAA 2Q3SA 3I0SA 1LWFA 4M42A 1QE1A 3BGRA 4CF2A 3M8SA 4Y1CA 1RBVA 3L2QA 4N56A 1A5WA 3TANA 1NK4A 3CG7A 5FRMA 3M8RA 4F3TA 2XY8A 2BDPA 4LH5A 3HVRA 2G8KA 3LDSA 2HB5A 4B9TA 4C8NA 4AHUA 4DQQA 3P5JA 3NH0A 2KZZA 4HTUA 4DSFA 4KFBA 3SQ2A 2QKBA 1JXBA 2D0CA 1RBRA 4FM0A 1NK9A 3OYMA 3HP9A 4MQ3A 4Z4HA 4C8OA 3CFRA 2HNYA 1T8EA 4JS5A 1S9EA 3NGYA 1DTQA 4DFKA 4GMJB 1BQMA 3U3YA 4K8ZA 4BE0A 4ELTA 4Y1DA 4XIUA 4H4MA 1SV5A 3D0PA 3U3GA 2HHSA 1TVRA 4FJNA 1VSIA 3OS0A 4M3TA 2KZMA 3KLGA 1RDDA 3PV8A 1TL1A 3V9SA 4FJHA 1HRHA 5HP1A 3OYCA 3QERA 3E01A 3VQ4A 1YVUA 2VG6A 3QIOA 4CECA 4ELUA 1WAFA 4EP4A 3ZSXA 4DTSA 4J2DA 4CHOA 4E7LA 3LALA 4ELVA 1S6QA 3VN5A 5CYQA 4FLUA 1VK0A 4PQUA 1NK6A 5I3UA 3TR8A 1NJXA 2OA8A 2OPSA 3VQCA 2KFZA 3DLHA 3NF8A 1TAUA 1IKXA 3V1QA 5KGWA 3V9XA 1XI1A 4FJMA 3DLGA 2YHAA 4CJWA 2FBYA 3PO4A 3OVNA 4DQPA 3P1GA 1KVAA 1HYVA 4CJTA 4HVJA 1NOZA 3NGZA 5EU7A 1LAWA 2P5GA 2PY5A 4KTQA 4NCBA 1NKBA 4Z4IA 1NK5A 3LZJA 4PWDA 5I42A 5C24A 3KD5E 4IDKA 4KHQA 1BIUA 2G8IA 3V1OA 4BE1A 4CJLA 4F2SA 3AO3A 2G8HA 1VSEA 3SUPA 3TARA 4FK2A 5D3GA 1U48A 3CYMA 4HUEA 3RMAA 3AVLA 2PZSA 1JLBA 4FJXA 1IH7A 3C6TA 4W5RA 1B9DA 4J2AA 3OJSA 3QESA 2BANA 3DRRA 1CZ9A 4CFAA 3O3FA 4OPKA 3VA0A 3QNNA 3K5OA 1HNVA 3C6UA 5JS2A 3RTVA 1RT1A 1A5XA 2R7YA 2HMIA 3B6PA 1GOAA 2B6AA 2E4LA 1JLCA 3T1AA 4FJGA 1XHXA 3LWMA 1QHTA 1SKRA 2F8TA 4Z4FA 1L3UA 4CF0A 4E3SA 3RMBA 2HHWA 4CEOA 3L3UA 3HL8A 5FRNA 3HM9A 4CEBA 4B3OA 4CEZA 1TKTA 3HYFA 2KFNA 1WSGA 3SQ0A 1J53A 1BQNA 1EX4A 1VSFA 1BGXT 3SV4A 1XHZA 1XC9A 4KRFA 1N6QA 1KRPA 4DSKA 4DTUA 2IAJA 3T19A 2DTUA 3PX0A 1RT6A 1ASUA 4FJIA 1LW2A 4CJUA 1RBUA 4KI6A 3TABA 2IGIA 1TKXA 5K14A 4CEDA 3TAQA 1RT7A 1BISA 2YKMA 1IHVA 1UWBA 4EP5A 4KAZA 3BDPA 4FZZA 1JL1A 3AA5X 4F2RA 3SYZA 4HCBA 4OKJA 3SQ1A 2HHQA 4B9MA 3NDKA 1J54A 3K58A 2W42A 5HRNA 2G8VA 4BE2A 4DTJA 2KW4A 2XY7A 2Z1IA 1I39A 4CCHA 3ZSVA 3WNFA 3ZCMA 2DFHA 2BE2A 3S3MA 2DFEA 3LP3A 2WONA 4CGIA 3SV3A 4LSNA 1RNHA 2ETJA 3DMJA 3DRSA 4TSXA 4KO0A 4BDZA 4DFPA 3LPTA 3ZT2A 4ZTJA 4M3UA 3SUNA 1HMVA 2ZQBA 3OYDA 4CK2A 2D0BA 1X1PA 4O4GA 3OYGA 4DTRA 1TKDA 2E6MA 1B92A 4C8LA 3HVTA 1LWCA 1U49A 4CEEA 1SL0A 4DSEA 3QINA 3MEEA 4UQGA 1CXUA 4O0IA 5CZ1A 1Y97A 2XRIA 3QLHA 4FJJA 3S3OA 4I9QA 4QCLA 3S9HA 4YFUA 1DTTA 3HPHA 4GW6A 4E7JA 3KK2A 2VWJA 3I0RA 4J2BA 3TAPA 1GOBA 3AA4A 2F8SA 3PY8A 4KHYA 1J9AA 3HXMA 3QEIA 4DQSA 3AA2A 5KGXA 1X9SA 4FCYA 3OYBA 1VSDA 1ASWA 5DMRA 1R0AA 2OYQA 1C0MA 3VQPA 2RKIA 3NF9A 1UA1A 3DLKA 3B6OA 4KV8A 2FBVA 1DLOA 2FBTA 2OPQA 1VSLA 4C8MA 1B9FA 1ZBUA 3OYAA 3C94A 3PUFA 2X78A 4ID1A 1WAJA 3D45A 3SPZA 2ZD1A 1KFSA 4CIGA 3K5LA 1HQEA 3AO1A 4CESA 4PUOA 4F4KA 1JLEA 2G8FA 2YKNA 2Y1IA 1UOCA 1VSJA 1TV6A 4IFYA 2QK9A 1Z25A 4CJSA 3SI6A 4W5QA 4OKKA 3VQ6A 2IDOA 4E89A 4CEAA 4CEQA 4B9VA 3QETA 4DSJA 3KTQA 1CLQA 1JLGA 3VQ5A 1D8YA 3IG1A 1W0HA 4AH9A 4KHNA 4DG1A 2XHBA 1FKPA 3AV9A 4CHPA 4DF8A 4GVMA 1RT4A 3OYLA 4B9NA 4F8RA 4E7IA 1JL2A 3ZSOA 2XY6A 1KVCA 2ZE2A 1QQCA 3SPYA 2OZSA 3ZT3A 4FJLA 2FBXA 3IS9A 3NFAA 3TAEA 4CJVA 3K5NA 4Q5VA 2B5JA 1F21A 2ITGA 3MXIA 1RILA 2YV0X 3LWLA 3THVA 1BI4A 2HW3A 4OVLA 3SUOA 5J2PA 4CJKA 3NGIA 3ZT1A 3DOLA 4E1MA 3OYEA 4N76A 1ZBIA 1RBTA 4B8AB 3K57A 1IG9A 3L8BA 3LPUA 4OGCA 4OLBA 1RT2A 4PY5A 3LP1A 4WE1A 2Z1GA 1HPZA 1LAVA 3AVNA 4O55A 1LV5A 3O4NA 4IG0A 1IHWA 4CEFA 1RTJA 3OYKA 2IS3A 4CK3A 4FVMA 3M8QA 1FXXA 2G8WA 3RR8A 3ULDA 3AVIA 1T7PA 4DS4A 1ZBLA 3CQ8A 2O4IA 3KLEA 4E1NA 3OS1A 3AA3A 1NK8A 4CJ5A 3IAYA 1L3VA 1S1VA 4BACA 1SUQA 1C0TA 1IKYA 1S1TA 3ZSYA 1IKVA 4CFCA 4O5BA 4ID5A 3O4QA 4JLHA 2HHVA 3KD1E 1EXQA 1WSHA 4O0JA 3SNNA 3NH1A 3V4IA 1JXEA 3FFIA 3TAMA 4CF1A 3AVKA 2F96A 2LSNA 3MEDA 3OYHA 4DU1A 3HT3A 4QOZB 1U4BA 1UAXA 3AVJA 3ISNC 4CHYA 3AVBA 4RW8A 1YTAA 1NK7A 1VSHA 4FLXA 4FJKA 2D5RA 1KLMA 2GUIA 3MXJA 4CJ4A 1U47A 1C6VX 3V9WA 1NJWA 1L3TA 1RTDA 1C0UA 1HJRA 4DMNA 4DQIA 3LP0A 3P83D 3ZSWA 4IFVA 4BWMA 3MAQA 4CJFA 1K6YA 2IOCA 1S1UA 5SWMA 1S6PA 3SCXA 1G15A 4BDYA 3AVHA 1BCMA 4DTMA 3VQEA 1RBSA 4CJPA 3VQ7A 4CF8A 3AO5A 2HNDA 3ZSZA 1KFDA 1WSJA 4B8CA 4Z4CA 4DLGA 3A2FA 3AVAA 4DLEA 3H08A 4LY7A 4ZHRA 2ATQA 2BGGA 2IC3A 1RT3A 3JSMA 5KI6A 4Z4GA 2D0AA 2HHTA 2GV9A 4Z0UA 2JGUA 4FM2A 3DOKA 3ZT0A 4OJRA 3AVGA 3QEWA 3KK1A 3SJJA 1J5OA 3KLFA 4BWJA 4CFBA 3K59A 3WNHA 3SUQA 4Z4EA 4CGFA 3OYNA 3PO5A 1WLJA 5J2MA 1QS4A 4CGHA 4KHWA 1TKZA 4AHRA 1QMCA 3G10A 4N41A 1NK0A 4E19A 1KLNA 4M3YA 3IRXA 4B9LA 2OPPA 3LZIA 3SZ2A 4EZ9A 1X9WA 3VA3A 1BHLA 2PYLA 1RDCA 1KTQA 1RCHA 2RPIA 4DFJA 1RDAA 4OKEA 4FLVA 3MXMA 1WNSA 3RRGA 3LAMA 1YTUA 1BCOA 1ZBHA 4FYDA 3OYFA 1WSFA 2YNHA 4CJRA 4FM1A 4H8KA 4EZ6A 3NHGA 5HRSA 5FDLA 3K5MA 1L3SA 4L8RB 3O3HA 3CFPA 4OLAA 2OZMA 3VQBA 1CXQA 4CFDA 4KTZA 3ITHA 1BL3A 3SQ4A 1L5UA 3RMDA 3O3GA 3LP2A 1KCFA 1UA0A 3KIOA 1Z26A 3NCIA 3L2VA 3S3NA 4HUGA 3RR7A 2WOMA 3CFOA 3OS2A 2RF2A 1SKSA 2OPRA 1W9HA 1KSPA 1EP4A 2I5JA 2KQ2A 4PA1A 4M45A 2XY5A 1C1BA 1EETA 1TGOA 3L2RA 3KK3A 4DSLA 3KLHA 3KJVA 5DK5A 4FLWA 1U04A 4AHVA 3HSTB 4NCGA 4FZXC 1QSSA 3DI6A 2X6NA 3OYIA 4E7HA 2EX3A 4CIFA 1TK8A 1HYSA 4DFMA 2HVIA 1S9GA 2YNFA 1Q9YA 4FK0A 3ALYA 3NF6A 5J2NA 1SL2A 1YT3A 1VRTA 4O44A 4KHSA 4YNQA 3VQQA 3V9UA 3HPGA 2O4GA 3G0ZA 4CK1A 1O1WA 2XO7A 4RW6A 3QNOA 3AVCA 3ZSQA 4DSIA 1VSMA 4NCAA 2RN2A 3V9ZA 2YNGA 4F3OA 2E6LA 2DFFA 1EKEA 1TL3A 5HROA 5SZTA 1VRUA 1TAQA 4KKOA 5HLFA 4H4OA 4M3WA 3NBPA 1RT5A 4CGJA 4RW4A 4CHZA 3OYJA 2G8UA 3L2UA 4CJ3A 4B9SA 4KPYA 5HRPA 1NJYA 1NJZA 4HUFA 4DU4A 1A5VA 1RTIA 5E41A 4W5OA 4AILC 3VQDA 1FK9A 4DQRA 4DF4A 1LWEA 3L3VA 3EY1A 3NE6A 4OGEA 4AHTA 1JKHA 1SKWA 3HPOA 1WN7A 1KVBA 3F73A 2VG7A 3DLEA 3QO9A 4LSLA 1GOCA 4RW9A 5HBMA 3AVFA 3PX4A 2A1RA 1LW0A 4N5SA 4QAGA 1IO2A 4RW7A 1JLFA 1C6VA 5CYMA 4M3ZA 3RMCA 4W5NA 1TK0A 3DM2A 1JLQA 2P5OA 4DTPA 3M8PA 4FJ7A 4W5TA 4FZYA 2HVHA 5D7UA 2YNIA 3MECA 4IBNA 2B4JA 4M3XA 1NKEA 2P51A 2A1SA 5JS1A 2HHXA 5KRTA 4NYFA 2GBZA 4ICLA 4CGGA 3QEVA 2VWKA 4LH4A 3LANA 1D9FA 5CZ2A 5CY4A 4E0DA 2Z1JA 3ZT4A 4RG8A 1IKWA 1HQUA 4AHSA 3NF7A 3HP6A 5J1EA 3QIPA 1QSYA 3ASMA 4KTWA 4FW2A 4M3RA 4BDPA 5C42A 3DLBA 5J2QA 1REVA 1VSKA