4Z8AA

Sh3-iii of drosophila rim-binding protein bound to a cacophony derived peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GPLGSPEFNRPVKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIM-binding protein, isoform F
publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rim-binding protein
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z8aA00
2DA9A 3M0RA 1PNJA 4OMPA 4WCIA 2DE0X 2EVRA 2P4RA 1UGVA 3JV3A 1GRIA 1KSWA 2O31A 2KNBB 1WFWA 3NHNA 5GJVB 3VS7A 4JJCA 3VS2A 2J6OA 2KRNA 2J05A 2YUQA 2DVJA 2EGAA 1NYFA 2LZ6B 3VS3A 2L3QA 3QWXX 1MV3A 1H92A 4X1VA 4GBQA 2J6FA 4RTTA 2K9GA 4AFQC 2C0OA 1YN8A 1ZUKA 1K9AA 3QWYA 1RI9A 5I22A 2OAWA 1GBRA 5IHNA 3VS4A 1SPKA 2EGEA 1M3BA 4Z88A 1VA7A 4AFSC 2CH4A 1PRLC 2FPFA 5FWBA 1LCKA 1UJYA 4RTYA 1YWPA 1OEBA 2W10A 2XMFA 1SRMA 2DL7A 4OMQA 4CC7A 1BBZA 2FG0A 4Z8AA 1AD5A 1HD3A 1H3HA 1GL5A 1UFFA 3M0UA 2KGTA 1BB9A 1GBQA 1WI7A 2JMCA 2L3PA 4R0KA 4KRTA 1E6HA 1AOJA 2RQVA 1M30A 2MIOA 1U5SA 2PNIA 3REAB 1RLPC 2A37A 2KRMA 2CUDA 2B86A 2BZYA 2RMOA 1K1ZA 2L2PA 1TUCA 1MUZA 1M3CA 1UE9A 2O9VA 1I07A 1SEMA 1ZUUA 4K11A 1NLOC 1QLYA 2M51A 3TSZA 1NEBA 2SEMA 2KYBA 2V1RA 2K7AA 3LH5A 4OMLA 1NG2A 3VS5A 3EG1A 3TVTA 2IIMA 4EIKA 1HSQA 2EKHA 2KE9A 1BU1A 1T3LA 1OOTA 1UHFA 2AK5A 1WIEA 2HSPA 2F2XA 2RN8A 1ABOA 4J9CA 2JM8A 3UF4A 4F16A 3U23A 1ZSGA 2ROTA 2O9SA 2DBKA 3GBQA 1U06A 2CUBA 4AG2C 2C0IA 2YUNA 1AWJA 1UHCA 4HXJA 2BZ8A 2FPDA 4HCKA 1VYTA 1M8MA 4OMMA 3IQLA 5GJWB 1QKXA 2MOXA 2O2OA 2DF6A 4LN2A 3EG3A 2W0ZA 3UA6A 4CC2A 1PKSA 4AFUC 1XOVA 2F2WA 2LJ0A 1W70A 1WLPB 1M27C 1UTIA 2KEAA 4Y92A 4JJBA 3VS0A 4ESRA 2K79A 2V1QA 3SHWA 3VS6A 2DM1A 1AZGB 2RQRA 2RQWA 2DJQA 3EG2A 5HCKA 2VVKA 5IHKA 2JW4A 2EYXA 2C0TA 1X43A 1AWOA 1QWFA 5IHIA 1QWEA 1I0CA 2PZ1A 2DRMA 1NYGA 1K4US 3VRZA 4LUDA 1W1FA 1K0XA 2YDLA 2VKNA 2PTKA 1WYXA 2EYZA 1AZEA 5I11A 1X6GA 2BZXA 4RTWA 1TG0A 4AG1C 1MV0B 2J7IA 2QDLA 2GTJA 3REBB 2D1XA 2F2VA 2LJ3A 2LJ1A 2FRWA 3ULRB 2EYWA 4GLMA 3CQTA 4DEYA 1JO8A 4JJDA 4IIMA 4LUEA 4J9EA 2DYBA 1HJDA 1G83A 1RUWA 1JQQA 1GCQA 2HBWA 2ESWA 3NGPA 3A98A 4CC4B 2KT8A 1M3AA 2FEIA 1T3SA 1KJWA 1PRMC 4HVWA 1ZLMA 5IXBA 2LCSA 1OPKA 4RUGA 2DLPA 2ED0A 1VYUA 2DL8A 3EHQA 4OMNA 2LQNA 1H8KA 1UJ0A 2EQIA 2M0YA 1SRLA 3RBBB 1N5ZA 2AKLA 4JPBW 2GNCA 2LNHB 2EYYA 2J6KA 1AWXA 2KYMA 4M4ZA 1PHTA 2JTEA 2EW3A 4J9GA 4AFZC 3NPFA 2YUOA 4J9IA 3PE0A 3R6NA 1UUEA 1PWTA 2KRSA 3FJ5A 2ED1A 2JS2A 3KFVA 2I0NA 2OI3A 2GBQA 5IXFA 1K0SA 2DMOA 2FO0A 3EGUA 4JZ4A 2AZSA 2RQTA 3M0TA 1WDXA 1QCFA 4HVUA 4J9DA 4E6RA 1WXBA 1NM7A 3UA7A 2ECZA 2ENMA 2JS0A 2FPEA 1K76A 1VYVA 2KR3A 2YUPA 4RTVA 1NEGA 2BTTA 1YP5A 5IH2A 2HEQA 1ZX6A 2D8HA 2CREA 3I5RA 2A08A 4F14A 1UDLA 4F17A 2KBTA 2D8JA 1CKAA 2EGCA 1WA7A 1Z9QA 2KXDA 1V1CA 1ARKA 4QT7A 2CT3A 3H0HA 1YCSB 2DL5A 2GQIA 1CKBA 2A36A 2FRYA 1FYNA 2G6FX 1W6XA 1JXMA 1AVZC 2X3XD 1E6GA 4OMOA 3SEMA 1WXUA 4HVVA 2KT1A 1TUDA 1SHGA 2O88A 4DEXA 1WXTA 3C0CA 2AKKA 3VRYA 2VWFA 2X3WD 2DRKA 3M0QA 1GFDA 2LQWA 2YSQA 2CDTA 1X69A 3O5ZA 2YT6A 2LX7A 2ABLA 1X6BA 1JU5C 1Z9ZA 1YNZA 1ZUYA 2ROLA 1QKWA 2JT4A 2L3SA 4LE9A 1J3TA 4A63B 2EBPA 1KIKA 2DX1A 1PKTA 1GFCA 1GCQC 2HDAA 2J06A 3NMZC 4J9BA 2DILA 4ORZA 1B07A 1I1JA 2H8HA 2JXBA 1Y0MA 1EFNA 3PVLA 1ABQA 1ZBJA 3EHRA 4D8DA 1NLPC 4J9FA 3UATA 1Y57A 5ECAA 1UG1A 4J9HA 3M0SA 2KROA 2RNAA 3EG0A 1UECA 4LNPA 1X27A 1E7OA 3I35A 4JZ3A 2DL3A 1AEYA 3H0FA 2E5KA 1U3OA 4D8KA 1T0HA 1GCPA 4RTXA 1A0NB 2CSQA 1IO6A 5L23A 2L0AA 2D0NA 2RF0A 4IIOA 2CH4W 3RNJA 1BK2A 2K6DA 2RPNA 4FSSA 5EC7A 2JM9A 1X2QA 3H41A 2OJ2A 3M0PA 1WX6A 1YWOA 1SSHA 2JMAA 1X2KA 2NUZA 2AZVA 3I5SA 1CSKA 3I9QA 2LMJA 2DBMA 1JEGA 5FWCA 3PVQA 3ZL7C 3VS1A 2LP5A 2CT4A 4RTZA 2CSIA 2K3BA 1OV3A 2DL4A 2GTOA 1SHFA 2SRCA 1AWWA 1RLQC 1S1NA 2NWMA 1KFZA 2DNUA 4CC3A 2GGRA 2KXCA 4ZNXA 1G2BA 1T0JA 2RQUA 1B3QA 4RTUA 1FMKA 1JXOA 2HCKA 2EPDA 5FW9A 3THKA 2K2MA 3H0IA 4Z89A 1OPLA 3TSWA 2A28A 2MCNA
chains in the Genus database with same CATH superfamily
4JS4A 4LDXA 2EYQA 4QVZA 3CC4A 2YXYA 1D09B 1PNJA 3VV0A 4V2SA 2EVRA 3JV3A 5GAN4 2O31A 1G3SA 3NHNA 3VS7A 4BD3A 2J6OA 2J05A 2EGAA 4FU6A 1YITA 4KUDK 2L3QA 3OYBA 4OF1A 1MV3A 1H92A 1K73C 1I5OB 3HSBA 1YJ9A 2J6FA 2KSSA 1WHGA 2K9GA 3CBPA 1TXQA 4IUVA 2BE7D 4A53A 5IHNA 2F5TX 4M78F 5HK0A 3JB9H 2JVVA 1SPKA 1IHVA 1VA7A 3J80E 2E70A 1UJYA 2AT1B 1H3ZA 1OEBA 4LDVA 1JBMA 1Y71A 4Q5WA 4BY6C 2L89A 4Z02A 3HRTA 3LW5E 1VUBA 2EQJA 1H3HA 4C92D 1UFFA 1WQWA 3M0UA 1D3BB 3QYHB 4EMHA 3MP1A 4A4FA 4ZN3A 4M77F 3E9GA 5GAOm 2RQVA 3RMQA 5CKFA 1QVGA 3F70A 1M30A 2MIOA 1N8RU 2FZKB 1QP2A 1RLPC 2KRMA 1UGQB 2FYKA 1I81A 1K1ZA 4ZGDB 3CXCA 1I07A 2QG9B 1ZUUA 2M51A 3CEYA 3PNWC 2SEMA 5LJ3h 4B6MA 2K7AA 4M7AF 3CCST 3TCJA 2DJZA 3TVTA 2F1LA 5KYYA 3MPUB 1K8AU 1QP3A 2OTJT 2KE9A 1BU1A 1BCOA 2H3JA 3OSSC 5KE2A 1N8RC 4PNOA 2AK5A 2JJ9A 2F2XA 2RN8A 3OBYA 3UF4A 1PD1A 3U23A 5J26A 2PVOB 4MDWA 2DBKA 3P8HA 3DB3A 4QW2A 4AG2C 3OS2A 4CRIA 4C0DC 1KD1U 1HK9A 1K8AC 5C6SA 4HCKA 1M8MA 3V7RA 4FCYA 4PJOA 5GANj 2PUOB 1KC8R 1QKXA 2O2OA 3EGDA 5FRNA 3EG3A 1Q7YU 4ZGJB 2W0ZA 4AMCA 4AFUC 2E41A 1XOVA 4IUQA 3VUZA 4Y28E 4JJBA 2COYA 4ESRA 4L59A 5KH6A 1RAFB 3CXCP 1K9MR 2HKQB 2WSFE 3JCMW 3JB9D 2JW4A 4E7ZA 2P0QA 2P4TA 1KD1C 3NTHA 2KI7A 5GANf 1ZSZC 3QHSA 2R57A 1K4US 3BW1A 5GAN2 1K0XA 3G6EA 1Q7YC 1PCXA 2YDLA 5GAOq 2VKNA 5GAN6 3OYLA 1VQ5A 3QDRB 2L8DA 2E12A 4M78B 2RI5A 4LDUA 3PTAA 4M75E 2FRWA 5AT1B 5GANe 3JRZA 3MCAB 1HJDA 1G83A 1RUWA 2HL5C 3C95A 4OVAA 1GCQA 2HBWA 3A98A 7AT1B 4CC4B 2GFUA 2CP2A 4FT4A 1M3AA 3CBOA 2O4XA 2RJDA 4GY5A 2LTOA 5A0DA 2GFAA 3O8VA 2QAZA 2ZPIB 4CI0C 2RH2A 2HKNA 3GPLA 2DLPA 4KT0E 1VYUA 2E6ZA 4M77B 1M90U 3CCQT 3EHQA 1YJWA 1UGPB 4OMNA 2LQNA 3CMEQ 1UJ0A 1SRLA 3RBBB 2DPPB 2LNHB 4N4GA 2EYYA 1RACB 2J6KA 2R58A 3PGGA 2EQMA 4M4ZA 4FL6A 3JCMQ 3UPUA 4AFZC 2JZ2A 5KE3A 2YUOA 4OMFB 5KCOA 1FMWA 1WNLA 3X26B 3R6NA 1UUEA 2JTFA 4C0ZA 3H8ZA 3OW2A 5CKHA 3CMEA 4J6WA 3L2VA 3BE3A 4B9XA 4HCBA 5IXFA 2E6NA 2PU9B 4IURA 2DO3A 3CCVQ 4EMKA 1D0ZA 2FZGB 3M0TA 1AT1B 3PT9A 3X24B 1YBYA 2ECZA 2FPEA 2L5QA 2RA2A 2DYIA 3EG9A 1PSFA 5LJ3f 2K5IA 2D8HA 2YHTA 3I55T 1LJOA 2CP3A 4NOYA 5GAOl 4C92G 1VOMA 4M75C 5GAOn 1V1CA 1ARKA 4C5HA 1YCSB 1JRIA 1YIJQ 2FRYA 5LJ3e 1MNDA 1VQMQ 1K73R 4BDYA 4OMOA 8AT1B 1RL2A 4NL2A 3CCRA 2HD0A 4PKCC 1O75A 5EG2A 2CZ0B 3VRYA 3V8LA 1IGUA 4FT2A 2CZ1B 2BKDN 1B34A 2E3IA 2LQWA 3S3NA 4PJOE 1MMDA 4HA8A 4PJMA 5CR2A 1YI2T 3OYGA 4C92C 3OW2P 4MDXA 4ZTFA 4J5YA 1QKWA 2R5AA 3FIFA 2HL3A 2DX1A 2QQAA 3LX7A 5GAN3 1GFCA 3I56T 3NMZC 4A54A 5CAIA 1B7TA 4PFOA 1NLPC 4D8DA 4J9FA 5L8RE 4JDSA 4FW1A 4J9HA 5CIUA 3L2QA 4ZN1A 1O9SA 2DL3A 1U3OA 1YCYA 5GAN8 4C8QE 5L23A 5FROA 4IIOA 2CH4W 3RNJA 4E7KA 1BK2A 1HXDA 3VJPA 3MJXA 2JM9A 4ZGEB 1BI1A 1X2QA 4PJJA 2E4HA 2KVQG 2K2VA 2V8IA 5GAMf 3G71A 3M4YA 3JCMh 4PFPA 1OZ2A 1MGQA 2NUZA 3FJPA 3GLXA 3PVQA 1X6OA 4KH1B 3HL8A 3EFOA 1OV3A 1OX9A 3EFSA 1WGSA 1AWWA 2LVMA 2E65A 1M1KU 4PJOC 4J7FA 3QJ6A 5DY9A 1M1FA 4VUBA 1S72T 2KXCA 1MMGA 1G2BA 1T0JA 2RQUA 5D6YA 4F7UE 3L2ZA 1VQOT 4RTUA 1R0CB 5GAMe 2HCKA 2MMPA 2XI9A 2VXEA 4C8QG 2A3LA 3HHTB 2DVEA 5HKCA 2K5FA 1R77A 3CCSQ 2EWNA 3M0RA 3GIBA 4L5GA 1C1AA 4M7DB 1TUGB 5HK3A 2EKOA 1UGVA 1GRIA 3SDZA 2CZ7B 1WFWA 5I2SA 4JJCA 2VUBA 1M1KC 3EGDB 3VS3A 1VQ6T 2X4XA 1QQJA 1XNIA 1MMNA 3OS5A 4X1VA 2MK5A 2RI2A 4RTTA 2G3RA 2M0OA 2OTJA 3UWNA 2M1HA 2LX9A 1ZSZA 2MI6A 1Q82U 5I22A 2NUTB 4C8QC 2OX7A 2YWWA 2DEQA 3L2WA 2QEXT 2KY9A 3VS4A 2DKGA 1VQ8A 1VIEA 2OTLA 3CD6T 2EJ9A 3E19A 1MNEA 2CH4A 3ME9A 1PRLC 4PL6A 3V7SA 2VYTA 4E7JA 3CCEA 4JS5A 2W10A 2YRCA 3VKIA 4FYWB 2ZGWA 4M78D 4Z8AA 3QG1A 4KH0B 1Q82C 3SWNB 4RCCA 1BB9A 3R6OA 1X01A 1C0MA 1E6HA 2YRDA 5KYUB 3PMTA 5HY6A 1U5SA 3CCLT 4MZPA 3M56A 2DXTA 4FW2A 2HMAA 4HKEA 3OQ5A 2B86A 2BZYA 2RMOA 4HCZA 1JB0E 1NE8A 3FDRA 1TUCA 2R5MA 3OYJA 1TU0B 1NLOC 3X25B 2V1RA 4M77D 1IHWA 3LH5A 4OMLA 1NG2A 4EIKA 3QUIA 3CMAT 3TREA 2AHJB 2EKHA 2OAUA 1GXIE 2CP5A 3QDFA 5LJ5h 1RAAB 3RUXA 1IRXA 4J8OA 2QGFB 1M8VA 2P84A 3L1AA 2CP7A 4D6WA 1BI0A 4J9CA 2VV5A 2XG8D 1D1BA 4F16A 4IUTA 4M7AD 2LT1A 1Q86U 4LD6A 2F69A 2CUBA 1PSEA 1W2BA 3CCQQ 3ER0A 2RJFA 4EMKB 3A5ZB 2QA4T 1VQ7A 2MWOA 1KQSA 2YLBA 2YUNA 2QTXA 5CKDA 2E64A 3LLRA 2QDYB 3CC2T 1ACMB 1SF9A 1VYTA 2EQKA 4OMMA 2QTVA 5GMKi 5GJWB 4QVCA 3JCMf 3PIOA 3UA6A 4CC2A 1PKSA 4R55A 4M75A 2DZCA 4DOVA 2F2WA 2LJ0A 1WLPB 1M27C 2MAMA 2JNGA 1VQNQ 2EJFA 1P92A 3OYHA 2V1QA 3OMGA 1QVPA 3RR6A 1AZGB 3G7ZA 4QQDA 2DJQA 3SD4A 3JCMc 3OYYA 5CQYA 4A4HA 3M58A 2C0TA 1X43A 1AWOA 1QWFA 2P0PA 3JCMe 3CC7T 2PZ1A 2DRMA 5FU7B 2M02A 1VQLT 2K3YA 3LH0A 3A8HB 5LJ3g 2PTKA 3I55Q 3OYCA 1D0XA 2XU8A 1RAHB 4ME7A 1YFNA 4C92A 1D1CA 2QDLA 3LWIA 5KYXA 4ELYC 4WTOB 2D1XA 2LJ3A 3ULRB 2EYWA 3VUBA 3CQTA 4DEYA 1TTHB 4LUEA 2DYBA 2L3RA 2KAFA 1W2BP 1OZ3A 2ESWA 1Y96B 2LC4A 4C5EA 1KQSP 2KT8A 3M54A 5FRMA 1YJNT 1ZLMA 1KHIA 4RUGA 3Q1JA 2ED0A 4BY6B 3FEOA 2QQSA 4J7IA 1YI2Q 4HT8A 1H8KA 1KQ1A 3HPWA 4IUPA 2X9HA 3OYMA 1RAGB 4EDUA 3WVEB 1FMVA 1PHTA 2JTEA 4J9GA 2RD1A 3J81E 4J9IA 3I56Q 2CP0A 3JCMX 1QVFS 1PWTA 2KRSA 4RG2A 3FC3A 1YI2A 4XTXA 4QQ6A 5LJ5j 2BIVA 2OI3A 1IZ6A 4MMKA 1WDXA 2X51A 4HVUA 4P5NA 4J6XA 2HNIA 2RM4A 2PQWA 3JB9J 3UA7A 2ENMA 1G5VA 1NEGA 5IH2A 2HEQA 4DBQA 2RJCA 1RABB 3I5RA 4LD9K 5GANd 2XDDA 2DD5A 5LJ5f 1QVGP 2KXDA 4XQ3A 1PG5B 2GQIA 1D1AA 2A36A 3DB4A 5CVIA 4A4KA 1BIAA 2G6FX 2LQKA 1G3YA 1JXMA 1AVZC 2X3XD 5GAMg 4M75F 1WXUA 2LRQA 2KT1A 3A8MB 2FZCB 4E7IA 4X34A 3JCMV 2O88A 5FLXE 4M7DD 5LJ5e 4JLIA 2VWFA 4MMLA 4E7LA 4M77G 1FX7A 4X9DA 3EH2A 2DTOA 1VQPT 1S72Q 2PVDB 2CDTA 2P0KA 2ZZDA 1VQOQ 3OYNA 1U1TA 1X6BA 2QGGA 1MHNA 1ZUYA 2CZ6B 2ROLA 4C8QA 1UGRB 2JT4A 3CCJT 4QQGA 3JB9I 1ZSZB 1AHJB 4A63B 1QCOA 3OSVA 4PJNA 4FM4B 3M53A 1PKTA 3LGLA 4C92F 1VQ4T 1S72A 1N9RA 2HDAA 3OYEA 2D9TA 1QMCA 1M1GA 4A4GA 5KYWA 1Y0MA 3PMIA 1ABQA 1ZBJA 3QSUA 3META 1VQ6Q 1ZA2B 3UATA 1Y57A 5GAMh 1UG1A 3EG0A 1UECA 3CPWS 2E5QA 3CBMA 2YRVA 6AT1B 4LNPA 3EGXA 5LL6S 4JZ3A 4C92E 4ANJA 4D8KA 3URGA 3H6ZA 1G3WA 4BE0A 4RTXA 2QEXQ 2CSQA 1IO6A 4F7UA 2L0AA 3ZBDA 1PC0A 3MEVA 5LJ3j 2QQ9A 3CD6Q 2D0NA 3JCMJ 1H641 4M7AB 5LJ3d 4XK8E 2K6DA 2RPNA 1R0BG 4FSSA 5EC7A 2AIRB 4L6V5 2C06A 1VQNT 2VB6A 1TSFA 3MP8A 3G4SQ 1M90C 4ELZC 2LNVA 1TS9A 1PD0A 1WX6A 1YWOA 3I5SA 1CSKA 2LMJA 3VS1A 3ASKA 4AT1B 5A0GA 1VQ9T 1M4ZA 4RTZA 5IAYA 2DL4A 3HRSA 5CK9A 3CCLQ 2BE9B 3HP9A 4FYYB 5FU6B 1KG1A 1OYXA 2ZPGB 3CCVA 2E1HA 2X4JA 1B3QA 3RMSA 3TU4K 1FMKA 1JXOA 3MHXA 5FW9A 3THKA 1Q81U 4Z89A 4PJOF 2A28A 4B9WA 4N4IA 2DA9A 2K5LA 9ATCB 2WSCE 1U1SA 2LQ8A 3CMAQ 3C12A 4WCIA 1LVKA 4XTZA 1KSWA 4J6YA 2KNBB 4O6JA 5D6WA 4PFZA 2KRNA 2YUQA 3HFNA 1U8RA 1VQKT 2LZ6B 3OBWA 1OULA 4M75B 4KGXB 1YIJA 1TOVA 2MYSA 1Q81C 1YN8A 4JJNK 1VQMA 1ZUKA 1K9AA 3JAME 2QA4Q 5A2QE 3CC2Q 3VU3C 1KQSS 1GBRA 5DLOA 3MEAA 3JCMP 4M7DE 2EGEA 2RHUA 1C6VX 2BUDA 4Z88A 4AFSC 3OYAA 4KUIA 3NTIA 2FPFA 3RESA 3JCMg 4C8QF 3A1PA 3HTRA 4C5GA 4FSXA 2RJEA 2QA4A 2FL7A 2XMFA 2DL7A 4OMQA 4QKUA 1YHQQ 3N5BB 2GCXA 1D3BA 4XU2A 1GL5A 3A8GB 3QO3A 5GAMj 2KGTA 2JUFA 1WI7A 2L3PA 3MO8A 3QZ9B 4R0KA 4KRTA 5GAMd 3CC7Q 2RB6A 2XIDA 2PNIA 1VQLQ 3AHUA 2A37A 3NTKA 3CCUT 1LOJA 2FHDA 1ZQ1A 3L2UA 3JB9G 3GF5A 1MUZA 1UE9A 2O9VA 1SEMA 1N8RR 4IUUA 1NEBA 4BDZA 4M7DG 2IPOB 4F7UF 3CC7A 3VS5A 3EG1A 1HSQA 2HSEB 1VQLA 5AYFA 5GMKh 2X4WA 4XU3A 3INZA 4RMOA 5KYYB 1I5LA 3GP8A 1OOTA 4RKUE 2HSPA 1WIEA 1NJIU 1ZA1B 1YJNQ 1ABOA 4BE2A 1K8AR 2VGNA 4LDWA 4RG8A 1ZSGA 1QVGS 3PIPA 5GAN5 3FRNA 2ROTA 2O9SA 1ZHIA 1KC8U 2D6FA 1TH7A 3CXCS 1I4K1 4F04B 1AWJA 4HXJA 2BZ8A 3E1SA 4M7DC 2DEUA 4JUVA 4OB1B 4WF2A 3DLLA 2MOXA 3OS0A 1N27A 3X28B 4PJOB 2DF6A 4LN2A 1NJIC 3A8LB 4UC4A 1XTDA 1XJWB 1KD1R 3VYHB 1W70A 1UTIA 3S3MA 2KEAA 1LPLA 3EH1A 2MWPA 3VS0A 2K79A 3SHWA 3VS6A 2DM1A 3CCSA 1Q7YR 1KC8C 2RQRA 1XQHA 2RQWA 5HCKA 4C5IA 1RAIB 1YJWT 4ZTJA 2KQWA 5IHIA 1QWEA 2VGMA 1R8OB 1NYGA 4R56A 3VRZA 1W1FA 4XU0A 4MZMA 3ZFJA 2K3XA 1AZEA 1D0YA 1TG0A 4AG1C 1MV0B 5KYNA 3LWHA 2J7IA 5LJ5g 2XHCA 1NPRA 1V76A 3M59A 1F1BB 3G4ST 2DD4A 1JO8A 4JJDA 4IIMA 3RIRA 2M16A 3SWNC 3M57A 3EFRA 1HYOA 1JQQA 3NGPA 2FEIA 1T3SA 5IT9E 2VXFA 4HVWA 2O4XB 3RKYA 5CKBA 4M77A 1IREB 1VQPQ 1OPKA 3C94A 5IN1A 1NZ9A 1UGSB 1Y07A 2EAYA 2M0YA 1WPYA 1DJ7B 3CCJQ 4N4HA 1AWXA 1M90R 2QYZA 2Y4YA 3KXTA 3CCMT 3CCRT 1VQ4Q 3PE0A 2DXUA 3QZ5B 4F7UB 1SSFA 4XTVA 1BIBA 2DXCA 1VIFA 2H3EB 2JS2A 2I0NA 3JCMd 1SG5A 2GBQA 4PLLA 4NL3A 1K0SA 2DMOA 1I8FA 3VYGA 2RQTA 2JOYA 2RHZA 4XAXB 4E6RA 1WXBA 1NM7A 2A0FB 2EJGA 3AT1B 1K76A 1VYVA 2KR3A 2HBPA 4RTVA 1YP5A 2LDMA 5M9OA 3CC4Q 5CKEA 3EG9B 2CREA 3SFMA 1QW1A 2V8JA 1UDLA 3JCMb 5KCHA 3S6WA 1CKAA 3CCQA 2EGCA 1WA7A 1Q86C 1YITQ 2RI3A 4QT7A 2DXBA 3H0HA 3OW2S 1UEBA 4XTYA 1CKBA 1YHQT 1YJ9Q 1FYNA 3FLGA 1X75C 2QXFA 4MZTA 2LCCA 1Q81R 4PK4A 3GNGA 5FU7C 2DTHA 4BI8B 3HFOA 1VQ9Q 5GMKe 2AKKA 1BI2A 2X3WD 1VQNA 3OMCA 2QI2A 1GFDA 1V29B 2YSQA 2CYZB 2YT6A 1B34B 2CP6A 2LX7A 5C0MA 2DTIA 3E2UA 2XICA 4JLGA 4M75D 1Z9ZA 3DKMA 2KK4A 3MEWA 2XK0A 5GAOp 2L3SA 1VQ9A 3G71T 1J3TA 1KIKA 1BYMA 3I55A 5GAN7 4J9BA 2JXBA 3BDUA 2DK3A 3P8DA 1EFNA 3WVDB 1VQKQ 3EHRA 3M0SA 2FVUA 2KROA 2RNAA 3HKSA 2DETA 4M78E 1KHCA 1E7OA 3EAEA 1FXXA 1AEYA 1EIFA 3NFCA 1VQKA 1GCPA 2XDPA 1A0NB 3UT1A 3DLMA 1OI1A 4XTWA 3SB2A 1OU9A 3C4SA 2Y4XA 5LJ5d 5J39A 2COWA 2OJ2A 4OB0B 3GNFB 4M77E 4KULA 1SSHA 2JMAA 2AZVA 1JJ2A 1QCNA 3I9QA 2IVWA 2DBMA 3I56A 3KBGA 5FWCA 3JSCA 1JEGA 2CT4A 2K3BA 2GTOA 1SHFA 5GMKm 1RLQC 1S1NA 2NWMA 4DA4A 1VQ8T 3EFOB 2OTLT 3CCUQ 4M78G 4ZNXA 2WSEE 2WACA 4M7AE 2HAXA 3CCET 1NJIR 3BY7A 2EPDA 2K4YA 1M1KR 2K2MA 2DIGA 3H0IA 1OPLA 4M7DA 3X20B 4C0DB 4BACA 4OMPA 2DE0X 2MF2A 2P4RA 2A7YA 3TEEA 3CCUA 3CPFA 5GJVB 1RI0A 3VS2A 2DVJA 1NYFA 2RHXA 3V8KA 3FB9A 3G6EQ 4PJOD 5I21A 2Y90A 3QWXX 3QPHA 1FWZA 1BCMA 4GBQA 4M78C 1VQ5Q 4AFQC 2C0OA 2NUTA 3LYIA 1Q95G 1W4SA 2F5KA 3QWYA 1RI9A 3P8BB 5I2MA 2QK0A 4BB7A 1OQKA 2OAWA 3TQ7P 4FYXB 2PVGB 4M7AG 5DM7R 1JJ2P 1BI3A 1M3BA 4PLIA 1Q82R 5FWBA 1LCKA 1VQOA 4RTYA 1YWPA 3S3OA 4KGZB 1SRMA 4M77C 4CC7A 3SWNA 5D6XA 1BBZA 2FG0A 2NUPA 2VC8A 3OYFA 1AD5A 1HD3A 1YJWQ 3HRUA 1VQ7T 3L42A 4KGVB 3A8OB 2HQHA 1OU8A 5KYUA 1GBQA 4C8QD 2JMCA 2VASA 1M2VA 1AOJA 3CC4T 2DAQA 4JRQA 3REAB 1VQ6A 4N0AC 2ZPEB 3QBYA 4M7AC 2CUDA 4EPCA 3QKJA 2GF7A 2L2PA 1M3CA 4LXCA 1WHJA 4K11A 1QLYA 3TSZA 1YITT 2KYBA 3OA6A 2HQXA 1LNXA 1G3TA 2IIMA 1YJ9T 1M9SA 2QEXA 3M55A 4E7HA 1N6AA 3CD6A 4LDYA 1T3LA 3M5AA 4M75G 3J7AF 3V8JA 1UHFA 3H9NA 1EZZB 2ZPBB 2JM8A 3M9QA 5FU6C 2V26A 3QYGB 3G4SA 2YLCA 3GBQA 3ZEHA 1U06A 2RK2A 2JN0A 2C0IA 4E47A 4E2FB 1WHKA 4FYVB 1UHCA 2FPDA 1Q86R 2RK1A 2D0QB 3IQLA 3CCLA 3JB9F 3CCMQ 3CCRQ 4JRPA 4DBHA 2PUKB 1WQ7A 4M7DF 4OGCA 4O5VA 4Y92A 1IXDA 2E10A 2MPXC 4II1A 2CKKA 3EG2A 2E3HA 4OB2B 3CMAA 2VVKA 2RHYA 5IHKA 5CCAA 1NPPA 2ZPFB 2LT4A 2XKOC 2EYXA 4J83A 3CCMA 1W2BS 2RO0A 1I0CA 1IB8A 1RAEB 3QIIA 4LUDA 2ZAEA 1TWBA 1WZOA 2GQVA 1WYXA 4GLKA 2EYZA 4BE1A 5I11A 1X6GA 2BZXA 4RTWA 3RERA 3LGFA 2QQRA 4PJLA 2EQUA 5GMKl 2DIQA 2NLUA 2GTJA 2DERA 1SKUB 4C92B 3REBB 1M5Q1 3OS1A 2F2VA 1WJQA 4X9CA 2LJ1A 5KYXB 3CC2A 4GLMA 1Y96A 4C0FA 4J9EA 2DFUA 1QVFA 2LCLA 4XTUA 3OB9A 1EX4A 3T9NA 1KJWA 1PRMC 4NS5A 5IXBA 5DLQE 4BI3A 1UB4A 2LCSA 1Y7XA 1YHQA 1MMAA 2DL8A 1WJRA 2NYSA 3G1JA 2EQIA 2COZA 4C0GA 3MP6A 1N5ZA 2AKLA 2FB7A 4JPBW 4E7SA 2GNCA 2CGHA 4PJOG 3G71Q 2KYMA 1ZBXA 2EW3A 4DBFA 1RADB 3NPFA 4QVDA 4XU1A 4IKFA 1WJSA 1KK7A 2QQBA 3FJ5A 5D7UA 2K57A 2O01E 2ED1A 3BDLA 4OP0A 3G6ET 3MEUA 3KFVA 2FO0A 3EGUA 3E9FA 4JZ4A 2AZSA 4EMGA 1VQ5T 4FIBA 2I2LA 8ATCB 1QCFA 3BFMA 4J9DA 5CO7A 2JS0A 3WXMB 2YUPA 2M9UA 5GAOr 2BTTA 1YJNA 1ZX6A 2X4YA 4DOWA 1WHMA 1QVFP 2A08A 4F14A 4JRKA 4BUGA 1K9MU 4F17A 2KBTA 2D8JA 4DQ2A 2CS7A 2XDBA 1Z9QA 3RKXA 5A0LA 2CT3A 3OYKA 2DL5A 3D7SB 1W6XA 3OY9A 2JTMA 2QASA 2OTJQ 1E6GA 3SEMA 4HVVA 2ZCFB 1TUDA 2B8AA 1JJ2S 1SHGA 4DEXA 1WXTA 3C0CA 2KMTA 2DRKA 3M0QA 1VQ8Q 2OTLQ 3CPWA 1K9MC 1X69A 4M78A 3O5ZA 4RCBA 2EFIA 4OB3B 4BI4A 2XD0A 3CCEQ 2ABLA 3CMET 1JU5C 1YNZA 4KBMB 2KDSA 2DZ9A 4LE9A 3RKWA 1WHHA 4C8QB 2EBPA 4F7UG 3GOXA 2HQEA 2HZYA 4ATOA 1GCQC 2ZPHB 2J06A 4ORZA 2DILA 1B07A 1I1JA 2H8HA 3PVLA 3M4GA 5KYWB 4TVRA 2IG0A 1N9SA 5ECAA 3CCVT 3RDVA 2ATCB 2V8KA 1NBEB 1X27A 2NUPB 3I35A 3H0FA 2E5KA 3EGXB 5CQXA 3MKDA 5GANg 1T0HA 1KQ2A 2RHIA 4N0AA 4YTLA 4M7AA 1M2VB 1VQPA 2RF0A 3UDCA 5GMKj 3OYDA 3QXEB 4DBRA 3OYIA 3H41A 4JRIA 3CCJA 3CPWP 1WHLA 2EIFA 4Y91A 1YIJT 3M0PA 4EMKC 2X35A 1VQMT 1X2KA 3PFSA 1VQ7Q 1VQ4A 5J3BA 2Z0WA 3ZL7C 2LP5A 3KUFA 1OX8A 1G8XA 2CSIA 2SRCA 1BKBA 3QJYA 4HT9A 1KFZA 2DNUA 4CC3A 2GGRA 3V7CA 1PM3A 4OGEA 4A4EA 1M2OA 5GANh 1K73U 3L2RA 1IGQA 3TSWA 4HCCA 2MCNA
chains in the Genus database with same CATH topology
2DA9A 3M0RA 1PNJA 4OMPA 4WCIA 2DE0X 2EVRA 2P4RA 1UGVA 3JV3A 1GRIA 1KSWA 2O31A 2KNBB 1WFWA 3NHNA 5GJVB 3VS7A 4JJCA 3VS2A 2J6OA 2KRNA 2J05A 2YUQA 2DVJA 2EGAA 1NYFA 2LZ6B 3VS3A 2L3QA 3QWXX 1MV3A 1H92A 4X1VA 4GBQA 2J6FA 4RTTA 2K9GA 4AFQC 2C0OA 1YN8A 1ZUKA 1K9AA 3QWYA 1RI9A 5I22A 2OAWA 1GBRA 5IHNA 3VS4A 1SPKA 2EGEA 1M3BA 4Z88A 1VA7A 4AFSC 2CH4A 1PRLC 2FPFA 5FWBA 1LCKA 1UJYA 4RTYA 1YWPA 1OEBA 2W10A 2XMFA 1SRMA 2DL7A 4OMQA 4CC7A 1BBZA 2FG0A 4Z8AA 1AD5A 1HD3A 1H3HA 1GL5A 1UFFA 3M0UA 2KGTA 1BB9A 1GBQA 1WI7A 2JMCA 2L3PA 4R0KA 4KRTA 1E6HA 1AOJA 2RQVA 1M30A 2MIOA 1U5SA 2PNIA 3REAB 1RLPC 2A37A 2KRMA 2CUDA 2B86A 2BZYA 2RMOA 1K1ZA 2L2PA 1TUCA 1MUZA 1M3CA 1UE9A 2O9VA 1I07A 1SEMA 1ZUUA 4K11A 1NLOC 1QLYA 2M51A 3TSZA 1NEBA 2SEMA 2KYBA 2V1RA 2K7AA 3LH5A 4OMLA 1NG2A 3VS5A 3EG1A 3TVTA 2IIMA 4EIKA 1HSQA 2EKHA 2KE9A 1BU1A 1T3LA 1OOTA 1UHFA 2AK5A 1WIEA 2HSPA 2F2XA 2RN8A 1ABOA 4J9CA 2JM8A 3UF4A 4F16A 3U23A 1ZSGA 2ROTA 2O9SA 2DBKA 3GBQA 1U06A 2CUBA 4AG2C 2C0IA 2YUNA 1AWJA 1UHCA 4HXJA 2BZ8A 2FPDA 4HCKA 1VYTA 1M8MA 4OMMA 3IQLA 5GJWB 1QKXA 2MOXA 2O2OA 2DF6A 4LN2A 3EG3A 2W0ZA 3UA6A 4CC2A 1PKSA 4AFUC 1XOVA 2F2WA 2LJ0A 1W70A 1WLPB 1M27C 1UTIA 2KEAA 4Y92A 4JJBA 3VS0A 4ESRA 2K79A 2V1QA 3SHWA 3VS6A 2DM1A 1AZGB 2RQRA 2RQWA 2DJQA 3EG2A 5HCKA 2VVKA 5IHKA 2JW4A 2EYXA 2C0TA 1X43A 1AWOA 1QWFA 5IHIA 1QWEA 1I0CA 2PZ1A 2DRMA 1NYGA 1K4US 3VRZA 4LUDA 1W1FA 1K0XA 2YDLA 2VKNA 2PTKA 1WYXA 2EYZA 1AZEA 5I11A 1X6GA 2BZXA 4RTWA 1TG0A 4AG1C 1MV0B 2J7IA 2QDLA 2GTJA 3REBB 2D1XA 2F2VA 2LJ3A 2LJ1A 2FRWA 3ULRB 2EYWA 4GLMA 3CQTA 4DEYA 1JO8A 4JJDA 4IIMA 4LUEA 4J9EA 2DYBA 1HJDA 1G83A 1RUWA 1JQQA 1GCQA 2HBWA 2ESWA 3NGPA 3A98A 4CC4B 2KT8A 1M3AA 2FEIA 1T3SA 1KJWA 1PRMC 4HVWA 1ZLMA 5IXBA 2LCSA 1OPKA 4RUGA 2DLPA 2ED0A 1VYUA 2DL8A 3EHQA 4OMNA 2LQNA 1H8KA 1UJ0A 2EQIA 2M0YA 1SRLA 3RBBB 1N5ZA 2AKLA 4JPBW 2GNCA 2LNHB 2EYYA 2J6KA 1AWXA 2KYMA 4M4ZA 1PHTA 2JTEA 2EW3A 4J9GA 4AFZC 3NPFA 2YUOA 4J9IA 3PE0A 3R6NA 1UUEA 1PWTA 2KRSA 3FJ5A 2ED1A 2JS2A 3KFVA 2I0NA 2OI3A 2GBQA 5IXFA 1K0SA 2DMOA 2FO0A 3EGUA 4JZ4A 2AZSA 2RQTA 3M0TA 1WDXA 1QCFA 4HVUA 4J9DA 4E6RA 1WXBA 1NM7A 3UA7A 2ECZA 2ENMA 2JS0A 2FPEA 1K76A 1VYVA 2KR3A 2YUPA 4RTVA 1NEGA 2BTTA 1YP5A 5IH2A 2HEQA 1ZX6A 2D8HA 2CREA 3I5RA 2A08A 4F14A 1UDLA 4F17A 2KBTA 2D8JA 1CKAA 2EGCA 1WA7A 1Z9QA 2KXDA 1V1CA 1ARKA 4QT7A 2CT3A 3H0HA 1YCSB 2DL5A 2GQIA 1CKBA 2A36A 2FRYA 1FYNA 2G6FX 1W6XA 1JXMA 1AVZC 2X3XD 1E6GA 4OMOA 3SEMA 1WXUA 4HVVA 2KT1A 1TUDA 1SHGA 2O88A 4DEXA 1WXTA 3C0CA 2AKKA 3VRYA 2VWFA 2X3WD 2DRKA 3M0QA 1GFDA 2LQWA 2YSQA 2CDTA 1X69A 3O5ZA 2YT6A 2LX7A 2ABLA 1X6BA 1JU5C 1Z9ZA 1YNZA 1ZUYA 2ROLA 1QKWA 2JT4A 2L3SA 4LE9A 1J3TA 4A63B 2EBPA 1KIKA 2DX1A 1PKTA 1GFCA 1GCQC 2HDAA 2J06A 3NMZC 4J9BA 2DILA 4ORZA 1B07A 1I1JA 2H8HA 2JXBA 1Y0MA 1EFNA 3PVLA 1ABQA 1ZBJA 3EHRA 4D8DA 1NLPC 4J9FA 3UATA 1Y57A 5ECAA 1UG1A 4J9HA 3M0SA 2KROA 2RNAA 3EG0A 1UECA 4LNPA 1X27A 1E7OA 3I35A 4JZ3A 2DL3A 1AEYA 3H0FA 2E5KA 1U3OA 4D8KA 1T0HA 1GCPA 4RTXA 1A0NB 2CSQA 1IO6A 5L23A 2L0AA 2D0NA 2RF0A 4IIOA 2CH4W 3RNJA 1BK2A 2K6DA 2RPNA 4FSSA 5EC7A 2JM9A 1X2QA 3H41A 2OJ2A 3M0PA 1WX6A 1YWOA 1SSHA 2JMAA 1X2KA 2NUZA 2AZVA 3I5SA 1CSKA 3I9QA 2LMJA 2DBMA 1JEGA 5FWCA 3PVQA 3ZL7C 3VS1A 2LP5A 2CT4A 4RTZA 2CSIA 2K3BA 1OV3A 2DL4A 2GTOA 1SHFA 2SRCA 1AWWA 1RLQC 1S1NA 2NWMA 1KFZA 2DNUA 4CC3A 2GGRA 2KXCA 4ZNXA 1G2BA 1T0JA 2RQUA 1B3QA 4RTUA 1FMKA 1JXOA 2HCKA 2EPDA 5FW9A 3THKA 2K2MA 3H0IA 4Z89A 1OPLA 3TSWA 2A28A 2MCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA9 A;  3M0R A;  1PNJ A;  4OMP A;  4WCI A;  2DE0 X;  2EVR A;  2P4R A;  1UGV A;  3JV3 A;  1GRI A;  1KSW A;  2O31 A;  2KNB B;  1WFW A;  3NHN A;  5GJV B;  3VS7 A;  4JJC A;  3VS2 A;  2J6O A;  2KRN A;  2J05 A;  2YUQ A;  2DVJ A;  2EGA A;  1NYF A;  2LZ6 B;  3VS3 A;  2L3Q A;  3QWX X;  1MV3 A;  1H92 A;  4X1V A;  4GBQ A;  2J6F A;  4RTT A;  2K9G A;  4AFQ C;  2C0O A;  1YN8 A;  1ZUK A;  1K9A A;  3QWY A;  1RI9 A;  5I22 A;  2OAW A;  1GBR A;  5IHN A;  3VS4 A;  1SPK A;  2EGE A;  1M3B A;  4Z88 A;  1VA7 A;  4AFS C;  2CH4 A;  1PRL C;  2FPF A;  5FWB A;  1LCK A;  1UJY A;  4RTY A;  1YWP A;  1OEB A;  2W10 A;  2XMF A;  1SRM A;  2DL7 A;  4OMQ A;  4CC7 A;  1BBZ A;  2FG0 A;  4Z8A A;  1AD5 A;  1HD3 A;  1H3H A;  1GL5 A;  1UFF A;  3M0U A;  2KGT A;  1BB9 A;  1GBQ A;  1WI7 A;  2JMC A;  2L3P A;  4R0K A;  4KRT A;  1E6H A;  1AOJ A;  2RQV A;  1M30 A;  2MIO A;  1U5S A;  2PNI A;  3REA B;  1RLP C;  2A37 A;  2KRM A;  2CUD A;  2B86 A;  2BZY A;  2RMO A;  1K1Z A;  2L2P A;  1TUC A;  1MUZ A;  1M3C A;  1UE9 A;  2O9V A;  1I07 A;  1SEM A;  1ZUU A;  4K11 A;  1NLO C;  1QLY A;  2M51 A;  3TSZ A;  1NEB A;  2SEM A;  2KYB A;  2V1R A;  2K7A A;  3LH5 A;  4OML A;  1NG2 A;  3VS5 A;  3EG1 A;  3TVT A;  2IIM A;  4EIK A;  1HSQ A;  2EKH A;  2KE9 A;  1BU1 A;  1T3L A;  1OOT A;  1UHF A;  2AK5 A;  1WIE A;  2HSP A;  2F2X A;  2RN8 A;  1ABO A;  4J9C A;  2JM8 A;  3UF4 A;  4F16 A;  3U23 A;  1ZSG A;  2ROT A;  2O9S A;  2DBK A;  3GBQ A;  1U06 A;  2CUB A;  4AG2 C;  2C0I A;  2YUN A;  1AWJ A;  1UHC A;  4HXJ A;  2BZ8 A;  2FPD A;  4HCK A;  1VYT A;  1M8M A;  4OMM A;  3IQL A;  5GJW B;  1QKX A;  2MOX A;  2O2O A;  2DF6 A;  4LN2 A;  3EG3 A;  2W0Z A;  3UA6 A;  4CC2 A;  1PKS A;  4AFU C;  1XOV A;  2F2W A;  2LJ0 A;  1W70 A;  1WLP B;  1M27 C;  1UTI A;  2KEA A;  4Y92 A;  4JJB A;  3VS0 A;  4ESR A;  2K79 A;  2V1Q A;  3SHW A;  3VS6 A;  2DM1 A;  1AZG B;  2RQR A;  2RQW A;  2DJQ A;  3EG2 A;  5HCK A;  2VVK A;  5IHK A;  2JW4 A;  2EYX A;  2C0T A;  1X43 A;  1AWO A;  1QWF A;  5IHI A;  1QWE A;  1I0C A;  2PZ1 A;  2DRM A;  1NYG A;  1K4U S;  3VRZ A;  4LUD A;  1W1F A;  1K0X A;  2YDL A;  2VKN A;  2PTK A;  1WYX A;  2EYZ A;  1AZE A;  5I11 A;  1X6G A;  2BZX A;  4RTW A;  1TG0 A;  4AG1 C;  1MV0 B;  2J7I A;  2QDL A;  2GTJ A;  3REB B;  2D1X A;  2F2V A;  2LJ3 A;  2LJ1 A;  2FRW A;  3ULR B;  2EYW A;  4GLM A;  3CQT A;  4DEY A;  1JO8 A;  4JJD A;  4IIM A;  4LUE A;  4J9E A;  2DYB A;  1HJD A;  1G83 A;  1RUW A;  1JQQ A;  1GCQ A;  2HBW A;  2ESW A;  3NGP A;  3A98 A;  4CC4 B;  2KT8 A;  1M3A A;  2FEI A;  1T3S A;  1KJW A;  1PRM C;  4HVW A;  1ZLM A;  5IXB A;  2LCS A;  1OPK A;  4RUG A;  2DLP A;  2ED0 A;  1VYU A;  2DL8 A;  3EHQ A;  4OMN A;  2LQN A;  1H8K A;  1UJ0 A;  2EQI A;  2M0Y A;  1SRL A;  3RBB B;  1N5Z A;  2AKL A;  4JPB W;  2GNC A;  2LNH B;  2EYY A;  2J6K A;  1AWX A;  2KYM A;  4M4Z A;  1PHT A;  2JTE A;  2EW3 A;  4J9G A;  4AFZ C;  3NPF A;  2YUO A;  4J9I A;  3PE0 A;  3R6N A;  1UUE A;  1PWT A;  2KRS A;  3FJ5 A;  2ED1 A;  2JS2 A;  3KFV A;  2I0N A;  2OI3 A;  2GBQ A;  5IXF A;  1K0S A;  2DMO A;  2FO0 A;  3EGU A;  4JZ4 A;  2AZS A;  2RQT A;  3M0T A;  1WDX A;  1QCF A;  4HVU A;  4J9D A;  4E6R A;  1WXB A;  1NM7 A;  3UA7 A;  2ECZ A;  2ENM A;  2JS0 A;  2FPE A;  1K76 A;  1VYV A;  2KR3 A;  2YUP A;  4RTV A;  1NEG A;  2BTT A;  1YP5 A;  5IH2 A;  2HEQ A;  1ZX6 A;  2D8H A;  2CRE A;  3I5R A;  2A08 A;  4F14 A;  1UDL A;  4F17 A;  2KBT A;  2D8J A;  1CKA A;  2EGC A;  1WA7 A;  1Z9Q A;  2KXD A;  1V1C A;  1ARK A;  4QT7 A;  2CT3 A;  3H0H A;  1YCS B;  2DL5 A;  2GQI A;  1CKB A;  2A36 A;  2FRY A;  1FYN A;  2G6F X;  1W6X A;  1JXM A;  1AVZ C;  2X3X D;  1E6G A;  4OMO A;  3SEM A;  1WXU A;  4HVV A;  2KT1 A;  1TUD A;  1SHG A;  2O88 A;  4DEX A;  1WXT A;  3C0C A;  2AKK A;  3VRY A;  2VWF A;  2X3W D;  2DRK A;  3M0Q A;  1GFD A;  2LQW A;  2YSQ A;  2CDT A;  1X69 A;  3O5Z A;  2YT6 A;  2LX7 A;  2ABL A;  1X6B A;  1JU5 C;  1Z9Z A;  1YNZ A;  1ZUY A;  2ROL A;  1QKW A;  2JT4 A;  2L3S A;  4LE9 A;  1J3T A;  4A63 B;  2EBP A;  1KIK A;  2DX1 A;  1PKT A;  1GFC A;  1GCQ C;  2HDA A;  2J06 A;  3NMZ C;  4J9B A;  2DIL A;  4ORZ A;  1B07 A;  1I1J A;  2H8H A;  2JXB A;  1Y0M A;  1EFN A;  3PVL A;  1ABQ A;  1ZBJ A;  3EHR A;  4D8D A;  1NLP C;  4J9F A;  3UAT A;  1Y57 A;  5ECA A;  1UG1 A;  4J9H A;  3M0S A;  2KRO A;  2RNA A;  3EG0 A;  1UEC A;  4LNP A;  1X27 A;  1E7O A;  3I35 A;  4JZ3 A;  2DL3 A;  1AEY A;  3H0F A;  2E5K A;  1U3O A;  4D8K A;  1T0H A;  1GCP A;  4RTX A;  1A0N B;  2CSQ A;  1IO6 A;  5L23 A;  2L0A A;  2D0N A;  2RF0 A;  4IIO A;  2CH4 W;  3RNJ A;  1BK2 A;  2K6D A;  2RPN A;  4FSS A;  5EC7 A;  2JM9 A;  1X2Q A;  3H41 A;  2OJ2 A;  3M0P A;  1WX6 A;  1YWO A;  1SSH A;  2JMA A;  1X2K A;  2NUZ A;  2AZV A;  3I5S A;  1CSK A;  3I9Q A;  2LMJ A;  2DBM A;  1JEG A;  5FWC A;  3PVQ A;  3ZL7 C;  3VS1 A;  2LP5 A;  2CT4 A;  4RTZ A;  2CSI A;  2K3B A;  1OV3 A;  2DL4 A;  2GTO A;  1SHF A;  2SRC A;  1AWW A;  1RLQ C;  1S1N A;  2NWM A;  1KFZ A;  2DNU A;  4CC3 A;  2GGR A;  2KXC A;  4ZNX A;  1G2B A;  1T0J A;  2RQU A;  1B3Q A;  4RTU A;  1FMK A;  1JXO A;  2HCK A;  2EPD A;  5FW9 A;  3THK A;  2K2M A;  3H0I A;  4Z89 A;  1OPL A;  3TSW A;  2A28 A;  2MCN A; 
#chains in the Genus database with same CATH topology
 4JS4 A;  4LDX A;  2EYQ A;  4QVZ A;  3CC4 A;  2YXY A;  1D09 B;  1PNJ A;  3VV0 A;  4V2S A;  2EVR A;  3JV3 A;  5GAN 4;  2O31 A;  1G3S A;  3NHN A;  3VS7 A;  4BD3 A;  2J6O A;  2J05 A;  2EGA A;  4FU6 A;  1YIT A;  4KUD K;  2L3Q A;  3OYB A;  4OF1 A;  1MV3 A;  1H92 A;  1K73 C;  1I5O B;  3HSB A;  1YJ9 A;  2J6F A;  2KSS A;  1WHG A;  2K9G A;  3CBP A;  1TXQ A;  4IUV A;  2BE7 D;  4A53 A;  5IHN A;  2F5T X;  4M78 F;  5HK0 A;  3JB9 H;  2JVV A;  1SPK A;  1IHV A;  1VA7 A;  3J80 E;  2E70 A;  1UJY A;  2AT1 B;  1H3Z A;  1OEB A;  4LDV A;  1JBM A;  1Y71 A;  4Q5W A;  4BY6 C;  2L89 A;  4Z02 A;  3HRT A;  3LW5 E;  1VUB A;  2EQJ A;  1H3H A;  4C92 D;  1UFF A;  1WQW A;  3M0U A;  1D3B B;  3QYH B;  4EMH A;  3MP1 A;  4A4F A;  4ZN3 A;  4M77 F;  3E9G A;  5GAO m;  2RQV A;  3RMQ A;  5CKF A;  1QVG A;  3F70 A;  1M30 A;  2MIO A;  1N8R U;  2FZK B;  1QP2 A;  1RLP C;  2KRM A;  1UGQ B;  2FYK A;  1I81 A;  1K1Z A;  4ZGD B;  3CXC A;  1I07 A;  2QG9 B;  1ZUU A;  2M51 A;  3CEY A;  3PNW C;  2SEM A;  5LJ3 h;  4B6M A;  2K7A A;  4M7A F;  3CCS T;  3TCJ A;  2DJZ A;  3TVT A;  2F1L A;  5KYY A;  3MPU B;  1K8A U;  1QP3 A;  2OTJ T;  2KE9 A;  1BU1 A;  1BCO A;  2H3J A;  3OSS C;  5KE2 A;  1N8R C;  4PNO A;  2AK5 A;  2JJ9 A;  2F2X A;  2RN8 A;  3OBY A;  3UF4 A;  1PD1 A;  3U23 A;  5J26 A;  2PVO B;  4MDW A;  2DBK A;  3P8H A;  3DB3 A;  4QW2 A;  4AG2 C;  3OS2 A;  4CRI A;  4C0D C;  1KD1 U;  1HK9 A;  1K8A C;  5C6S A;  4HCK A;  1M8M A;  3V7R A;  4FCY A;  4PJO A;  5GAN j;  2PUO B;  1KC8 R;  1QKX A;  2O2O A;  3EGD A;  5FRN A;  3EG3 A;  1Q7Y U;  4ZGJ B;  2W0Z A;  4AMC A;  4AFU C;  2E41 A;  1XOV A;  4IUQ A;  3VUZ A;  4Y28 E;  4JJB A;  2COY A;  4ESR A;  4L59 A;  5KH6 A;  1RAF B;  3CXC P;  1K9M R;  2HKQ B;  2WSF E;  3JCM W;  3JB9 D;  2JW4 A;  4E7Z A;  2P0Q A;  2P4T A;  1KD1 C;  3NTH A;  2KI7 A;  5GAN f;  1ZSZ C;  3QHS A;  2R57 A;  1K4U S;  3BW1 A;  5GAN 2;  1K0X A;  3G6E A;  1Q7Y C;  1PCX A;  2YDL A;  5GAO q;  2VKN A;  5GAN 6;  3OYL A;  1VQ5 A;  3QDR B;  2L8D A;  2E12 A;  4M78 B;  2RI5 A;  4LDU A;  3PTA A;  4M75 E;  2FRW A;  5AT1 B;  5GAN e;  3JRZ A;  3MCA B;  1HJD A;  1G83 A;  1RUW A;  2HL5 C;  3C95 A;  4OVA A;  1GCQ A;  2HBW A;  3A98 A;  7AT1 B;  4CC4 B;  2GFU A;  2CP2 A;  4FT4 A;  1M3A A;  3CBO A;  2O4X A;  2RJD A;  4GY5 A;  2LTO A;  5A0D A;  2GFA A;  3O8V A;  2QAZ A;  2ZPI B;  4CI0 C;  2RH2 A;  2HKN A;  3GPL A;  2DLP A;  4KT0 E;  1VYU A;  2E6Z A;  4M77 B;  1M90 U;  3CCQ T;  3EHQ A;  1YJW A;  1UGP B;  4OMN A;  2LQN A;  3CME Q;  1UJ0 A;  1SRL A;  3RBB B;  2DPP B;  2LNH B;  4N4G A;  2EYY A;  1RAC B;  2J6K A;  2R58 A;  3PGG A;  2EQM A;  4M4Z A;  4FL6 A;  3JCM Q;  3UPU A;  4AFZ C;  2JZ2 A;  5KE3 A;  2YUO A;  4OMF B;  5KCO A;  1FMW A;  1WNL A;  3X26 B;  3R6N A;  1UUE A;  2JTF A;  4C0Z A;  3H8Z A;  3OW2 A;  5CKH A;  3CME A;  4J6W A;  3L2V A;  3BE3 A;  4B9X A;  4HCB A;  5IXF A;  2E6N A;  2PU9 B;  4IUR A;  2DO3 A;  3CCV Q;  4EMK A;  1D0Z A;  2FZG B;  3M0T A;  1AT1 B;  3PT9 A;  3X24 B;  1YBY A;  2ECZ A;  2FPE A;  2L5Q A;  2RA2 A;  2DYI A;  3EG9 A;  1PSF A;  5LJ3 f;  2K5I A;  2D8H A;  2YHT A;  3I55 T;  1LJO A;  2CP3 A;  4NOY A;  5GAO l;  4C92 G;  1VOM A;  4M75 C;  5GAO n;  1V1C A;  1ARK A;  4C5H A;  1YCS B;  1JRI A;  1YIJ Q;  2FRY A;  5LJ3 e;  1MND A;  1VQM Q;  1K73 R;  4BDY A;  4OMO A;  8AT1 B;  1RL2 A;  4NL2 A;  3CCR A;  2HD0 A;  4PKC C;  1O75 A;  5EG2 A;  2CZ0 B;  3VRY A;  3V8L A;  1IGU A;  4FT2 A;  2CZ1 B;  2BKD N;  1B34 A;  2E3I A;  2LQW A;  3S3N A;  4PJO E;  1MMD A;  4HA8 A;  4PJM A;  5CR2 A;  1YI2 T;  3OYG A;  4C92 C;  3OW2 P;  4MDX A;  4ZTF A;  4J5Y A;  1QKW A;  2R5A A;  3FIF A;  2HL3 A;  2DX1 A;  2QQA A;  3LX7 A;  5GAN 3;  1GFC A;  3I56 T;  3NMZ C;  4A54 A;  5CAI A;  1B7T A;  4PFO A;  1NLP C;  4D8D A;  4J9F A;  5L8R E;  4JDS A;  4FW1 A;  4J9H A;  5CIU A;  3L2Q A;  4ZN1 A;  1O9S A;  2DL3 A;  1U3O A;  1YCY A;  5GAN 8;  4C8Q E;  5L23 A;  5FRO A;  4IIO A;  2CH4 W;  3RNJ A;  4E7K A;  1BK2 A;  1HXD A;  3VJP A;  3MJX A;  2JM9 A;  4ZGE B;  1BI1 A;  1X2Q A;  4PJJ A;  2E4H A;  2KVQ G;  2K2V A;  2V8I A;  5GAM f;  3G71 A;  3M4Y A;  3JCM h;  4PFP A;  1OZ2 A;  1MGQ A;  2NUZ A;  3FJP A;  3GLX A;  3PVQ A;  1X6O A;  4KH1 B;  3HL8 A;  3EFO A;  1OV3 A;  1OX9 A;  3EFS A;  1WGS A;  1AWW A;  2LVM A;  2E65 A;  1M1K U;  4PJO C;  4J7F A;  3QJ6 A;  5DY9 A;  1M1F A;  4VUB A;  1S72 T;  2KXC A;  1MMG A;  1G2B A;  1T0J A;  2RQU A;  5D6Y A;  4F7U E;  3L2Z A;  1VQO T;  4RTU A;  1R0C B;  5GAM e;  2HCK A;  2MMP A;  2XI9 A;  2VXE A;  4C8Q G;  2A3L A;  3HHT B;  2DVE A;  5HKC A;  2K5F A;  1R77 A;  3CCS Q;  2EWN A;  3M0R A;  3GIB A;  4L5G A;  1C1A A;  4M7D B;  1TUG B;  5HK3 A;  2EKO A;  1UGV A;  1GRI A;  3SDZ A;  2CZ7 B;  1WFW A;  5I2S A;  4JJC A;  2VUB A;  1M1K C;  3EGD B;  3VS3 A;  1VQ6 T;  2X4X A;  1QQJ A;  1XNI A;  1MMN A;  3OS5 A;  4X1V A;  2MK5 A;  2RI2 A;  4RTT A;  2G3R A;  2M0O A;  2OTJ A;  3UWN A;  2M1H A;  2LX9 A;  1ZSZ A;  2MI6 A;  1Q82 U;  5I22 A;  2NUT B;  4C8Q C;  2OX7 A;  2YWW A;  2DEQ A;  3L2W A;  2QEX T;  2KY9 A;  3VS4 A;  2DKG A;  1VQ8 A;  1VIE A;  2OTL A;  3CD6 T;  2EJ9 A;  3E19 A;  1MNE A;  2CH4 A;  3ME9 A;  1PRL C;  4PL6 A;  3V7S A;  2VYT A;  4E7J A;  3CCE A;  4JS5 A;  2W10 A;  2YRC A;  3VKI A;  4FYW B;  2ZGW A;  4M78 D;  4Z8A A;  3QG1 A;  4KH0 B;  1Q82 C;  3SWN B;  4RCC A;  1BB9 A;  3R6O A;  1X01 A;  1C0M A;  1E6H A;  2YRD A;  5KYU B;  3PMT A;  5HY6 A;  1U5S A;  3CCL T;  4MZP A;  3M56 A;  2DXT A;  4FW2 A;  2HMA A;  4HKE A;  3OQ5 A;  2B86 A;  2BZY A;  2RMO A;  4HCZ A;  1JB0 E;  1NE8 A;  3FDR A;  1TUC A;  2R5M A;  3OYJ A;  1TU0 B;  1NLO C;  3X25 B;  2V1R A;  4M77 D;  1IHW A;  3LH5 A;  4OML A;  1NG2 A;  4EIK A;  3QUI A;  3CMA T;  3TRE A;  2AHJ B;  2EKH A;  2OAU A;  1GXI E;  2CP5 A;  3QDF A;  5LJ5 h;  1RAA B;  3RUX A;  1IRX A;  4J8O A;  2QGF B;  1M8V A;  2P84 A;  3L1A A;  2CP7 A;  4D6W A;  1BI0 A;  4J9C A;  2VV5 A;  2XG8 D;  1D1B A;  4F16 A;  4IUT A;  4M7A D;  2LT1 A;  1Q86 U;  4LD6 A;  2F69 A;  2CUB A;  1PSE A;  1W2B A;  3CCQ Q;  3ER0 A;  2RJF A;  4EMK B;  3A5Z B;  2QA4 T;  1VQ7 A;  2MWO A;  1KQS A;  2YLB A;  2YUN A;  2QTX A;  5CKD A;  2E64 A;  3LLR A;  2QDY B;  3CC2 T;  1ACM B;  1SF9 A;  1VYT A;  2EQK A;  4OMM A;  2QTV A;  5GMK i;  5GJW B;  4QVC A;  3JCM f;  3PIO A;  3UA6 A;  4CC2 A;  1PKS A;  4R55 A;  4M75 A;  2DZC A;  4DOV A;  2F2W A;  2LJ0 A;  1WLP B;  1M27 C;  2MAM A;  2JNG A;  1VQN Q;  2EJF A;  1P92 A;  3OYH A;  2V1Q A;  3OMG A;  1QVP A;  3RR6 A;  1AZG B;  3G7Z A;  4QQD A;  2DJQ A;  3SD4 A;  3JCM c;  3OYY A;  5CQY A;  4A4H A;  3M58 A;  2C0T A;  1X43 A;  1AWO A;  1QWF A;  2P0P A;  3JCM e;  3CC7 T;  2PZ1 A;  2DRM A;  5FU7 B;  2M02 A;  1VQL T;  2K3Y A;  3LH0 A;  3A8H B;  5LJ3 g;  2PTK A;  3I55 Q;  3OYC A;  1D0X A;  2XU8 A;  1RAH B;  4ME7 A;  1YFN A;  4C92 A;  1D1C A;  2QDL A;  3LWI A;  5KYX A;  4ELY C;  4WTO B;  2D1X A;  2LJ3 A;  3ULR B;  2EYW A;  3VUB A;  3CQT A;  4DEY A;  1TTH B;  4LUE A;  2DYB A;  2L3R A;  2KAF A;  1W2B P;  1OZ3 A;  2ESW A;  1Y96 B;  2LC4 A;  4C5E A;  1KQS P;  2KT8 A;  3M54 A;  5FRM A;  1YJN T;  1ZLM A;  1KHI A;  4RUG A;  3Q1J A;  2ED0 A;  4BY6 B;  3FEO A;  2QQS A;  4J7I A;  1YI2 Q;  4HT8 A;  1H8K A;  1KQ1 A;  3HPW A;  4IUP A;  2X9H A;  3OYM A;  1RAG B;  4EDU A;  3WVE B;  1FMV A;  1PHT A;  2JTE A;  4J9G A;  2RD1 A;  3J81 E;  4J9I A;  3I56 Q;  2CP0 A;  3JCM X;  1QVF S;  1PWT A;  2KRS A;  4RG2 A;  3FC3 A;  1YI2 A;  4XTX A;  4QQ6 A;  5LJ5 j;  2BIV A;  2OI3 A;  1IZ6 A;  4MMK A;  1WDX A;  2X51 A;  4HVU A;  4P5N A;  4J6X A;  2HNI A;  2RM4 A;  2PQW A;  3JB9 J;  3UA7 A;  2ENM A;  1G5V A;  1NEG A;  5IH2 A;  2HEQ A;  4DBQ A;  2RJC A;  1RAB B;  3I5R A;  4LD9 K;  5GAN d;  2XDD A;  2DD5 A;  5LJ5 f;  1QVG P;  2KXD A;  4XQ3 A;  1PG5 B;  2GQI A;  1D1A A;  2A36 A;  3DB4 A;  5CVI A;  4A4K A;  1BIA A;  2G6F X;  2LQK A;  1G3Y A;  1JXM A;  1AVZ C;  2X3X D;  5GAM g;  4M75 F;  1WXU A;  2LRQ A;  2KT1 A;  3A8M B;  2FZC B;  4E7I A;  4X34 A;  3JCM V;  2O88 A;  5FLX E;  4M7D D;  5LJ5 e;  4JLI A;  2VWF A;  4MML A;  4E7L A;  4M77 G;  1FX7 A;  4X9D A;  3EH2 A;  2DTO A;  1VQP T;  1S72 Q;  2PVD B;  2CDT A;  2P0K A;  2ZZD A;  1VQO Q;  3OYN A;  1U1T A;  1X6B A;  2QGG A;  1MHN A;  1ZUY A;  2CZ6 B;  2ROL A;  4C8Q A;  1UGR B;  2JT4 A;  3CCJ T;  4QQG A;  3JB9 I;  1ZSZ B;  1AHJ B;  4A63 B;  1QCO A;  3OSV A;  4PJN A;  4FM4 B;  3M53 A;  1PKT A;  3LGL A;  4C92 F;  1VQ4 T;  1S72 A;  1N9R A;  2HDA A;  3OYE A;  2D9T A;  1QMC A;  1M1G A;  4A4G A;  5KYW A;  1Y0M A;  3PMI A;  1ABQ A;  1ZBJ A;  3QSU A;  3MET A;  1VQ6 Q;  1ZA2 B;  3UAT A;  1Y57 A;  5GAM h;  1UG1 A;  3EG0 A;  1UEC A;  3CPW S;  2E5Q A;  3CBM A;  2YRV A;  6AT1 B;  4LNP A;  3EGX A;  5LL6 S;  4JZ3 A;  4C92 E;  4ANJ A;  4D8K A;  3URG A;  3H6Z A;  1G3W A;  4BE0 A;  4RTX A;  2QEX Q;  2CSQ A;  1IO6 A;  4F7U A;  2L0A A;  3ZBD A;  1PC0 A;  3MEV A;  5LJ3 j;  2QQ9 A;  3CD6 Q;  2D0N A;  3JCM J;  1H64 1;  4M7A B;  5LJ3 d;  4XK8 E;  2K6D A;  2RPN A;  1R0B G;  4FSS A;  5EC7 A;  2AIR B;  4L6V 5;  2C06 A;  1VQN T;  2VB6 A;  1TSF A;  3MP8 A;  3G4S Q;  1M90 C;  4ELZ C;  2LNV A;  1TS9 A;  1PD0 A;  1WX6 A;  1YWO A;  3I5S A;  1CSK A;  2LMJ A;  3VS1 A;  3ASK A;  4AT1 B;  5A0G A;  1VQ9 T;  1M4Z A;  4RTZ A;  5IAY A;  2DL4 A;  3HRS A;  5CK9 A;  3CCL Q;  2BE9 B;  3HP9 A;  4FYY B;  5FU6 B;  1KG1 A;  1OYX A;  2ZPG B;  3CCV A;  2E1H A;  2X4J A;  1B3Q A;  3RMS A;  3TU4 K;  1FMK A;  1JXO A;  3MHX A;  5FW9 A;  3THK A;  1Q81 U;  4Z89 A;  4PJO F;  2A28 A;  4B9W A;  4N4I A;  2DA9 A;  2K5L A;  9ATC B;  2WSC E;  1U1S A;  2LQ8 A;  3CMA Q;  3C12 A;  4WCI A;  1LVK A;  4XTZ A;  1KSW A;  4J6Y A;  2KNB B;  4O6J A;  5D6W A;  4PFZ A;  2KRN A;  2YUQ A;  3HFN A;  1U8R A;  1VQK T;  2LZ6 B;  3OBW A;  1OUL A;  4M75 B;  4KGX B;  1YIJ A;  1TOV A;  2MYS A;  1Q81 C;  1YN8 A;  4JJN K;  1VQM A;  1ZUK A;  1K9A A;  3JAM E;  2QA4 Q;  5A2Q E;  3CC2 Q;  3VU3 C;  1KQS S;  1GBR A;  5DLO A;  3MEA A;  3JCM P;  4M7D E;  2EGE A;  2RHU A;  1C6V X;  2BUD A;  4Z88 A;  4AFS C;  3OYA A;  4KUI A;  3NTI A;  2FPF A;  3RES A;  3JCM g;  4C8Q F;  3A1P A;  3HTR A;  4C5G A;  4FSX A;  2RJE A;  2QA4 A;  2FL7 A;  2XMF A;  2DL7 A;  4OMQ A;  4QKU A;  1YHQ Q;  3N5B B;  2GCX A;  1D3B A;  4XU2 A;  1GL5 A;  3A8G B;  3QO3 A;  5GAM j;  2KGT A;  2JUF A;  1WI7 A;  2L3P A;  3MO8 A;  3QZ9 B;  4R0K A;  4KRT A;  5GAM d;  3CC7 Q;  2RB6 A;  2XID A;  2PNI A;  1VQL Q;  3AHU A;  2A37 A;  3NTK A;  3CCU T;  1LOJ A;  2FHD A;  1ZQ1 A;  3L2U A;  3JB9 G;  3GF5 A;  1MUZ A;  1UE9 A;  2O9V A;  1SEM A;  1N8R R;  4IUU A;  1NEB A;  4BDZ A;  4M7D G;  2IPO B;  4F7U F;  3CC7 A;  3VS5 A;  3EG1 A;  1HSQ A;  2HSE B;  1VQL A;  5AYF A;  5GMK h;  2X4W A;  4XU3 A;  3INZ A;  4RMO A;  5KYY B;  1I5L A;  3GP8 A;  1OOT A;  4RKU E;  2HSP A;  1WIE A;  1NJI U;  1ZA1 B;  1YJN Q;  1ABO A;  4BE2 A;  1K8A R;  2VGN A;  4LDW A;  4RG8 A;  1ZSG A;  1QVG S;  3PIP A;  5GAN 5;  3FRN A;  2ROT A;  2O9S A;  1ZHI A;  1KC8 U;  2D6F A;  1TH7 A;  3CXC S;  1I4K 1;  4F04 B;  1AWJ A;  4HXJ A;  2BZ8 A;  3E1S A;  4M7D C;  2DEU A;  4JUV A;  4OB1 B;  4WF2 A;  3DLL A;  2MOX A;  3OS0 A;  1N27 A;  3X28 B;  4PJO B;  2DF6 A;  4LN2 A;  1NJI C;  3A8L B;  4UC4 A;  1XTD A;  1XJW B;  1KD1 R;  3VYH B;  1W70 A;  1UTI A;  3S3M A;  2KEA A;  1LPL A;  3EH1 A;  2MWP A;  3VS0 A;  2K79 A;  3SHW A;  3VS6 A;  2DM1 A;  3CCS A;  1Q7Y R;  1KC8 C;  2RQR A;  1XQH A;  2RQW A;  5HCK A;  4C5I A;  1RAI B;  1YJW T;  4ZTJ A;  2KQW A;  5IHI A;  1QWE A;  2VGM A;  1R8O B;  1NYG A;  4R56 A;  3VRZ A;  1W1F A;  4XU0 A;  4MZM A;  3ZFJ A;  2K3X A;  1AZE A;  1D0Y A;  1TG0 A;  4AG1 C;  1MV0 B;  5KYN A;  3LWH A;  2J7I A;  5LJ5 g;  2XHC A;  1NPR A;  1V76 A;  3M59 A;  1F1B B;  3G4S T;  2DD4 A;  1JO8 A;  4JJD A;  4IIM A;  3RIR A;  2M16 A;  3SWN C;  3M57 A;  3EFR A;  1HYO A;  1JQQ A;  3NGP A;  2FEI A;  1T3S A;  5IT9 E;  2VXF A;  4HVW A;  2O4X B;  3RKY A;  5CKB A;  4M77 A;  1IRE B;  1VQP Q;  1OPK A;  3C94 A;  5IN1 A;  1NZ9 A;  1UGS B;  1Y07 A;  2EAY A;  2M0Y A;  1WPY A;  1DJ7 B;  3CCJ Q;  4N4H A;  1AWX A;  1M90 R;  2QYZ A;  2Y4Y A;  3KXT A;  3CCM T;  3CCR T;  1VQ4 Q;  3PE0 A;  2DXU A;  3QZ5 B;  4F7U B;  1SSF A;  4XTV A;  1BIB A;  2DXC A;  1VIF A;  2H3E B;  2JS2 A;  2I0N A;  3JCM d;  1SG5 A;  2GBQ A;  4PLL A;  4NL3 A;  1K0S A;  2DMO A;  1I8F A;  3VYG A;  2RQT A;  2JOY A;  2RHZ A;  4XAX B;  4E6R A;  1WXB A;  1NM7 A;  2A0F B;  2EJG A;  3AT1 B;  1K76 A;  1VYV A;  2KR3 A;  2HBP A;  4RTV A;  1YP5 A;  2LDM A;  5M9O A;  3CC4 Q;  5CKE A;  3EG9 B;  2CRE A;  3SFM A;  1QW1 A;  2V8J A;  1UDL A;  3JCM b;  5KCH A;  3S6W A;  1CKA A;  3CCQ A;  2EGC A;  1WA7 A;  1Q86 C;  1YIT Q;  2RI3 A;  4QT7 A;  2DXB A;  3H0H A;  3OW2 S;  1UEB A;  4XTY A;  1CKB A;  1YHQ T;  1YJ9 Q;  1FYN A;  3FLG A;  1X75 C;  2QXF A;  4MZT A;  2LCC A;  1Q81 R;  4PK4 A;  3GNG A;  5FU7 C;  2DTH A;  4BI8 B;  3HFO A;  1VQ9 Q;  5GMK e;  2AKK A;  1BI2 A;  2X3W D;  1VQN A;  3OMC A;  2QI2 A;  1GFD A;  1V29 B;  2YSQ A;  2CYZ B;  2YT6 A;  1B34 B;  2CP6 A;  2LX7 A;  5C0M A;  2DTI A;  3E2U A;  2XIC A;  4JLG A;  4M75 D;  1Z9Z A;  3DKM A;  2KK4 A;  3MEW A;  2XK0 A;  5GAO p;  2L3S A;  1VQ9 A;  3G71 T;  1J3T A;  1KIK A;  1BYM A;  3I55 A;  5GAN 7;  4J9B A;  2JXB A;  3BDU A;  2DK3 A;  3P8D A;  1EFN A;  3WVD B;  1VQK Q;  3EHR A;  3M0S A;  2FVU A;  2KRO A;  2RNA A;  3HKS A;  2DET A;  4M78 E;  1KHC A;  1E7O A;  3EAE A;  1FXX A;  1AEY A;  1EIF A;  3NFC A;  1VQK A;  1GCP A;  2XDP A;  1A0N B;  3UT1 A;  3DLM A;  1OI1 A;  4XTW A;  3SB2 A;  1OU9 A;  3C4S A;  2Y4X A;  5LJ5 d;  5J39 A;  2COW A;  2OJ2 A;  4OB0 B;  3GNF B;  4M77 E;  4KUL A;  1SSH A;  2JMA A;  2AZV A;  1JJ2 A;  1QCN A;  3I9Q A;  2IVW A;  2DBM A;  3I56 A;  3KBG A;  5FWC A;  3JSC A;  1JEG A;  2CT4 A;  2K3B A;  2GTO A;  1SHF A;  5GMK m;  1RLQ C;  1S1N A;  2NWM A;  4DA4 A;  1VQ8 T;  3EFO B;  2OTL T;  3CCU Q;  4M78 G;  4ZNX A;  2WSE E;  2WAC A;  4M7A E;  2HAX A;  3CCE T;  1NJI R;  3BY7 A;  2EPD A;  2K4Y A;  1M1K R;  2K2M A;  2DIG A;  3H0I A;  1OPL A;  4M7D A;  3X20 B;  4C0D B;  4BAC A;  4OMP A;  2DE0 X;  2MF2 A;  2P4R A;  2A7Y A;  3TEE A;  3CCU A;  3CPF A;  5GJV B;  1RI0 A;  3VS2 A;  2DVJ A;  1NYF A;  2RHX A;  3V8K A;  3FB9 A;  3G6E Q;  4PJO D;  5I21 A;  2Y90 A;  3QWX X;  3QPH A;  1FWZ A;  1BCM A;  4GBQ A;  4M78 C;  1VQ5 Q;  4AFQ C;  2C0O A;  2NUT A;  3LYI A;  1Q95 G;  1W4S A;  2F5K A;  3QWY A;  1RI9 A;  3P8B B;  5I2M A;  2QK0 A;  4BB7 A;  1OQK A;  2OAW A;  3TQ7 P;  4FYX B;  2PVG B;  4M7A G;  5DM7 R;  1JJ2 P;  1BI3 A;  1M3B A;  4PLI A;  1Q82 R;  5FWB A;  1LCK A;  1VQO A;  4RTY A;  1YWP A;  3S3O A;  4KGZ B;  1SRM A;  4M77 C;  4CC7 A;  3SWN A;  5D6X A;  1BBZ A;  2FG0 A;  2NUP A;  2VC8 A;  3OYF A;  1AD5 A;  1HD3 A;  1YJW Q;  3HRU A;  1VQ7 T;  3L42 A;  4KGV B;  3A8O B;  2HQH A;  1OU8 A;  5KYU A;  1GBQ A;  4C8Q D;  2JMC A;  2VAS A;  1M2V A;  1AOJ A;  3CC4 T;  2DAQ A;  4JRQ A;  3REA B;  1VQ6 A;  4N0A C;  2ZPE B;  3QBY A;  4M7A C;  2CUD A;  4EPC A;  3QKJ A;  2GF7 A;  2L2P A;  1M3C A;  4LXC A;  1WHJ A;  4K11 A;  1QLY A;  3TSZ A;  1YIT T;  2KYB A;  3OA6 A;  2HQX A;  1LNX A;  1G3T A;  2IIM A;  1YJ9 T;  1M9S A;  2QEX A;  3M55 A;  4E7H A;  1N6A A;  3CD6 A;  4LDY A;  1T3L A;  3M5A A;  4M75 G;  3J7A F;  3V8J A;  1UHF A;  3H9N A;  1EZZ B;  2ZPB B;  2JM8 A;  3M9Q A;  5FU6 C;  2V26 A;  3QYG B;  3G4S A;  2YLC A;  3GBQ A;  3ZEH A;  1U06 A;  2RK2 A;  2JN0 A;  2C0I A;  4E47 A;  4E2F B;  1WHK A;  4FYV B;  1UHC A;  2FPD A;  1Q86 R;  2RK1 A;  2D0Q B;  3IQL A;  3CCL A;  3JB9 F;  3CCM Q;  3CCR Q;  4JRP A;  4DBH A;  2PUK B;  1WQ7 A;  4M7D F;  4OGC A;  4O5V A;  4Y92 A;  1IXD A;  2E10 A;  2MPX C;  4II1 A;  2CKK A;  3EG2 A;  2E3H A;  4OB2 B;  3CMA A;  2VVK A;  2RHY A;  5IHK A;  5CCA A;  1NPP A;  2ZPF B;  2LT4 A;  2XKO C;  2EYX A;  4J83 A;  3CCM A;  1W2B S;  2RO0 A;  1I0C A;  1IB8 A;  1RAE B;  3QII A;  4LUD A;  2ZAE A;  1TWB A;  1WZO A;  2GQV A;  1WYX A;  4GLK A;  2EYZ A;  4BE1 A;  5I11 A;  1X6G A;  2BZX A;  4RTW A;  3RER A;  3LGF A;  2QQR A;  4PJL A;  2EQU A;  5GMK l;  2DIQ A;  2NLU A;  2GTJ A;  2DER A;  1SKU B;  4C92 B;  3REB B;  1M5Q 1;  3OS1 A;  2F2V A;  1WJQ A;  4X9C A;  2LJ1 A;  5KYX B;  3CC2 A;  4GLM A;  1Y96 A;  4C0F A;  4J9E A;  2DFU A;  1QVF A;  2LCL A;  4XTU A;  3OB9 A;  1EX4 A;  3T9N A;  1KJW A;  1PRM C;  4NS5 A;  5IXB A;  5DLQ E;  4BI3 A;  1UB4 A;  2LCS A;  1Y7X A;  1YHQ A;  1MMA A;  2DL8 A;  1WJR A;  2NYS A;  3G1J A;  2EQI A;  2COZ A;  4C0G A;  3MP6 A;  1N5Z A;  2AKL A;  2FB7 A;  4JPB W;  4E7S A;  2GNC A;  2CGH A;  4PJO G;  3G71 Q;  2KYM A;  1ZBX A;  2EW3 A;  4DBF A;  1RAD B;  3NPF A;  4QVD A;  4XU1 A;  4IKF A;  1WJS A;  1KK7 A;  2QQB A;  3FJ5 A;  5D7U A;  2K57 A;  2O01 E;  2ED1 A;  3BDL A;  4OP0 A;  3G6E T;  3MEU A;  3KFV A;  2FO0 A;  3EGU A;  3E9F A;  4JZ4 A;  2AZS A;  4EMG A;  1VQ5 T;  4FIB A;  2I2L A;  8ATC B;  1QCF A;  3BFM A;  4J9D A;  5CO7 A;  2JS0 A;  3WXM B;  2YUP A;  2M9U A;  5GAO r;  2BTT A;  1YJN A;  1ZX6 A;  2X4Y A;  4DOW A;  1WHM A;  1QVF P;  2A08 A;  4F14 A;  4JRK A;  4BUG A;  1K9M U;  4F17 A;  2KBT A;  2D8J A;  4DQ2 A;  2CS7 A;  2XDB A;  1Z9Q A;  3RKX A;  5A0L A;  2CT3 A;  3OYK A;  2DL5 A;  3D7S B;  1W6X A;  3OY9 A;  2JTM A;  2QAS A;  2OTJ Q;  1E6G A;  3SEM A;  4HVV A;  2ZCF B;  1TUD A;  2B8A A;  1JJ2 S;  1SHG A;  4DEX A;  1WXT A;  3C0C A;  2KMT A;  2DRK A;  3M0Q A;  1VQ8 Q;  2OTL Q;  3CPW A;  1K9M C;  1X69 A;  4M78 A;  3O5Z A;  4RCB A;  2EFI A;  4OB3 B;  4BI4 A;  2XD0 A;  3CCE Q;  2ABL A;  3CME T;  1JU5 C;  1YNZ A;  4KBM B;  2KDS A;  2DZ9 A;  4LE9 A;  3RKW A;  1WHH A;  4C8Q B;  2EBP A;  4F7U G;  3GOX A;  2HQE A;  2HZY A;  4ATO A;  1GCQ C;  2ZPH B;  2J06 A;  4ORZ A;  2DIL A;  1B07 A;  1I1J A;  2H8H A;  3PVL A;  3M4G A;  5KYW B;  4TVR A;  2IG0 A;  1N9S A;  5ECA A;  3CCV T;  3RDV A;  2ATC B;  2V8K A;  1NBE B;  1X27 A;  2NUP B;  3I35 A;  3H0F A;  2E5K A;  3EGX B;  5CQX A;  3MKD A;  5GAN g;  1T0H A;  1KQ2 A;  2RHI A;  4N0A A;  4YTL A;  4M7A A;  1M2V B;  1VQP A;  2RF0 A;  3UDC A;  5GMK j;  3OYD A;  3QXE B;  4DBR A;  3OYI A;  3H41 A;  4JRI A;  3CCJ A;  3CPW P;  1WHL A;  2EIF A;  4Y91 A;  1YIJ T;  3M0P A;  4EMK C;  2X35 A;  1VQM T;  1X2K A;  3PFS A;  1VQ7 Q;  1VQ4 A;  5J3B A;  2Z0W A;  3ZL7 C;  2LP5 A;  3KUF A;  1OX8 A;  1G8X A;  2CSI A;  2SRC A;  1BKB A;  3QJY A;  4HT9 A;  1KFZ A;  2DNU A;  4CC3 A;  2GGR A;  3V7C A;  1PM3 A;  4OGE A;  4A4E A;  1M2O A;  5GAN h;  1K73 U;  3L2R A;  1IGQ A;  3TSW A;  4HCC A;  2MCN A; 
#chains in the Genus database with same CATH homology
 2DA9 A;  3M0R A;  1PNJ A;  4OMP A;  4WCI A;  2DE0 X;  2EVR A;  2P4R A;  1UGV A;  3JV3 A;  1GRI A;  1KSW A;  2O31 A;  2KNB B;  1WFW A;  3NHN A;  5GJV B;  3VS7 A;  4JJC A;  3VS2 A;  2J6O A;  2KRN A;  2J05 A;  2YUQ A;  2DVJ A;  2EGA A;  1NYF A;  2LZ6 B;  3VS3 A;  2L3Q A;  3QWX X;  1MV3 A;  1H92 A;  4X1V A;  4GBQ A;  2J6F A;  4RTT A;  2K9G A;  4AFQ C;  2C0O A;  1YN8 A;  1ZUK A;  1K9A A;  3QWY A;  1RI9 A;  5I22 A;  2OAW A;  1GBR A;  5IHN A;  3VS4 A;  1SPK A;  2EGE A;  1M3B A;  4Z88 A;  1VA7 A;  4AFS C;  2CH4 A;  1PRL C;  2FPF A;  5FWB A;  1LCK A;  1UJY A;  4RTY A;  1YWP A;  1OEB A;  2W10 A;  2XMF A;  1SRM A;  2DL7 A;  4OMQ A;  4CC7 A;  1BBZ A;  2FG0 A;  4Z8A A;  1AD5 A;  1HD3 A;  1H3H A;  1GL5 A;  1UFF A;  3M0U A;  2KGT A;  1BB9 A;  1GBQ A;  1WI7 A;  2JMC A;  2L3P A;  4R0K A;  4KRT A;  1E6H A;  1AOJ A;  2RQV A;  1M30 A;  2MIO A;  1U5S A;  2PNI A;  3REA B;  1RLP C;  2A37 A;  2KRM A;  2CUD A;  2B86 A;  2BZY A;  2RMO A;  1K1Z A;  2L2P A;  1TUC A;  1MUZ A;  1M3C A;  1UE9 A;  2O9V A;  1I07 A;  1SEM A;  1ZUU A;  4K11 A;  1NLO C;  1QLY A;  2M51 A;  3TSZ A;  1NEB A;  2SEM A;  2KYB A;  2V1R A;  2K7A A;  3LH5 A;  4OML A;  1NG2 A;  3VS5 A;  3EG1 A;  3TVT A;  2IIM A;  4EIK A;  1HSQ A;  2EKH A;  2KE9 A;  1BU1 A;  1T3L A;  1OOT A;  1UHF A;  2AK5 A;  1WIE A;  2HSP A;  2F2X A;  2RN8 A;  1ABO A;  4J9C A;  2JM8 A;  3UF4 A;  4F16 A;  3U23 A;  1ZSG A;  2ROT A;  2O9S A;  2DBK A;  3GBQ A;  1U06 A;  2CUB A;  4AG2 C;  2C0I A;  2YUN A;  1AWJ A;  1UHC A;  4HXJ A;  2BZ8 A;  2FPD A;  4HCK A;  1VYT A;  1M8M A;  4OMM A;  3IQL A;  5GJW B;  1QKX A;  2MOX A;  2O2O A;  2DF6 A;  4LN2 A;  3EG3 A;  2W0Z A;  3UA6 A;  4CC2 A;  1PKS A;  4AFU C;  1XOV A;  2F2W A;  2LJ0 A;  1W70 A;  1WLP B;  1M27 C;  1UTI A;  2KEA A;  4Y92 A;  4JJB A;  3VS0 A;  4ESR A;  2K79 A;  2V1Q A;  3SHW A;  3VS6 A;  2DM1 A;  1AZG B;  2RQR A;  2RQW A;  2DJQ A;  3EG2 A;  5HCK A;  2VVK A;  5IHK A;  2JW4 A;  2EYX A;  2C0T A;  1X43 A;  1AWO A;  1QWF A;  5IHI A;  1QWE A;  1I0C A;  2PZ1 A;  2DRM A;  1NYG A;  1K4U S;  3VRZ A;  4LUD A;  1W1F A;  1K0X A;  2YDL A;  2VKN A;  2PTK A;  1WYX A;  2EYZ A;  1AZE A;  5I11 A;  1X6G A;  2BZX A;  4RTW A;  1TG0 A;  4AG1 C;  1MV0 B;  2J7I A;  2QDL A;  2GTJ A;  3REB B;  2D1X A;  2F2V A;  2LJ3 A;  2LJ1 A;  2FRW A;  3ULR B;  2EYW A;  4GLM A;  3CQT A;  4DEY A;  1JO8 A;  4JJD A;  4IIM A;  4LUE A;  4J9E A;  2DYB A;  1HJD A;  1G83 A;  1RUW A;  1JQQ A;  1GCQ A;  2HBW A;  2ESW A;  3NGP A;  3A98 A;  4CC4 B;  2KT8 A;  1M3A A;  2FEI A;  1T3S A;  1KJW A;  1PRM C;  4HVW A;  1ZLM A;  5IXB A;  2LCS A;  1OPK A;  4RUG A;  2DLP A;  2ED0 A;  1VYU A;  2DL8 A;  3EHQ A;  4OMN A;  2LQN A;  1H8K A;  1UJ0 A;  2EQI A;  2M0Y A;  1SRL A;  3RBB B;  1N5Z A;  2AKL A;  4JPB W;  2GNC A;  2LNH B;  2EYY A;  2J6K A;  1AWX A;  2KYM A;  4M4Z A;  1PHT A;  2JTE A;  2EW3 A;  4J9G A;  4AFZ C;  3NPF A;  2YUO A;  4J9I A;  3PE0 A;  3R6N A;  1UUE A;  1PWT A;  2KRS A;  3FJ5 A;  2ED1 A;  2JS2 A;  3KFV A;  2I0N A;  2OI3 A;  2GBQ A;  5IXF A;  1K0S A;  2DMO A;  2FO0 A;  3EGU A;  4JZ4 A;  2AZS A;  2RQT A;  3M0T A;  1WDX A;  1QCF A;  4HVU A;  4J9D A;  4E6R A;  1WXB A;  1NM7 A;  3UA7 A;  2ECZ A;  2ENM A;  2JS0 A;  2FPE A;  1K76 A;  1VYV A;  2KR3 A;  2YUP A;  4RTV A;  1NEG A;  2BTT A;  1YP5 A;  5IH2 A;  2HEQ A;  1ZX6 A;  2D8H A;  2CRE A;  3I5R A;  2A08 A;  4F14 A;  1UDL A;  4F17 A;  2KBT A;  2D8J A;  1CKA A;  2EGC A;  1WA7 A;  1Z9Q A;  2KXD A;  1V1C A;  1ARK A;  4QT7 A;  2CT3 A;  3H0H A;  1YCS B;  2DL5 A;  2GQI A;  1CKB A;  2A36 A;  2FRY A;  1FYN A;  2G6F X;  1W6X A;  1JXM A;  1AVZ C;  2X3X D;  1E6G A;  4OMO A;  3SEM A;  1WXU A;  4HVV A;  2KT1 A;  1TUD A;  1SHG A;  2O88 A;  4DEX A;  1WXT A;  3C0C A;  2AKK A;  3VRY A;  2VWF A;  2X3W D;  2DRK A;  3M0Q A;  1GFD A;  2LQW A;  2YSQ A;  2CDT A;  1X69 A;  3O5Z A;  2YT6 A;  2LX7 A;  2ABL A;  1X6B A;  1JU5 C;  1Z9Z A;  1YNZ A;  1ZUY A;  2ROL A;  1QKW A;  2JT4 A;  2L3S A;  4LE9 A;  1J3T A;  4A63 B;  2EBP A;  1KIK A;  2DX1 A;  1PKT A;  1GFC A;  1GCQ C;  2HDA A;  2J06 A;  3NMZ C;  4J9B A;  2DIL A;  4ORZ A;  1B07 A;  1I1J A;  2H8H A;  2JXB A;  1Y0M A;  1EFN A;  3PVL A;  1ABQ A;  1ZBJ A;  3EHR A;  4D8D A;  1NLP C;  4J9F A;  3UAT A;  1Y57 A;  5ECA A;  1UG1 A;  4J9H A;  3M0S A;  2KRO A;  2RNA A;  3EG0 A;  1UEC A;  4LNP A;  1X27 A;  1E7O A;  3I35 A;  4JZ3 A;  2DL3 A;  1AEY A;  3H0F A;  2E5K A;  1U3O A;  4D8K A;  1T0H A;  1GCP A;  4RTX A;  1A0N B;  2CSQ A;  1IO6 A;  5L23 A;  2L0A A;  2D0N A;  2RF0 A;  4IIO A;  2CH4 W;  3RNJ A;  1BK2 A;  2K6D A;  2RPN A;  4FSS A;  5EC7 A;  2JM9 A;  1X2Q A;  3H41 A;  2OJ2 A;  3M0P A;  1WX6 A;  1YWO A;  1SSH A;  2JMA A;  1X2K A;  2NUZ A;  2AZV A;  3I5S A;  1CSK A;  3I9Q A;  2LMJ A;  2DBM A;  1JEG A;  5FWC A;  3PVQ A;  3ZL7 C;  3VS1 A;  2LP5 A;  2CT4 A;  4RTZ A;  2CSI A;  2K3B A;  1OV3 A;  2DL4 A;  2GTO A;  1SHF A;  2SRC A;  1AWW A;  1RLQ C;  1S1N A;  2NWM A;  1KFZ A;  2DNU A;  4CC3 A;  2GGR A;  2KXC A;  4ZNX A;  1G2B A;  1T0J A;  2RQU A;  1B3Q A;  4RTU A;  1FMK A;  1JXO A;  2HCK A;  2EPD A;  5FW9 A;  3THK A;  2K2M A;  3H0I A;  4Z89 A;  1OPL A;  3TSW A;  2A28 A;  2MCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...