4Z8AA

Sh3-iii of drosophila rim-binding protein bound to a cacophony derived peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GPLGSPEFNRPVKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rim-binding protein
molecule keywords RIM-binding protein, isoform F
publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z8aA00
1V1CA 2VWFA 3LH5A 2J06A 4JJCA 1OOTA 2DYBA 2A28A 3O5ZA 2V1QA 1X6BA 2KYMA 1A0NB 1NLOC 1I1JA 2F2WA 1GBQA 1NYFA 2KRNA 1M3BA 1NM7A 1U3OA 1QLYA 2EBPA 2MIOA 2EKHA 2C0TA 4JJBA 2DA9A 2LNHB 5FWCA 2K3BA 2YT6A 1NEBA 1U06A 3M0RA 1Z9ZA 4K11A 4RTXA 2DL8A 4CC4B 2D0NA 2A08A 2XMFA 2CUDA 4CC3A 1PRLC 2JS2A 2A37A 2DE0X 1JO8A 2ROLA 4LE9A 2EYYA 1KIKA 1CKBA 1HD3A 3ZL7C 1E6HA 1FMKA 3EHQA 2VVKA 1UECA 2V1RA 1M3AA 3VS5A 2FEIA 1Y0MA 2A36A 3VS4A 2YUNA 3THKA 2DILA 3FJ5A 4OMOA 2BZYA 2MOXA 1ZLMA 2FPDA 1GCQC 1KSWA 1NEGA 1JQQA 2ESWA 3VS1A 2KYBA 3H0FA 1AWXA 3I9QA 2YUQA 3H41A 1BB9A 4DEXA 1X6GA 3A98A 1BU1A 1IO6A 3RBBB 2HDAA 2EGAA 4JPBW 4RTTA 1M27C 1WX6A 3TSWA 2O9SA 5ECAA 2FPEA 1YNZA 1T0HA 1CSKA 2DJQA 1M8MA 3NMZC 3M0UA 4OMLA 2AZVA 4CC7A 2J6KA 4RTZA 2D8JA 4OMPA 1BBZA 1GCQA 2DL4A 2DMOA 2F2XA 2J6FA 2CDTA 4RTYA 4E6RA 1AVZC 2RNAA 3M0PA 2EYXA 1QWFA 4CC2A 1H8KA 3UATA 2O9VA 2AKKA 1WXBA 2DX1A 2BTTA 2CSQA 3EGUA 2FRYA 2QDLA 3EG2A 3NHNA 2CSIA 4RUGA 1SRLA 4HVWA 1AZEA 2YSQA 3EG1A 2J7IA 2DVJA 2DRMA 1ZUUA 1S1NA 1WYXA 2LJ1A 1SHFA 4WCIA 2LMJA 2P4RA 3RNJA 3UA6A 2JTEA 3UF4A 3U23A 1QKWA 5L23A 2LP5A 1HSQA 1MUZA 1RLQC 1VYVA 2HBWA 2J6OA 3R6NA 1ABOA 1WXTA 5EC7A 1H3HA 3JV3A 1UGVA 1PKSA 2K2MA 2MCNA 4ZNXA 1JXMA 3I35A 2CH4W 2DLPA 2CT3A 1T0JA 1G83A 2EYWA 3VS6A 4RTUA 2EQIA 2OJ2A 1AEYA 3REAB 2VKNA 2RQVA 1K1ZA 2IIMA 2OAWA 3PVQA 3UA7A 2KRMA 1UHCA 2M51A 1UJYA 2H8HA 1B3QA 1UE9A 4HVUA 4F17A 5IHKA 3M0SA 2OI3A 4HVVA 1SSHA 1PNJA 1FYNA 4EIKA 2KXDA 1K76A 2RQUA 2C0IA 4Z89A 1QWEA 2SEMA 1AOJA 2JM8A 2PNIA 1MV3A 1VYTA 1VYUA 5HCKA 1AWJA 4JZ3A 2GGRA 4OMNA 5GJVB 2L2PA 1AZGB 1QKXA 3M0QA 1ZUYA 2HSPA 2JW4A 2HEQA 1WDXA 2ED1A 1X69A 4J9GA 2C0OA 1RUWA 3ULRB 3QWXX 2AKLA 4GBQA 2ECZA 3TSZA 1N5ZA 3VRZA 4ESRA 4M4ZA 5I22A 2YUOA 2JMAA 2RQWA 1K9AA 2DBKA 1UG1A 2GNCA 1NG2A 1PRMC 1GFCA 4Z88A 5IXFA 2RPNA 4HCKA 2EVRA 3KFVA 5IHIA 3CQTA 4RTVA 1HJDA 2GTOA 1JEGA 1SHGA 2G6FX 3VRYA 4J9CA 1OPKA 2AZSA 1YWOA 1UDLA 2ABLA 1XOVA 1AWWA 1UTIA 1PKTA 2GQIA 1K4US 4J9IA 1MV0B 2X3WD 1X43A 1RLPC 2B86A 2EGCA 1QCFA 2FPFA 2LCSA 2D1XA 2KNBB 2LJ0A 2D8HA 5IH2A 1YCSB 2E5KA 1YP5A 2KEAA 4JZ4A 1NLPC 1WA7A 1Y57A 4AFSC 2RN8A 1GCPA 5FWBA 4JJDA 4DEYA 1KJWA 4J9FA 3C0CA 1Z9QA 3H0HA 2YDLA 2DL5A 4OMQA 1UHFA 2KBTA 1JU5C 1W70A 2CUBA 1E7OA 2LX7A 4F14A 2J05A 1K0SA 4RTWA 4J9HA 2EW3A 3M0TA 2GTJA 3EHRA 1U5SA 2DL7A 4X1VA 1BK2A 2GBQA 2PTKA 3QWYA 2EPDA 2RF0A 3REBB 4J9DA 2SRCA 1GBRA 2DRKA 3GBQA 1X27A 5IXBA 1ABQA 1WFWA 1J3TA 3SEMA 2F2VA 1PHTA 1W1FA 1K0XA 1LCKA 1RI9A 2RQTA 2L3SA 1WLPB 3I5SA 2K9GA 4R0KA 1T3SA 5GJWB 2YUPA 2KT1A 2K79A 3H0IA 3PE0A 1G2BA 2JMCA 2L3QA 1SEMA 5FW9A 4AFUC 2L0AA 2DNUA 1ZSGA 4GLMA 3VS3A 1NYGA 4D8DA 2BZXA 2EYZA 2KR3A 2KT8A 1ARKA 1KFZA 1JXOA 2I0NA 3SHWA 2KXCA 1TG0A 2RMOA 4F16A 2KGTA 2ED0A 2NWMA 2KE9A 2ROTA 1TUDA 4AFQC 2O88A 3EG3A 1ZBJA 1X2KA 2LJ3A 2DBMA 1M30A 4LNPA 1AD5A 2DF6A 4AG2C 1I07A 2LQWA 4J9EA 1YN8A 1ZUKA 2EGEA 2LZ6B 1OEBA 1B07A 1AWOA 1ZX6A 4HXJA 1VA7A 3IQLA 2K7AA 2M0YA 1I0CA 2X3XD 3VS2A 4LN2A 1T3LA 2DM1A 3VS0A 2CREA 1UJ0A 1UFFA 2CT4A 1WIEA 1OPLA 1GFDA 4LUDA 4OMMA 2FG0A 1WXUA 2AK5A 2PZ1A 2CH4A 1CKAA 1SRMA 2L3PA 4Z8AA 1YWPA 2W10A 2NUZA 4KRTA 4QT7A 1OV3A 3VS7A 4D8KA 2O31A 4AG1C 1W6XA 2JS0A 1TUCA 2FRWA 1H92A 2K6DA 3TVTA 1E6GA 2LQNA 4LUEA 2JM9A 2DL3A 3NGPA 1PWTA 3I5RA 2JXBA 2O2OA 2W0ZA 3NPFA 2BZ8A 5IHNA 1WI7A 2KRSA 4A63B 2HCKA 4IIOA 1EFNA 1GRIA 1UUEA 4Y92A 4ORZA 1GL5A 1SPKA 5I11A 2KROA 2ENMA 3PVLA 4FSSA 4J9BA 1X2QA 3EG0A 2JT4A 4IIMA 2RQRA 2FO0A 1M3CA 4AFZC
chains in the Genus database with same CATH superfamily
2V8JA 3EFOA 2FHDA 1TSFA 3L2ZA 2A28A 2PU9B 2V1QA 4PNOA 4L59A 1NLOC 2KRNA 1NM7A 5HY6A 1U3OA 2EBPA 2MIOA 3A8HB 3JCMP 4A54A 4OGCA 4C0GA 4R56A 2HBPA 1IREB 4OB0B 4X34A 2QYZA 2KSSA 2QA4T 2P0KA 3OBYA 1BI0A 3X20B 3M0RA 3CC2A 5FRMA 1D3BB 1YCYA 3L2RA 2EQJA 4FYYB 2CZ6B 4CC4B 1VQ7Q 4C92D 4CC3A 1PRLC 1VQLT 3LGLA 4XTZA 3OYIA 3E9GA 2ROLA 4LE9A 2EYYA 1KIKA 2HD0A 4J5YA 2RJEA 1M3AA 5GANf 1O75A 5IAYA 1NJIC 3CMET 3VS4A 3THKA 4OP0A 3TCJA 2FPDA 5LJ3f 1VUBA 3C95A 4EMHA 4XTYA 2PVDB 3TQ7P 2ESWA 3CCRT 2KYBA 2CP3A 5KYXB 1KC8R 3JCMh 2KY9A 1WHJA 2YUQA 1W2BP 2EGAA 3CCLT 2VV5A 3I55Q 4JLIA 3BW1A 1PM3A 5GMKm 4HCCA 2DXTA 3OYGA 5A0DA 4BE1A 5CCAA 3CEYA 1ZSZA 4C92B 1QVGP 4JRQA 3DB3A 5GAMh 4CC7A 1P92A 4RTZA 4XAXB 3QYHB 2DL4A 1Y96B 4E7IA 1AVZC 3X25B 2RNAA 1U8RA 1R0BG 3J80E 1ZA2B 4BUGA 4C5IA 3EGDA 2CSQA 4E7ZA 3EGUA 3GF5A 2XHCA 2LT4A 3NHNA 1UGRB 2DD4A 4RUGA 1NJIU 3CXCA 2QTVA 2RK1A 3VU3C 1LNXA 1VQ6A 1S1NA 3QJ6A 1OU9A 2CZ0B 2P4RA 3RNJA 1M90C 2NUPB 2VB6A 2ZPEB 4M7AE 3TREA 4TVRA 1RLQC 3FDRA 2J6OA 2XDPA 4FL6A 1UB4A 1RAIB 1WXTA 4QQ6A 1PKSA 1G3YA 2CT3A 4ZTJA 1Q86R 1G83A 3HFNA 2EYWA 2EQIA 3L2WA 4KGXB 2RQVA 2IIMA 5CKEA 5I2SA 4RG2A 1M9SA 3JCMf 4LDWA 4QQGA 2OI3A 1D3BA 3JB9J 1SSHA 2O01E 1PNJA 1I81A 2KXDA 3CBOA 2GQVA 2YXYA 5LJ5h 1R8OB 2V26A 5D7UA 2VXFA 4M75E 2JM8A 3I55T 3EAEA 4OMNA 5GJVB 2L2PA 1WJRA 3P8DA 3JRZA 5GAMf 4DA4A 3M0QA 1OX8A 1ZUYA 3BDUA 4C8QC 3H8ZA 2QTXA 3EFRA 4GLKA 1RADB 3ULRB 4OF1A 5KE3A 2RHIA 2ECZA 2GCXA 5KYXA 1M90U 2P4TA 4GY5A 2RQWA 1D0YA 1IHVA 3CMAA 1UG1A 2GNCA 2DTOA 3CCUA 1PRMC 1GFCA 3JAME 3WXMB 2KI7A 5GANe 1KD1U 5GAOn 1ZBXA 4F7UG 4MZPA 4C92A 3MEUA 1JEGA 1SHGA 3VRYA 5M9OA 2AZSA 4LD6A 5LJ3e 1XOVA 1JBMA 1OI1A 2GQIA 1MV0B 1N8RU 1RLPC 1M5Q1 2B86A 1OZ2A 1TU0B 1Y96A 2FPFA 2LJ0A 5IH2A 1U1TA 2E5KA 1YP5A 3DLLA 4C8QG 1GCPA 1OQKA 4JDSA 4QW2A 4DEYA 2M0OA 1GXIE 2R58A 1BCOA 4DBRA 4J8OA 3PGGA 2KBTA 3QYGB 2MWOA 1VQ4Q 2LX7A 4A4HA 2J05A 1WZOA 4X9CA 1S72Q 4X1VA 1U5SA 1FX7A 4OB2B 1NPRA 3JCMQ 2NUPA 2RF0A 3BFMA 5IXBA 3PT9A 2E4HA 3SEMA 1EX4A 1TWBA 5A0GA 4E2FB 4JUVA 4PJMA 5CAIA 2RM4A 1TH7A 2R57A 3C94A 1KC8C 5GAOl 3X28B 4PJJA 1F1BB 4B9WA 1I5LA 2JJ9A 2QEXQ 3M53A 1T3SA 4M78C 4XTVA 2YUPA 3SB2A 2CZ7B 2QQ9A 4AMCA 1QW1A 5GANg 5J26A 1VQKQ 5FW9A 3M4GA 3CCMA 2LTOA 5GAOr 1Y71A 4OGEA 2L0AA 1OZ3A 3VS3A 4D8DA 1QCNA 5LJ3g 4E7HA 3QDRB 1VQPQ 2XK0A 3CC7Q 2KR3A 3OW2S 2DZ9A 1JXOA 2I0NA 2RMOA 2KGTA 2NWMA 4MDWA 2KE9A 3O8VA 4BI3A 1TUDA 5C6SA 2HAXA 4IUQA 2DTHA 4E47A 4OB1B 5GMKj 3JCMe 2DF6A 4AG2C 9ATCB 4MZMA 1YN8A 2O4XB 1B07A 4O6JA 1AWOA 1VA7A 3OMCA 4M78G 4QVDA 3QHSA 1VQ9A 2HKQB 3V8JA 2MPXC 1NJIR 3OYMA 1I0CA 3VS2A 1KC8U 1ZA1B 5GAMe 3RKWA 5HK0A 1UJ0A 4M77D 3QZ9B 4EDUA 2QQRA 3JCMV 1VQ4T 1CKAA 2L3PA 3SWNB 4Z8AA 4KRTA 2NUZA 4ELZC 1YIJA 1S72T 1K8AR 3FC3A 2FRWA 2KDSA 4FT4A 1Q86C 4E7JA 1JJ2P 4LUEA 2JM9A 3L42A 4J7FA 1FWZA 2BZ8A 2VXEA 4BI4A 1WI7A 2RH2A 4IIOA 1EFNA 3CCSA 2DXCA 5FRNA 4IUTA 3RESA 2QI2A 3L2UA 1X2QA 3QDFA 3CCVA 1MNDA 2QEXT 5KYWB 2E5QA 1M3CA 1WNLA 1XJWB 4M77B 1OOTA 2DYBA 3QKJA 4ZGEB 3O5ZA 1VQKT 3RERA 1RABB 3VJPA 5J39A 2F2WA 4C5GA 1QLYA 2VUBA 3JCMg 1VQPT 3CC7T 3JCMd 3INZA 2QA4A 2G3RA 1QVFP 1FMWA 2EQKA 1U06A 2M02A 3TU4K 5IT9E 2LCCA 3META 3UDCA 2M16A 4J6WA 2D0NA 3RMSA 2XMFA 4KH0B 3LYIA 2VYTA 1VQLA 3OYBA 5GAMg 2KQWA 4BE0A 1HD3A 2ZCFB 3ZL7C 1FMKA 2DXBA 3ASKA 3CBMA 3VS5A 2FEIA 1Y0MA 5GAN3 4N0AA 3CMEA 1NBEB 5GAN5 5D6WA 1KD1R 2DILA 1SSFA 2BZYA 2MOXA 4F7UF 1UGQB 2MYSA 1NEGA 2CZ1B 5CR2A 4JS4A 3CCRA 4M7AC 3H0FA 3JB9G 3OW2A 1N8RR 4BY6B 3A98A 1IO6A 4FYWB 4JPBW 3HSBA 2BE9B 5CO7A 1HYOA 3CCLA 1M27C 4DBQA 2EJGA 2HNIA 3TSWA 5FLXE 4C8QF 4Y91A 2O9SA 4A4KA 2FPEA 4II1A 1VQOA 1M1GA 1PD0A 1QP2A 1YNZA 1OX9A 2O4XA 1YJ9Q 2ZPBB 3EH2A 4KULA 4JJNK 1Q81R 2XG8D 4OMPA 1GCQA 2F2XA 3A8LB 3EGDB 4M7DD 2CDTA 2CYZB 1YBYA 4Y28E 2EYXA 3V7SA 1X01A 4M75C 3JCMc 4DOVA 1KQSP 4XU2A 3FLGA 4ZGDB 4CI0C 2K5IA 2CKKA 2LVMA 2DX1A 3MHXA 1B34A 4M7AG 1R77A 2F5KA 3LH0A 2CSIA 2DIGA 3HHTB 4PJNA 2GFUA 4RMOA 4M77F 1SRLA 2QQBA 4BE2A 2J7IA 3RUXA 2DRMA 3JCMb 1SHFA 1MNEA 3DKMA 3UA6A 2JTEA 3GP8A 1QKWA 2ZPFB 2LP5A 4ANJA 6AT1B 1VYVA 5KYWA 3OMGA 3VUZA 2HQEA 4OMFB 5EC7A 1H3HA 3CCJA 4M7DB 3JV3A 4EMKC 1UGVA 4M77A 4HCZA 2MCNA 1D1BA 1JXMA 1C0MA 1G3SA 2JTFA 1T0JA 2FZGB 2MI6A 1XQHA 1VQ5Q 5GAN8 4J7IA 4M75G 4IUPA 1AEYA 3REAB 2VKNA 4RKUE 3S3NA 2OAWA 3PVQA 3UA7A 2X51A 1IZ6A 2M51A 1UJYA 2M1HA 4PFPA 1QQJA 1UE9A 3D7SB 4HVUA 2EFIA 2DO3A 1FYNA 5HK3A 1K76A 4PJOD 2X4WA 2MMPA 2K4YA 1BIAA 4J6XA 5I21A 2E6NA 2PNIA 3I55A 1VYUA 5HCKA 4IUVA 2ZPGB 4JZ3A 3PIPA 3HRSA 2JVVA 5D6XA 4EPCA 1YJ9T 3UPUA 2HSPA 1K8AC 1WDXA 2ED1A 3CC2Q 2Y90A 1TUGB 2V8KA 4FW2A 2C0OA 1BI2A 3QWXX 1VQMQ 4GBQA 2HQXA 3E2UA 2QK0A 1MGQA 3J7AF 2DBKA 2WACA 5EG2A 1AT1B 1EZZB 3OYKA 4XU0A 2EQUA 2PUOB 2EVRA 4PJOB 2JTMA 3CQTA 4RTVA 1HJDA 5KYYB 2P84A 4J9CA 1OPKA 4FT2A 1WQWA 3OSVA 1AWWA 3GOXA 3MP1A 3MKDA 4J9IA 2X3WD 4LD9K 2DIQA 2HQHA 5IN1A 2LCSA 2D1XA 2D8HA 3M55A 3BDLA 4JZ4A 1LJOA 3V8KA 1WA7A 1Y57A 4AFSC 3M4YA 3OYLA 5KYNA 2PVGB 4YTLA 3C0CA 1Z9QA 5KE2A 5D6YA 2MWPA 1UHFA 2K2VA 4M7DF 1JU5C 4C92E 1QVFA 1VQ5T 2K3XA 3A8MB 4F14A 2DETA 2I2LA 4RTWA 2ZPHB 5GANj 1K8AU 2QG9B 3M0TA 2L5QA 5AYFA 1VQ7T 2GBQA 4A4FA 3GPLA 4C0FA 3QWYA 2HSEB 1YJNA 5LJ3j 3MP6A 2RD1A 4J9DA 2F1LA 4KBMB 3REBB 1KD1C 2D6FA 1GBRA 2DRKA 3GBQA 1X27A 4IKFA 3CCEQ 3MEAA 4JRPA 1UEBA 3CPWP 1W1FA 1C6VX 4M7DA 1SKUB 3Q1JA 3UWNA 1N8RC 1D1CA 1K9MR 1WLPB 2EKOA 2LT1A 2JOYA 2ZPIB 2K79A 4C5EA 3JB9F 3H0IA 3RMQA 2KVQG 4MMLA 3CC2T 3LWHA 1VQMT 4LDXA 3G71Q 4V2SA 1RAHB 1V29B 3FEOA 4UC4A 2DVEA 1Q81C 3JCMX 3SHWA 2KXCA 4MZTA 3E19A 1TG0A 5FROA 4AFQC 1WPYA 3C12A 1X75C 1ZBJA 1X2KA 4PKCC 1IHWA 1NPPA 2VGNA 4PJOF 4AT1B 2HZYA 1M30A 1NE8A 5KCOA 3JSCA 2JUFA 3SWNC 2LQWA 1G3WA 1YI2Q 1SF9A 3OS0A 1ZX6A 4M7AF 1WJSA 3IQLA 3QUIA 2PQWA 4JS5A 2K7AA 1T3LA 2DM1A 4PJOA 1BIBA 3HKSA 2QQSA 2QQAA 1VIEA 5KYYA 1OPLA 4LUDA 1WXUA 2AK5A 1VQ4A 1B7TA 1ZQ1A 3MP8A 3RKYA 3VS7A 3NFCA 4AG1C 4DOWA 8ATCB 2JS0A 5LL6S 5FU7C 2YWWA 2RHXA 3CMAQ 2QXFA 1VQNA 2DXUA 3M57A 2W0ZA 3NPFA 4BDZA 2QASA 2MF2A 3E9FA 4JLGA 2GFAA 1Q81U 3CCET 1PC0A 3MEVA 3A1PA 4ATOA 4M75F 4FSSA 2PUKB 1BI1A 4FM4B 2DAQA 2JT4A 4JRIA 1IXDA 5GMKi 5LJ5f 4D6WA 2E10A 2WSCE 4C0DC 3H6ZA 1BI3A 2DEUA 1V1CA 2VWFA 4NL2A 5GAMj 5L8RE 3LH5A 1VQKA 1DJ7B 1I1JA 3KXTA 2NUTA 1M3BA 3OSSC 3JB9H 3M58A 3QBYA 3G71T 2FVUA 1I4K1 2ZGWA 4ZGJB 2OTJA 2EKHA 3CBPA 5FWCA 1W2BA 1C1AA 1NEBA 2HMAA 1Z9ZA 2FZCB 3S3MA 1KHCA 4RTXA 2DL8A 5GANd 4Z02A 2DJZA 1KG1A 1I8FA 2DE0X 1RAFB 2K57A 5GAOp 3AHUA 5LJ3d 4C8QD 3GIBA 1ZSZC 3VUBA 1QVGA 1UECA 2VC8A 2R5MA 4FCYA 3CD6Q 1YI2T 2YUNA 3FJ5A 2MAMA 1Q82R 1KSWA 3QPHA 4OVAA 3NTIA 1H3ZA 1JQQA 3VS1A 1HK9A 1YITQ 3A5ZB 1AWXA 3I9QA 4QVCA 5HKCA 2DZCA 3H41A 1BB9A 4DEXA 2E65A 1BU1A 2ZZDA 4F7UB 3RBBB 1M2OA 3CCMQ 1TOVA 4RTTA 1WX6A 3M9QA 2ATCB 3L2QA 1T0HA 3F70A 2CP6A 3CMAT 1M8MA 3NMZC 3CC4Q 4C8QB 1K73C 5LJ5j 2AZVA 3TEEA 2J6KA 2DERA 2D8JA 1TXQA 1BBZA 1QMCA 2DMOA 3QO3A 2PVOB 4RTYA 5KYUB 3VYGA 1B34B 1G5VA 2AIRB 3L2VA 4HT9A 4QKUA 2EYQA 4CC2A 1H8KA 3UATA 2AKKA 1K9MC 1RI0A 1Q7YU 2FRYA 3FIFA 2LDMA 3QJYA 2D0QB 4KUDK 4C5HA 3OS2A 4HVWA 1YHQA 2NYSA 3EG1A 1V76A 5CK9A 1NZ9A 1ZUUA 2LJ1A 2LMJA 4LDVA 4FU6A 2E3HA 1IRXA 3PMTA 4DBHA 1MUZA 3G6EQ 1PSEA 3R6NA 1Q95G 2HKNA 3OYCA 3G4SQ 3I35A 3OYAA 2CH4W 2RI2A 2DLPA 1RL2A 3CD6T 2ZAEA 2BE7D 2OJ2A 4N4GA 1K73U 2QGFB 2Y4YA 4XU3A 3CXCP 2OTLQ 2XKOC 3M0SA 4IURA 4HVVA 1YITT 4EIKA 5LJ5e 3OYJA 5GAMd 3G7ZA 4Z89A 2DTIA 1QWEA 2SEMA 2QGGA 1AOJA 3CCMT 3S3OA 3DLMA 1MV3A 1VYTA 4M77E 1K9MU 2XU8A 1R0CB 3QIIA 1AZGB 4C92C 4R55A 3CCQQ 4NL3A 1LPLA 3CC4T 2JW4A 1ACMB 2HEQA 1X69A 2Z0WA 1WHHA 3SD4A 4FYXB 1RUWA 2FYKA 2LC4A 2NLUA 3MO8A 3TSZA 5CKDA 1RAEB 3VRZA 4BDYA 5I22A 2JMAA 4F7UA 1K9AA 3VYHB 2RJCA 2HL5C 3I56Q 1YJWQ 5IXFA 2RPNA 2WSFE 4HCKA 4QVZA 1LOJA 4HA8A 2OX7A 3M54A 1IGQA 1X6OA 3SFMA 1YWOA 2AT1B 2CGHA 4C8QA 1UDLA 2ABLA 5DM7R 5GAN2 2P0PA 1PKTA 1K4US 1X43A 3RDVA 1QVFS 1QCFA 3OBWA 4BB7A 1VQ8Q 1M8VA 2YHTA 4C92G 5KYUA 1XNIA 2FL7A 2KEAA 1NLPC 4RCCA 3VV0A 4ME7A 2QDYB 3G6ET 5FWBA 4ZN1A 1KJWA 1VQOQ 1WHMA 4J9FA 2COWA 1TS9A 3H0HA 2YDLA 5LJ5g 2DL5A 4KGZB 3G4ST 2RA2A 5GMKl 2DYIA 7AT1B 4KGVB 5LJ5d 1VQ5A 5FU6B 1E7OA 3X24B 1K0SA 4J9HA 3MPUB 2JN0A 4XQ3A 2AHJB 3JB9D 2EW3A 1VIFA 1VQ7A 4E7KA 1Y7XA 2PTKA 3MJXA 2OTLT 2A7YA 4PLLA 5CVIA 2R5AA 1ABQA 1WFWA 1Q82C 2F2VA 1I5OB 1PHTA 1K0XA 2JZ2A 1LCKA 1BKBA 4WTOB 4BI8B 3JCMW 3H9NA 3SDZA 3OYDA 1RI9A 2RQTA 2L3SA 4CRIA 3I5SA 3OB9A 4RCBA 2JNGA 2YRCA 3CCQT 1G2BA 1VQMA 4ZN3A 1ZSGA 4M78F 4GLMA 2E3IA 1NYGA 4EMGA 3CCJQ 1KQSS 4M7AD 2KT8A 1M1FA 2E6ZA 1ARKA 1KFZA 2A0FB 3V7CA 4MMKA 2LQ8A 3I56T 1PSFA 2H3EB 4DQ2A 4M7DE 1WJQA 1YJWT 1SG5A 2RB6A 3DB4A 2ROTA 3LX7A 2O88A 4B9XA 5DY9A 1WQ7A 3EG3A 2DK3A 1JJ2A 4M78A 2IVWA 4HT8A 2XD0A 2K5LA 1AD5A 1WHKA 1VQ8T 2P0QA 5AT1B 2EGEA 2EIFA 1Q7YR 3EH1A 1JRIA 4HXJA 4PFZA 1Q82U 2X4XA 2EWNA 1VQOT 2M0YA 4M75D 2X3XD 2C06A 2CREA 4X9DA 4M7AB 1WIEA 2XI9A 3ZFJA 3M56A 4OMMA 3M5AA 2PZ1A 3HP9A 4NOYA 2CH4A 5CIUA 5CKBA 1YWPA 1OV3A 2O31A 2OAUA 1W6XA 1EIFA 1G3TA 1E6GA 2WSEE 2LQNA 2COYA 3NGPA 3I5RA 2XIDA 2O2OA 5IHNA 1PG5B 1QVPA 1QP3A 3CCEA 4A63B 2HCKA 2DFUA 2MK5A 1GRIA 1UUEA 4Y92A 4ORZA 4A4EA 4J9BA 1K73R 4PJOE 5I2MA 3JB9I 1IB8A 4J83A 1BCMA 2RK2A 4IIMA 4XTUA 1N6AA 2L89A 2NUTB 2RQRA 2KAFA 1W2BS 1D0ZA 2F69A 4M75B 2J06A 4JJCA 2E70A 2E41A 1X6BA 2KYMA 1A0NB 4N0AC 1GBQA 1NYFA 4FYVB 3G71A 3HPWA 5GMKh 3CCJT 1W4SA 2C0TA 4JJBA 3S6WA 1QVGS 2DA9A 2DPPB 2LNHB 1VQ6Q 3FJPA 2K3BA 2YT6A 3GNFB 2CS7A 2YLCA 5DLOA 2IG0A 2LQKA 4K11A 1IGUA 1YFNA 3ZEHA 1G8XA 1N27A 2A08A 3PNWC 5A2QE 2Y4XA 2CUDA 3NTKA 2JS2A 2A37A 1JO8A 1YJNQ 1CKBA 1XTDA 1E6HA 2K5FA 3EHQA 2VVKA 2V1RA 4EMKB 4A53A 1KQ1A 4QQDA 4KT0E 1YI2A 2A36A 5CKHA 2LCLA 3FRNA 1U1SA 2M9UA 3PMIA 1WGSA 4OMOA 1ZLMA 5CQXA 1GCQC 1RAGB 2E12A 2QAZA 3N5BB 1M1KR 4HCBA 2L8DA 4N4HA 1MMNA 1KQSA 3M59A 1X6GA 4XK8E 2HDAA 4C92F 5A0LA 3V8LA 4IUUA 5J3BA 3NTHA 3OYNA 3EFSA 5ECAA 1MMAA 1CSKA 1WHGA 2DJQA 3M0UA 3EG9B 3OYHA 3CPWS 4OMLA 4LDUA 1KQ2A 3OS1A 3JCMJ 2XICA 1WHLA 2J6FA 4ELYC 1S72A 4E6RA 4M7AA 1BYMA 2IPOB 3M0PA 2H3JA 1QWFA 1D0XA 2O9VA 3EGXB 4Q5WA 3OW2P 4M77C 3CCUQ 3WVDB 1WXBA 4E7SA 2BTTA 1FXXA 1Y07A 3PFSA 1TTHB 3BE3A 2QDLA 3EG2A 2FB7A 2B8AA 3J81E 1AZEA 2YSQA 2E1HA 2LX9A 2DVJA 2QEXA 2BKDN 1VQ6T 1WYXA 1M2VB 3E1SA 4WCIA 4PK4A 3UF4A 3U23A 5L23A 2RHUA 3OY9A 1HSQA 1ZHIA 1MMDA 2LRQA 2HBWA 3RIRA 5CKFA 1ABOA 2L3RA 4M75A 2YRVA 4E7LA 1VQPA 3CC7A 3X26B 1YJNT 1O9SA 2K2MA 4FIBA 1VQNQ 4ZNXA 3WVEB 2EAYA 4NS5A 3CD6A 1OU8A 3FB9A 4B6MA 4L5GA 1HXDA 3VS6A 4RTUA 4A4GA 1K1ZA 4M77G 3QSUA 3ZBDA 3KUFA 2KRMA 1UHCA 2V8IA 3C4SA 2H8HA 1B3QA 2D9TA 3GLXA 4F17A 5IHKA 1Q7YC 4BY6C 1YITA 3QZ5B 2KK4A 1KK7A 2RQUA 2C0IA 1M4ZA 2A3LA 2COZA 2EJ9A 2VGMA 1AWJA 2GGRA 3V7RA 4EMKA 2OTJQ 2F5TX 1QKXA 3URGA 2BIVA 3OYFA 3CC4A 3HTRA 1MMGA 3OS5A 4J9GA 2RI3A 3L1AA 4WF2A 2CP2A 2AKLA 1N5ZA 3LGFA 1MHNA 4ESRA 4M4ZA 1OYXA 3AT1B 2YUOA 4KUIA 1D09B 1NG2A 3CCUT 2RJDA 2RHYA 5C0MA 1VOMA 4Z88A 4OB3B 5DLQE 3KFVA 5IHIA 3CPFA 4VUBA 2RJFA 4PFOA 4P5NA 2BUDA 2GTOA 4PL6A 2G6FX 3EG9A 3KBGA 2EQMA 1UTIA 2EGCA 5FU6C 5GAOm 5CQYA 3MEWA 2KNBB 2CP0A 2YLBA 4ZTFA 1YCSB 3CPWA 3A8OB 2EJFA 2RN8A 2RO0A 2GF7A 4F7UE 5KH6A 3G6EA 4FW1A 1VQ9Q 4M7DC 3EGXA 3HFOA 3LLRA 4JJDA 4HKEA 1PD1A 1VQNT 3OYYA 3G4SA 4OMQA 5GAOq 3OYEA 1W70A 2CUBA 2RI5A 4C0ZA 1YIJQ 4C8QE 3EFOB 2GTJA 3EHRA 2DL7A 4JRKA 1BK2A 1M2VA 3R6OA 2OTLA 5FU7B 2EPDA 4M78D 2SRCA 5KCHA 1J3TA 4PJLA 4LXCA 2DKGA 4F04B 2YRDA 3RKXA 1UGPB 3CCSQ 2KMTA 1M1KC 3MCAB 4PLIA 1RACB 5GAN4 3PTAA 5GMKe 2HL3A 1D1AA 2LNVA 1YHQQ 2OTJT 3CCVQ 2K9GA 3VKIA 3CCQA 3PIOA 4R0KA 2X35A 5GJWB 4M7DG 2KT1A 3UT1A 2FZKB 4C0DB 1QCOA 3PE0A 3A8GB 2JMCA 2L3QA 3LWIA 4KH1B 1SEMA 2DD5A 1RAAB 2DEQA 3ME9A 4AFUC 2XDDA 2DNUA 3RR6A 1M90R 1JJ2S 2CP7A 1N9RA 3QG1A 2BZXA 1LVKA 3ER0A 1AHJB 2EYZA 1YJ9A 3I56A 2CP5A 3HL8A 4F16A 2QA4Q 4MDXA 2ED0A 1Q86U 4PJOC 4XU1A 1YJWA 4M78B 2X4JA 2X4YA 4DBFA 2LJ3A 2DBMA 1VQLQ 3QXEB 5GAN7 4N4IA 4LNPA 3HRTA 1OULA 3OQ5A 1VQ8A 1I07A 1ZSZB 4J9EA 1N9SA 4BD3A 1ZUKA 2LZ6B 3CMEQ 1OEBA 3LW5E 2RHZA 5GANh 2XDBA 1VQ9T 1PCXA 3P8BB 1M1KU 4L6V5 3BY7A 3CCRQ 4XTWA 4LN2A 5LJ3h 3VS0A 1KHIA 1UFFA 2CT4A 4FSXA 3GNGA 1GFDA 2FG0A 2VASA 1SRMA 3G1JA 2W10A 3CCLQ 1YIJT 4QT7A 4D8KA 4XTXA 4M78E 3HRUA 3P8HA 3CXCS 4PJOG 1TUCA 4RG8A 3OA6A 2K6DA 1H92A 3TVTA 2DL3A 1PWTA 4BACA 2JXBA 1FMVA 3SWNA 1JB0E 2K3YA 2E64A 2KRSA 1UGSB 3CCST 4J6YA 1GL5A 1SPKA 5GAN6 1H641 5I11A 2KROA 2ENMA 3PVLA 4LDYA 3EG0A 1YHQT 2X9HA 3CCVT 3T9NA 4O5VA 8AT1B 2FO0A 4AFZC
chains in the Genus database with same CATH topology
1V1CA 2VWFA 3LH5A 2J06A 4JJCA 1OOTA 2DYBA 2A28A 3O5ZA 2V1QA 1X6BA 2KYMA 1A0NB 1NLOC 1I1JA 2F2WA 1GBQA 1NYFA 2KRNA 1M3BA 1NM7A 1U3OA 1QLYA 2EBPA 2MIOA 2EKHA 2C0TA 4JJBA 2DA9A 2LNHB 5FWCA 2K3BA 2YT6A 1NEBA 1U06A 3M0RA 1Z9ZA 4K11A 4RTXA 2DL8A 4CC4B 2D0NA 2A08A 2XMFA 2CUDA 4CC3A 1PRLC 2JS2A 2A37A 2DE0X 1JO8A 2ROLA 4LE9A 2EYYA 1KIKA 1CKBA 1HD3A 3ZL7C 1E6HA 1FMKA 3EHQA 2VVKA 1UECA 2V1RA 1M3AA 3VS5A 2FEIA 1Y0MA 2A36A 3VS4A 2YUNA 3THKA 2DILA 3FJ5A 4OMOA 2BZYA 2MOXA 1ZLMA 2FPDA 1GCQC 1KSWA 1NEGA 1JQQA 2ESWA 3VS1A 2KYBA 3H0FA 1AWXA 3I9QA 2YUQA 3H41A 1BB9A 4DEXA 1X6GA 3A98A 1BU1A 1IO6A 3RBBB 2HDAA 2EGAA 4JPBW 4RTTA 1M27C 1WX6A 3TSWA 2O9SA 5ECAA 2FPEA 1YNZA 1T0HA 1CSKA 2DJQA 1M8MA 3NMZC 3M0UA 4OMLA 2AZVA 4CC7A 2J6KA 4RTZA 2D8JA 4OMPA 1BBZA 1GCQA 2DL4A 2DMOA 2F2XA 2J6FA 2CDTA 4RTYA 4E6RA 1AVZC 2RNAA 3M0PA 2EYXA 1QWFA 4CC2A 1H8KA 3UATA 2O9VA 2AKKA 1WXBA 2DX1A 2BTTA 2CSQA 3EGUA 2FRYA 2QDLA 3EG2A 3NHNA 2CSIA 4RUGA 1SRLA 4HVWA 1AZEA 2YSQA 3EG1A 2J7IA 2DVJA 2DRMA 1ZUUA 1S1NA 1WYXA 2LJ1A 1SHFA 4WCIA 2LMJA 2P4RA 3RNJA 3UA6A 2JTEA 3UF4A 3U23A 1QKWA 5L23A 2LP5A 1HSQA 1MUZA 1RLQC 1VYVA 2HBWA 2J6OA 3R6NA 1ABOA 1WXTA 5EC7A 1H3HA 3JV3A 1UGVA 1PKSA 2K2MA 2MCNA 4ZNXA 1JXMA 3I35A 2CH4W 2DLPA 2CT3A 1T0JA 1G83A 2EYWA 3VS6A 4RTUA 2EQIA 2OJ2A 1AEYA 3REAB 2VKNA 2RQVA 1K1ZA 2IIMA 2OAWA 3PVQA 3UA7A 2KRMA 1UHCA 2M51A 1UJYA 2H8HA 1B3QA 1UE9A 4HVUA 4F17A 5IHKA 3M0SA 2OI3A 4HVVA 1SSHA 1PNJA 1FYNA 4EIKA 2KXDA 1K76A 2RQUA 2C0IA 4Z89A 1QWEA 2SEMA 1AOJA 2JM8A 2PNIA 1MV3A 1VYTA 1VYUA 5HCKA 1AWJA 4JZ3A 2GGRA 4OMNA 5GJVB 2L2PA 1AZGB 1QKXA 3M0QA 1ZUYA 2HSPA 2JW4A 2HEQA 1WDXA 2ED1A 1X69A 4J9GA 2C0OA 1RUWA 3ULRB 3QWXX 2AKLA 4GBQA 2ECZA 3TSZA 1N5ZA 3VRZA 4ESRA 4M4ZA 5I22A 2YUOA 2JMAA 2RQWA 1K9AA 2DBKA 1UG1A 2GNCA 1NG2A 1PRMC 1GFCA 4Z88A 5IXFA 2RPNA 4HCKA 2EVRA 3KFVA 5IHIA 3CQTA 4RTVA 1HJDA 2GTOA 1JEGA 1SHGA 2G6FX 3VRYA 4J9CA 1OPKA 2AZSA 1YWOA 1UDLA 2ABLA 1XOVA 1AWWA 1UTIA 1PKTA 2GQIA 1K4US 4J9IA 1MV0B 2X3WD 1X43A 1RLPC 2B86A 2EGCA 1QCFA 2FPFA 2LCSA 2D1XA 2KNBB 2LJ0A 2D8HA 5IH2A 1YCSB 2E5KA 1YP5A 2KEAA 4JZ4A 1NLPC 1WA7A 1Y57A 4AFSC 2RN8A 1GCPA 5FWBA 4JJDA 4DEYA 1KJWA 4J9FA 3C0CA 1Z9QA 3H0HA 2YDLA 2DL5A 4OMQA 1UHFA 2KBTA 1JU5C 1W70A 2CUBA 1E7OA 2LX7A 4F14A 2J05A 1K0SA 4RTWA 4J9HA 2EW3A 3M0TA 2GTJA 3EHRA 1U5SA 2DL7A 4X1VA 1BK2A 2GBQA 2PTKA 3QWYA 2EPDA 2RF0A 3REBB 4J9DA 2SRCA 1GBRA 2DRKA 3GBQA 1X27A 5IXBA 1ABQA 1WFWA 1J3TA 3SEMA 2F2VA 1PHTA 1W1FA 1K0XA 1LCKA 1RI9A 2RQTA 2L3SA 1WLPB 3I5SA 2K9GA 4R0KA 1T3SA 5GJWB 2YUPA 2KT1A 2K79A 3H0IA 3PE0A 1G2BA 2JMCA 2L3QA 1SEMA 5FW9A 4AFUC 2L0AA 2DNUA 1ZSGA 4GLMA 3VS3A 1NYGA 4D8DA 2BZXA 2EYZA 2KR3A 2KT8A 1ARKA 1KFZA 1JXOA 2I0NA 3SHWA 2KXCA 1TG0A 2RMOA 4F16A 2KGTA 2ED0A 2NWMA 2KE9A 2ROTA 1TUDA 4AFQC 2O88A 3EG3A 1ZBJA 1X2KA 2LJ3A 2DBMA 1M30A 4LNPA 1AD5A 2DF6A 4AG2C 1I07A 2LQWA 4J9EA 1YN8A 1ZUKA 2EGEA 2LZ6B 1OEBA 1B07A 1AWOA 1ZX6A 4HXJA 1VA7A 3IQLA 2K7AA 2M0YA 1I0CA 2X3XD 3VS2A 4LN2A 1T3LA 2DM1A 3VS0A 2CREA 1UJ0A 1UFFA 2CT4A 1WIEA 1OPLA 1GFDA 4LUDA 4OMMA 2FG0A 1WXUA 2AK5A 2PZ1A 2CH4A 1CKAA 1SRMA 2L3PA 4Z8AA 1YWPA 2W10A 2NUZA 4KRTA 4QT7A 1OV3A 3VS7A 4D8KA 2O31A 4AG1C 1W6XA 2JS0A 1TUCA 2FRWA 1H92A 2K6DA 3TVTA 1E6GA 2LQNA 4LUEA 2JM9A 2DL3A 3NGPA 1PWTA 3I5RA 2JXBA 2O2OA 2W0ZA 3NPFA 2BZ8A 5IHNA 1WI7A 2KRSA 4A63B 2HCKA 4IIOA 1EFNA 1GRIA 1UUEA 4Y92A 4ORZA 1GL5A 1SPKA 5I11A 2KROA 2ENMA 3PVLA 4FSSA 4J9BA 1X2QA 3EG0A 2JT4A 4IIMA 2RQRA 2FO0A 1M3CA 4AFZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  2VWF A;  3LH5 A;  2J06 A;  4JJC A;  1OOT A;  2DYB A;  2A28 A;  3O5Z A;  2V1Q A;  1X6B A;  2KYM A;  1A0N B;  1NLO C;  1I1J A;  2F2W A;  1GBQ A;  1NYF A;  2KRN A;  1M3B A;  1NM7 A;  1U3O A;  1QLY A;  2EBP A;  2MIO A;  2EKH A;  2C0T A;  4JJB A;  2DA9 A;  2LNH B;  5FWC A;  2K3B A;  2YT6 A;  1NEB A;  1U06 A;  3M0R A;  1Z9Z A;  4K11 A;  4RTX A;  2DL8 A;  4CC4 B;  2D0N A;  2A08 A;  2XMF A;  2CUD A;  4CC3 A;  1PRL C;  2JS2 A;  2A37 A;  2DE0 X;  1JO8 A;  2ROL A;  4LE9 A;  2EYY A;  1KIK A;  1CKB A;  1HD3 A;  3ZL7 C;  1E6H A;  1FMK A;  3EHQ A;  2VVK A;  1UEC A;  2V1R A;  1M3A A;  3VS5 A;  2FEI A;  1Y0M A;  2A36 A;  3VS4 A;  2YUN A;  3THK A;  2DIL A;  3FJ5 A;  4OMO A;  2BZY A;  2MOX A;  1ZLM A;  2FPD A;  1GCQ C;  1KSW A;  1NEG A;  1JQQ A;  2ESW A;  3VS1 A;  2KYB A;  3H0F A;  1AWX A;  3I9Q A;  2YUQ A;  3H41 A;  1BB9 A;  4DEX A;  1X6G A;  3A98 A;  1BU1 A;  1IO6 A;  3RBB B;  2HDA A;  2EGA A;  4JPB W;  4RTT A;  1M27 C;  1WX6 A;  3TSW A;  2O9S A;  5ECA A;  2FPE A;  1YNZ A;  1T0H A;  1CSK A;  2DJQ A;  1M8M A;  3NMZ C;  3M0U A;  4OML A;  2AZV A;  4CC7 A;  2J6K A;  4RTZ A;  2D8J A;  4OMP A;  1BBZ A;  1GCQ A;  2DL4 A;  2DMO A;  2F2X A;  2J6F A;  2CDT A;  4RTY A;  4E6R A;  1AVZ C;  2RNA A;  3M0P A;  2EYX A;  1QWF A;  4CC2 A;  1H8K A;  3UAT A;  2O9V A;  2AKK A;  1WXB A;  2DX1 A;  2BTT A;  2CSQ A;  3EGU A;  2FRY A;  2QDL A;  3EG2 A;  3NHN A;  2CSI A;  4RUG A;  1SRL A;  4HVW A;  1AZE A;  2YSQ A;  3EG1 A;  2J7I A;  2DVJ A;  2DRM A;  1ZUU A;  1S1N A;  1WYX A;  2LJ1 A;  1SHF A;  4WCI A;  2LMJ A;  2P4R A;  3RNJ A;  3UA6 A;  2JTE A;  3UF4 A;  3U23 A;  1QKW A;  5L23 A;  2LP5 A;  1HSQ A;  1MUZ A;  1RLQ C;  1VYV A;  2HBW A;  2J6O A;  3R6N A;  1ABO A;  1WXT A;  5EC7 A;  1H3H A;  3JV3 A;  1UGV A;  1PKS A;  2K2M A;  2MCN A;  4ZNX A;  1JXM A;  3I35 A;  2CH4 W;  2DLP A;  2CT3 A;  1T0J A;  1G83 A;  2EYW A;  3VS6 A;  4RTU A;  2EQI A;  2OJ2 A;  1AEY A;  3REA B;  2VKN A;  2RQV A;  1K1Z A;  2IIM A;  2OAW A;  3PVQ A;  3UA7 A;  2KRM A;  1UHC A;  2M51 A;  1UJY A;  2H8H A;  1B3Q A;  1UE9 A;  4HVU A;  4F17 A;  5IHK A;  3M0S A;  2OI3 A;  4HVV A;  1SSH A;  1PNJ A;  1FYN A;  4EIK A;  2KXD A;  1K76 A;  2RQU A;  2C0I A;  4Z89 A;  1QWE A;  2SEM A;  1AOJ A;  2JM8 A;  2PNI A;  1MV3 A;  1VYT A;  1VYU A;  5HCK A;  1AWJ A;  4JZ3 A;  2GGR A;  4OMN A;  5GJV B;  2L2P A;  1AZG B;  1QKX A;  3M0Q A;  1ZUY A;  2HSP A;  2JW4 A;  2HEQ A;  1WDX A;  2ED1 A;  1X69 A;  4J9G A;  2C0O A;  1RUW A;  3ULR B;  3QWX X;  2AKL A;  4GBQ A;  2ECZ A;  3TSZ A;  1N5Z A;  3VRZ A;  4ESR A;  4M4Z A;  5I22 A;  2YUO A;  2JMA A;  2RQW A;  1K9A A;  2DBK A;  1UG1 A;  2GNC A;  1NG2 A;  1PRM C;  1GFC A;  4Z88 A;  5IXF A;  2RPN A;  4HCK A;  2EVR A;  3KFV A;  5IHI A;  3CQT A;  4RTV A;  1HJD A;  2GTO A;  1JEG A;  1SHG A;  2G6F X;  3VRY A;  4J9C A;  1OPK A;  2AZS A;  1YWO A;  1UDL A;  2ABL A;  1XOV A;  1AWW A;  1UTI A;  1PKT A;  2GQI A;  1K4U S;  4J9I A;  1MV0 B;  2X3W D;  1X43 A;  1RLP C;  2B86 A;  2EGC A;  1QCF A;  2FPF A;  2LCS A;  2D1X A;  2KNB B;  2LJ0 A;  2D8H A;  5IH2 A;  1YCS B;  2E5K A;  1YP5 A;  2KEA A;  4JZ4 A;  1NLP C;  1WA7 A;  1Y57 A;  4AFS C;  2RN8 A;  1GCP A;  5FWB A;  4JJD A;  4DEY A;  1KJW A;  4J9F A;  3C0C A;  1Z9Q A;  3H0H A;  2YDL A;  2DL5 A;  4OMQ A;  1UHF A;  2KBT A;  1JU5 C;  1W70 A;  2CUB A;  1E7O A;  2LX7 A;  4F14 A;  2J05 A;  1K0S A;  4RTW A;  4J9H A;  2EW3 A;  3M0T A;  2GTJ A;  3EHR A;  1U5S A;  2DL7 A;  4X1V A;  1BK2 A;  2GBQ A;  2PTK A;  3QWY A;  2EPD A;  2RF0 A;  3REB B;  4J9D A;  2SRC A;  1GBR A;  2DRK A;  3GBQ A;  1X27 A;  5IXB A;  1ABQ A;  1WFW A;  1J3T A;  3SEM A;  2F2V A;  1PHT A;  1W1F A;  1K0X A;  1LCK A;  1RI9 A;  2RQT A;  2L3S A;  1WLP B;  3I5S A;  2K9G A;  4R0K A;  1T3S A;  5GJW B;  2YUP A;  2KT1 A;  2K79 A;  3H0I A;  3PE0 A;  1G2B A;  2JMC A;  2L3Q A;  1SEM A;  5FW9 A;  4AFU C;  2L0A A;  2DNU A;  1ZSG A;  4GLM A;  3VS3 A;  1NYG A;  4D8D A;  2BZX A;  2EYZ A;  2KR3 A;  2KT8 A;  1ARK A;  1KFZ A;  1JXO A;  2I0N A;  3SHW A;  2KXC A;  1TG0 A;  2RMO A;  4F16 A;  2KGT A;  2ED0 A;  2NWM A;  2KE9 A;  2ROT A;  1TUD A;  4AFQ C;  2O88 A;  3EG3 A;  1ZBJ A;  1X2K A;  2LJ3 A;  2DBM A;  1M30 A;  4LNP A;  1AD5 A;  2DF6 A;  4AG2 C;  1I07 A;  2LQW A;  4J9E A;  1YN8 A;  1ZUK A;  2EGE A;  2LZ6 B;  1OEB A;  1B07 A;  1AWO A;  1ZX6 A;  4HXJ A;  1VA7 A;  3IQL A;  2K7A A;  2M0Y A;  1I0C A;  2X3X D;  3VS2 A;  4LN2 A;  1T3L A;  2DM1 A;  3VS0 A;  2CRE A;  1UJ0 A;  1UFF A;  2CT4 A;  1WIE A;  1OPL A;  1GFD A;  4LUD A;  4OMM A;  2FG0 A;  1WXU A;  2AK5 A;  2PZ1 A;  2CH4 A;  1CKA A;  1SRM A;  2L3P A;  4Z8A A;  1YWP A;  2W10 A;  2NUZ A;  4KRT A;  4QT7 A;  1OV3 A;  3VS7 A;  4D8K A;  2O31 A;  4AG1 C;  1W6X A;  2JS0 A;  1TUC A;  2FRW A;  1H92 A;  2K6D A;  3TVT A;  1E6G A;  2LQN A;  4LUE A;  2JM9 A;  2DL3 A;  3NGP A;  1PWT A;  3I5R A;  2JXB A;  2O2O A;  2W0Z A;  3NPF A;  2BZ8 A;  5IHN A;  1WI7 A;  2KRS A;  4A63 B;  2HCK A;  4IIO A;  1EFN A;  1GRI A;  1UUE A;  4Y92 A;  4ORZ A;  1GL5 A;  1SPK A;  5I11 A;  2KRO A;  2ENM A;  3PVL A;  4FSS A;  4J9B A;  1X2Q A;  3EG0 A;  2JT4 A;  4IIM A;  2RQR A;  2FO0 A;  1M3C A;  4AFZ C; 
#chains in the Genus database with same CATH topology
 2V8J A;  3EFO A;  2FHD A;  1TSF A;  3L2Z A;  2A28 A;  2PU9 B;  2V1Q A;  4PNO A;  4L59 A;  1NLO C;  2KRN A;  1NM7 A;  5HY6 A;  1U3O A;  2EBP A;  2MIO A;  3A8H B;  3JCM P;  4A54 A;  4OGC A;  4C0G A;  4R56 A;  2HBP A;  1IRE B;  4OB0 B;  4X34 A;  2QYZ A;  2KSS A;  2QA4 T;  2P0K A;  3OBY A;  1BI0 A;  3X20 B;  3M0R A;  3CC2 A;  5FRM A;  1D3B B;  1YCY A;  3L2R A;  2EQJ A;  4FYY B;  2CZ6 B;  4CC4 B;  1VQ7 Q;  4C92 D;  4CC3 A;  1PRL C;  1VQL T;  3LGL A;  4XTZ A;  3OYI A;  3E9G A;  2ROL A;  4LE9 A;  2EYY A;  1KIK A;  2HD0 A;  4J5Y A;  2RJE A;  1M3A A;  5GAN f;  1O75 A;  5IAY A;  1NJI C;  3CME T;  3VS4 A;  3THK A;  4OP0 A;  3TCJ A;  2FPD A;  5LJ3 f;  1VUB A;  3C95 A;  4EMH A;  4XTY A;  2PVD B;  3TQ7 P;  2ESW A;  3CCR T;  2KYB A;  2CP3 A;  5KYX B;  1KC8 R;  3JCM h;  2KY9 A;  1WHJ A;  2YUQ A;  1W2B P;  2EGA A;  3CCL T;  2VV5 A;  3I55 Q;  4JLI A;  3BW1 A;  1PM3 A;  5GMK m;  4HCC A;  2DXT A;  3OYG A;  5A0D A;  4BE1 A;  5CCA A;  3CEY A;  1ZSZ A;  4C92 B;  1QVG P;  4JRQ A;  3DB3 A;  5GAM h;  4CC7 A;  1P92 A;  4RTZ A;  4XAX B;  3QYH B;  2DL4 A;  1Y96 B;  4E7I A;  1AVZ C;  3X25 B;  2RNA A;  1U8R A;  1R0B G;  3J80 E;  1ZA2 B;  4BUG A;  4C5I A;  3EGD A;  2CSQ A;  4E7Z A;  3EGU A;  3GF5 A;  2XHC A;  2LT4 A;  3NHN A;  1UGR B;  2DD4 A;  4RUG A;  1NJI U;  3CXC A;  2QTV A;  2RK1 A;  3VU3 C;  1LNX A;  1VQ6 A;  1S1N A;  3QJ6 A;  1OU9 A;  2CZ0 B;  2P4R A;  3RNJ A;  1M90 C;  2NUP B;  2VB6 A;  2ZPE B;  4M7A E;  3TRE A;  4TVR A;  1RLQ C;  3FDR A;  2J6O A;  2XDP A;  4FL6 A;  1UB4 A;  1RAI B;  1WXT A;  4QQ6 A;  1PKS A;  1G3Y A;  2CT3 A;  4ZTJ A;  1Q86 R;  1G83 A;  3HFN A;  2EYW A;  2EQI A;  3L2W A;  4KGX B;  2RQV A;  2IIM A;  5CKE A;  5I2S A;  4RG2 A;  1M9S A;  3JCM f;  4LDW A;  4QQG A;  2OI3 A;  1D3B A;  3JB9 J;  1SSH A;  2O01 E;  1PNJ A;  1I81 A;  2KXD A;  3CBO A;  2GQV A;  2YXY A;  5LJ5 h;  1R8O B;  2V26 A;  5D7U A;  2VXF A;  4M75 E;  2JM8 A;  3I55 T;  3EAE A;  4OMN A;  5GJV B;  2L2P A;  1WJR A;  3P8D A;  3JRZ A;  5GAM f;  4DA4 A;  3M0Q A;  1OX8 A;  1ZUY A;  3BDU A;  4C8Q C;  3H8Z A;  2QTX A;  3EFR A;  4GLK A;  1RAD B;  3ULR B;  4OF1 A;  5KE3 A;  2RHI A;  2ECZ A;  2GCX A;  5KYX A;  1M90 U;  2P4T A;  4GY5 A;  2RQW A;  1D0Y A;  1IHV A;  3CMA A;  1UG1 A;  2GNC A;  2DTO A;  3CCU A;  1PRM C;  1GFC A;  3JAM E;  3WXM B;  2KI7 A;  5GAN e;  1KD1 U;  5GAO n;  1ZBX A;  4F7U G;  4MZP A;  4C92 A;  3MEU A;  1JEG A;  1SHG A;  3VRY A;  5M9O A;  2AZS A;  4LD6 A;  5LJ3 e;  1XOV A;  1JBM A;  1OI1 A;  2GQI A;  1MV0 B;  1N8R U;  1RLP C;  1M5Q 1;  2B86 A;  1OZ2 A;  1TU0 B;  1Y96 A;  2FPF A;  2LJ0 A;  5IH2 A;  1U1T A;  2E5K A;  1YP5 A;  3DLL A;  4C8Q G;  1GCP A;  1OQK A;  4JDS A;  4QW2 A;  4DEY A;  2M0O A;  1GXI E;  2R58 A;  1BCO A;  4DBR A;  4J8O A;  3PGG A;  2KBT A;  3QYG B;  2MWO A;  1VQ4 Q;  2LX7 A;  4A4H A;  2J05 A;  1WZO A;  4X9C A;  1S72 Q;  4X1V A;  1U5S A;  1FX7 A;  4OB2 B;  1NPR A;  3JCM Q;  2NUP A;  2RF0 A;  3BFM A;  5IXB A;  3PT9 A;  2E4H A;  3SEM A;  1EX4 A;  1TWB A;  5A0G A;  4E2F B;  4JUV A;  4PJM A;  5CAI A;  2RM4 A;  1TH7 A;  2R57 A;  3C94 A;  1KC8 C;  5GAO l;  3X28 B;  4PJJ A;  1F1B B;  4B9W A;  1I5L A;  2JJ9 A;  2QEX Q;  3M53 A;  1T3S A;  4M78 C;  4XTV A;  2YUP A;  3SB2 A;  2CZ7 B;  2QQ9 A;  4AMC A;  1QW1 A;  5GAN g;  5J26 A;  1VQK Q;  5FW9 A;  3M4G A;  3CCM A;  2LTO A;  5GAO r;  1Y71 A;  4OGE A;  2L0A A;  1OZ3 A;  3VS3 A;  4D8D A;  1QCN A;  5LJ3 g;  4E7H A;  3QDR B;  1VQP Q;  2XK0 A;  3CC7 Q;  2KR3 A;  3OW2 S;  2DZ9 A;  1JXO A;  2I0N A;  2RMO A;  2KGT A;  2NWM A;  4MDW A;  2KE9 A;  3O8V A;  4BI3 A;  1TUD A;  5C6S A;  2HAX A;  4IUQ A;  2DTH A;  4E47 A;  4OB1 B;  5GMK j;  3JCM e;  2DF6 A;  4AG2 C;  9ATC B;  4MZM A;  1YN8 A;  2O4X B;  1B07 A;  4O6J A;  1AWO A;  1VA7 A;  3OMC A;  4M78 G;  4QVD A;  3QHS A;  1VQ9 A;  2HKQ B;  3V8J A;  2MPX C;  1NJI R;  3OYM A;  1I0C A;  3VS2 A;  1KC8 U;  1ZA1 B;  5GAM e;  3RKW A;  5HK0 A;  1UJ0 A;  4M77 D;  3QZ9 B;  4EDU A;  2QQR A;  3JCM V;  1VQ4 T;  1CKA A;  2L3P A;  3SWN B;  4Z8A A;  4KRT A;  2NUZ A;  4ELZ C;  1YIJ A;  1S72 T;  1K8A R;  3FC3 A;  2FRW A;  2KDS A;  4FT4 A;  1Q86 C;  4E7J A;  1JJ2 P;  4LUE A;  2JM9 A;  3L42 A;  4J7F A;  1FWZ A;  2BZ8 A;  2VXE A;  4BI4 A;  1WI7 A;  2RH2 A;  4IIO A;  1EFN A;  3CCS A;  2DXC A;  5FRN A;  4IUT A;  3RES A;  2QI2 A;  3L2U A;  1X2Q A;  3QDF A;  3CCV A;  1MND A;  2QEX T;  5KYW B;  2E5Q A;  1M3C A;  1WNL A;  1XJW B;  4M77 B;  1OOT A;  2DYB A;  3QKJ A;  4ZGE B;  3O5Z A;  1VQK T;  3RER A;  1RAB B;  3VJP A;  5J39 A;  2F2W A;  4C5G A;  1QLY A;  2VUB A;  3JCM g;  1VQP T;  3CC7 T;  3JCM d;  3INZ A;  2QA4 A;  2G3R A;  1QVF P;  1FMW A;  2EQK A;  1U06 A;  2M02 A;  3TU4 K;  5IT9 E;  2LCC A;  3MET A;  3UDC A;  2M16 A;  4J6W A;  2D0N A;  3RMS A;  2XMF A;  4KH0 B;  3LYI A;  2VYT A;  1VQL A;  3OYB A;  5GAM g;  2KQW A;  4BE0 A;  1HD3 A;  2ZCF B;  3ZL7 C;  1FMK A;  2DXB A;  3ASK A;  3CBM A;  3VS5 A;  2FEI A;  1Y0M A;  5GAN 3;  4N0A A;  3CME A;  1NBE B;  5GAN 5;  5D6W A;  1KD1 R;  2DIL A;  1SSF A;  2BZY A;  2MOX A;  4F7U F;  1UGQ B;  2MYS A;  1NEG A;  2CZ1 B;  5CR2 A;  4JS4 A;  3CCR A;  4M7A C;  3H0F A;  3JB9 G;  3OW2 A;  1N8R R;  4BY6 B;  3A98 A;  1IO6 A;  4FYW B;  4JPB W;  3HSB A;  2BE9 B;  5CO7 A;  1HYO A;  3CCL A;  1M27 C;  4DBQ A;  2EJG A;  2HNI A;  3TSW A;  5FLX E;  4C8Q F;  4Y91 A;  2O9S A;  4A4K A;  2FPE A;  4II1 A;  1VQO A;  1M1G A;  1PD0 A;  1QP2 A;  1YNZ A;  1OX9 A;  2O4X A;  1YJ9 Q;  2ZPB B;  3EH2 A;  4KUL A;  4JJN K;  1Q81 R;  2XG8 D;  4OMP A;  1GCQ A;  2F2X A;  3A8L B;  3EGD B;  4M7D D;  2CDT A;  2CYZ B;  1YBY A;  4Y28 E;  2EYX A;  3V7S A;  1X01 A;  4M75 C;  3JCM c;  4DOV A;  1KQS P;  4XU2 A;  3FLG A;  4ZGD B;  4CI0 C;  2K5I A;  2CKK A;  2LVM A;  2DX1 A;  3MHX A;  1B34 A;  4M7A G;  1R77 A;  2F5K A;  3LH0 A;  2CSI A;  2DIG A;  3HHT B;  4PJN A;  2GFU A;  4RMO A;  4M77 F;  1SRL A;  2QQB A;  4BE2 A;  2J7I A;  3RUX A;  2DRM A;  3JCM b;  1SHF A;  1MNE A;  3DKM A;  3UA6 A;  2JTE A;  3GP8 A;  1QKW A;  2ZPF B;  2LP5 A;  4ANJ A;  6AT1 B;  1VYV A;  5KYW A;  3OMG A;  3VUZ A;  2HQE A;  4OMF B;  5EC7 A;  1H3H A;  3CCJ A;  4M7D B;  3JV3 A;  4EMK C;  1UGV A;  4M77 A;  4HCZ A;  2MCN A;  1D1B A;  1JXM A;  1C0M A;  1G3S A;  2JTF A;  1T0J A;  2FZG B;  2MI6 A;  1XQH A;  1VQ5 Q;  5GAN 8;  4J7I A;  4M75 G;  4IUP A;  1AEY A;  3REA B;  2VKN A;  4RKU E;  3S3N A;  2OAW A;  3PVQ A;  3UA7 A;  2X51 A;  1IZ6 A;  2M51 A;  1UJY A;  2M1H A;  4PFP A;  1QQJ A;  1UE9 A;  3D7S B;  4HVU A;  2EFI A;  2DO3 A;  1FYN A;  5HK3 A;  1K76 A;  4PJO D;  2X4W A;  2MMP A;  2K4Y A;  1BIA A;  4J6X A;  5I21 A;  2E6N A;  2PNI A;  3I55 A;  1VYU A;  5HCK A;  4IUV A;  2ZPG B;  4JZ3 A;  3PIP A;  3HRS A;  2JVV A;  5D6X A;  4EPC A;  1YJ9 T;  3UPU A;  2HSP A;  1K8A C;  1WDX A;  2ED1 A;  3CC2 Q;  2Y90 A;  1TUG B;  2V8K A;  4FW2 A;  2C0O A;  1BI2 A;  3QWX X;  1VQM Q;  4GBQ A;  2HQX A;  3E2U A;  2QK0 A;  1MGQ A;  3J7A F;  2DBK A;  2WAC A;  5EG2 A;  1AT1 B;  1EZZ B;  3OYK A;  4XU0 A;  2EQU A;  2PUO B;  2EVR A;  4PJO B;  2JTM A;  3CQT A;  4RTV A;  1HJD A;  5KYY B;  2P84 A;  4J9C A;  1OPK A;  4FT2 A;  1WQW A;  3OSV A;  1AWW A;  3GOX A;  3MP1 A;  3MKD A;  4J9I A;  2X3W D;  4LD9 K;  2DIQ A;  2HQH A;  5IN1 A;  2LCS A;  2D1X A;  2D8H A;  3M55 A;  3BDL A;  4JZ4 A;  1LJO A;  3V8K A;  1WA7 A;  1Y57 A;  4AFS C;  3M4Y A;  3OYL A;  5KYN A;  2PVG B;  4YTL A;  3C0C A;  1Z9Q A;  5KE2 A;  5D6Y A;  2MWP A;  1UHF A;  2K2V A;  4M7D F;  1JU5 C;  4C92 E;  1QVF A;  1VQ5 T;  2K3X A;  3A8M B;  4F14 A;  2DET A;  2I2L A;  4RTW A;  2ZPH B;  5GAN j;  1K8A U;  2QG9 B;  3M0T A;  2L5Q A;  5AYF A;  1VQ7 T;  2GBQ A;  4A4F A;  3GPL A;  4C0F A;  3QWY A;  2HSE B;  1YJN A;  5LJ3 j;  3MP6 A;  2RD1 A;  4J9D A;  2F1L A;  4KBM B;  3REB B;  1KD1 C;  2D6F A;  1GBR A;  2DRK A;  3GBQ A;  1X27 A;  4IKF A;  3CCE Q;  3MEA A;  4JRP A;  1UEB A;  3CPW P;  1W1F A;  1C6V X;  4M7D A;  1SKU B;  3Q1J A;  3UWN A;  1N8R C;  1D1C A;  1K9M R;  1WLP B;  2EKO A;  2LT1 A;  2JOY A;  2ZPI B;  2K79 A;  4C5E A;  3JB9 F;  3H0I A;  3RMQ A;  2KVQ G;  4MML A;  3CC2 T;  3LWH A;  1VQM T;  4LDX A;  3G71 Q;  4V2S A;  1RAH B;  1V29 B;  3FEO A;  4UC4 A;  2DVE A;  1Q81 C;  3JCM X;  3SHW A;  2KXC A;  4MZT A;  3E19 A;  1TG0 A;  5FRO A;  4AFQ C;  1WPY A;  3C12 A;  1X75 C;  1ZBJ A;  1X2K A;  4PKC C;  1IHW A;  1NPP A;  2VGN A;  4PJO F;  4AT1 B;  2HZY A;  1M30 A;  1NE8 A;  5KCO A;  3JSC A;  2JUF A;  3SWN C;  2LQW A;  1G3W A;  1YI2 Q;  1SF9 A;  3OS0 A;  1ZX6 A;  4M7A F;  1WJS A;  3IQL A;  3QUI A;  2PQW A;  4JS5 A;  2K7A A;  1T3L A;  2DM1 A;  4PJO A;  1BIB A;  3HKS A;  2QQS A;  2QQA A;  1VIE A;  5KYY A;  1OPL A;  4LUD A;  1WXU A;  2AK5 A;  1VQ4 A;  1B7T A;  1ZQ1 A;  3MP8 A;  3RKY A;  3VS7 A;  3NFC A;  4AG1 C;  4DOW A;  8ATC B;  2JS0 A;  5LL6 S;  5FU7 C;  2YWW A;  2RHX A;  3CMA Q;  2QXF A;  1VQN A;  2DXU A;  3M57 A;  2W0Z A;  3NPF A;  4BDZ A;  2QAS A;  2MF2 A;  3E9F A;  4JLG A;  2GFA A;  1Q81 U;  3CCE T;  1PC0 A;  3MEV A;  3A1P A;  4ATO A;  4M75 F;  4FSS A;  2PUK B;  1BI1 A;  4FM4 B;  2DAQ A;  2JT4 A;  4JRI A;  1IXD A;  5GMK i;  5LJ5 f;  4D6W A;  2E10 A;  2WSC E;  4C0D C;  3H6Z A;  1BI3 A;  2DEU A;  1V1C A;  2VWF A;  4NL2 A;  5GAM j;  5L8R E;  3LH5 A;  1VQK A;  1DJ7 B;  1I1J A;  3KXT A;  2NUT A;  1M3B A;  3OSS C;  3JB9 H;  3M58 A;  3QBY A;  3G71 T;  2FVU A;  1I4K 1;  2ZGW A;  4ZGJ B;  2OTJ A;  2EKH A;  3CBP A;  5FWC A;  1W2B A;  1C1A A;  1NEB A;  2HMA A;  1Z9Z A;  2FZC B;  3S3M A;  1KHC A;  4RTX A;  2DL8 A;  5GAN d;  4Z02 A;  2DJZ A;  1KG1 A;  1I8F A;  2DE0 X;  1RAF B;  2K57 A;  5GAO p;  3AHU A;  5LJ3 d;  4C8Q D;  3GIB A;  1ZSZ C;  3VUB A;  1QVG A;  1UEC A;  2VC8 A;  2R5M A;  4FCY A;  3CD6 Q;  1YI2 T;  2YUN A;  3FJ5 A;  2MAM A;  1Q82 R;  1KSW A;  3QPH A;  4OVA A;  3NTI A;  1H3Z A;  1JQQ A;  3VS1 A;  1HK9 A;  1YIT Q;  3A5Z B;  1AWX A;  3I9Q A;  4QVC A;  5HKC A;  2DZC A;  3H41 A;  1BB9 A;  4DEX A;  2E65 A;  1BU1 A;  2ZZD A;  4F7U B;  3RBB B;  1M2O A;  3CCM Q;  1TOV A;  4RTT A;  1WX6 A;  3M9Q A;  2ATC B;  3L2Q A;  1T0H A;  3F70 A;  2CP6 A;  3CMA T;  1M8M A;  3NMZ C;  3CC4 Q;  4C8Q B;  1K73 C;  5LJ5 j;  2AZV A;  3TEE A;  2J6K A;  2DER A;  2D8J A;  1TXQ A;  1BBZ A;  1QMC A;  2DMO A;  3QO3 A;  2PVO B;  4RTY A;  5KYU B;  3VYG A;  1B34 B;  1G5V A;  2AIR B;  3L2V A;  4HT9 A;  4QKU A;  2EYQ A;  4CC2 A;  1H8K A;  3UAT A;  2AKK A;  1K9M C;  1RI0 A;  1Q7Y U;  2FRY A;  3FIF A;  2LDM A;  3QJY A;  2D0Q B;  4KUD K;  4C5H A;  3OS2 A;  4HVW A;  1YHQ A;  2NYS A;  3EG1 A;  1V76 A;  5CK9 A;  1NZ9 A;  1ZUU A;  2LJ1 A;  2LMJ A;  4LDV A;  4FU6 A;  2E3H A;  1IRX A;  3PMT A;  4DBH A;  1MUZ A;  3G6E Q;  1PSE A;  3R6N A;  1Q95 G;  2HKN A;  3OYC A;  3G4S Q;  3I35 A;  3OYA A;  2CH4 W;  2RI2 A;  2DLP A;  1RL2 A;  3CD6 T;  2ZAE A;  2BE7 D;  2OJ2 A;  4N4G A;  1K73 U;  2QGF B;  2Y4Y A;  4XU3 A;  3CXC P;  2OTL Q;  2XKO C;  3M0S A;  4IUR A;  4HVV A;  1YIT T;  4EIK A;  5LJ5 e;  3OYJ A;  5GAM d;  3G7Z A;  4Z89 A;  2DTI A;  1QWE A;  2SEM A;  2QGG A;  1AOJ A;  3CCM T;  3S3O A;  3DLM A;  1MV3 A;  1VYT A;  4M77 E;  1K9M U;  2XU8 A;  1R0C B;  3QII A;  1AZG B;  4C92 C;  4R55 A;  3CCQ Q;  4NL3 A;  1LPL A;  3CC4 T;  2JW4 A;  1ACM B;  2HEQ A;  1X69 A;  2Z0W A;  1WHH A;  3SD4 A;  4FYX B;  1RUW A;  2FYK A;  2LC4 A;  2NLU A;  3MO8 A;  3TSZ A;  5CKD A;  1RAE B;  3VRZ A;  4BDY A;  5I22 A;  2JMA A;  4F7U A;  1K9A A;  3VYH B;  2RJC A;  2HL5 C;  3I56 Q;  1YJW Q;  5IXF A;  2RPN A;  2WSF E;  4HCK A;  4QVZ A;  1LOJ A;  4HA8 A;  2OX7 A;  3M54 A;  1IGQ A;  1X6O A;  3SFM A;  1YWO A;  2AT1 B;  2CGH A;  4C8Q A;  1UDL A;  2ABL A;  5DM7 R;  5GAN 2;  2P0P A;  1PKT A;  1K4U S;  1X43 A;  3RDV A;  1QVF S;  1QCF A;  3OBW A;  4BB7 A;  1VQ8 Q;  1M8V A;  2YHT A;  4C92 G;  5KYU A;  1XNI A;  2FL7 A;  2KEA A;  1NLP C;  4RCC A;  3VV0 A;  4ME7 A;  2QDY B;  3G6E T;  5FWB A;  4ZN1 A;  1KJW A;  1VQO Q;  1WHM A;  4J9F A;  2COW A;  1TS9 A;  3H0H A;  2YDL A;  5LJ5 g;  2DL5 A;  4KGZ B;  3G4S T;  2RA2 A;  5GMK l;  2DYI A;  7AT1 B;  4KGV B;  5LJ5 d;  1VQ5 A;  5FU6 B;  1E7O A;  3X24 B;  1K0S A;  4J9H A;  3MPU B;  2JN0 A;  4XQ3 A;  2AHJ B;  3JB9 D;  2EW3 A;  1VIF A;  1VQ7 A;  4E7K A;  1Y7X A;  2PTK A;  3MJX A;  2OTL T;  2A7Y A;  4PLL A;  5CVI A;  2R5A A;  1ABQ A;  1WFW A;  1Q82 C;  2F2V A;  1I5O B;  1PHT A;  1K0X A;  2JZ2 A;  1LCK A;  1BKB A;  4WTO B;  4BI8 B;  3JCM W;  3H9N A;  3SDZ A;  3OYD A;  1RI9 A;  2RQT A;  2L3S A;  4CRI A;  3I5S A;  3OB9 A;  4RCB A;  2JNG A;  2YRC A;  3CCQ T;  1G2B A;  1VQM A;  4ZN3 A;  1ZSG A;  4M78 F;  4GLM A;  2E3I A;  1NYG A;  4EMG A;  3CCJ Q;  1KQS S;  4M7A D;  2KT8 A;  1M1F A;  2E6Z A;  1ARK A;  1KFZ A;  2A0F B;  3V7C A;  4MMK A;  2LQ8 A;  3I56 T;  1PSF A;  2H3E B;  4DQ2 A;  4M7D E;  1WJQ A;  1YJW T;  1SG5 A;  2RB6 A;  3DB4 A;  2ROT A;  3LX7 A;  2O88 A;  4B9X A;  5DY9 A;  1WQ7 A;  3EG3 A;  2DK3 A;  1JJ2 A;  4M78 A;  2IVW A;  4HT8 A;  2XD0 A;  2K5L A;  1AD5 A;  1WHK A;  1VQ8 T;  2P0Q A;  5AT1 B;  2EGE A;  2EIF A;  1Q7Y R;  3EH1 A;  1JRI A;  4HXJ A;  4PFZ A;  1Q82 U;  2X4X A;  2EWN A;  1VQO T;  2M0Y A;  4M75 D;  2X3X D;  2C06 A;  2CRE A;  4X9D A;  4M7A B;  1WIE A;  2XI9 A;  3ZFJ A;  3M56 A;  4OMM A;  3M5A A;  2PZ1 A;  3HP9 A;  4NOY A;  2CH4 A;  5CIU A;  5CKB A;  1YWP A;  1OV3 A;  2O31 A;  2OAU A;  1W6X A;  1EIF A;  1G3T A;  1E6G A;  2WSE E;  2LQN A;  2COY A;  3NGP A;  3I5R A;  2XID A;  2O2O A;  5IHN A;  1PG5 B;  1QVP A;  1QP3 A;  3CCE A;  4A63 B;  2HCK A;  2DFU A;  2MK5 A;  1GRI A;  1UUE A;  4Y92 A;  4ORZ A;  4A4E A;  4J9B A;  1K73 R;  4PJO E;  5I2M A;  3JB9 I;  1IB8 A;  4J83 A;  1BCM A;  2RK2 A;  4IIM A;  4XTU A;  1N6A A;  2L89 A;  2NUT B;  2RQR A;  2KAF A;  1W2B S;  1D0Z A;  2F69 A;  4M75 B;  2J06 A;  4JJC A;  2E70 A;  2E41 A;  1X6B A;  2KYM A;  1A0N B;  4N0A C;  1GBQ A;  1NYF A;  4FYV B;  3G71 A;  3HPW A;  5GMK h;  3CCJ T;  1W4S A;  2C0T A;  4JJB A;  3S6W A;  1QVG S;  2DA9 A;  2DPP B;  2LNH B;  1VQ6 Q;  3FJP A;  2K3B A;  2YT6 A;  3GNF B;  2CS7 A;  2YLC A;  5DLO A;  2IG0 A;  2LQK A;  4K11 A;  1IGU A;  1YFN A;  3ZEH A;  1G8X A;  1N27 A;  2A08 A;  3PNW C;  5A2Q E;  2Y4X A;  2CUD A;  3NTK A;  2JS2 A;  2A37 A;  1JO8 A;  1YJN Q;  1CKB A;  1XTD A;  1E6H A;  2K5F A;  3EHQ A;  2VVK A;  2V1R A;  4EMK B;  4A53 A;  1KQ1 A;  4QQD A;  4KT0 E;  1YI2 A;  2A36 A;  5CKH A;  2LCL A;  3FRN A;  1U1S A;  2M9U A;  3PMI A;  1WGS A;  4OMO A;  1ZLM A;  5CQX A;  1GCQ C;  1RAG B;  2E12 A;  2QAZ A;  3N5B B;  1M1K R;  4HCB A;  2L8D A;  4N4H A;  1MMN A;  1KQS A;  3M59 A;  1X6G A;  4XK8 E;  2HDA A;  4C92 F;  5A0L A;  3V8L A;  4IUU A;  5J3B A;  3NTH A;  3OYN A;  3EFS A;  5ECA A;  1MMA A;  1CSK A;  1WHG A;  2DJQ A;  3M0U A;  3EG9 B;  3OYH A;  3CPW S;  4OML A;  4LDU A;  1KQ2 A;  3OS1 A;  3JCM J;  2XIC A;  1WHL A;  2J6F A;  4ELY C;  1S72 A;  4E6R A;  4M7A A;  1BYM A;  2IPO B;  3M0P A;  2H3J A;  1QWF A;  1D0X A;  2O9V A;  3EGX B;  4Q5W A;  3OW2 P;  4M77 C;  3CCU Q;  3WVD B;  1WXB A;  4E7S A;  2BTT A;  1FXX A;  1Y07 A;  3PFS A;  1TTH B;  3BE3 A;  2QDL A;  3EG2 A;  2FB7 A;  2B8A A;  3J81 E;  1AZE A;  2YSQ A;  2E1H A;  2LX9 A;  2DVJ A;  2QEX A;  2BKD N;  1VQ6 T;  1WYX A;  1M2V B;  3E1S A;  4WCI A;  4PK4 A;  3UF4 A;  3U23 A;  5L23 A;  2RHU A;  3OY9 A;  1HSQ A;  1ZHI A;  1MMD A;  2LRQ A;  2HBW A;  3RIR A;  5CKF A;  1ABO A;  2L3R A;  4M75 A;  2YRV A;  4E7L A;  1VQP A;  3CC7 A;  3X26 B;  1YJN T;  1O9S A;  2K2M A;  4FIB A;  1VQN Q;  4ZNX A;  3WVE B;  2EAY A;  4NS5 A;  3CD6 A;  1OU8 A;  3FB9 A;  4B6M A;  4L5G A;  1HXD A;  3VS6 A;  4RTU A;  4A4G A;  1K1Z A;  4M77 G;  3QSU A;  3ZBD A;  3KUF A;  2KRM A;  1UHC A;  2V8I A;  3C4S A;  2H8H A;  1B3Q A;  2D9T A;  3GLX A;  4F17 A;  5IHK A;  1Q7Y C;  4BY6 C;  1YIT A;  3QZ5 B;  2KK4 A;  1KK7 A;  2RQU A;  2C0I A;  1M4Z A;  2A3L A;  2COZ A;  2EJ9 A;  2VGM A;  1AWJ A;  2GGR A;  3V7R A;  4EMK A;  2OTJ Q;  2F5T X;  1QKX A;  3URG A;  2BIV A;  3OYF A;  3CC4 A;  3HTR A;  1MMG A;  3OS5 A;  4J9G A;  2RI3 A;  3L1A A;  4WF2 A;  2CP2 A;  2AKL A;  1N5Z A;  3LGF A;  1MHN A;  4ESR A;  4M4Z A;  1OYX A;  3AT1 B;  2YUO A;  4KUI A;  1D09 B;  1NG2 A;  3CCU T;  2RJD A;  2RHY A;  5C0M A;  1VOM A;  4Z88 A;  4OB3 B;  5DLQ E;  3KFV A;  5IHI A;  3CPF A;  4VUB A;  2RJF A;  4PFO A;  4P5N A;  2BUD A;  2GTO A;  4PL6 A;  2G6F X;  3EG9 A;  3KBG A;  2EQM A;  1UTI A;  2EGC A;  5FU6 C;  5GAO m;  5CQY A;  3MEW A;  2KNB B;  2CP0 A;  2YLB A;  4ZTF A;  1YCS B;  3CPW A;  3A8O B;  2EJF A;  2RN8 A;  2RO0 A;  2GF7 A;  4F7U E;  5KH6 A;  3G6E A;  4FW1 A;  1VQ9 Q;  4M7D C;  3EGX A;  3HFO A;  3LLR A;  4JJD A;  4HKE A;  1PD1 A;  1VQN T;  3OYY A;  3G4S A;  4OMQ A;  5GAO q;  3OYE A;  1W70 A;  2CUB A;  2RI5 A;  4C0Z A;  1YIJ Q;  4C8Q E;  3EFO B;  2GTJ A;  3EHR A;  2DL7 A;  4JRK A;  1BK2 A;  1M2V A;  3R6O A;  2OTL A;  5FU7 B;  2EPD A;  4M78 D;  2SRC A;  5KCH A;  1J3T A;  4PJL A;  4LXC A;  2DKG A;  4F04 B;  2YRD A;  3RKX A;  1UGP B;  3CCS Q;  2KMT A;  1M1K C;  3MCA B;  4PLI A;  1RAC B;  5GAN 4;  3PTA A;  5GMK e;  2HL3 A;  1D1A A;  2LNV A;  1YHQ Q;  2OTJ T;  3CCV Q;  2K9G A;  3VKI A;  3CCQ A;  3PIO A;  4R0K A;  2X35 A;  5GJW B;  4M7D G;  2KT1 A;  3UT1 A;  2FZK B;  4C0D B;  1QCO A;  3PE0 A;  3A8G B;  2JMC A;  2L3Q A;  3LWI A;  4KH1 B;  1SEM A;  2DD5 A;  1RAA B;  2DEQ A;  3ME9 A;  4AFU C;  2XDD A;  2DNU A;  3RR6 A;  1M90 R;  1JJ2 S;  2CP7 A;  1N9R A;  3QG1 A;  2BZX A;  1LVK A;  3ER0 A;  1AHJ B;  2EYZ A;  1YJ9 A;  3I56 A;  2CP5 A;  3HL8 A;  4F16 A;  2QA4 Q;  4MDX A;  2ED0 A;  1Q86 U;  4PJO C;  4XU1 A;  1YJW A;  4M78 B;  2X4J A;  2X4Y A;  4DBF A;  2LJ3 A;  2DBM A;  1VQL Q;  3QXE B;  5GAN 7;  4N4I A;  4LNP A;  3HRT A;  1OUL A;  3OQ5 A;  1VQ8 A;  1I07 A;  1ZSZ B;  4J9E A;  1N9S A;  4BD3 A;  1ZUK A;  2LZ6 B;  3CME Q;  1OEB A;  3LW5 E;  2RHZ A;  5GAN h;  2XDB A;  1VQ9 T;  1PCX A;  3P8B B;  1M1K U;  4L6V 5;  3BY7 A;  3CCR Q;  4XTW A;  4LN2 A;  5LJ3 h;  3VS0 A;  1KHI A;  1UFF A;  2CT4 A;  4FSX A;  3GNG A;  1GFD A;  2FG0 A;  2VAS A;  1SRM A;  3G1J A;  2W10 A;  3CCL Q;  1YIJ T;  4QT7 A;  4D8K A;  4XTX A;  4M78 E;  3HRU A;  3P8H A;  3CXC S;  4PJO G;  1TUC A;  4RG8 A;  3OA6 A;  2K6D A;  1H92 A;  3TVT A;  2DL3 A;  1PWT A;  4BAC A;  2JXB A;  1FMV A;  3SWN A;  1JB0 E;  2K3Y A;  2E64 A;  2KRS A;  1UGS B;  3CCS T;  4J6Y A;  1GL5 A;  1SPK A;  5GAN 6;  1H64 1;  5I11 A;  2KRO A;  2ENM A;  3PVL A;  4LDY A;  3EG0 A;  1YHQ T;  2X9H A;  3CCV T;  3T9N A;  4O5V A;  8AT1 B;  2FO0 A;  4AFZ C; 
#chains in the Genus database with same CATH homology
 1V1C A;  2VWF A;  3LH5 A;  2J06 A;  4JJC A;  1OOT A;  2DYB A;  2A28 A;  3O5Z A;  2V1Q A;  1X6B A;  2KYM A;  1A0N B;  1NLO C;  1I1J A;  2F2W A;  1GBQ A;  1NYF A;  2KRN A;  1M3B A;  1NM7 A;  1U3O A;  1QLY A;  2EBP A;  2MIO A;  2EKH A;  2C0T A;  4JJB A;  2DA9 A;  2LNH B;  5FWC A;  2K3B A;  2YT6 A;  1NEB A;  1U06 A;  3M0R A;  1Z9Z A;  4K11 A;  4RTX A;  2DL8 A;  4CC4 B;  2D0N A;  2A08 A;  2XMF A;  2CUD A;  4CC3 A;  1PRL C;  2JS2 A;  2A37 A;  2DE0 X;  1JO8 A;  2ROL A;  4LE9 A;  2EYY A;  1KIK A;  1CKB A;  1HD3 A;  3ZL7 C;  1E6H A;  1FMK A;  3EHQ A;  2VVK A;  1UEC A;  2V1R A;  1M3A A;  3VS5 A;  2FEI A;  1Y0M A;  2A36 A;  3VS4 A;  2YUN A;  3THK A;  2DIL A;  3FJ5 A;  4OMO A;  2BZY A;  2MOX A;  1ZLM A;  2FPD A;  1GCQ C;  1KSW A;  1NEG A;  1JQQ A;  2ESW A;  3VS1 A;  2KYB A;  3H0F A;  1AWX A;  3I9Q A;  2YUQ A;  3H41 A;  1BB9 A;  4DEX A;  1X6G A;  3A98 A;  1BU1 A;  1IO6 A;  3RBB B;  2HDA A;  2EGA A;  4JPB W;  4RTT A;  1M27 C;  1WX6 A;  3TSW A;  2O9S A;  5ECA A;  2FPE A;  1YNZ A;  1T0H A;  1CSK A;  2DJQ A;  1M8M A;  3NMZ C;  3M0U A;  4OML A;  2AZV A;  4CC7 A;  2J6K A;  4RTZ A;  2D8J A;  4OMP A;  1BBZ A;  1GCQ A;  2DL4 A;  2DMO A;  2F2X A;  2J6F A;  2CDT A;  4RTY A;  4E6R A;  1AVZ C;  2RNA A;  3M0P A;  2EYX A;  1QWF A;  4CC2 A;  1H8K A;  3UAT A;  2O9V A;  2AKK A;  1WXB A;  2DX1 A;  2BTT A;  2CSQ A;  3EGU A;  2FRY A;  2QDL A;  3EG2 A;  3NHN A;  2CSI A;  4RUG A;  1SRL A;  4HVW A;  1AZE A;  2YSQ A;  3EG1 A;  2J7I A;  2DVJ A;  2DRM A;  1ZUU A;  1S1N A;  1WYX A;  2LJ1 A;  1SHF A;  4WCI A;  2LMJ A;  2P4R A;  3RNJ A;  3UA6 A;  2JTE A;  3UF4 A;  3U23 A;  1QKW A;  5L23 A;  2LP5 A;  1HSQ A;  1MUZ A;  1RLQ C;  1VYV A;  2HBW A;  2J6O A;  3R6N A;  1ABO A;  1WXT A;  5EC7 A;  1H3H A;  3JV3 A;  1UGV A;  1PKS A;  2K2M A;  2MCN A;  4ZNX A;  1JXM A;  3I35 A;  2CH4 W;  2DLP A;  2CT3 A;  1T0J A;  1G83 A;  2EYW A;  3VS6 A;  4RTU A;  2EQI A;  2OJ2 A;  1AEY A;  3REA B;  2VKN A;  2RQV A;  1K1Z A;  2IIM A;  2OAW A;  3PVQ A;  3UA7 A;  2KRM A;  1UHC A;  2M51 A;  1UJY A;  2H8H A;  1B3Q A;  1UE9 A;  4HVU A;  4F17 A;  5IHK A;  3M0S A;  2OI3 A;  4HVV A;  1SSH A;  1PNJ A;  1FYN A;  4EIK A;  2KXD A;  1K76 A;  2RQU A;  2C0I A;  4Z89 A;  1QWE A;  2SEM A;  1AOJ A;  2JM8 A;  2PNI A;  1MV3 A;  1VYT A;  1VYU A;  5HCK A;  1AWJ A;  4JZ3 A;  2GGR A;  4OMN A;  5GJV B;  2L2P A;  1AZG B;  1QKX A;  3M0Q A;  1ZUY A;  2HSP A;  2JW4 A;  2HEQ A;  1WDX A;  2ED1 A;  1X69 A;  4J9G A;  2C0O A;  1RUW A;  3ULR B;  3QWX X;  2AKL A;  4GBQ A;  2ECZ A;  3TSZ A;  1N5Z A;  3VRZ A;  4ESR A;  4M4Z A;  5I22 A;  2YUO A;  2JMA A;  2RQW A;  1K9A A;  2DBK A;  1UG1 A;  2GNC A;  1NG2 A;  1PRM C;  1GFC A;  4Z88 A;  5IXF A;  2RPN A;  4HCK A;  2EVR A;  3KFV A;  5IHI A;  3CQT A;  4RTV A;  1HJD A;  2GTO A;  1JEG A;  1SHG A;  2G6F X;  3VRY A;  4J9C A;  1OPK A;  2AZS A;  1YWO A;  1UDL A;  2ABL A;  1XOV A;  1AWW A;  1UTI A;  1PKT A;  2GQI A;  1K4U S;  4J9I A;  1MV0 B;  2X3W D;  1X43 A;  1RLP C;  2B86 A;  2EGC A;  1QCF A;  2FPF A;  2LCS A;  2D1X A;  2KNB B;  2LJ0 A;  2D8H A;  5IH2 A;  1YCS B;  2E5K A;  1YP5 A;  2KEA A;  4JZ4 A;  1NLP C;  1WA7 A;  1Y57 A;  4AFS C;  2RN8 A;  1GCP A;  5FWB A;  4JJD A;  4DEY A;  1KJW A;  4J9F A;  3C0C A;  1Z9Q A;  3H0H A;  2YDL A;  2DL5 A;  4OMQ A;  1UHF A;  2KBT A;  1JU5 C;  1W70 A;  2CUB A;  1E7O A;  2LX7 A;  4F14 A;  2J05 A;  1K0S A;  4RTW A;  4J9H A;  2EW3 A;  3M0T A;  2GTJ A;  3EHR A;  1U5S A;  2DL7 A;  4X1V A;  1BK2 A;  2GBQ A;  2PTK A;  3QWY A;  2EPD A;  2RF0 A;  3REB B;  4J9D A;  2SRC A;  1GBR A;  2DRK A;  3GBQ A;  1X27 A;  5IXB A;  1ABQ A;  1WFW A;  1J3T A;  3SEM A;  2F2V A;  1PHT A;  1W1F A;  1K0X A;  1LCK A;  1RI9 A;  2RQT A;  2L3S A;  1WLP B;  3I5S A;  2K9G A;  4R0K A;  1T3S A;  5GJW B;  2YUP A;  2KT1 A;  2K79 A;  3H0I A;  3PE0 A;  1G2B A;  2JMC A;  2L3Q A;  1SEM A;  5FW9 A;  4AFU C;  2L0A A;  2DNU A;  1ZSG A;  4GLM A;  3VS3 A;  1NYG A;  4D8D A;  2BZX A;  2EYZ A;  2KR3 A;  2KT8 A;  1ARK A;  1KFZ A;  1JXO A;  2I0N A;  3SHW A;  2KXC A;  1TG0 A;  2RMO A;  4F16 A;  2KGT A;  2ED0 A;  2NWM A;  2KE9 A;  2ROT A;  1TUD A;  4AFQ C;  2O88 A;  3EG3 A;  1ZBJ A;  1X2K A;  2LJ3 A;  2DBM A;  1M30 A;  4LNP A;  1AD5 A;  2DF6 A;  4AG2 C;  1I07 A;  2LQW A;  4J9E A;  1YN8 A;  1ZUK A;  2EGE A;  2LZ6 B;  1OEB A;  1B07 A;  1AWO A;  1ZX6 A;  4HXJ A;  1VA7 A;  3IQL A;  2K7A A;  2M0Y A;  1I0C A;  2X3X D;  3VS2 A;  4LN2 A;  1T3L A;  2DM1 A;  3VS0 A;  2CRE A;  1UJ0 A;  1UFF A;  2CT4 A;  1WIE A;  1OPL A;  1GFD A;  4LUD A;  4OMM A;  2FG0 A;  1WXU A;  2AK5 A;  2PZ1 A;  2CH4 A;  1CKA A;  1SRM A;  2L3P A;  4Z8A A;  1YWP A;  2W10 A;  2NUZ A;  4KRT A;  4QT7 A;  1OV3 A;  3VS7 A;  4D8K A;  2O31 A;  4AG1 C;  1W6X A;  2JS0 A;  1TUC A;  2FRW A;  1H92 A;  2K6D A;  3TVT A;  1E6G A;  2LQN A;  4LUE A;  2JM9 A;  2DL3 A;  3NGP A;  1PWT A;  3I5R A;  2JXB A;  2O2O A;  2W0Z A;  3NPF A;  2BZ8 A;  5IHN A;  1WI7 A;  2KRS A;  4A63 B;  2HCK A;  4IIO A;  1EFN A;  1GRI A;  1UUE A;  4Y92 A;  4ORZ A;  1GL5 A;  1SPK A;  5I11 A;  2KRO A;  2ENM A;  3PVL A;  4FSS A;  4J9B A;  1X2Q A;  3EG0 A;  2JT4 A;  4IIM A;  2RQR A;  2FO0 A;  1M3C A;  4AFZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...