4Z8AA

Sh3-iii of drosophila rim-binding protein bound to a cacophony derived peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
b'GPLGSPEFNRPVKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIM-binding protein, isoform F
publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rim-binding protein
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z8aA00
3QWXX 2CH4A 1CKAA 1XOVA 2RPNA 1AVZC 2AK5A 4OMLA 1KIKA 4Z8AA 4D8KA 3UATA 1ABQA 1AOJA 2DL5A 4DEYA 2RQTA 1S1NA 2KRSA 1UE9A 2A36A 2W0ZA 1X2KA 2ESWA 2K7AA 2DM1A 1B3QA 2AZSA 4J9HA 4GBQA 4CC2A 1RUWA 1AWXA 1UTIA 2OI3A 1K9AA 2BZYA 4HVWA 3H0HA 2L3QA 5IXBA 1G83A 1PKSA 2V1QA 3VS3A 4D8DA 2F2WA 1NEGA 3GBQA 1OPLA 1I1JA 2LCSA 2KXDA 1KSWA 3NHNA 1QWFA 2KYMA 1JO8A 2O2OA 1Z9QA 1LCKA 2KRMA 2LJ0A 2YUPA 2DL4A 2ENMA 4LN2A 1VYVA 2GNCA 2EYXA 1WX6A 3EHQA 1I0CA 3I9QA 4DEXA 2RMOA 2LJ3A 1BBZA 1NEBA 2ED1A 4FSSA 2RF0A 2EGCA 3R6NA 1VA7A 1WDXA 3JV3A 2CREA 1UG1A 4OMPA 2DA9A 2FRWA 1MV0B 1ABOA 1JU5C 2KE9A 2I0NA 2LJ1A 4OMNA 4WCIA 2A08A 1H8KA 2YT6A 1WYXA 2EKHA 4AFSC 2HDAA 2DLPA 3UA7A 1GCQC 4CC7A 2JTEA 1UUEA 1NLPC 2FPFA 5IXFA 1E6GA 4AFUC 2VKNA 5GJVB 2O9VA 2BZ8A 4F16A 2JW4A 1WXTA 3PVQA 1UECA 2ROTA 1OV3A 1HSQA 4GLMA 3EG2A 4IIMA 2D8JA 2O31A 4J9CA 2KEAA 2VWFA 2DL3A 1UFFA 1Z9ZA 3LH5A 2JS0A 4R0KA 2AKLA 4LUEA 4JJDA 4Y92A 3REBB 4J9DA 1TUDA 3H0IA 2J6FA 1SRMA 1X27A 2EYWA 3REAB 1WXUA 1OOTA 4RTYA 3THKA 3TVTA 2J6OA 4JZ3A 1MUZA 2JT4A 1JEGA 4ZNXA 3EG1A 2RQUA 2EGAA 1Y0MA 2F2VA 1AEYA 3M0SA 1U5SA 5GJWB 2ECZA 2L2PA 1YP5A 3H0FA 1W1FA 4ESRA 1J3TA 2FO0A 3EG3A 2LX7A 1RI9A 2GQIA 4QT7A 1V1CA 2MIOA 2RQWA 3I5RA 4LE9A 3NPFA 1X6GA 3FJ5A 4JJBA 4JZ4A 2PTKA 4IIOA 1AZGB 3VS1A 2BTTA 3M0UA 2L3PA 3M0RA 2V1RA 3ZL7C 2ROLA 1YNZA 2DMOA 4AFQC 1GL5A 2CUDA 3VS7A 2X3WD 2HCKA 1M3BA 1KJWA 2YDLA 2DL8A 2EGEA 1QLYA 2PNIA 1H3HA 2HBWA 2GGRA 1WFWA 1T3SA 4HXJA 2CUBA 1GRIA 1UHFA 2J6KA 1K0SA 2HSPA 4M4ZA 1PKTA 1FMKA 2J7IA 1A0NB 1W6XA 1HJDA 2LQNA 4F17A 5I11A 1SRLA 4X1VA 3C0CA 3M0PA 1WXBA 2C0IA 2KNBB 2YUQA 2EBPA 2KBTA 1BB9A 2NUZA 4Z88A 5IHKA 1ZUYA 1GBQA 4CC3A 2CDTA 1ZX6A 2K79A 1T0HA 1M3CA 2YUOA 2DBMA 2FEIA 4EIKA 3SEMA 1HD3A 1YN8A 2L3SA 2O88A 1QWEA 1CKBA 1SSHA 2DJQA 1ZUUA 1UJ0A 1X6BA 2JMCA 1UGVA 2D1XA 1TUCA 3VRZA 1B07A 2O9SA 2JM8A 4HCKA 4CC4B 1AWOA 1M3AA 4RTWA 2CT3A 2DL7A 1ZLMA 2C0OA 3VS6A 2J06A 1UHCA 1SHFA 1QKXA 1ARKA 1RLPC 4Z89A 2YSQA 1AZEA 1QCFA 2EYYA 1GFDA 1H92A 1E6HA 4RUGA 1NLOC 1G2BA 2F2XA 1GCPA 2EPDA 3I5SA 4RTXA 3QWYA 2FRYA 2E5KA 2DNUA 2LZ6B 2A28A 3U23A 1PRMC 4JJCA 1ZBJA 1I07A 1RLQC 4AFZC 2YUNA 2EW3A 2RN8A 1WI7A 3PVLA 2XMFA 4J9GA 2DVJA 3NMZC 1NM7A 2CSIA 1M30A 3TSZA 3O5ZA 1UDLA 1SPKA 1YWOA 1K1ZA 2BZXA 2ABLA 1YWPA 1WIEA 4LNPA 2LP5A 3I35A 5HCKA 2PZ1A 1ZSGA 3UA6A 1M27C 1BK2A 1NG2A 5IHIA 3VS2A 4OMQA 2KYBA 1GBRA 2JMAA 2OAWA 1N5ZA 1T3LA 2LQWA 5IH2A 1M8MA 2DRKA 2DF6A 1VYUA 1EFNA 2GTJA 1UJYA 4RTUA 5FWCA 1VYTA 3UF4A 4F14A 1MV3A 2ED0A 1PNJA 2B86A 2DBKA 1YCSB 3SHWA 2M0YA 2K2MA 4KRTA 2NWMA 2IIMA 2MOXA 3KFVA 2GBQA 2K3BA 2KRNA 2P4RA 3RBBB 1AWWA 5ECAA 3RNJA 1U3OA 1X69A 2AKKA 2MCNA 4E6RA 2JS2A 2QDLA 1AWJA 5IHNA 1ZUKA 2L0AA 2RQRA 4OMMA 2K6DA 3VS4A 1SEMA 4JPBW 2FPDA 2KROA 2EYZA 3EHRA 2D0NA 2DRMA 4J9FA 3A98A 3EG0A 4OMOA 2VVKA 3M0TA 2C0TA 1PRLC 2GTOA 1X2QA 2HEQA 2CT4A 2EQIA 1GFCA 1NYGA 1IO6A 2CH4W 3IQLA 2KR3A 3CQTA 4J9IA 2M51A 1E7OA 2W10A 1PHTA 1JXOA 4HVVA 3M0QA 1QKWA 2DYBA 1K4US 1NYFA 1U06A 3VS5A 1WA7A 2DE0X 5I22A 2DILA 1OPKA 2H8HA 4ORZA 3ULRB 2J05A 2FPEA 3EGUA 2CSQA 2EVRA 2JM9A 4J9EA 2LNHB 2KGTA 2A37A 2SRCA 2FG0A 1AD5A 1X43A 2RNAA 4LUDA 1K76A 2AZVA 2KXCA 3TSWA 2DX1A 1GCQA 1BU1A 1Y57A 3VS0A 4K11A 4RTZA 1K0XA 1TG0A 3NGPA 2G6FX 5FW9A 2JXBA 1FYNA 4A63B 1W70A 2LMJA 2D8HA 1JXMA 1OEBA 5EC7A 4HVUA 1T0JA 1KFZA 2X3XD 5FWBA 2KT1A 3H41A 1WLPB 4AG2C 2KT8A 2OJ2A 1SHGA 3PE0A 4RTTA 2K9GA 5L23A 4J9BA 3VRYA 1CSKA 1JQQA 4RTVA 4AG1C 2RQVA 1PWTA 2SEMA
chains in the Genus database with same CATH superfamily
1D3BB 2CH4A 3CD6A 1M8VA 2RPNA 1AVZC 5GAMg 2AK5A 2B8AA 4M77C 4A4FA 5KYNA 1Q86U 2FZCB 1VUBA 2QGFB 3UATA 4XU2A 4RCBA 3OYBA 3BDUA 2RQTA 3H6ZA 3I56A 4PJMA 5J3BA 2G3RA 2ESWA 3JCMb 2DTOA 4GY5A 2LVMA 2RK2A 1AWXA 2L89A 2OI3A 1VQ7T 1M1KC 4M7DB 5FRNA 1WHLA 2BZYA 1UB4A 3E2UA 3H9NA 1YJWQ 3LH0A 4BACA 2YRDA 4ZGJB 1D1CA 1BIBA 2DYIA 2E5QA 2IPOB 1K8AR 2KK4A 2F2WA 3INZA 1YJNT 1BI3A 4FYWB 2LCSA 4B9WA 1KSWA 2KYMA 2O2OA 4C8QG 1RADB 4J7IA 1OU9A 2EAYA 2R5MA 4PNOA 1M90U 2GNCA 2EYXA 1WX6A 3BY7A 4NOYA 2RMOA 2LJ3A 2ED1A 4FSSA 2LC4A 2MYSA 3F70A 1VA7A 1YITT 3OMCA 1OZ3A 3RERA 3DLMA 2DA9A 3QPHA 4ZN3A 4C5GA 2I0NA 5GAOp 4OMNA 4WCIA 4BB7A 3AHUA 2EKHA 3CMEA 2A0FB 3FC3A 1NLPC 3QXEB 3OYCA 4E7HA 1D0ZA 4BD3A 4C8QE 5J39A 2JW4A 5GAMe 1R0CB 1PC0A 2ZPIB 3DB4A 1UFFA 1Z9ZA 2RJFA 4LDYA 4MDWA 4RKUE 5C0MA 2XU8A 2K5FA 3A8GB 2MWOA 2F69A 4J9DA 1R77A 2LX9A 4M75D 5KYYB 1YJNA 4EMKB 1WXUA 4BUGA 4C0DC 3PFSA 2L8DA 2JT4A 3EH1A 1RAIB 4ZNXA 1ZBXA 1U5SA 1WPYA 2COWA 4C8QA 1X75C 2L2PA 5A0DA 3H0FA 1K8AU 1YITA 1FX7A 3TU4K 4M7AD 1RI9A 3JSCA 2FYKA 4PJOD 2EFIA 4LE9A 5GAOn 1X6GA 3FJ5A 2HQEA 3OYDA 3OQ5A 1Q86C 1NE8A 3V7RA 1M5Q1 2O01E 2BTTA 3M0UA 2L3PA 5GAMf 2V1RA 2QGGA 3CCLT 2DMOA 3NTKA 2ZPHB 4AFQC 1VQKT 2CUDA 1SG5A 4JRQA 2X3WD 5I21A 5I2SA 4XU3A 3JB9F 3EGXA 3MCAB 1KC8R 2EGEA 4XQ3A 2BIVA 2GGRA 1UGSB 1UHFA 4M75G 3JCMQ 5GMKi 2EIFA 3GLXA 2E70A 4II1A 4IKFA 2C0IA 1YI2A 2YUQA 2EBPA 3OYIA 2EQMA 3LGFA 3BE3A 2CP0A 3EGDB 2QTXA 1YIJT 5CKEA 2DEUA 1TU0B 1GBQA 2RHYA 3RDVA 4CC3A 1ZX6A 4LD6A 3V8KA 2CKKA 4M7AG 3E19A 4C92D 5AYFA 1M90C 2R57A 5GAOq 1VQPQ 4PJOG 3D7SB 3SEMA 1YJ9Q 2O88A 3JCMh 1QWEA 4KH0B 4FU6A 2DJQA 3I55Q 1X6BA 1K9MR 4ELYC 2D1XA 1TUCA 1B07A 4XTWA 2QEXA 1VQLA 2P0KA 4RTWA 3QYGB 3G4ST 2CT3A 2D0QB 1ZLMA 2CZ7B 3CCUT 4ZGDB 3JCMe 3MPUB 4DBFA 4KBMB 1AZEA 1QCFA 3X20B 1VQOT 3CCLA 1D1AA 1VQKA 1NLOC 4YTLA 3SWNA 4C5HA 1VOMA 2Y4XA 4RTXA 3QWYA 3CCST 2VGNA 2E5KA 5GMKl 3HSBA 3V8LA 2A28A 3EFOA 1ZBJA 1I07A 4M78D 2YLBA 2XDDA 4M75A 4AFZC 2YUNA 4C92G 4FCYA 2YRCA 2COYA 2RN8A 1VQ6Q 3A1PA 3OB9A 2BE9B 4F7UB 4C0ZA 2DVJA 2CSIA 3OBYA 1TXQA 3QO3A 1YIJA 1KC8U 2OTLT 3CCVA 2NYSA 2CZ1B 2QK0A 4KH1B 2NUPA 3I35A 5HCKA 1BI0A 4M77D 5KE2A 3UA6A 1M27C 1VQMA 1BK2A 4M7AA 1NG2A 1K8AC 2EKOA 4JUVA 4A4HA 1GBRA 3MP1A 4PJOA 3V8JA 4OVAA 3EG9B 2NUTA 3JCMf 2DZCA 3OS5A 3CCRT 1IXDA 1GXIE 5FWCA 1RAAB 3HFNA 4FYVB 3LWHA 3G4SA 2XHCA 3H8ZA 5KCOA 3CCUA 2QA4Q 2JN0A 2FB7A 2VXFA 5GAN7 2RHXA 2K2MA 3EAEA 5GANh 2NWMA 1YFNA 3QYHB 2IIMA 2MOXA 3VJPA 4MMKA 1VQOA 1K9MU 3EFSA 2K3BA 4HT8A 2QQSA 4M78G 3V7SA 2P4RA 2DXCA 4BY6C 2RJDA 2VB6A 1Q7YR 3M56A 2XI9A 4BI3A 1G3WA 5GANe 3QUIA 1SEMA 4BE1A 4JPBW 2KROA 2LT4A 1MMAA 3OYHA 1M2VB 3EG0A 1MNDA 1WQWA 4M77G 2RD1A 3M0TA 2HEQA 2C0TA 1PRLC 4MZMA 2EQIA 2GCXA 2KAFA 1NYGA 3M53A 4C92A 2OTLA 3OYNA 2PQWA 1E7OA 4HCBA 1VQNQ 3M0QA 1LVKA 5A0LA 3P8BB 1QKWA 5LJ3g 2EQUA 1K4US 1U06A 1S72T 4J6YA 1KQ1A 1QMCA 2DILA 1OPKA 2H8HA 4ORZA 3CPFA 3ULRB 3EGUA 5FU7C 2CSQA 3VYHB 3DB3A 1U8RA 3M4YA 2QQAA 3C4SA 2SRCA 3SWNC 1K76A 2LRQA 1C0MA 2EYQA 2BKDN 1GCQA 4N0AA 4C5EA 2E4HA 2V8JA 2D6FA 1Y57A 4M77E 3VS0A 4M75C 1K0XA 3NGPA 2QDYB 5CKFA 3OMGA 4KUDK 2DZ9A 2AHJB 1BCMA 4VUBA 4R55A 5GANf 1W70A 4PKCC 2D8HA 5IT9E 5EC7A 4HVUA 1T0JA 2EJGA 1VQ7Q 4M78A 2OJ2A 4RTTA 4RG2A 3RKXA 5GAN8 2KSSA 5D6YA 1JQQA 4M7AC 3OYLA 2HKQB 2RQVA 4PJOC 1KC8C 1Q7YU 2QI2A 2MMPA 1ABQA 4M77A 4KUIA 4FT4A 5CCAA 1QP3A 2KRSA 1UE9A 2QQRA 2RJCA 2HNIA 1C6VX 2LT1A 2K7AA 2DM1A 1B3QA 3GNGA 4J9HA 4CC2A 3TEEA 1VQ8T 4DBRA 4WTOB 1RACB 2YLCA 2L3QA 5IXBA 4XTYA 2E65A 5GAN3 4OB0B 3G6ET 1PKSA 5HKCA 3OYEA 4D8DA 1I1JA 1RAGB 1K9MC 4KGVB 1UEBA 2X9HA 1KQSP 1V76A 1JB0E 1Z9QA 2KRMA 4C8QB 4QKUA 5KYXA 4C92C 4LDXA 4V2SA 1VYVA 2Z0WA 3CD6T 4PLIA 3EHQA 1I0CA 4DEXA 1MMDA 2DD4A 4XU0A 2EGCA 3JV3A 2MPXC 2JUFA 3V7CA 3L2WA 5CIUA 3CMAT 1MNEA 4A54A 2VUBA 3S6WA 1UG1A 5HK0A 2DPPB 4ZTFA 1UGPB 2X4WA 4BE2A 1SF9A 1IHWA 2LJ1A 1H8KA 5KYUB 1WYXA 4AFSC 1M1GA 1YCYA 4IUPA 5GAOr 4Q5WA 1GCQC 4N0AC 2JTEA 5IXFA 5GJVB 4RMOA 4PJJA 4AT1B 4X9CA 1YHQA 2DTHA 2ROTA 3E9FA 1Q82R 4EMHA 4N4HA 2JNGA 2RM4A 4GLMA 1PD0A 4WF2A 3QG1A 3RUXA 2D8JA 2O31A 2M1HA 2HKNA 2KEAA 3LH5A 3QJYA 2JS0A 2RI5A 4M78C 3G6EA 3REBB 4E7IA 1TUDA 4E7KA 2DXBA 1WHHA 1D1BA 1SRMA 3REAB 4RTYA 1VQKQ 2CP2A 4L6V5 2J6OA 3GOXA 1TWBA 4J5YA 1JEGA 3OS0A 3VU3C 2PVDB 1D0XA 2F2VA 3QBYA 1AEYA 2JOYA 4ANJA 4HA8A 2K5LA 2JJ9A 4ESRA 3CMET 3CMAA 2VV5A 1WJSA 3KUFA 4QT7A 2QXFA 3I5RA 1D09B 5FROA 3JCMc 3NPFA 3C95A 4OB3B 1YIJQ 1ZQ1A 2XIDA 1Q7YC 4XTZA 3VS1A 1QCNA 1XQHA 2JTFA 2ROLA 5DLQE 4XTUA 2HCKA 1M3BA 3M4GA 2M0OA 1KJWA 2YDLA 5CVIA 1QLYA 2PNIA 4X34A 1H3HA 1T3SA 3CEYA 1K0SA 1IB8A 2HSPA 1PKTA 4A4KA 4M75B 1HJDA 5GAOl 4F17A 4XTXA 1SRLA 4XK8E 2ZPBB 3M9QA 3C0CA 2RH2A 1WXBA 2LCCA 1VQ5T 2KNBB 1W4SA 1HK9A 2GFUA 1UGRB 2OX7A 3FLGA 9ATCB 1VQ9T 1Y07A 4TVRA 1ZUYA 1Q82U 1T0HA 2NUPB 4DBQA 4M7AB 2DBMA 1KQSS 1HD3A 1YN8A 4PJOB 1PG5B 1WQ7A 3CCSQ 1CKBA 2JVVA 2OTJA 3CCET 1ZUUA 2FZKB 2O9SA 2QASA 1NBEB 4HCKA 4IURA 3X24B 1NJIR 4E7SA 3VS6A 3ER0A 3CC2A 3MEUA 2E6ZA 1ARKA 3NTHA 3CCQA 3OYMA 2BE7D 3PTAA 1YI2T 3M57A 1MMNA 3UWNA 4JDSA 4M7DF 2KMTA 3QJ6A 1GCPA 2EPDA 4EDUA 4M7DD 5GAN2 3CCRQ 4JJCA 2KY9A 1O75A 1RLQC 1VQ5A 3RR6A 1H641 1WJQA 4C92B 2RHIA 2XMFA 3M5AA 4J7FA 3A8LB 3NMZC 1NM7A 1VQ9A 3BDLA 3TSZA 1KHIA 3JCMg 2LNVA 2X4YA 3G7ZA 5GMKj 3BFMA 3PIOA 1X6OA 2QEXT 1YWOA 1K1ZA 1VQLT 3P8DA 2ABLA 2YRVA 3EH2A 1WIEA 5LJ3d 1KHCA 1TOVA 3GP8A 7AT1B 4L5GA 3CCEA 3VS2A 1KQSA 4LDVA 2JMAA 4ATOA 3CBMA 5IH2A 3JAME 2GTJA 3PNWC 3UF4A 4F14A 1PSEA 3OYGA 1PNJA 2B86A 3JB9D 2WSEE 2O4XB 3SDZA 4M7DG 3LX7A 5LJ5j 3OA6A 1S72Q 1M9SA 1BCOA 3CC4A 3QDRB 1X69A 4E6RA 1NJIU 2JS2A 2QDLA 4CI0C 1ZUKA 3ZFJA 4ZGEB 1H3ZA 4E2FB 3CCVT 1VIEA 3CC7T 3JCMP 3QDFA 2PVGB 2DRMA 4OMOA 1D0YA 2K3XA 4N4IA 4FL6A 2VVKA 1VQMT 1B34A 4M77B 1Q82C 1OYXA 4E7JA 3OSSC 2ZAEA 1IO6A 4M75E 3IQLA 4J9IA 4FIBA 2W10A 4O5VA 1JXOA 1IGQA 1VQ4T 3ZEHA 1YJWT 3VYGA 3VS5A 2DE0X 5I22A 3JB9G 3FDRA 2J05A 1D3BA 4NL2A 2KGTA 2FG0A 1AD5A 5GANg 2BUDA 4LUDA 1PM3A 4M7AE 3G71A 2HBPA 2DX1A 2LQKA 1WNLA 3OSVA 1BU1A 4A4EA 4PJOE 1G3YA 1LPLA 1VIFA 4K11A 2E6NA 1TG0A 5KYXB 5FW9A 3CXCP 2I2LA 3OYAA 3MEAA 2GQVA 2E10A 4M7DA 4HCZA 1BI2A 2CZ0B 1XTDA 1MHNA 1KK7A 5FWBA 4HKEA 4OMFB 1VQ8Q 5LJ5h 4IUUA 2EQJA 1EX4A 2KT8A 1RL2A 3PE0A 4IUQA 4J9BA 5CQYA 5C6SA 2QQ9A 3CC7A 2X4XA 2SEMA 3QWXX 2M02A 4D8KA 2HSEB 4J6XA 5LJ5e 1AOJA 4DEYA 1S1NA 3CD6Q 2A36A 1VQ4A 1YJWA 2W0ZA 4C92E 4JLIA 2DETA 1IREB 2IG0A 2AZSA 2A7YA 3N5BB 1C1AA 3CBOA 3QZ5B 3S3NA 1RUWA 3CMAQ 1NPPA 2E12A 3JRZA 2DO3A 2RHZA 2VC8A 2EQKA 4HVWA 3I56Q 4OP0A 2AIRB 3J7AF 1QVFA 1W2BP 1TSFA 3VS3A 2CS7A 1NEGA 3GBQA 1OPLA 3JB9H 1U1SA 2E64A 2VASA 4C0DB 2KXDA 3J81E 3OY9A 1MGQA 5GAOm 1RAFB 3NHNA 4MZTA 1LOJA 1I5OB 2HQXA 4LN2A 1NJIC 1BKBA 2ZPEB 5GAMd 1NEBA 1V29B 2WSCE 2RF0A 3R6NA 1NZ9A 2P0PA 4DA4A 4F7UF 2CREA 3P8HA 5KYYA 3VUBA 5DLOA 1AHJB 3SB2A 4EMKA 5LJ5f 1ABOA 2M9UA 4M78E 1FMWA 2DFUA 2R5AA 2A08A 2YT6A 1QVPA 2HDAA 5KCHA 2XKOC 3FEOA 3RMSA 1WHJA 2DIGA 2FPFA 5A0GA 1E6GA 4AFUC 2VKNA 2O9VA 3SFMA 2BZ8A 4JRPA 1G3SA 1WXTA 3ZBDA 2CP3A 1OV3A 4XU1A 3CMEQ 4LD9K 4QVCA 4BI8B 4CRIA 3EG2A 4M7DC 3M58A 3S3MA 2XG8D 2VWFA 2DL3A 5L8RE 2HL3A 4JJDA 4Y92A 3H0IA 1VQPT 1QCOA 4PFZA 2J6FA 3OBWA 1YJ9T 1X27A 2EYWA 3M59A 3FJPA 2DD5A 1R8OB 4PK4A 3HFOA 4JZ3A 3OS2A 2V8KA 2MK5A 4MMLA 3CXCS 2RQUA 2EGAA 2Y90A 2DXTA 1YJNQ 2WACA 2ECZA 3OS1A 1W1FA 2DXUA 2FO0A 1FWZA 2A3LA 2GQIA 3EGDA 1K73R 1QQJA 2MIOA 2RQWA 8AT1B 3AT1B 3CCJT 3R6OA 5KYWA 3KBGA 1YHQT 4JJBA 3UPUA 1AZGB 1YITQ 1RAHB 3L2ZA 4FW2A 2CP6A 3ZL7C 2XK0A 1YNZA 4E7ZA 3MJXA 3A8OB 4XAXB 3BW1A 3HRUA 3CCEQ 3TCJA 4HXJA 1GRIA 1KQ2A 4M4ZA 4B6MA 2J7IA 1A0NB 2JZ2A 1WZOA 3RIRA 1I4K1 4DQ2A 1ZSZA 1QVGP 4X9DA 1JJ2P 3LLRA 5D7UA 2KDSA 2P4TA 2KBTA 5GAN6 1BB9A 2NUZA 4Z88A 5IHKA 2CP7A 1VQPA 1YJ9A 3RKWA 1W2BS 1I5LA 3JCMd 4EMKC 2CDTA 3I55A 4UC4A 1M3CA 1YI2Q 2YUOA 2XICA 1FXXA 2FL7A 4JRKA 2L3SA 5DM7R 3VUZA 4BI4A 5CKDA 1OI1A 3VV0A 3CXCA 2H3JA 1UJ0A 3T9NA 4F7UA 2ZPFB 1UGVA 4ZTJA 3EGXB 3NTIA 3SD4A 3CCJA 5D6XA 4CC4B 1M3AA 4F04B 2DL7A 2C0OA 3OYFA 1SHFA 1RLPC 2QEXQ 3CPWP 1VQLQ 2YSQA 3OYKA 5KH6A 3WXMB 1I8FA 2LQ8A 4RUGA 1K73U 5IN1A 2MF2A 3EG9A 2DTIA 1G2BA 1OX8A 4BY6B 1WHKA 3HRTA 3L2UA 3I5SA 2V8IA 2FRYA 3HL8A 3CCLQ 4JS4A 2DNUA 4JS5A 2LZ6B 2RJEA 1B34B 2EW3A 1WI7A 4BDYA 4J9GA 1RI0A 4B9XA 4N4GA 1YBYA 2OTJT 2ZCFB 1M30A 5GAMj 3DKMA 4C8QF 4HT9A 4C8QD 1SPKA 2QQBA 1W2BA 3G1JA 3LW5E 3UDCA 1M2OA 2BZXA 3LWIA 4LNPA 2LP5A 2V26A 2PZ1A 4OGEA 3CC2T 1PCXA 1WGSA 3MHXA 5IHIA 3L2QA 2LDMA 3CCVQ 5FU7B 2QA4A 1M2VA 2K4YA 2RHUA 3CCQT 1T3LA 3CC7Q 1M8MA 2DRKA 3SWNB 5GANd 1VYUA 1UJYA 4RTUA 1VYTA 2F5KA 1VQMQ 3EFOB 1ZSZC 3QSUA 1P92A 2K2VA 1YCSB 3SHWA 2JTMA 2M0YA 4OB2B 4KRTA 2GBQA 1VQ4Q 3MO8A 3G4SQ 2VGMA 1IGUA 3CCUQ 2RA2A 2CGHA 3RBBB 2DK3A 5GAN5 5ECAA 3RNJA 3M55A 4O6JA 2K3YA 1U3OA 1N9RA 2MCNA 3A8MB 1JRIA 5IHNA 1AWJA 1VQOQ 2L0AA 2RQRA 2K6DA 3E9GA 3VS4A 3HPWA 5CR2A 2KQWA 1ZA1B 2D0NA 1VQNA 2EJ9A 1EZZB 4J9FA 3A98A 1QVGS 3VKIA 2NUTB 2HAXA 1QVFP 1JJ2S 3A5ZB 2EJFA 1X2QA 3GPLA 2CH4W 1HXDA 3HRSA 2M51A 1PHTA 3OW2P 3MEVA 2DYBA 5GAMh 1G5VA 1NYFA 3GF5A 1WA7A 4QQGA 1M1FA 2OTLQ 1WHGA 3L2VA 4PL6A 2JM9A 4J9EA 2LNHB 5CKBA 2DIQA 1OQKA 1Y96A 1X43A 1N6AA 5LL6S 2AZVA 2HMAA 2KXCA 4PLLA 4RCCA 3CC4T 1OZ2A 1ZA2B 1N9SA 1B7TA 3PIPA 5GAN4 1VQ7A 2G6FX 1QP2A 1LJOA 2JXBA 3CCMT 2YWWA 2L3RA 1K73C 3CPWS 1ACMB 2E3IA 5I2MA 4M75F 3MP6A 1JXMA 1OEBA 2X3XD 2KT1A 3H41A 4NS5A 4AG2C 1SHGA 2Y4YA 5L23A 1NPRA 3X26B 1IRXA 1IHVA 4FYXB 4OB1B 1Q81R 4RTVA 4AG1C 4DOWA 1PSFA 5IAYA 1CKAA 2DJZA 1XOVA 2GF7A 4QVDA 4OMLA 4Y28E 5FU6C 1KIKA 4Z8AA 1QVGA 5M9OA 4M7AF 2PUKB 1KD1R 3JB9I 1JJ2A 2DL5A 4PJOF 2CYZB 3L42A 3G71T 5CAIA 3HHTB 1X2KA 2DKGA 5D6WA 1TH7A 4FYYB 4GBQA 4JJNK 2NLUA 1UTIA 1K9AA 1BI1A 2E1HA 1TTHB 1OU8A 2PU9B 5KYUA 3H0HA 3LGLA 4M78B 3WVDB 1Q95G 4P5NA 1G83A 2V1QA 4JLGA 4XTVA 6AT1B 2PUOB 3RESA 1M4ZA 5LJ5g 3CCMA 1QWFA 1JO8A 1XNIA 5J26A 1LCKA 2LJ0A 2YUPA 2DL4A 2ENMA 4FW1A 1BYMA 4JRIA 3I9QA 1BBZA 3CPWA 2QTVA 1F1BB 4ZN1A 4C0FA 5KYWB 1WDXA 3EFRA 4C92F 1WHMA 5FLXE 4M7DE 4A53A 4OMPA 3HP9A 2FRWA 1MV0B 1TS9A 1JU5C 4KT0E 2KE9A 5GMKh 2OAUA 3C94A 4L59A 3CBPA 3KXTA 2DLPA 2QG9B 4PJLA 3JCMV 3UA7A 1QVFS 2KVQG 4CC7A 1UUEA 3S3OA 3HKSA 4OF1A 3FIFA 5GANj 4F16A 1Q81U 2MWPA 3C12A 3OW2S 1KG1A 5CKHA 3PVQA 1UECA 4A4GA 1HSQA 1ZSZB 2K57A 5GMKe 3L1AA 4KGZB 3HTRA 1G8XA 1EIFA 4IIMA 4J9CA 3CCJQ 2VXEA 2LTOA 1N8RR 2K5IA 4R0KA 1KD1U 2HQHA 2AKLA 1YHQQ 2COZA 1Y71A 4LUEA 4MDXA 4EPCA 5AT1B 5HY6A 1OOTA 3THKA 3TVTA 4M78F 1MUZA 2IVWA 3G6EQ 3EG1A 4C8QC 1UGQB 1Y0MA 3M0SA 2ZGWA 5GJWB 2ZZDA 1PD1A 1YP5A 1ZHIA 1OX9A 4FM4B 1J3TA 4IUTA 3EG3A 2ATCB 1LNXA 2LX7A 8ATCB 1XJWB 1V1CA 1AT1B 2X51A 4M77F 5FRMA 1BIAA 1O9SA 1SKUB 4JZ4A 2PTKA 4IIOA 3ASKA 2PVOB 3FRNA 3M0RA 3META 5CQXA 4R56A 1GL5A 3VS7A 2DL8A 2R58A 2X35A 2HBWA 1WFWA 2CUBA 2J6KA 2DAQA 1FMKA 2WSFE 3OW2A 1W6XA 2LQNA 4DOVA 4LXCA 5I11A 1JBMA 4X1VA 2FHDA 3M0PA 3MP8A 3RKYA 3PMTA 2XDPA 2XDBA 2YXYA 1M1KR 3CCSA 2K79A 4KULA 2RO0A 4PFPA 3PMIA 1Y7XA 4LDUA 3E1SA 2C06A 2FEIA 4EIKA 1N8RU 5LJ3j 1X01A 2F5TX 1SSHA 4E7LA 1R0BG 3QIIA 5FU6B 2X4JA 2JMCA 3VRZA 3JB9J 2JM8A 4OGCA 1AWOA 2OTJQ 2F1LA 2J06A 4QW2A 1UHCA 4QQDA 4FT2A 4E47A 1QKXA 2RI2A 4Z89A 4NL3A 3X25B 2D9TA 3OYJA 2KI7A 2EYYA 4ELZC 3CCRA 1GFDA 1Q81C 1H92A 1E6HA 1G3TA 4PJNA 3CC2Q 2F2XA 3A8HB 3RMQA 5HK3A 3CCQQ 2FVUA 1SSFA 3I55T 3JCMX 4IUVA 3U23A 1PRMC 1KD1C 1WJRA 4RG8A 2O4XA 3OYYA 4F7UG 4ME7A 3PVLA 2GFAA 2L5QA 1I81A 3O5ZA 2HZYA 1U1TA 1UDLA 2YHTA 3LYIA 4J8OA 2ZPGB 1VQ5Q 4QVZA 4GLKA 1RAEB 1YWPA 2DVEA 1VQ9Q 1MMGA 3L2RA 2E41A 1ZSGA 2DERA 2DEQA 1Y96B 2RI3A 4OMQA 2H3EB 3QZ9B 2KYBA 2OAWA 2CP5A 1N5ZA 2QAZA 4LDWA 2M16A 2LQWA 1M1KU 3TQ7P 5LJ3h 2DF6A 1EFNA 3GIBA 2VYTA 4J6WA 1S72A 1MV3A 2ED0A 4F7UE 2CZ6B 4HCCA 1VQ6T 2DBKA 4Z02A 3KFVA 3PGGA 2KRNA 5CK9A 2HD0A 5LJ3e 3TREA 1AWWA 4C0GA 1Q86R 2XD0A 2AKKA 2E3HA 3ME9A 2HL5C 5CO7A 4DBHA 4OMMA 2FPDA 2EYZA 4C5IA 3CC4Q 3EHRA 3NFCA 3PT9A 4Y91A 2RB6A 4FSXA 2LCLA 5EG2A 2GTOA 2CT4A 3JCMJ 2QA4T 1GFCA 1DJ7B 3CCMQ 2KR3A 4PFOA 3J80E 1N27A 3CQTA 2P84A 4MZPA 1FMVA 4EMGA 4HVVA 3WVEB 1N8RC 2P0QA 2AT1B 3I56T 3QHSA 3URGA 2MI6A 3UT1A 1IZ6A 3DLLA 2FPEA 2EVRA 4D6WA 2A37A 5KE3A 3O8VA 2EWNA 2RNAA 1M90R 3TSWA 3JCMW 3GNFB 5DY9A 1TUGB 1VQ6A 4QQ6A 2RK1A 5LJ3f 2FZGB 4RTZA 1QW1A 3Q1JA 1RABB 1VQ8A 5LJ5d 1FYNA 3G71Q 1HYOA 4A63B 1VQNT 2LMJA 4J83A 1KFZA 3QKJA 4BDZA 2QYZA 3M54A 3MEWA 1WLPB 3FB9A 5GMKm 2K9GA 1OULA 3VRYA 1CSKA 3X28B 3MKDA 4AMCA 5A2QE 4KGXB 2MAMA 1PWTA 4BE0A
chains in the Genus database with same CATH topology
3QWXX 2CH4A 1CKAA 1XOVA 2RPNA 1AVZC 2AK5A 4OMLA 1KIKA 4Z8AA 4D8KA 3UATA 1ABQA 1AOJA 2DL5A 4DEYA 2RQTA 1S1NA 2KRSA 1UE9A 2A36A 2W0ZA 1X2KA 2ESWA 2K7AA 2DM1A 1B3QA 2AZSA 4J9HA 4GBQA 4CC2A 1RUWA 1AWXA 1UTIA 2OI3A 1K9AA 2BZYA 4HVWA 3H0HA 2L3QA 5IXBA 1G83A 1PKSA 2V1QA 3VS3A 4D8DA 2F2WA 1NEGA 3GBQA 1OPLA 1I1JA 2LCSA 2KXDA 1KSWA 3NHNA 1QWFA 2KYMA 1JO8A 2O2OA 1Z9QA 1LCKA 2KRMA 2LJ0A 2YUPA 2DL4A 2ENMA 4LN2A 1VYVA 2GNCA 2EYXA 1WX6A 3EHQA 1I0CA 3I9QA 4DEXA 2RMOA 2LJ3A 1BBZA 1NEBA 2ED1A 4FSSA 2RF0A 2EGCA 3R6NA 1VA7A 1WDXA 3JV3A 2CREA 1UG1A 4OMPA 2DA9A 2FRWA 1MV0B 1ABOA 1JU5C 2KE9A 2I0NA 2LJ1A 4OMNA 4WCIA 2A08A 1H8KA 2YT6A 1WYXA 2EKHA 4AFSC 2HDAA 2DLPA 3UA7A 1GCQC 4CC7A 2JTEA 1UUEA 1NLPC 2FPFA 5IXFA 1E6GA 4AFUC 2VKNA 5GJVB 2O9VA 2BZ8A 4F16A 2JW4A 1WXTA 3PVQA 1UECA 2ROTA 1OV3A 1HSQA 4GLMA 3EG2A 4IIMA 2D8JA 2O31A 4J9CA 2KEAA 2VWFA 2DL3A 1UFFA 1Z9ZA 3LH5A 2JS0A 4R0KA 2AKLA 4LUEA 4JJDA 4Y92A 3REBB 4J9DA 1TUDA 3H0IA 2J6FA 1SRMA 1X27A 2EYWA 3REAB 1WXUA 1OOTA 4RTYA 3THKA 3TVTA 2J6OA 4JZ3A 1MUZA 2JT4A 1JEGA 4ZNXA 3EG1A 2RQUA 2EGAA 1Y0MA 2F2VA 1AEYA 3M0SA 1U5SA 5GJWB 2ECZA 2L2PA 1YP5A 3H0FA 1W1FA 4ESRA 1J3TA 2FO0A 3EG3A 2LX7A 1RI9A 2GQIA 4QT7A 1V1CA 2MIOA 2RQWA 3I5RA 4LE9A 3NPFA 1X6GA 3FJ5A 4JJBA 4JZ4A 2PTKA 4IIOA 1AZGB 3VS1A 2BTTA 3M0UA 2L3PA 3M0RA 2V1RA 3ZL7C 2ROLA 1YNZA 2DMOA 4AFQC 1GL5A 2CUDA 3VS7A 2X3WD 2HCKA 1M3BA 1KJWA 2YDLA 2DL8A 2EGEA 1QLYA 2PNIA 1H3HA 2HBWA 2GGRA 1WFWA 1T3SA 4HXJA 2CUBA 1GRIA 1UHFA 2J6KA 1K0SA 2HSPA 4M4ZA 1PKTA 1FMKA 2J7IA 1A0NB 1W6XA 1HJDA 2LQNA 4F17A 5I11A 1SRLA 4X1VA 3C0CA 3M0PA 1WXBA 2C0IA 2KNBB 2YUQA 2EBPA 2KBTA 1BB9A 2NUZA 4Z88A 5IHKA 1ZUYA 1GBQA 4CC3A 2CDTA 1ZX6A 2K79A 1T0HA 1M3CA 2YUOA 2DBMA 2FEIA 4EIKA 3SEMA 1HD3A 1YN8A 2L3SA 2O88A 1QWEA 1CKBA 1SSHA 2DJQA 1ZUUA 1UJ0A 1X6BA 2JMCA 1UGVA 2D1XA 1TUCA 3VRZA 1B07A 2O9SA 2JM8A 4HCKA 4CC4B 1AWOA 1M3AA 4RTWA 2CT3A 2DL7A 1ZLMA 2C0OA 3VS6A 2J06A 1UHCA 1SHFA 1QKXA 1ARKA 1RLPC 4Z89A 2YSQA 1AZEA 1QCFA 2EYYA 1GFDA 1H92A 1E6HA 4RUGA 1NLOC 1G2BA 2F2XA 1GCPA 2EPDA 3I5SA 4RTXA 3QWYA 2FRYA 2E5KA 2DNUA 2LZ6B 2A28A 3U23A 1PRMC 4JJCA 1ZBJA 1I07A 1RLQC 4AFZC 2YUNA 2EW3A 2RN8A 1WI7A 3PVLA 2XMFA 4J9GA 2DVJA 3NMZC 1NM7A 2CSIA 1M30A 3TSZA 3O5ZA 1UDLA 1SPKA 1YWOA 1K1ZA 2BZXA 2ABLA 1YWPA 1WIEA 4LNPA 2LP5A 3I35A 5HCKA 2PZ1A 1ZSGA 3UA6A 1M27C 1BK2A 1NG2A 5IHIA 3VS2A 4OMQA 2KYBA 1GBRA 2JMAA 2OAWA 1N5ZA 1T3LA 2LQWA 5IH2A 1M8MA 2DRKA 2DF6A 1VYUA 1EFNA 2GTJA 1UJYA 4RTUA 5FWCA 1VYTA 3UF4A 4F14A 1MV3A 2ED0A 1PNJA 2B86A 2DBKA 1YCSB 3SHWA 2M0YA 2K2MA 4KRTA 2NWMA 2IIMA 2MOXA 3KFVA 2GBQA 2K3BA 2KRNA 2P4RA 3RBBB 1AWWA 5ECAA 3RNJA 1U3OA 1X69A 2AKKA 2MCNA 4E6RA 2JS2A 2QDLA 1AWJA 5IHNA 1ZUKA 2L0AA 2RQRA 4OMMA 2K6DA 3VS4A 1SEMA 4JPBW 2FPDA 2KROA 2EYZA 3EHRA 2D0NA 2DRMA 4J9FA 3A98A 3EG0A 4OMOA 2VVKA 3M0TA 2C0TA 1PRLC 2GTOA 1X2QA 2HEQA 2CT4A 2EQIA 1GFCA 1NYGA 1IO6A 2CH4W 3IQLA 2KR3A 3CQTA 4J9IA 2M51A 1E7OA 2W10A 1PHTA 1JXOA 4HVVA 3M0QA 1QKWA 2DYBA 1K4US 1NYFA 1U06A 3VS5A 1WA7A 2DE0X 5I22A 2DILA 1OPKA 2H8HA 4ORZA 3ULRB 2J05A 2FPEA 3EGUA 2CSQA 2EVRA 2JM9A 4J9EA 2LNHB 2KGTA 2A37A 2SRCA 2FG0A 1AD5A 1X43A 2RNAA 4LUDA 1K76A 2AZVA 2KXCA 3TSWA 2DX1A 1GCQA 1BU1A 1Y57A 3VS0A 4K11A 4RTZA 1K0XA 1TG0A 3NGPA 2G6FX 5FW9A 2JXBA 1FYNA 4A63B 1W70A 2LMJA 2D8HA 1JXMA 1OEBA 5EC7A 4HVUA 1T0JA 1KFZA 2X3XD 5FWBA 2KT1A 3H41A 1WLPB 4AG2C 2KT8A 2OJ2A 1SHGA 3PE0A 4RTTA 2K9GA 5L23A 4J9BA 3VRYA 1CSKA 1JQQA 4RTVA 4AG1C 2RQVA 1PWTA 2SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWX X;  2CH4 A;  1CKA A;  1XOV A;  2RPN A;  1AVZ C;  2AK5 A;  4OML A;  1KIK A;  4Z8A A;  4D8K A;  3UAT A;  1ABQ A;  1AOJ A;  2DL5 A;  4DEY A;  2RQT A;  1S1N A;  2KRS A;  1UE9 A;  2A36 A;  2W0Z A;  1X2K A;  2ESW A;  2K7A A;  2DM1 A;  1B3Q A;  2AZS A;  4J9H A;  4GBQ A;  4CC2 A;  1RUW A;  1AWX A;  1UTI A;  2OI3 A;  1K9A A;  2BZY A;  4HVW A;  3H0H A;  2L3Q A;  5IXB A;  1G83 A;  1PKS A;  2V1Q A;  3VS3 A;  4D8D A;  2F2W A;  1NEG A;  3GBQ A;  1OPL A;  1I1J A;  2LCS A;  2KXD A;  1KSW A;  3NHN A;  1QWF A;  2KYM A;  1JO8 A;  2O2O A;  1Z9Q A;  1LCK A;  2KRM A;  2LJ0 A;  2YUP A;  2DL4 A;  2ENM A;  4LN2 A;  1VYV A;  2GNC A;  2EYX A;  1WX6 A;  3EHQ A;  1I0C A;  3I9Q A;  4DEX A;  2RMO A;  2LJ3 A;  1BBZ A;  1NEB A;  2ED1 A;  4FSS A;  2RF0 A;  2EGC A;  3R6N A;  1VA7 A;  1WDX A;  3JV3 A;  2CRE A;  1UG1 A;  4OMP A;  2DA9 A;  2FRW A;  1MV0 B;  1ABO A;  1JU5 C;  2KE9 A;  2I0N A;  2LJ1 A;  4OMN A;  4WCI A;  2A08 A;  1H8K A;  2YT6 A;  1WYX A;  2EKH A;  4AFS C;  2HDA A;  2DLP A;  3UA7 A;  1GCQ C;  4CC7 A;  2JTE A;  1UUE A;  1NLP C;  2FPF A;  5IXF A;  1E6G A;  4AFU C;  2VKN A;  5GJV B;  2O9V A;  2BZ8 A;  4F16 A;  2JW4 A;  1WXT A;  3PVQ A;  1UEC A;  2ROT A;  1OV3 A;  1HSQ A;  4GLM A;  3EG2 A;  4IIM A;  2D8J A;  2O31 A;  4J9C A;  2KEA A;  2VWF A;  2DL3 A;  1UFF A;  1Z9Z A;  3LH5 A;  2JS0 A;  4R0K A;  2AKL A;  4LUE A;  4JJD A;  4Y92 A;  3REB B;  4J9D A;  1TUD A;  3H0I A;  2J6F A;  1SRM A;  1X27 A;  2EYW A;  3REA B;  1WXU A;  1OOT A;  4RTY A;  3THK A;  3TVT A;  2J6O A;  4JZ3 A;  1MUZ A;  2JT4 A;  1JEG A;  4ZNX A;  3EG1 A;  2RQU A;  2EGA A;  1Y0M A;  2F2V A;  1AEY A;  3M0S A;  1U5S A;  5GJW B;  2ECZ A;  2L2P A;  1YP5 A;  3H0F A;  1W1F A;  4ESR A;  1J3T A;  2FO0 A;  3EG3 A;  2LX7 A;  1RI9 A;  2GQI A;  4QT7 A;  1V1C A;  2MIO A;  2RQW A;  3I5R A;  4LE9 A;  3NPF A;  1X6G A;  3FJ5 A;  4JJB A;  4JZ4 A;  2PTK A;  4IIO A;  1AZG B;  3VS1 A;  2BTT A;  3M0U A;  2L3P A;  3M0R A;  2V1R A;  3ZL7 C;  2ROL A;  1YNZ A;  2DMO A;  4AFQ C;  1GL5 A;  2CUD A;  3VS7 A;  2X3W D;  2HCK A;  1M3B A;  1KJW A;  2YDL A;  2DL8 A;  2EGE A;  1QLY A;  2PNI A;  1H3H A;  2HBW A;  2GGR A;  1WFW A;  1T3S A;  4HXJ A;  2CUB A;  1GRI A;  1UHF A;  2J6K A;  1K0S A;  2HSP A;  4M4Z A;  1PKT A;  1FMK A;  2J7I A;  1A0N B;  1W6X A;  1HJD A;  2LQN A;  4F17 A;  5I11 A;  1SRL A;  4X1V A;  3C0C A;  3M0P A;  1WXB A;  2C0I A;  2KNB B;  2YUQ A;  2EBP A;  2KBT A;  1BB9 A;  2NUZ A;  4Z88 A;  5IHK A;  1ZUY A;  1GBQ A;  4CC3 A;  2CDT A;  1ZX6 A;  2K79 A;  1T0H A;  1M3C A;  2YUO A;  2DBM A;  2FEI A;  4EIK A;  3SEM A;  1HD3 A;  1YN8 A;  2L3S A;  2O88 A;  1QWE A;  1CKB A;  1SSH A;  2DJQ A;  1ZUU A;  1UJ0 A;  1X6B A;  2JMC A;  1UGV A;  2D1X A;  1TUC A;  3VRZ A;  1B07 A;  2O9S A;  2JM8 A;  4HCK A;  4CC4 B;  1AWO A;  1M3A A;  4RTW A;  2CT3 A;  2DL7 A;  1ZLM A;  2C0O A;  3VS6 A;  2J06 A;  1UHC A;  1SHF A;  1QKX A;  1ARK A;  1RLP C;  4Z89 A;  2YSQ A;  1AZE A;  1QCF A;  2EYY A;  1GFD A;  1H92 A;  1E6H A;  4RUG A;  1NLO C;  1G2B A;  2F2X A;  1GCP A;  2EPD A;  3I5S A;  4RTX A;  3QWY A;  2FRY A;  2E5K A;  2DNU A;  2LZ6 B;  2A28 A;  3U23 A;  1PRM C;  4JJC A;  1ZBJ A;  1I07 A;  1RLQ C;  4AFZ C;  2YUN A;  2EW3 A;  2RN8 A;  1WI7 A;  3PVL A;  2XMF A;  4J9G A;  2DVJ A;  3NMZ C;  1NM7 A;  2CSI A;  1M30 A;  3TSZ A;  3O5Z A;  1UDL A;  1SPK A;  1YWO A;  1K1Z A;  2BZX A;  2ABL A;  1YWP A;  1WIE A;  4LNP A;  2LP5 A;  3I35 A;  5HCK A;  2PZ1 A;  1ZSG A;  3UA6 A;  1M27 C;  1BK2 A;  1NG2 A;  5IHI A;  3VS2 A;  4OMQ A;  2KYB A;  1GBR A;  2JMA A;  2OAW A;  1N5Z A;  1T3L A;  2LQW A;  5IH2 A;  1M8M A;  2DRK A;  2DF6 A;  1VYU A;  1EFN A;  2GTJ A;  1UJY A;  4RTU A;  5FWC A;  1VYT A;  3UF4 A;  4F14 A;  1MV3 A;  2ED0 A;  1PNJ A;  2B86 A;  2DBK A;  1YCS B;  3SHW A;  2M0Y A;  2K2M A;  4KRT A;  2NWM A;  2IIM A;  2MOX A;  3KFV A;  2GBQ A;  2K3B A;  2KRN A;  2P4R A;  3RBB B;  1AWW A;  5ECA A;  3RNJ A;  1U3O A;  1X69 A;  2AKK A;  2MCN A;  4E6R A;  2JS2 A;  2QDL A;  1AWJ A;  5IHN A;  1ZUK A;  2L0A A;  2RQR A;  4OMM A;  2K6D A;  3VS4 A;  1SEM A;  4JPB W;  2FPD A;  2KRO A;  2EYZ A;  3EHR A;  2D0N A;  2DRM A;  4J9F A;  3A98 A;  3EG0 A;  4OMO A;  2VVK A;  3M0T A;  2C0T A;  1PRL C;  2GTO A;  1X2Q A;  2HEQ A;  2CT4 A;  2EQI A;  1GFC A;  1NYG A;  1IO6 A;  2CH4 W;  3IQL A;  2KR3 A;  3CQT A;  4J9I A;  2M51 A;  1E7O A;  2W10 A;  1PHT A;  1JXO A;  4HVV A;  3M0Q A;  1QKW A;  2DYB A;  1K4U S;  1NYF A;  1U06 A;  3VS5 A;  1WA7 A;  2DE0 X;  5I22 A;  2DIL A;  1OPK A;  2H8H A;  4ORZ A;  3ULR B;  2J05 A;  2FPE A;  3EGU A;  2CSQ A;  2EVR A;  2JM9 A;  4J9E A;  2LNH B;  2KGT A;  2A37 A;  2SRC A;  2FG0 A;  1AD5 A;  1X43 A;  2RNA A;  4LUD A;  1K76 A;  2AZV A;  2KXC A;  3TSW A;  2DX1 A;  1GCQ A;  1BU1 A;  1Y57 A;  3VS0 A;  4K11 A;  4RTZ A;  1K0X A;  1TG0 A;  3NGP A;  2G6F X;  5FW9 A;  2JXB A;  1FYN A;  4A63 B;  1W70 A;  2LMJ A;  2D8H A;  1JXM A;  1OEB A;  5EC7 A;  4HVU A;  1T0J A;  1KFZ A;  2X3X D;  5FWB A;  2KT1 A;  3H41 A;  1WLP B;  4AG2 C;  2KT8 A;  2OJ2 A;  1SHG A;  3PE0 A;  4RTT A;  2K9G A;  5L23 A;  4J9B A;  3VRY A;  1CSK A;  1JQQ A;  4RTV A;  4AG1 C;  2RQV A;  1PWT A;  2SEM A; 
#chains in the Genus database with same CATH topology
 1D3B B;  2CH4 A;  3CD6 A;  1M8V A;  2RPN A;  1AVZ C;  5GAM g;  2AK5 A;  2B8A A;  4M77 C;  4A4F A;  5KYN A;  1Q86 U;  2FZC B;  1VUB A;  2QGF B;  3UAT A;  4XU2 A;  4RCB A;  3OYB A;  3BDU A;  2RQT A;  3H6Z A;  3I56 A;  4PJM A;  5J3B A;  2G3R A;  2ESW A;  3JCM b;  2DTO A;  4GY5 A;  2LVM A;  2RK2 A;  1AWX A;  2L89 A;  2OI3 A;  1VQ7 T;  1M1K C;  4M7D B;  5FRN A;  1WHL A;  2BZY A;  1UB4 A;  3E2U A;  3H9N A;  1YJW Q;  3LH0 A;  4BAC A;  2YRD A;  4ZGJ B;  1D1C A;  1BIB A;  2DYI A;  2E5Q A;  2IPO B;  1K8A R;  2KK4 A;  2F2W A;  3INZ A;  1YJN T;  1BI3 A;  4FYW B;  2LCS A;  4B9W A;  1KSW A;  2KYM A;  2O2O A;  4C8Q G;  1RAD B;  4J7I A;  1OU9 A;  2EAY A;  2R5M A;  4PNO A;  1M90 U;  2GNC A;  2EYX A;  1WX6 A;  3BY7 A;  4NOY A;  2RMO A;  2LJ3 A;  2ED1 A;  4FSS A;  2LC4 A;  2MYS A;  3F70 A;  1VA7 A;  1YIT T;  3OMC A;  1OZ3 A;  3RER A;  3DLM A;  2DA9 A;  3QPH A;  4ZN3 A;  4C5G A;  2I0N A;  5GAO p;  4OMN A;  4WCI A;  4BB7 A;  3AHU A;  2EKH A;  3CME A;  2A0F B;  3FC3 A;  1NLP C;  3QXE B;  3OYC A;  4E7H A;  1D0Z A;  4BD3 A;  4C8Q E;  5J39 A;  2JW4 A;  5GAM e;  1R0C B;  1PC0 A;  2ZPI B;  3DB4 A;  1UFF A;  1Z9Z A;  2RJF A;  4LDY A;  4MDW A;  4RKU E;  5C0M A;  2XU8 A;  2K5F A;  3A8G B;  2MWO A;  2F69 A;  4J9D A;  1R77 A;  2LX9 A;  4M75 D;  5KYY B;  1YJN A;  4EMK B;  1WXU A;  4BUG A;  4C0D C;  3PFS A;  2L8D A;  2JT4 A;  3EH1 A;  1RAI B;  4ZNX A;  1ZBX A;  1U5S A;  1WPY A;  2COW A;  4C8Q A;  1X75 C;  2L2P A;  5A0D A;  3H0F A;  1K8A U;  1YIT A;  1FX7 A;  3TU4 K;  4M7A D;  1RI9 A;  3JSC A;  2FYK A;  4PJO D;  2EFI A;  4LE9 A;  5GAO n;  1X6G A;  3FJ5 A;  2HQE A;  3OYD A;  3OQ5 A;  1Q86 C;  1NE8 A;  3V7R A;  1M5Q 1;  2O01 E;  2BTT A;  3M0U A;  2L3P A;  5GAM f;  2V1R A;  2QGG A;  3CCL T;  2DMO A;  3NTK A;  2ZPH B;  4AFQ C;  1VQK T;  2CUD A;  1SG5 A;  4JRQ A;  2X3W D;  5I21 A;  5I2S A;  4XU3 A;  3JB9 F;  3EGX A;  3MCA B;  1KC8 R;  2EGE A;  4XQ3 A;  2BIV A;  2GGR A;  1UGS B;  1UHF A;  4M75 G;  3JCM Q;  5GMK i;  2EIF A;  3GLX A;  2E70 A;  4II1 A;  4IKF A;  2C0I A;  1YI2 A;  2YUQ A;  2EBP A;  3OYI A;  2EQM A;  3LGF A;  3BE3 A;  2CP0 A;  3EGD B;  2QTX A;  1YIJ T;  5CKE A;  2DEU A;  1TU0 B;  1GBQ A;  2RHY A;  3RDV A;  4CC3 A;  1ZX6 A;  4LD6 A;  3V8K A;  2CKK A;  4M7A G;  3E19 A;  4C92 D;  5AYF A;  1M90 C;  2R57 A;  5GAO q;  1VQP Q;  4PJO G;  3D7S B;  3SEM A;  1YJ9 Q;  2O88 A;  3JCM h;  1QWE A;  4KH0 B;  4FU6 A;  2DJQ A;  3I55 Q;  1X6B A;  1K9M R;  4ELY C;  2D1X A;  1TUC A;  1B07 A;  4XTW A;  2QEX A;  1VQL A;  2P0K A;  4RTW A;  3QYG B;  3G4S T;  2CT3 A;  2D0Q B;  1ZLM A;  2CZ7 B;  3CCU T;  4ZGD B;  3JCM e;  3MPU B;  4DBF A;  4KBM B;  1AZE A;  1QCF A;  3X20 B;  1VQO T;  3CCL A;  1D1A A;  1VQK A;  1NLO C;  4YTL A;  3SWN A;  4C5H A;  1VOM A;  2Y4X A;  4RTX A;  3QWY A;  3CCS T;  2VGN A;  2E5K A;  5GMK l;  3HSB A;  3V8L A;  2A28 A;  3EFO A;  1ZBJ A;  1I07 A;  4M78 D;  2YLB A;  2XDD A;  4M75 A;  4AFZ C;  2YUN A;  4C92 G;  4FCY A;  2YRC A;  2COY A;  2RN8 A;  1VQ6 Q;  3A1P A;  3OB9 A;  2BE9 B;  4F7U B;  4C0Z A;  2DVJ A;  2CSI A;  3OBY A;  1TXQ A;  3QO3 A;  1YIJ A;  1KC8 U;  2OTL T;  3CCV A;  2NYS A;  2CZ1 B;  2QK0 A;  4KH1 B;  2NUP A;  3I35 A;  5HCK A;  1BI0 A;  4M77 D;  5KE2 A;  3UA6 A;  1M27 C;  1VQM A;  1BK2 A;  4M7A A;  1NG2 A;  1K8A C;  2EKO A;  4JUV A;  4A4H A;  1GBR A;  3MP1 A;  4PJO A;  3V8J A;  4OVA A;  3EG9 B;  2NUT A;  3JCM f;  2DZC A;  3OS5 A;  3CCR T;  1IXD A;  1GXI E;  5FWC A;  1RAA B;  3HFN A;  4FYV B;  3LWH A;  3G4S A;  2XHC A;  3H8Z A;  5KCO A;  3CCU A;  2QA4 Q;  2JN0 A;  2FB7 A;  2VXF A;  5GAN 7;  2RHX A;  2K2M A;  3EAE A;  5GAN h;  2NWM A;  1YFN A;  3QYH B;  2IIM A;  2MOX A;  3VJP A;  4MMK A;  1VQO A;  1K9M U;  3EFS A;  2K3B A;  4HT8 A;  2QQS A;  4M78 G;  3V7S A;  2P4R A;  2DXC A;  4BY6 C;  2RJD A;  2VB6 A;  1Q7Y R;  3M56 A;  2XI9 A;  4BI3 A;  1G3W A;  5GAN e;  3QUI A;  1SEM A;  4BE1 A;  4JPB W;  2KRO A;  2LT4 A;  1MMA A;  3OYH A;  1M2V B;  3EG0 A;  1MND A;  1WQW A;  4M77 G;  2RD1 A;  3M0T A;  2HEQ A;  2C0T A;  1PRL C;  4MZM A;  2EQI A;  2GCX A;  2KAF A;  1NYG A;  3M53 A;  4C92 A;  2OTL A;  3OYN A;  2PQW A;  1E7O A;  4HCB A;  1VQN Q;  3M0Q A;  1LVK A;  5A0L A;  3P8B B;  1QKW A;  5LJ3 g;  2EQU A;  1K4U S;  1U06 A;  1S72 T;  4J6Y A;  1KQ1 A;  1QMC A;  2DIL A;  1OPK A;  2H8H A;  4ORZ A;  3CPF A;  3ULR B;  3EGU A;  5FU7 C;  2CSQ A;  3VYH B;  3DB3 A;  1U8R A;  3M4Y A;  2QQA A;  3C4S A;  2SRC A;  3SWN C;  1K76 A;  2LRQ A;  1C0M A;  2EYQ A;  2BKD N;  1GCQ A;  4N0A A;  4C5E A;  2E4H A;  2V8J A;  2D6F A;  1Y57 A;  4M77 E;  3VS0 A;  4M75 C;  1K0X A;  3NGP A;  2QDY B;  5CKF A;  3OMG A;  4KUD K;  2DZ9 A;  2AHJ B;  1BCM A;  4VUB A;  4R55 A;  5GAN f;  1W70 A;  4PKC C;  2D8H A;  5IT9 E;  5EC7 A;  4HVU A;  1T0J A;  2EJG A;  1VQ7 Q;  4M78 A;  2OJ2 A;  4RTT A;  4RG2 A;  3RKX A;  5GAN 8;  2KSS A;  5D6Y A;  1JQQ A;  4M7A C;  3OYL A;  2HKQ B;  2RQV A;  4PJO C;  1KC8 C;  1Q7Y U;  2QI2 A;  2MMP A;  1ABQ A;  4M77 A;  4KUI A;  4FT4 A;  5CCA A;  1QP3 A;  2KRS A;  1UE9 A;  2QQR A;  2RJC A;  2HNI A;  1C6V X;  2LT1 A;  2K7A A;  2DM1 A;  1B3Q A;  3GNG A;  4J9H A;  4CC2 A;  3TEE A;  1VQ8 T;  4DBR A;  4WTO B;  1RAC B;  2YLC A;  2L3Q A;  5IXB A;  4XTY A;  2E65 A;  5GAN 3;  4OB0 B;  3G6E T;  1PKS A;  5HKC A;  3OYE A;  4D8D A;  1I1J A;  1RAG B;  1K9M C;  4KGV B;  1UEB A;  2X9H A;  1KQS P;  1V76 A;  1JB0 E;  1Z9Q A;  2KRM A;  4C8Q B;  4QKU A;  5KYX A;  4C92 C;  4LDX A;  4V2S A;  1VYV A;  2Z0W A;  3CD6 T;  4PLI A;  3EHQ A;  1I0C A;  4DEX A;  1MMD A;  2DD4 A;  4XU0 A;  2EGC A;  3JV3 A;  2MPX C;  2JUF A;  3V7C A;  3L2W A;  5CIU A;  3CMA T;  1MNE A;  4A54 A;  2VUB A;  3S6W A;  1UG1 A;  5HK0 A;  2DPP B;  4ZTF A;  1UGP B;  2X4W A;  4BE2 A;  1SF9 A;  1IHW A;  2LJ1 A;  1H8K A;  5KYU B;  1WYX A;  4AFS C;  1M1G A;  1YCY A;  4IUP A;  5GAO r;  4Q5W A;  1GCQ C;  4N0A C;  2JTE A;  5IXF A;  5GJV B;  4RMO A;  4PJJ A;  4AT1 B;  4X9C A;  1YHQ A;  2DTH A;  2ROT A;  3E9F A;  1Q82 R;  4EMH A;  4N4H A;  2JNG A;  2RM4 A;  4GLM A;  1PD0 A;  4WF2 A;  3QG1 A;  3RUX A;  2D8J A;  2O31 A;  2M1H A;  2HKN A;  2KEA A;  3LH5 A;  3QJY A;  2JS0 A;  2RI5 A;  4M78 C;  3G6E A;  3REB B;  4E7I A;  1TUD A;  4E7K A;  2DXB A;  1WHH A;  1D1B A;  1SRM A;  3REA B;  4RTY A;  1VQK Q;  2CP2 A;  4L6V 5;  2J6O A;  3GOX A;  1TWB A;  4J5Y A;  1JEG A;  3OS0 A;  3VU3 C;  2PVD B;  1D0X A;  2F2V A;  3QBY A;  1AEY A;  2JOY A;  4ANJ A;  4HA8 A;  2K5L A;  2JJ9 A;  4ESR A;  3CME T;  3CMA A;  2VV5 A;  1WJS A;  3KUF A;  4QT7 A;  2QXF A;  3I5R A;  1D09 B;  5FRO A;  3JCM c;  3NPF A;  3C95 A;  4OB3 B;  1YIJ Q;  1ZQ1 A;  2XID A;  1Q7Y C;  4XTZ A;  3VS1 A;  1QCN A;  1XQH A;  2JTF A;  2ROL A;  5DLQ E;  4XTU A;  2HCK A;  1M3B A;  3M4G A;  2M0O A;  1KJW A;  2YDL A;  5CVI A;  1QLY A;  2PNI A;  4X34 A;  1H3H A;  1T3S A;  3CEY A;  1K0S A;  1IB8 A;  2HSP A;  1PKT A;  4A4K A;  4M75 B;  1HJD A;  5GAO l;  4F17 A;  4XTX A;  1SRL A;  4XK8 E;  2ZPB B;  3M9Q A;  3C0C A;  2RH2 A;  1WXB A;  2LCC A;  1VQ5 T;  2KNB B;  1W4S A;  1HK9 A;  2GFU A;  1UGR B;  2OX7 A;  3FLG A;  9ATC B;  1VQ9 T;  1Y07 A;  4TVR A;  1ZUY A;  1Q82 U;  1T0H A;  2NUP B;  4DBQ A;  4M7A B;  2DBM A;  1KQS S;  1HD3 A;  1YN8 A;  4PJO B;  1PG5 B;  1WQ7 A;  3CCS Q;  1CKB A;  2JVV A;  2OTJ A;  3CCE T;  1ZUU A;  2FZK B;  2O9S A;  2QAS A;  1NBE B;  4HCK A;  4IUR A;  3X24 B;  1NJI R;  4E7S A;  3VS6 A;  3ER0 A;  3CC2 A;  3MEU A;  2E6Z A;  1ARK A;  3NTH A;  3CCQ A;  3OYM A;  2BE7 D;  3PTA A;  1YI2 T;  3M57 A;  1MMN A;  3UWN A;  4JDS A;  4M7D F;  2KMT A;  3QJ6 A;  1GCP A;  2EPD A;  4EDU A;  4M7D D;  5GAN 2;  3CCR Q;  4JJC A;  2KY9 A;  1O75 A;  1RLQ C;  1VQ5 A;  3RR6 A;  1H64 1;  1WJQ A;  4C92 B;  2RHI A;  2XMF A;  3M5A A;  4J7F A;  3A8L B;  3NMZ C;  1NM7 A;  1VQ9 A;  3BDL A;  3TSZ A;  1KHI A;  3JCM g;  2LNV A;  2X4Y A;  3G7Z A;  5GMK j;  3BFM A;  3PIO A;  1X6O A;  2QEX T;  1YWO A;  1K1Z A;  1VQL T;  3P8D A;  2ABL A;  2YRV A;  3EH2 A;  1WIE A;  5LJ3 d;  1KHC A;  1TOV A;  3GP8 A;  7AT1 B;  4L5G A;  3CCE A;  3VS2 A;  1KQS A;  4LDV A;  2JMA A;  4ATO A;  3CBM A;  5IH2 A;  3JAM E;  2GTJ A;  3PNW C;  3UF4 A;  4F14 A;  1PSE A;  3OYG A;  1PNJ A;  2B86 A;  3JB9 D;  2WSE E;  2O4X B;  3SDZ A;  4M7D G;  3LX7 A;  5LJ5 j;  3OA6 A;  1S72 Q;  1M9S A;  1BCO A;  3CC4 A;  3QDR B;  1X69 A;  4E6R A;  1NJI U;  2JS2 A;  2QDL A;  4CI0 C;  1ZUK A;  3ZFJ A;  4ZGE B;  1H3Z A;  4E2F B;  3CCV T;  1VIE A;  3CC7 T;  3JCM P;  3QDF A;  2PVG B;  2DRM A;  4OMO A;  1D0Y A;  2K3X A;  4N4I A;  4FL6 A;  2VVK A;  1VQM T;  1B34 A;  4M77 B;  1Q82 C;  1OYX A;  4E7J A;  3OSS C;  2ZAE A;  1IO6 A;  4M75 E;  3IQL A;  4J9I A;  4FIB A;  2W10 A;  4O5V A;  1JXO A;  1IGQ A;  1VQ4 T;  3ZEH A;  1YJW T;  3VYG A;  3VS5 A;  2DE0 X;  5I22 A;  3JB9 G;  3FDR A;  2J05 A;  1D3B A;  4NL2 A;  2KGT A;  2FG0 A;  1AD5 A;  5GAN g;  2BUD A;  4LUD A;  1PM3 A;  4M7A E;  3G71 A;  2HBP A;  2DX1 A;  2LQK A;  1WNL A;  3OSV A;  1BU1 A;  4A4E A;  4PJO E;  1G3Y A;  1LPL A;  1VIF A;  4K11 A;  2E6N A;  1TG0 A;  5KYX B;  5FW9 A;  3CXC P;  2I2L A;  3OYA A;  3MEA A;  2GQV A;  2E10 A;  4M7D A;  4HCZ A;  1BI2 A;  2CZ0 B;  1XTD A;  1MHN A;  1KK7 A;  5FWB A;  4HKE A;  4OMF B;  1VQ8 Q;  5LJ5 h;  4IUU A;  2EQJ A;  1EX4 A;  2KT8 A;  1RL2 A;  3PE0 A;  4IUQ A;  4J9B A;  5CQY A;  5C6S A;  2QQ9 A;  3CC7 A;  2X4X A;  2SEM A;  3QWX X;  2M02 A;  4D8K A;  2HSE B;  4J6X A;  5LJ5 e;  1AOJ A;  4DEY A;  1S1N A;  3CD6 Q;  2A36 A;  1VQ4 A;  1YJW A;  2W0Z A;  4C92 E;  4JLI A;  2DET A;  1IRE B;  2IG0 A;  2AZS A;  2A7Y A;  3N5B B;  1C1A A;  3CBO A;  3QZ5 B;  3S3N A;  1RUW A;  3CMA Q;  1NPP A;  2E12 A;  3JRZ A;  2DO3 A;  2RHZ A;  2VC8 A;  2EQK A;  4HVW A;  3I56 Q;  4OP0 A;  2AIR B;  3J7A F;  1QVF A;  1W2B P;  1TSF A;  3VS3 A;  2CS7 A;  1NEG A;  3GBQ A;  1OPL A;  3JB9 H;  1U1S A;  2E64 A;  2VAS A;  4C0D B;  2KXD A;  3J81 E;  3OY9 A;  1MGQ A;  5GAO m;  1RAF B;  3NHN A;  4MZT A;  1LOJ A;  1I5O B;  2HQX A;  4LN2 A;  1NJI C;  1BKB A;  2ZPE B;  5GAM d;  1NEB A;  1V29 B;  2WSC E;  2RF0 A;  3R6N A;  1NZ9 A;  2P0P A;  4DA4 A;  4F7U F;  2CRE A;  3P8H A;  5KYY A;  3VUB A;  5DLO A;  1AHJ B;  3SB2 A;  4EMK A;  5LJ5 f;  1ABO A;  2M9U A;  4M78 E;  1FMW A;  2DFU A;  2R5A A;  2A08 A;  2YT6 A;  1QVP A;  2HDA A;  5KCH A;  2XKO C;  3FEO A;  3RMS A;  1WHJ A;  2DIG A;  2FPF A;  5A0G A;  1E6G A;  4AFU C;  2VKN A;  2O9V A;  3SFM A;  2BZ8 A;  4JRP A;  1G3S A;  1WXT A;  3ZBD A;  2CP3 A;  1OV3 A;  4XU1 A;  3CME Q;  4LD9 K;  4QVC A;  4BI8 B;  4CRI A;  3EG2 A;  4M7D C;  3M58 A;  3S3M A;  2XG8 D;  2VWF A;  2DL3 A;  5L8R E;  2HL3 A;  4JJD A;  4Y92 A;  3H0I A;  1VQP T;  1QCO A;  4PFZ A;  2J6F A;  3OBW A;  1YJ9 T;  1X27 A;  2EYW A;  3M59 A;  3FJP A;  2DD5 A;  1R8O B;  4PK4 A;  3HFO A;  4JZ3 A;  3OS2 A;  2V8K A;  2MK5 A;  4MML A;  3CXC S;  2RQU A;  2EGA A;  2Y90 A;  2DXT A;  1YJN Q;  2WAC A;  2ECZ A;  3OS1 A;  1W1F A;  2DXU A;  2FO0 A;  1FWZ A;  2A3L A;  2GQI A;  3EGD A;  1K73 R;  1QQJ A;  2MIO A;  2RQW A;  8AT1 B;  3AT1 B;  3CCJ T;  3R6O A;  5KYW A;  3KBG A;  1YHQ T;  4JJB A;  3UPU A;  1AZG B;  1YIT Q;  1RAH B;  3L2Z A;  4FW2 A;  2CP6 A;  3ZL7 C;  2XK0 A;  1YNZ A;  4E7Z A;  3MJX A;  3A8O B;  4XAX B;  3BW1 A;  3HRU A;  3CCE Q;  3TCJ A;  4HXJ A;  1GRI A;  1KQ2 A;  4M4Z A;  4B6M A;  2J7I A;  1A0N B;  2JZ2 A;  1WZO A;  3RIR A;  1I4K 1;  4DQ2 A;  1ZSZ A;  1QVG P;  4X9D A;  1JJ2 P;  3LLR A;  5D7U A;  2KDS A;  2P4T A;  2KBT A;  5GAN 6;  1BB9 A;  2NUZ A;  4Z88 A;  5IHK A;  2CP7 A;  1VQP A;  1YJ9 A;  3RKW A;  1W2B S;  1I5L A;  3JCM d;  4EMK C;  2CDT A;  3I55 A;  4UC4 A;  1M3C A;  1YI2 Q;  2YUO A;  2XIC A;  1FXX A;  2FL7 A;  4JRK A;  2L3S A;  5DM7 R;  3VUZ A;  4BI4 A;  5CKD A;  1OI1 A;  3VV0 A;  3CXC A;  2H3J A;  1UJ0 A;  3T9N A;  4F7U A;  2ZPF B;  1UGV A;  4ZTJ A;  3EGX B;  3NTI A;  3SD4 A;  3CCJ A;  5D6X A;  4CC4 B;  1M3A A;  4F04 B;  2DL7 A;  2C0O A;  3OYF A;  1SHF A;  1RLP C;  2QEX Q;  3CPW P;  1VQL Q;  2YSQ A;  3OYK A;  5KH6 A;  3WXM B;  1I8F A;  2LQ8 A;  4RUG A;  1K73 U;  5IN1 A;  2MF2 A;  3EG9 A;  2DTI A;  1G2B A;  1OX8 A;  4BY6 B;  1WHK A;  3HRT A;  3L2U A;  3I5S A;  2V8I A;  2FRY A;  3HL8 A;  3CCL Q;  4JS4 A;  2DNU A;  4JS5 A;  2LZ6 B;  2RJE A;  1B34 B;  2EW3 A;  1WI7 A;  4BDY A;  4J9G A;  1RI0 A;  4B9X A;  4N4G A;  1YBY A;  2OTJ T;  2ZCF B;  1M30 A;  5GAM j;  3DKM A;  4C8Q F;  4HT9 A;  4C8Q D;  1SPK A;  2QQB A;  1W2B A;  3G1J A;  3LW5 E;  3UDC A;  1M2O A;  2BZX A;  3LWI A;  4LNP A;  2LP5 A;  2V26 A;  2PZ1 A;  4OGE A;  3CC2 T;  1PCX A;  1WGS A;  3MHX A;  5IHI A;  3L2Q A;  2LDM A;  3CCV Q;  5FU7 B;  2QA4 A;  1M2V A;  2K4Y A;  2RHU A;  3CCQ T;  1T3L A;  3CC7 Q;  1M8M A;  2DRK A;  3SWN B;  5GAN d;  1VYU A;  1UJY A;  4RTU A;  1VYT A;  2F5K A;  1VQM Q;  3EFO B;  1ZSZ C;  3QSU A;  1P92 A;  2K2V A;  1YCS B;  3SHW A;  2JTM A;  2M0Y A;  4OB2 B;  4KRT A;  2GBQ A;  1VQ4 Q;  3MO8 A;  3G4S Q;  2VGM A;  1IGU A;  3CCU Q;  2RA2 A;  2CGH A;  3RBB B;  2DK3 A;  5GAN 5;  5ECA A;  3RNJ A;  3M55 A;  4O6J A;  2K3Y A;  1U3O A;  1N9R A;  2MCN A;  3A8M B;  1JRI A;  5IHN A;  1AWJ A;  1VQO Q;  2L0A A;  2RQR A;  2K6D A;  3E9G A;  3VS4 A;  3HPW A;  5CR2 A;  2KQW A;  1ZA1 B;  2D0N A;  1VQN A;  2EJ9 A;  1EZZ B;  4J9F A;  3A98 A;  1QVG S;  3VKI A;  2NUT B;  2HAX A;  1QVF P;  1JJ2 S;  3A5Z B;  2EJF A;  1X2Q A;  3GPL A;  2CH4 W;  1HXD A;  3HRS A;  2M51 A;  1PHT A;  3OW2 P;  3MEV A;  2DYB A;  5GAM h;  1G5V A;  1NYF A;  3GF5 A;  1WA7 A;  4QQG A;  1M1F A;  2OTL Q;  1WHG A;  3L2V A;  4PL6 A;  2JM9 A;  4J9E A;  2LNH B;  5CKB A;  2DIQ A;  1OQK A;  1Y96 A;  1X43 A;  1N6A A;  5LL6 S;  2AZV A;  2HMA A;  2KXC A;  4PLL A;  4RCC A;  3CC4 T;  1OZ2 A;  1ZA2 B;  1N9S A;  1B7T A;  3PIP A;  5GAN 4;  1VQ7 A;  2G6F X;  1QP2 A;  1LJO A;  2JXB A;  3CCM T;  2YWW A;  2L3R A;  1K73 C;  3CPW S;  1ACM B;  2E3I A;  5I2M A;  4M75 F;  3MP6 A;  1JXM A;  1OEB A;  2X3X D;  2KT1 A;  3H41 A;  4NS5 A;  4AG2 C;  1SHG A;  2Y4Y A;  5L23 A;  1NPR A;  3X26 B;  1IRX A;  1IHV A;  4FYX B;  4OB1 B;  1Q81 R;  4RTV A;  4AG1 C;  4DOW A;  1PSF A;  5IAY A;  1CKA A;  2DJZ A;  1XOV A;  2GF7 A;  4QVD A;  4OML A;  4Y28 E;  5FU6 C;  1KIK A;  4Z8A A;  1QVG A;  5M9O A;  4M7A F;  2PUK B;  1KD1 R;  3JB9 I;  1JJ2 A;  2DL5 A;  4PJO F;  2CYZ B;  3L42 A;  3G71 T;  5CAI A;  3HHT B;  1X2K A;  2DKG A;  5D6W A;  1TH7 A;  4FYY B;  4GBQ A;  4JJN K;  2NLU A;  1UTI A;  1K9A A;  1BI1 A;  2E1H A;  1TTH B;  1OU8 A;  2PU9 B;  5KYU A;  3H0H A;  3LGL A;  4M78 B;  3WVD B;  1Q95 G;  4P5N A;  1G83 A;  2V1Q A;  4JLG A;  4XTV A;  6AT1 B;  2PUO B;  3RES A;  1M4Z A;  5LJ5 g;  3CCM A;  1QWF A;  1JO8 A;  1XNI A;  5J26 A;  1LCK A;  2LJ0 A;  2YUP A;  2DL4 A;  2ENM A;  4FW1 A;  1BYM A;  4JRI A;  3I9Q A;  1BBZ A;  3CPW A;  2QTV A;  1F1B B;  4ZN1 A;  4C0F A;  5KYW B;  1WDX A;  3EFR A;  4C92 F;  1WHM A;  5FLX E;  4M7D E;  4A53 A;  4OMP A;  3HP9 A;  2FRW A;  1MV0 B;  1TS9 A;  1JU5 C;  4KT0 E;  2KE9 A;  5GMK h;  2OAU A;  3C94 A;  4L59 A;  3CBP A;  3KXT A;  2DLP A;  2QG9 B;  4PJL A;  3JCM V;  3UA7 A;  1QVF S;  2KVQ G;  4CC7 A;  1UUE A;  3S3O A;  3HKS A;  4OF1 A;  3FIF A;  5GAN j;  4F16 A;  1Q81 U;  2MWP A;  3C12 A;  3OW2 S;  1KG1 A;  5CKH A;  3PVQ A;  1UEC A;  4A4G A;  1HSQ A;  1ZSZ B;  2K57 A;  5GMK e;  3L1A A;  4KGZ B;  3HTR A;  1G8X A;  1EIF A;  4IIM A;  4J9C A;  3CCJ Q;  2VXE A;  2LTO A;  1N8R R;  2K5I A;  4R0K A;  1KD1 U;  2HQH A;  2AKL A;  1YHQ Q;  2COZ A;  1Y71 A;  4LUE A;  4MDX A;  4EPC A;  5AT1 B;  5HY6 A;  1OOT A;  3THK A;  3TVT A;  4M78 F;  1MUZ A;  2IVW A;  3G6E Q;  3EG1 A;  4C8Q C;  1UGQ B;  1Y0M A;  3M0S A;  2ZGW A;  5GJW B;  2ZZD A;  1PD1 A;  1YP5 A;  1ZHI A;  1OX9 A;  4FM4 B;  1J3T A;  4IUT A;  3EG3 A;  2ATC B;  1LNX A;  2LX7 A;  8ATC B;  1XJW B;  1V1C A;  1AT1 B;  2X51 A;  4M77 F;  5FRM A;  1BIA A;  1O9S A;  1SKU B;  4JZ4 A;  2PTK A;  4IIO A;  3ASK A;  2PVO B;  3FRN A;  3M0R A;  3MET A;  5CQX A;  4R56 A;  1GL5 A;  3VS7 A;  2DL8 A;  2R58 A;  2X35 A;  2HBW A;  1WFW A;  2CUB A;  2J6K A;  2DAQ A;  1FMK A;  2WSF E;  3OW2 A;  1W6X A;  2LQN A;  4DOV A;  4LXC A;  5I11 A;  1JBM A;  4X1V A;  2FHD A;  3M0P A;  3MP8 A;  3RKY A;  3PMT A;  2XDP A;  2XDB A;  2YXY A;  1M1K R;  3CCS A;  2K79 A;  4KUL A;  2RO0 A;  4PFP A;  3PMI A;  1Y7X A;  4LDU A;  3E1S A;  2C06 A;  2FEI A;  4EIK A;  1N8R U;  5LJ3 j;  1X01 A;  2F5T X;  1SSH A;  4E7L A;  1R0B G;  3QII A;  5FU6 B;  2X4J A;  2JMC A;  3VRZ A;  3JB9 J;  2JM8 A;  4OGC A;  1AWO A;  2OTJ Q;  2F1L A;  2J06 A;  4QW2 A;  1UHC A;  4QQD A;  4FT2 A;  4E47 A;  1QKX A;  2RI2 A;  4Z89 A;  4NL3 A;  3X25 B;  2D9T A;  3OYJ A;  2KI7 A;  2EYY A;  4ELZ C;  3CCR A;  1GFD A;  1Q81 C;  1H92 A;  1E6H A;  1G3T A;  4PJN A;  3CC2 Q;  2F2X A;  3A8H B;  3RMQ A;  5HK3 A;  3CCQ Q;  2FVU A;  1SSF A;  3I55 T;  3JCM X;  4IUV A;  3U23 A;  1PRM C;  1KD1 C;  1WJR A;  4RG8 A;  2O4X A;  3OYY A;  4F7U G;  4ME7 A;  3PVL A;  2GFA A;  2L5Q A;  1I81 A;  3O5Z A;  2HZY A;  1U1T A;  1UDL A;  2YHT A;  3LYI A;  4J8O A;  2ZPG B;  1VQ5 Q;  4QVZ A;  4GLK A;  1RAE B;  1YWP A;  2DVE A;  1VQ9 Q;  1MMG A;  3L2R A;  2E41 A;  1ZSG A;  2DER A;  2DEQ A;  1Y96 B;  2RI3 A;  4OMQ A;  2H3E B;  3QZ9 B;  2KYB A;  2OAW A;  2CP5 A;  1N5Z A;  2QAZ A;  4LDW A;  2M16 A;  2LQW A;  1M1K U;  3TQ7 P;  5LJ3 h;  2DF6 A;  1EFN A;  3GIB A;  2VYT A;  4J6W A;  1S72 A;  1MV3 A;  2ED0 A;  4F7U E;  2CZ6 B;  4HCC A;  1VQ6 T;  2DBK A;  4Z02 A;  3KFV A;  3PGG A;  2KRN A;  5CK9 A;  2HD0 A;  5LJ3 e;  3TRE A;  1AWW A;  4C0G A;  1Q86 R;  2XD0 A;  2AKK A;  2E3H A;  3ME9 A;  2HL5 C;  5CO7 A;  4DBH A;  4OMM A;  2FPD A;  2EYZ A;  4C5I A;  3CC4 Q;  3EHR A;  3NFC A;  3PT9 A;  4Y91 A;  2RB6 A;  4FSX A;  2LCL A;  5EG2 A;  2GTO A;  2CT4 A;  3JCM J;  2QA4 T;  1GFC A;  1DJ7 B;  3CCM Q;  2KR3 A;  4PFO A;  3J80 E;  1N27 A;  3CQT A;  2P84 A;  4MZP A;  1FMV A;  4EMG A;  4HVV A;  3WVE B;  1N8R C;  2P0Q A;  2AT1 B;  3I56 T;  3QHS A;  3URG A;  2MI6 A;  3UT1 A;  1IZ6 A;  3DLL A;  2FPE A;  2EVR A;  4D6W A;  2A37 A;  5KE3 A;  3O8V A;  2EWN A;  2RNA A;  1M90 R;  3TSW A;  3JCM W;  3GNF B;  5DY9 A;  1TUG B;  1VQ6 A;  4QQ6 A;  2RK1 A;  5LJ3 f;  2FZG B;  4RTZ A;  1QW1 A;  3Q1J A;  1RAB B;  1VQ8 A;  5LJ5 d;  1FYN A;  3G71 Q;  1HYO A;  4A63 B;  1VQN T;  2LMJ A;  4J83 A;  1KFZ A;  3QKJ A;  4BDZ A;  2QYZ A;  3M54 A;  3MEW A;  1WLP B;  3FB9 A;  5GMK m;  2K9G A;  1OUL A;  3VRY A;  1CSK A;  3X28 B;  3MKD A;  4AMC A;  5A2Q E;  4KGX B;  2MAM A;  1PWT A;  4BE0 A; 
#chains in the Genus database with same CATH homology
 3QWX X;  2CH4 A;  1CKA A;  1XOV A;  2RPN A;  1AVZ C;  2AK5 A;  4OML A;  1KIK A;  4Z8A A;  4D8K A;  3UAT A;  1ABQ A;  1AOJ A;  2DL5 A;  4DEY A;  2RQT A;  1S1N A;  2KRS A;  1UE9 A;  2A36 A;  2W0Z A;  1X2K A;  2ESW A;  2K7A A;  2DM1 A;  1B3Q A;  2AZS A;  4J9H A;  4GBQ A;  4CC2 A;  1RUW A;  1AWX A;  1UTI A;  2OI3 A;  1K9A A;  2BZY A;  4HVW A;  3H0H A;  2L3Q A;  5IXB A;  1G83 A;  1PKS A;  2V1Q A;  3VS3 A;  4D8D A;  2F2W A;  1NEG A;  3GBQ A;  1OPL A;  1I1J A;  2LCS A;  2KXD A;  1KSW A;  3NHN A;  1QWF A;  2KYM A;  1JO8 A;  2O2O A;  1Z9Q A;  1LCK A;  2KRM A;  2LJ0 A;  2YUP A;  2DL4 A;  2ENM A;  4LN2 A;  1VYV A;  2GNC A;  2EYX A;  1WX6 A;  3EHQ A;  1I0C A;  3I9Q A;  4DEX A;  2RMO A;  2LJ3 A;  1BBZ A;  1NEB A;  2ED1 A;  4FSS A;  2RF0 A;  2EGC A;  3R6N A;  1VA7 A;  1WDX A;  3JV3 A;  2CRE A;  1UG1 A;  4OMP A;  2DA9 A;  2FRW A;  1MV0 B;  1ABO A;  1JU5 C;  2KE9 A;  2I0N A;  2LJ1 A;  4OMN A;  4WCI A;  2A08 A;  1H8K A;  2YT6 A;  1WYX A;  2EKH A;  4AFS C;  2HDA A;  2DLP A;  3UA7 A;  1GCQ C;  4CC7 A;  2JTE A;  1UUE A;  1NLP C;  2FPF A;  5IXF A;  1E6G A;  4AFU C;  2VKN A;  5GJV B;  2O9V A;  2BZ8 A;  4F16 A;  2JW4 A;  1WXT A;  3PVQ A;  1UEC A;  2ROT A;  1OV3 A;  1HSQ A;  4GLM A;  3EG2 A;  4IIM A;  2D8J A;  2O31 A;  4J9C A;  2KEA A;  2VWF A;  2DL3 A;  1UFF A;  1Z9Z A;  3LH5 A;  2JS0 A;  4R0K A;  2AKL A;  4LUE A;  4JJD A;  4Y92 A;  3REB B;  4J9D A;  1TUD A;  3H0I A;  2J6F A;  1SRM A;  1X27 A;  2EYW A;  3REA B;  1WXU A;  1OOT A;  4RTY A;  3THK A;  3TVT A;  2J6O A;  4JZ3 A;  1MUZ A;  2JT4 A;  1JEG A;  4ZNX A;  3EG1 A;  2RQU A;  2EGA A;  1Y0M A;  2F2V A;  1AEY A;  3M0S A;  1U5S A;  5GJW B;  2ECZ A;  2L2P A;  1YP5 A;  3H0F A;  1W1F A;  4ESR A;  1J3T A;  2FO0 A;  3EG3 A;  2LX7 A;  1RI9 A;  2GQI A;  4QT7 A;  1V1C A;  2MIO A;  2RQW A;  3I5R A;  4LE9 A;  3NPF A;  1X6G A;  3FJ5 A;  4JJB A;  4JZ4 A;  2PTK A;  4IIO A;  1AZG B;  3VS1 A;  2BTT A;  3M0U A;  2L3P A;  3M0R A;  2V1R A;  3ZL7 C;  2ROL A;  1YNZ A;  2DMO A;  4AFQ C;  1GL5 A;  2CUD A;  3VS7 A;  2X3W D;  2HCK A;  1M3B A;  1KJW A;  2YDL A;  2DL8 A;  2EGE A;  1QLY A;  2PNI A;  1H3H A;  2HBW A;  2GGR A;  1WFW A;  1T3S A;  4HXJ A;  2CUB A;  1GRI A;  1UHF A;  2J6K A;  1K0S A;  2HSP A;  4M4Z A;  1PKT A;  1FMK A;  2J7I A;  1A0N B;  1W6X A;  1HJD A;  2LQN A;  4F17 A;  5I11 A;  1SRL A;  4X1V A;  3C0C A;  3M0P A;  1WXB A;  2C0I A;  2KNB B;  2YUQ A;  2EBP A;  2KBT A;  1BB9 A;  2NUZ A;  4Z88 A;  5IHK A;  1ZUY A;  1GBQ A;  4CC3 A;  2CDT A;  1ZX6 A;  2K79 A;  1T0H A;  1M3C A;  2YUO A;  2DBM A;  2FEI A;  4EIK A;  3SEM A;  1HD3 A;  1YN8 A;  2L3S A;  2O88 A;  1QWE A;  1CKB A;  1SSH A;  2DJQ A;  1ZUU A;  1UJ0 A;  1X6B A;  2JMC A;  1UGV A;  2D1X A;  1TUC A;  3VRZ A;  1B07 A;  2O9S A;  2JM8 A;  4HCK A;  4CC4 B;  1AWO A;  1M3A A;  4RTW A;  2CT3 A;  2DL7 A;  1ZLM A;  2C0O A;  3VS6 A;  2J06 A;  1UHC A;  1SHF A;  1QKX A;  1ARK A;  1RLP C;  4Z89 A;  2YSQ A;  1AZE A;  1QCF A;  2EYY A;  1GFD A;  1H92 A;  1E6H A;  4RUG A;  1NLO C;  1G2B A;  2F2X A;  1GCP A;  2EPD A;  3I5S A;  4RTX A;  3QWY A;  2FRY A;  2E5K A;  2DNU A;  2LZ6 B;  2A28 A;  3U23 A;  1PRM C;  4JJC A;  1ZBJ A;  1I07 A;  1RLQ C;  4AFZ C;  2YUN A;  2EW3 A;  2RN8 A;  1WI7 A;  3PVL A;  2XMF A;  4J9G A;  2DVJ A;  3NMZ C;  1NM7 A;  2CSI A;  1M30 A;  3TSZ A;  3O5Z A;  1UDL A;  1SPK A;  1YWO A;  1K1Z A;  2BZX A;  2ABL A;  1YWP A;  1WIE A;  4LNP A;  2LP5 A;  3I35 A;  5HCK A;  2PZ1 A;  1ZSG A;  3UA6 A;  1M27 C;  1BK2 A;  1NG2 A;  5IHI A;  3VS2 A;  4OMQ A;  2KYB A;  1GBR A;  2JMA A;  2OAW A;  1N5Z A;  1T3L A;  2LQW A;  5IH2 A;  1M8M A;  2DRK A;  2DF6 A;  1VYU A;  1EFN A;  2GTJ A;  1UJY A;  4RTU A;  5FWC A;  1VYT A;  3UF4 A;  4F14 A;  1MV3 A;  2ED0 A;  1PNJ A;  2B86 A;  2DBK A;  1YCS B;  3SHW A;  2M0Y A;  2K2M A;  4KRT A;  2NWM A;  2IIM A;  2MOX A;  3KFV A;  2GBQ A;  2K3B A;  2KRN A;  2P4R A;  3RBB B;  1AWW A;  5ECA A;  3RNJ A;  1U3O A;  1X69 A;  2AKK A;  2MCN A;  4E6R A;  2JS2 A;  2QDL A;  1AWJ A;  5IHN A;  1ZUK A;  2L0A A;  2RQR A;  4OMM A;  2K6D A;  3VS4 A;  1SEM A;  4JPB W;  2FPD A;  2KRO A;  2EYZ A;  3EHR A;  2D0N A;  2DRM A;  4J9F A;  3A98 A;  3EG0 A;  4OMO A;  2VVK A;  3M0T A;  2C0T A;  1PRL C;  2GTO A;  1X2Q A;  2HEQ A;  2CT4 A;  2EQI A;  1GFC A;  1NYG A;  1IO6 A;  2CH4 W;  3IQL A;  2KR3 A;  3CQT A;  4J9I A;  2M51 A;  1E7O A;  2W10 A;  1PHT A;  1JXO A;  4HVV A;  3M0Q A;  1QKW A;  2DYB A;  1K4U S;  1NYF A;  1U06 A;  3VS5 A;  1WA7 A;  2DE0 X;  5I22 A;  2DIL A;  1OPK A;  2H8H A;  4ORZ A;  3ULR B;  2J05 A;  2FPE A;  3EGU A;  2CSQ A;  2EVR A;  2JM9 A;  4J9E A;  2LNH B;  2KGT A;  2A37 A;  2SRC A;  2FG0 A;  1AD5 A;  1X43 A;  2RNA A;  4LUD A;  1K76 A;  2AZV A;  2KXC A;  3TSW A;  2DX1 A;  1GCQ A;  1BU1 A;  1Y57 A;  3VS0 A;  4K11 A;  4RTZ A;  1K0X A;  1TG0 A;  3NGP A;  2G6F X;  5FW9 A;  2JXB A;  1FYN A;  4A63 B;  1W70 A;  2LMJ A;  2D8H A;  1JXM A;  1OEB A;  5EC7 A;  4HVU A;  1T0J A;  1KFZ A;  2X3X D;  5FWB A;  2KT1 A;  3H41 A;  1WLP B;  4AG2 C;  2KT8 A;  2OJ2 A;  1SHG A;  3PE0 A;  4RTT A;  2K9G A;  5L23 A;  4J9B A;  3VRY A;  1CSK A;  1JQQ A;  4RTV A;  4AG1 C;  2RQV A;  1PWT A;  2SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...