3QJ6A

The crystal structure of pwwp domain of human hepatoma-derived growth factor 2 in complex with h3k79me3 peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
90
Chain Sequence
PHAFKPGDLVFAKMKGYPHWPARIDDIAAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatoma-derived growth factor-related protein 2
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/ nuclear protein
total genus 20
structure length 90
sequence length 92
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qj6A00
3OYKA 2R58A 5J26A 3PMIA 1OZ3A 4A4HA 2K3XA 3MEWA 4CRIA 2RI2A 2RI3A 2RI5A 2LTOA 2X4YA 3EAEA 2LDMA 3OS2A 2QQSA 3ASKA 2MWPA 3PFSA 4B9XA 2QQRA 2RHZA 2BIVA 2G3RA 2FHDA 4LD6A 4E7HA 4E7IA 3MEUA 4E7LA 2HQEA 3MEVA 3L2VA 2BKDN 2GF7A 3QKJA 5IN1A 2RHXA 4PL6A 1XNIA 2B8AA 2LCCA 4C5HA 4IUPA 2GFUA 2LVMA 3GOXA 2R5AA 2L8DA 1N27A 1SSFA 3META 3PNWC 4FL6A 4IUUA 4A4FA 3OYMA 3SD4A 2RHYA 5FROA 2HQXA 3LH0A 4E7KA 3L42A 2CKKA 3E9GA 2IG0A 3P8HA 4BD3A 4C5EA 3OYBA 1H3ZA 2X35A 2EQUA 5KE3A 2E6NA 1OI1A 2RJEA 4Q5WA 3OA6A 3L2RA 1G5VA 2K3YA 4Z02A 2DIQA 3UT1A 1KHCA 2LRQA 4IUQA 2M16A 2EFIA 3MP1A 3ZEHA 3OYFA 4ZTJA 3S3MA 2EQKA 2YRVA 4OVAA 5KCOA 5J39A 1OYXA 2MWOA 2O4XA 4QQ6A 4RG2A 3OYCA 3OQ5A 3FEOA 2X4XA 2R57A 5D6YA 3LYIA 4QW2A 4QQDA 3OYLA 4BACA 3PMTA 5KH6A 4A4EA 3OYDA 2RJFA 3C4SA 3MO8A 2RJDA 4BE2A 4IKFA 3UWNA 4QVZA 2EQJA 4IUTA 3OY9A 2D9TA 2M0OA 4A4GA 4BE1A 1MHNA 3L2WA 1RI0A 3OS0A 2BUDA 3S3OA 3O8VA 4II1A 1WJSA 4QQGA 1WGSA 2VYTA 3QJ6A 4EDUA 3LX7A 4N4GA 4C5IA 3LGFA 2P0KA 3MEAA 2NLUA 2DIGA 3FC3A 5FRMA 2RHIA 2XDPA 3CEYA 2E5QA 4HCZA 3DB4A 4C5GA 2XK0A 3NTIA 3OYEA 3DB3A 2WACA 3S3NA 3MP8A 3MP6A 3OS1A 3H6ZA 3LLRA 5KCHA 3OMCA 5IAYA 3LGLA 2RO0A 5KE2A 3OB9A 3DLMA 5C6SA 5FRNA 2RHUA 2L3RA 3NTHA 2JZ2A 2EQMA 3F70A 4PLLA 4IURA 4B9WA 2F5KA 4PLIA 4N4IA 2EKOA 4BE0A 3QBYA 3L2QA 5CIUA 3FDRA 4GY5A 5D6WA 2O4XB 4ZTFA 4BDZA 2M1HA 3ME9A 3OYNA 3OYIA 4L59A 3OYGA 3OYHA 3BDLA 4E7JA 1WJRA 5M9OA 2PQWA 4X34A 3S6WA 4BDYA 4NS5A 1OZ2A 4FU6A 3QIIA 3FLGA 3H8ZA 5C0MA 3NTKA 3Q1JA 5D6XA 3OYAA 2X4WA 2RJCA 2R5MA 2DAQA 4UC4A 4IUVA 3L2UA 3P8DA 2GFAA 3KUFA 4N4HA 2L89A 3E9FA 3OMGA 2JTFA 3OYJA 1WJQA 3M9QA
chains in the Genus database with same CATH superfamily
3PMIA 3MEWA 2RI2A 4Z88A 1S72A 2EYZA 1IB8A 1VQPQ 2QQRA 3JCMW 1K9MU 2BIVA 4ORZA 2QQ9A 1W6XA 2LCCA 1T0HA 2DL4A 4IUPA 1KSWA 3TREA 3X28B 1FXXA 1B07A 1Y96A 1NYGA 3L1AA 1IGUA 2HQXA 5IXFA 2RK2A 2JS2A 1VQOT 3SDZA 4XK8E 1B34B 1ARKA 1C1AA 2VXFA 1KHCA 2V1RA 2CZ0B 4M78E 3OSVA 2FYKA 2XG8D 3A1PA 3HFOA 5HCKA 4PKCC 1X69A 2RQUA 5FU6B 3O5ZA 5LJ5d 2J7IA 1PHTA 1I8FA 1S1NA 4IUTA 4AFUC 3CCVT 4OB0B 4NOYA 2ESWA 3OS5A 3S3OA 1I4K1 1M2VB 1M27C 1U8RA 3GNFB 2EJFA 4D8KA 1JJ2P 2LC4A 4PJOD 2RH2A 2E41A 3EGUA 1KD1C 2VXEA 1W1FA 1YITQ 3OMCA 3M0UA 2DTHA 1BIAA 5FRNA 4E7ZA 2V26A 3NTHA 2EQMA 3F70A 4RTWA 4KULA 2OAUA 3WXMB 5GAMj 4RTZA 3QZ9B 2HAXA 5LJ5f 2RD1A 2NUTA 5GMKh 4JJDA 1WJRA 4PJMA 1KQ2A 1KC8R 4LUEA 3E1SA 3PT9A 4C0ZA 2PZ1A 4ZN3A 3ZFJA 3P8DA 2FZGB 1Y0MA 3VYHB 4OB3B 4LDXA 2YLCA 2ED1A 2ZPFB 1ZUKA 2HMAA 4CRIA 1HK9A 2DO3A 3CCMQ 1G8XA 2LDMA 1CKAA 3H0FA 2OTJT 1PRLC 3CCLT 1JB0E 2MAMA 5LJ3g 1QVFP 3SEMA 1X6BA 3INZA 3E2UA 4HCBA 2DXCA 5A0GA 2QA4A 2HL3A 4RG8A 1FMKA 2IG0A 2JXBA 1M3AA 2O01E 3JCMJ 4M77B 2IVWA 3M0QA 3H0HA 4ZTJA 4C8QB 5A0DA 3X20B 3JB9G 3KFVA 2JMCA 2O4XA 4QQ6A 4M75E 1SEMA 1VQMT 2QEXA 4PJOA 1PD0A 3UWNA 1VQLQ 4J7FA 1GXIE 4X9CA 2KBTA 4J9HA 3EG1A 5A2QE 1IZ6A 2ZPEB 4J83A 2OX7A 3PGGA 1M9SA 2XI9A 2DJZA 1SSHA 4DOVA 1E6HA 2VVKA 3MEAA 2CS7A 4DOWA 5DY9A 3JCMQ 2XK0A 2KK4A 2W10A 2MK5A 1QWEA 1ACMB 2NUPA 4XU2A 5KE2A 4JLIA 2E1HA 2AKLA 4LDWA 8AT1B 2K5LA 3V7CA 2F5KA 3VS4A 5CVIA 3CC4A 4JRKA 2M02A 3JCMd 3FDRA 1YJ9Q 2E5KA 4PJOC 3PIPA 1QQJA 4M78B 2AZVA 3QHSA 1VQKQ 2YUQA 4FM4B 4IIMA 1WXTA 4XTZA 1PRMC 2YWWA 1FWZA 1TH7A 2HKQB 2GCXA 1TTHB 5KYUB 1Q86C 3JB9D 4LDVA 5D7UA 4M7DA 1BU1A 1R77A 3NGPA 4M7AB 2A3LA 4JJBA 1ABOA 3PTAA 3A5ZB 4CC7A 5LJ5e 3QKJA 2J6OA 3NHNA 5IN1A 4FSSA 3JCMf 4HT8A 1WHGA 3M53A 3CC4T 2A0FB 4OMMA 4ZN1A 2DLPA 1QCNA 1OPKA 2KROA 5IT9E 1R0CB 1D1AA 2CREA 2RJEA 3GF5A 4XU1A 1ZLMA 1G3TA 3CC2Q 1M3CA 2VV5A 4M7DC 3RR6A 1UGVA 3OYLA 4WCIA 5A0LA 2D8JA 2D9TA 2F5TX 1VQ8T 2XU8A 1U1SA 3O8VA 1G3WA 5KYXA 2RQTA 3CCQA 1NPRA 2CZ1B 3QDFA 2DMOA 2K5FA 5GANh 5FRMA 3NTIA 3CCSQ 3M59A 3G71T 2KSSA 2ZZDA 3HRTA 1TS9A 3EFRA 4Y28E 5GAN2 4OMQA 1I5LA 3VS6A 2O9SA 1KD1U 4F17A 1AWWA 1QCOA 1X01A 3G6EQ 1B34A 3CCEQ 3I9QA 1WZOA 4M75B 4ME7A 3CC7A 4XTYA 4DBFA 2DVEA 4J9CA 1BYMA 1MMNA 1H8KA 3JB9H 1QLYA 4QVCA 2AZSA 2HKNA 2DXUA 1VQNT 3CCQT 2MF2A 1PC0A 2SEMA 1UHFA 4V2SA 1KC8C 1OZ3A 1WYXA 2OJ2A 1YNZA 3EAEA 1AWOA 3V7RA 2DX1A 2RHZA 2IIMA 1M2VA 4RTTA 5J3BA 4E7IA 4JRPA 2BKDN 2C0IA 3M0SA 4A53A 3HRUA 4XAXB 1UB4A 2R5AA 4FYVB 3QJYA 2D0QB 4J6YA 2HCKA 4OMFB 2X9HA 4KGXB 1TU0B 2E3IA 1BCOA 3CC7T 1W2BA 5FU6C 2L5QA 1K8AR 5CKDA 2MWOA 2DJQA 1MMGA 5I2MA 3OYCA 1MMAA 4QT7A 1VQ9A 5CO7A 1VQPA 3JCMe 2KE9A 4KH0B 2F2WA 1X6GA 2ECZA 4XU0A 3PVLA 4BE1A 1YHQQ 1JXOA 2CUBA 3OS0A 2RPNA 1TWBA 4L5GA 2VYTA 1WQ7A 4KUIA 3CCJQ 3JCMc 1FMVA 1T3LA 2DIGA 2VGNA 2Z0WA 4CI0C 4PFZA 2RHUA 2DYIA 5I21A 1NYFA 4PLIA 4KH1B 2K2MA 2XDDA 3EFOB 1G83A 5CIUA 1YIJQ 3RDVA 2F69A 1D1CA 2P84A 4BDZA 2ABLA 3M55A 3OYHA 2CZ7B 3EH1A 3OBYA 4M77A 1VQ9T 4FW2A 1PSEA 3CBMA 4C8QA 4KT0E 1HD3A 3JCMb 4IUVA 1GCPA 1AWJA 4N4HA 3I56Q 3X24B 2XKOC 2JTFA 4HCCA 1NJIR 2K79A 1YITA 1UDLA 2E12A 4A4HA 2A36A 4B6MA 1Q86U 5GAMf 3MEUA 4RTXA 3L2VA 2DRKA 2GF7A 1UFFA 2RHXA 2VC8A 2X3WD 2GFUA 3EH2A 2LVMA 3URGA 1ZSGA 3META 3OYMA 1N27A 1YBYA 4WF2A 4E7KA 2PNIA 4M77C 1A0NB 1V76A 4VUBA 2JJ9A 5CCAA 2LJ3A 3VS1A 5I2SA 5AT1B 1VQ7Q 2DTIA 4C8QC 1GFCA 1RAHB 2V8KA 2NUZA 4X1VA 4DEYA 1M2OA 3OYFA 2YRVA 3LWHA 2FZCB 4WTOB 4PJJA 3HP9A 2DL5A 4M78A 1UJYA 2K57A 3CCMA 1BBZA 1AHJB 2YDLA 2AK5A 1T3SA 1K73R 2M0OA 1WQWA 2AT1B 2DILA 2QI2A 3A98A 1ZQ1A 5KYUA 2B86A 2YUNA 4EDUA 1ABQA 1VQ6T 1RLQC 2FO0A 3BW1A 3AHUA 2CH4A 2HBPA 4M7AA 2NYSA 2YT6A 1D0ZA 2FPDA 1AD5A 1VUBA 2QGGA 1K0XA 1HYOA 4IURA 2LCLA 4J9DA 4JS5A 2KRMA 1WDXA 3QBYA 3CD6T 2DVJA 1VQLA 4OGCA 2Y4YA 3P8BB 2LNVA 1M4ZA 4FYXB 1Q7YR 5FW9A 2E4HA 1KFZA 2WSFE 3JCMg 2X4WA 1ZUYA 1D1BA 4MZPA 4F7UA 3L2UA 5GJVB 4HXJA 3OMGA 3CMAQ 4M7AC 2KYMA 2CUDA 2H8HA 1XQHA 3BY7A 3G4SQ 1U3OA 2QAZA 2HSEB 2QTVA 5GAN6 3I55Q 1VQ5Q 2G3RA 1NEGA 5LJ3h 1YJWQ 2QXFA 2RQRA 1KC8U 1ZA2B 1G2BA 2B8AA 1YJ9A 2EW3A 2XICA 1WLPB 4HVVA 1VQKA 1W70A 8ATCB 4NL2A 3WVEB 4PJOG 2PU9B 2FPEA 4JUVA 1D3BB 4C92D 1OYXA 3UPUA 1X27A 4J6XA 3OQ5A 2FEIA 2O31A 2SRCA 5LL6S 2X4JA 4M75A 2FPFA 4FIBA 4A63B 1K8AC 3EGDB 2QDYB 3T9NA 2I0NA 4C5IA 2JS0A 2DERA 3OBWA 3CCRT 3DB3A 1B7TA 1P92A 2QYZA 3CC2A 5KCHA 1KHIA 5KYNA 3JV3A 1PSFA 4J9EA 2C06A 4LE9A 3OW2S 1S72T 5CAIA 3VS3A 4RKUE 5D6WA 5HKCA 5GAOp 4M75C 4M7DG 1D0XA 2OTLQ 2M1HA 3QUIA 2CSIA 1R8OB 2EJ9A 2PVGB 4PK4A 3JB9F 1M8VA 2A28A 3NTKA 5D6XA 1HSQA 2W0ZA 2ZPIB 3M4YA 1YWOA 1TUDA 4DQ2A 1Q82R 2PUOB 4MMLA 3R6OA 2LCSA 5FWBA 3CCSA 4O5VA 1PG5B 1QP3A 2QDLA 1JU5C 3HKSA 4LD6A 3OW2A 1NJIC 3QPHA 2NWMA 2EYXA 4C92A 5EC7A 2LNHB 3CCEA 2GQIA 3FB9A 2X3XD 2VKNA 2LT1A 4ANJA 2J06A 1GRIA 4BD3A 2EQUA 5AYFA 2K3YA 7AT1B 4MDXA 2O9VA 4JLGA 3ULRB 2V8JA 2EFIA 3M4GA 1UGQB 3EFOA 5CQYA 4JRQA 3SHWA 3PVQA 2RMOA 1PCXA 1ZSZB 3OYDA 5GMKi 2FRYA 3TU4K 4M7DD 4QVZA 1B3QA 1RI9A 2QGFB 3L2WA 4ELYC 1RAIB 2KT1A 4C92C 2JVVA 1OPLA 4N4GA 2RQVA 2IPOB 4E6RA 2CP0A 1T0JA 2FRWA 1K73C 2JUFA 2JT4A 3DB4A 4FW1A 3TCJA 4PNOA 3EG9A 2EGCA 4OB2B 1K76A 4AMCA 2L3SA 3CMEQ 1Y57A 2DZ9A 5GMKj 2DL8A 2I2LA 4GLMA 4RTYA 4OGEA 3CCUQ 1RUWA 3KBGA 1YI2Q 4R56A 1LPLA 1YHQA 4L59A 4OB1B 2QA4T 1HXDA 4XTVA 3LWIA 4QVDA 3CCJA 1QMCA 5HY6A 4RCCA 1I81A 1NPPA 2F2XA 3G7ZA 2EYYA 5J26A 3RNJA 3EG0A 1Q7YC 1N8RC 2KQWA 1M1KR 4GBQA 3HHTB 2CGHA 2FHDA 2ZPGB 1OX9A 2QEXT 1JBMA 1YIJA 1ZHIA 2COWA 3GLXA 3GOXA 2VB6A 2L8DA 2J6KA 1VQOQ 3I5SA 1YJNQ 1D09B 5L23A 2G6FX 1LVKA 4BY6C 3V8JA 1QVGA 1YHQT 4BB7A 2HDAA 4LN2A 2MMPA 4IIOA 1NZ9A 3HL8A 1EIFA 2HD0A 3VS2A 2GNCA 2OAWA 3CCVQ 2Y4XA 2CP3A 2LQ8A 3C4SA 2K7AA 4BE2A 1JEGA 2DD5A 2FVUA 1RI0A 3J81E 5LJ5h 3GIBA 1K8AU 2P0PA 2ROLA 5FWCA 1JRIA 1SPKA 2XMFA 4M77G 3LGLA 3EFSA 1SHFA 3JCMV 3VUZA 2FB7A 2QASA 4C8QG 4MDWA 4TVRA 1IO6A 3CXCS 2QK0A 3QDRB 2L2PA 2DL3A 2CP7A 4MMKA 2Y90A 4OMLA 1AEYA 1RADB 2HBWA 2D0NA 1O75A 2JW4A 5GMKm 3J80E 3G1JA 1NLPC 2DF6A 4EMHA 3KUFA 1Z9QA 2JTEA 1V29B 2PUKB 1KIKA 3VRYA 3CPWA 4FYWB 4ZGDB 2EAYA 2RI3A 2RI5A 3C94A 4XQ3A 2OTJQ 2X4YA 1BI0A 3EGDA 3CCLQ 4ZGEB 2BE9B 2HZYA 1BI1A 1Q82C 4DBQA 4PJOE 4A54A 3CXCA 4PL6A 2MIOA 3REBB 4FL6A 1W2BS 4LD9K 3SWNB 2PTKA 1VA7A 2LX9A 1U1TA 1VYTA 1EX4A 1BI3A 1NJIU 3L2RA 5GAOr 3HSBA 3UT1A 4M77D 3M58A 2LQWA 1CSKA 3ZEHA 2KT8A 2EQKA 3CMAA 4C8QD 2V8IA 1QP2A 1GBRA 1VQMQ 2KMTA 2YHTA 2R57A 1G3YA 4XTWA 3I55A 1VQ5A 2KI7A 2EIFA 2RJDA 1YCSB 4M7AG 2EQJA 1YJWA 3BE3A 1K1ZA 2COYA 4A4GA 1MHNA 3EHRA 4XTUA 5GANj 4Z89A 3JRZA 4QQGA 1RACB 3QJ6A 4PJNA 2MOXA 1VQ4A 1C0MA 2GGRA 3CPFA 1WI7A 4M7DE 1SKUB 1O9SA 4HKEA 2QQBA 1WX6A 2BTTA 1K73U 1KQSS 4N4IA 4F7UG 1Y71A 1N5ZA 2KRSA 5LJ5g 1E7OA 4M78D 1Q81R 1KJWA 5FU7B 3BDLA 1H92A 3C0CA 4FU6A 3QIIA 4ESRA 2FG0A 3H8ZA 3JCMh 2LP5A 9ATCB 2R5MA 2DAQA 2KVQG 2LQNA 1IXDA 2JM9A 2JN0A 5GAMd 2HSPA 1VQ4T 2DETA 3OS2A 1QCFA 4M7AD 1VQPT 3QWXX 2ZPBB 2MPXC 1KG1A 3CBOA 3CC4Q 1Q7YU 1GCQA 1KQSA 1OOTA 2OTLA 1M1KC 2DK3A 4HT9A 2CDTA 4O6JA 3OYBA 4X9DA 4M75G 1G5VA 3EGXB 5CR2A 3EG2A 3E19A 1OU9A 2DKGA 2M16A 5CQXA 4E47A 3N5BB 1UJ0A 2XIDA 4XU3A 1G3SA 3HPWA 5J39A 2BE7D 5GAN5 1BK2A 3QWYA 4QW2A 1XJWB 3OYYA 2DBKA 3JSCA 2DRMA 3MO8A 1FX7A 1VQ8Q 4LUDA 3AT1B 4M4ZA 1GCQC 2LJ1A 1SF9A 2GQVA 4II1A 1QWFA 3M0PA 4E7SA 1SG5A 2KDSA 1UECA 3QSUA 3G71Q 2CSQA 4PJOB 2XDPA 1BKBA 1W2BP 3MKDA 3LLRA 5FLXE 4CC4B 1YITT 4B9WA 4D6WA 2J05A 1N6AA 4JJCA 4PJOF 4D8DA 3VUBA 3OYNA 3JB9J 4OF1A 1X6OA 4FT2A 1IHWA 4JS4A 4M75D 2RJCA 2DL7A 1VQNQ 3CCQQ 5GJWB 4C0DB 4DBHA 4C5EA 4C92G 4RTVA 1KK7A 4M78C 5KYWB 4A4KA 2DNUA 2MYSA 3CMEA 2AIRB 4PFPA 5GAN4 3ASKA 4B9XA 2CP6A 1BIBA 3CCMT 4CC3A 3PE0A 2E65A 4FSXA 4NL3A 2VUBA 1N8RR 2XD0A 4HVUA 3L2ZA 1YI2A 1N9RA 4PJLA 1NBEB 3R6NA 1Q82U 4DEXA 2DYBA 3OSSC 4LXCA 3VYGA 4Q5WA 3CC7Q 2CZ6B 2M0YA 2EWNA 2RF0A 1JJ2A 3BDUA 2YUPA 4JDSA 1WHMA 2DEQA 4M7DF 2X4XA 1SHGA 1OEBA 3VKIA 5IXBA 1HJDA 2X51A 3JAME 4KGZB 3CMET 3A8MB 4Y92A 1VQLT 2E10A 2WSCE 4M77E 1VQOA 1YJNA 4R55A 4C8QE 2NLUA 5GAOm 4KRTA 1QKXA 4C5GA 1M90R 2K4YA 3A8GB 4LNPA 5GAMe 1UEBA 1JQQA 2AHJB 3OB9A 5ECAA 3DLLA 2DD4A 4E2FB 1OQKA 5IHNA 3SWNA 3CCVA 1OU8A 1UGRB 4QKUA 4GY5A 5CK9A 1VQ9Q 2DZCA 1QVFA 3ME9A 1ZBXA 1YJ9T 4J9FA 2PQWA 4OP0A 5M9OA 5GAMh 1K4US 4AT1B 3RKYA 1VQKT 3FLGA 3OYAA 2A7YA 2RN8A 3JCMX 1PM3A 1TUGB 2MI6A 1N9SA 1Q81C 1YJNT 3OYJA 3WVDB 5LJ3j 3OYKA 2VGMA 1Y7XA 2DA9A 4JZ4A 1F1BB 5IH2A 4JRIA 3KXTA 5I11A 3LH5A 4E7HA 3TSWA 1BB9A 3SWNC 1RABB 1Z9ZA 1MV3A 1XNIA 3CQTA 4C0FA 1WXUA 1SSFA 4A4FA 1RL2A 3LH0A 2CKKA 2AKKA 4FCYA 3P8HA 2EGEA 3JCMP 2DPPB 3RBBB 1M1KU 1BCMA 2LRQA 1YCYA 4M7AE 1VIFA 3CC2T 3GNGA 5KCOA 5GMKe 2VASA 3MJXA 4FT4A 5KYYB 3FEOA 2OTJA 1EZZB 4ZGJB 4BACA 3CCLA 3PMTA 5KH6A 3G6EA 1XOVA 1M3BA 2E70A 3GPLA 5GANd 2EJGA 2V1QA 1VQ6Q 1I1JA 1EFNA 1TXQA 1MNEA 1Q95G 2DM1A 1UGPB 2RA2A 2XDBA 3EHQA 2P0KA 1WHJA 1WIEA 1X2QA 2P4TA 2RNAA 1QVPA 2E5QA 4JZ3A 3CEYA 4BI8B 4F7UE 3M0RA 2YRCA 2F1LA 5IAYA 4F04B 4AFQC 5C6SA 2DTOA 3CCST 4DBRA 3RKXA 4BI3A 3CD6Q 1VQMA 2BZXA 1UE9A 2L3PA 2ZAEA 2BZ8A 5FU7C 4N0AA 3X26B 1PD1A 3H0IA 2JTMA 2LQKA 2QQAA 2YLBA 3OYIA 1K9MR 3OYGA 3EGXA 5GANf 2WSEE 4EMKB 1MV0B 4NS5A 4F16A 3G6ET 3CCET 1M5Q1 1GBQA 3VS7A 2PVDB 3V7SA 2K5IA 3E9FA 4EMGA 1FMWA 1E6GA 3M9QA 4JPBW 2JMAA 1J3TA 3UF4A 1K0SA 2DBMA 2QQSA 2MWPA 3PFSA 2RB6A 1NLOC 4MZTA 1R0BG 4EIKA 2KRNA 4J8OA 4E7LA 1QVGS 5GAMg 4N0AC 4P5NA 4C0GA 2JM8A 4OMOA 1M30A 4IUUA 1NEBA 3SD4A 2L0AA 1LOJA 3THKA 3MHXA 4AFZC 5GMKl 4J9GA 4M77F 3A8OB 4LDUA 5KE3A 2D1XA 4C8QF 2KXDA 1YP5A 3MP1A 4OVAA 2H3EB 2EYQA 3ER0A 3REAB 1I5OB 3RIRA 5EG2A 4RG2A 4J7IA 1KQ1A 1WA7A 1VOMA 4JJNK 4Z8AA 3IQLA 1WFWA 3OW2P 1WHLA 1QW1A 1TOVA 1W4SA 1XTDA 2L3QA 2OI3A 1H641 2BUDA 3V8KA 3NMZC 2C0TA 3GP8A 2EGAA 3CCRQ 3LX7A 2ZGWA 2JNGA 2VWFA 5KYWA 3I56A 4PFOA 3CCJT 2EBPA 2XHCA 1MUZA 3MP6A 3OS1A 3H6ZA 1H3ZA 1S72Q 2L3RA 1UUEA 4RUGA 4CC2A 4M78F 5DLOA 3L2QA 1M90C 1M1GA 1MNDA 1VQ8A 4ELZC 1X2KA 1NG2A 2P0QA 1YIJT 1M1FA 4C92E 4E7JA 3S6WA 1TUCA 1VQ7A 1VYUA 1Y07A 3CPWS 1JO8A 4C0DC 3SB2A 3Q1JA 3V8LA 2EVRA 2ZPHB 3G71A 1ZUUA 1AWXA 2MCNA 2LT4A 1AT1B 1ZX6A 4M7AF 2R58A 3I56T 2EKHA 5DM7R 2K3XA 2GTOA 2FL7A 1RAEB 3VRZA 3FIFA 1Q81U 4HA8A 4J5YA 4F7UB 2HQEA 5GANe 4C5HA 2A37A 1D0YA 5I22A 1D3BA 2QTXA 2ENMA 3J7AF 2RHYA 5FROA 3L42A 3TEEA 3E9GA 2QG9B 4RTUA 2E6NA 3OA6A 4Z02A 1VQNA 1ZA1B 3GBQA 1VQ7T 3H9NA 3MCAB 4F7UF 5CKFA 3X25B 3S3MA 2C0OA 4L6V5 2E3HA 2K2VA 2DXBA 1CKBA 1WHKA 5D6YA 2KNBB 3FJPA 1OULA 4QQDA 4AFSC 1H3HA 2ED0A 5LJ5j 2K6DA 4M78G 3VJPA 3OY9A 2CP2A 3M5AA 4J6WA 1WNLA 2O2OA 2A08A 3H41A 1WGSA 5CKBA 1QVGP 3CBPA 3UDCA 1YN8A 4GLKA 2RHIA 1Y96B 2WACA 3JB9I 3G4SA 2RO0A 4HCKA 1X43A 2K3BA 2LZ6B 4PLLA 3M56A 3TSZA 1OX8A 3QYGB 4KGVB 5IHIA 4BE0A 2JOYA 2D6FA 5IHKA 2KAFA 4M75F 2EQIA 2QA4Q 2FZKB 3QYHB 3NFCA 5GAN7 1AOJA 5HK3A 3VS5A 1VYVA 3QG1A 5C0MA 1DJ7B 1TSFA 5KYYA 3RMQA 1NM7A 4J9BA 1K9MC 2KYBA 5LJ3d 2COZA 2P4RA 3VS0A 3CMAT 4YTLA 2LTOA 1NE8A 2QEXQ 1WXBA 3G4ST 4BI4A 1X75C 4MZMA 3I55T 1VQ5T 3RERA 2YSQA 4HVWA 2DXTA 4Y91A 1YJWT 3PNWC 3ZL7C 1PKTA 3UA7A 1UGSB 2F2VA 4DA4A 1RAAB 2CT4A 2YUOA 4BUGA 1ZSZA 1LNXA 2NUTB 3M0TA 1OI1A 1U06A 2DIQA 3RMSA 3QO3A 1MGQA 3CPWP 4C92B 5LJ3f 5DLQE 4KBMB 2J6FA 3D7SB 2HEQA 4ZNXA 1N8RU 2LJ0A 3LYIA 3TQ7P 4EMKA 2RJFA 3CXCP 4IKFA 1IGQA 2ZCFB 1WPYA 5GAOn 1KD1R 1LCKA 2DE0X 1IHVA 1WJSA 4FYYB 4C92F 2HNIA 1YFNA 3FRNA 4RMOA 3LGFA 2M9UA 4K11A 5GAN3 1ZSZC 5GANg 3DKMA 3A8HB 3S3NA 1QKWA 5GAN8 1LJOA 3EG3A 4ATOA 2JZ2A 1C6VX 1IREB 1OV3A 4J9IA 3A8LB 3TVTA 2CT3A 1RLPC 2EKOA 2CP5A 4RCBA 4EMKC 1TG0A 2PVOB 3M54A 2O4XB 1U5SA 3EG9B 3SFMA 3C12A 1BI2A 1SRLA 2OTLT 3U23A 1M8MA 1OZ2A 3M57A 4XTXA 1VQ6A 2E6ZA 1FYNA 1M90U 1AZGB 5GAOl 4UC4A 1WHHA 3RESA 1WJQA 2O88A 2EYWA 2L89A 2LX7A 1PNJA 2KY9A 3C95A 4AG1C 4BY6B 1RAFB 3CD6A 2NUPB 3HFNA 2E64A 3RKWA 3MEVA 2DEUA 2H3JA 1JJ2S 1K9AA 3MPUB 2EPDA 1MMDA 3QZ5B 4LDYA 3I5RA 4OMPA 2YRDA 4AG2C 2X35A 5GAOq 1AVZC 2GTJA 4IUQA 2LMJA 2KGTA 3PIOA 3CCUA 3RUXA 1ZBJA 1SRMA 2M51A 4A4EA 4M7DB 1YWPA 1KQSP 2K9GA 2D8HA 2BZYA 1VIEA 1I07A 3FJ5A 3I35A 4OMNA 2DFUA 3LW5E 1GL5A 4EPCA 6AT1B 1UG1A 1UTIA 3BFMA 3UA6A 2HL5C 3FC3A 2ATCB 1RAGB 4HCZA 3OYEA 1PWTA 2RQWA 5LJ3e 2RK1A 3MP8A 3QXEB 3DLMA 3HRSA 5L8RE 4F14A 1QVFS 3NPFA 3VU3C 2GBQA 2KEAA 2KXCA 2CH4W 1UHCA 4R0KA 3HTRA 3UATA 5HK0A 4KUDK 1V1CA 3ZBDA 1AZEA 2YXYA 5CKHA 4ZTFA 3CCUT 1Q86R 2ROTA 2HQHA 1GFDA 1IRXA 4X34A 4BDYA 1YI2T 2KR3A 3CCRA 3VV0A 1I0CA 1PKSA 2RM4A 2GFAA 5KYXB 1JXMA 5CKEA 1VQ4Q 2CYZB
chains in the Genus database with same CATH topology
1YITA 2E12A 3PMIA 4A4HA 3CPWA 3MEWA 2EAYA 2RI2A 4ZGDB 1S72A 2RI3A 2RI5A 3C94A 4XQ3A 2X4YA 1BI0A 2QQSA 4ZGEB 2MWPA 3PFSA 2QQRA 3JCMW 1Q86U 2BIVA 2RB6A 1K9MU 4MZTA 1BI1A 5GAMf 1Q82C 3MEUA 2QQ9A 4J8OA 3L2VA 4E7LA 1QVGS 2GF7A 4PJOE 5GAMg 4A54A 2RHXA 4N0AC 4P5NA 4PL6A 2LCCA 2VC8A 3CXCA 4IUPA 2GFUA 4C0GA 2LVMA 3URGA 3TREA 3X28B 1FXXA 3META 3OYMA 1N27A 4IUUA 1Y96A 1YBYA 4FL6A 4WF2A 3SWNB 3SD4A 1W2BS 1LOJA 2HQXA 3L1AA 3MHXA 4M77C 5GMKl 4E7KA 2RK2A 2LX9A 4M77F 4VUBA 1U1TA 3A8OB 4LDUA 3SDZA 1BI3A 4XK8E 5CCAA 1VQOT 1NJIU 5I2SA 5KE3A 2DTIA 4C8QC 1B34B 4C8QF 3L2RA 5GAOr 2V8KA 3HSBA 2VXFA 3UT1A 1KHCA 4M77D 3M58A 3MP1A 3ZEHA 3OYFA 2CZ0B 4M78E 2EQKA 2YRVA 4OVAA 4C8QD 3CMAA 3LWHA 3OSVA 2EYQA 1QP2A 2FYKA 2V8IA 2XG8D 3ER0A 3HFOA 2KMTA 3HP9A 3RIRA 4M78A 4PKCC 4RG2A 2K57A 2YHTA 4J7IA 5EG2A 5FU6B 2R57A 1KQ1A 3CCMA 1G3YA 4XTWA 3I55A 4JJNK 1VQ5A 2EIFA 5LJ5d 2RJDA 1AHJB 4M7AG 1QW1A 2EQJA 1I8FA 4IUTA 3CCVT 1YJWA 1W4SA 1XTDA 4OB0B 2M0OA 4NOYA 4A4GA 1MHNA 1WQWA 1H641 4XTUA 2QI2A 3OS5A 5GANj 3S3OA 2BUDA 1ZQ1A 3V8KA 1I4K1 3JRZA 4QQGA 3GP8A 3QJ6A 4EDUA 1U8RA 3LX7A 2ZGWA 1VQ6T 2JNGA 3GNFB 3BW1A 3I56A 2EJFA 1VQ4A 3AHUA 2LC4A 4PJOD 2HBPA 2RH2A 3CCJT 4M7AA 2XHCA 2E41A 1KD1C 2VXEA 3MP6A 3OS1A 3CPFA 3H6ZA 3OMCA 1H3ZA 1VUBA 2DTHA 1BIAA 4M7DE 5FRNA 2L3RA 3NTHA 1O9SA 2EQMA 3F70A 2QQBA 4HKEA 4IURA 4KULA 2OAUA 2LCLA 1K73U 3WXMB 1KQSS 4N4IA 4M78F 5GAMj 4JS5A 5DLOA 4F7UG 3QBYA 3CD6T 3L2QA 1M90C 3QZ9B 2HAXA 1M1GA 5LJ5f 1Y71A 4ELZC 1VQ8A 4OGCA 2Y4YA 1VQLA 2RD1A 5GMKh 2P0QA 3P8BB 5LJ5g 4M78D 1YIJT 1M1FA 2LNVA 5FU7B 3BDLA 4C92E 1WJRA 4E7JA 3S6WA 1KQ2A 1M4ZA 1VQ7A 1VQ6A 1Y07A 3QIIA 4FU6A 3CPWS 3E1SA 3H8ZA 3PT9A 4C0DC 3JCMh 4C0ZA 3SB2A 3Q1JA 2WSFE 3JCMg 3V8LA 2X4WA 2R5MA 2DAQA 4ZN3A 2KVQG 5CKEA 4MZPA 4F7UA 3ZFJA 2ZPHB 3L2UA 3G71A 3P8DA 2LT4A 3OMGA 3VYHB 4OB3B 2JN0A 4LDXA 4M7AC 5GAMd 2YLCA 4M7AF 2R58A 3I56T 2ZPFB 5DM7R 2K3XA 1XQHA 4CRIA 1HK9A 2FL7A 3OYIA 3BY7A 1VQ4T 2DO3A 3OS2A 2LDMA 5GAN6 3FIFA 4M7AD 2G3RA 1Q81U 2OTJT 5LJ3h 4HA8A 4J5YA 3CCLT 1JB0E 2MAMA 2QXFA 2HQEA 2ZPBB 4F7UB 5LJ3g 3CBOA 1VQPT 1KG1A 1KC8U 3INZA 1Q7YU 5GANe 1KQSA 4HCBA 2B8AA 4C5HA 1YJ9A 2DXCA 1D3BA 2QTXA 5A0GA 2OTLA 1M1KC 2QA4A 2XICA 2DK3A 4HT9A 1VQKA 3J7AF 2RHYA 4RG8A 5FROA 3L42A 3TEEA 4NL2A 3E9GA 2IG0A 4O6JA 2O01E 3OYBA 4X9DA 3WVEB 4PJOG 4M75G 2E6NA 1G5VA 3OA6A 2PU9B 4Z02A 4M77B 3JCMJ 1VQNA 2IVWA 5CR2A 3E19A 4JUVA 1VQ7T 2DKGA 2M16A 3MCAB 5CKFA 5CQXA 3X25B 4E47A 4F7UF 4ZTJA 3N5BB 1D3BB 2XIDA 4XU3A 4C8QB 5A0DA 3X20B 1G3SA 3S3MA 3JB9G 4C92D 4L6V5 3HPWA 2K2VA 5J39A 1OYXA 3UPUA 2O4XA 4J6XA 4QQ6A 2DXBA 3OQ5A 4M75E 5GAN5 5D6YA 3FJPA 4QW2A 4QQDA 1VQMT 5LL6S 2QEXA 3OYYA 3JSCA 3MO8A 4PJOA 2X4JA 1FX7A 4M75A 3UWNA 4J7FA 4X9CA 5LJ5j 3VJPA 4FIBA 4M78G 3OY9A 1K8AC 5A2QE 3M5AA 1IZ6A 1WNLA 2ZPEB 4J6WA 4J83A 2GQVA 2QDYB 3PGGA 4II1A 1M9SA 2XI9A 3T9NA 1WGSA 5CKBA 2DJZA 2KDSA 4C5IA 3CBPA 4DOVA 3QSUA 3MEAA 2CS7A 3OBWA 4DOWA 3CCRT 3UDCA 5DY9A 4PJOB 4GLKA 2RHIA 2XDPA 3JCMQ 1BKBA 1Y96B 2XK0A 3DB3A 1P92A 2KK4A 2WACA 3JB9I 3CC2A 5KCHA 3LLRA 3G4SA 4XU2A 2RO0A 5FLXE 5KE2A 1KHIA 4JLIA 2E1HA 4LDWA 1PSFA 1YITT 4PLLA 4B9WA 3M56A 2C06A 2K5LA 3V7CA 4D6WA 3OW2S 2F5KA 1S72T 5CVIA 3CC4A 5CAIA 4JRKA 3QYGB 4BE0A 2D6FA 2JOYA 4RKUE 1N6AA 3JCMd 3FDRA 5D6WA 5HKCA 5GAOp 4M75C 3PIPA 4PJOF 4M7DG 2KAFA 4M75F 4M78B 4PJOC 3VUBA 2M1HA 3QHSA 3QYHB 3OYNA 3JB9J 4OF1A 1X6OA 3QUIA 4FM4B 3NFCA 4XTZA 5GAN7 4FT2A 5HK3A 1FWZA 1R8OB 2EJ9A 2PVGB 1TH7A 4JS4A 3QG1A 4M75D 3JB9F 1M8VA 5C0MA 3NTKA 5D6XA 1DJ7B 2RJCA 3M4YA 2GCXA 2ZPIB 3RMQA 4DQ2A 1Q86C 4C0DB 2PUOB 4LDVA 5LJ3d 4MMLA 4C5EA 3R6OA 4C92G 3JB9D 4M7DA 3CCSA 4O5VA 4M78C 4A4KA 3CMAT 4YTLA 2LTOA 1QP3A 3CMEA 5GAN4 4M7AB 2A3LA 3ASKA 1NE8A 4B9XA 3HKSA 3PTAA 3A5ZB 4LD6A 1BIBA 4BI4A 5LJ5e 3G4ST 3CCMT 1X75C 4MZMA 3I55T 1VQ5T 2E65A 3RERA 4FSXA 3QKJA 2VUBA 4NL3A 3OW2A 1NJIC 3QPHA 5IN1A 2DXTA 4Y91A 3JCMf 4HT8A 1YJWT 2XD0A 3L2ZA 3M53A 4C92A 1YI2A 3CC4T 1N9RA 3PNWC 3CCEA 3FB9A 1UGSB 4DA4A 1Q82U 2LT1A 4LD9K 4ZN1A 3OSSC 4BD3A 4BUGA 1LNXA 2EQUA 3VYGA 5IT9E 4Q5WA 1OI1A 2RJEA 5AYFA 2K3YA 2CZ6B 3GF5A 4XU1A 2DIQA 2EWNA 1JJ2A 1G3TA 3RMSA 4MDXA 4JLGA 3QO3A 2V8JA 2EFIA 3BDUA 3M4GA 1MGQA 1UGQB 4C92B 4JDSA 5LJ3f 2VV5A 2DEQA 5DLQE 4M7DC 4M7DF 4KBMB 5CQYA 4JRQA 2X4XA 1N8RU 3LYIA 3OYLA 3VKIA 4EMKA 3OYDA 5GMKi 2RJFA 3TU4K 4IKFA 4M7DD 5A0LA 4QVZA 3JAME 2D9TA 2ZCFB 1WPYA 3CMET 2F5TX 3A8MB 3L2WA 1VQLT 4ELYC 5GAOn 1VQ8T 2E10A 2XU8A 1U1SA 3O8VA 1G3WA 4C92C 1WJSA 2JVVA 2WSCE 4M77E 2HNIA 4C92F 1VQOA 3CCQA 1YJNA 1NPRA 2CZ1B 4N4GA 3FRNA 4RMOA 4R55A 2K5FA 3LGFA 4C8QE 2NLUA 2M9UA 5GAN3 5GANh 5FRMA 5GANg 5GAOm 1K73C 3DKMA 2JUFA 3A8HB 3DB4A 4C5GA 3S3NA 3NTIA 3TCJA 4PNOA 2K4YA 3A8GB 3M59A 3G71T 5GAMe 1LJOA 5GAN8 2KSSA 1UEBA 2AHJB 3OB9A 4OB2B 3DLLA 4ATOA 2DD4A 2ZZDA 3HRTA 2JZ2A 3EFRA 1IREB 4Y28E 2DZ9A 3A8LB 5GMKj 5GAN2 2I2LA 1I5LA 1KD1U 3SWNA 2EKOA 3CCVA 4OGEA 4RCBA 4EMKC 1UGRB 3KBGA 1X01A 4GY5A 2PVOB 3M54A 5CK9A 2DZCA 2O4XB 1K9MC 4R56A 1QVFA 1B34A 3ME9A 3SFMA 1YHQA 4L59A 1ZBXA 1BI2A 3C12A 4OB1B 1YJ9T 5M9OA 2PQWA 4OP0A 5GAMh 2OTLT 1OZ2A 2QA4T 3M57A 4XTXA 4M75B 4ME7A 3RKYA 3CC7A 1HXDA 4XTYA 2E6ZA 3FLGA 1VQKT 4XTVA 1M90U 3OYAA 2A7YA 2DVEA 3JCMX 1BYMA 5GAOl 3LWIA 3JB9H 4UC4A 4QVDA 4QVCA 3CCJA 2MI6A 3RESA 5HY6A 4RCCA 2DXUA 1WJQA 1I81A 1NPPA 1N9SA 2L89A 1Q81C 1VQNT 3CCQT 1YJNT 2MF2A 3OYJA 3WVDB 5LJ3j 2KY9A 3OYKA 4V2SA 2VGMA 1Y7XA 3G7ZA 5J26A 1KC8C 1Q7YC 1OZ3A 2KQWA 1N8RC 3C95A 4BY6B 3EAEA 4JRIA 3KXTA 3V7RA 3CD6A 3HHTB 2CGHA 2RHZA 2FHDA 2ZPGB 3HFNA 2E64A 5J3BA 3RKWA 4E7HA 4E7IA 3MEVA 2QEXT 3SWNC 2BKDN 1JBMA 2H3JA 4JRPA 1YIJA 1XNIA 1ZHIA 1JJ2S 3GLXA 4A53A 4C0FA 3HRUA 3GOXA 4XAXB 1UB4A 2R5AA 2L8DA 1SSFA 4A4FA 3QZ5B 1RL2A 3LH0A 4LDYA 3QJYA 2CKKA 2D0QB 4J6YA 4OMFB 3P8HA 4BY6C 3V8JA 2X35A 5GAOq 1YHQT 1QVGA 4BB7A 3JCMP 2DPPB 1M1KU 2LRQA 4IUQA 1YCYA 3CC7T 4M7AE 2MMPA 1VIFA 1W2BA 1NZ9A 5FU6C 2L5QA 3CC2T 3GNGA 3HL8A 5KCOA 5GMKe 5CKDA 1EIFA 2HD0A 2MWOA 4FT4A 3PIOA 3OYCA 5I2MA 3CCUA 3FEOA 2OTJA 3RUXA 4ZGJB 4BACA 1VQ9A 5CO7A 3PMTA 1VQPA 5KH6A 4A4EA 3CCLA 4M7DB 2Y4XA 2LQ8A 3C4SA 3G6EA 3JCMe 4BE2A 1XOVA 2E70A 4XU0A 3GPLA 4BE1A 5GANd 2DD5A 2FVUA 2EJGA 1VIEA 1RI0A 3OS0A 3LW5E 3J81E 4L5GA 2VYTA 1WQ7A 5LJ5h 4KUIA 1UGPB 2RA2A 2XDBA 4EPCA 2P0KA 3GIBA 3JCMc 2DIGA 1K8AU 2P0PA 3BFMA 3FC3A 2VGNA 2P4TA 1QVPA 2E5QA 3CEYA 4HCZA 4BI8B 4F7UE 3OYEA 5LJ3e 1JRIA 2RK1A 3MP8A 4CI0C 3QXEB 4M77G 5IAYA 3LGLA 3EFSA 5C6SA 3DLMA 3HRSA 5L8RE 2RHUA 2DTOA 3JCMV 3VUZA 2FB7A 3CCST 1QVFS 3RKXA 4C8QG 3VU3C 4BI3A 5I21A 1VQMA 4MDWA 4PLIA 4TVRA 2XDDA 3CXCS 5HK0A 4KUDK 5FU7C 4N0AA 3QDRB 3ZBDA 5CIUA 3X26B 5CKHA 2F69A 2JTMA 4ZTFA 3CCUT 4BDZA 2LQKA 2QQAA 2Y90A 2YLBA 3M55A 4MMKA 3OYGA 3OYHA 2CZ7B 3OBYA 4M77A 1VQ9T 5GANf 2WSEE 4X34A 4EMKB 4BDYA 1YI2T 4NS5A 3G6ET 1O75A 1PSEA 3CBMA 3CCET 4C8QA 4KT0E 5GMKm 3CCRA 3J80E 1M5Q1 3VV0A 3JCMb 4IUVA 2PVDB 3V7SA 4EMHA 2RM4A 4N4HA 2GFAA 3KUFA 3X24B 2K5IA 2XKOC 1V29B 3E9FA 4EMGA 2JTFA 4HCCA 1GXIE 2CYZB 2PUKB 3M9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYK A;  2R58 A;  5J26 A;  3PMI A;  1OZ3 A;  4A4H A;  2K3X A;  3MEW A;  4CRI A;  2RI2 A;  2RI3 A;  2RI5 A;  2LTO A;  2X4Y A;  3EAE A;  2LDM A;  3OS2 A;  2QQS A;  3ASK A;  2MWP A;  3PFS A;  4B9X A;  2QQR A;  2RHZ A;  2BIV A;  2G3R A;  2FHD A;  4LD6 A;  4E7H A;  4E7I A;  3MEU A;  4E7L A;  2HQE A;  3MEV A;  3L2V A;  2BKD N;  2GF7 A;  3QKJ A;  5IN1 A;  2RHX A;  4PL6 A;  1XNI A;  2B8A A;  2LCC A;  4C5H A;  4IUP A;  2GFU A;  2LVM A;  3GOX A;  2R5A A;  2L8D A;  1N27 A;  1SSF A;  3MET A;  3PNW C;  4FL6 A;  4IUU A;  4A4F A;  3OYM A;  3SD4 A;  2RHY A;  5FRO A;  2HQX A;  3LH0 A;  4E7K A;  3L42 A;  2CKK A;  3E9G A;  2IG0 A;  3P8H A;  4BD3 A;  4C5E A;  3OYB A;  1H3Z A;  2X35 A;  2EQU A;  5KE3 A;  2E6N A;  1OI1 A;  2RJE A;  4Q5W A;  3OA6 A;  3L2R A;  1G5V A;  2K3Y A;  4Z02 A;  2DIQ A;  3UT1 A;  1KHC A;  2LRQ A;  4IUQ A;  2M16 A;  2EFI A;  3MP1 A;  3ZEH A;  3OYF A;  4ZTJ A;  3S3M A;  2EQK A;  2YRV A;  4OVA A;  5KCO A;  5J39 A;  1OYX A;  2MWO A;  2O4X A;  4QQ6 A;  4RG2 A;  3OYC A;  3OQ5 A;  3FEO A;  2X4X A;  2R57 A;  5D6Y A;  3LYI A;  4QW2 A;  4QQD A;  3OYL A;  4BAC A;  3PMT A;  5KH6 A;  4A4E A;  3OYD A;  2RJF A;  3C4S A;  3MO8 A;  2RJD A;  4BE2 A;  4IKF A;  3UWN A;  4QVZ A;  2EQJ A;  4IUT A;  3OY9 A;  2D9T A;  2M0O A;  4A4G A;  4BE1 A;  1MHN A;  3L2W A;  1RI0 A;  3OS0 A;  2BUD A;  3S3O A;  3O8V A;  4II1 A;  1WJS A;  4QQG A;  1WGS A;  2VYT A;  3QJ6 A;  4EDU A;  3LX7 A;  4N4G A;  4C5I A;  3LGF A;  2P0K A;  3MEA A;  2NLU A;  2DIG A;  3FC3 A;  5FRM A;  2RHI A;  2XDP A;  3CEY A;  2E5Q A;  4HCZ A;  3DB4 A;  4C5G A;  2XK0 A;  3NTI A;  3OYE A;  3DB3 A;  2WAC A;  3S3N A;  3MP8 A;  3MP6 A;  3OS1 A;  3H6Z A;  3LLR A;  5KCH A;  3OMC A;  5IAY A;  3LGL A;  2RO0 A;  5KE2 A;  3OB9 A;  3DLM A;  5C6S A;  5FRN A;  2RHU A;  2L3R A;  3NTH A;  2JZ2 A;  2EQM A;  3F70 A;  4PLL A;  4IUR A;  4B9W A;  2F5K A;  4PLI A;  4N4I A;  2EKO A;  4BE0 A;  3QBY A;  3L2Q A;  5CIU A;  3FDR A;  4GY5 A;  5D6W A;  2O4X B;  4ZTF A;  4BDZ A;  2M1H A;  3ME9 A;  3OYN A;  3OYI A;  4L59 A;  3OYG A;  3OYH A;  3BDL A;  4E7J A;  1WJR A;  5M9O A;  2PQW A;  4X34 A;  3S6W A;  4BDY A;  4NS5 A;  1OZ2 A;  4FU6 A;  3QII A;  3FLG A;  3H8Z A;  5C0M A;  3NTK A;  3Q1J A;  5D6X A;  3OYA A;  2X4W A;  2RJC A;  2R5M A;  2DAQ A;  4UC4 A;  4IUV A;  3L2U A;  3P8D A;  2GFA A;  3KUF A;  4N4H A;  2L89 A;  3E9F A;  3OMG A;  2JTF A;  3OYJ A;  1WJQ A;  3M9Q A; 
#chains in the Genus database with same CATH topology
 3PMI A;  3MEW A;  2RI2 A;  4Z88 A;  1S72 A;  2EYZ A;  1IB8 A;  1VQP Q;  2QQR A;  3JCM W;  1K9M U;  2BIV A;  4ORZ A;  2QQ9 A;  1W6X A;  2LCC A;  1T0H A;  2DL4 A;  4IUP A;  1KSW A;  3TRE A;  3X28 B;  1FXX A;  1B07 A;  1Y96 A;  1NYG A;  3L1A A;  1IGU A;  2HQX A;  5IXF A;  2RK2 A;  2JS2 A;  1VQO T;  3SDZ A;  4XK8 E;  1B34 B;  1ARK A;  1C1A A;  2VXF A;  1KHC A;  2V1R A;  2CZ0 B;  4M78 E;  3OSV A;  2FYK A;  2XG8 D;  3A1P A;  3HFO A;  5HCK A;  4PKC C;  1X69 A;  2RQU A;  5FU6 B;  3O5Z A;  5LJ5 d;  2J7I A;  1PHT A;  1I8F A;  1S1N A;  4IUT A;  4AFU C;  3CCV T;  4OB0 B;  4NOY A;  2ESW A;  3OS5 A;  3S3O A;  1I4K 1;  1M2V B;  1M27 C;  1U8R A;  3GNF B;  2EJF A;  4D8K A;  1JJ2 P;  2LC4 A;  4PJO D;  2RH2 A;  2E41 A;  3EGU A;  1KD1 C;  2VXE A;  1W1F A;  1YIT Q;  3OMC A;  3M0U A;  2DTH A;  1BIA A;  5FRN A;  4E7Z A;  2V26 A;  3NTH A;  2EQM A;  3F70 A;  4RTW A;  4KUL A;  2OAU A;  3WXM B;  5GAM j;  4RTZ A;  3QZ9 B;  2HAX A;  5LJ5 f;  2RD1 A;  2NUT A;  5GMK h;  4JJD A;  1WJR A;  4PJM A;  1KQ2 A;  1KC8 R;  4LUE A;  3E1S A;  3PT9 A;  4C0Z A;  2PZ1 A;  4ZN3 A;  3ZFJ A;  3P8D A;  2FZG B;  1Y0M A;  3VYH B;  4OB3 B;  4LDX A;  2YLC A;  2ED1 A;  2ZPF B;  1ZUK A;  2HMA A;  4CRI A;  1HK9 A;  2DO3 A;  3CCM Q;  1G8X A;  2LDM A;  1CKA A;  3H0F A;  2OTJ T;  1PRL C;  3CCL T;  1JB0 E;  2MAM A;  5LJ3 g;  1QVF P;  3SEM A;  1X6B A;  3INZ A;  3E2U A;  4HCB A;  2DXC A;  5A0G A;  2QA4 A;  2HL3 A;  4RG8 A;  1FMK A;  2IG0 A;  2JXB A;  1M3A A;  2O01 E;  3JCM J;  4M77 B;  2IVW A;  3M0Q A;  3H0H A;  4ZTJ A;  4C8Q B;  5A0D A;  3X20 B;  3JB9 G;  3KFV A;  2JMC A;  2O4X A;  4QQ6 A;  4M75 E;  1SEM A;  1VQM T;  2QEX A;  4PJO A;  1PD0 A;  3UWN A;  1VQL Q;  4J7F A;  1GXI E;  4X9C A;  2KBT A;  4J9H A;  3EG1 A;  5A2Q E;  1IZ6 A;  2ZPE B;  4J83 A;  2OX7 A;  3PGG A;  1M9S A;  2XI9 A;  2DJZ A;  1SSH A;  4DOV A;  1E6H A;  2VVK A;  3MEA A;  2CS7 A;  4DOW A;  5DY9 A;  3JCM Q;  2XK0 A;  2KK4 A;  2W10 A;  2MK5 A;  1QWE A;  1ACM B;  2NUP A;  4XU2 A;  5KE2 A;  4JLI A;  2E1H A;  2AKL A;  4LDW A;  8AT1 B;  2K5L A;  3V7C A;  2F5K A;  3VS4 A;  5CVI A;  3CC4 A;  4JRK A;  2M02 A;  3JCM d;  3FDR A;  1YJ9 Q;  2E5K A;  4PJO C;  3PIP A;  1QQJ A;  4M78 B;  2AZV A;  3QHS A;  1VQK Q;  2YUQ A;  4FM4 B;  4IIM A;  1WXT A;  4XTZ A;  1PRM C;  2YWW A;  1FWZ A;  1TH7 A;  2HKQ B;  2GCX A;  1TTH B;  5KYU B;  1Q86 C;  3JB9 D;  4LDV A;  5D7U A;  4M7D A;  1BU1 A;  1R77 A;  3NGP A;  4M7A B;  2A3L A;  4JJB A;  1ABO A;  3PTA A;  3A5Z B;  4CC7 A;  5LJ5 e;  3QKJ A;  2J6O A;  3NHN A;  5IN1 A;  4FSS A;  3JCM f;  4HT8 A;  1WHG A;  3M53 A;  3CC4 T;  2A0F B;  4OMM A;  4ZN1 A;  2DLP A;  1QCN A;  1OPK A;  2KRO A;  5IT9 E;  1R0C B;  1D1A A;  2CRE A;  2RJE A;  3GF5 A;  4XU1 A;  1ZLM A;  1G3T A;  3CC2 Q;  1M3C A;  2VV5 A;  4M7D C;  3RR6 A;  1UGV A;  3OYL A;  4WCI A;  5A0L A;  2D8J A;  2D9T A;  2F5T X;  1VQ8 T;  2XU8 A;  1U1S A;  3O8V A;  1G3W A;  5KYX A;  2RQT A;  3CCQ A;  1NPR A;  2CZ1 B;  3QDF A;  2DMO A;  2K5F A;  5GAN h;  5FRM A;  3NTI A;  3CCS Q;  3M59 A;  3G71 T;  2KSS A;  2ZZD A;  3HRT A;  1TS9 A;  3EFR A;  4Y28 E;  5GAN 2;  4OMQ A;  1I5L A;  3VS6 A;  2O9S A;  1KD1 U;  4F17 A;  1AWW A;  1QCO A;  1X01 A;  3G6E Q;  1B34 A;  3CCE Q;  3I9Q A;  1WZO A;  4M75 B;  4ME7 A;  3CC7 A;  4XTY A;  4DBF A;  2DVE A;  4J9C A;  1BYM A;  1MMN A;  1H8K A;  3JB9 H;  1QLY A;  4QVC A;  2AZS A;  2HKN A;  2DXU A;  1VQN T;  3CCQ T;  2MF2 A;  1PC0 A;  2SEM A;  1UHF A;  4V2S A;  1KC8 C;  1OZ3 A;  1WYX A;  2OJ2 A;  1YNZ A;  3EAE A;  1AWO A;  3V7R A;  2DX1 A;  2RHZ A;  2IIM A;  1M2V A;  4RTT A;  5J3B A;  4E7I A;  4JRP A;  2BKD N;  2C0I A;  3M0S A;  4A53 A;  3HRU A;  4XAX B;  1UB4 A;  2R5A A;  4FYV B;  3QJY A;  2D0Q B;  4J6Y A;  2HCK A;  4OMF B;  2X9H A;  4KGX B;  1TU0 B;  2E3I A;  1BCO A;  3CC7 T;  1W2B A;  5FU6 C;  2L5Q A;  1K8A R;  5CKD A;  2MWO A;  2DJQ A;  1MMG A;  5I2M A;  3OYC A;  1MMA A;  4QT7 A;  1VQ9 A;  5CO7 A;  1VQP A;  3JCM e;  2KE9 A;  4KH0 B;  2F2W A;  1X6G A;  2ECZ A;  4XU0 A;  3PVL A;  4BE1 A;  1YHQ Q;  1JXO A;  2CUB A;  3OS0 A;  2RPN A;  1TWB A;  4L5G A;  2VYT A;  1WQ7 A;  4KUI A;  3CCJ Q;  3JCM c;  1FMV A;  1T3L A;  2DIG A;  2VGN A;  2Z0W A;  4CI0 C;  4PFZ A;  2RHU A;  2DYI A;  5I21 A;  1NYF A;  4PLI A;  4KH1 B;  2K2M A;  2XDD A;  3EFO B;  1G83 A;  5CIU A;  1YIJ Q;  3RDV A;  2F69 A;  1D1C A;  2P84 A;  4BDZ A;  2ABL A;  3M55 A;  3OYH A;  2CZ7 B;  3EH1 A;  3OBY A;  4M77 A;  1VQ9 T;  4FW2 A;  1PSE A;  3CBM A;  4C8Q A;  4KT0 E;  1HD3 A;  3JCM b;  4IUV A;  1GCP A;  1AWJ A;  4N4H A;  3I56 Q;  3X24 B;  2XKO C;  2JTF A;  4HCC A;  1NJI R;  2K79 A;  1YIT A;  1UDL A;  2E12 A;  4A4H A;  2A36 A;  4B6M A;  1Q86 U;  5GAM f;  3MEU A;  4RTX A;  3L2V A;  2DRK A;  2GF7 A;  1UFF A;  2RHX A;  2VC8 A;  2X3W D;  2GFU A;  3EH2 A;  2LVM A;  3URG A;  1ZSG A;  3MET A;  3OYM A;  1N27 A;  1YBY A;  4WF2 A;  4E7K A;  2PNI A;  4M77 C;  1A0N B;  1V76 A;  4VUB A;  2JJ9 A;  5CCA A;  2LJ3 A;  3VS1 A;  5I2S A;  5AT1 B;  1VQ7 Q;  2DTI A;  4C8Q C;  1GFC A;  1RAH B;  2V8K A;  2NUZ A;  4X1V A;  4DEY A;  1M2O A;  3OYF A;  2YRV A;  3LWH A;  2FZC B;  4WTO B;  4PJJ A;  3HP9 A;  2DL5 A;  4M78 A;  1UJY A;  2K57 A;  3CCM A;  1BBZ A;  1AHJ B;  2YDL A;  2AK5 A;  1T3S A;  1K73 R;  2M0O A;  1WQW A;  2AT1 B;  2DIL A;  2QI2 A;  3A98 A;  1ZQ1 A;  5KYU A;  2B86 A;  2YUN A;  4EDU A;  1ABQ A;  1VQ6 T;  1RLQ C;  2FO0 A;  3BW1 A;  3AHU A;  2CH4 A;  2HBP A;  4M7A A;  2NYS A;  2YT6 A;  1D0Z A;  2FPD A;  1AD5 A;  1VUB A;  2QGG A;  1K0X A;  1HYO A;  4IUR A;  2LCL A;  4J9D A;  4JS5 A;  2KRM A;  1WDX A;  3QBY A;  3CD6 T;  2DVJ A;  1VQL A;  4OGC A;  2Y4Y A;  3P8B B;  2LNV A;  1M4Z A;  4FYX B;  1Q7Y R;  5FW9 A;  2E4H A;  1KFZ A;  2WSF E;  3JCM g;  2X4W A;  1ZUY A;  1D1B A;  4MZP A;  4F7U A;  3L2U A;  5GJV B;  4HXJ A;  3OMG A;  3CMA Q;  4M7A C;  2KYM A;  2CUD A;  2H8H A;  1XQH A;  3BY7 A;  3G4S Q;  1U3O A;  2QAZ A;  2HSE B;  2QTV A;  5GAN 6;  3I55 Q;  1VQ5 Q;  2G3R A;  1NEG A;  5LJ3 h;  1YJW Q;  2QXF A;  2RQR A;  1KC8 U;  1ZA2 B;  1G2B A;  2B8A A;  1YJ9 A;  2EW3 A;  2XIC A;  1WLP B;  4HVV A;  1VQK A;  1W70 A;  8ATC B;  4NL2 A;  3WVE B;  4PJO G;  2PU9 B;  2FPE A;  4JUV A;  1D3B B;  4C92 D;  1OYX A;  3UPU A;  1X27 A;  4J6X A;  3OQ5 A;  2FEI A;  2O31 A;  2SRC A;  5LL6 S;  2X4J A;  4M75 A;  2FPF A;  4FIB A;  4A63 B;  1K8A C;  3EGD B;  2QDY B;  3T9N A;  2I0N A;  4C5I A;  2JS0 A;  2DER A;  3OBW A;  3CCR T;  3DB3 A;  1B7T A;  1P92 A;  2QYZ A;  3CC2 A;  5KCH A;  1KHI A;  5KYN A;  3JV3 A;  1PSF A;  4J9E A;  2C06 A;  4LE9 A;  3OW2 S;  1S72 T;  5CAI A;  3VS3 A;  4RKU E;  5D6W A;  5HKC A;  5GAO p;  4M75 C;  4M7D G;  1D0X A;  2OTL Q;  2M1H A;  3QUI A;  2CSI A;  1R8O B;  2EJ9 A;  2PVG B;  4PK4 A;  3JB9 F;  1M8V A;  2A28 A;  3NTK A;  5D6X A;  1HSQ A;  2W0Z A;  2ZPI B;  3M4Y A;  1YWO A;  1TUD A;  4DQ2 A;  1Q82 R;  2PUO B;  4MML A;  3R6O A;  2LCS A;  5FWB A;  3CCS A;  4O5V A;  1PG5 B;  1QP3 A;  2QDL A;  1JU5 C;  3HKS A;  4LD6 A;  3OW2 A;  1NJI C;  3QPH A;  2NWM A;  2EYX A;  4C92 A;  5EC7 A;  2LNH B;  3CCE A;  2GQI A;  3FB9 A;  2X3X D;  2VKN A;  2LT1 A;  4ANJ A;  2J06 A;  1GRI A;  4BD3 A;  2EQU A;  5AYF A;  2K3Y A;  7AT1 B;  4MDX A;  2O9V A;  4JLG A;  3ULR B;  2V8J A;  2EFI A;  3M4G A;  1UGQ B;  3EFO A;  5CQY A;  4JRQ A;  3SHW A;  3PVQ A;  2RMO A;  1PCX A;  1ZSZ B;  3OYD A;  5GMK i;  2FRY A;  3TU4 K;  4M7D D;  4QVZ A;  1B3Q A;  1RI9 A;  2QGF B;  3L2W A;  4ELY C;  1RAI B;  2KT1 A;  4C92 C;  2JVV A;  1OPL A;  4N4G A;  2RQV A;  2IPO B;  4E6R A;  2CP0 A;  1T0J A;  2FRW A;  1K73 C;  2JUF A;  2JT4 A;  3DB4 A;  4FW1 A;  3TCJ A;  4PNO A;  3EG9 A;  2EGC A;  4OB2 B;  1K76 A;  4AMC A;  2L3S A;  3CME Q;  1Y57 A;  2DZ9 A;  5GMK j;  2DL8 A;  2I2L A;  4GLM A;  4RTY A;  4OGE A;  3CCU Q;  1RUW A;  3KBG A;  1YI2 Q;  4R56 A;  1LPL A;  1YHQ A;  4L59 A;  4OB1 B;  2QA4 T;  1HXD A;  4XTV A;  3LWI A;  4QVD A;  3CCJ A;  1QMC A;  5HY6 A;  4RCC A;  1I81 A;  1NPP A;  2F2X A;  3G7Z A;  2EYY A;  5J26 A;  3RNJ A;  3EG0 A;  1Q7Y C;  1N8R C;  2KQW A;  1M1K R;  4GBQ A;  3HHT B;  2CGH A;  2FHD A;  2ZPG B;  1OX9 A;  2QEX T;  1JBM A;  1YIJ A;  1ZHI A;  2COW A;  3GLX A;  3GOX A;  2VB6 A;  2L8D A;  2J6K A;  1VQO Q;  3I5S A;  1YJN Q;  1D09 B;  5L23 A;  2G6F X;  1LVK A;  4BY6 C;  3V8J A;  1QVG A;  1YHQ T;  4BB7 A;  2HDA A;  4LN2 A;  2MMP A;  4IIO A;  1NZ9 A;  3HL8 A;  1EIF A;  2HD0 A;  3VS2 A;  2GNC A;  2OAW A;  3CCV Q;  2Y4X A;  2CP3 A;  2LQ8 A;  3C4S A;  2K7A A;  4BE2 A;  1JEG A;  2DD5 A;  2FVU A;  1RI0 A;  3J81 E;  5LJ5 h;  3GIB A;  1K8A U;  2P0P A;  2ROL A;  5FWC A;  1JRI A;  1SPK A;  2XMF A;  4M77 G;  3LGL A;  3EFS A;  1SHF A;  3JCM V;  3VUZ A;  2FB7 A;  2QAS A;  4C8Q G;  4MDW A;  4TVR A;  1IO6 A;  3CXC S;  2QK0 A;  3QDR B;  2L2P A;  2DL3 A;  2CP7 A;  4MMK A;  2Y90 A;  4OML A;  1AEY A;  1RAD B;  2HBW A;  2D0N A;  1O75 A;  2JW4 A;  5GMK m;  3J80 E;  3G1J A;  1NLP C;  2DF6 A;  4EMH A;  3KUF A;  1Z9Q A;  2JTE A;  1V29 B;  2PUK B;  1KIK A;  3VRY A;  3CPW A;  4FYW B;  4ZGD B;  2EAY A;  2RI3 A;  2RI5 A;  3C94 A;  4XQ3 A;  2OTJ Q;  2X4Y A;  1BI0 A;  3EGD A;  3CCL Q;  4ZGE B;  2BE9 B;  2HZY A;  1BI1 A;  1Q82 C;  4DBQ A;  4PJO E;  4A54 A;  3CXC A;  4PL6 A;  2MIO A;  3REB B;  4FL6 A;  1W2B S;  4LD9 K;  3SWN B;  2PTK A;  1VA7 A;  2LX9 A;  1U1T A;  1VYT A;  1EX4 A;  1BI3 A;  1NJI U;  3L2R A;  5GAO r;  3HSB A;  3UT1 A;  4M77 D;  3M58 A;  2LQW A;  1CSK A;  3ZEH A;  2KT8 A;  2EQK A;  3CMA A;  4C8Q D;  2V8I A;  1QP2 A;  1GBR A;  1VQM Q;  2KMT A;  2YHT A;  2R57 A;  1G3Y A;  4XTW A;  3I55 A;  1VQ5 A;  2KI7 A;  2EIF A;  2RJD A;  1YCS B;  4M7A G;  2EQJ A;  1YJW A;  3BE3 A;  1K1Z A;  2COY A;  4A4G A;  1MHN A;  3EHR A;  4XTU A;  5GAN j;  4Z89 A;  3JRZ A;  4QQG A;  1RAC B;  3QJ6 A;  4PJN A;  2MOX A;  1VQ4 A;  1C0M A;  2GGR A;  3CPF A;  1WI7 A;  4M7D E;  1SKU B;  1O9S A;  4HKE A;  2QQB A;  1WX6 A;  2BTT A;  1K73 U;  1KQS S;  4N4I A;  4F7U G;  1Y71 A;  1N5Z A;  2KRS A;  5LJ5 g;  1E7O A;  4M78 D;  1Q81 R;  1KJW A;  5FU7 B;  3BDL A;  1H92 A;  3C0C A;  4FU6 A;  3QII A;  4ESR A;  2FG0 A;  3H8Z A;  3JCM h;  2LP5 A;  9ATC B;  2R5M A;  2DAQ A;  2KVQ G;  2LQN A;  1IXD A;  2JM9 A;  2JN0 A;  5GAM d;  2HSP A;  1VQ4 T;  2DET A;  3OS2 A;  1QCF A;  4M7A D;  1VQP T;  3QWX X;  2ZPB B;  2MPX C;  1KG1 A;  3CBO A;  3CC4 Q;  1Q7Y U;  1GCQ A;  1KQS A;  1OOT A;  2OTL A;  1M1K C;  2DK3 A;  4HT9 A;  2CDT A;  4O6J A;  3OYB A;  4X9D A;  4M75 G;  1G5V A;  3EGX B;  5CR2 A;  3EG2 A;  3E19 A;  1OU9 A;  2DKG A;  2M16 A;  5CQX A;  4E47 A;  3N5B B;  1UJ0 A;  2XID A;  4XU3 A;  1G3S A;  3HPW A;  5J39 A;  2BE7 D;  5GAN 5;  1BK2 A;  3QWY A;  4QW2 A;  1XJW B;  3OYY A;  2DBK A;  3JSC A;  2DRM A;  3MO8 A;  1FX7 A;  1VQ8 Q;  4LUD A;  3AT1 B;  4M4Z A;  1GCQ C;  2LJ1 A;  1SF9 A;  2GQV A;  4II1 A;  1QWF A;  3M0P A;  4E7S A;  1SG5 A;  2KDS A;  1UEC A;  3QSU A;  3G71 Q;  2CSQ A;  4PJO B;  2XDP A;  1BKB A;  1W2B P;  3MKD A;  3LLR A;  5FLX E;  4CC4 B;  1YIT T;  4B9W A;  4D6W A;  2J05 A;  1N6A A;  4JJC A;  4PJO F;  4D8D A;  3VUB A;  3OYN A;  3JB9 J;  4OF1 A;  1X6O A;  4FT2 A;  1IHW A;  4JS4 A;  4M75 D;  2RJC A;  2DL7 A;  1VQN Q;  3CCQ Q;  5GJW B;  4C0D B;  4DBH A;  4C5E A;  4C92 G;  4RTV A;  1KK7 A;  4M78 C;  5KYW B;  4A4K A;  2DNU A;  2MYS A;  3CME A;  2AIR B;  4PFP A;  5GAN 4;  3ASK A;  4B9X A;  2CP6 A;  1BIB A;  3CCM T;  4CC3 A;  3PE0 A;  2E65 A;  4FSX A;  4NL3 A;  2VUB A;  1N8R R;  2XD0 A;  4HVU A;  3L2Z A;  1YI2 A;  1N9R A;  4PJL A;  1NBE B;  3R6N A;  1Q82 U;  4DEX A;  2DYB A;  3OSS C;  4LXC A;  3VYG A;  4Q5W A;  3CC7 Q;  2CZ6 B;  2M0Y A;  2EWN A;  2RF0 A;  1JJ2 A;  3BDU A;  2YUP A;  4JDS A;  1WHM A;  2DEQ A;  4M7D F;  2X4X A;  1SHG A;  1OEB A;  3VKI A;  5IXB A;  1HJD A;  2X51 A;  3JAM E;  4KGZ B;  3CME T;  3A8M B;  4Y92 A;  1VQL T;  2E10 A;  2WSC E;  4M77 E;  1VQO A;  1YJN A;  4R55 A;  4C8Q E;  2NLU A;  5GAO m;  4KRT A;  1QKX A;  4C5G A;  1M90 R;  2K4Y A;  3A8G B;  4LNP A;  5GAM e;  1UEB A;  1JQQ A;  2AHJ B;  3OB9 A;  5ECA A;  3DLL A;  2DD4 A;  4E2F B;  1OQK A;  5IHN A;  3SWN A;  3CCV A;  1OU8 A;  1UGR B;  4QKU A;  4GY5 A;  5CK9 A;  1VQ9 Q;  2DZC A;  1QVF A;  3ME9 A;  1ZBX A;  1YJ9 T;  4J9F A;  2PQW A;  4OP0 A;  5M9O A;  5GAM h;  1K4U S;  4AT1 B;  3RKY A;  1VQK T;  3FLG A;  3OYA A;  2A7Y A;  2RN8 A;  3JCM X;  1PM3 A;  1TUG B;  2MI6 A;  1N9S A;  1Q81 C;  1YJN T;  3OYJ A;  3WVD B;  5LJ3 j;  3OYK A;  2VGM A;  1Y7X A;  2DA9 A;  4JZ4 A;  1F1B B;  5IH2 A;  4JRI A;  3KXT A;  5I11 A;  3LH5 A;  4E7H A;  3TSW A;  1BB9 A;  3SWN C;  1RAB B;  1Z9Z A;  1MV3 A;  1XNI A;  3CQT A;  4C0F A;  1WXU A;  1SSF A;  4A4F A;  1RL2 A;  3LH0 A;  2CKK A;  2AKK A;  4FCY A;  3P8H A;  2EGE A;  3JCM P;  2DPP B;  3RBB B;  1M1K U;  1BCM A;  2LRQ A;  1YCY A;  4M7A E;  1VIF A;  3CC2 T;  3GNG A;  5KCO A;  5GMK e;  2VAS A;  3MJX A;  4FT4 A;  5KYY B;  3FEO A;  2OTJ A;  1EZZ B;  4ZGJ B;  4BAC A;  3CCL A;  3PMT A;  5KH6 A;  3G6E A;  1XOV A;  1M3B A;  2E70 A;  3GPL A;  5GAN d;  2EJG A;  2V1Q A;  1VQ6 Q;  1I1J A;  1EFN A;  1TXQ A;  1MNE A;  1Q95 G;  2DM1 A;  1UGP B;  2RA2 A;  2XDB A;  3EHQ A;  2P0K A;  1WHJ A;  1WIE A;  1X2Q A;  2P4T A;  2RNA A;  1QVP A;  2E5Q A;  4JZ3 A;  3CEY A;  4BI8 B;  4F7U E;  3M0R A;  2YRC A;  2F1L A;  5IAY A;  4F04 B;  4AFQ C;  5C6S A;  2DTO A;  3CCS T;  4DBR A;  3RKX A;  4BI3 A;  3CD6 Q;  1VQM A;  2BZX A;  1UE9 A;  2L3P A;  2ZAE A;  2BZ8 A;  5FU7 C;  4N0A A;  3X26 B;  1PD1 A;  3H0I A;  2JTM A;  2LQK A;  2QQA A;  2YLB A;  3OYI A;  1K9M R;  3OYG A;  3EGX A;  5GAN f;  2WSE E;  4EMK B;  1MV0 B;  4NS5 A;  4F16 A;  3G6E T;  3CCE T;  1M5Q 1;  1GBQ A;  3VS7 A;  2PVD B;  3V7S A;  2K5I A;  3E9F A;  4EMG A;  1FMW A;  1E6G A;  3M9Q A;  4JPB W;  2JMA A;  1J3T A;  3UF4 A;  1K0S A;  2DBM A;  2QQS A;  2MWP A;  3PFS A;  2RB6 A;  1NLO C;  4MZT A;  1R0B G;  4EIK A;  2KRN A;  4J8O A;  4E7L A;  1QVG S;  5GAM g;  4N0A C;  4P5N A;  4C0G A;  2JM8 A;  4OMO A;  1M30 A;  4IUU A;  1NEB A;  3SD4 A;  2L0A A;  1LOJ A;  3THK A;  3MHX A;  4AFZ C;  5GMK l;  4J9G A;  4M77 F;  3A8O B;  4LDU A;  5KE3 A;  2D1X A;  4C8Q F;  2KXD A;  1YP5 A;  3MP1 A;  4OVA A;  2H3E B;  2EYQ A;  3ER0 A;  3REA B;  1I5O B;  3RIR A;  5EG2 A;  4RG2 A;  4J7I A;  1KQ1 A;  1WA7 A;  1VOM A;  4JJN K;  4Z8A A;  3IQL A;  1WFW A;  3OW2 P;  1WHL A;  1QW1 A;  1TOV A;  1W4S A;  1XTD A;  2L3Q A;  2OI3 A;  1H64 1;  2BUD A;  3V8K A;  3NMZ C;  2C0T A;  3GP8 A;  2EGA A;  3CCR Q;  3LX7 A;  2ZGW A;  2JNG A;  2VWF A;  5KYW A;  3I56 A;  4PFO A;  3CCJ T;  2EBP A;  2XHC A;  1MUZ A;  3MP6 A;  3OS1 A;  3H6Z A;  1H3Z A;  1S72 Q;  2L3R A;  1UUE A;  4RUG A;  4CC2 A;  4M78 F;  5DLO A;  3L2Q A;  1M90 C;  1M1G A;  1MND A;  1VQ8 A;  4ELZ C;  1X2K A;  1NG2 A;  2P0Q A;  1YIJ T;  1M1F A;  4C92 E;  4E7J A;  3S6W A;  1TUC A;  1VQ7 A;  1VYU A;  1Y07 A;  3CPW S;  1JO8 A;  4C0D C;  3SB2 A;  3Q1J A;  3V8L A;  2EVR A;  2ZPH B;  3G71 A;  1ZUU A;  1AWX A;  2MCN A;  2LT4 A;  1AT1 B;  1ZX6 A;  4M7A F;  2R58 A;  3I56 T;  2EKH A;  5DM7 R;  2K3X A;  2GTO A;  2FL7 A;  1RAE B;  3VRZ A;  3FIF A;  1Q81 U;  4HA8 A;  4J5Y A;  4F7U B;  2HQE A;  5GAN e;  4C5H A;  2A37 A;  1D0Y A;  5I22 A;  1D3B A;  2QTX A;  2ENM A;  3J7A F;  2RHY A;  5FRO A;  3L42 A;  3TEE A;  3E9G A;  2QG9 B;  4RTU A;  2E6N A;  3OA6 A;  4Z02 A;  1VQN A;  1ZA1 B;  3GBQ A;  1VQ7 T;  3H9N A;  3MCA B;  4F7U F;  5CKF A;  3X25 B;  3S3M A;  2C0O A;  4L6V 5;  2E3H A;  2K2V A;  2DXB A;  1CKB A;  1WHK A;  5D6Y A;  2KNB B;  3FJP A;  1OUL A;  4QQD A;  4AFS C;  1H3H A;  2ED0 A;  5LJ5 j;  2K6D A;  4M78 G;  3VJP A;  3OY9 A;  2CP2 A;  3M5A A;  4J6W A;  1WNL A;  2O2O A;  2A08 A;  3H41 A;  1WGS A;  5CKB A;  1QVG P;  3CBP A;  3UDC A;  1YN8 A;  4GLK A;  2RHI A;  1Y96 B;  2WAC A;  3JB9 I;  3G4S A;  2RO0 A;  4HCK A;  1X43 A;  2K3B A;  2LZ6 B;  4PLL A;  3M56 A;  3TSZ A;  1OX8 A;  3QYG B;  4KGV B;  5IHI A;  4BE0 A;  2JOY A;  2D6F A;  5IHK A;  2KAF A;  4M75 F;  2EQI A;  2QA4 Q;  2FZK B;  3QYH B;  3NFC A;  5GAN 7;  1AOJ A;  5HK3 A;  3VS5 A;  1VYV A;  3QG1 A;  5C0M A;  1DJ7 B;  1TSF A;  5KYY A;  3RMQ A;  1NM7 A;  4J9B A;  1K9M C;  2KYB A;  5LJ3 d;  2COZ A;  2P4R A;  3VS0 A;  3CMA T;  4YTL A;  2LTO A;  1NE8 A;  2QEX Q;  1WXB A;  3G4S T;  4BI4 A;  1X75 C;  4MZM A;  3I55 T;  1VQ5 T;  3RER A;  2YSQ A;  4HVW A;  2DXT A;  4Y91 A;  1YJW T;  3PNW C;  3ZL7 C;  1PKT A;  3UA7 A;  1UGS B;  2F2V A;  4DA4 A;  1RAA B;  2CT4 A;  2YUO A;  4BUG A;  1ZSZ A;  1LNX A;  2NUT B;  3M0T A;  1OI1 A;  1U06 A;  2DIQ A;  3RMS A;  3QO3 A;  1MGQ A;  3CPW P;  4C92 B;  5LJ3 f;  5DLQ E;  4KBM B;  2J6F A;  3D7S B;  2HEQ A;  4ZNX A;  1N8R U;  2LJ0 A;  3LYI A;  3TQ7 P;  4EMK A;  2RJF A;  3CXC P;  4IKF A;  1IGQ A;  2ZCF B;  1WPY A;  5GAO n;  1KD1 R;  1LCK A;  2DE0 X;  1IHV A;  1WJS A;  4FYY B;  4C92 F;  2HNI A;  1YFN A;  3FRN A;  4RMO A;  3LGF A;  2M9U A;  4K11 A;  5GAN 3;  1ZSZ C;  5GAN g;  3DKM A;  3A8H B;  3S3N A;  1QKW A;  5GAN 8;  1LJO A;  3EG3 A;  4ATO A;  2JZ2 A;  1C6V X;  1IRE B;  1OV3 A;  4J9I A;  3A8L B;  3TVT A;  2CT3 A;  1RLP C;  2EKO A;  2CP5 A;  4RCB A;  4EMK C;  1TG0 A;  2PVO B;  3M54 A;  2O4X B;  1U5S A;  3EG9 B;  3SFM A;  3C12 A;  1BI2 A;  1SRL A;  2OTL T;  3U23 A;  1M8M A;  1OZ2 A;  3M57 A;  4XTX A;  1VQ6 A;  2E6Z A;  1FYN A;  1M90 U;  1AZG B;  5GAO l;  4UC4 A;  1WHH A;  3RES A;  1WJQ A;  2O88 A;  2EYW A;  2L89 A;  2LX7 A;  1PNJ A;  2KY9 A;  3C95 A;  4AG1 C;  4BY6 B;  1RAF B;  3CD6 A;  2NUP B;  3HFN A;  2E64 A;  3RKW A;  3MEV A;  2DEU A;  2H3J A;  1JJ2 S;  1K9A A;  3MPU B;  2EPD A;  1MMD A;  3QZ5 B;  4LDY A;  3I5R A;  4OMP A;  2YRD A;  4AG2 C;  2X35 A;  5GAO q;  1AVZ C;  2GTJ A;  4IUQ A;  2LMJ A;  2KGT A;  3PIO A;  3CCU A;  3RUX A;  1ZBJ A;  1SRM A;  2M51 A;  4A4E A;  4M7D B;  1YWP A;  1KQS P;  2K9G A;  2D8H A;  2BZY A;  1VIE A;  1I07 A;  3FJ5 A;  3I35 A;  4OMN A;  2DFU A;  3LW5 E;  1GL5 A;  4EPC A;  6AT1 B;  1UG1 A;  1UTI A;  3BFM A;  3UA6 A;  2HL5 C;  3FC3 A;  2ATC B;  1RAG B;  4HCZ A;  3OYE A;  1PWT A;  2RQW A;  5LJ3 e;  2RK1 A;  3MP8 A;  3QXE B;  3DLM A;  3HRS A;  5L8R E;  4F14 A;  1QVF S;  3NPF A;  3VU3 C;  2GBQ A;  2KEA A;  2KXC A;  2CH4 W;  1UHC A;  4R0K A;  3HTR A;  3UAT A;  5HK0 A;  4KUD K;  1V1C A;  3ZBD A;  1AZE A;  2YXY A;  5CKH A;  4ZTF A;  3CCU T;  1Q86 R;  2ROT A;  2HQH A;  1GFD A;  1IRX A;  4X34 A;  4BDY A;  1YI2 T;  2KR3 A;  3CCR A;  3VV0 A;  1I0C A;  1PKS A;  2RM4 A;  2GFA A;  5KYX B;  1JXM A;  5CKE A;  1VQ4 Q;  2CYZ B; 
#chains in the Genus database with same CATH homology
 1YIT A;  2E12 A;  3PMI A;  4A4H A;  3CPW A;  3MEW A;  2EAY A;  2RI2 A;  4ZGD B;  1S72 A;  2RI3 A;  2RI5 A;  3C94 A;  4XQ3 A;  2X4Y A;  1BI0 A;  2QQS A;  4ZGE B;  2MWP A;  3PFS A;  2QQR A;  3JCM W;  1Q86 U;  2BIV A;  2RB6 A;  1K9M U;  4MZT A;  1BI1 A;  5GAM f;  1Q82 C;  3MEU A;  2QQ9 A;  4J8O A;  3L2V A;  4E7L A;  1QVG S;  2GF7 A;  4PJO E;  5GAM g;  4A54 A;  2RHX A;  4N0A C;  4P5N A;  4PL6 A;  2LCC A;  2VC8 A;  3CXC A;  4IUP A;  2GFU A;  4C0G A;  2LVM A;  3URG A;  3TRE A;  3X28 B;  1FXX A;  3MET A;  3OYM A;  1N27 A;  4IUU A;  1Y96 A;  1YBY A;  4FL6 A;  4WF2 A;  3SWN B;  3SD4 A;  1W2B S;  1LOJ A;  2HQX A;  3L1A A;  3MHX A;  4M77 C;  5GMK l;  4E7K A;  2RK2 A;  2LX9 A;  4M77 F;  4VUB A;  1U1T A;  3A8O B;  4LDU A;  3SDZ A;  1BI3 A;  4XK8 E;  5CCA A;  1VQO T;  1NJI U;  5I2S A;  5KE3 A;  2DTI A;  4C8Q C;  1B34 B;  4C8Q F;  3L2R A;  5GAO r;  2V8K A;  3HSB A;  2VXF A;  3UT1 A;  1KHC A;  4M77 D;  3M58 A;  3MP1 A;  3ZEH A;  3OYF A;  2CZ0 B;  4M78 E;  2EQK A;  2YRV A;  4OVA A;  4C8Q D;  3CMA A;  3LWH A;  3OSV A;  2EYQ A;  1QP2 A;  2FYK A;  2V8I A;  2XG8 D;  3ER0 A;  3HFO A;  2KMT A;  3HP9 A;  3RIR A;  4M78 A;  4PKC C;  4RG2 A;  2K57 A;  2YHT A;  4J7I A;  5EG2 A;  5FU6 B;  2R57 A;  1KQ1 A;  3CCM A;  1G3Y A;  4XTW A;  3I55 A;  4JJN K;  1VQ5 A;  2EIF A;  5LJ5 d;  2RJD A;  1AHJ B;  4M7A G;  1QW1 A;  2EQJ A;  1I8F A;  4IUT A;  3CCV T;  1YJW A;  1W4S A;  1XTD A;  4OB0 B;  2M0O A;  4NOY A;  4A4G A;  1MHN A;  1WQW A;  1H64 1;  4XTU A;  2QI2 A;  3OS5 A;  5GAN j;  3S3O A;  2BUD A;  1ZQ1 A;  3V8K A;  1I4K 1;  3JRZ A;  4QQG A;  3GP8 A;  3QJ6 A;  4EDU A;  1U8R A;  3LX7 A;  2ZGW A;  1VQ6 T;  2JNG A;  3GNF B;  3BW1 A;  3I56 A;  2EJF A;  1VQ4 A;  3AHU A;  2LC4 A;  4PJO D;  2HBP A;  2RH2 A;  3CCJ T;  4M7A A;  2XHC A;  2E41 A;  1KD1 C;  2VXE A;  3MP6 A;  3OS1 A;  3CPF A;  3H6Z A;  3OMC A;  1H3Z A;  1VUB A;  2DTH A;  1BIA A;  4M7D E;  5FRN A;  2L3R A;  3NTH A;  1O9S A;  2EQM A;  3F70 A;  2QQB A;  4HKE A;  4IUR A;  4KUL A;  2OAU A;  2LCL A;  1K73 U;  3WXM B;  1KQS S;  4N4I A;  4M78 F;  5GAM j;  4JS5 A;  5DLO A;  4F7U G;  3QBY A;  3CD6 T;  3L2Q A;  1M90 C;  3QZ9 B;  2HAX A;  1M1G A;  5LJ5 f;  1Y71 A;  4ELZ C;  1VQ8 A;  4OGC A;  2Y4Y A;  1VQL A;  2RD1 A;  5GMK h;  2P0Q A;  3P8B B;  5LJ5 g;  4M78 D;  1YIJ T;  1M1F A;  2LNV A;  5FU7 B;  3BDL A;  4C92 E;  1WJR A;  4E7J A;  3S6W A;  1KQ2 A;  1M4Z A;  1VQ7 A;  1VQ6 A;  1Y07 A;  3QII A;  4FU6 A;  3CPW S;  3E1S A;  3H8Z A;  3PT9 A;  4C0D C;  3JCM h;  4C0Z A;  3SB2 A;  3Q1J A;  2WSF E;  3JCM g;  3V8L A;  2X4W A;  2R5M A;  2DAQ A;  4ZN3 A;  2KVQ G;  5CKE A;  4MZP A;  4F7U A;  3ZFJ A;  2ZPH B;  3L2U A;  3G71 A;  3P8D A;  2LT4 A;  3OMG A;  3VYH B;  4OB3 B;  2JN0 A;  4LDX A;  4M7A C;  5GAM d;  2YLC A;  4M7A F;  2R58 A;  3I56 T;  2ZPF B;  5DM7 R;  2K3X A;  1XQH A;  4CRI A;  1HK9 A;  2FL7 A;  3OYI A;  3BY7 A;  1VQ4 T;  2DO3 A;  3OS2 A;  2LDM A;  5GAN 6;  3FIF A;  4M7A D;  2G3R A;  1Q81 U;  2OTJ T;  5LJ3 h;  4HA8 A;  4J5Y A;  3CCL T;  1JB0 E;  2MAM A;  2QXF A;  2HQE A;  2ZPB B;  4F7U B;  5LJ3 g;  3CBO A;  1VQP T;  1KG1 A;  1KC8 U;  3INZ A;  1Q7Y U;  5GAN e;  1KQS A;  4HCB A;  2B8A A;  4C5H A;  1YJ9 A;  2DXC A;  1D3B A;  2QTX A;  5A0G A;  2OTL A;  1M1K C;  2QA4 A;  2XIC A;  2DK3 A;  4HT9 A;  1VQK A;  3J7A F;  2RHY A;  4RG8 A;  5FRO A;  3L42 A;  3TEE A;  4NL2 A;  3E9G A;  2IG0 A;  4O6J A;  2O01 E;  3OYB A;  4X9D A;  3WVE B;  4PJO G;  4M75 G;  2E6N A;  1G5V A;  3OA6 A;  2PU9 B;  4Z02 A;  4M77 B;  3JCM J;  1VQN A;  2IVW A;  5CR2 A;  3E19 A;  4JUV A;  1VQ7 T;  2DKG A;  2M16 A;  3MCA B;  5CKF A;  5CQX A;  3X25 B;  4E47 A;  4F7U F;  4ZTJ A;  3N5B B;  1D3B B;  2XID A;  4XU3 A;  4C8Q B;  5A0D A;  3X20 B;  1G3S A;  3S3M A;  3JB9 G;  4C92 D;  4L6V 5;  3HPW A;  2K2V A;  5J39 A;  1OYX A;  3UPU A;  2O4X A;  4J6X A;  4QQ6 A;  2DXB A;  3OQ5 A;  4M75 E;  5GAN 5;  5D6Y A;  3FJP A;  4QW2 A;  4QQD A;  1VQM T;  5LL6 S;  2QEX A;  3OYY A;  3JSC A;  3MO8 A;  4PJO A;  2X4J A;  1FX7 A;  4M75 A;  3UWN A;  4J7F A;  4X9C A;  5LJ5 j;  3VJP A;  4FIB A;  4M78 G;  3OY9 A;  1K8A C;  5A2Q E;  3M5A A;  1IZ6 A;  1WNL A;  2ZPE B;  4J6W A;  4J83 A;  2GQV A;  2QDY B;  3PGG A;  4II1 A;  1M9S A;  2XI9 A;  3T9N A;  1WGS A;  5CKB A;  2DJZ A;  2KDS A;  4C5I A;  3CBP A;  4DOV A;  3QSU A;  3MEA A;  2CS7 A;  3OBW A;  4DOW A;  3CCR T;  3UDC A;  5DY9 A;  4PJO B;  4GLK A;  2RHI A;  2XDP A;  3JCM Q;  1BKB A;  1Y96 B;  2XK0 A;  3DB3 A;  1P92 A;  2KK4 A;  2WAC A;  3JB9 I;  3CC2 A;  5KCH A;  3LLR A;  3G4S A;  4XU2 A;  2RO0 A;  5FLX E;  5KE2 A;  1KHI A;  4JLI A;  2E1H A;  4LDW A;  1PSF A;  1YIT T;  4PLL A;  4B9W A;  3M56 A;  2C06 A;  2K5L A;  3V7C A;  4D6W A;  3OW2 S;  2F5K A;  1S72 T;  5CVI A;  3CC4 A;  5CAI A;  4JRK A;  3QYG B;  4BE0 A;  2D6F A;  2JOY A;  4RKU E;  1N6A A;  3JCM d;  3FDR A;  5D6W A;  5HKC A;  5GAO p;  4M75 C;  3PIP A;  4PJO F;  4M7D G;  2KAF A;  4M75 F;  4M78 B;  4PJO C;  3VUB A;  2M1H A;  3QHS A;  3QYH B;  3OYN A;  3JB9 J;  4OF1 A;  1X6O A;  3QUI A;  4FM4 B;  3NFC A;  4XTZ A;  5GAN 7;  4FT2 A;  5HK3 A;  1FWZ A;  1R8O B;  2EJ9 A;  2PVG B;  1TH7 A;  4JS4 A;  3QG1 A;  4M75 D;  3JB9 F;  1M8V A;  5C0M A;  3NTK A;  5D6X A;  1DJ7 B;  2RJC A;  3M4Y A;  2GCX A;  2ZPI B;  3RMQ A;  4DQ2 A;  1Q86 C;  4C0D B;  2PUO B;  4LDV A;  5LJ3 d;  4MML A;  4C5E A;  3R6O A;  4C92 G;  3JB9 D;  4M7D A;  3CCS A;  4O5V A;  4M78 C;  4A4K A;  3CMA T;  4YTL A;  2LTO A;  1QP3 A;  3CME A;  5GAN 4;  4M7A B;  2A3L A;  3ASK A;  1NE8 A;  4B9X A;  3HKS A;  3PTA A;  3A5Z B;  4LD6 A;  1BIB A;  4BI4 A;  5LJ5 e;  3G4S T;  3CCM T;  1X75 C;  4MZM A;  3I55 T;  1VQ5 T;  2E65 A;  3RER A;  4FSX A;  3QKJ A;  2VUB A;  4NL3 A;  3OW2 A;  1NJI C;  3QPH A;  5IN1 A;  2DXT A;  4Y91 A;  3JCM f;  4HT8 A;  1YJW T;  2XD0 A;  3L2Z A;  3M53 A;  4C92 A;  1YI2 A;  3CC4 T;  1N9R A;  3PNW C;  3CCE A;  3FB9 A;  1UGS B;  4DA4 A;  1Q82 U;  2LT1 A;  4LD9 K;  4ZN1 A;  3OSS C;  4BD3 A;  4BUG A;  1LNX A;  2EQU A;  3VYG A;  5IT9 E;  4Q5W A;  1OI1 A;  2RJE A;  5AYF A;  2K3Y A;  2CZ6 B;  3GF5 A;  4XU1 A;  2DIQ A;  2EWN A;  1JJ2 A;  1G3T A;  3RMS A;  4MDX A;  4JLG A;  3QO3 A;  2V8J A;  2EFI A;  3BDU A;  3M4G A;  1MGQ A;  1UGQ B;  4C92 B;  4JDS A;  5LJ3 f;  2VV5 A;  2DEQ A;  5DLQ E;  4M7D C;  4M7D F;  4KBM B;  5CQY A;  4JRQ A;  2X4X A;  1N8R U;  3LYI A;  3OYL A;  3VKI A;  4EMK A;  3OYD A;  5GMK i;  2RJF A;  3TU4 K;  4IKF A;  4M7D D;  5A0L A;  4QVZ A;  3JAM E;  2D9T A;  2ZCF B;  1WPY A;  3CME T;  2F5T X;  3A8M B;  3L2W A;  1VQL T;  4ELY C;  5GAO n;  1VQ8 T;  2E10 A;  2XU8 A;  1U1S A;  3O8V A;  1G3W A;  4C92 C;  1WJS A;  2JVV A;  2WSC E;  4M77 E;  2HNI A;  4C92 F;  1VQO A;  3CCQ A;  1YJN A;  1NPR A;  2CZ1 B;  4N4G A;  3FRN A;  4RMO A;  4R55 A;  2K5F A;  3LGF A;  4C8Q E;  2NLU A;  2M9U A;  5GAN 3;  5GAN h;  5FRM A;  5GAN g;  5GAO m;  1K73 C;  3DKM A;  2JUF A;  3A8H B;  3DB4 A;  4C5G A;  3S3N A;  3NTI A;  3TCJ A;  4PNO A;  2K4Y A;  3A8G B;  3M59 A;  3G71 T;  5GAM e;  1LJO A;  5GAN 8;  2KSS A;  1UEB A;  2AHJ B;  3OB9 A;  4OB2 B;  3DLL A;  4ATO A;  2DD4 A;  2ZZD A;  3HRT A;  2JZ2 A;  3EFR A;  1IRE B;  4Y28 E;  2DZ9 A;  3A8L B;  5GMK j;  5GAN 2;  2I2L A;  1I5L A;  1KD1 U;  3SWN A;  2EKO A;  3CCV A;  4OGE A;  4RCB A;  4EMK C;  1UGR B;  3KBG A;  1X01 A;  4GY5 A;  2PVO B;  3M54 A;  5CK9 A;  2DZC A;  2O4X B;  1K9M C;  4R56 A;  1QVF A;  1B34 A;  3ME9 A;  3SFM A;  1YHQ A;  4L59 A;  1ZBX A;  1BI2 A;  3C12 A;  4OB1 B;  1YJ9 T;  5M9O A;  2PQW A;  4OP0 A;  5GAM h;  2OTL T;  1OZ2 A;  2QA4 T;  3M57 A;  4XTX A;  4M75 B;  4ME7 A;  3RKY A;  3CC7 A;  1HXD A;  4XTY A;  2E6Z A;  3FLG A;  1VQK T;  4XTV A;  1M90 U;  3OYA A;  2A7Y A;  2DVE A;  3JCM X;  1BYM A;  5GAO l;  3LWI A;  3JB9 H;  4UC4 A;  4QVD A;  4QVC A;  3CCJ A;  2MI6 A;  3RES A;  5HY6 A;  4RCC A;  2DXU A;  1WJQ A;  1I81 A;  1NPP A;  1N9S A;  2L89 A;  1Q81 C;  1VQN T;  3CCQ T;  1YJN T;  2MF2 A;  3OYJ A;  3WVD B;  5LJ3 j;  2KY9 A;  3OYK A;  4V2S A;  2VGM A;  1Y7X A;  3G7Z A;  5J26 A;  1KC8 C;  1Q7Y C;  1OZ3 A;  2KQW A;  1N8R C;  3C95 A;  4BY6 B;  3EAE A;  4JRI A;  3KXT A;  3V7R A;  3CD6 A;  3HHT B;  2CGH A;  2RHZ A;  2FHD A;  2ZPG B;  3HFN A;  2E64 A;  5J3B A;  3RKW A;  4E7H A;  4E7I A;  3MEV A;  2QEX T;  3SWN C;  2BKD N;  1JBM A;  2H3J A;  4JRP A;  1YIJ A;  1XNI A;  1ZHI A;  1JJ2 S;  3GLX A;  4A53 A;  4C0F A;  3HRU A;  3GOX A;  4XAX B;  1UB4 A;  2R5A A;  2L8D A;  1SSF A;  4A4F A;  3QZ5 B;  1RL2 A;  3LH0 A;  4LDY A;  3QJY A;  2CKK A;  2D0Q B;  4J6Y A;  4OMF B;  3P8H A;  4BY6 C;  3V8J A;  2X35 A;  5GAO q;  1YHQ T;  1QVG A;  4BB7 A;  3JCM P;  2DPP B;  1M1K U;  2LRQ A;  4IUQ A;  1YCY A;  3CC7 T;  4M7A E;  2MMP A;  1VIF A;  1W2B A;  1NZ9 A;  5FU6 C;  2L5Q A;  3CC2 T;  3GNG A;  3HL8 A;  5KCO A;  5GMK e;  5CKD A;  1EIF A;  2HD0 A;  2MWO A;  4FT4 A;  3PIO A;  3OYC A;  5I2M A;  3CCU A;  3FEO A;  2OTJ A;  3RUX A;  4ZGJ B;  4BAC A;  1VQ9 A;  5CO7 A;  3PMT A;  1VQP A;  5KH6 A;  4A4E A;  3CCL A;  4M7D B;  2Y4X A;  2LQ8 A;  3C4S A;  3G6E A;  3JCM e;  4BE2 A;  1XOV A;  2E70 A;  4XU0 A;  3GPL A;  4BE1 A;  5GAN d;  2DD5 A;  2FVU A;  2EJG A;  1VIE A;  1RI0 A;  3OS0 A;  3LW5 E;  3J81 E;  4L5G A;  2VYT A;  1WQ7 A;  5LJ5 h;  4KUI A;  1UGP B;  2RA2 A;  2XDB A;  4EPC A;  2P0K A;  3GIB A;  3JCM c;  2DIG A;  1K8A U;  2P0P A;  3BFM A;  3FC3 A;  2VGN A;  2P4T A;  1QVP A;  2E5Q A;  3CEY A;  4HCZ A;  4BI8 B;  4F7U E;  3OYE A;  5LJ3 e;  1JRI A;  2RK1 A;  3MP8 A;  4CI0 C;  3QXE B;  4M77 G;  5IAY A;  3LGL A;  3EFS A;  5C6S A;  3DLM A;  3HRS A;  5L8R E;  2RHU A;  2DTO A;  3JCM V;  3VUZ A;  2FB7 A;  3CCS T;  1QVF S;  3RKX A;  4C8Q G;  3VU3 C;  4BI3 A;  5I21 A;  1VQM A;  4MDW A;  4PLI A;  4TVR A;  2XDD A;  3CXC S;  5HK0 A;  4KUD K;  5FU7 C;  4N0A A;  3QDR B;  3ZBD A;  5CIU A;  3X26 B;  5CKH A;  2F69 A;  2JTM A;  4ZTF A;  3CCU T;  4BDZ A;  2LQK A;  2QQA A;  2Y90 A;  2YLB A;  3M55 A;  4MMK A;  3OYG A;  3OYH A;  2CZ7 B;  3OBY A;  4M77 A;  1VQ9 T;  5GAN f;  2WSE E;  4X34 A;  4EMK B;  4BDY A;  1YI2 T;  4NS5 A;  3G6E T;  1O75 A;  1PSE A;  3CBM A;  3CCE T;  4C8Q A;  4KT0 E;  5GMK m;  3CCR A;  3J80 E;  1M5Q 1;  3VV0 A;  3JCM b;  4IUV A;  2PVD B;  3V7S A;  4EMH A;  2RM4 A;  4N4H A;  2GFA A;  3KUF A;  3X24 B;  2K5I A;  2XKO C;  1V29 B;  3E9F A;  4EMG A;  2JTF A;  4HCC A;  1GXI E;  2CYZ B;  2PUK B;  3M9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...