3QJ6A

The crystal structure of pwwp domain of human hepatoma-derived growth factor 2 in complex with h3k79me3 peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
90
Chain Sequence
PHAFKPGDLVFAKMKGYPHWPARIDDIAAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/ nuclear protein
molecule keywords Hepatoma-derived growth factor-related protein 2
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 90
sequence length 92
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qj6A00
5C6SA 2EQJA 4IUQA 4II1A 2DIQA 1WGSA 2GF7A 3L2VA 3GOXA 4IKFA 1G5VA 2L3RA 4C5HA 2BUDA 4IUUA 2LRQA 2MWOA 3QKJA 2QQRA 4EDUA 3OYIA 5J39A 3OMGA 4IUTA 1KHCA 3FLGA 3OYEA 2GFAA 3NTHA 4Q5WA 4CRIA 4ZTJA 2RHXA 3ME9A 4E7KA 2RI2A 3OYNA 2LDMA 4PLLA 3OYKA 2EQMA 3MP8A 3S3OA 2RHZA 4QQ6A 2CKKA 5D6XA 1H3ZA 2BKDN 2R5AA 3F70A 4PLIA 5FRMA 3OYHA 2E6NA 2RJDA 2YRVA 4A4FA 3Q1JA 2X4XA 3OYJA 3MO8A 4BE0A 3PMIA 2DAQA 3MEVA 3MEWA 3S3NA 1SSFA 3LLRA 4FL6A 2LTOA 1MHNA 4NS5A 5D6YA 5FRNA 2RHIA 2RHYA 3H8ZA 5KH6A 3LH0A 3LGLA 3LGFA 3ZEHA 2LCCA 4B9XA 2E5QA 2JZ2A 3OYMA 2HQEA 1OI1A 4ZTFA 2HQXA 2XK0A 3MP1A 2NLUA 4C5GA 1XNIA 3OYGA 4BDZA 2EFIA 3DB4A 1OZ3A 3CEYA 3L42A 2K3YA 1WJQA 2XDPA 4QVZA 3QIIA 4BACA 4E7JA 2QQSA 4FU6A 2RJFA 2MWPA 3OYFA 3OYAA 3OMCA 3L2WA 3C4SA 5C0MA 3LX7A 3H6ZA 2RO0A 3QBYA 4A4EA 1WJSA 3PFSA 3PMTA 4QQDA 4B9WA 3OS2A 3OB9A 4BDYA 4E7LA 3OA6A 3BDLA 3P8HA 2M0OA 2X35A 2D9TA 3O8VA 4A4HA 2IG0A 3OYDA 3L2RA 3UT1A 4X34A 2X4YA 1N27A 3META 3FC3A 4QW2A 3OY9A 2VYTA 5KCOA 3S3MA 3EAEA 2RJEA 4L59A 1WJRA 2O4XB 3M9QA 3E9FA 2EQUA 3NTKA 4C5IA 2BIVA 4BD3A 2M1HA 3E9GA 3S6WA 4LD6A 5KCHA 2B8AA 2K3XA 3UWNA 4PL6A 3OQ5A 5J26A 3ASKA 2R58A 3MEAA 3DLMA 2WACA 3LYIA 3DB3A 4GY5A 4IUVA 2O4XA 4E7HA 4RG2A 4BE2A 5IN1A 5M9OA 3PNWC 4Z02A 3OS1A 4IURA 5FROA 2P0KA 3QJ6A 4IUPA 5D6WA 4N4GA 2EQKA 5KE2A 2DIGA 3MEUA 3OYCA 2L89A 2EKOA 4E7IA 4UC4A 2F5KA 2R5MA 3FDRA 4N4HA 3MP6A 3OYBA 4N4IA 5CIUA 2PQWA 2FHDA 2X4WA 3OYLA 3L2QA 2GFUA 3L2UA 1OZ2A 2R57A 2RJCA 3SD4A 3FEOA 2RI3A 4BE1A 4OVAA 2L8DA 3KUFA 4C5EA 3P8DA 4HCZA 2JTFA 2G3RA 2RHUA 5IAYA 1RI0A 3NTIA 4QQGA 5KE3A 4A4GA 2LVMA 2M16A 3OS0A 1OYXA 2RI5A
chains in the Genus database with same CATH superfamily
5C6SA 2EQJA 1G5VA 2J06A 2XKOC 4KGZB 4JRQA 4LUDA 1NPRA 4ZTJA 2DBMA 4L6V5 4AT1B 3EG9B 2DPPB 1MGQA 4MMKA 3VV0A 1VQ6A 1EX4A 2X4XA 3RR6A 5GMKi 3OYJA 1Q81R 3TSZA 1B34B 4CC7A 1PD0A 3HFNA 1OU8A 1MHNA 4FYYB 2XIDA 2ABLA 1ZLMA 4DQ2A 5KH6A 3LH0A 2EGEA 3EFRA 2FG0A 4K11A 1VQPQ 3CCMT 4ELZC 2EBPA 3E2UA 4M77A 3QXEB 1VIFA 2PUKB 1Q82U 2QQSA 5KYUA 4XTYA 4M77D 4M78E 2J7IA 1UGVA 1X2KA 2GQIA 3H6ZA 3HRSA 2DRKA 1K8AC 3PMTA 2FZGB 1RAIB 4BDYA 4WF2A 2G6FX 3UA6A 3I5SA 3P8BB 2DMOA 3META 2FZKB 4C0DC 4LDWA 4KUIA 4KGVB 5GAN4 1UUEA 1K9AA 5J26A 3I35A 1KD1U 2QG9B 3CCUQ 2MMPA 3CPWS 4IUPA 5GANe 3G4ST 1KHIA 3JCMb 2OAWA 2X3XD 1M90U 2R57A 2EQIA 2RI3A 5DLOA 5GMKh 4HVUA 4OGCA 3UPUA 2LP5A 1VQLA 1RAEB 3NTIA 3CBPA 2VGNA 4M78B 1WZOA 2FL7A 1YITT 3CC4T 4II1A 2HKQB 1X75C 2FPEA 3EFOB 4R55A 2CDTA 1HSQA 3SWNC 1XJWB 2QQRA 1NYFA 1WHJA 5J39A 2DXBA 2QDYB 2YDLA 4OF1A 1O75A 4J9DA 4F14A 4E7KA 2DRMA 1AHJB 4QQ6A 4FIBA 4PJJA 4AFZC 2L2PA 3A8LB 1H3ZA 5FW9A 2HCKA 4A63B 2CZ0B 3M4YA 1FYNA 5FU7C 2RM4A 3EGDA 3M0UA 1SSHA 1I81A 4GBQA 2JJ9A 1Q81U 4A4KA 1VQ5T 1Z9ZA 1NPPA 3N5BB 3H0HA 2RD1A 3ZEHA 1W2BS 2EKHA 2HBWA 2DEUA 2E64A 3CCVQ 2C06A 2VUBA 3C94A 1E7OA 1QWFA 2HDAA 1UB4A 3TQ7P 2O9VA 1ARKA 1OPLA 2DTIA 3JB9I 4DOWA 3GF5A 3OB9A 3QZ9B 2A0FB 3QO3A 2AZVA 4BI4A 2X35A 1F1BB 4A4HA 3CC7A 1M30A 5GAN3 2CREA 2JN0A 3V7SA 4C8QE 4XU2A 1RADB 2EW3A 3QHSA 3BDUA 2DTHA 2KBTA 5FWBA 4CC3A 3L1AA 4M75E 4EPCA 3NHNA 2ZCFB 1G3YA 3CBOA 1N6AA 1HYOA 4RTVA 1Y96B 1I07A 4F7UE 1VIEA 1VQ9A 1AWJA 2DZCA 3FDRA 4N4IA 3RKWA 1VQOQ 3JCMc 1TUCA 1TU0B 2OI3A 2KRNA 1XTDA 1ZUUA 2XDDA 2JTFA 1BI3A 1RI0A 4LDXA 2LVMA 3I5RA 4XTVA 2L5QA 4PJLA 4MZMA 3L2ZA 2VXEA 2RHXA 2CP2A 4ZN1A 1UJ0A 2FVUA 2ZZDA 4PLLA 4C8QB 3QUIA 3OS5A 4J6WA 4OP0A 4B6MA 1OX9A 5IHKA 2JMCA 4M75B 3JB9H 2NUPA 3MEVA 5I22A 1D0ZA 3CCQQ 2O01E 3QSUA 1MMGA 2HQHA 4B9XA 4KUDK 4F7UB 1FWZA 1RAGB 4L5GA 1MUZA 1Q7YR 4KBMB 2FPFA 3QIIA 3G6ET 4JUVA 3RUXA 1EZZB 1QVFP 3X26B 4KGXB 2RJFA 5HKCA 2ENMA 4RG8A 3CD6T 3H0FA 5IXBA 4O6JA 3M4GA 2DO3A 1VQ6Q 1VQKA 1M8VA 3E1SA 4RTZA 5IHIA 2ECZA 1WJRA 3CCLT 2DXTA 1D3BA 3NTKA 2J6KA 1NBEB 2LQ8A 3LH5A 3LW5E 3OSVA 3FRNA 5M9OA 1OQKA 5AYFA 4JJBA 2LCLA 3M0PA 1KFZA 4JJCA 3MP6A 1VQ7T 1V1CA 2O2OA 1JB0E 3RNJA 3TREA 2QA4A 3EG0A 1HXDA 2O88A 2EJFA 1VQ8Q 1BCOA 1UTIA 1RAAB 4OMNA 1KIKA 4ME7A 1S72A 4KH1B 4EMGA 3L2VA 3V7CA 3PVQA 1SRLA 1Q86C 1K73R 4DOVA 3RERA 3EH2A 2GFAA 3OYEA 3NFCA 1OX8A 2J05A 3S3OA 1PM3A 1LJOA 1RLPC 2MPXC 4N0AA 5D6XA 3VU3C 3JSCA 1M1KU 1JEGA 3UF4A 1Y7XA 2DJZA 4E7ZA 2XG8D 1VQPT 1YWOA 1UGQB 2QGGA 2KRSA 1X2QA 1HK9A 3OYMA 1VQLQ 1YIJA 3CC4Q 4C5GA 3DB4A 1QQJA 4QVZA 3RDVA 3MKDA 1BI2A 3FB9A 2DBKA 2MWPA 3CCJA 1YJNA 3OW2P 2I2LA 4JJDA 4M7AA 1M3BA 2RA2A 3RIRA 1YHQT 2D9TA 2KT1A 3VRZA 5LJ5e 3SWNA 5FU6C 1NYGA 1SEMA 1BI1A 1RUWA 4MMLA 4OMOA 5KYXB 4CC4B 3QG1A 5HCKA 4C5IA 1H92A 1MNEA 1O9SA 3CCUT 3OQ5A 4M77E 1FMKA 1IGUA 2R58A 2VASA 3O5ZA 4LE9A 2IVWA 4YTLA 3NMZC 3JCMe 4A54A 4CI0C 1RL2A 4ESRA 2JMAA 2ROLA 2XI9A 1TUGB 4N4HA 5HK0A 3L2UA 1VQMQ 1WLPB 4DBHA 3VJPA 2KROA 4OVAA 1JJ2S 1QVFA 1ZSZA 1S1NA 2K5LA 5GAOr 2QK0A 3CC7Q 1M2VA 3UDCA 1NJIC 4XAXB 2X9HA 4X34A 2LMJA 2NUTA 2GF7A 1Y57A 1UFFA 5DLQE 2MWOA 4ZNXA 8AT1B 3PVLA 5ECAA 1K9MU 1I8FA 2VVKA 5GAN5 1BU1A 3H9NA 2DE0X 1M27C 1VQ9Q 3EG2A 4AFSC 4X1VA 1WHMA 1IO6A 3I55A 1K9MC 1Y71A 1ZUYA 4M77B 2QEXT 3S3NA 1I5LA 3CCVT 2GBQA 5KYUB 3A8GB 4PFOA 2CS7A 2DVEA 3MP1A 5GAN8 5LJ3j 3OYGA 1PKTA 3U23A 3JRZA 5KYWA 2K5FA 4J9HA 1NEBA 4DEYA 1H8KA 3OMCA 3C4SA 3ZBDA 5C0MA 2CP7A 3LX7A 2RK1A 1R0CB 2I0NA 1U06A 3HRTA 3PFSA 1BCMA 2XD0A 4HCBA 3REBB 3ZL7C 2XHCA 1FXXA 3M0QA 3HL8A 1K8AR 3L2RA 4JLGA 1KQSP 2IG0A 2MF2A 2A36A 2H8HA 2KMTA 3CC2A 4IIOA 2AKKA 1ACMB 4MDXA 2HEQA 2XDBA 2J6FA 1LCKA 3A8MB 4RKUE 3SEMA 4Y92A 1VQNA 1VQOT 5L8RE 4IURA 1GFDA 2P0KA 4JZ4A 1IRXA 4E7IA 3E19A 8ATCB 2YWWA 2CP5A 1V76A 3PT9A 2HSEB 1KQ1A 2DD5A 1KD1R 4J9GA 3OW2A 1ZA2B 1NZ9A 3WVDB 5J3BA 4BB7A 3JCMJ 3CCRA 4F04B 1CKAA 3I9QA 3JAME 1QVPA 2YUNA 4FW2A 3CMEA 1YJWA 3VS1A 5CKHA 3EGDB 2K3BA 2D6FA 1OEBA 3CCQT 4M4ZA 3JCMX 1WXUA 1B3QA 3PMIA 2DAQA 3BW1A 3G71Q 2H3JA 2WSEE 5DY9A 2QA4Q 4FL6A 5FRNA 2C0TA 3THKA 4M78C 2E10A 3EGUA 4WCIA 1S72Q 4J9CA 2LQKA 2ZPHB 2ZAEA 2AK5A 4D8DA 3H0IA 4OB2B 4PNOA 3VS5A 1VQ6T 2M0OA 4JZ3A 3OYDA 2F1LA 1TSFA 3RKXA 1WX6A 4EMKC 2X4YA 1K8AU 4ZGJB 1TXQA 1VYUA 2K3XA 2E6ZA 4GLKA 1JU5C 2WACA 3A8OB 5GAMd 2KT8A 4IUVA 2O4XA 1OPKA 4BY6C 3RESA 1YIJQ 2LCSA 1NEGA 4DA4A 1KG1A 1HJDA 2O31A 1VQ8T 1X43A 2CUDA 2CH4W 2EYWA 4LN2A 1YJNQ 2CSIA 3OYLA 1YHQQ 2RJCA 2C0OA 2M0YA 4HCCA 2EYQA 4LUEA 1WFWA 3G1JA 5D7UA 2P84A 3JCMW 1IXDA 1X27A 1PRLC 2JTMA 2P0PA 1M4ZA 2D8HA 3CPWP 1VQ4A 1D1AA 1W6XA 2GGRA 1PSFA 2CT4A 3TCJA 3OYIA 2DL3A 1WXTA 2D1XA 2VGMA 2NUPB 2EQMA 3QDFA 4XU3A 5I21A 3VUBA 3F70A 4OMFB 2M02A 2RQUA 5DM7R 4BE0A 5IH2A 2M51A 2GQVA 1VQLT 5CR2A 2YRCA 3MPUB 3LGLA 2PNIA 2WSCE 2NLUA 3CQTA 1WQ7A 3JCMP 3VRYA 2MI6A 4C0GA 3KXTA 4HT9A 4C8QC 3RMSA 4J9IA 1QVGP 4M78F 1YP5A 3R6NA 3CCSQ 1D3BB 1N8RC 2RMOA 1YJ9A 5GAN2 5GANd 1K0XA 2LQNA 2M9UA 3VS7A 2DNUA 2QEXQ 3EAEA 1AWOA 1UGPB 1D1CA 1ZBJA 3X25B 2XU8A 2YLCA 4KULA 2EAYA 4XQ3A 1K76A 1VQMT 1RABB 4M7AE 1ABQA 5IT9E 1OZ2A 3CC7T 2CP3A 1QKWA 2L3QA 4BE1A 1YI2A 3KFVA 2BZYA 2K57A 2L8DA 2RHUA 3M5AA 2EJ9A 3GOXA 3QZ5B 1D0XA 4M78G 3CC2Q 3GNGA 4IUUA 4J9EA 1FMVA 3OMGA 4HVVA 4IUTA 1ZQ1A 1VQ9T 4OMPA 2OTJA 2KEAA 4PLIA 4XTUA 2V8JA 3OYHA 1BI0A 2PU9B 4A4FA 3CMAA 4HKEA 4DBQA 2DJQA 2CYZB 2K5IA 2MIOA 1VA7A 4RUGA 1JO8A 1OU9A 3M53A 3T9NA 4E7SA 1OI1A 2X3WD 2HQXA 4M7AB 1OZ3A 3V8LA 1M1KR 1M8MA 2CP6A 2EVRA 3QDRB 3MHXA 4F17A 3CMEQ 1YJWQ 1WJSA 1WHGA 1I0CA 2DD4A 3X28B 1GRIA 2V8IA 2K4YA 2K6DA 4QW2A 3CXCP 5CKFA 3S3MA 1R8OB 2RJEA 3HP9A 3HSBA 1LPLA 1MV0B 3VUZA 4C8QF 2W0ZA 4C0ZA 4JS4A 1WA7A 4LDUA 2K7AA 3A5ZB 1X6GA 1DJ7B 4FT4A 1U8RA 1PC0A 4ELYC 2CH4A 1ZSZB 2HKNA 3MEUA 2EKOA 4F7UF 1NE8A 2R5MA 1TWBA 1BIAA 1M2VB 1NG2A 4QT7A 3OYBA 2PQWA 3L2QA 3REAB 3BFMA 1SRMA 2NUTB 3CD6A 5GMKj 4M78D 1VQKT 2AKLA 1QVFS 1GCQC 2HAXA 4OMMA 3M55A 3QYHB 5CKEA 2E12A 5FRMA 1LOJA 2M16A 2JM8A 3MEWA 4IUQA 2RQWA 1QVGA 1BBZA 2KNBB 2P4TA 2FRWA 1IGQA 3G7ZA 4J6YA 5LJ3e 4EMKA 2RK2A 1AZGB 2RQVA 1Q86U 2V1QA 3MP8A 3G71T 1NM7A 2L0AA 2E41A 5KYYA 2QA4T 4C8QG 4Z88A 2F2WA 2QDLA 2W10A 2ED1A 2YLBA 4NS5A 2MCNA 2C0IA 5KYWB 5FLXE 1K9MR 1S72T 1G3WA 3GBQA 4GLMA 2HSPA 2F5TX 4ZTFA 4F7UG 3PIOA 2DL8A 2DETA 3SHWA 2V8KA 2JVVA 4IIMA 4HVWA 1FX7A 2DXCA 2RO0A 2YUQA 2OTLA 3VS6A 4E7LA 4M7DC 1EFNA 1Z9QA 2EWNA 4PJOC 2FYKA 3PE0A 3QPHA 2FB7A 4L59A 3UATA 3E9FA 4RCCA 2QTXA 1YIJT 2A28A 2KVQG 2DKGA 4ZN3A 3DLMA 1SHGA 2SRCA 4PFZA 3CCJT 1YJNT 1BIBA 2BTTA 1YNZA 2JUFA 5CVIA 4FT2A 2EGCA 2LZ6B 2LX9A 2EQKA 4Z89A 5LJ5h 5IHNA 3M56A 4X9CA 4MZPA 1BYMA 5I11A 1U5SA 2Z0WA 1WYXA 2CUBA 2QXFA 1UDLA 4C5EA 3P8DA 1YJ9Q 3I56A 4C92C 2VV5A 1PCXA 2KYBA 3FJPA 3CCEA 3OW2S 3RKYA 2L3RA 3JCMh 2BUDA 3EHQA 2RF0A 1Q7YC 4C8QD 1NJIU 4E47A 4V2SA 1MMDA 3PIPA 3CXCA 1I5OB 1M3CA 1YN8A 2X51A 2RHZA 2E65A 4ORZA 1AD5A 2BKDN 2KQWA 2EIFA 2YSQA 1JBMA 2DXUA 3GNFB 5GJVB 3MO8A 1G2BA 1WHHA 2KR3A 2QI2A 4LDVA 4OMLA 3VKIA 1XOVA 1AOJA 2DFUA 1YI2Q 1YCSB 1MMNA 2FZCB 4PFPA 5LJ5d 1D1BA 1G3SA 3V8KA 2PUOB 3BE3A 1T0JA 2AHJB 5GAN6 2DVJA 3DKMA 3VS2A 3M58A 3CCST 2E3HA 4FW1A 4QKUA 1IHVA 2VC8A 1Y0MA 1B7TA 2QGFB 3JCMd 4RMOA 2V26A 5GAOq 2PVGB 3O8VA 2OTJQ 4RTUA 2VKNA 5GMKm 3CMAQ 1UHFA 2O4XB 2EQUA 5KYNA 4LXCA 2LT1A 1CKBA 1W1FA 3TU4K 4M7DF 2YUOA 3HHTB 3CCVA 2ROTA 3MEAA 5GAOn 2HZYA 1K73C 4PJOF 1G8XA 1M5Q1 2DZ9A 1VOMA 4BUGA 3PNWC 3CPFA 2RN8A 3VS3A 2FHDA 2X4WA 2GFUA 4OMQA 1T0HA 2V1RA 1U3OA 2AT1B 4HCKA 2HBPA 2KRMA 3CC2T 2QASA 2COYA 4Y28E 5FU6B 3WXMB 2HNIA 3R6OA 1OYXA 2RI5A 2GTJA 4FM4B 1WGSA 7AT1B 4DBFA 2ZPGB 4IKFA 1KC8U 2LRQA 1IHWA 5EC7A 4HXJA 2DERA 1C0MA 1KQSS 3FLGA 3VS0A 4CRIA 1ZUKA 4C92F 1RI9A 1K1ZA 1WXBA 1UEBA 4RTTA 2E6NA 2YRVA 1WQWA 4KRTA 3Q1JA 1KC8C 4M7DG 5HK3A 1VQKQ 4PJOG 4J7IA 2ZGWA 5CAIA 3ER0A 2JZ2A 3RMQA 3SDZA 1GBRA 4FYVB 3CEYA 2K79A 1WJQA 3CMET 4EMHA 1YJWT 2DL7A 4EIKA 1GCQA 1I4K1 2OAUA 1T3SA 1H3HA 5GAMh 3BDLA 4XU0A 2MAMA 2AIRB 3HTRA 4BI8B 1PNJA 1D0YA 3FC3A 3CCQA 3ZFJA 4OB0B 2EGAA 3BY7A 3M54A 2LNHB 1HD3A 4C92G 4J7FA 1WI7A 2Y4XA 4LD6A 1AT1B 1Y07A 1GFCA 4JDSA 3SFMA 3RBBB 4D6WA 1X69A 4NOYA 4Z02A 2DF6A 2DILA 1N5ZA 5D6WA 2L89A 3JV3A 2KGTA 3QYGB 4J9FA 4LDYA 2F5KA 1RAHB 2OTLQ 4HT8A 3M0RA 5GAMg 3OBYA 1AZEA 2CZ7B 3HFOA 1R0BG 3HRUA 2DX1A 3URGA 2QQBA 2P0QA 4E6RA 1P92A 3CCMA 4M7DA 1K0SA 3QKJA 1JXMA 4X9DA 4XK8E 4PJOA 4M7DD 1GBQA 1PHTA 3CCJQ 4PJOD 5I2MA 2K9GA 4DBRA 3AT1B 4ZGDB 5GAMf 5GMKl 2FEIA 1VQ8A 3QWYA 1UGSB 3C95A 4F16A 1SKUB 2RHIA 1QCOA 4RTWA 3JCMV 1Q82C 2PZ1A 1VQ4T 1M9SA 3I56Q 1KQSA 5GANh 2KXCA 3GP8A 3CCEQ 5GAN7 2DK3A 1XNIA 3M0TA 4N0AC 4Z8AA 3L42A 1PRMC 3V7RA 4KT0E 2KAFA 1MNDA 1OV3A 1BK2A 1ZHIA 2GCXA 2JS2A 4C92A 5GAOp 1AVZC 3G4SA 1UJYA 4B9WA 4C92D 3TEEA 3OA6A 4TVRA 2FRYA 2RQTA 2GTOA 1TUDA 5CK9A 2VXFA 2DTOA 5KCOA 1YWPA 1N8RU 3M9QA 5GMKe 1KD1C 2A7YA 4D8KA 3QJYA 2BIVA 2KDSA 5GAOl 1A0NB 2JNGA 1YITA 3KBGA 3A98A 4XTWA 3CC4A 4PL6A 4M7AC 2LJ3A 1AWWA 2DLPA 2A37A 1G83A 4GY5A 5GANg 5AT1B 3EGXA 2CGHA 1KQ2A 4JS5A 4AFUC 1M90C 2YRDA 2E5KA 3OS1A 2NWMA 4OGEA 4N4GA 1W2BP 3OYCA 4M75C 2JXBA 1YJ9T 2P4RA 9ATCB 1R77A 2DM1A 4BI3A 1QP2A 2F2XA 3I55Q 1B07A 1VQ5A 4J6XA 2BE7D 4QQGA 1TG0A 1BKBA 4EMKB 1YCYA 1QVGS 1AWXA 2O9SA 4C5HA 1JRIA 1IB8A 3SB2A 5KYYB 3OSSC 5GANf 3FJ5A 4EDUA 2JW4A 1UE9A 1M1GA 2KSSA 3A8HB 2JT4A 2JM9A 4LNPA 1RACB 4BY6B 4WTOB 1ZSZC 1Q81C 1LNXA 1NLPC 2EPDA 1C6VX 1YI2T 1SHFA 1VQMA 3JB9J 1Q95G 1KSWA 2VB6A 2PTKA 3EG9A 5GAMj 4C0DB 2HL5C 1EIFA 2LTOA 1B34A 1Q86R 2HQEA 4JJNK 2CZ1B 1RAFB 1MV3A 2DYBA 1VQNQ 4ANJA 1VYTA 2OTJT 2PVOB 4O5VA 2KI7A 3CMAT 2FO0A 4XU1A 4FCYA 5A2QE 2E70A 4FYWB 2SEMA 3OYYA 2QQ9A 3M57A 3E9GA 1ZBXA 2XICA 3CCRQ 3ASKA 1WHKA 2L3PA 3SWNB 3LWIA 1D09B 3DB3A 4E7HA 5LL6S 2XMFA 2LNVA 2ED0A 3QWXX 3CPWA 3INZA 5KE2A 3X24B 1ZSGA 2D0NA 3PGGA 2DA9A 4FSSA 1TOVA 5CQYA 3X20B 2KE9A 5EG2A 5FU7B 4M7AF 1X6OA 4LD9K 3EFSA 1T3LA 4AFQC 2F69A 2COWA 2GNCA 1QW1A 2H3EB 4NL2A 1MMAA 4M75F 4FYXB 3G6EA 1KHCA 1N9RA 2JTEA 3NTHA 4Q5WA 5GANj 1UECA 4M78A 3CXCS 3ME9A 4J83A 4FSXA 3OYKA 3MCAB 4AG2C 3EFOA 1JQQA 2R5AA 1WIEA 4E2FB 2RQRA 5CKDA 2DL5A 3J81E 1SSFA 2LC4A 3LLRA 1M2OA 1RLQC 1NJIR 2KYMA 3CCLA 2X4JA 4RTYA 3DLLA 2RNAA 3C0CA 1W2BA 2BZ8A 2HMAA 5LJ3h 1QMCA 1IREB 3UA7A 2F2VA 2K3YA 3IQLA 1E6GA 4BACA 3EHRA 4E7JA 2L3SA 4FU6A 3CCMQ 4M7AG 2BZXA 2YHTA 1SPKA 3L2WA 1OOTA 3OS2A 4M75G 2COZA 1VQ7A 3V8JA 2RH2A 3G71A 2RPNA 1ABOA 4JLIA 2VYTA 1ZA1B 2BE9B 3HPWA 4AMCA 1M3AA 2E4HA 3CBMA 5L23A 1VQ4Q 5KCHA 1WNLA 2ZPEB 2DYIA 3LYIA 4KH0B 5LJ3g 1K4US 4BE2A 3JB9F 1GL5A 2OTLT 2RB6A 3QJ6A 2D0QB 3GIBA 5LJ3d 1J3TA 2LT4A 2Y90A 1Y96A 1E6HA 3H41A 4M77C 5I2SA 1V29B 3FEOA 3G4SQ 4J9BA 1VQPA 3GPLA 1AEYA 1QLYA 2KY9A 2EFIA 4QVDA 1WHLA 2ZPFB 1W4SA 1PSEA 2K2MA 2VWFA 2JS0A 1OULA 5LJ3f 1M1KC 1YBYA 4DEXA 1YITQ 1IZ6A 4PK4A 4AG1C 2LDMA 2DEQA 2CKKA 2IPOB 4RCBA 2CT3A 1LVKA 1Q7YU 5A0GA 1YHQA 4OB1B 2HL3A 3EG1A 2QYZA 2ESWA 2HD0A 3HKSA 1KC8R 3I56T 4NL3A 3CCET 4C8QA 1PWTA 1KJWA 2QTVA 4C0FA 4M7AD 1VYVA 4JRKA 2RHYA 1KK7A 1QKXA 3H8ZA 3JB9G 2LQWA 2E5QA 5FWCA 2J6OA 4M75A 1VQ5Q 4M7DE 3CCUA 4BDZA 1G3TA 4A53A 3ULRB 4M75D 4Y91A 1UHCA 4PJOE 1JJ2P 1N9SA 4F7UA 4PJMA 5A0LA 3OBWA 3QBYA 3J7AF 2EYYA 1TH7A 6AT1B 4QVCA 4ZGEB 5IXFA 5LJ5g 1SF9A 1XQHA 1GXIE 4RTXA 2OJ2A 1ZX6A 2A3LA 3UT1A 2E1HA 4PKCC 4HA8A 4PJNA 3WVEB 3OY9A 4JPBW 2PVDB 2CZ6B 1X01A 2B8AA 3JCMg 2K2VA 2LJ0A 1PKSA 4RG2A 3A1PA 3VS4A 1QCNA 4C92E 5LJ5f 5GJWB 4R0KA 3I55T 4UC4A 1K73U 2KXDA 1GCPA 2YT6A 3CCSA 5CIUA 5CQXA 2A08A 3SD4A 1U1TA 2LJ1A 4M7DB 2LX7A 4R56A 3KUFA 5HY6A 1BB9A 4J5YA 2NYSA 2QEXA 2YUPA 4HCZA 3PTAA 2G3RA 2YXYA 4PJOB 1NLOC 4A4GA 3OS0A 3JCMf 2DIQA 2NUZA 4M77F 1JXOA 1WPYA 1C1AA 4CC2A 4MDWA 2Y4YA 3TVTA 2EYZA 4VUBA 2FPDA 2D8JA 3EG3A 2RI2A 3OYNA 4JRIA 3VYHB 5CKBA 2MOXA 3JB9D 2RJDA 1X6BA 4MZTA 3MJXA 2ZPBB 2JOYA 5CCAA 5D6YA 4XTXA 3LGFA 2LCCA 3J80E 5GAOm 4C92B 4ATOA 2E3IA 2XK0A 1Q82R 1VQNT 3VYGA 2OX7A 4JRPA 2XDPA 3C12A 3NGPA 1TS9A 2CSQA 2AZSA 2ZPIB 3TSWA 3OYFA 1TTHB 3OYAA 1VQOA 2IIMA 3G6EQ 4J8OA 1WDXA 3NPFA 4QQDA 1U1SA 1W70A 3P8HA 4OB3B 1CSKA 1UGRB 1I1JA 2EYXA 3CD6Q 4M77G 1FMWA 1QCFA 1QWEA 3JCMQ 1N27A 3D7SB 3CCRT 2MK5A 3EGXB 3LWHA 1QP3A 4BD3A 2M1HA 3S6WA 2CP0A 3UWNA 5A0DA 3CCLQ 3EH1A 3FIFA 3GLXA 5KYXA 3M59A 1YFNA 5IN1A 3M0SA 2B86A 5FROA 1PD1A 2ATCB 2DIGA 1M90R 1N8RR 5LJ5j 2WSFE 4XTZA 2QAZA 2DL4A 4P5NA 1M1FA 1UG1A 2QQAA 3AHUA 1VUBA 1JJ2A 1VQ7Q 2EJGA 2KK4A 5KE3A 5GAMe 1SG5A 2MYSA 5CO7A 5IAYA 4A4EA 1PG5B 1H641
chains in the Genus database with same CATH topology
5C6SA 2EQJA 4IUQA 1G5VA 1YCYA 2GF7A 1QVGS 1QVGA 5DLQE 2P4TA 4C5HA 1JRIA 3G7ZA 2XKOC 3SB2A 2MWOA 3OSSC 4J6YA 5GANf 4JRQA 4EDUA 1M1GA 2KSSA 5LJ3e 1K9MU 1NPRA 4EMKA 1I8FA 4ZTJA 3A8HB 5GAN5 2RK2A 4L6V5 1Q86U 3MP8A 2DPPB 1MGQA 4BY6B 3G71T 2E41A 4MMKA 1Q81C 3VV0A 2QA4T 1VQ6A 1LNXA 4C8QG 2X4XA 5GMKi 3OYJA 1YI2T 1VQMA 3JB9J 1B34B 5GAMj 2YLBA 1Y71A 4M77B 3HFNA 3I55A 2QEXT 3S3NA 1K9MC 4C0DB 1EIFA 2LTOA 1MHNA 4NS5A 3CCVT 1I5LA 2XIDA 5FLXE 4DQ2A 5KH6A 1S72T 3LH0A 3A8GB 3EFRA 1G3WA 3CCMT 1B34A 2CS7A 2HQEA 2DVEA 2F5TX 4ELZC 4ZTFA 4F7UG 3MP1A 5GAN8 3PIOA 5LJ3j 3OYGA 4JJNK 4M77A 3QXEB 1VIFA 2CZ1B 3JRZA 2PUKB 2K5FA 2V8KA 1Q82U 2QQSA 2JVVA 4XTYA 4M77D 4M78E 3OMCA 3C4SA 3ZBDA 1FX7A 2DXCA 3LX7A 5C0MA 3H6ZA 2RK1A 2RO0A 3HRSA 2PVOB 4O5VA 2OTLA 3HRTA 1K8AC 3PFSA 3PMTA 2XD0A 4BDYA 4E7LA 4M7DC 4HCBA 4WF2A 2XHCA 1FXXA 3CMAT 3HL8A 4XU1A 3P8BB 3L2RA 4JLGA 2EWNA 2IG0A 2MF2A 5A2QE 2E70A 4PJOC 2FYKA 4X34A 3META 2KMTA 3OYYA 4C0DC 3QPHA 4LDWA 4KUIA 2FB7A 4L59A 3E9FA 3CC2A 5GAN4 4RCCA 2QQ9A 2QTXA 3M57A 1YIJT 2KVQG 3E9GA 1ZBXA 2XICA 2DKGA 4MDXA 5J26A 2XDBA 3ASKA 4ZN3A 3SWNB 3DLMA 3LWIA 3DB3A 3A8MB 4RKUE 4E7HA 1KD1U 5LL6S 3CCJT 1YJNT 1BIBA 2LNVA 2JUFA 2MMPA 5CVIA 4FT2A 3CPWS 3CPWA 1VQNA 1VQOT 5L8RE 4IURA 3INZA 2P0KA 4IUPA 5GANe 2LX9A 3G4ST 2EQKA 1KHIA 5KE2A 4E7IA 3E19A 3X24B 3PGGA 5LJ5h 3JCMb 3M56A 5CQYA 3X20B 4X9CA 5EG2A 1M90U 5FU7B 4MZPA 2R57A 1BYMA 4M7AF 2RI3A 5DLOA 1X6OA 5GMKh 4LD9K 4OGCA 3UPUA 2QXFA 3PT9A 4C5EA 3P8DA 3EFSA 3I56A 4C92C 2VV5A 1VQLA 3FJPA 1KQ1A 3CCEA 2DD5A 2F69A 3NTIA 3OW2S 3OW2A 1QW1A 3CBPA 4NL2A 2VGNA 4M78B 1NZ9A 4M75F 3RKYA 3WVDB 2FL7A 1YITT 3CC4T 4II1A 5J3BA 1X75C 2L3RA 3JCMh 4BB7A 3CCRA 2BUDA 4R55A 3JCMJ 3SWNC 2QQRA 3JAME 4C8QD 1QVPA 5J39A 1Q7YC 1NJIU 4E47A 4V2SA 3CMEA 1YJWA 3G6EA 1KHCA 1N9RA 2DXBA 2QDYB 1O75A 3NTHA 4OF1A 4Q5WA 3PIPA 5GANj 4M78A 3CXCS 3ME9A 5CKHA 4J83A 3CXCA 4E7KA 4FSXA 3OYKA 2D6FA 1AHJB 2RHZA 3MCAB 4FIBA 2E65A 4QQ6A 3A8LB 2BKDN 2R5AA 1H3ZA 3CCQT 2KQWA 3JCMX 2EIFA 1JBMA 2DXUA 3GNFB 2CZ0B 3M4YA 3MO8A 5CKDA 5FU7C 2RM4A 3PMIA 2DAQA 3BW1A 3J81E 2QI2A 4LDVA 2H3JA 2WSEE 1I81A 3VKIA 5DY9A 1SSFA 1Q81U 1XOVA 2LC4A 3LLRA 4A4KA 1VQ5T 4FL6A 1NPPA 5FRNA 3N5BB 3CCLA 2RD1A 2X4JA 3ZEHA 5LJ5d 3DLLA 1G3SA 4M78C 2E10A 3V8KA 1W2BS 1W2BA 2PUOB 5LJ3h 2E64A 1IREB 2C06A 2VUBA 3C94A 2K3YA 2AHJB 4BACA 4E7JA 1UB4A 5GAN6 3DKMA 4FU6A 4M7AG 2LQKA 2ZPHB 2YHTA 3M58A 3CCST 3L2WA 2DTIA 3JB9I 4OB2B 4PNOA 4DOWA 3GF5A 3OS2A 2VC8A 1VQ6T 3OB9A 3QZ9B 3JCMd 3QO3A 4RMOA 2M0OA 5GAOq 4BI4A 4M75G 2X35A 1VQ7A 3V8JA 2PVGB 3O8VA 4A4HA 3OYDA 3CC7A 3RKXA 2RH2A 3G71A 4EMKC 5GAN3 2X4YA 1K8AU 4JLIA 2JN0A 3V7SA 2VYTA 4XU2A 4C8QE 5GMKm 3HPWA 4ZGJB 3QHSA 2O4XB 3BDUA 2EQUA 2DTHA 2LT1A 3L1AA 4M75E 3CBMA 3TU4K 4EPCA 4M7DF 5KCHA 2K3XA 3HHTB 1WNLA 2E6ZA 1G3YA 2ZCFB 2ZPEB 4GLKA 3CCVA 3CBOA 3MEAA 1N6AA 2WACA 3A8OB 3LYIA 5GAMd 5GAOn 1K73C 4IUVA 4PJOF 1Y96B 2O4XA 4BY6C 5LJ3g 3RESA 4F7UE 4BE2A 2DZ9A 1M5Q1 3JB9F 4DA4A 4BUGA 3PNWC 3CPFA 2OTLT 1KG1A 1VIEA 1VQ9A 2RB6A 3QJ6A 1VQ8T 2DZCA 2D0QB 3GIBA 5LJ3d 3FDRA 2LT4A 2Y90A 4N4IA 1Y96A 4M77C 2FHDA 2X4WA 3OYLA 3RKWA 2GFUA 5I2SA 2RJCA 1V29B 3FEOA 3JCMc 1XTDA 4HCCA 2EYQA 2XDDA 1VQPA 3GPLA 2HBPA 2JTFA 3JCMW 1BI3A 5IAYA 1RI0A 3CC2T 2JTMA 4Y28E 2KY9A 2P0PA 5FU6B 3WXMB 1M4ZA 2HNIA 2LVMA 2EFIA 3R6OA 1OYXA 2RI5A 4QVDA 4LDXA 4FM4B 1VQ4A 4XTVA 1WGSA 2L5QA 2ZPGB 4IKFA 2ZPFB 1PSFA 1W4SA 1PSEA 4MZMA 1KC8U 2LRQA 3OYIA 3TCJA 3L2ZA 5LJ3f 1M1KC 1KQSS 1YBYA 2VXEA 3FLGA 4CRIA 2RHXA 2VGMA 4ZN1A 4C92F 1IZ6A 2FVUA 2LDMA 2ZZDA 4PLLA 2EQMA 2DEQA 2CKKA 4XU3A 4RCBA 1UEBA 4C8QB 5I21A 1Q7YU 3VUBA 3F70A 3QUIA 5A0GA 2E6NA 2YRVA 1WQWA 4OMFB 3OS5A 3Q1JA 4J6WA 4OP0A 5DM7R 4BE0A 4OB1B 1YHQA 1KC8C 4M7DG 4M75B 3JB9H 5HK3A 3MEVA 2HD0A 3HKSA 3I56T 2GQVA 1VQLT 5CR2A 4NL3A 3CCET 2O01E 4PJOG 4C8QA 4J7IA 2ZGWA 4C0FA 3QSUA 4M7AD 5CAIA 4JRKA 2RHYA 3H8ZA 3JB9G 4B9XA 3LGLA 4F7UB 4KUDK 3ER0A 2E5QA 2JZ2A 1FWZA 4M75A 2WSCE 4L5GA 3RMQA 4M7DE 3SDZA 2NLUA 3CCUA 4BDZA 1G3TA 1WQ7A 3CEYA 4KBMB 4A53A 1WJQA 3QIIA 3CMET 4M75D 4Y91A 4JUVA 4EMHA 3RUXA 3G6ET 3JCMP 1YJWT 4PJOE 3X26B 1N9SA 4F7UA 2RJFA 5HKCA 2MI6A 5A0LA 4C0GA 3OBWA 3KXTA 1I4K1 4RG8A 3QBYA 3J7AF 4HT9A 3CD6T 1TH7A 4QVCA 4C8QC 3RMSA 4ZGEB 5LJ5g 2OAUA 1XQHA 4M78F 5GAMh 1D3BB 3BDLA 1N8RC 1GXIE 1YJ9A 5GAN2 4XU0A 2MAMA 4BI8B 2A3LA 5GANd 4O6JA 2M9UA 3M4GA 3UT1A 2E1HA 4PKCC 4HA8A 2DO3A 3FC3A 3WVEB 3ZFJA 3OY9A 3CCQA 1VQKA 1M8VA 3EAEA 3E1SA 4OB0B 3BY7A 3CCLT 1UGPB 1WJRA 2DXTA 3M54A 1D3BA 3NTKA 4C92G 2PVDB 4J7FA 3X25B 2XU8A 2YLCA 2CZ6B 1X01A 2Y4XA 4KULA 2B8AA 4LD6A 3JCMg 1Y07A 2K2VA 2OTJT 4JDSA 3SFMA 4D6WA 2LQ8A 4RG2A 2EAYA 3LW5E 4XQ3A 3OSVA 3FRNA 5M9OA 4C92E 4NOYA 4Z02A 5AYFA 1VQMT 5LJ5f 5D6WA 4M7AE 2LCLA 2L89A 4LDYA 3QYGB 3I55T 4UC4A 1K73U 2F5KA 5IT9E 3MP6A 3CCSA 1VQ7T 5CIUA 2QA4A 5CQXA 1JB0E 3TREA 1HXDA 1OZ2A 3CC7T 3SD4A 4BE1A 1U1TA 1YI2A 4HT8A 2EJFA 5GAMg 4M7DB 3OBYA 4R56A 2CZ7B 2K57A 2L8DA 3KUFA 5HY6A 3HFOA 4J5YA 2QEXA 4HCZA 3PTAA 2G3RA 2RHUA 3M5AA 3HRUA 4PJOB 3URGA 4ME7A 2EJ9A 2QQBA 1S72A 4A4GA 2P0QA 3OS0A 3JCMf 4EMGA 1P92A 2DIQA 3L2VA 3V7CA 3GOXA 3CCMA 4M7DA 1Q86C 3QZ5B 4M77F 4M78G 3GNGA 4IUUA 4DOVA 3RERA 1WPYA 3QKJA 4MDWA 2Y4YA 3OMGA 4X9DA 4XK8E 4PJOA 4IUTA 4M7DD 4VUBA 2GFAA 3OYEA 3NFCA 1ZQ1A 2RI2A 3OYNA 1VQ9T 4JRIA 3VYHB 3S3OA 4PJOD 5I2MA 5CKBA 1LJOA 2OTJA 4N0AA 5D6XA 3VU3C 3JB9D 4PLIA 4XTUA 2V8JA 3JSCA 2RJDA 1BI0A 3OYHA 2PU9B 1M1KU 4A4FA 1Y7XA 2DJZA 3CMAA 4HKEA 4MZTA 4ZGDB 5GAMf 5GMKl 2ZPBB 1VQ8A 2JOYA 2XG8D 1UGSB 1VQPT 3C95A 2CYZB 5CCAA 5D6YA 2K5IA 4XTXA 2RHIA 1UGQB 3JCMV 3LGFA 1Q82C 2LCCA 3J80E 5GAOm 1VQ4T 3M53A 1M9SA 1HK9A 3T9NA 4C92B 3OYMA 5GANh 1KQSA 4ATOA 1OI1A 3GP8A 2HQXA 2XK0A 5GAN7 1YIJA 1VQNT 3VYGA 2DK3A 1XNIA 4M7AB 4C5GA 3DB4A 4N0AC 1OZ3A 3L42A 3V8LA 4JRPA 4QVZA 2XDPA 3C12A 3V7RA 4KT0E 2KAFA 1BI2A 2ZPIB 3QDRB 3FB9A 3MHXA 1ZHIA 2GCXA 2MWPA 3OYFA 3CCJA 3OYAA 1YJNA 4C92A 5GAOp 2I2LA 1VQOA 4M7AA 1WJSA 4J8OA 3G4SA 4QQDA 4B9WA 2RA2A 2DD4A 3RIRA 3X28B 4C92D 1U1SA 3TEEA 3OA6A 3P8HA 1YHQT 4TVRA 2V8IA 2K4YA 4OB3B 1UGRB 2D9TA 5LJ5e 4M77G 3SWNA 3JCMQ 1N27A 5FU6C 4QW2A 2VXFA 5CK9A 2DTOA 5CKFA 5KCOA 3S3MA 1R8OB 1BI1A 3CCRT 2RJEA 1N8RU 3M9QA 3HP9A 4MMLA 5GMKe 3LWHA 3HSBA 1KD1C 1QP3A 2A7YA 3QG1A 3QJYA 2BIVA 2KDSA 3VUZA 4BD3A 4C5IA 4C8QF 5GAOl 2M1HA 2JNGA 3S6WA 1O9SA 3CCUT 1YITA 3KBGA 3UWNA 4XTWA 3CC4A 4PL6A 3OQ5A 4M77E 4C0ZA 5A0DA 4M7AC 2R58A 4JS4A 4LDUA 3FIFA 3GLXA 4GY5A 3A5ZB 5GANg 1KQ2A 2CGHA 2IVWA 4YTLA 1DJ7B 3M59A 3JCMe 4JS5A 4FT4A 5IN1A 1M90C 4A54A 4CI0C 1U8RA 3OS1A 4ELYC 5FROA 1RL2A 4OGEA 4N4GA 2XI9A 2DIGA 3MEUA 3OYCA 4M75C 2EKOA 4F7UF 1NE8A 2R5MA 2WSFE 4XTZA 5LJ5j 1YJ9T 4N4HA 1BIAA 3OYBA 2PQWA 3L2QA 4P5NA 3BFMA 1M1FA 5HK0A 3L2UA 4BI3A 3CD6A 5GMKj 1QP2A 4M78D 2QQAA 4OVAA 3VJPA 1VQKT 1VUBA 3AHUA 1JJ2S 1JJ2A 1QVFA 2HAXA 1QVFS 2EJGA 2K5LA 5GAOr 1VQ5A 3M55A 4J6XA 3QYHB 5CKEA 4QQGA 2KK4A 5KE3A 3UDCA 1BKBA 2E12A 4EMKB 4XAXB 5CO7A 5GAMe 1NJIC 5FRMA 1LOJA 2M16A 4A4EA 3MEWA 1H641
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C6S A;  2EQJ A;  4IUQ A;  4II1 A;  2DIQ A;  1WGS A;  2GF7 A;  3L2V A;  3GOX A;  4IKF A;  1G5V A;  2L3R A;  4C5H A;  2BUD A;  4IUU A;  2LRQ A;  2MWO A;  3QKJ A;  2QQR A;  4EDU A;  3OYI A;  5J39 A;  3OMG A;  4IUT A;  1KHC A;  3FLG A;  3OYE A;  2GFA A;  3NTH A;  4Q5W A;  4CRI A;  4ZTJ A;  2RHX A;  3ME9 A;  4E7K A;  2RI2 A;  3OYN A;  2LDM A;  4PLL A;  3OYK A;  2EQM A;  3MP8 A;  3S3O A;  2RHZ A;  4QQ6 A;  2CKK A;  5D6X A;  1H3Z A;  2BKD N;  2R5A A;  3F70 A;  4PLI A;  5FRM A;  3OYH A;  2E6N A;  2RJD A;  2YRV A;  4A4F A;  3Q1J A;  2X4X A;  3OYJ A;  3MO8 A;  4BE0 A;  3PMI A;  2DAQ A;  3MEV A;  3MEW A;  3S3N A;  1SSF A;  3LLR A;  4FL6 A;  2LTO A;  1MHN A;  4NS5 A;  5D6Y A;  5FRN A;  2RHI A;  2RHY A;  3H8Z A;  5KH6 A;  3LH0 A;  3LGL A;  3LGF A;  3ZEH A;  2LCC A;  4B9X A;  2E5Q A;  2JZ2 A;  3OYM A;  2HQE A;  1OI1 A;  4ZTF A;  2HQX A;  2XK0 A;  3MP1 A;  2NLU A;  4C5G A;  1XNI A;  3OYG A;  4BDZ A;  2EFI A;  3DB4 A;  1OZ3 A;  3CEY A;  3L42 A;  2K3Y A;  1WJQ A;  2XDP A;  4QVZ A;  3QII A;  4BAC A;  4E7J A;  2QQS A;  4FU6 A;  2RJF A;  2MWP A;  3OYF A;  3OYA A;  3OMC A;  3L2W A;  3C4S A;  5C0M A;  3LX7 A;  3H6Z A;  2RO0 A;  3QBY A;  4A4E A;  1WJS A;  3PFS A;  3PMT A;  4QQD A;  4B9W A;  3OS2 A;  3OB9 A;  4BDY A;  4E7L A;  3OA6 A;  3BDL A;  3P8H A;  2M0O A;  2X35 A;  2D9T A;  3O8V A;  4A4H A;  2IG0 A;  3OYD A;  3L2R A;  3UT1 A;  4X34 A;  2X4Y A;  1N27 A;  3MET A;  3FC3 A;  4QW2 A;  3OY9 A;  2VYT A;  5KCO A;  3S3M A;  3EAE A;  2RJE A;  4L59 A;  1WJR A;  2O4X B;  3M9Q A;  3E9F A;  2EQU A;  3NTK A;  4C5I A;  2BIV A;  4BD3 A;  2M1H A;  3E9G A;  3S6W A;  4LD6 A;  5KCH A;  2B8A A;  2K3X A;  3UWN A;  4PL6 A;  3OQ5 A;  5J26 A;  3ASK A;  2R58 A;  3MEA A;  3DLM A;  2WAC A;  3LYI A;  3DB3 A;  4GY5 A;  4IUV A;  2O4X A;  4E7H A;  4RG2 A;  4BE2 A;  5IN1 A;  5M9O A;  3PNW C;  4Z02 A;  3OS1 A;  4IUR A;  5FRO A;  2P0K A;  3QJ6 A;  4IUP A;  5D6W A;  4N4G A;  2EQK A;  5KE2 A;  2DIG A;  3MEU A;  3OYC A;  2L89 A;  2EKO A;  4E7I A;  4UC4 A;  2F5K A;  2R5M A;  3FDR A;  4N4H A;  3MP6 A;  3OYB A;  4N4I A;  5CIU A;  2PQW A;  2FHD A;  2X4W A;  3OYL A;  3L2Q A;  2GFU A;  3L2U A;  1OZ2 A;  2R57 A;  2RJC A;  3SD4 A;  3FEO A;  2RI3 A;  4BE1 A;  4OVA A;  2L8D A;  3KUF A;  4C5E A;  3P8D A;  4HCZ A;  2JTF A;  2G3R A;  2RHU A;  5IAY A;  1RI0 A;  3NTI A;  4QQG A;  5KE3 A;  4A4G A;  2LVM A;  2M16 A;  3OS0 A;  1OYX A;  2RI5 A; 
#chains in the Genus database with same CATH topology
 5C6S A;  2EQJ A;  1G5V A;  2J06 A;  2XKO C;  4KGZ B;  4JRQ A;  4LUD A;  1NPR A;  4ZTJ A;  2DBM A;  4L6V 5;  4AT1 B;  3EG9 B;  2DPP B;  1MGQ A;  4MMK A;  3VV0 A;  1VQ6 A;  1EX4 A;  2X4X A;  3RR6 A;  5GMK i;  3OYJ A;  1Q81 R;  3TSZ A;  1B34 B;  4CC7 A;  1PD0 A;  3HFN A;  1OU8 A;  1MHN A;  4FYY B;  2XID A;  2ABL A;  1ZLM A;  4DQ2 A;  5KH6 A;  3LH0 A;  2EGE A;  3EFR A;  2FG0 A;  4K11 A;  1VQP Q;  3CCM T;  4ELZ C;  2EBP A;  3E2U A;  4M77 A;  3QXE B;  1VIF A;  2PUK B;  1Q82 U;  2QQS A;  5KYU A;  4XTY A;  4M77 D;  4M78 E;  2J7I A;  1UGV A;  1X2K A;  2GQI A;  3H6Z A;  3HRS A;  2DRK A;  1K8A C;  3PMT A;  2FZG B;  1RAI B;  4BDY A;  4WF2 A;  2G6F X;  3UA6 A;  3I5S A;  3P8B B;  2DMO A;  3MET A;  2FZK B;  4C0D C;  4LDW A;  4KUI A;  4KGV B;  5GAN 4;  1UUE A;  1K9A A;  5J26 A;  3I35 A;  1KD1 U;  2QG9 B;  3CCU Q;  2MMP A;  3CPW S;  4IUP A;  5GAN e;  3G4S T;  1KHI A;  3JCM b;  2OAW A;  2X3X D;  1M90 U;  2R57 A;  2EQI A;  2RI3 A;  5DLO A;  5GMK h;  4HVU A;  4OGC A;  3UPU A;  2LP5 A;  1VQL A;  1RAE B;  3NTI A;  3CBP A;  2VGN A;  4M78 B;  1WZO A;  2FL7 A;  1YIT T;  3CC4 T;  4II1 A;  2HKQ B;  1X75 C;  2FPE A;  3EFO B;  4R55 A;  2CDT A;  1HSQ A;  3SWN C;  1XJW B;  2QQR A;  1NYF A;  1WHJ A;  5J39 A;  2DXB A;  2QDY B;  2YDL A;  4OF1 A;  1O75 A;  4J9D A;  4F14 A;  4E7K A;  2DRM A;  1AHJ B;  4QQ6 A;  4FIB A;  4PJJ A;  4AFZ C;  2L2P A;  3A8L B;  1H3Z A;  5FW9 A;  2HCK A;  4A63 B;  2CZ0 B;  3M4Y A;  1FYN A;  5FU7 C;  2RM4 A;  3EGD A;  3M0U A;  1SSH A;  1I81 A;  4GBQ A;  2JJ9 A;  1Q81 U;  4A4K A;  1VQ5 T;  1Z9Z A;  1NPP A;  3N5B B;  3H0H A;  2RD1 A;  3ZEH A;  1W2B S;  2EKH A;  2HBW A;  2DEU A;  2E64 A;  3CCV Q;  2C06 A;  2VUB A;  3C94 A;  1E7O A;  1QWF A;  2HDA A;  1UB4 A;  3TQ7 P;  2O9V A;  1ARK A;  1OPL A;  2DTI A;  3JB9 I;  4DOW A;  3GF5 A;  3OB9 A;  3QZ9 B;  2A0F B;  3QO3 A;  2AZV A;  4BI4 A;  2X35 A;  1F1B B;  4A4H A;  3CC7 A;  1M30 A;  5GAN 3;  2CRE A;  2JN0 A;  3V7S A;  4C8Q E;  4XU2 A;  1RAD B;  2EW3 A;  3QHS A;  3BDU A;  2DTH A;  2KBT A;  5FWB A;  4CC3 A;  3L1A A;  4M75 E;  4EPC A;  3NHN A;  2ZCF B;  1G3Y A;  3CBO A;  1N6A A;  1HYO A;  4RTV A;  1Y96 B;  1I07 A;  4F7U E;  1VIE A;  1VQ9 A;  1AWJ A;  2DZC A;  3FDR A;  4N4I A;  3RKW A;  1VQO Q;  3JCM c;  1TUC A;  1TU0 B;  2OI3 A;  2KRN A;  1XTD A;  1ZUU A;  2XDD A;  2JTF A;  1BI3 A;  1RI0 A;  4LDX A;  2LVM A;  3I5R A;  4XTV A;  2L5Q A;  4PJL A;  4MZM A;  3L2Z A;  2VXE A;  2RHX A;  2CP2 A;  4ZN1 A;  1UJ0 A;  2FVU A;  2ZZD A;  4PLL A;  4C8Q B;  3QUI A;  3OS5 A;  4J6W A;  4OP0 A;  4B6M A;  1OX9 A;  5IHK A;  2JMC A;  4M75 B;  3JB9 H;  2NUP A;  3MEV A;  5I22 A;  1D0Z A;  3CCQ Q;  2O01 E;  3QSU A;  1MMG A;  2HQH A;  4B9X A;  4KUD K;  4F7U B;  1FWZ A;  1RAG B;  4L5G A;  1MUZ A;  1Q7Y R;  4KBM B;  2FPF A;  3QII A;  3G6E T;  4JUV A;  3RUX A;  1EZZ B;  1QVF P;  3X26 B;  4KGX B;  2RJF A;  5HKC A;  2ENM A;  4RG8 A;  3CD6 T;  3H0F A;  5IXB A;  4O6J A;  3M4G A;  2DO3 A;  1VQ6 Q;  1VQK A;  1M8V A;  3E1S A;  4RTZ A;  5IHI A;  2ECZ A;  1WJR A;  3CCL T;  2DXT A;  1D3B A;  3NTK A;  2J6K A;  1NBE B;  2LQ8 A;  3LH5 A;  3LW5 E;  3OSV A;  3FRN A;  5M9O A;  1OQK A;  5AYF A;  4JJB A;  2LCL A;  3M0P A;  1KFZ A;  4JJC A;  3MP6 A;  1VQ7 T;  1V1C A;  2O2O A;  1JB0 E;  3RNJ A;  3TRE A;  2QA4 A;  3EG0 A;  1HXD A;  2O88 A;  2EJF A;  1VQ8 Q;  1BCO A;  1UTI A;  1RAA B;  4OMN A;  1KIK A;  4ME7 A;  1S72 A;  4KH1 B;  4EMG A;  3L2V A;  3V7C A;  3PVQ A;  1SRL A;  1Q86 C;  1K73 R;  4DOV A;  3RER A;  3EH2 A;  2GFA A;  3OYE A;  3NFC A;  1OX8 A;  2J05 A;  3S3O A;  1PM3 A;  1LJO A;  1RLP C;  2MPX C;  4N0A A;  5D6X A;  3VU3 C;  3JSC A;  1M1K U;  1JEG A;  3UF4 A;  1Y7X A;  2DJZ A;  4E7Z A;  2XG8 D;  1VQP T;  1YWO A;  1UGQ B;  2QGG A;  2KRS A;  1X2Q A;  1HK9 A;  3OYM A;  1VQL Q;  1YIJ A;  3CC4 Q;  4C5G A;  3DB4 A;  1QQJ A;  4QVZ A;  3RDV A;  3MKD A;  1BI2 A;  3FB9 A;  2DBK A;  2MWP A;  3CCJ A;  1YJN A;  3OW2 P;  2I2L A;  4JJD A;  4M7A A;  1M3B A;  2RA2 A;  3RIR A;  1YHQ T;  2D9T A;  2KT1 A;  3VRZ A;  5LJ5 e;  3SWN A;  5FU6 C;  1NYG A;  1SEM A;  1BI1 A;  1RUW A;  4MML A;  4OMO A;  5KYX B;  4CC4 B;  3QG1 A;  5HCK A;  4C5I A;  1H92 A;  1MNE A;  1O9S A;  3CCU T;  3OQ5 A;  4M77 E;  1FMK A;  1IGU A;  2R58 A;  2VAS A;  3O5Z A;  4LE9 A;  2IVW A;  4YTL A;  3NMZ C;  3JCM e;  4A54 A;  4CI0 C;  1RL2 A;  4ESR A;  2JMA A;  2ROL A;  2XI9 A;  1TUG B;  4N4H A;  5HK0 A;  3L2U A;  1VQM Q;  1WLP B;  4DBH A;  3VJP A;  2KRO A;  4OVA A;  1JJ2 S;  1QVF A;  1ZSZ A;  1S1N A;  2K5L A;  5GAO r;  2QK0 A;  3CC7 Q;  1M2V A;  3UDC A;  1NJI C;  4XAX B;  2X9H A;  4X34 A;  2LMJ A;  2NUT A;  2GF7 A;  1Y57 A;  1UFF A;  5DLQ E;  2MWO A;  4ZNX A;  8AT1 B;  3PVL A;  5ECA A;  1K9M U;  1I8F A;  2VVK A;  5GAN 5;  1BU1 A;  3H9N A;  2DE0 X;  1M27 C;  1VQ9 Q;  3EG2 A;  4AFS C;  4X1V A;  1WHM A;  1IO6 A;  3I55 A;  1K9M C;  1Y71 A;  1ZUY A;  4M77 B;  2QEX T;  3S3N A;  1I5L A;  3CCV T;  2GBQ A;  5KYU B;  3A8G B;  4PFO A;  2CS7 A;  2DVE A;  3MP1 A;  5GAN 8;  5LJ3 j;  3OYG A;  1PKT A;  3U23 A;  3JRZ A;  5KYW A;  2K5F A;  4J9H A;  1NEB A;  4DEY A;  1H8K A;  3OMC A;  3C4S A;  3ZBD A;  5C0M A;  2CP7 A;  3LX7 A;  2RK1 A;  1R0C B;  2I0N A;  1U06 A;  3HRT A;  3PFS A;  1BCM A;  2XD0 A;  4HCB A;  3REB B;  3ZL7 C;  2XHC A;  1FXX A;  3M0Q A;  3HL8 A;  1K8A R;  3L2R A;  4JLG A;  1KQS P;  2IG0 A;  2MF2 A;  2A36 A;  2H8H A;  2KMT A;  3CC2 A;  4IIO A;  2AKK A;  1ACM B;  4MDX A;  2HEQ A;  2XDB A;  2J6F A;  1LCK A;  3A8M B;  4RKU E;  3SEM A;  4Y92 A;  1VQN A;  1VQO T;  5L8R E;  4IUR A;  1GFD A;  2P0K A;  4JZ4 A;  1IRX A;  4E7I A;  3E19 A;  8ATC B;  2YWW A;  2CP5 A;  1V76 A;  3PT9 A;  2HSE B;  1KQ1 A;  2DD5 A;  1KD1 R;  4J9G A;  3OW2 A;  1ZA2 B;  1NZ9 A;  3WVD B;  5J3B A;  4BB7 A;  3JCM J;  3CCR A;  4F04 B;  1CKA A;  3I9Q A;  3JAM E;  1QVP A;  2YUN A;  4FW2 A;  3CME A;  1YJW A;  3VS1 A;  5CKH A;  3EGD B;  2K3B A;  2D6F A;  1OEB A;  3CCQ T;  4M4Z A;  3JCM X;  1WXU A;  1B3Q A;  3PMI A;  2DAQ A;  3BW1 A;  3G71 Q;  2H3J A;  2WSE E;  5DY9 A;  2QA4 Q;  4FL6 A;  5FRN A;  2C0T A;  3THK A;  4M78 C;  2E10 A;  3EGU A;  4WCI A;  1S72 Q;  4J9C A;  2LQK A;  2ZPH B;  2ZAE A;  2AK5 A;  4D8D A;  3H0I A;  4OB2 B;  4PNO A;  3VS5 A;  1VQ6 T;  2M0O A;  4JZ3 A;  3OYD A;  2F1L A;  1TSF A;  3RKX A;  1WX6 A;  4EMK C;  2X4Y A;  1K8A U;  4ZGJ B;  1TXQ A;  1VYU A;  2K3X A;  2E6Z A;  4GLK A;  1JU5 C;  2WAC A;  3A8O B;  5GAM d;  2KT8 A;  4IUV A;  2O4X A;  1OPK A;  4BY6 C;  3RES A;  1YIJ Q;  2LCS A;  1NEG A;  4DA4 A;  1KG1 A;  1HJD A;  2O31 A;  1VQ8 T;  1X43 A;  2CUD A;  2CH4 W;  2EYW A;  4LN2 A;  1YJN Q;  2CSI A;  3OYL A;  1YHQ Q;  2RJC A;  2C0O A;  2M0Y A;  4HCC A;  2EYQ A;  4LUE A;  1WFW A;  3G1J A;  5D7U A;  2P84 A;  3JCM W;  1IXD A;  1X27 A;  1PRL C;  2JTM A;  2P0P A;  1M4Z A;  2D8H A;  3CPW P;  1VQ4 A;  1D1A A;  1W6X A;  2GGR A;  1PSF A;  2CT4 A;  3TCJ A;  3OYI A;  2DL3 A;  1WXT A;  2D1X A;  2VGM A;  2NUP B;  2EQM A;  3QDF A;  4XU3 A;  5I21 A;  3VUB A;  3F70 A;  4OMF B;  2M02 A;  2RQU A;  5DM7 R;  4BE0 A;  5IH2 A;  2M51 A;  2GQV A;  1VQL T;  5CR2 A;  2YRC A;  3MPU B;  3LGL A;  2PNI A;  2WSC E;  2NLU A;  3CQT A;  1WQ7 A;  3JCM P;  3VRY A;  2MI6 A;  4C0G A;  3KXT A;  4HT9 A;  4C8Q C;  3RMS A;  4J9I A;  1QVG P;  4M78 F;  1YP5 A;  3R6N A;  3CCS Q;  1D3B B;  1N8R C;  2RMO A;  1YJ9 A;  5GAN 2;  5GAN d;  1K0X A;  2LQN A;  2M9U A;  3VS7 A;  2DNU A;  2QEX Q;  3EAE A;  1AWO A;  1UGP B;  1D1C A;  1ZBJ A;  3X25 B;  2XU8 A;  2YLC A;  4KUL A;  2EAY A;  4XQ3 A;  1K76 A;  1VQM T;  1RAB B;  4M7A E;  1ABQ A;  5IT9 E;  1OZ2 A;  3CC7 T;  2CP3 A;  1QKW A;  2L3Q A;  4BE1 A;  1YI2 A;  3KFV A;  2BZY A;  2K57 A;  2L8D A;  2RHU A;  3M5A A;  2EJ9 A;  3GOX A;  3QZ5 B;  1D0X A;  4M78 G;  3CC2 Q;  3GNG A;  4IUU A;  4J9E A;  1FMV A;  3OMG A;  4HVV A;  4IUT A;  1ZQ1 A;  1VQ9 T;  4OMP A;  2OTJ A;  2KEA A;  4PLI A;  4XTU A;  2V8J A;  3OYH A;  1BI0 A;  2PU9 B;  4A4F A;  3CMA A;  4HKE A;  4DBQ A;  2DJQ A;  2CYZ B;  2K5I A;  2MIO A;  1VA7 A;  4RUG A;  1JO8 A;  1OU9 A;  3M53 A;  3T9N A;  4E7S A;  1OI1 A;  2X3W D;  2HQX A;  4M7A B;  1OZ3 A;  3V8L A;  1M1K R;  1M8M A;  2CP6 A;  2EVR A;  3QDR B;  3MHX A;  4F17 A;  3CME Q;  1YJW Q;  1WJS A;  1WHG A;  1I0C A;  2DD4 A;  3X28 B;  1GRI A;  2V8I A;  2K4Y A;  2K6D A;  4QW2 A;  3CXC P;  5CKF A;  3S3M A;  1R8O B;  2RJE A;  3HP9 A;  3HSB A;  1LPL A;  1MV0 B;  3VUZ A;  4C8Q F;  2W0Z A;  4C0Z A;  4JS4 A;  1WA7 A;  4LDU A;  2K7A A;  3A5Z B;  1X6G A;  1DJ7 B;  4FT4 A;  1U8R A;  1PC0 A;  4ELY C;  2CH4 A;  1ZSZ B;  2HKN A;  3MEU A;  2EKO A;  4F7U F;  1NE8 A;  2R5M A;  1TWB A;  1BIA A;  1M2V B;  1NG2 A;  4QT7 A;  3OYB A;  2PQW A;  3L2Q A;  3REA B;  3BFM A;  1SRM A;  2NUT B;  3CD6 A;  5GMK j;  4M78 D;  1VQK T;  2AKL A;  1QVF S;  1GCQ C;  2HAX A;  4OMM A;  3M55 A;  3QYH B;  5CKE A;  2E12 A;  5FRM A;  1LOJ A;  2M16 A;  2JM8 A;  3MEW A;  4IUQ A;  2RQW A;  1QVG A;  1BBZ A;  2KNB B;  2P4T A;  2FRW A;  1IGQ A;  3G7Z A;  4J6Y A;  5LJ3 e;  4EMK A;  2RK2 A;  1AZG B;  2RQV A;  1Q86 U;  2V1Q A;  3MP8 A;  3G71 T;  1NM7 A;  2L0A A;  2E41 A;  5KYY A;  2QA4 T;  4C8Q G;  4Z88 A;  2F2W A;  2QDL A;  2W10 A;  2ED1 A;  2YLB A;  4NS5 A;  2MCN A;  2C0I A;  5KYW B;  5FLX E;  1K9M R;  1S72 T;  1G3W A;  3GBQ A;  4GLM A;  2HSP A;  2F5T X;  4ZTF A;  4F7U G;  3PIO A;  2DL8 A;  2DET A;  3SHW A;  2V8K A;  2JVV A;  4IIM A;  4HVW A;  1FX7 A;  2DXC A;  2RO0 A;  2YUQ A;  2OTL A;  3VS6 A;  4E7L A;  4M7D C;  1EFN A;  1Z9Q A;  2EWN A;  4PJO C;  2FYK A;  3PE0 A;  3QPH A;  2FB7 A;  4L59 A;  3UAT A;  3E9F A;  4RCC A;  2QTX A;  1YIJ T;  2A28 A;  2KVQ G;  2DKG A;  4ZN3 A;  3DLM A;  1SHG A;  2SRC A;  4PFZ A;  3CCJ T;  1YJN T;  1BIB A;  2BTT A;  1YNZ A;  2JUF A;  5CVI A;  4FT2 A;  2EGC A;  2LZ6 B;  2LX9 A;  2EQK A;  4Z89 A;  5LJ5 h;  5IHN A;  3M56 A;  4X9C A;  4MZP A;  1BYM A;  5I11 A;  1U5S A;  2Z0W A;  1WYX A;  2CUB A;  2QXF A;  1UDL A;  4C5E A;  3P8D A;  1YJ9 Q;  3I56 A;  4C92 C;  2VV5 A;  1PCX A;  2KYB A;  3FJP A;  3CCE A;  3OW2 S;  3RKY A;  2L3R A;  3JCM h;  2BUD A;  3EHQ A;  2RF0 A;  1Q7Y C;  4C8Q D;  1NJI U;  4E47 A;  4V2S A;  1MMD A;  3PIP A;  3CXC A;  1I5O B;  1M3C A;  1YN8 A;  2X51 A;  2RHZ A;  2E65 A;  4ORZ A;  1AD5 A;  2BKD N;  2KQW A;  2EIF A;  2YSQ A;  1JBM A;  2DXU A;  3GNF B;  5GJV B;  3MO8 A;  1G2B A;  1WHH A;  2KR3 A;  2QI2 A;  4LDV A;  4OML A;  3VKI A;  1XOV A;  1AOJ A;  2DFU A;  1YI2 Q;  1YCS B;  1MMN A;  2FZC B;  4PFP A;  5LJ5 d;  1D1B A;  1G3S A;  3V8K A;  2PUO B;  3BE3 A;  1T0J A;  2AHJ B;  5GAN 6;  2DVJ A;  3DKM A;  3VS2 A;  3M58 A;  3CCS T;  2E3H A;  4FW1 A;  4QKU A;  1IHV A;  2VC8 A;  1Y0M A;  1B7T A;  2QGF B;  3JCM d;  4RMO A;  2V26 A;  5GAO q;  2PVG B;  3O8V A;  2OTJ Q;  4RTU A;  2VKN A;  5GMK m;  3CMA Q;  1UHF A;  2O4X B;  2EQU A;  5KYN A;  4LXC A;  2LT1 A;  1CKB A;  1W1F A;  3TU4 K;  4M7D F;  2YUO A;  3HHT B;  3CCV A;  2ROT A;  3MEA A;  5GAO n;  2HZY A;  1K73 C;  4PJO F;  1G8X A;  1M5Q 1;  2DZ9 A;  1VOM A;  4BUG A;  3PNW C;  3CPF A;  2RN8 A;  3VS3 A;  2FHD A;  2X4W A;  2GFU A;  4OMQ A;  1T0H A;  2V1R A;  1U3O A;  2AT1 B;  4HCK A;  2HBP A;  2KRM A;  3CC2 T;  2QAS A;  2COY A;  4Y28 E;  5FU6 B;  3WXM B;  2HNI A;  3R6O A;  1OYX A;  2RI5 A;  2GTJ A;  4FM4 B;  1WGS A;  7AT1 B;  4DBF A;  2ZPG B;  4IKF A;  1KC8 U;  2LRQ A;  1IHW A;  5EC7 A;  4HXJ A;  2DER A;  1C0M A;  1KQS S;  3FLG A;  3VS0 A;  4CRI A;  1ZUK A;  4C92 F;  1RI9 A;  1K1Z A;  1WXB A;  1UEB A;  4RTT A;  2E6N A;  2YRV A;  1WQW A;  4KRT A;  3Q1J A;  1KC8 C;  4M7D G;  5HK3 A;  1VQK Q;  4PJO G;  4J7I A;  2ZGW A;  5CAI A;  3ER0 A;  2JZ2 A;  3RMQ A;  3SDZ A;  1GBR A;  4FYV B;  3CEY A;  2K79 A;  1WJQ A;  3CME T;  4EMH A;  1YJW T;  2DL7 A;  4EIK A;  1GCQ A;  1I4K 1;  2OAU A;  1T3S A;  1H3H A;  5GAM h;  3BDL A;  4XU0 A;  2MAM A;  2AIR B;  3HTR A;  4BI8 B;  1PNJ A;  1D0Y A;  3FC3 A;  3CCQ A;  3ZFJ A;  4OB0 B;  2EGA A;  3BY7 A;  3M54 A;  2LNH B;  1HD3 A;  4C92 G;  4J7F A;  1WI7 A;  2Y4X A;  4LD6 A;  1AT1 B;  1Y07 A;  1GFC A;  4JDS A;  3SFM A;  3RBB B;  4D6W A;  1X69 A;  4NOY A;  4Z02 A;  2DF6 A;  2DIL A;  1N5Z A;  5D6W A;  2L89 A;  3JV3 A;  2KGT A;  3QYG B;  4J9F A;  4LDY A;  2F5K A;  1RAH B;  2OTL Q;  4HT8 A;  3M0R A;  5GAM g;  3OBY A;  1AZE A;  2CZ7 B;  3HFO A;  1R0B G;  3HRU A;  2DX1 A;  3URG A;  2QQB A;  2P0Q A;  4E6R A;  1P92 A;  3CCM A;  4M7D A;  1K0S A;  3QKJ A;  1JXM A;  4X9D A;  4XK8 E;  4PJO A;  4M7D D;  1GBQ A;  1PHT A;  3CCJ Q;  4PJO D;  5I2M A;  2K9G A;  4DBR A;  3AT1 B;  4ZGD B;  5GAM f;  5GMK l;  2FEI A;  1VQ8 A;  3QWY A;  1UGS B;  3C95 A;  4F16 A;  1SKU B;  2RHI A;  1QCO A;  4RTW A;  3JCM V;  1Q82 C;  2PZ1 A;  1VQ4 T;  1M9S A;  3I56 Q;  1KQS A;  5GAN h;  2KXC A;  3GP8 A;  3CCE Q;  5GAN 7;  2DK3 A;  1XNI A;  3M0T A;  4N0A C;  4Z8A A;  3L42 A;  1PRM C;  3V7R A;  4KT0 E;  2KAF A;  1MND A;  1OV3 A;  1BK2 A;  1ZHI A;  2GCX A;  2JS2 A;  4C92 A;  5GAO p;  1AVZ C;  3G4S A;  1UJY A;  4B9W A;  4C92 D;  3TEE A;  3OA6 A;  4TVR A;  2FRY A;  2RQT A;  2GTO A;  1TUD A;  5CK9 A;  2VXF A;  2DTO A;  5KCO A;  1YWP A;  1N8R U;  3M9Q A;  5GMK e;  1KD1 C;  2A7Y A;  4D8K A;  3QJY A;  2BIV A;  2KDS A;  5GAO l;  1A0N B;  2JNG A;  1YIT A;  3KBG A;  3A98 A;  4XTW A;  3CC4 A;  4PL6 A;  4M7A C;  2LJ3 A;  1AWW A;  2DLP A;  2A37 A;  1G83 A;  4GY5 A;  5GAN g;  5AT1 B;  3EGX A;  2CGH A;  1KQ2 A;  4JS5 A;  4AFU C;  1M90 C;  2YRD A;  2E5K A;  3OS1 A;  2NWM A;  4OGE A;  4N4G A;  1W2B P;  3OYC A;  4M75 C;  2JXB A;  1YJ9 T;  2P4R A;  9ATC B;  1R77 A;  2DM1 A;  4BI3 A;  1QP2 A;  2F2X A;  3I55 Q;  1B07 A;  1VQ5 A;  4J6X A;  2BE7 D;  4QQG A;  1TG0 A;  1BKB A;  4EMK B;  1YCY A;  1QVG S;  1AWX A;  2O9S A;  4C5H A;  1JRI A;  1IB8 A;  3SB2 A;  5KYY B;  3OSS C;  5GAN f;  3FJ5 A;  4EDU A;  2JW4 A;  1UE9 A;  1M1G A;  2KSS A;  3A8H B;  2JT4 A;  2JM9 A;  4LNP A;  1RAC B;  4BY6 B;  4WTO B;  1ZSZ C;  1Q81 C;  1LNX A;  1NLP C;  2EPD A;  1C6V X;  1YI2 T;  1SHF A;  1VQM A;  3JB9 J;  1Q95 G;  1KSW A;  2VB6 A;  2PTK A;  3EG9 A;  5GAM j;  4C0D B;  2HL5 C;  1EIF A;  2LTO A;  1B34 A;  1Q86 R;  2HQE A;  4JJN K;  2CZ1 B;  1RAF B;  1MV3 A;  2DYB A;  1VQN Q;  4ANJ A;  1VYT A;  2OTJ T;  2PVO B;  4O5V A;  2KI7 A;  3CMA T;  2FO0 A;  4XU1 A;  4FCY A;  5A2Q E;  2E70 A;  4FYW B;  2SEM A;  3OYY A;  2QQ9 A;  3M57 A;  3E9G A;  1ZBX A;  2XIC A;  3CCR Q;  3ASK A;  1WHK A;  2L3P A;  3SWN B;  3LWI A;  1D09 B;  3DB3 A;  4E7H A;  5LL6 S;  2XMF A;  2LNV A;  2ED0 A;  3QWX X;  3CPW A;  3INZ A;  5KE2 A;  3X24 B;  1ZSG A;  2D0N A;  3PGG A;  2DA9 A;  4FSS A;  1TOV A;  5CQY A;  3X20 B;  2KE9 A;  5EG2 A;  5FU7 B;  4M7A F;  1X6O A;  4LD9 K;  3EFS A;  1T3L A;  4AFQ C;  2F69 A;  2COW A;  2GNC A;  1QW1 A;  2H3E B;  4NL2 A;  1MMA A;  4M75 F;  4FYX B;  3G6E A;  1KHC A;  1N9R A;  2JTE A;  3NTH A;  4Q5W A;  5GAN j;  1UEC A;  4M78 A;  3CXC S;  3ME9 A;  4J83 A;  4FSX A;  3OYK A;  3MCA B;  4AG2 C;  3EFO A;  1JQQ A;  2R5A A;  1WIE A;  4E2F B;  2RQR A;  5CKD A;  2DL5 A;  3J81 E;  1SSF A;  2LC4 A;  3LLR A;  1M2O A;  1RLQ C;  1NJI R;  2KYM A;  3CCL A;  2X4J A;  4RTY A;  3DLL A;  2RNA A;  3C0C A;  1W2B A;  2BZ8 A;  2HMA A;  5LJ3 h;  1QMC A;  1IRE B;  3UA7 A;  2F2V A;  2K3Y A;  3IQL A;  1E6G A;  4BAC A;  3EHR A;  4E7J A;  2L3S A;  4FU6 A;  3CCM Q;  4M7A G;  2BZX A;  2YHT A;  1SPK A;  3L2W A;  1OOT A;  3OS2 A;  4M75 G;  2COZ A;  1VQ7 A;  3V8J A;  2RH2 A;  3G71 A;  2RPN A;  1ABO A;  4JLI A;  2VYT A;  1ZA1 B;  2BE9 B;  3HPW A;  4AMC A;  1M3A A;  2E4H A;  3CBM A;  5L23 A;  1VQ4 Q;  5KCH A;  1WNL A;  2ZPE B;  2DYI A;  3LYI A;  4KH0 B;  5LJ3 g;  1K4U S;  4BE2 A;  3JB9 F;  1GL5 A;  2OTL T;  2RB6 A;  3QJ6 A;  2D0Q B;  3GIB A;  5LJ3 d;  1J3T A;  2LT4 A;  2Y90 A;  1Y96 A;  1E6H A;  3H41 A;  4M77 C;  5I2S A;  1V29 B;  3FEO A;  3G4S Q;  4J9B A;  1VQP A;  3GPL A;  1AEY A;  1QLY A;  2KY9 A;  2EFI A;  4QVD A;  1WHL A;  2ZPF B;  1W4S A;  1PSE A;  2K2M A;  2VWF A;  2JS0 A;  1OUL A;  5LJ3 f;  1M1K C;  1YBY A;  4DEX A;  1YIT Q;  1IZ6 A;  4PK4 A;  4AG1 C;  2LDM A;  2DEQ A;  2CKK A;  2IPO B;  4RCB A;  2CT3 A;  1LVK A;  1Q7Y U;  5A0G A;  1YHQ A;  4OB1 B;  2HL3 A;  3EG1 A;  2QYZ A;  2ESW A;  2HD0 A;  3HKS A;  1KC8 R;  3I56 T;  4NL3 A;  3CCE T;  4C8Q A;  1PWT A;  1KJW A;  2QTV A;  4C0F A;  4M7A D;  1VYV A;  4JRK A;  2RHY A;  1KK7 A;  1QKX A;  3H8Z A;  3JB9 G;  2LQW A;  2E5Q A;  5FWC A;  2J6O A;  4M75 A;  1VQ5 Q;  4M7D E;  3CCU A;  4BDZ A;  1G3T A;  4A53 A;  3ULR B;  4M75 D;  4Y91 A;  1UHC A;  4PJO E;  1JJ2 P;  1N9S A;  4F7U A;  4PJM A;  5A0L A;  3OBW A;  3QBY A;  3J7A F;  2EYY A;  1TH7 A;  6AT1 B;  4QVC A;  4ZGE B;  5IXF A;  5LJ5 g;  1SF9 A;  1XQH A;  1GXI E;  4RTX A;  2OJ2 A;  1ZX6 A;  2A3L A;  3UT1 A;  2E1H A;  4PKC C;  4HA8 A;  4PJN A;  3WVE B;  3OY9 A;  4JPB W;  2PVD B;  2CZ6 B;  1X01 A;  2B8A A;  3JCM g;  2K2V A;  2LJ0 A;  1PKS A;  4RG2 A;  3A1P A;  3VS4 A;  1QCN A;  4C92 E;  5LJ5 f;  5GJW B;  4R0K A;  3I55 T;  4UC4 A;  1K73 U;  2KXD A;  1GCP A;  2YT6 A;  3CCS A;  5CIU A;  5CQX A;  2A08 A;  3SD4 A;  1U1T A;  2LJ1 A;  4M7D B;  2LX7 A;  4R56 A;  3KUF A;  5HY6 A;  1BB9 A;  4J5Y A;  2NYS A;  2QEX A;  2YUP A;  4HCZ A;  3PTA A;  2G3R A;  2YXY A;  4PJO B;  1NLO C;  4A4G A;  3OS0 A;  3JCM f;  2DIQ A;  2NUZ A;  4M77 F;  1JXO A;  1WPY A;  1C1A A;  4CC2 A;  4MDW A;  2Y4Y A;  3TVT A;  2EYZ A;  4VUB A;  2FPD A;  2D8J A;  3EG3 A;  2RI2 A;  3OYN A;  4JRI A;  3VYH B;  5CKB A;  2MOX A;  3JB9 D;  2RJD A;  1X6B A;  4MZT A;  3MJX A;  2ZPB B;  2JOY A;  5CCA A;  5D6Y A;  4XTX A;  3LGF A;  2LCC A;  3J80 E;  5GAO m;  4C92 B;  4ATO A;  2E3I A;  2XK0 A;  1Q82 R;  1VQN T;  3VYG A;  2OX7 A;  4JRP A;  2XDP A;  3C12 A;  3NGP A;  1TS9 A;  2CSQ A;  2AZS A;  2ZPI B;  3TSW A;  3OYF A;  1TTH B;  3OYA A;  1VQO A;  2IIM A;  3G6E Q;  4J8O A;  1WDX A;  3NPF A;  4QQD A;  1U1S A;  1W70 A;  3P8H A;  4OB3 B;  1CSK A;  1UGR B;  1I1J A;  2EYX A;  3CD6 Q;  4M77 G;  1FMW A;  1QCF A;  1QWE A;  3JCM Q;  1N27 A;  3D7S B;  3CCR T;  2MK5 A;  3EGX B;  3LWH A;  1QP3 A;  4BD3 A;  2M1H A;  3S6W A;  2CP0 A;  3UWN A;  5A0D A;  3CCL Q;  3EH1 A;  3FIF A;  3GLX A;  5KYX A;  3M59 A;  1YFN A;  5IN1 A;  3M0S A;  2B86 A;  5FRO A;  1PD1 A;  2ATC B;  2DIG A;  1M90 R;  1N8R R;  5LJ5 j;  2WSF E;  4XTZ A;  2QAZ A;  2DL4 A;  4P5N A;  1M1F A;  1UG1 A;  2QQA A;  3AHU A;  1VUB A;  1JJ2 A;  1VQ7 Q;  2EJG A;  2KK4 A;  5KE3 A;  5GAM e;  1SG5 A;  2MYS A;  5CO7 A;  5IAY A;  4A4E A;  1PG5 B;  1H64 1; 
#chains in the Genus database with same CATH homology
 5C6S A;  2EQJ A;  4IUQ A;  1G5V A;  1YCY A;  2GF7 A;  1QVG S;  1QVG A;  5DLQ E;  2P4T A;  4C5H A;  1JRI A;  3G7Z A;  2XKO C;  3SB2 A;  2MWO A;  3OSS C;  4J6Y A;  5GAN f;  4JRQ A;  4EDU A;  1M1G A;  2KSS A;  5LJ3 e;  1K9M U;  1NPR A;  4EMK A;  1I8F A;  4ZTJ A;  3A8H B;  5GAN 5;  2RK2 A;  4L6V 5;  1Q86 U;  3MP8 A;  2DPP B;  1MGQ A;  4BY6 B;  3G71 T;  2E41 A;  4MMK A;  1Q81 C;  3VV0 A;  2QA4 T;  1VQ6 A;  1LNX A;  4C8Q G;  2X4X A;  5GMK i;  3OYJ A;  1YI2 T;  1VQM A;  3JB9 J;  1B34 B;  5GAM j;  2YLB A;  1Y71 A;  4M77 B;  3HFN A;  3I55 A;  2QEX T;  3S3N A;  1K9M C;  4C0D B;  1EIF A;  2LTO A;  1MHN A;  4NS5 A;  3CCV T;  1I5L A;  2XID A;  5FLX E;  4DQ2 A;  5KH6 A;  1S72 T;  3LH0 A;  3A8G B;  3EFR A;  1G3W A;  3CCM T;  1B34 A;  2CS7 A;  2HQE A;  2DVE A;  2F5T X;  4ELZ C;  4ZTF A;  4F7U G;  3MP1 A;  5GAN 8;  3PIO A;  5LJ3 j;  3OYG A;  4JJN K;  4M77 A;  3QXE B;  1VIF A;  2CZ1 B;  3JRZ A;  2PUK B;  2K5F A;  2V8K A;  1Q82 U;  2QQS A;  2JVV A;  4XTY A;  4M77 D;  4M78 E;  3OMC A;  3C4S A;  3ZBD A;  1FX7 A;  2DXC A;  3LX7 A;  5C0M A;  3H6Z A;  2RK1 A;  2RO0 A;  3HRS A;  2PVO B;  4O5V A;  2OTL A;  3HRT A;  1K8A C;  3PFS A;  3PMT A;  2XD0 A;  4BDY A;  4E7L A;  4M7D C;  4HCB A;  4WF2 A;  2XHC A;  1FXX A;  3CMA T;  3HL8 A;  4XU1 A;  3P8B B;  3L2R A;  4JLG A;  2EWN A;  2IG0 A;  2MF2 A;  5A2Q E;  2E70 A;  4PJO C;  2FYK A;  4X34 A;  3MET A;  2KMT A;  3OYY A;  4C0D C;  3QPH A;  4LDW A;  4KUI A;  2FB7 A;  4L59 A;  3E9F A;  3CC2 A;  5GAN 4;  4RCC A;  2QQ9 A;  2QTX A;  3M57 A;  1YIJ T;  2KVQ G;  3E9G A;  1ZBX A;  2XIC A;  2DKG A;  4MDX A;  5J26 A;  2XDB A;  3ASK A;  4ZN3 A;  3SWN B;  3DLM A;  3LWI A;  3DB3 A;  3A8M B;  4RKU E;  4E7H A;  1KD1 U;  5LL6 S;  3CCJ T;  1YJN T;  1BIB A;  2LNV A;  2JUF A;  2MMP A;  5CVI A;  4FT2 A;  3CPW S;  3CPW A;  1VQN A;  1VQO T;  5L8R E;  4IUR A;  3INZ A;  2P0K A;  4IUP A;  5GAN e;  2LX9 A;  3G4S T;  2EQK A;  1KHI A;  5KE2 A;  4E7I A;  3E19 A;  3X24 B;  3PGG A;  5LJ5 h;  3JCM b;  3M56 A;  5CQY A;  3X20 B;  4X9C A;  5EG2 A;  1M90 U;  5FU7 B;  4MZP A;  2R57 A;  1BYM A;  4M7A F;  2RI3 A;  5DLO A;  1X6O A;  5GMK h;  4LD9 K;  4OGC A;  3UPU A;  2QXF A;  3PT9 A;  4C5E A;  3P8D A;  3EFS A;  3I56 A;  4C92 C;  2VV5 A;  1VQL A;  3FJP A;  1KQ1 A;  3CCE A;  2DD5 A;  2F69 A;  3NTI A;  3OW2 S;  3OW2 A;  1QW1 A;  3CBP A;  4NL2 A;  2VGN A;  4M78 B;  1NZ9 A;  4M75 F;  3RKY A;  3WVD B;  2FL7 A;  1YIT T;  3CC4 T;  4II1 A;  5J3B A;  1X75 C;  2L3R A;  3JCM h;  4BB7 A;  3CCR A;  2BUD A;  4R55 A;  3JCM J;  3SWN C;  2QQR A;  3JAM E;  4C8Q D;  1QVP A;  5J39 A;  1Q7Y C;  1NJI U;  4E47 A;  4V2S A;  3CME A;  1YJW A;  3G6E A;  1KHC A;  1N9R A;  2DXB A;  2QDY B;  1O75 A;  3NTH A;  4OF1 A;  4Q5W A;  3PIP A;  5GAN j;  4M78 A;  3CXC S;  3ME9 A;  5CKH A;  4J83 A;  3CXC A;  4E7K A;  4FSX A;  3OYK A;  2D6F A;  1AHJ B;  2RHZ A;  3MCA B;  4FIB A;  2E65 A;  4QQ6 A;  3A8L B;  2BKD N;  2R5A A;  1H3Z A;  3CCQ T;  2KQW A;  3JCM X;  2EIF A;  1JBM A;  2DXU A;  3GNF B;  2CZ0 B;  3M4Y A;  3MO8 A;  5CKD A;  5FU7 C;  2RM4 A;  3PMI A;  2DAQ A;  3BW1 A;  3J81 E;  2QI2 A;  4LDV A;  2H3J A;  2WSE E;  1I81 A;  3VKI A;  5DY9 A;  1SSF A;  1Q81 U;  1XOV A;  2LC4 A;  3LLR A;  4A4K A;  1VQ5 T;  4FL6 A;  1NPP A;  5FRN A;  3N5B B;  3CCL A;  2RD1 A;  2X4J A;  3ZEH A;  5LJ5 d;  3DLL A;  1G3S A;  4M78 C;  2E10 A;  3V8K A;  1W2B S;  1W2B A;  2PUO B;  5LJ3 h;  2E64 A;  1IRE B;  2C06 A;  2VUB A;  3C94 A;  2K3Y A;  2AHJ B;  4BAC A;  4E7J A;  1UB4 A;  5GAN 6;  3DKM A;  4FU6 A;  4M7A G;  2LQK A;  2ZPH B;  2YHT A;  3M58 A;  3CCS T;  3L2W A;  2DTI A;  3JB9 I;  4OB2 B;  4PNO A;  4DOW A;  3GF5 A;  3OS2 A;  2VC8 A;  1VQ6 T;  3OB9 A;  3QZ9 B;  3JCM d;  3QO3 A;  4RMO A;  2M0O A;  5GAO q;  4BI4 A;  4M75 G;  2X35 A;  1VQ7 A;  3V8J A;  2PVG B;  3O8V A;  4A4H A;  3OYD A;  3CC7 A;  3RKX A;  2RH2 A;  3G71 A;  4EMK C;  5GAN 3;  2X4Y A;  1K8A U;  4JLI A;  2JN0 A;  3V7S A;  2VYT A;  4XU2 A;  4C8Q E;  5GMK m;  3HPW A;  4ZGJ B;  3QHS A;  2O4X B;  3BDU A;  2EQU A;  2DTH A;  2LT1 A;  3L1A A;  4M75 E;  3CBM A;  3TU4 K;  4EPC A;  4M7D F;  5KCH A;  2K3X A;  3HHT B;  1WNL A;  2E6Z A;  1G3Y A;  2ZCF B;  2ZPE B;  4GLK A;  3CCV A;  3CBO A;  3MEA A;  1N6A A;  2WAC A;  3A8O B;  3LYI A;  5GAM d;  5GAO n;  1K73 C;  4IUV A;  4PJO F;  1Y96 B;  2O4X A;  4BY6 C;  5LJ3 g;  3RES A;  4F7U E;  4BE2 A;  2DZ9 A;  1M5Q 1;  3JB9 F;  4DA4 A;  4BUG A;  3PNW C;  3CPF A;  2OTL T;  1KG1 A;  1VIE A;  1VQ9 A;  2RB6 A;  3QJ6 A;  1VQ8 T;  2DZC A;  2D0Q B;  3GIB A;  5LJ3 d;  3FDR A;  2LT4 A;  2Y90 A;  4N4I A;  1Y96 A;  4M77 C;  2FHD A;  2X4W A;  3OYL A;  3RKW A;  2GFU A;  5I2S A;  2RJC A;  1V29 B;  3FEO A;  3JCM c;  1XTD A;  4HCC A;  2EYQ A;  2XDD A;  1VQP A;  3GPL A;  2HBP A;  2JTF A;  3JCM W;  1BI3 A;  5IAY A;  1RI0 A;  3CC2 T;  2JTM A;  4Y28 E;  2KY9 A;  2P0P A;  5FU6 B;  3WXM B;  1M4Z A;  2HNI A;  2LVM A;  2EFI A;  3R6O A;  1OYX A;  2RI5 A;  4QVD A;  4LDX A;  4FM4 B;  1VQ4 A;  4XTV A;  1WGS A;  2L5Q A;  2ZPG B;  4IKF A;  2ZPF B;  1PSF A;  1W4S A;  1PSE A;  4MZM A;  1KC8 U;  2LRQ A;  3OYI A;  3TCJ A;  3L2Z A;  5LJ3 f;  1M1K C;  1KQS S;  1YBY A;  2VXE A;  3FLG A;  4CRI A;  2RHX A;  2VGM A;  4ZN1 A;  4C92 F;  1IZ6 A;  2FVU A;  2LDM A;  2ZZD A;  4PLL A;  2EQM A;  2DEQ A;  2CKK A;  4XU3 A;  4RCB A;  1UEB A;  4C8Q B;  5I21 A;  1Q7Y U;  3VUB A;  3F70 A;  3QUI A;  5A0G A;  2E6N A;  2YRV A;  1WQW A;  4OMF B;  3OS5 A;  3Q1J A;  4J6W A;  4OP0 A;  5DM7 R;  4BE0 A;  4OB1 B;  1YHQ A;  1KC8 C;  4M7D G;  4M75 B;  3JB9 H;  5HK3 A;  3MEV A;  2HD0 A;  3HKS A;  3I56 T;  2GQV A;  1VQL T;  5CR2 A;  4NL3 A;  3CCE T;  2O01 E;  4PJO G;  4C8Q A;  4J7I A;  2ZGW A;  4C0F A;  3QSU A;  4M7A D;  5CAI A;  4JRK A;  2RHY A;  3H8Z A;  3JB9 G;  4B9X A;  3LGL A;  4F7U B;  4KUD K;  3ER0 A;  2E5Q A;  2JZ2 A;  1FWZ A;  4M75 A;  2WSC E;  4L5G A;  3RMQ A;  4M7D E;  3SDZ A;  2NLU A;  3CCU A;  4BDZ A;  1G3T A;  1WQ7 A;  3CEY A;  4KBM B;  4A53 A;  1WJQ A;  3QII A;  3CME T;  4M75 D;  4Y91 A;  4JUV A;  4EMH A;  3RUX A;  3G6E T;  3JCM P;  1YJW T;  4PJO E;  3X26 B;  1N9S A;  4F7U A;  2RJF A;  5HKC A;  2MI6 A;  5A0L A;  4C0G A;  3OBW A;  3KXT A;  1I4K 1;  4RG8 A;  3QBY A;  3J7A F;  4HT9 A;  3CD6 T;  1TH7 A;  4QVC A;  4C8Q C;  3RMS A;  4ZGE B;  5LJ5 g;  2OAU A;  1XQH A;  4M78 F;  5GAM h;  1D3B B;  3BDL A;  1N8R C;  1GXI E;  1YJ9 A;  5GAN 2;  4XU0 A;  2MAM A;  4BI8 B;  2A3L A;  5GAN d;  4O6J A;  2M9U A;  3M4G A;  3UT1 A;  2E1H A;  4PKC C;  4HA8 A;  2DO3 A;  3FC3 A;  3WVE B;  3ZFJ A;  3OY9 A;  3CCQ A;  1VQK A;  1M8V A;  3EAE A;  3E1S A;  4OB0 B;  3BY7 A;  3CCL T;  1UGP B;  1WJR A;  2DXT A;  3M54 A;  1D3B A;  3NTK A;  4C92 G;  2PVD B;  4J7F A;  3X25 B;  2XU8 A;  2YLC A;  2CZ6 B;  1X01 A;  2Y4X A;  4KUL A;  2B8A A;  4LD6 A;  3JCM g;  1Y07 A;  2K2V A;  2OTJ T;  4JDS A;  3SFM A;  4D6W A;  2LQ8 A;  4RG2 A;  2EAY A;  3LW5 E;  4XQ3 A;  3OSV A;  3FRN A;  5M9O A;  4C92 E;  4NOY A;  4Z02 A;  5AYF A;  1VQM T;  5LJ5 f;  5D6W A;  4M7A E;  2LCL A;  2L89 A;  4LDY A;  3QYG B;  3I55 T;  4UC4 A;  1K73 U;  2F5K A;  5IT9 E;  3MP6 A;  3CCS A;  1VQ7 T;  5CIU A;  2QA4 A;  5CQX A;  1JB0 E;  3TRE A;  1HXD A;  1OZ2 A;  3CC7 T;  3SD4 A;  4BE1 A;  1U1T A;  1YI2 A;  4HT8 A;  2EJF A;  5GAM g;  4M7D B;  3OBY A;  4R56 A;  2CZ7 B;  2K57 A;  2L8D A;  3KUF A;  5HY6 A;  3HFO A;  4J5Y A;  2QEX A;  4HCZ A;  3PTA A;  2G3R A;  2RHU A;  3M5A A;  3HRU A;  4PJO B;  3URG A;  4ME7 A;  2EJ9 A;  2QQB A;  1S72 A;  4A4G A;  2P0Q A;  3OS0 A;  3JCM f;  4EMG A;  1P92 A;  2DIQ A;  3L2V A;  3V7C A;  3GOX A;  3CCM A;  4M7D A;  1Q86 C;  3QZ5 B;  4M77 F;  4M78 G;  3GNG A;  4IUU A;  4DOV A;  3RER A;  1WPY A;  3QKJ A;  4MDW A;  2Y4Y A;  3OMG A;  4X9D A;  4XK8 E;  4PJO A;  4IUT A;  4M7D D;  4VUB A;  2GFA A;  3OYE A;  3NFC A;  1ZQ1 A;  2RI2 A;  3OYN A;  1VQ9 T;  4JRI A;  3VYH B;  3S3O A;  4PJO D;  5I2M A;  5CKB A;  1LJO A;  2OTJ A;  4N0A A;  5D6X A;  3VU3 C;  3JB9 D;  4PLI A;  4XTU A;  2V8J A;  3JSC A;  2RJD A;  1BI0 A;  3OYH A;  2PU9 B;  1M1K U;  4A4F A;  1Y7X A;  2DJZ A;  3CMA A;  4HKE A;  4MZT A;  4ZGD B;  5GAM f;  5GMK l;  2ZPB B;  1VQ8 A;  2JOY A;  2XG8 D;  1UGS B;  1VQP T;  3C95 A;  2CYZ B;  5CCA A;  5D6Y A;  2K5I A;  4XTX A;  2RHI A;  1UGQ B;  3JCM V;  3LGF A;  1Q82 C;  2LCC A;  3J80 E;  5GAO m;  1VQ4 T;  3M53 A;  1M9S A;  1HK9 A;  3T9N A;  4C92 B;  3OYM A;  5GAN h;  1KQS A;  4ATO A;  1OI1 A;  3GP8 A;  2HQX A;  2XK0 A;  5GAN 7;  1YIJ A;  1VQN T;  3VYG A;  2DK3 A;  1XNI A;  4M7A B;  4C5G A;  3DB4 A;  4N0A C;  1OZ3 A;  3L42 A;  3V8L A;  4JRP A;  4QVZ A;  2XDP A;  3C12 A;  3V7R A;  4KT0 E;  2KAF A;  1BI2 A;  2ZPI B;  3QDR B;  3FB9 A;  3MHX A;  1ZHI A;  2GCX A;  2MWP A;  3OYF A;  3CCJ A;  3OYA A;  1YJN A;  4C92 A;  5GAO p;  2I2L A;  1VQO A;  4M7A A;  1WJS A;  4J8O A;  3G4S A;  4QQD A;  4B9W A;  2RA2 A;  2DD4 A;  3RIR A;  3X28 B;  4C92 D;  1U1S A;  3TEE A;  3OA6 A;  3P8H A;  1YHQ T;  4TVR A;  2V8I A;  2K4Y A;  4OB3 B;  1UGR B;  2D9T A;  5LJ5 e;  4M77 G;  3SWN A;  3JCM Q;  1N27 A;  5FU6 C;  4QW2 A;  2VXF A;  5CK9 A;  2DTO A;  5CKF A;  5KCO A;  3S3M A;  1R8O B;  1BI1 A;  3CCR T;  2RJE A;  1N8R U;  3M9Q A;  3HP9 A;  4MML A;  5GMK e;  3LWH A;  3HSB A;  1KD1 C;  1QP3 A;  2A7Y A;  3QG1 A;  3QJY A;  2BIV A;  2KDS A;  3VUZ A;  4BD3 A;  4C5I A;  4C8Q F;  5GAO l;  2M1H A;  2JNG A;  3S6W A;  1O9S A;  3CCU T;  1YIT A;  3KBG A;  3UWN A;  4XTW A;  3CC4 A;  4PL6 A;  3OQ5 A;  4M77 E;  4C0Z A;  5A0D A;  4M7A C;  2R58 A;  4JS4 A;  4LDU A;  3FIF A;  3GLX A;  4GY5 A;  3A5Z B;  5GAN g;  1KQ2 A;  2CGH A;  2IVW A;  4YTL A;  1DJ7 B;  3M59 A;  3JCM e;  4JS5 A;  4FT4 A;  5IN1 A;  1M90 C;  4A54 A;  4CI0 C;  1U8R A;  3OS1 A;  4ELY C;  5FRO A;  1RL2 A;  4OGE A;  4N4G A;  2XI9 A;  2DIG A;  3MEU A;  3OYC A;  4M75 C;  2EKO A;  4F7U F;  1NE8 A;  2R5M A;  2WSF E;  4XTZ A;  5LJ5 j;  1YJ9 T;  4N4H A;  1BIA A;  3OYB A;  2PQW A;  3L2Q A;  4P5N A;  3BFM A;  1M1F A;  5HK0 A;  3L2U A;  4BI3 A;  3CD6 A;  5GMK j;  1QP2 A;  4M78 D;  2QQA A;  4OVA A;  3VJP A;  1VQK T;  1VUB A;  3AHU A;  1JJ2 S;  1JJ2 A;  1QVF A;  2HAX A;  1QVF S;  2EJG A;  2K5L A;  5GAO r;  1VQ5 A;  3M55 A;  4J6X A;  3QYH B;  5CKE A;  4QQG A;  2KK4 A;  5KE3 A;  3UDC A;  1BKB A;  2E12 A;  4EMK B;  4XAX B;  5CO7 A;  5GAM e;  1NJI C;  5FRM A;  1LOJ A;  2M16 A;  4A4E A;  3MEW A;  1H64 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...