3QJ6A

The crystal structure of pwwp domain of human hepatoma-derived growth factor 2 in complex with h3k79me3 peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
90
Chain Sequence
PHAFKPGDLVFAKMKGYPHWPARIDDIAAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/ nuclear protein
molecule keywords Hepatoma-derived growth factor-related protein 2
total genus 20
structure length 90
sequence length 92
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qj6A00
1XNIA 2E5QA 2GF7A 2VYTA 2JTFA 3UWNA 2EQJA 2L3RA 3MEUA 4OVAA 4N4HA 2E6NA 4UC4A 5KH6A 5J39A 3P8DA 3L2WA 3OYJA 3KUFA 3QIIA 5D6WA 3OYHA 2D9TA 3SD4A 3DB3A 5IN1A 2RHIA 3GOXA 3LGFA 4LD6A 4C5HA 2X4YA 1MHNA 2RI2A 3S6WA 3S3OA 3S3MA 3OYFA 2RJEA 3OA6A 5FROA 3P8HA 2RO0A 4QQGA 3DLMA 3PFSA 4PL6A 4GY5A 2FHDA 3H6ZA 4B9XA 3EAEA 2EQUA 3OYAA 2M1HA 3O8VA 2R5AA 2HQXA 5KCOA 2R57A 4ZTJA 2M0OA 5M9OA 3UT1A 3OB9A 2GFUA 5FRMA 4EDUA 3LLRA 3LH0A 3H8ZA 3MEAA 3OYIA 1WJQA 2EQMA 4IUPA 3FC3A 4IUTA 1SSFA 2K3XA 4NS5A 4Z02A 2L89A 2NLUA 2DAQA 2DIGA 2X4XA 3E9FA 4IURA 3E9GA 4A4FA 3OS1A 3OY9A 3PMIA 4X34A 3OS0A 4IKFA 2R5MA 4A4EA 1H3ZA 2JZ2A 2EFIA 3OYGA 3MP8A 3FLGA 3NTIA 3FDRA 3MO8A 3OYEA 3L2VA 1OZ2A 3L2QA 2RJCA 3OYLA 5KE3A 2L8DA 3NTKA 4B9WA 4BE0A 2RJDA 2LVMA 2XDPA 1WJRA 2LTOA 2RI3A 4E7JA 2RHUA 3OQ5A 4C5EA 4N4IA 3OS2A 2HQEA 5FRNA 3LGLA 3C4SA 4Q5WA 2P0KA 3ASKA 3L2RA 3FEOA 3OYBA 3L2UA 2RI5A 2F5KA 4RG2A 3OYDA 4QQDA 3OYNA 3OYKA 3META 5C6SA 1WGSA 4E7LA 2QQRA 3M9QA 1WJSA 2EQKA 2M16A 4BACA 4BDZA 2O4XA 4FL6A 2QQSA 3BDLA 3OMCA 1G5VA 1OYXA 3PMTA 4L59A 2CKKA 2RHXA 4BE1A 3DB4A 3QKJA 4C5IA 2LRQA 5D6YA 5D6XA 2R58A 2GFAA 5J26A 4QVZA 4A4GA 3MEVA 1KHCA 2X4WA 2DIQA 2RHZA 4PLLA 4C5GA 4ZTFA 2PQWA 1RI0A 2YRVA 3NTHA 2B8AA 2XK0A 2BUDA 4FU6A 4E7IA 3QBYA 2BKDN 4N4GA 2EKOA 3L42A 4QQ6A 3OMGA 4BD3A 2IG0A 5KCHA 2O4XB 3ME9A 2K3YA 3F70A 3MP6A 3QJ6A 4E7KA 1OI1A 3OYCA 2X35A 4CRIA 2MWOA 4A4HA 2RHYA 2RJFA 4II1A 3PNWC 3ZEHA 5KE2A 5IAYA 4E7HA 3MEWA 4IUQA 4IUUA 3LYIA 2BIVA 3LX7A 2G3RA 3Q1JA 4IUVA 2MWPA 3S3NA 3CEYA 3MP1A 4QW2A 4BDYA 5C0MA 2LDMA 4HCZA 5CIUA 4PLIA 3OYMA 1N27A 4BE2A 2LCCA 1OZ3A 2WACA
chains in the Genus database with same CATH superfamily
1IHWA 2I2LA 2J7IA 1RAGB 1NPRA 3VS0A 1FXXA 1KC8C 3HL8A 3EFOB 3J81E 2M51A 3GPLA 1G3YA 2JMAA 3CD6T 1QVGP 2WSCE 1HD3A 4OB3B 2OTJA 1BCOA 5I11A 1PSEA 1NLPC 4XTYA 3CCVT 1Q86R 1T3LA 1ZSZC 5HK0A 1Y96A 1OEBA 1GBRA 2DTOA 2K4YA 2XG8D 1WHLA 1YJWA 1KFZA 3LH0A 4JPBW 5GANh 1Q81R 1TUGB 2KT1A 4MMKA 1WQ7A 1VQ7T 1QP3A 4J9EA 2J06A 5AYFA 3PMIA 1RAFB 1O9SA 2ZPFB 3SWNC 2Y4YA 2CP7A 4ZGEB 5LJ5d 2JS0A 3JV3A 1RLQC 1EX4A 1BIAA 4X1VA 4JZ3A 2XDPA 1TTHB 2JN0A 3OS2A 4R55A 2LQKA 3IQLA 1M3BA 4FYVB 2CZ1B 2YRDA 3CMEA 1UGRB 1K73U 2JVVA 1TSFA 2EQKA 3GIBA 5HY6A 4F7UG 3PMTA 3CCLQ 1SHFA 2RHXA 1D3BB 2RK1A 3KXTA 2GFAA 2DO3A 3TCJA 1OU9A 2JNGA 1KQSS 1JBMA 3CCVQ 2NUTB 1IGUA 4PJJA 4DEYA 3CCJA 3QJ6A 4ELZC 3R6NA 4HVVA 1OOTA 4ZNXA 5IAYA 4FW1A 1V1CA 4BDYA 3I55A 1GCPA 5C0MA 2OTLA 4LDUA 2PUKB 1N9RA 1TU0B 2JMCA 2FZCB 3EGUA 1NG2A 1QKXA 3QO3A 3OYHA 4EMKA 1OX9A 4MZPA 4C5HA 3C95A 2VGMA 2Y4XA 3QJYA 3VUBA 1D1AA 2KSSA 1XQHA 5IH2A 5GANg 4FT2A 4OMQA 2OTJQ 3O8VA 2QEXQ 4J6WA 2HQXA 1JB0E 2W0ZA 2KT8A 4ZTJA 2MYSA 5FU6B 2FRWA 4ATOA 2C06A 2HD0A 1HJDA 4M77G 5DY9A 1W2BS 2K3XA 2NLUA 4IKFA 1YWOA 2DVJA 3SEMA 1QCOA 1ZHIA 2E3IA 2OTLT 1N8RU 1T0HA 4QVCA 2K9GA 4M7AF 1Q82R 1AWXA 2YUQA 2H8HA 1VA7A 4HCBA 4MDXA 2AZVA 1FYNA 3EHRA 1T0JA 3FEOA 2DJQA 1WGSA 2K79A 1X01A 3HRSA 3OW2P 3OMCA 1W2BA 1VQ4Q 4RTUA 1UUEA 2QXFA 1M1KC 1PD1A 3INZA 4HKEA 3CCUT 4BY6B 1JJ2A 1RI0A 2QEXA 2E4HA 3EG2A 4HXJA 4F16A 2EKOA 2YUPA 2IG0A 4DA4A 1Q86U 3VYHB 2KRSA 3G4ST 3G6ET 4P5NA 2MWOA 3EFOA 2P4TA 2FG0A 3M0PA 3QZ9B 4KGVB 2XU8A 2PVGB 4M7DB 4LUDA 5DLQE 1D0YA 3EGXB 4PFZA 1VQ9T 1RL2A 1IXDA 1O75A 2CZ7B 2HKNA 1X2QA 4LN2A 5CIUA 2NUPB 3OYYA 2EGAA 1Q81C 5KYUA 5A0DA 4PJNA 1JQQA 2E65A 1NYGA 1TUCA 3J7AF 1MUZA 4KUIA 3JCMd 1NYFA 3QXEB 1ZBXA 1UB4A 4ANJA 4C8QB 3MCAB 4D8DA 2JW4A 4M4ZA 4E2FB 2ROTA 4XK8E 3M57A 2LZ6B 4JUVA 4EMKB 1FX7A 1YBYA 1OULA 3G6EA 1QKWA 4D8KA 1VYTA 1SSFA 2DILA 2DIGA 1W4SA 2EAYA 4N0AC 2ED0A 2GGRA 2RMOA 3RUXA 1RI9A 3C94A 1BBZA 2COWA 2RQVA 1FMVA 1J3TA 1ACMB 4RMOA 2GQVA 1LJOA 2KNBB 4PJLA 1M2VA 3E2UA 1VQLT 4DQ2A 2J05A 4M7DG 1I5LA 5KYNA 2O31A 3A8MB 1UGVA 2K6DA 2DL7A 3VV0A 4XU1A 2KMTA 3A8LB 3CC2Q 3V7SA 2QG9B 2YSQA 2E10A 4XU2A 2DA9A 4FYYB 1KHCA 3SB2A 4C5GA 2DEUA 5GAOm 2LX7A 2EBPA 3M0SA 1NJIC 4HA8A 1G3WA 1X75C 5A0GA 2FEIA 2KYMA 1BCMA 5IHNA 1PM3A 1TG0A 2CREA 3CCMT 1SRLA 4CC3A 1N8RC 3PIOA 5GAMe 3CPWP 1PKTA 4Y28E 4O6JA 2ED1A 2MPXC 4C8QF 4JRIA 3CCET 1N27A 4M7AE 5GMKi 1OZ3A 2CYZB 4C92G 1K8AR 1F1BB 1QW1A 2AT1B 4UC4A 2OTLQ 4A54A 3M0QA 1NJIU 2RHIA 1Q82U 5CAIA 4M7AB 1I5OB 2A7YA 1YWPA 1BIBA 2XDDA 1WXUA 2RQUA 3H6ZA 1E6GA 1BI1A 1VQKA 2EQUA 3LWHA 1YCSB 1VUBA 1WQWA 4OMLA 2DTHA 3CCRA 1AWWA 2JM8A 4FSSA 1QVPA 4ME7A 3FC3A 3CCQT 1B34A 2L89A 2X4XA 2MOXA 1TXQA 2F69A 2DYIA 1H3ZA 4OB1B 5EG2A 1M3CA 2X9HA 2CP2A 3HP9A 2D8HA 1U5SA 4LNPA 4C0FA 1GXIE 2JM9A 1WJRA 2LTOA 2FO0A 3X25B 3JB9H 1LPLA 1QVGA 2IIMA 1BKBA 5LL6S 4Y92A 5C6SA 4M78E 1UHFA 2QQRA 4C8QA 3SWNB 2JOYA 5D6YA 2DL5A 4F7UB 2VB6A 2D0QB 2RD1A 3OW2S 4FYXB 2NUZA 1AWOA 3CCQA 1VYVA 1ABQA 1P92A 2DMOA 2YHTA 2GQIA 2VWFA 2ZGWA 3ZEHA 5GAOr 4E7HA 2HL5C 1K76A 1E6HA 4CC2A 1Y7XA 3MJXA 5GAOq 1K9MC 1QWFA 2LJ3A 1W6XA 2ATCB 2GF7A 3N5BB 4JS5A 1WX6A 4N4HA 1OV3A 1XJWB 2J6KA 2QASA 3URGA 5I22A 2JJ9A 1UTIA 1NEBA 3PT9A 1WHJA 5CO7A 2RI2A 4RTVA 1X6GA 3CCJQ 4LDWA 1SHGA 3M4YA 2KROA 3VUZA 2DE0X 1R8OB 2PUOB 4PL6A 2CUDA 5LJ3f 3EAEA 7AT1B 2K7AA 2Z0WA 1YITQ 2F1LA 2DRKA 3OB9A 3LLRA 2A0FB 2LCLA 1OX8A 1VQMT 4MZMA 4IURA 1YI2A 3M55A 4A4FA 1TS9A 2XIDA 2BZ8A 1NEGA 2LQWA 1GCQC 3HRTA 3QYGB 1Q81U 4M78C 2RPNA 3JB9I 1VQLQ 2RJCA 3OYLA 3PE0A 2LVMA 2QA4Q 1IZ6A 4ORZA 3V8LA 3NHNA 1Y07A 3LGLA 4RCBA 4C92D 3JCMP 3CC4A 1T3SA 3THKA 2PU9B 3SDZA 3OYNA 1Q86C 3META 1JXOA 4J9GA 2A36A 4HVWA 3EH2A 4FL6A 4XQ3A 1BI2A 3QHSA 1Z9QA 2KE9A 3CMAQ 3RERA 2KAFA 5D6XA 4M77B 1I8FA 4Z88A 1YIJT 2EYQA 4E7IA 1VQ7A 2KVQG 1G3SA 5KCHA 3SWNA 2DTIA 4J7IA 3ME9A 4CRIA 1D09B 1OU8A 2O01E 3OBWA 1G3TA 3DKMA 3OYMA 1VQKQ 5GANj 1M5Q1 3EGDB 2E5QA 2VYTA 1IGQA 1TOVA 2JTFA 1K8AU 5DM7R 2QQAA 3TQ7P 3CMET 2A08A 2BE7D 3KFVA 2EVRA 4XAXB 4JJDA 4JRPA 2HMAA 4C8QD 2I0NA 3X26B 1B34B 5GMKj 3RKWA 2RO0A 4RTYA 4F17A 1N5ZA 1NBEB 4J9IA 4B9XA 5GAMg 3ULRB 1SPKA 1MMNA 3E1SA 2X3WD 5M9OA 1E7OA 2P4RA 2CP0A 3NGPA 1C6VX 3HFOA 1GFCA 1K8AC 1QWEA 3H8ZA 4XTXA 2QA4T 2KEAA 2CSQA 5GMKh 3WXMB 4OMFB 2JZ2A 3MO8A 2YLBA 1B07A 1PRLC 1GBQA 4B9WA 1UDLA 3VS5A 4M78A 4JJBA 1N8RR 3RR6A 4KT0E 2V8KA 5L8RE 5LJ3h 2FPEA 1WHKA 1JRIA 1I07A 1NJIR 4JZ4A 3VS1A 2KBTA 2V8IA 2DBKA 2AKKA 2X51A 2VXFA 1YHQQ 2CZ0B 4RTZA 2RHZA 3FB9A 2KQWA 3NTHA 1CKAA 2XK0A 3QBYA 5CQXA 3CXCA 3SHWA 5GAMj 3X20B 3M5AA 3MEWA 3QUIA 2AK5A 3A1PA 1ZSZA 2GTOA 2M0YA 3RIRA 5CCAA 5A0LA 4OB2B 5J39A 5GAMf 5KH6A 2P84A 1H8KA 2D9TA 1UFFA 5IXBA 2D6FA 4PJOD 2M02A 1ZX6A 2QDLA 2NWMA 2P0PA 2QQBA 3DLMA 3HKSA 1YJ9T 1WHGA 1PC0A 2LQ8A 2F2XA 4C8QG 5GMKe 5KYYA 1HXDA 4M77D 1VQ4T 5L23A 2M0OA 2RK2A 1WXBA 4LDXA 1I1JA 2BE9B 4OGEA 3G4SA 4L6V5 2DK3A 3REBB 5GANe 1KK7A 3E9GA 3G1JA 1X6OA 3OS0A 2R5MA 3A8HB 1MV0B 3L2VA 3JCMQ 4ZGDB 2XHCA 2L8DA 2ENMA 2P0QA 4XU3A 2RHUA 5CR2A 3OQ5A 3EGXA 2FB7A 4EMHA 3CCRQ 6AT1B 3M0UA 2EYXA 3PTAA 1YJ9A 4PNOA 1NLOC 4BE1A 5GAN7 1PRMC 1SF9A 3QG1A 2PNIA 1BK2A 2V1QA 1MV3A 3M0TA 3CMAT 2B8AA 1EFNA 2BUDA 3GF5A 1WHMA 4J6XA 1KD1U 2OTJT 2DJZA 5CK9A 1K9MR 2SRCA 3F70A 4E7KA 1OI1A 1D1BA 4EIKA 3G71Q 1VQOA 2D1XA 1YJNA 5I2SA 2MWPA 4FSXA 2M9UA 2CSIA 3MP1A 4BE2A 1VQLA 2A28A 2BTTA 2ABLA 1G8XA 3L2WA 2C0OA 1VQ5A 3SD4A 1YJNQ 1VQNT 1WI7A 1Y0MA 1VQ8Q 3M56A 1M1GA 4QQGA 1VQ6Q 2HBWA 2DKGA 4GY5A 2CZ6B 5EC7A 4CC7A 5KYWA 5GAN3 3V8KA 4JRQA 4MDWA 1HYOA 3RNJA 1KD1R 2DXTA 2ECZA 2HCKA 3FRNA 5HKCA 1VQ9A 5FRMA 2FPFA 2COYA 2DL8A 4IUPA 4LXCA 2KGTA 3CCLA 3PIPA 1RACB 4ZN1A 3OY9A 4XTZA 1SG5A 5HCKA 1B7TA 2JS2A 5KYYB 1Z9ZA 5KYUB 1ARKA 3BFMA 2HL3A 2KRNA 2JUFA 1RABB 1VIEA 3UPUA 1FMWA 4RG2A 1HSQA 4NL2A 1AZGB 3I55T 3M59A 2V8JA 3I5RA 2HKQB 1VQKT 2B86A 2BZYA 4C8QE 2QGGA 2J6OA 2XICA 1Y57A 4QKUA 4LD9K 2HDAA 4A4GA 1KHIA 2X4WA 5GAN2 3CCLT 1CKBA 2GNCA 2AZSA 3CC4Q 2EGCA 4C92C 3RMSA 5GAN4 4JS4A 1KJWA 1K9MU 1M9SA 3PNWC 1M8VA 2XMFA 3CBOA 3REAB 4OMOA 1M2VB 1Q82C 4L5GA 4DOWA 1VQ8T 4PLIA 2KDSA 3JCMV 1KQSP 3I5SA 4OVAA 4PJOE 3P8DA 2KXCA 3H0HA 4XTWA 3GOXA 4K11A 3EFRA 3LGFA 1AOJA 2PVOB 2X4YA 4OF1A 8AT1B 2DNUA 2ZZDA 4QVDA 2FZKB 4RCCA 5FROA 4M7AC 4M7DC 1XTDA 4C0DB 3AT1B 1PWTA 3JCMf 3CCMA 4PJOA 1C1AA 2CGHA 2R57A 4BUGA 1LOJA 2EYYA 5GMKl 2KY9A 4J7FA 4FYWB 2EGEA 1K0XA 1QVFA 3GNGA 3OYIA 1PHTA 1ZSZB 3U23A 1RAAB 4CI0C 4BI4A 4M75D 3CMEQ 5CVIA 3OYGA 1XOVA 3JSCA 2EWNA 3NTKA 4LDVA 5FWBA 1SSHA 4M77A 3G71T 2WSEE 4E7JA 2DBMA 1U1SA 4N4IA 2VV5A 4RTTA 5FRNA 2FVUA 3C4SA 3L2RA 1U8RA 2HSPA 1S72T 4J83A 3CC2A 2FZGB 4E47A 3GP8A 8ATCB 3UA6A 1M1KU 4RUGA 1AHJB 1K0SA 4J8OA 1G5VA 1WYXA 1OYXA 3FJPA 3VKIA 3RDVA 5GAMh 3H41A 2IPOB 2R58A 3CPWS 1I4K1 2K2MA 5GAMd 1ABOA 2F2WA 2A3LA 1ZA1B 1QMCA 4X9CA 1YI2T 3I56T 3EG0A 1FMKA 3R6OA 4E7ZA 2DX1A 2X35A 5KE2A 5FU7C 2QK0A 3A5ZB 4IUUA 3G71A 3FJ5A 3CEYA 1YITA 3M58A 1BU1A 5IHIA 3HSBA 2RA2A 3QSUA 3H9NA 3QWYA 4M77F 3CC4T 3CCSA 4M7DD 1K9AA 2L3RA 5CKDA 4M75F 2DPPB 4GBQA 4JJCA 1VQ9Q 1D1CA 1X27A 1M1KR 2DYBA 3QPHA 3BDUA 4LD6A 3S3MA 5LJ3e 1VQ5Q 1ZUUA 3MKDA 4DBFA 2QI2A 4IIMA 1JEGA 3PFSA 3HTRA 2LMJA 4E6RA 5LJ5h 2M1HA 1VQ6A 4AMCA 2XI9A 4M78B 2OI3A 2LCSA 3MPUB 1WZOA 3EHQA 5ECAA 1KQ2A 1M2OA 1YCYA 1I81A 1WFWA 4XTVA 4NS5A 4Z89A 2YDLA 2E64A 2LP5A 4X34A 4F14A 2NUPA 1VQPQ 1V76A 3H0IA 2D0NA 3PVLA 2QTVA 2QQ9A 1JU5C 4PJOB 1OZ2A 1PG5B 4J5YA 3DLLA 4C5EA 1UGPB 2EJFA 4N0AA 3EGDA 4E7LA 3JCMh 2H3JA 1WJSA 3VS2A 3CC7A 3GNFB 2EPDA 1KQSA 3CBMA 3TREA 3JCMb 2PTKA 1AEYA 2E12A 3EG1A 2DERA 5GAN5 4E7SA 2BKDN 4N4GA 1X6BA 4GLKA 3CXCP 1IREB 4A4HA 1SKUB 1AT1B 4FCYA 2FPDA 2A37A 4PJMA 2W10A 2LNVA 2EYWA 4ZGJB 1U06A 1VQPA 2FL7A 5FU6C 4HCCA 3CCQQ 1S1NA 2YUOA 4AT1B 2BZXA 2K57A 5D6WA 3CC7T 1EIFA 2COZA 2LJ1A 2CUBA 2NYSA 3A8GB 2FRYA 3P8HA 1RAEB 4AFZC 2FHDA 4KH0B 3CD6Q 3ZFJA 1LNXA 4FM4B 2DEQA 3EG9A 1MMAA 2SEMA 2ZPEB 2E6ZA 1NM7A 4ELYC 1VYUA 1U3OA 5KYXA 4V2SA 2RQWA 2VVKA 4M75E 3SFMA 1D0XA 3E9FA 2HZYA 3J80E 5KE3A 3BW1A 1KIKA 3TVTA 1MMDA 1UJYA 4M7DA 4M75G 1MNEA 2HQEA 4M75A 2L3SA 4AFUC 4J9CA 2C0IA 4C8QC 2RM4A 3EFSA 4QQDA 2O2OA 1Q7YU 4FW2A 3NMZC 1R77A 2M16A 4DBQA 2YXYA 1WLPB 3UDCA 4C92F 1VQ4A 2QA4A 2ZCFB 2O9VA 4QVZA 1UE9A 1Q7YR 4ZTFA 3QYHB 2PQWA 4XU0A 2YRVA 1BYMA 3CD6A 4F7UE 2K3BA 2L2PA 2EJGA 4CC4B 2QGFB 2MCNA 3OW2A 3CCSQ 2EJ9A 3OMGA 1KC8U 3CCVA 3AHUA 1PSFA 1M90U 2VASA 2LC4A 1UEBA 3CC7Q 3EH1A 4M7DE 4HVUA 2LCCA 4C92B 4BY6C 2QAZA 2E6NA 2OAUA 4JRKA 3WVDB 4FIBA 4AFSC 3DB3A 5IN1A 3V7CA 4B6MA 1NZ9A 1MHNA 3M4GA 4HCKA 4KGZB 4KH1B 1M1FA 2RJEA 1I0CA 4PK4A 1UG1A 3CXCS 4XTUA 2DLPA 1WDXA 2MK5A 3QWXX 2DFUA 1K73C 3JRZA 3WVEB 3JCMX 1W2BP 1M27C 4MMLA 4PFPA 4KUDK 1PKSA 1WJQA 2C0TA 2EQMA 4PJOF 1YJ9Q 5GAOn 1GRIA 5GAN8 4Z02A 2DAQA 1QVFP 5I2MA 1NPPA 3H0FA 1IRXA 2HQHA 1AD5A 3HFNA 4AFQC 3FLGA 2E3HA 4IIOA 3OBYA 1SEMA 1D3BA 4BE0A 1W1FA 5GANd 3CCJT 3VU3C 1YFNA 3HPWA 3CCMQ 4C0ZA 4NOYA 2KI7A 1OQKA 3ASKA 3CCEQ 3OYBA 4KBMB 1M90C 3L2UA 2F5KA 2CT4A 3BDLA 1BI3A 2E70A 4HT8A 2K2VA 3CBPA 2CH4A 2DVEA 1WIEA 4PLLA 4J9FA 4M75B 3QDRB 4FU6A 4A53A 1X69A 2DRMA 5HK3A 4LDYA 3M0RA 3L42A 4BD3A 3TEEA 4OP0A 1YJWT 2O4XB 2K3YA 3NFCA 4EPCA 2LJ0A 1KC8R 2MAMA 2YLCA 4M75C 2CH4W 1SRMA 3M54A 1Q95G 4RTWA 3LYIA 1YHQA 4M7AD 2G3RA 3UATA 4QW2A 1M8MA 1S72Q 3LH5A 4FT4A 3JCMJ 1RAIB 2WSFE 1M4ZA 4PKCC 4R56A 2KR3A 3EG9B 3O5ZA 3OYJA 2DM1A 5CKEA 2MF2A 3S3OA 4WF2A 3CMAA 1RUWA 1AWJA 2HEQA 1UHCA 1YI2Q 3VS6A 4DBHA 2CDTA 3OYAA 2EYZA 2R5AA 1HK9A 1OPLA 3I55Q 1QVFS 1VQOT 1YJNT 4J9DA 2H3EB 2L3PA 3X24B 2JTMA 1AZEA 1QCNA 2CS7A 2DZCA 3VRYA 3MEAA 3JB9J 1R0CB 3JB9G 5GAOl 2K5FA 1YHQT 1WXTA 1UGSB 2NUTA 1ZLMA 4A4EA 2QTXA 2EFIA 4LUEA 2RNAA 3MP8A 3FDRA 2ZPHB 2YUNA 5KYWB 2DD5A 3TSWA 4OMPA 1VQNA 5GMKm 1K1ZA 2JTEA 2RJDA 5CKBA 2HNIA 2RI3A 3CQTA 3FIFA 4M78D 1PCXA 1U1TA 2ROLA 1VIFA 3KBGA 4JLGA 3VYGA 2X4JA 9ATCB 1WPYA 4VUBA 2O4XA 4BI3A 2XD0A 3MHXA 4WTOB 4BB7A 1OPKA 2LRQA 3C12A 5A2QE 4Z8AA 2GBQA 1H3HA 2PVDB 3JAME 1PD0A 5FW9A 5J26A 2JT4A 1QQJA 5KYXB 1ZUYA 2VXEA 3ZL7C 3CPWA 3PGGA 1QLYA 3JCMg 2KK4A 3OS5A 4QQ6A 4PJOG 1PNJA 1JXMA 2V1RA 1M90R 5IXFA 2MIOA 2YWWA 3OYCA 1VOMA 3A98A 1WNLA 2RHYA 2RJFA 2ZPBB 3HHTB 3OSVA 4Y91A 4M7AG 2K5LA 1VQ7Q 1S72A 3CC2T 3UWNA 2EQJA 3OSSC 4J9BA 3QIIA 3BY7A 2OJ2A 1ZSGA 3TSZA 1N6AA 1UECA 1YP5A 1K73R 3S6WA 1VQOQ 5GJVB 3OA6A 4ZN3A 3QZ5B 4KULA 2O88A 3EG3A 2YT6A 2AKLA 5IHKA 1IB8A 2QDYB 5LJ5g 2KRMA 5LJ3j 2GFUA 4EDUA 3CCUA 1GL5A 1RADB 2QEXT 5LJ5j 1QCFA 2DXCA 1VQ8A 2ZAEA 1GFDA 3RMQA 1G83A 1EZZB 1LCKA 2PZ1A 3RBBB 3JCMc 3OYEA 3JB9D 1MNDA 3C0CA 2ZPIB 3L2QA 4X9DA 4C92E 1D0ZA 1KD1C 1DJ7B 3L2ZA 4ESRA 4Q5WA 2CT3A 4LE9A 4DBRA 5DLOA 2RI5A 3OYDA 2RQTA 2L3QA 1QP2A 3BE3A 3CCEA 4BACA 4BDZA 1YN8A 3RKXA 3LW5E 4L59A 4HT9A 2LT1A 3DB4A 3QKJA 4C5IA 5GANf 5J3BA 1VQMA 1VQ5T 3CPFA 2JXBA 3I35A 4YTLA 3MEVA 3LWIA 2DD4A 3ZBDA 5GAN6 5I21A 1TUDA 3VRZA 5LJ5f 1JJ2S 3MP6A 1ZBJA 2XDBA 1TWBA 3CCRT 4IUQA 3LX7A 1TH7A 4OGCA 4EMGA 3S3NA 5LJ3g 3JCMW 2LDMA 2J6FA 3I56Q 1Y71A 3GLXA 5IT9E 4QT7A 2DETA 1Y96B 4RKUE 2DXUA 1KG1A 1RAHB 2D8JA 1YNZA 1YIJA 2V26A 2CP5A 3VS3A 4KGXB 1ZQ1A 3OYFA 4M77C 4MZTA 4J9HA 3I9QA 3M53A 3GBQA 5CKFA 4PFOA 1MMGA 4PJOC 4RTXA 3I56A 4OMNA 3V8JA 4AG2C 2VGNA 2VC8A 2RB6A 4C0DC 3HRUA 1N9SA 1IHVA 4GLMA 2DL3A 3X28B 1BI0A 3RESA 1WA7A 3OS1A 1KQ1A 2LQNA 1UGQB 3E19A 5LJ3d 2F5TX 3ER0A 4M78F 2VKNA 4C0GA 3NTIA 4D6WA 2DL4A 5GJWB 1H641 3G7ZA 5CKHA 4AG1C 3G4SQ 1MGQA 4WCIA 1YJWQ 2E1HA 2P0KA 1AVZC 1VQ6T 1ZA2B 4A4KA 3M9QA 2QQSA 1K4US 2EQIA 2DXBA 3JB9F 4BI8B 3UA7A 3VS7A 1IO6A 2DIQA 5FU7B 2ESWA 4C92A 3TU4K 1LVKA 3NPFA 3P8BB 2G6FX 4M78G 3VS4A 5CQYA 2OX7A 5FWCA 4II1A 5AT1B 4JLIA 2VUBA 3Q1JA 4F7UA 2CP6A 2EKHA 1M30A 2ZPGB 2XKOC 4F04B 1GCQA 4HCZA 3JCMe 2LX9A 2WACA 4JDSA 1XNIA 2DF6A 5FLXE 2GCXA 2RF0A 1G2BA 3MEUA 3G6EQ 4EMKC 3KUFA 5LJ5e 3PVQA 3CCUQ 2LT4A 1YIJQ 4J6YA 4DEXA 3D7SB 1A0NB 4M77E 1KSWA 2DZ9A 1RLPC 3VJPA 5KCOA 2HAXA 1ZUKA 2AIRB 1WHHA 2K5IA 2MMPA 1BB9A 2YRCA 2KYBA 3UT1A 2RQRA 4RG8A 2RN8A 1VQPT 4M7AA 4IUTA 2E5KA 2LNHB 2QYZA 2Y90A 3L1AA 1R0BG 3A8OB 2KXDA 3UF4A 3RKYA 1QVGS 2RH2A 4JJNK 1VQMQ 2E41A 2F2VA 1CSKA 2AHJB 4A63B 2EW3A 2FYKA 2CP3A 3OYKA 1NE8A 3V7RA 1YITT 4O5VA 2MI6A 1UJ0A 2L5QA 1W70A 1B3QA 1V29B 4KRTA 2CKKA 3CCST 4OB0B 4R0KA 5D7UA 1X2KA 2O9SA 1H92A 4TVRA 1VQNQ 2L0AA 4M7DF 4NL3A 2OAWA 1FWZA 3QDFA 1X43A 2EIFA 2GTJA 5GAOp 1M3AA 1Q7YC 2HBPA 1JO8A 1JJ2P 2BIVA 4IUVA 1C0MA 3T9NA 2IVWA 2X3XD 4F7UF 4DOVA 2HSEB 4OMMA
chains in the Genus database with same CATH topology
3JCMV 2GF7A 3N5BB 4JS5A 2WSFE 4OVAA 4N4HA 4PJOE 1M4ZA 2I2LA 4PKCC 4R56A 3P8DA 3OYJA 5CKEA 3URGA 1NPRA 4XTWA 3GOXA 1FXXA 2MF2A 3EFRA 3LGFA 3HL8A 3PT9A 3J81E 2PVOB 1KC8C 2X4YA 5CO7A 3GPLA 2RI2A 3S3OA 1G3YA 4WF2A 4OF1A 3CMAA 2ZZDA 4LDWA 4QVDA 3CD6T 4RCCA 3M4YA 5FROA 4M7AC 3VUZA 2WSCE 4OB3B 2OTJA 4M7DC 1R8OB 2PUOB 4PL6A 5LJ3f 1PSEA 4XTYA 1XTDA 3EAEA 3CCVT 3OYAA 4C0DB 2R5AA 1HK9A 3JCMf 3CCMA 4PJOA 5HK0A 2CGHA 2R57A 1QVFS 1VQOT 1Y96A 1LOJA 4BUGA 1YJNT 3OB9A 3X24B 2JTMA 2DTOA 5GMKl 2K4YA 2XG8D 2KY9A 1YJWA 2CS7A 3LLRA 4J7FA 2DZCA 3LH0A 5GANh 4MMKA 2LCLA 1WQ7A 3GNGA 3MEAA 3OYIA 1QVFA 3JB9J 1VQMT 3JB9G 1VQ7T 4MZMA 2K5FA 1QP3A 5GAOl 4IURA 1YHQT 1YI2A 3M55A 4A4FA 1UGSB 5AYFA 3PMIA 4CI0C 2XIDA 1O9SA 1Q81U 2ZPFB 3SWNC 3HRTA 3QYGB 4M75D 2QTXA 5CVIA 2EFIA 4A4EA 4BI4A 3OYGA 3MP8A 2Y4YA 3FDRA 4ZGEB 2ZPHB 5LJ5d 1XOVA 2DD5A 4M78C 3JB9I 1VQNA 5GMKm 2RJCA 3OYLA 1BIAA 2EWNA 3JSCA 3NTKA 4LDVA 2RJDA 4M77A 5CKBA 2LVMA 3G71T 2XDPA 2WSEE 1IZ6A 2HNIA 2RI3A 4E7JA 2JN0A 3V8LA 1U1SA 3FIFA 4N4IA 4R55A 2VV5A 3OS2A 5FRNA 4M78D 1Y07A 1U1TA 3LGLA 4RCBA 2FVUA 1VIFA 2LQKA 3C4SA 3KBGA 4C92D 4J83A 2PU9B 4JLGA 2X4JA 3VYGA 3L2RA 1U8RA 1S72T 4E47A 3SDZA 2CZ1B 3OYNA 3GP8A 1Q86C 1WPYA 3META 3CMEA 1UGRB 1K73U 2JVVA 4VUBA 2EQKA 3GIBA 1M1KU 5HY6A 2O4XA 4FL6A 4XQ3A 1BI2A 1AHJB 3QHSA 3MHXA 4J8OA 4BI3A 4F7UG 2XD0A 3FJPA 1OYXA 3PMTA 3VKIA 1G5VA 5GAMh 2RHXA 4BB7A 2LRQA 3C12A 5A2QE 3RERA 1D3BB 2KAFA 5D6XA 2R58A 2PVDB 2RK1A 4M77B 3JAME 1I4K1 2GFAA 3KXTA 1I8FA 2DO3A 5J26A 2JNGA 3TCJA 1YIJT 1KQSS 1JBMA 5GAMd 2VXEA 2EYQA 2A3LA 3CPWA 3PGGA 4E7IA 3JCMg 2KK4A 4X9CA 3OS5A 1VQ7A 2KVQG 4QQ6A 1G3SA 4PJOG 1YI2T 5KCHA 3I56T 3SWNA 2DTIA 4J7IA 3ME9A 3CCJA 3R6OA 3QJ6A 3OYCA 2X35A 4CRIA 4ELZC 1WNLA 2RHYA 2RJFA 2ZPBB 3HHTB 5FU7C 3OSVA 5KE2A 3A5ZB 5IAYA 4IUUA 2O01E 3OBWA 1G3TA 4Y91A 3G71A 3CEYA 3I55A 3M58A 4BDYA 1YITA 5C0MA 3HSBA 3DKMA 2OTLA 3OYMA 4M7AG 4LDUA 1M5Q1 2PUKB 2RA2A 5GANj 3QSUA 2K5LA 4M77F 3CC4T 1N9RA 1S72A 3CC2T 2E5QA 2VYTA 3CCSA 4M7DD 2JTFA 3UWNA 1K8AU 2EQJA 2L3RA 2QQAA 3OSSC 4M75F 5CKDA 5DM7R 2DPPB 3CMET 3QO3A 3QIIA 3OYHA 4XAXB 3BY7A 4EMKA 4JRPA 3QPHA 1N6AA 3BDUA 4LD6A 4MZPA 4C5HA 4C8QD 3S6WA 3S3MA 3C95A 2VGMA 2Y4XA 3QJYA 1B34B 3X26B 3VUBA 5LJ3e 2KSSA 5GMKj 3OA6A 1XQHA 2QI2A 3RKWA 2RO0A 5GANg 4FT2A 3PFSA 4ZN3A 4B9XA 5GAMg 3QZ5B 5LJ5h 2M1HA 3O8VA 4KULA 4J6WA 1VQ6A 2HQXA 1JB0E 3E1SA 4ZTJA 2QDYB 5FU6B 5LJ5g 2XI9A 5M9OA 5LJ3j 4M78B 2GFUA 4ATOA 2C06A 4EDUA 3HFOA 3CCUA 2HD0A 1K8AC 2QEXT 5LJ5j 3H8ZA 2DXCA 4M77G 5DY9A 1VQ8A 4XTXA 1KQ2A 2QA4T 1YCYA 1I81A 1W2BS 4XTVA 4NS5A 2K3XA 2NLUA 2E64A 3RMQA 5GMKh 4X34A 4IKFA 3WXMB 4OMFB 2JZ2A 1ZHIA 2OTLT 3JCMc 3MO8A 3OYEA 1N8RU 2YLBA 3JB9D 2QQ9A 4QVCA 4PJOB 2ZPIB 4M7AF 1OZ2A 3L2QA 4B9WA 4X9DA 4C92E 4J5YA 4M78A 3DLLA 4HCBA 4C5EA 1UGPB 4KT0E 3CC2A 4MDXA 1KD1C 1DJ7B 3L2ZA 4Q5WA 2V8KA 3FEOA 5DLOA 5L8RE 5LJ3h 2RI5A 3OYDA 2EJFA 4N0AA 1WGSA 3JCMh 4E7LA 1QP2A 2H3JA 3CCEA 1WJSA 4BACA 4BDZA 3CC7A 1X01A 3RKXA 3GNFB 1JRIA 3LW5E 3HRSA 3OMCA 1W2BA 4L59A 4HT9A 1KQSA 2LT1A 3DB4A 2V8IA 3CBMA 3QKJA 4C5IA 2QXFA 3TREA 3JCMb 5GANf 5J3BA 2VXFA 1VQMA 1M1KC 1VQ5T 2E12A 3CPFA 4YTLA 3INZA 2CZ0B 3MEVA 3LWIA 2RHZA 3FB9A 4HKEA 3CCUT 4BY6B 1JJ2A 2KQWA 1RI0A 2DD4A 3NTHA 3ZBDA 2QEXA 5GAN6 2XK0A 5GAN5 5I21A 3QBYA 2BKDN 4N4GA 2EKOA 5CQXA 5LJ5f 1JJ2S 2IG0A 3CXCA 4DA4A 1Q86U 3VYHB 3MP6A 4GLKA 3G4ST 5GAMj 1IREB 3G6ET 4P5NA 2MWOA 4A4HA 2P4TA 3QZ9B 2XDBA 3X20B 3M5AA 2XU8A 3MEWA 3CCRT 4IUQA 2PVGB 4M7DB 3QUIA 3LX7A 5DLQE 1TH7A 4OGCA 4EMGA 1VQ9T 1RL2A 3S3NA 2LNVA 5LJ3g 1O75A 2CZ7B 4ZGJB 1VQPA 3JCMW 2LDMA 5CIUA 3RIRA 5CCAA 2FL7A 5A0LA 1Y71A 3GLXA 5FU6C 5IT9E 4HCCA 3OYYA 1Q81C 4OB2B 5J39A 5GAMf 1Y96B 5KH6A 4RKUE 2DXUA 5A0DA 2K57A 2E65A 1KG1A 5D6WA 2D9TA 3CC7T 1EIFA 1YIJA 3J7AF 2D6FA 4PJOD 4KUIA 3JCMd 3QXEB 1ZQ1A 3A8GB 3OYFA 4M77C 3P8HA 2P0PA 2QQBA 4MZTA 3M53A 3DLMA 3HKSA 5CKFA 1YJ9T 2FHDA 4PJOC 1ZBXA 2LQ8A 4C8QG 5GMKe 1UB4A 3I56A 4C8QB 3MCAB 1HXDA 3ZFJA 3V8JA 1LNXA 4M77D 1VQ4T 4FM4B 2DEQA 2VGNA 2VC8A 2RB6A 2M0OA 2RK2A 4XK8E 4C0DC 3HRUA 4LDXA 2ZPEB 3M57A 2E6ZA 1N9SA 4OGEA 4JUVA 4ELYC 1FX7A 4EMKB 3G4SA 1YBYA 3G6EA 4L6V5 3X28B 1BI0A 2DK3A 4V2SA 4M75E 3SFMA 3RESA 1SSFA 5GANe 3OS1A 1KQ1A 2DIGA 1W4SA 3E9FA 3E9GA 3E19A 1UGQB 1X6OA 3ER0A 2F5TX 2EAYA 2R5MA 4M78F 4N0AC 5LJ3d 3OS0A 3A8HB 4C0GA 3NTIA 4D6WA 3L2VA 3JCMQ 3RUXA 4ZGDB 1H641 3C94A 3G7ZA 5CKHA 2XHCA 5KE3A 2L8DA 2P0QA 3BW1A 3J80E 4RMOA 4XU3A 2GQVA 1LJOA 1MGQA 2RHUA 5CR2A 3OQ5A 4M7DA 4M75G 2FB7A 2HQEA 1VQLT 4M75A 4DQ2A 2E1HA 4M7DG 2P0KA 4EMHA 1I5LA 4C8QC 2RM4A 3EFSA 3A8MB 4QQDA 1VQ6T 3VV0A 1Q7YU 4XU1A 2KMTA 3A8LB 4A4KA 3M9QA 2M16A 3V7SA 3PTAA 1YJ9A 2QQSA 4PNOA 2DXBA 4BE1A 2E10A 5GAN7 3JB9F 3UDCA 4BI8B 4C92F 1VQ4A 4XU2A 2QA4A 3QG1A 2ZCFB 4QVZA 1KHCA 2DIQA 3SB2A 4C5GA 4ZTFA 3QYHB 5FU7B 2PQWA 4XU0A 5GAOm 3CMAT 2YRVA 1BYMA 2B8AA 1NJIC 3CD6A 4HA8A 4F7UE 1G3WA 1X75C 2BUDA 2EJGA 3GF5A 4C92A 4J6XA 5A0GA 3TU4K 3OW2A 3P8BB 1KD1U 2OTJT 2DJZA 4M78G 2EJ9A 5CK9A 3OMGA 5CQYA 1KC8U 3CCVA 3AHUA 1PSFA 3F70A 1M90U 4E7KA 1OI1A 3CCMT 4II1A 2LC4A 4JLIA 1VQOA 1N8RC 1YJNA 1UEBA 3PIOA 2VUBA 5GAMe 5I2SA 3Q1JA 4F7UA 2MWPA 4Y28E 4FSXA 2M9UA 4O6JA 3MP1A 2ZPGB 4M7DE 2XKOC 4C8QF 4JRIA 3CCET 3JCMe 4HCZA 4BE2A 1N27A 1VQLA 4M7AE 2LX9A 5GMKi 2LCCA 1OZ3A 2WACA 4C92B 4JDSA 1XNIA 5FLXE 2CYZB 4BY6C 2GCXA 4C92G 3MEUA 1QW1A 4UC4A 2E6NA 2OAUA 4JRKA 3WVDB 4FIBA 4A54A 4EMKC 3L2WA 3KUFA 1NJIU 1VQ5A 3SD4A 3DB3A 5IN1A 2RHIA 3V7CA 5LJ5e 1NZ9A 1Q82U 1VQNT 5CAIA 1MHNA 2LT4A 3M4GA 4M7AB 2A7YA 3M56A 1M1FA 2RJEA 4J6YA 3CXCS 1BIBA 1M1GA 4XTUA 4QQGA 2XDDA 4M77E 2DKGA 4GY5A 3H6ZA 1BI1A 2DZ9A 1VQKA 2CZ6B 2EQUA 3LWHA 5GAN3 3VJPA 5KCOA 1VUBA 3V8KA 3JRZA 4JRQA 1K73C 2HAXA 4MDWA 1WQWA 2K5IA 2DXTA 2MMPA 2DTHA 3WVEB 3JCMX 3CPWS 3CCRA 4MMLA 3UT1A 3FRNA 4RG8A 5HKCA 1VQ9A 4KUDK 5FRMA 1QVPA 4ME7A 1VQPT 1WJQA 2EQMA 4IUPA 3FC3A 4PJOF 4M7AA 3CCQT 3CCLA 1B34A 4IUTA 5GAOn 5GAN8 3PIPA 4Z02A 2L89A 2DAQA 2X4XA 4ZN1A 5I2MA 3OY9A 1NPPA 3CC4A 2F69A 2Y90A 4XTZA 3L1AA 3HFNA 1H3ZA 4OB1B 3A8OB 3FLGA 5EG2A 3OBYA 3HP9A 3RKYA 1QVGS 2RH2A 3BFMA 1D3BA 4BE0A 4C0FA 1GXIE 4JJNK 5GANd 3CCJT 1WJRA 2LTOA 3VU3C 3HPWA 3X25B 3JB9H 2E41A 2JUFA 2AHJB 4NOYA 4C0ZA 1VIEA 1QVGA 3ASKA 3UPUA 1BKBA 2FYKA 3OYBA 4KBMB 1M90C 3L2UA 4RG2A 2F5KA 5LL6S 4NL2A 3OYKA 1NE8A 3V7RA 5C6SA 4M78E 3I55T 4O5VA 3M59A 1YITT 2QQRA 2MI6A 4C8QA 3SWNB 2V8JA 2L5QA 3BDLA 1BI3A 1VQKT 1V29B 3CCST 2CKKA 4OB0B 4C8QE 2E70A 2JOYA 5D6YA 2XICA 4HT8A 2K2VA 4F7UB 2D0QB 4LD9K 3CBPA 4A4GA 2RD1A 3OW2S 4TVRA 1KHIA 2DVEA 2X4WA 4PLLA 4M75B 5GAN2 3QDRB 4NL3A 4M7DF 4FU6A 4A53A 5HK3A 3CCLT 1FWZA 3CCQA 4LDYA 1P92A 3L42A 4BD3A 2EIFA 5GAOp 3TEEA 4OP0A 4C92C 2YHTA 1YJWT 3RMSA 2O4XB 5GAN4 2K3YA 3JCMP 1Q7YC 4JS4A 3NFCA 4EPCA 1K9MU 2HBPA 2MAMA 2ZGWA 1M9SA 3PNWC 2YLCA 4M75C 3ZEHA 5GAOr 1M8VA 4E7HA 3CBOA 3M54A 1YHQA 3LYIA 2BIVA 4M7AD 2G3RA 4IUVA 1Q82C 4L5GA 1Y7XA 3T9NA 4DOWA 5GAOq 2IVWA 4QW2A 4F7UF 1K9MC 4DOVA 1VQ8T 4FT4A 4PLIA 3JCMJ 2KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNI A;  2E5Q A;  2GF7 A;  2VYT A;  2JTF A;  3UWN A;  2EQJ A;  2L3R A;  3MEU A;  4OVA A;  4N4H A;  2E6N A;  4UC4 A;  5KH6 A;  5J39 A;  3P8D A;  3L2W A;  3OYJ A;  3KUF A;  3QII A;  5D6W A;  3OYH A;  2D9T A;  3SD4 A;  3DB3 A;  5IN1 A;  2RHI A;  3GOX A;  3LGF A;  4LD6 A;  4C5H A;  2X4Y A;  1MHN A;  2RI2 A;  3S6W A;  3S3O A;  3S3M A;  3OYF A;  2RJE A;  3OA6 A;  5FRO A;  3P8H A;  2RO0 A;  4QQG A;  3DLM A;  3PFS A;  4PL6 A;  4GY5 A;  2FHD A;  3H6Z A;  4B9X A;  3EAE A;  2EQU A;  3OYA A;  2M1H A;  3O8V A;  2R5A A;  2HQX A;  5KCO A;  2R57 A;  4ZTJ A;  2M0O A;  5M9O A;  3UT1 A;  3OB9 A;  2GFU A;  5FRM A;  4EDU A;  3LLR A;  3LH0 A;  3H8Z A;  3MEA A;  3OYI A;  1WJQ A;  2EQM A;  4IUP A;  3FC3 A;  4IUT A;  1SSF A;  2K3X A;  4NS5 A;  4Z02 A;  2L89 A;  2NLU A;  2DAQ A;  2DIG A;  2X4X A;  3E9F A;  4IUR A;  3E9G A;  4A4F A;  3OS1 A;  3OY9 A;  3PMI A;  4X34 A;  3OS0 A;  4IKF A;  2R5M A;  4A4E A;  1H3Z A;  2JZ2 A;  2EFI A;  3OYG A;  3MP8 A;  3FLG A;  3NTI A;  3FDR A;  3MO8 A;  3OYE A;  3L2V A;  1OZ2 A;  3L2Q A;  2RJC A;  3OYL A;  5KE3 A;  2L8D A;  3NTK A;  4B9W A;  4BE0 A;  2RJD A;  2LVM A;  2XDP A;  1WJR A;  2LTO A;  2RI3 A;  4E7J A;  2RHU A;  3OQ5 A;  4C5E A;  4N4I A;  3OS2 A;  2HQE A;  5FRN A;  3LGL A;  3C4S A;  4Q5W A;  2P0K A;  3ASK A;  3L2R A;  3FEO A;  3OYB A;  3L2U A;  2RI5 A;  2F5K A;  4RG2 A;  3OYD A;  4QQD A;  3OYN A;  3OYK A;  3MET A;  5C6S A;  1WGS A;  4E7L A;  2QQR A;  3M9Q A;  1WJS A;  2EQK A;  2M16 A;  4BAC A;  4BDZ A;  2O4X A;  4FL6 A;  2QQS A;  3BDL A;  3OMC A;  1G5V A;  1OYX A;  3PMT A;  4L59 A;  2CKK A;  2RHX A;  4BE1 A;  3DB4 A;  3QKJ A;  4C5I A;  2LRQ A;  5D6Y A;  5D6X A;  2R58 A;  2GFA A;  5J26 A;  4QVZ A;  4A4G A;  3MEV A;  1KHC A;  2X4W A;  2DIQ A;  2RHZ A;  4PLL A;  4C5G A;  4ZTF A;  2PQW A;  1RI0 A;  2YRV A;  3NTH A;  2B8A A;  2XK0 A;  2BUD A;  4FU6 A;  4E7I A;  3QBY A;  2BKD N;  4N4G A;  2EKO A;  3L42 A;  4QQ6 A;  3OMG A;  4BD3 A;  2IG0 A;  5KCH A;  2O4X B;  3ME9 A;  2K3Y A;  3F70 A;  3MP6 A;  3QJ6 A;  4E7K A;  1OI1 A;  3OYC A;  2X35 A;  4CRI A;  2MWO A;  4A4H A;  2RHY A;  2RJF A;  4II1 A;  3PNW C;  3ZEH A;  5KE2 A;  5IAY A;  4E7H A;  3MEW A;  4IUQ A;  4IUU A;  3LYI A;  2BIV A;  3LX7 A;  2G3R A;  3Q1J A;  4IUV A;  2MWP A;  3S3N A;  3CEY A;  3MP1 A;  4QW2 A;  4BDY A;  5C0M A;  2LDM A;  4HCZ A;  5CIU A;  4PLI A;  3OYM A;  1N27 A;  4BE2 A;  2LCC A;  1OZ3 A;  2WAC A; 
#chains in the Genus database with same CATH topology
 1IHW A;  2I2L A;  2J7I A;  1RAG B;  1NPR A;  3VS0 A;  1FXX A;  1KC8 C;  3HL8 A;  3EFO B;  3J81 E;  2M51 A;  3GPL A;  1G3Y A;  2JMA A;  3CD6 T;  1QVG P;  2WSC E;  1HD3 A;  4OB3 B;  2OTJ A;  1BCO A;  5I11 A;  1PSE A;  1NLP C;  4XTY A;  3CCV T;  1Q86 R;  1T3L A;  1ZSZ C;  5HK0 A;  1Y96 A;  1OEB A;  1GBR A;  2DTO A;  2K4Y A;  2XG8 D;  1WHL A;  1YJW A;  1KFZ A;  3LH0 A;  4JPB W;  5GAN h;  1Q81 R;  1TUG B;  2KT1 A;  4MMK A;  1WQ7 A;  1VQ7 T;  1QP3 A;  4J9E A;  2J06 A;  5AYF A;  3PMI A;  1RAF B;  1O9S A;  2ZPF B;  3SWN C;  2Y4Y A;  2CP7 A;  4ZGE B;  5LJ5 d;  2JS0 A;  3JV3 A;  1RLQ C;  1EX4 A;  1BIA A;  4X1V A;  4JZ3 A;  2XDP A;  1TTH B;  2JN0 A;  3OS2 A;  4R55 A;  2LQK A;  3IQL A;  1M3B A;  4FYV B;  2CZ1 B;  2YRD A;  3CME A;  1UGR B;  1K73 U;  2JVV A;  1TSF A;  2EQK A;  3GIB A;  5HY6 A;  4F7U G;  3PMT A;  3CCL Q;  1SHF A;  2RHX A;  1D3B B;  2RK1 A;  3KXT A;  2GFA A;  2DO3 A;  3TCJ A;  1OU9 A;  2JNG A;  1KQS S;  1JBM A;  3CCV Q;  2NUT B;  1IGU A;  4PJJ A;  4DEY A;  3CCJ A;  3QJ6 A;  4ELZ C;  3R6N A;  4HVV A;  1OOT A;  4ZNX A;  5IAY A;  4FW1 A;  1V1C A;  4BDY A;  3I55 A;  1GCP A;  5C0M A;  2OTL A;  4LDU A;  2PUK B;  1N9R A;  1TU0 B;  2JMC A;  2FZC B;  3EGU A;  1NG2 A;  1QKX A;  3QO3 A;  3OYH A;  4EMK A;  1OX9 A;  4MZP A;  4C5H A;  3C95 A;  2VGM A;  2Y4X A;  3QJY A;  3VUB A;  1D1A A;  2KSS A;  1XQH A;  5IH2 A;  5GAN g;  4FT2 A;  4OMQ A;  2OTJ Q;  3O8V A;  2QEX Q;  4J6W A;  2HQX A;  1JB0 E;  2W0Z A;  2KT8 A;  4ZTJ A;  2MYS A;  5FU6 B;  2FRW A;  4ATO A;  2C06 A;  2HD0 A;  1HJD A;  4M77 G;  5DY9 A;  1W2B S;  2K3X A;  2NLU A;  4IKF A;  1YWO A;  2DVJ A;  3SEM A;  1QCO A;  1ZHI A;  2E3I A;  2OTL T;  1N8R U;  1T0H A;  4QVC A;  2K9G A;  4M7A F;  1Q82 R;  1AWX A;  2YUQ A;  2H8H A;  1VA7 A;  4HCB A;  4MDX A;  2AZV A;  1FYN A;  3EHR A;  1T0J A;  3FEO A;  2DJQ A;  1WGS A;  2K79 A;  1X01 A;  3HRS A;  3OW2 P;  3OMC A;  1W2B A;  1VQ4 Q;  4RTU A;  1UUE A;  2QXF A;  1M1K C;  1PD1 A;  3INZ A;  4HKE A;  3CCU T;  4BY6 B;  1JJ2 A;  1RI0 A;  2QEX A;  2E4H A;  3EG2 A;  4HXJ A;  4F16 A;  2EKO A;  2YUP A;  2IG0 A;  4DA4 A;  1Q86 U;  3VYH B;  2KRS A;  3G4S T;  3G6E T;  4P5N A;  2MWO A;  3EFO A;  2P4T A;  2FG0 A;  3M0P A;  3QZ9 B;  4KGV B;  2XU8 A;  2PVG B;  4M7D B;  4LUD A;  5DLQ E;  1D0Y A;  3EGX B;  4PFZ A;  1VQ9 T;  1RL2 A;  1IXD A;  1O75 A;  2CZ7 B;  2HKN A;  1X2Q A;  4LN2 A;  5CIU A;  2NUP B;  3OYY A;  2EGA A;  1Q81 C;  5KYU A;  5A0D A;  4PJN A;  1JQQ A;  2E65 A;  1NYG A;  1TUC A;  3J7A F;  1MUZ A;  4KUI A;  3JCM d;  1NYF A;  3QXE B;  1ZBX A;  1UB4 A;  4ANJ A;  4C8Q B;  3MCA B;  4D8D A;  2JW4 A;  4M4Z A;  4E2F B;  2ROT A;  4XK8 E;  3M57 A;  2LZ6 B;  4JUV A;  4EMK B;  1FX7 A;  1YBY A;  1OUL A;  3G6E A;  1QKW A;  4D8K A;  1VYT A;  1SSF A;  2DIL A;  2DIG A;  1W4S A;  2EAY A;  4N0A C;  2ED0 A;  2GGR A;  2RMO A;  3RUX A;  1RI9 A;  3C94 A;  1BBZ A;  2COW A;  2RQV A;  1FMV A;  1J3T A;  1ACM B;  4RMO A;  2GQV A;  1LJO A;  2KNB B;  4PJL A;  1M2V A;  3E2U A;  1VQL T;  4DQ2 A;  2J05 A;  4M7D G;  1I5L A;  5KYN A;  2O31 A;  3A8M B;  1UGV A;  2K6D A;  2DL7 A;  3VV0 A;  4XU1 A;  2KMT A;  3A8L B;  3CC2 Q;  3V7S A;  2QG9 B;  2YSQ A;  2E10 A;  4XU2 A;  2DA9 A;  4FYY B;  1KHC A;  3SB2 A;  4C5G A;  2DEU A;  5GAO m;  2LX7 A;  2EBP A;  3M0S A;  1NJI C;  4HA8 A;  1G3W A;  1X75 C;  5A0G A;  2FEI A;  2KYM A;  1BCM A;  5IHN A;  1PM3 A;  1TG0 A;  2CRE A;  3CCM T;  1SRL A;  4CC3 A;  1N8R C;  3PIO A;  5GAM e;  3CPW P;  1PKT A;  4Y28 E;  4O6J A;  2ED1 A;  2MPX C;  4C8Q F;  4JRI A;  3CCE T;  1N27 A;  4M7A E;  5GMK i;  1OZ3 A;  2CYZ B;  4C92 G;  1K8A R;  1F1B B;  1QW1 A;  2AT1 B;  4UC4 A;  2OTL Q;  4A54 A;  3M0Q A;  1NJI U;  2RHI A;  1Q82 U;  5CAI A;  4M7A B;  1I5O B;  2A7Y A;  1YWP A;  1BIB A;  2XDD A;  1WXU A;  2RQU A;  3H6Z A;  1E6G A;  1BI1 A;  1VQK A;  2EQU A;  3LWH A;  1YCS B;  1VUB A;  1WQW A;  4OML A;  2DTH A;  3CCR A;  1AWW A;  2JM8 A;  4FSS A;  1QVP A;  4ME7 A;  3FC3 A;  3CCQ T;  1B34 A;  2L89 A;  2X4X A;  2MOX A;  1TXQ A;  2F69 A;  2DYI A;  1H3Z A;  4OB1 B;  5EG2 A;  1M3C A;  2X9H A;  2CP2 A;  3HP9 A;  2D8H A;  1U5S A;  4LNP A;  4C0F A;  1GXI E;  2JM9 A;  1WJR A;  2LTO A;  2FO0 A;  3X25 B;  3JB9 H;  1LPL A;  1QVG A;  2IIM A;  1BKB A;  5LL6 S;  4Y92 A;  5C6S A;  4M78 E;  1UHF A;  2QQR A;  4C8Q A;  3SWN B;  2JOY A;  5D6Y A;  2DL5 A;  4F7U B;  2VB6 A;  2D0Q B;  2RD1 A;  3OW2 S;  4FYX B;  2NUZ A;  1AWO A;  3CCQ A;  1VYV A;  1ABQ A;  1P92 A;  2DMO A;  2YHT A;  2GQI A;  2VWF A;  2ZGW A;  3ZEH A;  5GAO r;  4E7H A;  2HL5 C;  1K76 A;  1E6H A;  4CC2 A;  1Y7X A;  3MJX A;  5GAO q;  1K9M C;  1QWF A;  2LJ3 A;  1W6X A;  2ATC B;  2GF7 A;  3N5B B;  4JS5 A;  1WX6 A;  4N4H A;  1OV3 A;  1XJW B;  2J6K A;  2QAS A;  3URG A;  5I22 A;  2JJ9 A;  1UTI A;  1NEB A;  3PT9 A;  1WHJ A;  5CO7 A;  2RI2 A;  4RTV A;  1X6G A;  3CCJ Q;  4LDW A;  1SHG A;  3M4Y A;  2KRO A;  3VUZ A;  2DE0 X;  1R8O B;  2PUO B;  4PL6 A;  2CUD A;  5LJ3 f;  3EAE A;  7AT1 B;  2K7A A;  2Z0W A;  1YIT Q;  2F1L A;  2DRK A;  3OB9 A;  3LLR A;  2A0F B;  2LCL A;  1OX8 A;  1VQM T;  4MZM A;  4IUR A;  1YI2 A;  3M55 A;  4A4F A;  1TS9 A;  2XID A;  2BZ8 A;  1NEG A;  2LQW A;  1GCQ C;  3HRT A;  3QYG B;  1Q81 U;  4M78 C;  2RPN A;  3JB9 I;  1VQL Q;  2RJC A;  3OYL A;  3PE0 A;  2LVM A;  2QA4 Q;  1IZ6 A;  4ORZ A;  3V8L A;  3NHN A;  1Y07 A;  3LGL A;  4RCB A;  4C92 D;  3JCM P;  3CC4 A;  1T3S A;  3THK A;  2PU9 B;  3SDZ A;  3OYN A;  1Q86 C;  3MET A;  1JXO A;  4J9G A;  2A36 A;  4HVW A;  3EH2 A;  4FL6 A;  4XQ3 A;  1BI2 A;  3QHS A;  1Z9Q A;  2KE9 A;  3CMA Q;  3RER A;  2KAF A;  5D6X A;  4M77 B;  1I8F A;  4Z88 A;  1YIJ T;  2EYQ A;  4E7I A;  1VQ7 A;  2KVQ G;  1G3S A;  5KCH A;  3SWN A;  2DTI A;  4J7I A;  3ME9 A;  4CRI A;  1D09 B;  1OU8 A;  2O01 E;  3OBW A;  1G3T A;  3DKM A;  3OYM A;  1VQK Q;  5GAN j;  1M5Q 1;  3EGD B;  2E5Q A;  2VYT A;  1IGQ A;  1TOV A;  2JTF A;  1K8A U;  5DM7 R;  2QQA A;  3TQ7 P;  3CME T;  2A08 A;  2BE7 D;  3KFV A;  2EVR A;  4XAX B;  4JJD A;  4JRP A;  2HMA A;  4C8Q D;  2I0N A;  3X26 B;  1B34 B;  5GMK j;  3RKW A;  2RO0 A;  4RTY A;  4F17 A;  1N5Z A;  1NBE B;  4J9I A;  4B9X A;  5GAM g;  3ULR B;  1SPK A;  1MMN A;  3E1S A;  2X3W D;  5M9O A;  1E7O A;  2P4R A;  2CP0 A;  3NGP A;  1C6V X;  3HFO A;  1GFC A;  1K8A C;  1QWE A;  3H8Z A;  4XTX A;  2QA4 T;  2KEA A;  2CSQ A;  5GMK h;  3WXM B;  4OMF B;  2JZ2 A;  3MO8 A;  2YLB A;  1B07 A;  1PRL C;  1GBQ A;  4B9W A;  1UDL A;  3VS5 A;  4M78 A;  4JJB A;  1N8R R;  3RR6 A;  4KT0 E;  2V8K A;  5L8R E;  5LJ3 h;  2FPE A;  1WHK A;  1JRI A;  1I07 A;  1NJI R;  4JZ4 A;  3VS1 A;  2KBT A;  2V8I A;  2DBK A;  2AKK A;  2X51 A;  2VXF A;  1YHQ Q;  2CZ0 B;  4RTZ A;  2RHZ A;  3FB9 A;  2KQW A;  3NTH A;  1CKA A;  2XK0 A;  3QBY A;  5CQX A;  3CXC A;  3SHW A;  5GAM j;  3X20 B;  3M5A A;  3MEW A;  3QUI A;  2AK5 A;  3A1P A;  1ZSZ A;  2GTO A;  2M0Y A;  3RIR A;  5CCA A;  5A0L A;  4OB2 B;  5J39 A;  5GAM f;  5KH6 A;  2P84 A;  1H8K A;  2D9T A;  1UFF A;  5IXB A;  2D6F A;  4PJO D;  2M02 A;  1ZX6 A;  2QDL A;  2NWM A;  2P0P A;  2QQB A;  3DLM A;  3HKS A;  1YJ9 T;  1WHG A;  1PC0 A;  2LQ8 A;  2F2X A;  4C8Q G;  5GMK e;  5KYY A;  1HXD A;  4M77 D;  1VQ4 T;  5L23 A;  2M0O A;  2RK2 A;  1WXB A;  4LDX A;  1I1J A;  2BE9 B;  4OGE A;  3G4S A;  4L6V 5;  2DK3 A;  3REB B;  5GAN e;  1KK7 A;  3E9G A;  3G1J A;  1X6O A;  3OS0 A;  2R5M A;  3A8H B;  1MV0 B;  3L2V A;  3JCM Q;  4ZGD B;  2XHC A;  2L8D A;  2ENM A;  2P0Q A;  4XU3 A;  2RHU A;  5CR2 A;  3OQ5 A;  3EGX A;  2FB7 A;  4EMH A;  3CCR Q;  6AT1 B;  3M0U A;  2EYX A;  3PTA A;  1YJ9 A;  4PNO A;  1NLO C;  4BE1 A;  5GAN 7;  1PRM C;  1SF9 A;  3QG1 A;  2PNI A;  1BK2 A;  2V1Q A;  1MV3 A;  3M0T A;  3CMA T;  2B8A A;  1EFN A;  2BUD A;  3GF5 A;  1WHM A;  4J6X A;  1KD1 U;  2OTJ T;  2DJZ A;  5CK9 A;  1K9M R;  2SRC A;  3F70 A;  4E7K A;  1OI1 A;  1D1B A;  4EIK A;  3G71 Q;  1VQO A;  2D1X A;  1YJN A;  5I2S A;  2MWP A;  4FSX A;  2M9U A;  2CSI A;  3MP1 A;  4BE2 A;  1VQL A;  2A28 A;  2BTT A;  2ABL A;  1G8X A;  3L2W A;  2C0O A;  1VQ5 A;  3SD4 A;  1YJN Q;  1VQN T;  1WI7 A;  1Y0M A;  1VQ8 Q;  3M56 A;  1M1G A;  4QQG A;  1VQ6 Q;  2HBW A;  2DKG A;  4GY5 A;  2CZ6 B;  5EC7 A;  4CC7 A;  5KYW A;  5GAN 3;  3V8K A;  4JRQ A;  4MDW A;  1HYO A;  3RNJ A;  1KD1 R;  2DXT A;  2ECZ A;  2HCK A;  3FRN A;  5HKC A;  1VQ9 A;  5FRM A;  2FPF A;  2COY A;  2DL8 A;  4IUP A;  4LXC A;  2KGT A;  3CCL A;  3PIP A;  1RAC B;  4ZN1 A;  3OY9 A;  4XTZ A;  1SG5 A;  5HCK A;  1B7T A;  2JS2 A;  5KYY B;  1Z9Z A;  5KYU B;  1ARK A;  3BFM A;  2HL3 A;  2KRN A;  2JUF A;  1RAB B;  1VIE A;  3UPU A;  1FMW A;  4RG2 A;  1HSQ A;  4NL2 A;  1AZG B;  3I55 T;  3M59 A;  2V8J A;  3I5R A;  2HKQ B;  1VQK T;  2B86 A;  2BZY A;  4C8Q E;  2QGG A;  2J6O A;  2XIC A;  1Y57 A;  4QKU A;  4LD9 K;  2HDA A;  4A4G A;  1KHI A;  2X4W A;  5GAN 2;  3CCL T;  1CKB A;  2GNC A;  2AZS A;  3CC4 Q;  2EGC A;  4C92 C;  3RMS A;  5GAN 4;  4JS4 A;  1KJW A;  1K9M U;  1M9S A;  3PNW C;  1M8V A;  2XMF A;  3CBO A;  3REA B;  4OMO A;  1M2V B;  1Q82 C;  4L5G A;  4DOW A;  1VQ8 T;  4PLI A;  2KDS A;  3JCM V;  1KQS P;  3I5S A;  4OVA A;  4PJO E;  3P8D A;  2KXC A;  3H0H A;  4XTW A;  3GOX A;  4K11 A;  3EFR A;  3LGF A;  1AOJ A;  2PVO B;  2X4Y A;  4OF1 A;  8AT1 B;  2DNU A;  2ZZD A;  4QVD A;  2FZK B;  4RCC A;  5FRO A;  4M7A C;  4M7D C;  1XTD A;  4C0D B;  3AT1 B;  1PWT A;  3JCM f;  3CCM A;  4PJO A;  1C1A A;  2CGH A;  2R57 A;  4BUG A;  1LOJ A;  2EYY A;  5GMK l;  2KY9 A;  4J7F A;  4FYW B;  2EGE A;  1K0X A;  1QVF A;  3GNG A;  3OYI A;  1PHT A;  1ZSZ B;  3U23 A;  1RAA B;  4CI0 C;  4BI4 A;  4M75 D;  3CME Q;  5CVI A;  3OYG A;  1XOV A;  3JSC A;  2EWN A;  3NTK A;  4LDV A;  5FWB A;  1SSH A;  4M77 A;  3G71 T;  2WSE E;  4E7J A;  2DBM A;  1U1S A;  4N4I A;  2VV5 A;  4RTT A;  5FRN A;  2FVU A;  3C4S A;  3L2R A;  1U8R A;  2HSP A;  1S72 T;  4J83 A;  3CC2 A;  2FZG B;  4E47 A;  3GP8 A;  8ATC B;  3UA6 A;  1M1K U;  4RUG A;  1AHJ B;  1K0S A;  4J8O A;  1G5V A;  1WYX A;  1OYX A;  3FJP A;  3VKI A;  3RDV A;  5GAM h;  3H41 A;  2IPO B;  2R58 A;  3CPW S;  1I4K 1;  2K2M A;  5GAM d;  1ABO A;  2F2W A;  2A3L A;  1ZA1 B;  1QMC A;  4X9C A;  1YI2 T;  3I56 T;  3EG0 A;  1FMK A;  3R6O A;  4E7Z A;  2DX1 A;  2X35 A;  5KE2 A;  5FU7 C;  2QK0 A;  3A5Z B;  4IUU A;  3G71 A;  3FJ5 A;  3CEY A;  1YIT A;  3M58 A;  1BU1 A;  5IHI A;  3HSB A;  2RA2 A;  3QSU A;  3H9N A;  3QWY A;  4M77 F;  3CC4 T;  3CCS A;  4M7D D;  1K9A A;  2L3R A;  5CKD A;  4M75 F;  2DPP B;  4GBQ A;  4JJC A;  1VQ9 Q;  1D1C A;  1X27 A;  1M1K R;  2DYB A;  3QPH A;  3BDU A;  4LD6 A;  3S3M A;  5LJ3 e;  1VQ5 Q;  1ZUU A;  3MKD A;  4DBF A;  2QI2 A;  4IIM A;  1JEG A;  3PFS A;  3HTR A;  2LMJ A;  4E6R A;  5LJ5 h;  2M1H A;  1VQ6 A;  4AMC A;  2XI9 A;  4M78 B;  2OI3 A;  2LCS A;  3MPU B;  1WZO A;  3EHQ A;  5ECA A;  1KQ2 A;  1M2O A;  1YCY A;  1I81 A;  1WFW A;  4XTV A;  4NS5 A;  4Z89 A;  2YDL A;  2E64 A;  2LP5 A;  4X34 A;  4F14 A;  2NUP A;  1VQP Q;  1V76 A;  3H0I A;  2D0N A;  3PVL A;  2QTV A;  2QQ9 A;  1JU5 C;  4PJO B;  1OZ2 A;  1PG5 B;  4J5Y A;  3DLL A;  4C5E A;  1UGP B;  2EJF A;  4N0A A;  3EGD A;  4E7L A;  3JCM h;  2H3J A;  1WJS A;  3VS2 A;  3CC7 A;  3GNF B;  2EPD A;  1KQS A;  3CBM A;  3TRE A;  3JCM b;  2PTK A;  1AEY A;  2E12 A;  3EG1 A;  2DER A;  5GAN 5;  4E7S A;  2BKD N;  4N4G A;  1X6B A;  4GLK A;  3CXC P;  1IRE B;  4A4H A;  1SKU B;  1AT1 B;  4FCY A;  2FPD A;  2A37 A;  4PJM A;  2W10 A;  2LNV A;  2EYW A;  4ZGJ B;  1U06 A;  1VQP A;  2FL7 A;  5FU6 C;  4HCC A;  3CCQ Q;  1S1N A;  2YUO A;  4AT1 B;  2BZX A;  2K57 A;  5D6W A;  3CC7 T;  1EIF A;  2COZ A;  2LJ1 A;  2CUB A;  2NYS A;  3A8G B;  2FRY A;  3P8H A;  1RAE B;  4AFZ C;  2FHD A;  4KH0 B;  3CD6 Q;  3ZFJ A;  1LNX A;  4FM4 B;  2DEQ A;  3EG9 A;  1MMA A;  2SEM A;  2ZPE B;  2E6Z A;  1NM7 A;  4ELY C;  1VYU A;  1U3O A;  5KYX A;  4V2S A;  2RQW A;  2VVK A;  4M75 E;  3SFM A;  1D0X A;  3E9F A;  2HZY A;  3J80 E;  5KE3 A;  3BW1 A;  1KIK A;  3TVT A;  1MMD A;  1UJY A;  4M7D A;  4M75 G;  1MNE A;  2HQE A;  4M75 A;  2L3S A;  4AFU C;  4J9C A;  2C0I A;  4C8Q C;  2RM4 A;  3EFS A;  4QQD A;  2O2O A;  1Q7Y U;  4FW2 A;  3NMZ C;  1R77 A;  2M16 A;  4DBQ A;  2YXY A;  1WLP B;  3UDC A;  4C92 F;  1VQ4 A;  2QA4 A;  2ZCF B;  2O9V A;  4QVZ A;  1UE9 A;  1Q7Y R;  4ZTF A;  3QYH B;  2PQW A;  4XU0 A;  2YRV A;  1BYM A;  3CD6 A;  4F7U E;  2K3B A;  2L2P A;  2EJG A;  4CC4 B;  2QGF B;  2MCN A;  3OW2 A;  3CCS Q;  2EJ9 A;  3OMG A;  1KC8 U;  3CCV A;  3AHU A;  1PSF A;  1M90 U;  2VAS A;  2LC4 A;  1UEB A;  3CC7 Q;  3EH1 A;  4M7D E;  4HVU A;  2LCC A;  4C92 B;  4BY6 C;  2QAZ A;  2E6N A;  2OAU A;  4JRK A;  3WVD B;  4FIB A;  4AFS C;  3DB3 A;  5IN1 A;  3V7C A;  4B6M A;  1NZ9 A;  1MHN A;  3M4G A;  4HCK A;  4KGZ B;  4KH1 B;  1M1F A;  2RJE A;  1I0C A;  4PK4 A;  1UG1 A;  3CXC S;  4XTU A;  2DLP A;  1WDX A;  2MK5 A;  3QWX X;  2DFU A;  1K73 C;  3JRZ A;  3WVE B;  3JCM X;  1W2B P;  1M27 C;  4MML A;  4PFP A;  4KUD K;  1PKS A;  1WJQ A;  2C0T A;  2EQM A;  4PJO F;  1YJ9 Q;  5GAO n;  1GRI A;  5GAN 8;  4Z02 A;  2DAQ A;  1QVF P;  5I2M A;  1NPP A;  3H0F A;  1IRX A;  2HQH A;  1AD5 A;  3HFN A;  4AFQ C;  3FLG A;  2E3H A;  4IIO A;  3OBY A;  1SEM A;  1D3B A;  4BE0 A;  1W1F A;  5GAN d;  3CCJ T;  3VU3 C;  1YFN A;  3HPW A;  3CCM Q;  4C0Z A;  4NOY A;  2KI7 A;  1OQK A;  3ASK A;  3CCE Q;  3OYB A;  4KBM B;  1M90 C;  3L2U A;  2F5K A;  2CT4 A;  3BDL A;  1BI3 A;  2E70 A;  4HT8 A;  2K2V A;  3CBP A;  2CH4 A;  2DVE A;  1WIE A;  4PLL A;  4J9F A;  4M75 B;  3QDR B;  4FU6 A;  4A53 A;  1X69 A;  2DRM A;  5HK3 A;  4LDY A;  3M0R A;  3L42 A;  4BD3 A;  3TEE A;  4OP0 A;  1YJW T;  2O4X B;  2K3Y A;  3NFC A;  4EPC A;  2LJ0 A;  1KC8 R;  2MAM A;  2YLC A;  4M75 C;  2CH4 W;  1SRM A;  3M54 A;  1Q95 G;  4RTW A;  3LYI A;  1YHQ A;  4M7A D;  2G3R A;  3UAT A;  4QW2 A;  1M8M A;  1S72 Q;  3LH5 A;  4FT4 A;  3JCM J;  1RAI B;  2WSF E;  1M4Z A;  4PKC C;  4R56 A;  2KR3 A;  3EG9 B;  3O5Z A;  3OYJ A;  2DM1 A;  5CKE A;  2MF2 A;  3S3O A;  4WF2 A;  3CMA A;  1RUW A;  1AWJ A;  2HEQ A;  1UHC A;  1YI2 Q;  3VS6 A;  4DBH A;  2CDT A;  3OYA A;  2EYZ A;  2R5A A;  1HK9 A;  1OPL A;  3I55 Q;  1QVF S;  1VQO T;  1YJN T;  4J9D A;  2H3E B;  2L3P A;  3X24 B;  2JTM A;  1AZE A;  1QCN A;  2CS7 A;  2DZC A;  3VRY A;  3MEA A;  3JB9 J;  1R0C B;  3JB9 G;  5GAO l;  2K5F A;  1YHQ T;  1WXT A;  1UGS B;  2NUT A;  1ZLM A;  4A4E A;  2QTX A;  2EFI A;  4LUE A;  2RNA A;  3MP8 A;  3FDR A;  2ZPH B;  2YUN A;  5KYW B;  2DD5 A;  3TSW A;  4OMP A;  1VQN A;  5GMK m;  1K1Z A;  2JTE A;  2RJD A;  5CKB A;  2HNI A;  2RI3 A;  3CQT A;  3FIF A;  4M78 D;  1PCX A;  1U1T A;  2ROL A;  1VIF A;  3KBG A;  4JLG A;  3VYG A;  2X4J A;  9ATC B;  1WPY A;  4VUB A;  2O4X A;  4BI3 A;  2XD0 A;  3MHX A;  4WTO B;  4BB7 A;  1OPK A;  2LRQ A;  3C12 A;  5A2Q E;  4Z8A A;  2GBQ A;  1H3H A;  2PVD B;  3JAM E;  1PD0 A;  5FW9 A;  5J26 A;  2JT4 A;  1QQJ A;  5KYX B;  1ZUY A;  2VXE A;  3ZL7 C;  3CPW A;  3PGG A;  1QLY A;  3JCM g;  2KK4 A;  3OS5 A;  4QQ6 A;  4PJO G;  1PNJ A;  1JXM A;  2V1R A;  1M90 R;  5IXF A;  2MIO A;  2YWW A;  3OYC A;  1VOM A;  3A98 A;  1WNL A;  2RHY A;  2RJF A;  2ZPB B;  3HHT B;  3OSV A;  4Y91 A;  4M7A G;  2K5L A;  1VQ7 Q;  1S72 A;  3CC2 T;  3UWN A;  2EQJ A;  3OSS C;  4J9B A;  3QII A;  3BY7 A;  2OJ2 A;  1ZSG A;  3TSZ A;  1N6A A;  1UEC A;  1YP5 A;  1K73 R;  3S6W A;  1VQO Q;  5GJV B;  3OA6 A;  4ZN3 A;  3QZ5 B;  4KUL A;  2O88 A;  3EG3 A;  2YT6 A;  2AKL A;  5IHK A;  1IB8 A;  2QDY B;  5LJ5 g;  2KRM A;  5LJ3 j;  2GFU A;  4EDU A;  3CCU A;  1GL5 A;  1RAD B;  2QEX T;  5LJ5 j;  1QCF A;  2DXC A;  1VQ8 A;  2ZAE A;  1GFD A;  3RMQ A;  1G83 A;  1EZZ B;  1LCK A;  2PZ1 A;  3RBB B;  3JCM c;  3OYE A;  3JB9 D;  1MND A;  3C0C A;  2ZPI B;  3L2Q A;  4X9D A;  4C92 E;  1D0Z A;  1KD1 C;  1DJ7 B;  3L2Z A;  4ESR A;  4Q5W A;  2CT3 A;  4LE9 A;  4DBR A;  5DLO A;  2RI5 A;  3OYD A;  2RQT A;  2L3Q A;  1QP2 A;  3BE3 A;  3CCE A;  4BAC A;  4BDZ A;  1YN8 A;  3RKX A;  3LW5 E;  4L59 A;  4HT9 A;  2LT1 A;  3DB4 A;  3QKJ A;  4C5I A;  5GAN f;  5J3B A;  1VQM A;  1VQ5 T;  3CPF A;  2JXB A;  3I35 A;  4YTL A;  3MEV A;  3LWI A;  2DD4 A;  3ZBD A;  5GAN 6;  5I21 A;  1TUD A;  3VRZ A;  5LJ5 f;  1JJ2 S;  3MP6 A;  1ZBJ A;  2XDB A;  1TWB A;  3CCR T;  4IUQ A;  3LX7 A;  1TH7 A;  4OGC A;  4EMG A;  3S3N A;  5LJ3 g;  3JCM W;  2LDM A;  2J6F A;  3I56 Q;  1Y71 A;  3GLX A;  5IT9 E;  4QT7 A;  2DET A;  1Y96 B;  4RKU E;  2DXU A;  1KG1 A;  1RAH B;  2D8J A;  1YNZ A;  1YIJ A;  2V26 A;  2CP5 A;  3VS3 A;  4KGX B;  1ZQ1 A;  3OYF A;  4M77 C;  4MZT A;  4J9H A;  3I9Q A;  3M53 A;  3GBQ A;  5CKF A;  4PFO A;  1MMG A;  4PJO C;  4RTX A;  3I56 A;  4OMN A;  3V8J A;  4AG2 C;  2VGN A;  2VC8 A;  2RB6 A;  4C0D C;  3HRU A;  1N9S A;  1IHV A;  4GLM A;  2DL3 A;  3X28 B;  1BI0 A;  3RES A;  1WA7 A;  3OS1 A;  1KQ1 A;  2LQN A;  1UGQ B;  3E19 A;  5LJ3 d;  2F5T X;  3ER0 A;  4M78 F;  2VKN A;  4C0G A;  3NTI A;  4D6W A;  2DL4 A;  5GJW B;  1H64 1;  3G7Z A;  5CKH A;  4AG1 C;  3G4S Q;  1MGQ A;  4WCI A;  1YJW Q;  2E1H A;  2P0K A;  1AVZ C;  1VQ6 T;  1ZA2 B;  4A4K A;  3M9Q A;  2QQS A;  1K4U S;  2EQI A;  2DXB A;  3JB9 F;  4BI8 B;  3UA7 A;  3VS7 A;  1IO6 A;  2DIQ A;  5FU7 B;  2ESW A;  4C92 A;  3TU4 K;  1LVK A;  3NPF A;  3P8B B;  2G6F X;  4M78 G;  3VS4 A;  5CQY A;  2OX7 A;  5FWC A;  4II1 A;  5AT1 B;  4JLI A;  2VUB A;  3Q1J A;  4F7U A;  2CP6 A;  2EKH A;  1M30 A;  2ZPG B;  2XKO C;  4F04 B;  1GCQ A;  4HCZ A;  3JCM e;  2LX9 A;  2WAC A;  4JDS A;  1XNI A;  2DF6 A;  5FLX E;  2GCX A;  2RF0 A;  1G2B A;  3MEU A;  3G6E Q;  4EMK C;  3KUF A;  5LJ5 e;  3PVQ A;  3CCU Q;  2LT4 A;  1YIJ Q;  4J6Y A;  4DEX A;  3D7S B;  1A0N B;  4M77 E;  1KSW A;  2DZ9 A;  1RLP C;  3VJP A;  5KCO A;  2HAX A;  1ZUK A;  2AIR B;  1WHH A;  2K5I A;  2MMP A;  1BB9 A;  2YRC A;  2KYB A;  3UT1 A;  2RQR A;  4RG8 A;  2RN8 A;  1VQP T;  4M7A A;  4IUT A;  2E5K A;  2LNH B;  2QYZ A;  2Y90 A;  3L1A A;  1R0B G;  3A8O B;  2KXD A;  3UF4 A;  3RKY A;  1QVG S;  2RH2 A;  4JJN K;  1VQM Q;  2E41 A;  2F2V A;  1CSK A;  2AHJ B;  4A63 B;  2EW3 A;  2FYK A;  2CP3 A;  3OYK A;  1NE8 A;  3V7R A;  1YIT T;  4O5V A;  2MI6 A;  1UJ0 A;  2L5Q A;  1W70 A;  1B3Q A;  1V29 B;  4KRT A;  2CKK A;  3CCS T;  4OB0 B;  4R0K A;  5D7U A;  1X2K A;  2O9S A;  1H92 A;  4TVR A;  1VQN Q;  2L0A A;  4M7D F;  4NL3 A;  2OAW A;  1FWZ A;  3QDF A;  1X43 A;  2EIF A;  2GTJ A;  5GAO p;  1M3A A;  1Q7Y C;  2HBP A;  1JO8 A;  1JJ2 P;  2BIV A;  4IUV A;  1C0M A;  3T9N A;  2IVW A;  2X3X D;  4F7U F;  4DOV A;  2HSE B;  4OMM A; 
#chains in the Genus database with same CATH homology
 3JCM V;  2GF7 A;  3N5B B;  4JS5 A;  2WSF E;  4OVA A;  4N4H A;  4PJO E;  1M4Z A;  2I2L A;  4PKC C;  4R56 A;  3P8D A;  3OYJ A;  5CKE A;  3URG A;  1NPR A;  4XTW A;  3GOX A;  1FXX A;  2MF2 A;  3EFR A;  3LGF A;  3HL8 A;  3PT9 A;  3J81 E;  2PVO B;  1KC8 C;  2X4Y A;  5CO7 A;  3GPL A;  2RI2 A;  3S3O A;  1G3Y A;  4WF2 A;  4OF1 A;  3CMA A;  2ZZD A;  4LDW A;  4QVD A;  3CD6 T;  4RCC A;  3M4Y A;  5FRO A;  4M7A C;  3VUZ A;  2WSC E;  4OB3 B;  2OTJ A;  4M7D C;  1R8O B;  2PUO B;  4PL6 A;  5LJ3 f;  1PSE A;  4XTY A;  1XTD A;  3EAE A;  3CCV T;  3OYA A;  4C0D B;  2R5A A;  1HK9 A;  3JCM f;  3CCM A;  4PJO A;  5HK0 A;  2CGH A;  2R57 A;  1QVF S;  1VQO T;  1Y96 A;  1LOJ A;  4BUG A;  1YJN T;  3OB9 A;  3X24 B;  2JTM A;  2DTO A;  5GMK l;  2K4Y A;  2XG8 D;  2KY9 A;  1YJW A;  2CS7 A;  3LLR A;  4J7F A;  2DZC A;  3LH0 A;  5GAN h;  4MMK A;  2LCL A;  1WQ7 A;  3GNG A;  3MEA A;  3OYI A;  1QVF A;  3JB9 J;  1VQM T;  3JB9 G;  1VQ7 T;  4MZM A;  2K5F A;  1QP3 A;  5GAO l;  4IUR A;  1YHQ T;  1YI2 A;  3M55 A;  4A4F A;  1UGS B;  5AYF A;  3PMI A;  4CI0 C;  2XID A;  1O9S A;  1Q81 U;  2ZPF B;  3SWN C;  3HRT A;  3QYG B;  4M75 D;  2QTX A;  5CVI A;  2EFI A;  4A4E A;  4BI4 A;  3OYG A;  3MP8 A;  2Y4Y A;  3FDR A;  4ZGE B;  2ZPH B;  5LJ5 d;  1XOV A;  2DD5 A;  4M78 C;  3JB9 I;  1VQN A;  5GMK m;  2RJC A;  3OYL A;  1BIA A;  2EWN A;  3JSC A;  3NTK A;  4LDV A;  2RJD A;  4M77 A;  5CKB A;  2LVM A;  3G71 T;  2XDP A;  2WSE E;  1IZ6 A;  2HNI A;  2RI3 A;  4E7J A;  2JN0 A;  3V8L A;  1U1S A;  3FIF A;  4N4I A;  4R55 A;  2VV5 A;  3OS2 A;  5FRN A;  4M78 D;  1Y07 A;  1U1T A;  3LGL A;  4RCB A;  2FVU A;  1VIF A;  2LQK A;  3C4S A;  3KBG A;  4C92 D;  4J83 A;  2PU9 B;  4JLG A;  2X4J A;  3VYG A;  3L2R A;  1U8R A;  1S72 T;  4E47 A;  3SDZ A;  2CZ1 B;  3OYN A;  3GP8 A;  1Q86 C;  1WPY A;  3MET A;  3CME A;  1UGR B;  1K73 U;  2JVV A;  4VUB A;  2EQK A;  3GIB A;  1M1K U;  5HY6 A;  2O4X A;  4FL6 A;  4XQ3 A;  1BI2 A;  1AHJ B;  3QHS A;  3MHX A;  4J8O A;  4BI3 A;  4F7U G;  2XD0 A;  3FJP A;  1OYX A;  3PMT A;  3VKI A;  1G5V A;  5GAM h;  2RHX A;  4BB7 A;  2LRQ A;  3C12 A;  5A2Q E;  3RER A;  1D3B B;  2KAF A;  5D6X A;  2R58 A;  2PVD B;  2RK1 A;  4M77 B;  3JAM E;  1I4K 1;  2GFA A;  3KXT A;  1I8F A;  2DO3 A;  5J26 A;  2JNG A;  3TCJ A;  1YIJ T;  1KQS S;  1JBM A;  5GAM d;  2VXE A;  2EYQ A;  2A3L A;  3CPW A;  3PGG A;  4E7I A;  3JCM g;  2KK4 A;  4X9C A;  3OS5 A;  1VQ7 A;  2KVQ G;  4QQ6 A;  1G3S A;  4PJO G;  1YI2 T;  5KCH A;  3I56 T;  3SWN A;  2DTI A;  4J7I A;  3ME9 A;  3CCJ A;  3R6O A;  3QJ6 A;  3OYC A;  2X35 A;  4CRI A;  4ELZ C;  1WNL A;  2RHY A;  2RJF A;  2ZPB B;  3HHT B;  5FU7 C;  3OSV A;  5KE2 A;  3A5Z B;  5IAY A;  4IUU A;  2O01 E;  3OBW A;  1G3T A;  4Y91 A;  3G71 A;  3CEY A;  3I55 A;  3M58 A;  4BDY A;  1YIT A;  5C0M A;  3HSB A;  3DKM A;  2OTL A;  3OYM A;  4M7A G;  4LDU A;  1M5Q 1;  2PUK B;  2RA2 A;  5GAN j;  3QSU A;  2K5L A;  4M77 F;  3CC4 T;  1N9R A;  1S72 A;  3CC2 T;  2E5Q A;  2VYT A;  3CCS A;  4M7D D;  2JTF A;  3UWN A;  1K8A U;  2EQJ A;  2L3R A;  2QQA A;  3OSS C;  4M75 F;  5CKD A;  5DM7 R;  2DPP B;  3CME T;  3QO3 A;  3QII A;  3OYH A;  4XAX B;  3BY7 A;  4EMK A;  4JRP A;  3QPH A;  1N6A A;  3BDU A;  4LD6 A;  4MZP A;  4C5H A;  4C8Q D;  3S6W A;  3S3M A;  3C95 A;  2VGM A;  2Y4X A;  3QJY A;  1B34 B;  3X26 B;  3VUB A;  5LJ3 e;  2KSS A;  5GMK j;  3OA6 A;  1XQH A;  2QI2 A;  3RKW A;  2RO0 A;  5GAN g;  4FT2 A;  3PFS A;  4ZN3 A;  4B9X A;  5GAM g;  3QZ5 B;  5LJ5 h;  2M1H A;  3O8V A;  4KUL A;  4J6W A;  1VQ6 A;  2HQX A;  1JB0 E;  3E1S A;  4ZTJ A;  2QDY B;  5FU6 B;  5LJ5 g;  2XI9 A;  5M9O A;  5LJ3 j;  4M78 B;  2GFU A;  4ATO A;  2C06 A;  4EDU A;  3HFO A;  3CCU A;  2HD0 A;  1K8A C;  2QEX T;  5LJ5 j;  3H8Z A;  2DXC A;  4M77 G;  5DY9 A;  1VQ8 A;  4XTX A;  1KQ2 A;  2QA4 T;  1YCY A;  1I81 A;  1W2B S;  4XTV A;  4NS5 A;  2K3X A;  2NLU A;  2E64 A;  3RMQ A;  5GMK h;  4X34 A;  4IKF A;  3WXM B;  4OMF B;  2JZ2 A;  1ZHI A;  2OTL T;  3JCM c;  3MO8 A;  3OYE A;  1N8R U;  2YLB A;  3JB9 D;  2QQ9 A;  4QVC A;  4PJO B;  2ZPI B;  4M7A F;  1OZ2 A;  3L2Q A;  4B9W A;  4X9D A;  4C92 E;  4J5Y A;  4M78 A;  3DLL A;  4HCB A;  4C5E A;  1UGP B;  4KT0 E;  3CC2 A;  4MDX A;  1KD1 C;  1DJ7 B;  3L2Z A;  4Q5W A;  2V8K A;  3FEO A;  5DLO A;  5L8R E;  5LJ3 h;  2RI5 A;  3OYD A;  2EJF A;  4N0A A;  1WGS A;  3JCM h;  4E7L A;  1QP2 A;  2H3J A;  3CCE A;  1WJS A;  4BAC A;  4BDZ A;  3CC7 A;  1X01 A;  3RKX A;  3GNF B;  1JRI A;  3LW5 E;  3HRS A;  3OMC A;  1W2B A;  4L59 A;  4HT9 A;  1KQS A;  2LT1 A;  3DB4 A;  2V8I A;  3CBM A;  3QKJ A;  4C5I A;  2QXF A;  3TRE A;  3JCM b;  5GAN f;  5J3B A;  2VXF A;  1VQM A;  1M1K C;  1VQ5 T;  2E12 A;  3CPF A;  4YTL A;  3INZ A;  2CZ0 B;  3MEV A;  3LWI A;  2RHZ A;  3FB9 A;  4HKE A;  3CCU T;  4BY6 B;  1JJ2 A;  2KQW A;  1RI0 A;  2DD4 A;  3NTH A;  3ZBD A;  2QEX A;  5GAN 6;  2XK0 A;  5GAN 5;  5I21 A;  3QBY A;  2BKD N;  4N4G A;  2EKO A;  5CQX A;  5LJ5 f;  1JJ2 S;  2IG0 A;  3CXC A;  4DA4 A;  1Q86 U;  3VYH B;  3MP6 A;  4GLK A;  3G4S T;  5GAM j;  1IRE B;  3G6E T;  4P5N A;  2MWO A;  4A4H A;  2P4T A;  3QZ9 B;  2XDB A;  3X20 B;  3M5A A;  2XU8 A;  3MEW A;  3CCR T;  4IUQ A;  2PVG B;  4M7D B;  3QUI A;  3LX7 A;  5DLQ E;  1TH7 A;  4OGC A;  4EMG A;  1VQ9 T;  1RL2 A;  3S3N A;  2LNV A;  5LJ3 g;  1O75 A;  2CZ7 B;  4ZGJ B;  1VQP A;  3JCM W;  2LDM A;  5CIU A;  3RIR A;  5CCA A;  2FL7 A;  5A0L A;  1Y71 A;  3GLX A;  5FU6 C;  5IT9 E;  4HCC A;  3OYY A;  1Q81 C;  4OB2 B;  5J39 A;  5GAM f;  1Y96 B;  5KH6 A;  4RKU E;  2DXU A;  5A0D A;  2K57 A;  2E65 A;  1KG1 A;  5D6W A;  2D9T A;  3CC7 T;  1EIF A;  1YIJ A;  3J7A F;  2D6F A;  4PJO D;  4KUI A;  3JCM d;  3QXE B;  1ZQ1 A;  3A8G B;  3OYF A;  4M77 C;  3P8H A;  2P0P A;  2QQB A;  4MZT A;  3M53 A;  3DLM A;  3HKS A;  5CKF A;  1YJ9 T;  2FHD A;  4PJO C;  1ZBX A;  2LQ8 A;  4C8Q G;  5GMK e;  1UB4 A;  3I56 A;  4C8Q B;  3MCA B;  1HXD A;  3ZFJ A;  3V8J A;  1LNX A;  4M77 D;  1VQ4 T;  4FM4 B;  2DEQ A;  2VGN A;  2VC8 A;  2RB6 A;  2M0O A;  2RK2 A;  4XK8 E;  4C0D C;  3HRU A;  4LDX A;  2ZPE B;  3M57 A;  2E6Z A;  1N9S A;  4OGE A;  4JUV A;  4ELY C;  1FX7 A;  4EMK B;  3G4S A;  1YBY A;  3G6E A;  4L6V 5;  3X28 B;  1BI0 A;  2DK3 A;  4V2S A;  4M75 E;  3SFM A;  3RES A;  1SSF A;  5GAN e;  3OS1 A;  1KQ1 A;  2DIG A;  1W4S A;  3E9F A;  3E9G A;  3E19 A;  1UGQ B;  1X6O A;  3ER0 A;  2F5T X;  2EAY A;  2R5M A;  4M78 F;  4N0A C;  5LJ3 d;  3OS0 A;  3A8H B;  4C0G A;  3NTI A;  4D6W A;  3L2V A;  3JCM Q;  3RUX A;  4ZGD B;  1H64 1;  3C94 A;  3G7Z A;  5CKH A;  2XHC A;  5KE3 A;  2L8D A;  2P0Q A;  3BW1 A;  3J80 E;  4RMO A;  4XU3 A;  2GQV A;  1LJO A;  1MGQ A;  2RHU A;  5CR2 A;  3OQ5 A;  4M7D A;  4M75 G;  2FB7 A;  2HQE A;  1VQL T;  4M75 A;  4DQ2 A;  2E1H A;  4M7D G;  2P0K A;  4EMH A;  1I5L A;  4C8Q C;  2RM4 A;  3EFS A;  3A8M B;  4QQD A;  1VQ6 T;  3VV0 A;  1Q7Y U;  4XU1 A;  2KMT A;  3A8L B;  4A4K A;  3M9Q A;  2M16 A;  3V7S A;  3PTA A;  1YJ9 A;  2QQS A;  4PNO A;  2DXB A;  4BE1 A;  2E10 A;  5GAN 7;  3JB9 F;  3UDC A;  4BI8 B;  4C92 F;  1VQ4 A;  4XU2 A;  2QA4 A;  3QG1 A;  2ZCF B;  4QVZ A;  1KHC A;  2DIQ A;  3SB2 A;  4C5G A;  4ZTF A;  3QYH B;  5FU7 B;  2PQW A;  4XU0 A;  5GAO m;  3CMA T;  2YRV A;  1BYM A;  2B8A A;  1NJI C;  3CD6 A;  4HA8 A;  4F7U E;  1G3W A;  1X75 C;  2BUD A;  2EJG A;  3GF5 A;  4C92 A;  4J6X A;  5A0G A;  3TU4 K;  3OW2 A;  3P8B B;  1KD1 U;  2OTJ T;  2DJZ A;  4M78 G;  2EJ9 A;  5CK9 A;  3OMG A;  5CQY A;  1KC8 U;  3CCV A;  3AHU A;  1PSF A;  3F70 A;  1M90 U;  4E7K A;  1OI1 A;  3CCM T;  4II1 A;  2LC4 A;  4JLI A;  1VQO A;  1N8R C;  1YJN A;  1UEB A;  3PIO A;  2VUB A;  5GAM e;  5I2S A;  3Q1J A;  4F7U A;  2MWP A;  4Y28 E;  4FSX A;  2M9U A;  4O6J A;  3MP1 A;  2ZPG B;  4M7D E;  2XKO C;  4C8Q F;  4JRI A;  3CCE T;  3JCM e;  4HCZ A;  4BE2 A;  1N27 A;  1VQL A;  4M7A E;  2LX9 A;  5GMK i;  2LCC A;  1OZ3 A;  2WAC A;  4C92 B;  4JDS A;  1XNI A;  5FLX E;  2CYZ B;  4BY6 C;  2GCX A;  4C92 G;  3MEU A;  1QW1 A;  4UC4 A;  2E6N A;  2OAU A;  4JRK A;  3WVD B;  4FIB A;  4A54 A;  4EMK C;  3L2W A;  3KUF A;  1NJI U;  1VQ5 A;  3SD4 A;  3DB3 A;  5IN1 A;  2RHI A;  3V7C A;  5LJ5 e;  1NZ9 A;  1Q82 U;  1VQN T;  5CAI A;  1MHN A;  2LT4 A;  3M4G A;  4M7A B;  2A7Y A;  3M56 A;  1M1F A;  2RJE A;  4J6Y A;  3CXC S;  1BIB A;  1M1G A;  4XTU A;  4QQG A;  2XDD A;  4M77 E;  2DKG A;  4GY5 A;  3H6Z A;  1BI1 A;  2DZ9 A;  1VQK A;  2CZ6 B;  2EQU A;  3LWH A;  5GAN 3;  3VJP A;  5KCO A;  1VUB A;  3V8K A;  3JRZ A;  4JRQ A;  1K73 C;  2HAX A;  4MDW A;  1WQW A;  2K5I A;  2DXT A;  2MMP A;  2DTH A;  3WVE B;  3JCM X;  3CPW S;  3CCR A;  4MML A;  3UT1 A;  3FRN A;  4RG8 A;  5HKC A;  1VQ9 A;  4KUD K;  5FRM A;  1QVP A;  4ME7 A;  1VQP T;  1WJQ A;  2EQM A;  4IUP A;  3FC3 A;  4PJO F;  4M7A A;  3CCQ T;  3CCL A;  1B34 A;  4IUT A;  5GAO n;  5GAN 8;  3PIP A;  4Z02 A;  2L89 A;  2DAQ A;  2X4X A;  4ZN1 A;  5I2M A;  3OY9 A;  1NPP A;  3CC4 A;  2F69 A;  2Y90 A;  4XTZ A;  3L1A A;  3HFN A;  1H3Z A;  4OB1 B;  3A8O B;  3FLG A;  5EG2 A;  3OBY A;  3HP9 A;  3RKY A;  1QVG S;  2RH2 A;  3BFM A;  1D3B A;  4BE0 A;  4C0F A;  1GXI E;  4JJN K;  5GAN d;  3CCJ T;  1WJR A;  2LTO A;  3VU3 C;  3HPW A;  3X25 B;  3JB9 H;  2E41 A;  2JUF A;  2AHJ B;  4NOY A;  4C0Z A;  1VIE A;  1QVG A;  3ASK A;  3UPU A;  1BKB A;  2FYK A;  3OYB A;  4KBM B;  1M90 C;  3L2U A;  4RG2 A;  2F5K A;  5LL6 S;  4NL2 A;  3OYK A;  1NE8 A;  3V7R A;  5C6S A;  4M78 E;  3I55 T;  4O5V A;  3M59 A;  1YIT T;  2QQR A;  2MI6 A;  4C8Q A;  3SWN B;  2V8J A;  2L5Q A;  3BDL A;  1BI3 A;  1VQK T;  1V29 B;  3CCS T;  2CKK A;  4OB0 B;  4C8Q E;  2E70 A;  2JOY A;  5D6Y A;  2XIC A;  4HT8 A;  2K2V A;  4F7U B;  2D0Q B;  4LD9 K;  3CBP A;  4A4G A;  2RD1 A;  3OW2 S;  4TVR A;  1KHI A;  2DVE A;  2X4W A;  4PLL A;  4M75 B;  5GAN 2;  3QDR B;  4NL3 A;  4M7D F;  4FU6 A;  4A53 A;  5HK3 A;  3CCL T;  1FWZ A;  3CCQ A;  4LDY A;  1P92 A;  3L42 A;  4BD3 A;  2EIF A;  5GAO p;  3TEE A;  4OP0 A;  4C92 C;  2YHT A;  1YJW T;  3RMS A;  2O4X B;  5GAN 4;  2K3Y A;  3JCM P;  1Q7Y C;  4JS4 A;  3NFC A;  4EPC A;  1K9M U;  2HBP A;  2MAM A;  2ZGW A;  1M9S A;  3PNW C;  2YLC A;  4M75 C;  3ZEH A;  5GAO r;  1M8V A;  4E7H A;  3CBO A;  3M54 A;  1YHQ A;  3LYI A;  2BIV A;  4M7A D;  2G3R A;  4IUV A;  1Q82 C;  4L5G A;  1Y7X A;  3T9N A;  4DOW A;  5GAO q;  2IVW A;  4QW2 A;  4F7U F;  1K9M C;  4DOV A;  1VQ8 T;  4FT4 A;  4PLI A;  3JCM J;  2KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...