1KQ1A

1.55 a crystal structure of the pleiotropic translational regulator, hfq
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Host Factor for Q beta
publication title Structures of the pleiotropic translational regulator Hfq and an Hfq-RNA complex: a bacterial Sm-like protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 15
structure length 60
sequence length 60
chains with identical sequence B, H, I, K, M, N, R, S, T, W, Y
ec nomenclature
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kq1A00
3SWNA 4M7AC 4RCBA 1X01A 1N9SA 5GMKl 2EWNA 2DEQA 1D3BB 4N0AA 4X9CA 4M7AB 1WNLA 3V8LA 4F7UA 5GANh 5LJ5j 4Y91A 5GANd 3JB9I 3M4GA 3JCMP 2ZGWA 4M77G 1KQ2A 1D3BA 5GAMg 4M7AA 1LNXA 4XTWA 5GAN4 3JB9G 2E65A 4M78A 4F7UF 1I4K1 5GMKj 4JRKA 4A53A 3JCMJ 4XU1A 1M5Q1 2YLBA 4XU2A 5DY9A 4M7AF 4MMLA 4F7UE 5GAN7 4M78F 3RESA 1B34B 1U1SA 2CGHA 3QO3A 4PJOE 3V7RA 5GAN5 4M7AE 2QTXA 4N0AC 4M75G 5GAOn 1B34A 3V8KA 5LJ3e 4M78E 4EMGA 2DZ9A 5GANg 3JB9J 4C8QA 2DTOA 4PJOC 2VXFA 4XTZA 3JCMd 2E1HA 2EJGA 3JCMh 5CAIA 4PJOB 3BW1A 4M78C 4X9DA 3RKXA 2DVEA 4C92E 5LJ5d 4M7AD 3RKWA 5LJ5h 4NOYA 3JB9H 2E10A 4M78B 4M78D 4C8QF 2EJ9A 4QVCA 2DXTA 2I2LA 4QVDA 3JCMX 2DKGA 5GAOl 2RM4A 4C92C 3JCMb 2E41A 5GAMf 1MGQA 5GMKh 4XTVA 2EAYA 3QHSA 2JN0A 4XTYA 4C92B 1HK9A 4C8QE 5LJ3j 5GAN2 1M8VA 4XU0A 4PJOF 5LJ3f 4M7DG 4C92A 3QSUA 5GMKi 3JB9F 2RB6A 2YHTA 4C8QC 5GMKm 5GAMe 3JCMQ 2FYKA 1U1TA 4M77E 1Y96A 4RCCA 4XTXA 4JUVA 4C8QB 3JCMg 4C8QD 1BIBA 4C92F 1I81A 4PJOA 5LJ5g 4M77C 4HT9A 5GANf 1TH7A 5GAOq 3V7SA 4M77B 4WF2A 4XU3A 4PJOD 3V8JA 4M77A 3JB9D 4OP0A 2RA2A 5GAMj 4JLIA 3RIRA 5GANe 4C8QG 2DTHA 1WQWA 4EMKA 3AHUA 2HNIA 3L1AA 4M75E 1YCYA 5GAN6 4HA8A 3QUIA 4J5YA 4XQ3A 5LJ3d 3HFNA 2DTIA 5LJ3h 4M77F 2RD1A 3FB9A 4JRIA 3JCMV 4EMHA 4M7DA 4M75C 2E64A 1Y96B 1BIAA 1WPYA 5GAN3 4M75B 3BY7A 3JCMc 1KQ1A 2Y90A 1JRIA 3PGGA 1LOJA 1JBMA 3FIFA 3L2ZA 1LJOA 4M75A 4NL3A 4M7DF 4F7UG 4J6YA 3JCMf 4PNOA 5GAOm 1WQ7A 5GANj 2VXEA 5GAOr 4A54A 4DQ2A 2FB7A 4PJOG 5LJ5f 4M7AG 3SB2A 2EJFA 4M77D 1N9RA 2K57A 4MMKA 4EMKC 4HT8A 4M7DE 3V7CA 4M75F 3RKYA 4M78G 4J6WA 4EMKB 3EFSA 3GIBA 2YLCA 4C92D 3JCMe 5LJ3g 5GAMd 3HSBA 1HXDA 3VU3C 5GAMh 3EFRA 4M7DC 5LJ5e 4C92G 3FJPA 3HFOA 3RERA 2DJZA 3JCMW 5GAN8 4M7DD 4M7DB 3BDUA 4V2SA 2DZCA 4XTUA 1I8FA 3SWNC 1I5LA 2VC8A 5GMKe 3RUXA 5GAOp 1H641 4J6XA 3SWNB 2DXUA 3INZA 4M75D 4F7UB 3BFMA 4NL2A 5I21A
chains in the Genus database with same CATH superfamily
1NZ9A 2K5IA 4F7UA 2DEQA 1U06A 3NTHA 4F16A 3CC4Q 4BACA 2JT4A 4DEYA 5J39A 5DY9A 4IUUA 4E7ZA 1M2VB 2BZXA 4GLMA 1U1SA 3V7RA 4LE9A 1TU0B 4EMGA 2K4YA 1N5ZA 2KGTA 3SDZA 4A4HA 4BI4A 1QMCA 2J6FA 3VS5A 2PZ1A 4BE2A 4QVCA 3OYHA 4LNPA 2RM4A 5GAMf 1WHGA 4ME7A 1W6XA 1A0NB 3OYFA 1M4ZA 5LJ3f 2H8HA 2OTJT 3PMTA 1X2QA 3A1PA 3VRZA 1VQKA 4RTVA 2MAMA 1BCOA 3HKSA 2DK3A 5KCHA 4M77C 5IHNA 1AZGB 3CCMQ 4WF2A 4J9GA 5FU6C 4PJJA 4BDZA 3TSWA 3CCJA 2XHCA 1ZQ1A 4FCYA 2HBWA 1NJIR 3PMIA 2BIVA 1SPKA 1FWZA 4HA8A 4PJLA 1ZA2B 3FB9A 2J06A 4LUEA 4ORZA 2P0QA 3JCMc 1JQQA 4HXJA 3CCVA 2O9SA 2HL3A 5KYUB 3PIOA 5CKDA 2K57A 3X20B 5FRMA 2QDYB 3RKYA 2DXBA 2DL4A 1BBZA 4O6JA 1D1BA 5L23A 3OYMA 1Q82U 2QQRA 3M0TA 2RMOA 1ZHIA 4J6XA 2V1QA 1WHJA 1UFFA 3L2UA 3CMET 3CCSQ 1M2OA 1X01A 1QCNA 2EWNA 4ZN3A 3QIIA 2JS2A 1KQSP 3E2UA 3KBGA 1M1GA 2XK0A 2ZAEA 1Q7YR 1VQ8Q 1M27C 4XU2A 2JJ9A 4OMMA 4F7UE 4TVRA 1AD5A 1K8AR 2LRQA 1W2BS 1ARKA 3N5BB 5J26A 1Y7XA 2ZPFB 4PJOC 2V8KA 1G83A 1AOJA 2EW3A 3QKJA 3VYGA 1UGVA 2RJCA 5CKBA 1GFDA 1T0JA 2XICA 2ROTA 2JN0A 1M8MA 1TUCA 2RB6A 1OZ2A 3A8HB 5GMKm 3VUBA 1YITT 1K73U 4MZMA 3S3MA 2EYYA 2CYZB 1VQLA 1X6BA 4MDWA 3VRYA 4Z8AA 1N8RU 3M57A 3VS4A 3QZ9B 1JB0E 3OYAA 3CXCS 2QQAA 2FZGB 3L2RA 4EMKA 1RAFB 2DTIA 1PNJA 1BIAA 4FT2A 1OU8A 1V1CA 2B8AA 1UB4A 2Y90A 2ABLA 2L89A 4PNOA 1YJNQ 4C0ZA 2CDTA 3CBMA 1YHQT 1ZSGA 1XJWB 1UE9A 3GPLA 3PT9A 1K8AC 3V7CA 2XMFA 2XU8A 1Q95G 2RI3A 2YLCA 1VIFA 2DJQA 2K79A 4KGXB 3CC4A 2FRYA 1VA7A 3I55T 1SSHA 1OX8A 4CC7A 2ED0A 5GAOp 1H641 1BI2A 4KH1B 3QDFA 4F04B 5I21A 1IRXA 6AT1B 2NUPA 3OS1A 4E7HA 3V8LA 3MEAA 1OQKA 3M56A 1RABB 4JRPA 1FXXA 4KUDK 1VQ4T 1VIEA 4M78A 1XTDA 2CUDA 4PL6A 4F7UF 2J6KA 2DL3A 1QLYA 2ESWA 2NLUA 2DRKA 3CCLT 5AYFA 2AKKA 4OMOA 4JJDA 2JNGA 3ASKA 5GAN5 1CKAA 1VQPT 2JVVA 5I22A 1ACMB 1E6GA 3OBYA 4OB3B 3EG9A 4BE1A 4J9BA 3CCMA 5GAOl 3QWXX 1F1BB 3NPFA 2ZPBB 3G71Q 1Y07A 1VQ9Q 1M3AA 1M1FA 4QQGA 1UEBA 1VQ7T 1UGQB 3PVLA 5A0GA 2XI9A 1IGQA 4E6RA 1TH7A 1HSQA 1YJ9Q 2HAXA 1I5OB 4N4GA 1YWOA 2E64A 1WJSA 1VQOT 3OY9A 2QEXT 2A36A 3QYGB 1JJ2A 1K73R 3CCSA 2MYSA 2KDSA 3UATA 1Q82C 3RMQA 3MEVA 1N8RR 1IHWA 3FJPA 5KH6A 3BDUA 1X27A 1SEMA 4E7SA 4JS5A 1B7TA 5I2MA 3TVTA 2R57A 1VQMT 1VQNT 1IGUA 1RADB 4E2FB 1PCXA 3OYBA 3CCUT 4M77G 3NHNA 2MOXA 5GAMg 1RL2A 3CCRT 1R77A 3CCET 4X1VA 2BTTA 1X75C 1D0YA 2A7YA 5FWCA 5GAN7 3QO3A 1OV3A 3OW2S 1M2VA 4A4KA 2FZCB 2OTJQ 2FPDA 5IHKA 3QZ5B 4M78E 2LZ6B 1YIJT 3H41A 4E47A 5CAIA 1UHFA 3GF5A 4X9DA 4C92E 3VYHB 2D8JA 1M3CA 4AFZC 3VS3A 2LX9A 5CKHA 4DA4A 2SRCA 2EQUA 4IUVA 1K73C 2E6ZA 3QSUA 3CD6A 2DL7A 2E3HA 1G3YA 1Y57A 3CC2T 4C0FA 1RI0A 2AKLA 1N8RC 2QXFA 2PUKB 2FVUA 1AVZC 3FEOA 2A37A 1ZUUA 5GAOq 4IUTA 1OX9A 3E19A 1YJNA 3V8JA 2RI5A 4OP0A 2EVRA 1K9MR 1WHLA 1VYTA 3P8HA 1WLPB 2F2WA 3C94A 2DEUA 4C92D 3HSBA 2E70A 2RD1A 1WYXA 2NYSA 3R6NA 4M75C 2DM1A 4HCKA 1LOJA 3ZFJA 4C0DB 3HL8A 1M30A 2CKKA 4DBFA 4PJOG 1WFWA 2AHJB 3A8OB 1H92A 3MKDA 2EIFA 5KYUA 1Y0MA 2J6OA 4EMKB 2QYZA 5IXBA 3LGFA 1JJ2P 2LT4A 3RDVA 2DIGA 3NTKA 1GL5A 1LCKA 3OBWA 2LJ0A 2DZCA 1WXBA 1GCQA 2PUOB 2M16A 3KUFA 1S72T 3OB9A 3M5AA 4N0AA 4X9CA 3DLLA 3JB9I 2W0ZA 3GNGA 3LH0A 4XTWA 4M4ZA 1M3BA 3CCQT 3QJYA 1KFZA 3OYCA 4CC4B 4FU6A 3LW5E 2YLBA 4CI0C 4M78F 5CKEA 5CVIA 3G71A 1VQ9A 3DKMA 1B34B 2DAQA 1K9MC 3CCVQ 3CBOA 2VXFA 1FMKA 4HCCA 1H3HA 3D7SB 2DVEA 2X3WD 4M78B 2DXTA 1C0MA 3M0PA 1MGQA 1TUDA 1QP2A 2KT1A 4C92B 2M9UA 4R0KA 2LQ8A 4C8QC 5DLOA 4DBQA 1CKBA 2DLPA 4BI8B 2MI6A 4N4HA 1JO8A 5KE2A 1NJIU 1VYUA 3OYIA 1PG5B 2DD4A 2WSEE 3PTAA 2ZCFB 3HRUA 4Y92A 4JLIA 3HPWA 3THKA 5CR2A 3VS1A 3UA6A 1YI2T 1HJDA 3EAEA 1QWEA 3MP8A 4OB2B 5L8RE 1MMAA 2M1HA 1X6OA 2BKDN 3I55Q 2J7IA 1JRIA 4OMQA 1VOMA 2ZPIB 5GANj 4ELZC 4XK8E 1U3OA 2P0PA 2FHDA 2RQRA 1UHCA 3CC7T 1HYOA 2HDAA 3S3NA 4J6WA 2OTLT 2X51A 5HKCA 4C5HA 5CQXA 2KSSA 2DERA 2DJZA 4Z89A 1M90U 2D9TA 1I8FA 2B86A 4E7KA 2F2XA 2M02A 2VC8A 3VS6A 4HCBA 2AK5A 1PSFA 3E9GA 3VS7A 2OTJA 1VQPQ 5GMKl 1VQLQ 1KC8R 1EFNA 2JXBA 1B07A 2D0NA 1Q7YU 2KI7A 2H3JA 1LNXA 1BK2A 5GAN4 1AWOA 1N27A 2W10A 4JRKA 1RACB 4QT7A 2XDDA 3MP6A 2CSQA 1P92A 4GBQA 2RF0A 3VS2A 2DVJA 4ZGDB 1I0CA 3S6WA 5GAOn 3JSCA 4KT0E 1U5SA 4LDYA 4R55A 3NGPA 4M7AD 2JMCA 3JB9H 4F17A 2MCNA 3OS5A 3M53A 2O31A 1OZ3A 5LJ3j 4RMOA 1GXIE 1BCMA 4LDXA 5D6XA 4DBHA 4RTXA 2RK1A 4C8QD 1I81A 4E7JA 3CMEA 1B3QA 1DJ7B 4QW2A 1TOVA 2MMPA 5GANe 3LLRA 5HK3A 2LDMA 1I5LA 2KY9A 2V8JA 5I2SA 2YRCA 2HL5C 2OI3A 3I56T 3M9QA 3X26B 3DLMA 1UGRB 1JBMA 4J6YA 3CPWA 1WQ7A 3VKIA 4A54A 3GLXA 4C5IA 3OYYA 2X4JA 1XQHA 3CCUQ 3GIBA 3OYNA 2LQKA 4PKCC 3JCMe 4J7FA 3P8BB 4QKUA 3VU3C 3C4SA 4M7DC 2WACA 2IPOB 2RK2A 4MDXA 2AT1B 4FW1A 2FG0A 2R58A 2E5KA 5A0LA 3SWNB 2DYBA 2R5AA 2QGFB 4AFQC 4E7IA 2RHUA 4M7AB 1YITA 1BKBA 4YTLA 2QG9B 3CMAQ 1PSEA 2HEQA 4DOWA 4J9EA 3JAME 1NG2A 2YUNA 4FYYB 1GCPA 1ZBJA 2KRMA 2LQNA 2OX7A 4M75G 2AZSA 5LJ3e 2L8DA 1M90R 5IHIA 2EFIA 1NLPC 1YN8A 4B9WA 2MF2A 1WJRA 1TTHB 3OYJA 3I35A 1QCOA 2EKOA 4L59A 3LX7A 3WXMB 1VQ5Q 1XNIA 2KNBB 3NTIA 5KYXA 2ZPGB 3QPHA 2BUDA 4M77E 2PVOB 4A4GA 1NJIC 3TU4K 2P4RA 5FRNA 4HT9A 3I55A 4KBMB 3RNJA 4FT4A 5CCAA 1ZBXA 2CT4A 7AT1B 1VQKT 3G1JA 3EFOB 4K11A 3MJXA 2RPNA 4AFUC 2DMOA 5GAN6 1WJQA 2HQHA 2E6NA 2AIRB 2Y4XA 1CSKA 3URGA 5CQYA 1OYXA 2XG8D 3CCLA 2E3IA 2L3RA 2VXEA 1S72Q 3MP1A 1VQPA 2DFUA 4M7AG 4M77D 4KULA 2JM9A 2LC4A 3CPWP 3KXTA 1M90C 2K5FA 1QKXA 2D1XA 1SKUB 3RERA 3JCMW 4M7DD 3CD6Q 3LYIA 1K1ZA 1SG5A 4IUPA 5KYNA 2NUTA 4BI3A 4JZ3A 4C8QG 2QASA 1Q7YC 1VQ7A 1XOVA 2DO3A 2FPFA 1D3BB 5GANd 3IQLA 2K3YA 4OB1B 5LJ5j 2D8HA 3M4GA 4FW2A 3JCMP 2BE9B 4HVUA 2JTEA 2KK4A 1YJWT 2K3BA 3OS2A 2V8IA 2MK5A 3CXCA 3HRTA 2QA4Q 2RQUA 4C5GA 4PJOE 2QTXA 1B34A 1HD3A 3RMSA 2RN8A 4B9XA 2HCKA 4XTZA 1JU5C 3JCMd 2RQVA 3RKXA 1GBQA 3RKWA 1TXQA 3LWIA 1YP5A 5CIUA 1BB9A 3EHQA 4FYXB 2DKGA 2QEXA 2ATCB 2CSIA 1ZLMA 2LJ3A 5DLQE 1MNDA 4XU0A 2PVGB 4C92A 3EGXA 2KVQG 2RHZA 3Q1JA 1YI2Q 2YUOA 5D6YA 3M0UA 1Y96A 1JXOA 3M0QA 1BYMA 1K9MU 3EGDB 1UUEA 2M51A 3V7SA 2QI2A 4M77B 4CC2A 1VQMA 2JOYA 4PJOD 4L5GA 4J7IA 2EQIA 1WIEA 1VQNA 5FU6B 2RA2A 2CT3A 3RIRA 3CC7Q 4BY6C 1K9AA 3CCUA 2OTLQ 4ZTJA 3FDRA 5LJ3d 3JCMV 1MMDA 1AT1B 3CCRA 3CCEA 2GFUA 4KGVB 2QTVA 3L2WA 1KQ1A 2O4XB 3FIFA 1K0XA 1O9SA 2DETA 2XKOC 2OJ2A 3G4ST 1PWTA 4DQ2A 1D1CA 1G8XA 3H0HA 3H0FA 3CMAA 4ZN1A 5LJ5e 1T0HA 1MV3A 2LMJA 2KROA 4BB7A 2IVWA 1MV0B 4Y91A 4BE0A 4OVAA 1NYFA 3A8GB 5GMKj 4OGEA 3JCMJ 4DEXA 1M5Q1 1SSFA 3UDCA 4MMLA 2DE0X 1VQ5A 4C0GA 2JMAA 3U23A 2HSPA 4PJOB 2KRNA 3O8VA 5IAYA 2LP5A 3PIPA 2CP7A 2X4YA 3JCMX 2F5KA 1K0SA 2A28A 4JRQA 1HK9A 1SRMA 5GAN2 1BI1A 4FL6A 2LCSA 4M7DG 3T9NA 5GMKi 1BI3A 3SEMA 3I56Q 2RHIA 2O88A 2SEMA 1KJWA 2C0IA 2X4WA 2VV5A 3PE0A 1S72A 3FRNA 2HKQB 4PFPA 1RUWA 3F70A 4NS5A 4RTYA 2LNVA 1WQWA 3L1AA 5KYXB 1VQ6T 1UDLA 3CCQA 5GAN3 1QVGA 4GY5A 1I1JA 4FYWB 1PRMC 1IXDA 4NL3A 1OU9A 3OW2A 1K4US 2KYMA 2K2MA 3SB2A 1ZSZC 2RHYA 1V76A 1KHCA 1NLOC 1PD1A 4IIOA 2YT6A 3EFRA 4KGZB 2YRVA 2K2VA 4J9HA 4KUIA 2WSFE 3TQ7P 3A8MB 4CRIA 5D7UA 5GMKe 4JJNK 1KC8U 2QA4A 3SWNA 4RCBA 1N9SA 2DIQA 3ZEHA 2RQTA 3VS0A 1U8RA 3CMEQ 3MCAB 2CZ1B 2ZGWA 4RTUA 4M7AA 2C06A 2KBTA 2JUFA 1VQ8T 4O5VA 2E65A 1SF9A 2ZPHB 4Z02A 4A63B 4XU1A 2K6DA 4RTTA 2JM8A 3C12A 9ATCB 2EQMA 2NUTB 4ANJA 3OMGA 5FU7C 1YI2A 4C8QA 2RJEA 1MUZA 3L42A 3GBQA 1E7OA 2PTKA 5LJ5d 4J9CA 2DPPB 2YRDA 2I2LA 3LH5A 3QJ6A 4XTVA 3QHSA 3CC7A 2OTLA 3UA7A 1VUBA 3JCMQ 3P8DA 1SRLA 4C92F 5C6SA 1YITQ 1PKTA 2VVKA 3EH2A 1R0BG 1UGPB 2CH4A 3JB9D 3M4YA 2H3EB 3CBPA 2DXCA 4M75E 2VGNA 1RI9A 3EGXB 3EFOA 3HFNA 2CP2A 4LD9K 1Y96B 3M0SA 2DL8A 3GNFB 3DB4A 1D09B 2QQ9A 2CZ7B 2DF6A 3SFMA 2KAFA 3OA6A 4JJBA 2KQWA 1QVGP 4WCIA 4GLKA 3S3OA 2FB7A 2EJFA 3META 4HVVA 3OW2P 1YHQQ 3O5ZA 3EFSA 4OGCA 2DBMA 1AZEA 1KG1A 2JS0A 3RUXA 2DXUA 2VGMA 4J83A 4M75D 4D8DA 1QCFA 1FX7A 2DILA 1Z9QA 4J8OA 5GANh 3HP9A 1R0CB 2MWPA 1D3BA 2MWOA 3L2VA 3BE3A 4D6WA 1S1NA 3JRZA 1VQ4Q 1RAAB 2BZYA 2HQEA 3RESA 3DB3A 4M7AE 1RAIB 2PNIA 4AFSC 3CCLQ 3JB9J 3JCMh 1QW1A 2XIDA 3I56A 1Q86R 4LDUA 1TWBA 2DL5A 3EH1A 3G71T 2GF7A 2E41A 4A4EA 1QP3A 2XDPA 4Z88A 1QVFA 3JV3A 4C8QE 5FW9A 3VUZA 1PM3A 4MZPA 1IHVA 1J3TA 1KQSS 4XTXA 4JUVA 1VQ7Q 2CUBA 2CH4W 1YFNA 2O9VA 1W4SA 3QWYA 4X34A 1H3ZA 1QQJA 1RAGB 5GANf 2K5LA 3FC3A 1YJ9T 4E7LA 1Y71A 2P0KA 4XU3A 1ZA1B 1QKWA 4IUQA 1NE8A 3EGDA 3G4SQ 1N6AA 5DM7R 2V1RA 4M77A 2COYA 1E6HA 3J7AF 5GAMj 1OI1A 2DTHA 3AHUA 4J5YA 5LJ3h 2G6FX 4JS4A 4M7DA 1KSWA 2GNCA 4M75B 2QK0A 2CP5A 8ATCB 3JCMf 3TSZA 2O4XA 5GAOr 1VQOQ 1FYNA 2X9HA 2QEXQ 2NUZA 1GFCA 2P4TA 1O75A 2CP6A 2F69A 2RJFA 1PHTA 1KC8C 4V2SA 1Q86C 2IG0A 3H8ZA 2E4HA 3CPWS 2HBPA 2HZYA 2DD5A 2EKHA 1MMGA 5FU7B 5KYWA 2RHXA 2VUBA 1VQMQ 2K9GA 2VASA 2L0AA 1ABOA 1VQNQ 3HHTB 2LX7A 5D6WA 1RLQC 4N4IA 3JB9G 2GTOA 2C0TA 1I4K1 3M58A 4ELYC 1H8KA 3BDLA 1WA7A 1JEGA 3CCRQ 3CCEQ 2FEIA 4M7AF 2GQIA 3REBB 1X69A 5KYYA 5C0MA 1KD1U 2AZVA 3V8KA 3ME9A 2DZ9A 1K76A 4PK4A 3G6ET 2DTOA 4BDYA 3FJ5A 3BW1A 4JJCA 2FL7A 1YIJQ 2IIMA 2E10A 2LVMA 4C8QF 2EGEA 4PJOA 5CO7A 1M1KR 4A4FA 1I07A 3MPUB 4XTYA 1WDXA 1QWFA 3I5RA 2YHTA 1VQ6Q 3LGLA 5GAMe 2EYZA 2YDLA 1QVFP 4C8QB 5CK9A 1AHJB 2YWWA 3CC2Q 3EGUA 1PKSA 2F2VA 1MMNA 2D0QB 1GRIA 2LNHB 1TSFA 1NBEB 2HNIA 2OAWA 2O01E 1UGSB 1YCYA 1YHQA 5HCKA 4Y28E 1C6VX 2CZ0B 2RJDA 1YJWA 3ULRB 1GBRA 3QDRB 1VYVA 4IKFA 3I5SA 2O2OA 3PGGA 3L2ZA 1LJOA 1RLPC 1OULA 1UECA 1OPKA 4HCZA 1OEBA 2ENMA 2L2PA 3EHRA 3QBYA 2LCLA 4RTWA 4M7DE 2CREA 3H0IA 2EQKA 2PQWA 1HXDA 5IXFA 3QG1A 5GAN8 2EPDA 1VQ4A 1M1KC 2YXYA 3CEYA 4NL2A 2OAUA 3CCJT 4QVZA 1G5VA 1EZZB 1OOTA 3OS0A 3NMZC 3M0RA 1W2BA 4II1A 3UPUA 4AT1B 1WHKA 1SHGA 4C5EA 2COWA 2YSQA 3TREA 3CCQQ 3CCVT 3UF4A 1KHIA 2FO0A 2KXCA 4R56A 4F14A 1G2BA 3TEEA 5LJ5h 5FLXE 2EJ9A 4QVDA 1SHFA 3G4SA 5IN1A 2EAYA 1UTIA 1X6GA 3OSVA 2L3SA 2A3LA 1U1TA 1G3TA 2EYQA 4LDWA 1KK7A 4DOVA 1UJ0A 4EPCA 2JW4A 2HQXA 3QXEB 2GFAA 2ROLA 2CP3A 1KD1R 4QQDA 1VQOA 3X24B 5M9OA 2KE9A 4XAXB 2DBKA 1LVKA 3ZL7C 1WGSA 3MEWA 4M77F 1AWXA 2WSCE 1WX6A 2EYXA 2YUPA 4J9IA 2VKNA 4FSXA 1WPYA 1UG1A 4C0DC 2LJ1A 3H6ZA 2KMTA 2GTJA 4ATOA 2DRMA 4M7DF 2FPEA 3OYDA 5LJ5f 2M0OA 2KXDA 4EMKC 2CZ6B 4J9DA 1R8OB 1ZX6A 5GAMd 2C0OA 1MNEA 2XDBA 1RAHB 4M7DB 3M55A 2VWFA 4XTUA 2GCXA 2VB6A 3QYHB 1VQLT 1T3LA 1V29B 1Q82R 2D6FA 4DBRA 4F7UB 1TS9A 4LXCA 1WNLA 4RTZA 4IIMA 2A08A 3FLGA 2RH2A 3J80E 4AG2C 3AT1B 3OYKA 1YIJA 1W2BP 4PFZA 3PNWC 1PRLC 2EBPA 1KD1C 1X2KA 1OPLA 2KT8A 2PU9B 5KYWB 3M59A 1JJ2S 4KRTA 5GANg 1VQ6A 2DA9A 2RO0A 2E1HA 2EJGA 3CC4T 4M78C 2HMAA 3CC2A 2ECZA 2LCCA 1G3SA 4UC4A 4C92C 5A0DA 5GMKh 4ESRA 4PJOF 1M9SA 3E9FA 2Z0WA 5KCOA 1X43A 3A5ZB 3EG1A 5KYYB 2RQWA 4PJMA 4LN2A 3JCMg 2L5QA 3CXCP 3UT1A 1QVPA 3OSSC 1WXTA 8AT1B 4ZTFA 2KYBA 2BZ8A 1JXMA 1D1AA 1NEBA 3A98A 3OMCA 3I9QA 1ZSZA 1ZUKA 1AWWA 3EG3A 4D8KA 2FZKB 4XQ3A 3PVQA 1G3WA 1YWPA 4IURA 4JRIA 1IZ6A 2R5MA 1EX4A 4OB0B 1VQ8A 1W1FA 4FIBA 3E1SA 1WHHA 3BY7A 1TG0A 3CPFA 4RG2A 3CCMT 4M75A 1AEYA 4F7UG 1PD0A 2I0NA 3CQTA 4HT8A 2RNAA 4MMKA 2E12A 5J3BA 1TUGB 2A0FB 5LJ3g 4LUDA 2JTMA 5IH2A 3EG0A 2X35A 1QVGS 1Q81U 1Z9ZA 2YUQA 2M0YA 4AMCA 2CS7A 2L3QA 5HK0A 5I11A 3R6OA 4RG8A 4CC3A 2JZ2A 3CMAT 1KIKA 3G6EQ 1KQ2A 5KE3A 3GOXA 1WXUA 2HSEB 5FROA 1WI7A 5AT1B 1YNZA 2BE7D 1D0ZA 4OMNA 3GP8A 3VV0A 2XD0A 2DX1A 3J81E 1FMWA 3OYGA 5CKFA 3CCST 2X4XA 3TCJA 1IREB 3LWHA 5LL6S 2L3PA 3KFVA 1Q86U 4FSSA 1IO6A 5EG2A 3H9NA 3SHWA 1W70A 2ED1A 4NOYA 1BU1A 2QAZA 4M78D 2GQVA 1YBYA 2K3XA 3RBBB 1VQ5T 4PLLA 3JCMb 3MEUA 1YCSB 2P84A 4EDUA 4MZTA 4PJNA 3X25B 4HKEA 3OYLA 5GJWB 3G7ZA 4ZNXA 2J05A 1ZUYA 2V26A 1BIBA 1T3SA 2X3XD 3MO8A 4J9FA 2LQWA 2HD0A 3VJPA 2CP0A 2ZZDA 2QQBA 3C95A 2JTFA 3C0CA 2KRSA 4BD3A 2Y4YA 2MPXC 1LPLA 3OYEA 2GBQA 1WZOA 4BY6B 5HY6A 1VQKQ 4LDVA 4KH0B 2EQJA 4RKUE 4EMHA 4ZGEB 2F1LA 2LT1A 3REAB 1UJYA 5GAOm 3ER0A 2K7AA 3CCJQ 1N9RA 4OF1A 3HTRA 3CD6T 1NYGA 5GJVB 2LTOA 2RI2A 3HFOA 3OQ5A 4EIKA 3SWNC 2NWMA 4RUGA 4JZ4A 4L6V5 2NUPB 3INZA 3RR6A 3EG2A 1YJNT 4M7AC 4OMFB 2QGGA 1NM7A 2COZA 4JDSA 5A2QE 3MHXA 2ZPEB 4A53A 4FYVB 1YJ9A 2QA4T 1GCQC 4LD6A 1YJWQ 2FRWA 1RAEB 1ABQA 2E5QA 5IT9E 2CGHA 1PC0A 4JPBW 5FWBA 2DNUA 4PFOA 4N0AC 5EC7A 1Q81R 2G3RA 3L2QA 2VYTA 2F5TX 2KEAA 3EG9B 1M1KU 4P5NA 4OMLA 3A8LB 3SD4A 4QQ6A 1M8VA 2HKNA 3JB9F 1IB8A 2FYKA 4Q5WA 4RCCA 1EIFA 2GGRA 1WHMA 2PVDB 2EGCA 3NFCA 1BI0A 5LJ5g 3X28B 4WTOB 1QVFS 1VQ9T 2QQSA 1NEGA 2EGAA 4FM4B 3UWNA 2QDLA 4BUGA 3QUIA 3ZBDA 4OMPA 3WVEB 1FMVA 1AWJA 4B6MA 1NPPA 4PLIA 4ZGJB 5ECAA 1MHNA 3M54A 4HVWA 4JLGA 1NPRA 3WVDB 3PFSA 4M75F 4M78G 3G6EA 1ZSZB 1Q81C 2MIOA 5GAMh 1K8AU 4C92G 1D0XA 4AG1C 1C1AA 2KR3A 3HRSA 4VUBA 1KQSA 3BFMA 2DYIA 2EYWA
chains in the Genus database with same CATH topology
1NZ9A 3OB9A 4QVZA 3M5AA 1S72T 2K5IA 3OS0A 1G5VA 4F7UA 2DEQA 4N0AA 4X9CA 3DLLA 1W2BA 3JB9I 4Y91A 4BE0A 3GNGA 4OVAA 3NTHA 3LH0A 4II1A 4XTWA 3UPUA 3A8GB 5GMKj 3CCQT 4OGEA 3JCMJ 4BACA 3QJYA 4C5EA 3OYCA 5J39A 4FU6A 3TREA 3LW5E 1M5Q1 2YLBA 5DY9A 4CI0C 1SSFA 3UDCA 4IUUA 4MMLA 3CCVT 4M78F 5CKEA 5CVIA 3G71A 1VQ9A 3DKMA 1B34B 1U1SA 1VQ5A 2DAQA 3V7RA 4C0GA 1K9MC 1KHIA 4R56A 3CBOA 4EMGA 2K4YA 3SDZA 4A4HA 2VXFA 4HCCA 3TEEA 4BI4A 4PJOB 2DVEA 5LJ5h 5FLXE 3O8VA 4M78B 5IAYA 4QVCA 3OYHA 2EJ9A 4QVDA 2DXTA 2X4YA 3JCMX 3PIPA 4BE2A 2RM4A 2F5KA 5GAMf 3G4SA 1MGQA 4ME7A 1QP2A 5IN1A 2EAYA 4JRQA 4C92B 1HK9A 5GAN2 1BI1A 2M9UA 4FL6A 3OYFA 1M4ZA 5LJ3f 4M7DG 3T9NA 2LQ8A 2OTJT 3PMTA 3OSVA 5GMKi 4C8QC 5DLOA 1BI3A 1VQKA 2A3LA 1U1TA 2MAMA 1G3TA 2EYQA 3HKSA 4LDWA 2DK3A 4BI8B 4DOVA 2MI6A 4N4HA 2RHIA 4EPCA 5KE2A 5KCHA 4M77C 2HQXA 1NJIU 3QXEB 3OYIA 2GFAA 4WF2A 2X4WA 2DD4A 2WSEE 5FU6C 3PTAA 2VV5A 4BDZA 4QQDA 3CCJA 1VQOA 2ZCFB 3X24B 5M9OA 2XHCA 1ZQ1A 1S72A 3HRUA 3FRNA 3PMIA 4JLIA 2BIVA 3F70A 4NS5A 4XAXB 2LNVA 1WQWA 3HPWA 3L1AA 1FWZA 1WGSA 4HA8A 5CR2A 1VQ6T 3MEWA 4M77F 3FB9A 1YI2T 3EAEA 2WSCE 3CCQA 3MP8A 4FSXA 1WPYA 4OB2B 5L8RE 2P0QA 2M1HA 1X6OA 5GAN3 4C0DC 2BKDN 3JCMc 1QVGA 4GY5A 1JRIA 3H6ZA 2KMTA 4ATOA 4NL3A 3CCVA 3OW2A 4M7DF 2ZPIB 1QVFA 5GANj 4ELZC 4XK8E 2P0PA 2FHDA 3PIOA 5CKDA 5LJ5f 3OYDA 2M0OA 3SB2A 4EMKC 2K57A 2RHYA 2CZ6B 3X20B 3CC7T 5FRMA 2QDYB 1KHCA 1R8OB 3RKYA 3S3NA 4J6WA 2OTLT 2DXBA 5GAMd 5HKCA 3EFRA 4C5HA 4O6JA 5CQXA 2XDBA 2KSSA 2YRVA 2K2VA 2DJZA 4KUIA 3M55A 3OYMA 1Q82U 1M90U 4M7DB 2WSFE 3A8MB 2D9TA 1I8FA 2QQRA 4XTUA 4CRIA 4E7KA 2GCXA 1ZHIA 2VC8A 5GMKe 4JJNK 3QYHB 1KC8U 4J6XA 1VQLT 4HCBA 1V29B 2D6FA 1PSFA 3L2UA 3CMET 4F7UB 3E9GA 2QA4A 3SWNA 2OTJA 4RCBA 1X01A 1N9SA 2DIQA 5GMKl 3ZEHA 2EWNA 1U8RA 1WNLA 4ZN3A 3QIIA 3MCAB 2CZ1B 2ZGWA 3FLGA 1Q7YU 4M7AA 2H3JA 2C06A 2RH2A 2JUFA 3J80E 1LNXA 3KBGA 5GAN4 4O5VA 3OYKA 1VQ8T 2E65A 1YIJA 1M1GA 1N27A 2XK0A 4JRKA 3PNWC 2ZPHB 4Z02A 2XDDA 4XU1A 3MP6A 4XU2A 1P92A 4F7UE 3C12A 1KD1C 2EQMA 4TVRA 2LRQA 2PU9B 4ZGDB 1W2BS 3N5BB 3S6WA 3M59A 3OMGA 5FU7C 5J26A 5GANg 1Y7XA 5GAOn 1YI2A 1JJ2S 2ZPFB 3JSCA 4KT0E 4C8QA 4PJOC 2RJEA 2V8KA 4LDYA 2RO0A 3L42A 2E1HA 2EJGA 3CC4T 4R55A 4M78C 4M7AD 3QKJA 5LJ5d 3VYGA 3CC2A 2DPPB 3JB9H 2LCCA 1G3SA 2I2LA 2RJCA 5CKBA 4UC4A 4C92C 5A0DA 3OS5A 2XICA 3M53A 3QJ6A 4XTVA 5GMKh 3QHSA 2JN0A 1OZ3A 5LJ3j 4RMOA 1GXIE 3CC7A 4PJOF 1M9SA 3E9FA 5KCOA 2OTLA 4LDXA 3A5ZB 2RB6A 1OZ2A 3A8HB 1VUBA 5GMKm 3VUBA 3JCMQ 1YITT 5D6XA 1K73U 4MZMA 3S3MA 2RK1A 3JCMg 4C8QD 2L5QA 3P8DA 4C92F 1I81A 3UT1A 5C6SA 1QVPA 3OSSC 2CYZB 4ZTFA 4E7JA 1VQLA 4MDWA 1UGPB 3CMEA 1N8RU 1DJ7B 3M57A 4QW2A 3QZ9B 1JB0E 3JB9D 3OYAA 2MMPA 3OMCA 3CXCS 2QQAA 3M4YA 3CBPA 5GANe 4EMKA 3L2RA 2DXCA 4M75E 2VGNA 3LLRA 4XQ3A 5HK3A 2LDMA 1I5LA 3HFNA 1G3WA 2DTIA 4IURA 4JRIA 1IZ6A 2KY9A 2R5MA 2V8JA 4OB0B 5I2SA 1VQ8A 4LD9K 1Y96B 1BIAA 4FIBA 3E1SA 4FT2A 3I56T 3M9QA 3X26B 2B8AA 3BY7A 3GNFB 1UB4A 3DB4A 2QQ9A 3CPFA 2Y90A 2CZ7B 3DLMA 1UGRB 3SFMA 1JBMA 2KAFA 4RG2A 3CCMT 4M75A 4F7UG 2L89A 4J6YA 3OA6A 4PNOA 3CPWA 1WQ7A 2KQWA 4C0ZA 1YHQT 3CBMA 4C8QE 3VKIA 4GLKA 3GLXA 4A54A 2FB7A 3S3OA 4C5IA 4HT8A 2EJFA 3META 4MMKA 3GPLA 3PT9A 3OYYA 1K8AC 2E12A 3V7CA 2X4JA 1XQHA 2XU8A 5J3BA 3EFSA 3GIBA 3OYNA 2LQKA 2RI3A 2YLCA 4PKCC 3JCMe 5LJ3g 4J7FA 3P8BB 3VU3C 1VIFA 2JTMA 3C4SA 2WACA 3CC4A 4M7DC 4OGCA 2X35A 1QVGS 2RK2A 1Q81U 4MDXA 3I55T 2R58A 1KG1A 3RUXA 5A0LA 5GAOp 1H641 3SWNB 1BI2A 2DXUA 2VGMA 4J83A 2CS7A 4M75D 1FX7A 5I21A 5HK0A 2R5AA 3R6OA 3OS1A 4E7HA 4RG8A 4E7IA 2JZ2A 2RHUA 4J8OA 4M7AB 3HP9A 1BKBA 3MEAA 3V8LA 5GANh 2MWPA 1YITA 3M56A 1KQ2A 1D3BA 2MWOA 4YTLA 5KE3A 3L2VA 3GOXA 1FXXA 4JRPA 5FROA 4KUDK 1VQ4T 1VIEA 4M78A 1XTDA 4PL6A 4F7UF 4D6WA 1PSEA 3JRZA 4DOWA 2NLUA 3GP8A 3JAME 3VV0A 3CCLT 2HQEA 5AYFA 2XD0A 3J81E 3RESA 3OYGA 3DB3A 2JNGA 5CKFA 3ASKA 5GAN5 3CCST 4M7AE 2X4XA 3TCJA 1IREB 4M75G 3LWHA 5LL6S 1VQPT 1Q86U 3JB9J 5LJ3e 2L8DA 5EG2A 2EFIA 2JVVA 4B9WA 2MF2A 3JCMh 1QW1A 1WJRA 3OBYA 2XIDA 4OB3B 3I56A 4LDUA 4NOYA 3CCJT 4M78D 4BE1A 2GQVA 5GAOl 1YBYA 3G71T 3OYJA 2K3XA 2GF7A 3CCMA 1VQ5T 4PLLA 3JCMb 2E41A 4A4EA 1QP3A 2XDPA 2ZPBB 3MEUA 4EDUA 2EKOA 4L59A 4MZTA 1Y07A 3LX7A 3WXMB 4HKEA 1M1FA 4QQGA 1UEBA 3VUZA 1XNIA 4MZPA 3OYLA 3NTIA 1VQ7T 2ZPGB 1KQSS 4ZTJA 1UGQB 3G7ZA 3QPHA 2BUDA 4M77E 2PVOB 4XTXA 4A4GA 4JUVA 1NJIC 3TU4K 5A0GA 2XI9A 1BIBA 5FRNA 1W4SA 4X34A 1H3ZA 3MO8A 4HT9A 3I55A 4KBMB 5GANf 1TH7A 2HD0A 2K5LA 3VJPA 3FC3A 2ZZDA 4E7LA 1YJ9T 2QQBA 1Y71A 2P0KA 3C95A 4XU3A 4IUQA 2JTFA 1NE8A 4FT4A 1N6AA 1ZBXA 5CCAA 4M77A 5DM7R 3CMAT 3J7AF 4BD3A 1VQKT 5GAMj 2HAXA 2Y4YA 1OI1A 2DTHA 3OYEA 4N4GA 3AHUA 4BY6B 5HY6A 5GAN6 4J5YA 1WJQA 5LJ3h 4LDVA 2E6NA 4JS4A 2EQJA 4RKUE 4EMHA 4ZGEB 4M7DA 2Y4XA 2E64A 3URGA 5CQYA 1OYXA 2LT1A 4M75B 1WJSA 2XG8D 1VQOT 3OY9A 3CCLA 2QEXT 3JCMf 5GAOm 3ER0A 2O4XA 2L3RA 2VXEA 3QYGB 5GAOr 1JJ2A 3CCSA 3MP1A 1VQPA 4M7AG 4M77D 1N9RA 4OF1A 4KULA 2LC4A 2KDSA 1Q82C 3KXTA 3CD6T 1M90C 3RMQA 2K5FA 2P4TA 1O75A 2F69A 2LTOA 2RI2A 3MEVA 2RJFA 3FJPA 3HFOA 3OQ5A 1KC8C 3JCMW 3RERA 4M7DD 5KH6A 3BDUA 1Q86C 4V2SA 2IG0A 4JS5A 3H8ZA 3LYIA 3SWNC 5I2MA 2R57A 3CPWS 4IUPA 4L6V5 2HBPA 1VQMT 2DD5A 4BI3A 3INZA 1YJNT 4C8QG 1VQNT 5FU7B 4M7AC 1Q7YC 1VQ7A 2RHXA 1XOVA 2VUBA 2DO3A 4OMFB 1D3BB 5GANd 2K3YA 3OYBA 4OB1B 5LJ5j 3CCUT 3M4GA 3JCMP 3HHTB 4M77G 2KK4A 5GAMg 1RL2A 5D6WA 3CCRT 3CCET 4JDSA 4N4IA 5A2QE 3JB9G 1YJWT 1I4K1 3MHXA 2ZPEB 3M58A 4A53A 4ELYC 1YJ9A 3BDLA 3OS2A 2QA4T 2V8IA 4LD6A 4M7AF 3CXCA 1X75C 2A7YA 5GAN7 2E5QA 5IT9E 3HRTA 2CGHA 3QO3A 4C5GA 4PJOE 3OW2S 4A4KA 2QTXA 4N0AC 5C0MA 1KD1U 3QZ5B 1B34A 2G3RA 3V8KA 4M78E 3ME9A 2DZ9A 3RMSA 3L2QA 4B9XA 2VYTA 2F5TX 2DTOA 3G6ET 1YIJT 1M1KU 4XTZA 3JCMd 4BDYA 4E47A 5CAIA 3BW1A 3GF5A 4X9DA 3RKXA 3VYHB 4P5NA 4C92E 2FL7A 3RKWA 3LWIA 2E10A 2LVMA 5CIUA 4C8QF 4PJOA 5CO7A 3A8LB 2DKGA 2QEXA 2LX9A 5CKHA 5DLQE 4A4FA 3SD4A 4XTYA 4DA4A 4QQ6A 2EQUA 4IUVA 1M8VA 4XU0A 1K73C 2E6ZA 2PVGB 4C92A 3QSUA 2KVQG 2RHZA 3JB9F 3CD6A 2YHTA 3Q1JA 3LGLA 5GAMe 2FYKA 4Q5WA 1G3YA 1Y96A 4RCCA 1EIFA 5D6YA 4C0FA 4C8QB 3CC2T 2PVDB 3NFCA 1RI0A 5CK9A 1BI0A 1AHJB 1N8RC 5LJ5g 2QXFA 2PUKB 2FVUA 1BYMA 3FEOA 1K9MU 5GAOq 3V7SA 2QI2A 4M77B 1VQMA 2JOYA 4IUTA 4PJOD 3E19A 4L5GA 2D0QB 3X28B 4J7IA 1YJNA 3V8JA 1QVFS 1VQNA 5FU6B 2RI5A 4OP0A 2RA2A 1VQ6A 1VQ9T 3RIRA 2QQSA 4BY6C 3P8HA 4FM4B 2HNIA 1YHQA 3C94A 2O01E 1UGSB 1YCYA 3UWNA 3FDRA 4BUGA 3CCUA 3QUIA 3ZBDA 4C92D 4Y28E 5LJ3d 3JCMV 2E70A 3HSBA 2RD1A 3WVEB 3CCRA 3CCEA 2CZ0B 1YJWA 2RJDA 4M75C 2GFUA 3QDRB 3L2WA 1NPPA 4IKFA 1KQ1A 4PLIA 4ZGJB 3PGGA 1LOJA 2O4XB 3FIFA 3L2ZA 3ZFJA 4C0DB 1O9SA 1LJOA 1MHNA 2XKOC 3HL8A 4HCZA 3G4ST 2CKKA 3M54A 4JLGA 3WVDB 1NPRA 3QBYA 4PJOG 4DQ2A 2AHJB 2LCLA 3A8OB 3PFSA 4M7DE 2EIFA 4M75F 4M78G 3G6EA 4EMKB 1Q81C 2EQKA 2PQWA 3LGFA 1HXDA 5GAMh 2LT4A 3CMAA 1K8AU 4ZN1A 2DIGA 3NTKA 3QG1A 4C92G 5LJ5e 3OBWA 3X25B 5GAN8 2DZCA 1VQ4A 1M1KC 3HRSA 2PUOB 2M16A 3CEYA 4VUBA 4BB7A 1KQSA 2IVWA 3BFMA 4NL2A 2OAUA 3KUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWN A;  4M7A C;  4RCB A;  1X01 A;  1N9S A;  5GMK l;  2EWN A;  2DEQ A;  1D3B B;  4N0A A;  4X9C A;  4M7A B;  1WNL A;  3V8L A;  4F7U A;  5GAN h;  5LJ5 j;  4Y91 A;  5GAN d;  3JB9 I;  3M4G A;  3JCM P;  2ZGW A;  4M77 G;  1KQ2 A;  1D3B A;  5GAM g;  4M7A A;  1LNX A;  4XTW A;  5GAN 4;  3JB9 G;  2E65 A;  4M78 A;  4F7U F;  1I4K 1;  5GMK j;  4JRK A;  4A53 A;  3JCM J;  4XU1 A;  1M5Q 1;  2YLB A;  4XU2 A;  5DY9 A;  4M7A F;  4MML A;  4F7U E;  5GAN 7;  4M78 F;  3RES A;  1B34 B;  1U1S A;  2CGH A;  3QO3 A;  4PJO E;  3V7R A;  5GAN 5;  4M7A E;  2QTX A;  4N0A C;  4M75 G;  5GAO n;  1B34 A;  3V8K A;  5LJ3 e;  4M78 E;  4EMG A;  2DZ9 A;  5GAN g;  3JB9 J;  4C8Q A;  2DTO A;  4PJO C;  2VXF A;  4XTZ A;  3JCM d;  2E1H A;  2EJG A;  3JCM h;  5CAI A;  4PJO B;  3BW1 A;  4M78 C;  4X9D A;  3RKX A;  2DVE A;  4C92 E;  5LJ5 d;  4M7A D;  3RKW A;  5LJ5 h;  4NOY A;  3JB9 H;  2E10 A;  4M78 B;  4M78 D;  4C8Q F;  2EJ9 A;  4QVC A;  2DXT A;  2I2L A;  4QVD A;  3JCM X;  2DKG A;  5GAO l;  2RM4 A;  4C92 C;  3JCM b;  2E41 A;  5GAM f;  1MGQ A;  5GMK h;  4XTV A;  2EAY A;  3QHS A;  2JN0 A;  4XTY A;  4C92 B;  1HK9 A;  4C8Q E;  5LJ3 j;  5GAN 2;  1M8V A;  4XU0 A;  4PJO F;  5LJ3 f;  4M7D G;  4C92 A;  3QSU A;  5GMK i;  3JB9 F;  2RB6 A;  2YHT A;  4C8Q C;  5GMK m;  5GAM e;  3JCM Q;  2FYK A;  1U1T A;  4M77 E;  1Y96 A;  4RCC A;  4XTX A;  4JUV A;  4C8Q B;  3JCM g;  4C8Q D;  1BIB A;  4C92 F;  1I81 A;  4PJO A;  5LJ5 g;  4M77 C;  4HT9 A;  5GAN f;  1TH7 A;  5GAO q;  3V7S A;  4M77 B;  4WF2 A;  4XU3 A;  4PJO D;  3V8J A;  4M77 A;  3JB9 D;  4OP0 A;  2RA2 A;  5GAM j;  4JLI A;  3RIR A;  5GAN e;  4C8Q G;  2DTH A;  1WQW A;  4EMK A;  3AHU A;  2HNI A;  3L1A A;  4M75 E;  1YCY A;  5GAN 6;  4HA8 A;  3QUI A;  4J5Y A;  4XQ3 A;  5LJ3 d;  3HFN A;  2DTI A;  5LJ3 h;  4M77 F;  2RD1 A;  3FB9 A;  4JRI A;  3JCM V;  4EMH A;  4M7D A;  4M75 C;  2E64 A;  1Y96 B;  1BIA A;  1WPY A;  5GAN 3;  4M75 B;  3BY7 A;  3JCM c;  1KQ1 A;  2Y90 A;  1JRI A;  3PGG A;  1LOJ A;  1JBM A;  3FIF A;  3L2Z A;  1LJO A;  4M75 A;  4NL3 A;  4M7D F;  4F7U G;  4J6Y A;  3JCM f;  4PNO A;  5GAO m;  1WQ7 A;  5GAN j;  2VXE A;  5GAO r;  4A54 A;  4DQ2 A;  2FB7 A;  4PJO G;  5LJ5 f;  4M7A G;  3SB2 A;  2EJF A;  4M77 D;  1N9R A;  2K57 A;  4MMK A;  4EMK C;  4HT8 A;  4M7D E;  3V7C A;  4M75 F;  3RKY A;  4M78 G;  4J6W A;  4EMK B;  3EFS A;  3GIB A;  2YLC A;  4C92 D;  3JCM e;  5LJ3 g;  5GAM d;  3HSB A;  1HXD A;  3VU3 C;  5GAM h;  3EFR A;  4M7D C;  5LJ5 e;  4C92 G;  3FJP A;  3HFO A;  3RER A;  2DJZ A;  3JCM W;  5GAN 8;  4M7D D;  4M7D B;  3BDU A;  4V2S A;  2DZC A;  4XTU A;  1I8F A;  3SWN C;  1I5L A;  2VC8 A;  5GMK e;  3RUX A;  5GAO p;  1H64 1;  4J6X A;  3SWN B;  2DXU A;  3INZ A;  4M75 D;  4F7U B;  3BFM A;  4NL2 A;  5I21 A; 
#chains in the Genus database with same CATH topology
 1NZ9 A;  2K5I A;  4F7U A;  2DEQ A;  1U06 A;  3NTH A;  4F16 A;  3CC4 Q;  4BAC A;  2JT4 A;  4DEY A;  5J39 A;  5DY9 A;  4IUU A;  4E7Z A;  1M2V B;  2BZX A;  4GLM A;  1U1S A;  3V7R A;  4LE9 A;  1TU0 B;  4EMG A;  2K4Y A;  1N5Z A;  2KGT A;  3SDZ A;  4A4H A;  4BI4 A;  1QMC A;  2J6F A;  3VS5 A;  2PZ1 A;  4BE2 A;  4QVC A;  3OYH A;  4LNP A;  2RM4 A;  5GAM f;  1WHG A;  4ME7 A;  1W6X A;  1A0N B;  3OYF A;  1M4Z A;  5LJ3 f;  2H8H A;  2OTJ T;  3PMT A;  1X2Q A;  3A1P A;  3VRZ A;  1VQK A;  4RTV A;  2MAM A;  1BCO A;  3HKS A;  2DK3 A;  5KCH A;  4M77 C;  5IHN A;  1AZG B;  3CCM Q;  4WF2 A;  4J9G A;  5FU6 C;  4PJJ A;  4BDZ A;  3TSW A;  3CCJ A;  2XHC A;  1ZQ1 A;  4FCY A;  2HBW A;  1NJI R;  3PMI A;  2BIV A;  1SPK A;  1FWZ A;  4HA8 A;  4PJL A;  1ZA2 B;  3FB9 A;  2J06 A;  4LUE A;  4ORZ A;  2P0Q A;  3JCM c;  1JQQ A;  4HXJ A;  3CCV A;  2O9S A;  2HL3 A;  5KYU B;  3PIO A;  5CKD A;  2K57 A;  3X20 B;  5FRM A;  2QDY B;  3RKY A;  2DXB A;  2DL4 A;  1BBZ A;  4O6J A;  1D1B A;  5L23 A;  3OYM A;  1Q82 U;  2QQR A;  3M0T A;  2RMO A;  1ZHI A;  4J6X A;  2V1Q A;  1WHJ A;  1UFF A;  3L2U A;  3CME T;  3CCS Q;  1M2O A;  1X01 A;  1QCN A;  2EWN A;  4ZN3 A;  3QII A;  2JS2 A;  1KQS P;  3E2U A;  3KBG A;  1M1G A;  2XK0 A;  2ZAE A;  1Q7Y R;  1VQ8 Q;  1M27 C;  4XU2 A;  2JJ9 A;  4OMM A;  4F7U E;  4TVR A;  1AD5 A;  1K8A R;  2LRQ A;  1W2B S;  1ARK A;  3N5B B;  5J26 A;  1Y7X A;  2ZPF B;  4PJO C;  2V8K A;  1G83 A;  1AOJ A;  2EW3 A;  3QKJ A;  3VYG A;  1UGV A;  2RJC A;  5CKB A;  1GFD A;  1T0J A;  2XIC A;  2ROT A;  2JN0 A;  1M8M A;  1TUC A;  2RB6 A;  1OZ2 A;  3A8H B;  5GMK m;  3VUB A;  1YIT T;  1K73 U;  4MZM A;  3S3M A;  2EYY A;  2CYZ B;  1VQL A;  1X6B A;  4MDW A;  3VRY A;  4Z8A A;  1N8R U;  3M57 A;  3VS4 A;  3QZ9 B;  1JB0 E;  3OYA A;  3CXC S;  2QQA A;  2FZG B;  3L2R A;  4EMK A;  1RAF B;  2DTI A;  1PNJ A;  1BIA A;  4FT2 A;  1OU8 A;  1V1C A;  2B8A A;  1UB4 A;  2Y90 A;  2ABL A;  2L89 A;  4PNO A;  1YJN Q;  4C0Z A;  2CDT A;  3CBM A;  1YHQ T;  1ZSG A;  1XJW B;  1UE9 A;  3GPL A;  3PT9 A;  1K8A C;  3V7C A;  2XMF A;  2XU8 A;  1Q95 G;  2RI3 A;  2YLC A;  1VIF A;  2DJQ A;  2K79 A;  4KGX B;  3CC4 A;  2FRY A;  1VA7 A;  3I55 T;  1SSH A;  1OX8 A;  4CC7 A;  2ED0 A;  5GAO p;  1H64 1;  1BI2 A;  4KH1 B;  3QDF A;  4F04 B;  5I21 A;  1IRX A;  6AT1 B;  2NUP A;  3OS1 A;  4E7H A;  3V8L A;  3MEA A;  1OQK A;  3M56 A;  1RAB B;  4JRP A;  1FXX A;  4KUD K;  1VQ4 T;  1VIE A;  4M78 A;  1XTD A;  2CUD A;  4PL6 A;  4F7U F;  2J6K A;  2DL3 A;  1QLY A;  2ESW A;  2NLU A;  2DRK A;  3CCL T;  5AYF A;  2AKK A;  4OMO A;  4JJD A;  2JNG A;  3ASK A;  5GAN 5;  1CKA A;  1VQP T;  2JVV A;  5I22 A;  1ACM B;  1E6G A;  3OBY A;  4OB3 B;  3EG9 A;  4BE1 A;  4J9B A;  3CCM A;  5GAO l;  3QWX X;  1F1B B;  3NPF A;  2ZPB B;  3G71 Q;  1Y07 A;  1VQ9 Q;  1M3A A;  1M1F A;  4QQG A;  1UEB A;  1VQ7 T;  1UGQ B;  3PVL A;  5A0G A;  2XI9 A;  1IGQ A;  4E6R A;  1TH7 A;  1HSQ A;  1YJ9 Q;  2HAX A;  1I5O B;  4N4G A;  1YWO A;  2E64 A;  1WJS A;  1VQO T;  3OY9 A;  2QEX T;  2A36 A;  3QYG B;  1JJ2 A;  1K73 R;  3CCS A;  2MYS A;  2KDS A;  3UAT A;  1Q82 C;  3RMQ A;  3MEV A;  1N8R R;  1IHW A;  3FJP A;  5KH6 A;  3BDU A;  1X27 A;  1SEM A;  4E7S A;  4JS5 A;  1B7T A;  5I2M A;  3TVT A;  2R57 A;  1VQM T;  1VQN T;  1IGU A;  1RAD B;  4E2F B;  1PCX A;  3OYB A;  3CCU T;  4M77 G;  3NHN A;  2MOX A;  5GAM g;  1RL2 A;  3CCR T;  1R77 A;  3CCE T;  4X1V A;  2BTT A;  1X75 C;  1D0Y A;  2A7Y A;  5FWC A;  5GAN 7;  3QO3 A;  1OV3 A;  3OW2 S;  1M2V A;  4A4K A;  2FZC B;  2OTJ Q;  2FPD A;  5IHK A;  3QZ5 B;  4M78 E;  2LZ6 B;  1YIJ T;  3H41 A;  4E47 A;  5CAI A;  1UHF A;  3GF5 A;  4X9D A;  4C92 E;  3VYH B;  2D8J A;  1M3C A;  4AFZ C;  3VS3 A;  2LX9 A;  5CKH A;  4DA4 A;  2SRC A;  2EQU A;  4IUV A;  1K73 C;  2E6Z A;  3QSU A;  3CD6 A;  2DL7 A;  2E3H A;  1G3Y A;  1Y57 A;  3CC2 T;  4C0F A;  1RI0 A;  2AKL A;  1N8R C;  2QXF A;  2PUK B;  2FVU A;  1AVZ C;  3FEO A;  2A37 A;  1ZUU A;  5GAO q;  4IUT A;  1OX9 A;  3E19 A;  1YJN A;  3V8J A;  2RI5 A;  4OP0 A;  2EVR A;  1K9M R;  1WHL A;  1VYT A;  3P8H A;  1WLP B;  2F2W A;  3C94 A;  2DEU A;  4C92 D;  3HSB A;  2E70 A;  2RD1 A;  1WYX A;  2NYS A;  3R6N A;  4M75 C;  2DM1 A;  4HCK A;  1LOJ A;  3ZFJ A;  4C0D B;  3HL8 A;  1M30 A;  2CKK A;  4DBF A;  4PJO G;  1WFW A;  2AHJ B;  3A8O B;  1H92 A;  3MKD A;  2EIF A;  5KYU A;  1Y0M A;  2J6O A;  4EMK B;  2QYZ A;  5IXB A;  3LGF A;  1JJ2 P;  2LT4 A;  3RDV A;  2DIG A;  3NTK A;  1GL5 A;  1LCK A;  3OBW A;  2LJ0 A;  2DZC A;  1WXB A;  1GCQ A;  2PUO B;  2M16 A;  3KUF A;  1S72 T;  3OB9 A;  3M5A A;  4N0A A;  4X9C A;  3DLL A;  3JB9 I;  2W0Z A;  3GNG A;  3LH0 A;  4XTW A;  4M4Z A;  1M3B A;  3CCQ T;  3QJY A;  1KFZ A;  3OYC A;  4CC4 B;  4FU6 A;  3LW5 E;  2YLB A;  4CI0 C;  4M78 F;  5CKE A;  5CVI A;  3G71 A;  1VQ9 A;  3DKM A;  1B34 B;  2DAQ A;  1K9M C;  3CCV Q;  3CBO A;  2VXF A;  1FMK A;  4HCC A;  1H3H A;  3D7S B;  2DVE A;  2X3W D;  4M78 B;  2DXT A;  1C0M A;  3M0P A;  1MGQ A;  1TUD A;  1QP2 A;  2KT1 A;  4C92 B;  2M9U A;  4R0K A;  2LQ8 A;  4C8Q C;  5DLO A;  4DBQ A;  1CKB A;  2DLP A;  4BI8 B;  2MI6 A;  4N4H A;  1JO8 A;  5KE2 A;  1NJI U;  1VYU A;  3OYI A;  1PG5 B;  2DD4 A;  2WSE E;  3PTA A;  2ZCF B;  3HRU A;  4Y92 A;  4JLI A;  3HPW A;  3THK A;  5CR2 A;  3VS1 A;  3UA6 A;  1YI2 T;  1HJD A;  3EAE A;  1QWE A;  3MP8 A;  4OB2 B;  5L8R E;  1MMA A;  2M1H A;  1X6O A;  2BKD N;  3I55 Q;  2J7I A;  1JRI A;  4OMQ A;  1VOM A;  2ZPI B;  5GAN j;  4ELZ C;  4XK8 E;  1U3O A;  2P0P A;  2FHD A;  2RQR A;  1UHC A;  3CC7 T;  1HYO A;  2HDA A;  3S3N A;  4J6W A;  2OTL T;  2X51 A;  5HKC A;  4C5H A;  5CQX A;  2KSS A;  2DER A;  2DJZ A;  4Z89 A;  1M90 U;  2D9T A;  1I8F A;  2B86 A;  4E7K A;  2F2X A;  2M02 A;  2VC8 A;  3VS6 A;  4HCB A;  2AK5 A;  1PSF A;  3E9G A;  3VS7 A;  2OTJ A;  1VQP Q;  5GMK l;  1VQL Q;  1KC8 R;  1EFN A;  2JXB A;  1B07 A;  2D0N A;  1Q7Y U;  2KI7 A;  2H3J A;  1LNX A;  1BK2 A;  5GAN 4;  1AWO A;  1N27 A;  2W10 A;  4JRK A;  1RAC B;  4QT7 A;  2XDD A;  3MP6 A;  2CSQ A;  1P92 A;  4GBQ A;  2RF0 A;  3VS2 A;  2DVJ A;  4ZGD B;  1I0C A;  3S6W A;  5GAO n;  3JSC A;  4KT0 E;  1U5S A;  4LDY A;  4R55 A;  3NGP A;  4M7A D;  2JMC A;  3JB9 H;  4F17 A;  2MCN A;  3OS5 A;  3M53 A;  2O31 A;  1OZ3 A;  5LJ3 j;  4RMO A;  1GXI E;  1BCM A;  4LDX A;  5D6X A;  4DBH A;  4RTX A;  2RK1 A;  4C8Q D;  1I81 A;  4E7J A;  3CME A;  1B3Q A;  1DJ7 B;  4QW2 A;  1TOV A;  2MMP A;  5GAN e;  3LLR A;  5HK3 A;  2LDM A;  1I5L A;  2KY9 A;  2V8J A;  5I2S A;  2YRC A;  2HL5 C;  2OI3 A;  3I56 T;  3M9Q A;  3X26 B;  3DLM A;  1UGR B;  1JBM A;  4J6Y A;  3CPW A;  1WQ7 A;  3VKI A;  4A54 A;  3GLX A;  4C5I A;  3OYY A;  2X4J A;  1XQH A;  3CCU Q;  3GIB A;  3OYN A;  2LQK A;  4PKC C;  3JCM e;  4J7F A;  3P8B B;  4QKU A;  3VU3 C;  3C4S A;  4M7D C;  2WAC A;  2IPO B;  2RK2 A;  4MDX A;  2AT1 B;  4FW1 A;  2FG0 A;  2R58 A;  2E5K A;  5A0L A;  3SWN B;  2DYB A;  2R5A A;  2QGF B;  4AFQ C;  4E7I A;  2RHU A;  4M7A B;  1YIT A;  1BKB A;  4YTL A;  2QG9 B;  3CMA Q;  1PSE A;  2HEQ A;  4DOW A;  4J9E A;  3JAM E;  1NG2 A;  2YUN A;  4FYY B;  1GCP A;  1ZBJ A;  2KRM A;  2LQN A;  2OX7 A;  4M75 G;  2AZS A;  5LJ3 e;  2L8D A;  1M90 R;  5IHI A;  2EFI A;  1NLP C;  1YN8 A;  4B9W A;  2MF2 A;  1WJR A;  1TTH B;  3OYJ A;  3I35 A;  1QCO A;  2EKO A;  4L59 A;  3LX7 A;  3WXM B;  1VQ5 Q;  1XNI A;  2KNB B;  3NTI A;  5KYX A;  2ZPG B;  3QPH A;  2BUD A;  4M77 E;  2PVO B;  4A4G A;  1NJI C;  3TU4 K;  2P4R A;  5FRN A;  4HT9 A;  3I55 A;  4KBM B;  3RNJ A;  4FT4 A;  5CCA A;  1ZBX A;  2CT4 A;  7AT1 B;  1VQK T;  3G1J A;  3EFO B;  4K11 A;  3MJX A;  2RPN A;  4AFU C;  2DMO A;  5GAN 6;  1WJQ A;  2HQH A;  2E6N A;  2AIR B;  2Y4X A;  1CSK A;  3URG A;  5CQY A;  1OYX A;  2XG8 D;  3CCL A;  2E3I A;  2L3R A;  2VXE A;  1S72 Q;  3MP1 A;  1VQP A;  2DFU A;  4M7A G;  4M77 D;  4KUL A;  2JM9 A;  2LC4 A;  3CPW P;  3KXT A;  1M90 C;  2K5F A;  1QKX A;  2D1X A;  1SKU B;  3RER A;  3JCM W;  4M7D D;  3CD6 Q;  3LYI A;  1K1Z A;  1SG5 A;  4IUP A;  5KYN A;  2NUT A;  4BI3 A;  4JZ3 A;  4C8Q G;  2QAS A;  1Q7Y C;  1VQ7 A;  1XOV A;  2DO3 A;  2FPF A;  1D3B B;  5GAN d;  3IQL A;  2K3Y A;  4OB1 B;  5LJ5 j;  2D8H A;  3M4G A;  4FW2 A;  3JCM P;  2BE9 B;  4HVU A;  2JTE A;  2KK4 A;  1YJW T;  2K3B A;  3OS2 A;  2V8I A;  2MK5 A;  3CXC A;  3HRT A;  2QA4 Q;  2RQU A;  4C5G A;  4PJO E;  2QTX A;  1B34 A;  1HD3 A;  3RMS A;  2RN8 A;  4B9X A;  2HCK A;  4XTZ A;  1JU5 C;  3JCM d;  2RQV A;  3RKX A;  1GBQ A;  3RKW A;  1TXQ A;  3LWI A;  1YP5 A;  5CIU A;  1BB9 A;  3EHQ A;  4FYX B;  2DKG A;  2QEX A;  2ATC B;  2CSI A;  1ZLM A;  2LJ3 A;  5DLQ E;  1MND A;  4XU0 A;  2PVG B;  4C92 A;  3EGX A;  2KVQ G;  2RHZ A;  3Q1J A;  1YI2 Q;  2YUO A;  5D6Y A;  3M0U A;  1Y96 A;  1JXO A;  3M0Q A;  1BYM A;  1K9M U;  3EGD B;  1UUE A;  2M51 A;  3V7S A;  2QI2 A;  4M77 B;  4CC2 A;  1VQM A;  2JOY A;  4PJO D;  4L5G A;  4J7I A;  2EQI A;  1WIE A;  1VQN A;  5FU6 B;  2RA2 A;  2CT3 A;  3RIR A;  3CC7 Q;  4BY6 C;  1K9A A;  3CCU A;  2OTL Q;  4ZTJ A;  3FDR A;  5LJ3 d;  3JCM V;  1MMD A;  1AT1 B;  3CCR A;  3CCE A;  2GFU A;  4KGV B;  2QTV A;  3L2W A;  1KQ1 A;  2O4X B;  3FIF A;  1K0X A;  1O9S A;  2DET A;  2XKO C;  2OJ2 A;  3G4S T;  1PWT A;  4DQ2 A;  1D1C A;  1G8X A;  3H0H A;  3H0F A;  3CMA A;  4ZN1 A;  5LJ5 e;  1T0H A;  1MV3 A;  2LMJ A;  2KRO A;  4BB7 A;  2IVW A;  1MV0 B;  4Y91 A;  4BE0 A;  4OVA A;  1NYF A;  3A8G B;  5GMK j;  4OGE A;  3JCM J;  4DEX A;  1M5Q 1;  1SSF A;  3UDC A;  4MML A;  2DE0 X;  1VQ5 A;  4C0G A;  2JMA A;  3U23 A;  2HSP A;  4PJO B;  2KRN A;  3O8V A;  5IAY A;  2LP5 A;  3PIP A;  2CP7 A;  2X4Y A;  3JCM X;  2F5K A;  1K0S A;  2A28 A;  4JRQ A;  1HK9 A;  1SRM A;  5GAN 2;  1BI1 A;  4FL6 A;  2LCS A;  4M7D G;  3T9N A;  5GMK i;  1BI3 A;  3SEM A;  3I56 Q;  2RHI A;  2O88 A;  2SEM A;  1KJW A;  2C0I A;  2X4W A;  2VV5 A;  3PE0 A;  1S72 A;  3FRN A;  2HKQ B;  4PFP A;  1RUW A;  3F70 A;  4NS5 A;  4RTY A;  2LNV A;  1WQW A;  3L1A A;  5KYX B;  1VQ6 T;  1UDL A;  3CCQ A;  5GAN 3;  1QVG A;  4GY5 A;  1I1J A;  4FYW B;  1PRM C;  1IXD A;  4NL3 A;  1OU9 A;  3OW2 A;  1K4U S;  2KYM A;  2K2M A;  3SB2 A;  1ZSZ C;  2RHY A;  1V76 A;  1KHC A;  1NLO C;  1PD1 A;  4IIO A;  2YT6 A;  3EFR A;  4KGZ B;  2YRV A;  2K2V A;  4J9H A;  4KUI A;  2WSF E;  3TQ7 P;  3A8M B;  4CRI A;  5D7U A;  5GMK e;  4JJN K;  1KC8 U;  2QA4 A;  3SWN A;  4RCB A;  1N9S A;  2DIQ A;  3ZEH A;  2RQT A;  3VS0 A;  1U8R A;  3CME Q;  3MCA B;  2CZ1 B;  2ZGW A;  4RTU A;  4M7A A;  2C06 A;  2KBT A;  2JUF A;  1VQ8 T;  4O5V A;  2E65 A;  1SF9 A;  2ZPH B;  4Z02 A;  4A63 B;  4XU1 A;  2K6D A;  4RTT A;  2JM8 A;  3C12 A;  9ATC B;  2EQM A;  2NUT B;  4ANJ A;  3OMG A;  5FU7 C;  1YI2 A;  4C8Q A;  2RJE A;  1MUZ A;  3L42 A;  3GBQ A;  1E7O A;  2PTK A;  5LJ5 d;  4J9C A;  2DPP B;  2YRD A;  2I2L A;  3LH5 A;  3QJ6 A;  4XTV A;  3QHS A;  3CC7 A;  2OTL A;  3UA7 A;  1VUB A;  3JCM Q;  3P8D A;  1SRL A;  4C92 F;  5C6S A;  1YIT Q;  1PKT A;  2VVK A;  3EH2 A;  1R0B G;  1UGP B;  2CH4 A;  3JB9 D;  3M4Y A;  2H3E B;  3CBP A;  2DXC A;  4M75 E;  2VGN A;  1RI9 A;  3EGX B;  3EFO A;  3HFN A;  2CP2 A;  4LD9 K;  1Y96 B;  3M0S A;  2DL8 A;  3GNF B;  3DB4 A;  1D09 B;  2QQ9 A;  2CZ7 B;  2DF6 A;  3SFM A;  2KAF A;  3OA6 A;  4JJB A;  2KQW A;  1QVG P;  4WCI A;  4GLK A;  3S3O A;  2FB7 A;  2EJF A;  3MET A;  4HVV A;  3OW2 P;  1YHQ Q;  3O5Z A;  3EFS A;  4OGC A;  2DBM A;  1AZE A;  1KG1 A;  2JS0 A;  3RUX A;  2DXU A;  2VGM A;  4J83 A;  4M75 D;  4D8D A;  1QCF A;  1FX7 A;  2DIL A;  1Z9Q A;  4J8O A;  5GAN h;  3HP9 A;  1R0C B;  2MWP A;  1D3B A;  2MWO A;  3L2V A;  3BE3 A;  4D6W A;  1S1N A;  3JRZ A;  1VQ4 Q;  1RAA B;  2BZY A;  2HQE A;  3RES A;  3DB3 A;  4M7A E;  1RAI B;  2PNI A;  4AFS C;  3CCL Q;  3JB9 J;  3JCM h;  1QW1 A;  2XID A;  3I56 A;  1Q86 R;  4LDU A;  1TWB A;  2DL5 A;  3EH1 A;  3G71 T;  2GF7 A;  2E41 A;  4A4E A;  1QP3 A;  2XDP A;  4Z88 A;  1QVF A;  3JV3 A;  4C8Q E;  5FW9 A;  3VUZ A;  1PM3 A;  4MZP A;  1IHV A;  1J3T A;  1KQS S;  4XTX A;  4JUV A;  1VQ7 Q;  2CUB A;  2CH4 W;  1YFN A;  2O9V A;  1W4S A;  3QWY A;  4X34 A;  1H3Z A;  1QQJ A;  1RAG B;  5GAN f;  2K5L A;  3FC3 A;  1YJ9 T;  4E7L A;  1Y71 A;  2P0K A;  4XU3 A;  1ZA1 B;  1QKW A;  4IUQ A;  1NE8 A;  3EGD A;  3G4S Q;  1N6A A;  5DM7 R;  2V1R A;  4M77 A;  2COY A;  1E6H A;  3J7A F;  5GAM j;  1OI1 A;  2DTH A;  3AHU A;  4J5Y A;  5LJ3 h;  2G6F X;  4JS4 A;  4M7D A;  1KSW A;  2GNC A;  4M75 B;  2QK0 A;  2CP5 A;  8ATC B;  3JCM f;  3TSZ A;  2O4X A;  5GAO r;  1VQO Q;  1FYN A;  2X9H A;  2QEX Q;  2NUZ A;  1GFC A;  2P4T A;  1O75 A;  2CP6 A;  2F69 A;  2RJF A;  1PHT A;  1KC8 C;  4V2S A;  1Q86 C;  2IG0 A;  3H8Z A;  2E4H A;  3CPW S;  2HBP A;  2HZY A;  2DD5 A;  2EKH A;  1MMG A;  5FU7 B;  5KYW A;  2RHX A;  2VUB A;  1VQM Q;  2K9G A;  2VAS A;  2L0A A;  1ABO A;  1VQN Q;  3HHT B;  2LX7 A;  5D6W A;  1RLQ C;  4N4I A;  3JB9 G;  2GTO A;  2C0T A;  1I4K 1;  3M58 A;  4ELY C;  1H8K A;  3BDL A;  1WA7 A;  1JEG A;  3CCR Q;  3CCE Q;  2FEI A;  4M7A F;  2GQI A;  3REB B;  1X69 A;  5KYY A;  5C0M A;  1KD1 U;  2AZV A;  3V8K A;  3ME9 A;  2DZ9 A;  1K76 A;  4PK4 A;  3G6E T;  2DTO A;  4BDY A;  3FJ5 A;  3BW1 A;  4JJC A;  2FL7 A;  1YIJ Q;  2IIM A;  2E10 A;  2LVM A;  4C8Q F;  2EGE A;  4PJO A;  5CO7 A;  1M1K R;  4A4F A;  1I07 A;  3MPU B;  4XTY A;  1WDX A;  1QWF A;  3I5R A;  2YHT A;  1VQ6 Q;  3LGL A;  5GAM e;  2EYZ A;  2YDL A;  1QVF P;  4C8Q B;  5CK9 A;  1AHJ B;  2YWW A;  3CC2 Q;  3EGU A;  1PKS A;  2F2V A;  1MMN A;  2D0Q B;  1GRI A;  2LNH B;  1TSF A;  1NBE B;  2HNI A;  2OAW A;  2O01 E;  1UGS B;  1YCY A;  1YHQ A;  5HCK A;  4Y28 E;  1C6V X;  2CZ0 B;  2RJD A;  1YJW A;  3ULR B;  1GBR A;  3QDR B;  1VYV A;  4IKF A;  3I5S A;  2O2O A;  3PGG A;  3L2Z A;  1LJO A;  1RLP C;  1OUL A;  1UEC A;  1OPK A;  4HCZ A;  1OEB A;  2ENM A;  2L2P A;  3EHR A;  3QBY A;  2LCL A;  4RTW A;  4M7D E;  2CRE A;  3H0I A;  2EQK A;  2PQW A;  1HXD A;  5IXF A;  3QG1 A;  5GAN 8;  2EPD A;  1VQ4 A;  1M1K C;  2YXY A;  3CEY A;  4NL2 A;  2OAU A;  3CCJ T;  4QVZ A;  1G5V A;  1EZZ B;  1OOT A;  3OS0 A;  3NMZ C;  3M0R A;  1W2B A;  4II1 A;  3UPU A;  4AT1 B;  1WHK A;  1SHG A;  4C5E A;  2COW A;  2YSQ A;  3TRE A;  3CCQ Q;  3CCV T;  3UF4 A;  1KHI A;  2FO0 A;  2KXC A;  4R56 A;  4F14 A;  1G2B A;  3TEE A;  5LJ5 h;  5FLX E;  2EJ9 A;  4QVD A;  1SHF A;  3G4S A;  5IN1 A;  2EAY A;  1UTI A;  1X6G A;  3OSV A;  2L3S A;  2A3L A;  1U1T A;  1G3T A;  2EYQ A;  4LDW A;  1KK7 A;  4DOV A;  1UJ0 A;  4EPC A;  2JW4 A;  2HQX A;  3QXE B;  2GFA A;  2ROL A;  2CP3 A;  1KD1 R;  4QQD A;  1VQO A;  3X24 B;  5M9O A;  2KE9 A;  4XAX B;  2DBK A;  1LVK A;  3ZL7 C;  1WGS A;  3MEW A;  4M77 F;  1AWX A;  2WSC E;  1WX6 A;  2EYX A;  2YUP A;  4J9I A;  2VKN A;  4FSX A;  1WPY A;  1UG1 A;  4C0D C;  2LJ1 A;  3H6Z A;  2KMT A;  2GTJ A;  4ATO A;  2DRM A;  4M7D F;  2FPE A;  3OYD A;  5LJ5 f;  2M0O A;  2KXD A;  4EMK C;  2CZ6 B;  4J9D A;  1R8O B;  1ZX6 A;  5GAM d;  2C0O A;  1MNE A;  2XDB A;  1RAH B;  4M7D B;  3M55 A;  2VWF A;  4XTU A;  2GCX A;  2VB6 A;  3QYH B;  1VQL T;  1T3L A;  1V29 B;  1Q82 R;  2D6F A;  4DBR A;  4F7U B;  1TS9 A;  4LXC A;  1WNL A;  4RTZ A;  4IIM A;  2A08 A;  3FLG A;  2RH2 A;  3J80 E;  4AG2 C;  3AT1 B;  3OYK A;  1YIJ A;  1W2B P;  4PFZ A;  3PNW C;  1PRL C;  2EBP A;  1KD1 C;  1X2K A;  1OPL A;  2KT8 A;  2PU9 B;  5KYW B;  3M59 A;  1JJ2 S;  4KRT A;  5GAN g;  1VQ6 A;  2DA9 A;  2RO0 A;  2E1H A;  2EJG A;  3CC4 T;  4M78 C;  2HMA A;  3CC2 A;  2ECZ A;  2LCC A;  1G3S A;  4UC4 A;  4C92 C;  5A0D A;  5GMK h;  4ESR A;  4PJO F;  1M9S A;  3E9F A;  2Z0W A;  5KCO A;  1X43 A;  3A5Z B;  3EG1 A;  5KYY B;  2RQW A;  4PJM A;  4LN2 A;  3JCM g;  2L5Q A;  3CXC P;  3UT1 A;  1QVP A;  3OSS C;  1WXT A;  8AT1 B;  4ZTF A;  2KYB A;  2BZ8 A;  1JXM A;  1D1A A;  1NEB A;  3A98 A;  3OMC A;  3I9Q A;  1ZSZ A;  1ZUK A;  1AWW A;  3EG3 A;  4D8K A;  2FZK B;  4XQ3 A;  3PVQ A;  1G3W A;  1YWP A;  4IUR A;  4JRI A;  1IZ6 A;  2R5M A;  1EX4 A;  4OB0 B;  1VQ8 A;  1W1F A;  4FIB A;  3E1S A;  1WHH A;  3BY7 A;  1TG0 A;  3CPF A;  4RG2 A;  3CCM T;  4M75 A;  1AEY A;  4F7U G;  1PD0 A;  2I0N A;  3CQT A;  4HT8 A;  2RNA A;  4MMK A;  2E12 A;  5J3B A;  1TUG B;  2A0F B;  5LJ3 g;  4LUD A;  2JTM A;  5IH2 A;  3EG0 A;  2X35 A;  1QVG S;  1Q81 U;  1Z9Z A;  2YUQ A;  2M0Y A;  4AMC A;  2CS7 A;  2L3Q A;  5HK0 A;  5I11 A;  3R6O A;  4RG8 A;  4CC3 A;  2JZ2 A;  3CMA T;  1KIK A;  3G6E Q;  1KQ2 A;  5KE3 A;  3GOX A;  1WXU A;  2HSE B;  5FRO A;  1WI7 A;  5AT1 B;  1YNZ A;  2BE7 D;  1D0Z A;  4OMN A;  3GP8 A;  3VV0 A;  2XD0 A;  2DX1 A;  3J81 E;  1FMW A;  3OYG A;  5CKF A;  3CCS T;  2X4X A;  3TCJ A;  1IRE B;  3LWH A;  5LL6 S;  2L3P A;  3KFV A;  1Q86 U;  4FSS A;  1IO6 A;  5EG2 A;  3H9N A;  3SHW A;  1W70 A;  2ED1 A;  4NOY A;  1BU1 A;  2QAZ A;  4M78 D;  2GQV A;  1YBY A;  2K3X A;  3RBB B;  1VQ5 T;  4PLL A;  3JCM b;  3MEU A;  1YCS B;  2P84 A;  4EDU A;  4MZT A;  4PJN A;  3X25 B;  4HKE A;  3OYL A;  5GJW B;  3G7Z A;  4ZNX A;  2J05 A;  1ZUY A;  2V26 A;  1BIB A;  1T3S A;  2X3X D;  3MO8 A;  4J9F A;  2LQW A;  2HD0 A;  3VJP A;  2CP0 A;  2ZZD A;  2QQB A;  3C95 A;  2JTF A;  3C0C A;  2KRS A;  4BD3 A;  2Y4Y A;  2MPX C;  1LPL A;  3OYE A;  2GBQ A;  1WZO A;  4BY6 B;  5HY6 A;  1VQK Q;  4LDV A;  4KH0 B;  2EQJ A;  4RKU E;  4EMH A;  4ZGE B;  2F1L A;  2LT1 A;  3REA B;  1UJY A;  5GAO m;  3ER0 A;  2K7A A;  3CCJ Q;  1N9R A;  4OF1 A;  3HTR A;  3CD6 T;  1NYG A;  5GJV B;  2LTO A;  2RI2 A;  3HFO A;  3OQ5 A;  4EIK A;  3SWN C;  2NWM A;  4RUG A;  4JZ4 A;  4L6V 5;  2NUP B;  3INZ A;  3RR6 A;  3EG2 A;  1YJN T;  4M7A C;  4OMF B;  2QGG A;  1NM7 A;  2COZ A;  4JDS A;  5A2Q E;  3MHX A;  2ZPE B;  4A53 A;  4FYV B;  1YJ9 A;  2QA4 T;  1GCQ C;  4LD6 A;  1YJW Q;  2FRW A;  1RAE B;  1ABQ A;  2E5Q A;  5IT9 E;  2CGH A;  1PC0 A;  4JPB W;  5FWB A;  2DNU A;  4PFO A;  4N0A C;  5EC7 A;  1Q81 R;  2G3R A;  3L2Q A;  2VYT A;  2F5T X;  2KEA A;  3EG9 B;  1M1K U;  4P5N A;  4OML A;  3A8L B;  3SD4 A;  4QQ6 A;  1M8V A;  2HKN A;  3JB9 F;  1IB8 A;  2FYK A;  4Q5W A;  4RCC A;  1EIF A;  2GGR A;  1WHM A;  2PVD B;  2EGC A;  3NFC A;  1BI0 A;  5LJ5 g;  3X28 B;  4WTO B;  1QVF S;  1VQ9 T;  2QQS A;  1NEG A;  2EGA A;  4FM4 B;  3UWN A;  2QDL A;  4BUG A;  3QUI A;  3ZBD A;  4OMP A;  3WVE B;  1FMV A;  1AWJ A;  4B6M A;  1NPP A;  4PLI A;  4ZGJ B;  5ECA A;  1MHN A;  3M54 A;  4HVW A;  4JLG A;  1NPR A;  3WVD B;  3PFS A;  4M75 F;  4M78 G;  3G6E A;  1ZSZ B;  1Q81 C;  2MIO A;  5GAM h;  1K8A U;  4C92 G;  1D0X A;  4AG1 C;  1C1A A;  2KR3 A;  3HRS A;  4VUB A;  1KQS A;  3BFM A;  2DYI A;  2EYW A; 
#chains in the Genus database with same CATH homology
 1NZ9 A;  3OB9 A;  4QVZ A;  3M5A A;  1S72 T;  2K5I A;  3OS0 A;  1G5V A;  4F7U A;  2DEQ A;  4N0A A;  4X9C A;  3DLL A;  1W2B A;  3JB9 I;  4Y91 A;  4BE0 A;  3GNG A;  4OVA A;  3NTH A;  3LH0 A;  4II1 A;  4XTW A;  3UPU A;  3A8G B;  5GMK j;  3CCQ T;  4OGE A;  3JCM J;  4BAC A;  3QJY A;  4C5E A;  3OYC A;  5J39 A;  4FU6 A;  3TRE A;  3LW5 E;  1M5Q 1;  2YLB A;  5DY9 A;  4CI0 C;  1SSF A;  3UDC A;  4IUU A;  4MML A;  3CCV T;  4M78 F;  5CKE A;  5CVI A;  3G71 A;  1VQ9 A;  3DKM A;  1B34 B;  1U1S A;  1VQ5 A;  2DAQ A;  3V7R A;  4C0G A;  1K9M C;  1KHI A;  4R56 A;  3CBO A;  4EMG A;  2K4Y A;  3SDZ A;  4A4H A;  2VXF A;  4HCC A;  3TEE A;  4BI4 A;  4PJO B;  2DVE A;  5LJ5 h;  5FLX E;  3O8V A;  4M78 B;  5IAY A;  4QVC A;  3OYH A;  2EJ9 A;  4QVD A;  2DXT A;  2X4Y A;  3JCM X;  3PIP A;  4BE2 A;  2RM4 A;  2F5K A;  5GAM f;  3G4S A;  1MGQ A;  4ME7 A;  1QP2 A;  5IN1 A;  2EAY A;  4JRQ A;  4C92 B;  1HK9 A;  5GAN 2;  1BI1 A;  2M9U A;  4FL6 A;  3OYF A;  1M4Z A;  5LJ3 f;  4M7D G;  3T9N A;  2LQ8 A;  2OTJ T;  3PMT A;  3OSV A;  5GMK i;  4C8Q C;  5DLO A;  1BI3 A;  1VQK A;  2A3L A;  1U1T A;  2MAM A;  1G3T A;  2EYQ A;  3HKS A;  4LDW A;  2DK3 A;  4BI8 B;  4DOV A;  2MI6 A;  4N4H A;  2RHI A;  4EPC A;  5KE2 A;  5KCH A;  4M77 C;  2HQX A;  1NJI U;  3QXE B;  3OYI A;  2GFA A;  4WF2 A;  2X4W A;  2DD4 A;  2WSE E;  5FU6 C;  3PTA A;  2VV5 A;  4BDZ A;  4QQD A;  3CCJ A;  1VQO A;  2ZCF B;  3X24 B;  5M9O A;  2XHC A;  1ZQ1 A;  1S72 A;  3HRU A;  3FRN A;  3PMI A;  4JLI A;  2BIV A;  3F70 A;  4NS5 A;  4XAX B;  2LNV A;  1WQW A;  3HPW A;  3L1A A;  1FWZ A;  1WGS A;  4HA8 A;  5CR2 A;  1VQ6 T;  3MEW A;  4M77 F;  3FB9 A;  1YI2 T;  3EAE A;  2WSC E;  3CCQ A;  3MP8 A;  4FSX A;  1WPY A;  4OB2 B;  5L8R E;  2P0Q A;  2M1H A;  1X6O A;  5GAN 3;  4C0D C;  2BKD N;  3JCM c;  1QVG A;  4GY5 A;  1JRI A;  3H6Z A;  2KMT A;  4ATO A;  4NL3 A;  3CCV A;  3OW2 A;  4M7D F;  2ZPI B;  1QVF A;  5GAN j;  4ELZ C;  4XK8 E;  2P0P A;  2FHD A;  3PIO A;  5CKD A;  5LJ5 f;  3OYD A;  2M0O A;  3SB2 A;  4EMK C;  2K57 A;  2RHY A;  2CZ6 B;  3X20 B;  3CC7 T;  5FRM A;  2QDY B;  1KHC A;  1R8O B;  3RKY A;  3S3N A;  4J6W A;  2OTL T;  2DXB A;  5GAM d;  5HKC A;  3EFR A;  4C5H A;  4O6J A;  5CQX A;  2XDB A;  2KSS A;  2YRV A;  2K2V A;  2DJZ A;  4KUI A;  3M55 A;  3OYM A;  1Q82 U;  1M90 U;  4M7D B;  2WSF E;  3A8M B;  2D9T A;  1I8F A;  2QQR A;  4XTU A;  4CRI A;  4E7K A;  2GCX A;  1ZHI A;  2VC8 A;  5GMK e;  4JJN K;  3QYH B;  1KC8 U;  4J6X A;  1VQL T;  4HCB A;  1V29 B;  2D6F A;  1PSF A;  3L2U A;  3CME T;  4F7U B;  3E9G A;  2QA4 A;  3SWN A;  2OTJ A;  4RCB A;  1X01 A;  1N9S A;  2DIQ A;  5GMK l;  3ZEH A;  2EWN A;  1U8R A;  1WNL A;  4ZN3 A;  3QII A;  3MCA B;  2CZ1 B;  2ZGW A;  3FLG A;  1Q7Y U;  4M7A A;  2H3J A;  2C06 A;  2RH2 A;  2JUF A;  3J80 E;  1LNX A;  3KBG A;  5GAN 4;  4O5V A;  3OYK A;  1VQ8 T;  2E65 A;  1YIJ A;  1M1G A;  1N27 A;  2XK0 A;  4JRK A;  3PNW C;  2ZPH B;  4Z02 A;  2XDD A;  4XU1 A;  3MP6 A;  4XU2 A;  1P92 A;  4F7U E;  3C12 A;  1KD1 C;  2EQM A;  4TVR A;  2LRQ A;  2PU9 B;  4ZGD B;  1W2B S;  3N5B B;  3S6W A;  3M59 A;  3OMG A;  5FU7 C;  5J26 A;  5GAN g;  1Y7X A;  5GAO n;  1YI2 A;  1JJ2 S;  2ZPF B;  3JSC A;  4KT0 E;  4C8Q A;  4PJO C;  2RJE A;  2V8K A;  4LDY A;  2RO0 A;  3L42 A;  2E1H A;  2EJG A;  3CC4 T;  4R55 A;  4M78 C;  4M7A D;  3QKJ A;  5LJ5 d;  3VYG A;  3CC2 A;  2DPP B;  3JB9 H;  2LCC A;  1G3S A;  2I2L A;  2RJC A;  5CKB A;  4UC4 A;  4C92 C;  5A0D A;  3OS5 A;  2XIC A;  3M53 A;  3QJ6 A;  4XTV A;  5GMK h;  3QHS A;  2JN0 A;  1OZ3 A;  5LJ3 j;  4RMO A;  1GXI E;  3CC7 A;  4PJO F;  1M9S A;  3E9F A;  5KCO A;  2OTL A;  4LDX A;  3A5Z B;  2RB6 A;  1OZ2 A;  3A8H B;  1VUB A;  5GMK m;  3VUB A;  3JCM Q;  1YIT T;  5D6X A;  1K73 U;  4MZM A;  3S3M A;  2RK1 A;  3JCM g;  4C8Q D;  2L5Q A;  3P8D A;  4C92 F;  1I81 A;  3UT1 A;  5C6S A;  1QVP A;  3OSS C;  2CYZ B;  4ZTF A;  4E7J A;  1VQL A;  4MDW A;  1UGP B;  3CME A;  1N8R U;  1DJ7 B;  3M57 A;  4QW2 A;  3QZ9 B;  1JB0 E;  3JB9 D;  3OYA A;  2MMP A;  3OMC A;  3CXC S;  2QQA A;  3M4Y A;  3CBP A;  5GAN e;  4EMK A;  3L2R A;  2DXC A;  4M75 E;  2VGN A;  3LLR A;  4XQ3 A;  5HK3 A;  2LDM A;  1I5L A;  3HFN A;  1G3W A;  2DTI A;  4IUR A;  4JRI A;  1IZ6 A;  2KY9 A;  2R5M A;  2V8J A;  4OB0 B;  5I2S A;  1VQ8 A;  4LD9 K;  1Y96 B;  1BIA A;  4FIB A;  3E1S A;  4FT2 A;  3I56 T;  3M9Q A;  3X26 B;  2B8A A;  3BY7 A;  3GNF B;  1UB4 A;  3DB4 A;  2QQ9 A;  3CPF A;  2Y90 A;  2CZ7 B;  3DLM A;  1UGR B;  3SFM A;  1JBM A;  2KAF A;  4RG2 A;  3CCM T;  4M75 A;  4F7U G;  2L89 A;  4J6Y A;  3OA6 A;  4PNO A;  3CPW A;  1WQ7 A;  2KQW A;  4C0Z A;  1YHQ T;  3CBM A;  4C8Q E;  3VKI A;  4GLK A;  3GLX A;  4A54 A;  2FB7 A;  3S3O A;  4C5I A;  4HT8 A;  2EJF A;  3MET A;  4MMK A;  3GPL A;  3PT9 A;  3OYY A;  1K8A C;  2E12 A;  3V7C A;  2X4J A;  1XQH A;  2XU8 A;  5J3B A;  3EFS A;  3GIB A;  3OYN A;  2LQK A;  2RI3 A;  2YLC A;  4PKC C;  3JCM e;  5LJ3 g;  4J7F A;  3P8B B;  3VU3 C;  1VIF A;  2JTM A;  3C4S A;  2WAC A;  3CC4 A;  4M7D C;  4OGC A;  2X35 A;  1QVG S;  2RK2 A;  1Q81 U;  4MDX A;  3I55 T;  2R58 A;  1KG1 A;  3RUX A;  5A0L A;  5GAO p;  1H64 1;  3SWN B;  1BI2 A;  2DXU A;  2VGM A;  4J83 A;  2CS7 A;  4M75 D;  1FX7 A;  5I21 A;  5HK0 A;  2R5A A;  3R6O A;  3OS1 A;  4E7H A;  4RG8 A;  4E7I A;  2JZ2 A;  2RHU A;  4J8O A;  4M7A B;  3HP9 A;  1BKB A;  3MEA A;  3V8L A;  5GAN h;  2MWP A;  1YIT A;  3M56 A;  1KQ2 A;  1D3B A;  2MWO A;  4YTL A;  5KE3 A;  3L2V A;  3GOX A;  1FXX A;  4JRP A;  5FRO A;  4KUD K;  1VQ4 T;  1VIE A;  4M78 A;  1XTD A;  4PL6 A;  4F7U F;  4D6W A;  1PSE A;  3JRZ A;  4DOW A;  2NLU A;  3GP8 A;  3JAM E;  3VV0 A;  3CCL T;  2HQE A;  5AYF A;  2XD0 A;  3J81 E;  3RES A;  3OYG A;  3DB3 A;  2JNG A;  5CKF A;  3ASK A;  5GAN 5;  3CCS T;  4M7A E;  2X4X A;  3TCJ A;  1IRE B;  4M75 G;  3LWH A;  5LL6 S;  1VQP T;  1Q86 U;  3JB9 J;  5LJ3 e;  2L8D A;  5EG2 A;  2EFI A;  2JVV A;  4B9W A;  2MF2 A;  3JCM h;  1QW1 A;  1WJR A;  3OBY A;  2XID A;  4OB3 B;  3I56 A;  4LDU A;  4NOY A;  3CCJ T;  4M78 D;  4BE1 A;  2GQV A;  5GAO l;  1YBY A;  3G71 T;  3OYJ A;  2K3X A;  2GF7 A;  3CCM A;  1VQ5 T;  4PLL A;  3JCM b;  2E41 A;  4A4E A;  1QP3 A;  2XDP A;  2ZPB B;  3MEU A;  4EDU A;  2EKO A;  4L59 A;  4MZT A;  1Y07 A;  3LX7 A;  3WXM B;  4HKE A;  1M1F A;  4QQG A;  1UEB A;  3VUZ A;  1XNI A;  4MZP A;  3OYL A;  3NTI A;  1VQ7 T;  2ZPG B;  1KQS S;  4ZTJ A;  1UGQ B;  3G7Z A;  3QPH A;  2BUD A;  4M77 E;  2PVO B;  4XTX A;  4A4G A;  4JUV A;  1NJI C;  3TU4 K;  5A0G A;  2XI9 A;  1BIB A;  5FRN A;  1W4S A;  4X34 A;  1H3Z A;  3MO8 A;  4HT9 A;  3I55 A;  4KBM B;  5GAN f;  1TH7 A;  2HD0 A;  2K5L A;  3VJP A;  3FC3 A;  2ZZD A;  4E7L A;  1YJ9 T;  2QQB A;  1Y71 A;  2P0K A;  3C95 A;  4XU3 A;  4IUQ A;  2JTF A;  1NE8 A;  4FT4 A;  1N6A A;  1ZBX A;  5CCA A;  4M77 A;  5DM7 R;  3CMA T;  3J7A F;  4BD3 A;  1VQK T;  5GAM j;  2HAX A;  2Y4Y A;  1OI1 A;  2DTH A;  3OYE A;  4N4G A;  3AHU A;  4BY6 B;  5HY6 A;  5GAN 6;  4J5Y A;  1WJQ A;  5LJ3 h;  4LDV A;  2E6N A;  4JS4 A;  2EQJ A;  4RKU E;  4EMH A;  4ZGE B;  4M7D A;  2Y4X A;  2E64 A;  3URG A;  5CQY A;  1OYX A;  2LT1 A;  4M75 B;  1WJS A;  2XG8 D;  1VQO T;  3OY9 A;  3CCL A;  2QEX T;  3JCM f;  5GAO m;  3ER0 A;  2O4X A;  2L3R A;  2VXE A;  3QYG B;  5GAO r;  1JJ2 A;  3CCS A;  3MP1 A;  1VQP A;  4M7A G;  4M77 D;  1N9R A;  4OF1 A;  4KUL A;  2LC4 A;  2KDS A;  1Q82 C;  3KXT A;  3CD6 T;  1M90 C;  3RMQ A;  2K5F A;  2P4T A;  1O75 A;  2F69 A;  2LTO A;  2RI2 A;  3MEV A;  2RJF A;  3FJP A;  3HFO A;  3OQ5 A;  1KC8 C;  3JCM W;  3RER A;  4M7D D;  5KH6 A;  3BDU A;  1Q86 C;  4V2S A;  2IG0 A;  4JS5 A;  3H8Z A;  3LYI A;  3SWN C;  5I2M A;  2R57 A;  3CPW S;  4IUP A;  4L6V 5;  2HBP A;  1VQM T;  2DD5 A;  4BI3 A;  3INZ A;  1YJN T;  4C8Q G;  1VQN T;  5FU7 B;  4M7A C;  1Q7Y C;  1VQ7 A;  2RHX A;  1XOV A;  2VUB A;  2DO3 A;  4OMF B;  1D3B B;  5GAN d;  2K3Y A;  3OYB A;  4OB1 B;  5LJ5 j;  3CCU T;  3M4G A;  3JCM P;  3HHT B;  4M77 G;  2KK4 A;  5GAM g;  1RL2 A;  5D6W A;  3CCR T;  3CCE T;  4JDS A;  4N4I A;  5A2Q E;  3JB9 G;  1YJW T;  1I4K 1;  3MHX A;  2ZPE B;  3M58 A;  4A53 A;  4ELY C;  1YJ9 A;  3BDL A;  3OS2 A;  2QA4 T;  2V8I A;  4LD6 A;  4M7A F;  3CXC A;  1X75 C;  2A7Y A;  5GAN 7;  2E5Q A;  5IT9 E;  3HRT A;  2CGH A;  3QO3 A;  4C5G A;  4PJO E;  3OW2 S;  4A4K A;  2QTX A;  4N0A C;  5C0M A;  1KD1 U;  3QZ5 B;  1B34 A;  2G3R A;  3V8K A;  4M78 E;  3ME9 A;  2DZ9 A;  3RMS A;  3L2Q A;  4B9X A;  2VYT A;  2F5T X;  2DTO A;  3G6E T;  1YIJ T;  1M1K U;  4XTZ A;  3JCM d;  4BDY A;  4E47 A;  5CAI A;  3BW1 A;  3GF5 A;  4X9D A;  3RKX A;  3VYH B;  4P5N A;  4C92 E;  2FL7 A;  3RKW A;  3LWI A;  2E10 A;  2LVM A;  5CIU A;  4C8Q F;  4PJO A;  5CO7 A;  3A8L B;  2DKG A;  2QEX A;  2LX9 A;  5CKH A;  5DLQ E;  4A4F A;  3SD4 A;  4XTY A;  4DA4 A;  4QQ6 A;  2EQU A;  4IUV A;  1M8V A;  4XU0 A;  1K73 C;  2E6Z A;  2PVG B;  4C92 A;  3QSU A;  2KVQ G;  2RHZ A;  3JB9 F;  3CD6 A;  2YHT A;  3Q1J A;  3LGL A;  5GAM e;  2FYK A;  4Q5W A;  1G3Y A;  1Y96 A;  4RCC A;  1EIF A;  5D6Y A;  4C0F A;  4C8Q B;  3CC2 T;  2PVD B;  3NFC A;  1RI0 A;  5CK9 A;  1BI0 A;  1AHJ B;  1N8R C;  5LJ5 g;  2QXF A;  2PUK B;  2FVU A;  1BYM A;  3FEO A;  1K9M U;  5GAO q;  3V7S A;  2QI2 A;  4M77 B;  1VQM A;  2JOY A;  4IUT A;  4PJO D;  3E19 A;  4L5G A;  2D0Q B;  3X28 B;  4J7I A;  1YJN A;  3V8J A;  1QVF S;  1VQN A;  5FU6 B;  2RI5 A;  4OP0 A;  2RA2 A;  1VQ6 A;  1VQ9 T;  3RIR A;  2QQS A;  4BY6 C;  3P8H A;  4FM4 B;  2HNI A;  1YHQ A;  3C94 A;  2O01 E;  1UGS B;  1YCY A;  3UWN A;  3FDR A;  4BUG A;  3CCU A;  3QUI A;  3ZBD A;  4C92 D;  4Y28 E;  5LJ3 d;  3JCM V;  2E70 A;  3HSB A;  2RD1 A;  3WVE B;  3CCR A;  3CCE A;  2CZ0 B;  1YJW A;  2RJD A;  4M75 C;  2GFU A;  3QDR B;  3L2W A;  1NPP A;  4IKF A;  1KQ1 A;  4PLI A;  4ZGJ B;  3PGG A;  1LOJ A;  2O4X B;  3FIF A;  3L2Z A;  3ZFJ A;  4C0D B;  1O9S A;  1LJO A;  1MHN A;  2XKO C;  3HL8 A;  4HCZ A;  3G4S T;  2CKK A;  3M54 A;  4JLG A;  3WVD B;  1NPR A;  3QBY A;  4PJO G;  4DQ2 A;  2AHJ B;  2LCL A;  3A8O B;  3PFS A;  4M7D E;  2EIF A;  4M75 F;  4M78 G;  3G6E A;  4EMK B;  1Q81 C;  2EQK A;  2PQW A;  3LGF A;  1HXD A;  5GAM h;  2LT4 A;  3CMA A;  1K8A U;  4ZN1 A;  2DIG A;  3NTK A;  3QG1 A;  4C92 G;  5LJ5 e;  3OBW A;  3X25 B;  5GAN 8;  2DZC A;  1VQ4 A;  1M1K C;  3HRS A;  2PUO B;  2M16 A;  3CEY A;  4VUB A;  4BB7 A;  1KQS A;  2IVW A;  3BFM A;  4NL2 A;  2OAU A;  3KUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...