1KQ1A

1.55 a crystal structure of the pleiotropic translational regulator, hfq
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Host Factor for Q beta
publication title Structures of the pleiotropic translational regulator Hfq and an Hfq-RNA complex: a bacterial Sm-like protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation
total genus 15
structure length 60
sequence length 60
chains with identical sequence B, H, I, K, M, N, R, S, T, W, Y
ec nomenclature
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kq1A00
3SB2A 3BY7A 1YCYA 4EMKC 1WQWA 3RKXA 4M77G 3JCMf 5LJ3j 2VC8A 1M5Q1 4F7UF 3EFRA 2EJFA 5GAMd 5GAOm 3JCMW 4J6XA 4J6YA 5GAMe 3JCMc 2E1HA 5GAN5 2DKGA 3JCMg 4C92C 2E64A 4A54A 4XQ3A 1HK9A 1U1SA 4J5YA 4NOYA 2YLBA 2RD1A 4RCCA 1D3BB 5GAN6 5GANh 3RERA 4MMKA 4M7DC 4M75C 4Y91A 4C92G 3GIBA 4F7UA 1LNXA 2DXTA 4M78F 4M7AB 4C8QC 2E10A 2YHTA 3EFSA 4M7DG 4PJOB 1KQ1A 1WQ7A 4XTYA 3RIRA 5GAMf 3JB9F 2DZ9A 1N9RA 2QTXA 4M7AF 3BDUA 4M7AE 4C8QG 2E41A 4J6WA 4N0AC 2EAYA 4MMLA 3RESA 4F7UB 5GAMg 1TH7A 5GANj 4PJOE 3HFNA 4X9CA 2K57A 3SWNA 5GAN8 4XU0A 1D3BA 4X9DA 3VU3C 3JCMb 5LJ5d 4F7UE 2VXEA 1X01A 4NL2A 4XTUA 3V7CA 2DXUA 5LJ5e 3JB9D 3QO3A 5GAOr 4M7AA 3RUXA 5GMKl 5LJ3d 4M7AD 4PJOA 4M77F 2EWNA 1MGQA 3SWNB 2RB6A 4PJOD 2FYKA 2ZGWA 4M78B 5GMKm 5LJ3e 3QSUA 1H641 3AHUA 3L1AA 3JCMh 1WPYA 5GMKh 3V7SA 4M78E 1LJOA 3HFOA 1BIBA 2DJZA 4M7DB 2VXFA 4M75B 4C92F 2CGHA 2DVEA 3V8JA 4M77A 5LJ5f 4NL3A 4XU1A 4EMGA 3JCMP 1I5LA 1N9SA 2RM4A 4M7DF 4M7DE 5LJ3f 4M75F 2DTHA 4M75E 4EMKA 5LJ5g 2I2LA 4M78A 5GMKj 4M78D 4C8QF 5GANd 4M77B 5LJ3g 4C92A 3FJPA 5GANe 5GAMh 5GAN4 4PJOC 4C92D 1Y96B 3JB9G 3JCMX 4EMKB 3V8KA 5GAOq 2EJ9A 4M77E 3V8LA 4M7DA 4OP0A 4M7AG 5GAN7 4M75A 4HT8A 4M7DD 1M8VA 4PJOG 4M75D 4JLIA 5GMKi 4EMHA 4C92B 4QVCA 4C8QA 2HNIA 3FB9A 5DY9A 4C8QD 5CAIA 5I21A 2EJGA 4PNOA 4F7UG 1I81A 5GAMj 3HSBA 4JRKA 1JBMA 4C92E 1LOJA 4WF2A 4XU3A 4DQ2A 4N0AA 4XTZA 3RKYA 4XTXA 5GAOn 2FB7A 4M77D 5GAOl 4C8QB 1B34B 4JRIA 3SWNC 1Y96A 5GANg 4HT9A 4M78C 3JB9J 4XU2A 1BIAA 3FIFA 5GAOp 2Y90A 1I8FA 2E65A 2DEQA 3BW1A 3JB9H 3INZA 5GAN3 2DZCA 2JN0A 4C8QE 3JCMQ 4M78G 4M7AC 5GANf 3JCMd 3JCMV 5LJ5h 4XTWA 4HA8A 1I4K1 3QHSA 3JCMe 1HXDA 3JB9I 3BFMA 5GMKe 2YLCA 3M4GA 5LJ3h 3L2ZA 2DTIA 3PGGA 4XTVA 2DTOA 4M75G 1WNLA 4QVDA 1B34A 1KQ2A 3V7RA 4A53A 5GAN2 3JCMJ 3RKWA 4V2SA 4JUVA 4M77C 4PJOF 3QUIA 5LJ5j 4RCBA 1JRIA 2RA2A 1U1TA
chains in the Genus database with same CATH superfamily
2QDYB 2NUPA 2EBPA 2K2MA 2LQKA 1GXIE 3F70A 4E2FB 4FL6A 4FYXB 4QQDA 1U1SA 3GLXA 4KH1B 1ZSGA 4JLGA 1WJQA 2JM9A 4M7AB 3RIRA 2LNVA 1W2BS 4C0DC 1I07A 4M7AF 3RMQA 1YNZA 4MMLA 3THKA 1PKTA 1Y57A 3OYGA 5IHKA 4WTOB 3FDRA 3VU3C 2JJ9A 4JZ3A 3G71T 2XDDA 1EZZB 1H641 2LZ6B 1DJ7B 1LJOA 2GBQA 1M1KR 3FEOA 2KEAA 2V8JA 2RMOA 3CCQQ 3VS4A 3I5SA 2E5QA 2V1QA 1YJNQ 4KUDK 1MNEA 3FJPA 2RQUA 3MP8A 1PD0A 1RL2A 1UJYA 1M8VA 3G6ET 1VQ9T 2YUNA 4RKUE 1K8AC 3FB9A 4EDUA 1M90C 4RMOA 4PNOA 3CC2T 4F04B 3HSBA 4FW2A 2EVRA 3QDFA 4WCIA 2FB7A 2ZPBB 4J9IA 3ZL7C 2DZCA 1PKSA 1R8OB 4BB7A 2LX7A 4OMQA 1YI2Q 1I4K1 3QPHA 3CCMQ 4ZGJB 3REAB 3H0FA 3A8HB 5CIUA 4GBQA 2QEXT 4M75G 3EGUA 2FEIA 1WHJA 3HPWA 3CXCP 3RKWA 2L8DA 5IH2A 1PNJA 4ATOA 4F7UF 1NLOC 4RUGA 1G3SA 2DIQA 2RQRA 1HK9A 3NGPA 3M58A 3GPLA 1KQSS 5A2QE 2FZKB 1YCSB 2F2WA 2KT1A 1WXTA 2LP5A 2XIDA 5GJWB 4E6RA 2DYIA 2EW3A 3QG1A 1VQLA 3M59A 5KYUB 2DXTA 4M78F 2G6FX 2YHTA 1G3YA 5GAMf 3CMAA 5D6XA 4HCCA 4OB1B 4QQGA 1VQKQ 4MZMA 5GAN8 3GOXA 5FU7B 4X34A 1OU8A 3E9GA 2YRVA 4M7AA 1PRMC 2DK3A 3TSZA 1WLPB 2DAQA 2KDSA 1VQMT 3FRNA 1G83A 1YJ9Q 4MDWA 3CPWS 3PFSA 1I5LA 5LJ5g 2K5LA 4KRTA 4FT4A 3CCQT 1VQOA 2PZ1A 1R0BG 8AT1B 2GTJA 2CSQA 4ZNXA 3HHTB 4ORZA 3JCMX 4A63B 4FCYA 1OX8A 2FRYA 2PTKA 4J83A 1SSFA 5KCHA 5I2MA 1BI3A 3G71A 5CAIA 3CMET 1YHQT 2FZCB 4PFZA 5GAMj 2BZ8A 2JXBA 4BD3A 4M77D 4PK4A 2DEUA 1E6HA 2CP3A 2D8HA 4HT9A 1TG0A 1T3LA 1WFWA 1WI7A 4M7AC 2OTJT 1K0SA 2KXCA 2P0QA 4HA8A 4OMMA 1T0JA 2K4YA 1Q95G 4OMOA 2B8AA 3OYMA 1UGQB 1YIJQ 2XG8D 3PIPA 4AMCA 4JUVA 3QYHB 4PJOF 1S72T 3G6EA 1VQ9A 2DXCA 3QYGB 2NUTB 2YDLA 3CC2A 3O8VA 2OAUA 2QI2A 1TTHB 2C0TA 1WXUA 4A54A 1PC0A 2YLBA 4AFUC 2VGMA 3LH5A 3OYDA 4F7UA 2FG0A 2F2XA 2FHDA 1X6GA 1ZBJA 1WQ7A 1FX7A 4FIBA 2LTOA 2CP2A 2DL3A 2QEXA 4HCZA 4XU0A 1VQKT 1SPKA 3M0RA 4HXJA 2AIRB 3RUXA 1I5OB 3OS5A 2RI2A 1C0MA 8ATCB 1UTIA 2LRQA 2EYWA 3OMGA 5KE3A 1EX4A 5IN1A 5D6YA 1WHKA 2KXDA 1W70A 3CC7Q 1QCOA 1XJWB 1NJIU 4HVVA 5AYFA 4M75E 3CCJQ 1T0HA 3PE0A 4QW2A 2HSPA 2HL5C 4J9DA 4Z89A 2O4XB 5IHIA 4HT8A 2QA4Q 2EGEA 4EMHA 1W6XA 4C8QD 5I21A 2EJGA 2LJ3A 4F7UG 1D1BA 1KHCA 4K11A 3VS2A 3QDRB 1KSWA 4C0FA 1QLYA 1UFFA 1VQMA 5EC7A 2O2OA 4M78C 2EGCA 2R58A 5GAOp 3EG3A 2LT4A 2X4JA 4M78G 3ZBDA 1K9MU 2DD4A 1QVGA 4DBFA 1BKBA 2RK2A 1KD1R 1M8MA 2D1XA 3CCQA 2ECZA 7AT1B 2QQSA 3I9QA 4IURA 3V7RA 3WVDB 2ED0A 2RHZA 4AT1B 3OS1A 4J7IA 2D9TA 2CZ0B 1EIFA 4PKCC 1TXQA 1UB4A 5GAMd 4LD6A 3A8OB 2LMJA 3CMEA 4L59A 2DL4A 1YHQA 4JPBW 3QKJA 2E64A 2COYA 4NOYA 2R5MA 2L2PA 3MEVA 1M1KC 5GAN6 4MMKA 2IPOB 2QTVA 2JS2A 4ELZC 1WHGA 1AWJA 4J9FA 2OTJA 4Q5WA 3FC3A 2E3IA 1X6OA 2X4YA 1Q82C 2DNUA 5IXBA 3JCMb 4NS5A 1M2VA 3JAME 1M1FA 1S72A 1OV3A 4KT0E 2E6NA 3CCUT 4BDYA 3AHUA 4OB2B 1IHVA 2QASA 3MEUA 2PVDB 4FSSA 4E7KA 1SG5A 4C92F 3EGDB 3OB9A 2M1HA 1SHFA 1ABOA 2JNGA 2KI7A 2YRCA 4ESRA 3QWYA 1SF9A 3ME9A 2XKOC 3CCJT 2RHIA 5FU6B 3CC4T 4PJOC 4KUIA 5FWBA 5KYWA 5GAN7 1VQKA 4PJOG 5GMKi 5DY9A 4B9WA 1I81A 1VQ8Q 4XTZA 4ZGDB 3A1PA 2CZ6B 4JRIA 4BI8B 4A4FA 1X2KA 1K73R 3QBYA 4C0DB 2I0NA 2PQWA 1PWTA 1ZBXA 4PJNA 1GCQA 2G3RA 3QJ6A 3META 4FM4B 3QHSA 3FJ5A 4C0ZA 2HZYA 1MMAA 2EQJA 4QVDA 3CXCA 2LQWA 2CH4A 2GQIA 3OBWA 4V2SA 3TU4K 2HBPA 2DM1A 3SB2A 4UC4A 1JJ2A 4MDXA 1EFNA 4Y92A 2O9SA 2KROA 5GAOl 3RKXA 1HD3A 3O5ZA 3JB9H 4HKEA 1K8AU 1M90U 3J81E 1M27C 5FRMA 2P4TA 4PJLA 2L3PA 4BUGA 1WA7A 1H3HA 2X4WA 3I56Q 1X43A 3CBOA 2AHJB 1Y71A 2DA9A 4KGVB 1IGUA 5GJVB 4F7UE 1VYVA 3P8BB 1GCQC 4M77F 2CP0A 3ZFJA 2YXYA 3GNGA 1AWWA 5KYXA 2EQUA 2KRSA 2RNAA 4M78E 2LJ0A 3VS5A 1OI1A 1QKWA 4M75B 1V76A 5AT1B 5A0GA 1PD1A 2O88A 5LJ3f 4M75F 2DTHA 3P8DA 4LUDA 2DXBA 1OZ2A 2CUDA 2QAZA 3A5ZB 4HVUA 4EIKA 3VS0A 4C92A 5GAMh 2M9UA 2GQVA 2RI5A 2DBMA 3OYAA 5DLQE 3EGDA 5D6WA 2ZPEB 1VQPT 1UEBA 4IUUA 2QQ9A 2O31A 3C95A 1UGSB 3RR6A 3CCVQ 2D0NA 4XU3A 3CCUA 3S3OA 4EPCA 2AT1B 1U3OA 1RI0A 1BIAA 1MNDA 2KNBB 3CCET 3JCMQ 1U5SA 4XTWA 1N8RC 3CCJA 4J7FA 2DTOA 3CC4A 1WNLA 2E4HA 2DILA 1X2QA 1P92A 1YFNA 3DB3A 2W10A 4PJMA 3SHWA 1WQWA 4IIOA 3JCMf 5LJ3j 3EFRA 2MYSA 1RACB 2ZPIB 2QGFB 4J6YA 5GAMe 1QVFP 1R77A 4IKFA 4C92C 3SD4A 4J5YA 1G3WA 3HP9A 1K9AA 4C92G 1LPLA 2EPDA 2XI9A 4CRIA 1IO6A 1RAAB 2FPEA 1SSHA 3JV3A 4PJOE 2EGAA 5M9OA 2KR3A 2VASA 3I56T 4LDXA 3QZ9B 1W2BP 3PTAA 1PSFA 1VQ4Q 3OBYA 2F69A 3EHQA 2QQRA 1NM7A 1BK2A 2FYKA 5GMKm 1I1JA 5IAYA 1IXDA 3NPFA 4PL6A 3HFOA 1FMWA 3MEWA 5KE2A 2H8HA 3VKIA 2AK5A 1VQOT 4M77A 3U23A 1K76A 1O9SA 1BCOA 1N9SA 3CD6T 1D09B 2P4RA 1QVGS 4HVWA 4EMKA 1KD1C 3OYFA 2QDLA 1M9SA 2X4XA 2A3LA 2ZZDA 2KK4A 1SRLA 2V26A 4M75A 4M7DD 2PNIA 4OB0B 1UG1A 4ZN3A 3ULRB 3T9NA 1KFZA 3OSVA 1VOMA 2BIVA 4PLLA 3UATA 2YRDA 4XTXA 2H3EB 3RDVA 1YJWT 5A0LA 1VQ6Q 2CT3A 3TQ7P 2KYMA 5GAN3 3Q1JA 1AZEA 1NPRA 2FO0A 2VGNA 1E6GA 1IB8A 2COZA 2EYXA 2YLCA 3C4SA 4DEXA 1Q82R 4AFZC 2X3WD 1T3SA 3OYYA 5GAN2 1G8XA 2RN8A 2ED1A 4M77C 4KBMB 3GP8A 5L23A 1U1TA 1JQQA 2DD5A 1YCYA 4EMKC 2KE9A 3DB4A 4M77G 1VQPA 1X27A 4XQ3A 1VQ7T 1D3BB 3RERA 1FMKA 1C6VX 2X35A 4M75C 1JXMA 3CCEA 1KQ1A 1KQSP 4F7UB 2RK1A 4OMNA 4KGZB 1BI1A 2VXEA 3PNWC 2OTLQ 3JB9D 3QO3A 5LJ3d 1TSFA 2RB6A 4M78B 3A8LB 2KY9A 3UA6A 5CR2A 2NYSA 1K73C 1RADB 1VIFA 4GLMA 4R55A 2LJ1A 3VUZA 1AZGB 4D8DA 3EH1A 1WDXA 1M1KU 2RHUA 3EFOB 1VQ5Q 3CPWP 1QW1A 1UGVA 4J9HA 2X51A 1E7OA 4QVZA 1U06A 1Q86C 1RAHB 4GLKA 3I56A 5HK0A 1JJ2S 4J9CA 2L0AA 2FPFA 1Q82U 1BBZA 2JT4A 2JW4A 2KVQG 4Z02A 2LNHB 2J6FA 2MCNA 5GANf 4C92E 1RLPC 4F14A 2ABLA 2K6DA 4CC4B 3GNFB 1JEGA 1YWOA 2XDBA 5KCOA 1OULA 4LDWA 3JCMd 3D7SB 1YJNT 3CD6A 2H3JA 5HY6A 2XMFA 1QWEA 2KGTA 4C5GA 3OW2S 3FLGA 1NG2A 2SRCA 1F1BB 4AG2C 1ABQA 4LXCA 2COWA 2PVOB 2RI3A 5J26A 1D1CA 2MOXA 3JCMc 1XNIA 2EIFA 3EG9A 2RF0A 1YJWA 2BTTA 1NZ9A 2W0ZA 2JMAA 1IHWA 2F5KA 3S3MA 3JRZA 1YI2T 2A08A 3CCMT 3EFSA 4PJOB 4RTZA 3M53A 3CCRQ 1K0XA 4TVRA 5GANj 1M30A 3H41A 2MMPA 1D3BA 1N6AA 1TUCA 3X20B 1KJWA 2DL8A 1K1ZA 3WVEB 4JJCA 2K5FA 5I11A 2KT8A 1M2VB 5I22A 4P5NA 3REBB 3M9QA 1VQ7A 4YTLA 1X69A 2DVJA 3UPUA 4IUTA 1N8RR 4R0KA 4M78A 1YITQ 4N4HA 3QIIA 5CVIA 3X25B 2M51A 2RHXA 4C0GA 5CKDA 1VQ5T 1AVZC 4M77E 1K4US 2YUOA 3KFVA 4ZTJA 2WSFE 3H8ZA 2CUBA 4FW1A 1Q81C 3CEYA 5KYWB 4JRKA 1NYFA 1NPPA 4N0AA 2C06A 1YJ9T 2ROLA 3EFOA 3H0IA 4OF1A 1CSKA 1WX6A 1YBYA 4JZ4A 3PMIA 5FROA 3BDLA 2E65A 1Y0MA 4LDYA 3TCJA 3UF4A 2LC4A 1GCPA 2R57A 2FRWA 3PVLA 3MP6A 1MV0B 2M0OA 2M16A 3CCSQ 2JTMA 2JVVA 1YP5A 5LJ3h 2QK0A 3L2ZA 1M3CA 1ZA2B 4ANJA 4C5HA 3LGLA 4RCBA 3H9NA 3M54A 2VUBA 1M5Q1 1QVFA 1QQJA 2HQHA 1H92A 5DLOA 1UJ0A 5FW9A 2BE7D 3CCLQ 1V29B 4MZTA 4OGEA 2DYBA 2XK0A 3VS6A 1FXXA 5ECAA 2DZ9A 4N4GA 1YJNA 4N0AC 1YIJT 3RESA 3G4SQ 1V1CA 1MHNA 1UE9A 1OQKA 2FL7A 4X9CA 2A28A 2DRKA 3I55Q 1ZQ1A 2MIOA 4XTUA 1N8RU 2K5IA 2ZAEA 4M7AD 4PJOA 4ZN1A 5LJ3e 2D8JA 3L1AA 3JCMh 1Y07A 2VB6A 3X24B 1BIBA 3LGFA 1N27A 2VXFA 5LJ5f 5KYXB 4DBQA 2DO3A 1AD5A 3A8MB 3X28B 3JSCA 3CCMA 1YI2A 4LDVA 2VV5A 1ZHIA 2K9GA 5GANd 1YITT 2L89A 2J6KA 1D0YA 2ZCFB 3TEEA 4JJDA 2VYTA 2GFAA 2QQBA 1S1NA 2EYQA 2XDPA 4D8KA 4C92B 1KC8R 3EAEA 3KBGA 2GNCA 1ZA1B 1JBMA 5GAOn 1X75C 2QXFA 1IGQA 4FYYB 3CC7T 2HBWA 4II1A 2P84A 2DEQA 3X26B 4QT7A 2BZYA 2DL7A 4J9EA 3JCMe 4FSXA 2NWMA 3E2UA 1XTDA 1QCNA 2QA4T 1TS9A 1NEBA 1VQ5A 1KD1U 2K3XA 3VS7A 2CREA 1I0CA 4F16A 5LJ5j 5FWCA 2RA2A 1M3BA 2DJQA 2YT6A 2M0YA 3I5RA 3AT1B 4FYWB 2XD0A 1WHLA 1YJ9A 2A37A 4RCCA 2BKDN 4VUBA 3OS0A 3CCLT 3QZ5B 1ZUYA 2XICA 4BI3A 2HQEA 2ZPFB 1N9RA 1Q86R 2E41A 2HSEB 1KG1A 3PMTA 1YWPA 3G4ST 3E19A 4JJNK 2F5TX 4B6MA 3HRSA 3NTKA 3UA7A 2AZVA 2DE0X 4M4ZA 2WSEE 4PLIA 1NYGA 5IHNA 4BY6C 4ELYC 2WSCE 1OX9A 1CKBA 2CGHA 3JCMP 1BI2A 3MO8A 1VQLQ 3OYJA 3OYCA 3CMAQ 4E7ZA 4M77B 3CPWA 1AWOA 1YIJA 3GBQA 4LE9A 4EMKB 1RUWA 1W4SA 4HCBA 5FLXE 2KSSA 2ESWA 4JLIA 2KYBA 2ENMA 4LDUA 1AOJA 3DLMA 3RKYA 2LX9A 4X1VA 1WHHA 2Y90A 2KMTA 3INZA 2CT4A 1HJDA 1WJSA 1HYOA 1K73U 3DKMA 1XQHA 1OZ3A 3JB9I 3A98A 5KYYB 2CDTA 4XTVA 4QKUA 2JS0A 1YITA 3S3NA 1UDLA 5CKHA 5D7UA 3QJYA 2RJEA 2P0PA 1VQ8T 1Q86U 2VC8A 3G71Q 1RABB 2E1HA 5GAN5 1Z9ZA 2YWWA 2HEQA 2EQIA 1KHIA 1G3TA 3OSSC 3HKSA 2HQXA 3CC7A 3BE3A 5GANh 3OMCA 3ZEHA 3GIBA 4ME7A 5HCKA 2RO0A 3EH2A 4A4HA 1QWFA 5GAMg 2V8KA 2QA4A 5LJ5d 2DL5A 2MK5A 2DXUA 1Q81R 2CS7A 2CZ1B 4JS4A 4F17A 3M0QA 2CKKA 5EG2A 3NFCA 1RAGB 3CC2Q 3L2RA 4J9GA 2EFIA 3OYBA 5I2SA 4NL3A 1UHCA 2GGRA 2A7YA 2HCKA 3CCLA 2DFUA 2X9HA 1JB0E 2MPXC 3ER0A 2IIMA 3LH0A 4C8QF 5CCAA 2E6ZA 1WXBA 5GANe 2D6FA 4E7IA 3JB9G 5GAOq 3V8KA 1QVGP 2EJ9A 1MUZA 3V8LA 2QEXQ 1PG5B 1QVPA 3G4SA 1ARKA 1LVKA 2PUKB 3UWNA 1R0CB 3E9FA 1OPKA 3M55A 2LCLA 3OYKA 4DQ2A 1M2OA 2QGGA 3SDZA 2LVMA 2HAXA 1D1AA 2PUOB 3TSWA 4XU2A 3FIFA 1QP2A 1KIKA 1BB9A 3BW1A 3L42A 3LW5E 4OMLA 1VA7A 4IUVA 2CP5A 1NEGA 2MWOA 3JCMV 2EQKA 1HXDA 5J3BA 5A0DA 6AT1B 1UUEA 3SEMA 2DTIA 1OEBA 1XOVA 1SRMA 1GRIA 1JXOA 2O01E 3VS1A 4KH0B 1TOVA 2E3HA 3BY7A 2K7AA 1G2BA 3CCVT 1H8KA 3OYEA 3JCMW 2HKQB 5KYYA 2XHCA 2DKGA 2KQWA 4RTUA 2RD1A 3EGXB 3LWHA 1VQMQ 3UDCA 1BU1A 1Q81U 2Y4XA 3S6WA 2K2VA 3M0TA 3EG9B 3OYLA 2HKNA 1Q7YR 2BZXA 4XTYA 4BE1A 3A8GB 2QTXA 4ZTFA 1RAFB 2M02A 1NE8A 3SWNA 2E70A 2JTFA 4X9DA 2NUZA 1KC8C 4AG1C 1N5ZA 4ZGEB 1VQ8A 1JO8A 3C94A 5CQXA 3CMEQ 1YHQQ 5CK9A 1WPYA 2FZGB 1TU0B 1VUBA 2DJZA 2RPNA 3V8JA 4XU1A 4EMGA 5HK3A 4M7DE 4A4GA 1ZSZB 4L5GA 2OTJQ 2VKNA 1BI0A 4RTTA 4C92D 1Y96B 3EG0A 1VQ4T 3MHXA 1AWXA 1PRLC 4C8QA 1S72Q 1BYMA 2YUQA 2KAFA 3OA6A 1MV3A 4WF2A 1JJ2P 3E1SA 1H3ZA 3SWNC 2K3YA 3P8HA 5IXFA 2HL3A 4JJBA 4LNPA 1UECA 1M3AA 2CP6A 2XU8A 1C1AA 3J80E 5C0MA 3TREA 3CXCS 5LJ5h 4QQ6A 1VQNQ 2LQ8A 3MCAB 2MF2A 1MMGA 2J05A 1PHTA 3PGGA 2RQTA 1U8RA 1IREB 4JRQA 2JM8A 1Q7YU 4PFOA 1MMNA 4MZPA 5L8RE 3OW2P 2GF7A 5C6SA 5GAOm 4J6XA 1GL5A 2KBTA 3M56A 4JS5A 1VQ6T 3DLLA 3J7AF 4LD9K 2C0OA 2DPPB 4L6V5 4E7SA 4Y91A 1NLPC 2EYZA 4BI4A 1WHMA 4C8QC 4A4KA 2DX1A 3VRYA 1TWBA 2P0KA 3QXEB 2NLUA 2RQVA 4C8QG 1AEYA 3EGXA 2J6OA 1RLQC 1GFCA 1ZUUA 4BE0A 2EQMA 1X01A 5LJ5e 4XAXB 3CCVA 3QSUA 3TVTA 3OYIA 2F2VA 3PIOA 1NJIR 1OYXA 2OX7A 3VRZA 3L2WA 1AT1B 2RM4A 1KK7A 2JMCA 2WACA 2B86A 4J9BA 5GMKj 2AKKA 2KRNA 3GF5A 2HD0A 1FMVA 1OOTA 2OTLT 1D0ZA 1BCMA 4OP0A 4LN2A 4PFPA 4M7AG 4M75D 2KRMA 3LX7A 4CC3A 3LLRA 3EG2A 1J3TA 1ZSZA 4A4EA 2K79A 2MAMA 1B34B 4IUQA 1Y96A 3LYIA 4OB3B 1K9MR 2E12A 4O6JA 2V1RA 2ZPHB 4RG2A 3VJPA 1RAIB 1SEMA 1VQNT 1UGRB 2OJ2A 5J39A 3CBPA 3JCMJ 2IVWA 1VQ4A 3QUIA 3PVQA 5CKFA 4RTYA 2DLPA 3NHNA 3I35A 4BY6B 2VVKA 1GFDA 1B7TA 4BACA 5KYUA 3URGA 3LWIA 2RHYA 4B9XA 3CCUQ 4E7JA 4R56A 3QWXX 2L3RA 2CSIA 3SFMA 2RJCA 3L2UA 4KULA 1RAEB 1ZSZC 1PCXA 3BDUA 5IT9E 4J6WA 1TH7A 2CH4W 2A0FB 3CC4Q 2LQNA 2L3QA 5DM7R 1TUGB 2F1LA 5GAOr 1LCKA 3R6OA 5GMKl 1Z9QA 3ASKA 3HTRA 1MGQA 2MI6A 2DMOA 2RJFA 5CO7A 4DEYA 3G7ZA 4Y28E 1VQ6A 3M0SA 3M57A 4M7DB 1QMCA 2V8IA 3OYHA 4M7DF 3CCRT 1W2BA 2Y4YA 5LJ3g 3VS3A 2O9VA 1GBRA 2LCSA 4JRPA 3MP1A 4PJJA 2HNIA 1QCFA 5FU7C 2YUPA 4CC7A 5CKEA 3NTIA 4C5IA 3M5AA 4DBHA 1ACMB 4O5VA 4RTWA 2CZ7B 1Q7YC 4C8QE 1B3QA 5LL6S 4AFQC 4KGXB 4AFSC 2LCCA 2HDAA 2VWFA 1B34A 1JU5C 4BDZA 2NUTA 4A53A 2OTLA 1JRIA 4RTVA 4J8OA 2ZPGB 1K8AR 1M90R 3M0UA 1HSQA 3JCMg 1PM3A 3L2VA 1WIEA 2L3SA 2C0IA 4C5EA 2IG0A 9ATCB 2MWPA 4BE2A 1ZUKA 3CCST 2E10A 2QQAA 1G5VA 3JB9F 1YN8A 2RJDA 2DERA 4M7AE 2EAYA 4FU6A 2EKOA 2R5AA 3HFNA 1VQNA 2K57A 3HL8A 5HKCA 1Y7XA 1A0NB 4NL2A 3V7CA 2DIGA 1NBEB 1VQPQ 1GBQA 1FWZA 3L2QA 2PU9B 2PVGB 2DBKA 3V7SA 1WYXA 1KQSA 2K3BA 2DVEA 2L5QA 3H0HA 3HRTA 2E5KA 1ZLMA 3RMSA 3RBBB 4DOWA 3CCEQ 2O4XA 1CKAA 1RI9A 4M78D 2EKHA 3H6ZA 2SEMA 3R6NA 2OI3A 5GAN4 3I55T 4DBRA 3MJXA 1UGPB 1X6BA 2JUFA 3NTHA 4M7DA 3M4YA 1IZ6A 4FYVB 2QG9B 3KUFA 1ZX6A 1D0XA 2ATCB 3KXTA 3WXMB 2LT1A 1SHGA 2AZSA 2QYZA 1LOJA 1KC8U 1MMDA 4Z8AA 1I8FA 2JZ2A 2HMAA 2YSQA 2J06A 2NUPB 2FPDA 3CPFA 3G1JA 4CC2A 3CCRA 3CBMA 3BFMA 4E47A 3M4GA 2BE9B 2A36A 1WZOA 1KQ2A 1IRXA 3OW2A 3EHRA 3N5BB 2EJFA 1PSEA 1WGSA 1NJIC 1VYTA 2LDMA 3EG1A 4JDSA 3OQ5A 4N4IA 3VV0A 1UHFA 2BUDA 5KH6A 1WJRA 2D0QB 3M0PA 5KYNA 4M7DC 4IUPA 2FVUA 1LNXA 1VQOQ 4M7DG 3C0CA 2OAWA 4E7HA 3CD6Q 2CP7A 1OPLA 3OYNA 2JOYA 3MKDA 2X3XD 5CQYA 3VYHB 4XK8E 2GFUA 2EWNA 3SWNB 1M1GA 4PJOD 1AHJB 2ZGWA 3C12A 3MEAA 2CYZB 1K9MC 5GMKh 1QKXA 4HCKA 1B07A 3OS2A 1YJWQ 3HRUA 1TUDA 4E7LA 4DOVA 4RG8A 3UT1A 1W1FA 2DRMA 3CCSA 2I2LA 2DETA 3NMZC 1M4ZA 4IIMA 4OMFB 2ROTA 4LUEA 2J7IA 2RQWA 3G6EQ 4OMPA 3CQTA 1VQ9Q 3MPUB 2EYYA 3OY9A 2RH2A 1SKUB 4QVCA 1O75A 2DF6A 4FT2A 4RTXA 3IQLA 3VUBA 1VIEA 4D6WA 4C8QB 5GANg 2Z0WA 3JB9J 1VQLT 1VQ7Q 2JN0A 2GTOA 3PT9A 3CMAT 1QP3A 3VYGA 4Z88A 5CKBA 5GMKe 4OVAA 5FRNA 4DA4A 4GY5A 4OGCA 3RNJA 1FYNA 3I55A 2AKLA 2JTEA 4CI0C 1QVFS 5FU6C 2GCXA 1OU9A 1VYUA
chains in the Genus database with same CATH topology
2QDYB 4MZPA 4UC4A 5L8RE 3SB2A 1JJ2A 4MDXA 3M54A 5GAOl 3RKXA 2VUBA 1M5Q1 2GF7A 5C6SA 2LQKA 3JB9H 5GAOm 1QVFA 4J6XA 3JCMW 1GXIE 4HKEA 3M56A 3F70A 5DLOA 4JS5A 1VQ6T 4FL6A 3DLLA 3J7AF 4QQDA 4LD9K 1U1SA 3GLXA 2DPPB 4L6V5 1K8AU 1M90U 4JLGA 1WJQA 1V29B 4MZTA 4OGEA 3J81E 4Y91A 4BI4A 4M7AB 4C8QC 2XK0A 5FRMA 4A4KA 2P4TA 1FXXA 2LNVA 3RIRA 1W2BS 2DZ9A 4N4GA 4BUGA 4C0DC 1YJNA 2P0KA 4M7AF 3QXEB 2NLUA 3RMQA 2X4WA 4C8QG 4N0AC 1YIJT 4MMLA 3RESA 1MHNA 2FL7A 3CBOA 4X9CA 2AHJB 3OYGA 1Y71A 3FDRA 3VU3C 1ZQ1A 4F7UE 4BE0A 2EQMA 1X01A 4XTUA 5LJ5e 3P8BB 1N8RU 3G71T 2K5IA 4M7AD 4XAXB 4M77F 4ZN1A 2XDDA 4PJOA 5LJ3e 3CCVA 3ZFJA 3QSUA 3GNGA 3OYIA 3PIOA 1H641 3L1AA 1OYXA 3JCMh 1DJ7B 1Y07A 2EQUA 4M78E 1LJOA 3X24B 1BIBA 3LGFA 1N27A 2VXFA 1OI1A 4M75B 5LJ5f 3FEOA 5A0GA 3L2WA 2RM4A 2V8JA 5LJ3f 1YI2A 2DO3A 2DTHA 3A8MB 4M75F 3JSCA 3X28B 3CCMA 3P8DA 4LDVA 2VV5A 1ZHIA 2DXBA 1OZ2A 2E5QA 2WACA 5GMKj 5GANd 4KUDK 3A5ZB 1YITT 4C92A 3FJPA 2L89A 3GF5A 3MP8A 2HD0A 5GAMh 1RL2A 2ZCFB 2M9UA 3TEEA 2GQVA 2RI5A 2OTLT 4OP0A 4M7AG 3OYAA 5DLQE 2VYTA 2GFAA 2QQBA 5D6WA 3G6ET 4M75D 1M8VA 2EYQA 2XDPA 2ZPEB 3LX7A 1VQ9T 4RKUE 4C92B 1VQPT 1K8AC 3FB9A 1UEBA 3EAEA 4EDUA 3KBGA 4IUUA 1M90C 2QQ9A 3LLRA 4RMOA 4PNOA 3CC2T 3C95A 1UGSB 3HSBA 1JBMA 5GAOn 4XU3A 1X75C 3CCUA 2QXFA 4A4EA 3S3OA 2FB7A 4EPCA 3CC7T 2MAMA 1B34B 2ZPBB 4IUQA 1Y96A 3LYIA 4OB3B 1RI0A 4II1A 1BIAA 2E12A 2DEQA 4O6JA 3X26B 2DZCA 3CCET 3JCMQ 2ZPHB 4RG2A 1R8OB 4BB7A 4XTWA 1I4K1 3QPHA 3VJPA 4FSXA 3JCMe 4ZGJB 1N8RC 3A8HB 5CIUA 1VQNT 3CCJA 4J7FA 1UGRB 2DTOA 2QEXT 1XTDA 4M75G 5J39A 3CC4A 1WNLA 3CBPA 2QA4T 3HPWA 3JCMJ 3RKWA 2L8DA 1KD1U 2K3XA 1VQ5A 2IVWA 1VQ4A 3QUIA 5CKFA 1P92A 5LJ5j 3DB3A 2RA2A 4ATOA 1WQWA 3JCMf 4BY6B 5LJ3j 4F7UF 3EFRA 2ZPIB 4J6YA 5GAMe 1G3SA 2DIQA 4BACA 3URGA 4IKFA 4C92C 2XD0A 3LWIA 3SD4A 2RHYA 1HK9A 4B9XA 3M58A 4J5YA 1YJ9A 3GPLA 4RCCA 4E7JA 1KQSS 1G3WA 2BKDN 4R56A 5A2QE 3HP9A 2XIDA 4VUBA 3OS0A 2L3RA 4C92G 3SFMA 2XI9A 4CRIA 3CCLT 2RJCA 3QG1A 3QZ5B 3M59A 1VQLA 2DXTA 4M78F 3L2UA 4KULA 2YHTA 1G3YA 2XICA 4BI3A 5GAMf 3CMAA 1NJIC 2HQEA 2ZPFB 1N9RA 5D6XA 4HCCA 3BDUA 5IT9E 2E41A 4J6WA 4OB1B 4QQGA 4PJOE 5M9OA 1KG1A 1TH7A 3PMTA 4MZMA 3I56T 3G4ST 3E19A 5GAN8 3GOXA 4JJNK 5DM7R 2F5TX 5FU7B 4LDXA 3HRSA 3QZ9B 4X34A 3NTKA 3PTAA 1PSFA 3E9GA 2YRVA 3OBYA 2F69A 5GAOr 4M7AA 2QQRA 3R6OA 5GMKl 2DK3A 3ASKA 1MGQA 2MI6A 2WSEE 4PLIA 2FYKA 5GMKm 5IAYA 2DAQA 2RJFA 2KDSA 5CO7A 1VQMT 3G7ZA 4PL6A 4Y28E 3FRNA 1VQ6A 3HFOA 3MEWA 4BY6C 5KE2A 4ELYC 2WSCE 3M57A 4M7DB 4MDWA 3VKIA 2CGHA 1VQOT 4M77A 3CPWS 3PFSA 1O9SA 3JCMP 1I5LA 1BI2A 1N9SA 2V8IA 3MO8A 3OYHA 3CD6T 1QVGS 4M7DF 3OYJA 5LJ5g 4EMKA 2K5LA 3OYCA 3CCRT 1KD1C 3OYFA 1W2BA 4FT4A 3CCQT 1VQOA 2Y4YA 4M77B 5LJ3g 3CPWA 1M9SA 2X4XA 1YIJA 2A3LA 3HHTB 3JCMX 4EMKB 2ZZDA 2KK4A 1W4SA 4HCBA 4M75A 4JRPA 4M7DD 5FLXE 2KSSA 3MP1A 4JLIA 4OB0B 4J83A 4ZN3A 4LDUA 1SSFA 3T9NA 5I2MA 5KCHA 2HNIA 1BI3A 3G71A 5CAIA 3CMET 1YHQT 5FU7C 5GAMj 3DLMA 3OSVA 4PLLA 2BIVA 3NTIA 5CKEA 2LX9A 3RKYA 4XTXA 4BD3A 4M77D 4C5IA 1YJWT 3M5AA 5A0LA 4HT9A 1Q7YU 2Y90A 4O5VA 2CZ7B 2KMTA 3INZA 4C8QE 5GAN3 1Q7YC 3Q1JA 1NPRA 4M7AC 1WJSA 5LL6S 2VGNA 1K73U 2OTJT 3DKMA 1XQHA 2P0QA 4HA8A 1OZ3A 3JB9I 3C4SA 2YLCA 2K4YA 2LCCA 2B8AA 3OYMA 1UGQB 4XTVA 1YITA 3S3NA 1B34A 3OYYA 4BDZA 4A53A 2XG8D 5GAN2 3PIPA 2OTLA 4JUVA 3QYHB 4M77C 5CKHA 4PJOF 3QJYA 4KBMB 3GP8A 1S72T 3G6EA 1JRIA 2RJEA 1U1TA 2P0PA 1VQ9A 2DXCA 2DD5A 1YCYA 4EMKC 1VQ8T 1VQPA 3DB4A 3QYGB 4J8OA 2VC8A 4M77G 1Q86U 2ZPGB 2E1HA 3O8VA 3CC2A 5GAN5 2OAUA 2QI2A 3JCMg 1KHIA 1G3TA 4XQ3A 4A54A 2YLBA 3L2VA 1VQ7T 3OSSC 3HKSA 2HQXA 1D3BB 3CC7A 5GANh 2VGMA 3OYDA 3RERA 4C5EA 2X35A 2IG0A 3OMCA 4M75C 2MWPA 3ZEHA 3GIBA 4F7UA 2FHDA 4BE2A 4ME7A 3CCST 2E10A 3CCEA 2QQAA 1KQ1A 1WQ7A 1G5VA 3JB9F 1FX7A 2RO0A 4FIBA 2RJDA 4A4HA 2LTOA 4M7AE 2EAYA 4F7UB 2RK1A 4FU6A 2EKOA 5GAMg 2R5AA 3HFNA 1VQNA 2K57A 2QEXA 4HCZA 3HL8A 4XU0A 1VQKT 2V8KA 5HKCA 2QA4A 1Y7XA 5LJ5d 1BI1A 2VXEA 4NL2A 3PNWC 3V7CA 3JB9D 2DIGA 2DXUA 2CS7A 2CZ1B 3QO3A 3RUXA 4JS4A 5LJ3d 2RB6A 3OS5A 4M78B 2RI2A 2CKKA 2LRQA 5EG2A 3NFCA 1FWZA 3A8LB 2KY9A 3L2QA 2PU9B 3OMGA 2PVGB 5CR2A 5KE3A 3L2RA 3V7SA 1K73C 5IN1A 5D6YA 2EFIA 3OYBA 1VIFA 1KQSA 5I2SA 2DVEA 1NJIU 2L5QA 4NL3A 4R55A 3HRTA 2A7YA 3VUZA 3RMSA 5AYFA 3CCLA 1JB0E 4M75E 4DOWA 1M1KU 2O4XA 3ER0A 2RHUA 3LH0A 4M78D 4C8QF 3H6ZA 2E6ZA 5CCAA 4QW2A 1QW1A 5GANe 5GAN4 3I55T 2D6FA 4E7IA 3JB9G 4QVZA 1Q86C 1UGPB 2JUFA 3NTHA 2EJ9A 4GLKA 3V8KA 5GAOq 3V8LA 4M7DA 2O4XB 1QVPA 3M4YA 1IZ6A 5HK0A 3I56A 3G4SA 2PUKB 4HT8A 3UWNA 1JJ2S 3KUFA 4EMHA 3E9FA 4C8QD 3KXTA 2KVQG 1Q82U 4Z02A 2EJGA 3WXMB 5I21A 2LT1A 3M55A 4F7UG 2LCLA 1KHCA 3OYKA 5GANf 4C92E 1LOJA 4DQ2A 1KC8U 3QDRB 3SDZA 4C0FA 2LVMA 1VQMA 2HAXA 2PUOB 3GNFB 4M78C 4XU2A 2R58A 3FIFA 1QP2A 5GAOp 1I8FA 2JZ2A 2XDBA 2LT4A 2X4JA 3BW1A 3L42A 3LW5E 5KCOA 4IUVA 4M78G 3ZBDA 1K9MU 2MWOA 3CPFA 4LDWA 2EQKA 3JCMV 2DD4A 3JCMd 1YJNT 2H3JA 1QVGA 3CD6A 5HY6A 3CCRA 1HXDA 3CBMA 3BFMA 1BKBA 2RK2A 4E47A 5J3BA 3M4GA 4C5GA 5A0DA 3CCQA 2DTIA 1XOVA 3OW2S 2QQSA 4IURA 5FRNA 1KQ2A 2O01E 3FLGA 3V7RA 3WVDB 2RHZA 3OS1A 4J7IA 2D9TA 2CZ0B 1EIFA 3BY7A 4PKCC 3OW2A 1UB4A 3CCVT 5GAMd 2PVOB 2RI3A 3N5BB 2EJFA 3A8OB 1PSEA 1WGSA 4L59A 4LD6A 2LDMA 5J26A 3JCMc 3OYEA 3CMEA 4JDSA 1YHQA 1XNIA 2EIFA 2DKGA 2XHCA 3OQ5A 3QKJA 4N4IA 2E64A 3VV0A 4NOYA 2KQWA 5KH6A 2BUDA 2R5MA 1WJRA 2RD1A 2D0QB 3MEVA 3LWHA 5GAN6 1YJWA 3UDCA 4MMKA 1M1KC 4M7DC 4IUPA 1NZ9A 2FVUA 2Y4XA 1Q81U 2F5KA 3S6WA 3S3MA 3JRZA 2K2VA 1LNXA 1YI2T 4ELZC 3CCMT 3EFSA 3OYLA 4M7DG 4PJOB 4XTYA 4BE1A 4E7HA 3A8GB 2OTJA 2QTXA 4Q5WA 3FC3A 4ZTFA 3M53A 4TVRA 3OYNA 5GANj 1X6OA 2X4YA 2JOYA 1NE8A 1Q82C 3SWNA 2E70A 2MMPA 1D3BA 2JTFA 4X9DA 3JCMb 1N6AA 5CQYA 4NS5A 1KC8C 3X20B 3JAME 1M1FA 3VYHB 4XK8E 1S72A 2GFUA 2EWNA 3SWNB 4KT0E 1M1GA 3WVEB 4ZGEB 1AHJB 2E6NA 2ZGWA 1VQ8A 3C12A 4PJOD 2K5FA 5CQXA 3C94A 3CCUT 4BDYA 3AHUA 3MEAA 4OB2B 5CK9A 2CYZB 1K9MC 1WPYA 5GMKh 3MEUA 1VUBA 2DJZA 2PVDB 4E7KA 3OS2A 4P5NA 1VQ7A 3M9QA 4C92F 3HRUA 3V8JA 4YTLA 3OB9A 2M1HA 4XU1A 4EMGA 4E7LA 5HK3A 2JNGA 4DOVA 3UPUA 4IUTA 4M7DE 4RG8A 3UT1A 3CCSA 2I2LA 4A4GA 1M4ZA 3ME9A 4M78A 4N4HA 2XKOC 3QIIA 4OMFB 5CVIA 3X25B 4L5GA 3CCJT 2RHIA 5FU6B 3CC4T 1BI0A 2RHXA 4PJOC 4C92D 4KUIA 1Y96B 4C0GA 5CKDA 1VQ5T 4M77E 1VQ4T 3MHXA 5GAN7 1VQKA 3OY9A 4PJOG 5GMKi 2RH2A 4ZTJA 4QVCA 2WSFE 4C8QA 3H8ZA 5DY9A 4B9WA 1O75A 1Q81C 1BYMA 1I81A 3CEYA 4FT2A 3VUBA 2KAFA 4JRKA 3OA6A 1NPPA 1VIEA 4WF2A 4D6WA 4N0AA 4XTZA 1YJ9T 2C06A 4OF1A 4ZGDB 3E1SA 2CZ6B 4JRIA 4C8QB 3SWNC 2K3YA 1H3ZA 5GANg 3P8HA 1YBYA 4BI8B 4A4FA 3JB9J 3PMIA 3QBYA 5FROA 4C0DB 3BDLA 2E65A 4LDYA 3TCJA 1VQLT 2LC4A 2PQWA 2JN0A 2XU8A 1ZBXA 3PT9A 2R57A 3J80E 3CMAT 2G3RA 5C0MA 3QJ6A 3TREA 3CXCS 3META 1QP3A 3MP6A 4FM4B 3VYGA 4QQ6A 5LJ5h 3QHSA 2M16A 2M0OA 5CKBA 5GMKe 2LQ8A 2JTMA 2JVVA 2MF2A 3MCAB 4GY5A 4OVAA 4OGCA 5LJ3h 4DA4A 4C0ZA 3L2ZA 3PGGA 1U8RA 1IREB 2EQJA 4QVDA 3I55A 4JRQA 3CXCA 4CI0C 4C5HA 1QVFS 3OBWA 4V2SA 3TU4K 3LGLA 5FU6C 2HBPA 2GCXA 4RCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SB2 A;  3BY7 A;  1YCY A;  4EMK C;  1WQW A;  3RKX A;  4M77 G;  3JCM f;  5LJ3 j;  2VC8 A;  1M5Q 1;  4F7U F;  3EFR A;  2EJF A;  5GAM d;  5GAO m;  3JCM W;  4J6X A;  4J6Y A;  5GAM e;  3JCM c;  2E1H A;  5GAN 5;  2DKG A;  3JCM g;  4C92 C;  2E64 A;  4A54 A;  4XQ3 A;  1HK9 A;  1U1S A;  4J5Y A;  4NOY A;  2YLB A;  2RD1 A;  4RCC A;  1D3B B;  5GAN 6;  5GAN h;  3RER A;  4MMK A;  4M7D C;  4M75 C;  4Y91 A;  4C92 G;  3GIB A;  4F7U A;  1LNX A;  2DXT A;  4M78 F;  4M7A B;  4C8Q C;  2E10 A;  2YHT A;  3EFS A;  4M7D G;  4PJO B;  1KQ1 A;  1WQ7 A;  4XTY A;  3RIR A;  5GAM f;  3JB9 F;  2DZ9 A;  1N9R A;  2QTX A;  4M7A F;  3BDU A;  4M7A E;  4C8Q G;  2E41 A;  4J6W A;  4N0A C;  2EAY A;  4MML A;  3RES A;  4F7U B;  5GAM g;  1TH7 A;  5GAN j;  4PJO E;  3HFN A;  4X9C A;  2K57 A;  3SWN A;  5GAN 8;  4XU0 A;  1D3B A;  4X9D A;  3VU3 C;  3JCM b;  5LJ5 d;  4F7U E;  2VXE A;  1X01 A;  4NL2 A;  4XTU A;  3V7C A;  2DXU A;  5LJ5 e;  3JB9 D;  3QO3 A;  5GAO r;  4M7A A;  3RUX A;  5GMK l;  5LJ3 d;  4M7A D;  4PJO A;  4M77 F;  2EWN A;  1MGQ A;  3SWN B;  2RB6 A;  4PJO D;  2FYK A;  2ZGW A;  4M78 B;  5GMK m;  5LJ3 e;  3QSU A;  1H64 1;  3AHU A;  3L1A A;  3JCM h;  1WPY A;  5GMK h;  3V7S A;  4M78 E;  1LJO A;  3HFO A;  1BIB A;  2DJZ A;  4M7D B;  2VXF A;  4M75 B;  4C92 F;  2CGH A;  2DVE A;  3V8J A;  4M77 A;  5LJ5 f;  4NL3 A;  4XU1 A;  4EMG A;  3JCM P;  1I5L A;  1N9S A;  2RM4 A;  4M7D F;  4M7D E;  5LJ3 f;  4M75 F;  2DTH A;  4M75 E;  4EMK A;  5LJ5 g;  2I2L A;  4M78 A;  5GMK j;  4M78 D;  4C8Q F;  5GAN d;  4M77 B;  5LJ3 g;  4C92 A;  3FJP A;  5GAN e;  5GAM h;  5GAN 4;  4PJO C;  4C92 D;  1Y96 B;  3JB9 G;  3JCM X;  4EMK B;  3V8K A;  5GAO q;  2EJ9 A;  4M77 E;  3V8L A;  4M7D A;  4OP0 A;  4M7A G;  5GAN 7;  4M75 A;  4HT8 A;  4M7D D;  1M8V A;  4PJO G;  4M75 D;  4JLI A;  5GMK i;  4EMH A;  4C92 B;  4QVC A;  4C8Q A;  2HNI A;  3FB9 A;  5DY9 A;  4C8Q D;  5CAI A;  5I21 A;  2EJG A;  4PNO A;  4F7U G;  1I81 A;  5GAM j;  3HSB A;  4JRK A;  1JBM A;  4C92 E;  1LOJ A;  4WF2 A;  4XU3 A;  4DQ2 A;  4N0A A;  4XTZ A;  3RKY A;  4XTX A;  5GAO n;  2FB7 A;  4M77 D;  5GAO l;  4C8Q B;  1B34 B;  4JRI A;  3SWN C;  1Y96 A;  5GAN g;  4HT9 A;  4M78 C;  3JB9 J;  4XU2 A;  1BIA A;  3FIF A;  5GAO p;  2Y90 A;  1I8F A;  2E65 A;  2DEQ A;  3BW1 A;  3JB9 H;  3INZ A;  5GAN 3;  2DZC A;  2JN0 A;  4C8Q E;  3JCM Q;  4M78 G;  4M7A C;  5GAN f;  3JCM d;  3JCM V;  5LJ5 h;  4XTW A;  4HA8 A;  1I4K 1;  3QHS A;  3JCM e;  1HXD A;  3JB9 I;  3BFM A;  5GMK e;  2YLC A;  3M4G A;  5LJ3 h;  3L2Z A;  2DTI A;  3PGG A;  4XTV A;  2DTO A;  4M75 G;  1WNL A;  4QVD A;  1B34 A;  1KQ2 A;  3V7R A;  4A53 A;  5GAN 2;  3JCM J;  3RKW A;  4V2S A;  4JUV A;  4M77 C;  4PJO F;  3QUI A;  5LJ5 j;  4RCB A;  1JRI A;  2RA2 A;  1U1T A; 
#chains in the Genus database with same CATH topology
 2QDY B;  2NUP A;  2EBP A;  2K2M A;  2LQK A;  1GXI E;  3F70 A;  4E2F B;  4FL6 A;  4FYX B;  4QQD A;  1U1S A;  3GLX A;  4KH1 B;  1ZSG A;  4JLG A;  1WJQ A;  2JM9 A;  4M7A B;  3RIR A;  2LNV A;  1W2B S;  4C0D C;  1I07 A;  4M7A F;  3RMQ A;  1YNZ A;  4MML A;  3THK A;  1PKT A;  1Y57 A;  3OYG A;  5IHK A;  4WTO B;  3FDR A;  3VU3 C;  2JJ9 A;  4JZ3 A;  3G71 T;  2XDD A;  1EZZ B;  1H64 1;  2LZ6 B;  1DJ7 B;  1LJO A;  2GBQ A;  1M1K R;  3FEO A;  2KEA A;  2V8J A;  2RMO A;  3CCQ Q;  3VS4 A;  3I5S A;  2E5Q A;  2V1Q A;  1YJN Q;  4KUD K;  1MNE A;  3FJP A;  2RQU A;  3MP8 A;  1PD0 A;  1RL2 A;  1UJY A;  1M8V A;  3G6E T;  1VQ9 T;  2YUN A;  4RKU E;  1K8A C;  3FB9 A;  4EDU A;  1M90 C;  4RMO A;  4PNO A;  3CC2 T;  4F04 B;  3HSB A;  4FW2 A;  2EVR A;  3QDF A;  4WCI A;  2FB7 A;  2ZPB B;  4J9I A;  3ZL7 C;  2DZC A;  1PKS A;  1R8O B;  4BB7 A;  2LX7 A;  4OMQ A;  1YI2 Q;  1I4K 1;  3QPH A;  3CCM Q;  4ZGJ B;  3REA B;  3H0F A;  3A8H B;  5CIU A;  4GBQ A;  2QEX T;  4M75 G;  3EGU A;  2FEI A;  1WHJ A;  3HPW A;  3CXC P;  3RKW A;  2L8D A;  5IH2 A;  1PNJ A;  4ATO A;  4F7U F;  1NLO C;  4RUG A;  1G3S A;  2DIQ A;  2RQR A;  1HK9 A;  3NGP A;  3M58 A;  3GPL A;  1KQS S;  5A2Q E;  2FZK B;  1YCS B;  2F2W A;  2KT1 A;  1WXT A;  2LP5 A;  2XID A;  5GJW B;  4E6R A;  2DYI A;  2EW3 A;  3QG1 A;  1VQL A;  3M59 A;  5KYU B;  2DXT A;  4M78 F;  2G6F X;  2YHT A;  1G3Y A;  5GAM f;  3CMA A;  5D6X A;  4HCC A;  4OB1 B;  4QQG A;  1VQK Q;  4MZM A;  5GAN 8;  3GOX A;  5FU7 B;  4X34 A;  1OU8 A;  3E9G A;  2YRV A;  4M7A A;  1PRM C;  2DK3 A;  3TSZ A;  1WLP B;  2DAQ A;  2KDS A;  1VQM T;  3FRN A;  1G83 A;  1YJ9 Q;  4MDW A;  3CPW S;  3PFS A;  1I5L A;  5LJ5 g;  2K5L A;  4KRT A;  4FT4 A;  3CCQ T;  1VQO A;  2PZ1 A;  1R0B G;  8AT1 B;  2GTJ A;  2CSQ A;  4ZNX A;  3HHT B;  4ORZ A;  3JCM X;  4A63 B;  4FCY A;  1OX8 A;  2FRY A;  2PTK A;  4J83 A;  1SSF A;  5KCH A;  5I2M A;  1BI3 A;  3G71 A;  5CAI A;  3CME T;  1YHQ T;  2FZC B;  4PFZ A;  5GAM j;  2BZ8 A;  2JXB A;  4BD3 A;  4M77 D;  4PK4 A;  2DEU A;  1E6H A;  2CP3 A;  2D8H A;  4HT9 A;  1TG0 A;  1T3L A;  1WFW A;  1WI7 A;  4M7A C;  2OTJ T;  1K0S A;  2KXC A;  2P0Q A;  4HA8 A;  4OMM A;  1T0J A;  2K4Y A;  1Q95 G;  4OMO A;  2B8A A;  3OYM A;  1UGQ B;  1YIJ Q;  2XG8 D;  3PIP A;  4AMC A;  4JUV A;  3QYH B;  4PJO F;  1S72 T;  3G6E A;  1VQ9 A;  2DXC A;  3QYG B;  2NUT B;  2YDL A;  3CC2 A;  3O8V A;  2OAU A;  2QI2 A;  1TTH B;  2C0T A;  1WXU A;  4A54 A;  1PC0 A;  2YLB A;  4AFU C;  2VGM A;  3LH5 A;  3OYD A;  4F7U A;  2FG0 A;  2F2X A;  2FHD A;  1X6G A;  1ZBJ A;  1WQ7 A;  1FX7 A;  4FIB A;  2LTO A;  2CP2 A;  2DL3 A;  2QEX A;  4HCZ A;  4XU0 A;  1VQK T;  1SPK A;  3M0R A;  4HXJ A;  2AIR B;  3RUX A;  1I5O B;  3OS5 A;  2RI2 A;  1C0M A;  8ATC B;  1UTI A;  2LRQ A;  2EYW A;  3OMG A;  5KE3 A;  1EX4 A;  5IN1 A;  5D6Y A;  1WHK A;  2KXD A;  1W70 A;  3CC7 Q;  1QCO A;  1XJW B;  1NJI U;  4HVV A;  5AYF A;  4M75 E;  3CCJ Q;  1T0H A;  3PE0 A;  4QW2 A;  2HSP A;  2HL5 C;  4J9D A;  4Z89 A;  2O4X B;  5IHI A;  4HT8 A;  2QA4 Q;  2EGE A;  4EMH A;  1W6X A;  4C8Q D;  5I21 A;  2EJG A;  2LJ3 A;  4F7U G;  1D1B A;  1KHC A;  4K11 A;  3VS2 A;  3QDR B;  1KSW A;  4C0F A;  1QLY A;  1UFF A;  1VQM A;  5EC7 A;  2O2O A;  4M78 C;  2EGC A;  2R58 A;  5GAO p;  3EG3 A;  2LT4 A;  2X4J A;  4M78 G;  3ZBD A;  1K9M U;  2DD4 A;  1QVG A;  4DBF A;  1BKB A;  2RK2 A;  1KD1 R;  1M8M A;  2D1X A;  3CCQ A;  2ECZ A;  7AT1 B;  2QQS A;  3I9Q A;  4IUR A;  3V7R A;  3WVD B;  2ED0 A;  2RHZ A;  4AT1 B;  3OS1 A;  4J7I A;  2D9T A;  2CZ0 B;  1EIF A;  4PKC C;  1TXQ A;  1UB4 A;  5GAM d;  4LD6 A;  3A8O B;  2LMJ A;  3CME A;  4L59 A;  2DL4 A;  1YHQ A;  4JPB W;  3QKJ A;  2E64 A;  2COY A;  4NOY A;  2R5M A;  2L2P A;  3MEV A;  1M1K C;  5GAN 6;  4MMK A;  2IPO B;  2QTV A;  2JS2 A;  4ELZ C;  1WHG A;  1AWJ A;  4J9F A;  2OTJ A;  4Q5W A;  3FC3 A;  2E3I A;  1X6O A;  2X4Y A;  1Q82 C;  2DNU A;  5IXB A;  3JCM b;  4NS5 A;  1M2V A;  3JAM E;  1M1F A;  1S72 A;  1OV3 A;  4KT0 E;  2E6N A;  3CCU T;  4BDY A;  3AHU A;  4OB2 B;  1IHV A;  2QAS A;  3MEU A;  2PVD B;  4FSS A;  4E7K A;  1SG5 A;  4C92 F;  3EGD B;  3OB9 A;  2M1H A;  1SHF A;  1ABO A;  2JNG A;  2KI7 A;  2YRC A;  4ESR A;  3QWY A;  1SF9 A;  3ME9 A;  2XKO C;  3CCJ T;  2RHI A;  5FU6 B;  3CC4 T;  4PJO C;  4KUI A;  5FWB A;  5KYW A;  5GAN 7;  1VQK A;  4PJO G;  5GMK i;  5DY9 A;  4B9W A;  1I81 A;  1VQ8 Q;  4XTZ A;  4ZGD B;  3A1P A;  2CZ6 B;  4JRI A;  4BI8 B;  4A4F A;  1X2K A;  1K73 R;  3QBY A;  4C0D B;  2I0N A;  2PQW A;  1PWT A;  1ZBX A;  4PJN A;  1GCQ A;  2G3R A;  3QJ6 A;  3MET A;  4FM4 B;  3QHS A;  3FJ5 A;  4C0Z A;  2HZY A;  1MMA A;  2EQJ A;  4QVD A;  3CXC A;  2LQW A;  2CH4 A;  2GQI A;  3OBW A;  4V2S A;  3TU4 K;  2HBP A;  2DM1 A;  3SB2 A;  4UC4 A;  1JJ2 A;  4MDX A;  1EFN A;  4Y92 A;  2O9S A;  2KRO A;  5GAO l;  3RKX A;  1HD3 A;  3O5Z A;  3JB9 H;  4HKE A;  1K8A U;  1M90 U;  3J81 E;  1M27 C;  5FRM A;  2P4T A;  4PJL A;  2L3P A;  4BUG A;  1WA7 A;  1H3H A;  2X4W A;  3I56 Q;  1X43 A;  3CBO A;  2AHJ B;  1Y71 A;  2DA9 A;  4KGV B;  1IGU A;  5GJV B;  4F7U E;  1VYV A;  3P8B B;  1GCQ C;  4M77 F;  2CP0 A;  3ZFJ A;  2YXY A;  3GNG A;  1AWW A;  5KYX A;  2EQU A;  2KRS A;  2RNA A;  4M78 E;  2LJ0 A;  3VS5 A;  1OI1 A;  1QKW A;  4M75 B;  1V76 A;  5AT1 B;  5A0G A;  1PD1 A;  2O88 A;  5LJ3 f;  4M75 F;  2DTH A;  3P8D A;  4LUD A;  2DXB A;  1OZ2 A;  2CUD A;  2QAZ A;  3A5Z B;  4HVU A;  4EIK A;  3VS0 A;  4C92 A;  5GAM h;  2M9U A;  2GQV A;  2RI5 A;  2DBM A;  3OYA A;  5DLQ E;  3EGD A;  5D6W A;  2ZPE B;  1VQP T;  1UEB A;  4IUU A;  2QQ9 A;  2O31 A;  3C95 A;  1UGS B;  3RR6 A;  3CCV Q;  2D0N A;  4XU3 A;  3CCU A;  3S3O A;  4EPC A;  2AT1 B;  1U3O A;  1RI0 A;  1BIA A;  1MND A;  2KNB B;  3CCE T;  3JCM Q;  1U5S A;  4XTW A;  1N8R C;  3CCJ A;  4J7F A;  2DTO A;  3CC4 A;  1WNL A;  2E4H A;  2DIL A;  1X2Q A;  1P92 A;  1YFN A;  3DB3 A;  2W10 A;  4PJM A;  3SHW A;  1WQW A;  4IIO A;  3JCM f;  5LJ3 j;  3EFR A;  2MYS A;  1RAC B;  2ZPI B;  2QGF B;  4J6Y A;  5GAM e;  1QVF P;  1R77 A;  4IKF A;  4C92 C;  3SD4 A;  4J5Y A;  1G3W A;  3HP9 A;  1K9A A;  4C92 G;  1LPL A;  2EPD A;  2XI9 A;  4CRI A;  1IO6 A;  1RAA B;  2FPE A;  1SSH A;  3JV3 A;  4PJO E;  2EGA A;  5M9O A;  2KR3 A;  2VAS A;  3I56 T;  4LDX A;  3QZ9 B;  1W2B P;  3PTA A;  1PSF A;  1VQ4 Q;  3OBY A;  2F69 A;  3EHQ A;  2QQR A;  1NM7 A;  1BK2 A;  2FYK A;  5GMK m;  1I1J A;  5IAY A;  1IXD A;  3NPF A;  4PL6 A;  3HFO A;  1FMW A;  3MEW A;  5KE2 A;  2H8H A;  3VKI A;  2AK5 A;  1VQO T;  4M77 A;  3U23 A;  1K76 A;  1O9S A;  1BCO A;  1N9S A;  3CD6 T;  1D09 B;  2P4R A;  1QVG S;  4HVW A;  4EMK A;  1KD1 C;  3OYF A;  2QDL A;  1M9S A;  2X4X A;  2A3L A;  2ZZD A;  2KK4 A;  1SRL A;  2V26 A;  4M75 A;  4M7D D;  2PNI A;  4OB0 B;  1UG1 A;  4ZN3 A;  3ULR B;  3T9N A;  1KFZ A;  3OSV A;  1VOM A;  2BIV A;  4PLL A;  3UAT A;  2YRD A;  4XTX A;  2H3E B;  3RDV A;  1YJW T;  5A0L A;  1VQ6 Q;  2CT3 A;  3TQ7 P;  2KYM A;  5GAN 3;  3Q1J A;  1AZE A;  1NPR A;  2FO0 A;  2VGN A;  1E6G A;  1IB8 A;  2COZ A;  2EYX A;  2YLC A;  3C4S A;  4DEX A;  1Q82 R;  4AFZ C;  2X3W D;  1T3S A;  3OYY A;  5GAN 2;  1G8X A;  2RN8 A;  2ED1 A;  4M77 C;  4KBM B;  3GP8 A;  5L23 A;  1U1T A;  1JQQ A;  2DD5 A;  1YCY A;  4EMK C;  2KE9 A;  3DB4 A;  4M77 G;  1VQP A;  1X27 A;  4XQ3 A;  1VQ7 T;  1D3B B;  3RER A;  1FMK A;  1C6V X;  2X35 A;  4M75 C;  1JXM A;  3CCE A;  1KQ1 A;  1KQS P;  4F7U B;  2RK1 A;  4OMN A;  4KGZ B;  1BI1 A;  2VXE A;  3PNW C;  2OTL Q;  3JB9 D;  3QO3 A;  5LJ3 d;  1TSF A;  2RB6 A;  4M78 B;  3A8L B;  2KY9 A;  3UA6 A;  5CR2 A;  2NYS A;  1K73 C;  1RAD B;  1VIF A;  4GLM A;  4R55 A;  2LJ1 A;  3VUZ A;  1AZG B;  4D8D A;  3EH1 A;  1WDX A;  1M1K U;  2RHU A;  3EFO B;  1VQ5 Q;  3CPW P;  1QW1 A;  1UGV A;  4J9H A;  2X51 A;  1E7O A;  4QVZ A;  1U06 A;  1Q86 C;  1RAH B;  4GLK A;  3I56 A;  5HK0 A;  1JJ2 S;  4J9C A;  2L0A A;  2FPF A;  1Q82 U;  1BBZ A;  2JT4 A;  2JW4 A;  2KVQ G;  4Z02 A;  2LNH B;  2J6F A;  2MCN A;  5GAN f;  4C92 E;  1RLP C;  4F14 A;  2ABL A;  2K6D A;  4CC4 B;  3GNF B;  1JEG A;  1YWO A;  2XDB A;  5KCO A;  1OUL A;  4LDW A;  3JCM d;  3D7S B;  1YJN T;  3CD6 A;  2H3J A;  5HY6 A;  2XMF A;  1QWE A;  2KGT A;  4C5G A;  3OW2 S;  3FLG A;  1NG2 A;  2SRC A;  1F1B B;  4AG2 C;  1ABQ A;  4LXC A;  2COW A;  2PVO B;  2RI3 A;  5J26 A;  1D1C A;  2MOX A;  3JCM c;  1XNI A;  2EIF A;  3EG9 A;  2RF0 A;  1YJW A;  2BTT A;  1NZ9 A;  2W0Z A;  2JMA A;  1IHW A;  2F5K A;  3S3M A;  3JRZ A;  1YI2 T;  2A08 A;  3CCM T;  3EFS A;  4PJO B;  4RTZ A;  3M53 A;  3CCR Q;  1K0X A;  4TVR A;  5GAN j;  1M30 A;  3H41 A;  2MMP A;  1D3B A;  1N6A A;  1TUC A;  3X20 B;  1KJW A;  2DL8 A;  1K1Z A;  3WVE B;  4JJC A;  2K5F A;  5I11 A;  2KT8 A;  1M2V B;  5I22 A;  4P5N A;  3REB B;  3M9Q A;  1VQ7 A;  4YTL A;  1X69 A;  2DVJ A;  3UPU A;  4IUT A;  1N8R R;  4R0K A;  4M78 A;  1YIT Q;  4N4H A;  3QII A;  5CVI A;  3X25 B;  2M51 A;  2RHX A;  4C0G A;  5CKD A;  1VQ5 T;  1AVZ C;  4M77 E;  1K4U S;  2YUO A;  3KFV A;  4ZTJ A;  2WSF E;  3H8Z A;  2CUB A;  4FW1 A;  1Q81 C;  3CEY A;  5KYW B;  4JRK A;  1NYF A;  1NPP A;  4N0A A;  2C06 A;  1YJ9 T;  2ROL A;  3EFO A;  3H0I A;  4OF1 A;  1CSK A;  1WX6 A;  1YBY A;  4JZ4 A;  3PMI A;  5FRO A;  3BDL A;  2E65 A;  1Y0M A;  4LDY A;  3TCJ A;  3UF4 A;  2LC4 A;  1GCP A;  2R57 A;  2FRW A;  3PVL A;  3MP6 A;  1MV0 B;  2M0O A;  2M16 A;  3CCS Q;  2JTM A;  2JVV A;  1YP5 A;  5LJ3 h;  2QK0 A;  3L2Z A;  1M3C A;  1ZA2 B;  4ANJ A;  4C5H A;  3LGL A;  4RCB A;  3H9N A;  3M54 A;  2VUB A;  1M5Q 1;  1QVF A;  1QQJ A;  2HQH A;  1H92 A;  5DLO A;  1UJ0 A;  5FW9 A;  2BE7 D;  3CCL Q;  1V29 B;  4MZT A;  4OGE A;  2DYB A;  2XK0 A;  3VS6 A;  1FXX A;  5ECA A;  2DZ9 A;  4N4G A;  1YJN A;  4N0A C;  1YIJ T;  3RES A;  3G4S Q;  1V1C A;  1MHN A;  1UE9 A;  1OQK A;  2FL7 A;  4X9C A;  2A28 A;  2DRK A;  3I55 Q;  1ZQ1 A;  2MIO A;  4XTU A;  1N8R U;  2K5I A;  2ZAE A;  4M7A D;  4PJO A;  4ZN1 A;  5LJ3 e;  2D8J A;  3L1A A;  3JCM h;  1Y07 A;  2VB6 A;  3X24 B;  1BIB A;  3LGF A;  1N27 A;  2VXF A;  5LJ5 f;  5KYX B;  4DBQ A;  2DO3 A;  1AD5 A;  3A8M B;  3X28 B;  3JSC A;  3CCM A;  1YI2 A;  4LDV A;  2VV5 A;  1ZHI A;  2K9G A;  5GAN d;  1YIT T;  2L89 A;  2J6K A;  1D0Y A;  2ZCF B;  3TEE A;  4JJD A;  2VYT A;  2GFA A;  2QQB A;  1S1N A;  2EYQ A;  2XDP A;  4D8K A;  4C92 B;  1KC8 R;  3EAE A;  3KBG A;  2GNC A;  1ZA1 B;  1JBM A;  5GAO n;  1X75 C;  2QXF A;  1IGQ A;  4FYY B;  3CC7 T;  2HBW A;  4II1 A;  2P84 A;  2DEQ A;  3X26 B;  4QT7 A;  2BZY A;  2DL7 A;  4J9E A;  3JCM e;  4FSX A;  2NWM A;  3E2U A;  1XTD A;  1QCN A;  2QA4 T;  1TS9 A;  1NEB A;  1VQ5 A;  1KD1 U;  2K3X A;  3VS7 A;  2CRE A;  1I0C A;  4F16 A;  5LJ5 j;  5FWC A;  2RA2 A;  1M3B A;  2DJQ A;  2YT6 A;  2M0Y A;  3I5R A;  3AT1 B;  4FYW B;  2XD0 A;  1WHL A;  1YJ9 A;  2A37 A;  4RCC A;  2BKD N;  4VUB A;  3OS0 A;  3CCL T;  3QZ5 B;  1ZUY A;  2XIC A;  4BI3 A;  2HQE A;  2ZPF B;  1N9R A;  1Q86 R;  2E41 A;  2HSE B;  1KG1 A;  3PMT A;  1YWP A;  3G4S T;  3E19 A;  4JJN K;  2F5T X;  4B6M A;  3HRS A;  3NTK A;  3UA7 A;  2AZV A;  2DE0 X;  4M4Z A;  2WSE E;  4PLI A;  1NYG A;  5IHN A;  4BY6 C;  4ELY C;  2WSC E;  1OX9 A;  1CKB A;  2CGH A;  3JCM P;  1BI2 A;  3MO8 A;  1VQL Q;  3OYJ A;  3OYC A;  3CMA Q;  4E7Z A;  4M77 B;  3CPW A;  1AWO A;  1YIJ A;  3GBQ A;  4LE9 A;  4EMK B;  1RUW A;  1W4S A;  4HCB A;  5FLX E;  2KSS A;  2ESW A;  4JLI A;  2KYB A;  2ENM A;  4LDU A;  1AOJ A;  3DLM A;  3RKY A;  2LX9 A;  4X1V A;  1WHH A;  2Y90 A;  2KMT A;  3INZ A;  2CT4 A;  1HJD A;  1WJS A;  1HYO A;  1K73 U;  3DKM A;  1XQH A;  1OZ3 A;  3JB9 I;  3A98 A;  5KYY B;  2CDT A;  4XTV A;  4QKU A;  2JS0 A;  1YIT A;  3S3N A;  1UDL A;  5CKH A;  5D7U A;  3QJY A;  2RJE A;  2P0P A;  1VQ8 T;  1Q86 U;  2VC8 A;  3G71 Q;  1RAB B;  2E1H A;  5GAN 5;  1Z9Z A;  2YWW A;  2HEQ A;  2EQI A;  1KHI A;  1G3T A;  3OSS C;  3HKS A;  2HQX A;  3CC7 A;  3BE3 A;  5GAN h;  3OMC A;  3ZEH A;  3GIB A;  4ME7 A;  5HCK A;  2RO0 A;  3EH2 A;  4A4H A;  1QWF A;  5GAM g;  2V8K A;  2QA4 A;  5LJ5 d;  2DL5 A;  2MK5 A;  2DXU A;  1Q81 R;  2CS7 A;  2CZ1 B;  4JS4 A;  4F17 A;  3M0Q A;  2CKK A;  5EG2 A;  3NFC A;  1RAG B;  3CC2 Q;  3L2R A;  4J9G A;  2EFI A;  3OYB A;  5I2S A;  4NL3 A;  1UHC A;  2GGR A;  2A7Y A;  2HCK A;  3CCL A;  2DFU A;  2X9H A;  1JB0 E;  2MPX C;  3ER0 A;  2IIM A;  3LH0 A;  4C8Q F;  5CCA A;  2E6Z A;  1WXB A;  5GAN e;  2D6F A;  4E7I A;  3JB9 G;  5GAO q;  3V8K A;  1QVG P;  2EJ9 A;  1MUZ A;  3V8L A;  2QEX Q;  1PG5 B;  1QVP A;  3G4S A;  1ARK A;  1LVK A;  2PUK B;  3UWN A;  1R0C B;  3E9F A;  1OPK A;  3M55 A;  2LCL A;  3OYK A;  4DQ2 A;  1M2O A;  2QGG A;  3SDZ A;  2LVM A;  2HAX A;  1D1A A;  2PUO B;  3TSW A;  4XU2 A;  3FIF A;  1QP2 A;  1KIK A;  1BB9 A;  3BW1 A;  3L42 A;  3LW5 E;  4OML A;  1VA7 A;  4IUV A;  2CP5 A;  1NEG A;  2MWO A;  3JCM V;  2EQK A;  1HXD A;  5J3B A;  5A0D A;  6AT1 B;  1UUE A;  3SEM A;  2DTI A;  1OEB A;  1XOV A;  1SRM A;  1GRI A;  1JXO A;  2O01 E;  3VS1 A;  4KH0 B;  1TOV A;  2E3H A;  3BY7 A;  2K7A A;  1G2B A;  3CCV T;  1H8K A;  3OYE A;  3JCM W;  2HKQ B;  5KYY A;  2XHC A;  2DKG A;  2KQW A;  4RTU A;  2RD1 A;  3EGX B;  3LWH A;  1VQM Q;  3UDC A;  1BU1 A;  1Q81 U;  2Y4X A;  3S6W A;  2K2V A;  3M0T A;  3EG9 B;  3OYL A;  2HKN A;  1Q7Y R;  2BZX A;  4XTY A;  4BE1 A;  3A8G B;  2QTX A;  4ZTF A;  1RAF B;  2M02 A;  1NE8 A;  3SWN A;  2E70 A;  2JTF A;  4X9D A;  2NUZ A;  1KC8 C;  4AG1 C;  1N5Z A;  4ZGE B;  1VQ8 A;  1JO8 A;  3C94 A;  5CQX A;  3CME Q;  1YHQ Q;  5CK9 A;  1WPY A;  2FZG B;  1TU0 B;  1VUB A;  2DJZ A;  2RPN A;  3V8J A;  4XU1 A;  4EMG A;  5HK3 A;  4M7D E;  4A4G A;  1ZSZ B;  4L5G A;  2OTJ Q;  2VKN A;  1BI0 A;  4RTT A;  4C92 D;  1Y96 B;  3EG0 A;  1VQ4 T;  3MHX A;  1AWX A;  1PRL C;  4C8Q A;  1S72 Q;  1BYM A;  2YUQ A;  2KAF A;  3OA6 A;  1MV3 A;  4WF2 A;  1JJ2 P;  3E1S A;  1H3Z A;  3SWN C;  2K3Y A;  3P8H A;  5IXF A;  2HL3 A;  4JJB A;  4LNP A;  1UEC A;  1M3A A;  2CP6 A;  2XU8 A;  1C1A A;  3J80 E;  5C0M A;  3TRE A;  3CXC S;  5LJ5 h;  4QQ6 A;  1VQN Q;  2LQ8 A;  3MCA B;  2MF2 A;  1MMG A;  2J05 A;  1PHT A;  3PGG A;  2RQT A;  1U8R A;  1IRE B;  4JRQ A;  2JM8 A;  1Q7Y U;  4PFO A;  1MMN A;  4MZP A;  5L8R E;  3OW2 P;  2GF7 A;  5C6S A;  5GAO m;  4J6X A;  1GL5 A;  2KBT A;  3M56 A;  4JS5 A;  1VQ6 T;  3DLL A;  3J7A F;  4LD9 K;  2C0O A;  2DPP B;  4L6V 5;  4E7S A;  4Y91 A;  1NLP C;  2EYZ A;  4BI4 A;  1WHM A;  4C8Q C;  4A4K A;  2DX1 A;  3VRY A;  1TWB A;  2P0K A;  3QXE B;  2NLU A;  2RQV A;  4C8Q G;  1AEY A;  3EGX A;  2J6O A;  1RLQ C;  1GFC A;  1ZUU A;  4BE0 A;  2EQM A;  1X01 A;  5LJ5 e;  4XAX B;  3CCV A;  3QSU A;  3TVT A;  3OYI A;  2F2V A;  3PIO A;  1NJI R;  1OYX A;  2OX7 A;  3VRZ A;  3L2W A;  1AT1 B;  2RM4 A;  1KK7 A;  2JMC A;  2WAC A;  2B86 A;  4J9B A;  5GMK j;  2AKK A;  2KRN A;  3GF5 A;  2HD0 A;  1FMV A;  1OOT A;  2OTL T;  1D0Z A;  1BCM A;  4OP0 A;  4LN2 A;  4PFP A;  4M7A G;  4M75 D;  2KRM A;  3LX7 A;  4CC3 A;  3LLR A;  3EG2 A;  1J3T A;  1ZSZ A;  4A4E A;  2K79 A;  2MAM A;  1B34 B;  4IUQ A;  1Y96 A;  3LYI A;  4OB3 B;  1K9M R;  2E12 A;  4O6J A;  2V1R A;  2ZPH B;  4RG2 A;  3VJP A;  1RAI B;  1SEM A;  1VQN T;  1UGR B;  2OJ2 A;  5J39 A;  3CBP A;  3JCM J;  2IVW A;  1VQ4 A;  3QUI A;  3PVQ A;  5CKF A;  4RTY A;  2DLP A;  3NHN A;  3I35 A;  4BY6 B;  2VVK A;  1GFD A;  1B7T A;  4BAC A;  5KYU A;  3URG A;  3LWI A;  2RHY A;  4B9X A;  3CCU Q;  4E7J A;  4R56 A;  3QWX X;  2L3R A;  2CSI A;  3SFM A;  2RJC A;  3L2U A;  4KUL A;  1RAE B;  1ZSZ C;  1PCX A;  3BDU A;  5IT9 E;  4J6W A;  1TH7 A;  2CH4 W;  2A0F B;  3CC4 Q;  2LQN A;  2L3Q A;  5DM7 R;  1TUG B;  2F1L A;  5GAO r;  1LCK A;  3R6O A;  5GMK l;  1Z9Q A;  3ASK A;  3HTR A;  1MGQ A;  2MI6 A;  2DMO A;  2RJF A;  5CO7 A;  4DEY A;  3G7Z A;  4Y28 E;  1VQ6 A;  3M0S A;  3M57 A;  4M7D B;  1QMC A;  2V8I A;  3OYH A;  4M7D F;  3CCR T;  1W2B A;  2Y4Y A;  5LJ3 g;  3VS3 A;  2O9V A;  1GBR A;  2LCS A;  4JRP A;  3MP1 A;  4PJJ A;  2HNI A;  1QCF A;  5FU7 C;  2YUP A;  4CC7 A;  5CKE A;  3NTI A;  4C5I A;  3M5A A;  4DBH A;  1ACM B;  4O5V A;  4RTW A;  2CZ7 B;  1Q7Y C;  4C8Q E;  1B3Q A;  5LL6 S;  4AFQ C;  4KGX B;  4AFS C;  2LCC A;  2HDA A;  2VWF A;  1B34 A;  1JU5 C;  4BDZ A;  2NUT A;  4A53 A;  2OTL A;  1JRI A;  4RTV A;  4J8O A;  2ZPG B;  1K8A R;  1M90 R;  3M0U A;  1HSQ A;  3JCM g;  1PM3 A;  3L2V A;  1WIE A;  2L3S A;  2C0I A;  4C5E A;  2IG0 A;  9ATC B;  2MWP A;  4BE2 A;  1ZUK A;  3CCS T;  2E10 A;  2QQA A;  1G5V A;  3JB9 F;  1YN8 A;  2RJD A;  2DER A;  4M7A E;  2EAY A;  4FU6 A;  2EKO A;  2R5A A;  3HFN A;  1VQN A;  2K57 A;  3HL8 A;  5HKC A;  1Y7X A;  1A0N B;  4NL2 A;  3V7C A;  2DIG A;  1NBE B;  1VQP Q;  1GBQ A;  1FWZ A;  3L2Q A;  2PU9 B;  2PVG B;  2DBK A;  3V7S A;  1WYX A;  1KQS A;  2K3B A;  2DVE A;  2L5Q A;  3H0H A;  3HRT A;  2E5K A;  1ZLM A;  3RMS A;  3RBB B;  4DOW A;  3CCE Q;  2O4X A;  1CKA A;  1RI9 A;  4M78 D;  2EKH A;  3H6Z A;  2SEM A;  3R6N A;  2OI3 A;  5GAN 4;  3I55 T;  4DBR A;  3MJX A;  1UGP B;  1X6B A;  2JUF A;  3NTH A;  4M7D A;  3M4Y A;  1IZ6 A;  4FYV B;  2QG9 B;  3KUF A;  1ZX6 A;  1D0X A;  2ATC B;  3KXT A;  3WXM B;  2LT1 A;  1SHG A;  2AZS A;  2QYZ A;  1LOJ A;  1KC8 U;  1MMD A;  4Z8A A;  1I8F A;  2JZ2 A;  2HMA A;  2YSQ A;  2J06 A;  2NUP B;  2FPD A;  3CPF A;  3G1J A;  4CC2 A;  3CCR A;  3CBM A;  3BFM A;  4E47 A;  3M4G A;  2BE9 B;  2A36 A;  1WZO A;  1KQ2 A;  1IRX A;  3OW2 A;  3EHR A;  3N5B B;  2EJF A;  1PSE A;  1WGS A;  1NJI C;  1VYT A;  2LDM A;  3EG1 A;  4JDS A;  3OQ5 A;  4N4I A;  3VV0 A;  1UHF A;  2BUD A;  5KH6 A;  1WJR A;  2D0Q B;  3M0P A;  5KYN A;  4M7D C;  4IUP A;  2FVU A;  1LNX A;  1VQO Q;  4M7D G;  3C0C A;  2OAW A;  4E7H A;  3CD6 Q;  2CP7 A;  1OPL A;  3OYN A;  2JOY A;  3MKD A;  2X3X D;  5CQY A;  3VYH B;  4XK8 E;  2GFU A;  2EWN A;  3SWN B;  1M1G A;  4PJO D;  1AHJ B;  2ZGW A;  3C12 A;  3MEA A;  2CYZ B;  1K9M C;  5GMK h;  1QKX A;  4HCK A;  1B07 A;  3OS2 A;  1YJW Q;  3HRU A;  1TUD A;  4E7L A;  4DOV A;  4RG8 A;  3UT1 A;  1W1F A;  2DRM A;  3CCS A;  2I2L A;  2DET A;  3NMZ C;  1M4Z A;  4IIM A;  4OMF B;  2ROT A;  4LUE A;  2J7I A;  2RQW A;  3G6E Q;  4OMP A;  3CQT A;  1VQ9 Q;  3MPU B;  2EYY A;  3OY9 A;  2RH2 A;  1SKU B;  4QVC A;  1O75 A;  2DF6 A;  4FT2 A;  4RTX A;  3IQL A;  3VUB A;  1VIE A;  4D6W A;  4C8Q B;  5GAN g;  2Z0W A;  3JB9 J;  1VQL T;  1VQ7 Q;  2JN0 A;  2GTO A;  3PT9 A;  3CMA T;  1QP3 A;  3VYG A;  4Z88 A;  5CKB A;  5GMK e;  4OVA A;  5FRN A;  4DA4 A;  4GY5 A;  4OGC A;  3RNJ A;  1FYN A;  3I55 A;  2AKL A;  2JTE A;  4CI0 C;  1QVF S;  5FU6 C;  2GCX A;  1OU9 A;  1VYU A; 
#chains in the Genus database with same CATH homology
 2QDY B;  4MZP A;  4UC4 A;  5L8R E;  3SB2 A;  1JJ2 A;  4MDX A;  3M54 A;  5GAO l;  3RKX A;  2VUB A;  1M5Q 1;  2GF7 A;  5C6S A;  2LQK A;  3JB9 H;  5GAO m;  1QVF A;  4J6X A;  3JCM W;  1GXI E;  4HKE A;  3M56 A;  3F70 A;  5DLO A;  4JS5 A;  1VQ6 T;  4FL6 A;  3DLL A;  3J7A F;  4QQD A;  4LD9 K;  1U1S A;  3GLX A;  2DPP B;  4L6V 5;  1K8A U;  1M90 U;  4JLG A;  1WJQ A;  1V29 B;  4MZT A;  4OGE A;  3J81 E;  4Y91 A;  4BI4 A;  4M7A B;  4C8Q C;  2XK0 A;  5FRM A;  4A4K A;  2P4T A;  1FXX A;  2LNV A;  3RIR A;  1W2B S;  2DZ9 A;  4N4G A;  4BUG A;  4C0D C;  1YJN A;  2P0K A;  4M7A F;  3QXE B;  2NLU A;  3RMQ A;  2X4W A;  4C8Q G;  4N0A C;  1YIJ T;  4MML A;  3RES A;  1MHN A;  2FL7 A;  3CBO A;  4X9C A;  2AHJ B;  3OYG A;  1Y71 A;  3FDR A;  3VU3 C;  1ZQ1 A;  4F7U E;  4BE0 A;  2EQM A;  1X01 A;  4XTU A;  5LJ5 e;  3P8B B;  1N8R U;  3G71 T;  2K5I A;  4M7A D;  4XAX B;  4M77 F;  4ZN1 A;  2XDD A;  4PJO A;  5LJ3 e;  3CCV A;  3ZFJ A;  3QSU A;  3GNG A;  3OYI A;  3PIO A;  1H64 1;  3L1A A;  1OYX A;  3JCM h;  1DJ7 B;  1Y07 A;  2EQU A;  4M78 E;  1LJO A;  3X24 B;  1BIB A;  3LGF A;  1N27 A;  2VXF A;  1OI1 A;  4M75 B;  5LJ5 f;  3FEO A;  5A0G A;  3L2W A;  2RM4 A;  2V8J A;  5LJ3 f;  1YI2 A;  2DO3 A;  2DTH A;  3A8M B;  4M75 F;  3JSC A;  3X28 B;  3CCM A;  3P8D A;  4LDV A;  2VV5 A;  1ZHI A;  2DXB A;  1OZ2 A;  2E5Q A;  2WAC A;  5GMK j;  5GAN d;  4KUD K;  3A5Z B;  1YIT T;  4C92 A;  3FJP A;  2L89 A;  3GF5 A;  3MP8 A;  2HD0 A;  5GAM h;  1RL2 A;  2ZCF B;  2M9U A;  3TEE A;  2GQV A;  2RI5 A;  2OTL T;  4OP0 A;  4M7A G;  3OYA A;  5DLQ E;  2VYT A;  2GFA A;  2QQB A;  5D6W A;  3G6E T;  4M75 D;  1M8V A;  2EYQ A;  2XDP A;  2ZPE B;  3LX7 A;  1VQ9 T;  4RKU E;  4C92 B;  1VQP T;  1K8A C;  3FB9 A;  1UEB A;  3EAE A;  4EDU A;  3KBG A;  4IUU A;  1M90 C;  2QQ9 A;  3LLR A;  4RMO A;  4PNO A;  3CC2 T;  3C95 A;  1UGS B;  3HSB A;  1JBM A;  5GAO n;  4XU3 A;  1X75 C;  3CCU A;  2QXF A;  4A4E A;  3S3O A;  2FB7 A;  4EPC A;  3CC7 T;  2MAM A;  1B34 B;  2ZPB B;  4IUQ A;  1Y96 A;  3LYI A;  4OB3 B;  1RI0 A;  4II1 A;  1BIA A;  2E12 A;  2DEQ A;  4O6J A;  3X26 B;  2DZC A;  3CCE T;  3JCM Q;  2ZPH B;  4RG2 A;  1R8O B;  4BB7 A;  4XTW A;  1I4K 1;  3QPH A;  3VJP A;  4FSX A;  3JCM e;  4ZGJ B;  1N8R C;  3A8H B;  5CIU A;  1VQN T;  3CCJ A;  4J7F A;  1UGR B;  2DTO A;  2QEX T;  1XTD A;  4M75 G;  5J39 A;  3CC4 A;  1WNL A;  3CBP A;  2QA4 T;  3HPW A;  3JCM J;  3RKW A;  2L8D A;  1KD1 U;  2K3X A;  1VQ5 A;  2IVW A;  1VQ4 A;  3QUI A;  5CKF A;  1P92 A;  5LJ5 j;  3DB3 A;  2RA2 A;  4ATO A;  1WQW A;  3JCM f;  4BY6 B;  5LJ3 j;  4F7U F;  3EFR A;  2ZPI B;  4J6Y A;  5GAM e;  1G3S A;  2DIQ A;  4BAC A;  3URG A;  4IKF A;  4C92 C;  2XD0 A;  3LWI A;  3SD4 A;  2RHY A;  1HK9 A;  4B9X A;  3M58 A;  4J5Y A;  1YJ9 A;  3GPL A;  4RCC A;  4E7J A;  1KQS S;  1G3W A;  2BKD N;  4R56 A;  5A2Q E;  3HP9 A;  2XID A;  4VUB A;  3OS0 A;  2L3R A;  4C92 G;  3SFM A;  2XI9 A;  4CRI A;  3CCL T;  2RJC A;  3QG1 A;  3QZ5 B;  3M59 A;  1VQL A;  2DXT A;  4M78 F;  3L2U A;  4KUL A;  2YHT A;  1G3Y A;  2XIC A;  4BI3 A;  5GAM f;  3CMA A;  1NJI C;  2HQE A;  2ZPF B;  1N9R A;  5D6X A;  4HCC A;  3BDU A;  5IT9 E;  2E41 A;  4J6W A;  4OB1 B;  4QQG A;  4PJO E;  5M9O A;  1KG1 A;  1TH7 A;  3PMT A;  4MZM A;  3I56 T;  3G4S T;  3E19 A;  5GAN 8;  3GOX A;  4JJN K;  5DM7 R;  2F5T X;  5FU7 B;  4LDX A;  3HRS A;  3QZ9 B;  4X34 A;  3NTK A;  3PTA A;  1PSF A;  3E9G A;  2YRV A;  3OBY A;  2F69 A;  5GAO r;  4M7A A;  2QQR A;  3R6O A;  5GMK l;  2DK3 A;  3ASK A;  1MGQ A;  2MI6 A;  2WSE E;  4PLI A;  2FYK A;  5GMK m;  5IAY A;  2DAQ A;  2RJF A;  2KDS A;  5CO7 A;  1VQM T;  3G7Z A;  4PL6 A;  4Y28 E;  3FRN A;  1VQ6 A;  3HFO A;  3MEW A;  4BY6 C;  5KE2 A;  4ELY C;  2WSC E;  3M57 A;  4M7D B;  4MDW A;  3VKI A;  2CGH A;  1VQO T;  4M77 A;  3CPW S;  3PFS A;  1O9S A;  3JCM P;  1I5L A;  1BI2 A;  1N9S A;  2V8I A;  3MO8 A;  3OYH A;  3CD6 T;  1QVG S;  4M7D F;  3OYJ A;  5LJ5 g;  4EMK A;  2K5L A;  3OYC A;  3CCR T;  1KD1 C;  3OYF A;  1W2B A;  4FT4 A;  3CCQ T;  1VQO A;  2Y4Y A;  4M77 B;  5LJ3 g;  3CPW A;  1M9S A;  2X4X A;  1YIJ A;  2A3L A;  3HHT B;  3JCM X;  4EMK B;  2ZZD A;  2KK4 A;  1W4S A;  4HCB A;  4M75 A;  4JRP A;  4M7D D;  5FLX E;  2KSS A;  3MP1 A;  4JLI A;  4OB0 B;  4J83 A;  4ZN3 A;  4LDU A;  1SSF A;  3T9N A;  5I2M A;  5KCH A;  2HNI A;  1BI3 A;  3G71 A;  5CAI A;  3CME T;  1YHQ T;  5FU7 C;  5GAM j;  3DLM A;  3OSV A;  4PLL A;  2BIV A;  3NTI A;  5CKE A;  2LX9 A;  3RKY A;  4XTX A;  4BD3 A;  4M77 D;  4C5I A;  1YJW T;  3M5A A;  5A0L A;  4HT9 A;  1Q7Y U;  2Y90 A;  4O5V A;  2CZ7 B;  2KMT A;  3INZ A;  4C8Q E;  5GAN 3;  1Q7Y C;  3Q1J A;  1NPR A;  4M7A C;  1WJS A;  5LL6 S;  2VGN A;  1K73 U;  2OTJ T;  3DKM A;  1XQH A;  2P0Q A;  4HA8 A;  1OZ3 A;  3JB9 I;  3C4S A;  2YLC A;  2K4Y A;  2LCC A;  2B8A A;  3OYM A;  1UGQ B;  4XTV A;  1YIT A;  3S3N A;  1B34 A;  3OYY A;  4BDZ A;  4A53 A;  2XG8 D;  5GAN 2;  3PIP A;  2OTL A;  4JUV A;  3QYH B;  4M77 C;  5CKH A;  4PJO F;  3QJY A;  4KBM B;  3GP8 A;  1S72 T;  3G6E A;  1JRI A;  2RJE A;  1U1T A;  2P0P A;  1VQ9 A;  2DXC A;  2DD5 A;  1YCY A;  4EMK C;  1VQ8 T;  1VQP A;  3DB4 A;  3QYG B;  4J8O A;  2VC8 A;  4M77 G;  1Q86 U;  2ZPG B;  2E1H A;  3O8V A;  3CC2 A;  5GAN 5;  2OAU A;  2QI2 A;  3JCM g;  1KHI A;  1G3T A;  4XQ3 A;  4A54 A;  2YLB A;  3L2V A;  1VQ7 T;  3OSS C;  3HKS A;  2HQX A;  1D3B B;  3CC7 A;  5GAN h;  2VGM A;  3OYD A;  3RER A;  4C5E A;  2X35 A;  2IG0 A;  3OMC A;  4M75 C;  2MWP A;  3ZEH A;  3GIB A;  4F7U A;  2FHD A;  4BE2 A;  4ME7 A;  3CCS T;  2E10 A;  3CCE A;  2QQA A;  1KQ1 A;  1WQ7 A;  1G5V A;  3JB9 F;  1FX7 A;  2RO0 A;  4FIB A;  2RJD A;  4A4H A;  2LTO A;  4M7A E;  2EAY A;  4F7U B;  2RK1 A;  4FU6 A;  2EKO A;  5GAM g;  2R5A A;  3HFN A;  1VQN A;  2K57 A;  2QEX A;  4HCZ A;  3HL8 A;  4XU0 A;  1VQK T;  2V8K A;  5HKC A;  2QA4 A;  1Y7X A;  5LJ5 d;  1BI1 A;  2VXE A;  4NL2 A;  3PNW C;  3V7C A;  3JB9 D;  2DIG A;  2DXU A;  2CS7 A;  2CZ1 B;  3QO3 A;  3RUX A;  4JS4 A;  5LJ3 d;  2RB6 A;  3OS5 A;  4M78 B;  2RI2 A;  2CKK A;  2LRQ A;  5EG2 A;  3NFC A;  1FWZ A;  3A8L B;  2KY9 A;  3L2Q A;  2PU9 B;  3OMG A;  2PVG B;  5CR2 A;  5KE3 A;  3L2R A;  3V7S A;  1K73 C;  5IN1 A;  5D6Y A;  2EFI A;  3OYB A;  1VIF A;  1KQS A;  5I2S A;  2DVE A;  1NJI U;  2L5Q A;  4NL3 A;  4R55 A;  3HRT A;  2A7Y A;  3VUZ A;  3RMS A;  5AYF A;  3CCL A;  1JB0 E;  4M75 E;  4DOW A;  1M1K U;  2O4X A;  3ER0 A;  2RHU A;  3LH0 A;  4M78 D;  4C8Q F;  3H6Z A;  2E6Z A;  5CCA A;  4QW2 A;  1QW1 A;  5GAN e;  5GAN 4;  3I55 T;  2D6F A;  4E7I A;  3JB9 G;  4QVZ A;  1Q86 C;  1UGP B;  2JUF A;  3NTH A;  2EJ9 A;  4GLK A;  3V8K A;  5GAO q;  3V8L A;  4M7D A;  2O4X B;  1QVP A;  3M4Y A;  1IZ6 A;  5HK0 A;  3I56 A;  3G4S A;  2PUK B;  4HT8 A;  3UWN A;  1JJ2 S;  3KUF A;  4EMH A;  3E9F A;  4C8Q D;  3KXT A;  2KVQ G;  1Q82 U;  4Z02 A;  2EJG A;  3WXM B;  5I21 A;  2LT1 A;  3M55 A;  4F7U G;  2LCL A;  1KHC A;  3OYK A;  5GAN f;  4C92 E;  1LOJ A;  4DQ2 A;  1KC8 U;  3QDR B;  3SDZ A;  4C0F A;  2LVM A;  1VQM A;  2HAX A;  2PUO B;  3GNF B;  4M78 C;  4XU2 A;  2R58 A;  3FIF A;  1QP2 A;  5GAO p;  1I8F A;  2JZ2 A;  2XDB A;  2LT4 A;  2X4J A;  3BW1 A;  3L42 A;  3LW5 E;  5KCO A;  4IUV A;  4M78 G;  3ZBD A;  1K9M U;  2MWO A;  3CPF A;  4LDW A;  2EQK A;  3JCM V;  2DD4 A;  3JCM d;  1YJN T;  2H3J A;  1QVG A;  3CD6 A;  5HY6 A;  3CCR A;  1HXD A;  3CBM A;  3BFM A;  1BKB A;  2RK2 A;  4E47 A;  5J3B A;  3M4G A;  4C5G A;  5A0D A;  3CCQ A;  2DTI A;  1XOV A;  3OW2 S;  2QQS A;  4IUR A;  5FRN A;  1KQ2 A;  2O01 E;  3FLG A;  3V7R A;  3WVD B;  2RHZ A;  3OS1 A;  4J7I A;  2D9T A;  2CZ0 B;  1EIF A;  3BY7 A;  4PKC C;  3OW2 A;  1UB4 A;  3CCV T;  5GAM d;  2PVO B;  2RI3 A;  3N5B B;  2EJF A;  3A8O B;  1PSE A;  1WGS A;  4L59 A;  4LD6 A;  2LDM A;  5J26 A;  3JCM c;  3OYE A;  3CME A;  4JDS A;  1YHQ A;  1XNI A;  2EIF A;  2DKG A;  2XHC A;  3OQ5 A;  3QKJ A;  4N4I A;  2E64 A;  3VV0 A;  4NOY A;  2KQW A;  5KH6 A;  2BUD A;  2R5M A;  1WJR A;  2RD1 A;  2D0Q B;  3MEV A;  3LWH A;  5GAN 6;  1YJW A;  3UDC A;  4MMK A;  1M1K C;  4M7D C;  4IUP A;  1NZ9 A;  2FVU A;  2Y4X A;  1Q81 U;  2F5K A;  3S6W A;  3S3M A;  3JRZ A;  2K2V A;  1LNX A;  1YI2 T;  4ELZ C;  3CCM T;  3EFS A;  3OYL A;  4M7D G;  4PJO B;  4XTY A;  4BE1 A;  4E7H A;  3A8G B;  2OTJ A;  2QTX A;  4Q5W A;  3FC3 A;  4ZTF A;  3M53 A;  4TVR A;  3OYN A;  5GAN j;  1X6O A;  2X4Y A;  2JOY A;  1NE8 A;  1Q82 C;  3SWN A;  2E70 A;  2MMP A;  1D3B A;  2JTF A;  4X9D A;  3JCM b;  1N6A A;  5CQY A;  4NS5 A;  1KC8 C;  3X20 B;  3JAM E;  1M1F A;  3VYH B;  4XK8 E;  1S72 A;  2GFU A;  2EWN A;  3SWN B;  4KT0 E;  1M1G A;  3WVE B;  4ZGE B;  1AHJ B;  2E6N A;  2ZGW A;  1VQ8 A;  3C12 A;  4PJO D;  2K5F A;  5CQX A;  3C94 A;  3CCU T;  4BDY A;  3AHU A;  3MEA A;  4OB2 B;  5CK9 A;  2CYZ B;  1K9M C;  1WPY A;  5GMK h;  3MEU A;  1VUB A;  2DJZ A;  2PVD B;  4E7K A;  3OS2 A;  4P5N A;  1VQ7 A;  3M9Q A;  4C92 F;  3HRU A;  3V8J A;  4YTL A;  3OB9 A;  2M1H A;  4XU1 A;  4EMG A;  4E7L A;  5HK3 A;  2JNG A;  4DOV A;  3UPU A;  4IUT A;  4M7D E;  4RG8 A;  3UT1 A;  3CCS A;  2I2L A;  4A4G A;  1M4Z A;  3ME9 A;  4M78 A;  4N4H A;  2XKO C;  3QII A;  4OMF B;  5CVI A;  3X25 B;  4L5G A;  3CCJ T;  2RHI A;  5FU6 B;  3CC4 T;  1BI0 A;  2RHX A;  4PJO C;  4C92 D;  4KUI A;  1Y96 B;  4C0G A;  5CKD A;  1VQ5 T;  4M77 E;  1VQ4 T;  3MHX A;  5GAN 7;  1VQK A;  3OY9 A;  4PJO G;  5GMK i;  2RH2 A;  4ZTJ A;  4QVC A;  2WSF E;  4C8Q A;  3H8Z A;  5DY9 A;  4B9W A;  1O75 A;  1Q81 C;  1BYM A;  1I81 A;  3CEY A;  4FT2 A;  3VUB A;  2KAF A;  4JRK A;  3OA6 A;  1NPP A;  1VIE A;  4WF2 A;  4D6W A;  4N0A A;  4XTZ A;  1YJ9 T;  2C06 A;  4OF1 A;  4ZGD B;  3E1S A;  2CZ6 B;  4JRI A;  4C8Q B;  3SWN C;  2K3Y A;  1H3Z A;  5GAN g;  3P8H A;  1YBY A;  4BI8 B;  4A4F A;  3JB9 J;  3PMI A;  3QBY A;  5FRO A;  4C0D B;  3BDL A;  2E65 A;  4LDY A;  3TCJ A;  1VQL T;  2LC4 A;  2PQW A;  2JN0 A;  2XU8 A;  1ZBX A;  3PT9 A;  2R57 A;  3J80 E;  3CMA T;  2G3R A;  5C0M A;  3QJ6 A;  3TRE A;  3CXC S;  3MET A;  1QP3 A;  3MP6 A;  4FM4 B;  3VYG A;  4QQ6 A;  5LJ5 h;  3QHS A;  2M16 A;  2M0O A;  5CKB A;  5GMK e;  2LQ8 A;  2JTM A;  2JVV A;  2MF2 A;  3MCA B;  4GY5 A;  4OVA A;  4OGC A;  5LJ3 h;  4DA4 A;  4C0Z A;  3L2Z A;  3PGG A;  1U8R A;  1IRE B;  2EQJ A;  4QVD A;  3I55 A;  4JRQ A;  3CXC A;  4CI0 C;  4C5H A;  1QVF S;  3OBW A;  4V2S A;  3TU4 K;  3LGL A;  5FU6 C;  2HBP A;  2GCX A;  4RCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...