5EC7A

Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 5.0
rcsb
source organism Gallus gallus
total genus 12
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ec7A00
3H0IA 1PNJA 1X69A 2YUNA 1EFNA 4JPBW 3NMZC 1I0CA 2EYXA 4RUGA 2KRNA 3TSZA 2DRKA 1HD3A 4HXJA 4F17A 3VS4A 2ROLA 2V1RA 1E6HA 2J05A 2RF0A 2NWMA 2MCNA 1BB9A 3C0CA 1SHGA 2GBQA 1VYVA 1X27A 4AFSC 2JTEA 4F14A 2FO0A 2KRSA 2BTTA 3PVQA 3UF4A 1MUZA 5FWBA 2L0AA 2DNUA 1ZUKA 1UECA 3I35A 1M27C 2W0ZA 1GCQA 4M4ZA 2DL7A 2OJ2A 1UFFA 2EYYA 2RPNA 1NM7A 4HVUA 1QLYA 1K0SA 2GNCA 2GQIA 1SEMA 2A36A 3NHNA 2BZXA 1RI9A 4AFZC 1JQQA 2EVRA 5I22A 1NLPC 2FRWA 1HJDA 1I1JA 4A63B 1H92A 3M0PA 1BU1A 2DL4A 4GBQA 1SPKA 3VS7A 1ZUUA 1CKAA 4OMOA 1UJ0A 1NEBA 1OOTA 2GGRA 1FMKA 1VYTA 1YP5A 2AKKA 1KJWA 2FEIA 2KGTA 1KSWA 2X3XD 2CT4A 4AG1C 1Z9QA 1CSKA 1YCSB 1SRMA 2AZVA 1PKSA 3I9QA 3REAB 1NG2A 1PWTA 2FPEA 3H41A 1AWJA 1JEGA 2PNIA 4E6RA 2DL3A 2W10A 1NLOC 2G6FX 5FW9A 2PZ1A 2IIMA 2KYBA 3EGUA 2O31A 4IIMA 2F2WA 3GBQA 3R6NA 5FWCA 5IHKA 1OV3A 2ECZA 2DE0X 3VS5A 4RTWA 2JMCA 5ECAA 1AWWA 1AZEA 2VVKA 5HCKA 1ABOA 2F2XA 2KNBB 1ZLMA 1M3BA 1ZX6A 2DX1A 2YSQA 1OEBA 1NEGA 2ED0A 3M0UA 4RTUA 1WI7A 3NPFA 2CDTA 2PTKA 1K76A 1UHCA 2J6FA 4RTYA 2J7IA 1K9AA 1V1CA 2KT1A 2LMJA 2FPDA 1M30A 4LN2A 1MV0B 1U3OA 1UE9A 2KXCA 4F16A 3M0TA 4OMQA 2CSIA 2GTJA 1TUDA 1G2BA 2KROA 2I0NA 3UA6A 1PKTA 4ORZA 2DBKA 3M0SA 1A0NB 1RLPC 2ESWA 2AK5A 1T3LA 1X43A 1PRMC 2LZ6B 4QT7A 2GTOA 2K6DA 1QCFA 2DBMA 2D8HA 2DMOA 3VRZA 2KR3A 2LX7A 2YUOA 4AFUC 4LUDA 1AEYA 2MOXA 2HSPA 1GBRA 4RTVA 2EPDA 3SHWA 2XMFA 3UA7A 1TUCA 1UGVA 3EG3A 2LQNA 1UJYA 1QKXA 2C0TA 1X6BA 2LNHB 1BBZA 1WDXA 4JJBA 3VS6A 2BZYA 1OPLA 2OI3A 4EIKA 2AZSA 2YUPA 1AD5A 3QWXX 1TG0A 2A08A 2HCKA 1H3HA 2RQTA 3EHQA 4J9DA 4D8DA 4JJDA 1KIKA 4HCKA 2SEMA 3TVTA 3H0HA 2KRMA 2CUBA 4ZNXA 2EBPA 1X6GA 2EGCA 3VRYA 2LCSA 4J9EA 2FRYA 1AOJA 2EYWA 2ED1A 4LNPA 1M3AA 3SEMA 1GCPA 2A37A 1FYNA 5IXFA 1Y57A 2YDLA 2DL8A 1CKBA 2EW3A 3EG2A 2C0OA 4J9BA 1WYXA 4J9CA 1E7OA 2DVJA 4CC3A 1K4US 2CSQA 4LUEA 3RNJA 4AG2C 1UDLA 2M0YA 1KFZA 1NYGA 1K0XA 1GRIA 1M3CA 4CC7A 2ABLA 1SRLA 2O9SA 1X2KA 2RN8A 5IH2A 1NYFA 1SSHA 2DA9A 2K2MA 1M8MA 5I11A 2L3PA 4JZ3A 2CREA 5GJWB 3KFVA 4OMNA 1MV3A 2DM1A 4Z89A 2ENMA 1ABQA 1ZBJA 2KXDA 1QWEA 3EG0A 4X1VA 2O2OA 2CH4A 1JO8A 4RTXA 2F2VA 1Z9ZA 4JJCA 1SHFA 2H8HA 2O88A 1JU5C 2YUQA 2VWFA 2E5KA 2DYBA 4HVWA 2K79A 2NUZA 1U06A 3REBB 1GL5A 2CUDA 2L3QA 1AZGB 5IHNA 4RTTA 1VA7A 2J6KA 2K9GA 3I5SA 4Z88A 2EKHA 4WCIA 4J9FA 1J3TA 1YWPA 1PHTA 4J9HA 2FG0A 2V1QA 2YT6A 3NGPA 1WXBA 2LJ3A 4GLMA 3UATA 4ESRA 5IXBA 1QKWA 2DLPA 3PE0A 5EC7A 4DEXA 4JZ4A 2CT3A 2DILA 4J9GA 1RLQC 4CC4B 2KBTA 3TSWA 2JXBA 3M0QA 1QWFA 1W6XA 1T3SA 2LP5A 4AFQC 1I07A 2MIOA 4HVVA 4KRTA 3U23A 1BK2A 3EG1A 3LH5A 1OPKA 1B3QA 2EGAA 1WLPB 1H8KA 1WXUA 2LQWA 2JMAA 1N5ZA 3THKA 2RNAA 2JW4A 3A98A 1UG1A 3O5ZA 4IIOA 1G83A 2B86A 4J9IA 2FPFA 2RQWA 3IQLA 2DRMA 2ROTA 2CH4W 2C0IA 4RTZA 1GCQC 2HDAA 1AWOA 2JT4A 2J6OA 2RQVA 1WFWA 1IO6A 4Y92A 4OMMA 2DJQA 2VKNA 1WIEA 2DL5A 2X3WD 1RUWA 3JV3A 4OMPA 1T0JA 2LJ1A 2SRCA 3PVLA 2D1XA 1W70A 2A28A 5IHIA 2KT8A 1GFDA 1LCKA 2O9VA 2D0NA 2M51A 1JXOA 2RQRA 3RBBB 2K3BA 2HEQA 1PRLC 2K7AA 1XOVA 2LJ0A 2QDLA 2KYMA 1Y0MA 2EQIA 2JM9A 2KE9A 1ZSGA 3QWYA 3I5RA 1T0HA 1YNZA 2D8JA 1X2QA 4DEYA 1E6GA 3ZL7C 1YN8A 3VS2A 3EHRA 1GFCA 2AKLA 1UTIA 2KEAA 4LE9A 2JM8A 2DF6A 1UUEA 3CQTA 2L3SA 2J06A 1UHFA 1VYUA 1AVZC 2RMOA 1WX6A 1HSQA 2RQUA 1S1NA 1JXMA 1WXTA 4OMLA 2P4RA 3VS0A 1GBQA 2EYZA 1B07A 1ARKA 2BZ8A 4Z8AA 1K1ZA 3FJ5A 3H0FA 3VS1A 1WA7A 4D8KA 4FSSA 1U5SA 2JS2A 1ZUYA 5L23A 4R0KA 5GJVB 4K11A 4CC2A 2EGEA 1YWOA 2L2PA 1W1FA 3VS3A 3M0RA 2OAWA 2JS0A 3ULRB 1AWXA 2HBWA
chains in the Genus database with same CATH superfamily
1PNJA 3KXTA 1X69A 1TXQA 2EYXA 4IUTA 4QVDA 4HXJA 3CCVA 4N0AC 3H6ZA 3VS4A 4XU0A 2V1RA 3JCMJ 2RF0A 3SD4A 1BB9A 1K8AR 1SHGA 2GBQA 1X27A 4AFSC 4XQ3A 2JTEA 4C92A 1VQKA 3G71Q 2BTTA 3UF4A 4DQ2A 4AT1B 3CBOA 3RKXA 2DNUA 4C92E 1FMVA 1UECA 3JCMc 1KK7A 5GAN8 2W0ZA 4LDYA 3HRTA 3EGXB 4M4ZA 4ELZC 1VQ7T 2RPNA 4PFPA 3OW2P 3ASKA 1PSFA 1HK9A 1QVFA 1K0SA 3OYGA 1SEMA 3CBMA 3NHNA 3PT9A 3QBYA 2BZXA 1RI9A 5J39A 3UT1A 1ZQ1A 2FHDA 1B34B 4J5YA 1W2BS 2KK4A 4E7SA 3FC3A 1WHMA 1VQ8Q 1HJDA 3PFSA 3M0PA 1BU1A 4GBQA 2E41A 4E7LA 3MPUB 4OP0A 5C6SA 2DVEA 1K73U 1CKAA 2KQWA 1OOTA 5D6XA 4DBQA 2AKKA 4LXCA 3M5AA 2KGTA 2MAMA 2X4XA 1D3BB 2VASA 4AG1C 4C8QD 1SRMA 1PKSA 3REAB 4C0ZA 4ZGJB 4KGVB 2RHUA 3H41A 2NUTB 1WQ7A 3L42A 1QP2A 2ZCFB 3DKMA 2DL3A 3LH0A 2G6FX 3CPWA 2O31A 4IIMA 1KD1C 1S72A 5FWCA 1PG5B 1OV3A 2ECZA 2DE0X 1TU0B 2JMCA 1AWWA 4C92D 2CYZB 3GP8A 2VVKA 1ABOA 2PU9B 2F2XA 5FRNA 5LJ5f 4PLLA 4A4KA 4M78G 3C95A 3NPFA 3VUBA 2J6FA 3MCAB 5CVIA 3FLGA 3CMET 1WJRA 4M75A 2LMJA 2X4YA 1G2BA 3UA6A 2I0NA 2ATCB 3MEVA 4MDXA 4M75E 3CC4A 2XICA 5LJ3f 1RAFB 4OF1A 1WHJA 2XG8D 1YJ9Q 1X43A 3CCET 2D0QB 4VUBA 2GTOA 1M8VA 2K3XA 1QCFA 2RI2A 2E3HA 1IHWA 2E6ZA 3EFOA 2DMOA 5CKFA 2LX7A 2DTIA 4LUDA 4M78A 2WACA 3CMAT 1AEYA 1C1AA 3MP1A 4RTVA 5KYUA 1LOJA 5HK3A 4IURA 2OTJQ 4C5HA 3UA7A 4M78E 4OB3B 1KC8R 1QCOA 4PL6A 2ZPBB 2LNHB 5M9OA 1YJNA 1VQNT 1ZA2B 3QDFA 4L6V5 5LL6S 3CXCP 3V7RA 5GAOn 4PJMA 2AZSA 3M53A 2Y4YA 3OY9A 3I55T 3NTHA 3JCMh 3TVTA 1X6GA 1EIFA 4J9EA 2FRYA 3P8BB 2ED1A 4RCBA 1IRXA 1FYNA 2IG0A 5IXFA 2YDLA 1M1FA 2YXYA 2C0OA 2Z0WA 1BI2A 2LCLA 4M75D 4LUEA 2YHTA 3L2VA 2EJ9A 3OYDA 1SG5A 2F5TX 3E2UA 4JDSA 4LDUA 3QHSA 2OX7A 1M3CA 4Y91A 1KD1U 2ABLA 2CZ7B 1SRLA 4X34A 2DA9A 3I56A 2CREA 3KFVA 4QVZA 3CCSQ 4LD6A 2HQHA 2DM1A 2EIFA 1N9RA 3TQ7P 4M77A 1HYOA 5LJ5e 2PVOB 4X1VA 3TREA 2L5QA 1YI2Q 2QK0A 2DERA 1VQPQ 2DZ9A 2MWOA 2VYTA 4M77E 4JJCA 1SHFA 2O88A 1IREB 2E5KA 3VU3C 8ATCB 3FDRA 1GL5A 3OA6A 4JRKA 4HCBA 3HL8A 4RTTA 1U1SA 1WZOA 2K9GA 3I5SA 3CCLQ 5LJ3e 1YWPA 2E64A 3OYNA 3BY7A 2FG0A 3DLMA 2DPPB 4DOVA 3CCQT 3OYMA 1G3WA 5IXBA 1QKWA 2DLPA 2KY9A 5EC7A 5GAN3 3EH2A 2DILA 2Y4XA 2X51A 3J80E 1IZ6A 2X9HA 2KBTA 2DIGA 3TSWA 1VUBA 2LP5A 2V8JA 3E19A 4AFQC 5DLOA 2MIOA 3PNWC 4JLIA 1JJ2S 1BK2A 3M58A 3G4SQ 3OBWA 1YCYA 5GANd 4C92C 4M7AG 3THKA 2CGHA 3H8ZA 1UG1A 3MEAA 1SKUB 2FPFA 1M1KC 2RQWA 3IQLA 1KQSS 5A0GA 1VQ8A 5CR2A 2HKNA 4X9DA 1AWOA 2JT4A 2VGMA 5GMKe 2DJQA 4KH0B 3UPUA 2K2VA 2VKNA 1WIEA 4RG8A 3MHXA 4M77D 1T0JA 2SRCA 4PJOG 5A0LA 1QVPA 2O4XA 3CD6A 1LCKA 4A4FA 4C92F 2FZKB 2RQRA 3RBBB 2MI6A 2JNGA 4RCCA 3CBPA 2QDLA 2E3IA 1Y0MA 2KYMA 3GNGA 3M56A 4V2SA 1VQMQ 2DTOA 3QWYA 1PM3A 3OMGA 5IAYA 4M7AA 3HTRA 2D8JA 2E5QA 1X2QA 3OSVA 4DEYA 3ZL7C 2JUFA 3VS2A 3EHRA 2RJFA 2F69A 1Y96A 1FMWA 2DYIA 3CCJT 2VXEA 4LE9A 4M7AE 2P0PA 1JBMA 2BE7D 2LX9A 2JOYA 2JM8A 4QW2A 3CQTA 2J06A 1UHFA 2RMOA 1WX6A 1Q81C 2KDSA 3FRNA 2EAYA 4C5GA 1S1NA 2QEXQ 2P0QA 1VQOQ 5KYWA 4PJOA 1GBQA 1U5SA 2JS2A 4PJOE 5L23A 1QW1A 4K11A 1BI0A 4D6WA 2EGEA 1YJNT 1W1FA 1Q86C 3C12A 1OYXA 1BCMA 3ULRB 1QVFS 2YUNA 5CCAA 1N8RC 1YITQ 5FU6B 4RUGA 1IGQA 4F17A 3QXEB 4E7IA 1YJ9A 5FLXE 4F7UG 3E1SA 2NWMA 3O8VA 1RAEB 4O5VA 2DFUA 3FB9A 1ZSZB 2JJ9A 4F7UB 5LJ3j 2OTJA 2HZYA 4J8OA 3BDLA 3N5BB 1WNLA 2RJDA 1VQLT 2M02A 1M1KU 1M27C 1GCQA 2E10A 2XKOC 3I56T 2LQKA 4M75F 1UFFA 2EYYA 3ER0A 3QDRB 4M78C 3PIOA 1QLYA 3OYAA 3VKIA 3FEOA 4NL3A 1ZA1B 2GNCA 2A36A 2NLUA 2P0KA 2RK1A 2VXFA 2RH2A 2X35A 2FRWA 5CAIA 5D6YA 4F7UA 1I1JA 6AT1B 4E7HA 4A63B 3X28B 4PJOD 3CCRQ 3EGDB 2M9UA 2IPOB 4R56A 3VS7A 2KMTA 1ZUUA 3OW2A 5GANf 4PKCC 4F7UE 1UJ0A 1KQ1A 3J81E 2DXTA 1YIJQ 4LDVA 4OGEA 3RKYA 1KSWA 1Z9QA 1CSKA 1R0CB 3G6EQ 1K73R 4E7JA 3QJ6A 2QA4Q 3RESA 2FPEA 3NTIA 1LNXA 3OBYA 3CCUQ 3JCMP 1HXDA 1Q81U 4BI4A 2EQUA 5GAMh 4FW1A 3CCMA 2MMPA 2PNIA 4KUIA 1QCNA 2HQEA 2VGNA 1NLOC 5FW9A 4RKUE 1QQJA 2KYBA 5J26A 4WF2A 2F2WA 3L2WA 4FYVB 1KG1A 1YI2A 3M59A 1YHQT 2QG9B 3CEYA 4ZTJA 5GANg 5HCKA 4C8QB 2FL7A 1NJIU 5GAN7 1Q86U 2YSQA 4FM4B 1RAGB 3M9QA 2COYA 2ED0A 2MF2A 2CDTA 4J7IA 1N8RU 2KSSA 3ME9A 3OYFA 3JB9G 3EH1A 2FPDA 5CKHA 4LN2A 1MV0B 2RHYA 1UE9A 2CSIA 2LT4A 3CD6T 1PKTA 3NFCA 2DBKA 4HA8A 1A0NB 5DLQE 3VV0A 4XU2A 3HFNA 3OB9A 4M77F 1TH7A 3G4SA 4HCCA 4BUGA 1BI1A 5A0DA 1YJWA 2KVQG 4BY6B 4TVRA 2HSPA 1UB4A 2OTLT 4BDZA 4MZMA 3ZBDA 5GAMj 1UGVA 1M1GA 4XU1A 3RKWA 3QG1A 2C0TA 1M2VB 1X6BA 3QZ9B 2QYZA 1WDXA 4JJBA 3VS6A 2GFAA 3L2QA 1TSFA 2YUPA 3BFMA 1JJ2P 1TG0A 4PFZA 5GANe 2HCKA 3EGXA 3EHQA 2R58A 4JJDA 4PJLA 4ME7A 5GMKi 2GF7A 4HCKA 1VQ6A 1YFNA 2EBPA 2KI7A 1VQMA 2GFUA 3CXCA 2EYWA 1KHCA 1WJSA 1B34A 1KQSP 4OMFB 5IN1A 1CKBA 2QQAA 4N4GA 2DVJA 1I4K1 5HY6A 3OYBA 3QPHA 1R77A 1K0XA 4M7AC 2RHZA 2QEXA 1VQOA 2O9SA 2QQ9A 4CRIA 3OYLA 2LVMA 3CC7T 2L3PA 4KGZB 1D3BA 4PJNA 4B6MA 4DBRA 4M7DG 2IVWA 2EJFA 1TOVA 4ATOA 1C0MA 2H3EB 3JB9I 4DBHA 2LT1A 4OMNA 4Z89A 5FROA 1ZBJA 1QWEA 2NUTA 1KD1R 2CH4A 1VQ7Q 4M7DB 1JO8A 3JCMQ 2F2VA 3VYGA 4PJOC 2H8HA 2V26A 1PSEA 4M7AF 2VWFA 4XTVA 1BIAA 1VQ5T 3H9NA 3JB9D 1FWZA 2DKGA 3DB4A 2NUZA 1U06A 1YITA 2YWWA 3OYJA 2L3QA 1QVGP 1VA7A 2FVUA 3JB9H 2J6KA 1D1BA 4WCIA 1J3TA 2DAQA 2V1QA 2YT6A 2PUOB 4GLMA 1MMNA 1FX7A 3CC2T 4ZTFA 1EX4A 1KHIA 4J9GA 4PJOF 3AHUA 4CC4B 2QAZA 2JXBA 1W6XA 1I07A 1M9SA 1U1TA 3U23A 3EG1A 1D0YA 3LH5A 2CP3A 3CCMT 2EGAA 3QIIA 3V8KA 1V76A 5AYFA 4XU3A 4WTOB 3PMTA 1N5ZA 5KH6A 4HT9A 2RJCA 1BI3A 4IIOA 4PK4A 1RABB 4FCYA 1XTDA 1VQ9T 1GCQC 4KULA 3CCRA 1IGUA 1I5LA 4X9CA 1WFWA 1IO6A 4OGCA 4OMMA 2HQXA 2CP2A 1RACB 2X3WD 3G7ZA 5D6WA 1RUWA 3JV3A 2P4TA 9ATCB 2QQRA 1YIJA 1W70A 2KT8A 2M0OA 1K9MC 1G5VA 1GFDA 4PLIA 2O9VA 2M51A 3V7SA 1JXOA 1ZSZC 2NUPB 3QYGB 2HEQA 3CMEQ 4BACA 2K7AA 1MGQA 3G6EA 1X75C 1RI0A 1RAIB 2JM9A 2KE9A 2D9TA 3X20B 5I2SA 3CCVT 2QA4A 3M54A 7AT1B 2OAUA 3CCUA 1M5Q1 1T0HA 1YNZA 1W4SA 3VJPA 4A4HA 1WJQA 3GLXA 1YN8A 2AKLA 2LCCA 3BDUA 3QKJA 3KBGA 1VQ4A 2X4WA 3WVEB 1VQKT 4OB0B 2DF6A 3CCEQ 2L3SA 1WGSA 1WQWA 2BUDA 2G3RA 1AVZC 2QTVA 5HK0A 1G8XA 3OYEA 3QUIA 1YJWT 4C0DC 2RQUA 2PQWA 1JXMA 2QGGA 1WXTA 4OMLA 2P4RA 3CMAQ 3Q1JA 1ARKA 4M78D 5CQXA 1K1ZA 3VS1A 4GY5A 4B9WA 2DXBA 4OB2B 2LRQA 4FSSA 3BE3A 4R0KA 5GJVB 2X4JA 2DEQA 5CIUA 1V29B 1VQNQ 4FW2A 3I55Q 2R57A 4E47A 1WPYA 4ZN3A 2RK2A 2HBWA 2I2LA 3H0IA 1Q82C 4N4IA 5FU7C 4EMHA 4LD9K 1RL2A 5L8RE 1EFNA 1VQ6T 1I0CA 1UGRB 3TSZA 3SWNB 3G71A 2ROLA 1Y7XA 4L59A 1E6HA 2QTXA 2J05A 2XI9A 2MCNA 1M90C 3L2ZA 3HRSA 2E4HA 3OW2S 3RMQA 2FO0A 4KGXB 3PMIA 3PVQA 2AIRB 5FWBA 2CP7A 2R5MA 2L0AA 2JTMA 3I35A 5LJ5h 1H3ZA 1PCXA 1S72T 2OJ2A 1OU9A 4HVUA 4YTLA 4A53A 1D0XA 1UGQB 2GQIA 3JCMW 3EG9B 4AFZC 1M1KR 3JSCA 5KYYB 3S3NA 3OYCA 1K9MU 1D09B 3G1JA 3JCMV 2ZPEB 4EMKB 1ZHIA 1H92A 2ZPGB 4QKUA 3HP9A 4JLGA 2ZPHB 5J3BA 3MO8A 4HKEA 4LDXA 4OMOA 2A3LA 5LJ3h 1G3YA 4FYWB 4Y28E 2GGRA 1FMKA 1VYTA 1YP5A 3WVDB 2MYSA 2R5AA 2FEIA 1W2BP 2X3XD 4EDUA 2MPXC 3CC4T 3PIPA 2A7YA 2CT4A 2F1LA 1JB0E 3JB9F 2AZVA 3I9QA 3CCQQ 5GAMg 4Q5WA 4EMGA 3LYIA 1XJWB 2Y90A 4ANJA 1DJ7B 2GQVA 4E6RA 4J7FA 5CKEA 2XDBA 1G3SA 2V8IA 5KCHA 1TUGB 3EGUA 1Q81R 5IHKA 1VQ7A 3JCMd 4RTWA 1PD0A 1IHVA 2YRDA 1AHJB 4OVAA 5GMKh 1M3BA 4Z02A 4FYXB 2L8DA 3QZ5B 1NJIC 3JAME 5LJ5j 3MJXA 1NEGA 4RTUA 1Q82U 1UGSB 1K76A 1UHCA 4RTYA 1U8RA 4JS5A 1MMAA 1B7TA 3A1PA 2KT1A 1M30A 2RHIA 1U3OA 1NJIR 4F16A 1Q86R 3M0TA 2L89A 2GTJA 1TUDA 4RMOA 2KROA 2D6FA 4ORZA 1M90U 1VIFA 3LGLA 3M0SA 2QDYB 1N8RR 1Q7YC 4JS4A 1O9SA 4P5NA 3M55A 2AK5A 4JRIA 3EFSA 3MP6A 1PRMC 2LZ6B 2VC8A 4QT7A 2K6DA 5KYXB 4M7DC 4M7AD 2D8HA 5FRMA 3VRZA 2YUOA 2XIDA 3CXCS 2EKOA 3RUXA 3CCJQ 1VQ4T 1TWBA 2MOXA 1SSFA 4BI8B 2XMFA 1R0BG 2LQNA 1UJYA 1QKXA 2QQSA 1OU8A 1ZSZA 4II1A 3CPWS 2BZYA 1OPLA 2HL5C 2OI3A 1AD5A 3QWXX 2JVVA 4UC4A 4J9DA 3PTAA 1YJNQ 4A54A 2KRMA 2CUBA 3DB3A 4M78F 5D7UA 4ZNXA 3S3OA 5AT1B 4MZPA 3RR6A 5GMKj 4QQ6A 3SEMA 4N4HA 1Y57A 2DL8A 2MWPA 1VIEA 2EW3A 3A8MB 1JJ2A 4MMKA 2E65A 3LLRA 4J9BA 3SFMA 4B9XA 4JJNK 3EGDA 4CC3A 1K4US 2KAFA 3G71T 1LPLA 1NPRA 3CCSA 3JRZA 3CCEA 4AG2C 1UDLA 2DIQA 4C8QG 1GRIA 1KQSA 4LDWA 2RN8A 3CMAA 5I11A 2BIVA 4JZ3A 1VQPA 4JRPA 2EWNA 2HAXA 1MV3A 3L1AA 4JRQA 2ENMA 3GOXA 1VQLQ 1ABQA 2O01E 1UGPB 5KYNA 2KXDA 2DJZA 1BKBA 2K5LA 3I56Q 5CK9A 1VQ8T 4RTXA 4J6XA 2RI3A 8AT1B 4MDWA 2E1HA 3CCLA 2DYBA 1WHHA 4HVWA 2WSCE 2K79A 3RIRA 1N6AA 3REBB 3UWNA 1P92A 2JN0A 1OZ2A 5IHNA 1Q7YU 4C92B 3QJYA 4C8QA 3BW1A 3JCMf 2EKHA 3M4GA 4C0FA 1PHTA 3ZEHA 1M2OA 1WXBA 4ESRA 3UATA 1K8AC 3PE0A 3A8OB 4C8QE 3OSSC 1RLQC 3MP8A 2DO3A 3M0QA 1QVGA 1T3SA 2BE9B 3P8DA 1WHKA 2RB6A 1IXDA 2ZPIB 4AMCA 1MMDA 4A4GA 4KRTA 4IUUA 3NTKA 2QI2A 3JCMb 1B3QA 1WLPB 2LNVA 2BKDN 1WXUA 2RM4A 2LQWA 4PFOA 2JMAA 4IUVA 2LC4A 3OS5A 2RNAA 4O6JA 3A98A 2XHCA 3FIFA 2FB7A 3O5ZA 1G83A 3P8HA 3OS0A 2HMAA 2ROTA 2CH4W 2C0IA 3JCMg 1YHQQ 3SWNC 2HDAA 5DM7R 2J6OA 4FT2A 3JCMX 3M57A 4Y92A 3HKSA 4QQDA 4XK8E 2DL5A 4MMLA 4OMPA 4XTXA 4FYYB 3PVLA 2D1XA 2A28A 3X25B 2DD4A 2QXFA 1M2VA 4IUPA 2LJ0A 3OYKA 3CCQA 3F70A 3L2UA 1YJ9T 3PGGA 1MNEA 3CD6Q 4J6YA 2PVGB 1G3TA 4MZTA 1E6GA 4GLKA 2K5FA 3HFOA 1LJOA 1UTIA 4BDYA 1QMCA 2KEAA 4FT4A 4M75G 1UUEA 2OTJT 1VYUA 4KT0E 4EMKC 4CI0C 4R55A 1Q95G 3SB2A 2EYZA 2RI5A 1B07A 1D1AA 2OTLQ 4M75B 2GCXA 4Z8AA 2HD0A 3H0FA 4BE0A 1ZUYA 5GANh 3RMSA 2RJEA 2L2PA 3VS3A 3M0RA 3GPLA 2OAWA 3C94A 1Y07A 2FZCB 3JCMe 1AWXA 2ZGWA 4QQGA 1K8AU 1TTHB 4FU6A 4M7DA 3EFOB 5GAMd 4JPBW 3NMZC 1I5OB 4M78B 2KRNA 3VYHB 2DRKA 5EG2A 5KE3A 1HD3A 5KYUB 3SDZA 3TCJA 1I8FA 4BE2A 4M7DE 5C0MA 1AT1B 4BB7A 3C0CA 3LWHA 1X6OA 1VYVA 4F14A 3CCJA 1Y71A 3URGA 1QVFP 2KRSA 3CCST 2CS7A 1MUZA 1NZ9A 5LJ5g 1ZUKA 1KC8C 2DL7A 3CC7Q 1YI2T 1EZZB 1VOMA 5FU6C 1VQPT 1NM7A 3A8HB 2NYSA 3S3MA 2XU8A 4EPCA 1JQQA 2M1HA 2EVRA 5I22A 1NLPC 2K3YA 2QQBA 5GAOq 2DL4A 4XTUA 1SPKA 2K57A 3CCLT 1WHLA 1VQ5Q 3GNFB 5LJ3g 1NEBA 3OQ5A 1K9MR 5GANj 1MMGA 4J83A 4M77G 4BE1A 1D0ZA 1KJWA 2RD1A 3JB9J 3CPWP 1I81A 4ZGEB 2CP6A 1IB8A 2JTFA 1YCSB 4XAXB 2ZPFB 1NG2A 1PWTA 4M77B 2COWA 4DA4A 3CC2Q 4NL2A 2C06A 4A4EA 1AWJA 3G4ST 2NUPA 4M7DD 1JEGA 4F7UF 2EJGA 2CKKA 4F04B 1ACMB 1OULA 1W2BA 3QO3A 2W10A 3UDCA 4NOYA 1VQLA 5HKCA 2PZ1A 4FSXA 2IIMA 2QASA 4E7KA 3WXMB 5GAOl 1RAHB 5GAN4 3CCMQ 3GBQA 3R6NA 1R8OB 3VS5A 2YRVA 5ECAA 1AZEA 2VB6A 3KUFA 2DTHA 2KNBB 1ZLMA 3X24B 4XTYA 1ZX6A 2DX1A 2CP0A 1OEBA 3M0UA 1VQ9Q 1WI7A 2EQMA 2PTKA 2EYQA 2J7IA 1K9AA 3HSBA 1V1CA 1OI1A 4N0AA 5GAOm 4XTZA 1VQMT 1OZ3A 2KXCA 3L2RA 3OYHA 4OMQA 5A2QE 1Q82R 1RLPC 2ESWA 2AHJB 4HCZA 2DETA 4DOWA 4C8QC 2XD0A 3CCVQ 1T3LA 2EQJA 3HHTB 1RAAB 2CP5A 5I21A 1N27A 2DBMA 2WSEE 1M90R 1KC8U 3TEEA 2KR3A 4AFUC 2QEXT 1VQOT 3SWNA 1XNIA 1VQKQ 2YLBA 1GBRA 2CZ6B 4XTWA 5GAMf 2EPDA 3SHWA 1TUCA 1YJWQ 4KBMB 3EG3A 1YHQA 2O4XB 1OQKA 2CZ0B 4C8QF 4PNOA 3HPWA 1BBZA 1PD1A 4KH1B 2YRCA 4EIKA 3VUZA 2M16A 2A08A 2A0FB 4M7AB 3S6WA 3R6OA 1H3HA 4E7ZA 2RQTA 4D8DA 2FZGB 1KIKA 2XDDA 2HBPA 2SEMA 1YITT 2RO0A 3H0HA 2K4YA 4BY6C 1Y96B 2COZA 3VRYA 2EGCA 2LCSA 1YBYA 3EG9A 1AOJA 2WSFE 3GIBA 4LNPA 1M3AA 1GCPA 2A37A 3A5ZB 4RG2A 5KYYA 3EG2A 4C5IA 4ELYC 1WYXA 1VQ6Q 4EMKA 2B8AA 4J9CA 1BIBA 1E7OA 5GAOp 2CSQA 2FYKA 4FL6A 5KYWB 4PJOB 1UEBA 3RNJA 1KQ2A 2M0YA 1KFZA 1NYGA 3RERA 4CC7A 4QVCA 3E9GA 5KCOA 1X2KA 5IH2A 1NYFA 1SSHA 2K2MA 1M8MA 4C0GA 1GXIE 5GJWB 2OTLA 1LVKA 3LWIA 3E9FA 2DK3A 5I2MA 4ZGDB 1OX8A 4BD3A 3EG0A 2MK5A 1QVGS 1SF9A 2O2OA 1S72Q 2DXCA 1Z9ZA 1MNDA 3CCRT 2HNIA 1JU5C 3FJPA 2YUQA 3OYIA 2E12A 5GAOr 4IKFA 1BCOA 1NBEB 1YIJT 4BI3A 3LX7A 3OS2A 2CUDA 2DZCA 3OMCA 1AZGB 3X26B 1WHGA 2DD5A 5IT9E 5GAN6 4Z88A 3EAEA 3MKDA 4J9FA 3HRUA 4ZN1A 3TU4K 4J9HA 3EFRA 3G6ET 3QYHB 1PC0A 3NGPA 2XK0A 2LJ3A 2QA4T 4E2FB 3CCUT 4DEXA 4JZ4A 2CT3A 2YLCA 3META 3CC4Q 1Q7YR 4M75C 3A8GB 1BYMA 5CKDA 1QWFA 5CQYA 4J6WA 1QP3A 2HSEB 2LQ8A 4HVVA 4KUDK 5GAMe 2RA2A 2CZ1B 2P84A 4NS5A 1OPKA 3QSUA 3V8JA 3CC7A 1H8KA 4PJJA 1FXXA 1H641 3V7CA 1ZBXA 1OX9A 3T9NA 2L3RA 2JW4A 2EQKA 5KE2A 4L5GA 2ZAEA 2PUKB 5DY9A 3DLLA 2B86A 4J9IA 5KYXA 3RDVA 3V8LA 4M7DF 2DRMA 1C6VX 2V8KA 3M4YA 1M4ZA 4IUQA 4RTZA 1TS9A 2F5KA 2RHXA 2RQVA 5GAN5 5CKBA 2E70A 1NPPA 4JUVA 2K5IA 3CMEA 4HT8A 1VQ5A 2EFIA 4FIBA 2LJ1A 5IHIA 4OB1B 4C0DB 2D0NA 2K3BA 4C5EA 1PRLC 2H3JA 1XOVA 3ZFJA 1D1CA 2EQIA 3OS1A 2HL3A 3INZA 1K73C 1ZSGA 3CC2A 3OYYA 3I5RA 3CPFA 2XDPA 4DBFA 5LJ5d 1GFCA 2HKQB 1XQHA 2VV5A 1RADB 2LDMA 2JZ2A 5GAN2 2AT1B 2ZZDA 1JRIA 5FU7B 1HSQA 2DXUA 3LW5E 3A8LB 3VS0A 1VQ4Q 2VUBA 5GMKl 2LTOA 1MHNA 3C4SA 2DEUA 1NE8A 1VQNA 2BZ8A 2PVDB 3FJ5A 3D7SB 1WA7A 4D8KA 4C92G 3I55A 3AT1B 3J7AF 5LJ3d 1VQ9A 2E6NA 3GF5A 3LGFA 4CC2A 1YWOA 1N9SA 1O75A 3MEUA 3MEWA 5CO7A 4M77C 1F1BB 2QGFB 1X01A 2JS0A 5GMKm
chains in the Genus database with same CATH topology
3H0IA 1PNJA 1X69A 2YUNA 1EFNA 4JPBW 3NMZC 1I0CA 2EYXA 4RUGA 2KRNA 3TSZA 2DRKA 1HD3A 4HXJA 4F17A 3VS4A 2ROLA 2V1RA 1E6HA 2J05A 2RF0A 2NWMA 2MCNA 1BB9A 3C0CA 1SHGA 2GBQA 1VYVA 1X27A 4AFSC 2JTEA 4F14A 2FO0A 2KRSA 2BTTA 3PVQA 3UF4A 1MUZA 5FWBA 2L0AA 2DNUA 1ZUKA 1UECA 3I35A 1M27C 2W0ZA 1GCQA 4M4ZA 2DL7A 2OJ2A 1UFFA 2EYYA 2RPNA 1NM7A 4HVUA 1QLYA 1K0SA 2GNCA 2GQIA 1SEMA 2A36A 3NHNA 2BZXA 1RI9A 4AFZC 1JQQA 2EVRA 5I22A 1NLPC 2FRWA 1HJDA 1I1JA 4A63B 1H92A 3M0PA 1BU1A 2DL4A 4GBQA 1SPKA 3VS7A 1ZUUA 1CKAA 4OMOA 1UJ0A 1NEBA 1OOTA 2GGRA 1FMKA 1VYTA 1YP5A 2AKKA 1KJWA 2FEIA 2KGTA 1KSWA 2X3XD 2CT4A 4AG1C 1Z9QA 1CSKA 1YCSB 1SRMA 2AZVA 1PKSA 3I9QA 3REAB 1NG2A 1PWTA 2FPEA 3H41A 1AWJA 1JEGA 2PNIA 4E6RA 2DL3A 2W10A 1NLOC 2G6FX 5FW9A 2PZ1A 2IIMA 2KYBA 3EGUA 2O31A 4IIMA 2F2WA 3GBQA 3R6NA 5FWCA 5IHKA 1OV3A 2ECZA 2DE0X 3VS5A 4RTWA 2JMCA 5ECAA 1AWWA 1AZEA 2VVKA 5HCKA 1ABOA 2F2XA 2KNBB 1ZLMA 1M3BA 1ZX6A 2DX1A 2YSQA 1OEBA 1NEGA 2ED0A 3M0UA 4RTUA 1WI7A 3NPFA 2CDTA 2PTKA 1K76A 1UHCA 2J6FA 4RTYA 2J7IA 1K9AA 1V1CA 2KT1A 2LMJA 2FPDA 1M30A 4LN2A 1MV0B 1U3OA 1UE9A 2KXCA 4F16A 3M0TA 4OMQA 2CSIA 2GTJA 1TUDA 1G2BA 2KROA 2I0NA 3UA6A 1PKTA 4ORZA 2DBKA 3M0SA 1A0NB 1RLPC 2ESWA 2AK5A 1T3LA 1X43A 1PRMC 2LZ6B 4QT7A 2GTOA 2K6DA 1QCFA 2DBMA 2D8HA 2DMOA 3VRZA 2KR3A 2LX7A 2YUOA 4AFUC 4LUDA 1AEYA 2MOXA 2HSPA 1GBRA 4RTVA 2EPDA 3SHWA 2XMFA 3UA7A 1TUCA 1UGVA 3EG3A 2LQNA 1UJYA 1QKXA 2C0TA 1X6BA 2LNHB 1BBZA 1WDXA 4JJBA 3VS6A 2BZYA 1OPLA 2OI3A 4EIKA 2AZSA 2YUPA 1AD5A 3QWXX 1TG0A 2A08A 2HCKA 1H3HA 2RQTA 3EHQA 4J9DA 4D8DA 4JJDA 1KIKA 4HCKA 2SEMA 3TVTA 3H0HA 2KRMA 2CUBA 4ZNXA 2EBPA 1X6GA 2EGCA 3VRYA 2LCSA 4J9EA 2FRYA 1AOJA 2EYWA 2ED1A 4LNPA 1M3AA 3SEMA 1GCPA 2A37A 1FYNA 5IXFA 1Y57A 2YDLA 2DL8A 1CKBA 2EW3A 3EG2A 2C0OA 4J9BA 1WYXA 4J9CA 1E7OA 2DVJA 4CC3A 1K4US 2CSQA 4LUEA 3RNJA 4AG2C 1UDLA 2M0YA 1KFZA 1NYGA 1K0XA 1GRIA 1M3CA 4CC7A 2ABLA 1SRLA 2O9SA 1X2KA 2RN8A 5IH2A 1NYFA 1SSHA 2DA9A 2K2MA 1M8MA 5I11A 2L3PA 4JZ3A 2CREA 5GJWB 3KFVA 4OMNA 1MV3A 2DM1A 4Z89A 2ENMA 1ABQA 1ZBJA 2KXDA 1QWEA 3EG0A 4X1VA 2O2OA 2CH4A 1JO8A 4RTXA 2F2VA 1Z9ZA 4JJCA 1SHFA 2H8HA 2O88A 1JU5C 2YUQA 2VWFA 2E5KA 2DYBA 4HVWA 2K79A 2NUZA 1U06A 3REBB 1GL5A 2CUDA 2L3QA 1AZGB 5IHNA 4RTTA 1VA7A 2J6KA 2K9GA 3I5SA 4Z88A 2EKHA 4WCIA 4J9FA 1J3TA 1YWPA 1PHTA 4J9HA 2FG0A 2V1QA 2YT6A 3NGPA 1WXBA 2LJ3A 4GLMA 3UATA 4ESRA 5IXBA 1QKWA 2DLPA 3PE0A 5EC7A 4DEXA 4JZ4A 2CT3A 2DILA 4J9GA 1RLQC 4CC4B 2KBTA 3TSWA 2JXBA 3M0QA 1QWFA 1W6XA 1T3SA 2LP5A 4AFQC 1I07A 2MIOA 4HVVA 4KRTA 3U23A 1BK2A 3EG1A 3LH5A 1OPKA 1B3QA 2EGAA 1WLPB 1H8KA 1WXUA 2LQWA 2JMAA 1N5ZA 3THKA 2RNAA 2JW4A 3A98A 1UG1A 3O5ZA 4IIOA 1G83A 2B86A 4J9IA 2FPFA 2RQWA 3IQLA 2DRMA 2ROTA 2CH4W 2C0IA 4RTZA 1GCQC 2HDAA 1AWOA 2JT4A 2J6OA 2RQVA 1WFWA 1IO6A 4Y92A 4OMMA 2DJQA 2VKNA 1WIEA 2DL5A 2X3WD 1RUWA 3JV3A 4OMPA 1T0JA 2LJ1A 2SRCA 3PVLA 2D1XA 1W70A 2A28A 5IHIA 2KT8A 1GFDA 1LCKA 2O9VA 2D0NA 2M51A 1JXOA 2RQRA 3RBBB 2K3BA 2HEQA 1PRLC 2K7AA 1XOVA 2LJ0A 2QDLA 2KYMA 1Y0MA 2EQIA 2JM9A 2KE9A 1ZSGA 3QWYA 3I5RA 1T0HA 1YNZA 2D8JA 1X2QA 4DEYA 1E6GA 3ZL7C 1YN8A 3VS2A 3EHRA 1GFCA 2AKLA 1UTIA 2KEAA 4LE9A 2JM8A 2DF6A 1UUEA 3CQTA 2L3SA 2J06A 1UHFA 1VYUA 1AVZC 2RMOA 1WX6A 1HSQA 2RQUA 1S1NA 1JXMA 1WXTA 4OMLA 2P4RA 3VS0A 1GBQA 2EYZA 1B07A 1ARKA 2BZ8A 4Z8AA 1K1ZA 3FJ5A 3H0FA 3VS1A 1WA7A 4D8KA 4FSSA 1U5SA 2JS2A 1ZUYA 5L23A 4R0KA 5GJVB 4K11A 4CC2A 2EGEA 1YWOA 2L2PA 1W1FA 3VS3A 3M0RA 2OAWA 2JS0A 3ULRB 1AWXA 2HBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0I A;  1PNJ A;  1X69 A;  2YUN A;  1EFN A;  4JPB W;  3NMZ C;  1I0C A;  2EYX A;  4RUG A;  2KRN A;  3TSZ A;  2DRK A;  1HD3 A;  4HXJ A;  4F17 A;  3VS4 A;  2ROL A;  2V1R A;  1E6H A;  2J05 A;  2RF0 A;  2NWM A;  2MCN A;  1BB9 A;  3C0C A;  1SHG A;  2GBQ A;  1VYV A;  1X27 A;  4AFS C;  2JTE A;  4F14 A;  2FO0 A;  2KRS A;  2BTT A;  3PVQ A;  3UF4 A;  1MUZ A;  5FWB A;  2L0A A;  2DNU A;  1ZUK A;  1UEC A;  3I35 A;  1M27 C;  2W0Z A;  1GCQ A;  4M4Z A;  2DL7 A;  2OJ2 A;  1UFF A;  2EYY A;  2RPN A;  1NM7 A;  4HVU A;  1QLY A;  1K0S A;  2GNC A;  2GQI A;  1SEM A;  2A36 A;  3NHN A;  2BZX A;  1RI9 A;  4AFZ C;  1JQQ A;  2EVR A;  5I22 A;  1NLP C;  2FRW A;  1HJD A;  1I1J A;  4A63 B;  1H92 A;  3M0P A;  1BU1 A;  2DL4 A;  4GBQ A;  1SPK A;  3VS7 A;  1ZUU A;  1CKA A;  4OMO A;  1UJ0 A;  1NEB A;  1OOT A;  2GGR A;  1FMK A;  1VYT A;  1YP5 A;  2AKK A;  1KJW A;  2FEI A;  2KGT A;  1KSW A;  2X3X D;  2CT4 A;  4AG1 C;  1Z9Q A;  1CSK A;  1YCS B;  1SRM A;  2AZV A;  1PKS A;  3I9Q A;  3REA B;  1NG2 A;  1PWT A;  2FPE A;  3H41 A;  1AWJ A;  1JEG A;  2PNI A;  4E6R A;  2DL3 A;  2W10 A;  1NLO C;  2G6F X;  5FW9 A;  2PZ1 A;  2IIM A;  2KYB A;  3EGU A;  2O31 A;  4IIM A;  2F2W A;  3GBQ A;  3R6N A;  5FWC A;  5IHK A;  1OV3 A;  2ECZ A;  2DE0 X;  3VS5 A;  4RTW A;  2JMC A;  5ECA A;  1AWW A;  1AZE A;  2VVK A;  5HCK A;  1ABO A;  2F2X A;  2KNB B;  1ZLM A;  1M3B A;  1ZX6 A;  2DX1 A;  2YSQ A;  1OEB A;  1NEG A;  2ED0 A;  3M0U A;  4RTU A;  1WI7 A;  3NPF A;  2CDT A;  2PTK A;  1K76 A;  1UHC A;  2J6F A;  4RTY A;  2J7I A;  1K9A A;  1V1C A;  2KT1 A;  2LMJ A;  2FPD A;  1M30 A;  4LN2 A;  1MV0 B;  1U3O A;  1UE9 A;  2KXC A;  4F16 A;  3M0T A;  4OMQ A;  2CSI A;  2GTJ A;  1TUD A;  1G2B A;  2KRO A;  2I0N A;  3UA6 A;  1PKT A;  4ORZ A;  2DBK A;  3M0S A;  1A0N B;  1RLP C;  2ESW A;  2AK5 A;  1T3L A;  1X43 A;  1PRM C;  2LZ6 B;  4QT7 A;  2GTO A;  2K6D A;  1QCF A;  2DBM A;  2D8H A;  2DMO A;  3VRZ A;  2KR3 A;  2LX7 A;  2YUO A;  4AFU C;  4LUD A;  1AEY A;  2MOX A;  2HSP A;  1GBR A;  4RTV A;  2EPD A;  3SHW A;  2XMF A;  3UA7 A;  1TUC A;  1UGV A;  3EG3 A;  2LQN A;  1UJY A;  1QKX A;  2C0T A;  1X6B A;  2LNH B;  1BBZ A;  1WDX A;  4JJB A;  3VS6 A;  2BZY A;  1OPL A;  2OI3 A;  4EIK A;  2AZS A;  2YUP A;  1AD5 A;  3QWX X;  1TG0 A;  2A08 A;  2HCK A;  1H3H A;  2RQT A;  3EHQ A;  4J9D A;  4D8D A;  4JJD A;  1KIK A;  4HCK A;  2SEM A;  3TVT A;  3H0H A;  2KRM A;  2CUB A;  4ZNX A;  2EBP A;  1X6G A;  2EGC A;  3VRY A;  2LCS A;  4J9E A;  2FRY A;  1AOJ A;  2EYW A;  2ED1 A;  4LNP A;  1M3A A;  3SEM A;  1GCP A;  2A37 A;  1FYN A;  5IXF A;  1Y57 A;  2YDL A;  2DL8 A;  1CKB A;  2EW3 A;  3EG2 A;  2C0O A;  4J9B A;  1WYX A;  4J9C A;  1E7O A;  2DVJ A;  4CC3 A;  1K4U S;  2CSQ A;  4LUE A;  3RNJ A;  4AG2 C;  1UDL A;  2M0Y A;  1KFZ A;  1NYG A;  1K0X A;  1GRI A;  1M3C A;  4CC7 A;  2ABL A;  1SRL A;  2O9S A;  1X2K A;  2RN8 A;  5IH2 A;  1NYF A;  1SSH A;  2DA9 A;  2K2M A;  1M8M A;  5I11 A;  2L3P A;  4JZ3 A;  2CRE A;  5GJW B;  3KFV A;  4OMN A;  1MV3 A;  2DM1 A;  4Z89 A;  2ENM A;  1ABQ A;  1ZBJ A;  2KXD A;  1QWE A;  3EG0 A;  4X1V A;  2O2O A;  2CH4 A;  1JO8 A;  4RTX A;  2F2V A;  1Z9Z A;  4JJC A;  1SHF A;  2H8H A;  2O88 A;  1JU5 C;  2YUQ A;  2VWF A;  2E5K A;  2DYB A;  4HVW A;  2K79 A;  2NUZ A;  1U06 A;  3REB B;  1GL5 A;  2CUD A;  2L3Q A;  1AZG B;  5IHN A;  4RTT A;  1VA7 A;  2J6K A;  2K9G A;  3I5S A;  4Z88 A;  2EKH A;  4WCI A;  4J9F A;  1J3T A;  1YWP A;  1PHT A;  4J9H A;  2FG0 A;  2V1Q A;  2YT6 A;  3NGP A;  1WXB A;  2LJ3 A;  4GLM A;  3UAT A;  4ESR A;  5IXB A;  1QKW A;  2DLP A;  3PE0 A;  5EC7 A;  4DEX A;  4JZ4 A;  2CT3 A;  2DIL A;  4J9G A;  1RLQ C;  4CC4 B;  2KBT A;  3TSW A;  2JXB A;  3M0Q A;  1QWF A;  1W6X A;  1T3S A;  2LP5 A;  4AFQ C;  1I07 A;  2MIO A;  4HVV A;  4KRT A;  3U23 A;  1BK2 A;  3EG1 A;  3LH5 A;  1OPK A;  1B3Q A;  2EGA A;  1WLP B;  1H8K A;  1WXU A;  2LQW A;  2JMA A;  1N5Z A;  3THK A;  2RNA A;  2JW4 A;  3A98 A;  1UG1 A;  3O5Z A;  4IIO A;  1G83 A;  2B86 A;  4J9I A;  2FPF A;  2RQW A;  3IQL A;  2DRM A;  2ROT A;  2CH4 W;  2C0I A;  4RTZ A;  1GCQ C;  2HDA A;  1AWO A;  2JT4 A;  2J6O A;  2RQV A;  1WFW A;  1IO6 A;  4Y92 A;  4OMM A;  2DJQ A;  2VKN A;  1WIE A;  2DL5 A;  2X3W D;  1RUW A;  3JV3 A;  4OMP A;  1T0J A;  2LJ1 A;  2SRC A;  3PVL A;  2D1X A;  1W70 A;  2A28 A;  5IHI A;  2KT8 A;  1GFD A;  1LCK A;  2O9V A;  2D0N A;  2M51 A;  1JXO A;  2RQR A;  3RBB B;  2K3B A;  2HEQ A;  1PRL C;  2K7A A;  1XOV A;  2LJ0 A;  2QDL A;  2KYM A;  1Y0M A;  2EQI A;  2JM9 A;  2KE9 A;  1ZSG A;  3QWY A;  3I5R A;  1T0H A;  1YNZ A;  2D8J A;  1X2Q A;  4DEY A;  1E6G A;  3ZL7 C;  1YN8 A;  3VS2 A;  3EHR A;  1GFC A;  2AKL A;  1UTI A;  2KEA A;  4LE9 A;  2JM8 A;  2DF6 A;  1UUE A;  3CQT A;  2L3S A;  2J06 A;  1UHF A;  1VYU A;  1AVZ C;  2RMO A;  1WX6 A;  1HSQ A;  2RQU A;  1S1N A;  1JXM A;  1WXT A;  4OML A;  2P4R A;  3VS0 A;  1GBQ A;  2EYZ A;  1B07 A;  1ARK A;  2BZ8 A;  4Z8A A;  1K1Z A;  3FJ5 A;  3H0F A;  3VS1 A;  1WA7 A;  4D8K A;  4FSS A;  1U5S A;  2JS2 A;  1ZUY A;  5L23 A;  4R0K A;  5GJV B;  4K11 A;  4CC2 A;  2EGE A;  1YWO A;  2L2P A;  1W1F A;  3VS3 A;  3M0R A;  2OAW A;  2JS0 A;  3ULR B;  1AWX A;  2HBW A; 
#chains in the Genus database with same CATH topology
 1PNJ A;  3KXT A;  1X69 A;  1TXQ A;  2EYX A;  4IUT A;  4QVD A;  4HXJ A;  3CCV A;  4N0A C;  3H6Z A;  3VS4 A;  4XU0 A;  2V1R A;  3JCM J;  2RF0 A;  3SD4 A;  1BB9 A;  1K8A R;  1SHG A;  2GBQ A;  1X27 A;  4AFS C;  4XQ3 A;  2JTE A;  4C92 A;  1VQK A;  3G71 Q;  2BTT A;  3UF4 A;  4DQ2 A;  4AT1 B;  3CBO A;  3RKX A;  2DNU A;  4C92 E;  1FMV A;  1UEC A;  3JCM c;  1KK7 A;  5GAN 8;  2W0Z A;  4LDY A;  3HRT A;  3EGX B;  4M4Z A;  4ELZ C;  1VQ7 T;  2RPN A;  4PFP A;  3OW2 P;  3ASK A;  1PSF A;  1HK9 A;  1QVF A;  1K0S A;  3OYG A;  1SEM A;  3CBM A;  3NHN A;  3PT9 A;  3QBY A;  2BZX A;  1RI9 A;  5J39 A;  3UT1 A;  1ZQ1 A;  2FHD A;  1B34 B;  4J5Y A;  1W2B S;  2KK4 A;  4E7S A;  3FC3 A;  1WHM A;  1VQ8 Q;  1HJD A;  3PFS A;  3M0P A;  1BU1 A;  4GBQ A;  2E41 A;  4E7L A;  3MPU B;  4OP0 A;  5C6S A;  2DVE A;  1K73 U;  1CKA A;  2KQW A;  1OOT A;  5D6X A;  4DBQ A;  2AKK A;  4LXC A;  3M5A A;  2KGT A;  2MAM A;  2X4X A;  1D3B B;  2VAS A;  4AG1 C;  4C8Q D;  1SRM A;  1PKS A;  3REA B;  4C0Z A;  4ZGJ B;  4KGV B;  2RHU A;  3H41 A;  2NUT B;  1WQ7 A;  3L42 A;  1QP2 A;  2ZCF B;  3DKM A;  2DL3 A;  3LH0 A;  2G6F X;  3CPW A;  2O31 A;  4IIM A;  1KD1 C;  1S72 A;  5FWC A;  1PG5 B;  1OV3 A;  2ECZ A;  2DE0 X;  1TU0 B;  2JMC A;  1AWW A;  4C92 D;  2CYZ B;  3GP8 A;  2VVK A;  1ABO A;  2PU9 B;  2F2X A;  5FRN A;  5LJ5 f;  4PLL A;  4A4K A;  4M78 G;  3C95 A;  3NPF A;  3VUB A;  2J6F A;  3MCA B;  5CVI A;  3FLG A;  3CME T;  1WJR A;  4M75 A;  2LMJ A;  2X4Y A;  1G2B A;  3UA6 A;  2I0N A;  2ATC B;  3MEV A;  4MDX A;  4M75 E;  3CC4 A;  2XIC A;  5LJ3 f;  1RAF B;  4OF1 A;  1WHJ A;  2XG8 D;  1YJ9 Q;  1X43 A;  3CCE T;  2D0Q B;  4VUB A;  2GTO A;  1M8V A;  2K3X A;  1QCF A;  2RI2 A;  2E3H A;  1IHW A;  2E6Z A;  3EFO A;  2DMO A;  5CKF A;  2LX7 A;  2DTI A;  4LUD A;  4M78 A;  2WAC A;  3CMA T;  1AEY A;  1C1A A;  3MP1 A;  4RTV A;  5KYU A;  1LOJ A;  5HK3 A;  4IUR A;  2OTJ Q;  4C5H A;  3UA7 A;  4M78 E;  4OB3 B;  1KC8 R;  1QCO A;  4PL6 A;  2ZPB B;  2LNH B;  5M9O A;  1YJN A;  1VQN T;  1ZA2 B;  3QDF A;  4L6V 5;  5LL6 S;  3CXC P;  3V7R A;  5GAO n;  4PJM A;  2AZS A;  3M53 A;  2Y4Y A;  3OY9 A;  3I55 T;  3NTH A;  3JCM h;  3TVT A;  1X6G A;  1EIF A;  4J9E A;  2FRY A;  3P8B B;  2ED1 A;  4RCB A;  1IRX A;  1FYN A;  2IG0 A;  5IXF A;  2YDL A;  1M1F A;  2YXY A;  2C0O A;  2Z0W A;  1BI2 A;  2LCL A;  4M75 D;  4LUE A;  2YHT A;  3L2V A;  2EJ9 A;  3OYD A;  1SG5 A;  2F5T X;  3E2U A;  4JDS A;  4LDU A;  3QHS A;  2OX7 A;  1M3C A;  4Y91 A;  1KD1 U;  2ABL A;  2CZ7 B;  1SRL A;  4X34 A;  2DA9 A;  3I56 A;  2CRE A;  3KFV A;  4QVZ A;  3CCS Q;  4LD6 A;  2HQH A;  2DM1 A;  2EIF A;  1N9R A;  3TQ7 P;  4M77 A;  1HYO A;  5LJ5 e;  2PVO B;  4X1V A;  3TRE A;  2L5Q A;  1YI2 Q;  2QK0 A;  2DER A;  1VQP Q;  2DZ9 A;  2MWO A;  2VYT A;  4M77 E;  4JJC A;  1SHF A;  2O88 A;  1IRE B;  2E5K A;  3VU3 C;  8ATC B;  3FDR A;  1GL5 A;  3OA6 A;  4JRK A;  4HCB A;  3HL8 A;  4RTT A;  1U1S A;  1WZO A;  2K9G A;  3I5S A;  3CCL Q;  5LJ3 e;  1YWP A;  2E64 A;  3OYN A;  3BY7 A;  2FG0 A;  3DLM A;  2DPP B;  4DOV A;  3CCQ T;  3OYM A;  1G3W A;  5IXB A;  1QKW A;  2DLP A;  2KY9 A;  5EC7 A;  5GAN 3;  3EH2 A;  2DIL A;  2Y4X A;  2X51 A;  3J80 E;  1IZ6 A;  2X9H A;  2KBT A;  2DIG A;  3TSW A;  1VUB A;  2LP5 A;  2V8J A;  3E19 A;  4AFQ C;  5DLO A;  2MIO A;  3PNW C;  4JLI A;  1JJ2 S;  1BK2 A;  3M58 A;  3G4S Q;  3OBW A;  1YCY A;  5GAN d;  4C92 C;  4M7A G;  3THK A;  2CGH A;  3H8Z A;  1UG1 A;  3MEA A;  1SKU B;  2FPF A;  1M1K C;  2RQW A;  3IQL A;  1KQS S;  5A0G A;  1VQ8 A;  5CR2 A;  2HKN A;  4X9D A;  1AWO A;  2JT4 A;  2VGM A;  5GMK e;  2DJQ A;  4KH0 B;  3UPU A;  2K2V A;  2VKN A;  1WIE A;  4RG8 A;  3MHX A;  4M77 D;  1T0J A;  2SRC A;  4PJO G;  5A0L A;  1QVP A;  2O4X A;  3CD6 A;  1LCK A;  4A4F A;  4C92 F;  2FZK B;  2RQR A;  3RBB B;  2MI6 A;  2JNG A;  4RCC A;  3CBP A;  2QDL A;  2E3I A;  1Y0M A;  2KYM A;  3GNG A;  3M56 A;  4V2S A;  1VQM Q;  2DTO A;  3QWY A;  1PM3 A;  3OMG A;  5IAY A;  4M7A A;  3HTR A;  2D8J A;  2E5Q A;  1X2Q A;  3OSV A;  4DEY A;  3ZL7 C;  2JUF A;  3VS2 A;  3EHR A;  2RJF A;  2F69 A;  1Y96 A;  1FMW A;  2DYI A;  3CCJ T;  2VXE A;  4LE9 A;  4M7A E;  2P0P A;  1JBM A;  2BE7 D;  2LX9 A;  2JOY A;  2JM8 A;  4QW2 A;  3CQT A;  2J06 A;  1UHF A;  2RMO A;  1WX6 A;  1Q81 C;  2KDS A;  3FRN A;  2EAY A;  4C5G A;  1S1N A;  2QEX Q;  2P0Q A;  1VQO Q;  5KYW A;  4PJO A;  1GBQ A;  1U5S A;  2JS2 A;  4PJO E;  5L23 A;  1QW1 A;  4K11 A;  1BI0 A;  4D6W A;  2EGE A;  1YJN T;  1W1F A;  1Q86 C;  3C12 A;  1OYX A;  1BCM A;  3ULR B;  1QVF S;  2YUN A;  5CCA A;  1N8R C;  1YIT Q;  5FU6 B;  4RUG A;  1IGQ A;  4F17 A;  3QXE B;  4E7I A;  1YJ9 A;  5FLX E;  4F7U G;  3E1S A;  2NWM A;  3O8V A;  1RAE B;  4O5V A;  2DFU A;  3FB9 A;  1ZSZ B;  2JJ9 A;  4F7U B;  5LJ3 j;  2OTJ A;  2HZY A;  4J8O A;  3BDL A;  3N5B B;  1WNL A;  2RJD A;  1VQL T;  2M02 A;  1M1K U;  1M27 C;  1GCQ A;  2E10 A;  2XKO C;  3I56 T;  2LQK A;  4M75 F;  1UFF A;  2EYY A;  3ER0 A;  3QDR B;  4M78 C;  3PIO A;  1QLY A;  3OYA A;  3VKI A;  3FEO A;  4NL3 A;  1ZA1 B;  2GNC A;  2A36 A;  2NLU A;  2P0K A;  2RK1 A;  2VXF A;  2RH2 A;  2X35 A;  2FRW A;  5CAI A;  5D6Y A;  4F7U A;  1I1J A;  6AT1 B;  4E7H A;  4A63 B;  3X28 B;  4PJO D;  3CCR Q;  3EGD B;  2M9U A;  2IPO B;  4R56 A;  3VS7 A;  2KMT A;  1ZUU A;  3OW2 A;  5GAN f;  4PKC C;  4F7U E;  1UJ0 A;  1KQ1 A;  3J81 E;  2DXT A;  1YIJ Q;  4LDV A;  4OGE A;  3RKY A;  1KSW A;  1Z9Q A;  1CSK A;  1R0C B;  3G6E Q;  1K73 R;  4E7J A;  3QJ6 A;  2QA4 Q;  3RES A;  2FPE A;  3NTI A;  1LNX A;  3OBY A;  3CCU Q;  3JCM P;  1HXD A;  1Q81 U;  4BI4 A;  2EQU A;  5GAM h;  4FW1 A;  3CCM A;  2MMP A;  2PNI A;  4KUI A;  1QCN A;  2HQE A;  2VGN A;  1NLO C;  5FW9 A;  4RKU E;  1QQJ A;  2KYB A;  5J26 A;  4WF2 A;  2F2W A;  3L2W A;  4FYV B;  1KG1 A;  1YI2 A;  3M59 A;  1YHQ T;  2QG9 B;  3CEY A;  4ZTJ A;  5GAN g;  5HCK A;  4C8Q B;  2FL7 A;  1NJI U;  5GAN 7;  1Q86 U;  2YSQ A;  4FM4 B;  1RAG B;  3M9Q A;  2COY A;  2ED0 A;  2MF2 A;  2CDT A;  4J7I A;  1N8R U;  2KSS A;  3ME9 A;  3OYF A;  3JB9 G;  3EH1 A;  2FPD A;  5CKH A;  4LN2 A;  1MV0 B;  2RHY A;  1UE9 A;  2CSI A;  2LT4 A;  3CD6 T;  1PKT A;  3NFC A;  2DBK A;  4HA8 A;  1A0N B;  5DLQ E;  3VV0 A;  4XU2 A;  3HFN A;  3OB9 A;  4M77 F;  1TH7 A;  3G4S A;  4HCC A;  4BUG A;  1BI1 A;  5A0D A;  1YJW A;  2KVQ G;  4BY6 B;  4TVR A;  2HSP A;  1UB4 A;  2OTL T;  4BDZ A;  4MZM A;  3ZBD A;  5GAM j;  1UGV A;  1M1G A;  4XU1 A;  3RKW A;  3QG1 A;  2C0T A;  1M2V B;  1X6B A;  3QZ9 B;  2QYZ A;  1WDX A;  4JJB A;  3VS6 A;  2GFA A;  3L2Q A;  1TSF A;  2YUP A;  3BFM A;  1JJ2 P;  1TG0 A;  4PFZ A;  5GAN e;  2HCK A;  3EGX A;  3EHQ A;  2R58 A;  4JJD A;  4PJL A;  4ME7 A;  5GMK i;  2GF7 A;  4HCK A;  1VQ6 A;  1YFN A;  2EBP A;  2KI7 A;  1VQM A;  2GFU A;  3CXC A;  2EYW A;  1KHC A;  1WJS A;  1B34 A;  1KQS P;  4OMF B;  5IN1 A;  1CKB A;  2QQA A;  4N4G A;  2DVJ A;  1I4K 1;  5HY6 A;  3OYB A;  3QPH A;  1R77 A;  1K0X A;  4M7A C;  2RHZ A;  2QEX A;  1VQO A;  2O9S A;  2QQ9 A;  4CRI A;  3OYL A;  2LVM A;  3CC7 T;  2L3P A;  4KGZ B;  1D3B A;  4PJN A;  4B6M A;  4DBR A;  4M7D G;  2IVW A;  2EJF A;  1TOV A;  4ATO A;  1C0M A;  2H3E B;  3JB9 I;  4DBH A;  2LT1 A;  4OMN A;  4Z89 A;  5FRO A;  1ZBJ A;  1QWE A;  2NUT A;  1KD1 R;  2CH4 A;  1VQ7 Q;  4M7D B;  1JO8 A;  3JCM Q;  2F2V A;  3VYG A;  4PJO C;  2H8H A;  2V26 A;  1PSE A;  4M7A F;  2VWF A;  4XTV A;  1BIA A;  1VQ5 T;  3H9N A;  3JB9 D;  1FWZ A;  2DKG A;  3DB4 A;  2NUZ A;  1U06 A;  1YIT A;  2YWW A;  3OYJ A;  2L3Q A;  1QVG P;  1VA7 A;  2FVU A;  3JB9 H;  2J6K A;  1D1B A;  4WCI A;  1J3T A;  2DAQ A;  2V1Q A;  2YT6 A;  2PUO B;  4GLM A;  1MMN A;  1FX7 A;  3CC2 T;  4ZTF A;  1EX4 A;  1KHI A;  4J9G A;  4PJO F;  3AHU A;  4CC4 B;  2QAZ A;  2JXB A;  1W6X A;  1I07 A;  1M9S A;  1U1T A;  3U23 A;  3EG1 A;  1D0Y A;  3LH5 A;  2CP3 A;  3CCM T;  2EGA A;  3QII A;  3V8K A;  1V76 A;  5AYF A;  4XU3 A;  4WTO B;  3PMT A;  1N5Z A;  5KH6 A;  4HT9 A;  2RJC A;  1BI3 A;  4IIO A;  4PK4 A;  1RAB B;  4FCY A;  1XTD A;  1VQ9 T;  1GCQ C;  4KUL A;  3CCR A;  1IGU A;  1I5L A;  4X9C A;  1WFW A;  1IO6 A;  4OGC A;  4OMM A;  2HQX A;  2CP2 A;  1RAC B;  2X3W D;  3G7Z A;  5D6W A;  1RUW A;  3JV3 A;  2P4T A;  9ATC B;  2QQR A;  1YIJ A;  1W70 A;  2KT8 A;  2M0O A;  1K9M C;  1G5V A;  1GFD A;  4PLI A;  2O9V A;  2M51 A;  3V7S A;  1JXO A;  1ZSZ C;  2NUP B;  3QYG B;  2HEQ A;  3CME Q;  4BAC A;  2K7A A;  1MGQ A;  3G6E A;  1X75 C;  1RI0 A;  1RAI B;  2JM9 A;  2KE9 A;  2D9T A;  3X20 B;  5I2S A;  3CCV T;  2QA4 A;  3M54 A;  7AT1 B;  2OAU A;  3CCU A;  1M5Q 1;  1T0H A;  1YNZ A;  1W4S A;  3VJP A;  4A4H A;  1WJQ A;  3GLX A;  1YN8 A;  2AKL A;  2LCC A;  3BDU A;  3QKJ A;  3KBG A;  1VQ4 A;  2X4W A;  3WVE B;  1VQK T;  4OB0 B;  2DF6 A;  3CCE Q;  2L3S A;  1WGS A;  1WQW A;  2BUD A;  2G3R A;  1AVZ C;  2QTV A;  5HK0 A;  1G8X A;  3OYE A;  3QUI A;  1YJW T;  4C0D C;  2RQU A;  2PQW A;  1JXM A;  2QGG A;  1WXT A;  4OML A;  2P4R A;  3CMA Q;  3Q1J A;  1ARK A;  4M78 D;  5CQX A;  1K1Z A;  3VS1 A;  4GY5 A;  4B9W A;  2DXB A;  4OB2 B;  2LRQ A;  4FSS A;  3BE3 A;  4R0K A;  5GJV B;  2X4J A;  2DEQ A;  5CIU A;  1V29 B;  1VQN Q;  4FW2 A;  3I55 Q;  2R57 A;  4E47 A;  1WPY A;  4ZN3 A;  2RK2 A;  2HBW A;  2I2L A;  3H0I A;  1Q82 C;  4N4I A;  5FU7 C;  4EMH A;  4LD9 K;  1RL2 A;  5L8R E;  1EFN A;  1VQ6 T;  1I0C A;  1UGR B;  3TSZ A;  3SWN B;  3G71 A;  2ROL A;  1Y7X A;  4L59 A;  1E6H A;  2QTX A;  2J05 A;  2XI9 A;  2MCN A;  1M90 C;  3L2Z A;  3HRS A;  2E4H A;  3OW2 S;  3RMQ A;  2FO0 A;  4KGX B;  3PMI A;  3PVQ A;  2AIR B;  5FWB A;  2CP7 A;  2R5M A;  2L0A A;  2JTM A;  3I35 A;  5LJ5 h;  1H3Z A;  1PCX A;  1S72 T;  2OJ2 A;  1OU9 A;  4HVU A;  4YTL A;  4A53 A;  1D0X A;  1UGQ B;  2GQI A;  3JCM W;  3EG9 B;  4AFZ C;  1M1K R;  3JSC A;  5KYY B;  3S3N A;  3OYC A;  1K9M U;  1D09 B;  3G1J A;  3JCM V;  2ZPE B;  4EMK B;  1ZHI A;  1H92 A;  2ZPG B;  4QKU A;  3HP9 A;  4JLG A;  2ZPH B;  5J3B A;  3MO8 A;  4HKE A;  4LDX A;  4OMO A;  2A3L A;  5LJ3 h;  1G3Y A;  4FYW B;  4Y28 E;  2GGR A;  1FMK A;  1VYT A;  1YP5 A;  3WVD B;  2MYS A;  2R5A A;  2FEI A;  1W2B P;  2X3X D;  4EDU A;  2MPX C;  3CC4 T;  3PIP A;  2A7Y A;  2CT4 A;  2F1L A;  1JB0 E;  3JB9 F;  2AZV A;  3I9Q A;  3CCQ Q;  5GAM g;  4Q5W A;  4EMG A;  3LYI A;  1XJW B;  2Y90 A;  4ANJ A;  1DJ7 B;  2GQV A;  4E6R A;  4J7F A;  5CKE A;  2XDB A;  1G3S A;  2V8I A;  5KCH A;  1TUG B;  3EGU A;  1Q81 R;  5IHK A;  1VQ7 A;  3JCM d;  4RTW A;  1PD0 A;  1IHV A;  2YRD A;  1AHJ B;  4OVA A;  5GMK h;  1M3B A;  4Z02 A;  4FYX B;  2L8D A;  3QZ5 B;  1NJI C;  3JAM E;  5LJ5 j;  3MJX A;  1NEG A;  4RTU A;  1Q82 U;  1UGS B;  1K76 A;  1UHC A;  4RTY A;  1U8R A;  4JS5 A;  1MMA A;  1B7T A;  3A1P A;  2KT1 A;  1M30 A;  2RHI A;  1U3O A;  1NJI R;  4F16 A;  1Q86 R;  3M0T A;  2L89 A;  2GTJ A;  1TUD A;  4RMO A;  2KRO A;  2D6F A;  4ORZ A;  1M90 U;  1VIF A;  3LGL A;  3M0S A;  2QDY B;  1N8R R;  1Q7Y C;  4JS4 A;  1O9S A;  4P5N A;  3M55 A;  2AK5 A;  4JRI A;  3EFS A;  3MP6 A;  1PRM C;  2LZ6 B;  2VC8 A;  4QT7 A;  2K6D A;  5KYX B;  4M7D C;  4M7A D;  2D8H A;  5FRM A;  3VRZ A;  2YUO A;  2XID A;  3CXC S;  2EKO A;  3RUX A;  3CCJ Q;  1VQ4 T;  1TWB A;  2MOX A;  1SSF A;  4BI8 B;  2XMF A;  1R0B G;  2LQN A;  1UJY A;  1QKX A;  2QQS A;  1OU8 A;  1ZSZ A;  4II1 A;  3CPW S;  2BZY A;  1OPL A;  2HL5 C;  2OI3 A;  1AD5 A;  3QWX X;  2JVV A;  4UC4 A;  4J9D A;  3PTA A;  1YJN Q;  4A54 A;  2KRM A;  2CUB A;  3DB3 A;  4M78 F;  5D7U A;  4ZNX A;  3S3O A;  5AT1 B;  4MZP A;  3RR6 A;  5GMK j;  4QQ6 A;  3SEM A;  4N4H A;  1Y57 A;  2DL8 A;  2MWP A;  1VIE A;  2EW3 A;  3A8M B;  1JJ2 A;  4MMK A;  2E65 A;  3LLR A;  4J9B A;  3SFM A;  4B9X A;  4JJN K;  3EGD A;  4CC3 A;  1K4U S;  2KAF A;  3G71 T;  1LPL A;  1NPR A;  3CCS A;  3JRZ A;  3CCE A;  4AG2 C;  1UDL A;  2DIQ A;  4C8Q G;  1GRI A;  1KQS A;  4LDW A;  2RN8 A;  3CMA A;  5I11 A;  2BIV A;  4JZ3 A;  1VQP A;  4JRP A;  2EWN A;  2HAX A;  1MV3 A;  3L1A A;  4JRQ A;  2ENM A;  3GOX A;  1VQL Q;  1ABQ A;  2O01 E;  1UGP B;  5KYN A;  2KXD A;  2DJZ A;  1BKB A;  2K5L A;  3I56 Q;  5CK9 A;  1VQ8 T;  4RTX A;  4J6X A;  2RI3 A;  8AT1 B;  4MDW A;  2E1H A;  3CCL A;  2DYB A;  1WHH A;  4HVW A;  2WSC E;  2K79 A;  3RIR A;  1N6A A;  3REB B;  3UWN A;  1P92 A;  2JN0 A;  1OZ2 A;  5IHN A;  1Q7Y U;  4C92 B;  3QJY A;  4C8Q A;  3BW1 A;  3JCM f;  2EKH A;  3M4G A;  4C0F A;  1PHT A;  3ZEH A;  1M2O A;  1WXB A;  4ESR A;  3UAT A;  1K8A C;  3PE0 A;  3A8O B;  4C8Q E;  3OSS C;  1RLQ C;  3MP8 A;  2DO3 A;  3M0Q A;  1QVG A;  1T3S A;  2BE9 B;  3P8D A;  1WHK A;  2RB6 A;  1IXD A;  2ZPI B;  4AMC A;  1MMD A;  4A4G A;  4KRT A;  4IUU A;  3NTK A;  2QI2 A;  3JCM b;  1B3Q A;  1WLP B;  2LNV A;  2BKD N;  1WXU A;  2RM4 A;  2LQW A;  4PFO A;  2JMA A;  4IUV A;  2LC4 A;  3OS5 A;  2RNA A;  4O6J A;  3A98 A;  2XHC A;  3FIF A;  2FB7 A;  3O5Z A;  1G83 A;  3P8H A;  3OS0 A;  2HMA A;  2ROT A;  2CH4 W;  2C0I A;  3JCM g;  1YHQ Q;  3SWN C;  2HDA A;  5DM7 R;  2J6O A;  4FT2 A;  3JCM X;  3M57 A;  4Y92 A;  3HKS A;  4QQD A;  4XK8 E;  2DL5 A;  4MML A;  4OMP A;  4XTX A;  4FYY B;  3PVL A;  2D1X A;  2A28 A;  3X25 B;  2DD4 A;  2QXF A;  1M2V A;  4IUP A;  2LJ0 A;  3OYK A;  3CCQ A;  3F70 A;  3L2U A;  1YJ9 T;  3PGG A;  1MNE A;  3CD6 Q;  4J6Y A;  2PVG B;  1G3T A;  4MZT A;  1E6G A;  4GLK A;  2K5F A;  3HFO A;  1LJO A;  1UTI A;  4BDY A;  1QMC A;  2KEA A;  4FT4 A;  4M75 G;  1UUE A;  2OTJ T;  1VYU A;  4KT0 E;  4EMK C;  4CI0 C;  4R55 A;  1Q95 G;  3SB2 A;  2EYZ A;  2RI5 A;  1B07 A;  1D1A A;  2OTL Q;  4M75 B;  2GCX A;  4Z8A A;  2HD0 A;  3H0F A;  4BE0 A;  1ZUY A;  5GAN h;  3RMS A;  2RJE A;  2L2P A;  3VS3 A;  3M0R A;  3GPL A;  2OAW A;  3C94 A;  1Y07 A;  2FZC B;  3JCM e;  1AWX A;  2ZGW A;  4QQG A;  1K8A U;  1TTH B;  4FU6 A;  4M7D A;  3EFO B;  5GAM d;  4JPB W;  3NMZ C;  1I5O B;  4M78 B;  2KRN A;  3VYH B;  2DRK A;  5EG2 A;  5KE3 A;  1HD3 A;  5KYU B;  3SDZ A;  3TCJ A;  1I8F A;  4BE2 A;  4M7D E;  5C0M A;  1AT1 B;  4BB7 A;  3C0C A;  3LWH A;  1X6O A;  1VYV A;  4F14 A;  3CCJ A;  1Y71 A;  3URG A;  1QVF P;  2KRS A;  3CCS T;  2CS7 A;  1MUZ A;  1NZ9 A;  5LJ5 g;  1ZUK A;  1KC8 C;  2DL7 A;  3CC7 Q;  1YI2 T;  1EZZ B;  1VOM A;  5FU6 C;  1VQP T;  1NM7 A;  3A8H B;  2NYS A;  3S3M A;  2XU8 A;  4EPC A;  1JQQ A;  2M1H A;  2EVR A;  5I22 A;  1NLP C;  2K3Y A;  2QQB A;  5GAO q;  2DL4 A;  4XTU A;  1SPK A;  2K57 A;  3CCL T;  1WHL A;  1VQ5 Q;  3GNF B;  5LJ3 g;  1NEB A;  3OQ5 A;  1K9M R;  5GAN j;  1MMG A;  4J83 A;  4M77 G;  4BE1 A;  1D0Z A;  1KJW A;  2RD1 A;  3JB9 J;  3CPW P;  1I81 A;  4ZGE B;  2CP6 A;  1IB8 A;  2JTF A;  1YCS B;  4XAX B;  2ZPF B;  1NG2 A;  1PWT A;  4M77 B;  2COW A;  4DA4 A;  3CC2 Q;  4NL2 A;  2C06 A;  4A4E A;  1AWJ A;  3G4S T;  2NUP A;  4M7D D;  1JEG A;  4F7U F;  2EJG A;  2CKK A;  4F04 B;  1ACM B;  1OUL A;  1W2B A;  3QO3 A;  2W10 A;  3UDC A;  4NOY A;  1VQL A;  5HKC A;  2PZ1 A;  4FSX A;  2IIM A;  2QAS A;  4E7K A;  3WXM B;  5GAO l;  1RAH B;  5GAN 4;  3CCM Q;  3GBQ A;  3R6N A;  1R8O B;  3VS5 A;  2YRV A;  5ECA A;  1AZE A;  2VB6 A;  3KUF A;  2DTH A;  2KNB B;  1ZLM A;  3X24 B;  4XTY A;  1ZX6 A;  2DX1 A;  2CP0 A;  1OEB A;  3M0U A;  1VQ9 Q;  1WI7 A;  2EQM A;  2PTK A;  2EYQ A;  2J7I A;  1K9A A;  3HSB A;  1V1C A;  1OI1 A;  4N0A A;  5GAO m;  4XTZ A;  1VQM T;  1OZ3 A;  2KXC A;  3L2R A;  3OYH A;  4OMQ A;  5A2Q E;  1Q82 R;  1RLP C;  2ESW A;  2AHJ B;  4HCZ A;  2DET A;  4DOW A;  4C8Q C;  2XD0 A;  3CCV Q;  1T3L A;  2EQJ A;  3HHT B;  1RAA B;  2CP5 A;  5I21 A;  1N27 A;  2DBM A;  2WSE E;  1M90 R;  1KC8 U;  3TEE A;  2KR3 A;  4AFU C;  2QEX T;  1VQO T;  3SWN A;  1XNI A;  1VQK Q;  2YLB A;  1GBR A;  2CZ6 B;  4XTW A;  5GAM f;  2EPD A;  3SHW A;  1TUC A;  1YJW Q;  4KBM B;  3EG3 A;  1YHQ A;  2O4X B;  1OQK A;  2CZ0 B;  4C8Q F;  4PNO A;  3HPW A;  1BBZ A;  1PD1 A;  4KH1 B;  2YRC A;  4EIK A;  3VUZ A;  2M16 A;  2A08 A;  2A0F B;  4M7A B;  3S6W A;  3R6O A;  1H3H A;  4E7Z A;  2RQT A;  4D8D A;  2FZG B;  1KIK A;  2XDD A;  2HBP A;  2SEM A;  1YIT T;  2RO0 A;  3H0H A;  2K4Y A;  4BY6 C;  1Y96 B;  2COZ A;  3VRY A;  2EGC A;  2LCS A;  1YBY A;  3EG9 A;  1AOJ A;  2WSF E;  3GIB A;  4LNP A;  1M3A A;  1GCP A;  2A37 A;  3A5Z B;  4RG2 A;  5KYY A;  3EG2 A;  4C5I A;  4ELY C;  1WYX A;  1VQ6 Q;  4EMK A;  2B8A A;  4J9C A;  1BIB A;  1E7O A;  5GAO p;  2CSQ A;  2FYK A;  4FL6 A;  5KYW B;  4PJO B;  1UEB A;  3RNJ A;  1KQ2 A;  2M0Y A;  1KFZ A;  1NYG A;  3RER A;  4CC7 A;  4QVC A;  3E9G A;  5KCO A;  1X2K A;  5IH2 A;  1NYF A;  1SSH A;  2K2M A;  1M8M A;  4C0G A;  1GXI E;  5GJW B;  2OTL A;  1LVK A;  3LWI A;  3E9F A;  2DK3 A;  5I2M A;  4ZGD B;  1OX8 A;  4BD3 A;  3EG0 A;  2MK5 A;  1QVG S;  1SF9 A;  2O2O A;  1S72 Q;  2DXC A;  1Z9Z A;  1MND A;  3CCR T;  2HNI A;  1JU5 C;  3FJP A;  2YUQ A;  3OYI A;  2E12 A;  5GAO r;  4IKF A;  1BCO A;  1NBE B;  1YIJ T;  4BI3 A;  3LX7 A;  3OS2 A;  2CUD A;  2DZC A;  3OMC A;  1AZG B;  3X26 B;  1WHG A;  2DD5 A;  5IT9 E;  5GAN 6;  4Z88 A;  3EAE A;  3MKD A;  4J9F A;  3HRU A;  4ZN1 A;  3TU4 K;  4J9H A;  3EFR A;  3G6E T;  3QYH B;  1PC0 A;  3NGP A;  2XK0 A;  2LJ3 A;  2QA4 T;  4E2F B;  3CCU T;  4DEX A;  4JZ4 A;  2CT3 A;  2YLC A;  3MET A;  3CC4 Q;  1Q7Y R;  4M75 C;  3A8G B;  1BYM A;  5CKD A;  1QWF A;  5CQY A;  4J6W A;  1QP3 A;  2HSE B;  2LQ8 A;  4HVV A;  4KUD K;  5GAM e;  2RA2 A;  2CZ1 B;  2P84 A;  4NS5 A;  1OPK A;  3QSU A;  3V8J A;  3CC7 A;  1H8K A;  4PJJ A;  1FXX A;  1H64 1;  3V7C A;  1ZBX A;  1OX9 A;  3T9N A;  2L3R A;  2JW4 A;  2EQK A;  5KE2 A;  4L5G A;  2ZAE A;  2PUK B;  5DY9 A;  3DLL A;  2B86 A;  4J9I A;  5KYX A;  3RDV A;  3V8L A;  4M7D F;  2DRM A;  1C6V X;  2V8K A;  3M4Y A;  1M4Z A;  4IUQ A;  4RTZ A;  1TS9 A;  2F5K A;  2RHX A;  2RQV A;  5GAN 5;  5CKB A;  2E70 A;  1NPP A;  4JUV A;  2K5I A;  3CME A;  4HT8 A;  1VQ5 A;  2EFI A;  4FIB A;  2LJ1 A;  5IHI A;  4OB1 B;  4C0D B;  2D0N A;  2K3B A;  4C5E A;  1PRL C;  2H3J A;  1XOV A;  3ZFJ A;  1D1C A;  2EQI A;  3OS1 A;  2HL3 A;  3INZ A;  1K73 C;  1ZSG A;  3CC2 A;  3OYY A;  3I5R A;  3CPF A;  2XDP A;  4DBF A;  5LJ5 d;  1GFC A;  2HKQ B;  1XQH A;  2VV5 A;  1RAD B;  2LDM A;  2JZ2 A;  5GAN 2;  2AT1 B;  2ZZD A;  1JRI A;  5FU7 B;  1HSQ A;  2DXU A;  3LW5 E;  3A8L B;  3VS0 A;  1VQ4 Q;  2VUB A;  5GMK l;  2LTO A;  1MHN A;  3C4S A;  2DEU A;  1NE8 A;  1VQN A;  2BZ8 A;  2PVD B;  3FJ5 A;  3D7S B;  1WA7 A;  4D8K A;  4C92 G;  3I55 A;  3AT1 B;  3J7A F;  5LJ3 d;  1VQ9 A;  2E6N A;  3GF5 A;  3LGF A;  4CC2 A;  1YWO A;  1N9S A;  1O75 A;  3MEU A;  3MEW A;  5CO7 A;  4M77 C;  1F1B B;  2QGF B;  1X01 A;  2JS0 A;  5GMK m; 
#chains in the Genus database with same CATH homology
 3H0I A;  1PNJ A;  1X69 A;  2YUN A;  1EFN A;  4JPB W;  3NMZ C;  1I0C A;  2EYX A;  4RUG A;  2KRN A;  3TSZ A;  2DRK A;  1HD3 A;  4HXJ A;  4F17 A;  3VS4 A;  2ROL A;  2V1R A;  1E6H A;  2J05 A;  2RF0 A;  2NWM A;  2MCN A;  1BB9 A;  3C0C A;  1SHG A;  2GBQ A;  1VYV A;  1X27 A;  4AFS C;  2JTE A;  4F14 A;  2FO0 A;  2KRS A;  2BTT A;  3PVQ A;  3UF4 A;  1MUZ A;  5FWB A;  2L0A A;  2DNU A;  1ZUK A;  1UEC A;  3I35 A;  1M27 C;  2W0Z A;  1GCQ A;  4M4Z A;  2DL7 A;  2OJ2 A;  1UFF A;  2EYY A;  2RPN A;  1NM7 A;  4HVU A;  1QLY A;  1K0S A;  2GNC A;  2GQI A;  1SEM A;  2A36 A;  3NHN A;  2BZX A;  1RI9 A;  4AFZ C;  1JQQ A;  2EVR A;  5I22 A;  1NLP C;  2FRW A;  1HJD A;  1I1J A;  4A63 B;  1H92 A;  3M0P A;  1BU1 A;  2DL4 A;  4GBQ A;  1SPK A;  3VS7 A;  1ZUU A;  1CKA A;  4OMO A;  1UJ0 A;  1NEB A;  1OOT A;  2GGR A;  1FMK A;  1VYT A;  1YP5 A;  2AKK A;  1KJW A;  2FEI A;  2KGT A;  1KSW A;  2X3X D;  2CT4 A;  4AG1 C;  1Z9Q A;  1CSK A;  1YCS B;  1SRM A;  2AZV A;  1PKS A;  3I9Q A;  3REA B;  1NG2 A;  1PWT A;  2FPE A;  3H41 A;  1AWJ A;  1JEG A;  2PNI A;  4E6R A;  2DL3 A;  2W10 A;  1NLO C;  2G6F X;  5FW9 A;  2PZ1 A;  2IIM A;  2KYB A;  3EGU A;  2O31 A;  4IIM A;  2F2W A;  3GBQ A;  3R6N A;  5FWC A;  5IHK A;  1OV3 A;  2ECZ A;  2DE0 X;  3VS5 A;  4RTW A;  2JMC A;  5ECA A;  1AWW A;  1AZE A;  2VVK A;  5HCK A;  1ABO A;  2F2X A;  2KNB B;  1ZLM A;  1M3B A;  1ZX6 A;  2DX1 A;  2YSQ A;  1OEB A;  1NEG A;  2ED0 A;  3M0U A;  4RTU A;  1WI7 A;  3NPF A;  2CDT A;  2PTK A;  1K76 A;  1UHC A;  2J6F A;  4RTY A;  2J7I A;  1K9A A;  1V1C A;  2KT1 A;  2LMJ A;  2FPD A;  1M30 A;  4LN2 A;  1MV0 B;  1U3O A;  1UE9 A;  2KXC A;  4F16 A;  3M0T A;  4OMQ A;  2CSI A;  2GTJ A;  1TUD A;  1G2B A;  2KRO A;  2I0N A;  3UA6 A;  1PKT A;  4ORZ A;  2DBK A;  3M0S A;  1A0N B;  1RLP C;  2ESW A;  2AK5 A;  1T3L A;  1X43 A;  1PRM C;  2LZ6 B;  4QT7 A;  2GTO A;  2K6D A;  1QCF A;  2DBM A;  2D8H A;  2DMO A;  3VRZ A;  2KR3 A;  2LX7 A;  2YUO A;  4AFU C;  4LUD A;  1AEY A;  2MOX A;  2HSP A;  1GBR A;  4RTV A;  2EPD A;  3SHW A;  2XMF A;  3UA7 A;  1TUC A;  1UGV A;  3EG3 A;  2LQN A;  1UJY A;  1QKX A;  2C0T A;  1X6B A;  2LNH B;  1BBZ A;  1WDX A;  4JJB A;  3VS6 A;  2BZY A;  1OPL A;  2OI3 A;  4EIK A;  2AZS A;  2YUP A;  1AD5 A;  3QWX X;  1TG0 A;  2A08 A;  2HCK A;  1H3H A;  2RQT A;  3EHQ A;  4J9D A;  4D8D A;  4JJD A;  1KIK A;  4HCK A;  2SEM A;  3TVT A;  3H0H A;  2KRM A;  2CUB A;  4ZNX A;  2EBP A;  1X6G A;  2EGC A;  3VRY A;  2LCS A;  4J9E A;  2FRY A;  1AOJ A;  2EYW A;  2ED1 A;  4LNP A;  1M3A A;  3SEM A;  1GCP A;  2A37 A;  1FYN A;  5IXF A;  1Y57 A;  2YDL A;  2DL8 A;  1CKB A;  2EW3 A;  3EG2 A;  2C0O A;  4J9B A;  1WYX A;  4J9C A;  1E7O A;  2DVJ A;  4CC3 A;  1K4U S;  2CSQ A;  4LUE A;  3RNJ A;  4AG2 C;  1UDL A;  2M0Y A;  1KFZ A;  1NYG A;  1K0X A;  1GRI A;  1M3C A;  4CC7 A;  2ABL A;  1SRL A;  2O9S A;  1X2K A;  2RN8 A;  5IH2 A;  1NYF A;  1SSH A;  2DA9 A;  2K2M A;  1M8M A;  5I11 A;  2L3P A;  4JZ3 A;  2CRE A;  5GJW B;  3KFV A;  4OMN A;  1MV3 A;  2DM1 A;  4Z89 A;  2ENM A;  1ABQ A;  1ZBJ A;  2KXD A;  1QWE A;  3EG0 A;  4X1V A;  2O2O A;  2CH4 A;  1JO8 A;  4RTX A;  2F2V A;  1Z9Z A;  4JJC A;  1SHF A;  2H8H A;  2O88 A;  1JU5 C;  2YUQ A;  2VWF A;  2E5K A;  2DYB A;  4HVW A;  2K79 A;  2NUZ A;  1U06 A;  3REB B;  1GL5 A;  2CUD A;  2L3Q A;  1AZG B;  5IHN A;  4RTT A;  1VA7 A;  2J6K A;  2K9G A;  3I5S A;  4Z88 A;  2EKH A;  4WCI A;  4J9F A;  1J3T A;  1YWP A;  1PHT A;  4J9H A;  2FG0 A;  2V1Q A;  2YT6 A;  3NGP A;  1WXB A;  2LJ3 A;  4GLM A;  3UAT A;  4ESR A;  5IXB A;  1QKW A;  2DLP A;  3PE0 A;  5EC7 A;  4DEX A;  4JZ4 A;  2CT3 A;  2DIL A;  4J9G A;  1RLQ C;  4CC4 B;  2KBT A;  3TSW A;  2JXB A;  3M0Q A;  1QWF A;  1W6X A;  1T3S A;  2LP5 A;  4AFQ C;  1I07 A;  2MIO A;  4HVV A;  4KRT A;  3U23 A;  1BK2 A;  3EG1 A;  3LH5 A;  1OPK A;  1B3Q A;  2EGA A;  1WLP B;  1H8K A;  1WXU A;  2LQW A;  2JMA A;  1N5Z A;  3THK A;  2RNA A;  2JW4 A;  3A98 A;  1UG1 A;  3O5Z A;  4IIO A;  1G83 A;  2B86 A;  4J9I A;  2FPF A;  2RQW A;  3IQL A;  2DRM A;  2ROT A;  2CH4 W;  2C0I A;  4RTZ A;  1GCQ C;  2HDA A;  1AWO A;  2JT4 A;  2J6O A;  2RQV A;  1WFW A;  1IO6 A;  4Y92 A;  4OMM A;  2DJQ A;  2VKN A;  1WIE A;  2DL5 A;  2X3W D;  1RUW A;  3JV3 A;  4OMP A;  1T0J A;  2LJ1 A;  2SRC A;  3PVL A;  2D1X A;  1W70 A;  2A28 A;  5IHI A;  2KT8 A;  1GFD A;  1LCK A;  2O9V A;  2D0N A;  2M51 A;  1JXO A;  2RQR A;  3RBB B;  2K3B A;  2HEQ A;  1PRL C;  2K7A A;  1XOV A;  2LJ0 A;  2QDL A;  2KYM A;  1Y0M A;  2EQI A;  2JM9 A;  2KE9 A;  1ZSG A;  3QWY A;  3I5R A;  1T0H A;  1YNZ A;  2D8J A;  1X2Q A;  4DEY A;  1E6G A;  3ZL7 C;  1YN8 A;  3VS2 A;  3EHR A;  1GFC A;  2AKL A;  1UTI A;  2KEA A;  4LE9 A;  2JM8 A;  2DF6 A;  1UUE A;  3CQT A;  2L3S A;  2J06 A;  1UHF A;  1VYU A;  1AVZ C;  2RMO A;  1WX6 A;  1HSQ A;  2RQU A;  1S1N A;  1JXM A;  1WXT A;  4OML A;  2P4R A;  3VS0 A;  1GBQ A;  2EYZ A;  1B07 A;  1ARK A;  2BZ8 A;  4Z8A A;  1K1Z A;  3FJ5 A;  3H0F A;  3VS1 A;  1WA7 A;  4D8K A;  4FSS A;  1U5S A;  2JS2 A;  1ZUY A;  5L23 A;  4R0K A;  5GJV B;  4K11 A;  4CC2 A;  2EGE A;  1YWO A;  2L2P A;  1W1F A;  3VS3 A;  3M0R A;  2OAW A;  2JS0 A;  3ULR B;  1AWX A;  2HBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...