5EC7A

Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 5.0
rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 12
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ec7A00
1JXMA 4HVUA 2OJ2A 2NWMA 1G83A 2LZ6B 2K6DA 1JQQA 2SRCA 1QCFA 4JJDA 4Z88A 2QDLA 2DNUA 4CC2A 2KRMA 1X43A 1M30A 2EVRA 4CC7A 3I35A 2FEIA 2VKNA 3VS0A 2ROTA 4J9BA 1GL5A 2JS2A 3RNJA 3VS6A 2L0AA 1WXBA 4JPBW 1AOJA 1W1FA 4LE9A 1UJYA 2DF6A 4AG1C 1G2BA 1Y57A 2KEAA 4OMLA 3IQLA 4AFSC 3NHNA 1WLPB 1RI9A 2DL7A 4RTXA 2LJ1A 2GNCA 1ZLMA 4FSSA 2GGRA 1GCQA 5FW9A 1UTIA 1X2KA 2CH4W 1KFZA 3VRYA 2KROA 1PRMC 2DL3A 2D8JA 2CSQA 3QWXX 1NM7A 2YUQA 4GLMA 5FWCA 2EPDA 1JO8A 1MUZA 3GBQA 4D8DA 2EYXA 2DILA 3EHRA 3JV3A 1K9AA 4J9HA 3UATA 1J3TA 3U23A 1SRLA 2DL5A 3PE0A 2HDAA 3M0RA 4HVVA 1FMKA 1ABQA 1K0SA 1M3AA 2GTJA 3SHWA 1M3BA 2ROLA 2VVKA 4AFUC 2K7AA 2CT3A 2LP5A 2F2XA 4OMOA 4IIMA 1S1NA 1TUDA 3ZL7C 2NUZA 1YWPA 1M8MA 2O88A 1Y0MA 4RTTA 2AK5A 2LX7A 4E6RA 1W70A 1E6GA 3H0IA 4RUGA 1NYGA 4QT7A 2KXCA 3QWYA 4CC3A 1UG1A 1VYTA 4RTYA 2KRSA 2CSIA 2RQVA 1UGVA 2B86A 4WCIA 3I9QA 2RQTA 2AKKA 1X2QA 2CH4A 2HSPA 2YUNA 2W0ZA 4OMPA 2GBQA 3PVLA 1ARKA 1PHTA 3VS4A 1BBZA 3EG3A 2JMAA 3O5ZA 4A63B 4Z89A 2L2PA 3VS3A 3VS5A 1PKTA 3EG1A 4R0KA 2DX1A 2VWFA 4DEYA 1KSWA 2RQWA 1SEMA 2RNAA 2W10A 1ZBJA 2EGEA 2AZVA 1AZEA 4AFQC 4F16A 2LNHB 4HVWA 1B07A 1NLOC 1HSQA 2KNBB 2L3QA 3PVQA 1IO6A 1X6BA 2SEMA 1FYNA 1OEBA 1V1CA 3UA6A 2MIOA 2CDTA 1WXTA 2RN8A 2ENMA 2D0NA 2JW4A 3H0HA 2KXDA 1MV0B 2E5KA 1QLYA 1QKWA 1VYVA 1Z9QA 2KRNA 2X3WD 1GRIA 1NLPC 2JS0A 1MV3A 1AWWA 2H8HA 4F17A 3VS1A 1VYUA 1UHFA 1QWEA 2EQIA 1AD5A 4DEXA 2FRYA 2JT4A 2EBPA 2V1QA 3NMZC 2PZ1A 2EGCA 1M3CA 2LCSA 2V1RA 4Z8AA 1QWFA 2BZ8A 2C0OA 3H0FA 2ECZA 2K79A 2JM9A 1RLPC 1ZUUA 1UFFA 1PNJA 3THKA 1YN8A 1ABOA 5I11A 1AVZC 2OI3A 2JXBA 5I22A 1ZUYA 1U06A 2J6OA 3REBB 1T0JA 3C0CA 3TSZA 1YP5A 1SHGA 2KYBA 1A0NB 2O9VA 1B3QA 2X3XD 1T3LA 2A37A 1CSKA 4AFZC 3NGPA 4Y92A 3TVTA 3M0TA 1T3SA 5IH2A 4K11A 2M51A 1PWTA 2AZSA 4RTWA 2AKLA 2MCNA 1U3OA 1LCKA 1GCQC 2O9SA 1GBRA 2PTKA 2JMCA 2LMJA 4RTVA 1BB9A 2FO0A 5IXFA 1KJWA 3M0QA 1UJ0A 2ESWA 2XMFA 1ZX6A 1SRMA 1NYFA 4J9DA 1K0XA 1BK2A 3EHQA 2DL4A 4J9EA 2A36A 4IIOA 2J06A 1TUCA 1OPKA 3KFVA 2EYYA 1N5ZA 1UE9A 2YSQA 4JZ3A 2DL8A 2YT6A 1CKBA 4LN2A 1OV3A 1NG2A 2CUDA 3R6NA 2DRMA 2YUOA 2D8HA 2K2MA 1VA7A 2RQUA 1PRLC 1JU5C 5GJVB 2LJ0A 2C0TA 1X27A 3EG0A 2K9GA 1K76A 4RTZA 4X1VA 1TG0A 2EYZA 2DYBA 1AEYA 1PKSA 2GQIA 1K1ZA 2CT4A 4HXJA 2C0IA 2KT8A 1HJDA 4JZ4A 3UF4A 1H8KA 1X6GA 1YCSB 4J9CA 1E7OA 1WXUA 2L3SA 1WX6A 2FPEA 2RMOA 1W6XA 2JTEA 3H41A 4LUEA 1YWOA 2DA9A 4LNPA 1JXOA 3FJ5A 1E6HA 2F2VA 1WIEA 2BZXA 5IHNA 5IHIA 1WYXA 3I5SA 2BTTA 2KBTA 1JEGA 2HCKA 2LQWA 4KRTA 1WDXA 1GBQA 1ZSGA 4ESRA 1NEGA 1H92A 2IIMA 1YNZA 2J05A 4JJBA 1AZGB 1OPLA 4ORZA 5EC7A 2YUPA 2M0YA 1GCPA 5FWBA 2RPNA 2CUBA 2RF0A 2DJQA 5GJWB 2DBKA 1WI7A 2J6KA 3EGUA 4M4ZA 1SPKA 5IHKA 2OAWA 3A98A 2DBMA 1CKAA 2PNIA 2DM1A 4CC4B 4ZNXA 1UDLA 2FPFA 1K4US 2MOXA 2FPDA 2LJ3A 4JJCA 2L3PA 2O2OA 1OOTA 3ULRB 3CQTA 3LH5A 2K3BA 3M0PA 2HBWA 2I0NA 2KYMA 2HEQA 4AG2C 1M27C 4J9IA 2J7IA 3EG2A 2CREA 1I1JA 2KE9A 2DLPA 2KGTA 1GFCA 4OMMA 5L23A 1KIKA 3SEMA 2ABLA 1NEBA 3RBBB 1UUEA 4RTUA 2DRKA 2EGAA 1SSHA 1T0HA 1GFDA 4J9GA 1X69A 4EIKA 3REAB 1I07A 1U5SA 3M0SA 1AWOA 2KR3A 4OMQA 2FRWA 1I0CA 1BU1A 1UECA 3NPFA 3UA7A 2P4RA 4OMNA 4GBQA 5HCKA 4F14A 1AWJA 1HD3A 2DVJA 2D1XA 5IXBA 1H3HA 2ED1A 2G6FX 2EYWA 1AWXA 2J6FA 3M0UA 2F2WA 5ECAA 2O31A 1QKXA 1RUWA 2RQRA 1UHCA 2YDLA 3TSWA 4HCKA 2ED0A 1WA7A 1Z9ZA 2DE0X 1ZUKA 3VRZA 4D8KA 2BZYA 4J9FA 2EKHA 1EFNA 1XOVA 3VS2A 2FG0A 1RLQC 2DMOA 2A08A 1WFWA 2EW3A 2KT1A 2JM8A 4LUDA 2LQNA 3I5RA 2GTOA 2A28A 1SHFA 3VS7A
chains in the Genus database with same CATH superfamily
2R57A 4HVUA 1EZZB 2NUPB 3LGFA 2NWMA 4C92A 4EMHA 1G83A 2QGFB 3QO3A 2CZ0B 2SRCA 3JAME 2M02A 4Z88A 3JB9J 1UGSB 2KRMA 5A0GA 1KHIA 2EVRA 4CC7A 1N6AA 2FEIA 4J9BA 1RAFB 5C0MA 3VS6A 1WXBA 4JPBW 3JB9H 1W1FA 3DKMA 2LDMA 3OBWA 1Q81U 3MCAB 4AG1C 1G2BA 4J6XA 1WLPB 1RI9A 4BI8B 1YBYA 2BE9B 3C94A 1ZLMA 3KBGA 3H6ZA 1VQKQ 4NS5A 2BIVA 5FW9A 4M7AC 4B6MA 2HD0A 2KROA 4LD6A 1PRMC 2DL3A 2D8JA 3CC4Q 4OGEA 3CCVQ 1Q82R 1X6OA 3F70A 2YUQA 5CKBA 4J83A 5FWCA 3LYIA 2DTIA 1MUZA 2E3HA 3GBQA 2RHYA 3CPWA 2L8DA 4XU0A 5KCHA 3CMAT 3L2QA 2K2VA 3U23A 3VYHB 3A1PA 1K0SA 1IHVA 5LJ3e 1MMAA 1M3BA 3FRNA 2K7AA 4KUIA 2CT3A 1S1NA 5J3BA 1G3TA 1YWPA 1M8MA 1Y0MA 3RKYA 3S6WA 4M77C 4V2SA 4PJJA 2V8JA 2KXCA 3SWNA 3CXCA 1VQLT 2QYZA 1D1AA 1UG1A 4X9CA 1VYTA 3QXEB 4RTYA 5FU6B 2KRSA 3RIRA 2B86A 4WCIA 4BACA 4RMOA 3CCET 1IB8A 3L2UA 4QKUA 1X2QA 1YJNT 3NTHA 3OBYA 4GY5A 1PHTA 4MMKA 4ZGDB 1N8RC 2JMAA 4YTLA 3S3MA 4Z89A 4KGZB 2JTFA 4PLIA 1WHJA 2QI2A 3CCJA 3OYEA 3CMET 2VWFA 4DEYA 2RQWA 4NL3A 2EGEA 4J5YA 2DFUA 4XU2A 4AFQC 4HVWA 4LDWA 1NLOC 2L3QA 4ZN1A 4BD3A 3X26B 4A4EA 3GIBA 1V1CA 3UA6A 4XTYA 3JCMf 5LL6S 1VQOT 2DK3A 3M57A 2BKDN 1NBEB 2VASA 1M1KC 4M75F 2E5KA 4JUVA 2E6ZA 4IUVA 4C5IA 1NLPC 2JS0A 1MV3A 4L6V5 1AWWA 1B34B 2XU8A 4JLIA 3JCMW 4F7UE 4M78E 1AD5A 4DEXA 3AHUA 2QAZA 2EBPA 3NMZC 1OI1A 3E19A 1I5LA 1M3CA 7AT1B 2YRVA 1OZ2A 1TTHB 4XTWA 2JZ2A 2JJ9A 4OB1B 4PJOE 1VQ9Q 4XTVA 5FRNA 2RA2A 2BE7D 4PJLA 3HRSA 1N8RR 3THKA 1ABOA 1VIFA 2H3EB 2ZPBB 1KK7A 2QQRA 4A4GA 3CCVT 1IRXA 2K57A 3EGXB 2LVMA 1A0NB 1D3BB 2FB7A 4LXCA 1B3QA 2L3RA 3HPWA 2AHJB 4EMKA 1TH7A 4OB2B 3I55Q 1K73C 3TVTA 3M0TA 3MO8A 1O9SA 1BI0A 3HP9A 4N4GA 4C92B 4RTWA 3M5AA 2DD5A 2DXTA 5GMKl 4MDXA 4J6YA 5L8RE 5GAOq 2FO0A 5IXFA 2XDPA 3CPWS 2ESWA 2XMFA 4L5GA 4Y91A 3P8BB 1BCOA 4KBMB 3UDCA 3CC2A 2A36A 4NL2A 5GANf 2H3JA 1VQNT 1YJ9Q 2LQ8A 3KFVA 2EYYA 3CC7A 2EJGA 3CCUA 3CD6T 2EWNA 1CKBA 1QQJA 5CK9A 4B9WA 1SKUB 3R6NA 3UWNA 3JCMV 1H3ZA 1RAEB 2RQUA 5LJ3g 4JLGA 3QG1A 2C06A 3MJXA 1X27A 3CCEQ 1Q81C 3CCRA 1BYMA 1Y7XA 2AT1B 1TG0A 4A4HA 3CC7Q 4FYYB 3CCUQ 1ZSZA 1PKSA 2QQBA 2CT4A 1VQKT 1X6GA 4A53A 1E7OA 1S72T 2FPEA 4VUBA 2XI9A 2RMOA 4JS4A 4FSXA 1YWOA 2EQMA 3HRTA 1KD1R 4C0FA 1WYXA 4M75E 1N8RU 1IGUA 1D3BA 2KBTA 2E70A 1WDXA 1ZSGA 5DLQE 4ESRA 4E7HA 1H92A 2IIMA 1YNZA 2DYIA 4ORZA 1AZGB 3OYDA 2YUPA 2M0YA 1ZBXA 2RPNA 1G3WA 2CUBA 4DOVA 2DBKA 4HA8A 1WI7A 5IHKA 3A98A 4CC4B 4ANJA 4HT9A 2QDYB 5EG2A 2MOXA 2FPDA 2LJ3A 2QASA 4FYWB 3QKJA 5HY6A 3C95A 4JJCA 4PFOA 4JDSA 1VQNQ 1YJWA 4FW1A 1OX8A 4RCCA 2E4HA 1WJRA 3ULRB 3LH5A 2K3BA 5GMKm 2KAFA 1R0CB 3M0PA 2KYMA 2HEQA 1NPRA 1AT1B 1R8OB 2QQSA 4QVZA 3E9GA 2WSFE 3R6OA 2J7IA 2VC8A 1I1JA 5GMKj 1KD1U 5KYYB 2LX9A 2DLPA 2X4WA 3OYMA 1GFCA 5L23A 2KY9A 1M90C 2DTHA 1NEBA 1KQSA 3RBBB 1C6VX 1GXIE 2FZCB 5A0LA 2RM4A 4J9GA 4IUQA 2DXBA 1I07A 5GANe 1AWOA 1VQ5A 2KR3A 1TU0B 2FRWA 1BU1A 3OW2P 4EMKB 1OX9A 2DVJA 1H3HA 2ED1A 5AT1B 2EYWA 3OQ5A 5ECAA 4C0DC 4MZMA 2G3RA 2RI5A 2VB6A 5FROA 2PQWA 4N0AA 3SWNB 3L2WA 1ZSZC 1UEBA 2X4JA 4FYXB 5D7UA 1YJNQ 1WA7A 1Z9ZA 4D8KA 2E5QA 4EPCA 5GAN6 3HSBA 5LJ3h 3OB9A 1XOVA 2GQVA 3DB3A 5LJ5g 4AMCA 1RLQC 2YLCA 2IPOB 4FW2A 2KT1A 4C92E 2JM8A 1G8XA 2CGHA 4DBFA 1XJWB 4M7DF 2KMTA 4MDWA 1VQ4A 1EIFA 4J7IA 2A28A 2COWA 3PIPA 5GANd 2E10A 1JXMA 5LJ5j 2OTJQ 2PVOB 4O6JA 2K6DA 4PJOA 1X01A 2O4XA 3ZEHA 3EFRA 2OTLA 2DAQA 2PVGB 1PG5B 1X43A 3M59A 1M30A 5C6SA 4EDUA 1IXDA 2VV5A 3ZBDA 1YI2T 5GAN3 2ROTA 2RJCA 4KH1B 2A7YA 2JS2A 3RNJA 3FB9A 5FU6C 3NTIA 4FT2A 4M7DG 3RKXA 2GFUA 2FZGB 3IQLA 3M9QA 2QG9B 3QSUA 3NFCA 4M75G 1KQ2A 4QVDA 4RTXA 2GNCA 2D6FA 2EJ9A 2HQHA 3V8JA 3CC4T 4FM4B 1GCQA 1UTIA 3G6EQ 1KFZA 1XTDA 4PLLA 3QWXX 3OYJA 1D0YA 5KCOA 1Y96B 3PIOA 4AT1B 3G4SA 4PKCC 3M4YA 3RMQA 2EQJA 4M75B 1H641 4C8QF 4C0GA 2EYXA 1ZSZB 3JCMc 2M1HA 4KH0B 2K4YA 3RESA 3CC4A 4M78C 4F7UB 1HK9A 3PE0A 2HDAA 2HSEB 3M0RA 3CMEQ 4PJOD 1M3AA 4BE1A 2VUBA 3CCQT 4AFUC 4C8QG 1WHMA 1TUDA 1VQMA 1N9SA 4MZTA 4PL6A 2O88A 4RTTA 4R56A 1KC8U 1W70A 4XU1A 1QW1A 1ZQ1A 4QT7A 3CMEA 5M9OA 5CAIA 1UGPB 3OSSC 5D6WA 1M90U 4XTXA 4OP0A 3QDFA 2NUTA 2X4YA 2RQTA 2AKKA 3MPUB 5GAOl 2FYKA 2XIDA 2F5TX 3MHXA 2W0ZA 4LD9K 2GBQA 1M1FA 1ARKA 2JOYA 3J7AF 2DXUA 1BBZA 1NJIC 5GMKi 3O5ZA 2K5FA 3GLXA 1TXQA 4J6WA 2XDBA 3EG1A 3HKSA 4R0KA 4DBQA 5HK3A 3I55A 2XG8D 1SEMA 2R58A 4IUUA 2W10A 1Y07A 4BDYA 3OYGA 5LJ3j 1VQPQ 2YRDA 4F16A 1K9MR 3JCMX 1W2BS 3TEEA 4PJNA 1V29B 3QYHB 2KNBB 4FYVB 1D09B 2SEMA 6AT1B 3JCMb 1VQLA 2MIOA 4M75C 4RG8A 8AT1B 4M78G 2MYSA 2MWOA 1VQPA 2DPPB 2ENMA 3CD6Q 1VQ5T 1QKWA 2LCLA 2KRNA 3EG9A 2ZCFB 1GRIA 2Z0WA 3I56T 1JRIA 5KYNA 3A8GB 4F17A 2XKOC 2EYQA 2RD1A 3BDLA 1YCYA 3CCLA 4M78F 1BCMA 2V1QA 4EMGA 3C4SA 3CXCS 4C5EA 2LCSA 1QMCA 4QQDA 1M8VA 2C0OA 1OQKA 3H0FA 2K79A 2Y90A 3I55T 2EQKA 4KULA 1PNJA 3MP6A 3FLGA 1RI0A 4M7DC 2JXBA 2V8KA 1I8FA 1LPLA 1ZUYA 3QDRB 1OZ3A 2J6OA 1FX7A 3TSZA 3LLRA 1YP5A 3HFOA 5AYFA 4C5HA 1SHGA 1FMVA 4FU6A 3L2ZA 3QHSA 2D0QB 3S3NA 3RKWA 1VQ6A 1CSKA 2A37A 1WQWA 5FU7B 5DY9A 2K3YA 2QA4T 5GANj 2P4TA 3OW2A 2E6NA 3ASKA 3EGXA 4IUPA 2M51A 1YHQQ 1IREB 3M4GA 4X9DA 2V8IA 4QQ6A 1KJWA 1YI2A 5FLXE 4M77D 1NYFA 3MEUA 4B9XA 1QVGA 2VXFA 4ZTFA 4IIOA 2COZA 2HL5C 2NYSA 2HKNA 3OS5A 1TUCA 3VYGA 2DZ9A 1I81A 4FIBA 5CCAA 2YT6A 5GAN5 1R0BG 4LN2A 1OV3A 1UB4A 1AHJB 1RAAB 2CUDA 3JSCA 2YUOA 2K2MA 1PRLC 4R55A 1G5VA 3GF5A 5KYWA 1JU5C 1YIJQ 4ZGJB 5GAOn 4LDUA 2C0TA 5IN1A 2EYZA 1AEYA 2GQIA 1K1ZA 4M77F 1ZHIA 2C0IA 5CIUA 4JZ4A 4PJMA 1WXUA 2L3SA 1WX6A 2IVWA 2LT4A 1YIJA 4M75A 2JTEA 1OULA 4LUEA 1Q7YR 1MMNA 2DA9A 2CZ1B 5IHNA 5GAMj 2BZXA 4ATOA 2F1LA 4M77G 4C5GA 1Q86R 2LT1A 3OMGA 5CVIA 2VXEA 4JJBA 1WQ7A 5A2QE 2FL7A 1GCPA 2WSEE 1VIEA 2OAUA 2RF0A 4XTUA 5GJWB 5CO7A 1EX4A 2PVDB 3HFNA 1D1BA 4ME7A 1M1KR 2PNIA 3T9NA 1C0MA 3ER0A 1XNIA 3UPUA 3OA6A 2RHXA 1JB0E 3EG9B 4XAXB 1IGQA 3CQTA 2KSSA 2CYZB 2HBWA 4DA4A 3PNWC 5KYYA 4PFZA 4AG2C 4A4KA 1M27C 1BIBA 8ATCB 3H9NA 3J81E 3EG2A 2CREA 4WF2A 5J39A 4F7UA 3CBPA 2KGTA 1KIKA 2HBPA 3OYFA 1G3YA 3I56Q 2QEXA 4RTUA 2EGAA 3E1SA 1SSHA 1T0HA 1YITA 1JJ2A 3M0SA 3VJPA 1FMWA 4PNOA 1UECA 1Q7YU 3EH2A 1VQKA 4M77E 4GBQA 4OB0B 5IAYA 4Z02A 1HD3A 2D1XA 3QZ5B 2F2WA 4C8QB 2O31A 2DZCA 3MEVA 3CCMQ 1UHCA 2K5LA 2LNVA 1ZA2B 3JCMg 5KE2A 5LJ3f 4N4IA 2QEXT 2BZYA 2EKHA 4BY6C 4M77A 3VS2A 1Y96A 2FG0A 2DMOA 3CCMA 2A08A 2MI6A 5IT9E 3PMTA 2LQNA 2E3IA 3E9FA 1YJNA 3CCUT 3CC7T 3VS7A 2DETA 5GAN2 4E2FB 5KYWB 2OJ2A 3A8HB 2LZ6B 1K8AR 1QVFS 2PU9B 4JJDA 4CC2A 5CKDA 3A5ZB 1M2VB 4N4HA 3QIIA 1MHNA 1VQ4Q 1LNXA 3SFMA 4OF1A 1BI1A 1WJQA 1GL5A 2AIRB 1AOJA 3CCQQ 4M7AE 4PFPA 1KHCA 4LE9A 4OMFB 2OTLT 4HCCA 2OTLQ 3MEAA 1UJYA 1W4SA 3S3OA 2DF6A 2ZPGB 1NZ9A 2KEAA 4OMLA 3JCMe 3NHNA 3P8HA 3GPLA 2DL7A 4FSSA 4KGVB 1VQ4T 2GGRA 3URGA 3A8LB 1X2KA 3VRYA 4A54A 2KDSA 2PUOB 3RR6A 3A8OB 1PSFA 3G7ZA 3N5BB 2EPDA 2DXCA 1Q86C 3V8LA 2RHZA 4D8DA 5HKCA 2RH2A 3JV3A 1K9AA 3CC2Q 4J9HA 4ELZC 2E65A 1O75A 4ZGEB 3JCMQ 5CKFA 3LX7A 2DIGA 1VQ8T 1FMKA 2OX7A 2JNGA 3G71A 2BUDA 3CCRT 2HAXA 2GTJA 2D9TA 2E12A 4ZTJA 1VQNA 4OMOA 4IIMA 1F1BB 1ZA1B 3ZL7C 2NUZA 4NOYA 2AK5A 2LX7A 1VQOA 4E6RA 1E6GA 2K5IA 4RUGA 2L89A 5FRMA 2P84A 4OB3B 3QWYA 2HMAA 4D6WA 1MNDA 1VQ9A 3MEWA 1UGVA 3I9QA 2MK5A 2JN0A 3DLMA 2HSPA 4OMPA 3OSVA 3FEOA 3VS4A 4TVRA 3OYNA 3CCEA 5FU7C 3V7RA 3M55A 1PKTA 2Y4YA 2DX1A 5GMKe 1KSWA 1QVPA 1I4K1 2COYA 1K9MC 3CCVA 4IUTA 2AZVA 1B34A 4MMLA 3D7SB 3GP8A 3CEYA 4C92D 1HSQA 4MZPA 5HK0A 5I2MA 9ATCB 3L2RA 1X6BA 3EFOA 1OEBA 3HTRA 2CDTA 2RJDA 1WXTA 2V26A 1PSEA 1YIJT 1YJWQ 1MV0B 4C8QE 4PJOC 1R77A 2CS7A 3VS1A 1QWEA 2MMPA 2JT4A 1BIAA 3NTKA 3WXMB 2QTXA 2EGCA 2X4XA 5DM7R 5CKEA 2V1RA 4QQGA 1QWFA 1WHHA 3CBOA 2QQAA 2BZ8A 2JM9A 4KGXB 5I21A 5I11A 1AVZC 1VQ5Q 5I22A 3BE3A 1RACB 1HXDA 2LCCA 4WTOB 4C0ZA 2F69A 3C0CA 2JUFA 3QPHA 5GMKh 2KYBA 4E47A 1ACMB 2O9VA 3LGLA 2Y4XA 2DEUA 2X3XD 4JRKA 4AFZC 5GAOp 1K73R 1D0XA 3NGPA 4Y92A 4J8OA 4M7DE 4IURA 2FHDA 1B7TA 4PJOF 2MCNA 1LCKA 1GCQC 2XDDA 2PTKA 4RTVA 1UJ0A 1ZX6A 3G4SQ 2GCXA 4J9DA 5GANh 1K0XA 1BK2A 3MP1A 2GFAA 3EHQA 2DL4A 3TCJA 2RB6A 3DB4A 5J26A 2QA4A 3GNFB 3QYGB 3TREA 3PFSA 1MMDA 2DTOA 1N5ZA 1UE9A 2YSQA 3QJYA 4RCBA 3HL8A 4C92G 1NG2A 1M9SA 5CKHA 4QVCA 1VQMQ 1KG1A 4C8QC 2LJ0A 3G1JA 2K9GA 4RTZA 4X1VA 2YLBA 2MF2A 2DYBA 4M7AF 1YFNA 3HRUA 3I56A 4C8QD 1XQHA 4J9CA 2QEXQ 3OYCA 1UGQB 1W6XA 2PUKB 1KC8R 2DO3A 2R5MA 2E1HA 5GAOr 2F5KA 4LNPA 1JXOA 4XU3A 2X51A 5IHIA 3M53A 4IKFA 3AT1B 3I5SA 2BTTA 3RMSA 1JEGA 1M2VA 2HCKA 1Q86U 4ZN3A 4KRTA 4JS5A 1NEGA 3X20B 4HCZA 3OY9A 5EC7A 4M75D 3PT9A 4E7ZA 5GAMd 2DJQA 2ZPFB 4JRIA 4F7UF 3LWHA 3EGUA 5CR2A 1OU8A 4M4ZA 5KYXB 1LVKA 1CKAA 2FZKB 1MMGA 1Q82C 2QTVA 4EMKC 2M9UA 3G6EA 2CP5A 3OYKA 3FJPA 3VU3C 3VUZA 2L3PA 2RJEA 2O2OA 1OOTA 4BUGA 1VQ9T 4QW2A 2OTJA 4XK8E 2I0NA 3SDZA 3VV0A 1QVFP 1WNLA 2YHTA 4DQ2A 1RL2A 3RDVA 4JRPA 1M1KU 3FDRA 3E2UA 2HKQB 3WVDB 2EQUA 3L1AA 1RAGB 3EGDA 4OMMA 3SEMA 2XICA 3OYIA 2QQ9A 4E7IA 4LDYA 3CCQA 1VQ7Q 3CCSA 1UUEA 2P0QA 5GAN4 1GFDA 4EIKA 1X69A 3REAB 1U5SA 1VQOQ 4OVAA 1VQMT 1I5OB 4OMQA 3OYBA 4P5NA 3NPFA 3UA7A 3SD4A 2X35A 4OMNA 1TSFA 3CCLT 4PJOB 1WHKA 5HCKA 4F14A 1VQ7A 5GAMf 1QP2A 1AWJA 4M78D 5IXBA 3RUXA 1NJIR 2G6FX 2J6FA 3M0UA 4Y28E 4E7KA 4Q5WA 1UGRB 4M78A 1QKXA 2A0FB 4XTZA 2RQRA 4UC4A 3TSWA 4C92C 4FCYA 4HCKA 2DJZA 3VKIA 2KK4A 3LH0A 3G4ST 3VUBA 1TUGB 1YI2Q 3VRZA 1TWBA 4J9FA 1D1CA 1EFNA 2X9HA 1MNEA 1MGQA 4BI3A 2CP3A 1P92A 3KXTA 1IZ6A 1QCOA 1OU9A 3G71Q 4BE2A 1WFWA 1YJWT 2EW3A 4GLKA 2DERA 2B8AA 4LUDA 5KYXA 1YJ9A 3JCMP 3I5RA 1IHWA 3PGGA 3OYYA 1SSFA 1Q81R 2GTOA 1SHFA 2DEQA 2GF7A 1JQQA 2QK0A 1VQLQ 1QCFA 2QDLA 1M1GA 2DNUA 2E41A 1SG5A 2XK0A 3CCRQ 3L2VA 3I35A 2ZAEA 1WPYA 2VKNA 3VS0A 2EIFA 2WSCE 3GOXA 1KD1C 1VQ8Q 2L0AA 1NJIU 2ATCB 3CPFA 3CCLQ 1Y57A 4LDVA 4AFSC 4HKEA 3EGDB 3X28B 1K8AU 2LJ1A 1VQ8A 4M7DA 2DIQA 2VYTA 4II1A 3HHTB 3CXCP 4KT0E 3ME9A 3C12A 2M0OA 5KYUB 1BKBA 2CH4W 4RKUE 4XQ3A 1YHQA 2CSQA 2K3XA 2XD0A 1NM7A 3G71T 5LJ3d 3OYLA 4JRQA 4GLMA 3DLLA 1PCXA 2RI3A 4PJOG 4BDZA 1JO8A 3H8ZA 1FXXA 2YRCA 3M58A 2DILA 5A0DA 1NE8A 1SF9A 3EHRA 3JCMh 3UATA 1J3TA 1SRLA 2DL5A 3A8MB 1YITT 1W2BA 3KUFA 3OS1A 3FC3A 1KQSP 4HVVA 2R5AA 1ABQA 4F7UG 3JCMd 5LJ5h 3QUIA 2NUTB 3SHWA 3EFOB 2ROLA 2VVKA 3CC2T 2LP5A 2F2XA 3EAEA 5LJ5d 4CI0C 3QBYA 3H0IA 1V76A 1NYGA 3M56A 4CC3A 3Q1JA 2QA4Q 1PM3A 2CSIA 2RQVA 1N9RA 4HCBA 4L59A 2KQWA 2VGMA 1QCNA 5GAMg 3CCJQ 2CH4A 2MAMA 2YUNA 5I2SA 1HYOA 3P8DA 3PVLA 4DOWA 3EG3A 4M7DB 1M4ZA 3CCMT 4A63B 4M7AB 2L2PA 3MP8A 3X24B 4F04B 3VS3A 2HQEA 2DD4A 3VS5A 3O8VA 3JB9G 4E7SA 4O5VA 2RNAA 1ZBJA 4OGCA 1AZEA 3CBMA 2LNHB 4BY6B 1N27A 3OW2S 1B07A 4FL6A 3PVQA 3FIFA 2ZPEB 3JB9D 1IO6A 2EFIA 3M54A 1RADB 2LRQA 4CRIA 1FYNA 1OYXA 2WACA 2ZPHB 2LTOA 3META 2RN8A 2JW4A 2D0NA 3QJ6A 3H0HA 5GAN8 3J80E 2KXDA 2RK2A 3V7SA 1QVGP 1QLYA 2HQXA 3OS0A 1VYVA 1Z9QA 2X3WD 3OYAA 2H8HA 3JRZA 1VYUA 1UHFA 2EQIA 2FRYA 3BW1A 1QP3A 2DVEA 2HL3A 2PZ1A 1S72A 1JBMA 5D6XA 4M77B 4Z8AA 4BE0A 2YXYA 3QZ9B 1PD1A 3BFMA 2ECZA 1RLPC 2QGGA 3CCJT 1BI3A 2RHUA 1ZUUA 1UFFA 1YN8A 1YITQ 5D6YA 2OI3A 2MWPA 1U1SA 1S72Q 4M7AD 2MPXC 1U06A 3CPWP 3REBB 1T0JA 2EAYA 1LJOA 1PC0A 1T3LA 1NPPA 2DKGA 2KI7A 3CCSQ 5KE3A 1T3SA 4JJNK 5IH2A 4K11A 1PWTA 2AZSA 3LWIA 2AKLA 1U3OA 4M7AA 2O9SA 5GAMe 1GBRA 2JMCA 2LMJA 1VQ6T 1BB9A 2HNIA 1BI2A 2CP0A 3M0QA 1SRMA 2O4XB 1YJ9T 1DJ7B 3EFSA 5GAN7 4J9EA 1D0ZA 4A4FA 2J06A 1OPKA 3MKDA 3RERA 2RI2A 2EJFA 2CP7A 2DL8A 4JZ3A 1WHLA 1VUBA 3OS2A 1M5Q1 2DRMA 2D8HA 1C1AA 1VA7A 2NUPA 5GJVB 3EG0A 1RABB 1K76A 4N0AC 1TOVA 3TQ7P 5LJ5f 4M78B 4HXJA 1LOJA 2KT8A 1K8AC 1HJDA 3UF4A 1H8KA 1X75C 1YCSB 2IG0A 3SWNC 1KC8C 1U8RA 5GAMh 1RAHB 3H41A 2CZ7B 1U1TA 5GANg 5KH6A 1Q7YC 5CQYA 4C92F 3FJ5A 1E6HA 2F2VA 1WIEA 3UT1A 1WZOA 2CP6A 4DBHA 2LQWA 1YHQT 2XHCA 1GBQA 2J05A 4M7AG 2FVUA 1OPLA 4ELYC 3OYHA 1G3SA 5FWBA 3OMCA 3CD6A 3CCST 2J6KA 2L5QA 2NLUA 2OTJT 2RO0A 1SPKA 2OAWA 3BY7A 2DBMA 2DM1A 4PK4A 2KVQG 2JTMA 3JB9F 4ZNXA 1UDLA 2QXFA 2FPFA 1K4US 5GAOm 3G6ET 3PTAA 4FT4A 1JJ2S 4DBRA 1W2BP 4RG2A 3JCMJ 2P0PA 2A3LA 2YWWA 3SB2A 1FWZA 4M7DD 4LDXA 1KQSS 5KYUA 2LQKA 1WGSA 3PMIA 4J9IA 3INZA 1WHGA 1KQ1A 2KE9A 1M2OA 2RJFA 4C0DB 1QVFA 3CMAQ 2EKOA 2ZPIB 2ABLA 1JJ2P 1VQ6Q 2ZGWA 1M90R 4KUDK 4BI4A 2DRKA 2CZ6B 1VQ7T 4C8QA 2HZYA 3LW5E 2LC4A 1WJSA 1PD0A 3CMAA 1I0CA 5CQXA 2P4RA 1VQPT 4J7FA 1Q95G 2ZZDA 4X34A 2RK1A 2P0KA 3TU4K 3BDUA 2RHIA 1AWXA 3GNGA 4E7LA 2E64A 3X25B 1RUWA 4E7JA 2YDLA 2O01E 1QVGS 2JVVA 2VGNA 2ED0A 2DE0X 5DLOA 2M16A 1VOMA 1ZUKA 3ZFJA 1K9MU 1K73U 5LJ5e 2CP2A 4BB7A 2I2LA 1Q82U 3L42A 3V8KA 2CKKA 3EH1A 3V7CA 4HT8A 1Y71A 3JB9I 1RAIB 3WVEB 1TS9A
chains in the Genus database with same CATH topology
1JXMA 4HVUA 2OJ2A 2NWMA 1G83A 2LZ6B 2K6DA 1JQQA 2SRCA 1QCFA 4JJDA 4Z88A 2QDLA 2DNUA 4CC2A 2KRMA 1X43A 1M30A 2EVRA 4CC7A 3I35A 2FEIA 2VKNA 3VS0A 2ROTA 4J9BA 1GL5A 2JS2A 3RNJA 3VS6A 2L0AA 1WXBA 4JPBW 1AOJA 1W1FA 4LE9A 1UJYA 2DF6A 4AG1C 1G2BA 1Y57A 2KEAA 4OMLA 3IQLA 4AFSC 3NHNA 1WLPB 1RI9A 2DL7A 4RTXA 2LJ1A 2GNCA 1ZLMA 4FSSA 2GGRA 1GCQA 5FW9A 1UTIA 1X2KA 2CH4W 1KFZA 3VRYA 2KROA 1PRMC 2DL3A 2D8JA 2CSQA 3QWXX 1NM7A 2YUQA 4GLMA 5FWCA 2EPDA 1JO8A 1MUZA 3GBQA 4D8DA 2EYXA 2DILA 3EHRA 3JV3A 1K9AA 4J9HA 3UATA 1J3TA 3U23A 1SRLA 2DL5A 3PE0A 2HDAA 3M0RA 4HVVA 1FMKA 1ABQA 1K0SA 1M3AA 2GTJA 3SHWA 1M3BA 2ROLA 2VVKA 4AFUC 2K7AA 2CT3A 2LP5A 2F2XA 4OMOA 4IIMA 1S1NA 1TUDA 3ZL7C 2NUZA 1YWPA 1M8MA 2O88A 1Y0MA 4RTTA 2AK5A 2LX7A 4E6RA 1W70A 1E6GA 3H0IA 4RUGA 1NYGA 4QT7A 2KXCA 3QWYA 4CC3A 1UG1A 1VYTA 4RTYA 2KRSA 2CSIA 2RQVA 1UGVA 2B86A 4WCIA 3I9QA 2RQTA 2AKKA 1X2QA 2CH4A 2HSPA 2YUNA 2W0ZA 4OMPA 2GBQA 3PVLA 1ARKA 1PHTA 3VS4A 1BBZA 3EG3A 2JMAA 3O5ZA 4A63B 4Z89A 2L2PA 3VS3A 3VS5A 1PKTA 3EG1A 4R0KA 2DX1A 2VWFA 4DEYA 1KSWA 2RQWA 1SEMA 2RNAA 2W10A 1ZBJA 2EGEA 2AZVA 1AZEA 4AFQC 4F16A 2LNHB 4HVWA 1B07A 1NLOC 1HSQA 2KNBB 2L3QA 3PVQA 1IO6A 1X6BA 2SEMA 1FYNA 1OEBA 1V1CA 3UA6A 2MIOA 2CDTA 1WXTA 2RN8A 2ENMA 2D0NA 2JW4A 3H0HA 2KXDA 1MV0B 2E5KA 1QLYA 1QKWA 1VYVA 1Z9QA 2KRNA 2X3WD 1GRIA 1NLPC 2JS0A 1MV3A 1AWWA 2H8HA 4F17A 3VS1A 1VYUA 1UHFA 1QWEA 2EQIA 1AD5A 4DEXA 2FRYA 2JT4A 2EBPA 2V1QA 3NMZC 2PZ1A 2EGCA 1M3CA 2LCSA 2V1RA 4Z8AA 1QWFA 2BZ8A 2C0OA 3H0FA 2ECZA 2K79A 2JM9A 1RLPC 1ZUUA 1UFFA 1PNJA 3THKA 1YN8A 1ABOA 5I11A 1AVZC 2OI3A 2JXBA 5I22A 1ZUYA 1U06A 2J6OA 3REBB 1T0JA 3C0CA 3TSZA 1YP5A 1SHGA 2KYBA 1A0NB 2O9VA 1B3QA 2X3XD 1T3LA 2A37A 1CSKA 4AFZC 3NGPA 4Y92A 3TVTA 3M0TA 1T3SA 5IH2A 4K11A 2M51A 1PWTA 2AZSA 4RTWA 2AKLA 2MCNA 1U3OA 1LCKA 1GCQC 2O9SA 1GBRA 2PTKA 2JMCA 2LMJA 4RTVA 1BB9A 2FO0A 5IXFA 1KJWA 3M0QA 1UJ0A 2ESWA 2XMFA 1ZX6A 1SRMA 1NYFA 4J9DA 1K0XA 1BK2A 3EHQA 2DL4A 4J9EA 2A36A 4IIOA 2J06A 1TUCA 1OPKA 3KFVA 2EYYA 1N5ZA 1UE9A 2YSQA 4JZ3A 2DL8A 2YT6A 1CKBA 4LN2A 1OV3A 1NG2A 2CUDA 3R6NA 2DRMA 2YUOA 2D8HA 2K2MA 1VA7A 2RQUA 1PRLC 1JU5C 5GJVB 2LJ0A 2C0TA 1X27A 3EG0A 2K9GA 1K76A 4RTZA 4X1VA 1TG0A 2EYZA 2DYBA 1AEYA 1PKSA 2GQIA 1K1ZA 2CT4A 4HXJA 2C0IA 2KT8A 1HJDA 4JZ4A 3UF4A 1H8KA 1X6GA 1YCSB 4J9CA 1E7OA 1WXUA 2L3SA 1WX6A 2FPEA 2RMOA 1W6XA 2JTEA 3H41A 4LUEA 1YWOA 2DA9A 4LNPA 1JXOA 3FJ5A 1E6HA 2F2VA 1WIEA 2BZXA 5IHNA 5IHIA 1WYXA 3I5SA 2BTTA 2KBTA 1JEGA 2HCKA 2LQWA 4KRTA 1WDXA 1GBQA 1ZSGA 4ESRA 1NEGA 1H92A 2IIMA 1YNZA 2J05A 4JJBA 1AZGB 1OPLA 4ORZA 5EC7A 2YUPA 2M0YA 1GCPA 5FWBA 2RPNA 2CUBA 2RF0A 2DJQA 5GJWB 2DBKA 1WI7A 2J6KA 3EGUA 4M4ZA 1SPKA 5IHKA 2OAWA 3A98A 2DBMA 1CKAA 2PNIA 2DM1A 4CC4B 4ZNXA 1UDLA 2FPFA 1K4US 2MOXA 2FPDA 2LJ3A 4JJCA 2L3PA 2O2OA 1OOTA 3ULRB 3CQTA 3LH5A 2K3BA 3M0PA 2HBWA 2I0NA 2KYMA 2HEQA 4AG2C 1M27C 4J9IA 2J7IA 3EG2A 2CREA 1I1JA 2KE9A 2DLPA 2KGTA 1GFCA 4OMMA 5L23A 1KIKA 3SEMA 2ABLA 1NEBA 3RBBB 1UUEA 4RTUA 2DRKA 2EGAA 1SSHA 1T0HA 1GFDA 4J9GA 1X69A 4EIKA 3REAB 1I07A 1U5SA 3M0SA 1AWOA 2KR3A 4OMQA 2FRWA 1I0CA 1BU1A 1UECA 3NPFA 3UA7A 2P4RA 4OMNA 4GBQA 5HCKA 4F14A 1AWJA 1HD3A 2DVJA 2D1XA 5IXBA 1H3HA 2ED1A 2G6FX 2EYWA 1AWXA 2J6FA 3M0UA 2F2WA 5ECAA 2O31A 1QKXA 1RUWA 2RQRA 1UHCA 2YDLA 3TSWA 4HCKA 2ED0A 1WA7A 1Z9ZA 2DE0X 1ZUKA 3VRZA 4D8KA 2BZYA 4J9FA 2EKHA 1EFNA 1XOVA 3VS2A 2FG0A 1RLQC 2DMOA 2A08A 1WFWA 2EW3A 2KT1A 2JM8A 4LUDA 2LQNA 3I5RA 2GTOA 2A28A 1SHFA 3VS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXM A;  4HVU A;  2OJ2 A;  2NWM A;  1G83 A;  2LZ6 B;  2K6D A;  1JQQ A;  2SRC A;  1QCF A;  4JJD A;  4Z88 A;  2QDL A;  2DNU A;  4CC2 A;  2KRM A;  1X43 A;  1M30 A;  2EVR A;  4CC7 A;  3I35 A;  2FEI A;  2VKN A;  3VS0 A;  2ROT A;  4J9B A;  1GL5 A;  2JS2 A;  3RNJ A;  3VS6 A;  2L0A A;  1WXB A;  4JPB W;  1AOJ A;  1W1F A;  4LE9 A;  1UJY A;  2DF6 A;  4AG1 C;  1G2B A;  1Y57 A;  2KEA A;  4OML A;  3IQL A;  4AFS C;  3NHN A;  1WLP B;  1RI9 A;  2DL7 A;  4RTX A;  2LJ1 A;  2GNC A;  1ZLM A;  4FSS A;  2GGR A;  1GCQ A;  5FW9 A;  1UTI A;  1X2K A;  2CH4 W;  1KFZ A;  3VRY A;  2KRO A;  1PRM C;  2DL3 A;  2D8J A;  2CSQ A;  3QWX X;  1NM7 A;  2YUQ A;  4GLM A;  5FWC A;  2EPD A;  1JO8 A;  1MUZ A;  3GBQ A;  4D8D A;  2EYX A;  2DIL A;  3EHR A;  3JV3 A;  1K9A A;  4J9H A;  3UAT A;  1J3T A;  3U23 A;  1SRL A;  2DL5 A;  3PE0 A;  2HDA A;  3M0R A;  4HVV A;  1FMK A;  1ABQ A;  1K0S A;  1M3A A;  2GTJ A;  3SHW A;  1M3B A;  2ROL A;  2VVK A;  4AFU C;  2K7A A;  2CT3 A;  2LP5 A;  2F2X A;  4OMO A;  4IIM A;  1S1N A;  1TUD A;  3ZL7 C;  2NUZ A;  1YWP A;  1M8M A;  2O88 A;  1Y0M A;  4RTT A;  2AK5 A;  2LX7 A;  4E6R A;  1W70 A;  1E6G A;  3H0I A;  4RUG A;  1NYG A;  4QT7 A;  2KXC A;  3QWY A;  4CC3 A;  1UG1 A;  1VYT A;  4RTY A;  2KRS A;  2CSI A;  2RQV A;  1UGV A;  2B86 A;  4WCI A;  3I9Q A;  2RQT A;  2AKK A;  1X2Q A;  2CH4 A;  2HSP A;  2YUN A;  2W0Z A;  4OMP A;  2GBQ A;  3PVL A;  1ARK A;  1PHT A;  3VS4 A;  1BBZ A;  3EG3 A;  2JMA A;  3O5Z A;  4A63 B;  4Z89 A;  2L2P A;  3VS3 A;  3VS5 A;  1PKT A;  3EG1 A;  4R0K A;  2DX1 A;  2VWF A;  4DEY A;  1KSW A;  2RQW A;  1SEM A;  2RNA A;  2W10 A;  1ZBJ A;  2EGE A;  2AZV A;  1AZE A;  4AFQ C;  4F16 A;  2LNH B;  4HVW A;  1B07 A;  1NLO C;  1HSQ A;  2KNB B;  2L3Q A;  3PVQ A;  1IO6 A;  1X6B A;  2SEM A;  1FYN A;  1OEB A;  1V1C A;  3UA6 A;  2MIO A;  2CDT A;  1WXT A;  2RN8 A;  2ENM A;  2D0N A;  2JW4 A;  3H0H A;  2KXD A;  1MV0 B;  2E5K A;  1QLY A;  1QKW A;  1VYV A;  1Z9Q A;  2KRN A;  2X3W D;  1GRI A;  1NLP C;  2JS0 A;  1MV3 A;  1AWW A;  2H8H A;  4F17 A;  3VS1 A;  1VYU A;  1UHF A;  1QWE A;  2EQI A;  1AD5 A;  4DEX A;  2FRY A;  2JT4 A;  2EBP A;  2V1Q A;  3NMZ C;  2PZ1 A;  2EGC A;  1M3C A;  2LCS A;  2V1R A;  4Z8A A;  1QWF A;  2BZ8 A;  2C0O A;  3H0F A;  2ECZ A;  2K79 A;  2JM9 A;  1RLP C;  1ZUU A;  1UFF A;  1PNJ A;  3THK A;  1YN8 A;  1ABO A;  5I11 A;  1AVZ C;  2OI3 A;  2JXB A;  5I22 A;  1ZUY A;  1U06 A;  2J6O A;  3REB B;  1T0J A;  3C0C A;  3TSZ A;  1YP5 A;  1SHG A;  2KYB A;  1A0N B;  2O9V A;  1B3Q A;  2X3X D;  1T3L A;  2A37 A;  1CSK A;  4AFZ C;  3NGP A;  4Y92 A;  3TVT A;  3M0T A;  1T3S A;  5IH2 A;  4K11 A;  2M51 A;  1PWT A;  2AZS A;  4RTW A;  2AKL A;  2MCN A;  1U3O A;  1LCK A;  1GCQ C;  2O9S A;  1GBR A;  2PTK A;  2JMC A;  2LMJ A;  4RTV A;  1BB9 A;  2FO0 A;  5IXF A;  1KJW A;  3M0Q A;  1UJ0 A;  2ESW A;  2XMF A;  1ZX6 A;  1SRM A;  1NYF A;  4J9D A;  1K0X A;  1BK2 A;  3EHQ A;  2DL4 A;  4J9E A;  2A36 A;  4IIO A;  2J06 A;  1TUC A;  1OPK A;  3KFV A;  2EYY A;  1N5Z A;  1UE9 A;  2YSQ A;  4JZ3 A;  2DL8 A;  2YT6 A;  1CKB A;  4LN2 A;  1OV3 A;  1NG2 A;  2CUD A;  3R6N A;  2DRM A;  2YUO A;  2D8H A;  2K2M A;  1VA7 A;  2RQU A;  1PRL C;  1JU5 C;  5GJV B;  2LJ0 A;  2C0T A;  1X27 A;  3EG0 A;  2K9G A;  1K76 A;  4RTZ A;  4X1V A;  1TG0 A;  2EYZ A;  2DYB A;  1AEY A;  1PKS A;  2GQI A;  1K1Z A;  2CT4 A;  4HXJ A;  2C0I A;  2KT8 A;  1HJD A;  4JZ4 A;  3UF4 A;  1H8K A;  1X6G A;  1YCS B;  4J9C A;  1E7O A;  1WXU A;  2L3S A;  1WX6 A;  2FPE A;  2RMO A;  1W6X A;  2JTE A;  3H41 A;  4LUE A;  1YWO A;  2DA9 A;  4LNP A;  1JXO A;  3FJ5 A;  1E6H A;  2F2V A;  1WIE A;  2BZX A;  5IHN A;  5IHI A;  1WYX A;  3I5S A;  2BTT A;  2KBT A;  1JEG A;  2HCK A;  2LQW A;  4KRT A;  1WDX A;  1GBQ A;  1ZSG A;  4ESR A;  1NEG A;  1H92 A;  2IIM A;  1YNZ A;  2J05 A;  4JJB A;  1AZG B;  1OPL A;  4ORZ A;  5EC7 A;  2YUP A;  2M0Y A;  1GCP A;  5FWB A;  2RPN A;  2CUB A;  2RF0 A;  2DJQ A;  5GJW B;  2DBK A;  1WI7 A;  2J6K A;  3EGU A;  4M4Z A;  1SPK A;  5IHK A;  2OAW A;  3A98 A;  2DBM A;  1CKA A;  2PNI A;  2DM1 A;  4CC4 B;  4ZNX A;  1UDL A;  2FPF A;  1K4U S;  2MOX A;  2FPD A;  2LJ3 A;  4JJC A;  2L3P A;  2O2O A;  1OOT A;  3ULR B;  3CQT A;  3LH5 A;  2K3B A;  3M0P A;  2HBW A;  2I0N A;  2KYM A;  2HEQ A;  4AG2 C;  1M27 C;  4J9I A;  2J7I A;  3EG2 A;  2CRE A;  1I1J A;  2KE9 A;  2DLP A;  2KGT A;  1GFC A;  4OMM A;  5L23 A;  1KIK A;  3SEM A;  2ABL A;  1NEB A;  3RBB B;  1UUE A;  4RTU A;  2DRK A;  2EGA A;  1SSH A;  1T0H A;  1GFD A;  4J9G A;  1X69 A;  4EIK A;  3REA B;  1I07 A;  1U5S A;  3M0S A;  1AWO A;  2KR3 A;  4OMQ A;  2FRW A;  1I0C A;  1BU1 A;  1UEC A;  3NPF A;  3UA7 A;  2P4R A;  4OMN A;  4GBQ A;  5HCK A;  4F14 A;  1AWJ A;  1HD3 A;  2DVJ A;  2D1X A;  5IXB A;  1H3H A;  2ED1 A;  2G6F X;  2EYW A;  1AWX A;  2J6F A;  3M0U A;  2F2W A;  5ECA A;  2O31 A;  1QKX A;  1RUW A;  2RQR A;  1UHC A;  2YDL A;  3TSW A;  4HCK A;  2ED0 A;  1WA7 A;  1Z9Z A;  2DE0 X;  1ZUK A;  3VRZ A;  4D8K A;  2BZY A;  4J9F A;  2EKH A;  1EFN A;  1XOV A;  3VS2 A;  2FG0 A;  1RLQ C;  2DMO A;  2A08 A;  1WFW A;  2EW3 A;  2KT1 A;  2JM8 A;  4LUD A;  2LQN A;  3I5R A;  2GTO A;  2A28 A;  1SHF A;  3VS7 A; 
#chains in the Genus database with same CATH topology
 2R57 A;  4HVU A;  1EZZ B;  2NUP B;  3LGF A;  2NWM A;  4C92 A;  4EMH A;  1G83 A;  2QGF B;  3QO3 A;  2CZ0 B;  2SRC A;  3JAM E;  2M02 A;  4Z88 A;  3JB9 J;  1UGS B;  2KRM A;  5A0G A;  1KHI A;  2EVR A;  4CC7 A;  1N6A A;  2FEI A;  4J9B A;  1RAF B;  5C0M A;  3VS6 A;  1WXB A;  4JPB W;  3JB9 H;  1W1F A;  3DKM A;  2LDM A;  3OBW A;  1Q81 U;  3MCA B;  4AG1 C;  1G2B A;  4J6X A;  1WLP B;  1RI9 A;  4BI8 B;  1YBY A;  2BE9 B;  3C94 A;  1ZLM A;  3KBG A;  3H6Z A;  1VQK Q;  4NS5 A;  2BIV A;  5FW9 A;  4M7A C;  4B6M A;  2HD0 A;  2KRO A;  4LD6 A;  1PRM C;  2DL3 A;  2D8J A;  3CC4 Q;  4OGE A;  3CCV Q;  1Q82 R;  1X6O A;  3F70 A;  2YUQ A;  5CKB A;  4J83 A;  5FWC A;  3LYI A;  2DTI A;  1MUZ A;  2E3H A;  3GBQ A;  2RHY A;  3CPW A;  2L8D A;  4XU0 A;  5KCH A;  3CMA T;  3L2Q A;  2K2V A;  3U23 A;  3VYH B;  3A1P A;  1K0S A;  1IHV A;  5LJ3 e;  1MMA A;  1M3B A;  3FRN A;  2K7A A;  4KUI A;  2CT3 A;  1S1N A;  5J3B A;  1G3T A;  1YWP A;  1M8M A;  1Y0M A;  3RKY A;  3S6W A;  4M77 C;  4V2S A;  4PJJ A;  2V8J A;  2KXC A;  3SWN A;  3CXC A;  1VQL T;  2QYZ A;  1D1A A;  1UG1 A;  4X9C A;  1VYT A;  3QXE B;  4RTY A;  5FU6 B;  2KRS A;  3RIR A;  2B86 A;  4WCI A;  4BAC A;  4RMO A;  3CCE T;  1IB8 A;  3L2U A;  4QKU A;  1X2Q A;  1YJN T;  3NTH A;  3OBY A;  4GY5 A;  1PHT A;  4MMK A;  4ZGD B;  1N8R C;  2JMA A;  4YTL A;  3S3M A;  4Z89 A;  4KGZ B;  2JTF A;  4PLI A;  1WHJ A;  2QI2 A;  3CCJ A;  3OYE A;  3CME T;  2VWF A;  4DEY A;  2RQW A;  4NL3 A;  2EGE A;  4J5Y A;  2DFU A;  4XU2 A;  4AFQ C;  4HVW A;  4LDW A;  1NLO C;  2L3Q A;  4ZN1 A;  4BD3 A;  3X26 B;  4A4E A;  3GIB A;  1V1C A;  3UA6 A;  4XTY A;  3JCM f;  5LL6 S;  1VQO T;  2DK3 A;  3M57 A;  2BKD N;  1NBE B;  2VAS A;  1M1K C;  4M75 F;  2E5K A;  4JUV A;  2E6Z A;  4IUV A;  4C5I A;  1NLP C;  2JS0 A;  1MV3 A;  4L6V 5;  1AWW A;  1B34 B;  2XU8 A;  4JLI A;  3JCM W;  4F7U E;  4M78 E;  1AD5 A;  4DEX A;  3AHU A;  2QAZ A;  2EBP A;  3NMZ C;  1OI1 A;  3E19 A;  1I5L A;  1M3C A;  7AT1 B;  2YRV A;  1OZ2 A;  1TTH B;  4XTW A;  2JZ2 A;  2JJ9 A;  4OB1 B;  4PJO E;  1VQ9 Q;  4XTV A;  5FRN A;  2RA2 A;  2BE7 D;  4PJL A;  3HRS A;  1N8R R;  3THK A;  1ABO A;  1VIF A;  2H3E B;  2ZPB B;  1KK7 A;  2QQR A;  4A4G A;  3CCV T;  1IRX A;  2K57 A;  3EGX B;  2LVM A;  1A0N B;  1D3B B;  2FB7 A;  4LXC A;  1B3Q A;  2L3R A;  3HPW A;  2AHJ B;  4EMK A;  1TH7 A;  4OB2 B;  3I55 Q;  1K73 C;  3TVT A;  3M0T A;  3MO8 A;  1O9S A;  1BI0 A;  3HP9 A;  4N4G A;  4C92 B;  4RTW A;  3M5A A;  2DD5 A;  2DXT A;  5GMK l;  4MDX A;  4J6Y A;  5L8R E;  5GAO q;  2FO0 A;  5IXF A;  2XDP A;  3CPW S;  2ESW A;  2XMF A;  4L5G A;  4Y91 A;  3P8B B;  1BCO A;  4KBM B;  3UDC A;  3CC2 A;  2A36 A;  4NL2 A;  5GAN f;  2H3J A;  1VQN T;  1YJ9 Q;  2LQ8 A;  3KFV A;  2EYY A;  3CC7 A;  2EJG A;  3CCU A;  3CD6 T;  2EWN A;  1CKB A;  1QQJ A;  5CK9 A;  4B9W A;  1SKU B;  3R6N A;  3UWN A;  3JCM V;  1H3Z A;  1RAE B;  2RQU A;  5LJ3 g;  4JLG A;  3QG1 A;  2C06 A;  3MJX A;  1X27 A;  3CCE Q;  1Q81 C;  3CCR A;  1BYM A;  1Y7X A;  2AT1 B;  1TG0 A;  4A4H A;  3CC7 Q;  4FYY B;  3CCU Q;  1ZSZ A;  1PKS A;  2QQB A;  2CT4 A;  1VQK T;  1X6G A;  4A53 A;  1E7O A;  1S72 T;  2FPE A;  4VUB A;  2XI9 A;  2RMO A;  4JS4 A;  4FSX A;  1YWO A;  2EQM A;  3HRT A;  1KD1 R;  4C0F A;  1WYX A;  4M75 E;  1N8R U;  1IGU A;  1D3B A;  2KBT A;  2E70 A;  1WDX A;  1ZSG A;  5DLQ E;  4ESR A;  4E7H A;  1H92 A;  2IIM A;  1YNZ A;  2DYI A;  4ORZ A;  1AZG B;  3OYD A;  2YUP A;  2M0Y A;  1ZBX A;  2RPN A;  1G3W A;  2CUB A;  4DOV A;  2DBK A;  4HA8 A;  1WI7 A;  5IHK A;  3A98 A;  4CC4 B;  4ANJ A;  4HT9 A;  2QDY B;  5EG2 A;  2MOX A;  2FPD A;  2LJ3 A;  2QAS A;  4FYW B;  3QKJ A;  5HY6 A;  3C95 A;  4JJC A;  4PFO A;  4JDS A;  1VQN Q;  1YJW A;  4FW1 A;  1OX8 A;  4RCC A;  2E4H A;  1WJR A;  3ULR B;  3LH5 A;  2K3B A;  5GMK m;  2KAF A;  1R0C B;  3M0P A;  2KYM A;  2HEQ A;  1NPR A;  1AT1 B;  1R8O B;  2QQS A;  4QVZ A;  3E9G A;  2WSF E;  3R6O A;  2J7I A;  2VC8 A;  1I1J A;  5GMK j;  1KD1 U;  5KYY B;  2LX9 A;  2DLP A;  2X4W A;  3OYM A;  1GFC A;  5L23 A;  2KY9 A;  1M90 C;  2DTH A;  1NEB A;  1KQS A;  3RBB B;  1C6V X;  1GXI E;  2FZC B;  5A0L A;  2RM4 A;  4J9G A;  4IUQ A;  2DXB A;  1I07 A;  5GAN e;  1AWO A;  1VQ5 A;  2KR3 A;  1TU0 B;  2FRW A;  1BU1 A;  3OW2 P;  4EMK B;  1OX9 A;  2DVJ A;  1H3H A;  2ED1 A;  5AT1 B;  2EYW A;  3OQ5 A;  5ECA A;  4C0D C;  4MZM A;  2G3R A;  2RI5 A;  2VB6 A;  5FRO A;  2PQW A;  4N0A A;  3SWN B;  3L2W A;  1ZSZ C;  1UEB A;  2X4J A;  4FYX B;  5D7U A;  1YJN Q;  1WA7 A;  1Z9Z A;  4D8K A;  2E5Q A;  4EPC A;  5GAN 6;  3HSB A;  5LJ3 h;  3OB9 A;  1XOV A;  2GQV A;  3DB3 A;  5LJ5 g;  4AMC A;  1RLQ C;  2YLC A;  2IPO B;  4FW2 A;  2KT1 A;  4C92 E;  2JM8 A;  1G8X A;  2CGH A;  4DBF A;  1XJW B;  4M7D F;  2KMT A;  4MDW A;  1VQ4 A;  1EIF A;  4J7I A;  2A28 A;  2COW A;  3PIP A;  5GAN d;  2E10 A;  1JXM A;  5LJ5 j;  2OTJ Q;  2PVO B;  4O6J A;  2K6D A;  4PJO A;  1X01 A;  2O4X A;  3ZEH A;  3EFR A;  2OTL A;  2DAQ A;  2PVG B;  1PG5 B;  1X43 A;  3M59 A;  1M30 A;  5C6S A;  4EDU A;  1IXD A;  2VV5 A;  3ZBD A;  1YI2 T;  5GAN 3;  2ROT A;  2RJC A;  4KH1 B;  2A7Y A;  2JS2 A;  3RNJ A;  3FB9 A;  5FU6 C;  3NTI A;  4FT2 A;  4M7D G;  3RKX A;  2GFU A;  2FZG B;  3IQL A;  3M9Q A;  2QG9 B;  3QSU A;  3NFC A;  4M75 G;  1KQ2 A;  4QVD A;  4RTX A;  2GNC A;  2D6F A;  2EJ9 A;  2HQH A;  3V8J A;  3CC4 T;  4FM4 B;  1GCQ A;  1UTI A;  3G6E Q;  1KFZ A;  1XTD A;  4PLL A;  3QWX X;  3OYJ A;  1D0Y A;  5KCO A;  1Y96 B;  3PIO A;  4AT1 B;  3G4S A;  4PKC C;  3M4Y A;  3RMQ A;  2EQJ A;  4M75 B;  1H64 1;  4C8Q F;  4C0G A;  2EYX A;  1ZSZ B;  3JCM c;  2M1H A;  4KH0 B;  2K4Y A;  3RES A;  3CC4 A;  4M78 C;  4F7U B;  1HK9 A;  3PE0 A;  2HDA A;  2HSE B;  3M0R A;  3CME Q;  4PJO D;  1M3A A;  4BE1 A;  2VUB A;  3CCQ T;  4AFU C;  4C8Q G;  1WHM A;  1TUD A;  1VQM A;  1N9S A;  4MZT A;  4PL6 A;  2O88 A;  4RTT A;  4R56 A;  1KC8 U;  1W70 A;  4XU1 A;  1QW1 A;  1ZQ1 A;  4QT7 A;  3CME A;  5M9O A;  5CAI A;  1UGP B;  3OSS C;  5D6W A;  1M90 U;  4XTX A;  4OP0 A;  3QDF A;  2NUT A;  2X4Y A;  2RQT A;  2AKK A;  3MPU B;  5GAO l;  2FYK A;  2XID A;  2F5T X;  3MHX A;  2W0Z A;  4LD9 K;  2GBQ A;  1M1F A;  1ARK A;  2JOY A;  3J7A F;  2DXU A;  1BBZ A;  1NJI C;  5GMK i;  3O5Z A;  2K5F A;  3GLX A;  1TXQ A;  4J6W A;  2XDB A;  3EG1 A;  3HKS A;  4R0K A;  4DBQ A;  5HK3 A;  3I55 A;  2XG8 D;  1SEM A;  2R58 A;  4IUU A;  2W10 A;  1Y07 A;  4BDY A;  3OYG A;  5LJ3 j;  1VQP Q;  2YRD A;  4F16 A;  1K9M R;  3JCM X;  1W2B S;  3TEE A;  4PJN A;  1V29 B;  3QYH B;  2KNB B;  4FYV B;  1D09 B;  2SEM A;  6AT1 B;  3JCM b;  1VQL A;  2MIO A;  4M75 C;  4RG8 A;  8AT1 B;  4M78 G;  2MYS A;  2MWO A;  1VQP A;  2DPP B;  2ENM A;  3CD6 Q;  1VQ5 T;  1QKW A;  2LCL A;  2KRN A;  3EG9 A;  2ZCF B;  1GRI A;  2Z0W A;  3I56 T;  1JRI A;  5KYN A;  3A8G B;  4F17 A;  2XKO C;  2EYQ A;  2RD1 A;  3BDL A;  1YCY A;  3CCL A;  4M78 F;  1BCM A;  2V1Q A;  4EMG A;  3C4S A;  3CXC S;  4C5E A;  2LCS A;  1QMC A;  4QQD A;  1M8V A;  2C0O A;  1OQK A;  3H0F A;  2K79 A;  2Y90 A;  3I55 T;  2EQK A;  4KUL A;  1PNJ A;  3MP6 A;  3FLG A;  1RI0 A;  4M7D C;  2JXB A;  2V8K A;  1I8F A;  1LPL A;  1ZUY A;  3QDR B;  1OZ3 A;  2J6O A;  1FX7 A;  3TSZ A;  3LLR A;  1YP5 A;  3HFO A;  5AYF A;  4C5H A;  1SHG A;  1FMV A;  4FU6 A;  3L2Z A;  3QHS A;  2D0Q B;  3S3N A;  3RKW A;  1VQ6 A;  1CSK A;  2A37 A;  1WQW A;  5FU7 B;  5DY9 A;  2K3Y A;  2QA4 T;  5GAN j;  2P4T A;  3OW2 A;  2E6N A;  3ASK A;  3EGX A;  4IUP A;  2M51 A;  1YHQ Q;  1IRE B;  3M4G A;  4X9D A;  2V8I A;  4QQ6 A;  1KJW A;  1YI2 A;  5FLX E;  4M77 D;  1NYF A;  3MEU A;  4B9X A;  1QVG A;  2VXF A;  4ZTF A;  4IIO A;  2COZ A;  2HL5 C;  2NYS A;  2HKN A;  3OS5 A;  1TUC A;  3VYG A;  2DZ9 A;  1I81 A;  4FIB A;  5CCA A;  2YT6 A;  5GAN 5;  1R0B G;  4LN2 A;  1OV3 A;  1UB4 A;  1AHJ B;  1RAA B;  2CUD A;  3JSC A;  2YUO A;  2K2M A;  1PRL C;  4R55 A;  1G5V A;  3GF5 A;  5KYW A;  1JU5 C;  1YIJ Q;  4ZGJ B;  5GAO n;  4LDU A;  2C0T A;  5IN1 A;  2EYZ A;  1AEY A;  2GQI A;  1K1Z A;  4M77 F;  1ZHI A;  2C0I A;  5CIU A;  4JZ4 A;  4PJM A;  1WXU A;  2L3S A;  1WX6 A;  2IVW A;  2LT4 A;  1YIJ A;  4M75 A;  2JTE A;  1OUL A;  4LUE A;  1Q7Y R;  1MMN A;  2DA9 A;  2CZ1 B;  5IHN A;  5GAM j;  2BZX A;  4ATO A;  2F1L A;  4M77 G;  4C5G A;  1Q86 R;  2LT1 A;  3OMG A;  5CVI A;  2VXE A;  4JJB A;  1WQ7 A;  5A2Q E;  2FL7 A;  1GCP A;  2WSE E;  1VIE A;  2OAU A;  2RF0 A;  4XTU A;  5GJW B;  5CO7 A;  1EX4 A;  2PVD B;  3HFN A;  1D1B A;  4ME7 A;  1M1K R;  2PNI A;  3T9N A;  1C0M A;  3ER0 A;  1XNI A;  3UPU A;  3OA6 A;  2RHX A;  1JB0 E;  3EG9 B;  4XAX B;  1IGQ A;  3CQT A;  2KSS A;  2CYZ B;  2HBW A;  4DA4 A;  3PNW C;  5KYY A;  4PFZ A;  4AG2 C;  4A4K A;  1M27 C;  1BIB A;  8ATC B;  3H9N A;  3J81 E;  3EG2 A;  2CRE A;  4WF2 A;  5J39 A;  4F7U A;  3CBP A;  2KGT A;  1KIK A;  2HBP A;  3OYF A;  1G3Y A;  3I56 Q;  2QEX A;  4RTU A;  2EGA A;  3E1S A;  1SSH A;  1T0H A;  1YIT A;  1JJ2 A;  3M0S A;  3VJP A;  1FMW A;  4PNO A;  1UEC A;  1Q7Y U;  3EH2 A;  1VQK A;  4M77 E;  4GBQ A;  4OB0 B;  5IAY A;  4Z02 A;  1HD3 A;  2D1X A;  3QZ5 B;  2F2W A;  4C8Q B;  2O31 A;  2DZC A;  3MEV A;  3CCM Q;  1UHC A;  2K5L A;  2LNV A;  1ZA2 B;  3JCM g;  5KE2 A;  5LJ3 f;  4N4I A;  2QEX T;  2BZY A;  2EKH A;  4BY6 C;  4M77 A;  3VS2 A;  1Y96 A;  2FG0 A;  2DMO A;  3CCM A;  2A08 A;  2MI6 A;  5IT9 E;  3PMT A;  2LQN A;  2E3I A;  3E9F A;  1YJN A;  3CCU T;  3CC7 T;  3VS7 A;  2DET A;  5GAN 2;  4E2F B;  5KYW B;  2OJ2 A;  3A8H B;  2LZ6 B;  1K8A R;  1QVF S;  2PU9 B;  4JJD A;  4CC2 A;  5CKD A;  3A5Z B;  1M2V B;  4N4H A;  3QII A;  1MHN A;  1VQ4 Q;  1LNX A;  3SFM A;  4OF1 A;  1BI1 A;  1WJQ A;  1GL5 A;  2AIR B;  1AOJ A;  3CCQ Q;  4M7A E;  4PFP A;  1KHC A;  4LE9 A;  4OMF B;  2OTL T;  4HCC A;  2OTL Q;  3MEA A;  1UJY A;  1W4S A;  3S3O A;  2DF6 A;  2ZPG B;  1NZ9 A;  2KEA A;  4OML A;  3JCM e;  3NHN A;  3P8H A;  3GPL A;  2DL7 A;  4FSS A;  4KGV B;  1VQ4 T;  2GGR A;  3URG A;  3A8L B;  1X2K A;  3VRY A;  4A54 A;  2KDS A;  2PUO B;  3RR6 A;  3A8O B;  1PSF A;  3G7Z A;  3N5B B;  2EPD A;  2DXC A;  1Q86 C;  3V8L A;  2RHZ A;  4D8D A;  5HKC A;  2RH2 A;  3JV3 A;  1K9A A;  3CC2 Q;  4J9H A;  4ELZ C;  2E65 A;  1O75 A;  4ZGE B;  3JCM Q;  5CKF A;  3LX7 A;  2DIG A;  1VQ8 T;  1FMK A;  2OX7 A;  2JNG A;  3G71 A;  2BUD A;  3CCR T;  2HAX A;  2GTJ A;  2D9T A;  2E12 A;  4ZTJ A;  1VQN A;  4OMO A;  4IIM A;  1F1B B;  1ZA1 B;  3ZL7 C;  2NUZ A;  4NOY A;  2AK5 A;  2LX7 A;  1VQO A;  4E6R A;  1E6G A;  2K5I A;  4RUG A;  2L89 A;  5FRM A;  2P84 A;  4OB3 B;  3QWY A;  2HMA A;  4D6W A;  1MND A;  1VQ9 A;  3MEW A;  1UGV A;  3I9Q A;  2MK5 A;  2JN0 A;  3DLM A;  2HSP A;  4OMP A;  3OSV A;  3FEO A;  3VS4 A;  4TVR A;  3OYN A;  3CCE A;  5FU7 C;  3V7R A;  3M55 A;  1PKT A;  2Y4Y A;  2DX1 A;  5GMK e;  1KSW A;  1QVP A;  1I4K 1;  2COY A;  1K9M C;  3CCV A;  4IUT A;  2AZV A;  1B34 A;  4MML A;  3D7S B;  3GP8 A;  3CEY A;  4C92 D;  1HSQ A;  4MZP A;  5HK0 A;  5I2M A;  9ATC B;  3L2R A;  1X6B A;  3EFO A;  1OEB A;  3HTR A;  2CDT A;  2RJD A;  1WXT A;  2V26 A;  1PSE A;  1YIJ T;  1YJW Q;  1MV0 B;  4C8Q E;  4PJO C;  1R77 A;  2CS7 A;  3VS1 A;  1QWE A;  2MMP A;  2JT4 A;  1BIA A;  3NTK A;  3WXM B;  2QTX A;  2EGC A;  2X4X A;  5DM7 R;  5CKE A;  2V1R A;  4QQG A;  1QWF A;  1WHH A;  3CBO A;  2QQA A;  2BZ8 A;  2JM9 A;  4KGX B;  5I21 A;  5I11 A;  1AVZ C;  1VQ5 Q;  5I22 A;  3BE3 A;  1RAC B;  1HXD A;  2LCC A;  4WTO B;  4C0Z A;  2F69 A;  3C0C A;  2JUF A;  3QPH A;  5GMK h;  2KYB A;  4E47 A;  1ACM B;  2O9V A;  3LGL A;  2Y4X A;  2DEU A;  2X3X D;  4JRK A;  4AFZ C;  5GAO p;  1K73 R;  1D0X A;  3NGP A;  4Y92 A;  4J8O A;  4M7D E;  4IUR A;  2FHD A;  1B7T A;  4PJO F;  2MCN A;  1LCK A;  1GCQ C;  2XDD A;  2PTK A;  4RTV A;  1UJ0 A;  1ZX6 A;  3G4S Q;  2GCX A;  4J9D A;  5GAN h;  1K0X A;  1BK2 A;  3MP1 A;  2GFA A;  3EHQ A;  2DL4 A;  3TCJ A;  2RB6 A;  3DB4 A;  5J26 A;  2QA4 A;  3GNF B;  3QYG B;  3TRE A;  3PFS A;  1MMD A;  2DTO A;  1N5Z A;  1UE9 A;  2YSQ A;  3QJY A;  4RCB A;  3HL8 A;  4C92 G;  1NG2 A;  1M9S A;  5CKH A;  4QVC A;  1VQM Q;  1KG1 A;  4C8Q C;  2LJ0 A;  3G1J A;  2K9G A;  4RTZ A;  4X1V A;  2YLB A;  2MF2 A;  2DYB A;  4M7A F;  1YFN A;  3HRU A;  3I56 A;  4C8Q D;  1XQH A;  4J9C A;  2QEX Q;  3OYC A;  1UGQ B;  1W6X A;  2PUK B;  1KC8 R;  2DO3 A;  2R5M A;  2E1H A;  5GAO r;  2F5K A;  4LNP A;  1JXO A;  4XU3 A;  2X51 A;  5IHI A;  3M53 A;  4IKF A;  3AT1 B;  3I5S A;  2BTT A;  3RMS A;  1JEG A;  1M2V A;  2HCK A;  1Q86 U;  4ZN3 A;  4KRT A;  4JS5 A;  1NEG A;  3X20 B;  4HCZ A;  3OY9 A;  5EC7 A;  4M75 D;  3PT9 A;  4E7Z A;  5GAM d;  2DJQ A;  2ZPF B;  4JRI A;  4F7U F;  3LWH A;  3EGU A;  5CR2 A;  1OU8 A;  4M4Z A;  5KYX B;  1LVK A;  1CKA A;  2FZK B;  1MMG A;  1Q82 C;  2QTV A;  4EMK C;  2M9U A;  3G6E A;  2CP5 A;  3OYK A;  3FJP A;  3VU3 C;  3VUZ A;  2L3P A;  2RJE A;  2O2O A;  1OOT A;  4BUG A;  1VQ9 T;  4QW2 A;  2OTJ A;  4XK8 E;  2I0N A;  3SDZ A;  3VV0 A;  1QVF P;  1WNL A;  2YHT A;  4DQ2 A;  1RL2 A;  3RDV A;  4JRP A;  1M1K U;  3FDR A;  3E2U A;  2HKQ B;  3WVD B;  2EQU A;  3L1A A;  1RAG B;  3EGD A;  4OMM A;  3SEM A;  2XIC A;  3OYI A;  2QQ9 A;  4E7I A;  4LDY A;  3CCQ A;  1VQ7 Q;  3CCS A;  1UUE A;  2P0Q A;  5GAN 4;  1GFD A;  4EIK A;  1X69 A;  3REA B;  1U5S A;  1VQO Q;  4OVA A;  1VQM T;  1I5O B;  4OMQ A;  3OYB A;  4P5N A;  3NPF A;  3UA7 A;  3SD4 A;  2X35 A;  4OMN A;  1TSF A;  3CCL T;  4PJO B;  1WHK A;  5HCK A;  4F14 A;  1VQ7 A;  5GAM f;  1QP2 A;  1AWJ A;  4M78 D;  5IXB A;  3RUX A;  1NJI R;  2G6F X;  2J6F A;  3M0U A;  4Y28 E;  4E7K A;  4Q5W A;  1UGR B;  4M78 A;  1QKX A;  2A0F B;  4XTZ A;  2RQR A;  4UC4 A;  3TSW A;  4C92 C;  4FCY A;  4HCK A;  2DJZ A;  3VKI A;  2KK4 A;  3LH0 A;  3G4S T;  3VUB A;  1TUG B;  1YI2 Q;  3VRZ A;  1TWB A;  4J9F A;  1D1C A;  1EFN A;  2X9H A;  1MNE A;  1MGQ A;  4BI3 A;  2CP3 A;  1P92 A;  3KXT A;  1IZ6 A;  1QCO A;  1OU9 A;  3G71 Q;  4BE2 A;  1WFW A;  1YJW T;  2EW3 A;  4GLK A;  2DER A;  2B8A A;  4LUD A;  5KYX A;  1YJ9 A;  3JCM P;  3I5R A;  1IHW A;  3PGG A;  3OYY A;  1SSF A;  1Q81 R;  2GTO A;  1SHF A;  2DEQ A;  2GF7 A;  1JQQ A;  2QK0 A;  1VQL Q;  1QCF A;  2QDL A;  1M1G A;  2DNU A;  2E41 A;  1SG5 A;  2XK0 A;  3CCR Q;  3L2V A;  3I35 A;  2ZAE A;  1WPY A;  2VKN A;  3VS0 A;  2EIF A;  2WSC E;  3GOX A;  1KD1 C;  1VQ8 Q;  2L0A A;  1NJI U;  2ATC B;  3CPF A;  3CCL Q;  1Y57 A;  4LDV A;  4AFS C;  4HKE A;  3EGD B;  3X28 B;  1K8A U;  2LJ1 A;  1VQ8 A;  4M7D A;  2DIQ A;  2VYT A;  4II1 A;  3HHT B;  3CXC P;  4KT0 E;  3ME9 A;  3C12 A;  2M0O A;  5KYU B;  1BKB A;  2CH4 W;  4RKU E;  4XQ3 A;  1YHQ A;  2CSQ A;  2K3X A;  2XD0 A;  1NM7 A;  3G71 T;  5LJ3 d;  3OYL A;  4JRQ A;  4GLM A;  3DLL A;  1PCX A;  2RI3 A;  4PJO G;  4BDZ A;  1JO8 A;  3H8Z A;  1FXX A;  2YRC A;  3M58 A;  2DIL A;  5A0D A;  1NE8 A;  1SF9 A;  3EHR A;  3JCM h;  3UAT A;  1J3T A;  1SRL A;  2DL5 A;  3A8M B;  1YIT T;  1W2B A;  3KUF A;  3OS1 A;  3FC3 A;  1KQS P;  4HVV A;  2R5A A;  1ABQ A;  4F7U G;  3JCM d;  5LJ5 h;  3QUI A;  2NUT B;  3SHW A;  3EFO B;  2ROL A;  2VVK A;  3CC2 T;  2LP5 A;  2F2X A;  3EAE A;  5LJ5 d;  4CI0 C;  3QBY A;  3H0I A;  1V76 A;  1NYG A;  3M56 A;  4CC3 A;  3Q1J A;  2QA4 Q;  1PM3 A;  2CSI A;  2RQV A;  1N9R A;  4HCB A;  4L59 A;  2KQW A;  2VGM A;  1QCN A;  5GAM g;  3CCJ Q;  2CH4 A;  2MAM A;  2YUN A;  5I2S A;  1HYO A;  3P8D A;  3PVL A;  4DOW A;  3EG3 A;  4M7D B;  1M4Z A;  3CCM T;  4A63 B;  4M7A B;  2L2P A;  3MP8 A;  3X24 B;  4F04 B;  3VS3 A;  2HQE A;  2DD4 A;  3VS5 A;  3O8V A;  3JB9 G;  4E7S A;  4O5V A;  2RNA A;  1ZBJ A;  4OGC A;  1AZE A;  3CBM A;  2LNH B;  4BY6 B;  1N27 A;  3OW2 S;  1B07 A;  4FL6 A;  3PVQ A;  3FIF A;  2ZPE B;  3JB9 D;  1IO6 A;  2EFI A;  3M54 A;  1RAD B;  2LRQ A;  4CRI A;  1FYN A;  1OYX A;  2WAC A;  2ZPH B;  2LTO A;  3MET A;  2RN8 A;  2JW4 A;  2D0N A;  3QJ6 A;  3H0H A;  5GAN 8;  3J80 E;  2KXD A;  2RK2 A;  3V7S A;  1QVG P;  1QLY A;  2HQX A;  3OS0 A;  1VYV A;  1Z9Q A;  2X3W D;  3OYA A;  2H8H A;  3JRZ A;  1VYU A;  1UHF A;  2EQI A;  2FRY A;  3BW1 A;  1QP3 A;  2DVE A;  2HL3 A;  2PZ1 A;  1S72 A;  1JBM A;  5D6X A;  4M77 B;  4Z8A A;  4BE0 A;  2YXY A;  3QZ9 B;  1PD1 A;  3BFM A;  2ECZ A;  1RLP C;  2QGG A;  3CCJ T;  1BI3 A;  2RHU A;  1ZUU A;  1UFF A;  1YN8 A;  1YIT Q;  5D6Y A;  2OI3 A;  2MWP A;  1U1S A;  1S72 Q;  4M7A D;  2MPX C;  1U06 A;  3CPW P;  3REB B;  1T0J A;  2EAY A;  1LJO A;  1PC0 A;  1T3L A;  1NPP A;  2DKG A;  2KI7 A;  3CCS Q;  5KE3 A;  1T3S A;  4JJN K;  5IH2 A;  4K11 A;  1PWT A;  2AZS A;  3LWI A;  2AKL A;  1U3O A;  4M7A A;  2O9S A;  5GAM e;  1GBR A;  2JMC A;  2LMJ A;  1VQ6 T;  1BB9 A;  2HNI A;  1BI2 A;  2CP0 A;  3M0Q A;  1SRM A;  2O4X B;  1YJ9 T;  1DJ7 B;  3EFS A;  5GAN 7;  4J9E A;  1D0Z A;  4A4F A;  2J06 A;  1OPK A;  3MKD A;  3RER A;  2RI2 A;  2EJF A;  2CP7 A;  2DL8 A;  4JZ3 A;  1WHL A;  1VUB A;  3OS2 A;  1M5Q 1;  2DRM A;  2D8H A;  1C1A A;  1VA7 A;  2NUP A;  5GJV B;  3EG0 A;  1RAB B;  1K76 A;  4N0A C;  1TOV A;  3TQ7 P;  5LJ5 f;  4M78 B;  4HXJ A;  1LOJ A;  2KT8 A;  1K8A C;  1HJD A;  3UF4 A;  1H8K A;  1X75 C;  1YCS B;  2IG0 A;  3SWN C;  1KC8 C;  1U8R A;  5GAM h;  1RAH B;  3H41 A;  2CZ7 B;  1U1T A;  5GAN g;  5KH6 A;  1Q7Y C;  5CQY A;  4C92 F;  3FJ5 A;  1E6H A;  2F2V A;  1WIE A;  3UT1 A;  1WZO A;  2CP6 A;  4DBH A;  2LQW A;  1YHQ T;  2XHC A;  1GBQ A;  2J05 A;  4M7A G;  2FVU A;  1OPL A;  4ELY C;  3OYH A;  1G3S A;  5FWB A;  3OMC A;  3CD6 A;  3CCS T;  2J6K A;  2L5Q A;  2NLU A;  2OTJ T;  2RO0 A;  1SPK A;  2OAW A;  3BY7 A;  2DBM A;  2DM1 A;  4PK4 A;  2KVQ G;  2JTM A;  3JB9 F;  4ZNX A;  1UDL A;  2QXF A;  2FPF A;  1K4U S;  5GAO m;  3G6E T;  3PTA A;  4FT4 A;  1JJ2 S;  4DBR A;  1W2B P;  4RG2 A;  3JCM J;  2P0P A;  2A3L A;  2YWW A;  3SB2 A;  1FWZ A;  4M7D D;  4LDX A;  1KQS S;  5KYU A;  2LQK A;  1WGS A;  3PMI A;  4J9I A;  3INZ A;  1WHG A;  1KQ1 A;  2KE9 A;  1M2O A;  2RJF A;  4C0D B;  1QVF A;  3CMA Q;  2EKO A;  2ZPI B;  2ABL A;  1JJ2 P;  1VQ6 Q;  2ZGW A;  1M90 R;  4KUD K;  4BI4 A;  2DRK A;  2CZ6 B;  1VQ7 T;  4C8Q A;  2HZY A;  3LW5 E;  2LC4 A;  1WJS A;  1PD0 A;  3CMA A;  1I0C A;  5CQX A;  2P4R A;  1VQP T;  4J7F A;  1Q95 G;  2ZZD A;  4X34 A;  2RK1 A;  2P0K A;  3TU4 K;  3BDU A;  2RHI A;  1AWX A;  3GNG A;  4E7L A;  2E64 A;  3X25 B;  1RUW A;  4E7J A;  2YDL A;  2O01 E;  1QVG S;  2JVV A;  2VGN A;  2ED0 A;  2DE0 X;  5DLO A;  2M16 A;  1VOM A;  1ZUK A;  3ZFJ A;  1K9M U;  1K73 U;  5LJ5 e;  2CP2 A;  4BB7 A;  2I2L A;  1Q82 U;  3L42 A;  3V8K A;  2CKK A;  3EH1 A;  3V7C A;  4HT8 A;  1Y71 A;  3JB9 I;  1RAI B;  3WVE B;  1TS9 A; 
#chains in the Genus database with same CATH homology
 1JXM A;  4HVU A;  2OJ2 A;  2NWM A;  1G83 A;  2LZ6 B;  2K6D A;  1JQQ A;  2SRC A;  1QCF A;  4JJD A;  4Z88 A;  2QDL A;  2DNU A;  4CC2 A;  2KRM A;  1X43 A;  1M30 A;  2EVR A;  4CC7 A;  3I35 A;  2FEI A;  2VKN A;  3VS0 A;  2ROT A;  4J9B A;  1GL5 A;  2JS2 A;  3RNJ A;  3VS6 A;  2L0A A;  1WXB A;  4JPB W;  1AOJ A;  1W1F A;  4LE9 A;  1UJY A;  2DF6 A;  4AG1 C;  1G2B A;  1Y57 A;  2KEA A;  4OML A;  3IQL A;  4AFS C;  3NHN A;  1WLP B;  1RI9 A;  2DL7 A;  4RTX A;  2LJ1 A;  2GNC A;  1ZLM A;  4FSS A;  2GGR A;  1GCQ A;  5FW9 A;  1UTI A;  1X2K A;  2CH4 W;  1KFZ A;  3VRY A;  2KRO A;  1PRM C;  2DL3 A;  2D8J A;  2CSQ A;  3QWX X;  1NM7 A;  2YUQ A;  4GLM A;  5FWC A;  2EPD A;  1JO8 A;  1MUZ A;  3GBQ A;  4D8D A;  2EYX A;  2DIL A;  3EHR A;  3JV3 A;  1K9A A;  4J9H A;  3UAT A;  1J3T A;  3U23 A;  1SRL A;  2DL5 A;  3PE0 A;  2HDA A;  3M0R A;  4HVV A;  1FMK A;  1ABQ A;  1K0S A;  1M3A A;  2GTJ A;  3SHW A;  1M3B A;  2ROL A;  2VVK A;  4AFU C;  2K7A A;  2CT3 A;  2LP5 A;  2F2X A;  4OMO A;  4IIM A;  1S1N A;  1TUD A;  3ZL7 C;  2NUZ A;  1YWP A;  1M8M A;  2O88 A;  1Y0M A;  4RTT A;  2AK5 A;  2LX7 A;  4E6R A;  1W70 A;  1E6G A;  3H0I A;  4RUG A;  1NYG A;  4QT7 A;  2KXC A;  3QWY A;  4CC3 A;  1UG1 A;  1VYT A;  4RTY A;  2KRS A;  2CSI A;  2RQV A;  1UGV A;  2B86 A;  4WCI A;  3I9Q A;  2RQT A;  2AKK A;  1X2Q A;  2CH4 A;  2HSP A;  2YUN A;  2W0Z A;  4OMP A;  2GBQ A;  3PVL A;  1ARK A;  1PHT A;  3VS4 A;  1BBZ A;  3EG3 A;  2JMA A;  3O5Z A;  4A63 B;  4Z89 A;  2L2P A;  3VS3 A;  3VS5 A;  1PKT A;  3EG1 A;  4R0K A;  2DX1 A;  2VWF A;  4DEY A;  1KSW A;  2RQW A;  1SEM A;  2RNA A;  2W10 A;  1ZBJ A;  2EGE A;  2AZV A;  1AZE A;  4AFQ C;  4F16 A;  2LNH B;  4HVW A;  1B07 A;  1NLO C;  1HSQ A;  2KNB B;  2L3Q A;  3PVQ A;  1IO6 A;  1X6B A;  2SEM A;  1FYN A;  1OEB A;  1V1C A;  3UA6 A;  2MIO A;  2CDT A;  1WXT A;  2RN8 A;  2ENM A;  2D0N A;  2JW4 A;  3H0H A;  2KXD A;  1MV0 B;  2E5K A;  1QLY A;  1QKW A;  1VYV A;  1Z9Q A;  2KRN A;  2X3W D;  1GRI A;  1NLP C;  2JS0 A;  1MV3 A;  1AWW A;  2H8H A;  4F17 A;  3VS1 A;  1VYU A;  1UHF A;  1QWE A;  2EQI A;  1AD5 A;  4DEX A;  2FRY A;  2JT4 A;  2EBP A;  2V1Q A;  3NMZ C;  2PZ1 A;  2EGC A;  1M3C A;  2LCS A;  2V1R A;  4Z8A A;  1QWF A;  2BZ8 A;  2C0O A;  3H0F A;  2ECZ A;  2K79 A;  2JM9 A;  1RLP C;  1ZUU A;  1UFF A;  1PNJ A;  3THK A;  1YN8 A;  1ABO A;  5I11 A;  1AVZ C;  2OI3 A;  2JXB A;  5I22 A;  1ZUY A;  1U06 A;  2J6O A;  3REB B;  1T0J A;  3C0C A;  3TSZ A;  1YP5 A;  1SHG A;  2KYB A;  1A0N B;  2O9V A;  1B3Q A;  2X3X D;  1T3L A;  2A37 A;  1CSK A;  4AFZ C;  3NGP A;  4Y92 A;  3TVT A;  3M0T A;  1T3S A;  5IH2 A;  4K11 A;  2M51 A;  1PWT A;  2AZS A;  4RTW A;  2AKL A;  2MCN A;  1U3O A;  1LCK A;  1GCQ C;  2O9S A;  1GBR A;  2PTK A;  2JMC A;  2LMJ A;  4RTV A;  1BB9 A;  2FO0 A;  5IXF A;  1KJW A;  3M0Q A;  1UJ0 A;  2ESW A;  2XMF A;  1ZX6 A;  1SRM A;  1NYF A;  4J9D A;  1K0X A;  1BK2 A;  3EHQ A;  2DL4 A;  4J9E A;  2A36 A;  4IIO A;  2J06 A;  1TUC A;  1OPK A;  3KFV A;  2EYY A;  1N5Z A;  1UE9 A;  2YSQ A;  4JZ3 A;  2DL8 A;  2YT6 A;  1CKB A;  4LN2 A;  1OV3 A;  1NG2 A;  2CUD A;  3R6N A;  2DRM A;  2YUO A;  2D8H A;  2K2M A;  1VA7 A;  2RQU A;  1PRL C;  1JU5 C;  5GJV B;  2LJ0 A;  2C0T A;  1X27 A;  3EG0 A;  2K9G A;  1K76 A;  4RTZ A;  4X1V A;  1TG0 A;  2EYZ A;  2DYB A;  1AEY A;  1PKS A;  2GQI A;  1K1Z A;  2CT4 A;  4HXJ A;  2C0I A;  2KT8 A;  1HJD A;  4JZ4 A;  3UF4 A;  1H8K A;  1X6G A;  1YCS B;  4J9C A;  1E7O A;  1WXU A;  2L3S A;  1WX6 A;  2FPE A;  2RMO A;  1W6X A;  2JTE A;  3H41 A;  4LUE A;  1YWO A;  2DA9 A;  4LNP A;  1JXO A;  3FJ5 A;  1E6H A;  2F2V A;  1WIE A;  2BZX A;  5IHN A;  5IHI A;  1WYX A;  3I5S A;  2BTT A;  2KBT A;  1JEG A;  2HCK A;  2LQW A;  4KRT A;  1WDX A;  1GBQ A;  1ZSG A;  4ESR A;  1NEG A;  1H92 A;  2IIM A;  1YNZ A;  2J05 A;  4JJB A;  1AZG B;  1OPL A;  4ORZ A;  5EC7 A;  2YUP A;  2M0Y A;  1GCP A;  5FWB A;  2RPN A;  2CUB A;  2RF0 A;  2DJQ A;  5GJW B;  2DBK A;  1WI7 A;  2J6K A;  3EGU A;  4M4Z A;  1SPK A;  5IHK A;  2OAW A;  3A98 A;  2DBM A;  1CKA A;  2PNI A;  2DM1 A;  4CC4 B;  4ZNX A;  1UDL A;  2FPF A;  1K4U S;  2MOX A;  2FPD A;  2LJ3 A;  4JJC A;  2L3P A;  2O2O A;  1OOT A;  3ULR B;  3CQT A;  3LH5 A;  2K3B A;  3M0P A;  2HBW A;  2I0N A;  2KYM A;  2HEQ A;  4AG2 C;  1M27 C;  4J9I A;  2J7I A;  3EG2 A;  2CRE A;  1I1J A;  2KE9 A;  2DLP A;  2KGT A;  1GFC A;  4OMM A;  5L23 A;  1KIK A;  3SEM A;  2ABL A;  1NEB A;  3RBB B;  1UUE A;  4RTU A;  2DRK A;  2EGA A;  1SSH A;  1T0H A;  1GFD A;  4J9G A;  1X69 A;  4EIK A;  3REA B;  1I07 A;  1U5S A;  3M0S A;  1AWO A;  2KR3 A;  4OMQ A;  2FRW A;  1I0C A;  1BU1 A;  1UEC A;  3NPF A;  3UA7 A;  2P4R A;  4OMN A;  4GBQ A;  5HCK A;  4F14 A;  1AWJ A;  1HD3 A;  2DVJ A;  2D1X A;  5IXB A;  1H3H A;  2ED1 A;  2G6F X;  2EYW A;  1AWX A;  2J6F A;  3M0U A;  2F2W A;  5ECA A;  2O31 A;  1QKX A;  1RUW A;  2RQR A;  1UHC A;  2YDL A;  3TSW A;  4HCK A;  2ED0 A;  1WA7 A;  1Z9Z A;  2DE0 X;  1ZUK A;  3VRZ A;  4D8K A;  2BZY A;  4J9F A;  2EKH A;  1EFN A;  1XOV A;  3VS2 A;  2FG0 A;  1RLQ C;  2DMO A;  2A08 A;  1WFW A;  2EW3 A;  2KT1 A;  2JM8 A;  4LUD A;  2LQN A;  3I5R A;  2GTO A;  2A28 A;  1SHF A;  3VS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...