5EC7A

Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'MTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 5.0
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 12
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ec7A00
1ZSGA 4F14A 2LJ3A 1UJ0A 1E6HA 1YWOA 2ECZA 2PNIA 3NGPA 4WCIA 1UUEA 1YNZA 1CKAA 2EGEA 1M3BA 2GTOA 2PTKA 3IQLA 2EYZA 2KNBB 1PKTA 4A63B 1M3CA 2CH4A 2FPDA 2YUQA 2FRYA 1PHTA 2AK5A 3H0FA 1OOTA 1ZUUA 2EGCA 2GGRA 1UDLA 1AEYA 2PZ1A 4RTVA 5IHNA 1OPLA 2O31A 4J9HA 2LJ1A 1HJDA 2CDTA 2O9SA 3ZL7C 2EBPA 1K76A 1VYVA 1GCQA 2KRMA 2KEAA 2EGAA 2KRSA 1GCPA 1QWFA 2V1RA 1M8MA 2CREA 4QT7A 2EPDA 2OJ2A 2ED0A 1PKSA 1UECA 1T0HA 2SEMA 1JEGA 3H41A 4JZ3A 1X6GA 4K11A 5HCKA 2O88A 4GBQA 3R6NA 5EC7A 1KFZA 2AKLA 2C0IA 2EYYA 1TUCA 1X43A 4RTXA 1NYFA 1J3TA 2DL7A 2LQWA 3EG0A 2MOXA 2VWFA 1AD5A 3NMZC 2K79A 1QWEA 3VS7A 3VRZA 1AZGB 1T3SA 2FG0A 2J6FA 3U23A 1T3LA 4LNPA 2CSQA 2L3PA 1Y0MA 3RBBB 4AG2C 5FWCA 1WX6A 3TVTA 2JT4A 1X2QA 2NUZA 1GL5A 4AFSC 1HD3A 3A98A 4LUDA 1UFFA 2RF0A 3TSWA 1WDXA 2JS0A 4J9EA 1Z9QA 1JXOA 4OMNA 2BZ8A 2KXCA 3NPFA 5GJVB 1I1JA 2QDLA 1SRLA 4FSSA 1WIEA 2DL5A 5FWBA 1CKBA 1NG2A 2DILA 1AWOA 3H0IA 2RMOA 4J9CA 4HCKA 4LN2A 1SHGA 4OMPA 3VS1A 2CUBA 1OV3A 2G6FX 3EG1A 2ABLA 1MV0B 4RTZA 1OEBA 2RQVA 1UG1A 2CH4W 2I0NA 1IO6A 2RPNA 3M0SA 4AFZC 4Z8AA 2FPEA 4CC7A 1YCSB 2J05A 4DEYA 2JM8A 2L2PA 1QKWA 5L23A 2JM9A 4X1VA 1JU5C 1X69A 1WXUA 4J9GA 4ZNXA 3I9QA 3H0HA 3GBQA 1BBZA 1PRMC 1UHCA 2LZ6B 1ARKA 2A37A 2L3SA 2HCKA 1M3AA 1S1NA 1U5SA 2HEQA 1VA7A 3REAB 3UATA 2FEIA 2GQIA 1NLOC 3VS5A 4GLMA 2MIOA 1E6GA 1AWXA 2YSQA 1WLPB 2HSPA 1GFCA 3VRYA 1GRIA 2L0AA 1WXBA 2RQRA 1QCFA 1U06A 2KT1A 2JXBA 4F17A 4HXJA 2DVJA 3M0TA 1SEMA 4J9DA 2ROLA 2X3XD 1X27A 5GJWB 3VS6A 5IHIA 1H8KA 2W0ZA 2O2OA 2DL4A 1I07A 2FO0A 1GFDA 4J9IA 2RQUA 1TG0A 1Z9ZA 3C0CA 3EHQA 1K0SA 1SSHA 1CSKA 4F16A 2F2VA 2ROTA 2BZYA 3NHNA 4DEXA 4Z89A 1JQQA 1AWWA 2EVRA 3TSZA 1M30A 3VS3A 2IIMA 2NWMA 1AOJA 1H92A 3SEMA 2J6KA 1GBQA 2DL8A 2EKHA 4HVUA 1XOVA 4JPBW 1N5ZA 1W6XA 3FJ5A 3M0UA 4D8DA 2RN8A 1WFWA 4Y92A 4Z88A 4M4ZA 1ZUKA 2FRWA 1UJYA 1VYUA 2DNUA 3I5RA 1WI7A 2SRCA 4JJDA 2KXDA 1KJWA 2RNAA 2DRMA 1K9AA 2DLPA 3UA6A 1G83A 2W10A 3THKA 2DM1A 3M0PA 1X2KA 5I22A 1VYTA 2EYWA 4KRTA 2LP5A 1PWTA 2V1QA 3QWYA 1WXTA 2D8HA 1YP5A 1RUWA 1OPKA 2M0YA 2EYXA 3M0QA 1NLPC 2YUNA 2D8JA 1HSQA 3EG2A 3RNJA 2J06A 1BU1A 2YUOA 1ZLMA 1ZX6A 1QKXA 1RLQC 1GBRA 3KFVA 2A28A 2M51A 4E6RA 1UE9A 2YT6A 4LUEA 1TUDA 2KE9A 2LX7A 1FMKA 1RI9A 2F2XA 3O5ZA 1ABOA 2RQWA 3M0RA 2BZXA 1AWJA 2DF6A 3PVQA 2MCNA 4OMOA 4CC4B 2VVKA 1FYNA 2D1XA 2YDLA 4AFQC 1AVZC 2EQIA 2KR3A 1BK2A 4R0KA 2J7IA 2J6OA 2FPFA 2KROA 1NYGA 4HVVA 5ECAA 4CC2A 3VS0A 2K2MA 1MUZA 1M27C 1QLYA 1LCKA 2H8HA 2HDAA 1K1ZA 1EFNA 2KYMA 1AZEA 3JV3A 1JO8A 2A36A 1JXMA 4J9BA 2B86A 4IIMA 2CSIA 3PE0A 1MV3A 4J9FA 4JJCA 5I11A 3VS2A 5IXBA 3LH5A 2X3WD 1KSWA 4IIOA 4HVWA 1NEGA 4RUGA 1GCQC 2K9GA 2AZVA 5IXFA 3VS4A 2JW4A 3PVLA 3EGUA 2CT3A 2LNHB 2ED1A 5IHKA 4D8KA 2DRKA 1W70A 2F2WA 3REBB 2LMJA 3ULRB 1ZBJA 2P4RA 2L3QA 2LQNA 2AZSA 1YN8A 2LCSA 1YWPA 2C0TA 2DL3A 1ABQA 1K4US 2OI3A 4OMLA 4RTYA 1B07A 4LE9A 2VKNA 4ESRA 3I5SA 2KGTA 2OAWA 2JS2A 2XMFA 1G2BA 4RTTA 4OMQA 4ORZA 1UHFA 2JMCA 1NM7A 2HBWA 2JMAA 1PNJA 3QWXX 2DX1A 4OMMA 1WYXA 2DA9A 2EW3A 1SRMA 2CUDA 1RLPC 1WA7A 3UA7A 1B3QA 2KBTA 1BB9A 1UTIA 2ENMA 4RTUA 2KT8A 3UF4A 1V1CA 2GTJA 1SPKA 1NEBA 2GBQA 3EG3A 2DBKA 1ZUYA 1E7OA 2KRNA 1KIKA 1PRLC 1A0NB 1UGVA 4JZ4A 2YUPA 1T0JA 2K7AA 4CC3A 4JJBA 2A08A 2E5KA 1I0CA 3SHWA 1H3HA 2D0NA 2K6DA 2K3BA 2ESWA 2KYBA 2GNCA 4RTWA 4EIKA 1K0XA 2DMOA 4AG1C 2DJQA 2BTTA 3EHRA 2CT4A 2DE0X 2O9VA 1SHFA 4AFUC 1W1FA 2C0OA 1U3OA 1Y57A 2RQTA 1X6BA 2LJ0A 2AKKA 2DYBA 5IH2A 3I35A 3CQTA 5FW9A 2DBMA 2JTEA
chains in the Genus database with same CATH superfamily
3I55Q 5HY6A 2OTJT 4F14A 1UJ0A 1ZSZB 4HCZA 2O4XA 2PNIA 3JCMe 3OS2A 1NJIU 3IQLA 1GXIE 1PKTA 2CP5A 4A63B 1VQLQ 2LC4A 1H641 2CH4A 5KYUB 3TU4K 1QVFP 4M77F 4RG2A 3E9FA 3NTKA 3QPHA 4C0GA 2GGRA 4XU1A 5IHNA 3M55A 4J9HA 4M7DF 2MPXC 1HK9A 2CDTA 2EBPA 2HQEA 3HHTB 1WQWA 4HKEA 2KRSA 1QWFA 2CP2A 4E47A 1M8MA 4QT7A 2O4XB 3M5AA 2A7YA 4DA4A 3H41A 1X6GA 2PUOB 3CCMT 2O88A 4GBQA 3R6NA 2EYYA 5GAMh 1TUCA 1X43A 2O01E 5LJ3g 2DL7A 2MOXA 1Q86C 1AD5A 2K5IA 4IUUA 5D6YA 1AZGB 4IUQA 3U23A 4DBRA 1VQMQ 1T3LA 3LLRA 5FU6B 4RG8A 4C0FA 3QDRB 1WHGA 3UWNA 1VQ5T 1W4SA 3G4SQ 3PIPA 1WHKA 5D6XA 3CXCS 5GJVB 2RH2A 3D7SB 2COYA 3CCLQ 4ZGDB 4LD6A 4JJNK 1VQ9Q 4XTXA 2DL5A 3BDUA 2JZ2A 5FWBA 3G71T 2EYQA 3OYCA 3PT9A 1CKBA 1AWOA 2EKOA 2RMOA 2E6NA 3F70A 4M7DG 1TWBA 4J7FA 3VS1A 2CUBA 2P0QA 1OV3A 2EFIA 3CXCA 4RTZA 1VQPQ 4V2SA 3FDRA 2JOYA 2I0NA 1IO6A 2QA4A 2RPNA 3EGDA 2RK1A 3EAEA 3M0SA 1F1BB 4PJLA 4AFZC 4Z8AA 4DOVA 5FROA 1VQNQ 1YCSB 2GQVA 3M56A 1HXDA 4DEYA 2JM8A 2DK3A 3M9QA 1XTDA 2QG9B 2XU8A 1ACMB 4J9GA 3C95A 2V8JA 4JUVA 3OY9A 3Q1JA 1ARKA 2L3SA 4X34A 2HCKA 1TSFA 1U5SA 2HEQA 5J26A 1OYXA 1YJNT 1VA7A 3REAB 3L1AA 5GAN3 2GQIA 2HL5C 2IPOB 3VS5A 1PSEA 1VQOA 4N4GA 1Q81C 4GLMA 2MIOA 1K8AC 1JJ2P 1NE8A 3VRYA 3M54A 2MYSA 3EGDB 2HBPA 1QCFA 3QUIA 4F04B 1RACB 3CD6Q 4J8OA 1S72A 4KUIA 3MP6A 2ZPIB 1H8KA 2W0ZA 2O2OA 1YHQT 2RQUA 1TG0A 1UGRB 1Z9ZA 4NOYA 3EHQA 1YI2T 1CSKA 2JVVA 3NHNA 2ROTA 2BZYA 3HRSA 4Z89A 1KC8C 3VS3A 1M30A 4LD9K 2IIMA 2NWMA 1SG5A 1K9MU 4ME7A 1GBQA 1PG5B 2DL8A 2EKHA 3TCJA 3FJ5A 1VQ4Q 2G3RA 2K4YA 1JBMA 2FRWA 1UJYA 1VYUA 3BDLA 3JCMg 1U1SA 3V8JA 2KQWA 4JS4A 3JCMW 4IUVA 1MHNA 2E4HA 2KXDA 4C92C 5CKBA 3A5ZB 2RNAA 3INZA 2DRMA 2M1HA 4M75F 2YRDA 4BE1A 5GAOn 2DERA 2V1QA 4QQ6A 1BI0A 1WXTA 1N8RU 4Y91A 1YP5A 2M0YA 4A53A 2YRCA 1LNXA 4HCCA 2YUNA 2D8JA 3HFNA 3JB9G 3RNJA 2H3EB 1QMCA 2YUOA 2CP0A 1ZLMA 4EPCA 2M51A 1MMGA 3OA6A 4ELZC 2KE9A 4FYVB 5GAN7 8ATCB 3M0RA 2DF6A 1FYNA 1ZBXA 2PVGB 1UGSB 4R0KA 1Q86U 2KAFA 5LJ5h 1VQ6A 1YIJT 2KROA 4FIBA 5ECAA 3S3MA 4EMGA 3V8LA 4Z02A 4BD3A 3FIFA 4BI4A 3V7CA 4A4GA 2H8HA 2RB6A 2HDAA 4ZGJB 2PVOB 1TH7A 3JV3A 2YLCA 1JXMA 4JS5A 1IRXA 1OULA 2CSIA 4FSXA 2FZCB 4OB2B 3M57A 4CI0C 4RUGA 2OTLA 4L6V5 1KQSS 3RKYA 1VQOQ 4F7UE 3SB2A 2LT1A 1W70A 4RKUE 5GANe 3CCMQ 1ZQ1A 5CK9A 3CCQA 3SFMA 2C0TA 1D1AA 2RJFA 3HL8A 1ABQA 2VKNA 4ESRA 3I5SA 4N0AC 1Q86R 1NJIC 2F69A 1UHFA 1NM7A 4XTWA 2B8AA 4M78C 3V7RA 4PK4A 1VQ5Q 4OMMA 3QZ5B 2EW3A 3OB9A 2MF2A 5HKCA 5LJ5j 1RLPC 2ZPEB 4C92A 3UPUA 1YITT 1B3QA 2RJEA 1BIBA 4PNOA 1VOMA 3G71Q 2OAUA 1K8AU 3UF4A 1V1CA 2GTJA 2QGGA 1I5OB 2GBQA 5GAMg 1EIFA 4EMHA 3I55A 2DIGA 1ZUYA 1KIKA 4ATOA 4JZ4A 2HAXA 4CC3A 3MEVA 2ZAEA 5DM7R 3CCJA 4M77C 1I0CA 4JLGA 1WHHA 5LJ3j 2D0NA 2DTHA 4OGCA 5LJ5d 3EH1A 4IUTA 4BDYA 4AG1C 4EMKC 2BTTA 5LJ3e 5FU7C 4C92B 2CT4A 1SHFA 5GAN5 1QVGA 1BI1A 2AT1B 1C6VX 3OW2S 2EQUA 3I35A 3DLMA 5GMKi 2XHCA 2LJ3A 1E6HA 2ECZA 4PFZA 1O9SA 1Y07A 2VB6A 2QK0A 2QEXA 2WACA 1M3BA 2Y90A 1Y96A 2EYZA 1K8AR 2KNBB 3OW2A 4MDWA 2QASA 2EJFA 4XAXB 2FPDA 2KVQG 3RKXA 1PHTA 3H0FA 1OOTA 5CVIA 2X35A 2EGCA 1N27A 4XU3A 1VQMA 3OQ5A 3T9NA 3LWHA 1HJDA 2CYZB 1K76A 1VYVA 1YHQQ 1VQ6Q 3E19A 2KEAA 2EGAA 4HCBA 1YI2Q 2QQBA 2OJ2A 1PKSA 2XIDA 1T0HA 2SEMA 2RD1A 2YLBA 1YJWA 2QGFB 1VQ9A 4F7UG 1Y96B 2WSEE 1KFZA 3KBGA 1OX8A 3ZFJA 4BE2A 1J3TA 2MK5A 3NMZC 3VS7A 3JCMJ 1LOJA 4N0AA 3CMAA 5FLXE 2NUPA 3M58A 4QW2A 2OTLQ 1VQKT 1KHCA 2MWPA 4C8QC 1WX6A 4M78A 1HD3A 4LUDA 1WDXA 4J9EA 2XDDA 1VQNA 2E1HA 1JXOA 3L2QA 1SKUB 4OMNA 2XICA 3OS0A 5AYFA 2QDLA 3SD4A 1YBYA 4FSSA 2QYZA 3V7SA 3CMET 4L5GA 3CPFA 5GAOq 3LH0A 4QKUA 3H0IA 3OSVA 4HCKA 3CCET 1K73U 5CCAA 1SHGA 4OMPA 3A8LB 2NUPB 4KH0B 1K9MC 4RCBA 2RQVA 2RHXA 2LNVA 5KE2A 4BUGA 4M78B 3JCMX 2FPEA 5GAOm 5GAN8 4NL2A 2J05A 4EMKA 3CD6A 2L2PA 2FHDA 4B9WA 4ANJA 3M53A 4X1VA 5CKHA 1O75A 1IXDA 1WGSA 1H3ZA 3MCAB 3H0HA 3GBQA 4A4HA 3CCST 4ZTJA 2A37A 3CXCP 2ZPFB 2VGMA 1FMVA 2P0KA 1KQ1A 1YIJQ 3G6ET 5DY9A 2VASA 3CCJQ 1DJ7B 2VXFA 2DXCA 1QW1A 1AWXA 4QQDA 2CP6A 2L89A 3GLXA 3CCVT 4PJOC 1GRIA 1N8RC 1VIEA 1TXQA 2EIFA 1FMWA 2KT1A 2JXBA 4F17A 3JCMd 4HXJA 2DVJA 2BE7D 2KMTA 3M0TA 4EMKB 4BY6C 5FU7B 3VKIA 1I4K1 1K73R 3VS6A 1D0XA 4B9XA 5C0MA 1VQ4A 2LVMA 4LDXA 2JN0A 2K5LA 4M75C 3VJPA 2DL4A 2QEXQ 1GFDA 4J9IA 3C0CA 1K0SA 2F2VA 1MMNA 4DEXA 3OYGA 1JQQA 2EVRA 4KUDK 1H92A 2R5AA 2Z0WA 3OYEA 3HRUA 3GP8A 3C4SA 4ZGEB 3H9NA 4JRQA 1M4ZA 1SF9A 3M0UA 4D8DA 2HL3A 1NJIR 1WFWA 3OYDA 3OYKA 2LX9A 4M4ZA 4XTVA 5GAOp 3CCUT 3OYHA 2FZKB 3LYIA 4C8QA 2DNUA 3MHXA 2EAYA 1WI7A 2M16A 2ZPBB 2KDSA 1KJWA 1YJWQ 5LJ5f 1K9AA 4MZMA 9ATCB 1G83A 2W10A 2RI3A 2OTJA 2DM1A 5I22A 3FLGA 3CCRT 3CMAQ 5KYWA 3OBYA 2D8HA 2XDPA 2EYXA 3CBOA 1NLPC 3I56T 4E7JA 1HSQA 4HT8A 3EG2A 2QAZA 3DKMA 4M7AC 1BU1A 2D9TA 1QKXA 4C8QB 3GF5A 3KFVA 1VQ8T 4E6RA 2YT6A 1TUDA 2LX7A 3RMSA 2VC8A 1RI9A 3O5ZA 4C92D 3PVQA 4OMOA 4FM4B 2E5QA 4L59A 2YDLA 1C0MA 1AVZC 4XTYA 2K3YA 5KYWB 3M59A 2V8IA 3OS1A 3CCMA 4BDZA 3CC4T 4CC2A 2K2MA 1MUZA 1Y7XA 4OB0B 2DZ9A 4XTUA 3KUFA 4PJOA 3EFRA 1EFNA 4HA8A 2ATCB 1AZEA 2DXUA 5GAMe 1N9SA 1VUBA 4JJCA 1BKBA 3PE0A 5IXBA 3VS2A 3P8BB 4OGEA 3CC7T 4R55A 4XU2A 1RAFB 3JB9F 3RUXA 4HVWA 1GCQC 1TS9A 2AZVA 3CBPA 1VQ5A 2IVWA 4J83A 3PVLA 1V76A 4FT2A 4M75A 5IHKA 4D8KA 1YJ9T 2WSFE 3REBB 5M9OA 5J39A 3TREA 1M5Q1 2P4RA 2LQNA 3S6WA 2HQHA 3G71A 2XI9A 1LJOA 2DL3A 1BI3A 2OI3A 4PJOB 2Y4XA 4LE9A 2V8KA 3JB9J 2KGTA 3SWNC 2A0FB 1VQKQ 1G2BA 4KULA 2BKDN 1M2VA 3QKJA 2HBWA 4A54A 1WJRA 3E9GA 1PNJA 4IUPA 1BYMA 2DX1A 2DETA 1SRMA 4M75B 1R0CB 3VUBA 3CPWS 2ZGWA 4KBMB 5GANh 1EZZB 3CMEQ 2ENMA 4RTUA 2FZGB 3PTAA 1YJNA 2XG8D 4JRIA 1SPKA 4QQGA 2GCXA 2CZ7B 4IURA 3HKSA 4VUBA 3CPWA 1WQ7A 5CO7A 3X24B 1PSFA 1JJ2S 1M2VB 3SHWA 2YXYA 4M7AA 1K9MR 2NLUA 1UB4A 2V26A 3QSUA 4M78D 2P4TA 2O9VA 2OTJQ 2RHIA 2ZZDA 1PD0A 1Y57A 2R57A 3CC2T 1QCNA 2DYBA 1R8OB 5IH2A 3JCMf 3VV0A 1YHQA 2HQXA 1ZSGA 3FRNA 2RJCA 4TVRA 1YI2A 1TTHB 3OSSC 3MO8A 4WCIA 3QZ9B 1UUEA 1CKAA 2EGEA 1IGUA 3DLLA 3QO3A 3QYGB 2COWA 2BUDA 2GTOA 4M7AB 4BI8B 4QVDA 1QVGP 4M77D 5FRMA 1K73C 1N8RR 1FX7A 1RL2A 2IG0A 1PCXA 2RO0A 2FRYA 3OBWA 2AK5A 2K3XA 5GANj 2DEQA 5LJ3h 1RAEB 3L2UA 1B7TA 3GPLA 1G3SA 4RTVA 1VQLT 1AEYA 1FWZA 2O9SA 3ZL7C 2DEUA 1WHLA 1GCQA 3UDCA 2FVUA 1VQ7T 3OW2P 2CREA 5CAIA 5DLQE 3V8KA 1JEGA 2DO3A 5A0GA 1KQSA 2C0IA 1ZHIA 2RHZA 2E70A 5GANd 4C92E 3L42A 3EG0A 2K79A 2VXEA 2F5TX 1Q82U 3OYJA 3SWNA 1YCYA 2J6FA 3A8GB 2M02A 4LNPA 3CCUQ 2CSQA 1SSFA 1Y0MA 1W2BS 4MMKA 3X20B 4AG2C 5FWCA 5IT9E 2KSSA 1LVKA 2R5MA 2JT4A 1X2QA 2NUZA 1GL5A 3CBMA 3A98A 4OP0A 3TSWA 2JS0A 1Z9QA 2KXCA 3NPFA 1KHIA 2YHTA 4IKFA 5GMKe 1I1JA 1SRLA 4EDUA 7AT1B 3CCRQ 1IHVA 1W2BA 1QVPA 3J81E 1BCMA 1WHJA 2YRVA 3G4ST 2K57A 2DILA 2QQRA 1YIJA 2JTFA 4E7LA 3CCLT 1WNLA 2CGHA 5HK0A 4MZPA 2LQ8A 3SWNB 4YTLA 3EG1A 2ABLA 1MV0B 1VQ8Q 2CH4W 4II1A 4M7DC 4F7UF 2DTIA 2XDBA 4C8QD 4CC7A 1KG1A 2VYTA 3BW1A 1YJNQ 1VQPT 1QKWA 5L23A 2JM9A 1FXXA 1JU5C 1X69A 4J7IA 3I9QA 3R6OA 2FYKA 1UHCA 2MWOA 2LZ6B 1AT1B 2CP7A 1M3AA 5LJ3d 2CZ0B 2D6FA 1G3YA 3WVEB 4X9DA 4C92F 3CC4Q 2HSEB 3BE3A 4MMLA 1NLOC 3LX7A 3JRZA 4E7ZA 3QXEB 4J6WA 1WLPB 1YFNA 2E3IA 2HSPA 4DBHA 5CKDA 2E65A 5I21A 2L0AA 1LPLA 1WXBA 5C6SA 2HZYA 1U06A 1IHWA 2CZ6B 4J9DA 2ROLA 2X3XD 5DLOA 3JB9I 5GJWB 2A3LA 2E12A 3JCMV 2F1LA 1TU0B 5KYYA 5IHIA 8AT1B 2L8DA 4DBQA 3OYMA 3L2WA 1YITA 5GAN6 5HK3A 2FO0A 4ZN1A 3JCMh 4PLIA 2JNGA 3PIOA 4PJNA 4M78E 3VYHB 3NTIA 1AWWA 2DJZA 3TSZA 1NZ9A 1X75C 2RJDA 1RAAB 3SEMA 2PQWA 4PJOD 2J6KA 2C06A 4HVUA 3PMTA 4JPBW 1N5ZA 4E7SA 2RN8A 4J5YA 4J6YA 2DIQA 4C5IA 4C92G 5KYYB 1ZUKA 1M1GA 3LWIA 3I5RA 3WVDB 4O6JA 1PM3A 2SRCA 3ASKA 5A0DA 3RMQA 4C0DC 3PNWC 5I2MA 4M75D 4P5NA 1BCOA 1XQHA 3UA6A 1I8FA 3J80E 2H3JA 2DTOA 4XU0A 3M0PA 1OU9A 4C5HA 1VYTA 3FJPA 4KRTA 2LP5A 3QWYA 4MDXA 3FB9A 4M77A 3C12A 2PU9B 2RM4A 1X6OA 4XTZA 3FEOA 2QTVA 2X4XA 2COZA 4LXCA 4GY5A 2F5KA 4M7DA 2A28A 1UE9A 3MKDA 1FMKA 2F2XA 2JUFA 3HRTA 3O8VA 2BZXA 3A1PA 3LW5E 2MCNA 1MGQA 4M78F 1TOVA 2VVKA 1Q7YC 3OMGA 1HYOA 2NYSA 3DB3A 4JLIA 2J7IA 2J6OA 2FPFA 3L2ZA 3A8HB 4HVVA 4M77B 3E2UA 3VS0A 3OMCA 5IAYA 1OZ3A 1QLYA 2CS7A 5KH6A 1JB0E 3S3NA 4UC4A 3JCMQ 4M7AD 2D0QB 1K1ZA 4M7DB 1V29B 2KK4A 2DAQA 3PGGA 2QA4T 1VQKA 4IIMA 2B86A 5I11A 4J9FA 2M9UA 3OYNA 3LH5A 2HKQB 2X3WD 1XJWB 2MMPA 5GANf 1KSWA 4LDYA 4RCCA 4IIOA 2EJ9A 1VQ7Q 1NEGA 2HKNA 5IXFA 1IB8A 4QVZA 3G1JA 2JW4A 3EGUA 2LNHB 5LJ5g 3P8HA 2F2WA 2LMJA 3QDFA 1G8XA 2DZCA 5A0LA 2AZSA 1QCOA 3CMEA 1RAIB 1G3TA 4C8QE 1YWPA 4E7HA 1VQOT 3ZEHA 2FL7A 1NPRA 4RTYA 2EWNA 3CCEA 4JRPA 2BIVA 2K2VA 4M78G 4FYWB 2OAWA 1RAHB 1ZA1B 3HFOA 2XMFA 3X28B 4RTTA 4OMQA 3HP9A 2JMCA 3N5BB 5CQXA 1S72T 1YITQ 1KQ2A 4R56A 4A4FA 4PJJA 1WYXA 1OX9A 2DA9A 1KD1C 4DBFA 4PFPA 1WA7A 3RR6A 3H8ZA 2KBTA 3CCSA 1UTIA 4Y28E 4A4EA 2P0PA 4LDUA 1JRIA 3G6EA 1NEBA 3PMIA 3EG3A 2NUTA 3RIRA 4M77G 4LDVA 2E41A 1A0NB 1VIFA 1T0JA 2K7AA 3P8DA 3HPWA 3ME9A 2HMAA 4KH1B 3CCVA 2E5KA 5LJ3f 1QVFS 1H3HA 3NTHA 2K6DA 2LCCA 2LDMA 2K3BA 3EFSA 1D3BA 2GNCA 4RTWA 1Q82C 4EIKA 3RDVA 2RK2A 2DMOA 1OQKA 3EHRA 4PKCC 2DE0X 1KK7A 4C0DB 4AFUC 2XK0A 1W1FA 2C0OA 5FRNA 3QG1A 1U3OA 3M4YA 1X6BA 2JTMA 4PJOE 2LJ0A 2AKKA 3CPWP 4C8QF 1IREB 1QVFA 3CQTA 3JAME 2DBMA 4A4KA 1NBEB 2NUTB 5GMKl 1YWOA 2KI7A 4FYYB 1IZ6A 5GAMj 2OX7A 3AT1B 3NGPA 3ER0A 1YNZA 1N9RA 2PTKA 1BI2A 2L5QA 2GFUA 4KGXB 5D6WA 5KE3A 4M75E 3MEAA 4XQ3A 1D3BB 1M3CA 3E1SA 3EG9A 2LQKA 2YUQA 3UT1A 1ZUUA 2MAMA 1U8RA 3MPUB 2DVEA 2P84A 5EG2A 3CCUA 1UDLA 4FU6A 2PZ1A 1OPLA 5L8RE 2O31A 2LJ1A 4C5EA 1NPPA 5GAMd 3BFMA 1B34A 2KRMA 2HD0A 1GCPA 4ZN3A 2V1RA 2LRQA 2EPDA 2ED0A 5KCOA 1UECA 3JCMc 3OYLA 3GNGA 4JZ3A 3HTRA 4K11A 5HCKA 5CQYA 1VQ6T 2RI2A 3GIBA 3CCRA 3MJXA 3GOXA 1IGQA 5EC7A 2AKLA 4D6WA 4RTXA 1NYFA 2LQWA 1XNIA 3CEYA 3EFOA 3EG9B 4BY6B 2VWFA 5CR2A 3I56A 3LGLA 3AHUA 1QWEA 4C8QG 3VRZA 1T3SA 1G5VA 2FG0A 1UEBA 2DKGA 2L3PA 4OMFB 3RBBB 1VQ8A 4PJOF 1Q7YU 3TVTA 2VUBA 1B34B 4AFSC 1UFFA 3HSBA 3OYAA 2RF0A 1KQSP 5KYNA 4KGVB 2OTLT 2BZ8A 4ELYC 4M7AE 1M90C 4CRIA 3MEUA 3CCEQ 5D7UA 2LT4A 1WIEA 3CCQT 1RAGB 2E10A 1BIAA 4JDSA 2DXTA 1NG2A 3EFOB 3CC4A 1OI1A 4J9CA 3VU3C 2EJGA 4E2FB 4LN2A 1M1KC 2JJ9A 3L2RA 2G6FX 1PD1A 2E3HA 5I2SA 2RI5A 1OEBA 1UG1A 4NL3A 2RHUA 3EGXA 1I81A 3J7AF 3CCSQ 1W2BP 3CC7A 3G6EQ 5GAOl 1JJ2A 2HNIA 2X9HA 3OS5A 5GMKh 1D0ZA 1WXUA 4ZNXA 3META 1BBZA 1PRMC 1YJ9A 1Q7YR 3QIIA 1S1NA 3CCVQ 2WSCE 3UATA 2X4YA 2FEIA 4PJOG 3I55T 1WZOA 4N4HA 5CKEA 2VGNA 2EQMA 1OU8A 3OYYA 3JCMP 1E6GA 4LDWA 2YSQA 1GFCA 2RHYA 4AMCA 3CCJT 2QA4Q 4OF1A 4PJMA 2CKKA 2RQRA 1KD1U 3EGXB 5CIUA 4FYXB 3OYBA 4M7DD 1WJQA 3QJYA 3RKWA 1SEMA 4OB3B 4O5VA 4M75G 4M7AF 1X27A 4RMOA 3H6ZA 4PLLA 2FB7A 1UGQB 3WXMB 4HT9A 4JRKA 3SDZA 3BY7A 1I07A 1R0BG 3RESA 2EQJA 1SSHA 3A8MB 4F16A 3GNFB 4BI3A 2QEXT 3S3OA 5J3BA 1AHJB 1AOJA 3FC3A 2DD4A 2AIRB 2RA2A 2CP3A 1RADB 2KY9A 1XOVA 1S72Q 2DFUA 1W6XA 1QP3A 4F7UA 4AT1B 5GMKj 4Y92A 3DB4A 2QXFA 1MNEA 4Z88A 5GAN2 4BB7A 1VQMT 3URGA 2XD0A 1I5LA 1RI0A 1QQJA 3NFCA 4JJDA 1KD1R 3CC2A 5A2QE 2M0OA 2DXBA 3X26B 2PVDB 2L3RA 2X51A 5CKFA 2DLPA 3I56Q 3L2VA 4PFOA 3THKA 1RABB 3QHSA 3JB9H 1X2KA 1Q81U 2EYWA 1YJWT 1VQ9T 1WPYA 1ZSZC 4M7AG 1PWTA 2Y4YA 5LJ5e 1RUWA 3LGFA 1OPKA 3M0QA 3VYGA 4BACA 2PUKB 4F7UB 1M8VA 2J06A 3CMAT 1QVGS 1ZX6A 2YWWA 4XK8E 1RLQC 1C1AA 1Y71A 1GBRA 1MNDA 4E7IA 3EH2A 4LUEA 1Q82R 2K5FA 1MMDA 1VQLA 2VV5A 1ABOA 2RQWA 1VQNT 1AWJA 2DYIA 2GF7A 1WJSA 4CC4B 1VQ7A 2D1XA 3JSCA 4AFQC 4FT4A 2QQAA 2EQIA 4C0ZA 1KC8U 2KR3A 1BK2A 4GLKA 5GAOr 2QI2A 5GMKm 3JCMb 3MP8A 3OYIA 1NYGA 5GAMf 4B6MA 1N6AA 2E6ZA 4QVCA 1M27C 3A8OB 1LCKA 1TUGB 4KGZB 3CC7Q 2AHJB 1D0YA 2KYMA 3KXTA 3TQ7P 1Q81R 4OB1B 1PC0A 1JO8A 2A36A 4J9BA 5GAN4 4E7KA 1MV3A 3JB9D 1YJ9Q 5FU6C 4DOWA 1M90U 3CD6T 1D09B 3VUZA 1EX4A 3QYHB 4WTOB 5KYXA 2K9GA 5IN1A 3TEEA 3VS4A 2CT3A 4KT0E 2ED1A 4WF2A 2DRKA 1X01A 1D1CA 1M1KU 3ULRB 4ZTFA 3QJ6A 1ZBJA 2L3QA 2LTOA 3QBYA 5KCHA 2ZPHB 1YN8A 2LCSA 3G4SA 4FCYA 2X4JA 3MEWA 3CCLA 4BE0A 1ZA2B 1K4US 4OMLA 1M2OA 4OVAA 1R77A 1P92A 1B07A 1Q95G 1KC8R 4NS5A 2JS2A 4FW2A 2CZ1B 3G7ZA 4ORZA 1M1FA 5AT1B 3ZBDA 2QQ9A 2JMAA 3MP1A 5KYXB 3QWXX 6AT1B 1MMAA 1VQPA 1UGPB 4M77E 1VQ4T 2X4WA 2CUDA 4X9CA 3PFSA 2GFAA 4J6XA 3UA7A 1U1TA 3CCQQ 1BB9A 4N4IA 2DPPB 2KT8A 4M7DE 1M90R 2E64A 3X25B 2I2LA 2BE9B 2DBKA 2QTXA 1E7OA 1M9SA 2KRNA 4FL6A 1PRLC 1QP2A 1WHMA 1UGVA 1ZSZA 2XKOC 2ZCFB 2YUPA 4DQ2A 4JJBA 1M1KR 2A08A 3C94A 3RERA 4C5GA 2MI6A 5LL6S 2ESWA 3CC2Q 2QQSA 2KYBA 4MZTA 2QDYB 4FW1A 5KYUA 5GANg 1K0XA 2DJQA 1OZ2A 2DD5A 3M4GA 4Q5WA 2R58A 2ZPGB 2RQTA 2LCLA 1D1BA 5FW9A 3OYFA 4PL6A 2EQKA 1G3WA 2JTEA
chains in the Genus database with same CATH topology
1ZSGA 4F14A 2LJ3A 1UJ0A 1E6HA 1YWOA 2ECZA 2PNIA 3NGPA 4WCIA 1UUEA 1YNZA 1CKAA 2EGEA 1M3BA 2GTOA 2PTKA 3IQLA 2EYZA 2KNBB 1PKTA 4A63B 1M3CA 2CH4A 2FPDA 2YUQA 2FRYA 1PHTA 2AK5A 3H0FA 1OOTA 1ZUUA 2EGCA 2GGRA 1UDLA 1AEYA 2PZ1A 4RTVA 5IHNA 1OPLA 2O31A 4J9HA 2LJ1A 1HJDA 2CDTA 2O9SA 3ZL7C 2EBPA 1K76A 1VYVA 1GCQA 2KRMA 2KEAA 2EGAA 2KRSA 1GCPA 1QWFA 2V1RA 1M8MA 2CREA 4QT7A 2EPDA 2OJ2A 2ED0A 1PKSA 1UECA 1T0HA 2SEMA 1JEGA 3H41A 4JZ3A 1X6GA 4K11A 5HCKA 2O88A 4GBQA 3R6NA 5EC7A 1KFZA 2AKLA 2C0IA 2EYYA 1TUCA 1X43A 4RTXA 1NYFA 1J3TA 2DL7A 2LQWA 3EG0A 2MOXA 2VWFA 1AD5A 3NMZC 2K79A 1QWEA 3VS7A 3VRZA 1AZGB 1T3SA 2FG0A 2J6FA 3U23A 1T3LA 4LNPA 2CSQA 2L3PA 1Y0MA 3RBBB 4AG2C 5FWCA 1WX6A 3TVTA 2JT4A 1X2QA 2NUZA 1GL5A 4AFSC 1HD3A 3A98A 4LUDA 1UFFA 2RF0A 3TSWA 1WDXA 2JS0A 4J9EA 1Z9QA 1JXOA 4OMNA 2BZ8A 2KXCA 3NPFA 5GJVB 1I1JA 2QDLA 1SRLA 4FSSA 1WIEA 2DL5A 5FWBA 1CKBA 1NG2A 2DILA 1AWOA 3H0IA 2RMOA 4J9CA 4HCKA 4LN2A 1SHGA 4OMPA 3VS1A 2CUBA 1OV3A 2G6FX 3EG1A 2ABLA 1MV0B 4RTZA 1OEBA 2RQVA 1UG1A 2CH4W 2I0NA 1IO6A 2RPNA 3M0SA 4AFZC 4Z8AA 2FPEA 4CC7A 1YCSB 2J05A 4DEYA 2JM8A 2L2PA 1QKWA 5L23A 2JM9A 4X1VA 1JU5C 1X69A 1WXUA 4J9GA 4ZNXA 3I9QA 3H0HA 3GBQA 1BBZA 1PRMC 1UHCA 2LZ6B 1ARKA 2A37A 2L3SA 2HCKA 1M3AA 1S1NA 1U5SA 2HEQA 1VA7A 3REAB 3UATA 2FEIA 2GQIA 1NLOC 3VS5A 4GLMA 2MIOA 1E6GA 1AWXA 2YSQA 1WLPB 2HSPA 1GFCA 3VRYA 1GRIA 2L0AA 1WXBA 2RQRA 1QCFA 1U06A 2KT1A 2JXBA 4F17A 4HXJA 2DVJA 3M0TA 1SEMA 4J9DA 2ROLA 2X3XD 1X27A 5GJWB 3VS6A 5IHIA 1H8KA 2W0ZA 2O2OA 2DL4A 1I07A 2FO0A 1GFDA 4J9IA 2RQUA 1TG0A 1Z9ZA 3C0CA 3EHQA 1K0SA 1SSHA 1CSKA 4F16A 2F2VA 2ROTA 2BZYA 3NHNA 4DEXA 4Z89A 1JQQA 1AWWA 2EVRA 3TSZA 1M30A 3VS3A 2IIMA 2NWMA 1AOJA 1H92A 3SEMA 2J6KA 1GBQA 2DL8A 2EKHA 4HVUA 1XOVA 4JPBW 1N5ZA 1W6XA 3FJ5A 3M0UA 4D8DA 2RN8A 1WFWA 4Y92A 4Z88A 4M4ZA 1ZUKA 2FRWA 1UJYA 1VYUA 2DNUA 3I5RA 1WI7A 2SRCA 4JJDA 2KXDA 1KJWA 2RNAA 2DRMA 1K9AA 2DLPA 3UA6A 1G83A 2W10A 3THKA 2DM1A 3M0PA 1X2KA 5I22A 1VYTA 2EYWA 4KRTA 2LP5A 1PWTA 2V1QA 3QWYA 1WXTA 2D8HA 1YP5A 1RUWA 1OPKA 2M0YA 2EYXA 3M0QA 1NLPC 2YUNA 2D8JA 1HSQA 3EG2A 3RNJA 2J06A 1BU1A 2YUOA 1ZLMA 1ZX6A 1QKXA 1RLQC 1GBRA 3KFVA 2A28A 2M51A 4E6RA 1UE9A 2YT6A 4LUEA 1TUDA 2KE9A 2LX7A 1FMKA 1RI9A 2F2XA 3O5ZA 1ABOA 2RQWA 3M0RA 2BZXA 1AWJA 2DF6A 3PVQA 2MCNA 4OMOA 4CC4B 2VVKA 1FYNA 2D1XA 2YDLA 4AFQC 1AVZC 2EQIA 2KR3A 1BK2A 4R0KA 2J7IA 2J6OA 2FPFA 2KROA 1NYGA 4HVVA 5ECAA 4CC2A 3VS0A 2K2MA 1MUZA 1M27C 1QLYA 1LCKA 2H8HA 2HDAA 1K1ZA 1EFNA 2KYMA 1AZEA 3JV3A 1JO8A 2A36A 1JXMA 4J9BA 2B86A 4IIMA 2CSIA 3PE0A 1MV3A 4J9FA 4JJCA 5I11A 3VS2A 5IXBA 3LH5A 2X3WD 1KSWA 4IIOA 4HVWA 1NEGA 4RUGA 1GCQC 2K9GA 2AZVA 5IXFA 3VS4A 2JW4A 3PVLA 3EGUA 2CT3A 2LNHB 2ED1A 5IHKA 4D8KA 2DRKA 1W70A 2F2WA 3REBB 2LMJA 3ULRB 1ZBJA 2P4RA 2L3QA 2LQNA 2AZSA 1YN8A 2LCSA 1YWPA 2C0TA 2DL3A 1ABQA 1K4US 2OI3A 4OMLA 4RTYA 1B07A 4LE9A 2VKNA 4ESRA 3I5SA 2KGTA 2OAWA 2JS2A 2XMFA 1G2BA 4RTTA 4OMQA 4ORZA 1UHFA 2JMCA 1NM7A 2HBWA 2JMAA 1PNJA 3QWXX 2DX1A 4OMMA 1WYXA 2DA9A 2EW3A 1SRMA 2CUDA 1RLPC 1WA7A 3UA7A 1B3QA 2KBTA 1BB9A 1UTIA 2ENMA 4RTUA 2KT8A 3UF4A 1V1CA 2GTJA 1SPKA 1NEBA 2GBQA 3EG3A 2DBKA 1ZUYA 1E7OA 2KRNA 1KIKA 1PRLC 1A0NB 1UGVA 4JZ4A 2YUPA 1T0JA 2K7AA 4CC3A 4JJBA 2A08A 2E5KA 1I0CA 3SHWA 1H3HA 2D0NA 2K6DA 2K3BA 2ESWA 2KYBA 2GNCA 4RTWA 4EIKA 1K0XA 2DMOA 4AG1C 2DJQA 2BTTA 3EHRA 2CT4A 2DE0X 2O9VA 1SHFA 4AFUC 1W1FA 2C0OA 1U3OA 1Y57A 2RQTA 1X6BA 2LJ0A 2AKKA 2DYBA 5IH2A 3I35A 3CQTA 5FW9A 2DBMA 2JTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSG A;  4F14 A;  2LJ3 A;  1UJ0 A;  1E6H A;  1YWO A;  2ECZ A;  2PNI A;  3NGP A;  4WCI A;  1UUE A;  1YNZ A;  1CKA A;  2EGE A;  1M3B A;  2GTO A;  2PTK A;  3IQL A;  2EYZ A;  2KNB B;  1PKT A;  4A63 B;  1M3C A;  2CH4 A;  2FPD A;  2YUQ A;  2FRY A;  1PHT A;  2AK5 A;  3H0F A;  1OOT A;  1ZUU A;  2EGC A;  2GGR A;  1UDL A;  1AEY A;  2PZ1 A;  4RTV A;  5IHN A;  1OPL A;  2O31 A;  4J9H A;  2LJ1 A;  1HJD A;  2CDT A;  2O9S A;  3ZL7 C;  2EBP A;  1K76 A;  1VYV A;  1GCQ A;  2KRM A;  2KEA A;  2EGA A;  2KRS A;  1GCP A;  1QWF A;  2V1R A;  1M8M A;  2CRE A;  4QT7 A;  2EPD A;  2OJ2 A;  2ED0 A;  1PKS A;  1UEC A;  1T0H A;  2SEM A;  1JEG A;  3H41 A;  4JZ3 A;  1X6G A;  4K11 A;  5HCK A;  2O88 A;  4GBQ A;  3R6N A;  5EC7 A;  1KFZ A;  2AKL A;  2C0I A;  2EYY A;  1TUC A;  1X43 A;  4RTX A;  1NYF A;  1J3T A;  2DL7 A;  2LQW A;  3EG0 A;  2MOX A;  2VWF A;  1AD5 A;  3NMZ C;  2K79 A;  1QWE A;  3VS7 A;  3VRZ A;  1AZG B;  1T3S A;  2FG0 A;  2J6F A;  3U23 A;  1T3L A;  4LNP A;  2CSQ A;  2L3P A;  1Y0M A;  3RBB B;  4AG2 C;  5FWC A;  1WX6 A;  3TVT A;  2JT4 A;  1X2Q A;  2NUZ A;  1GL5 A;  4AFS C;  1HD3 A;  3A98 A;  4LUD A;  1UFF A;  2RF0 A;  3TSW A;  1WDX A;  2JS0 A;  4J9E A;  1Z9Q A;  1JXO A;  4OMN A;  2BZ8 A;  2KXC A;  3NPF A;  5GJV B;  1I1J A;  2QDL A;  1SRL A;  4FSS A;  1WIE A;  2DL5 A;  5FWB A;  1CKB A;  1NG2 A;  2DIL A;  1AWO A;  3H0I A;  2RMO A;  4J9C A;  4HCK A;  4LN2 A;  1SHG A;  4OMP A;  3VS1 A;  2CUB A;  1OV3 A;  2G6F X;  3EG1 A;  2ABL A;  1MV0 B;  4RTZ A;  1OEB A;  2RQV A;  1UG1 A;  2CH4 W;  2I0N A;  1IO6 A;  2RPN A;  3M0S A;  4AFZ C;  4Z8A A;  2FPE A;  4CC7 A;  1YCS B;  2J05 A;  4DEY A;  2JM8 A;  2L2P A;  1QKW A;  5L23 A;  2JM9 A;  4X1V A;  1JU5 C;  1X69 A;  1WXU A;  4J9G A;  4ZNX A;  3I9Q A;  3H0H A;  3GBQ A;  1BBZ A;  1PRM C;  1UHC A;  2LZ6 B;  1ARK A;  2A37 A;  2L3S A;  2HCK A;  1M3A A;  1S1N A;  1U5S A;  2HEQ A;  1VA7 A;  3REA B;  3UAT A;  2FEI A;  2GQI A;  1NLO C;  3VS5 A;  4GLM A;  2MIO A;  1E6G A;  1AWX A;  2YSQ A;  1WLP B;  2HSP A;  1GFC A;  3VRY A;  1GRI A;  2L0A A;  1WXB A;  2RQR A;  1QCF A;  1U06 A;  2KT1 A;  2JXB A;  4F17 A;  4HXJ A;  2DVJ A;  3M0T A;  1SEM A;  4J9D A;  2ROL A;  2X3X D;  1X27 A;  5GJW B;  3VS6 A;  5IHI A;  1H8K A;  2W0Z A;  2O2O A;  2DL4 A;  1I07 A;  2FO0 A;  1GFD A;  4J9I A;  2RQU A;  1TG0 A;  1Z9Z A;  3C0C A;  3EHQ A;  1K0S A;  1SSH A;  1CSK A;  4F16 A;  2F2V A;  2ROT A;  2BZY A;  3NHN A;  4DEX A;  4Z89 A;  1JQQ A;  1AWW A;  2EVR A;  3TSZ A;  1M30 A;  3VS3 A;  2IIM A;  2NWM A;  1AOJ A;  1H92 A;  3SEM A;  2J6K A;  1GBQ A;  2DL8 A;  2EKH A;  4HVU A;  1XOV A;  4JPB W;  1N5Z A;  1W6X A;  3FJ5 A;  3M0U A;  4D8D A;  2RN8 A;  1WFW A;  4Y92 A;  4Z88 A;  4M4Z A;  1ZUK A;  2FRW A;  1UJY A;  1VYU A;  2DNU A;  3I5R A;  1WI7 A;  2SRC A;  4JJD A;  2KXD A;  1KJW A;  2RNA A;  2DRM A;  1K9A A;  2DLP A;  3UA6 A;  1G83 A;  2W10 A;  3THK A;  2DM1 A;  3M0P A;  1X2K A;  5I22 A;  1VYT A;  2EYW A;  4KRT A;  2LP5 A;  1PWT A;  2V1Q A;  3QWY A;  1WXT A;  2D8H A;  1YP5 A;  1RUW A;  1OPK A;  2M0Y A;  2EYX A;  3M0Q A;  1NLP C;  2YUN A;  2D8J A;  1HSQ A;  3EG2 A;  3RNJ A;  2J06 A;  1BU1 A;  2YUO A;  1ZLM A;  1ZX6 A;  1QKX A;  1RLQ C;  1GBR A;  3KFV A;  2A28 A;  2M51 A;  4E6R A;  1UE9 A;  2YT6 A;  4LUE A;  1TUD A;  2KE9 A;  2LX7 A;  1FMK A;  1RI9 A;  2F2X A;  3O5Z A;  1ABO A;  2RQW A;  3M0R A;  2BZX A;  1AWJ A;  2DF6 A;  3PVQ A;  2MCN A;  4OMO A;  4CC4 B;  2VVK A;  1FYN A;  2D1X A;  2YDL A;  4AFQ C;  1AVZ C;  2EQI A;  2KR3 A;  1BK2 A;  4R0K A;  2J7I A;  2J6O A;  2FPF A;  2KRO A;  1NYG A;  4HVV A;  5ECA A;  4CC2 A;  3VS0 A;  2K2M A;  1MUZ A;  1M27 C;  1QLY A;  1LCK A;  2H8H A;  2HDA A;  1K1Z A;  1EFN A;  2KYM A;  1AZE A;  3JV3 A;  1JO8 A;  2A36 A;  1JXM A;  4J9B A;  2B86 A;  4IIM A;  2CSI A;  3PE0 A;  1MV3 A;  4J9F A;  4JJC A;  5I11 A;  3VS2 A;  5IXB A;  3LH5 A;  2X3W D;  1KSW A;  4IIO A;  4HVW A;  1NEG A;  4RUG A;  1GCQ C;  2K9G A;  2AZV A;  5IXF A;  3VS4 A;  2JW4 A;  3PVL A;  3EGU A;  2CT3 A;  2LNH B;  2ED1 A;  5IHK A;  4D8K A;  2DRK A;  1W70 A;  2F2W A;  3REB B;  2LMJ A;  3ULR B;  1ZBJ A;  2P4R A;  2L3Q A;  2LQN A;  2AZS A;  1YN8 A;  2LCS A;  1YWP A;  2C0T A;  2DL3 A;  1ABQ A;  1K4U S;  2OI3 A;  4OML A;  4RTY A;  1B07 A;  4LE9 A;  2VKN A;  4ESR A;  3I5S A;  2KGT A;  2OAW A;  2JS2 A;  2XMF A;  1G2B A;  4RTT A;  4OMQ A;  4ORZ A;  1UHF A;  2JMC A;  1NM7 A;  2HBW A;  2JMA A;  1PNJ A;  3QWX X;  2DX1 A;  4OMM A;  1WYX A;  2DA9 A;  2EW3 A;  1SRM A;  2CUD A;  1RLP C;  1WA7 A;  3UA7 A;  1B3Q A;  2KBT A;  1BB9 A;  1UTI A;  2ENM A;  4RTU A;  2KT8 A;  3UF4 A;  1V1C A;  2GTJ A;  1SPK A;  1NEB A;  2GBQ A;  3EG3 A;  2DBK A;  1ZUY A;  1E7O A;  2KRN A;  1KIK A;  1PRL C;  1A0N B;  1UGV A;  4JZ4 A;  2YUP A;  1T0J A;  2K7A A;  4CC3 A;  4JJB A;  2A08 A;  2E5K A;  1I0C A;  3SHW A;  1H3H A;  2D0N A;  2K6D A;  2K3B A;  2ESW A;  2KYB A;  2GNC A;  4RTW A;  4EIK A;  1K0X A;  2DMO A;  4AG1 C;  2DJQ A;  2BTT A;  3EHR A;  2CT4 A;  2DE0 X;  2O9V A;  1SHF A;  4AFU C;  1W1F A;  2C0O A;  1U3O A;  1Y57 A;  2RQT A;  1X6B A;  2LJ0 A;  2AKK A;  2DYB A;  5IH2 A;  3I35 A;  3CQT A;  5FW9 A;  2DBM A;  2JTE A; 
#chains in the Genus database with same CATH topology
 3I55 Q;  5HY6 A;  2OTJ T;  4F14 A;  1UJ0 A;  1ZSZ B;  4HCZ A;  2O4X A;  2PNI A;  3JCM e;  3OS2 A;  1NJI U;  3IQL A;  1GXI E;  1PKT A;  2CP5 A;  4A63 B;  1VQL Q;  2LC4 A;  1H64 1;  2CH4 A;  5KYU B;  3TU4 K;  1QVF P;  4M77 F;  4RG2 A;  3E9F A;  3NTK A;  3QPH A;  4C0G A;  2GGR A;  4XU1 A;  5IHN A;  3M55 A;  4J9H A;  4M7D F;  2MPX C;  1HK9 A;  2CDT A;  2EBP A;  2HQE A;  3HHT B;  1WQW A;  4HKE A;  2KRS A;  1QWF A;  2CP2 A;  4E47 A;  1M8M A;  4QT7 A;  2O4X B;  3M5A A;  2A7Y A;  4DA4 A;  3H41 A;  1X6G A;  2PUO B;  3CCM T;  2O88 A;  4GBQ A;  3R6N A;  2EYY A;  5GAM h;  1TUC A;  1X43 A;  2O01 E;  5LJ3 g;  2DL7 A;  2MOX A;  1Q86 C;  1AD5 A;  2K5I A;  4IUU A;  5D6Y A;  1AZG B;  4IUQ A;  3U23 A;  4DBR A;  1VQM Q;  1T3L A;  3LLR A;  5FU6 B;  4RG8 A;  4C0F A;  3QDR B;  1WHG A;  3UWN A;  1VQ5 T;  1W4S A;  3G4S Q;  3PIP A;  1WHK A;  5D6X A;  3CXC S;  5GJV B;  2RH2 A;  3D7S B;  2COY A;  3CCL Q;  4ZGD B;  4LD6 A;  4JJN K;  1VQ9 Q;  4XTX A;  2DL5 A;  3BDU A;  2JZ2 A;  5FWB A;  3G71 T;  2EYQ A;  3OYC A;  3PT9 A;  1CKB A;  1AWO A;  2EKO A;  2RMO A;  2E6N A;  3F70 A;  4M7D G;  1TWB A;  4J7F A;  3VS1 A;  2CUB A;  2P0Q A;  1OV3 A;  2EFI A;  3CXC A;  4RTZ A;  1VQP Q;  4V2S A;  3FDR A;  2JOY A;  2I0N A;  1IO6 A;  2QA4 A;  2RPN A;  3EGD A;  2RK1 A;  3EAE A;  3M0S A;  1F1B B;  4PJL A;  4AFZ C;  4Z8A A;  4DOV A;  5FRO A;  1VQN Q;  1YCS B;  2GQV A;  3M56 A;  1HXD A;  4DEY A;  2JM8 A;  2DK3 A;  3M9Q A;  1XTD A;  2QG9 B;  2XU8 A;  1ACM B;  4J9G A;  3C95 A;  2V8J A;  4JUV A;  3OY9 A;  3Q1J A;  1ARK A;  2L3S A;  4X34 A;  2HCK A;  1TSF A;  1U5S A;  2HEQ A;  5J26 A;  1OYX A;  1YJN T;  1VA7 A;  3REA B;  3L1A A;  5GAN 3;  2GQI A;  2HL5 C;  2IPO B;  3VS5 A;  1PSE A;  1VQO A;  4N4G A;  1Q81 C;  4GLM A;  2MIO A;  1K8A C;  1JJ2 P;  1NE8 A;  3VRY A;  3M54 A;  2MYS A;  3EGD B;  2HBP A;  1QCF A;  3QUI A;  4F04 B;  1RAC B;  3CD6 Q;  4J8O A;  1S72 A;  4KUI A;  3MP6 A;  2ZPI B;  1H8K A;  2W0Z A;  2O2O A;  1YHQ T;  2RQU A;  1TG0 A;  1UGR B;  1Z9Z A;  4NOY A;  3EHQ A;  1YI2 T;  1CSK A;  2JVV A;  3NHN A;  2ROT A;  2BZY A;  3HRS A;  4Z89 A;  1KC8 C;  3VS3 A;  1M30 A;  4LD9 K;  2IIM A;  2NWM A;  1SG5 A;  1K9M U;  4ME7 A;  1GBQ A;  1PG5 B;  2DL8 A;  2EKH A;  3TCJ A;  3FJ5 A;  1VQ4 Q;  2G3R A;  2K4Y A;  1JBM A;  2FRW A;  1UJY A;  1VYU A;  3BDL A;  3JCM g;  1U1S A;  3V8J A;  2KQW A;  4JS4 A;  3JCM W;  4IUV A;  1MHN A;  2E4H A;  2KXD A;  4C92 C;  5CKB A;  3A5Z B;  2RNA A;  3INZ A;  2DRM A;  2M1H A;  4M75 F;  2YRD A;  4BE1 A;  5GAO n;  2DER A;  2V1Q A;  4QQ6 A;  1BI0 A;  1WXT A;  1N8R U;  4Y91 A;  1YP5 A;  2M0Y A;  4A53 A;  2YRC A;  1LNX A;  4HCC A;  2YUN A;  2D8J A;  3HFN A;  3JB9 G;  3RNJ A;  2H3E B;  1QMC A;  2YUO A;  2CP0 A;  1ZLM A;  4EPC A;  2M51 A;  1MMG A;  3OA6 A;  4ELZ C;  2KE9 A;  4FYV B;  5GAN 7;  8ATC B;  3M0R A;  2DF6 A;  1FYN A;  1ZBX A;  2PVG B;  1UGS B;  4R0K A;  1Q86 U;  2KAF A;  5LJ5 h;  1VQ6 A;  1YIJ T;  2KRO A;  4FIB A;  5ECA A;  3S3M A;  4EMG A;  3V8L A;  4Z02 A;  4BD3 A;  3FIF A;  4BI4 A;  3V7C A;  4A4G A;  2H8H A;  2RB6 A;  2HDA A;  4ZGJ B;  2PVO B;  1TH7 A;  3JV3 A;  2YLC A;  1JXM A;  4JS5 A;  1IRX A;  1OUL A;  2CSI A;  4FSX A;  2FZC B;  4OB2 B;  3M57 A;  4CI0 C;  4RUG A;  2OTL A;  4L6V 5;  1KQS S;  3RKY A;  1VQO Q;  4F7U E;  3SB2 A;  2LT1 A;  1W70 A;  4RKU E;  5GAN e;  3CCM Q;  1ZQ1 A;  5CK9 A;  3CCQ A;  3SFM A;  2C0T A;  1D1A A;  2RJF A;  3HL8 A;  1ABQ A;  2VKN A;  4ESR A;  3I5S A;  4N0A C;  1Q86 R;  1NJI C;  2F69 A;  1UHF A;  1NM7 A;  4XTW A;  2B8A A;  4M78 C;  3V7R A;  4PK4 A;  1VQ5 Q;  4OMM A;  3QZ5 B;  2EW3 A;  3OB9 A;  2MF2 A;  5HKC A;  5LJ5 j;  1RLP C;  2ZPE B;  4C92 A;  3UPU A;  1YIT T;  1B3Q A;  2RJE A;  1BIB A;  4PNO A;  1VOM A;  3G71 Q;  2OAU A;  1K8A U;  3UF4 A;  1V1C A;  2GTJ A;  2QGG A;  1I5O B;  2GBQ A;  5GAM g;  1EIF A;  4EMH A;  3I55 A;  2DIG A;  1ZUY A;  1KIK A;  4ATO A;  4JZ4 A;  2HAX A;  4CC3 A;  3MEV A;  2ZAE A;  5DM7 R;  3CCJ A;  4M77 C;  1I0C A;  4JLG A;  1WHH A;  5LJ3 j;  2D0N A;  2DTH A;  4OGC A;  5LJ5 d;  3EH1 A;  4IUT A;  4BDY A;  4AG1 C;  4EMK C;  2BTT A;  5LJ3 e;  5FU7 C;  4C92 B;  2CT4 A;  1SHF A;  5GAN 5;  1QVG A;  1BI1 A;  2AT1 B;  1C6V X;  3OW2 S;  2EQU A;  3I35 A;  3DLM A;  5GMK i;  2XHC A;  2LJ3 A;  1E6H A;  2ECZ A;  4PFZ A;  1O9S A;  1Y07 A;  2VB6 A;  2QK0 A;  2QEX A;  2WAC A;  1M3B A;  2Y90 A;  1Y96 A;  2EYZ A;  1K8A R;  2KNB B;  3OW2 A;  4MDW A;  2QAS A;  2EJF A;  4XAX B;  2FPD A;  2KVQ G;  3RKX A;  1PHT A;  3H0F A;  1OOT A;  5CVI A;  2X35 A;  2EGC A;  1N27 A;  4XU3 A;  1VQM A;  3OQ5 A;  3T9N A;  3LWH A;  1HJD A;  2CYZ B;  1K76 A;  1VYV A;  1YHQ Q;  1VQ6 Q;  3E19 A;  2KEA A;  2EGA A;  4HCB A;  1YI2 Q;  2QQB A;  2OJ2 A;  1PKS A;  2XID A;  1T0H A;  2SEM A;  2RD1 A;  2YLB A;  1YJW A;  2QGF B;  1VQ9 A;  4F7U G;  1Y96 B;  2WSE E;  1KFZ A;  3KBG A;  1OX8 A;  3ZFJ A;  4BE2 A;  1J3T A;  2MK5 A;  3NMZ C;  3VS7 A;  3JCM J;  1LOJ A;  4N0A A;  3CMA A;  5FLX E;  2NUP A;  3M58 A;  4QW2 A;  2OTL Q;  1VQK T;  1KHC A;  2MWP A;  4C8Q C;  1WX6 A;  4M78 A;  1HD3 A;  4LUD A;  1WDX A;  4J9E A;  2XDD A;  1VQN A;  2E1H A;  1JXO A;  3L2Q A;  1SKU B;  4OMN A;  2XIC A;  3OS0 A;  5AYF A;  2QDL A;  3SD4 A;  1YBY A;  4FSS A;  2QYZ A;  3V7S A;  3CME T;  4L5G A;  3CPF A;  5GAO q;  3LH0 A;  4QKU A;  3H0I A;  3OSV A;  4HCK A;  3CCE T;  1K73 U;  5CCA A;  1SHG A;  4OMP A;  3A8L B;  2NUP B;  4KH0 B;  1K9M C;  4RCB A;  2RQV A;  2RHX A;  2LNV A;  5KE2 A;  4BUG A;  4M78 B;  3JCM X;  2FPE A;  5GAO m;  5GAN 8;  4NL2 A;  2J05 A;  4EMK A;  3CD6 A;  2L2P A;  2FHD A;  4B9W A;  4ANJ A;  3M53 A;  4X1V A;  5CKH A;  1O75 A;  1IXD A;  1WGS A;  1H3Z A;  3MCA B;  3H0H A;  3GBQ A;  4A4H A;  3CCS T;  4ZTJ A;  2A37 A;  3CXC P;  2ZPF B;  2VGM A;  1FMV A;  2P0K A;  1KQ1 A;  1YIJ Q;  3G6E T;  5DY9 A;  2VAS A;  3CCJ Q;  1DJ7 B;  2VXF A;  2DXC A;  1QW1 A;  1AWX A;  4QQD A;  2CP6 A;  2L89 A;  3GLX A;  3CCV T;  4PJO C;  1GRI A;  1N8R C;  1VIE A;  1TXQ A;  2EIF A;  1FMW A;  2KT1 A;  2JXB A;  4F17 A;  3JCM d;  4HXJ A;  2DVJ A;  2BE7 D;  2KMT A;  3M0T A;  4EMK B;  4BY6 C;  5FU7 B;  3VKI A;  1I4K 1;  1K73 R;  3VS6 A;  1D0X A;  4B9X A;  5C0M A;  1VQ4 A;  2LVM A;  4LDX A;  2JN0 A;  2K5L A;  4M75 C;  3VJP A;  2DL4 A;  2QEX Q;  1GFD A;  4J9I A;  3C0C A;  1K0S A;  2F2V A;  1MMN A;  4DEX A;  3OYG A;  1JQQ A;  2EVR A;  4KUD K;  1H92 A;  2R5A A;  2Z0W A;  3OYE A;  3HRU A;  3GP8 A;  3C4S A;  4ZGE B;  3H9N A;  4JRQ A;  1M4Z A;  1SF9 A;  3M0U A;  4D8D A;  2HL3 A;  1NJI R;  1WFW A;  3OYD A;  3OYK A;  2LX9 A;  4M4Z A;  4XTV A;  5GAO p;  3CCU T;  3OYH A;  2FZK B;  3LYI A;  4C8Q A;  2DNU A;  3MHX A;  2EAY A;  1WI7 A;  2M16 A;  2ZPB B;  2KDS A;  1KJW A;  1YJW Q;  5LJ5 f;  1K9A A;  4MZM A;  9ATC B;  1G83 A;  2W10 A;  2RI3 A;  2OTJ A;  2DM1 A;  5I22 A;  3FLG A;  3CCR T;  3CMA Q;  5KYW A;  3OBY A;  2D8H A;  2XDP A;  2EYX A;  3CBO A;  1NLP C;  3I56 T;  4E7J A;  1HSQ A;  4HT8 A;  3EG2 A;  2QAZ A;  3DKM A;  4M7A C;  1BU1 A;  2D9T A;  1QKX A;  4C8Q B;  3GF5 A;  3KFV A;  1VQ8 T;  4E6R A;  2YT6 A;  1TUD A;  2LX7 A;  3RMS A;  2VC8 A;  1RI9 A;  3O5Z A;  4C92 D;  3PVQ A;  4OMO A;  4FM4 B;  2E5Q A;  4L59 A;  2YDL A;  1C0M A;  1AVZ C;  4XTY A;  2K3Y A;  5KYW B;  3M59 A;  2V8I A;  3OS1 A;  3CCM A;  4BDZ A;  3CC4 T;  4CC2 A;  2K2M A;  1MUZ A;  1Y7X A;  4OB0 B;  2DZ9 A;  4XTU A;  3KUF A;  4PJO A;  3EFR A;  1EFN A;  4HA8 A;  2ATC B;  1AZE A;  2DXU A;  5GAM e;  1N9S A;  1VUB A;  4JJC A;  1BKB A;  3PE0 A;  5IXB A;  3VS2 A;  3P8B B;  4OGE A;  3CC7 T;  4R55 A;  4XU2 A;  1RAF B;  3JB9 F;  3RUX A;  4HVW A;  1GCQ C;  1TS9 A;  2AZV A;  3CBP A;  1VQ5 A;  2IVW A;  4J83 A;  3PVL A;  1V76 A;  4FT2 A;  4M75 A;  5IHK A;  4D8K A;  1YJ9 T;  2WSF E;  3REB B;  5M9O A;  5J39 A;  3TRE A;  1M5Q 1;  2P4R A;  2LQN A;  3S6W A;  2HQH A;  3G71 A;  2XI9 A;  1LJO A;  2DL3 A;  1BI3 A;  2OI3 A;  4PJO B;  2Y4X A;  4LE9 A;  2V8K A;  3JB9 J;  2KGT A;  3SWN C;  2A0F B;  1VQK Q;  1G2B A;  4KUL A;  2BKD N;  1M2V A;  3QKJ A;  2HBW A;  4A54 A;  1WJR A;  3E9G A;  1PNJ A;  4IUP A;  1BYM A;  2DX1 A;  2DET A;  1SRM A;  4M75 B;  1R0C B;  3VUB A;  3CPW S;  2ZGW A;  4KBM B;  5GAN h;  1EZZ B;  3CME Q;  2ENM A;  4RTU A;  2FZG B;  3PTA A;  1YJN A;  2XG8 D;  4JRI A;  1SPK A;  4QQG A;  2GCX A;  2CZ7 B;  4IUR A;  3HKS A;  4VUB A;  3CPW A;  1WQ7 A;  5CO7 A;  3X24 B;  1PSF A;  1JJ2 S;  1M2V B;  3SHW A;  2YXY A;  4M7A A;  1K9M R;  2NLU A;  1UB4 A;  2V26 A;  3QSU A;  4M78 D;  2P4T A;  2O9V A;  2OTJ Q;  2RHI A;  2ZZD A;  1PD0 A;  1Y57 A;  2R57 A;  3CC2 T;  1QCN A;  2DYB A;  1R8O B;  5IH2 A;  3JCM f;  3VV0 A;  1YHQ A;  2HQX A;  1ZSG A;  3FRN A;  2RJC A;  4TVR A;  1YI2 A;  1TTH B;  3OSS C;  3MO8 A;  4WCI A;  3QZ9 B;  1UUE A;  1CKA A;  2EGE A;  1IGU A;  3DLL A;  3QO3 A;  3QYG B;  2COW A;  2BUD A;  2GTO A;  4M7A B;  4BI8 B;  4QVD A;  1QVG P;  4M77 D;  5FRM A;  1K73 C;  1N8R R;  1FX7 A;  1RL2 A;  2IG0 A;  1PCX A;  2RO0 A;  2FRY A;  3OBW A;  2AK5 A;  2K3X A;  5GAN j;  2DEQ A;  5LJ3 h;  1RAE B;  3L2U A;  1B7T A;  3GPL A;  1G3S A;  4RTV A;  1VQL T;  1AEY A;  1FWZ A;  2O9S A;  3ZL7 C;  2DEU A;  1WHL A;  1GCQ A;  3UDC A;  2FVU A;  1VQ7 T;  3OW2 P;  2CRE A;  5CAI A;  5DLQ E;  3V8K A;  1JEG A;  2DO3 A;  5A0G A;  1KQS A;  2C0I A;  1ZHI A;  2RHZ A;  2E70 A;  5GAN d;  4C92 E;  3L42 A;  3EG0 A;  2K79 A;  2VXE A;  2F5T X;  1Q82 U;  3OYJ A;  3SWN A;  1YCY A;  2J6F A;  3A8G B;  2M02 A;  4LNP A;  3CCU Q;  2CSQ A;  1SSF A;  1Y0M A;  1W2B S;  4MMK A;  3X20 B;  4AG2 C;  5FWC A;  5IT9 E;  2KSS A;  1LVK A;  2R5M A;  2JT4 A;  1X2Q A;  2NUZ A;  1GL5 A;  3CBM A;  3A98 A;  4OP0 A;  3TSW A;  2JS0 A;  1Z9Q A;  2KXC A;  3NPF A;  1KHI A;  2YHT A;  4IKF A;  5GMK e;  1I1J A;  1SRL A;  4EDU A;  7AT1 B;  3CCR Q;  1IHV A;  1W2B A;  1QVP A;  3J81 E;  1BCM A;  1WHJ A;  2YRV A;  3G4S T;  2K57 A;  2DIL A;  2QQR A;  1YIJ A;  2JTF A;  4E7L A;  3CCL T;  1WNL A;  2CGH A;  5HK0 A;  4MZP A;  2LQ8 A;  3SWN B;  4YTL A;  3EG1 A;  2ABL A;  1MV0 B;  1VQ8 Q;  2CH4 W;  4II1 A;  4M7D C;  4F7U F;  2DTI A;  2XDB A;  4C8Q D;  4CC7 A;  1KG1 A;  2VYT A;  3BW1 A;  1YJN Q;  1VQP T;  1QKW A;  5L23 A;  2JM9 A;  1FXX A;  1JU5 C;  1X69 A;  4J7I A;  3I9Q A;  3R6O A;  2FYK A;  1UHC A;  2MWO A;  2LZ6 B;  1AT1 B;  2CP7 A;  1M3A A;  5LJ3 d;  2CZ0 B;  2D6F A;  1G3Y A;  3WVE B;  4X9D A;  4C92 F;  3CC4 Q;  2HSE B;  3BE3 A;  4MML A;  1NLO C;  3LX7 A;  3JRZ A;  4E7Z A;  3QXE B;  4J6W A;  1WLP B;  1YFN A;  2E3I A;  2HSP A;  4DBH A;  5CKD A;  2E65 A;  5I21 A;  2L0A A;  1LPL A;  1WXB A;  5C6S A;  2HZY A;  1U06 A;  1IHW A;  2CZ6 B;  4J9D A;  2ROL A;  2X3X D;  5DLO A;  3JB9 I;  5GJW B;  2A3L A;  2E12 A;  3JCM V;  2F1L A;  1TU0 B;  5KYY A;  5IHI A;  8AT1 B;  2L8D A;  4DBQ A;  3OYM A;  3L2W A;  1YIT A;  5GAN 6;  5HK3 A;  2FO0 A;  4ZN1 A;  3JCM h;  4PLI A;  2JNG A;  3PIO A;  4PJN A;  4M78 E;  3VYH B;  3NTI A;  1AWW A;  2DJZ A;  3TSZ A;  1NZ9 A;  1X75 C;  2RJD A;  1RAA B;  3SEM A;  2PQW A;  4PJO D;  2J6K A;  2C06 A;  4HVU A;  3PMT A;  4JPB W;  1N5Z A;  4E7S A;  2RN8 A;  4J5Y A;  4J6Y A;  2DIQ A;  4C5I A;  4C92 G;  5KYY B;  1ZUK A;  1M1G A;  3LWI A;  3I5R A;  3WVD B;  4O6J A;  1PM3 A;  2SRC A;  3ASK A;  5A0D A;  3RMQ A;  4C0D C;  3PNW C;  5I2M A;  4M75 D;  4P5N A;  1BCO A;  1XQH A;  3UA6 A;  1I8F A;  3J80 E;  2H3J A;  2DTO A;  4XU0 A;  3M0P A;  1OU9 A;  4C5H A;  1VYT A;  3FJP A;  4KRT A;  2LP5 A;  3QWY A;  4MDX A;  3FB9 A;  4M77 A;  3C12 A;  2PU9 B;  2RM4 A;  1X6O A;  4XTZ A;  3FEO A;  2QTV A;  2X4X A;  2COZ A;  4LXC A;  4GY5 A;  2F5K A;  4M7D A;  2A28 A;  1UE9 A;  3MKD A;  1FMK A;  2F2X A;  2JUF A;  3HRT A;  3O8V A;  2BZX A;  3A1P A;  3LW5 E;  2MCN A;  1MGQ A;  4M78 F;  1TOV A;  2VVK A;  1Q7Y C;  3OMG A;  1HYO A;  2NYS A;  3DB3 A;  4JLI A;  2J7I A;  2J6O A;  2FPF A;  3L2Z A;  3A8H B;  4HVV A;  4M77 B;  3E2U A;  3VS0 A;  3OMC A;  5IAY A;  1OZ3 A;  1QLY A;  2CS7 A;  5KH6 A;  1JB0 E;  3S3N A;  4UC4 A;  3JCM Q;  4M7A D;  2D0Q B;  1K1Z A;  4M7D B;  1V29 B;  2KK4 A;  2DAQ A;  3PGG A;  2QA4 T;  1VQK A;  4IIM A;  2B86 A;  5I11 A;  4J9F A;  2M9U A;  3OYN A;  3LH5 A;  2HKQ B;  2X3W D;  1XJW B;  2MMP A;  5GAN f;  1KSW A;  4LDY A;  4RCC A;  4IIO A;  2EJ9 A;  1VQ7 Q;  1NEG A;  2HKN A;  5IXF A;  1IB8 A;  4QVZ A;  3G1J A;  2JW4 A;  3EGU A;  2LNH B;  5LJ5 g;  3P8H A;  2F2W A;  2LMJ A;  3QDF A;  1G8X A;  2DZC A;  5A0L A;  2AZS A;  1QCO A;  3CME A;  1RAI B;  1G3T A;  4C8Q E;  1YWP A;  4E7H A;  1VQO T;  3ZEH A;  2FL7 A;  1NPR A;  4RTY A;  2EWN A;  3CCE A;  4JRP A;  2BIV A;  2K2V A;  4M78 G;  4FYW B;  2OAW A;  1RAH B;  1ZA1 B;  3HFO A;  2XMF A;  3X28 B;  4RTT A;  4OMQ A;  3HP9 A;  2JMC A;  3N5B B;  5CQX A;  1S72 T;  1YIT Q;  1KQ2 A;  4R56 A;  4A4F A;  4PJJ A;  1WYX A;  1OX9 A;  2DA9 A;  1KD1 C;  4DBF A;  4PFP A;  1WA7 A;  3RR6 A;  3H8Z A;  2KBT A;  3CCS A;  1UTI A;  4Y28 E;  4A4E A;  2P0P A;  4LDU A;  1JRI A;  3G6E A;  1NEB A;  3PMI A;  3EG3 A;  2NUT A;  3RIR A;  4M77 G;  4LDV A;  2E41 A;  1A0N B;  1VIF A;  1T0J A;  2K7A A;  3P8D A;  3HPW A;  3ME9 A;  2HMA A;  4KH1 B;  3CCV A;  2E5K A;  5LJ3 f;  1QVF S;  1H3H A;  3NTH A;  2K6D A;  2LCC A;  2LDM A;  2K3B A;  3EFS A;  1D3B A;  2GNC A;  4RTW A;  1Q82 C;  4EIK A;  3RDV A;  2RK2 A;  2DMO A;  1OQK A;  3EHR A;  4PKC C;  2DE0 X;  1KK7 A;  4C0D B;  4AFU C;  2XK0 A;  1W1F A;  2C0O A;  5FRN A;  3QG1 A;  1U3O A;  3M4Y A;  1X6B A;  2JTM A;  4PJO E;  2LJ0 A;  2AKK A;  3CPW P;  4C8Q F;  1IRE B;  1QVF A;  3CQT A;  3JAM E;  2DBM A;  4A4K A;  1NBE B;  2NUT B;  5GMK l;  1YWO A;  2KI7 A;  4FYY B;  1IZ6 A;  5GAM j;  2OX7 A;  3AT1 B;  3NGP A;  3ER0 A;  1YNZ A;  1N9R A;  2PTK A;  1BI2 A;  2L5Q A;  2GFU A;  4KGX B;  5D6W A;  5KE3 A;  4M75 E;  3MEA A;  4XQ3 A;  1D3B B;  1M3C A;  3E1S A;  3EG9 A;  2LQK A;  2YUQ A;  3UT1 A;  1ZUU A;  2MAM A;  1U8R A;  3MPU B;  2DVE A;  2P84 A;  5EG2 A;  3CCU A;  1UDL A;  4FU6 A;  2PZ1 A;  1OPL A;  5L8R E;  2O31 A;  2LJ1 A;  4C5E A;  1NPP A;  5GAM d;  3BFM A;  1B34 A;  2KRM A;  2HD0 A;  1GCP A;  4ZN3 A;  2V1R A;  2LRQ A;  2EPD A;  2ED0 A;  5KCO A;  1UEC A;  3JCM c;  3OYL A;  3GNG A;  4JZ3 A;  3HTR A;  4K11 A;  5HCK A;  5CQY A;  1VQ6 T;  2RI2 A;  3GIB A;  3CCR A;  3MJX A;  3GOX A;  1IGQ A;  5EC7 A;  2AKL A;  4D6W A;  4RTX A;  1NYF A;  2LQW A;  1XNI A;  3CEY A;  3EFO A;  3EG9 B;  4BY6 B;  2VWF A;  5CR2 A;  3I56 A;  3LGL A;  3AHU A;  1QWE A;  4C8Q G;  3VRZ A;  1T3S A;  1G5V A;  2FG0 A;  1UEB A;  2DKG A;  2L3P A;  4OMF B;  3RBB B;  1VQ8 A;  4PJO F;  1Q7Y U;  3TVT A;  2VUB A;  1B34 B;  4AFS C;  1UFF A;  3HSB A;  3OYA A;  2RF0 A;  1KQS P;  5KYN A;  4KGV B;  2OTL T;  2BZ8 A;  4ELY C;  4M7A E;  1M90 C;  4CRI A;  3MEU A;  3CCE Q;  5D7U A;  2LT4 A;  1WIE A;  3CCQ T;  1RAG B;  2E10 A;  1BIA A;  4JDS A;  2DXT A;  1NG2 A;  3EFO B;  3CC4 A;  1OI1 A;  4J9C A;  3VU3 C;  2EJG A;  4E2F B;  4LN2 A;  1M1K C;  2JJ9 A;  3L2R A;  2G6F X;  1PD1 A;  2E3H A;  5I2S A;  2RI5 A;  1OEB A;  1UG1 A;  4NL3 A;  2RHU A;  3EGX A;  1I81 A;  3J7A F;  3CCS Q;  1W2B P;  3CC7 A;  3G6E Q;  5GAO l;  1JJ2 A;  2HNI A;  2X9H A;  3OS5 A;  5GMK h;  1D0Z A;  1WXU A;  4ZNX A;  3MET A;  1BBZ A;  1PRM C;  1YJ9 A;  1Q7Y R;  3QII A;  1S1N A;  3CCV Q;  2WSC E;  3UAT A;  2X4Y A;  2FEI A;  4PJO G;  3I55 T;  1WZO A;  4N4H A;  5CKE A;  2VGN A;  2EQM A;  1OU8 A;  3OYY A;  3JCM P;  1E6G A;  4LDW A;  2YSQ A;  1GFC A;  2RHY A;  4AMC A;  3CCJ T;  2QA4 Q;  4OF1 A;  4PJM A;  2CKK A;  2RQR A;  1KD1 U;  3EGX B;  5CIU A;  4FYX B;  3OYB A;  4M7D D;  1WJQ A;  3QJY A;  3RKW A;  1SEM A;  4OB3 B;  4O5V A;  4M75 G;  4M7A F;  1X27 A;  4RMO A;  3H6Z A;  4PLL A;  2FB7 A;  1UGQ B;  3WXM B;  4HT9 A;  4JRK A;  3SDZ A;  3BY7 A;  1I07 A;  1R0B G;  3RES A;  2EQJ A;  1SSH A;  3A8M B;  4F16 A;  3GNF B;  4BI3 A;  2QEX T;  3S3O A;  5J3B A;  1AHJ B;  1AOJ A;  3FC3 A;  2DD4 A;  2AIR B;  2RA2 A;  2CP3 A;  1RAD B;  2KY9 A;  1XOV A;  1S72 Q;  2DFU A;  1W6X A;  1QP3 A;  4F7U A;  4AT1 B;  5GMK j;  4Y92 A;  3DB4 A;  2QXF A;  1MNE A;  4Z88 A;  5GAN 2;  4BB7 A;  1VQM T;  3URG A;  2XD0 A;  1I5L A;  1RI0 A;  1QQJ A;  3NFC A;  4JJD A;  1KD1 R;  3CC2 A;  5A2Q E;  2M0O A;  2DXB A;  3X26 B;  2PVD B;  2L3R A;  2X51 A;  5CKF A;  2DLP A;  3I56 Q;  3L2V A;  4PFO A;  3THK A;  1RAB B;  3QHS A;  3JB9 H;  1X2K A;  1Q81 U;  2EYW A;  1YJW T;  1VQ9 T;  1WPY A;  1ZSZ C;  4M7A G;  1PWT A;  2Y4Y A;  5LJ5 e;  1RUW A;  3LGF A;  1OPK A;  3M0Q A;  3VYG A;  4BAC A;  2PUK B;  4F7U B;  1M8V A;  2J06 A;  3CMA T;  1QVG S;  1ZX6 A;  2YWW A;  4XK8 E;  1RLQ C;  1C1A A;  1Y71 A;  1GBR A;  1MND A;  4E7I A;  3EH2 A;  4LUE A;  1Q82 R;  2K5F A;  1MMD A;  1VQL A;  2VV5 A;  1ABO A;  2RQW A;  1VQN T;  1AWJ A;  2DYI A;  2GF7 A;  1WJS A;  4CC4 B;  1VQ7 A;  2D1X A;  3JSC A;  4AFQ C;  4FT4 A;  2QQA A;  2EQI A;  4C0Z A;  1KC8 U;  2KR3 A;  1BK2 A;  4GLK A;  5GAO r;  2QI2 A;  5GMK m;  3JCM b;  3MP8 A;  3OYI A;  1NYG A;  5GAM f;  4B6M A;  1N6A A;  2E6Z A;  4QVC A;  1M27 C;  3A8O B;  1LCK A;  1TUG B;  4KGZ B;  3CC7 Q;  2AHJ B;  1D0Y A;  2KYM A;  3KXT A;  3TQ7 P;  1Q81 R;  4OB1 B;  1PC0 A;  1JO8 A;  2A36 A;  4J9B A;  5GAN 4;  4E7K A;  1MV3 A;  3JB9 D;  1YJ9 Q;  5FU6 C;  4DOW A;  1M90 U;  3CD6 T;  1D09 B;  3VUZ A;  1EX4 A;  3QYH B;  4WTO B;  5KYX A;  2K9G A;  5IN1 A;  3TEE A;  3VS4 A;  2CT3 A;  4KT0 E;  2ED1 A;  4WF2 A;  2DRK A;  1X01 A;  1D1C A;  1M1K U;  3ULR B;  4ZTF A;  3QJ6 A;  1ZBJ A;  2L3Q A;  2LTO A;  3QBY A;  5KCH A;  2ZPH B;  1YN8 A;  2LCS A;  3G4S A;  4FCY A;  2X4J A;  3MEW A;  3CCL A;  4BE0 A;  1ZA2 B;  1K4U S;  4OML A;  1M2O A;  4OVA A;  1R77 A;  1P92 A;  1B07 A;  1Q95 G;  1KC8 R;  4NS5 A;  2JS2 A;  4FW2 A;  2CZ1 B;  3G7Z A;  4ORZ A;  1M1F A;  5AT1 B;  3ZBD A;  2QQ9 A;  2JMA A;  3MP1 A;  5KYX B;  3QWX X;  6AT1 B;  1MMA A;  1VQP A;  1UGP B;  4M77 E;  1VQ4 T;  2X4W A;  2CUD A;  4X9C A;  3PFS A;  2GFA A;  4J6X A;  3UA7 A;  1U1T A;  3CCQ Q;  1BB9 A;  4N4I A;  2DPP B;  2KT8 A;  4M7D E;  1M90 R;  2E64 A;  3X25 B;  2I2L A;  2BE9 B;  2DBK A;  2QTX A;  1E7O A;  1M9S A;  2KRN A;  4FL6 A;  1PRL C;  1QP2 A;  1WHM A;  1UGV A;  1ZSZ A;  2XKO C;  2ZCF B;  2YUP A;  4DQ2 A;  4JJB A;  1M1K R;  2A08 A;  3C94 A;  3RER A;  4C5G A;  2MI6 A;  5LL6 S;  2ESW A;  3CC2 Q;  2QQS A;  2KYB A;  4MZT A;  2QDY B;  4FW1 A;  5KYU A;  5GAN g;  1K0X A;  2DJQ A;  1OZ2 A;  2DD5 A;  3M4G A;  4Q5W A;  2R58 A;  2ZPG B;  2RQT A;  2LCL A;  1D1B A;  5FW9 A;  3OYF A;  4PL6 A;  2EQK A;  1G3W A;  2JTE A; 
#chains in the Genus database with same CATH homology
 1ZSG A;  4F14 A;  2LJ3 A;  1UJ0 A;  1E6H A;  1YWO A;  2ECZ A;  2PNI A;  3NGP A;  4WCI A;  1UUE A;  1YNZ A;  1CKA A;  2EGE A;  1M3B A;  2GTO A;  2PTK A;  3IQL A;  2EYZ A;  2KNB B;  1PKT A;  4A63 B;  1M3C A;  2CH4 A;  2FPD A;  2YUQ A;  2FRY A;  1PHT A;  2AK5 A;  3H0F A;  1OOT A;  1ZUU A;  2EGC A;  2GGR A;  1UDL A;  1AEY A;  2PZ1 A;  4RTV A;  5IHN A;  1OPL A;  2O31 A;  4J9H A;  2LJ1 A;  1HJD A;  2CDT A;  2O9S A;  3ZL7 C;  2EBP A;  1K76 A;  1VYV A;  1GCQ A;  2KRM A;  2KEA A;  2EGA A;  2KRS A;  1GCP A;  1QWF A;  2V1R A;  1M8M A;  2CRE A;  4QT7 A;  2EPD A;  2OJ2 A;  2ED0 A;  1PKS A;  1UEC A;  1T0H A;  2SEM A;  1JEG A;  3H41 A;  4JZ3 A;  1X6G A;  4K11 A;  5HCK A;  2O88 A;  4GBQ A;  3R6N A;  5EC7 A;  1KFZ A;  2AKL A;  2C0I A;  2EYY A;  1TUC A;  1X43 A;  4RTX A;  1NYF A;  1J3T A;  2DL7 A;  2LQW A;  3EG0 A;  2MOX A;  2VWF A;  1AD5 A;  3NMZ C;  2K79 A;  1QWE A;  3VS7 A;  3VRZ A;  1AZG B;  1T3S A;  2FG0 A;  2J6F A;  3U23 A;  1T3L A;  4LNP A;  2CSQ A;  2L3P A;  1Y0M A;  3RBB B;  4AG2 C;  5FWC A;  1WX6 A;  3TVT A;  2JT4 A;  1X2Q A;  2NUZ A;  1GL5 A;  4AFS C;  1HD3 A;  3A98 A;  4LUD A;  1UFF A;  2RF0 A;  3TSW A;  1WDX A;  2JS0 A;  4J9E A;  1Z9Q A;  1JXO A;  4OMN A;  2BZ8 A;  2KXC A;  3NPF A;  5GJV B;  1I1J A;  2QDL A;  1SRL A;  4FSS A;  1WIE A;  2DL5 A;  5FWB A;  1CKB A;  1NG2 A;  2DIL A;  1AWO A;  3H0I A;  2RMO A;  4J9C A;  4HCK A;  4LN2 A;  1SHG A;  4OMP A;  3VS1 A;  2CUB A;  1OV3 A;  2G6F X;  3EG1 A;  2ABL A;  1MV0 B;  4RTZ A;  1OEB A;  2RQV A;  1UG1 A;  2CH4 W;  2I0N A;  1IO6 A;  2RPN A;  3M0S A;  4AFZ C;  4Z8A A;  2FPE A;  4CC7 A;  1YCS B;  2J05 A;  4DEY A;  2JM8 A;  2L2P A;  1QKW A;  5L23 A;  2JM9 A;  4X1V A;  1JU5 C;  1X69 A;  1WXU A;  4J9G A;  4ZNX A;  3I9Q A;  3H0H A;  3GBQ A;  1BBZ A;  1PRM C;  1UHC A;  2LZ6 B;  1ARK A;  2A37 A;  2L3S A;  2HCK A;  1M3A A;  1S1N A;  1U5S A;  2HEQ A;  1VA7 A;  3REA B;  3UAT A;  2FEI A;  2GQI A;  1NLO C;  3VS5 A;  4GLM A;  2MIO A;  1E6G A;  1AWX A;  2YSQ A;  1WLP B;  2HSP A;  1GFC A;  3VRY A;  1GRI A;  2L0A A;  1WXB A;  2RQR A;  1QCF A;  1U06 A;  2KT1 A;  2JXB A;  4F17 A;  4HXJ A;  2DVJ A;  3M0T A;  1SEM A;  4J9D A;  2ROL A;  2X3X D;  1X27 A;  5GJW B;  3VS6 A;  5IHI A;  1H8K A;  2W0Z A;  2O2O A;  2DL4 A;  1I07 A;  2FO0 A;  1GFD A;  4J9I A;  2RQU A;  1TG0 A;  1Z9Z A;  3C0C A;  3EHQ A;  1K0S A;  1SSH A;  1CSK A;  4F16 A;  2F2V A;  2ROT A;  2BZY A;  3NHN A;  4DEX A;  4Z89 A;  1JQQ A;  1AWW A;  2EVR A;  3TSZ A;  1M30 A;  3VS3 A;  2IIM A;  2NWM A;  1AOJ A;  1H92 A;  3SEM A;  2J6K A;  1GBQ A;  2DL8 A;  2EKH A;  4HVU A;  1XOV A;  4JPB W;  1N5Z A;  1W6X A;  3FJ5 A;  3M0U A;  4D8D A;  2RN8 A;  1WFW A;  4Y92 A;  4Z88 A;  4M4Z A;  1ZUK A;  2FRW A;  1UJY A;  1VYU A;  2DNU A;  3I5R A;  1WI7 A;  2SRC A;  4JJD A;  2KXD A;  1KJW A;  2RNA A;  2DRM A;  1K9A A;  2DLP A;  3UA6 A;  1G83 A;  2W10 A;  3THK A;  2DM1 A;  3M0P A;  1X2K A;  5I22 A;  1VYT A;  2EYW A;  4KRT A;  2LP5 A;  1PWT A;  2V1Q A;  3QWY A;  1WXT A;  2D8H A;  1YP5 A;  1RUW A;  1OPK A;  2M0Y A;  2EYX A;  3M0Q A;  1NLP C;  2YUN A;  2D8J A;  1HSQ A;  3EG2 A;  3RNJ A;  2J06 A;  1BU1 A;  2YUO A;  1ZLM A;  1ZX6 A;  1QKX A;  1RLQ C;  1GBR A;  3KFV A;  2A28 A;  2M51 A;  4E6R A;  1UE9 A;  2YT6 A;  4LUE A;  1TUD A;  2KE9 A;  2LX7 A;  1FMK A;  1RI9 A;  2F2X A;  3O5Z A;  1ABO A;  2RQW A;  3M0R A;  2BZX A;  1AWJ A;  2DF6 A;  3PVQ A;  2MCN A;  4OMO A;  4CC4 B;  2VVK A;  1FYN A;  2D1X A;  2YDL A;  4AFQ C;  1AVZ C;  2EQI A;  2KR3 A;  1BK2 A;  4R0K A;  2J7I A;  2J6O A;  2FPF A;  2KRO A;  1NYG A;  4HVV A;  5ECA A;  4CC2 A;  3VS0 A;  2K2M A;  1MUZ A;  1M27 C;  1QLY A;  1LCK A;  2H8H A;  2HDA A;  1K1Z A;  1EFN A;  2KYM A;  1AZE A;  3JV3 A;  1JO8 A;  2A36 A;  1JXM A;  4J9B A;  2B86 A;  4IIM A;  2CSI A;  3PE0 A;  1MV3 A;  4J9F A;  4JJC A;  5I11 A;  3VS2 A;  5IXB A;  3LH5 A;  2X3W D;  1KSW A;  4IIO A;  4HVW A;  1NEG A;  4RUG A;  1GCQ C;  2K9G A;  2AZV A;  5IXF A;  3VS4 A;  2JW4 A;  3PVL A;  3EGU A;  2CT3 A;  2LNH B;  2ED1 A;  5IHK A;  4D8K A;  2DRK A;  1W70 A;  2F2W A;  3REB B;  2LMJ A;  3ULR B;  1ZBJ A;  2P4R A;  2L3Q A;  2LQN A;  2AZS A;  1YN8 A;  2LCS A;  1YWP A;  2C0T A;  2DL3 A;  1ABQ A;  1K4U S;  2OI3 A;  4OML A;  4RTY A;  1B07 A;  4LE9 A;  2VKN A;  4ESR A;  3I5S A;  2KGT A;  2OAW A;  2JS2 A;  2XMF A;  1G2B A;  4RTT A;  4OMQ A;  4ORZ A;  1UHF A;  2JMC A;  1NM7 A;  2HBW A;  2JMA A;  1PNJ A;  3QWX X;  2DX1 A;  4OMM A;  1WYX A;  2DA9 A;  2EW3 A;  1SRM A;  2CUD A;  1RLP C;  1WA7 A;  3UA7 A;  1B3Q A;  2KBT A;  1BB9 A;  1UTI A;  2ENM A;  4RTU A;  2KT8 A;  3UF4 A;  1V1C A;  2GTJ A;  1SPK A;  1NEB A;  2GBQ A;  3EG3 A;  2DBK A;  1ZUY A;  1E7O A;  2KRN A;  1KIK A;  1PRL C;  1A0N B;  1UGV A;  4JZ4 A;  2YUP A;  1T0J A;  2K7A A;  4CC3 A;  4JJB A;  2A08 A;  2E5K A;  1I0C A;  3SHW A;  1H3H A;  2D0N A;  2K6D A;  2K3B A;  2ESW A;  2KYB A;  2GNC A;  4RTW A;  4EIK A;  1K0X A;  2DMO A;  4AG1 C;  2DJQ A;  2BTT A;  3EHR A;  2CT4 A;  2DE0 X;  2O9V A;  1SHF A;  4AFU C;  1W1F A;  2C0O A;  1U3O A;  1Y57 A;  2RQT A;  1X6B A;  2LJ0 A;  2AKK A;  2DYB A;  5IH2 A;  3I35 A;  3CQT A;  5FW9 A;  2DBM A;  2JTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...