5EC7A

Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 5.0
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 12
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ec7A00
1AWWA 4LUEA 1QKWA 4F16A 4RTYA 3VS5A 4AFUC 1YWPA 2K2MA 1HSQA 1H92A 1SEMA 4HVWA 1Z9QA 2GBQA 2GTOA 4J9IA 4RTWA 2DF6A 2A28A 1UFFA 2D8HA 2VVKA 4JJCA 1V1CA 2KT1A 5GJWB 3SHWA 1K0XA 1VYUA 2RQUA 3SEMA 2LJ0A 2DM1A 2X3WD 2VKNA 1K0SA 3VRZA 1GCPA 1T0HA 2F2XA 2DL4A 5IHNA 4ESRA 1WA7A 5IXBA 1H8KA 2CSQA 2DL3A 1ZUYA 1GL5A 1QWFA 2EKHA 1AD5A 2RQWA 2YDLA 1RLQC 2LCSA 2EYZA 3UA6A 2FPFA 4AG2C 1AVZC 4IIOA 2YSQA 1JXOA 4CC4B 2SRCA 5EC7A 1K1ZA 2EVRA 1AWOA 2P4RA 2ED1A 1GBRA 3NHNA 4F17A 2J6FA 2L3SA 2KRSA 2X3XD 2KEAA 4GLMA 3M0UA 5ECAA 1X69A 1KSWA 1UDLA 4AFQC 1UHCA 2LMJA 3VS1A 1WXUA 2GNCA 2DNUA 1PRMC 2C0OA 1ZUKA 2AZSA 2FEIA 1X43A 3H41A 2H8HA 3PVQA 1ABOA 1NG2A 2A36A 3ZL7C 1ZUUA 3UA7A 2RQRA 1OOTA 1U5SA 1QWEA 2MOXA 1A0NB 3PE0A 2D8JA 2F2VA 3KFVA 1HD3A 2J7IA 1AZEA 5HCKA 1OV3A 1T3SA 1X6GA 4EIKA 1GCQA 4J9CA 5IH2A 3M0RA 2DL5A 1G83A 2FRYA 1UG1A 2BZYA 2O88A 2K6DA 2V1RA 1K9AA 3I5RA 4OMOA 1Y57A 2LQNA 4KRTA 1JQQA 5L23A 3FJ5A 1GFDA 1SRLA 1W1FA 1PRLC 1TUDA 1W70A 3VS0A 1FMKA 1PKSA 3CQTA 3M0TA 2LP5A 2CH4A 2DJQA 2DLPA 4JJDA 3A98A 2BZXA 1X2KA 2EBPA 3REAB 4Z8AA 1NM7A 1SHGA 3M0SA 1J3TA 1VA7A 2HDAA 2JXBA 5I22A 2RMOA 1BBZA 2JMAA 1KIKA 1PWTA 1B3QA 2RQTA 1GBQA 4ORZA 1ARKA 1I1JA 4RTXA 4J9EA 4K11A 4CC2A 2DA9A 2KR3A 2L0AA 1Y0MA 2EYYA 2F2WA 1YN8A 1M3AA 3U23A 2AK5A 2DRMA 3VS2A 4CC7A 5GJVB 4DEXA 2ESWA 1PHTA 1OEBA 2O9VA 1JO8A 2EQIA 2OAWA 1ZX6A 2E5KA 3PVLA 3C0CA 1NEGA 1CSKA 1U3OA 2HCKA 2K79A 2XMFA 2A08A 3QWYA 4HXJA 2JS0A 2JTEA 4IIMA 3GBQA 2YUPA 3TVTA 2CREA 3UF4A 2J6OA 1M3BA 4HVUA 2DMOA 1T0JA 3NPFA 1AEYA 2CT4A 2C0TA 3VRYA 1B07A 4JJBA 1AZGB 4OMPA 1GRIA 1UECA 3VS6A 2B86A 2JT4A 1YP5A 4RTVA 2MCNA 2NUZA 2L2PA 2GTJA 2LQWA 4A63B 1RLPC 1NLOC 1AWJA 2EW3A 1NYGA 2GGRA 1EFNA 3I35A 2YUOA 4RTZA 2AZVA 2D1XA 2PTKA 3EG0A 2ECZA 1IO6A 3EG1A 2VWFA 4GBQA 4AG1C 3THKA 1WXBA 2KYBA 2K9GA 2J06A 2AKKA 4OMMA 4FSSA 2LJ1A 1E6GA 2JM8A 4JZ3A 2O31A 4M4ZA 2KBTA 5FW9A 3RBBB 2EGEA 3QWXX 2HEQA 2KNBB 4AFZC 2KXDA 2I0NA 2KRMA 2EGCA 2KE9A 1N5ZA 2EYXA 2JW4A 1NLPC 5IHIA 1OPKA 4Z89A 2LNHB 2EPDA 2GQIA 1MV3A 2FPEA 1SSHA 1KJWA 1JXMA 1SHFA 1UUEA 2ED0A 1I0CA 2PNIA 4J9DA 2RN8A 2CDTA 1K4US 4HCKA 1AOJA 1WIEA 1YCSB 5I11A 4RTTA 1KFZA 1BU1A 2L3QA 4X1VA 4J9BA 1QKXA 1PKTA 4ZNXA 2KXCA 2HBWA 1YNZA 1I07A 3VS4A 2LJ3A 1ZSGA 3O5ZA 3M0QA 3ULRB 2ROTA 3M0PA 2D0NA 2G6FX 2L3PA 4OMQA 4DEYA 2W0ZA 2IIMA 1WFWA 1JU5C 2O2OA 2ENMA 2W10A 4F14A 1VYVA 3I9QA 2QDLA 2LZ6B 3H0HA 4RTUA 3VS7A 2DL7A 2M0YA 2MIOA 1UJ0A 2ABLA 1CKAA 2KT8A 1ZBJA 2EYWA 1MV0B 1UTIA 3EGUA 2CH4W 4QT7A 3UATA 4J9FA 1WI7A 3NMZC 2FPDA 4HVVA 5FWCA 1GFCA 2V1QA 4J9HA 2HSPA 1AWXA 2DILA 1M8MA 1E6HA 1ZLMA 1TG0A 1RI9A 1WXTA 2FO0A 5IHKA 2DBKA 3EG3A 4Z88A 2KYMA 4CC3A 2OI3A 1CKBA 4Y92A 2EGAA 2KGTA 4JZ4A 2OJ2A 2K3BA 2CUBA 3NGPA 2PZ1A 2RNAA 2KRNA 1Z9ZA 2RPNA 1M30A 1OPLA 4JPBW 1BB9A 3TSWA 1WYXA 3JV3A 3RNJA 1NYFA 4D8DA 2KROA 1NEBA 2CSIA 2SEMA 2O9SA 4LE9A 3REBB 1WX6A 2DL8A 2AKLA 2NWMA 1G2BA 3EG2A 1X6BA 4OMNA 1T3LA 1WLPB 2DBMA 2JMCA 3H0IA 2RQVA 1GCQC 2YUQA 2A37A 2FRWA 3VS3A 3R6NA 3EHQA 2DYBA 2ROLA 4RUGA 1SRMA 1UE9A 1MUZA 2DE0X 2JM9A 2DVJA 1BK2A 1UHFA 1PNJA 2FG0A 1LCKA 1ABQA 4D8KA 1FYNA 2RF0A 1S1NA 1SPKA 3H0FA 4E6RA 2BZ8A 4R0KA 3TSZA 1VYTA 3I5SA 4LN2A 1QCFA 1TUCA 2CUDA 4LUDA 1M27C 2LX7A 1RUWA 2CT3A 1M3CA 5IXFA 1H3HA 1E7OA 2DX1A 2C0IA 4AFSC 2K7AA 1JEGA 4LNPA 1HJDA 3IQLA 4OMLA 5FWBA 2JS2A 1X2QA 2DRKA 2J6KA 1UGVA 1K76A 3EHRA 1QLYA 1WDXA 2YUNA 1XOVA 1U06A 2YT6A 3LH5A 4WCIA 4J9GA 1UJYA 2BTTA 2J05A 1X27A 1W6XA 1YWOA 2M51A
chains in the Genus database with same CATH superfamily
1UGPB 1B7TA 5KCHA 4RMOA 1H92A 1WQWA 1S72T 4M78A 4R55A 3OYLA 4F7UB 1K9MU 2DF6A 1VQPT 2RJDA 2D8HA 2ZGWA 1TH7A 2DTIA 5C6SA 5GAN3 3A8MB 3PIOA 3SHWA 2L5QA 1MHNA 4A4EA 3SEMA 3JCMg 5IXBA 3CCRT 1H8KA 2CSQA 2RHXA 3LWIA 4Y91A 4E7ZA 4C5HA 4M7AD 3CMEA 2YDLA 2LCSA 4E2FB 4F7UE 3UA6A 4XU3A 9ATCB 4NL3A 1YI2Q 2BE9B 3S3MA 2ED1A 1D3BA 3L2UA 2J6FA 2L3SA 2X3XD 4GLMA 4OMFB 5CAIA 3G6EQ 3FLGA 2FZGB 5CCAA 3PGGA 3QYGB 1PM3A 3S3OA 2DNUA 2OTLQ 2VGNA 1PRMC 3HRUA 2RI2A 1VQ7T 4XTYA 4KUDK 4J6YA 2NUTA 2AZSA 2LTOA 1YIJA 2ZCFB 1W2BA 4C8QE 3CC7A 4JLIA 1D1AA 1X43A 3INZA 1TS9A 2OX7A 1BI1A 5KYXA 3PVQA 2ZPIB 1ABOA 1NG2A 2E6NA 2RQRA 1U5SA 4JUVA 1RACB 2MOXA 3CPWA 1A0NB 1X6OA 2D8JA 2DEQA 2F2VA 1OU8A 1VQ8Q 3OY9A 2CZ7B 1WJRA 4JS4A 3OYBA 2J7IA 4E7SA 1AZEA 5HCKA 2F69A 1X75C 4EIKA 4J9CA 5IH2A 2QEXA 5CVIA 4NS5A 1RAEB 5GAN6 5LJ3j 2BZYA 5HY6A 4FIBA 1G8XA 5I2MA 3CXCA 1Y57A 1KD1U 1BIAA 2FL7A 2KI7A 4PJOG 5KYWB 4M77B 1SRLA 3CCMQ 2CZ0B 3QJ6A 5IN1A 1VQMA 3CQTA 3OS2A 2LP5A 2ZPFB 2CH4A 3QXEB 2KK4A 1IHWA 1TXQA 2EJ9A 3REAB 1NM7A 3FDRA 5CIUA 4GLKA 1J3TA 1KIKA 8AT1B 2RMOA 2JMAA 3QZ9B 3QPHA 2K4YA 4RTXA 4J9EA 1VQ4Q 3VV0A 1M5Q1 2KY9A 4IURA 2HNIA 3EGDA 2KR3A 3C95A 1TSFA 1D09B 4E7LA 2CZ6B 4PJOC 3C4SA 4IUUA 3SWNA 3G71Q 5GAMf 1G3YA 1YN8A 3EH1A 2RK2A 1S72Q 3X28B 2AK5A 3VS2A 1XJWB 2VXFA 3CCSA 2O9VA 1JO8A 3EFOB 1Q81U 3GF5A 1VQPQ 3J81E 1U3OA 1CSKA 1IREB 3QWYA 4MMKA 2JTEA 1TUGB 2IG0A 3GBQA 1D1CA 1NPRA 1U1SA 3I55Q 2J6OA 3CCRQ 4PLIA 3CC2T 1T0JA 1NPPA 4F04B 1VQLQ 2QQSA 2WSCE 1VQ6A 2XU8A 3QYHB 1VQKT 3CBMA 1AZGB 4M75D 2B86A 5GAOr 3CCJA 1YP5A 3CPWP 4ATOA 2LQWA 1LJOA 2QA4A 2EW3A 2JTMA 4XTUA 2X4YA 3I35A 4C0DB 3V8KA 5GMKi 2EWNA 2MI6A 1VQ7Q 2VYTA 3EG1A 4OB0B 5GAOq 4HKEA 4M78G 3ER0A 3PMTA 4EMGA 5DLQE 5GANh 4BI8B 3OYMA 4BUGA 2LJ1A 4YTLA 4PKCC 5D6WA 2EGEA 2HEQA 3JRZA 2PUKB 3N5BB 2KE9A 1BCOA 1N5ZA 2EYXA 2JW4A 5DY9A 3META 2EQJA 4J5YA 3JB9G 3RKXA 1K73U 3LGFA 2PNIA 3CCLA 3CD6T 1FWZA 5FLXE 2LRQA 3M56A 4OGCA 1RL2A 2MWPA 2RN8A 1K4US 4C92E 4DQ2A 4HCKA 2M9UA 2DTHA 2CGHA 1M2OA 1KFZA 3LH0A 3G1JA 4M78C 1N27A 3OYYA 4J9BA 3A5ZB 3WVEB 1PKTA 3CCUQ 4ZNXA 3DLLA 2HBWA 1YNZA 4RG8A 3VS4A 3MP6A 1WQ7A 5GMKl 5GAN4 4C8QD 3M0PA 3HFNA 4OMQA 4DEYA 3JCMc 3L42A 5A2QE 1M4ZA 1O75A 2W10A 4F14A 3I9QA 4NOYA 5LJ3d 2ZAEA 4PJOF 3VKIA 3H0HA 3CC4A 4RTUA 4BE2A 1N8RU 3OMGA 3MEVA 3JCMJ 1CKAA 2KT8A 3CCET 2EYWA 1MV0B 1LPLA 3L1AA 2RI3A 1C6VX 1WI7A 1MMNA 3NMZC 2OTJA 4HVVA 1G3SA 1AHJB 5FU7B 2VUBA 3OB9A 2MPXC 1E6HA 1TG0A 2FO0A 3CMAA 1AT1B 1YBYA 1RI0A 1KC8C 1RAAB 3MEAA 2HMAA 1NJIU 1Q86C 2OJ2A 4XTVA 1IZ6A 4XAXB 2RPNA 4HT8A 4BI4A 1BB9A 4BY6B 3RNJA 4OF1A 3A8OB 2SEMA 1PSEA 1TWBA 3REBB 1WHMA 5FRNA 4KGVB 2QAZA 2AKLA 1N6AA 5HKCA 4C0ZA 1T3LA 2E4HA 4M7AB 2JMCA 3H0IA 2RQVA 1BKBA 2CP3A 5GAOn 4E47A 1WHGA 1FX7A 3M59A 4P5NA 3UT1A 1UE9A 3QIIA 2JM9A 3OYJA 1BK2A 1UHFA 2K2VA 3JB9D 3VYHB 2MK5A 2RF0A 1ZQ1A 4DOVA 1TTHB 1M2VB 4R0KA 3TSZA 1VYTA 4Z02A 1XQHA 2RHIA 2LX7A 1JJ2P 2EJGA 4M7DA 1KHCA 1VUBA 3QDFA 4PJMA 2QQRA 2C0IA 5CKDA 1R0CB 2E3HA 1VQ9Q 1JEGA 4OMLA 5FWBA 2JS2A 4M78F 1PG5B 3E2UA 2DFUA 3P8BB 3EGXA 1QLYA 4FSXA 2ZPHB 1C1AA 2M02A 5I2SA 5J3BA 2VV5A 3HP9A 1N9RA 4MDWA 1UJYA 2BTTA 2J05A 3SWNC 3L2ZA 2M51A 1D0XA 3OYIA 4RTYA 4AFUC 1Y96B 2K2MA 1HSQA 1SEMA 2E64A 3HKSA 5CO7A 2DPPB 1Z9QA 2GBQA 2GTOA 4RTWA 2E12A 3JB9F 4AMCA 1YITT 1UFFA 2VVKA 4JJCA 3CCQQ 2KT1A 1I4K1 5LJ5j 2LQKA 1G5VA 4FU6A 2QDYB 1YI2T 2DM1A 1TU0B 1RAFB 1T0HA 4ZTFA 2DL4A 4E7HA 4QVCA 1WA7A 4C0FA 1ZUYA 1GL5A 3CCEQ 1ZSZC 2K3XA 1RLQC 5GAN2 3FB9A 2OTLT 4C92D 2ZPBB 3A8HB 4ZN1A 3J7AF 1AWOA 3BFMA 1VQOQ 2EFIA 2KRSA 2KEAA 5ECAA 2KAFA 3OA6A 1KQ2A 3OYNA 2QASA 3ZEHA 1X69A 1UHCA 2LMJA 1M1KR 1I5LA 1WXUA 4L6V5 1LVKA 4XTWA 2C0OA 1ZUKA 1BI3A 4KH1B 2AHJB 1F1BB 2LT1A 2CKKA 4BE1A 2YWWA 2QQAA 2H8HA 3ZL7C 1ZUUA 3GNGA 2PQWA 3UA7A 1OOTA 2X9HA 3PE0A 1YCYA 1KK7A 2X4XA 4RG2A 5GAMg 1HD3A 2YXYA 1KD1R 3RUXA 4M75B 2RHUA 3OS1A 1C0MA 2LX9A 4XK8E 3E1SA 4LDYA 3UDCA 3LW5E 5LJ3f 3NFCA 2DL5A 1G83A 2FRYA 4PFZA 1UG1A 4A54A 2QTXA 3I5RA 4XTZA 4OMOA 2HL5C 2LQNA 4KRTA 1JQQA 1GFDA 1PRLC 1WZOA 2LVMA 2XD0A 4FYVB 3E19A 2VB6A 1PKSA 5CR2A 2CP5A 2DJQA 3HPWA 3A98A 4AT1B 2BZXA 2EBPA 6AT1B 4C5EA 1Y07A 5GMKe 3G71T 5CQYA 3I56A 1VQKA 1D0YA 5I22A 1BBZA 4X9DA 2FYKA 1B3QA 2CP7A 3CCJQ 1ARKA 1Q81R 1MMAA 5M9OA 1YJ9Q 2DA9A 2L0AA 5D6YA 3JCMd 1Y0MA 2NYSA 2F2WA 2DXTA 5KH6A 4M77A 3GPLA 3TCJA 2EJFA 2KDSA 5GJVB 2ESWA 4EMKA 2P4TA 1PHTA 3I55T 3G4SA 4LD9K 1EIFA 2M0OA 1VQLT 2E5KA 2C06A 4PJOE 1YITQ 4DBFA 3QUIA 2RJEA 3TQ7P 1NE8A 4KGZB 1NEGA 2K79A 2PVGB 4C8QB 2XMFA 2COWA 2JS0A 1O9SA 2P0PA 1U8RA 2O01E 2QYZA 2CREA 3UF4A 2RI5A 1JRIA 4M7DG 3NPFA 1B34A 2C0TA 2GFAA 5A0LA 2RHZA 1IB8A 4DBRA 1UECA 3VJPA 3VS6A 5GAOl 3CD6A 2MCNA 3JB9J 2LT4A 2GTJA 2Y4XA 1VQ5Q 4A63B 1RLPC 2DTOA 1NLOC 3JCMQ 1NYGA 4JDSA 5LJ5d 2RK1A 3OQ5A 2XIDA 2HQXA 3EFOA 2AZVA 5KYUA 5CKFA 2PTKA 2ECZA 1QVFP 5FU6C 2L89A 1IGQA 1IHVA 4OMMA 2A7YA 4M7DC 4FSSA 3RDVA 3SDZA 1E6GA 2JM8A 1M1GA 4OVAA 1K73R 3QWXX 2HKQB 2KNBB 3BE3A 1QVGS 5J26A 3QO3A 1NLPC 1OPKA 2R58A 4Z89A 3CCUT 1H641 1MV3A 2FPEA 1BIBA 1SSHA 3HHTB 1UUEA 2DD4A 1ACMB 2RHYA 1I0CA 1OYXA 5GMKm 1LOJA 3KXTA 2QG9B 2MAMA 1OZ3A 4J9DA 4XU0A 4KUIA 3G7ZA 1SSFA 2CDTA 1YJWT 3RESA 2E70A 5I11A 1KC8U 2XG8D 2Y90A 3EG9B 1K8AC 2HKNA 3CBPA 4X1VA 5LJ3e 4QQGA 1Q86U 5DM7R 2KXCA 3JCMV 3O5ZA 2WSFE 3M0QA 3BW1A 2ROTA 1KHIA 1N8RR 4XTXA 4M78E 2G6FX 2VGMA 2W0ZA 2IIMA 3PT9A 1RAIB 1WFWA 1JU5C 2GCXA 2E65A 2ENMA 1UGSB 1VYVA 1MNEA 4N4GA 4A4FA 4BDZA 2JJ9A 5GANj 2ZPEB 4ZTJA 3JCMX 3VS7A 2DL7A 2M0YA 3HTRA 2ATCB 1UJ0A 4KT0E 1ZBJA 3EGUA 4QT7A 3UATA 1MMDA 3JCMW 1Q82C 4J7IA 2XHCA 2ZPGB 2HL3A 4JRIA 1NJIR 2OAUA 1YHQA 1AWXA 2HZYA 1W2BP 1M8MA 5C0MA 2DO3A 4DOWA 1WXTA 4PJLA 2V26A 1SG5A 3GOXA 5GANe 2CZ1B 2DBKA 1YJNA 2HSEB 2QK0A 1WJQA 2KYMA 2OI3A 1ZSZA 3D7SB 1CKBA 4IKFA 1QCOA 4Y92A 2EGAA 1X01A 2GFUA 3PIPA 3NGPA 3JB9H 2LCLA 1Z9ZA 4JPBW 1M30A 1WNLA 2CP2A 1NYFA 2KROA 1NEBA 2CSIA 4A4GA 1VQNQ 2O9SA 3EFSA 1OULA 1WX6A 2NWMA 1G2BA 1X6BA 4OMNA 3CXCP 1NBEB 1G3TA 4DBQA 2A37A 4C92B 2DYBA 2QGGA 1UGRB 3VU3C 4JRPA 5LL6S 3JCMb 4M7DF 4A4KA 1MUZA 8ATCB 4J7FA 4PJOD 5I21A 5KYYA 3X26B 4M77G 4D8KA 1VQ9T 1FYNA 1KQSS 1H3ZA 2E10A 1PD1A 3I5SA 1Q7YC 5KE2A 1QCFA 4QW2A 1YI2A 3EGDB 2CP6A 1E7OA 3SWNB 1UGQB 1M90C 2DX1A 4AFSC 1WHJA 3G6EA 4PLLA 1KG1A 4LNPA 1HJDA 1PSFA 4M7AA 2J6KA 2OTLA 1EX4A 5A0GA 1R8OB 3LH5A 2V8IA 2O4XA 4L5GA 1PCXA 4J9GA 1YJWQ 1YIJT 1KQ1A 1W6XA 1YWOA 3CC7T 3CCQT 4M77C 1AWWA 4LUEA 4EMKC 1QKWA 4GY5A 2HBPA 1D1BA 3HFOA 2PU9B 1M2VA 5GAN5 3FRNA 5D6XA 1M1KC 1VQ8A 4LDWA 4BACA 1D0ZA 1OU9A 2RJFA 3HSBA 1V1CA 4ELZC 5LJ5f 1SKUB 4ELYC 2RQUA 4J6WA 2LJ0A 4C5IA 3H6ZA 4FYYB 3OW2S 2VKNA 1K0SA 1VIEA 3VRZA 1GCPA 2F2XA 3GLXA 1VQOT 2X4WA 4HA8A 2DL3A 3GP8A 4F7UF 4JRQA 1QWFA 4MMLA 5LJ3g 3UWNA 1AD5A 3CCMA 2LCCA 2EQMA 2FPFA 4AG2C 1AVZC 2QTVA 4IIOA 2YSQA 2SRCA 5EC7A 4QQ6A 5DLOA 2MMPA 5FRMA 3VUBA 3OYDA 3L2RA 4HT9A 4OP0A 5CQXA 1R0BG 2YRVA 3FJPA 2HQHA 3LX7A 2PVDB 1HXDA 2VC8A 1UDLA 5GANd 2XK0A 3BDUA 3CCVQ 3VS1A 3V7RA 4M78D 1LNXA 4MDXA 3L2WA 1VQ4A 1FMWA 2BKDN 3QSUA 4C5GA 2FEIA 1Y7XA 3NTIA 1TOVA 3G71A 3H41A 1KQSA 1S72A 4M77D 2EAYA 2LC4A 2BE7D 3CCST 2F1LA 4JJNK 5GAMh 1VQPA 4C0DC 3RKWA 3L2VA 1OV3A 1T3SA 3RR6A 2EIFA 3JB9I 4PL6A 5HK3A 3I55A 3CCRA 4JLGA 1VQLA 3V8JA 5FROA 2DD5A 5L23A 3QZ5B 3CMEQ 1VQ6T 2KSSA 5AT1B 2M1HA 4PJNA 3O8VA 4LD6A 3M0TA 2DJZA 5A0DA 2CP0A 3CCJT 1K9MR 4JJDA 3JCMe 1YJ9T 2DZ9A 2E6ZA 4OB3B 3RMSA 4Z8AA 4M77F 3RIRA 1QVFS 1M8VA 1VA7A 2HDAA 2JXBA 2X4JA 4M75A 1VQ7A 3M5AA 1QP3A 1YIJQ 2Z0WA 3A8LB 3C12A 3MJXA 3CC7Q 4K11A 4CC2A 2EYYA 4UC4A 3QBYA 3ME9A 1M3AA 3U23A 2DRMA 4PNOA 4CC7A 4QVDA 1PD0A 4FM4B 2GQVA 2EQIA 2OAWA 2DXCA 1ZX6A 3MP1A 3PVLA 3C0CA 2JTFA 3OSSC 2CS7A 2HCKA 4HXJA 2A08A 3OYEA 5KCOA 1WHKA 4JRKA 3CCLT 3MCAB 2WACA 2XI9A 2QEXQ 3AHUA 1VOMA 1FMVA 1VQ5T 5LJ5e 1M3BA 4HVUA 2DMOA 4N0AA 3V7SA 1NZ9A 4X34A 1AEYA 3CCUA 4F7UA 3VRYA 4E7JA 4Y28E 1B07A 4JJBA 1QVPA 4RCBA 4OMPA 5FU7C 1K8AU 4M7AG 2HD0A 1VQMQ 2JT4A 2NUZA 2L2PA 2NLUA 2V8KA 2V8JA 2NUPB 2DEUA 3F70A 3MP8A 4IUPA 3EG0A 4BI3A 3LWHA 4MZTA 4D6WA 2VWFA 4GBQA 4AG1C 4BY6C 2K5IA 3QHSA 2EKOA 2KYBA 2K9GA 1OX8A 3EGXB 1N8RC 3PMIA 3V8LA 3UPUA 1IXDA 3GIBA 3MKDA 4JZ3A 2O31A 2KBTA 1W2BS 3PTAA 2K3YA 4IUQA 3M9QA 3CCSQ 2EGCA 4LDXA 4M7AC 2MWOA 4M7DE 1KC8R 1Q82U 5IHIA 2I2LA 3CMAT 2LNHB 3M55A 2EPDA 1XTDA 2GQIA 4E7IA 4DA4A 3OYHA 1KJWA 4OB1B 1SHFA 2ED0A 2E41A 2HQEA 3OS5A 4LDUA 1P92A 3CPWS 1IGUA 1I8FA 2XDPA 1UEBA 1WIEA 1AOJA 1WJSA 1YCSB 3CC2A 2P84A 4RTTA 3RMQA 3OYGA 2L3QA 4J83A 1QKXA 3CPFA 2YLBA 1VQ6Q 4PJOB 2XICA 3OBWA 2LJ3A 3TU4K 3CXCS 2D0NA 4FYWB 2P0KA 2E1HA 1UB4A 2QA4Q 1ZBXA 3X20B 1VIFA 3RERA 3P8HA 3AT1B 3JSCA 5GANf 5KYWA 2LZ6B 2QI2A 1RAGB 4R56A 2XDDA 2K57A 3T9NA 2MIOA 2VASA 2DVEA 1UTIA 2JUFA 2CH4W 4EDUA 4J9FA 4OGEA 2Y4YA 3OYCA 2FPDA 3EG9A 2CYZB 1GFCA 1MNDA 2V1QA 2WSEE 2HSPA 3SB2A 3CEYA 2DILA 4C0GA 2YHTA 3X24B 5GAOp 1ZLMA 2FHDA 1Q7YU 4XU2A 1VQ9A 5GMKh 2RH2A 3HL8A 1N9SA 1PC0A 1VQNT 3EG3A 3V7CA 4CC3A 3CCLQ 1M90U 2JZ2A 2KGTA 2K3BA 3MO8A 2CUBA 2PZ1A 2RNAA 4JS5A 1M1FA 1RADB 4ZGDB 4A4HA 3JV3A 3H8ZA 4D8DA 1ZA2B 1QMCA 3MEUA 2DAQA 2GF7A 4LE9A 4TVRA 5KYNA 2EYQA 4M75G 2AIRB 2DKGA 4LDVA 2YUQA 2FRWA 3CCQA 3VS3A 3R6NA 3EHQA 2R5AA 3KUFA 2YLCA 1EZZB 1W4SA 1M1KU 4KBMB 2DVJA 3CC4Q 5LJ5g 1PNJA 1LCKA 2JOYA 1BCMA 3X25B 3H9NA 4FW2A 3CCEA 2DERA 4OB2B 4M7AF 1S1NA 3EAEA 4M78B 2XKOC 4E6RA 5GAN8 4LN2A 2OTJQ 1TUCA 1WHLA 4LUDA 4FT2A 1M27C 2CT3A 2DXUA 1MMGA 4BDYA 1VQOA 5IXFA 4IUTA 4QQDA 3DKMA 4M75C 3CMAQ 3E9FA 4EMKB 1V29B 2VXEA 1HK9A 3OSVA 1UGVA 1K76A 3EHRA 4F7UG 4C92A 2YUNA 4NL2A 1XOVA 3GNFB 1U06A 4WCIA 1WPYA 3SD4A 1XNIA 4B9WA 2B8AA 4F16A 3VS5A 2RD1A 1YWPA 1D3BB 3M4YA 4HVWA 2YRCA 1B34B 4J9IA 4DBHA 4M77E 2A28A 5EG2A 4C8QG 3FEOA 4PFPA 2NUTB 5GJWB 1K0XA 1VYUA 2AT1B 4N0AC 4MZPA 1JJ2S 2JNGA 2HAXA 3LGLA 2X3WD 4WTOB 4M7DD 5IHNA 4ESRA 2PUOB 5KYXB 5KYUB 5LJ3h 3SFMA 3BDLA 2EKHA 2RQWA 4B6MA 3CCVT 2EYZA 2M16A 4CRIA 3CBOA 1G3WA 1JXOA 4CC4B 2F5TX 1K1ZA 2EVRA 2X35A 1Y71A 2P4RA 2KMTA 1I81A 1GBRA 4PFOA 3NHNA 4F17A 3NTKA 3M0UA 2QQBA 4HCZA 4WF2A 4C8QC 1KSWA 4AFQC 3I56T 2GNCA 3A8GB 4EMHA 3DLMA 1YFNA 1MGQA 3L2QA 1QVGA 1YJ9A 3TEEA 2MYSA 1K9MC 4V2SA 3M4GA 2A36A 3S6WA 1QWEA 3MEWA 3G4ST 1BI0A 2EQUA 1YITA 3KFVA 3E9GA 3JCMf 3CMET 4KGXB 2A0FB 1X6GA 4B9XA 1GCQA 2QGFB 4FYXB 2K5LA 3M0RA 3URGA 1QCNA 2O88A 2K6DA 2V1RA 1K9AA 5J39A 3FJ5A 1W1FA 4ZGJB 4M75F 1TUDA 1W70A 3VS0A 3PNWC 2COYA 1FMKA 3HRTA 1M9SA 2DYIA 1VQ5A 2DLPA 1WHHA 2PVOB 3M54A 4Q5WA 1X2KA 1DJ7B 2RJCA 3MPUB 1SHGA 4LXCA 3M0SA 5L8RE 3LLRA 4O5VA 1PWTA 2JN0A 1JJ2A 2RQTA 4FL6A 1GBQA 4ORZA 2D9TA 1I1JA 3DB4A 4FW1A 1ZSZB 3OYFA 2FVUA 2E3IA 1SF9A 2R57A 1HYOA 4X9CA 3A1PA 2QEXT 5GAMj 2DIGA 3BY7A 4DEXA 2LQ8A 1OX9A 2YRDA 1OEBA 2E5QA 3S3NA 2DIQA 4PK4A 2DK3A 4FCYA 1Q95G 1KD1C 4IIMA 1VQMT 1K8AR 2YUPA 3TVTA 3MHXA 1Y96A 3OYAA 3FIFA 1QVGP 3ZFJA 2CT4A 4KH0B 5GAMe 2G3RA 4RKUE 5KYYB 4C8QF 3P8DA 1GRIA 1IRXA 2D0QB 2F5KA 4RTVA 4BE0A 3EH2A 1WGSA 4C92G 4MZMA 1AWJA 3CC2Q 2GGRA 2COZA 3KBGA 1EFNA 4ANJA 3WXMB 2YUOA 4RTZA 2D1XA 3I56Q 1VQKQ 3OYKA 2JVVA 1IO6A 2DZCA 1GXIE 3HRSA 3M53A 4BD3A 3QG1A 3THKA 1WXBA 5GANg 1Q82R 2J06A 2AKKA 5GAN7 2O4XB 2BUDA 1R77A 1Q81C 3ZBDA 4M4ZA 5IT9E 5FW9A 3RBBB 3VUZA 1YHQT 4XU1A 2H3EB 5CK9A 2QXFA 2KXDA 2I0NA 2KRMA 4AFZC 2DETA 3OS0A 3G4SQ 3JCMP 4C92C 4O6JA 3J80E 1YJNT 1JXMA 3QDRB 4M7AE 1V76A 4VUBA 1FXXA 2RO0A 2NUPA 4QVZA 5IAYA 3JAME 2QA4T 1QW1A 4L59A 4HCBA 1BU1A 3VYGA 1VQNA 2LDMA 3TREA 1I07A 1ZSGA 3CD6Q 3ULRB 3OW2A 2L3PA 4PJJA 3QJYA 1ZHIA 2DXBA 2RA2A 2O2OA 2X51A 1I5OB 4II1A 5CKEA 4CI0C 2QDLA 2A3LA 5HK0A 1BYMA 2RM4A 4E7KA 4XQ3A 5D7UA 3OMCA 2ABLA 3LYIA 1Q7YR 3FC3A 1JB0E 2BIVA 2EQKA 4ZN3A 2ZZDA 5FWCA 5GAOm 3QKJA 4J9HA 1M90R 5AYFA 1QQJA 3JCMh 1K73C 4PJOA 3Q1JA 1RI9A 4N4HA 3ASKA 3G6ET 3M57A 4ME7A 3C94A 5IHKA 4J8OA 4Z88A 4A53A 3OBYA 1KQSP 5FU6B 4JZ4A 1YJWA 3DB3A 2L3RA 1JBMA 2KRNA 1OPLA 3TSWA 1WYXA 3PFSA 4M7DB 5GAMd 1ZA1B 2XDBA 1OZ2A 2KVQG 2DL8A 3CC4T 4C8QA 4RCCA 2FB7A 3EG2A 2LNVA 1WLPB 2DBMA 1GCQC 4FT4A 2IPOB 1VQ8T 2RB6A 2ROLA 5CKBA 2OTJT 1RABB 4RUGA 2K5FA 1OQKA 1BI2A 1SRMA 2DE0X 2FZCB 3RKYA 5LJ5h 1U1TA 1RAHB 2FZKB 3NTHA 2FG0A 4HCCA 2IVWA 1ABQA 4EPCA 1SPKA 3H0FA 1Q86R 3CCMT 2BZ8A 2KQWA 4N4IA 4C92F 2H3JA 2CUDA 3R6OA 1OI1A 1QVFA 1RUWA 1YHQQ 3EFRA 4QKUA 1M3CA 3OW2P 2MF2A 2L8DA 2R5MA 5GMKj 1QP2A 1H3HA 2D6FA 5CKHA 1NJIC 4BB7A 4KULA 3WVDB 3M58A 2K7AA 3IQLA 2P0QA 1YJNQ 4IUVA 1X2QA 3CCVA 2DRKA 7AT1B 1WDXA 4ZGEB 2YT6A 4M75E 2QQ9A 4J6XA 1X27A 5KE3A 1VQ4T
chains in the Genus database with same CATH topology
1AWWA 4LUEA 1QKWA 4F16A 4RTYA 3VS5A 4AFUC 1YWPA 2K2MA 1HSQA 1H92A 1SEMA 4HVWA 1Z9QA 2GBQA 2GTOA 4J9IA 4RTWA 2DF6A 2A28A 1UFFA 2D8HA 2VVKA 4JJCA 1V1CA 2KT1A 5GJWB 3SHWA 1K0XA 1VYUA 2RQUA 3SEMA 2LJ0A 2DM1A 2X3WD 2VKNA 1K0SA 3VRZA 1GCPA 1T0HA 2F2XA 2DL4A 5IHNA 4ESRA 1WA7A 5IXBA 1H8KA 2CSQA 2DL3A 1ZUYA 1GL5A 1QWFA 2EKHA 1AD5A 2RQWA 2YDLA 1RLQC 2LCSA 2EYZA 3UA6A 2FPFA 4AG2C 1AVZC 4IIOA 2YSQA 1JXOA 4CC4B 2SRCA 5EC7A 1K1ZA 2EVRA 1AWOA 2P4RA 2ED1A 1GBRA 3NHNA 4F17A 2J6FA 2L3SA 2KRSA 2X3XD 2KEAA 4GLMA 3M0UA 5ECAA 1X69A 1KSWA 1UDLA 4AFQC 1UHCA 2LMJA 3VS1A 1WXUA 2GNCA 2DNUA 1PRMC 2C0OA 1ZUKA 2AZSA 2FEIA 1X43A 3H41A 2H8HA 3PVQA 1ABOA 1NG2A 2A36A 3ZL7C 1ZUUA 3UA7A 2RQRA 1OOTA 1U5SA 1QWEA 2MOXA 1A0NB 3PE0A 2D8JA 2F2VA 3KFVA 1HD3A 2J7IA 1AZEA 5HCKA 1OV3A 1T3SA 1X6GA 4EIKA 1GCQA 4J9CA 5IH2A 3M0RA 2DL5A 1G83A 2FRYA 1UG1A 2BZYA 2O88A 2K6DA 2V1RA 1K9AA 3I5RA 4OMOA 1Y57A 2LQNA 4KRTA 1JQQA 5L23A 3FJ5A 1GFDA 1SRLA 1W1FA 1PRLC 1TUDA 1W70A 3VS0A 1FMKA 1PKSA 3CQTA 3M0TA 2LP5A 2CH4A 2DJQA 2DLPA 4JJDA 3A98A 2BZXA 1X2KA 2EBPA 3REAB 4Z8AA 1NM7A 1SHGA 3M0SA 1J3TA 1VA7A 2HDAA 2JXBA 5I22A 2RMOA 1BBZA 2JMAA 1KIKA 1PWTA 1B3QA 2RQTA 1GBQA 4ORZA 1ARKA 1I1JA 4RTXA 4J9EA 4K11A 4CC2A 2DA9A 2KR3A 2L0AA 1Y0MA 2EYYA 2F2WA 1YN8A 1M3AA 3U23A 2AK5A 2DRMA 3VS2A 4CC7A 5GJVB 4DEXA 2ESWA 1PHTA 1OEBA 2O9VA 1JO8A 2EQIA 2OAWA 1ZX6A 2E5KA 3PVLA 3C0CA 1NEGA 1CSKA 1U3OA 2HCKA 2K79A 2XMFA 2A08A 3QWYA 4HXJA 2JS0A 2JTEA 4IIMA 3GBQA 2YUPA 3TVTA 2CREA 3UF4A 2J6OA 1M3BA 4HVUA 2DMOA 1T0JA 3NPFA 1AEYA 2CT4A 2C0TA 3VRYA 1B07A 4JJBA 1AZGB 4OMPA 1GRIA 1UECA 3VS6A 2B86A 2JT4A 1YP5A 4RTVA 2MCNA 2NUZA 2L2PA 2GTJA 2LQWA 4A63B 1RLPC 1NLOC 1AWJA 2EW3A 1NYGA 2GGRA 1EFNA 3I35A 2YUOA 4RTZA 2AZVA 2D1XA 2PTKA 3EG0A 2ECZA 1IO6A 3EG1A 2VWFA 4GBQA 4AG1C 3THKA 1WXBA 2KYBA 2K9GA 2J06A 2AKKA 4OMMA 4FSSA 2LJ1A 1E6GA 2JM8A 4JZ3A 2O31A 4M4ZA 2KBTA 5FW9A 3RBBB 2EGEA 3QWXX 2HEQA 2KNBB 4AFZC 2KXDA 2I0NA 2KRMA 2EGCA 2KE9A 1N5ZA 2EYXA 2JW4A 1NLPC 5IHIA 1OPKA 4Z89A 2LNHB 2EPDA 2GQIA 1MV3A 2FPEA 1SSHA 1KJWA 1JXMA 1SHFA 1UUEA 2ED0A 1I0CA 2PNIA 4J9DA 2RN8A 2CDTA 1K4US 4HCKA 1AOJA 1WIEA 1YCSB 5I11A 4RTTA 1KFZA 1BU1A 2L3QA 4X1VA 4J9BA 1QKXA 1PKTA 4ZNXA 2KXCA 2HBWA 1YNZA 1I07A 3VS4A 2LJ3A 1ZSGA 3O5ZA 3M0QA 3ULRB 2ROTA 3M0PA 2D0NA 2G6FX 2L3PA 4OMQA 4DEYA 2W0ZA 2IIMA 1WFWA 1JU5C 2O2OA 2ENMA 2W10A 4F14A 1VYVA 3I9QA 2QDLA 2LZ6B 3H0HA 4RTUA 3VS7A 2DL7A 2M0YA 2MIOA 1UJ0A 2ABLA 1CKAA 2KT8A 1ZBJA 2EYWA 1MV0B 1UTIA 3EGUA 2CH4W 4QT7A 3UATA 4J9FA 1WI7A 3NMZC 2FPDA 4HVVA 5FWCA 1GFCA 2V1QA 4J9HA 2HSPA 1AWXA 2DILA 1M8MA 1E6HA 1ZLMA 1TG0A 1RI9A 1WXTA 2FO0A 5IHKA 2DBKA 3EG3A 4Z88A 2KYMA 4CC3A 2OI3A 1CKBA 4Y92A 2EGAA 2KGTA 4JZ4A 2OJ2A 2K3BA 2CUBA 3NGPA 2PZ1A 2RNAA 2KRNA 1Z9ZA 2RPNA 1M30A 1OPLA 4JPBW 1BB9A 3TSWA 1WYXA 3JV3A 3RNJA 1NYFA 4D8DA 2KROA 1NEBA 2CSIA 2SEMA 2O9SA 4LE9A 3REBB 1WX6A 2DL8A 2AKLA 2NWMA 1G2BA 3EG2A 1X6BA 4OMNA 1T3LA 1WLPB 2DBMA 2JMCA 3H0IA 2RQVA 1GCQC 2YUQA 2A37A 2FRWA 3VS3A 3R6NA 3EHQA 2DYBA 2ROLA 4RUGA 1SRMA 1UE9A 1MUZA 2DE0X 2JM9A 2DVJA 1BK2A 1UHFA 1PNJA 2FG0A 1LCKA 1ABQA 4D8KA 1FYNA 2RF0A 1S1NA 1SPKA 3H0FA 4E6RA 2BZ8A 4R0KA 3TSZA 1VYTA 3I5SA 4LN2A 1QCFA 1TUCA 2CUDA 4LUDA 1M27C 2LX7A 1RUWA 2CT3A 1M3CA 5IXFA 1H3HA 1E7OA 2DX1A 2C0IA 4AFSC 2K7AA 1JEGA 4LNPA 1HJDA 3IQLA 4OMLA 5FWBA 2JS2A 1X2QA 2DRKA 2J6KA 1UGVA 1K76A 3EHRA 1QLYA 1WDXA 2YUNA 1XOVA 1U06A 2YT6A 3LH5A 4WCIA 4J9GA 1UJYA 2BTTA 2J05A 1X27A 1W6XA 1YWOA 2M51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWW A;  4LUE A;  1QKW A;  4F16 A;  4RTY A;  3VS5 A;  4AFU C;  1YWP A;  2K2M A;  1HSQ A;  1H92 A;  1SEM A;  4HVW A;  1Z9Q A;  2GBQ A;  2GTO A;  4J9I A;  4RTW A;  2DF6 A;  2A28 A;  1UFF A;  2D8H A;  2VVK A;  4JJC A;  1V1C A;  2KT1 A;  5GJW B;  3SHW A;  1K0X A;  1VYU A;  2RQU A;  3SEM A;  2LJ0 A;  2DM1 A;  2X3W D;  2VKN A;  1K0S A;  3VRZ A;  1GCP A;  1T0H A;  2F2X A;  2DL4 A;  5IHN A;  4ESR A;  1WA7 A;  5IXB A;  1H8K A;  2CSQ A;  2DL3 A;  1ZUY A;  1GL5 A;  1QWF A;  2EKH A;  1AD5 A;  2RQW A;  2YDL A;  1RLQ C;  2LCS A;  2EYZ A;  3UA6 A;  2FPF A;  4AG2 C;  1AVZ C;  4IIO A;  2YSQ A;  1JXO A;  4CC4 B;  2SRC A;  5EC7 A;  1K1Z A;  2EVR A;  1AWO A;  2P4R A;  2ED1 A;  1GBR A;  3NHN A;  4F17 A;  2J6F A;  2L3S A;  2KRS A;  2X3X D;  2KEA A;  4GLM A;  3M0U A;  5ECA A;  1X69 A;  1KSW A;  1UDL A;  4AFQ C;  1UHC A;  2LMJ A;  3VS1 A;  1WXU A;  2GNC A;  2DNU A;  1PRM C;  2C0O A;  1ZUK A;  2AZS A;  2FEI A;  1X43 A;  3H41 A;  2H8H A;  3PVQ A;  1ABO A;  1NG2 A;  2A36 A;  3ZL7 C;  1ZUU A;  3UA7 A;  2RQR A;  1OOT A;  1U5S A;  1QWE A;  2MOX A;  1A0N B;  3PE0 A;  2D8J A;  2F2V A;  3KFV A;  1HD3 A;  2J7I A;  1AZE A;  5HCK A;  1OV3 A;  1T3S A;  1X6G A;  4EIK A;  1GCQ A;  4J9C A;  5IH2 A;  3M0R A;  2DL5 A;  1G83 A;  2FRY A;  1UG1 A;  2BZY A;  2O88 A;  2K6D A;  2V1R A;  1K9A A;  3I5R A;  4OMO A;  1Y57 A;  2LQN A;  4KRT A;  1JQQ A;  5L23 A;  3FJ5 A;  1GFD A;  1SRL A;  1W1F A;  1PRL C;  1TUD A;  1W70 A;  3VS0 A;  1FMK A;  1PKS A;  3CQT A;  3M0T A;  2LP5 A;  2CH4 A;  2DJQ A;  2DLP A;  4JJD A;  3A98 A;  2BZX A;  1X2K A;  2EBP A;  3REA B;  4Z8A A;  1NM7 A;  1SHG A;  3M0S A;  1J3T A;  1VA7 A;  2HDA A;  2JXB A;  5I22 A;  2RMO A;  1BBZ A;  2JMA A;  1KIK A;  1PWT A;  1B3Q A;  2RQT A;  1GBQ A;  4ORZ A;  1ARK A;  1I1J A;  4RTX A;  4J9E A;  4K11 A;  4CC2 A;  2DA9 A;  2KR3 A;  2L0A A;  1Y0M A;  2EYY A;  2F2W A;  1YN8 A;  1M3A A;  3U23 A;  2AK5 A;  2DRM A;  3VS2 A;  4CC7 A;  5GJV B;  4DEX A;  2ESW A;  1PHT A;  1OEB A;  2O9V A;  1JO8 A;  2EQI A;  2OAW A;  1ZX6 A;  2E5K A;  3PVL A;  3C0C A;  1NEG A;  1CSK A;  1U3O A;  2HCK A;  2K79 A;  2XMF A;  2A08 A;  3QWY A;  4HXJ A;  2JS0 A;  2JTE A;  4IIM A;  3GBQ A;  2YUP A;  3TVT A;  2CRE A;  3UF4 A;  2J6O A;  1M3B A;  4HVU A;  2DMO A;  1T0J A;  3NPF A;  1AEY A;  2CT4 A;  2C0T A;  3VRY A;  1B07 A;  4JJB A;  1AZG B;  4OMP A;  1GRI A;  1UEC A;  3VS6 A;  2B86 A;  2JT4 A;  1YP5 A;  4RTV A;  2MCN A;  2NUZ A;  2L2P A;  2GTJ A;  2LQW A;  4A63 B;  1RLP C;  1NLO C;  1AWJ A;  2EW3 A;  1NYG A;  2GGR A;  1EFN A;  3I35 A;  2YUO A;  4RTZ A;  2AZV A;  2D1X A;  2PTK A;  3EG0 A;  2ECZ A;  1IO6 A;  3EG1 A;  2VWF A;  4GBQ A;  4AG1 C;  3THK A;  1WXB A;  2KYB A;  2K9G A;  2J06 A;  2AKK A;  4OMM A;  4FSS A;  2LJ1 A;  1E6G A;  2JM8 A;  4JZ3 A;  2O31 A;  4M4Z A;  2KBT A;  5FW9 A;  3RBB B;  2EGE A;  3QWX X;  2HEQ A;  2KNB B;  4AFZ C;  2KXD A;  2I0N A;  2KRM A;  2EGC A;  2KE9 A;  1N5Z A;  2EYX A;  2JW4 A;  1NLP C;  5IHI A;  1OPK A;  4Z89 A;  2LNH B;  2EPD A;  2GQI A;  1MV3 A;  2FPE A;  1SSH A;  1KJW A;  1JXM A;  1SHF A;  1UUE A;  2ED0 A;  1I0C A;  2PNI A;  4J9D A;  2RN8 A;  2CDT A;  1K4U S;  4HCK A;  1AOJ A;  1WIE A;  1YCS B;  5I11 A;  4RTT A;  1KFZ A;  1BU1 A;  2L3Q A;  4X1V A;  4J9B A;  1QKX A;  1PKT A;  4ZNX A;  2KXC A;  2HBW A;  1YNZ A;  1I07 A;  3VS4 A;  2LJ3 A;  1ZSG A;  3O5Z A;  3M0Q A;  3ULR B;  2ROT A;  3M0P A;  2D0N A;  2G6F X;  2L3P A;  4OMQ A;  4DEY A;  2W0Z A;  2IIM A;  1WFW A;  1JU5 C;  2O2O A;  2ENM A;  2W10 A;  4F14 A;  1VYV A;  3I9Q A;  2QDL A;  2LZ6 B;  3H0H A;  4RTU A;  3VS7 A;  2DL7 A;  2M0Y A;  2MIO A;  1UJ0 A;  2ABL A;  1CKA A;  2KT8 A;  1ZBJ A;  2EYW A;  1MV0 B;  1UTI A;  3EGU A;  2CH4 W;  4QT7 A;  3UAT A;  4J9F A;  1WI7 A;  3NMZ C;  2FPD A;  4HVV A;  5FWC A;  1GFC A;  2V1Q A;  4J9H A;  2HSP A;  1AWX A;  2DIL A;  1M8M A;  1E6H A;  1ZLM A;  1TG0 A;  1RI9 A;  1WXT A;  2FO0 A;  5IHK A;  2DBK A;  3EG3 A;  4Z88 A;  2KYM A;  4CC3 A;  2OI3 A;  1CKB A;  4Y92 A;  2EGA A;  2KGT A;  4JZ4 A;  2OJ2 A;  2K3B A;  2CUB A;  3NGP A;  2PZ1 A;  2RNA A;  2KRN A;  1Z9Z A;  2RPN A;  1M30 A;  1OPL A;  4JPB W;  1BB9 A;  3TSW A;  1WYX A;  3JV3 A;  3RNJ A;  1NYF A;  4D8D A;  2KRO A;  1NEB A;  2CSI A;  2SEM A;  2O9S A;  4LE9 A;  3REB B;  1WX6 A;  2DL8 A;  2AKL A;  2NWM A;  1G2B A;  3EG2 A;  1X6B A;  4OMN A;  1T3L A;  1WLP B;  2DBM A;  2JMC A;  3H0I A;  2RQV A;  1GCQ C;  2YUQ A;  2A37 A;  2FRW A;  3VS3 A;  3R6N A;  3EHQ A;  2DYB A;  2ROL A;  4RUG A;  1SRM A;  1UE9 A;  1MUZ A;  2DE0 X;  2JM9 A;  2DVJ A;  1BK2 A;  1UHF A;  1PNJ A;  2FG0 A;  1LCK A;  1ABQ A;  4D8K A;  1FYN A;  2RF0 A;  1S1N A;  1SPK A;  3H0F A;  4E6R A;  2BZ8 A;  4R0K A;  3TSZ A;  1VYT A;  3I5S A;  4LN2 A;  1QCF A;  1TUC A;  2CUD A;  4LUD A;  1M27 C;  2LX7 A;  1RUW A;  2CT3 A;  1M3C A;  5IXF A;  1H3H A;  1E7O A;  2DX1 A;  2C0I A;  4AFS C;  2K7A A;  1JEG A;  4LNP A;  1HJD A;  3IQL A;  4OML A;  5FWB A;  2JS2 A;  1X2Q A;  2DRK A;  2J6K A;  1UGV A;  1K76 A;  3EHR A;  1QLY A;  1WDX A;  2YUN A;  1XOV A;  1U06 A;  2YT6 A;  3LH5 A;  4WCI A;  4J9G A;  1UJY A;  2BTT A;  2J05 A;  1X27 A;  1W6X A;  1YWO A;  2M51 A; 
#chains in the Genus database with same CATH topology
 1UGP B;  1B7T A;  5KCH A;  4RMO A;  1H92 A;  1WQW A;  1S72 T;  4M78 A;  4R55 A;  3OYL A;  4F7U B;  1K9M U;  2DF6 A;  1VQP T;  2RJD A;  2D8H A;  2ZGW A;  1TH7 A;  2DTI A;  5C6S A;  5GAN 3;  3A8M B;  3PIO A;  3SHW A;  2L5Q A;  1MHN A;  4A4E A;  3SEM A;  3JCM g;  5IXB A;  3CCR T;  1H8K A;  2CSQ A;  2RHX A;  3LWI A;  4Y91 A;  4E7Z A;  4C5H A;  4M7A D;  3CME A;  2YDL A;  2LCS A;  4E2F B;  4F7U E;  3UA6 A;  4XU3 A;  9ATC B;  4NL3 A;  1YI2 Q;  2BE9 B;  3S3M A;  2ED1 A;  1D3B A;  3L2U A;  2J6F A;  2L3S A;  2X3X D;  4GLM A;  4OMF B;  5CAI A;  3G6E Q;  3FLG A;  2FZG B;  5CCA A;  3PGG A;  3QYG B;  1PM3 A;  3S3O A;  2DNU A;  2OTL Q;  2VGN A;  1PRM C;  3HRU A;  2RI2 A;  1VQ7 T;  4XTY A;  4KUD K;  4J6Y A;  2NUT A;  2AZS A;  2LTO A;  1YIJ A;  2ZCF B;  1W2B A;  4C8Q E;  3CC7 A;  4JLI A;  1D1A A;  1X43 A;  3INZ A;  1TS9 A;  2OX7 A;  1BI1 A;  5KYX A;  3PVQ A;  2ZPI B;  1ABO A;  1NG2 A;  2E6N A;  2RQR A;  1U5S A;  4JUV A;  1RAC B;  2MOX A;  3CPW A;  1A0N B;  1X6O A;  2D8J A;  2DEQ A;  2F2V A;  1OU8 A;  1VQ8 Q;  3OY9 A;  2CZ7 B;  1WJR A;  4JS4 A;  3OYB A;  2J7I A;  4E7S A;  1AZE A;  5HCK A;  2F69 A;  1X75 C;  4EIK A;  4J9C A;  5IH2 A;  2QEX A;  5CVI A;  4NS5 A;  1RAE B;  5GAN 6;  5LJ3 j;  2BZY A;  5HY6 A;  4FIB A;  1G8X A;  5I2M A;  3CXC A;  1Y57 A;  1KD1 U;  1BIA A;  2FL7 A;  2KI7 A;  4PJO G;  5KYW B;  4M77 B;  1SRL A;  3CCM Q;  2CZ0 B;  3QJ6 A;  5IN1 A;  1VQM A;  3CQT A;  3OS2 A;  2LP5 A;  2ZPF B;  2CH4 A;  3QXE B;  2KK4 A;  1IHW A;  1TXQ A;  2EJ9 A;  3REA B;  1NM7 A;  3FDR A;  5CIU A;  4GLK A;  1J3T A;  1KIK A;  8AT1 B;  2RMO A;  2JMA A;  3QZ9 B;  3QPH A;  2K4Y A;  4RTX A;  4J9E A;  1VQ4 Q;  3VV0 A;  1M5Q 1;  2KY9 A;  4IUR A;  2HNI A;  3EGD A;  2KR3 A;  3C95 A;  1TSF A;  1D09 B;  4E7L A;  2CZ6 B;  4PJO C;  3C4S A;  4IUU A;  3SWN A;  3G71 Q;  5GAM f;  1G3Y A;  1YN8 A;  3EH1 A;  2RK2 A;  1S72 Q;  3X28 B;  2AK5 A;  3VS2 A;  1XJW B;  2VXF A;  3CCS A;  2O9V A;  1JO8 A;  3EFO B;  1Q81 U;  3GF5 A;  1VQP Q;  3J81 E;  1U3O A;  1CSK A;  1IRE B;  3QWY A;  4MMK A;  2JTE A;  1TUG B;  2IG0 A;  3GBQ A;  1D1C A;  1NPR A;  1U1S A;  3I55 Q;  2J6O A;  3CCR Q;  4PLI A;  3CC2 T;  1T0J A;  1NPP A;  4F04 B;  1VQL Q;  2QQS A;  2WSC E;  1VQ6 A;  2XU8 A;  3QYH B;  1VQK T;  3CBM A;  1AZG B;  4M75 D;  2B86 A;  5GAO r;  3CCJ A;  1YP5 A;  3CPW P;  4ATO A;  2LQW A;  1LJO A;  2QA4 A;  2EW3 A;  2JTM A;  4XTU A;  2X4Y A;  3I35 A;  4C0D B;  3V8K A;  5GMK i;  2EWN A;  2MI6 A;  1VQ7 Q;  2VYT A;  3EG1 A;  4OB0 B;  5GAO q;  4HKE A;  4M78 G;  3ER0 A;  3PMT A;  4EMG A;  5DLQ E;  5GAN h;  4BI8 B;  3OYM A;  4BUG A;  2LJ1 A;  4YTL A;  4PKC C;  5D6W A;  2EGE A;  2HEQ A;  3JRZ A;  2PUK B;  3N5B B;  2KE9 A;  1BCO A;  1N5Z A;  2EYX A;  2JW4 A;  5DY9 A;  3MET A;  2EQJ A;  4J5Y A;  3JB9 G;  3RKX A;  1K73 U;  3LGF A;  2PNI A;  3CCL A;  3CD6 T;  1FWZ A;  5FLX E;  2LRQ A;  3M56 A;  4OGC A;  1RL2 A;  2MWP A;  2RN8 A;  1K4U S;  4C92 E;  4DQ2 A;  4HCK A;  2M9U A;  2DTH A;  2CGH A;  1M2O A;  1KFZ A;  3LH0 A;  3G1J A;  4M78 C;  1N27 A;  3OYY A;  4J9B A;  3A5Z B;  3WVE B;  1PKT A;  3CCU Q;  4ZNX A;  3DLL A;  2HBW A;  1YNZ A;  4RG8 A;  3VS4 A;  3MP6 A;  1WQ7 A;  5GMK l;  5GAN 4;  4C8Q D;  3M0P A;  3HFN A;  4OMQ A;  4DEY A;  3JCM c;  3L42 A;  5A2Q E;  1M4Z A;  1O75 A;  2W10 A;  4F14 A;  3I9Q A;  4NOY A;  5LJ3 d;  2ZAE A;  4PJO F;  3VKI A;  3H0H A;  3CC4 A;  4RTU A;  4BE2 A;  1N8R U;  3OMG A;  3MEV A;  3JCM J;  1CKA A;  2KT8 A;  3CCE T;  2EYW A;  1MV0 B;  1LPL A;  3L1A A;  2RI3 A;  1C6V X;  1WI7 A;  1MMN A;  3NMZ C;  2OTJ A;  4HVV A;  1G3S A;  1AHJ B;  5FU7 B;  2VUB A;  3OB9 A;  2MPX C;  1E6H A;  1TG0 A;  2FO0 A;  3CMA A;  1AT1 B;  1YBY A;  1RI0 A;  1KC8 C;  1RAA B;  3MEA A;  2HMA A;  1NJI U;  1Q86 C;  2OJ2 A;  4XTV A;  1IZ6 A;  4XAX B;  2RPN A;  4HT8 A;  4BI4 A;  1BB9 A;  4BY6 B;  3RNJ A;  4OF1 A;  3A8O B;  2SEM A;  1PSE A;  1TWB A;  3REB B;  1WHM A;  5FRN A;  4KGV B;  2QAZ A;  2AKL A;  1N6A A;  5HKC A;  4C0Z A;  1T3L A;  2E4H A;  4M7A B;  2JMC A;  3H0I A;  2RQV A;  1BKB A;  2CP3 A;  5GAO n;  4E47 A;  1WHG A;  1FX7 A;  3M59 A;  4P5N A;  3UT1 A;  1UE9 A;  3QII A;  2JM9 A;  3OYJ A;  1BK2 A;  1UHF A;  2K2V A;  3JB9 D;  3VYH B;  2MK5 A;  2RF0 A;  1ZQ1 A;  4DOV A;  1TTH B;  1M2V B;  4R0K A;  3TSZ A;  1VYT A;  4Z02 A;  1XQH A;  2RHI A;  2LX7 A;  1JJ2 P;  2EJG A;  4M7D A;  1KHC A;  1VUB A;  3QDF A;  4PJM A;  2QQR A;  2C0I A;  5CKD A;  1R0C B;  2E3H A;  1VQ9 Q;  1JEG A;  4OML A;  5FWB A;  2JS2 A;  4M78 F;  1PG5 B;  3E2U A;  2DFU A;  3P8B B;  3EGX A;  1QLY A;  4FSX A;  2ZPH B;  1C1A A;  2M02 A;  5I2S A;  5J3B A;  2VV5 A;  3HP9 A;  1N9R A;  4MDW A;  1UJY A;  2BTT A;  2J05 A;  3SWN C;  3L2Z A;  2M51 A;  1D0X A;  3OYI A;  4RTY A;  4AFU C;  1Y96 B;  2K2M A;  1HSQ A;  1SEM A;  2E64 A;  3HKS A;  5CO7 A;  2DPP B;  1Z9Q A;  2GBQ A;  2GTO A;  4RTW A;  2E12 A;  3JB9 F;  4AMC A;  1YIT T;  1UFF A;  2VVK A;  4JJC A;  3CCQ Q;  2KT1 A;  1I4K 1;  5LJ5 j;  2LQK A;  1G5V A;  4FU6 A;  2QDY B;  1YI2 T;  2DM1 A;  1TU0 B;  1RAF B;  1T0H A;  4ZTF A;  2DL4 A;  4E7H A;  4QVC A;  1WA7 A;  4C0F A;  1ZUY A;  1GL5 A;  3CCE Q;  1ZSZ C;  2K3X A;  1RLQ C;  5GAN 2;  3FB9 A;  2OTL T;  4C92 D;  2ZPB B;  3A8H B;  4ZN1 A;  3J7A F;  1AWO A;  3BFM A;  1VQO Q;  2EFI A;  2KRS A;  2KEA A;  5ECA A;  2KAF A;  3OA6 A;  1KQ2 A;  3OYN A;  2QAS A;  3ZEH A;  1X69 A;  1UHC A;  2LMJ A;  1M1K R;  1I5L A;  1WXU A;  4L6V 5;  1LVK A;  4XTW A;  2C0O A;  1ZUK A;  1BI3 A;  4KH1 B;  2AHJ B;  1F1B B;  2LT1 A;  2CKK A;  4BE1 A;  2YWW A;  2QQA A;  2H8H A;  3ZL7 C;  1ZUU A;  3GNG A;  2PQW A;  3UA7 A;  1OOT A;  2X9H A;  3PE0 A;  1YCY A;  1KK7 A;  2X4X A;  4RG2 A;  5GAM g;  1HD3 A;  2YXY A;  1KD1 R;  3RUX A;  4M75 B;  2RHU A;  3OS1 A;  1C0M A;  2LX9 A;  4XK8 E;  3E1S A;  4LDY A;  3UDC A;  3LW5 E;  5LJ3 f;  3NFC A;  2DL5 A;  1G83 A;  2FRY A;  4PFZ A;  1UG1 A;  4A54 A;  2QTX A;  3I5R A;  4XTZ A;  4OMO A;  2HL5 C;  2LQN A;  4KRT A;  1JQQ A;  1GFD A;  1PRL C;  1WZO A;  2LVM A;  2XD0 A;  4FYV B;  3E19 A;  2VB6 A;  1PKS A;  5CR2 A;  2CP5 A;  2DJQ A;  3HPW A;  3A98 A;  4AT1 B;  2BZX A;  2EBP A;  6AT1 B;  4C5E A;  1Y07 A;  5GMK e;  3G71 T;  5CQY A;  3I56 A;  1VQK A;  1D0Y A;  5I22 A;  1BBZ A;  4X9D A;  2FYK A;  1B3Q A;  2CP7 A;  3CCJ Q;  1ARK A;  1Q81 R;  1MMA A;  5M9O A;  1YJ9 Q;  2DA9 A;  2L0A A;  5D6Y A;  3JCM d;  1Y0M A;  2NYS A;  2F2W A;  2DXT A;  5KH6 A;  4M77 A;  3GPL A;  3TCJ A;  2EJF A;  2KDS A;  5GJV B;  2ESW A;  4EMK A;  2P4T A;  1PHT A;  3I55 T;  3G4S A;  4LD9 K;  1EIF A;  2M0O A;  1VQL T;  2E5K A;  2C06 A;  4PJO E;  1YIT Q;  4DBF A;  3QUI A;  2RJE A;  3TQ7 P;  1NE8 A;  4KGZ B;  1NEG A;  2K79 A;  2PVG B;  4C8Q B;  2XMF A;  2COW A;  2JS0 A;  1O9S A;  2P0P A;  1U8R A;  2O01 E;  2QYZ A;  2CRE A;  3UF4 A;  2RI5 A;  1JRI A;  4M7D G;  3NPF A;  1B34 A;  2C0T A;  2GFA A;  5A0L A;  2RHZ A;  1IB8 A;  4DBR A;  1UEC A;  3VJP A;  3VS6 A;  5GAO l;  3CD6 A;  2MCN A;  3JB9 J;  2LT4 A;  2GTJ A;  2Y4X A;  1VQ5 Q;  4A63 B;  1RLP C;  2DTO A;  1NLO C;  3JCM Q;  1NYG A;  4JDS A;  5LJ5 d;  2RK1 A;  3OQ5 A;  2XID A;  2HQX A;  3EFO A;  2AZV A;  5KYU A;  5CKF A;  2PTK A;  2ECZ A;  1QVF P;  5FU6 C;  2L89 A;  1IGQ A;  1IHV A;  4OMM A;  2A7Y A;  4M7D C;  4FSS A;  3RDV A;  3SDZ A;  1E6G A;  2JM8 A;  1M1G A;  4OVA A;  1K73 R;  3QWX X;  2HKQ B;  2KNB B;  3BE3 A;  1QVG S;  5J26 A;  3QO3 A;  1NLP C;  1OPK A;  2R58 A;  4Z89 A;  3CCU T;  1H64 1;  1MV3 A;  2FPE A;  1BIB A;  1SSH A;  3HHT B;  1UUE A;  2DD4 A;  1ACM B;  2RHY A;  1I0C A;  1OYX A;  5GMK m;  1LOJ A;  3KXT A;  2QG9 B;  2MAM A;  1OZ3 A;  4J9D A;  4XU0 A;  4KUI A;  3G7Z A;  1SSF A;  2CDT A;  1YJW T;  3RES A;  2E70 A;  5I11 A;  1KC8 U;  2XG8 D;  2Y90 A;  3EG9 B;  1K8A C;  2HKN A;  3CBP A;  4X1V A;  5LJ3 e;  4QQG A;  1Q86 U;  5DM7 R;  2KXC A;  3JCM V;  3O5Z A;  2WSF E;  3M0Q A;  3BW1 A;  2ROT A;  1KHI A;  1N8R R;  4XTX A;  4M78 E;  2G6F X;  2VGM A;  2W0Z A;  2IIM A;  3PT9 A;  1RAI B;  1WFW A;  1JU5 C;  2GCX A;  2E65 A;  2ENM A;  1UGS B;  1VYV A;  1MNE A;  4N4G A;  4A4F A;  4BDZ A;  2JJ9 A;  5GAN j;  2ZPE B;  4ZTJ A;  3JCM X;  3VS7 A;  2DL7 A;  2M0Y A;  3HTR A;  2ATC B;  1UJ0 A;  4KT0 E;  1ZBJ A;  3EGU A;  4QT7 A;  3UAT A;  1MMD A;  3JCM W;  1Q82 C;  4J7I A;  2XHC A;  2ZPG B;  2HL3 A;  4JRI A;  1NJI R;  2OAU A;  1YHQ A;  1AWX A;  2HZY A;  1W2B P;  1M8M A;  5C0M A;  2DO3 A;  4DOW A;  1WXT A;  4PJL A;  2V26 A;  1SG5 A;  3GOX A;  5GAN e;  2CZ1 B;  2DBK A;  1YJN A;  2HSE B;  2QK0 A;  1WJQ A;  2KYM A;  2OI3 A;  1ZSZ A;  3D7S B;  1CKB A;  4IKF A;  1QCO A;  4Y92 A;  2EGA A;  1X01 A;  2GFU A;  3PIP A;  3NGP A;  3JB9 H;  2LCL A;  1Z9Z A;  4JPB W;  1M30 A;  1WNL A;  2CP2 A;  1NYF A;  2KRO A;  1NEB A;  2CSI A;  4A4G A;  1VQN Q;  2O9S A;  3EFS A;  1OUL A;  1WX6 A;  2NWM A;  1G2B A;  1X6B A;  4OMN A;  3CXC P;  1NBE B;  1G3T A;  4DBQ A;  2A37 A;  4C92 B;  2DYB A;  2QGG A;  1UGR B;  3VU3 C;  4JRP A;  5LL6 S;  3JCM b;  4M7D F;  4A4K A;  1MUZ A;  8ATC B;  4J7F A;  4PJO D;  5I21 A;  5KYY A;  3X26 B;  4M77 G;  4D8K A;  1VQ9 T;  1FYN A;  1KQS S;  1H3Z A;  2E10 A;  1PD1 A;  3I5S A;  1Q7Y C;  5KE2 A;  1QCF A;  4QW2 A;  1YI2 A;  3EGD B;  2CP6 A;  1E7O A;  3SWN B;  1UGQ B;  1M90 C;  2DX1 A;  4AFS C;  1WHJ A;  3G6E A;  4PLL A;  1KG1 A;  4LNP A;  1HJD A;  1PSF A;  4M7A A;  2J6K A;  2OTL A;  1EX4 A;  5A0G A;  1R8O B;  3LH5 A;  2V8I A;  2O4X A;  4L5G A;  1PCX A;  4J9G A;  1YJW Q;  1YIJ T;  1KQ1 A;  1W6X A;  1YWO A;  3CC7 T;  3CCQ T;  4M77 C;  1AWW A;  4LUE A;  4EMK C;  1QKW A;  4GY5 A;  2HBP A;  1D1B A;  3HFO A;  2PU9 B;  1M2V A;  5GAN 5;  3FRN A;  5D6X A;  1M1K C;  1VQ8 A;  4LDW A;  4BAC A;  1D0Z A;  1OU9 A;  2RJF A;  3HSB A;  1V1C A;  4ELZ C;  5LJ5 f;  1SKU B;  4ELY C;  2RQU A;  4J6W A;  2LJ0 A;  4C5I A;  3H6Z A;  4FYY B;  3OW2 S;  2VKN A;  1K0S A;  1VIE A;  3VRZ A;  1GCP A;  2F2X A;  3GLX A;  1VQO T;  2X4W A;  4HA8 A;  2DL3 A;  3GP8 A;  4F7U F;  4JRQ A;  1QWF A;  4MML A;  5LJ3 g;  3UWN A;  1AD5 A;  3CCM A;  2LCC A;  2EQM A;  2FPF A;  4AG2 C;  1AVZ C;  2QTV A;  4IIO A;  2YSQ A;  2SRC A;  5EC7 A;  4QQ6 A;  5DLO A;  2MMP A;  5FRM A;  3VUB A;  3OYD A;  3L2R A;  4HT9 A;  4OP0 A;  5CQX A;  1R0B G;  2YRV A;  3FJP A;  2HQH A;  3LX7 A;  2PVD B;  1HXD A;  2VC8 A;  1UDL A;  5GAN d;  2XK0 A;  3BDU A;  3CCV Q;  3VS1 A;  3V7R A;  4M78 D;  1LNX A;  4MDX A;  3L2W A;  1VQ4 A;  1FMW A;  2BKD N;  3QSU A;  4C5G A;  2FEI A;  1Y7X A;  3NTI A;  1TOV A;  3G71 A;  3H41 A;  1KQS A;  1S72 A;  4M77 D;  2EAY A;  2LC4 A;  2BE7 D;  3CCS T;  2F1L A;  4JJN K;  5GAM h;  1VQP A;  4C0D C;  3RKW A;  3L2V A;  1OV3 A;  1T3S A;  3RR6 A;  2EIF A;  3JB9 I;  4PL6 A;  5HK3 A;  3I55 A;  3CCR A;  4JLG A;  1VQL A;  3V8J A;  5FRO A;  2DD5 A;  5L23 A;  3QZ5 B;  3CME Q;  1VQ6 T;  2KSS A;  5AT1 B;  2M1H A;  4PJN A;  3O8V A;  4LD6 A;  3M0T A;  2DJZ A;  5A0D A;  2CP0 A;  3CCJ T;  1K9M R;  4JJD A;  3JCM e;  1YJ9 T;  2DZ9 A;  2E6Z A;  4OB3 B;  3RMS A;  4Z8A A;  4M77 F;  3RIR A;  1QVF S;  1M8V A;  1VA7 A;  2HDA A;  2JXB A;  2X4J A;  4M75 A;  1VQ7 A;  3M5A A;  1QP3 A;  1YIJ Q;  2Z0W A;  3A8L B;  3C12 A;  3MJX A;  3CC7 Q;  4K11 A;  4CC2 A;  2EYY A;  4UC4 A;  3QBY A;  3ME9 A;  1M3A A;  3U23 A;  2DRM A;  4PNO A;  4CC7 A;  4QVD A;  1PD0 A;  4FM4 B;  2GQV A;  2EQI A;  2OAW A;  2DXC A;  1ZX6 A;  3MP1 A;  3PVL A;  3C0C A;  2JTF A;  3OSS C;  2CS7 A;  2HCK A;  4HXJ A;  2A08 A;  3OYE A;  5KCO A;  1WHK A;  4JRK A;  3CCL T;  3MCA B;  2WAC A;  2XI9 A;  2QEX Q;  3AHU A;  1VOM A;  1FMV A;  1VQ5 T;  5LJ5 e;  1M3B A;  4HVU A;  2DMO A;  4N0A A;  3V7S A;  1NZ9 A;  4X34 A;  1AEY A;  3CCU A;  4F7U A;  3VRY A;  4E7J A;  4Y28 E;  1B07 A;  4JJB A;  1QVP A;  4RCB A;  4OMP A;  5FU7 C;  1K8A U;  4M7A G;  2HD0 A;  1VQM Q;  2JT4 A;  2NUZ A;  2L2P A;  2NLU A;  2V8K A;  2V8J A;  2NUP B;  2DEU A;  3F70 A;  3MP8 A;  4IUP A;  3EG0 A;  4BI3 A;  3LWH A;  4MZT A;  4D6W A;  2VWF A;  4GBQ A;  4AG1 C;  4BY6 C;  2K5I A;  3QHS A;  2EKO A;  2KYB A;  2K9G A;  1OX8 A;  3EGX B;  1N8R C;  3PMI A;  3V8L A;  3UPU A;  1IXD A;  3GIB A;  3MKD A;  4JZ3 A;  2O31 A;  2KBT A;  1W2B S;  3PTA A;  2K3Y A;  4IUQ A;  3M9Q A;  3CCS Q;  2EGC A;  4LDX A;  4M7A C;  2MWO A;  4M7D E;  1KC8 R;  1Q82 U;  5IHI A;  2I2L A;  3CMA T;  2LNH B;  3M55 A;  2EPD A;  1XTD A;  2GQI A;  4E7I A;  4DA4 A;  3OYH A;  1KJW A;  4OB1 B;  1SHF A;  2ED0 A;  2E41 A;  2HQE A;  3OS5 A;  4LDU A;  1P92 A;  3CPW S;  1IGU A;  1I8F A;  2XDP A;  1UEB A;  1WIE A;  1AOJ A;  1WJS A;  1YCS B;  3CC2 A;  2P84 A;  4RTT A;  3RMQ A;  3OYG A;  2L3Q A;  4J83 A;  1QKX A;  3CPF A;  2YLB A;  1VQ6 Q;  4PJO B;  2XIC A;  3OBW A;  2LJ3 A;  3TU4 K;  3CXC S;  2D0N A;  4FYW B;  2P0K A;  2E1H A;  1UB4 A;  2QA4 Q;  1ZBX A;  3X20 B;  1VIF A;  3RER A;  3P8H A;  3AT1 B;  3JSC A;  5GAN f;  5KYW A;  2LZ6 B;  2QI2 A;  1RAG B;  4R56 A;  2XDD A;  2K57 A;  3T9N A;  2MIO A;  2VAS A;  2DVE A;  1UTI A;  2JUF A;  2CH4 W;  4EDU A;  4J9F A;  4OGE A;  2Y4Y A;  3OYC A;  2FPD A;  3EG9 A;  2CYZ B;  1GFC A;  1MND A;  2V1Q A;  2WSE E;  2HSP A;  3SB2 A;  3CEY A;  2DIL A;  4C0G A;  2YHT A;  3X24 B;  5GAO p;  1ZLM A;  2FHD A;  1Q7Y U;  4XU2 A;  1VQ9 A;  5GMK h;  2RH2 A;  3HL8 A;  1N9S A;  1PC0 A;  1VQN T;  3EG3 A;  3V7C A;  4CC3 A;  3CCL Q;  1M90 U;  2JZ2 A;  2KGT A;  2K3B A;  3MO8 A;  2CUB A;  2PZ1 A;  2RNA A;  4JS5 A;  1M1F A;  1RAD B;  4ZGD B;  4A4H A;  3JV3 A;  3H8Z A;  4D8D A;  1ZA2 B;  1QMC A;  3MEU A;  2DAQ A;  2GF7 A;  4LE9 A;  4TVR A;  5KYN A;  2EYQ A;  4M75 G;  2AIR B;  2DKG A;  4LDV A;  2YUQ A;  2FRW A;  3CCQ A;  3VS3 A;  3R6N A;  3EHQ A;  2R5A A;  3KUF A;  2YLC A;  1EZZ B;  1W4S A;  1M1K U;  4KBM B;  2DVJ A;  3CC4 Q;  5LJ5 g;  1PNJ A;  1LCK A;  2JOY A;  1BCM A;  3X25 B;  3H9N A;  4FW2 A;  3CCE A;  2DER A;  4OB2 B;  4M7A F;  1S1N A;  3EAE A;  4M78 B;  2XKO C;  4E6R A;  5GAN 8;  4LN2 A;  2OTJ Q;  1TUC A;  1WHL A;  4LUD A;  4FT2 A;  1M27 C;  2CT3 A;  2DXU A;  1MMG A;  4BDY A;  1VQO A;  5IXF A;  4IUT A;  4QQD A;  3DKM A;  4M75 C;  3CMA Q;  3E9F A;  4EMK B;  1V29 B;  2VXE A;  1HK9 A;  3OSV A;  1UGV A;  1K76 A;  3EHR A;  4F7U G;  4C92 A;  2YUN A;  4NL2 A;  1XOV A;  3GNF B;  1U06 A;  4WCI A;  1WPY A;  3SD4 A;  1XNI A;  4B9W A;  2B8A A;  4F16 A;  3VS5 A;  2RD1 A;  1YWP A;  1D3B B;  3M4Y A;  4HVW A;  2YRC A;  1B34 B;  4J9I A;  4DBH A;  4M77 E;  2A28 A;  5EG2 A;  4C8Q G;  3FEO A;  4PFP A;  2NUT B;  5GJW B;  1K0X A;  1VYU A;  2AT1 B;  4N0A C;  4MZP A;  1JJ2 S;  2JNG A;  2HAX A;  3LGL A;  2X3W D;  4WTO B;  4M7D D;  5IHN A;  4ESR A;  2PUO B;  5KYX B;  5KYU B;  5LJ3 h;  3SFM A;  3BDL A;  2EKH A;  2RQW A;  4B6M A;  3CCV T;  2EYZ A;  2M16 A;  4CRI A;  3CBO A;  1G3W A;  1JXO A;  4CC4 B;  2F5T X;  1K1Z A;  2EVR A;  2X35 A;  1Y71 A;  2P4R A;  2KMT A;  1I81 A;  1GBR A;  4PFO A;  3NHN A;  4F17 A;  3NTK A;  3M0U A;  2QQB A;  4HCZ A;  4WF2 A;  4C8Q C;  1KSW A;  4AFQ C;  3I56 T;  2GNC A;  3A8G B;  4EMH A;  3DLM A;  1YFN A;  1MGQ A;  3L2Q A;  1QVG A;  1YJ9 A;  3TEE A;  2MYS A;  1K9M C;  4V2S A;  3M4G A;  2A36 A;  3S6W A;  1QWE A;  3MEW A;  3G4S T;  1BI0 A;  2EQU A;  1YIT A;  3KFV A;  3E9G A;  3JCM f;  3CME T;  4KGX B;  2A0F B;  1X6G A;  4B9X A;  1GCQ A;  2QGF B;  4FYX B;  2K5L A;  3M0R A;  3URG A;  1QCN A;  2O88 A;  2K6D A;  2V1R A;  1K9A A;  5J39 A;  3FJ5 A;  1W1F A;  4ZGJ B;  4M75 F;  1TUD A;  1W70 A;  3VS0 A;  3PNW C;  2COY A;  1FMK A;  3HRT A;  1M9S A;  2DYI A;  1VQ5 A;  2DLP A;  1WHH A;  2PVO B;  3M54 A;  4Q5W A;  1X2K A;  1DJ7 B;  2RJC A;  3MPU B;  1SHG A;  4LXC A;  3M0S A;  5L8R E;  3LLR A;  4O5V A;  1PWT A;  2JN0 A;  1JJ2 A;  2RQT A;  4FL6 A;  1GBQ A;  4ORZ A;  2D9T A;  1I1J A;  3DB4 A;  4FW1 A;  1ZSZ B;  3OYF A;  2FVU A;  2E3I A;  1SF9 A;  2R57 A;  1HYO A;  4X9C A;  3A1P A;  2QEX T;  5GAM j;  2DIG A;  3BY7 A;  4DEX A;  2LQ8 A;  1OX9 A;  2YRD A;  1OEB A;  2E5Q A;  3S3N A;  2DIQ A;  4PK4 A;  2DK3 A;  4FCY A;  1Q95 G;  1KD1 C;  4IIM A;  1VQM T;  1K8A R;  2YUP A;  3TVT A;  3MHX A;  1Y96 A;  3OYA A;  3FIF A;  1QVG P;  3ZFJ A;  2CT4 A;  4KH0 B;  5GAM e;  2G3R A;  4RKU E;  5KYY B;  4C8Q F;  3P8D A;  1GRI A;  1IRX A;  2D0Q B;  2F5K A;  4RTV A;  4BE0 A;  3EH2 A;  1WGS A;  4C92 G;  4MZM A;  1AWJ A;  3CC2 Q;  2GGR A;  2COZ A;  3KBG A;  1EFN A;  4ANJ A;  3WXM B;  2YUO A;  4RTZ A;  2D1X A;  3I56 Q;  1VQK Q;  3OYK A;  2JVV A;  1IO6 A;  2DZC A;  1GXI E;  3HRS A;  3M53 A;  4BD3 A;  3QG1 A;  3THK A;  1WXB A;  5GAN g;  1Q82 R;  2J06 A;  2AKK A;  5GAN 7;  2O4X B;  2BUD A;  1R77 A;  1Q81 C;  3ZBD A;  4M4Z A;  5IT9 E;  5FW9 A;  3RBB B;  3VUZ A;  1YHQ T;  4XU1 A;  2H3E B;  5CK9 A;  2QXF A;  2KXD A;  2I0N A;  2KRM A;  4AFZ C;  2DET A;  3OS0 A;  3G4S Q;  3JCM P;  4C92 C;  4O6J A;  3J80 E;  1YJN T;  1JXM A;  3QDR B;  4M7A E;  1V76 A;  4VUB A;  1FXX A;  2RO0 A;  2NUP A;  4QVZ A;  5IAY A;  3JAM E;  2QA4 T;  1QW1 A;  4L59 A;  4HCB A;  1BU1 A;  3VYG A;  1VQN A;  2LDM A;  3TRE A;  1I07 A;  1ZSG A;  3CD6 Q;  3ULR B;  3OW2 A;  2L3P A;  4PJJ A;  3QJY A;  1ZHI A;  2DXB A;  2RA2 A;  2O2O A;  2X51 A;  1I5O B;  4II1 A;  5CKE A;  4CI0 C;  2QDL A;  2A3L A;  5HK0 A;  1BYM A;  2RM4 A;  4E7K A;  4XQ3 A;  5D7U A;  3OMC A;  2ABL A;  3LYI A;  1Q7Y R;  3FC3 A;  1JB0 E;  2BIV A;  2EQK A;  4ZN3 A;  2ZZD A;  5FWC A;  5GAO m;  3QKJ A;  4J9H A;  1M90 R;  5AYF A;  1QQJ A;  3JCM h;  1K73 C;  4PJO A;  3Q1J A;  1RI9 A;  4N4H A;  3ASK A;  3G6E T;  3M57 A;  4ME7 A;  3C94 A;  5IHK A;  4J8O A;  4Z88 A;  4A53 A;  3OBY A;  1KQS P;  5FU6 B;  4JZ4 A;  1YJW A;  3DB3 A;  2L3R A;  1JBM A;  2KRN A;  1OPL A;  3TSW A;  1WYX A;  3PFS A;  4M7D B;  5GAM d;  1ZA1 B;  2XDB A;  1OZ2 A;  2KVQ G;  2DL8 A;  3CC4 T;  4C8Q A;  4RCC A;  2FB7 A;  3EG2 A;  2LNV A;  1WLP B;  2DBM A;  1GCQ C;  4FT4 A;  2IPO B;  1VQ8 T;  2RB6 A;  2ROL A;  5CKB A;  2OTJ T;  1RAB B;  4RUG A;  2K5F A;  1OQK A;  1BI2 A;  1SRM A;  2DE0 X;  2FZC B;  3RKY A;  5LJ5 h;  1U1T A;  1RAH B;  2FZK B;  3NTH A;  2FG0 A;  4HCC A;  2IVW A;  1ABQ A;  4EPC A;  1SPK A;  3H0F A;  1Q86 R;  3CCM T;  2BZ8 A;  2KQW A;  4N4I A;  4C92 F;  2H3J A;  2CUD A;  3R6O A;  1OI1 A;  1QVF A;  1RUW A;  1YHQ Q;  3EFR A;  4QKU A;  1M3C A;  3OW2 P;  2MF2 A;  2L8D A;  2R5M A;  5GMK j;  1QP2 A;  1H3H A;  2D6F A;  5CKH A;  1NJI C;  4BB7 A;  4KUL A;  3WVD B;  3M58 A;  2K7A A;  3IQL A;  2P0Q A;  1YJN Q;  4IUV A;  1X2Q A;  3CCV A;  2DRK A;  7AT1 B;  1WDX A;  4ZGE B;  2YT6 A;  4M75 E;  2QQ9 A;  4J6X A;  1X27 A;  5KE3 A;  1VQ4 T; 
#chains in the Genus database with same CATH homology
 1AWW A;  4LUE A;  1QKW A;  4F16 A;  4RTY A;  3VS5 A;  4AFU C;  1YWP A;  2K2M A;  1HSQ A;  1H92 A;  1SEM A;  4HVW A;  1Z9Q A;  2GBQ A;  2GTO A;  4J9I A;  4RTW A;  2DF6 A;  2A28 A;  1UFF A;  2D8H A;  2VVK A;  4JJC A;  1V1C A;  2KT1 A;  5GJW B;  3SHW A;  1K0X A;  1VYU A;  2RQU A;  3SEM A;  2LJ0 A;  2DM1 A;  2X3W D;  2VKN A;  1K0S A;  3VRZ A;  1GCP A;  1T0H A;  2F2X A;  2DL4 A;  5IHN A;  4ESR A;  1WA7 A;  5IXB A;  1H8K A;  2CSQ A;  2DL3 A;  1ZUY A;  1GL5 A;  1QWF A;  2EKH A;  1AD5 A;  2RQW A;  2YDL A;  1RLQ C;  2LCS A;  2EYZ A;  3UA6 A;  2FPF A;  4AG2 C;  1AVZ C;  4IIO A;  2YSQ A;  1JXO A;  4CC4 B;  2SRC A;  5EC7 A;  1K1Z A;  2EVR A;  1AWO A;  2P4R A;  2ED1 A;  1GBR A;  3NHN A;  4F17 A;  2J6F A;  2L3S A;  2KRS A;  2X3X D;  2KEA A;  4GLM A;  3M0U A;  5ECA A;  1X69 A;  1KSW A;  1UDL A;  4AFQ C;  1UHC A;  2LMJ A;  3VS1 A;  1WXU A;  2GNC A;  2DNU A;  1PRM C;  2C0O A;  1ZUK A;  2AZS A;  2FEI A;  1X43 A;  3H41 A;  2H8H A;  3PVQ A;  1ABO A;  1NG2 A;  2A36 A;  3ZL7 C;  1ZUU A;  3UA7 A;  2RQR A;  1OOT A;  1U5S A;  1QWE A;  2MOX A;  1A0N B;  3PE0 A;  2D8J A;  2F2V A;  3KFV A;  1HD3 A;  2J7I A;  1AZE A;  5HCK A;  1OV3 A;  1T3S A;  1X6G A;  4EIK A;  1GCQ A;  4J9C A;  5IH2 A;  3M0R A;  2DL5 A;  1G83 A;  2FRY A;  1UG1 A;  2BZY A;  2O88 A;  2K6D A;  2V1R A;  1K9A A;  3I5R A;  4OMO A;  1Y57 A;  2LQN A;  4KRT A;  1JQQ A;  5L23 A;  3FJ5 A;  1GFD A;  1SRL A;  1W1F A;  1PRL C;  1TUD A;  1W70 A;  3VS0 A;  1FMK A;  1PKS A;  3CQT A;  3M0T A;  2LP5 A;  2CH4 A;  2DJQ A;  2DLP A;  4JJD A;  3A98 A;  2BZX A;  1X2K A;  2EBP A;  3REA B;  4Z8A A;  1NM7 A;  1SHG A;  3M0S A;  1J3T A;  1VA7 A;  2HDA A;  2JXB A;  5I22 A;  2RMO A;  1BBZ A;  2JMA A;  1KIK A;  1PWT A;  1B3Q A;  2RQT A;  1GBQ A;  4ORZ A;  1ARK A;  1I1J A;  4RTX A;  4J9E A;  4K11 A;  4CC2 A;  2DA9 A;  2KR3 A;  2L0A A;  1Y0M A;  2EYY A;  2F2W A;  1YN8 A;  1M3A A;  3U23 A;  2AK5 A;  2DRM A;  3VS2 A;  4CC7 A;  5GJV B;  4DEX A;  2ESW A;  1PHT A;  1OEB A;  2O9V A;  1JO8 A;  2EQI A;  2OAW A;  1ZX6 A;  2E5K A;  3PVL A;  3C0C A;  1NEG A;  1CSK A;  1U3O A;  2HCK A;  2K79 A;  2XMF A;  2A08 A;  3QWY A;  4HXJ A;  2JS0 A;  2JTE A;  4IIM A;  3GBQ A;  2YUP A;  3TVT A;  2CRE A;  3UF4 A;  2J6O A;  1M3B A;  4HVU A;  2DMO A;  1T0J A;  3NPF A;  1AEY A;  2CT4 A;  2C0T A;  3VRY A;  1B07 A;  4JJB A;  1AZG B;  4OMP A;  1GRI A;  1UEC A;  3VS6 A;  2B86 A;  2JT4 A;  1YP5 A;  4RTV A;  2MCN A;  2NUZ A;  2L2P A;  2GTJ A;  2LQW A;  4A63 B;  1RLP C;  1NLO C;  1AWJ A;  2EW3 A;  1NYG A;  2GGR A;  1EFN A;  3I35 A;  2YUO A;  4RTZ A;  2AZV A;  2D1X A;  2PTK A;  3EG0 A;  2ECZ A;  1IO6 A;  3EG1 A;  2VWF A;  4GBQ A;  4AG1 C;  3THK A;  1WXB A;  2KYB A;  2K9G A;  2J06 A;  2AKK A;  4OMM A;  4FSS A;  2LJ1 A;  1E6G A;  2JM8 A;  4JZ3 A;  2O31 A;  4M4Z A;  2KBT A;  5FW9 A;  3RBB B;  2EGE A;  3QWX X;  2HEQ A;  2KNB B;  4AFZ C;  2KXD A;  2I0N A;  2KRM A;  2EGC A;  2KE9 A;  1N5Z A;  2EYX A;  2JW4 A;  1NLP C;  5IHI A;  1OPK A;  4Z89 A;  2LNH B;  2EPD A;  2GQI A;  1MV3 A;  2FPE A;  1SSH A;  1KJW A;  1JXM A;  1SHF A;  1UUE A;  2ED0 A;  1I0C A;  2PNI A;  4J9D A;  2RN8 A;  2CDT A;  1K4U S;  4HCK A;  1AOJ A;  1WIE A;  1YCS B;  5I11 A;  4RTT A;  1KFZ A;  1BU1 A;  2L3Q A;  4X1V A;  4J9B A;  1QKX A;  1PKT A;  4ZNX A;  2KXC A;  2HBW A;  1YNZ A;  1I07 A;  3VS4 A;  2LJ3 A;  1ZSG A;  3O5Z A;  3M0Q A;  3ULR B;  2ROT A;  3M0P A;  2D0N A;  2G6F X;  2L3P A;  4OMQ A;  4DEY A;  2W0Z A;  2IIM A;  1WFW A;  1JU5 C;  2O2O A;  2ENM A;  2W10 A;  4F14 A;  1VYV A;  3I9Q A;  2QDL A;  2LZ6 B;  3H0H A;  4RTU A;  3VS7 A;  2DL7 A;  2M0Y A;  2MIO A;  1UJ0 A;  2ABL A;  1CKA A;  2KT8 A;  1ZBJ A;  2EYW A;  1MV0 B;  1UTI A;  3EGU A;  2CH4 W;  4QT7 A;  3UAT A;  4J9F A;  1WI7 A;  3NMZ C;  2FPD A;  4HVV A;  5FWC A;  1GFC A;  2V1Q A;  4J9H A;  2HSP A;  1AWX A;  2DIL A;  1M8M A;  1E6H A;  1ZLM A;  1TG0 A;  1RI9 A;  1WXT A;  2FO0 A;  5IHK A;  2DBK A;  3EG3 A;  4Z88 A;  2KYM A;  4CC3 A;  2OI3 A;  1CKB A;  4Y92 A;  2EGA A;  2KGT A;  4JZ4 A;  2OJ2 A;  2K3B A;  2CUB A;  3NGP A;  2PZ1 A;  2RNA A;  2KRN A;  1Z9Z A;  2RPN A;  1M30 A;  1OPL A;  4JPB W;  1BB9 A;  3TSW A;  1WYX A;  3JV3 A;  3RNJ A;  1NYF A;  4D8D A;  2KRO A;  1NEB A;  2CSI A;  2SEM A;  2O9S A;  4LE9 A;  3REB B;  1WX6 A;  2DL8 A;  2AKL A;  2NWM A;  1G2B A;  3EG2 A;  1X6B A;  4OMN A;  1T3L A;  1WLP B;  2DBM A;  2JMC A;  3H0I A;  2RQV A;  1GCQ C;  2YUQ A;  2A37 A;  2FRW A;  3VS3 A;  3R6N A;  3EHQ A;  2DYB A;  2ROL A;  4RUG A;  1SRM A;  1UE9 A;  1MUZ A;  2DE0 X;  2JM9 A;  2DVJ A;  1BK2 A;  1UHF A;  1PNJ A;  2FG0 A;  1LCK A;  1ABQ A;  4D8K A;  1FYN A;  2RF0 A;  1S1N A;  1SPK A;  3H0F A;  4E6R A;  2BZ8 A;  4R0K A;  3TSZ A;  1VYT A;  3I5S A;  4LN2 A;  1QCF A;  1TUC A;  2CUD A;  4LUD A;  1M27 C;  2LX7 A;  1RUW A;  2CT3 A;  1M3C A;  5IXF A;  1H3H A;  1E7O A;  2DX1 A;  2C0I A;  4AFS C;  2K7A A;  1JEG A;  4LNP A;  1HJD A;  3IQL A;  4OML A;  5FWB A;  2JS2 A;  1X2Q A;  2DRK A;  2J6K A;  1UGV A;  1K76 A;  3EHR A;  1QLY A;  1WDX A;  2YUN A;  1XOV A;  1U06 A;  2YT6 A;  3LH5 A;  4WCI A;  4J9G A;  1UJY A;  2BTT A;  2J05 A;  1X27 A;  1W6X A;  1YWO A;  2M51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...