5DY9A

Y68t hfq from methanococcus jannaschii in complex with amp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDTIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Hfq-like protein
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dy9A00
3JB9G 2QTXA 5GMKm 4M75D 2YLCA 5GANf 4NL3A 2DXTA 1YCYA 4M77E 4M77F 4QVDA 2FYKA 3JCMP 3GIBA 1M8VA 2HNIA 4M78B 3BFMA 4C92F 5GAN5 5LJ5g 2DTHA 3RUXA 2EWNA 1I8FA 4PJOA 5DY9A 5GMKh 5LJ3h 4PJOD 4M77G 3JB9H 4C8QE 3M4GA 4M77B 4XTYA 3JCMW 2EAYA 2YLBA 3JCMV 5GAMe 1BIAA 5GAN6 4M7DF 3JCMh 3V8JA 3BDUA 4C92G 1D3BB 1Y96B 4C92A 4C92B 3RIRA 4M7AD 3INZA 4PJOC 1LNXA 4RCBA 3JCMQ 3EFSA 5GMKl 5LJ3e 3V7RA 1KQ2A 4JRIA 3AHUA 3HSBA 2DJZA 4XU0A 4C8QB 4HA8A 4J5YA 4M7DG 5LJ5j 4M7DB 3JCMe 4M7AC 5GAOp 5LJ5d 3V8KA 3JB9D 1M5Q1 2VXFA 4WF2A 4NL2A 2YHTA 4Y91A 5GAOn 3L1AA 4OP0A 4QVCA 4EMGA 4M78G 4M78A 5GAMh 3QUIA 3RERA 2EJGA 1LOJA 4XTWA 5GAN4 3PGGA 4J6XA 5LJ3g 5GANh 1WPYA 4X9CA 2RB6A 4M77A 2VC8A 4J6WA 4M75E 4M75F 4M77D 4C8QF 4DQ2A 4F7UF 4F7UE 3JCMJ 4M78C 1I81A 2E65A 1D3BA 1Y96A 3FB9A 3FIFA 5GAN8 4EMKB 5I21A 4C92D 4EMHA 3V8LA 5GANe 5LJ5f 4M77C 4C8QA 4C8QG 1JBMA 4F7UG 4M75B 4PJOE 1HK9A 5GAOm 4F7UB 4M7DA 1X01A 4M7DD 3HFOA 4C92C 3VU3C 3JCMc 5GMKj 5LJ3j 1JRIA 3QHSA 4J6YA 2JN0A 3BW1A 5LJ3d 3EFRA 3L2ZA 3SWNB 4M7AE 4C8QC 1TH7A 1N9SA 2DZCA 5GAMg 2DXUA 2E64A 4MMLA 4M7DC 4M78D 3JCMd 3JB9I 1LJOA 1WNLA 2E1HA 3HFNA 1WQWA 2RM4A 4XU3A 4XU1A 5GANg 3JCMb 3SB2A 5GAN7 2E41A 4HT9A 2Y90A 2EJ9A 4NOYA 5GAOr 2DVEA 4XTUA 3JCMg 1MGQA 1B34B 3BY7A 4EMKA 3JB9J 2DTOA 1U1TA 3QO3A 2ZGWA 1I4K1 3RKXA 1U1SA 4M75G 4M75A 4X9DA 4A53A 5GAMj 4F7UA 3V7SA 5LJ3f 4C8QD 4XTXA 4PJOF 5GAMd 2RA2A 4JRKA 4M78E 4EMKC 4XQ3A 2RD1A 3RESA 5GAOq 5GANj 4HT8A 3RKYA 5GMKi 1WQ7A 3JCMf 4XTVA 2EJFA 2VXEA 3SWNA 5GANd 4XU2A 5GAN3 4C92E 1N9RA 4M75C 3FJPA 4N0AA 4M7AF 2DTIA 4PJOG 5LJ5h 4RCCA 2DKGA 2DZ9A 2CGHA 3RKWA 5CAIA 4PJOB 4JUVA 4V2SA 1KQ1A 2K57A 5GAN2 4JLIA 3QSUA 4M7DE 3SWNC 2FB7A 4M7AA 4M7AG 4XTZA 4N0AC 3JB9F 2E10A 4PNOA 4M7AB 1HXDA 5LJ5e 1BIBA 1B34A 2I2LA 1I5LA 5GMKe 1H641 3JCMX 5GAMf 5GAOl 4MMKA 2DEQA 4M78F 4A54A 3V7CA
chains in the Genus database with same CATH superfamily
4J7IA 5CO7A 4ATOA 2P4RA 1UJ0A 1MNEA 1SSHA 2PVOB 4PJOA 2BTTA 1MV0B 5DY9A 1BI1A 4BI3A 3S3NA 1KC8U 2ZPHB 3SHWA 3HHTB 4MZMA 3QWYA 4CI0C 1QVFS 3CCMA 2Z0WA 4J9BA 2DJZA 1S72Q 3AHUA 1BCMA 2L3SA 4AT1B 1YI2A 4X1VA 4XK8E 3CBPA 1J3TA 3L1AA 4FU6A 2EBPA 1LOJA 3OBWA 3DB3A 1EFNA 2EGEA 3R6OA 2YSQA 4JLGA 2F1LA 1M1GA 2RQVA 2ROLA 1K73U 4R0KA 1D0ZA 2CSQA 4HVVA 1Q82C 3LW5E 1VQ4A 3VU3C 9ATCB 4E7JA 2DFUA 3CC4A 4AFZC 1T0JA 1OZ3A 1D1AA 2AK5A 2K5LA 1VYVA 1K1ZA 3OMGA 3DLMA 3RKXA 2RMOA 4PJOF 1X6BA 1JJ2P 2E5QA 3OS5A 3CCSQ 5GANd 1YJNQ 2EQIA 2JOYA 4R55A 2P4TA 3RNJA 5KYWA 5D7UA 3EG9B 5CQXA 1VQLA 1M3BA 3X28B 2CYZB 2VGNA 3OYAA 3CMAT 2QQSA 1YIJA 2HMAA 1E6GA 4L6V5 3QYHB 1NJIC 2YLCA 3FC3A 4LNPA 1K8AC 3M57A 2EQMA 4QVDA 2NUPA 3QXEB 2X4WA 1OU8A 1VQKA 5L8RE 2EYQA 2J05A 3LWIA 1D1CA 2P0PA 4M77G 2KQWA 1IGUA 2YRDA 4HXJA 1GBQA 1BIAA 4C92G 4C92A 5CKBA 1X27A 1RAIB 4CC4B 4C8QB 3C0CA 1VQMQ 1RLPC 2VXFA 1K9AA 4OMPA 2K3XA 5ECAA 2F2VA 1IB8A 1N6AA 5CKEA 1QP2A 1YHQT 3CPWS 4XTWA 3CCUA 4CC2A 2AKLA 5LJ3g 2XICA 1YITA 3EGDA 2E65A 2O88A 1Y96A 4OMMA 3J81E 2A08A 4F14A 2XDBA 2HDAA 2J6KA 2KI7A 4Z88A 5KYUA 3ZBDA 5FU6C 5AT1B 2CH4A 1ZQ1A 1KJWA 4KUIA 1VQ8T 5IHKA 3G4SQ 4LDXA 3L42A 2FPFA 4D6WA 2DA9A 2RHZA 4XTUA 2CDTA 2BZXA 3PMIA 3OYIA 1JU5C 1M1KU 2O2OA 4QVZA 2E3HA 1U1TA 1W2BS 1HD3A 3S6WA 2X4XA 3R6NA 2DF6A 1QW1A 3EG2A 1FX7A 2RJCA 3UATA 1M90C 1N9RA 2K4YA 3GBQA 4RCCA 2MMPA 5DM7R 2J6OA 1FWZA 3LX7A 2QEXQ 4M7AG 4M7AA 2K3BA 1NYFA 1OPLA 3M56A 1KG1A 1P92A 4GY5A 1C1AA 1C6VX 2CKKA 4RTXA 2D1XA 2RJFA 1B7TA 2QTXA 4M75D 4NL3A 1YCYA 2XI9A 3NTHA 1YN8A 3FDRA 1QWEA 1VIEA 2WSFE 4K11A 2ED1A 2FPEA 2EAYA 1NPRA 2YLBA 2XD0A 5D6XA 1E7OA 2QQAA 1KC8C 2YUOA 1EX4A 4E7LA 2D8JA 4XU0A 4OMLA 3H6ZA 5LJ5j 4KGXB 2LJ0A 1UECA 4KUDK 4M7DB 3MO8A 2NLUA 1RUWA 4C0FA 2CP3A 5HKCA 1G3SA 1G3WA 4FYVB 4GLMA 3S3MA 2RHXA 3JSCA 4C8QF 3MCAB 2CP0A 1VQ6Q 2OI3A 3CCMQ 2KBTA 3V8LA 2DPPB 4KT0E 1YI2Q 1HK9A 2LT1A 2KYBA 4A4GA 1ZSZA 2L3QA 2DJQA 4LD9K 4E47A 1B07A 3CMAA 4JZ3A 4PLIA 2KK4A 2K6DA 2VGMA 2V26A 5CKFA 1MGQA 2QXFA 3QO3A 1QQJA 1RACB 1YBYA 3A8MB 3MJXA 1YJWT 3C4SA 2JXBA 4XQ3A 3RESA 4HT8A 1QKWA 4C92E 4M75C 3FJPA 4N0AA 3CC4Q 1YJ9T 5CAIA 4OMFB 2EVRA 2J7IA 2JS2A 3L2VA 3VUZA 1AD5A 4PFZA 4KH0B 3H8ZA 2HSEB 1VQ9Q 4FM4B 2DVJA 1VIFA 3M0RA 2JJ9A 1AT1B 3CBMA 5IT9E 3ZFJA 3J80E 2ZAEA 5CQYA 4DBFA 2GFAA 2H8HA 2AIRB 5FU7B 1VQLQ 1M2VA 2X35A 3JCMh 3RIRA 4RCBA 1GBRA 3VRYA 2LQWA 2YUNA 3M58A 1AVZC 3VYGA 1VQ8A 4NL2A 2YHTA 1R0CB 2HQHA 5KH6A 2VV5A 3OQ5A 2EJGA 4DBRA 2A7YA 1QVGP 2RK1A 2COYA 2FHDA 4QKUA 2KYMA 2HAXA 2B8AA 4FW1A 4IKFA 4M77C 3HP9A 4F7UG 3REAB 1WIEA 4CC3A 3OYMA 5FWBA 2HBPA 2RK2A 4C92C 5EC7A 2D8HA 2LCLA 2JN0A 3BW1A 3TSZA 4M7AE 3CCUQ 4VUBA 1U3OA 2J06A 1YITQ 1ZHIA 5I11A 2V1RA 1ARKA 2K79A 2DVEA 4ZNXA 1QKXA 3BY7A 3CPFA 1K76A 5GJWB 2NUTA 2DTOA 1SG5A 3UA7A 4X9DA 1M1KC 2W10A 1UGRB 4FYWB 2DBMA 4EMKC 5IXBA 2FZGB 2ZZDA 2HZYA 1ZA1B 2MCNA 5GAN3 4J9IA 2COWA 2DL5A 2JW4A 1WJRA 2RI2A 2MWPA 1W1FA 4BACA 2DIGA 2MI6A 1FYNA 1VQOT 1KHIA 1X6OA 5KYXA 4A54A 3LLRA 3G1JA 4LUDA 2F2XA 2NYSA 3DKMA 3META 3TCJA 4DEXA 2L89A 1OYXA 1GCQC 1VQ4T 1WXTA 3A8LB 4PJNA 3JCMV 2DXBA 1KFZA 3JCMQ 2PVDB 3EFSA 1NBEB 2WACA 5LJ3e 1XTDA 1RABB 4J5YA 4WTOB 2LZ6B 2M9UA 1RI9A 4M7AC 1UGPB 3IQLA 5LJ5d 1Q81U 1IZ6A 4P5NA 1VA7A 2QA4A 4Z02A 3Q1JA 4J6XA 5GANh 4AMCA 4X9CA 3TVTA 2LJ1A 1YJWA 3GP8A 5GAN8 4MZTA 2O4XB 2LX9A 4L5GA 1YNZA 1YFNA 1YJ9A 2HKNA 1UGSB 1VQLT 4M7DD 1EZZB 2KROA 2ZPBB 4JS5A 3KXTA 2MF2A 2X51A 2K5FA 2O9SA 1YIJT 2V1QA 4AG2C 2KRSA 2RH2A 4LDWA 3NHNA 1YWPA 2PUOB 3EGXA 3QZ9B 2GQVA 2KDSA 3JCMb 2YWWA 2Y90A 2FG0A 4C0DB 2QASA 1VQKT 3OW2P 5GAMj 1QLYA 2RNAA 4OB2B 3DLLA 2EW3A 2JTFA 3JCMf 2PQWA 4BE2A 3CCET 3CMAQ 2DZ9A 1UHFA 4PJOB 1X2QA 3L2WA 2PVGB 4J9GA 2KXDA 3CCVA 3E1SA 3CCJT 3FRNA 2XDDA 1B34A 1H3ZA 3ZEHA 2HCKA 2ZPEB 4E2FB 5CKDA 2FZKB 4LUEA 1JXOA 2FYKA 2B86A 1AZEA 1PKTA 2XDPA 4IUPA 3WXMB 4C5IA 1M27C 4J7FA 1N8RR 1YHQQ 2IG0A 1MNDA 1Q7YR 4F04B 2IIMA 2LCCA 2RQTA 1AZGB 1R77A 4OP0A 3D7SB 3UT1A 2E12A 3CD6T 4JDSA 5DLOA 2XIDA 1TWBA 3CQTA 4QQGA 2CP2A 2QQBA 2QQ9A 1VQ8Q 2P84A 1AWXA 1QWFA 3OYGA 1Y07A 4EIKA 1X2KA 5GMKj 4AFQC 3OYDA 3PFSA 2QK0A 2GNCA 4LDVA 1VQOA 5CK9A 2GF7A 2E64A 2RF0A 4M78D 1LJOA 3A5ZB 1E6HA 5M9OA 1BBZA 2Y4YA 3RMSA 2L3RA 5KYWB 3OYNA 3I9QA 1PD0A 1SF9A 3F70A 3I56T 5GAOr 4FIBA 1N8RU 4MZPA 1IHWA 3TSWA 1I4K1 4M75G 4M75A 1WZOA 2BZ8A 3QKJA 2LVMA 4KGZB 2LP5A 2NUPB 1W4SA 1Q86C 2KRMA 3MP1A 4JJCA 1IREB 5IHNA 1B3QA 3JAME 2IPOB 4TVRA 2GTOA 4ORZA 3LGLA 2BUDA 4E7KA 1CKAA 5GANf 1WHKA 5A2QE 4JJNK 2BZYA 1RLQC 3DB4A 3EGDB 4BY6C 2K2VA 1Y96B 1TUCA 3O8VA 4LDYA 2CSIA 1VQPA 2E3IA 3HRSA 4PKCC 2JMAA 1TTHB 3JB9D 1NLPC 1RADB 5KYUB 3M9QA 4ZN1A 2DILA 2LJ3A 1Q81C 3ULRB 3FJ5A 4HCZA 2AT1B 2AZVA 1SEMA 1ACMB 2JUFA 3PGGA 3M59A 2I0NA 4M77A 1WHHA 4M75F 4M78C 4WCIA 1D3BA 2HKQB 5CVIA 4L59A 2ABLA 5FLXE 3CCEA 2VB6A 1VQ7T 3RBBB 3I35A 1TUDA 3QHSA 2DETA 3CCJA 2DEUA 3CXCS 4ME7A 1R8OB 4BI8B 1SSFA 5IHIA 3TEEA 2EKOA 5CIUA 4DOWA 1YJWQ 4J83A 2D0QB 3LGFA 2A36A 3TU4K 4HT9A 2JNGA 4EMKA 3TREA 4BI4A 2QYZA 1JJ2A 2HSPA 3KFVA 1KD1C 1YJ9Q 2FL7A 2EPDA 4BE1A 2RO0A 3QJYA 3V7SA 5GAMd 1NEBA 3OSVA 1IXDA 2EJFA 2Y4XA 2DTIA 4MDXA 2DKGA 4PJMA 1PSFA 4QQ6A 4J9CA 2DBKA 1AEYA 2EGCA 1ZUKA 2GFUA 2RHIA 5GMKm 3CD6A 3GLXA 4OMOA 1SRMA 1GCQA 2JT4A 2YUPA 1T3LA 4M77F 2HD0A 4C92F 2DTHA 2LDMA 2M1HA 2LQ8A 2NWMA 3CCQT 5LL6S 4PJOD 1KQSP 1ZBJA 3HRTA 1M2OA 1PKSA 2C0IA 5I2MA 2CS7A 3H9NA 5GMKl 3OYKA 1KQ2A 2EYWA 2KSSA 4CRIA 4ZGEB 5CR2A 1ZSZB 2KMTA 3I56A 2JS0A 3VJPA 5FRNA 3H41A 3NTKA 4OVAA 3A8GB 3P8DA 3M54A 2RB6A 3BDLA 2VC8A 4M75E 1SHGA 5FROA 4II1A 4HCBA 2MK5A 1TOVA 1G3YA 3C12A 3I55A 4IUUA 2F2WA 4PJLA 1RAHB 5LJ3j 4GBQA 4C5EA 2RHUA 2DXCA 1WGSA 2RM4A 3G7ZA 1TUGB 2CUDA 2RJDA 4LD6A 3VRZA 1PNJA 3JB9J 3L2UA 1N8RC 1U1SA 4A53A 1WHGA 2YUQA 3H0FA 4OB0B 3T9NA 1VQOQ 1K73C 3NMZC 2RI5A 2ROTA 1H3HA 2LMJA 4NS5A 1QVFP 4RG8A 4M7AF 5LJ5h 3GNGA 1GCPA 4JLIA 2AKKA 1M2VB 3SWNC 2YDLA 2QA4T 4IUQA 1QP3A 1FMWA 5D6WA 1UFFA 4MMKA 2FEIA 4R56A 1VQ4Q 2JMCA 1NLOC 4M77E 2KR3A 5KYYA 1UDLA 2M02A 1X6GA 2QTVA 3X20B 4PL6A 1VQ7A 1MMAA 4KRTA 2DRKA 2A3LA 5GAN6 2H3EB 1IHVA 1QCOA 2K2MA 2A37A 3UDCA 2KT1A 2PUKB 4M7DG 1C0MA 1S1NA 3V8KA 2HL5C 1X43A 3M53A 2OTJT 2R5AA 2FO0A 3OYFA 2BKDN 2EQKA 2O9VA 4Z8AA 4J6WA 4D8DA 1N5ZA 1Y7XA 2G6FX 3FIFA 5CKHA 2VYTA 1BKBA 2K3YA 1YIJQ 1VQPQ 2NUTB 4BD3A 2XG8D 1JBMA 4HVUA 2DE0X 4FYXB 2WSCE 2KT8A 3CCVT 1U5SA 2X3WD 4LDUA 4Q5WA 3VS5A 1IGQA 1VQKQ 1EIFA 7AT1B 2RJEA 3X24B 4FSSA 1WQWA 5GANg 3LWHA 4CC7A 4NOYA 2RN8A 4HKEA 3CCEQ 3CC2T 2V8KA 4BDZA 5KYXB 3CCQA 4RTVA 4F7UA 4C8QD 1NZ9A 1VQNT 1RAEB 3CCJQ 3HPWA 3EAEA 4JJDA 4KBMB 1D0XA 5CCAA 3G6ET 2CGHA 4FSXA 3OYLA 4JUVA 3OS0A 1KQ1A 3MKDA 1I1JA 2CREA 3H0IA 2A28A 3ASKA 2VKNA 3CXCP 4BUGA 4KULA 2I2LA 3EG1A 1U06A 3JCMX 4OGCA 3CPWP 1PD1A 1UEBA 3EHRA 1PM3A 3OMCA 2L2PA 3KUFA 4B6MA 2QGGA 4X34A 2ZPFB 2HNIA 4XAXB 2EWNA 4ELYC 1JEGA 2VUBA 1ABOA 2X9HA 2C06A 3VS0A 3V8JA 4D8KA 4QW2A 1JJ2S 2RQWA 5FU6B 5AYFA 8AT1B 3CD6Q 4ELZC 2RI3A 1M5Q1 2SRCA 1AOJA 4ZGJB 1QVGA 5GAOn 4M78G 4M78A 1YJNA 1W2BP 3CCRT 1KK7A 3S3OA 1I5OB 1WHMA 4RTUA 4RG2A 2K5IA 1QVPA 4F17A 4F7UF 5IXFA 2QG9B 2BIVA 2YXYA 1PG5B 5LJ5f 2DD4A 2QDLA 5DLQE 2YT6A 5GAOm 3KBGA 2HQEA 3PVLA 1G83A 3JCMc 3I56Q 2KVQG 5LJ3d 3UA6A 4PLLA 4C8QC 1MMDA 2O01E 1MMGA 2H3JA 3OYYA 2QI2A 4OF1A 1JXMA 1AWJA 1O75A 4AFUC 1WDXA 2XK0A 2DMOA 2EJ9A 3BE3A 2FVUA 3FLGA 1VYTA 4J9DA 1B34B 2JM8A 3UPUA 2OX7A 3EH1A 2DYIA 1LCKA 3CMET 2XMFA 1WHLA 2CH4W 5A0DA 3UWNA 2LX7A 2ED0A 5GMKi 3G71T 4FYYB 1OEBA 1ABQA 2F5TX 1VQPT 1G5VA 2IVWA 2KRNA 2ZPGB 2F69A 2FZCB 4JRPA 4M7DE 1MUZA 1W70A 4C5GA 2OTJA 3OA6A 5GJVB 1H641 5A0LA 3GOXA 1W2BA 4M78F 3JB9G 1M90R 8ATCB 3M0TA 4JZ4A 1IRXA 2OAUA 1XNIA 4E7IA 4ZGDB 1BB9A 2DM1A 1RL2A 3M4GA 3JCMW 3J7AF 3OYHA 2PTKA 5J26A 1LNXA 1SKUB 3NPFA 4PK4A 2K9GA 2LQKA 2KNBB 2M0OA 2K7AA 1I0CA 1Z9QA 3EFOA 3JCMe 1OI1A 4HVWA 3M55A 1M30A 5FWCA 2OTLT 3PNWC 4QVCA 4EMGA 5GAMh 1RAFB 4J9HA 3CC2A 1VQ7Q 3QBYA 1V76A 4Y28E 1KC8R 3PTAA 1H92A 4F7UE 3JCMJ 3VYHB 1VQNA 4IURA 3NGPA 5I21A 4JRQA 1K9MR 1D0YA 1Q95G 2DL4A 2D6FA 4J9FA 1NEGA 4M75B 3G6EA 3QZ5B 3TQ7P 3OS1A 4JS4A 1H8KA 2MIOA 3EFRA 3L2RA 2DZCA 3CC7T 2DD5A 4M7DC 3HFNA 3OW2A 2AZSA 3SB2A 5GAN7 2E41A 4IUVA 1Y71A 2DL8A 1Y57A 2FPDA 4RTYA 3M0PA 3OS2A 2RD1A 1UE9A 1WFWA 3QPHA 2MAMA 1WQ7A 4XTVA 3SWNA 5EG2A 4PJOG 1PRMC 2LC4A 4IIOA 2EGAA 3HTRA 2D9TA 4OMNA 1TG0A 4N4IA 2DYBA 4FT4A 5IN1A 3LH5A 4OB1B 2DERA 1K9MU 1VQ6A 3UF4A 3L2QA 3P8BB 3CCQQ 2MYSA 4N4GA 4M78E 3PIOA 3CCRA 4RMOA 4GLKA 3GNFB 3PE0A 1Q7YU 3FEOA 2EFIA 1WHJA 3M0QA 5C0MA 1HJDA 5GAN5 3CCLT 2EYYA 3VS1A 1I8FA 3I55T 4LN2A 5GMKh 2CT3A 4M77B 4XTYA 1UG1A 3BDUA 1D3BB 4A4HA 4C92B 3M0UA 2EIFA 1BI2A 2RHYA 4HA8A 2QDYB 5FW9A 1V29B 5GAOp 1XQHA 2HBWA 3M0SA 4Y91A 3E19A 3QUIA 1CKBA 1PWTA 5GAN4 3CMEA 3E9FA 2L5QA 1PCXA 4DQ2A 2E70A 5IAYA 4B9WA 2CZ6B 2D0NA 3RMQA 1I07A 4EMKB 1AWOA 3G71A 5KCHA 5FU7C 5GANe 4E7ZA 4A4KA 1TU0B 4RTZA 5I22A 1VQ9A 2RPNA 3OSSC 2VASA 1M9SA 1MMNA 1VUBA 4J6YA 1OULA 2E5KA 4J9EA 3HKSA 5KE2A 1R0BG 4IIMA 3P8HA 3VS7A 1BI3A 3RR6A 1NE8A 3OBYA 1RI0A 2LT4A 4RUGA 2ZCFB 3PVQA 4F16A 4OMQA 1BI0A 1WLPB 2P0QA 3PIPA 1AWWA 4XTXA 4JRKA 4PFOA 1QVGS 2QA4Q 1M3CA 1ZUYA 2JZ2A 2VXEA 1YCSB 2KY9A 2QQRA 4XU2A 3M4YA 4BDYA 4RTWA 2DAQA 5J39A 4N4HA 3ER0A 3JV3A 1O9SA 3VKIA 1SHFA 3CEYA 3JRZA 4PNOA 4M7AB 1M1KR 2E4HA 5HK0A 1FXXA 2OTLA 5GAMf 2HQXA 1RAAB 3C94A 1NYGA 2DXTA 2LRQA 1K0SA 3QWXX 2JTEA 2LQNA 1JQQA 3JCMP 5KCOA 1QMCA 1ZLMA 5LJ5g 2W0ZA 5C6SA 1VQ5T 1UGVA 4RTTA 4KH1B 3EG9A 1OZ2A 5GAMe 2XKOC 3U23A 1ZA2B 2OTJQ 3INZA 4YTLA 1JB0E 1OX8A 4JRIA 2CZ0B 3CC7A 4KGVB 3M5AA 3I5RA 2M0YA 3MEWA 4DBQA 2VWFA 2GGRA 2LNHB 1XOVA 3A8OB 1S72T 3E2UA 2CP7A 2MOXA 3MEVA 3CCVQ 2GBQA 5KE3A 1I81A 1UGQB 2DL7A 3VV0A 3MEAA 2DLPA 4C8QA 4C8QG 4PJOE 2DO3A 5KYNA 1M8MA 2ZPIB 1T0HA 3CC2Q 2E6NA 1N9SA 2COZA 3OYBA 3WVEB 4IUTA 3EG0A 2P0KA 1SRLA 5FRMA 1VQNQ 2HL3A 3MP6A 1SPKA 3JCMg 2DK3A 4DA4A 3G6EQ 1N27A 2ZGWA 3CBOA 3CCLA 4LE9A 1KIKA 2KXCA 1WXBA 5KYYB 4DBHA 2R5MA 4EPCA 3RKWA 3PT9A 2MWOA 4V2SA 1KHCA 2K57A 5L23A 3QDRB 3A1PA 2X3XD 1QCNA 2CP5A 4ESRA 2E10A 3CCST 2V8IA 2CUBA 1YJNT 1VYUA 5GMKe 2YRCA 3GF5A 5HK3A 4UC4A 1K4US 1K9MC 3OYJA 4C0DC 2E6ZA 1KQSA 1Q7YC 3X26B 3ME9A 1PC0A 3RUXA 4LXCA 3OW2S 5LJ3h 3QIIA 1GFDA 2BE9B 4A4EA 3OB9A 2ECZA 4PJOC 3MEUA 3VUBA 3CCRQ 3V7RA 3EGUA 2JTMA 2ATCB 2LTOA 4J8OA 3VS2A 2OJ2A 2DNUA 4M4ZA 1NPPA 1WX6A 3LYIA 1BK2A 4ZTJA 1NG2A 3PMTA 4E6RA 4JJBA 1WPYA 1M3AA 1GRIA 5A0GA 1VQMT 4M77D 4JPBW 3FB9A 3MPUB 4C92D 4EMHA 2QGFB 3VS3A 4ANJA 1YP5A 1XJWB 4F7UB 3MP8A 2SEMA 4M7DA 1X01A 3HFOA 3A98A 2JVVA 2C0OA 3L2ZA 5D6YA 4Z89A 4ZN3A 2CZ1B 2XHCA 2M16A 2DXUA 4QQDA 3CMEQ 1OPKA 2GTJA 1BCOA 4OGEA 1W6XA 3RDVA 2RQRA 2KEAA 3G71Q 1A0NB 2FRYA 1WJQA 1CSKA 2X4YA 3QJ6A 1YHQA 4FCYA 1QVFA 3G4ST 1VQ5A 2G3RA 1AHJB 3SEMA 4ZTFA 2LCSA 4BY6B 1T3SA 4DEYA 2RQUA 5GAN2 1TSFA 2L0AA 1G8XA 4AFSC 1UB4A 3ZL7C 4XTZA 3EH2A 2DIQA 1HXDA 2CT4A 1YWOA 5HY6A 2M51A 3NFCA 1MV3A 1Q82R 2DEQA 4C0GA 4RKUE 4O6JA 2DX1A 1S72A 3SDZA 2EQUA 1Q86R 2QEXT 4C5HA 1JO8A 4O5VA 3GIBA 2ESWA 4M78B 3BFMA 1LPLA 1ZUUA 2L8DA 2KGTA 3JB9H 4C8QE 4OB3B 1OX9A 2C0TA 1G3TA 1GXIE 4M7DF 1NM7A 1WXUA 3NTIA 2OTLQ 4M7AD 1UUEA 1HYOA 3HSBA 1PRLC 4BB7A 1M1FA 1FMVA 1PHTA 1WI7A 1UHCA 1QCFA 4BE0A 2R58A 3C95A 1GL5A 3VS4A 1TXQA 1OOTA 1OV3A 1NJIR 3CC7Q 4PJJA 1OU9A 1U8RA 3EG3A 1Q82U 3SD4A 1K8AR 3OYCA 2L3PA 1Q81R 1Q86U 1JRIA 1RAGB 1Y0MA 3CCSA 1VQ6T 3CCMT 5GAMg 4MMLA 3JB9I 1YI2T 4MDWA 3EGXB 3SFMA 1GFCA 2GQIA 3H0HA 3QYGB 2GCXA 2JM9A 4QT7A 5LJ3f 2EYXA 1ZSGA 5GANj 3RKYA 4A4FA 4AG1C 3CXCA 3I5SA 2DL3A 2ENMA 3URGA 3CPWA 3QSUA 1KD1R 6AT1B 5LJ5e 1I5LA 1D09B 5HCKA 1NJIU 5GAOl 3CC4T 2PNIA 3CCLQ 3I55Q 1WA7A 1K8AU 4Y92A 3EFOB 3AT1B 2EYZA 1VQMA 5I2SA 3EHQA 1M8VA 2R57A 1VQ9T 2WSEE 1UJYA 1KSWA 1G2BA 3REBB 2F5KA 3E9GA 4B9XA 3GPLA 1BU1A 2A0FB 2EKHA 2O31A 2QAZA 2PZ1A 1TS9A 4E7HA 5J3BA 3HRUA 4WF2A 2EQJA 3O5ZA 1Z9ZA 1K0XA 1UTIA 3QDFA 1VOMA 4EDUA 3RERA 4DOVA 2PU9B 1BYMA 1IO6A 4HCCA 4A63B 3G4SA 3N5BB 1KD1U 5IH2A 4C0ZA 4HCKA 1X75C 1HSQA 3THKA 2BE7D 3OYEA 3HL8A 1ZX6A 2DRMA 2MPXC 3VS6A 2NUZA 1V1CA 1KQSS 4PFPA 1X69A 2X4JA 4FW2A 1D1BA 3SWNB 2FRWA 1TH7A 3WVDB 1MHNA 3JCMd 2KE9A 1ZSZC 3LH0A 1WNLA 1WYXA 2E1HA 3A8HB 4XU1A 2OAWA 4XU3A 3MHXA 2QEXA 2O4XA 2LNVA 2V8JA 1PSEA 2CP6A 3CCUT 1M4ZA 1WJSA 1DJ7B 1YITT 2RA2A 2AHJB 4FL6A 1M90U 5GAOq 2YRVA 2J6FA 2XU8A 2KAFA 3OY9A 4FT2A 3X25B 2HEQA 2CZ7B 1F1BB 4E7SA 1FMKA 1ZBXA 2FB7A 4N0AC 3JB9F 3QG1A 2VVKA 1BIBA 1OQKA 1LVKA 1VQ5Q 3V7CA 1K73R
chains in the Genus database with same CATH topology
4J7IA 4R56A 3LLRA 2DXTA 2LRQA 5CO7A 4ATOA 4M77E 3DKMA 3JCMP 5KCOA 3META 3TCJA 2L89A 2PVOB 5LJ5g 1OYXA 5C6SA 4PJOA 1VQ5T 5DY9A 1BI1A 3X20B 4BI3A 4PL6A 3S3NA 1VQ7A 1VQ4T 3A8LB 1KC8U 1OZ2A 3JCMV 2A3LA 2XKOC 5GAMe 5GAN6 2ZPHB 2DXBA 3HHTB 3INZA 4MZMA 3JCMQ 2PVDB 3EFSA 4YTLA 3UDCA 1JB0E 4CI0C 2WACA 5LJ3e 1QVFS 1XTDA 4JRIA 3CCMA 2CZ0B 3AHUA 2DJZA 3CC7A 2PUKB 4J5YA 4M7DG 2M9UA 4M7AC 3M5AA 1YI2A 1UGPB 3MEWA 3V8KA 5LJ5d 1Q81U 1IZ6A 4XK8E 3CBPA 4P5NA 3M53A 2OTJT 2R5AA 2QA4A 3L1AA 3OYFA 1XOVA 3A8OB 4FU6A 2BKDN 2EQKA 1S72T 4Z02A 1LOJA 3OBWA 3Q1JA 4J6XA 5GANh 3MEVA 3DB3A 4X9CA 4J6WA 3R6OA 5KE3A 1Y7XA 1I81A 4JLGA 3GP8A 3FIFA 1YJWA 5GAN8 1UGQB 4MZTA 1M1GA 5CKHA 2O4XB 2LX9A 2VYTA 1BKBA 2K3YA 4L5GA 3VV0A 4BD3A 3MEAA 2XG8D 4C8QG 4C8QA 1JBMA 1YJ9A 1K73U 4PJOE 2DO3A 1UGSB 2WSCE 1Q82C 3LW5E 2ZPIB 3CCVT 1VQ4A 1VQLT 4M7DD 3VU3C 4LDUA 4Q5WA 2ZPBB 4JS5A 3KXTA 4E7JA 2MF2A 2K5FA 2E6NA 1EIFA 1N9SA 1YIJT 2RJEA 4LDWA 2RH2A 3OYBA 3X24B 3WVEB 4IUTA 3CC4A 2PUOB 1WQWA 3QZ9B 5GANg 2GQVA 2KDSA 3LWHA 2P0KA 5FRMA 3JCMb 1OZ3A 2Y90A 4NOYA 4C0DB 3MP6A 4HKEA 3JCMg 3CC2T 1VQKT 2K5LA 2DK3A 2V8KA 4DA4A 1N27A 4BDZA 3OMGA 3DLMA 2ZGWA 3RKXA 3CBOA 5GAMj 3CCLA 3CCQA 4F7UA 4C8QD 1NZ9A 4PJOF 4OB2B 1VQNT 3DLLA 2E5QA 3OS5A 2JTFA 3HPWA 3EAEA 3JCMf 2PQWA 5GANd 4KBMB 4BE2A 3CCET 5CCAA 2R5MA 4EPCA 3G6ET 2JOYA 2DZ9A 2CGHA 3RKWA 4FSXA 4PJOB 3OYLA 3L2WA 3PT9A 2MWOA 4JUVA 1KQ1A 4R55A 1KHCA 2K57A 3OS0A 2P4TA 4V2SA 3QDRB 2PVGB 3ASKA 5CQXA 1VQLA 3CCVA 3E1SA 3CCJT 3X28B 2CYZB 2E10A 3CCST 2V8IA 2VGNA 3FRNA 4BUGA 2XDDA 4KULA 1B34A 2I2LA 3ZEHA 3OYAA 5GMKe 1YJNT 3CMAT 1H3ZA 2QQSA 3JCMX 4OGCA 1YIJA 3GF5A 5HK3A 2ZPEB 4UC4A 4L6V5 1UEBA 5CKDA 1K9MC 3OYJA 3QYHB 4C0DC 1NJIC 2YLCA 3OMCA 2E6ZA 3FC3A 1K8AC 3KUFA 1KQSA 3M57A 2EQMA 4X34A 4QVDA 2ZPFB 3QXEB 2FYKA 1Q7YC 3X26B 2HNIA 2X4WA 1VQKA 3ME9A 5L8RE 2EYQA 3RUXA 4XAXB 2EWNA 4ELYC 3LWIA 2P0PA 3OW2S 5LJ3h 2XDPA 3QIIA 4IUPA 4M77G 2VUBA 2KQWA 3WXMB 4C5IA 1BIAA 2C06A 3V8JA 4C92G 4C92A 4A4EA 3OB9A 4QW2A 1JJ2S 4J7FA 5CKBA 4PJOC 3MEUA 3VUBA 3V7RA 5FU6B 2IG0A 5AYFA 4C8QB 2JTMA 4ELZC 2LTOA 4J8OA 2RI3A 1M5Q1 2VXFA 2LCCA 1NPPA 2K3XA 4ZGJB 3LYIA 1QVGA 5GAOn 4OP0A 1N6AA 4M78G 4M78A 5CKEA 1YJNA 3UT1A 3CCRT 3S3OA 1QP2A 1YHQT 4ZTJA 3CPWS 4XTWA 3CCUA 2E12A 3PMTA 5LJ3g 3CD6T 1WPYA 4RG2A 2K5IA 2XICA 5A0GA 4JDSA 1QVPA 5DLOA 1VQMT 1YITA 4M77D 4F7UF 2E65A 3FB9A 1Y96A 2XIDA 2BIVA 4C92D 4EMHA 4QQGA 3J81E 5LJ5f 2DD4A 2QQBA 2QQ9A 2XDBA 5DLQE 5GAOm 4F7UB 3MP8A 3OYGA 4M7DA 1X01A 3KBGA 2HQEA 3HFOA 1Y07A 5GMKj 3JCMc 2KVQG 3ZBDA 2JVVA 3PFSA 5FU6C 5LJ3d 3OYDA 3L2ZA 4PLLA 4LDVA 5D6YA 4C8QC 2O01E 2CZ1B 4ZN3A 1VQOA 2XHCA 1ZQ1A 2GF7A 2M16A 2DXUA 2E64A 4QQDA 5CK9A 4M78D 2H3JA 3OYYA 1LJOA 2QI2A 3A5ZB 4KUIA 4OF1A 1VQ8T 5M9OA 2Y4YA 4OGEA 3RMSA 2L3RA 1O75A 3L42A 3OYNA 4LDXA 2XK0A 3F70A 2EJ9A 4D6WA 3I56T 5GAOr 2FVUA 2RHZA 4FIBA 3FLGA 4XTUA 3OYIA 1WJQA 1B34B 3PMIA 4MZPA 1N8RU 2X4YA 3UPUA 1M1KU 4QVZA 3QJ6A 1U1TA 1W2BS 3CMET 1I4K1 1YHQA 4M75G 4M75A 1QVFA 3G4ST 1VQ5A 5A0DA 2G3RA 3QKJA 1AHJB 2X4XA 3S6WA 3UWNA 2LVMA 4ZTFA 1QW1A 1FX7A 2RJCA 5GMKi 1W4SA 3G71T 1M90C 1Q86C 1N9RA 2K4YA 4BY6B 3MP1A 2F5TX 4RCCA 1VQPT 2MMPA 5DM7R 1IREB 5GAN2 1G5VA 2IVWA 4JRPA 2ZPGB 1FWZA 2F69A 3LX7A 4M7DE 1UB4A 4M7AA 4M7AG 4XTZA 2DIQA 3JAME 4C5GA 1HXDA 4TVRA 3M56A 2OTJA 3OA6A 1H641 5HY6A 1KG1A 1P92A 5A0LA 4GY5A 3NFCA 3LGLA 3GOXA 2CKKA 1W2BA 2DEQA 4C0GA 4M78F 2BUDA 4RKUE 4E7KA 4O6JA 2RJFA 3JB9G 1S72A 2QTXA 5GANf 4M75D 2EQUA 3SDZA 4NL3A 2QEXT 1YCYA 2XI9A 3NTHA 4C5HA 4O5VA 3GIBA 5A2QE 4JJNK 3FDRA 4M78B 2OAUA 3BFMA 1VIEA 2WSFE 1XNIA 4E7IA 4ZGDB 3DB4A 2L8DA 1RL2A 3JB9H 4C8QE 4OB3B 3M4GA 3JCMW 3J7AF 2EAYA 1NPRA 2YLBA 3OYHA 1G3TA 1GXIE 4BY6C 2XD0A 4M7DF 2K2VA 5D6XA 1Y96B 5J26A 3NTIA 4M7AD 2QQAA 3O8VA 1KC8C 1LNXA 4LDYA 4E7LA 2LQKA 2M0OA 3HSBA 4XU0A 1VQPA 3H6ZA 3HRSA 4PKCC 5LJ5j 4KUDK 4M7DB 3JCMe 1OI1A 3MO8A 3M55A 2NLUA 3JB9D 4C0FA 3M9QA 5HKCA 4ZN1A 4BB7A 1G3SA 2OTLT 3PNWC 1M1FA 4QVCA 4EMGA 1Q81C 1G3WA 5GAMh 4HCZA 3CC2A 2JUFA 3PGGA 3QBYA 4Y28E 3M59A 3S3MA 3PTAA 4M77A 2RHXA 3JSCA 4M75F 4C8QF 4F7UE 4BE0A 3JCMJ 2R58A 3MCAB 4M78C 3C95A 1D3BA 4IURA 5CVIA 3VYHB 1VQNA 5I21A 4JRQA 4L59A 5FLXE 3CCEA 3V8LA 2DPPB 1U8RA 1Q82U 1VQ7T 2D6FA 3SD4A 4KT0E 3G6EA 4M75B 3OYCA 1HK9A 3QZ5B 3OS1A 2LT1A 4A4GA 1Q86U 4JS4A 1JRIA 3QHSA 3EFRA 3CCJA 3CXCS 3L2RA 4ME7A 3CCSA 4LD9K 4E47A 3CCMT 1VQ6T 2DZCA 5GAMg 3CC7T 2DD5A 4MMLA 3CMAA 4M7DC 1R8OB 3JB9I 4BI8B 1SSFA 1YI2T 3HFNA 4MDWA 3TEEA 2EKOA 5CIUA 4PLIA 4DOWA 3OW2A 2KK4A 2D0QB 2VGMA 3LGFA 4J83A 2E41A 5CKFA 3SB2A 3SFMA 5GAN7 4IUVA 3TU4K 4HT9A 1Y71A 2JNGA 4EMKA 1MGQA 3TREA 4BI4A 2QXFA 1JJ2A 3QYGB 1KD1C 2GCXA 3QO3A 2FL7A 4BE1A 1YBYA 3A8MB 2RO0A 3QJYA 3V7SA 5LJ3f 5GAMd 3OS2A 3OSVA 1YJWT 3C4SA 4XQ3A 2RD1A 3RESA 5GANj 4HT8A 3QPHA 3RKYA 4A4FA 2MAMA 1WQ7A 4XTVA 2EJFA 3SWNA 2Y4XA 4C92E 4M75C 3CXCA 3FJPA 4N0AA 5EG2A 2DTIA 4PJOG 4MDXA 2DKGA 1YJ9T 2LC4A 5CAIA 4OMFB 2D9TA 1PSFA 3URGA 3CPWA 4QQ6A 3QSUA 3L2VA 4N4IA 3VUZA 4FT4A 5LJ5e 5IN1A 1I5LA 4OB1B 1K9MU 3H8ZA 1NJIU 1VQ6A 3L2QA 5GAOl 3CC4T 3P8BB 1VQ9T 4N4GA 4M78E 3PIOA 4FM4B 3CCRA 1K8AU 1VIFA 4RMOA 2GFUA 2RHIA 4GLKA 3GNFB 5GMKm 3CD6A 1Q7YU 3CBMA 3FEOA 3GLXA 5IT9E 2EFIA 3ZFJA 1VQMA 5I2SA 4M77F 3J80E 5CQYA 5C0MA 1M8VA 2R57A 2HD0A 4C92F 5GAN5 3CCLT 2DTHA 2LDMA 2M1HA 1I8FA 2GFAA 2LQ8A 2WSEE 5LL6S 3I55T 3CCQT 5GMKh 4PJOD 5FU7B 2X35A 2F5KA 4M77B 3HRTA 4XTYA 3E9GA 3JCMh 3BDUA 1D3BB 5I2MA 4B9XA 3GPLA 4A4HA 3RIRA 2CS7A 4C92B 4RCBA 2EIFA 5GMKl 1BI2A 3OYKA 1KQ2A 2RHYA 4E7HA 2KSSA 5J3BA 4HA8A 2QDYB 4CRIA 4ZGEB 3M58A 5CR2A 1V29B 3VYGA 5GAOp 1VQ8A 3HRUA 1XQHA 4WF2A 4NL2A 2YHTA 4Y91A 2KMTA 2EQJA 3I56A 3E19A 5KH6A 3VJPA 5FRNA 4EDUA 3QUIA 2VV5A 3OQ5A 3RERA 2EJGA 2A7YA 4DOVA 2PU9B 3NTKA 4OVAA 5GAN4 3CMEA 3A8GB 3E9FA 3M54A 3P8DA 1BYMA 4HCCA 2RB6A 3BDLA 2VC8A 2L5QA 4M75E 3G4SA 4DQ2A 3N5BB 1KD1U 2E70A 5FROA 2RK1A 4II1A 2CZ6B 2FHDA 4B9WA 3RMQA 4C0ZA 5IAYA 4HCBA 4EMKB 2HAXA 2B8AA 1X75C 5KCHA 3G71A 5FU7C 5GANe 3OYEA 4IKFA 4A4KA 4M77C 3HP9A 1VQ9A 3HL8A 1G3YA 3C12A 4F7UG 3I55A 3OYMA 4IUUA 1KQSS 2HBPA 2RK2A 3OSSC 4C92C 5LJ3j 2X4JA 2LCLA 1M9SA 1VUBA 4J6YA 2JN0A 3BW1A 3SWNB 4M7AE 3HKSA 5KE2A 1TH7A 4C5EA 2RHUA 3WVDB 4A54A 1MHNA 3P8HA 3JCMd 1BI3A 4VUBA 3LH0A 1NE8A 1WNLA 2DXCA 1WGSA 2E1HA 2RM4A 1ZHIA 1RI0A 3A8HB 3G7ZA 3OBYA 4XU3A 4XU1A 2LT4A 3JB9F 2RJDA 4LD6A 3MHXA 2ZCFB 2DVEA 2QEXA 2O4XA 3BY7A 3CPFA 3JB9J 3L2UA 2LNVA 2V8JA 1PSEA 1BI0A 2DTOA 3CCUT 2P0QA 3PIPA 1M4ZA 1N8RC 1U1SA 1WJSA 4X9DA 4A53A 1M1KC 1DJ7B 1YITT 1UGRB 4XTXA 2RA2A 4JRKA 2AHJB 4EMKC 4FL6A 1M90U 2ZZDA 5GAOq 1QVGS 4OB0B 3T9NA 2YRVA 1K73C 2RI5A 2JZ2A 2VXEA 5GAN3 2KY9A 2QQRA 4NS5A 4XU2A 4RG8A 1WJRA 4M7AF 2XU8A 5LJ5h 2KAFA 3M4YA 3OY9A 4BDYA 4FT2A 2DAQA 5J39A 4N4HA 2RI2A 2MWPA 3X25B 3ER0A 3GNGA 4JLIA 1O9SA 2CZ7B 3VKIA 3CEYA 4BACA 1ZBXA 3SWNC 2DIGA 2FB7A 3JRZA 2MI6A 4N0AC 2QA4T 4PNOA 4M7AB 1VQOT 3QG1A 4IUQA 1QP3A 1KHIA 1BIBA 1X6OA 5HK0A 5D6WA 1FXXA 2OTLA 5GAMf 4MMKA 2HQXA 3C94A 3V7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 G;  2QTX A;  5GMK m;  4M75 D;  2YLC A;  5GAN f;  4NL3 A;  2DXT A;  1YCY A;  4M77 E;  4M77 F;  4QVD A;  2FYK A;  3JCM P;  3GIB A;  1M8V A;  2HNI A;  4M78 B;  3BFM A;  4C92 F;  5GAN 5;  5LJ5 g;  2DTH A;  3RUX A;  2EWN A;  1I8F A;  4PJO A;  5DY9 A;  5GMK h;  5LJ3 h;  4PJO D;  4M77 G;  3JB9 H;  4C8Q E;  3M4G A;  4M77 B;  4XTY A;  3JCM W;  2EAY A;  2YLB A;  3JCM V;  5GAM e;  1BIA A;  5GAN 6;  4M7D F;  3JCM h;  3V8J A;  3BDU A;  4C92 G;  1D3B B;  1Y96 B;  4C92 A;  4C92 B;  3RIR A;  4M7A D;  3INZ A;  4PJO C;  1LNX A;  4RCB A;  3JCM Q;  3EFS A;  5GMK l;  5LJ3 e;  3V7R A;  1KQ2 A;  4JRI A;  3AHU A;  3HSB A;  2DJZ A;  4XU0 A;  4C8Q B;  4HA8 A;  4J5Y A;  4M7D G;  5LJ5 j;  4M7D B;  3JCM e;  4M7A C;  5GAO p;  5LJ5 d;  3V8K A;  3JB9 D;  1M5Q 1;  2VXF A;  4WF2 A;  4NL2 A;  2YHT A;  4Y91 A;  5GAO n;  3L1A A;  4OP0 A;  4QVC A;  4EMG A;  4M78 G;  4M78 A;  5GAM h;  3QUI A;  3RER A;  2EJG A;  1LOJ A;  4XTW A;  5GAN 4;  3PGG A;  4J6X A;  5LJ3 g;  5GAN h;  1WPY A;  4X9C A;  2RB6 A;  4M77 A;  2VC8 A;  4J6W A;  4M75 E;  4M75 F;  4M77 D;  4C8Q F;  4DQ2 A;  4F7U F;  4F7U E;  3JCM J;  4M78 C;  1I81 A;  2E65 A;  1D3B A;  1Y96 A;  3FB9 A;  3FIF A;  5GAN 8;  4EMK B;  5I21 A;  4C92 D;  4EMH A;  3V8L A;  5GAN e;  5LJ5 f;  4M77 C;  4C8Q A;  4C8Q G;  1JBM A;  4F7U G;  4M75 B;  4PJO E;  1HK9 A;  5GAO m;  4F7U B;  4M7D A;  1X01 A;  4M7D D;  3HFO A;  4C92 C;  3VU3 C;  3JCM c;  5GMK j;  5LJ3 j;  1JRI A;  3QHS A;  4J6Y A;  2JN0 A;  3BW1 A;  5LJ3 d;  3EFR A;  3L2Z A;  3SWN B;  4M7A E;  4C8Q C;  1TH7 A;  1N9S A;  2DZC A;  5GAM g;  2DXU A;  2E64 A;  4MML A;  4M7D C;  4M78 D;  3JCM d;  3JB9 I;  1LJO A;  1WNL A;  2E1H A;  3HFN A;  1WQW A;  2RM4 A;  4XU3 A;  4XU1 A;  5GAN g;  3JCM b;  3SB2 A;  5GAN 7;  2E41 A;  4HT9 A;  2Y90 A;  2EJ9 A;  4NOY A;  5GAO r;  2DVE A;  4XTU A;  3JCM g;  1MGQ A;  1B34 B;  3BY7 A;  4EMK A;  3JB9 J;  2DTO A;  1U1T A;  3QO3 A;  2ZGW A;  1I4K 1;  3RKX A;  1U1S A;  4M75 G;  4M75 A;  4X9D A;  4A53 A;  5GAM j;  4F7U A;  3V7S A;  5LJ3 f;  4C8Q D;  4XTX A;  4PJO F;  5GAM d;  2RA2 A;  4JRK A;  4M78 E;  4EMK C;  4XQ3 A;  2RD1 A;  3RES A;  5GAO q;  5GAN j;  4HT8 A;  3RKY A;  5GMK i;  1WQ7 A;  3JCM f;  4XTV A;  2EJF A;  2VXE A;  3SWN A;  5GAN d;  4XU2 A;  5GAN 3;  4C92 E;  1N9R A;  4M75 C;  3FJP A;  4N0A A;  4M7A F;  2DTI A;  4PJO G;  5LJ5 h;  4RCC A;  2DKG A;  2DZ9 A;  2CGH A;  3RKW A;  5CAI A;  4PJO B;  4JUV A;  4V2S A;  1KQ1 A;  2K57 A;  5GAN 2;  4JLI A;  3QSU A;  4M7D E;  3SWN C;  2FB7 A;  4M7A A;  4M7A G;  4XTZ A;  4N0A C;  3JB9 F;  2E10 A;  4PNO A;  4M7A B;  1HXD A;  5LJ5 e;  1BIB A;  1B34 A;  2I2L A;  1I5L A;  5GMK e;  1H64 1;  3JCM X;  5GAM f;  5GAO l;  4MMK A;  2DEQ A;  4M78 F;  4A54 A;  3V7C A; 
#chains in the Genus database with same CATH topology
 4J7I A;  5CO7 A;  4ATO A;  2P4R A;  1UJ0 A;  1MNE A;  1SSH A;  2PVO B;  4PJO A;  2BTT A;  1MV0 B;  5DY9 A;  1BI1 A;  4BI3 A;  3S3N A;  1KC8 U;  2ZPH B;  3SHW A;  3HHT B;  4MZM A;  3QWY A;  4CI0 C;  1QVF S;  3CCM A;  2Z0W A;  4J9B A;  2DJZ A;  1S72 Q;  3AHU A;  1BCM A;  2L3S A;  4AT1 B;  1YI2 A;  4X1V A;  4XK8 E;  3CBP A;  1J3T A;  3L1A A;  4FU6 A;  2EBP A;  1LOJ A;  3OBW A;  3DB3 A;  1EFN A;  2EGE A;  3R6O A;  2YSQ A;  4JLG A;  2F1L A;  1M1G A;  2RQV A;  2ROL A;  1K73 U;  4R0K A;  1D0Z A;  2CSQ A;  4HVV A;  1Q82 C;  3LW5 E;  1VQ4 A;  3VU3 C;  9ATC B;  4E7J A;  2DFU A;  3CC4 A;  4AFZ C;  1T0J A;  1OZ3 A;  1D1A A;  2AK5 A;  2K5L A;  1VYV A;  1K1Z A;  3OMG A;  3DLM A;  3RKX A;  2RMO A;  4PJO F;  1X6B A;  1JJ2 P;  2E5Q A;  3OS5 A;  3CCS Q;  5GAN d;  1YJN Q;  2EQI A;  2JOY A;  4R55 A;  2P4T A;  3RNJ A;  5KYW A;  5D7U A;  3EG9 B;  5CQX A;  1VQL A;  1M3B A;  3X28 B;  2CYZ B;  2VGN A;  3OYA A;  3CMA T;  2QQS A;  1YIJ A;  2HMA A;  1E6G A;  4L6V 5;  3QYH B;  1NJI C;  2YLC A;  3FC3 A;  4LNP A;  1K8A C;  3M57 A;  2EQM A;  4QVD A;  2NUP A;  3QXE B;  2X4W A;  1OU8 A;  1VQK A;  5L8R E;  2EYQ A;  2J05 A;  3LWI A;  1D1C A;  2P0P A;  4M77 G;  2KQW A;  1IGU A;  2YRD A;  4HXJ A;  1GBQ A;  1BIA A;  4C92 G;  4C92 A;  5CKB A;  1X27 A;  1RAI B;  4CC4 B;  4C8Q B;  3C0C A;  1VQM Q;  1RLP C;  2VXF A;  1K9A A;  4OMP A;  2K3X A;  5ECA A;  2F2V A;  1IB8 A;  1N6A A;  5CKE A;  1QP2 A;  1YHQ T;  3CPW S;  4XTW A;  3CCU A;  4CC2 A;  2AKL A;  5LJ3 g;  2XIC A;  1YIT A;  3EGD A;  2E65 A;  2O88 A;  1Y96 A;  4OMM A;  3J81 E;  2A08 A;  4F14 A;  2XDB A;  2HDA A;  2J6K A;  2KI7 A;  4Z88 A;  5KYU A;  3ZBD A;  5FU6 C;  5AT1 B;  2CH4 A;  1ZQ1 A;  1KJW A;  4KUI A;  1VQ8 T;  5IHK A;  3G4S Q;  4LDX A;  3L42 A;  2FPF A;  4D6W A;  2DA9 A;  2RHZ A;  4XTU A;  2CDT A;  2BZX A;  3PMI A;  3OYI A;  1JU5 C;  1M1K U;  2O2O A;  4QVZ A;  2E3H A;  1U1T A;  1W2B S;  1HD3 A;  3S6W A;  2X4X A;  3R6N A;  2DF6 A;  1QW1 A;  3EG2 A;  1FX7 A;  2RJC A;  3UAT A;  1M90 C;  1N9R A;  2K4Y A;  3GBQ A;  4RCC A;  2MMP A;  5DM7 R;  2J6O A;  1FWZ A;  3LX7 A;  2QEX Q;  4M7A G;  4M7A A;  2K3B A;  1NYF A;  1OPL A;  3M56 A;  1KG1 A;  1P92 A;  4GY5 A;  1C1A A;  1C6V X;  2CKK A;  4RTX A;  2D1X A;  2RJF A;  1B7T A;  2QTX A;  4M75 D;  4NL3 A;  1YCY A;  2XI9 A;  3NTH A;  1YN8 A;  3FDR A;  1QWE A;  1VIE A;  2WSF E;  4K11 A;  2ED1 A;  2FPE A;  2EAY A;  1NPR A;  2YLB A;  2XD0 A;  5D6X A;  1E7O A;  2QQA A;  1KC8 C;  2YUO A;  1EX4 A;  4E7L A;  2D8J A;  4XU0 A;  4OML A;  3H6Z A;  5LJ5 j;  4KGX B;  2LJ0 A;  1UEC A;  4KUD K;  4M7D B;  3MO8 A;  2NLU A;  1RUW A;  4C0F A;  2CP3 A;  5HKC A;  1G3S A;  1G3W A;  4FYV B;  4GLM A;  3S3M A;  2RHX A;  3JSC A;  4C8Q F;  3MCA B;  2CP0 A;  1VQ6 Q;  2OI3 A;  3CCM Q;  2KBT A;  3V8L A;  2DPP B;  4KT0 E;  1YI2 Q;  1HK9 A;  2LT1 A;  2KYB A;  4A4G A;  1ZSZ A;  2L3Q A;  2DJQ A;  4LD9 K;  4E47 A;  1B07 A;  3CMA A;  4JZ3 A;  4PLI A;  2KK4 A;  2K6D A;  2VGM A;  2V26 A;  5CKF A;  1MGQ A;  2QXF A;  3QO3 A;  1QQJ A;  1RAC B;  1YBY A;  3A8M B;  3MJX A;  1YJW T;  3C4S A;  2JXB A;  4XQ3 A;  3RES A;  4HT8 A;  1QKW A;  4C92 E;  4M75 C;  3FJP A;  4N0A A;  3CC4 Q;  1YJ9 T;  5CAI A;  4OMF B;  2EVR A;  2J7I A;  2JS2 A;  3L2V A;  3VUZ A;  1AD5 A;  4PFZ A;  4KH0 B;  3H8Z A;  2HSE B;  1VQ9 Q;  4FM4 B;  2DVJ A;  1VIF A;  3M0R A;  2JJ9 A;  1AT1 B;  3CBM A;  5IT9 E;  3ZFJ A;  3J80 E;  2ZAE A;  5CQY A;  4DBF A;  2GFA A;  2H8H A;  2AIR B;  5FU7 B;  1VQL Q;  1M2V A;  2X35 A;  3JCM h;  3RIR A;  4RCB A;  1GBR A;  3VRY A;  2LQW A;  2YUN A;  3M58 A;  1AVZ C;  3VYG A;  1VQ8 A;  4NL2 A;  2YHT A;  1R0C B;  2HQH A;  5KH6 A;  2VV5 A;  3OQ5 A;  2EJG A;  4DBR A;  2A7Y A;  1QVG P;  2RK1 A;  2COY A;  2FHD A;  4QKU A;  2KYM A;  2HAX A;  2B8A A;  4FW1 A;  4IKF A;  4M77 C;  3HP9 A;  4F7U G;  3REA B;  1WIE A;  4CC3 A;  3OYM A;  5FWB A;  2HBP A;  2RK2 A;  4C92 C;  5EC7 A;  2D8H A;  2LCL A;  2JN0 A;  3BW1 A;  3TSZ A;  4M7A E;  3CCU Q;  4VUB A;  1U3O A;  2J06 A;  1YIT Q;  1ZHI A;  5I11 A;  2V1R A;  1ARK A;  2K79 A;  2DVE A;  4ZNX A;  1QKX A;  3BY7 A;  3CPF A;  1K76 A;  5GJW B;  2NUT A;  2DTO A;  1SG5 A;  3UA7 A;  4X9D A;  1M1K C;  2W10 A;  1UGR B;  4FYW B;  2DBM A;  4EMK C;  5IXB A;  2FZG B;  2ZZD A;  2HZY A;  1ZA1 B;  2MCN A;  5GAN 3;  4J9I A;  2COW A;  2DL5 A;  2JW4 A;  1WJR A;  2RI2 A;  2MWP A;  1W1F A;  4BAC A;  2DIG A;  2MI6 A;  1FYN A;  1VQO T;  1KHI A;  1X6O A;  5KYX A;  4A54 A;  3LLR A;  3G1J A;  4LUD A;  2F2X A;  2NYS A;  3DKM A;  3MET A;  3TCJ A;  4DEX A;  2L89 A;  1OYX A;  1GCQ C;  1VQ4 T;  1WXT A;  3A8L B;  4PJN A;  3JCM V;  2DXB A;  1KFZ A;  3JCM Q;  2PVD B;  3EFS A;  1NBE B;  2WAC A;  5LJ3 e;  1XTD A;  1RAB B;  4J5Y A;  4WTO B;  2LZ6 B;  2M9U A;  1RI9 A;  4M7A C;  1UGP B;  3IQL A;  5LJ5 d;  1Q81 U;  1IZ6 A;  4P5N A;  1VA7 A;  2QA4 A;  4Z02 A;  3Q1J A;  4J6X A;  5GAN h;  4AMC A;  4X9C A;  3TVT A;  2LJ1 A;  1YJW A;  3GP8 A;  5GAN 8;  4MZT A;  2O4X B;  2LX9 A;  4L5G A;  1YNZ A;  1YFN A;  1YJ9 A;  2HKN A;  1UGS B;  1VQL T;  4M7D D;  1EZZ B;  2KRO A;  2ZPB B;  4JS5 A;  3KXT A;  2MF2 A;  2X51 A;  2K5F A;  2O9S A;  1YIJ T;  2V1Q A;  4AG2 C;  2KRS A;  2RH2 A;  4LDW A;  3NHN A;  1YWP A;  2PUO B;  3EGX A;  3QZ9 B;  2GQV A;  2KDS A;  3JCM b;  2YWW A;  2Y90 A;  2FG0 A;  4C0D B;  2QAS A;  1VQK T;  3OW2 P;  5GAM j;  1QLY A;  2RNA A;  4OB2 B;  3DLL A;  2EW3 A;  2JTF A;  3JCM f;  2PQW A;  4BE2 A;  3CCE T;  3CMA Q;  2DZ9 A;  1UHF A;  4PJO B;  1X2Q A;  3L2W A;  2PVG B;  4J9G A;  2KXD A;  3CCV A;  3E1S A;  3CCJ T;  3FRN A;  2XDD A;  1B34 A;  1H3Z A;  3ZEH A;  2HCK A;  2ZPE B;  4E2F B;  5CKD A;  2FZK B;  4LUE A;  1JXO A;  2FYK A;  2B86 A;  1AZE A;  1PKT A;  2XDP A;  4IUP A;  3WXM B;  4C5I A;  1M27 C;  4J7F A;  1N8R R;  1YHQ Q;  2IG0 A;  1MND A;  1Q7Y R;  4F04 B;  2IIM A;  2LCC A;  2RQT A;  1AZG B;  1R77 A;  4OP0 A;  3D7S B;  3UT1 A;  2E12 A;  3CD6 T;  4JDS A;  5DLO A;  2XID A;  1TWB A;  3CQT A;  4QQG A;  2CP2 A;  2QQB A;  2QQ9 A;  1VQ8 Q;  2P84 A;  1AWX A;  1QWF A;  3OYG A;  1Y07 A;  4EIK A;  1X2K A;  5GMK j;  4AFQ C;  3OYD A;  3PFS A;  2QK0 A;  2GNC A;  4LDV A;  1VQO A;  5CK9 A;  2GF7 A;  2E64 A;  2RF0 A;  4M78 D;  1LJO A;  3A5Z B;  1E6H A;  5M9O A;  1BBZ A;  2Y4Y A;  3RMS A;  2L3R A;  5KYW B;  3OYN A;  3I9Q A;  1PD0 A;  1SF9 A;  3F70 A;  3I56 T;  5GAO r;  4FIB A;  1N8R U;  4MZP A;  1IHW A;  3TSW A;  1I4K 1;  4M75 G;  4M75 A;  1WZO A;  2BZ8 A;  3QKJ A;  2LVM A;  4KGZ B;  2LP5 A;  2NUP B;  1W4S A;  1Q86 C;  2KRM A;  3MP1 A;  4JJC A;  1IRE B;  5IHN A;  1B3Q A;  3JAM E;  2IPO B;  4TVR A;  2GTO A;  4ORZ A;  3LGL A;  2BUD A;  4E7K A;  1CKA A;  5GAN f;  1WHK A;  5A2Q E;  4JJN K;  2BZY A;  1RLQ C;  3DB4 A;  3EGD B;  4BY6 C;  2K2V A;  1Y96 B;  1TUC A;  3O8V A;  4LDY A;  2CSI A;  1VQP A;  2E3I A;  3HRS A;  4PKC C;  2JMA A;  1TTH B;  3JB9 D;  1NLP C;  1RAD B;  5KYU B;  3M9Q A;  4ZN1 A;  2DIL A;  2LJ3 A;  1Q81 C;  3ULR B;  3FJ5 A;  4HCZ A;  2AT1 B;  2AZV A;  1SEM A;  1ACM B;  2JUF A;  3PGG A;  3M59 A;  2I0N A;  4M77 A;  1WHH A;  4M75 F;  4M78 C;  4WCI A;  1D3B A;  2HKQ B;  5CVI A;  4L59 A;  2ABL A;  5FLX E;  3CCE A;  2VB6 A;  1VQ7 T;  3RBB B;  3I35 A;  1TUD A;  3QHS A;  2DET A;  3CCJ A;  2DEU A;  3CXC S;  4ME7 A;  1R8O B;  4BI8 B;  1SSF A;  5IHI A;  3TEE A;  2EKO A;  5CIU A;  4DOW A;  1YJW Q;  4J83 A;  2D0Q B;  3LGF A;  2A36 A;  3TU4 K;  4HT9 A;  2JNG A;  4EMK A;  3TRE A;  4BI4 A;  2QYZ A;  1JJ2 A;  2HSP A;  3KFV A;  1KD1 C;  1YJ9 Q;  2FL7 A;  2EPD A;  4BE1 A;  2RO0 A;  3QJY A;  3V7S A;  5GAM d;  1NEB A;  3OSV A;  1IXD A;  2EJF A;  2Y4X A;  2DTI A;  4MDX A;  2DKG A;  4PJM A;  1PSF A;  4QQ6 A;  4J9C A;  2DBK A;  1AEY A;  2EGC A;  1ZUK A;  2GFU A;  2RHI A;  5GMK m;  3CD6 A;  3GLX A;  4OMO A;  1SRM A;  1GCQ A;  2JT4 A;  2YUP A;  1T3L A;  4M77 F;  2HD0 A;  4C92 F;  2DTH A;  2LDM A;  2M1H A;  2LQ8 A;  2NWM A;  3CCQ T;  5LL6 S;  4PJO D;  1KQS P;  1ZBJ A;  3HRT A;  1M2O A;  1PKS A;  2C0I A;  5I2M A;  2CS7 A;  3H9N A;  5GMK l;  3OYK A;  1KQ2 A;  2EYW A;  2KSS A;  4CRI A;  4ZGE B;  5CR2 A;  1ZSZ B;  2KMT A;  3I56 A;  2JS0 A;  3VJP A;  5FRN A;  3H41 A;  3NTK A;  4OVA A;  3A8G B;  3P8D A;  3M54 A;  2RB6 A;  3BDL A;  2VC8 A;  4M75 E;  1SHG A;  5FRO A;  4II1 A;  4HCB A;  2MK5 A;  1TOV A;  1G3Y A;  3C12 A;  3I55 A;  4IUU A;  2F2W A;  4PJL A;  1RAH B;  5LJ3 j;  4GBQ A;  4C5E A;  2RHU A;  2DXC A;  1WGS A;  2RM4 A;  3G7Z A;  1TUG B;  2CUD A;  2RJD A;  4LD6 A;  3VRZ A;  1PNJ A;  3JB9 J;  3L2U A;  1N8R C;  1U1S A;  4A53 A;  1WHG A;  2YUQ A;  3H0F A;  4OB0 B;  3T9N A;  1VQO Q;  1K73 C;  3NMZ C;  2RI5 A;  2ROT A;  1H3H A;  2LMJ A;  4NS5 A;  1QVF P;  4RG8 A;  4M7A F;  5LJ5 h;  3GNG A;  1GCP A;  4JLI A;  2AKK A;  1M2V B;  3SWN C;  2YDL A;  2QA4 T;  4IUQ A;  1QP3 A;  1FMW A;  5D6W A;  1UFF A;  4MMK A;  2FEI A;  4R56 A;  1VQ4 Q;  2JMC A;  1NLO C;  4M77 E;  2KR3 A;  5KYY A;  1UDL A;  2M02 A;  1X6G A;  2QTV A;  3X20 B;  4PL6 A;  1VQ7 A;  1MMA A;  4KRT A;  2DRK A;  2A3L A;  5GAN 6;  2H3E B;  1IHV A;  1QCO A;  2K2M A;  2A37 A;  3UDC A;  2KT1 A;  2PUK B;  4M7D G;  1C0M A;  1S1N A;  3V8K A;  2HL5 C;  1X43 A;  3M53 A;  2OTJ T;  2R5A A;  2FO0 A;  3OYF A;  2BKD N;  2EQK A;  2O9V A;  4Z8A A;  4J6W A;  4D8D A;  1N5Z A;  1Y7X A;  2G6F X;  3FIF A;  5CKH A;  2VYT A;  1BKB A;  2K3Y A;  1YIJ Q;  1VQP Q;  2NUT B;  4BD3 A;  2XG8 D;  1JBM A;  4HVU A;  2DE0 X;  4FYX B;  2WSC E;  2KT8 A;  3CCV T;  1U5S A;  2X3W D;  4LDU A;  4Q5W A;  3VS5 A;  1IGQ A;  1VQK Q;  1EIF A;  7AT1 B;  2RJE A;  3X24 B;  4FSS A;  1WQW A;  5GAN g;  3LWH A;  4CC7 A;  4NOY A;  2RN8 A;  4HKE A;  3CCE Q;  3CC2 T;  2V8K A;  4BDZ A;  5KYX B;  3CCQ A;  4RTV A;  4F7U A;  4C8Q D;  1NZ9 A;  1VQN T;  1RAE B;  3CCJ Q;  3HPW A;  3EAE A;  4JJD A;  4KBM B;  1D0X A;  5CCA A;  3G6E T;  2CGH A;  4FSX A;  3OYL A;  4JUV A;  3OS0 A;  1KQ1 A;  3MKD A;  1I1J A;  2CRE A;  3H0I A;  2A28 A;  3ASK A;  2VKN A;  3CXC P;  4BUG A;  4KUL A;  2I2L A;  3EG1 A;  1U06 A;  3JCM X;  4OGC A;  3CPW P;  1PD1 A;  1UEB A;  3EHR A;  1PM3 A;  3OMC A;  2L2P A;  3KUF A;  4B6M A;  2QGG A;  4X34 A;  2ZPF B;  2HNI A;  4XAX B;  2EWN A;  4ELY C;  1JEG A;  2VUB A;  1ABO A;  2X9H A;  2C06 A;  3VS0 A;  3V8J A;  4D8K A;  4QW2 A;  1JJ2 S;  2RQW A;  5FU6 B;  5AYF A;  8AT1 B;  3CD6 Q;  4ELZ C;  2RI3 A;  1M5Q 1;  2SRC A;  1AOJ A;  4ZGJ B;  1QVG A;  5GAO n;  4M78 G;  4M78 A;  1YJN A;  1W2B P;  3CCR T;  1KK7 A;  3S3O A;  1I5O B;  1WHM A;  4RTU A;  4RG2 A;  2K5I A;  1QVP A;  4F17 A;  4F7U F;  5IXF A;  2QG9 B;  2BIV A;  2YXY A;  1PG5 B;  5LJ5 f;  2DD4 A;  2QDL A;  5DLQ E;  2YT6 A;  5GAO m;  3KBG A;  2HQE A;  3PVL A;  1G83 A;  3JCM c;  3I56 Q;  2KVQ G;  5LJ3 d;  3UA6 A;  4PLL A;  4C8Q C;  1MMD A;  2O01 E;  1MMG A;  2H3J A;  3OYY A;  2QI2 A;  4OF1 A;  1JXM A;  1AWJ A;  1O75 A;  4AFU C;  1WDX A;  2XK0 A;  2DMO A;  2EJ9 A;  3BE3 A;  2FVU A;  3FLG A;  1VYT A;  4J9D A;  1B34 B;  2JM8 A;  3UPU A;  2OX7 A;  3EH1 A;  2DYI A;  1LCK A;  3CME T;  2XMF A;  1WHL A;  2CH4 W;  5A0D A;  3UWN A;  2LX7 A;  2ED0 A;  5GMK i;  3G71 T;  4FYY B;  1OEB A;  1ABQ A;  2F5T X;  1VQP T;  1G5V A;  2IVW A;  2KRN A;  2ZPG B;  2F69 A;  2FZC B;  4JRP A;  4M7D E;  1MUZ A;  1W70 A;  4C5G A;  2OTJ A;  3OA6 A;  5GJV B;  1H64 1;  5A0L A;  3GOX A;  1W2B A;  4M78 F;  3JB9 G;  1M90 R;  8ATC B;  3M0T A;  4JZ4 A;  1IRX A;  2OAU A;  1XNI A;  4E7I A;  4ZGD B;  1BB9 A;  2DM1 A;  1RL2 A;  3M4G A;  3JCM W;  3J7A F;  3OYH A;  2PTK A;  5J26 A;  1LNX A;  1SKU B;  3NPF A;  4PK4 A;  2K9G A;  2LQK A;  2KNB B;  2M0O A;  2K7A A;  1I0C A;  1Z9Q A;  3EFO A;  3JCM e;  1OI1 A;  4HVW A;  3M55 A;  1M30 A;  5FWC A;  2OTL T;  3PNW C;  4QVC A;  4EMG A;  5GAM h;  1RAF B;  4J9H A;  3CC2 A;  1VQ7 Q;  3QBY A;  1V76 A;  4Y28 E;  1KC8 R;  3PTA A;  1H92 A;  4F7U E;  3JCM J;  3VYH B;  1VQN A;  4IUR A;  3NGP A;  5I21 A;  4JRQ A;  1K9M R;  1D0Y A;  1Q95 G;  2DL4 A;  2D6F A;  4J9F A;  1NEG A;  4M75 B;  3G6E A;  3QZ5 B;  3TQ7 P;  3OS1 A;  4JS4 A;  1H8K A;  2MIO A;  3EFR A;  3L2R A;  2DZC A;  3CC7 T;  2DD5 A;  4M7D C;  3HFN A;  3OW2 A;  2AZS A;  3SB2 A;  5GAN 7;  2E41 A;  4IUV A;  1Y71 A;  2DL8 A;  1Y57 A;  2FPD A;  4RTY A;  3M0P A;  3OS2 A;  2RD1 A;  1UE9 A;  1WFW A;  3QPH A;  2MAM A;  1WQ7 A;  4XTV A;  3SWN A;  5EG2 A;  4PJO G;  1PRM C;  2LC4 A;  4IIO A;  2EGA A;  3HTR A;  2D9T A;  4OMN A;  1TG0 A;  4N4I A;  2DYB A;  4FT4 A;  5IN1 A;  3LH5 A;  4OB1 B;  2DER A;  1K9M U;  1VQ6 A;  3UF4 A;  3L2Q A;  3P8B B;  3CCQ Q;  2MYS A;  4N4G A;  4M78 E;  3PIO A;  3CCR A;  4RMO A;  4GLK A;  3GNF B;  3PE0 A;  1Q7Y U;  3FEO A;  2EFI A;  1WHJ A;  3M0Q A;  5C0M A;  1HJD A;  5GAN 5;  3CCL T;  2EYY A;  3VS1 A;  1I8F A;  3I55 T;  4LN2 A;  5GMK h;  2CT3 A;  4M77 B;  4XTY A;  1UG1 A;  3BDU A;  1D3B B;  4A4H A;  4C92 B;  3M0U A;  2EIF A;  1BI2 A;  2RHY A;  4HA8 A;  2QDY B;  5FW9 A;  1V29 B;  5GAO p;  1XQH A;  2HBW A;  3M0S A;  4Y91 A;  3E19 A;  3QUI A;  1CKB A;  1PWT A;  5GAN 4;  3CME A;  3E9F A;  2L5Q A;  1PCX A;  4DQ2 A;  2E70 A;  5IAY A;  4B9W A;  2CZ6 B;  2D0N A;  3RMQ A;  1I07 A;  4EMK B;  1AWO A;  3G71 A;  5KCH A;  5FU7 C;  5GAN e;  4E7Z A;  4A4K A;  1TU0 B;  4RTZ A;  5I22 A;  1VQ9 A;  2RPN A;  3OSS C;  2VAS A;  1M9S A;  1MMN A;  1VUB A;  4J6Y A;  1OUL A;  2E5K A;  4J9E A;  3HKS A;  5KE2 A;  1R0B G;  4IIM A;  3P8H A;  3VS7 A;  1BI3 A;  3RR6 A;  1NE8 A;  3OBY A;  1RI0 A;  2LT4 A;  4RUG A;  2ZCF B;  3PVQ A;  4F16 A;  4OMQ A;  1BI0 A;  1WLP B;  2P0Q A;  3PIP A;  1AWW A;  4XTX A;  4JRK A;  4PFO A;  1QVG S;  2QA4 Q;  1M3C A;  1ZUY A;  2JZ2 A;  2VXE A;  1YCS B;  2KY9 A;  2QQR A;  4XU2 A;  3M4Y A;  4BDY A;  4RTW A;  2DAQ A;  5J39 A;  4N4H A;  3ER0 A;  3JV3 A;  1O9S A;  3VKI A;  1SHF A;  3CEY A;  3JRZ A;  4PNO A;  4M7A B;  1M1K R;  2E4H A;  5HK0 A;  1FXX A;  2OTL A;  5GAM f;  2HQX A;  1RAA B;  3C94 A;  1NYG A;  2DXT A;  2LRQ A;  1K0S A;  3QWX X;  2JTE A;  2LQN A;  1JQQ A;  3JCM P;  5KCO A;  1QMC A;  1ZLM A;  5LJ5 g;  2W0Z A;  5C6S A;  1VQ5 T;  1UGV A;  4RTT A;  4KH1 B;  3EG9 A;  1OZ2 A;  5GAM e;  2XKO C;  3U23 A;  1ZA2 B;  2OTJ Q;  3INZ A;  4YTL A;  1JB0 E;  1OX8 A;  4JRI A;  2CZ0 B;  3CC7 A;  4KGV B;  3M5A A;  3I5R A;  2M0Y A;  3MEW A;  4DBQ A;  2VWF A;  2GGR A;  2LNH B;  1XOV A;  3A8O B;  1S72 T;  3E2U A;  2CP7 A;  2MOX A;  3MEV A;  3CCV Q;  2GBQ A;  5KE3 A;  1I81 A;  1UGQ B;  2DL7 A;  3VV0 A;  3MEA A;  2DLP A;  4C8Q A;  4C8Q G;  4PJO E;  2DO3 A;  5KYN A;  1M8M A;  2ZPI B;  1T0H A;  3CC2 Q;  2E6N A;  1N9S A;  2COZ A;  3OYB A;  3WVE B;  4IUT A;  3EG0 A;  2P0K A;  1SRL A;  5FRM A;  1VQN Q;  2HL3 A;  3MP6 A;  1SPK A;  3JCM g;  2DK3 A;  4DA4 A;  3G6E Q;  1N27 A;  2ZGW A;  3CBO A;  3CCL A;  4LE9 A;  1KIK A;  2KXC A;  1WXB A;  5KYY B;  4DBH A;  2R5M A;  4EPC A;  3RKW A;  3PT9 A;  2MWO A;  4V2S A;  1KHC A;  2K57 A;  5L23 A;  3QDR B;  3A1P A;  2X3X D;  1QCN A;  2CP5 A;  4ESR A;  2E10 A;  3CCS T;  2V8I A;  2CUB A;  1YJN T;  1VYU A;  5GMK e;  2YRC A;  3GF5 A;  5HK3 A;  4UC4 A;  1K4U S;  1K9M C;  3OYJ A;  4C0D C;  2E6Z A;  1KQS A;  1Q7Y C;  3X26 B;  3ME9 A;  1PC0 A;  3RUX A;  4LXC A;  3OW2 S;  5LJ3 h;  3QII A;  1GFD A;  2BE9 B;  4A4E A;  3OB9 A;  2ECZ A;  4PJO C;  3MEU A;  3VUB A;  3CCR Q;  3V7R A;  3EGU A;  2JTM A;  2ATC B;  2LTO A;  4J8O A;  3VS2 A;  2OJ2 A;  2DNU A;  4M4Z A;  1NPP A;  1WX6 A;  3LYI A;  1BK2 A;  4ZTJ A;  1NG2 A;  3PMT A;  4E6R A;  4JJB A;  1WPY A;  1M3A A;  1GRI A;  5A0G A;  1VQM T;  4M77 D;  4JPB W;  3FB9 A;  3MPU B;  4C92 D;  4EMH A;  2QGF B;  3VS3 A;  4ANJ A;  1YP5 A;  1XJW B;  4F7U B;  3MP8 A;  2SEM A;  4M7D A;  1X01 A;  3HFO A;  3A98 A;  2JVV A;  2C0O A;  3L2Z A;  5D6Y A;  4Z89 A;  4ZN3 A;  2CZ1 B;  2XHC A;  2M16 A;  2DXU A;  4QQD A;  3CME Q;  1OPK A;  2GTJ A;  1BCO A;  4OGE A;  1W6X A;  3RDV A;  2RQR A;  2KEA A;  3G71 Q;  1A0N B;  2FRY A;  1WJQ A;  1CSK A;  2X4Y A;  3QJ6 A;  1YHQ A;  4FCY A;  1QVF A;  3G4S T;  1VQ5 A;  2G3R A;  1AHJ B;  3SEM A;  4ZTF A;  2LCS A;  4BY6 B;  1T3S A;  4DEY A;  2RQU A;  5GAN 2;  1TSF A;  2L0A A;  1G8X A;  4AFS C;  1UB4 A;  3ZL7 C;  4XTZ A;  3EH2 A;  2DIQ A;  1HXD A;  2CT4 A;  1YWO A;  5HY6 A;  2M51 A;  3NFC A;  1MV3 A;  1Q82 R;  2DEQ A;  4C0G A;  4RKU E;  4O6J A;  2DX1 A;  1S72 A;  3SDZ A;  2EQU A;  1Q86 R;  2QEX T;  4C5H A;  1JO8 A;  4O5V A;  3GIB A;  2ESW A;  4M78 B;  3BFM A;  1LPL A;  1ZUU A;  2L8D A;  2KGT A;  3JB9 H;  4C8Q E;  4OB3 B;  1OX9 A;  2C0T A;  1G3T A;  1GXI E;  4M7D F;  1NM7 A;  1WXU A;  3NTI A;  2OTL Q;  4M7A D;  1UUE A;  1HYO A;  3HSB A;  1PRL C;  4BB7 A;  1M1F A;  1FMV A;  1PHT A;  1WI7 A;  1UHC A;  1QCF A;  4BE0 A;  2R58 A;  3C95 A;  1GL5 A;  3VS4 A;  1TXQ A;  1OOT A;  1OV3 A;  1NJI R;  3CC7 Q;  4PJJ A;  1OU9 A;  1U8R A;  3EG3 A;  1Q82 U;  3SD4 A;  1K8A R;  3OYC A;  2L3P A;  1Q81 R;  1Q86 U;  1JRI A;  1RAG B;  1Y0M A;  3CCS A;  1VQ6 T;  3CCM T;  5GAM g;  4MML A;  3JB9 I;  1YI2 T;  4MDW A;  3EGX B;  3SFM A;  1GFC A;  2GQI A;  3H0H A;  3QYG B;  2GCX A;  2JM9 A;  4QT7 A;  5LJ3 f;  2EYX A;  1ZSG A;  5GAN j;  3RKY A;  4A4F A;  4AG1 C;  3CXC A;  3I5S A;  2DL3 A;  2ENM A;  3URG A;  3CPW A;  3QSU A;  1KD1 R;  6AT1 B;  5LJ5 e;  1I5L A;  1D09 B;  5HCK A;  1NJI U;  5GAO l;  3CC4 T;  2PNI A;  3CCL Q;  3I55 Q;  1WA7 A;  1K8A U;  4Y92 A;  3EFO B;  3AT1 B;  2EYZ A;  1VQM A;  5I2S A;  3EHQ A;  1M8V A;  2R57 A;  1VQ9 T;  2WSE E;  1UJY A;  1KSW A;  1G2B A;  3REB B;  2F5K A;  3E9G A;  4B9X A;  3GPL A;  1BU1 A;  2A0F B;  2EKH A;  2O31 A;  2QAZ A;  2PZ1 A;  1TS9 A;  4E7H A;  5J3B A;  3HRU A;  4WF2 A;  2EQJ A;  3O5Z A;  1Z9Z A;  1K0X A;  1UTI A;  3QDF A;  1VOM A;  4EDU A;  3RER A;  4DOV A;  2PU9 B;  1BYM A;  1IO6 A;  4HCC A;  4A63 B;  3G4S A;  3N5B B;  1KD1 U;  5IH2 A;  4C0Z A;  4HCK A;  1X75 C;  1HSQ A;  3THK A;  2BE7 D;  3OYE A;  3HL8 A;  1ZX6 A;  2DRM A;  2MPX C;  3VS6 A;  2NUZ A;  1V1C A;  1KQS S;  4PFP A;  1X69 A;  2X4J A;  4FW2 A;  1D1B A;  3SWN B;  2FRW A;  1TH7 A;  3WVD B;  1MHN A;  3JCM d;  2KE9 A;  1ZSZ C;  3LH0 A;  1WNL A;  1WYX A;  2E1H A;  3A8H B;  4XU1 A;  2OAW A;  4XU3 A;  3MHX A;  2QEX A;  2O4X A;  2LNV A;  2V8J A;  1PSE A;  2CP6 A;  3CCU T;  1M4Z A;  1WJS A;  1DJ7 B;  1YIT T;  2RA2 A;  2AHJ B;  4FL6 A;  1M90 U;  5GAO q;  2YRV A;  2J6F A;  2XU8 A;  2KAF A;  3OY9 A;  4FT2 A;  3X25 B;  2HEQ A;  2CZ7 B;  1F1B B;  4E7S A;  1FMK A;  1ZBX A;  2FB7 A;  4N0A C;  3JB9 F;  3QG1 A;  2VVK A;  1BIB A;  1OQK A;  1LVK A;  1VQ5 Q;  3V7C A;  1K73 R; 
#chains in the Genus database with same CATH homology
 4J7I A;  4R56 A;  3LLR A;  2DXT A;  2LRQ A;  5CO7 A;  4ATO A;  4M77 E;  3DKM A;  3JCM P;  5KCO A;  3MET A;  3TCJ A;  2L89 A;  2PVO B;  5LJ5 g;  1OYX A;  5C6S A;  4PJO A;  1VQ5 T;  5DY9 A;  1BI1 A;  3X20 B;  4BI3 A;  4PL6 A;  3S3N A;  1VQ7 A;  1VQ4 T;  3A8L B;  1KC8 U;  1OZ2 A;  3JCM V;  2A3L A;  2XKO C;  5GAM e;  5GAN 6;  2ZPH B;  2DXB A;  3HHT B;  3INZ A;  4MZM A;  3JCM Q;  2PVD B;  3EFS A;  4YTL A;  3UDC A;  1JB0 E;  4CI0 C;  2WAC A;  5LJ3 e;  1QVF S;  1XTD A;  4JRI A;  3CCM A;  2CZ0 B;  3AHU A;  2DJZ A;  3CC7 A;  2PUK B;  4J5Y A;  4M7D G;  2M9U A;  4M7A C;  3M5A A;  1YI2 A;  1UGP B;  3MEW A;  3V8K A;  5LJ5 d;  1Q81 U;  1IZ6 A;  4XK8 E;  3CBP A;  4P5N A;  3M53 A;  2OTJ T;  2R5A A;  2QA4 A;  3L1A A;  3OYF A;  1XOV A;  3A8O B;  4FU6 A;  2BKD N;  2EQK A;  1S72 T;  4Z02 A;  1LOJ A;  3OBW A;  3Q1J A;  4J6X A;  5GAN h;  3MEV A;  3DB3 A;  4X9C A;  4J6W A;  3R6O A;  5KE3 A;  1Y7X A;  1I81 A;  4JLG A;  3GP8 A;  3FIF A;  1YJW A;  5GAN 8;  1UGQ B;  4MZT A;  1M1G A;  5CKH A;  2O4X B;  2LX9 A;  2VYT A;  1BKB A;  2K3Y A;  4L5G A;  3VV0 A;  4BD3 A;  3MEA A;  2XG8 D;  4C8Q G;  4C8Q A;  1JBM A;  1YJ9 A;  1K73 U;  4PJO E;  2DO3 A;  1UGS B;  2WSC E;  1Q82 C;  3LW5 E;  2ZPI B;  3CCV T;  1VQ4 A;  1VQL T;  4M7D D;  3VU3 C;  4LDU A;  4Q5W A;  2ZPB B;  4JS5 A;  3KXT A;  4E7J A;  2MF2 A;  2K5F A;  2E6N A;  1EIF A;  1N9S A;  1YIJ T;  2RJE A;  4LDW A;  2RH2 A;  3OYB A;  3X24 B;  3WVE B;  4IUT A;  3CC4 A;  2PUO B;  1WQW A;  3QZ9 B;  5GAN g;  2GQV A;  2KDS A;  3LWH A;  2P0K A;  5FRM A;  3JCM b;  1OZ3 A;  2Y90 A;  4NOY A;  4C0D B;  3MP6 A;  4HKE A;  3JCM g;  3CC2 T;  1VQK T;  2K5L A;  2DK3 A;  2V8K A;  4DA4 A;  1N27 A;  4BDZ A;  3OMG A;  3DLM A;  2ZGW A;  3RKX A;  3CBO A;  5GAM j;  3CCL A;  3CCQ A;  4F7U A;  4C8Q D;  1NZ9 A;  4PJO F;  4OB2 B;  1VQN T;  3DLL A;  2E5Q A;  3OS5 A;  2JTF A;  3HPW A;  3EAE A;  3JCM f;  2PQW A;  5GAN d;  4KBM B;  4BE2 A;  3CCE T;  5CCA A;  2R5M A;  4EPC A;  3G6E T;  2JOY A;  2DZ9 A;  2CGH A;  3RKW A;  4FSX A;  4PJO B;  3OYL A;  3L2W A;  3PT9 A;  2MWO A;  4JUV A;  1KQ1 A;  4R55 A;  1KHC A;  2K57 A;  3OS0 A;  2P4T A;  4V2S A;  3QDR B;  2PVG B;  3ASK A;  5CQX A;  1VQL A;  3CCV A;  3E1S A;  3CCJ T;  3X28 B;  2CYZ B;  2E10 A;  3CCS T;  2V8I A;  2VGN A;  3FRN A;  4BUG A;  2XDD A;  4KUL A;  1B34 A;  2I2L A;  3ZEH A;  3OYA A;  5GMK e;  1YJN T;  3CMA T;  1H3Z A;  2QQS A;  3JCM X;  4OGC A;  1YIJ A;  3GF5 A;  5HK3 A;  2ZPE B;  4UC4 A;  4L6V 5;  1UEB A;  5CKD A;  1K9M C;  3OYJ A;  3QYH B;  4C0D C;  1NJI C;  2YLC A;  3OMC A;  2E6Z A;  3FC3 A;  1K8A C;  3KUF A;  1KQS A;  3M57 A;  2EQM A;  4X34 A;  4QVD A;  2ZPF B;  3QXE B;  2FYK A;  1Q7Y C;  3X26 B;  2HNI A;  2X4W A;  1VQK A;  3ME9 A;  5L8R E;  2EYQ A;  3RUX A;  4XAX B;  2EWN A;  4ELY C;  3LWI A;  2P0P A;  3OW2 S;  5LJ3 h;  2XDP A;  3QII A;  4IUP A;  4M77 G;  2VUB A;  2KQW A;  3WXM B;  4C5I A;  1BIA A;  2C06 A;  3V8J A;  4C92 G;  4C92 A;  4A4E A;  3OB9 A;  4QW2 A;  1JJ2 S;  4J7F A;  5CKB A;  4PJO C;  3MEU A;  3VUB A;  3V7R A;  5FU6 B;  2IG0 A;  5AYF A;  4C8Q B;  2JTM A;  4ELZ C;  2LTO A;  4J8O A;  2RI3 A;  1M5Q 1;  2VXF A;  2LCC A;  1NPP A;  2K3X A;  4ZGJ B;  3LYI A;  1QVG A;  5GAO n;  4OP0 A;  1N6A A;  4M78 G;  4M78 A;  5CKE A;  1YJN A;  3UT1 A;  3CCR T;  3S3O A;  1QP2 A;  1YHQ T;  4ZTJ A;  3CPW S;  4XTW A;  3CCU A;  2E12 A;  3PMT A;  5LJ3 g;  3CD6 T;  1WPY A;  4RG2 A;  2K5I A;  2XIC A;  5A0G A;  4JDS A;  1QVP A;  5DLO A;  1VQM T;  1YIT A;  4M77 D;  4F7U F;  2E65 A;  3FB9 A;  1Y96 A;  2XID A;  2BIV A;  4C92 D;  4EMH A;  4QQG A;  3J81 E;  5LJ5 f;  2DD4 A;  2QQB A;  2QQ9 A;  2XDB A;  5DLQ E;  5GAO m;  4F7U B;  3MP8 A;  3OYG A;  4M7D A;  1X01 A;  3KBG A;  2HQE A;  3HFO A;  1Y07 A;  5GMK j;  3JCM c;  2KVQ G;  3ZBD A;  2JVV A;  3PFS A;  5FU6 C;  5LJ3 d;  3OYD A;  3L2Z A;  4PLL A;  4LDV A;  5D6Y A;  4C8Q C;  2O01 E;  2CZ1 B;  4ZN3 A;  1VQO A;  2XHC A;  1ZQ1 A;  2GF7 A;  2M16 A;  2DXU A;  2E64 A;  4QQD A;  5CK9 A;  4M78 D;  2H3J A;  3OYY A;  1LJO A;  2QI2 A;  3A5Z B;  4KUI A;  4OF1 A;  1VQ8 T;  5M9O A;  2Y4Y A;  4OGE A;  3RMS A;  2L3R A;  1O75 A;  3L42 A;  3OYN A;  4LDX A;  2XK0 A;  3F70 A;  2EJ9 A;  4D6W A;  3I56 T;  5GAO r;  2FVU A;  2RHZ A;  4FIB A;  3FLG A;  4XTU A;  3OYI A;  1WJQ A;  1B34 B;  3PMI A;  4MZP A;  1N8R U;  2X4Y A;  3UPU A;  1M1K U;  4QVZ A;  3QJ6 A;  1U1T A;  1W2B S;  3CME T;  1I4K 1;  1YHQ A;  4M75 G;  4M75 A;  1QVF A;  3G4S T;  1VQ5 A;  5A0D A;  2G3R A;  3QKJ A;  1AHJ B;  2X4X A;  3S6W A;  3UWN A;  2LVM A;  4ZTF A;  1QW1 A;  1FX7 A;  2RJC A;  5GMK i;  1W4S A;  3G71 T;  1M90 C;  1Q86 C;  1N9R A;  2K4Y A;  4BY6 B;  3MP1 A;  2F5T X;  4RCC A;  1VQP T;  2MMP A;  5DM7 R;  1IRE B;  5GAN 2;  1G5V A;  2IVW A;  4JRP A;  2ZPG B;  1FWZ A;  2F69 A;  3LX7 A;  4M7D E;  1UB4 A;  4M7A A;  4M7A G;  4XTZ A;  2DIQ A;  3JAM E;  4C5G A;  1HXD A;  4TVR A;  3M56 A;  2OTJ A;  3OA6 A;  1H64 1;  5HY6 A;  1KG1 A;  1P92 A;  5A0L A;  4GY5 A;  3NFC A;  3LGL A;  3GOX A;  2CKK A;  1W2B A;  2DEQ A;  4C0G A;  4M78 F;  2BUD A;  4RKU E;  4E7K A;  4O6J A;  2RJF A;  3JB9 G;  1S72 A;  2QTX A;  5GAN f;  4M75 D;  2EQU A;  3SDZ A;  4NL3 A;  2QEX T;  1YCY A;  2XI9 A;  3NTH A;  4C5H A;  4O5V A;  3GIB A;  5A2Q E;  4JJN K;  3FDR A;  4M78 B;  2OAU A;  3BFM A;  1VIE A;  2WSF E;  1XNI A;  4E7I A;  4ZGD B;  3DB4 A;  2L8D A;  1RL2 A;  3JB9 H;  4C8Q E;  4OB3 B;  3M4G A;  3JCM W;  3J7A F;  2EAY A;  1NPR A;  2YLB A;  3OYH A;  1G3T A;  1GXI E;  4BY6 C;  2XD0 A;  4M7D F;  2K2V A;  5D6X A;  1Y96 B;  5J26 A;  3NTI A;  4M7A D;  2QQA A;  3O8V A;  1KC8 C;  1LNX A;  4LDY A;  4E7L A;  2LQK A;  2M0O A;  3HSB A;  4XU0 A;  1VQP A;  3H6Z A;  3HRS A;  4PKC C;  5LJ5 j;  4KUD K;  4M7D B;  3JCM e;  1OI1 A;  3MO8 A;  3M55 A;  2NLU A;  3JB9 D;  4C0F A;  3M9Q A;  5HKC A;  4ZN1 A;  4BB7 A;  1G3S A;  2OTL T;  3PNW C;  1M1F A;  4QVC A;  4EMG A;  1Q81 C;  1G3W A;  5GAM h;  4HCZ A;  3CC2 A;  2JUF A;  3PGG A;  3QBY A;  4Y28 E;  3M59 A;  3S3M A;  3PTA A;  4M77 A;  2RHX A;  3JSC A;  4M75 F;  4C8Q F;  4F7U E;  4BE0 A;  3JCM J;  2R58 A;  3MCA B;  4M78 C;  3C95 A;  1D3B A;  4IUR A;  5CVI A;  3VYH B;  1VQN A;  5I21 A;  4JRQ A;  4L59 A;  5FLX E;  3CCE A;  3V8L A;  2DPP B;  1U8R A;  1Q82 U;  1VQ7 T;  2D6F A;  3SD4 A;  4KT0 E;  3G6E A;  4M75 B;  3OYC A;  1HK9 A;  3QZ5 B;  3OS1 A;  2LT1 A;  4A4G A;  1Q86 U;  4JS4 A;  1JRI A;  3QHS A;  3EFR A;  3CCJ A;  3CXC S;  3L2R A;  4ME7 A;  3CCS A;  4LD9 K;  4E47 A;  3CCM T;  1VQ6 T;  2DZC A;  5GAM g;  3CC7 T;  2DD5 A;  4MML A;  3CMA A;  4M7D C;  1R8O B;  3JB9 I;  4BI8 B;  1SSF A;  1YI2 T;  3HFN A;  4MDW A;  3TEE A;  2EKO A;  5CIU A;  4PLI A;  4DOW A;  3OW2 A;  2KK4 A;  2D0Q B;  2VGM A;  3LGF A;  4J83 A;  2E41 A;  5CKF A;  3SB2 A;  3SFM A;  5GAN 7;  4IUV A;  3TU4 K;  4HT9 A;  1Y71 A;  2JNG A;  4EMK A;  1MGQ A;  3TRE A;  4BI4 A;  2QXF A;  1JJ2 A;  3QYG B;  1KD1 C;  2GCX A;  3QO3 A;  2FL7 A;  4BE1 A;  1YBY A;  3A8M B;  2RO0 A;  3QJY A;  3V7S A;  5LJ3 f;  5GAM d;  3OS2 A;  3OSV A;  1YJW T;  3C4S A;  4XQ3 A;  2RD1 A;  3RES A;  5GAN j;  4HT8 A;  3QPH A;  3RKY A;  4A4F A;  2MAM A;  1WQ7 A;  4XTV A;  2EJF A;  3SWN A;  2Y4X A;  4C92 E;  4M75 C;  3CXC A;  3FJP A;  4N0A A;  5EG2 A;  2DTI A;  4PJO G;  4MDX A;  2DKG A;  1YJ9 T;  2LC4 A;  5CAI A;  4OMF B;  2D9T A;  1PSF A;  3URG A;  3CPW A;  4QQ6 A;  3QSU A;  3L2V A;  4N4I A;  3VUZ A;  4FT4 A;  5LJ5 e;  5IN1 A;  1I5L A;  4OB1 B;  1K9M U;  3H8Z A;  1NJI U;  1VQ6 A;  3L2Q A;  5GAO l;  3CC4 T;  3P8B B;  1VQ9 T;  4N4G A;  4M78 E;  3PIO A;  4FM4 B;  3CCR A;  1K8A U;  1VIF A;  4RMO A;  2GFU A;  2RHI A;  4GLK A;  3GNF B;  5GMK m;  3CD6 A;  1Q7Y U;  3CBM A;  3FEO A;  3GLX A;  5IT9 E;  2EFI A;  3ZFJ A;  1VQM A;  5I2S A;  4M77 F;  3J80 E;  5CQY A;  5C0M A;  1M8V A;  2R57 A;  2HD0 A;  4C92 F;  5GAN 5;  3CCL T;  2DTH A;  2LDM A;  2M1H A;  1I8F A;  2GFA A;  2LQ8 A;  2WSE E;  5LL6 S;  3I55 T;  3CCQ T;  5GMK h;  4PJO D;  5FU7 B;  2X35 A;  2F5K A;  4M77 B;  3HRT A;  4XTY A;  3E9G A;  3JCM h;  3BDU A;  1D3B B;  5I2M A;  4B9X A;  3GPL A;  4A4H A;  3RIR A;  2CS7 A;  4C92 B;  4RCB A;  2EIF A;  5GMK l;  1BI2 A;  3OYK A;  1KQ2 A;  2RHY A;  4E7H A;  2KSS A;  5J3B A;  4HA8 A;  2QDY B;  4CRI A;  4ZGE B;  3M58 A;  5CR2 A;  1V29 B;  3VYG A;  5GAO p;  1VQ8 A;  3HRU A;  1XQH A;  4WF2 A;  4NL2 A;  2YHT A;  4Y91 A;  2KMT A;  2EQJ A;  3I56 A;  3E19 A;  5KH6 A;  3VJP A;  5FRN A;  4EDU A;  3QUI A;  2VV5 A;  3OQ5 A;  3RER A;  2EJG A;  2A7Y A;  4DOV A;  2PU9 B;  3NTK A;  4OVA A;  5GAN 4;  3CME A;  3A8G B;  3E9F A;  3M54 A;  3P8D A;  1BYM A;  4HCC A;  2RB6 A;  3BDL A;  2VC8 A;  2L5Q A;  4M75 E;  3G4S A;  4DQ2 A;  3N5B B;  1KD1 U;  2E70 A;  5FRO A;  2RK1 A;  4II1 A;  2CZ6 B;  2FHD A;  4B9W A;  3RMQ A;  4C0Z A;  5IAY A;  4HCB A;  4EMK B;  2HAX A;  2B8A A;  1X75 C;  5KCH A;  3G71 A;  5FU7 C;  5GAN e;  3OYE A;  4IKF A;  4A4K A;  4M77 C;  3HP9 A;  1VQ9 A;  3HL8 A;  1G3Y A;  3C12 A;  4F7U G;  3I55 A;  3OYM A;  4IUU A;  1KQS S;  2HBP A;  2RK2 A;  3OSS C;  4C92 C;  5LJ3 j;  2X4J A;  2LCL A;  1M9S A;  1VUB A;  4J6Y A;  2JN0 A;  3BW1 A;  3SWN B;  4M7A E;  3HKS A;  5KE2 A;  1TH7 A;  4C5E A;  2RHU A;  3WVD B;  4A54 A;  1MHN A;  3P8H A;  3JCM d;  1BI3 A;  4VUB A;  3LH0 A;  1NE8 A;  1WNL A;  2DXC A;  1WGS A;  2E1H A;  2RM4 A;  1ZHI A;  1RI0 A;  3A8H B;  3G7Z A;  3OBY A;  4XU3 A;  4XU1 A;  2LT4 A;  3JB9 F;  2RJD A;  4LD6 A;  3MHX A;  2ZCF B;  2DVE A;  2QEX A;  2O4X A;  3BY7 A;  3CPF A;  3JB9 J;  3L2U A;  2LNV A;  2V8J A;  1PSE A;  1BI0 A;  2DTO A;  3CCU T;  2P0Q A;  3PIP A;  1M4Z A;  1N8R C;  1U1S A;  1WJS A;  4X9D A;  4A53 A;  1M1K C;  1DJ7 B;  1YIT T;  1UGR B;  4XTX A;  2RA2 A;  4JRK A;  2AHJ B;  4EMK C;  4FL6 A;  1M90 U;  2ZZD A;  5GAO q;  1QVG S;  4OB0 B;  3T9N A;  2YRV A;  1K73 C;  2RI5 A;  2JZ2 A;  2VXE A;  5GAN 3;  2KY9 A;  2QQR A;  4NS5 A;  4XU2 A;  4RG8 A;  1WJR A;  4M7A F;  2XU8 A;  5LJ5 h;  2KAF A;  3M4Y A;  3OY9 A;  4BDY A;  4FT2 A;  2DAQ A;  5J39 A;  4N4H A;  2RI2 A;  2MWP A;  3X25 B;  3ER0 A;  3GNG A;  4JLI A;  1O9S A;  2CZ7 B;  3VKI A;  3CEY A;  4BAC A;  1ZBX A;  3SWN C;  2DIG A;  2FB7 A;  3JRZ A;  2MI6 A;  4N0A C;  2QA4 T;  4PNO A;  4M7A B;  1VQO T;  3QG1 A;  4IUQ A;  1QP3 A;  1KHI A;  1BIB A;  1X6O A;  5HK0 A;  5D6W A;  1FXX A;  2OTL A;  5GAM f;  4MMK A;  2HQX A;  3C94 A;  3V7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...