5DY9A

Y68t hfq from methanococcus jannaschii in complex with amp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDTIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hfq-like protein
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Rna binding protein
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dy9A00
4QVDA 3RKXA 1M5Q1 2RM4A 3FB9A 1LNXA 4M75F 3V8KA 4M78B 3JCMf 3PGGA 4PNOA 4WF2A 1KQ2A 3JCMd 4M7AG 4XTYA 5GAMh 5GANh 2EAYA 4X9DA 1YCYA 3RKWA 5LJ3g 4N0AA 2RD1A 4C92A 1H641 1JBMA 4M78D 3SWNC 4HT8A 2RA2A 3JCMX 3RESA 2K57A 4PJOE 1D3BA 4F7UA 1LOJA 1Y96A 4PJOF 4F7UF 5GAN2 3QHSA 4M78C 3JCMQ 3V7SA 4X9CA 4EMGA 4M77B 1N9SA 4RCBA 4EMKA 2DTOA 5LJ5j 5GAOl 3M4GA 4XTUA 5GMKh 1JRIA 1U1TA 3AHUA 1MGQA 4M7DB 4J6XA 2DTIA 4C8QB 4M7AF 3V7CA 3JCMg 2JN0A 4M77D 4XQ3A 2YLBA 5LJ5e 4J6YA 2EJ9A 4M75A 5DY9A 4MMKA 4XTZA 4J6WA 5GAMj 5GANj 4XU2A 3JCMP 2CGHA 3JCMJ 1KQ1A 4M77C 4XU1A 5GAOr 1N9RA 4JUVA 4C92B 2VC8A 5GAN8 4OP0A 5GAMe 1HK9A 1LJOA 4M78G 5LJ3h 5GANe 3RERA 4V2SA 3BW1A 2EJFA 5CAIA 1D3BB 2I2LA 3L1AA 4F7UB 5GAOm 3JB9D 3QO3A 3L2ZA 1Y96B 4C92D 5GAOn 4PJOA 4QVCA 2DXUA 2RB6A 2DEQA 5I21A 2EWNA 4J5YA 2VXEA 4EMKB 5GMKj 5LJ5f 3JB9J 2EJGA 5LJ5d 4M7AA 1I8FA 2DXTA 2VXFA 4N0AC 4XTWA 4C92C 3FJPA 4XU0A 4A54A 4HA8A 4M78E 3JCMV 5GMKe 4M77G 1B34A 2DZCA 3SB2A 1BIBA 1TH7A 4M75B 4M7DD 3JCMh 4XU3A 4M78F 4JRKA 3JCMc 3RKYA 4C8QD 4C8QG 5GAMf 5GANf 5GAMd 5GANd 4EMKC 4NOYA 1WNLA 4M75D 2ZGWA 4DQ2A 5LJ3j 4M7DC 2DTHA 4C8QC 2DZ9A 5GMKm 1WPYA 3RIRA 2FYKA 1I4K1 5LJ5g 2HNIA 3INZA 5GAN6 4M77E 4PJOB 3JB9G 1WQWA 4M75C 4C92G 5LJ3e 1X01A 3HFOA 4M7DE 5GAN5 4MMLA 4C8QE 4M77F 2DJZA 2YLCA 5GMKl 4XTXA 2YHTA 3SWNA 4PJOD 4M7DG 4M7AB 4JLIA 3FIFA 3JB9I 1M8VA 4A53A 5GAMg 5GANg 5GAN7 3VU3C 3JCMW 4HT9A 2DVEA 1B34B 1U1SA 2Y90A 4M78A 3V8LA 4M7AD 3JCMb 5GAN3 4PJOC 4NL2A 2DKGA 3V7RA 4EMHA 4C92E 5GAOp 1BIAA 2E65A 1HXDA 2QTXA 3JB9F 3JB9H 3JCMe 4JRIA 4C92F 3RUXA 4M75G 4M7AC 4F7UE 5GAOq 2E41A 5LJ3f 3QUIA 3V8JA 5LJ3d 5GMKi 2FB7A 2E10A 3HFNA 1I5LA 4XTVA 4M7AE 4M77A 3EFSA 4NL3A 3BFMA 3EFRA 1WQ7A 5LJ5h 1I81A 4Y91A 5GAN4 4M7DA 3BDUA 3SWNB 4C8QA 4RCCA 3HSBA 2E64A 4PJOG 2E1HA 4F7UG 3BY7A 4C8QF 3QSUA 3GIBA 4M7DF 4M75E
chains in the Genus database with same CATH superfamily
4BB7A 2DETA 4M78B 3OA6A 2YUPA 1K73R 1VQ5A 4LDWA 3HRTA 4AG1C 1M27C 2D0NA 1ZA2B 2A0FB 1QVGA 1H641 1O75A 1SRLA 2JS2A 2HZYA 1YNZA 2LNHB 2RQUA 1LOJA 3S3OA 3V7SA 4EMGA 4M7AE 4RCBA 1X6OA 4RTVA 3M4GA 3CCQT 4M7DB 1VQPQ 1YITA 1Q82U 2E3HA 1BI1A 2KYBA 3VV0A 1CKAA 1Q7YC 4JPBW 5GAMj 2KT1A 4XU1A 2AKKA 2CZ6B 2X51A 4A63B 3OYLA 1ZUYA 1TUDA 4F7UB 2FZKB 3H41A 5CKEA 1ZHIA 1E6GA 2HBPA 5FU6B 2DXUA 3FJ5A 1OZ3A 5LJ5f 4Y92A 4KGVB 1N5ZA 4XTWA 4XU0A 4AFZC 1N8RU 3JCMh 4E47A 2YXYA 4JRKA 4C8QD 2FPEA 4PJMA 2HQXA 1NEBA 4L5GA 2IG0A 2O2OA 5KYXB 3CCVT 5FWCA 2LC4A 2DD5A 4C5EA 3TREA 1VQ6T 1ZX6A 4PL6A 1P92A 4M77F 2KT8A 2DVJA 1R8OB 4PJOD 3HRUA 1ZLMA 1Y57A 1JQQA 1Q95G 5I2MA 3PIPA 3MEAA 1JU5C 1YI2T 2QQAA 1OX8A 4M78A 3OS5A 3VRZA 1RAGB 3G6ET 1W4SA 2DKGA 2X4YA 4J9CA 1U8RA 2O9SA 1NEGA 2FG0A 4ORZA 4HCBA 1M3AA 3GBQA 1KQSP 2E41A 5GJVB 5LJ3d 4GLKA 1ZBXA 1VQ8T 2OI3A 3G4SA 2KYMA 2E4HA 2K4YA 3EFSA 4LXCA 2GQIA 4M7DA 1QVGS 1WI7A 1NPRA 3CCST 1NYGA 2R57A 4L6V5 5ECAA 1X2QA 3V8KA 1Q81C 4GLMA 1I1JA 3TU4K 6AT1B 1I07A 4J7IA 3SFMA 4OMPA 2KROA 4BY6B 3P8DA 4FYYB 2LT1A 3LX7A 4CC3A 4F7UA 1W1FA 3MP1A 1TTHB 5IXBA 4M4ZA 5CCAA 2CZ7B 1VQMQ 1N9SA 4Q5WA 3AHUA 1YCSB 3GPLA 1BI0A 4R56A 2Y4YA 3G1JA 4KH1B 5LJ5e 2DIGA 4J6YA 4GY5A 4OMMA 1X43A 2PVDB 2RHIA 4OP0A 3A5ZB 3CPWA 4M78G 5KYXA 1VQOA 4IIOA 1QVFP 4QVZA 1WHKA 2GNCA 2GFUA 1G3YA 3EH2A 2K6DA 4C5GA 2VXEA 2EJGA 1VIFA 1MMGA 2SRCA 2VGMA 3ULRB 3CC4T 3OYFA 3I55A 3NGPA 3UDCA 3UPUA 1VQKT 3NMZC 3SB2A 4M75B 4M7DG 3PMIA 4A4HA 1M1GA 4HKEA 1WNLA 3G7ZA 3OBWA 2ZGWA 2FZCB 4E6RA 1N27A 2ROTA 1U5SA 2DMOA 3E2UA 1W6XA 4J8OA 2OAWA 2FHDA 2YLCA 3CC7A 3GNFB 2O4XB 3JCMb 3FC3A 4FW1A 5CKDA 3UA7A 2XDDA 5A0DA 4C92F 3H0FA 1SRMA 3CCUT 3CCET 1M3CA 2E10A 1UGPB 2L0AA 4FL6A 1UHFA 3HFNA 3KUFA 1MHNA 2PNIA 3PE0A 2P0QA 4AMCA 2FL7A 2V8KA 5LJ5h 5GAN4 1N6AA 3CCQA 1UJYA 4BI8B 2E1HA 3M53A 3QZ5B 2ZAEA 2JJ9A 1VYTA 3OSSC 2RHXA 4OB0B 2RA2A 5HCKA 5GJWB 4RTZA 1VQ4T 4KULA 2DTOA 3DKMA 2X4XA 2D8JA 2HSEB 2EGEA 2KY9A 2FPDA 4M75A 3MP6A 1YJWQ 4L59A 2J7IA 5IXFA 2CSQA 4WCIA 2DEUA 1D0ZA 1QMCA 3JCMJ 5EG2A 3X20B 4IUTA 3CCVA 4OGCA 4FSSA 2QGGA 2L2PA 1WHMA 2CH4A 2HL3A 1SPKA 5CR2A 4JRPA 2DNUA 5I21A 4VUBA 2JT4A 3CXCS 1SG5A 3PIOA 3KBGA 5HK0A 4Z89A 3RMSA 4DA4A 4DBHA 3M55A 2O4XA 4OB2B 3HKSA 1QP3A 3CMAQ 4EMKC 2KAFA 1RAIB 1FMWA 1NYFA 5LJ3j 2QQRA 1M90C 3CCRT 2P0PA 1VQ8A 3INZA 4PJOB 4M77E 3UWNA 3HFOA 2RK2A 1ABOA 4XTXA 4AFUC 2RN8A 1A0NB 3LW5E 3CCSA 2F1LA 5GAMg 3CD6T 1YJNQ 2AZVA 2BUDA 1WX6A 2KRNA 4JZ3A 3M0RA 1VQ9Q 2MOXA 4M75G 1OV3A 2HAXA 2GF7A 2BZXA 1LVKA 1YP5A 4Z02A 2YSQA 1IXDA 2ZPFB 3NTHA 2HD0A 2EFIA 5D6WA 5D6XA 4LUDA 4RCCA 4E7SA 3QSUA 2B86A 2HQEA 5FROA 4HXJA 3WXMB 1QWEA 2O31A 1N8RC 1Y7XA 2FZGB 4N0AA 1Y71A 4RTYA 5KH6A 2MMPA 1IGQA 1RAEB 2JTFA 3MHXA 4J9GA 4DEXA 1NLOC 1JRIA 2ZPGB 3CC4A 3M54A 3G71Q 1X6BA 2EJ9A 1V1CA 3QDFA 4RUGA 1M1KC 1VQNT 4Z88A 1ABQA 2EKOA 5FU7B 1Z9ZA 3VUZA 5GAN8 1GXIE 2OTLT 2K2VA 4FYWB 5I22A 2F2XA 4PJOA 3LYIA 2HSPA 3CCJQ 2F69A 2YRCA 1HSQA 3GF5A 1GBQA 1VIEA 1QVGP 2KRSA 1KC8R 1WHJA 4N4IA 3S6WA 2GGRA 2AK5A 3C94A 2P4TA 4M7DD 2DL4A 8AT1B 3C4SA 5GANd 3NTIA 3TQ7P 3MJXA 3CC2A 1SEMA 1H3HA 1IGUA 2L89A 2D1XA 4B6MA 1TS9A 3CCEA 3UF4A 2LCLA 2D9TA 2EYZA 2C06A 1QCOA 4C8QE 3DB4A 3JB9I 3X24B 1RABB 4RTWA 1RADB 3A8MB 5D7UA 1VUBA 4RTUA 4C92E 1R0CB 2K3BA 4QW2A 1QW1A 2ZPEB 4M7AC 1VYUA 3H8ZA 2QXFA 1SHGA 2RI5A 2DRKA 1BYMA 2CH4W 4PJOG 2MWOA 1SSFA 4X34A 1M90R 3JRZA 3I5RA 1M1FA 2KXDA 3PGGA 2LQWA 1T3LA 2LVMA 3CMEA 4BE2A 1XTDA 2DLPA 2ABLA 2YWWA 2A36A 2FO0A 3JCMQ 2ZPBB 2F5TX 4J9HA 3LLRA 4FM4B 3S3MA 2XKOC 1YIJQ 4C0GA 2KK4A 4HVUA 1GCPA 1OPKA 1JEGA 3H0HA 5GAOr 4F14A 4ME7A 4II1A 1NZ9A 4PJNA 3M4YA 3BW1A 3CCRA 4J9BA 2K5IA 3L2ZA 1ZUUA 3SDZA 1BB9A 2HMAA 1IO6A 2EYXA 1VOMA 4IUVA 3LGLA 1KD1C 1YJ9T 3JCMc 4M78F 1WJSA 5J39A 4IUQA 5GAMf 5EC7A 4LE9A 2A28A 4BACA 2PVOB 3TCJA 2JM8A 2V1QA 1Y07A 2DO3A 4DBQA 2VVKA 1YHQQ 1QQJA 3OYAA 2PVGB 2HNIA 1UB4A 4PKCC 5GAN6 2DPPB 3Q1JA 3L2WA 1M1KR 2QA4Q 3OYDA 2CZ0B 3PT9A 2M0OA 4BUGA 2DVEA 4DOWA 1GL5A 1QKXA 1RI9A 2EQJA 2PZ1A 3QG1A 4JRIA 3RUXA 3CCMA 2V8IA 5GMKi 2O01E 3I56T 4F16A 1OOTA 1ACMB 2YUOA 1TSFA 3A8GB 5IN1A 3CXCP 1WQ7A 3L2QA 1G83A 2QQSA 3M0SA 2PUKB 3META 1XOVA 2RM4A 2K3YA 4ANJA 3OYNA 1KC8U 1VQNA 4D8DA 2VWFA 3ZL7C 5LJ3g 2HL5C 3QXEB 4J9IA 2L8DA 2M16A 2R5MA 1NE8A 4PJJA 3DB3A 3OYGA 3H9NA 5GAN2 4Z8AA 4MZTA 2RJCA 2DTIA 4LDUA 3NHNA 4ESRA 1TWBA 3CC7T 4RG2A 1MMNA 3BE3A 4J6WA 3OS2A 5GANj 3OYCA 4E2FB 1PKTA 5GAMe 4LD6A 2AIRB 2XI9A 2FVUA 3M9QA 4AG2C 3OYKA 4QVCA 2E70A 1Q86U 1MV3A 2DK3A 3JB9J 4C0DB 1I8FA 2VXFA 1IB8A 1VQPT 1AWOA 2ED0A 1MNDA 3OSVA 3OYBA 2DZCA 4JJCA 4FIBA 5FLXE 1UUEA 3RKYA 1FWZA 5IH2A 3X25B 1G3TA 2DL8A 1K9MU 3OS1A 3QJYA 2OX7A 4OMNA 3ZEHA 3J7AF 1EIFA 1TG0A 2XU8A 3R6OA 2V8JA 2ED1A 2DL5A 4JZ4A 3FIFA 1NJIR 1UJ0A 5IT9E 2ZPIB 2FEIA 2MF2A 2DE0X 4FT2A 5CQXA 2DF6A 2COYA 2ENMA 1KD1R 2O9VA 2VB6A 4YTLA 2RI2A 5DM7R 2DAQA 2XDBA 1WHGA 2NUZA 2CUBA 2EBPA 4M75F 5AT1B 2OTJA 5GAMh 1MNEA 3EHQA 2EAYA 2A08A 2QTVA 1PWTA 3GOXA 5CK9A 2M51A 1VQ6Q 3D7SB 1IHWA 1RLPC 4PFOA 3RNJA 4OMFB 1U1TA 1YI2Q 1GFCA 1PHTA 1GBRA 4B9WA 2JS0A 2QQBA 1K8AU 3G6EQ 2L3SA 1X69A 1YJ9A 4JS4A 4JJDA 1PD0A 2FRYA 2CP6A 3M0TA 3JAME 2CGHA 3PVLA 2QAZA 5A0GA 4M77C 1KFZA 1N9RA 2VC8A 2JM9A 2C0TA 1U3OA 1D3BB 3JB9D 1M2OA 1RUWA 3QWXX 3S3NA 3ER0A 5GMKj 1VQMT 2BE7D 4CI0C 4M78E 3JCMV 1D0YA 2RQVA 3T9NA 4Y28E 3A8OB 3JSCA 2LX7A 2J6FA 3I9QA 2E6ZA 3EG2A 5IAYA 2X9HA 2DZ9A 3MEUA 5GMKm 3I56A 4E7KA 3PFSA 2JNGA 4M7DE 3OYIA 2EYWA 4JLIA 1B3QA 3LH0A 2E3IA 4IUUA 2H3EB 1CKBA 4EDUA 2WSCE 3BDLA 4NL2A 3CXCA 4AFQC 4F7UE 5LJ3f 1K73U 4DBRA 1TU0B 2KGTA 3JV3A 3M0UA 1Q7YR 4F17A 1AWJA 3OY9A 1VQKQ 1OZ2A 4F7UG 4C8QF 5IHIA 1C1AA 3M57A 3RKWA 4EIKA 2ROLA 1UHCA 2I0NA 3CC2T 1PCXA 3EG1A 1S72Q 1D3BA 5FW9A 3PVQA 4PJOF 1IREB 3EFOB 2KEAA 3VJPA 1MGQA 1D0XA 2QDYB 3CCLQ 1VQPA 3E9GA 1K76A 2GBQA 2PQWA 2YRVA 1NJIU 4OB3B 1OQKA 1QLYA 3CBOA 4CRIA 5L8RE 4LN2A 2R58A 3CCUQ 3OQ5A 4ZNXA 2I2LA 3QO3A 2XDPA 1K0SA 2M9UA 4J9EA 9ATCB 4C92C 1IRXA 3GLXA 1FMVA 1TXQA 2NYSA 4XU3A 1YJWT 2M02A 3EGUA 2G3RA 2DBMA 4NOYA 2ZZDA 1U06A 3CMET 1ZUKA 4IIMA 1XJWB 4MZPA 1WPYA 1VQ4Q 4XAXB 2HKNA 1WDXA 3VS5A 3C0CA 5LJ3e 4FT4A 1WIEA 2DJZA 1Q81R 2PTKA 5GANg 1AOJA 2KBTA 4M7AD 1M4ZA 1BIAA 1AWXA 3CMAT 2KDSA 1VQLQ 3IQLA 1ZSZC 2RJFA 3HPWA 3EFOA 3CC7Q 3GP8A 2D0QB 1TUCA 3O5ZA 4IUPA 3VS6A 3HSBA 2E64A 2RF0A 4M75E 3L2VA 1Q82C 4IURA 1KQ2A 1W2BA 3A1PA 3R6NA 1KHIA 1WGSA 1WXUA 3M0QA 2DYBA 1VQ9T 3JCMX 2LQ8A 1K9MC 4KBMB 4DBFA 4C5HA 5I11A 2QASA 2KI7A 1VQMA 3CD6Q 4KH0B 1JXOA 2EGCA 2MAMA 4XTZA 3RR6A 1RI0A 2RO0A 3QYGB 2XMFA 4MDWA 4ZTFA 4JUVA 1HK9A 4CC2A 1PC0A 5LJ3h 3CCMT 3UA6A 1ARKA 5GAOm 1KG1A 1RACB 3I5SA 2DBKA 2RB6A 4EMKB 3ZFJA 4JDSA 2X4JA 1O9SA 3G71T 1KK7A 3MPUB 4D6WA 2PUOB 4BI4A 3U23A 2A7YA 2DTHA 2MI6A 2CP3A 5J26A 5FRMA 1K9AA 1QWFA 1KHCA 2O88A 2IIMA 2HDAA 1WZOA 1M8VA 5CKBA 2LDMA 3RBBB 1YWPA 2K9GA 2Y90A 1SSHA 2RMOA 3V7RA 1VQ7Q 3FDRA 1RLQC 2EQMA 2E65A 2OTLQ 3LGFA 8ATCB 4KRTA 4ZN1A 1HD3A 3A98A 3ASKA 3F70A 3VS7A 1W2BS 2RK1A 1AZGB 2QEXQ 4Y91A 1T0HA 3BDUA 4O6JA 2LX9A 3BY7A 2LMJA 2H3JA 3RKXA 1M5Q1 2EGAA 1D09B 2E5QA 1VQ5Q 4ZN3A 4OB1B 3JCMd 3HHTB 1B07A 1AEYA 4OGEA 3SWNC 1IHVA 4PJOE 2RQRA 5C6SA 4PFZA 4X9CA 4EMKA 1IZ6A 3FRNA 2CUDA 5KCOA 5GAOl 1YITQ 2AT1B 1Q81U 4XQ3A 3OYEA 3L2UA 1YJWA 3JCMP 1LPLA 4D8KA 3MKDA 3P8HA 3J80E 2DFUA 2LJ3A 1I0CA 1Q82R 5L23A 2EWNA 1TUGB 4BDYA 2JUFA 2XG8D 4HA8A 4HCZA 4IKFA 5GANf 2GTJA 4C0FA 2OTJT 1JB0E 3MO8A 1M3BA 2WSEE 3N5BB 3CMAA 1OU9A 4FYXB 2COZA 2P84A 3JB9G 2VUBA 3EGDB 4M7AB 1N8RR 3HP9A 2W0ZA 2G6FX 4A53A 5KYUB 2EVRA 1YJNA 2VKNA 2KMTA 4FSXA 1SHFA 5CKHA 2KQWA 1VQ9A 3G4SQ 3E9FA 1JO8A 1GFDA 1BKBA 2RI3A 2EIFA 4NL3A 4NS5A 3RMQA 2QA4T 1WJRA 4M7DF 3OYYA 5FWBA 2QI2A 3VS2A 1YWOA 3UATA 4JJNK 4LD9K 4N4HA 5LL6S 2J6KA 3REAB 1X2KA 1NPPA 3CPFA 2RD1A 2CS7A 3RESA 2KVQG 4OMOA 5M9OA 2F2VA 4F7UF 3QHSA 4M78C 3OYMA 3X26B 2P0KA 3V7CA 2LTOA 4M77D 1X75C 1WYXA 1C0MA 2DD4A 3G71A 3SHWA 2VGNA 1MMDA 2CSIA 2DM1A 2RQTA 2MWPA 1VQOQ 1OEBA 3P8BB 2K3XA 1D1BA 5GANe 2QG9B 2L3PA 3ZBDA 2EJFA 4PK4A 1Y96B 3FLGA 3CCJA 3EGDA 5LJ5d 3I55Q 4M7AA 2QDLA 2FRWA 5IHKA 3OMCA 5KYUA 2YDLA 2CZ1B 3PTAA 2NWMA 1RAHB 1WHHA 2Z0WA 4E7ZA 3EG3A 1MUZA 1UTIA 1BBZA 3RIRA 3O8VA 1I4K1 1K4US 2DERA 5HKCA 3M0PA 1AHJB 2NUPB 2HKQB 1NLPC 1U1SA 2X3WD 4B9XA 1CSKA 4QQ6A 3HTRA 4EMHA 5GAOp 2EYYA 1M90U 2CT3A 5HK3A 2LCSA 3H0IA 4OMQA 1F1BB 3CCQQ 4WTOB 3NFCA 1BI2A 2C0IA 1R0BG 2VYTA 4ELYC 4TVRA 1G3WA 2HCKA 4M7AG 5GANh 2A37A 1VYVA 1UGVA 1WXBA 4RG8A 4HT8A 3VYGA 1KSWA 5CO7A 1Y96A 3M58A 4ELZC 5KYNA 2JTEA 4BY6C 2LZ6B 1T0JA 2DRMA 3CBPA 2EW3A 4MMKA 4K11A 1YIJA 4R55A 3VUBA 2YUNA 4C5IA 1KQ1A 1DJ7B 4A4KA 3CCVQ 4X1VA 3WVEB 2JMAA 2V1RA 4FCYA 1PSEA 2L3RA 3L1AA 4C92D 1W2BP 3VS3A 1JJ2A 4HCCA 3THKA 1M1KU 2NUPA 5GMKe 4KGZB 2JOYA 1BIBA 1M2VB 1D1CA 2F5KA 1VQ8Q 2CP5A 2IPOB 5I2SA 1QCNA 1YHQA 4PJLA 4M75C 1JXMA 1X01A 3MEVA 1M9SA 4RTXA 5A2QE 2F2WA 3EG9B 1WA7A 2YHTA 2QA4A 4OMLA 3CCSQ 5CVIA 3VRYA 3OYHA 3LH5A 2BIVA 2L5QA 3V8LA 4XK8E 5GAN3 3SEMA 1EX4A 2RH2A 2HQHA 4E7IA 2CKKA 3AT1B 1FMKA 2DL3A 1FYNA 2LT4A 3NPFA 1NM7A 3OYJA 4XTVA 2QK0A 5KYWB 4AFSC 2XIDA 1I81A 1G8XA 2J05A 4BI3A 2V26A 2EYQA 3KFVA 1RAFB 1PSFA 4GBQA 4QQDA 4PNOA 1XNIA 4DEYA 1C6VX 1G3SA 4JRQA 1JBMA 4DOVA 2RQWA 1J3TA 2DX1A 2XD0A 3E19A 2VASA 2MCNA 3OW2A 2BZYA 4A4FA 2LCCA 4M77B 5LJ5j 1K1ZA 2XHCA 5GMKh 3CC4Q 2XICA 1OX9A 1HYOA 1S1NA 4QQGA 4ZGDB 4FU6A 1UFFA 2WSFE 4XU2A 1M2VA 1OPLA 2RPNA 1JJ2S 2EQUA 1GCQC 4E7LA 3TSZA 2KE9A 1UG1A 3FEOA 5CAIA 1XQHA 2CP2A 4EPCA 1S72T 4R0KA 2LQKA 2LP5A 5KE3A 2DEQA 3EG9A 4J5YA 3DLLA 2KXCA 3EH1A 2W10A 2K79A 4N0AC 3TVTA 3CCLT 4J9DA 1ZSGA 1UGRB 2XK0A 4F04B 2KR3A 4UC4A 2BTTA 1AD5A 3CC2Q 2ESWA 2JW4A 1Y0MA 2COWA 2LQNA 4C8QC 3CCEQ 3CQTA 3QYHB 1B7TA 5AYFA 5KYWA 3VS1A 1KIKA 5GMKl 2RHZA 2C0OA 1KD1U 2ECZA 1AT1B 4OVAA 2M0YA 3JCMW 4HT9A 4PJOC 2HEQA 1OYXA 1QVPA 1BCOA 1HXDA 1TOVA 2X4WA 1KC8C 3JB9F 3JB9H 1X27A 1X6GA 4JS5A 2J6OA 2CP7A 1AWWA 1H92A 2MIOA 2ZPHB 4M77A 4QKUA 5CQYA 3CPWS 3OBYA 2B8AA 1KJWA 4QVDA 2DILA 3OW2S 3CMEQ 2KRMA 4E7HA 2GQVA 2AHJB 3RDVA 4JJBA 3QDRB 2RHUA 3QKJA 1H3ZA 1VQLT 3ME9A 2DXBA 1VQ6A 2K2MA 3C12A 3KXTA 4XTUA 4J6XA 4C8QB 1Q86C 3JCMg 2D8HA 3HRSA 1YI2A 5FRNA 5DY9A 3G6EA 2DJQA 1YJNT 1ZQ1A 2MK5A 2RJEA 2AKLA 4C92B 3QPHA 3TSWA 3CCRQ 3RERA 5D6YA 4V2SA 1V76A 3H6ZA 4PLIA 1E6HA 5KCHA 1QKWA 3EG0A 2KSSA 4N4GA 3NTKA 4KUDK 1RAAB 2ZCFB 5FU7C 2P4RA 2CP0A 4A54A 1KQSA 1SKUB 2MYSA 5J3BA 2D6FA 5DLOA 1FX7A 4M77G 3REBB 3EGXB 4E7JA 2CREA 2RJDA 4O5VA 4BE1A 4A4EA 4KUIA 2RNAA 4MZMA 3TEEA 2FYKA 1Z9QA 4HVWA 3WVDB 1GCQA 4JLGA 4FW2A 2L3QA 2JZ2A 4J7FA 2E6NA 4A4GA 2JTMA 1Q7YU 1ZSZB 2LJ1A 1WXTA 1M30A 4AT1B 5DLQE 3CCMQ 2MPXC 2K5LA 2EPDA 3X28B 5GAOq 3V8JA 1OI1A 1OULA 1BK2A 3HL8A 5IHNA 1MMAA 3CCJT 3GIBA 4C8QA 2ATCB 7AT1B 1VQKA 1UE9A 1QVFA 3FB9A 1BI3A 1VQNQ 1PKSA 2JMCA 3QJ6A 1E7OA 4WF2A 4LDYA 1K8AC 2X35A 3L2RA 2R5AA 4X9DA 1YCYA 1VQ7T 3E1SA 1HJDA 1YN8A 4C92A 4M78D 1S72A 1H8KA 2NUTB 4MDXA 5KYYB 2VV5A 3OB9A 2QEXT 2BE9B 4PLLA 1OU8A 4M7AF 3C95A 3LWIA 4CC4B 2JN0A 3CCLA 2YLBA 2J06A 2IVWA 2LJ0A 2CT4A 3UT1A 3EGXA 2K7AA 1VQ5T 1I5OB 1PD1A 3M56A 1ZA1B 1UGQB 2JXBA 4RMOA 2DL7A 1LJOA 1KQSS 3GNGA 3CCUA 5KE2A 2CDTA 5GAOn 1V29B 1YITT 2HBWA 2QYZA 3FJPA 1BCMA 1AZEA 1ZSZA 1QP2A 1TH7A 5CKFA 4C8QG 2GCXA 3DLMA 4J83A 5GAMd 1YFNA 1WLPB 3I35A 5C0MA 4DQ2A 1WJQA 1PG5B 4CC7A 1Q86R 3MEWA 1T3SA 1NG2A 4QT7A 5LJ5g 1K73C 1VQ4A 3PMTA 4C92G 4HVVA 2EQKA 3QIIA 4KT0E 3OS0A 4OF1A 3OMGA 5GAN7 3PNWC 1B34B 4BD3A 1K9MR 2E5KA 1YIJT 1JJ2P 2SEMA 5CIUA 4RKUE 1QCFA 2K5FA 3QUIA 2DYIA 2KNBB 4ZTJA 1VQLA 2YT6A 1QVFS 2NUTA 1I5LA 5KYYA 2X3XD 3EFRA 2E12A 3VYHB 3J81E 1WFWA 1WHLA 3SWNB 1YBYA 2BKDN 3A8HB 2M1HA 3EHRA 2OTJQ 1LNXA 2YUQA 3JCMf 3MP8A 4HCKA 4XTYA 1NJIC 4LNPA 1K0XA 1BU1A 1MV0B 1UEBA 4KGXB 3QWYA 4LDXA 2K57A 3G4ST 1G5VA 4ZGJB 1YHQT 3MCAB 1RL2A 3VS4A 2CYZB 2QQ9A 1PM3A 4LUEA 1YJ9Q 2BZ8A 3CD6A 2OJ2A 1UGSB 3A8LB 1W70A 5HY6A 3SD4A 2LNVA 2OAUA 3URGA 5A0LA 3EAEA 1PRLC 1D1AA 3VKIA 1NBEB 2QGFB 2GFAA 3QBYA 1GRIA 2AZSA 1K8AR 1M8MA 3L42A 4LDVA 2LRQA 2DXTA 3CPWP 4PFPA 2EQIA 1EZZB 1B34A 2DXCA 3OW2P 4ATOA 4M75D 4C0DC 1ZBJA 2EKHA 4ZGEB 4M7DC 1G2BA 3I56Q 1VQOT 1R77A 1WQWA 1UDLA 5GAN5 4MMLA 1AVZC 2FPFA 3SWNA 4C0ZA 3I55T 1FXXA 2PU9B 4BDZA 4FYVB 3VU3C 1PNJA 2NLUA 1LCKA 3CBMA 3CEYA 3QZ9B 2Y4XA 1UECA 5FU6C 1VQ7A 2A3LA 2QTXA 4RTTA 3JCMe 2OTLA 2GTOA 3M59A 2RHYA 1VA7A 3LWHA 2JVVA 2YRDA 2FB7A 2H8HA 4BE0A 4J9FA 1SF9A 2DA9A 3BFMA 2QEXA 2DIQA 4P5NA 3VS0A 2WACA 1EFNA 3M5AA 1PRMC
chains in the Genus database with same CATH topology
4X34A 4BB7A 3L2VA 3JRZA 1PSFA 4QQDA 1Q82C 4IURA 1KQ2A 1M1FA 4M78B 3PGGA 4PNOA 3OA6A 1W2BA 1XNIA 1VQ5A 4LDWA 3HRTA 1G3SA 2LVMA 3CMEA 4JRQA 1QVGA 1H641 4BE2A 1KHIA 1WGSA 1XTDA 1JBMA 4DOVA 1O75A 1VQ9T 3JCMX 2LQ8A 2XD0A 1K9MC 4KBMB 3E19A 1LOJA 4C5HA 3OW2A 4A4FA 3S3OA 3JCMQ 2LCCA 3V7SA 4EMGA 2ZPBB 4M77B 1X6OA 2XHCA 4RCBA 5LJ5j 3CCQT 2F5TX 3M4GA 5GMKh 2XICA 1VQMA 4M7DB 1YITA 1Q82U 3LLRA 1BI1A 4FM4B 3S3MA 4QQGA 2XKOC 3VV0A 1Q7YC 2MAMA 4XTZA 2KK4A 4FU6A 4C0GA 4ZGDB 2WSFE 5GAMj 4XU2A 1RI0A 2RO0A 3QYGB 4XU1A 2CZ6B 3OYLA 1JJ2S 2EQUA 4MDWA 4E7LA 4JUVA 5GAOr 4ZTFA 4ME7A 4II1A 1HK9A 1NZ9A 5LJ3h 3FEOA 3CCMT 3M4YA 3BW1A 5CAIA 3CCRA 1XQHA 4F7UB 5GAOm 1KG1A 2K5IA 5CKEA 1ZHIA 3L2ZA 4EPCA 1S72T 2LQKA 2HBPA 5FU6B 3SDZA 2DXUA 2RB6A 2DEQA 5KE3A 4J5YA 4EMKB 1OZ3A 4JDSA 3ZFJA 5LJ5f 4IUVA 3DLLA 2X4JA 3LGLA 4N0AC 4XTWA 1O9SA 4XU0A 3CCLT 1KD1C 1YJ9T 3G71T 1UGRB 2XK0A 4D6WA 1N8RU 3JCMh 3JCMc 4M78F 4JRKA 4C8QD 1WJSA 4E47A 4IUQA 5GAMf 5J39A 2HQXA 2PUOB 4UC4A 4BI4A 4BACA 2A7YA 2PVOB 4L5GA 3TCJA 1Y07A 2IG0A 2DO3A 2DTHA 2MI6A 4C8QC 3CCVT 5J26A 5FRMA 2LC4A 3OYAA 3QYHB 2DD5A 2PVGB 2HNIA 3TREA 1UB4A 4PKCC 4C5EA 2DPPB 5AYFA 1KHCA 5GAN6 3Q1JA 3L2WA 1VQ6T 4PL6A 3OYDA 1P92A 2CZ0B 4M77F 5GMKl 2RHZA 1R8OB 1KD1U 4PJOD 3HRUA 1M8VA 3PT9A 5I2MA 3PIPA 2M0OA 3MEAA 2LDMA 4OVAA 5CKBA 4BUGA 1YI2T 3JCMW 4HT9A 2DVEA 2QQAA 2Y90A 4DOWA 4M78A 3OS5A 4PJOC 3G6ET 3V7RA 1W4SA 2DKGA 2X4YA 1OYXA 1U8RA 3FDRA 1QVPA 2EQJA 2EQMA 2E65A 1HXDA 2X4WA 3LGFA 1KC8C 4HCBA 3QG1A 3JB9F 4JRIA 3JB9H 3RUXA 4JS5A 3CCMA 2E41A 2V8IA 4ZN1A 5LJ3d 4GLKA 1ZBXA 5GMKi 2O01E 3I56T 3ASKA 3F70A 1VQ8T 3G4SA 2K4YA 1W2BS 2RK1A 2ZPHB 3EFSA 3A8GB 4M77A 5IN1A 1WQ7A 3L2QA 4M7DA 4Y91A 3BDUA 1QVGS 4O6JA 5CQYA 2LX9A 3CPWS 1NPRA 3OBYA 2B8AA 3BY7A 3CCST 2QQSA 2H3JA 4QVDA 2PUKB 3META 2R57A 1XOVA 1M5Q1 4L6V5 2RM4A 3RKXA 2K3YA 2E5QA 3V8KA 3OW2S 3OYNA 4ZN3A 1Q81C 1KC8U 1VQNA 4OB1B 3JCMd 3HHTB 3TU4K 5LJ3g 3QXEB 4J7IA 4OGEA 3SFMA 4E7HA 2GQVA 2L8DA 2M16A 4BY6B 2AHJB 3SWNC 3P8DA 2LT1A 2R5MA 4PJOE 3QDRB 3LX7A 2RHUA 4F7UA 1NE8A 3QKJA 1H3ZA 1VQLT 3MP1A 3DB3A 3ME9A 3OYGA 2DXBA 5C6SA 5GAN2 1VQ6A 5CCAA 2CZ7B 4MZTA 4X9CA 4EMKA 1N9SA 2RJCA 1IZ6A 3C12A 3FRNA 4Q5WA 5KCOA 4XTUA 5GAOl 3KXTA 3AHUA 3GPLA 4J6XA 1BI0A 2DTIA 4C8QB 4LDUA 1Q86C 3JCMg 4R56A 2Y4YA 3HRSA 4XQ3A 1YI2A 5LJ5e 2DIGA 1Q81U 4J6YA 4RG2A 3CC7T 5FRNA 5DY9A 3G6EA 4J6WA 3OS2A 4GY5A 5GANj 3OYEA 3L2UA 2PVDB 1YJNT 1YJWA 3JCMP 2RHIA 1ZQ1A 2RJEA 3OYCA 4C92B 3QPHA 4OP0A 3A5ZB 5GAMe 3CPWA 4M78G 1VQOA 5D6YA 3RERA 4LD6A 4V2SA 3H6ZA 2XI9A 3P8HA 4PLIA 4QVZA 5KCHA 3J80E 2FVUA 2GFUA 3M9QA 3OYKA 1G3YA 4QVCA 2E70A 2KSSA 1Q86U 2EWNA 2DK3A 2VXEA 4C5GA 3NTKA 2EJGA 2JUFA 1VIFA 4N4GA 4C0DB 2ZCFB 5FU7C 1I8FA 2VGMA 4KUDK 2VXFA 3CC4T 3OYFA 4A54A 3I55A 2XG8D 1VQPT 1KQSA 3OSVA 4HA8A 4HCZA 5J3BA 3UDCA 3UPUA 5DLOA 1FX7A 4M77G 1VQKT 3OYBA 2D6FA 2DZCA 3SB2A 4IKFA 4FIBA 4M75B 4M7DG 5FLXE 4BDYA 3RKYA 4E7JA 1FWZA 2RJDA 3PMIA 4C0FA 4O5VA 1JB0E 5GANf 3MO8A 3X25B 4A4HA 1M1GA 1G3TA 2WSEE 4HKEA 4BE1A 3N5BB 1WNLA 3G7ZA 3OBWA 2ZGWA 4KUIA 4A4EA 3CMAA 1K9MU 3OS1A 1N27A 3QJYA 4MZMA 3TEEA 2FYKA 3WVDB 3JB9G 4J8OA 2VUBA 3ZEHA 4JLGA 3J7AF 1EIFA 2FHDA 2XU8A 2YLCA 3R6OA 2V8JA 2JZ2A 4J7FA 2E6NA 4M7AB 4A4GA 3FIFA 3HP9A 5IT9E 2JTMA 1Q7YU 4A53A 2ZPIB 3CC7A 3GNFB 2MF2A 2O4XB 3JCMb 1YJNA 3FC3A 5DLQE 5CKDA 2KMTA 4FSXA 5CKHA 2XDDA 5A0DA 4FT2A 5CQXA 4C92F 2K5LA 3X28B 2KQWA 5GAOq 1VQ9A 3V8JA 3CCUT 3E9FA 1OI1A 3CCET 2E10A 1UGPB 3HFNA 4FL6A 4YTLA 1BKBA 2RI3A 3KUFA 1MHNA 2EIFA 2RI2A 5DM7R 4NL3A 2P0QA 2DAQA 3HL8A 4NS5A 2FL7A 2V8KA 3RMQA 5LJ5h 1N6AA 5GAN4 3CCJT 4C8QA 3CCQA 2QA4T 4BI8B 1WJRA 4M7DF 3OYYA 2E1HA 2QI2A 1VQKA 3M53A 3QZ5B 1QVFA 4JJNK 3FB9A 1BI3A 4LD9K 4N4HA 5LL6S 3QJ6A 4M75F 2OTJA 4WF2A 4LDYA 1K8AC 2X35A 5GAMh 2R5AA 3L2RA 2EAYA 3OSSC 1YCYA 4X9DA 1VQ7T 1NPPA 2RHXA 3E1SA 3CPFA 2RD1A 4C92A 4OB0B 2CS7A 4M78D 3GOXA 5CK9A 2RA2A 3RESA 2KVQG 5M9OA 1S72A 4F7UF 3QHSA 4M78C 3OYMA 1VQ4T 4MDXA 2VV5A 3X26B 4KULA 2DTOA 3OB9A 2QEXT 4OMFB 3DKMA 1U1TA 4PLLA 2X4XA 2P0KA 4M7AF 3C95A 3LWIA 3V7CA 3CCLA 2JN0A 2LTOA 4B9WA 1X75C 2QQBA 2YLBA 4M77D 2KY9A 1K8AU 2DD4A 2IVWA 1YJ9A 4M75A 3UT1A 3MP6A 3G71A 4JS4A 4L59A 3JAME 2CGHA 2VGNA 1VQ5T 3JCMJ 5A0GA 4M77C 2MWPA 1N9RA 5EG2A 3M56A 2VC8A 3P8BB 1UGQB 3X20B 4RMOA 2K3XA 1LJOA 4IUTA 5GANe 1KQSS 3GNGA 3ZBDA 3CCVA 4OGCA 3CCUA 2EJFA 1D3BB 5KE2A 3JB9D 1Y96B 5GAOn 5CR2A 4JRPA 3FLGA 3JB9J 3S3NA 3ER0A 3CCJA 5I21A 4VUBA 5GMKj 1VQMT 1V29B 5LJ5d 3CXCS 4M7AA 3PIOA 1YITT 4CI0C 3KBGA 5HK0A 3FJPA 3OMCA 3RMSA 4M78E 3JCMV 1QP2A 4DA4A 1TH7A 3M55A 2O4XA 2CZ1B 5CKFA 3T9NA 3PTAA 4C8QG 2GCXA 4OB2B 2OTJT 3HKSA 4Y28E 3DLMA 3A8OB 4J83A 1QP3A 5GAMd 4EMKC 3JSCA 5C0MA 2KAFA 4DQ2A 1WJQA 5LJ3j 2E6ZA 2QQRA 5IAYA 1M90C 3MEWA 2DZ9A 3MEUA 5GMKm 3CCRT 3RIRA 2P0PA 3I56A 3O8VA 1I4K1 4E7KA 3PFSA 5LJ5g 1VQ8A 3INZA 4PJOB 4M77E 2JNGA 1VQ4A 3PMTA 3UWNA 4C92G 1K73C 3HFOA 4M7DE 3OYIA 2RK2A 2EQKA 3QIIA 4KT0E 4XTXA 3OS0A 4OF1A 3LW5E 5HKCA 4JLIA 3LH0A 4IUUA 3CCSA 3OMGA 5GAMg 3PNWC 5GAN7 1AHJB 3CD6T 1B34B 1U1SA 2WSCE 3BDLA 4B9XA 4BD3A 4EDUA 4QQ6A 4NL2A 1YIJT 2BUDA 4EMHA 5GAOp 1M90U 5CIUA 4RKUE 3CXCA 2K5FA 5HK3A 4M75G 4F7UE 2HAXA 2GF7A 5LJ3f 3QUIA 1K73U 4Z02A 4ZTJA 1VQLA 1QVFS 1I5LA 2ZPFB 2XDBA 3NTHA 2HD0A 4M7AE 2EFIA 3EFRA 2E12A 5D6WA 5D6XA 3VYHB 3J81E 3NFCA 3OY9A 1BI2A 1YBYA 3SWNB 2BKDN 4RCCA 3QSUA 1OZ2A 4F7UG 3A8HB 4C8QF 2HQEA 2VYTA 4ELYC 5FROA 2M1HA 4TVRA 1LNXA 3JCMf 1G3WA 3WXMB 3MP8A 4M7AG 3M57A 4XTYA 5GANh 3RKWA 1N8RC 1Y7XA 1NJIC 4N0AA 1Y71A 4RG8A 5KH6A 2MMPA 4HT8A 3VYGA 1UEBA 4LDXA 3CC2T 2K57A 5CO7A 1D3BA 1Y96A 3G4ST 4PJOF 1G5VA 4ZGJB 1YHQT 3M58A 4ELZC 2JTFA 3MHXA 1IREB 3MCAB 1RL2A 2CYZB 2QQ9A 3VJPA 1JRIA 1MGQA 2QDYB 2ZPGB 4BY6C 3CC4A 1VQPA 3E9GA 3M54A 3CD6A 1UGSB 3CBPA 3A8LB 2PQWA 2EJ9A 5HY6A 2YRVA 4MMKA 3SD4A 1NJIU 1YIJA 1M1KC 4OB3B 3VUBA 2LNVA 4R55A 1VQNT 2OAUA 3CBOA 3URGA 5A0LA 3EAEA 1KQ1A 5L8RE 4C5IA 1DJ7B 4CRIA 2EKOA 5FU7B 4A4KA 3VUZA 2R58A 3VKIA 5GAN8 1GXIE 3WVEB 2OTLT 2K2VA 3OQ5A 1PSEA 2L3RA 2I2LA 3L1AA 4PJOA 3LYIA 3QO3A 2GFAA 2XDPA 4C92D 2F69A 3QBYA 3GF5A 1VIEA 3L42A 1JJ2A 2M9UA 4LDVA 2LRQA 2DXTA 4HCCA 4C92C 1M1KU 4N4IA 5GMKe 3S6WA 1B34A 2DXCA 2JOYA 1BIBA 3C94A 2P4TA 3GLXA 4M7DD 4XU3A 1YJWT 4ATOA 3C4SA 5GANd 3NTIA 2G3RA 4NOYA 2ZZDA 4M75D 4C0DC 3CMET 2F5KA 4ZGEB 3CC2A 1VQOT 4M7DC 4MZPA 2L89A 1WPYA 4XAXB 5I2SA 3CCEA 1YHQA 2LCLA 1WQWA 4M75C 2D9TA 5LJ3e 1X01A 3MEVA 4FT4A 2C06A 5GAN5 1M9SA 4MMLA 4C8QE 3DB4A 5A2QE 2DJZA 2YHTA 2QA4A 3SWNA 3JB9I 5CVIA 4C0ZA 3OYHA 3I55T 1FXXA 2BIVA 2L5QA 3X24B 2PU9B 5GANg 4BDZA 3VU3C 3V8LA 3A8MB 2NLUA 3CBMA 4XK8E 5GAN3 4M7AD 1VUBA 3CEYA 3QZ9B 2Y4XA 4C92E 5FU6C 2RH2A 2A3LA 1M4ZA 1VQ7A 1BIAA 2QTXA 4E7IA 2CKKA 3JCMe 3CMAT 2OTLA 4M7AC 4QW2A 1QW1A 2ZPEB 2KDSA 3M59A 2RHYA 2LT4A 3LWHA 2JVVA 3H8ZA 2FB7A 2RJFA 3OYJA 4BE0A 4XTVA 3HPWA 2QXFA 2RI5A 3BFMA 2D0QB 3GP8A 2XIDA 1I81A 2DIQA 4IUPA 2QEXA 4P5NA 4BI3A 1BYMA 3HSBA 2E64A 2WACA 2MWOA 4PJOG 1SSFA 3M5AA 3GIBA 2EYQA 4M75E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QVD A;  3RKX A;  1M5Q 1;  2RM4 A;  3FB9 A;  1LNX A;  4M75 F;  3V8K A;  4M78 B;  3JCM f;  3PGG A;  4PNO A;  4WF2 A;  1KQ2 A;  3JCM d;  4M7A G;  4XTY A;  5GAM h;  5GAN h;  2EAY A;  4X9D A;  1YCY A;  3RKW A;  5LJ3 g;  4N0A A;  2RD1 A;  4C92 A;  1H64 1;  1JBM A;  4M78 D;  3SWN C;  4HT8 A;  2RA2 A;  3JCM X;  3RES A;  2K57 A;  4PJO E;  1D3B A;  4F7U A;  1LOJ A;  1Y96 A;  4PJO F;  4F7U F;  5GAN 2;  3QHS A;  4M78 C;  3JCM Q;  3V7S A;  4X9C A;  4EMG A;  4M77 B;  1N9S A;  4RCB A;  4EMK A;  2DTO A;  5LJ5 j;  5GAO l;  3M4G A;  4XTU A;  5GMK h;  1JRI A;  1U1T A;  3AHU A;  1MGQ A;  4M7D B;  4J6X A;  2DTI A;  4C8Q B;  4M7A F;  3V7C A;  3JCM g;  2JN0 A;  4M77 D;  4XQ3 A;  2YLB A;  5LJ5 e;  4J6Y A;  2EJ9 A;  4M75 A;  5DY9 A;  4MMK A;  4XTZ A;  4J6W A;  5GAM j;  5GAN j;  4XU2 A;  3JCM P;  2CGH A;  3JCM J;  1KQ1 A;  4M77 C;  4XU1 A;  5GAO r;  1N9R A;  4JUV A;  4C92 B;  2VC8 A;  5GAN 8;  4OP0 A;  5GAM e;  1HK9 A;  1LJO A;  4M78 G;  5LJ3 h;  5GAN e;  3RER A;  4V2S A;  3BW1 A;  2EJF A;  5CAI A;  1D3B B;  2I2L A;  3L1A A;  4F7U B;  5GAO m;  3JB9 D;  3QO3 A;  3L2Z A;  1Y96 B;  4C92 D;  5GAO n;  4PJO A;  4QVC A;  2DXU A;  2RB6 A;  2DEQ A;  5I21 A;  2EWN A;  4J5Y A;  2VXE A;  4EMK B;  5GMK j;  5LJ5 f;  3JB9 J;  2EJG A;  5LJ5 d;  4M7A A;  1I8F A;  2DXT A;  2VXF A;  4N0A C;  4XTW A;  4C92 C;  3FJP A;  4XU0 A;  4A54 A;  4HA8 A;  4M78 E;  3JCM V;  5GMK e;  4M77 G;  1B34 A;  2DZC A;  3SB2 A;  1BIB A;  1TH7 A;  4M75 B;  4M7D D;  3JCM h;  4XU3 A;  4M78 F;  4JRK A;  3JCM c;  3RKY A;  4C8Q D;  4C8Q G;  5GAM f;  5GAN f;  5GAM d;  5GAN d;  4EMK C;  4NOY A;  1WNL A;  4M75 D;  2ZGW A;  4DQ2 A;  5LJ3 j;  4M7D C;  2DTH A;  4C8Q C;  2DZ9 A;  5GMK m;  1WPY A;  3RIR A;  2FYK A;  1I4K 1;  5LJ5 g;  2HNI A;  3INZ A;  5GAN 6;  4M77 E;  4PJO B;  3JB9 G;  1WQW A;  4M75 C;  4C92 G;  5LJ3 e;  1X01 A;  3HFO A;  4M7D E;  5GAN 5;  4MML A;  4C8Q E;  4M77 F;  2DJZ A;  2YLC A;  5GMK l;  4XTX A;  2YHT A;  3SWN A;  4PJO D;  4M7D G;  4M7A B;  4JLI A;  3FIF A;  3JB9 I;  1M8V A;  4A53 A;  5GAM g;  5GAN g;  5GAN 7;  3VU3 C;  3JCM W;  4HT9 A;  2DVE A;  1B34 B;  1U1S A;  2Y90 A;  4M78 A;  3V8L A;  4M7A D;  3JCM b;  5GAN 3;  4PJO C;  4NL2 A;  2DKG A;  3V7R A;  4EMH A;  4C92 E;  5GAO p;  1BIA A;  2E65 A;  1HXD A;  2QTX A;  3JB9 F;  3JB9 H;  3JCM e;  4JRI A;  4C92 F;  3RUX A;  4M75 G;  4M7A C;  4F7U E;  5GAO q;  2E41 A;  5LJ3 f;  3QUI A;  3V8J A;  5LJ3 d;  5GMK i;  2FB7 A;  2E10 A;  3HFN A;  1I5L A;  4XTV A;  4M7A E;  4M77 A;  3EFS A;  4NL3 A;  3BFM A;  3EFR A;  1WQ7 A;  5LJ5 h;  1I81 A;  4Y91 A;  5GAN 4;  4M7D A;  3BDU A;  3SWN B;  4C8Q A;  4RCC A;  3HSB A;  2E64 A;  4PJO G;  2E1H A;  4F7U G;  3BY7 A;  4C8Q F;  3QSU A;  3GIB A;  4M7D F;  4M75 E; 
#chains in the Genus database with same CATH topology
 4BB7 A;  2DET A;  4M78 B;  3OA6 A;  2YUP A;  1K73 R;  1VQ5 A;  4LDW A;  3HRT A;  4AG1 C;  1M27 C;  2D0N A;  1ZA2 B;  2A0F B;  1QVG A;  1H64 1;  1O75 A;  1SRL A;  2JS2 A;  2HZY A;  1YNZ A;  2LNH B;  2RQU A;  1LOJ A;  3S3O A;  3V7S A;  4EMG A;  4M7A E;  4RCB A;  1X6O A;  4RTV A;  3M4G A;  3CCQ T;  4M7D B;  1VQP Q;  1YIT A;  1Q82 U;  2E3H A;  1BI1 A;  2KYB A;  3VV0 A;  1CKA A;  1Q7Y C;  4JPB W;  5GAM j;  2KT1 A;  4XU1 A;  2AKK A;  2CZ6 B;  2X51 A;  4A63 B;  3OYL A;  1ZUY A;  1TUD A;  4F7U B;  2FZK B;  3H41 A;  5CKE A;  1ZHI A;  1E6G A;  2HBP A;  5FU6 B;  2DXU A;  3FJ5 A;  1OZ3 A;  5LJ5 f;  4Y92 A;  4KGV B;  1N5Z A;  4XTW A;  4XU0 A;  4AFZ C;  1N8R U;  3JCM h;  4E47 A;  2YXY A;  4JRK A;  4C8Q D;  2FPE A;  4PJM A;  2HQX A;  1NEB A;  4L5G A;  2IG0 A;  2O2O A;  5KYX B;  3CCV T;  5FWC A;  2LC4 A;  2DD5 A;  4C5E A;  3TRE A;  1VQ6 T;  1ZX6 A;  4PL6 A;  1P92 A;  4M77 F;  2KT8 A;  2DVJ A;  1R8O B;  4PJO D;  3HRU A;  1ZLM A;  1Y57 A;  1JQQ A;  1Q95 G;  5I2M A;  3PIP A;  3MEA A;  1JU5 C;  1YI2 T;  2QQA A;  1OX8 A;  4M78 A;  3OS5 A;  3VRZ A;  1RAG B;  3G6E T;  1W4S A;  2DKG A;  2X4Y A;  4J9C A;  1U8R A;  2O9S A;  1NEG A;  2FG0 A;  4ORZ A;  4HCB A;  1M3A A;  3GBQ A;  1KQS P;  2E41 A;  5GJV B;  5LJ3 d;  4GLK A;  1ZBX A;  1VQ8 T;  2OI3 A;  3G4S A;  2KYM A;  2E4H A;  2K4Y A;  3EFS A;  4LXC A;  2GQI A;  4M7D A;  1QVG S;  1WI7 A;  1NPR A;  3CCS T;  1NYG A;  2R57 A;  4L6V 5;  5ECA A;  1X2Q A;  3V8K A;  1Q81 C;  4GLM A;  1I1J A;  3TU4 K;  6AT1 B;  1I07 A;  4J7I A;  3SFM A;  4OMP A;  2KRO A;  4BY6 B;  3P8D A;  4FYY B;  2LT1 A;  3LX7 A;  4CC3 A;  4F7U A;  1W1F A;  3MP1 A;  1TTH B;  5IXB A;  4M4Z A;  5CCA A;  2CZ7 B;  1VQM Q;  1N9S A;  4Q5W A;  3AHU A;  1YCS B;  3GPL A;  1BI0 A;  4R56 A;  2Y4Y A;  3G1J A;  4KH1 B;  5LJ5 e;  2DIG A;  4J6Y A;  4GY5 A;  4OMM A;  1X43 A;  2PVD B;  2RHI A;  4OP0 A;  3A5Z B;  3CPW A;  4M78 G;  5KYX A;  1VQO A;  4IIO A;  1QVF P;  4QVZ A;  1WHK A;  2GNC A;  2GFU A;  1G3Y A;  3EH2 A;  2K6D A;  4C5G A;  2VXE A;  2EJG A;  1VIF A;  1MMG A;  2SRC A;  2VGM A;  3ULR B;  3CC4 T;  3OYF A;  3I55 A;  3NGP A;  3UDC A;  3UPU A;  1VQK T;  3NMZ C;  3SB2 A;  4M75 B;  4M7D G;  3PMI A;  4A4H A;  1M1G A;  4HKE A;  1WNL A;  3G7Z A;  3OBW A;  2ZGW A;  2FZC B;  4E6R A;  1N27 A;  2ROT A;  1U5S A;  2DMO A;  3E2U A;  1W6X A;  4J8O A;  2OAW A;  2FHD A;  2YLC A;  3CC7 A;  3GNF B;  2O4X B;  3JCM b;  3FC3 A;  4FW1 A;  5CKD A;  3UA7 A;  2XDD A;  5A0D A;  4C92 F;  3H0F A;  1SRM A;  3CCU T;  3CCE T;  1M3C A;  2E10 A;  1UGP B;  2L0A A;  4FL6 A;  1UHF A;  3HFN A;  3KUF A;  1MHN A;  2PNI A;  3PE0 A;  2P0Q A;  4AMC A;  2FL7 A;  2V8K A;  5LJ5 h;  5GAN 4;  1N6A A;  3CCQ A;  1UJY A;  4BI8 B;  2E1H A;  3M53 A;  3QZ5 B;  2ZAE A;  2JJ9 A;  1VYT A;  3OSS C;  2RHX A;  4OB0 B;  2RA2 A;  5HCK A;  5GJW B;  4RTZ A;  1VQ4 T;  4KUL A;  2DTO A;  3DKM A;  2X4X A;  2D8J A;  2HSE B;  2EGE A;  2KY9 A;  2FPD A;  4M75 A;  3MP6 A;  1YJW Q;  4L59 A;  2J7I A;  5IXF A;  2CSQ A;  4WCI A;  2DEU A;  1D0Z A;  1QMC A;  3JCM J;  5EG2 A;  3X20 B;  4IUT A;  3CCV A;  4OGC A;  4FSS A;  2QGG A;  2L2P A;  1WHM A;  2CH4 A;  2HL3 A;  1SPK A;  5CR2 A;  4JRP A;  2DNU A;  5I21 A;  4VUB A;  2JT4 A;  3CXC S;  1SG5 A;  3PIO A;  3KBG A;  5HK0 A;  4Z89 A;  3RMS A;  4DA4 A;  4DBH A;  3M55 A;  2O4X A;  4OB2 B;  3HKS A;  1QP3 A;  3CMA Q;  4EMK C;  2KAF A;  1RAI B;  1FMW A;  1NYF A;  5LJ3 j;  2QQR A;  1M90 C;  3CCR T;  2P0P A;  1VQ8 A;  3INZ A;  4PJO B;  4M77 E;  3UWN A;  3HFO A;  2RK2 A;  1ABO A;  4XTX A;  4AFU C;  2RN8 A;  1A0N B;  3LW5 E;  3CCS A;  2F1L A;  5GAM g;  3CD6 T;  1YJN Q;  2AZV A;  2BUD A;  1WX6 A;  2KRN A;  4JZ3 A;  3M0R A;  1VQ9 Q;  2MOX A;  4M75 G;  1OV3 A;  2HAX A;  2GF7 A;  2BZX A;  1LVK A;  1YP5 A;  4Z02 A;  2YSQ A;  1IXD A;  2ZPF B;  3NTH A;  2HD0 A;  2EFI A;  5D6W A;  5D6X A;  4LUD A;  4RCC A;  4E7S A;  3QSU A;  2B86 A;  2HQE A;  5FRO A;  4HXJ A;  3WXM B;  1QWE A;  2O31 A;  1N8R C;  1Y7X A;  2FZG B;  4N0A A;  1Y71 A;  4RTY A;  5KH6 A;  2MMP A;  1IGQ A;  1RAE B;  2JTF A;  3MHX A;  4J9G A;  4DEX A;  1NLO C;  1JRI A;  2ZPG B;  3CC4 A;  3M54 A;  3G71 Q;  1X6B A;  2EJ9 A;  1V1C A;  3QDF A;  4RUG A;  1M1K C;  1VQN T;  4Z88 A;  1ABQ A;  2EKO A;  5FU7 B;  1Z9Z A;  3VUZ A;  5GAN 8;  1GXI E;  2OTL T;  2K2V A;  4FYW B;  5I22 A;  2F2X A;  4PJO A;  3LYI A;  2HSP A;  3CCJ Q;  2F69 A;  2YRC A;  1HSQ A;  3GF5 A;  1GBQ A;  1VIE A;  1QVG P;  2KRS A;  1KC8 R;  1WHJ A;  4N4I A;  3S6W A;  2GGR A;  2AK5 A;  3C94 A;  2P4T A;  4M7D D;  2DL4 A;  8AT1 B;  3C4S A;  5GAN d;  3NTI A;  3TQ7 P;  3MJX A;  3CC2 A;  1SEM A;  1H3H A;  1IGU A;  2L89 A;  2D1X A;  4B6M A;  1TS9 A;  3CCE A;  3UF4 A;  2LCL A;  2D9T A;  2EYZ A;  2C06 A;  1QCO A;  4C8Q E;  3DB4 A;  3JB9 I;  3X24 B;  1RAB B;  4RTW A;  1RAD B;  3A8M B;  5D7U A;  1VUB A;  4RTU A;  4C92 E;  1R0C B;  2K3B A;  4QW2 A;  1QW1 A;  2ZPE B;  4M7A C;  1VYU A;  3H8Z A;  2QXF A;  1SHG A;  2RI5 A;  2DRK A;  1BYM A;  2CH4 W;  4PJO G;  2MWO A;  1SSF A;  4X34 A;  1M90 R;  3JRZ A;  3I5R A;  1M1F A;  2KXD A;  3PGG A;  2LQW A;  1T3L A;  2LVM A;  3CME A;  4BE2 A;  1XTD A;  2DLP A;  2ABL A;  2YWW A;  2A36 A;  2FO0 A;  3JCM Q;  2ZPB B;  2F5T X;  4J9H A;  3LLR A;  4FM4 B;  3S3M A;  2XKO C;  1YIJ Q;  4C0G A;  2KK4 A;  4HVU A;  1GCP A;  1OPK A;  1JEG A;  3H0H A;  5GAO r;  4F14 A;  4ME7 A;  4II1 A;  1NZ9 A;  4PJN A;  3M4Y A;  3BW1 A;  3CCR A;  4J9B A;  2K5I A;  3L2Z A;  1ZUU A;  3SDZ A;  1BB9 A;  2HMA A;  1IO6 A;  2EYX A;  1VOM A;  4IUV A;  3LGL A;  1KD1 C;  1YJ9 T;  3JCM c;  4M78 F;  1WJS A;  5J39 A;  4IUQ A;  5GAM f;  5EC7 A;  4LE9 A;  2A28 A;  4BAC A;  2PVO B;  3TCJ A;  2JM8 A;  2V1Q A;  1Y07 A;  2DO3 A;  4DBQ A;  2VVK A;  1YHQ Q;  1QQJ A;  3OYA A;  2PVG B;  2HNI A;  1UB4 A;  4PKC C;  5GAN 6;  2DPP B;  3Q1J A;  3L2W A;  1M1K R;  2QA4 Q;  3OYD A;  2CZ0 B;  3PT9 A;  2M0O A;  4BUG A;  2DVE A;  4DOW A;  1GL5 A;  1QKX A;  1RI9 A;  2EQJ A;  2PZ1 A;  3QG1 A;  4JRI A;  3RUX A;  3CCM A;  2V8I A;  5GMK i;  2O01 E;  3I56 T;  4F16 A;  1OOT A;  1ACM B;  2YUO A;  1TSF A;  3A8G B;  5IN1 A;  3CXC P;  1WQ7 A;  3L2Q A;  1G83 A;  2QQS A;  3M0S A;  2PUK B;  3MET A;  1XOV A;  2RM4 A;  2K3Y A;  4ANJ A;  3OYN A;  1KC8 U;  1VQN A;  4D8D A;  2VWF A;  3ZL7 C;  5LJ3 g;  2HL5 C;  3QXE B;  4J9I A;  2L8D A;  2M16 A;  2R5M A;  1NE8 A;  4PJJ A;  3DB3 A;  3OYG A;  3H9N A;  5GAN 2;  4Z8A A;  4MZT A;  2RJC A;  2DTI A;  4LDU A;  3NHN A;  4ESR A;  1TWB A;  3CC7 T;  4RG2 A;  1MMN A;  3BE3 A;  4J6W A;  3OS2 A;  5GAN j;  3OYC A;  4E2F B;  1PKT A;  5GAM e;  4LD6 A;  2AIR B;  2XI9 A;  2FVU A;  3M9Q A;  4AG2 C;  3OYK A;  4QVC A;  2E70 A;  1Q86 U;  1MV3 A;  2DK3 A;  3JB9 J;  4C0D B;  1I8F A;  2VXF A;  1IB8 A;  1VQP T;  1AWO A;  2ED0 A;  1MND A;  3OSV A;  3OYB A;  2DZC A;  4JJC A;  4FIB A;  5FLX E;  1UUE A;  3RKY A;  1FWZ A;  5IH2 A;  3X25 B;  1G3T A;  2DL8 A;  1K9M U;  3OS1 A;  3QJY A;  2OX7 A;  4OMN A;  3ZEH A;  3J7A F;  1EIF A;  1TG0 A;  2XU8 A;  3R6O A;  2V8J A;  2ED1 A;  2DL5 A;  4JZ4 A;  3FIF A;  1NJI R;  1UJ0 A;  5IT9 E;  2ZPI B;  2FEI A;  2MF2 A;  2DE0 X;  4FT2 A;  5CQX A;  2DF6 A;  2COY A;  2ENM A;  1KD1 R;  2O9V A;  2VB6 A;  4YTL A;  2RI2 A;  5DM7 R;  2DAQ A;  2XDB A;  1WHG A;  2NUZ A;  2CUB A;  2EBP A;  4M75 F;  5AT1 B;  2OTJ A;  5GAM h;  1MNE A;  3EHQ A;  2EAY A;  2A08 A;  2QTV A;  1PWT A;  3GOX A;  5CK9 A;  2M51 A;  1VQ6 Q;  3D7S B;  1IHW A;  1RLP C;  4PFO A;  3RNJ A;  4OMF B;  1U1T A;  1YI2 Q;  1GFC A;  1PHT A;  1GBR A;  4B9W A;  2JS0 A;  2QQB A;  1K8A U;  3G6E Q;  2L3S A;  1X69 A;  1YJ9 A;  4JS4 A;  4JJD A;  1PD0 A;  2FRY A;  2CP6 A;  3M0T A;  3JAM E;  2CGH A;  3PVL A;  2QAZ A;  5A0G A;  4M77 C;  1KFZ A;  1N9R A;  2VC8 A;  2JM9 A;  2C0T A;  1U3O A;  1D3B B;  3JB9 D;  1M2O A;  1RUW A;  3QWX X;  3S3N A;  3ER0 A;  5GMK j;  1VQM T;  2BE7 D;  4CI0 C;  4M78 E;  3JCM V;  1D0Y A;  2RQV A;  3T9N A;  4Y28 E;  3A8O B;  3JSC A;  2LX7 A;  2J6F A;  3I9Q A;  2E6Z A;  3EG2 A;  5IAY A;  2X9H A;  2DZ9 A;  3MEU A;  5GMK m;  3I56 A;  4E7K A;  3PFS A;  2JNG A;  4M7D E;  3OYI A;  2EYW A;  4JLI A;  1B3Q A;  3LH0 A;  2E3I A;  4IUU A;  2H3E B;  1CKB A;  4EDU A;  2WSC E;  3BDL A;  4NL2 A;  3CXC A;  4AFQ C;  4F7U E;  5LJ3 f;  1K73 U;  4DBR A;  1TU0 B;  2KGT A;  3JV3 A;  3M0U A;  1Q7Y R;  4F17 A;  1AWJ A;  3OY9 A;  1VQK Q;  1OZ2 A;  4F7U G;  4C8Q F;  5IHI A;  1C1A A;  3M57 A;  3RKW A;  4EIK A;  2ROL A;  1UHC A;  2I0N A;  3CC2 T;  1PCX A;  3EG1 A;  1S72 Q;  1D3B A;  5FW9 A;  3PVQ A;  4PJO F;  1IRE B;  3EFO B;  2KEA A;  3VJP A;  1MGQ A;  1D0X A;  2QDY B;  3CCL Q;  1VQP A;  3E9G A;  1K76 A;  2GBQ A;  2PQW A;  2YRV A;  1NJI U;  4OB3 B;  1OQK A;  1QLY A;  3CBO A;  4CRI A;  5L8R E;  4LN2 A;  2R58 A;  3CCU Q;  3OQ5 A;  4ZNX A;  2I2L A;  3QO3 A;  2XDP A;  1K0S A;  2M9U A;  4J9E A;  9ATC B;  4C92 C;  1IRX A;  3GLX A;  1FMV A;  1TXQ A;  2NYS A;  4XU3 A;  1YJW T;  2M02 A;  3EGU A;  2G3R A;  2DBM A;  4NOY A;  2ZZD A;  1U06 A;  3CME T;  1ZUK A;  4IIM A;  1XJW B;  4MZP A;  1WPY A;  1VQ4 Q;  4XAX B;  2HKN A;  1WDX A;  3VS5 A;  3C0C A;  5LJ3 e;  4FT4 A;  1WIE A;  2DJZ A;  1Q81 R;  2PTK A;  5GAN g;  1AOJ A;  2KBT A;  4M7A D;  1M4Z A;  1BIA A;  1AWX A;  3CMA T;  2KDS A;  1VQL Q;  3IQL A;  1ZSZ C;  2RJF A;  3HPW A;  3EFO A;  3CC7 Q;  3GP8 A;  2D0Q B;  1TUC A;  3O5Z A;  4IUP A;  3VS6 A;  3HSB A;  2E64 A;  2RF0 A;  4M75 E;  3L2V A;  1Q82 C;  4IUR A;  1KQ2 A;  1W2B A;  3A1P A;  3R6N A;  1KHI A;  1WGS A;  1WXU A;  3M0Q A;  2DYB A;  1VQ9 T;  3JCM X;  2LQ8 A;  1K9M C;  4KBM B;  4DBF A;  4C5H A;  5I11 A;  2QAS A;  2KI7 A;  1VQM A;  3CD6 Q;  4KH0 B;  1JXO A;  2EGC A;  2MAM A;  4XTZ A;  3RR6 A;  1RI0 A;  2RO0 A;  3QYG B;  2XMF A;  4MDW A;  4ZTF A;  4JUV A;  1HK9 A;  4CC2 A;  1PC0 A;  5LJ3 h;  3CCM T;  3UA6 A;  1ARK A;  5GAO m;  1KG1 A;  1RAC B;  3I5S A;  2DBK A;  2RB6 A;  4EMK B;  3ZFJ A;  4JDS A;  2X4J A;  1O9S A;  3G71 T;  1KK7 A;  3MPU B;  4D6W A;  2PUO B;  4BI4 A;  3U23 A;  2A7Y A;  2DTH A;  2MI6 A;  2CP3 A;  5J26 A;  5FRM A;  1K9A A;  1QWF A;  1KHC A;  2O88 A;  2IIM A;  2HDA A;  1WZO A;  1M8V A;  5CKB A;  2LDM A;  3RBB B;  1YWP A;  2K9G A;  2Y90 A;  1SSH A;  2RMO A;  3V7R A;  1VQ7 Q;  3FDR A;  1RLQ C;  2EQM A;  2E65 A;  2OTL Q;  3LGF A;  8ATC B;  4KRT A;  4ZN1 A;  1HD3 A;  3A98 A;  3ASK A;  3F70 A;  3VS7 A;  1W2B S;  2RK1 A;  1AZG B;  2QEX Q;  4Y91 A;  1T0H A;  3BDU A;  4O6J A;  2LX9 A;  3BY7 A;  2LMJ A;  2H3J A;  3RKX A;  1M5Q 1;  2EGA A;  1D09 B;  2E5Q A;  1VQ5 Q;  4ZN3 A;  4OB1 B;  3JCM d;  3HHT B;  1B07 A;  1AEY A;  4OGE A;  3SWN C;  1IHV A;  4PJO E;  2RQR A;  5C6S A;  4PFZ A;  4X9C A;  4EMK A;  1IZ6 A;  3FRN A;  2CUD A;  5KCO A;  5GAO l;  1YIT Q;  2AT1 B;  1Q81 U;  4XQ3 A;  3OYE A;  3L2U A;  1YJW A;  3JCM P;  1LPL A;  4D8K A;  3MKD A;  3P8H A;  3J80 E;  2DFU A;  2LJ3 A;  1I0C A;  1Q82 R;  5L23 A;  2EWN A;  1TUG B;  4BDY A;  2JUF A;  2XG8 D;  4HA8 A;  4HCZ A;  4IKF A;  5GAN f;  2GTJ A;  4C0F A;  2OTJ T;  1JB0 E;  3MO8 A;  1M3B A;  2WSE E;  3N5B B;  3CMA A;  1OU9 A;  4FYX B;  2COZ A;  2P84 A;  3JB9 G;  2VUB A;  3EGD B;  4M7A B;  1N8R R;  3HP9 A;  2W0Z A;  2G6F X;  4A53 A;  5KYU B;  2EVR A;  1YJN A;  2VKN A;  2KMT A;  4FSX A;  1SHF A;  5CKH A;  2KQW A;  1VQ9 A;  3G4S Q;  3E9F A;  1JO8 A;  1GFD A;  1BKB A;  2RI3 A;  2EIF A;  4NL3 A;  4NS5 A;  3RMQ A;  2QA4 T;  1WJR A;  4M7D F;  3OYY A;  5FWB A;  2QI2 A;  3VS2 A;  1YWO A;  3UAT A;  4JJN K;  4LD9 K;  4N4H A;  5LL6 S;  2J6K A;  3REA B;  1X2K A;  1NPP A;  3CPF A;  2RD1 A;  2CS7 A;  3RES A;  2KVQ G;  4OMO A;  5M9O A;  2F2V A;  4F7U F;  3QHS A;  4M78 C;  3OYM A;  3X26 B;  2P0K A;  3V7C A;  2LTO A;  4M77 D;  1X75 C;  1WYX A;  1C0M A;  2DD4 A;  3G71 A;  3SHW A;  2VGN A;  1MMD A;  2CSI A;  2DM1 A;  2RQT A;  2MWP A;  1VQO Q;  1OEB A;  3P8B B;  2K3X A;  1D1B A;  5GAN e;  2QG9 B;  2L3P A;  3ZBD A;  2EJF A;  4PK4 A;  1Y96 B;  3FLG A;  3CCJ A;  3EGD A;  5LJ5 d;  3I55 Q;  4M7A A;  2QDL A;  2FRW A;  5IHK A;  3OMC A;  5KYU A;  2YDL A;  2CZ1 B;  3PTA A;  2NWM A;  1RAH B;  1WHH A;  2Z0W A;  4E7Z A;  3EG3 A;  1MUZ A;  1UTI A;  1BBZ A;  3RIR A;  3O8V A;  1I4K 1;  1K4U S;  2DER A;  5HKC A;  3M0P A;  1AHJ B;  2NUP B;  2HKQ B;  1NLP C;  1U1S A;  2X3W D;  4B9X A;  1CSK A;  4QQ6 A;  3HTR A;  4EMH A;  5GAO p;  2EYY A;  1M90 U;  2CT3 A;  5HK3 A;  2LCS A;  3H0I A;  4OMQ A;  1F1B B;  3CCQ Q;  4WTO B;  3NFC A;  1BI2 A;  2C0I A;  1R0B G;  2VYT A;  4ELY C;  4TVR A;  1G3W A;  2HCK A;  4M7A G;  5GAN h;  2A37 A;  1VYV A;  1UGV A;  1WXB A;  4RG8 A;  4HT8 A;  3VYG A;  1KSW A;  5CO7 A;  1Y96 A;  3M58 A;  4ELZ C;  5KYN A;  2JTE A;  4BY6 C;  2LZ6 B;  1T0J A;  2DRM A;  3CBP A;  2EW3 A;  4MMK A;  4K11 A;  1YIJ A;  4R55 A;  3VUB A;  2YUN A;  4C5I A;  1KQ1 A;  1DJ7 B;  4A4K A;  3CCV Q;  4X1V A;  3WVE B;  2JMA A;  2V1R A;  4FCY A;  1PSE A;  2L3R A;  3L1A A;  4C92 D;  1W2B P;  3VS3 A;  1JJ2 A;  4HCC A;  3THK A;  1M1K U;  2NUP A;  5GMK e;  4KGZ B;  2JOY A;  1BIB A;  1M2V B;  1D1C A;  2F5K A;  1VQ8 Q;  2CP5 A;  2IPO B;  5I2S A;  1QCN A;  1YHQ A;  4PJL A;  4M75 C;  1JXM A;  1X01 A;  3MEV A;  1M9S A;  4RTX A;  5A2Q E;  2F2W A;  3EG9 B;  1WA7 A;  2YHT A;  2QA4 A;  4OML A;  3CCS Q;  5CVI A;  3VRY A;  3OYH A;  3LH5 A;  2BIV A;  2L5Q A;  3V8L A;  4XK8 E;  5GAN 3;  3SEM A;  1EX4 A;  2RH2 A;  2HQH A;  4E7I A;  2CKK A;  3AT1 B;  1FMK A;  2DL3 A;  1FYN A;  2LT4 A;  3NPF A;  1NM7 A;  3OYJ A;  4XTV A;  2QK0 A;  5KYW B;  4AFS C;  2XID A;  1I81 A;  1G8X A;  2J05 A;  4BI3 A;  2V26 A;  2EYQ A;  3KFV A;  1RAF B;  1PSF A;  4GBQ A;  4QQD A;  4PNO A;  1XNI A;  4DEY A;  1C6V X;  1G3S A;  4JRQ A;  1JBM A;  4DOV A;  2RQW A;  1J3T A;  2DX1 A;  2XD0 A;  3E19 A;  2VAS A;  2MCN A;  3OW2 A;  2BZY A;  4A4F A;  2LCC A;  4M77 B;  5LJ5 j;  1K1Z A;  2XHC A;  5GMK h;  3CC4 Q;  2XIC A;  1OX9 A;  1HYO A;  1S1N A;  4QQG A;  4ZGD B;  4FU6 A;  1UFF A;  2WSF E;  4XU2 A;  1M2V A;  1OPL A;  2RPN A;  1JJ2 S;  2EQU A;  1GCQ C;  4E7L A;  3TSZ A;  2KE9 A;  1UG1 A;  3FEO A;  5CAI A;  1XQH A;  2CP2 A;  4EPC A;  1S72 T;  4R0K A;  2LQK A;  2LP5 A;  5KE3 A;  2DEQ A;  3EG9 A;  4J5Y A;  3DLL A;  2KXC A;  3EH1 A;  2W10 A;  2K79 A;  4N0A C;  3TVT A;  3CCL T;  4J9D A;  1ZSG A;  1UGR B;  2XK0 A;  4F04 B;  2KR3 A;  4UC4 A;  2BTT A;  1AD5 A;  3CC2 Q;  2ESW A;  2JW4 A;  1Y0M A;  2COW A;  2LQN A;  4C8Q C;  3CCE Q;  3CQT A;  3QYH B;  1B7T A;  5AYF A;  5KYW A;  3VS1 A;  1KIK A;  5GMK l;  2RHZ A;  2C0O A;  1KD1 U;  2ECZ A;  1AT1 B;  4OVA A;  2M0Y A;  3JCM W;  4HT9 A;  4PJO C;  2HEQ A;  1OYX A;  1QVP A;  1BCO A;  1HXD A;  1TOV A;  2X4W A;  1KC8 C;  3JB9 F;  3JB9 H;  1X27 A;  1X6G A;  4JS5 A;  2J6O A;  2CP7 A;  1AWW A;  1H92 A;  2MIO A;  2ZPH B;  4M77 A;  4QKU A;  5CQY A;  3CPW S;  3OBY A;  2B8A A;  1KJW A;  4QVD A;  2DIL A;  3OW2 S;  3CME Q;  2KRM A;  4E7H A;  2GQV A;  2AHJ B;  3RDV A;  4JJB A;  3QDR B;  2RHU A;  3QKJ A;  1H3Z A;  1VQL T;  3ME9 A;  2DXB A;  1VQ6 A;  2K2M A;  3C12 A;  3KXT A;  4XTU A;  4J6X A;  4C8Q B;  1Q86 C;  3JCM g;  2D8H A;  3HRS A;  1YI2 A;  5FRN A;  5DY9 A;  3G6E A;  2DJQ A;  1YJN T;  1ZQ1 A;  2MK5 A;  2RJE A;  2AKL A;  4C92 B;  3QPH A;  3TSW A;  3CCR Q;  3RER A;  5D6Y A;  4V2S A;  1V76 A;  3H6Z A;  4PLI A;  1E6H A;  5KCH A;  1QKW A;  3EG0 A;  2KSS A;  4N4G A;  3NTK A;  4KUD K;  1RAA B;  2ZCF B;  5FU7 C;  2P4R A;  2CP0 A;  4A54 A;  1KQS A;  1SKU B;  2MYS A;  5J3B A;  2D6F A;  5DLO A;  1FX7 A;  4M77 G;  3REB B;  3EGX B;  4E7J A;  2CRE A;  2RJD A;  4O5V A;  4BE1 A;  4A4E A;  4KUI A;  2RNA A;  4MZM A;  3TEE A;  2FYK A;  1Z9Q A;  4HVW A;  3WVD B;  1GCQ A;  4JLG A;  4FW2 A;  2L3Q A;  2JZ2 A;  4J7F A;  2E6N A;  4A4G A;  2JTM A;  1Q7Y U;  1ZSZ B;  2LJ1 A;  1WXT A;  1M30 A;  4AT1 B;  5DLQ E;  3CCM Q;  2MPX C;  2K5L A;  2EPD A;  3X28 B;  5GAO q;  3V8J A;  1OI1 A;  1OUL A;  1BK2 A;  3HL8 A;  5IHN A;  1MMA A;  3CCJ T;  3GIB A;  4C8Q A;  2ATC B;  7AT1 B;  1VQK A;  1UE9 A;  1QVF A;  3FB9 A;  1BI3 A;  1VQN Q;  1PKS A;  2JMC A;  3QJ6 A;  1E7O A;  4WF2 A;  4LDY A;  1K8A C;  2X35 A;  3L2R A;  2R5A A;  4X9D A;  1YCY A;  1VQ7 T;  3E1S A;  1HJD A;  1YN8 A;  4C92 A;  4M78 D;  1S72 A;  1H8K A;  2NUT B;  4MDX A;  5KYY B;  2VV5 A;  3OB9 A;  2QEX T;  2BE9 B;  4PLL A;  1OU8 A;  4M7A F;  3C95 A;  3LWI A;  4CC4 B;  2JN0 A;  3CCL A;  2YLB A;  2J06 A;  2IVW A;  2LJ0 A;  2CT4 A;  3UT1 A;  3EGX A;  2K7A A;  1VQ5 T;  1I5O B;  1PD1 A;  3M56 A;  1ZA1 B;  1UGQ B;  2JXB A;  4RMO A;  2DL7 A;  1LJO A;  1KQS S;  3GNG A;  3CCU A;  5KE2 A;  2CDT A;  5GAO n;  1V29 B;  1YIT T;  2HBW A;  2QYZ A;  3FJP A;  1BCM A;  1AZE A;  1ZSZ A;  1QP2 A;  1TH7 A;  5CKF A;  4C8Q G;  2GCX A;  3DLM A;  4J83 A;  5GAM d;  1YFN A;  1WLP B;  3I35 A;  5C0M A;  4DQ2 A;  1WJQ A;  1PG5 B;  4CC7 A;  1Q86 R;  3MEW A;  1T3S A;  1NG2 A;  4QT7 A;  5LJ5 g;  1K73 C;  1VQ4 A;  3PMT A;  4C92 G;  4HVV A;  2EQK A;  3QII A;  4KT0 E;  3OS0 A;  4OF1 A;  3OMG A;  5GAN 7;  3PNW C;  1B34 B;  4BD3 A;  1K9M R;  2E5K A;  1YIJ T;  1JJ2 P;  2SEM A;  5CIU A;  4RKU E;  1QCF A;  2K5F A;  3QUI A;  2DYI A;  2KNB B;  4ZTJ A;  1VQL A;  2YT6 A;  1QVF S;  2NUT A;  1I5L A;  5KYY A;  2X3X D;  3EFR A;  2E12 A;  3VYH B;  3J81 E;  1WFW A;  1WHL A;  3SWN B;  1YBY A;  2BKD N;  3A8H B;  2M1H A;  3EHR A;  2OTJ Q;  1LNX A;  2YUQ A;  3JCM f;  3MP8 A;  4HCK A;  4XTY A;  1NJI C;  4LNP A;  1K0X A;  1BU1 A;  1MV0 B;  1UEB A;  4KGX B;  3QWY A;  4LDX A;  2K57 A;  3G4S T;  1G5V A;  4ZGJ B;  1YHQ T;  3MCA B;  1RL2 A;  3VS4 A;  2CYZ B;  2QQ9 A;  1PM3 A;  4LUE A;  1YJ9 Q;  2BZ8 A;  3CD6 A;  2OJ2 A;  1UGS B;  3A8L B;  1W70 A;  5HY6 A;  3SD4 A;  2LNV A;  2OAU A;  3URG A;  5A0L A;  3EAE A;  1PRL C;  1D1A A;  3VKI A;  1NBE B;  2QGF B;  2GFA A;  3QBY A;  1GRI A;  2AZS A;  1K8A R;  1M8M A;  3L42 A;  4LDV A;  2LRQ A;  2DXT A;  3CPW P;  4PFP A;  2EQI A;  1EZZ B;  1B34 A;  2DXC A;  3OW2 P;  4ATO A;  4M75 D;  4C0D C;  1ZBJ A;  2EKH A;  4ZGE B;  4M7D C;  1G2B A;  3I56 Q;  1VQO T;  1R77 A;  1WQW A;  1UDL A;  5GAN 5;  4MML A;  1AVZ C;  2FPF A;  3SWN A;  4C0Z A;  3I55 T;  1FXX A;  2PU9 B;  4BDZ A;  4FYV B;  3VU3 C;  1PNJ A;  2NLU A;  1LCK A;  3CBM A;  3CEY A;  3QZ9 B;  2Y4X A;  1UEC A;  5FU6 C;  1VQ7 A;  2A3L A;  2QTX A;  4RTT A;  3JCM e;  2OTL A;  2GTO A;  3M59 A;  2RHY A;  1VA7 A;  3LWH A;  2JVV A;  2YRD A;  2FB7 A;  2H8H A;  4BE0 A;  4J9F A;  1SF9 A;  2DA9 A;  3BFM A;  2QEX A;  2DIQ A;  4P5N A;  3VS0 A;  2WAC A;  1EFN A;  3M5A A;  1PRM C; 
#chains in the Genus database with same CATH homology
 4X34 A;  4BB7 A;  3L2V A;  3JRZ A;  1PSF A;  4QQD A;  1Q82 C;  4IUR A;  1KQ2 A;  1M1F A;  4M78 B;  3PGG A;  4PNO A;  3OA6 A;  1W2B A;  1XNI A;  1VQ5 A;  4LDW A;  3HRT A;  1G3S A;  2LVM A;  3CME A;  4JRQ A;  1QVG A;  1H64 1;  4BE2 A;  1KHI A;  1WGS A;  1XTD A;  1JBM A;  4DOV A;  1O75 A;  1VQ9 T;  3JCM X;  2LQ8 A;  2XD0 A;  1K9M C;  4KBM B;  3E19 A;  1LOJ A;  4C5H A;  3OW2 A;  4A4F A;  3S3O A;  3JCM Q;  2LCC A;  3V7S A;  4EMG A;  2ZPB B;  4M77 B;  1X6O A;  2XHC A;  4RCB A;  5LJ5 j;  3CCQ T;  2F5T X;  3M4G A;  5GMK h;  2XIC A;  1VQM A;  4M7D B;  1YIT A;  1Q82 U;  3LLR A;  1BI1 A;  4FM4 B;  3S3M A;  4QQG A;  2XKO C;  3VV0 A;  1Q7Y C;  2MAM A;  4XTZ A;  2KK4 A;  4FU6 A;  4C0G A;  4ZGD B;  2WSF E;  5GAM j;  4XU2 A;  1RI0 A;  2RO0 A;  3QYG B;  4XU1 A;  2CZ6 B;  3OYL A;  1JJ2 S;  2EQU A;  4MDW A;  4E7L A;  4JUV A;  5GAO r;  4ZTF A;  4ME7 A;  4II1 A;  1HK9 A;  1NZ9 A;  5LJ3 h;  3FEO A;  3CCM T;  3M4Y A;  3BW1 A;  5CAI A;  3CCR A;  1XQH A;  4F7U B;  5GAO m;  1KG1 A;  2K5I A;  5CKE A;  1ZHI A;  3L2Z A;  4EPC A;  1S72 T;  2LQK A;  2HBP A;  5FU6 B;  3SDZ A;  2DXU A;  2RB6 A;  2DEQ A;  5KE3 A;  4J5Y A;  4EMK B;  1OZ3 A;  4JDS A;  3ZFJ A;  5LJ5 f;  4IUV A;  3DLL A;  2X4J A;  3LGL A;  4N0A C;  4XTW A;  1O9S A;  4XU0 A;  3CCL T;  1KD1 C;  1YJ9 T;  3G71 T;  1UGR B;  2XK0 A;  4D6W A;  1N8R U;  3JCM h;  3JCM c;  4M78 F;  4JRK A;  4C8Q D;  1WJS A;  4E47 A;  4IUQ A;  5GAM f;  5J39 A;  2HQX A;  2PUO B;  4UC4 A;  4BI4 A;  4BAC A;  2A7Y A;  2PVO B;  4L5G A;  3TCJ A;  1Y07 A;  2IG0 A;  2DO3 A;  2DTH A;  2MI6 A;  4C8Q C;  3CCV T;  5J26 A;  5FRM A;  2LC4 A;  3OYA A;  3QYH B;  2DD5 A;  2PVG B;  2HNI A;  3TRE A;  1UB4 A;  4PKC C;  4C5E A;  2DPP B;  5AYF A;  1KHC A;  5GAN 6;  3Q1J A;  3L2W A;  1VQ6 T;  4PL6 A;  3OYD A;  1P92 A;  2CZ0 B;  4M77 F;  5GMK l;  2RHZ A;  1R8O B;  1KD1 U;  4PJO D;  3HRU A;  1M8V A;  3PT9 A;  5I2M A;  3PIP A;  2M0O A;  3MEA A;  2LDM A;  4OVA A;  5CKB A;  4BUG A;  1YI2 T;  3JCM W;  4HT9 A;  2DVE A;  2QQA A;  2Y90 A;  4DOW A;  4M78 A;  3OS5 A;  4PJO C;  3G6E T;  3V7R A;  1W4S A;  2DKG A;  2X4Y A;  1OYX A;  1U8R A;  3FDR A;  1QVP A;  2EQJ A;  2EQM A;  2E65 A;  1HXD A;  2X4W A;  3LGF A;  1KC8 C;  4HCB A;  3QG1 A;  3JB9 F;  4JRI A;  3JB9 H;  3RUX A;  4JS5 A;  3CCM A;  2E41 A;  2V8I A;  4ZN1 A;  5LJ3 d;  4GLK A;  1ZBX A;  5GMK i;  2O01 E;  3I56 T;  3ASK A;  3F70 A;  1VQ8 T;  3G4S A;  2K4Y A;  1W2B S;  2RK1 A;  2ZPH B;  3EFS A;  3A8G B;  4M77 A;  5IN1 A;  1WQ7 A;  3L2Q A;  4M7D A;  4Y91 A;  3BDU A;  1QVG S;  4O6J A;  5CQY A;  2LX9 A;  3CPW S;  1NPR A;  3OBY A;  2B8A A;  3BY7 A;  3CCS T;  2QQS A;  2H3J A;  4QVD A;  2PUK B;  3MET A;  2R57 A;  1XOV A;  1M5Q 1;  4L6V 5;  2RM4 A;  3RKX A;  2K3Y A;  2E5Q A;  3V8K A;  3OW2 S;  3OYN A;  4ZN3 A;  1Q81 C;  1KC8 U;  1VQN A;  4OB1 B;  3JCM d;  3HHT B;  3TU4 K;  5LJ3 g;  3QXE B;  4J7I A;  4OGE A;  3SFM A;  4E7H A;  2GQV A;  2L8D A;  2M16 A;  4BY6 B;  2AHJ B;  3SWN C;  3P8D A;  2LT1 A;  2R5M A;  4PJO E;  3QDR B;  3LX7 A;  2RHU A;  4F7U A;  1NE8 A;  3QKJ A;  1H3Z A;  1VQL T;  3MP1 A;  3DB3 A;  3ME9 A;  3OYG A;  2DXB A;  5C6S A;  5GAN 2;  1VQ6 A;  5CCA A;  2CZ7 B;  4MZT A;  4X9C A;  4EMK A;  1N9S A;  2RJC A;  1IZ6 A;  3C12 A;  3FRN A;  4Q5W A;  5KCO A;  4XTU A;  5GAO l;  3KXT A;  3AHU A;  3GPL A;  4J6X A;  1BI0 A;  2DTI A;  4C8Q B;  4LDU A;  1Q86 C;  3JCM g;  4R56 A;  2Y4Y A;  3HRS A;  4XQ3 A;  1YI2 A;  5LJ5 e;  2DIG A;  1Q81 U;  4J6Y A;  4RG2 A;  3CC7 T;  5FRN A;  5DY9 A;  3G6E A;  4J6W A;  3OS2 A;  4GY5 A;  5GAN j;  3OYE A;  3L2U A;  2PVD B;  1YJN T;  1YJW A;  3JCM P;  2RHI A;  1ZQ1 A;  2RJE A;  3OYC A;  4C92 B;  3QPH A;  4OP0 A;  3A5Z B;  5GAM e;  3CPW A;  4M78 G;  1VQO A;  5D6Y A;  3RER A;  4LD6 A;  4V2S A;  3H6Z A;  2XI9 A;  3P8H A;  4PLI A;  4QVZ A;  5KCH A;  3J80 E;  2FVU A;  2GFU A;  3M9Q A;  3OYK A;  1G3Y A;  4QVC A;  2E70 A;  2KSS A;  1Q86 U;  2EWN A;  2DK3 A;  2VXE A;  4C5G A;  3NTK A;  2EJG A;  2JUF A;  1VIF A;  4N4G A;  4C0D B;  2ZCF B;  5FU7 C;  1I8F A;  2VGM A;  4KUD K;  2VXF A;  3CC4 T;  3OYF A;  4A54 A;  3I55 A;  2XG8 D;  1VQP T;  1KQS A;  3OSV A;  4HA8 A;  4HCZ A;  5J3B A;  3UDC A;  3UPU A;  5DLO A;  1FX7 A;  4M77 G;  1VQK T;  3OYB A;  2D6F A;  2DZC A;  3SB2 A;  4IKF A;  4FIB A;  4M75 B;  4M7D G;  5FLX E;  4BDY A;  3RKY A;  4E7J A;  1FWZ A;  2RJD A;  3PMI A;  4C0F A;  4O5V A;  1JB0 E;  5GAN f;  3MO8 A;  3X25 B;  4A4H A;  1M1G A;  1G3T A;  2WSE E;  4HKE A;  4BE1 A;  3N5B B;  1WNL A;  3G7Z A;  3OBW A;  2ZGW A;  4KUI A;  4A4E A;  3CMA A;  1K9M U;  3OS1 A;  1N27 A;  3QJY A;  4MZM A;  3TEE A;  2FYK A;  3WVD B;  3JB9 G;  4J8O A;  2VUB A;  3ZEH A;  4JLG A;  3J7A F;  1EIF A;  2FHD A;  2XU8 A;  2YLC A;  3R6O A;  2V8J A;  2JZ2 A;  4J7F A;  2E6N A;  4M7A B;  4A4G A;  3FIF A;  3HP9 A;  5IT9 E;  2JTM A;  1Q7Y U;  4A53 A;  2ZPI B;  3CC7 A;  3GNF B;  2MF2 A;  2O4X B;  3JCM b;  1YJN A;  3FC3 A;  5DLQ E;  5CKD A;  2KMT A;  4FSX A;  5CKH A;  2XDD A;  5A0D A;  4FT2 A;  5CQX A;  4C92 F;  2K5L A;  3X28 B;  2KQW A;  5GAO q;  1VQ9 A;  3V8J A;  3CCU T;  3E9F A;  1OI1 A;  3CCE T;  2E10 A;  1UGP B;  3HFN A;  4FL6 A;  4YTL A;  1BKB A;  2RI3 A;  3KUF A;  1MHN A;  2EIF A;  2RI2 A;  5DM7 R;  4NL3 A;  2P0Q A;  2DAQ A;  3HL8 A;  4NS5 A;  2FL7 A;  2V8K A;  3RMQ A;  5LJ5 h;  1N6A A;  5GAN 4;  3CCJ T;  4C8Q A;  3CCQ A;  2QA4 T;  4BI8 B;  1WJR A;  4M7D F;  3OYY A;  2E1H A;  2QI2 A;  1VQK A;  3M53 A;  3QZ5 B;  1QVF A;  4JJN K;  3FB9 A;  1BI3 A;  4LD9 K;  4N4H A;  5LL6 S;  3QJ6 A;  4M75 F;  2OTJ A;  4WF2 A;  4LDY A;  1K8A C;  2X35 A;  5GAM h;  2R5A A;  3L2R A;  2EAY A;  3OSS C;  1YCY A;  4X9D A;  1VQ7 T;  1NPP A;  2RHX A;  3E1S A;  3CPF A;  2RD1 A;  4C92 A;  4OB0 B;  2CS7 A;  4M78 D;  3GOX A;  5CK9 A;  2RA2 A;  3RES A;  2KVQ G;  5M9O A;  1S72 A;  4F7U F;  3QHS A;  4M78 C;  3OYM A;  1VQ4 T;  4MDX A;  2VV5 A;  3X26 B;  4KUL A;  2DTO A;  3OB9 A;  2QEX T;  4OMF B;  3DKM A;  1U1T A;  4PLL A;  2X4X A;  2P0K A;  4M7A F;  3C95 A;  3LWI A;  3V7C A;  3CCL A;  2JN0 A;  2LTO A;  4B9W A;  1X75 C;  2QQB A;  2YLB A;  4M77 D;  2KY9 A;  1K8A U;  2DD4 A;  2IVW A;  1YJ9 A;  4M75 A;  3UT1 A;  3MP6 A;  3G71 A;  4JS4 A;  4L59 A;  3JAM E;  2CGH A;  2VGN A;  1VQ5 T;  3JCM J;  5A0G A;  4M77 C;  2MWP A;  1N9R A;  5EG2 A;  3M56 A;  2VC8 A;  3P8B B;  1UGQ B;  3X20 B;  4RMO A;  2K3X A;  1LJO A;  4IUT A;  5GAN e;  1KQS S;  3GNG A;  3ZBD A;  3CCV A;  4OGC A;  3CCU A;  2EJF A;  1D3B B;  5KE2 A;  3JB9 D;  1Y96 B;  5GAO n;  5CR2 A;  4JRP A;  3FLG A;  3JB9 J;  3S3N A;  3ER0 A;  3CCJ A;  5I21 A;  4VUB A;  5GMK j;  1VQM T;  1V29 B;  5LJ5 d;  3CXC S;  4M7A A;  3PIO A;  1YIT T;  4CI0 C;  3KBG A;  5HK0 A;  3FJP A;  3OMC A;  3RMS A;  4M78 E;  3JCM V;  1QP2 A;  4DA4 A;  1TH7 A;  3M55 A;  2O4X A;  2CZ1 B;  5CKF A;  3T9N A;  3PTA A;  4C8Q G;  2GCX A;  4OB2 B;  2OTJ T;  3HKS A;  4Y28 E;  3DLM A;  3A8O B;  4J83 A;  1QP3 A;  5GAM d;  4EMK C;  3JSC A;  5C0M A;  2KAF A;  4DQ2 A;  1WJQ A;  5LJ3 j;  2E6Z A;  2QQR A;  5IAY A;  1M90 C;  3MEW A;  2DZ9 A;  3MEU A;  5GMK m;  3CCR T;  3RIR A;  2P0P A;  3I56 A;  3O8V A;  1I4K 1;  4E7K A;  3PFS A;  5LJ5 g;  1VQ8 A;  3INZ A;  4PJO B;  4M77 E;  2JNG A;  1VQ4 A;  3PMT A;  3UWN A;  4C92 G;  1K73 C;  3HFO A;  4M7D E;  3OYI A;  2RK2 A;  2EQK A;  3QII A;  4KT0 E;  4XTX A;  3OS0 A;  4OF1 A;  3LW5 E;  5HKC A;  4JLI A;  3LH0 A;  4IUU A;  3CCS A;  3OMG A;  5GAM g;  3PNW C;  5GAN 7;  1AHJ B;  3CD6 T;  1B34 B;  1U1S A;  2WSC E;  3BDL A;  4B9X A;  4BD3 A;  4EDU A;  4QQ6 A;  4NL2 A;  1YIJ T;  2BUD A;  4EMH A;  5GAO p;  1M90 U;  5CIU A;  4RKU E;  3CXC A;  2K5F A;  5HK3 A;  4M75 G;  4F7U E;  2HAX A;  2GF7 A;  5LJ3 f;  3QUI A;  1K73 U;  4Z02 A;  4ZTJ A;  1VQL A;  1QVF S;  1I5L A;  2ZPF B;  2XDB A;  3NTH A;  2HD0 A;  4M7A E;  2EFI A;  3EFR A;  2E12 A;  5D6W A;  5D6X A;  3VYH B;  3J81 E;  3NFC A;  3OY9 A;  1BI2 A;  1YBY A;  3SWN B;  2BKD N;  4RCC A;  3QSU A;  1OZ2 A;  4F7U G;  3A8H B;  4C8Q F;  2HQE A;  2VYT A;  4ELY C;  5FRO A;  2M1H A;  4TVR A;  1LNX A;  3JCM f;  1G3W A;  3WXM B;  3MP8 A;  4M7A G;  3M57 A;  4XTY A;  5GAN h;  3RKW A;  1N8R C;  1Y7X A;  1NJI C;  4N0A A;  1Y71 A;  4RG8 A;  5KH6 A;  2MMP A;  4HT8 A;  3VYG A;  1UEB A;  4LDX A;  3CC2 T;  2K57 A;  5CO7 A;  1D3B A;  1Y96 A;  3G4S T;  4PJO F;  1G5V A;  4ZGJ B;  1YHQ T;  3M58 A;  4ELZ C;  2JTF A;  3MHX A;  1IRE B;  3MCA B;  1RL2 A;  2CYZ B;  2QQ9 A;  3VJP A;  1JRI A;  1MGQ A;  2QDY B;  2ZPG B;  4BY6 C;  3CC4 A;  1VQP A;  3E9G A;  3M54 A;  3CD6 A;  1UGS B;  3CBP A;  3A8L B;  2PQW A;  2EJ9 A;  5HY6 A;  2YRV A;  4MMK A;  3SD4 A;  1NJI U;  1YIJ A;  1M1K C;  4OB3 B;  3VUB A;  2LNV A;  4R55 A;  1VQN T;  2OAU A;  3CBO A;  3URG A;  5A0L A;  3EAE A;  1KQ1 A;  5L8R E;  4C5I A;  1DJ7 B;  4CRI A;  2EKO A;  5FU7 B;  4A4K A;  3VUZ A;  2R58 A;  3VKI A;  5GAN 8;  1GXI E;  3WVE B;  2OTL T;  2K2V A;  3OQ5 A;  1PSE A;  2L3R A;  2I2L A;  3L1A A;  4PJO A;  3LYI A;  3QO3 A;  2GFA A;  2XDP A;  4C92 D;  2F69 A;  3QBY A;  3GF5 A;  1VIE A;  3L42 A;  1JJ2 A;  2M9U A;  4LDV A;  2LRQ A;  2DXT A;  4HCC A;  4C92 C;  1M1K U;  4N4I A;  5GMK e;  3S6W A;  1B34 A;  2DXC A;  2JOY A;  1BIB A;  3C94 A;  2P4T A;  3GLX A;  4M7D D;  4XU3 A;  1YJW T;  4ATO A;  3C4S A;  5GAN d;  3NTI A;  2G3R A;  4NOY A;  2ZZD A;  4M75 D;  4C0D C;  3CME T;  2F5K A;  4ZGE B;  3CC2 A;  1VQO T;  4M7D C;  4MZP A;  2L89 A;  1WPY A;  4XAX B;  5I2S A;  3CCE A;  1YHQ A;  2LCL A;  1WQW A;  4M75 C;  2D9T A;  5LJ3 e;  1X01 A;  3MEV A;  4FT4 A;  2C06 A;  5GAN 5;  1M9S A;  4MML A;  4C8Q E;  3DB4 A;  5A2Q E;  2DJZ A;  2YHT A;  2QA4 A;  3SWN A;  3JB9 I;  5CVI A;  4C0Z A;  3OYH A;  3I55 T;  1FXX A;  2BIV A;  2L5Q A;  3X24 B;  2PU9 B;  5GAN g;  4BDZ A;  3VU3 C;  3V8L A;  3A8M B;  2NLU A;  3CBM A;  4XK8 E;  5GAN 3;  4M7A D;  1VUB A;  3CEY A;  3QZ9 B;  2Y4X A;  4C92 E;  5FU6 C;  2RH2 A;  2A3L A;  1M4Z A;  1VQ7 A;  1BIA A;  2QTX A;  4E7I A;  2CKK A;  3JCM e;  3CMA T;  2OTL A;  4M7A C;  4QW2 A;  1QW1 A;  2ZPE B;  2KDS A;  3M59 A;  2RHY A;  2LT4 A;  3LWH A;  2JVV A;  3H8Z A;  2FB7 A;  2RJF A;  3OYJ A;  4BE0 A;  4XTV A;  3HPW A;  2QXF A;  2RI5 A;  3BFM A;  2D0Q B;  3GP8 A;  2XID A;  1I81 A;  2DIQ A;  4IUP A;  2QEX A;  4P5N A;  4BI3 A;  1BYM A;  3HSB A;  2E64 A;  2WAC A;  2MWO A;  4PJO G;  1SSF A;  3M5A A;  3GIB A;  2EYQ A;  4M75 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...