5DY9A

Y68t hfq from methanococcus jannaschii in complex with amp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDTIEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hfq-like protein
molecule tags Rna binding protein
source organism Methanocaldococcus jannaschii dsm 2661
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dy9A00
3JCMP 3RKWA 3JB9F 4M7AD 4C92A 3V8JA 3V8LA 4XU2A 4M7AG 5GANh 5GANf 4X9CA 3JCMg 1Y96A 5GAOl 5GMKe 3JCMJ 5GAN8 4F7UA 3JCMd 1WQ7A 1YCYA 2YHTA 3FIFA 1D3BA 4MMKA 5LJ5j 4JUVA 4PJOA 3HSBA 5GAN7 2CGHA 2QTXA 4OP0A 4XU3A 5GAN5 3JB9I 3BFMA 3INZA 4HT9A 1B34B 4M7DE 3JB9G 2YLBA 2DEQA 1WNLA 2DZ9A 4HA8A 3RIRA 3RKYA 1TH7A 1KQ1A 5GAN4 3JCMV 5LJ5d 4M77B 4C8QG 3JB9D 4M7AF 5GMKm 4PNOA 4J5YA 3JCMW 4C8QA 4RCCA 2ZGWA 4C8QD 5GAN2 4XU0A 4Y91A 2RD1A 3RERA 4C92F 4X9DA 3BDUA 4M77C 2E65A 1B34A 1U1TA 1WQWA 4F7UF 5GAOn 3GIBA 4J6WA 4JLIA 5GANj 4M75D 1X01A 4M78E 2E64A 4M75A 4N0AC 4JRIA 4C92D 2EJ9A 4QVDA 5GAMg 3QSUA 4C8QF 2DKGA 5GANe 2RB6A 4M77F 1H641 5GANd 4M75G 5GMKh 2EWNA 5LJ5g 2DVEA 4C92G 4M7AC 2DXTA 2DTIA 4XTVA 4M75C 1MGQA 4C8QC 3V7SA 3PGGA 4NL3A 1KQ2A 3EFRA 4M77A 1I5LA 4XTYA 4XTXA 4XU1A 2EJGA 4EMKC 3HFOA 4M75F 4M78D 4HT8A 4M7AA 4M78C 2DZCA 1I81A 5LJ5h 5GAMf 3SWNC 5I21A 5GAMh 1U1SA 4M7DC 3RUXA 4V2SA 4M78G 1BIBA 5GAMe 4PJOC 1Y96B 5LJ3j 4XTZA 5GAOq 4C92B 2DTOA 5LJ3h 4M7DF 4PJOE 3RESA 4PJOG 3JCMX 4PJOB 2I2LA 2K57A 5GAOm 5GMKi 1JRIA 3QUIA 2VXFA 2E41A 3HFNA 3SWNA 4A54A 3JCMe 2DXUA 2EJFA 1BIAA 3L2ZA 3M4GA 4M78B 3RKXA 2VC8A 5LJ3d 3V7CA 3V7RA 3VU3C 4EMKB 4QVCA 4XTUA 4M77D 1I4K1 5GMKl 4M7DD 1M8VA 3JCMc 3V8KA 2Y90A 4PJOD 3JCMQ 3BY7A 3FJPA 1WPYA 4M7DG 4M77G 1M5Q1 4C8QB 1LJOA 4NOYA 4C92C 4DQ2A 2E1HA 3JB9H 2FB7A 5GMKj 1HXDA 4F7UB 5DY9A 2YLCA 4M77E 3SWNB 3AHUA 3EFSA 1JBMA 4NL2A 5CAIA 3JCMh 4EMGA 3JCMf 5GAMd 4M7DA 4WF2A 4EMKA 3SB2A 5GANg 5LJ3g 4M7AE 2DJZA 3QHSA 5LJ3f 2EAYA 4M7AB 3L1AA 4A53A 4M75B 4J6XA 5GAOp 4C92E 2E10A 4XQ3A 5GAN3 4M75E 4M78A 1N9RA 4XTWA 5GAMj 5LJ3e 4F7UE 4JRKA 5LJ5f 5GAOr 3JCMb 2FYKA 1N9SA 4M78F 5GAN6 3BW1A 1LOJA 4MMLA 1LNXA 2DTHA 3QO3A 4J6YA 2VXEA 4N0AA 2RA2A 4RCBA 4C8QE 4EMHA 3JB9J 2HNIA 3FB9A 4F7UG 1D3BB 5LJ5e 2JN0A 4PJOF 1HK9A 2RM4A 1I8FA 4M7DB
chains in the Genus database with same CATH superfamily
2L8DA 2JMCA 2JVVA 1X2QA 3R6NA 1G5VA 5ECAA 2DL7A 2ZPIB 1Y96A 1VQKT 2CP5A 3BDLA 3O8VA 1YNZA 3EG9A 3VS3A 3H41A 1PRLC 2NUTB 1OOTA 3CCRQ 3LGFA 3D7SB 1W2BP 4DEXA 2D6FA 2BIVA 4C5IA 1WXUA 1Y0MA 1TSFA 4OB1B 2XG8D 1YITQ 1JXMA 2KAFA 3QJYA 1OPKA 5GANd 1G83A 3QYHB 2VWFA 2QDLA 2R5MA 1KD1U 4M77A 1K8AC 3MEWA 2PUKB 5FU7C 4LNPA 2FRWA 4M75F 3OYEA 4OMFB 4ZTFA 1TOVA 2L3RA 3OSSC 2JTEA 3TEEA 3S3NA 2OAWA 5LJ3h 4M7DF 3P8DA 4FYXB 3M9QA 1VQ9A 4CC7A 3EGXB 2RJDA 5GMKl 2K2VA 1I4K1 3LLRA 2OTLT 4MZMA 3G4SA 2OTJA 4LDWA 3CC4Q 3GOXA 3CEYA 4OMOA 2KDSA 1VQ4T 1VQPQ 1KJWA 1KSWA 1WGSA 1QQJA 3NHNA 3FEOA 2DF6A 4BI3A 1QLYA 2E5KA 2EYWA 5GAOp 2ZPHB 4JJDA 4XTWA 2J6KA 1SSHA 1X27A 2CZ1B 4GBQA 3UF4A 4M78F 2NUPB 1YI2A 1MMDA 1XTDA 2DYBA 5KYUA 1Y71A 1D3BB 5LJ5e 3GP8A 1VUBA 2K3YA 3RMQA 3NTHA 1DJ7B 2CZ7B 4N4GA 5GANh 4PJMA 1TWBA 1E6GA 5GAOl 3JCMJ 3OW2P 1PSFA 2DD4A 3CCSQ 3BFMA 1D0YA 1VQNA 1VQ8A 2F2VA 1BI1A 2GGRA 2K6DA 2F1LA 4OMLA 2A37A 1G3WA 3M0RA 2PVOB 5IH2A 2QTVA 3NGPA 4J9HA 2KY9A 3BDUA 2X4XA 4YTLA 4AG1C 5GAOn 1VIEA 4F7UF 2NLUA 4IUQA 4EDUA 5GANe 3OYIA 1D0ZA 2XI9A 3CPWS 2XK0A 4HCCA 3I55T 2E70A 1IHVA 2LX7A 2KBTA 2JZ2A 4BE2A 4HXJA 1VQ4A 3PVQA 2QEXQ 5HY6A 3M58A 2HSPA 1RADB 2X4WA 4EIKA 2XD0A 3GNGA 1UG1A 2LDMA 3RMSA 3CMAA 1D09B 4LDVA 2VC8A 2F69A 1KC8U 2EFIA 4E7SA 1RAIB 4TVRA 2KYBA 1MMNA 1SKUB 3ZEHA 3N5BB 3RR6A 2OTLA 2VGMA 2NUPA 4LE9A 4C5HA 4EMGA 3CCUT 3SFMA 2B8AA 1TUGB 2ECZA 2O01E 2XDDA 2L89A 2V8JA 1U06A 5LJ3f 5CVIA 1QVGA 4R0KA 4IIOA 4KUDK 2LVMA 1M1KR 2LJ1A 3CPWP 1OEBA 2CT4A 4JRKA 1HYOA 3CBOA 1RAGB 2A08A 1M27C 2F5TX 2GFUA 2KROA 4ME7A 4E7IA 1OU8A 1WDXA 4J9IA 2QA4Q 3X24B 2ZCFB 4M7AD 3CCMA 2KYMA 4F04B 4J7IA 1Q7YR 2O9VA 2A36A 5LJ5j 1YFNA 4FIBA 3CCVT 4GY5A 3M4YA 1VQPA 5CIUA 3A98A 2DEQA 4J9CA 1KC8C 5GAN4 3EH2A 5FROA 1RAEB 4LDXA 3MJXA 4C8QG 1NE8A 1KHCA 3CCQQ 1AVZC 2ZGWA 3L2QA 2E3IA 5KYNA 1ZUKA 4M75D 3A8OB 1YI2Q 2HBPA 2CUDA 3QSUA 4C8QF 3E9GA 1YCSB 2EWNA 1RABB 2V8KA 2KNBB 2J6OA 2L2PA 2O31A 3GBQA 1VQ7A 3M54A 4XTXA 2RF0A 1NYFA 1UJYA 2LJ0A 2YRCA 4IKFA 5KE2A 1ABQA 3RNJA 2K9GA 1VQ8Q 2EQMA 3MCAB 2RHXA 1M8VA 1YIJQ 2HEQA 2XIDA 4EMKB 1GCPA 4R55A 1KC8R 4QVZA 4J8OA 4B6MA 3A8HB 4FYWB 2DJZA 1OU9A 2WSFE 2H8HA 2AK5A 4C92E 2E10A 4IUUA 5LJ5f 3REAB 2YUNA 3BW1A 1BYMA 4F7UG 3JCMP 1Y7XA 3CMAT 3V8JA 1FX7A 5FU6B 5IHNA 4RTYA 2CT3A 5GMKe 5D7UA 1YCYA 2EQJA 2JS2A 4VUBA 3CPFA 4C0ZA 1U8RA 1VIFA 2C0IA 3CCEA 2HQHA 4HA8A 3E19A 1FMWA 2X35A 1V29B 2YRDA 2M1HA 3LX7A 4C8QD 2VB6A 4M4ZA 3RERA 4O6JA 1FXXA 1WQWA 1ZQ1A 2DE0X 4FW1A 4J6WA 5GANj 1UHCA 2O4XA 3EG3A 2DBKA 1FMVA 1PWTA 3E1SA 4A4KA 1T3LA 2QXFA 2MYSA 1PM3A 3OS0A 5D6WA 4NL3A 1QMCA 1ZSZC 3VS6A 2HZYA 3EGUA 1GL5A 4AG2C 2DZCA 4HVVA 2DLPA 5CKHA 2RQVA 1VQOT 2CUBA 2L3SA 3CXCA 2K57A 1SSFA 3L42A 1WHHA 1G2BA 2PVDB 4KGXB 4JJCA 3OYKA 4PJOD 2E41A 3G71Q 1T3SA 9ATCB 2DFUA 2P4RA 5KCHA 5FRMA 2PQWA 1UTIA 2ZPEB 3TU4K 1PHTA 2D8JA 4LD6A 4NOYA 2A0FB 3M0SA 4NL2A 2RHYA 1TXQA 5KYWB 3A8MB 2G3RA 3OYDA 3OYAA 1NG2A 4J9GA 1RLPC 2BZ8A 4J6XA 3PNWC 1Q86C 2RJEA 1N9RA 2V26A 1JB0E 3PT9A 4HVWA 4MMLA 1H8KA 4BACA 4KH0B 1WA7A 2M9UA 4FSXA 1KQSA 5KYXB 2LQNA 5HKCA 2DL5A 3G6EQ 2KK4A 5GAN8 3CMEA 4BD3A 2HKQB 2DD5A 2CGHA 3A5ZB 2EQUA 3RIRA 3PIPA 3TSZA 3JB9D 4PK4A 4PNOA 4KGZB 1MMAA 2JTMA 2RD1A 4CC3A 4CI0C 1IHWA 3VS0A 3L2UA 1YHQQ 5KYWA 1CSKA 3MP1A 3VS1A 2ENMA 3O5ZA 2AKLA 5CQXA 2DBMA 2GQIA 1PKTA 1GCQA 2E6NA 3NTKA 4F16A 1GFCA 1AZGB 5KE3A 1OI1A 2EJGA 2M51A 1RAFB 4RTZA 3SWNC 2VV5A 1YI2T 2EGEA 2K7AA 5GAMe 1M1GA 1H92A 1WYXA 2YT6A 4C92B 2VKNA 4RTWA 4ELZC 2K3BA 2KRNA 5DLOA 3JCMe 3CD6Q 1S72A 4HCKA 4Y92A 2DAQA 3SD4A 1A0NB 4J9DA 3LYIA 2DL3A 1RUWA 3X25B 3TCJA 3DB4A 4ZTJA 4E7ZA 8AT1B 1JBMA 4ZN3A 4WF2A 1AZEA 2DRKA 1N8RC 2DIQA 2J06A 2L5QA 1N8RU 2EYYA 3OQ5A 4M75B 3M5AA 4Q5WA 4PJLA 5GAMj 3U23A 3VV0A 3CCJA 1VQ5Q 1UEBA 2JN0A 1HK9A 2G6FX 4F7UA 3OYGA 2O9SA 3CC2T 3C4SA 1W2BS 4FYYB 1OZ3A 3UATA 3JAME 3G4SQ 2OTJQ 1M90U 4BI4A 4PJOA 3CC7T 2C0OA 4LXCA 5GAN7 1MHNA 2FZKB 2GFAA 2P0QA 2GBQA 2DZ9A 3AT1B 1X69A 3QG1A 2QI2A 5D6YA 2KEAA 2RJFA 4XU0A 1M4ZA 1IB8A 2ZZDA 4JLIA 1X01A 4M78E 4C92D 3KUFA 4JRIA 2K5FA 1F1BB 2VASA 4OMPA 1XOVA 3UA7A 1M1KU 2DJQA 3EG1A 2CP2A 1JQQA 5IN1A 3EFRA 3DB3A 4XU1A 4M7AA 1RI9A 4RTTA 2DL8A 4PJOE 5IHIA 2I2LA 1VQNQ 4AFSC 1VQ5T 2EJFA 4IUVA 4JS5A 3VYHB 4M7DD 4M77D 3PFSA 1AEYA 4N4HA 4RTXA 1M5Q1 5KYYA 1K0XA 2X3XD 1NJIR 1XJWB 4HCBA 2DXBA 1K9MC 1S72T 2YLCA 5A0DA 1YJWA 1K9MU 2RQUA 1GBQA 3CCET 3CC2Q 3FC3A 2EAYA 3SHWA 4LDYA 2CDTA 1JEGA 4MDWA 1OX8A 4BE1A 1YJNQ 2KQWA 3OS1A 2DYIA 4BB7A 1VQ9Q 2LT1A 3UWNA 5CCAA 4XU2A 3CD6A 2CP3A 1HSQA 3MEAA 3JCMg 1EIFA 2K5LA 2C0TA 2QASA 4X34A 1Q82R 3JCMd 3Q1JA 3FIFA 1D3BA 2AIRB 3QJ6A 4OP0A 3I5SA 2M02A 1T0HA 1KQ1A 1NYGA 4M77B 2PU9B 2Z0WA 4AT1B 3JCMW 1M2OA 1QVFA 2KT1A 3FRNA 4AFZC 1PD1A 1WXTA 1U1TA 3OYLA 1VA7A 2WSEE 3CCVA 2PUOB 1GCQC 4E7LA 4DOWA 8ATCB 2FPFA 1B7TA 3OS2A 3QZ5B 4C92G 1EX4A 4XTVA 1PKSA 1MGQA 1K1ZA 1KQ2A 1U5SA 2COYA 2KMTA 4B9WA 4EMKC 1VYUA 1I81A 1YHQT 2X3WD 5J26A 2AKKA 2RQRA 3ME9A 1SF9A 1PC0A 5LJ3j 2BZXA 5CKBA 4ANJA 5GMKi 5GJWB 3QBYA 1YJNT 4N4IA 4A54A 4M7DA 2QQAA 4A4GA 2DXUA 3H6ZA 5LJ3d 3VU3C 3OYHA 4JPBW 1VQLA 5CQYA 3G7ZA 5I2MA 1MV3A 3GLXA 2FRYA 3NPFA 4M77G 4M7DG 4QQDA 4BUGA 1C6VX 3VRZA 1D1AA 1VQLT 2CYZB 3OY9A 4ESRA 2GNCA 2ATCB 1QVGP 2JMAA 1VQ7Q 1VQOA 1HD3A 3R6OA 1X6GA 4M78A 2QYZA 3OS5A 2DILA 3JCMb 2QEXA 4D6WA 4N0AA 1KD1R 3M55A 3OMGA 1M3AA 1I1JA 4PJOF 2K3XA 3VYGA 4DEYA 4HVUA 3GNFB 4KGVB 2CKKA 1M90C 2EQIA 1WQ7A 2CREA 2JM9A 3LW5E 4HKEA 2OJ2A 6AT1B 4M7DE 1NM7A 3H0IA 3A8LB 1WNLA 2F5KA 2QGGA 5IAYA 1WJSA 1X6BA 5KYUB 1TTHB 2RQWA 2DERA 1NJIU 2NUZA 4J5YA 1Y57A 4C8QA 4Y91A 4ZN1A 1UGVA 1Q82C 1B34A 3C12A 1M2VB 1ZSZA 3X20B 4N0AC 1SHGA 1WJQA 2ABLA 1GXIE 4OMNA 1K0SA 3OYYA 2DXTA 3OBWA 4M75C 4WTOB 2W10A 4RG8A 3CCMQ 1KK7A 2E12A 3CCLQ 1X6OA 1UDLA 3CXCP 1ZA1B 4RUGA 4MZPA 1PG5B 3X26B 2B86A 1VQ7T 4C0DB 3HL8A 1CKBA 1NEBA 4CC4B 2CZ0B 1SRLA 1PNJA 2IVWA 2KE9A 1WXBA 1ZX6A 3V7RA 4M7AC 3V7CA 3MP8A 2MAMA 2MK5A 3FJPA 3MPUB 4C92C 1YITT 1AOJA 2CP6A 2FPEA 1WHMA 1P92A 3SWNB 5KH6A 1NZ9A 1LVKA 1ABOA 3CCQT 3PMTA 4FCYA 4ZGEB 1M1KC 3EHQA 1VQKA 2MI6A 4ZNXA 3MHXA 2FYKA 3S3MA 1LNXA 4J6YA 3JB9J 2HNIA 1KQSS 1ZBXA 1TU0B 3M0PA 3PMIA 1B3QA 4QKUA 2CH4A 5I2SA 2KR3A 7AT1B 3G71A 3HHTB 1WHGA 4BE0A 2RHIA 2DXCA 3SEMA 2ZPFB 4E47A 2KXDA 3VUBA 5GAN5 3CCLT 3INZA 2QQRA 4ATOA 4JZ4A 4OMMA 2E6ZA 4AMCA 1FYNA 4OGEA 2JOYA 1YIJT 1TG0A 3LGLA 4EPCA 4DBRA 4PLLA 2H3JA 3I5RA 1QWFA 1VYTA 2R58A 1OPLA 4KH1B 1D0XA 1RACB 1QP3A 2V1QA 3G6ET 3HPWA 4OVAA 2EKHA 4C0DC 2DVEA 1PRMC 1NPRA 1YJWT 4MDXA 1C0MA 2CS7A 2Y4YA 2GTJA 1W6XA 3HFOA 2YWWA 2RO0A 5LJ5h 3QXEB 1YWPA 4V2SA 1QVFP 2DMOA 1UGRB 4XAXB 3OW2A 2XDBA 3TQ7P 4E2FB 5J3BA 4ZGDB 1O75A 2SEMA 1JJ2P 1VQ6A 1D1BA 3BE3A 2VXFA 5GAMg 1K9AA 1OQKA 3RKXA 1D1CA 2P0PA 3JCMc 4J9BA 3BY7A 4DQ2A 1LJOA 1RAAB 1TUCA 2VUBA 2FB7A 2QK0A 4PFZA 5FLXE 4E7HA 1V76A 2HD0A 2SRCA 2K5IA 2IPOB 1K73U 2YUQA 5LJ3g 3C0CA 1RLQC 2H3EB 4C5EA 1TS9A 4BI8B 3QIIA 3EGDA 4CRIA 4D8KA 3QO3A 4RTUA 2J6FA 1KQSP 1GRIA 2JNGA 2RM4A 1Q95G 1UGPB 3FLGA 5DM7R 1QCNA 4Z8AA 4FT4A 2V1RA 1G3SA 2KI7A 5A2QE 4IIMA 1SG5A 2YUOA 2QTXA 2EYXA 1IZ6A 5KYXA 3J7AF 1IGQA 1AWOA 2JM8A 2YUPA 3E2UA 3TREA 5LJ5d 3NFCA 1WLPB 1W1FA 2EQKA 2X51A 1VQMT 4X9DA 2L3QA 3MEUA 4DOVA 2L0AA 1ZHIA 5HK3A 5A0LA 2COZA 3KXTA 3URGA 4MZTA 3H9NA 3CCST 3CC7Q 2LMJA 1UJ0A 4PLIA 4HCZA 2MWOA 3QWYA 2AZVA 5KYYB 4HT8A 5I11A 2EKOA 2D8HA 3OBYA 1M90R 3SDZA 4M78G 3CCSA 1YN8A 1Y96B 1X2KA 2FZCB 2GQVA 2DTOA 1ZLMA 2NWMA 3RESA 4PJOG 1FMKA 2DNUA 2QG9B 5GAOm 2YRVA 2RJCA 3L2ZA 4L59A 2MOXA 2W0ZA 4D8DA 4NS5A 4FT2A 3JCMQ 1IRXA 2RI2A 4FM4B 3I56A 3JB9H 2X4JA 1AT1B 1R0BG 5DY9A 1ZUYA 1W70A 4II1A 1EFNA 1QCOA 3JCMh 3JCMf 2HDAA 1MNEA 3M0QA 3CCQA 3RDVA 3L1AA 4A53A 1NLOC 2RNAA 4M75E 5I22A 3CD6T 3DLLA 4C8QE 3A8GB 4OMQA 4WCIA 3FB9A 1N27A 3EG0A 1VQ6Q 3JB9F 1IREB 2JS0A 2HQXA 1R8OB 2P0KA 1VQMQ 2RQTA 3CMET 2YHTA 4FSSA 1G3TA 2DETA 2LC4A 2RK2A 2OI3A 4RTVA 4L6V5 3JB9G 4PL6A 3OYNA 2RHUA 3JCMV 3REBB 1NJIC 1UUEA 2EPDA 3LH5A 4FU6A 1YIJA 4ZGJB 2LCCA 4DBHA 2JJ9A 1CKAA 4M75A 2MCNA 4J9FA 3CCJQ 1VQ5A 1K76A 1SRMA 3UA6A 4CC2A 5GMKh 2AZSA 2QQBA 2EGCA 1BCOA 2MIOA 2XHCA 1M3BA 3ZFJA 3I56T 2O88A 3QPHA 4M7DC 5I21A 3RUXA 3EGDB 3NTIA 2HL3A 2L3PA 2OAUA 2HBWA 3X28B 2LTOA 4PJOB 2XDPA 1S1NA 3EG2A 2HMAA 4Z89A 1K73C 3M59A 4M78B 2HL5C 4GLKA 1RAHB 1T0JA 2NYSA 4C8QB 3CCVQ 2QEXT 1HXDA 5EC7A 2P4TA 3CCRA 2XU8A 5GAMd 1K9MR 4UC4A 1ZBJA 1VQ6T 3QZ9B 1OX9A 3QYGB 2ROTA 5FW9A 1VOMA 1JO8A 2QA4T 5GAN6 3CBPA 5CKDA 3G71T 1JJ2A 1WJRA 1C1AA 2LP5A 1YJ9A 4OB3B 2JT4A 1MNDA 4M7DB 4Y28E 1IXDA 4BY6B 1M1FA 1SEMA 2EVRA 1WHLA 4JZ3A 1M2VA 4X9CA 1NLPC 1QWEA 1M3CA 2KSSA 2D0QB 2IIMA 3I56Q 4R56A 3JV3A 2J05A 2YLBA 4DBQA 3J80E 1Q86U 4PJJA 1TH7A 1N6AA 2QQ9A 1YJWQ 4JRPA 3EFOA 1GFDA 2E4HA 1UECA 1BI2A 5GAN2 5EG2A 2JUFA 3P8BB 2FPDA 3VJPA 1YJNA 2A7YA 2RB6A 4M77F 5FWBA 4PFPA 3OW2S 2BKDN 3VKIA 1PSEA 1XNIA 1AWWA 2XICA 4F14A 2CH4W 2HCKA 2COWA 4AFUC 3KBGA 2V8IA 2RI5A 2OX7A 1X75C 4XTZA 3CPWA 1Q82U 1JXOA 2CZ6B 1JRIA 1BIAA 3M4GA 1EZZB 1HJDA 2ESWA 3HRUA 2EYZA 4OB0B 1YJ9T 4PKCC 4JRQA 3WVEB 1I0CA 2E1HA 1N8RR 3F70A 4M77E 1XQHA 1J3TA 3EFSA 2BZYA 3DKMA 2RMOA 5FU7B 4FW2A 1OV3A 1PCXA 1Q81C 4XQ3A 1JJ2S 4B9XA 3JSCA 3CCRT 1M8MA 5GAOr 4F7UE 1WI7A 1AHJB 1YITA 4L5GA 2DTHA 5LL6S 3VRYA 5CKEA 1AWJA 3UDCA 1FWZA 4LUEA 4OGCA 2GCXA 3S3OA 5CR2A 1NEGA 3LWIA 1UHFA 4DBFA 1VQLQ 2LCSA 3META 4DA4A 3HSBA 4A4FA 3OMCA 1B34B 2EIFA 2QGFB 2YDLA 3UPUA 4M7AF 2LNHB 4E6RA 3HRTA 4E7JA 2DIGA 4C92F 1Y07A 1ZUUA 1SPKA 1VQKQ 3EH1A 2E64A 3FJ5A 2EJ9A 4QVDA 1WHJA 2QQSA 2OTLQ 4QT7A 4M75G 2FHDA 1YJ9Q 3MEVA 4Z02A 5D6XA 4PFOA 2XKOC 3CC4T 1E7OA 1WZOA 3PGGA 4KBMB 1BCMA 2ZPGB 2DK3A 2M0YA 1ZSZB 5AT1B 3QWXX 4M78D 2QDYB 5IXFA 2RPNA 2RK1A 5HCKA 2MPXC 4KULA 4JLGA 1BU1A 1KD1C 1RL2A 3QUIA 3SWNA 2E3HA 3OB9A 3PE0A 2FVUA 5GAOq 5C6SA 1Q86R 3IQLA 2Y90A 2DRMA 2AHJB 2LT4A 5IHKA 5GMKj 3JRZA 2M16A 1W2BA 3MKDA 3S6WA 3ZL7C 2RH2A 2ROLA 3OYFA 1VQ9T 1R77A 3QHSA 5FU6C 5CKFA 1IGUA 5LJ3e 2DA9A 2HSEB 2KT8A 1YP5A 4E7KA 1QCFA 3WVDB 4XK8E 1I8FA 2LRQA 3HRSA 3RKWA 1U3OA 3P8HA 1S72Q 2HQEA 5GJVB 1VQPT 5GANf 1VQ4Q 4F17A 4O5VA 1G8XA 2MMPA 3THKA 4J83A 2QAZA 4XU3A 5J39A 2VGNA 2ZPBB 4HT9A 1ARKA 1BK2A 3RKYA 2LX9A 2JXBA 4C0GA 3CMAQ 5GMKm 4RCCA 1QVPA 2DVJA 4LD9K 3H0FA 2JW4A 2K2MA 4AFQC 2LCLA 2KGTA 5A0GA 1WFWA 1QW1A 1BBZA 1IO6A 1H641 5DLQE 4LUDA 1PD0A 2FG0A 1K73R 2ED0A 1MV0B 3CC2A 1ACMB 1I5LA 1AD5A 1H3HA 1K8AU 2PTKA 4P5NA 3LH0A 1U1SA 2CSIA 4A4EA 4PJNA 2QA4A 1WIEA 4Z88A 3QDFA 3NMZC 2R57A 2FZGB 1OZ2A 3I55Q 3HFNA 1RI0A 4OB2B 4QVCA 2LQWA 2HAXA 2EGAA 1UE9A 3ER0A 3V8KA 2AT1B 1QKWA 3QDRB 4ELYC 2IG0A 5KCOA 2PVGB 5CAIA 2BE7D 4EMKA 3SB2A 1NPPA 1R0CB 3MP6A 4C5GA 1Z9ZA 3CC7A 4M7AB 4J9EA 2LQ8A 4ORZA 5IXBA 2O4XB 5GAN3 2R5AA 1QP2A 5L8RE 2MWPA 2DO3A 2DM1A 3WXMB 1O9SA 2HKNA 1LOJA 2VXEA 4FYVB 4RCBA 3M56A 4EMHA 1UGSB 1Q7YU 3DLMA 1QVFS 3M0UA 3CCUQ 4QQGA 3CCJT 4C92A 1V1CA 4RKUE 2BTTA 3A1PA 3V8LA 3VUZA 2BE9B 1MUZA 2LNVA 2GTOA 4JDSA 3PTAA 2DPPB 1UB4A 1K4US 4BY6C 3C95A 3OSVA 3I35A 5M9OA 4JUVA 1SHFA 2I0NA 3JB9I 1LPLA 4IURA 5IT9E 2EBPA 3G1JA 1BKBA 3OA6A 2D1XA 2LZ6B 3M0TA 5FWCA 4LDUA 3GIBA 3VS5A 2DEUA 2RHZA 3RBBB 4C0FA 1Q81U 2KVQG 2DKGA 4IUTA 3ASKA 3GF5A 2F2WA 2JTFA 4C8QC 4BDYA 1ZSGA 2PNIA 1QVGS 3EAEA 3CQTA 4M78C 4A63B 5GAMh 5GAMf 4IUPA 1BI0A 2E5QA 1ZA2B 4PJOC 2BUDA 2VVKA 3KFVA 3PIOA 2WSCE 4K11A 5L23A 2X4YA 3JCMX 4RG2A 4KT0E 3I9QA 2O2OA 2DL4A 1MMGA 2Y4XA 2ED1A 4XTUA 1OYXA 3HKSA 2MF2A 1BI3A 2K79A 4KUIA 2FL7A 3CCEQ 4J7FA 4F7UB 1X43A 2D0NA 3VS2A 2KRSA 4X1VA 3OYCA 1UFFA 1VQNT 4M7AE 5GANg 1VYVA 1NBEB 2YSQA 3M57A 4A4HA 2P84A 4JJBA 1B07A 2DX1A 3CBMA 1UGQB 1Z9QA 1YHQA 1N9SA 2LJ3A 5CK9A 2FO0A 3FDRA 1N5ZA 2RN8A 1KFZA 1G3YA 3C94A 2F2XA 3ZBDA 3J81E 2FEIA 3MO8A 3I55A 1M30A 5FRNA 2ZAEA 4M7AG 3CCLA 4MMKA 5CO7A 1YBYA 2PZ1A 3QKJA 3HP9A 1H3ZA 3EHRA 2KRMA 3E9FA 2CSQA 2VYTA 1VQOQ 3EG9B 3G4ST 2OTJT 4M77C 2E65A 1GBRA 3CC4A 2K4YA 3T9NA 2NUTA 3OYBA 2GF7A 3L2WA 1AWXA 5LJ5g 2DTIA 3OYJA 3CCUA 1JU5C 3V7SA 1LCKA 3VS7A 2J7IA 4JJNK 4XTYA 2EW3A 3H8ZA 3UT1A 2YXYA 3OYMA 1VQMA 1K8AR 4LN2A 4GLMA 3EGXA 2CP0A 1E6HA 5AYFA 1WX6A 3H0HA 1M9SA 1BIBA 2RI3A 2WACA 1TUDA 3PVLA 3EFOB 2KXCA 1KHIA 3CXCS 1KG1A 1YWOA 2LQKA 2X9HA 3G6EA 2C06A 1QKXA 3CMEQ 2CP7A 3TSWA 1WPYA 3CCMT 4KRTA 3ULRB 5C0MA 3AHUA 1Q7YC 1WHKA 2A28A 3GPLA 1VQ8T 4FL6A 3L2VA 2A3LA 1Q81R 1W4SA 3L2RA 4QQ6A 2M0OA 4QW2A 1KIKA 5HK0A 2D9TA 4JS4A 2XMFA 1I07A 3HTRA 1OULA 3M53A 3LWHA 1I5OB 4BDZA 4RMOA 2RA2A 3VS4A 2EYQA 1BB9A 4OF1A 3TVTA
chains in the Genus database with same CATH topology
2L8DA 4OGCA 2GCXA 3S3OA 5I2SA 5HKCA 2JVVA 5CR2A 3G71A 1G5VA 3HHTB 2KK4A 3LWIA 2ZPIB 1Y96A 4BE0A 2RHIA 5GAN8 3CMEA 1VQKT 2DXCA 3BDLA 3O8VA 2ZPFB 2DD5A 3META 4BD3A 4E47A 4DA4A 3HSBA 2CGHA 3VUBA 4A4FA 3A5ZB 5GAN5 3OMCA 3CCLT 3INZA 2QQRA 4ATOA 1B34B 2EQUA 3RIRA 2E6ZA 2EIFA 3PIPA 4OGEA 2JOYA 3LGFA 3UPUA 3JB9D 4M7AF 1YIJT 3LGLA 4PNOA 4EPCA 4PLLA 3HRTA 4E7JA 2H3JA 2JTMA 2RD1A 2D6FA 2DIGA 2BIVA 4C5IA 4C92F 1Y07A 4CI0C 2R58A 3L2UA 4OB1B 2XG8D 2E64A 1QP3A 2EJ9A 4QVDA 3MP1A 3G6ET 3HPWA 2KAFA 4OVAA 2QQSA 3QJYA 5GANd 4C0DC 4M75G 2FHDA 2DVEA 3MEVA 3QYHB 5D6XA 4Z02A 1NPRA 1YJWT 5CQXA 4MDXA 2XKOC 2R5MA 3CC4T 3PGGA 2E6NA 1KD1U 2CS7A 2Y4YA 3NTKA 4KBMB 4M77A 1K8AC 2ZPGB 2DK3A 5KE3A 1OI1A 3MEWA 2PUKB 2EJGA 5FU7C 3HFOA 4M75F 4M78D 3OYEA 2RO0A 2QDYB 4OMFB 4ZTFA 5LJ5h 3QXEB 3SWNC 2VV5A 1YI2T 4V2SA 2L3RA 1M1GA 3OSSC 5GAMe 3TEEA 3S3NA 1UGRB 2RK1A 4C92B 5LJ3h 4M7DF 3P8DA 4XAXB 4KULA 3OW2A 2XDBA 4ZGDB 4JLGA 5J3BA 1O75A 3M9QA 1VQ6A 4ELZC 1KD1C 1RL2A 2VXFA 3QUIA 3SWNA 5DLOA 3OB9A 3JCMe 5GAMg 1VQ9A 2FVUA 5GAOq 2RJDA 3RKXA 5C6SA 2K2VA 5GMKl 1S72A 1I4K1 2DAQA 3LLRA 2OTLT 4MZMA 2P0PA 3JCMc 2Y90A 3SD4A 3G4SA 2OTJA 4LDWA 3BY7A 3LYIA 2AHJB 4DQ2A 1LJOA 3X25B 2LT4A 2VUBA 3DB4A 3CEYA 3TCJA 3GOXA 2FB7A 3JRZA 5GMKj 2KDSA 4ZTJA 1VQ4T 2M16A 1W2BA 5FLXE 4E7HA 3S6WA 2HD0A 1WGSA 1JBMA 2K5IA 2RH2A 1K73U 4ZN3A 4WF2A 3FEOA 5LJ3g 1N8RC 2DIQA 3OYFA 1VQ9T 3QHSA 4BI3A 2L5QA 5FU6C 4C5EA 1N8RU 5CKFA 5GAOp 3OQ5A 4M75B 4Q5WA 3M5AA 2ZPHB 4BI8B 3QIIA 4XTWA 5GAMj 3CD6A 5LJ3e 4CRIA 2CZ1B 4M78F 1YI2A 3QO3A 3VV0A 3CCJA 1XTDA 1Y71A 1UEBA 1D3BB 5LJ5e 4E7KA 2JN0A 3WVDB 1VUBA 3GP8A 2K3YA 1HK9A 2JNGA 2RM4A 3RMQA 4XK8E 1UGPB 3NTHA 1I8FA 4F7UA 3OYGA 2LRQA 1DJ7B 3HRSA 3CC2T 3FLGA 3RKWA 3C4SA 5DM7R 2CZ7B 3P8HA 4N4GA 4FT4A 1W2BS 1OZ3A 3JAME 2HQEA 5GANh 1VQPT 5GANf 1G3SA 5A2QE 4O5VA 5GAOl 3JCMJ 1M90U 1PSFA 2MMPA 2DD4A 4BI4A 4PJOA 4J83A 5GAN7 3CC7T 2QTXA 1MHNA 5J39A 4XU3A 2GFAA 1IZ6A 2P0QA 2VGNA 2ZPBB 3BFMA 3J7AF 4HT9A 2DZ9A 3RKYA 1VQNA 3TREA 1VQ8A 2LX9A 5LJ5d 1BI1A 3QG1A 3NFCA 4C0GA 2QI2A 2EQKA 5D6YA 5GMKm 1G3WA 4RCCA 2PVOB 2RJFA 4XU0A 1VQMT 1M4ZA 1QVPA 2KY9A 4LD9K 4X9DA 3BDUA 3MEUA 2X4XA 4YTLA 5GAOn 1VIEA 4DOVA 4F7UF 2LCLA 2ZZDA 2NLUA 4JLIA 4IUQA 1X01A 4M78E 4C92D 3KUFA 4JRIA 5A0GA 2K5FA 1QW1A 4EDUA 5GANe 3OYIA 1H641 1XOVA 2XI9A 5DLQE 1M1KU 1ZHIA 5HK3A 5A0LA 3CPWS 2XK0A 4HCCA 3I55T 2E70A 3KXTA 3URGA 4MZTA 3CCST 3CC2A 5IN1A 3EFRA 1I5LA 3DB3A 4PLIA 4HCZA 2MWOA 4XU1A 2JZ2A 4BE2A 1VQ4A 4HT8A 1K8AU 4M7AA 2EKOA 4P5NA 3OBYA 3LH0A 1U1SA 3SDZA 4M78G 5HY6A 4A4EA 3CCSA 3M58A 1Y96B 2GQVA 2X4WA 2DTOA 2QA4A 4PJOE 3RESA 4PJOG 2I2LA 1YJWA 5GAOm 2R57A 1VQ5T 1OZ2A 2XD0A 3GNGA 3HFNA 2LDMA 2YRVA 3RMSA 3CMAA 2EJFA 2RJCA 3L2ZA 4LDVA 4IUVA 1RI0A 4OB2B 2VC8A 3VYHB 4L59A 2F69A 4QVCA 4JS5A 2HAXA 4M7DD 4M77D 1KC8U 3ER0A 3PFSA 3V8KA 2EFIA 4NS5A 4FT2A 4N4HA 3JCMQ 2RI2A 4TVRA 1M5Q1 4FM4B 3I56A 3JB9H 2X4JA 4HCBA 2DXBA 3ZEHA 1K9MC 3QDRB 4ELYC 3N5BB 5DY9A 2IG0A 2YLCA 1S72T 2OTLA 4II1A 2VGMA 5KCOA 2PVGB 5CAIA 3JCMh 4C5HA 3JCMf 4EMGA 5A0DA 4EMKA 3SFMA 2B8AA 1NPPA 3SB2A 3CCUT 2XDDA 2O01E 2L89A 2V8JA 3MP6A 4C5GA 3CC7A 5LJ3f 3CCQA 3CCET 3FC3A 2EAYA 5CVIA 4M7AB 1QVGA 3L1AA 2LQ8A 4A53A 2O4XB 5GAN3 4KUDK 2R5AA 2LVMA 4M75E 1QP2A 4LDYA 5L8RE 2MWPA 4MDWA 2DO3A 4JRKA 4BE1A 3WXMB 3CBOA 1O9SA 2F5TX 2GFUA 1LOJA 4ME7A 3CD6T 3DLLA 4E7IA 2VXEA 3M56A 2KQWA 3A8GB 1UGSB 4RCBA 3DLMA 3FB9A 4C8QE 4EMHA 3OS1A 1Q7YU 1QVFS 3X24B 1N27A 4BB7A 2ZCFB 4QQGA 1IREB 3CCMA 3JB9F 3CCJT 4C92A 4M7AD 4RKUE 2HQXA 2LT1A 3V8LA 3UWNA 1R8OB 4J7IA 4XU2A 2P0KA 3VUZA 2LNVA 5CCAA 3PTAA 4JDSA 3MEAA 2DPPB 3JCMg 1EIFA 1UB4A 2K5LA 4BY6C 3C95A 4X34A 3OSVA 3JCMd 3Q1JA 5M9OA 3CMET 2YHTA 3FIFA 1D3BA 5LJ5j 4FIBA 1G3TA 4JUVA 3QJ6A 2LC4A 4OP0A 3CCVT 4GY5A 3JB9I 3M4YA 1VQPA 2RK2A 5CIUA 4IURA 5IT9E 3JB9G 2DEQA 4L6V5 4PL6A 1KC8C 1KQ1A 2RHUA 5FROA 5GAN4 3JCMV 3OYNA 1NJIC 4LDXA 4M77B 4C8QG 4FU6A 2PU9B 1NE8A 1YIJA 1BKBA 3OA6A 3JCMW 1KHCA 2ZGWA 4ZGJB 3FRNA 1QVFA 3L2QA 2LCCA 4LDUA 3OYLA 1U1TA 3GIBA 2WSEE 3CCVA 2PUOB 2RHZA 4C0FA 4M75D 3A8OB 4M75A 4DOWA 4E7LA 1Q81U 2HBPA 2KVQG 1VQ5A 3QSUA 4C8QF 2DKGA 4IUTA 3E9GA 3OS2A 5GMKh 2EWNA 3ASKA 3QZ5B 4C92G 2V8KA 2QQBA 3GF5A 4XTVA 1MGQA 2JTFA 4C8QC 2XHCA 1KQ2A 1VQ7A 4BDYA 3M54A 3ZFJA 4XTXA 3I56T 2KMTA 4B9WA 1QVGS 4EMKC 3EAEA 3QPHA 4M78C 1I81A 5GAMh 1YHQT 5GAMf 5I21A 4M7DC 4IKFA 5J26A 3RUXA 4IUPA 5KE2A 1BI0A 3ME9A 2E5QA 3NTIA 4PJOC 2BUDA 5LJ3j 3PIOA 2WSCE 2OAUA 5CKBA 2X4YA 3X28B 2LTOA 3JCMX 4PJOB 4RG2A 2XDPA 4KT0E 5GMKi 2EQMA 3MCAB 2RHXA 3QBYA 4N4IA 4A54A 1YJNT 1M8VA 1K73C 2QQAA 3M59A 4A4GA 2DXUA 3H6ZA 4M78B 5LJ3d 3VU3C 3OYHA 2Y4XA 2XIDA 4EMKB 4R55A 1VQLA 4XTUA 5CQYA 1OYXA 4GLKA 3G7ZA 3HKSA 5I2MA 3GLXA 2MF2A 4QVZA 4M7DG 4M77G 4C8QB 4QQDA 1BI3A 4BUGA 2QEXT 4KUIA 1HXDA 2FL7A 4J7FA 4F7UB 2P4TA 4J8OA 1VQLT 2CYZB 3CCRA 2XU8A 3OYCA 3OY9A 5GAMd 3A8HB 1VQNT 4M7DA 4UC4A 5GANg 4M7AE 2DJZA 2WSFE 3M57A 3QZ9B 4A4HA 1VQ6T 3QYGB 1VQOA 3R6OA 4C92E 2E10A 3CBMA 4M78A 2QA4T 3OS5A 4IUUA 5LJ5f 1UGQB 3JCMb 1YHQA 1N9SA 5GAN6 3BW1A 5CK9A 2QEXA 3CBPA 3FDRA 4D6WA 4N0AA 5CKDA 3G71T 1JJ2A 1WJRA 3M55A 1BYMA 4F7UG 3OMGA 1G3YA 3C94A 1YJ9A 4PJOF 4OB3B 2K3XA 3VYGA 3ZBDA 4M7DB 3J81E 3JCMP 1Y7XA 3GNFB 3MO8A 4Y28E 3I55A 5FRNA 3CMAT 3V8JA 1FX7A 4BY6B 1M1FA 2CKKA 5FU6B 1M90C 4M7AG 3CCLA 4X9CA 5GMKe 1K9MU 1WQ7A 1YCYA 2KSSA 4MMKA 2EQJA 4VUBA 5CO7A 3CPFA 2D0QB 4C0ZA 1U8RA 1YBYA 1VIFA 3LW5E 4HKEA 3QKJA 4R56A 3CCEA 4M7DE 2YLBA 3A8LB 1WNLA 2F5KA 3E19A 3HP9A 4HA8A 1TH7A 3J80E 1Q86U 1N6AA 5IAYA 1WJSA 1H3ZA 2QQ9A 2X35A 1V29B 3E9FA 4JRPA 1NJIU 4J5YA 1BI2A 2M1HA 2VYTA 4C8QA 3LX7A 4C8QD 5GAN2 4Y91A 3RERA 4O6JA 4ZN1A 5EG2A 2JUFA 1Q82C 3G4ST 2OTJT 4M77C 2E65A 1B34A 1FXXA 1WQWA 1ZQ1A 3C12A 3CC4A 2K4YA 4J6WA 3P8BB 3T9NA 3X20B 3OYBA 5GANj 4N0AC 2GF7A 2O4XA 3VJPA 3L2WA 1YJNA 2A7YA 1WJQA 2RB6A 3E1SA 4M77F 4A4KA 1GXIE 5LJ5g 3OW2S 3OYYA 2BKDN 2DXTA 3VKIA 3OBWA 1PSEA 2DTIA 2QXFA 3OYJA 4M75C 3OS0A 3CCUA 3V7SA 5D6WA 4RG8A 1XNIA 4NL3A 4JJNK 4XTYA 2XICA 2E12A 3H8ZA 3UT1A 1X6OA 1VQMA 3OYMA 2DZCA 4MZPA 5CKHA 5AYFA 3X26B 1VQ7T 1M9SA 4C0DB 1BIBA 3KBGA 2V8IA 2RI5A 3HL8A 1X75C 4XTZA 3CPWA 1VQOT 2RI3A 1Q82U 2CZ0B 2WACA 3CXCA 2K57A 1SSFA 1KHIA 2CZ6B 2PVDB 3L42A 3CXCS 1KG1A 1JRIA 2IVWA 2LQKA 2E41A 3OYKA 4PJOD 3G6EA 1BIAA 3M4GA 3V7RA 4M7AC 3V7CA 2C06A 3HRUA 4OB0B 5KCHA 3MP8A 5FRMA 2MAMA 2PQWA 1YJ9T 4PKCC 4JRQA 3FJPA 1WPYA 3WVEB 2ZPEB 3TU4K 4C92C 4LD6A 4NOYA 3CCMT 2E1HA 1YITT 3F70A 1P92A 4M77E 1XQHA 3SWNB 5KH6A 5C0MA 3AHUA 1NZ9A 3EFSA 1Q7YC 4NL2A 2RHYA 3DKMA 3GPLA 1VQ8T 4FL6A 3A8MB 2G3RA 5FU7B 2A3LA 3L2VA 3OYDA 3CCQT 3OYAA 3PMTA 1W4SA 3L2RA 1Q81C 4QQ6A 4ZGEB 2M0OA 1M1KC 4J6XA 4QW2A 3PNWC 4XQ3A 5HK0A 4B9XA 1JJ2S 2D9TA 2RJEA 1N9RA 3JSCA 1JB0E 3CCRT 4JS4A 1Q86C 5GAOr 3PT9A 4F7UE 1VQKA 2MI6A 1AHJB 3MHXA 2FYKA 3M53A 3S3MA 1YITA 4L5GA 4MMLA 3LWHA 1LNXA 2DTHA 4J6YA 4BDZA 5LL6S 4RMOA 2RA2A 4BACA 3JB9J 2HNIA 1KQSS 1ZBXA 5CKEA 3UDCA 2EYQA 2M9UA 4FSXA 1FWZA 1KQSA 4OF1A 3PMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM P;  3RKW A;  3JB9 F;  4M7A D;  4C92 A;  3V8J A;  3V8L A;  4XU2 A;  4M7A G;  5GAN h;  5GAN f;  4X9C A;  3JCM g;  1Y96 A;  5GAO l;  5GMK e;  3JCM J;  5GAN 8;  4F7U A;  3JCM d;  1WQ7 A;  1YCY A;  2YHT A;  3FIF A;  1D3B A;  4MMK A;  5LJ5 j;  4JUV A;  4PJO A;  3HSB A;  5GAN 7;  2CGH A;  2QTX A;  4OP0 A;  4XU3 A;  5GAN 5;  3JB9 I;  3BFM A;  3INZ A;  4HT9 A;  1B34 B;  4M7D E;  3JB9 G;  2YLB A;  2DEQ A;  1WNL A;  2DZ9 A;  4HA8 A;  3RIR A;  3RKY A;  1TH7 A;  1KQ1 A;  5GAN 4;  3JCM V;  5LJ5 d;  4M77 B;  4C8Q G;  3JB9 D;  4M7A F;  5GMK m;  4PNO A;  4J5Y A;  3JCM W;  4C8Q A;  4RCC A;  2ZGW A;  4C8Q D;  5GAN 2;  4XU0 A;  4Y91 A;  2RD1 A;  3RER A;  4C92 F;  4X9D A;  3BDU A;  4M77 C;  2E65 A;  1B34 A;  1U1T A;  1WQW A;  4F7U F;  5GAO n;  3GIB A;  4J6W A;  4JLI A;  5GAN j;  4M75 D;  1X01 A;  4M78 E;  2E64 A;  4M75 A;  4N0A C;  4JRI A;  4C92 D;  2EJ9 A;  4QVD A;  5GAM g;  3QSU A;  4C8Q F;  2DKG A;  5GAN e;  2RB6 A;  4M77 F;  1H64 1;  5GAN d;  4M75 G;  5GMK h;  2EWN A;  5LJ5 g;  2DVE A;  4C92 G;  4M7A C;  2DXT A;  2DTI A;  4XTV A;  4M75 C;  1MGQ A;  4C8Q C;  3V7S A;  3PGG A;  4NL3 A;  1KQ2 A;  3EFR A;  4M77 A;  1I5L A;  4XTY A;  4XTX A;  4XU1 A;  2EJG A;  4EMK C;  3HFO A;  4M75 F;  4M78 D;  4HT8 A;  4M7A A;  4M78 C;  2DZC A;  1I81 A;  5LJ5 h;  5GAM f;  3SWN C;  5I21 A;  5GAM h;  1U1S A;  4M7D C;  3RUX A;  4V2S A;  4M78 G;  1BIB A;  5GAM e;  4PJO C;  1Y96 B;  5LJ3 j;  4XTZ A;  5GAO q;  4C92 B;  2DTO A;  5LJ3 h;  4M7D F;  4PJO E;  3RES A;  4PJO G;  3JCM X;  4PJO B;  2I2L A;  2K57 A;  5GAO m;  5GMK i;  1JRI A;  3QUI A;  2VXF A;  2E41 A;  3HFN A;  3SWN A;  4A54 A;  3JCM e;  2DXU A;  2EJF A;  1BIA A;  3L2Z A;  3M4G A;  4M78 B;  3RKX A;  2VC8 A;  5LJ3 d;  3V7C A;  3V7R A;  3VU3 C;  4EMK B;  4QVC A;  4XTU A;  4M77 D;  1I4K 1;  5GMK l;  4M7D D;  1M8V A;  3JCM c;  3V8K A;  2Y90 A;  4PJO D;  3JCM Q;  3BY7 A;  3FJP A;  1WPY A;  4M7D G;  4M77 G;  1M5Q 1;  4C8Q B;  1LJO A;  4NOY A;  4C92 C;  4DQ2 A;  2E1H A;  3JB9 H;  2FB7 A;  5GMK j;  1HXD A;  4F7U B;  5DY9 A;  2YLC A;  4M77 E;  3SWN B;  3AHU A;  3EFS A;  1JBM A;  4NL2 A;  5CAI A;  3JCM h;  4EMG A;  3JCM f;  5GAM d;  4M7D A;  4WF2 A;  4EMK A;  3SB2 A;  5GAN g;  5LJ3 g;  4M7A E;  2DJZ A;  3QHS A;  5LJ3 f;  2EAY A;  4M7A B;  3L1A A;  4A53 A;  4M75 B;  4J6X A;  5GAO p;  4C92 E;  2E10 A;  4XQ3 A;  5GAN 3;  4M75 E;  4M78 A;  1N9R A;  4XTW A;  5GAM j;  5LJ3 e;  4F7U E;  4JRK A;  5LJ5 f;  5GAO r;  3JCM b;  2FYK A;  1N9S A;  4M78 F;  5GAN 6;  3BW1 A;  1LOJ A;  4MML A;  1LNX A;  2DTH A;  3QO3 A;  4J6Y A;  2VXE A;  4N0A A;  2RA2 A;  4RCB A;  4C8Q E;  4EMH A;  3JB9 J;  2HNI A;  3FB9 A;  4F7U G;  1D3B B;  5LJ5 e;  2JN0 A;  4PJO F;  1HK9 A;  2RM4 A;  1I8F A;  4M7D B; 
#chains in the Genus database with same CATH topology
 2L8D A;  2JMC A;  2JVV A;  1X2Q A;  3R6N A;  1G5V A;  5ECA A;  2DL7 A;  2ZPI B;  1Y96 A;  1VQK T;  2CP5 A;  3BDL A;  3O8V A;  1YNZ A;  3EG9 A;  3VS3 A;  3H41 A;  1PRL C;  2NUT B;  1OOT A;  3CCR Q;  3LGF A;  3D7S B;  1W2B P;  4DEX A;  2D6F A;  2BIV A;  4C5I A;  1WXU A;  1Y0M A;  1TSF A;  4OB1 B;  2XG8 D;  1YIT Q;  1JXM A;  2KAF A;  3QJY A;  1OPK A;  5GAN d;  1G83 A;  3QYH B;  2VWF A;  2QDL A;  2R5M A;  1KD1 U;  4M77 A;  1K8A C;  3MEW A;  2PUK B;  5FU7 C;  4LNP A;  2FRW A;  4M75 F;  3OYE A;  4OMF B;  4ZTF A;  1TOV A;  2L3R A;  3OSS C;  2JTE A;  3TEE A;  3S3N A;  2OAW A;  5LJ3 h;  4M7D F;  3P8D A;  4FYX B;  3M9Q A;  1VQ9 A;  4CC7 A;  3EGX B;  2RJD A;  5GMK l;  2K2V A;  1I4K 1;  3LLR A;  2OTL T;  4MZM A;  3G4S A;  2OTJ A;  4LDW A;  3CC4 Q;  3GOX A;  3CEY A;  4OMO A;  2KDS A;  1VQ4 T;  1VQP Q;  1KJW A;  1KSW A;  1WGS A;  1QQJ A;  3NHN A;  3FEO A;  2DF6 A;  4BI3 A;  1QLY A;  2E5K A;  2EYW A;  5GAO p;  2ZPH B;  4JJD A;  4XTW A;  2J6K A;  1SSH A;  1X27 A;  2CZ1 B;  4GBQ A;  3UF4 A;  4M78 F;  2NUP B;  1YI2 A;  1MMD A;  1XTD A;  2DYB A;  5KYU A;  1Y71 A;  1D3B B;  5LJ5 e;  3GP8 A;  1VUB A;  2K3Y A;  3RMQ A;  3NTH A;  1DJ7 B;  2CZ7 B;  4N4G A;  5GAN h;  4PJM A;  1TWB A;  1E6G A;  5GAO l;  3JCM J;  3OW2 P;  1PSF A;  2DD4 A;  3CCS Q;  3BFM A;  1D0Y A;  1VQN A;  1VQ8 A;  2F2V A;  1BI1 A;  2GGR A;  2K6D A;  2F1L A;  4OML A;  2A37 A;  1G3W A;  3M0R A;  2PVO B;  5IH2 A;  2QTV A;  3NGP A;  4J9H A;  2KY9 A;  3BDU A;  2X4X A;  4YTL A;  4AG1 C;  5GAO n;  1VIE A;  4F7U F;  2NLU A;  4IUQ A;  4EDU A;  5GAN e;  3OYI A;  1D0Z A;  2XI9 A;  3CPW S;  2XK0 A;  4HCC A;  3I55 T;  2E70 A;  1IHV A;  2LX7 A;  2KBT A;  2JZ2 A;  4BE2 A;  4HXJ A;  1VQ4 A;  3PVQ A;  2QEX Q;  5HY6 A;  3M58 A;  2HSP A;  1RAD B;  2X4W A;  4EIK A;  2XD0 A;  3GNG A;  1UG1 A;  2LDM A;  3RMS A;  3CMA A;  1D09 B;  4LDV A;  2VC8 A;  2F69 A;  1KC8 U;  2EFI A;  4E7S A;  1RAI B;  4TVR A;  2KYB A;  1MMN A;  1SKU B;  3ZEH A;  3N5B B;  3RR6 A;  2OTL A;  2VGM A;  2NUP A;  4LE9 A;  4C5H A;  4EMG A;  3CCU T;  3SFM A;  2B8A A;  1TUG B;  2ECZ A;  2O01 E;  2XDD A;  2L89 A;  2V8J A;  1U06 A;  5LJ3 f;  5CVI A;  1QVG A;  4R0K A;  4IIO A;  4KUD K;  2LVM A;  1M1K R;  2LJ1 A;  3CPW P;  1OEB A;  2CT4 A;  4JRK A;  1HYO A;  3CBO A;  1RAG B;  2A08 A;  1M27 C;  2F5T X;  2GFU A;  2KRO A;  4ME7 A;  4E7I A;  1OU8 A;  1WDX A;  4J9I A;  2QA4 Q;  3X24 B;  2ZCF B;  4M7A D;  3CCM A;  2KYM A;  4F04 B;  4J7I A;  1Q7Y R;  2O9V A;  2A36 A;  5LJ5 j;  1YFN A;  4FIB A;  3CCV T;  4GY5 A;  3M4Y A;  1VQP A;  5CIU A;  3A98 A;  2DEQ A;  4J9C A;  1KC8 C;  5GAN 4;  3EH2 A;  5FRO A;  1RAE B;  4LDX A;  3MJX A;  4C8Q G;  1NE8 A;  1KHC A;  3CCQ Q;  1AVZ C;  2ZGW A;  3L2Q A;  2E3I A;  5KYN A;  1ZUK A;  4M75 D;  3A8O B;  1YI2 Q;  2HBP A;  2CUD A;  3QSU A;  4C8Q F;  3E9G A;  1YCS B;  2EWN A;  1RAB B;  2V8K A;  2KNB B;  2J6O A;  2L2P A;  2O31 A;  3GBQ A;  1VQ7 A;  3M54 A;  4XTX A;  2RF0 A;  1NYF A;  1UJY A;  2LJ0 A;  2YRC A;  4IKF A;  5KE2 A;  1ABQ A;  3RNJ A;  2K9G A;  1VQ8 Q;  2EQM A;  3MCA B;  2RHX A;  1M8V A;  1YIJ Q;  2HEQ A;  2XID A;  4EMK B;  1GCP A;  4R55 A;  1KC8 R;  4QVZ A;  4J8O A;  4B6M A;  3A8H B;  4FYW B;  2DJZ A;  1OU9 A;  2WSF E;  2H8H A;  2AK5 A;  4C92 E;  2E10 A;  4IUU A;  5LJ5 f;  3REA B;  2YUN A;  3BW1 A;  1BYM A;  4F7U G;  3JCM P;  1Y7X A;  3CMA T;  3V8J A;  1FX7 A;  5FU6 B;  5IHN A;  4RTY A;  2CT3 A;  5GMK e;  5D7U A;  1YCY A;  2EQJ A;  2JS2 A;  4VUB A;  3CPF A;  4C0Z A;  1U8R A;  1VIF A;  2C0I A;  3CCE A;  2HQH A;  4HA8 A;  3E19 A;  1FMW A;  2X35 A;  1V29 B;  2YRD A;  2M1H A;  3LX7 A;  4C8Q D;  2VB6 A;  4M4Z A;  3RER A;  4O6J A;  1FXX A;  1WQW A;  1ZQ1 A;  2DE0 X;  4FW1 A;  4J6W A;  5GAN j;  1UHC A;  2O4X A;  3EG3 A;  2DBK A;  1FMV A;  1PWT A;  3E1S A;  4A4K A;  1T3L A;  2QXF A;  2MYS A;  1PM3 A;  3OS0 A;  5D6W A;  4NL3 A;  1QMC A;  1ZSZ C;  3VS6 A;  2HZY A;  3EGU A;  1GL5 A;  4AG2 C;  2DZC A;  4HVV A;  2DLP A;  5CKH A;  2RQV A;  1VQO T;  2CUB A;  2L3S A;  3CXC A;  2K57 A;  1SSF A;  3L42 A;  1WHH A;  1G2B A;  2PVD B;  4KGX B;  4JJC A;  3OYK A;  4PJO D;  2E41 A;  3G71 Q;  1T3S A;  9ATC B;  2DFU A;  2P4R A;  5KCH A;  5FRM A;  2PQW A;  1UTI A;  2ZPE B;  3TU4 K;  1PHT A;  2D8J A;  4LD6 A;  4NOY A;  2A0F B;  3M0S A;  4NL2 A;  2RHY A;  1TXQ A;  5KYW B;  3A8M B;  2G3R A;  3OYD A;  3OYA A;  1NG2 A;  4J9G A;  1RLP C;  2BZ8 A;  4J6X A;  3PNW C;  1Q86 C;  2RJE A;  1N9R A;  2V26 A;  1JB0 E;  3PT9 A;  4HVW A;  4MML A;  1H8K A;  4BAC A;  4KH0 B;  1WA7 A;  2M9U A;  4FSX A;  1KQS A;  5KYX B;  2LQN A;  5HKC A;  2DL5 A;  3G6E Q;  2KK4 A;  5GAN 8;  3CME A;  4BD3 A;  2HKQ B;  2DD5 A;  2CGH A;  3A5Z B;  2EQU A;  3RIR A;  3PIP A;  3TSZ A;  3JB9 D;  4PK4 A;  4PNO A;  4KGZ B;  1MMA A;  2JTM A;  2RD1 A;  4CC3 A;  4CI0 C;  1IHW A;  3VS0 A;  3L2U A;  1YHQ Q;  5KYW A;  1CSK A;  3MP1 A;  3VS1 A;  2ENM A;  3O5Z A;  2AKL A;  5CQX A;  2DBM A;  2GQI A;  1PKT A;  1GCQ A;  2E6N A;  3NTK A;  4F16 A;  1GFC A;  1AZG B;  5KE3 A;  1OI1 A;  2EJG A;  2M51 A;  1RAF B;  4RTZ A;  3SWN C;  2VV5 A;  1YI2 T;  2EGE A;  2K7A A;  5GAM e;  1M1G A;  1H92 A;  1WYX A;  2YT6 A;  4C92 B;  2VKN A;  4RTW A;  4ELZ C;  2K3B A;  2KRN A;  5DLO A;  3JCM e;  3CD6 Q;  1S72 A;  4HCK A;  4Y92 A;  2DAQ A;  3SD4 A;  1A0N B;  4J9D A;  3LYI A;  2DL3 A;  1RUW A;  3X25 B;  3TCJ A;  3DB4 A;  4ZTJ A;  4E7Z A;  8AT1 B;  1JBM A;  4ZN3 A;  4WF2 A;  1AZE A;  2DRK A;  1N8R C;  2DIQ A;  2J06 A;  2L5Q A;  1N8R U;  2EYY A;  3OQ5 A;  4M75 B;  3M5A A;  4Q5W A;  4PJL A;  5GAM j;  3U23 A;  3VV0 A;  3CCJ A;  1VQ5 Q;  1UEB A;  2JN0 A;  1HK9 A;  2G6F X;  4F7U A;  3OYG A;  2O9S A;  3CC2 T;  3C4S A;  1W2B S;  4FYY B;  1OZ3 A;  3UAT A;  3JAM E;  3G4S Q;  2OTJ Q;  1M90 U;  4BI4 A;  4PJO A;  3CC7 T;  2C0O A;  4LXC A;  5GAN 7;  1MHN A;  2FZK B;  2GFA A;  2P0Q A;  2GBQ A;  2DZ9 A;  3AT1 B;  1X69 A;  3QG1 A;  2QI2 A;  5D6Y A;  2KEA A;  2RJF A;  4XU0 A;  1M4Z A;  1IB8 A;  2ZZD A;  4JLI A;  1X01 A;  4M78 E;  4C92 D;  3KUF A;  4JRI A;  2K5F A;  1F1B B;  2VAS A;  4OMP A;  1XOV A;  3UA7 A;  1M1K U;  2DJQ A;  3EG1 A;  2CP2 A;  1JQQ A;  5IN1 A;  3EFR A;  3DB3 A;  4XU1 A;  4M7A A;  1RI9 A;  4RTT A;  2DL8 A;  4PJO E;  5IHI A;  2I2L A;  1VQN Q;  4AFS C;  1VQ5 T;  2EJF A;  4IUV A;  4JS5 A;  3VYH B;  4M7D D;  4M77 D;  3PFS A;  1AEY A;  4N4H A;  4RTX A;  1M5Q 1;  5KYY A;  1K0X A;  2X3X D;  1NJI R;  1XJW B;  4HCB A;  2DXB A;  1K9M C;  1S72 T;  2YLC A;  5A0D A;  1YJW A;  1K9M U;  2RQU A;  1GBQ A;  3CCE T;  3CC2 Q;  3FC3 A;  2EAY A;  3SHW A;  4LDY A;  2CDT A;  1JEG A;  4MDW A;  1OX8 A;  4BE1 A;  1YJN Q;  2KQW A;  3OS1 A;  2DYI A;  4BB7 A;  1VQ9 Q;  2LT1 A;  3UWN A;  5CCA A;  4XU2 A;  3CD6 A;  2CP3 A;  1HSQ A;  3MEA A;  3JCM g;  1EIF A;  2K5L A;  2C0T A;  2QAS A;  4X34 A;  1Q82 R;  3JCM d;  3Q1J A;  3FIF A;  1D3B A;  2AIR B;  3QJ6 A;  4OP0 A;  3I5S A;  2M02 A;  1T0H A;  1KQ1 A;  1NYG A;  4M77 B;  2PU9 B;  2Z0W A;  4AT1 B;  3JCM W;  1M2O A;  1QVF A;  2KT1 A;  3FRN A;  4AFZ C;  1PD1 A;  1WXT A;  1U1T A;  3OYL A;  1VA7 A;  2WSE E;  3CCV A;  2PUO B;  1GCQ C;  4E7L A;  4DOW A;  8ATC B;  2FPF A;  1B7T A;  3OS2 A;  3QZ5 B;  4C92 G;  1EX4 A;  4XTV A;  1PKS A;  1MGQ A;  1K1Z A;  1KQ2 A;  1U5S A;  2COY A;  2KMT A;  4B9W A;  4EMK C;  1VYU A;  1I81 A;  1YHQ T;  2X3W D;  5J26 A;  2AKK A;  2RQR A;  3ME9 A;  1SF9 A;  1PC0 A;  5LJ3 j;  2BZX A;  5CKB A;  4ANJ A;  5GMK i;  5GJW B;  3QBY A;  1YJN T;  4N4I A;  4A54 A;  4M7D A;  2QQA A;  4A4G A;  2DXU A;  3H6Z A;  5LJ3 d;  3VU3 C;  3OYH A;  4JPB W;  1VQL A;  5CQY A;  3G7Z A;  5I2M A;  1MV3 A;  3GLX A;  2FRY A;  3NPF A;  4M77 G;  4M7D G;  4QQD A;  4BUG A;  1C6V X;  3VRZ A;  1D1A A;  1VQL T;  2CYZ B;  3OY9 A;  4ESR A;  2GNC A;  2ATC B;  1QVG P;  2JMA A;  1VQ7 Q;  1VQO A;  1HD3 A;  3R6O A;  1X6G A;  4M78 A;  2QYZ A;  3OS5 A;  2DIL A;  3JCM b;  2QEX A;  4D6W A;  4N0A A;  1KD1 R;  3M55 A;  3OMG A;  1M3A A;  1I1J A;  4PJO F;  2K3X A;  3VYG A;  4DEY A;  4HVU A;  3GNF B;  4KGV B;  2CKK A;  1M90 C;  2EQI A;  1WQ7 A;  2CRE A;  2JM9 A;  3LW5 E;  4HKE A;  2OJ2 A;  6AT1 B;  4M7D E;  1NM7 A;  3H0I A;  3A8L B;  1WNL A;  2F5K A;  2QGG A;  5IAY A;  1WJS A;  1X6B A;  5KYU B;  1TTH B;  2RQW A;  2DER A;  1NJI U;  2NUZ A;  4J5Y A;  1Y57 A;  4C8Q A;  4Y91 A;  4ZN1 A;  1UGV A;  1Q82 C;  1B34 A;  3C12 A;  1M2V B;  1ZSZ A;  3X20 B;  4N0A C;  1SHG A;  1WJQ A;  2ABL A;  1GXI E;  4OMN A;  1K0S A;  3OYY A;  2DXT A;  3OBW A;  4M75 C;  4WTO B;  2W10 A;  4RG8 A;  3CCM Q;  1KK7 A;  2E12 A;  3CCL Q;  1X6O A;  1UDL A;  3CXC P;  1ZA1 B;  4RUG A;  4MZP A;  1PG5 B;  3X26 B;  2B86 A;  1VQ7 T;  4C0D B;  3HL8 A;  1CKB A;  1NEB A;  4CC4 B;  2CZ0 B;  1SRL A;  1PNJ A;  2IVW A;  2KE9 A;  1WXB A;  1ZX6 A;  3V7R A;  4M7A C;  3V7C A;  3MP8 A;  2MAM A;  2MK5 A;  3FJP A;  3MPU B;  4C92 C;  1YIT T;  1AOJ A;  2CP6 A;  2FPE A;  1WHM A;  1P92 A;  3SWN B;  5KH6 A;  1NZ9 A;  1LVK A;  1ABO A;  3CCQ T;  3PMT A;  4FCY A;  4ZGE B;  1M1K C;  3EHQ A;  1VQK A;  2MI6 A;  4ZNX A;  3MHX A;  2FYK A;  3S3M A;  1LNX A;  4J6Y A;  3JB9 J;  2HNI A;  1KQS S;  1ZBX A;  1TU0 B;  3M0P A;  3PMI A;  1B3Q A;  4QKU A;  2CH4 A;  5I2S A;  2KR3 A;  7AT1 B;  3G71 A;  3HHT B;  1WHG A;  4BE0 A;  2RHI A;  2DXC A;  3SEM A;  2ZPF B;  4E47 A;  2KXD A;  3VUB A;  5GAN 5;  3CCL T;  3INZ A;  2QQR A;  4ATO A;  4JZ4 A;  4OMM A;  2E6Z A;  4AMC A;  1FYN A;  4OGE A;  2JOY A;  1YIJ T;  1TG0 A;  3LGL A;  4EPC A;  4DBR A;  4PLL A;  2H3J A;  3I5R A;  1QWF A;  1VYT A;  2R58 A;  1OPL A;  4KH1 B;  1D0X A;  1RAC B;  1QP3 A;  2V1Q A;  3G6E T;  3HPW A;  4OVA A;  2EKH A;  4C0D C;  2DVE A;  1PRM C;  1NPR A;  1YJW T;  4MDX A;  1C0M A;  2CS7 A;  2Y4Y A;  2GTJ A;  1W6X A;  3HFO A;  2YWW A;  2RO0 A;  5LJ5 h;  3QXE B;  1YWP A;  4V2S A;  1QVF P;  2DMO A;  1UGR B;  4XAX B;  3OW2 A;  2XDB A;  3TQ7 P;  4E2F B;  5J3B A;  4ZGD B;  1O75 A;  2SEM A;  1JJ2 P;  1VQ6 A;  1D1B A;  3BE3 A;  2VXF A;  5GAM g;  1K9A A;  1OQK A;  3RKX A;  1D1C A;  2P0P A;  3JCM c;  4J9B A;  3BY7 A;  4DQ2 A;  1LJO A;  1RAA B;  1TUC A;  2VUB A;  2FB7 A;  2QK0 A;  4PFZ A;  5FLX E;  4E7H A;  1V76 A;  2HD0 A;  2SRC A;  2K5I A;  2IPO B;  1K73 U;  2YUQ A;  5LJ3 g;  3C0C A;  1RLQ C;  2H3E B;  4C5E A;  1TS9 A;  4BI8 B;  3QII A;  3EGD A;  4CRI A;  4D8K A;  3QO3 A;  4RTU A;  2J6F A;  1KQS P;  1GRI A;  2JNG A;  2RM4 A;  1Q95 G;  1UGP B;  3FLG A;  5DM7 R;  1QCN A;  4Z8A A;  4FT4 A;  2V1R A;  1G3S A;  2KI7 A;  5A2Q E;  4IIM A;  1SG5 A;  2YUO A;  2QTX A;  2EYX A;  1IZ6 A;  5KYX A;  3J7A F;  1IGQ A;  1AWO A;  2JM8 A;  2YUP A;  3E2U A;  3TRE A;  5LJ5 d;  3NFC A;  1WLP B;  1W1F A;  2EQK A;  2X51 A;  1VQM T;  4X9D A;  2L3Q A;  3MEU A;  4DOV A;  2L0A A;  1ZHI A;  5HK3 A;  5A0L A;  2COZ A;  3KXT A;  3URG A;  4MZT A;  3H9N A;  3CCS T;  3CC7 Q;  2LMJ A;  1UJ0 A;  4PLI A;  4HCZ A;  2MWO A;  3QWY A;  2AZV A;  5KYY B;  4HT8 A;  5I11 A;  2EKO A;  2D8H A;  3OBY A;  1M90 R;  3SDZ A;  4M78 G;  3CCS A;  1YN8 A;  1Y96 B;  1X2K A;  2FZC B;  2GQV A;  2DTO A;  1ZLM A;  2NWM A;  3RES A;  4PJO G;  1FMK A;  2DNU A;  2QG9 B;  5GAO m;  2YRV A;  2RJC A;  3L2Z A;  4L59 A;  2MOX A;  2W0Z A;  4D8D A;  4NS5 A;  4FT2 A;  3JCM Q;  1IRX A;  2RI2 A;  4FM4 B;  3I56 A;  3JB9 H;  2X4J A;  1AT1 B;  1R0B G;  5DY9 A;  1ZUY A;  1W70 A;  4II1 A;  1EFN A;  1QCO A;  3JCM h;  3JCM f;  2HDA A;  1MNE A;  3M0Q A;  3CCQ A;  3RDV A;  3L1A A;  4A53 A;  1NLO C;  2RNA A;  4M75 E;  5I22 A;  3CD6 T;  3DLL A;  4C8Q E;  3A8G B;  4OMQ A;  4WCI A;  3FB9 A;  1N27 A;  3EG0 A;  1VQ6 Q;  3JB9 F;  1IRE B;  2JS0 A;  2HQX A;  1R8O B;  2P0K A;  1VQM Q;  2RQT A;  3CME T;  2YHT A;  4FSS A;  1G3T A;  2DET A;  2LC4 A;  2RK2 A;  2OI3 A;  4RTV A;  4L6V 5;  3JB9 G;  4PL6 A;  3OYN A;  2RHU A;  3JCM V;  3REB B;  1NJI C;  1UUE A;  2EPD A;  3LH5 A;  4FU6 A;  1YIJ A;  4ZGJ B;  2LCC A;  4DBH A;  2JJ9 A;  1CKA A;  4M75 A;  2MCN A;  4J9F A;  3CCJ Q;  1VQ5 A;  1K76 A;  1SRM A;  3UA6 A;  4CC2 A;  5GMK h;  2AZS A;  2QQB A;  2EGC A;  1BCO A;  2MIO A;  2XHC A;  1M3B A;  3ZFJ A;  3I56 T;  2O88 A;  3QPH A;  4M7D C;  5I21 A;  3RUX A;  3EGD B;  3NTI A;  2HL3 A;  2L3P A;  2OAU A;  2HBW A;  3X28 B;  2LTO A;  4PJO B;  2XDP A;  1S1N A;  3EG2 A;  2HMA A;  4Z89 A;  1K73 C;  3M59 A;  4M78 B;  2HL5 C;  4GLK A;  1RAH B;  1T0J A;  2NYS A;  4C8Q B;  3CCV Q;  2QEX T;  1HXD A;  5EC7 A;  2P4T A;  3CCR A;  2XU8 A;  5GAM d;  1K9M R;  4UC4 A;  1ZBJ A;  1VQ6 T;  3QZ9 B;  1OX9 A;  3QYG B;  2ROT A;  5FW9 A;  1VOM A;  1JO8 A;  2QA4 T;  5GAN 6;  3CBP A;  5CKD A;  3G71 T;  1JJ2 A;  1WJR A;  1C1A A;  2LP5 A;  1YJ9 A;  4OB3 B;  2JT4 A;  1MND A;  4M7D B;  4Y28 E;  1IXD A;  4BY6 B;  1M1F A;  1SEM A;  2EVR A;  1WHL A;  4JZ3 A;  1M2V A;  4X9C A;  1NLP C;  1QWE A;  1M3C A;  2KSS A;  2D0Q B;  2IIM A;  3I56 Q;  4R56 A;  3JV3 A;  2J05 A;  2YLB A;  4DBQ A;  3J80 E;  1Q86 U;  4PJJ A;  1TH7 A;  1N6A A;  2QQ9 A;  1YJW Q;  4JRP A;  3EFO A;  1GFD A;  2E4H A;  1UEC A;  1BI2 A;  5GAN 2;  5EG2 A;  2JUF A;  3P8B B;  2FPD A;  3VJP A;  1YJN A;  2A7Y A;  2RB6 A;  4M77 F;  5FWB A;  4PFP A;  3OW2 S;  2BKD N;  3VKI A;  1PSE A;  1XNI A;  1AWW A;  2XIC A;  4F14 A;  2CH4 W;  2HCK A;  2COW A;  4AFU C;  3KBG A;  2V8I A;  2RI5 A;  2OX7 A;  1X75 C;  4XTZ A;  3CPW A;  1Q82 U;  1JXO A;  2CZ6 B;  1JRI A;  1BIA A;  3M4G A;  1EZZ B;  1HJD A;  2ESW A;  3HRU A;  2EYZ A;  4OB0 B;  1YJ9 T;  4PKC C;  4JRQ A;  3WVE B;  1I0C A;  2E1H A;  1N8R R;  3F70 A;  4M77 E;  1XQH A;  1J3T A;  3EFS A;  2BZY A;  3DKM A;  2RMO A;  5FU7 B;  4FW2 A;  1OV3 A;  1PCX A;  1Q81 C;  4XQ3 A;  1JJ2 S;  4B9X A;  3JSC A;  3CCR T;  1M8M A;  5GAO r;  4F7U E;  1WI7 A;  1AHJ B;  1YIT A;  4L5G A;  2DTH A;  5LL6 S;  3VRY A;  5CKE A;  1AWJ A;  3UDC A;  1FWZ A;  4LUE A;  4OGC A;  2GCX A;  3S3O A;  5CR2 A;  1NEG A;  3LWI A;  1UHF A;  4DBF A;  1VQL Q;  2LCS A;  3MET A;  4DA4 A;  3HSB A;  4A4F A;  3OMC A;  1B34 B;  2EIF A;  2QGF B;  2YDL A;  3UPU A;  4M7A F;  2LNH B;  4E6R A;  3HRT A;  4E7J A;  2DIG A;  4C92 F;  1Y07 A;  1ZUU A;  1SPK A;  1VQK Q;  3EH1 A;  2E64 A;  3FJ5 A;  2EJ9 A;  4QVD A;  1WHJ A;  2QQS A;  2OTL Q;  4QT7 A;  4M75 G;  2FHD A;  1YJ9 Q;  3MEV A;  4Z02 A;  5D6X A;  4PFO A;  2XKO C;  3CC4 T;  1E7O A;  1WZO A;  3PGG A;  4KBM B;  1BCM A;  2ZPG B;  2DK3 A;  2M0Y A;  1ZSZ B;  5AT1 B;  3QWX X;  4M78 D;  2QDY B;  5IXF A;  2RPN A;  2RK1 A;  5HCK A;  2MPX C;  4KUL A;  4JLG A;  1BU1 A;  1KD1 C;  1RL2 A;  3QUI A;  3SWN A;  2E3H A;  3OB9 A;  3PE0 A;  2FVU A;  5GAO q;  5C6S A;  1Q86 R;  3IQL A;  2Y90 A;  2DRM A;  2AHJ B;  2LT4 A;  5IHK A;  5GMK j;  3JRZ A;  2M16 A;  1W2B A;  3MKD A;  3S6W A;  3ZL7 C;  2RH2 A;  2ROL A;  3OYF A;  1VQ9 T;  1R77 A;  3QHS A;  5FU6 C;  5CKF A;  1IGU A;  5LJ3 e;  2DA9 A;  2HSE B;  2KT8 A;  1YP5 A;  4E7K A;  1QCF A;  3WVD B;  4XK8 E;  1I8F A;  2LRQ A;  3HRS A;  3RKW A;  1U3O A;  3P8H A;  1S72 Q;  2HQE A;  5GJV B;  1VQP T;  5GAN f;  1VQ4 Q;  4F17 A;  4O5V A;  1G8X A;  2MMP A;  3THK A;  4J83 A;  2QAZ A;  4XU3 A;  5J39 A;  2VGN A;  2ZPB B;  4HT9 A;  1ARK A;  1BK2 A;  3RKY A;  2LX9 A;  2JXB A;  4C0G A;  3CMA Q;  5GMK m;  4RCC A;  1QVP A;  2DVJ A;  4LD9 K;  3H0F A;  2JW4 A;  2K2M A;  4AFQ C;  2LCL A;  2KGT A;  5A0G A;  1WFW A;  1QW1 A;  1BBZ A;  1IO6 A;  1H64 1;  5DLQ E;  4LUD A;  1PD0 A;  2FG0 A;  1K73 R;  2ED0 A;  1MV0 B;  3CC2 A;  1ACM B;  1I5L A;  1AD5 A;  1H3H A;  1K8A U;  2PTK A;  4P5N A;  3LH0 A;  1U1S A;  2CSI A;  4A4E A;  4PJN A;  2QA4 A;  1WIE A;  4Z88 A;  3QDF A;  3NMZ C;  2R57 A;  2FZG B;  1OZ2 A;  3I55 Q;  3HFN A;  1RI0 A;  4OB2 B;  4QVC A;  2LQW A;  2HAX A;  2EGA A;  1UE9 A;  3ER0 A;  3V8K A;  2AT1 B;  1QKW A;  3QDR B;  4ELY C;  2IG0 A;  5KCO A;  2PVG B;  5CAI A;  2BE7 D;  4EMK A;  3SB2 A;  1NPP A;  1R0C B;  3MP6 A;  4C5G A;  1Z9Z A;  3CC7 A;  4M7A B;  4J9E A;  2LQ8 A;  4ORZ A;  5IXB A;  2O4X B;  5GAN 3;  2R5A A;  1QP2 A;  5L8R E;  2MWP A;  2DO3 A;  2DM1 A;  3WXM B;  1O9S A;  2HKN A;  1LOJ A;  2VXE A;  4FYV B;  4RCB A;  3M56 A;  4EMH A;  1UGS B;  1Q7Y U;  3DLM A;  1QVF S;  3M0U A;  3CCU Q;  4QQG A;  3CCJ T;  4C92 A;  1V1C A;  4RKU E;  2BTT A;  3A1P A;  3V8L A;  3VUZ A;  2BE9 B;  1MUZ A;  2LNV A;  2GTO A;  4JDS A;  3PTA A;  2DPP B;  1UB4 A;  1K4U S;  4BY6 C;  3C95 A;  3OSV A;  3I35 A;  5M9O A;  4JUV A;  1SHF A;  2I0N A;  3JB9 I;  1LPL A;  4IUR A;  5IT9 E;  2EBP A;  3G1J A;  1BKB A;  3OA6 A;  2D1X A;  2LZ6 B;  3M0T A;  5FWC A;  4LDU A;  3GIB A;  3VS5 A;  2DEU A;  2RHZ A;  3RBB B;  4C0F A;  1Q81 U;  2KVQ G;  2DKG A;  4IUT A;  3ASK A;  3GF5 A;  2F2W A;  2JTF A;  4C8Q C;  4BDY A;  1ZSG A;  2PNI A;  1QVG S;  3EAE A;  3CQT A;  4M78 C;  4A63 B;  5GAM h;  5GAM f;  4IUP A;  1BI0 A;  2E5Q A;  1ZA2 B;  4PJO C;  2BUD A;  2VVK A;  3KFV A;  3PIO A;  2WSC E;  4K11 A;  5L23 A;  2X4Y A;  3JCM X;  4RG2 A;  4KT0 E;  3I9Q A;  2O2O A;  2DL4 A;  1MMG A;  2Y4X A;  2ED1 A;  4XTU A;  1OYX A;  3HKS A;  2MF2 A;  1BI3 A;  2K79 A;  4KUI A;  2FL7 A;  3CCE Q;  4J7F A;  4F7U B;  1X43 A;  2D0N A;  3VS2 A;  2KRS A;  4X1V A;  3OYC A;  1UFF A;  1VQN T;  4M7A E;  5GAN g;  1VYV A;  1NBE B;  2YSQ A;  3M57 A;  4A4H A;  2P84 A;  4JJB A;  1B07 A;  2DX1 A;  3CBM A;  1UGQ B;  1Z9Q A;  1YHQ A;  1N9S A;  2LJ3 A;  5CK9 A;  2FO0 A;  3FDR A;  1N5Z A;  2RN8 A;  1KFZ A;  1G3Y A;  3C94 A;  2F2X A;  3ZBD A;  3J81 E;  2FEI A;  3MO8 A;  3I55 A;  1M30 A;  5FRN A;  2ZAE A;  4M7A G;  3CCL A;  4MMK A;  5CO7 A;  1YBY A;  2PZ1 A;  3QKJ A;  3HP9 A;  1H3Z A;  3EHR A;  2KRM A;  3E9F A;  2CSQ A;  2VYT A;  1VQO Q;  3EG9 B;  3G4S T;  2OTJ T;  4M77 C;  2E65 A;  1GBR A;  3CC4 A;  2K4Y A;  3T9N A;  2NUT A;  3OYB A;  2GF7 A;  3L2W A;  1AWX A;  5LJ5 g;  2DTI A;  3OYJ A;  3CCU A;  1JU5 C;  3V7S A;  1LCK A;  3VS7 A;  2J7I A;  4JJN K;  4XTY A;  2EW3 A;  3H8Z A;  3UT1 A;  2YXY A;  3OYM A;  1VQM A;  1K8A R;  4LN2 A;  4GLM A;  3EGX A;  2CP0 A;  1E6H A;  5AYF A;  1WX6 A;  3H0H A;  1M9S A;  1BIB A;  2RI3 A;  2WAC A;  1TUD A;  3PVL A;  3EFO B;  2KXC A;  1KHI A;  3CXC S;  1KG1 A;  1YWO A;  2LQK A;  2X9H A;  3G6E A;  2C06 A;  1QKX A;  3CME Q;  2CP7 A;  3TSW A;  1WPY A;  3CCM T;  4KRT A;  3ULR B;  5C0M A;  3AHU A;  1Q7Y C;  1WHK A;  2A28 A;  3GPL A;  1VQ8 T;  4FL6 A;  3L2V A;  2A3L A;  1Q81 R;  1W4S A;  3L2R A;  4QQ6 A;  2M0O A;  4QW2 A;  1KIK A;  5HK0 A;  2D9T A;  4JS4 A;  2XMF A;  1I07 A;  3HTR A;  1OUL A;  3M53 A;  3LWH A;  1I5O B;  4BDZ A;  4RMO A;  2RA2 A;  3VS4 A;  2EYQ A;  1BB9 A;  4OF1 A;  3TVT A; 
#chains in the Genus database with same CATH homology
 2L8D A;  4OGC A;  2GCX A;  3S3O A;  5I2S A;  5HKC A;  2JVV A;  5CR2 A;  3G71 A;  1G5V A;  3HHT B;  2KK4 A;  3LWI A;  2ZPI B;  1Y96 A;  4BE0 A;  2RHI A;  5GAN 8;  3CME A;  1VQK T;  2DXC A;  3BDL A;  3O8V A;  2ZPF B;  2DD5 A;  3MET A;  4BD3 A;  4E47 A;  4DA4 A;  3HSB A;  2CGH A;  3VUB A;  4A4F A;  3A5Z B;  5GAN 5;  3OMC A;  3CCL T;  3INZ A;  2QQR A;  4ATO A;  1B34 B;  2EQU A;  3RIR A;  2E6Z A;  2EIF A;  3PIP A;  4OGE A;  2JOY A;  3LGF A;  3UPU A;  3JB9 D;  4M7A F;  1YIJ T;  3LGL A;  4PNO A;  4EPC A;  4PLL A;  3HRT A;  4E7J A;  2H3J A;  2JTM A;  2RD1 A;  2D6F A;  2DIG A;  2BIV A;  4C5I A;  4C92 F;  1Y07 A;  4CI0 C;  2R58 A;  3L2U A;  4OB1 B;  2XG8 D;  2E64 A;  1QP3 A;  2EJ9 A;  4QVD A;  3MP1 A;  3G6E T;  3HPW A;  2KAF A;  4OVA A;  2QQS A;  3QJY A;  5GAN d;  4C0D C;  4M75 G;  2FHD A;  2DVE A;  3MEV A;  3QYH B;  5D6X A;  4Z02 A;  1NPR A;  1YJW T;  5CQX A;  4MDX A;  2XKO C;  2R5M A;  3CC4 T;  3PGG A;  2E6N A;  1KD1 U;  2CS7 A;  2Y4Y A;  3NTK A;  4KBM B;  4M77 A;  1K8A C;  2ZPG B;  2DK3 A;  5KE3 A;  1OI1 A;  3MEW A;  2PUK B;  2EJG A;  5FU7 C;  3HFO A;  4M75 F;  4M78 D;  3OYE A;  2RO0 A;  2QDY B;  4OMF B;  4ZTF A;  5LJ5 h;  3QXE B;  3SWN C;  2VV5 A;  1YI2 T;  4V2S A;  2L3R A;  1M1G A;  3OSS C;  5GAM e;  3TEE A;  3S3N A;  1UGR B;  2RK1 A;  4C92 B;  5LJ3 h;  4M7D F;  3P8D A;  4XAX B;  4KUL A;  3OW2 A;  2XDB A;  4ZGD B;  4JLG A;  5J3B A;  1O75 A;  3M9Q A;  1VQ6 A;  4ELZ C;  1KD1 C;  1RL2 A;  2VXF A;  3QUI A;  3SWN A;  5DLO A;  3OB9 A;  3JCM e;  5GAM g;  1VQ9 A;  2FVU A;  5GAO q;  2RJD A;  3RKX A;  5C6S A;  2K2V A;  5GMK l;  1S72 A;  1I4K 1;  2DAQ A;  3LLR A;  2OTL T;  4MZM A;  2P0P A;  3JCM c;  2Y90 A;  3SD4 A;  3G4S A;  2OTJ A;  4LDW A;  3BY7 A;  3LYI A;  2AHJ B;  4DQ2 A;  1LJO A;  3X25 B;  2LT4 A;  2VUB A;  3DB4 A;  3CEY A;  3TCJ A;  3GOX A;  2FB7 A;  3JRZ A;  5GMK j;  2KDS A;  4ZTJ A;  1VQ4 T;  2M16 A;  1W2B A;  5FLX E;  4E7H A;  3S6W A;  2HD0 A;  1WGS A;  1JBM A;  2K5I A;  2RH2 A;  1K73 U;  4ZN3 A;  4WF2 A;  3FEO A;  5LJ3 g;  1N8R C;  2DIQ A;  3OYF A;  1VQ9 T;  3QHS A;  4BI3 A;  2L5Q A;  5FU6 C;  4C5E A;  1N8R U;  5CKF A;  5GAO p;  3OQ5 A;  4M75 B;  4Q5W A;  3M5A A;  2ZPH B;  4BI8 B;  3QII A;  4XTW A;  5GAM j;  3CD6 A;  5LJ3 e;  4CRI A;  2CZ1 B;  4M78 F;  1YI2 A;  3QO3 A;  3VV0 A;  3CCJ A;  1XTD A;  1Y71 A;  1UEB A;  1D3B B;  5LJ5 e;  4E7K A;  2JN0 A;  3WVD B;  1VUB A;  3GP8 A;  2K3Y A;  1HK9 A;  2JNG A;  2RM4 A;  3RMQ A;  4XK8 E;  1UGP B;  3NTH A;  1I8F A;  4F7U A;  3OYG A;  2LRQ A;  1DJ7 B;  3HRS A;  3CC2 T;  3FLG A;  3RKW A;  3C4S A;  5DM7 R;  2CZ7 B;  3P8H A;  4N4G A;  4FT4 A;  1W2B S;  1OZ3 A;  3JAM E;  2HQE A;  5GAN h;  1VQP T;  5GAN f;  1G3S A;  5A2Q E;  4O5V A;  5GAO l;  3JCM J;  1M90 U;  1PSF A;  2MMP A;  2DD4 A;  4BI4 A;  4PJO A;  4J83 A;  5GAN 7;  3CC7 T;  2QTX A;  1MHN A;  5J39 A;  4XU3 A;  2GFA A;  1IZ6 A;  2P0Q A;  2VGN A;  2ZPB B;  3BFM A;  3J7A F;  4HT9 A;  2DZ9 A;  3RKY A;  1VQN A;  3TRE A;  1VQ8 A;  2LX9 A;  5LJ5 d;  1BI1 A;  3QG1 A;  3NFC A;  4C0G A;  2QI2 A;  2EQK A;  5D6Y A;  5GMK m;  1G3W A;  4RCC A;  2PVO B;  2RJF A;  4XU0 A;  1VQM T;  1M4Z A;  1QVP A;  2KY9 A;  4LD9 K;  4X9D A;  3BDU A;  3MEU A;  2X4X A;  4YTL A;  5GAO n;  1VIE A;  4DOV A;  4F7U F;  2LCL A;  2ZZD A;  2NLU A;  4JLI A;  4IUQ A;  1X01 A;  4M78 E;  4C92 D;  3KUF A;  4JRI A;  5A0G A;  2K5F A;  1QW1 A;  4EDU A;  5GAN e;  3OYI A;  1H64 1;  1XOV A;  2XI9 A;  5DLQ E;  1M1K U;  1ZHI A;  5HK3 A;  5A0L A;  3CPW S;  2XK0 A;  4HCC A;  3I55 T;  2E70 A;  3KXT A;  3URG A;  4MZT A;  3CCS T;  3CC2 A;  5IN1 A;  3EFR A;  1I5L A;  3DB3 A;  4PLI A;  4HCZ A;  2MWO A;  4XU1 A;  2JZ2 A;  4BE2 A;  1VQ4 A;  4HT8 A;  1K8A U;  4M7A A;  2EKO A;  4P5N A;  3OBY A;  3LH0 A;  1U1S A;  3SDZ A;  4M78 G;  5HY6 A;  4A4E A;  3CCS A;  3M58 A;  1Y96 B;  2GQV A;  2X4W A;  2DTO A;  2QA4 A;  4PJO E;  3RES A;  4PJO G;  2I2L A;  1YJW A;  5GAO m;  2R57 A;  1VQ5 T;  1OZ2 A;  2XD0 A;  3GNG A;  3HFN A;  2LDM A;  2YRV A;  3RMS A;  3CMA A;  2EJF A;  2RJC A;  3L2Z A;  4LDV A;  4IUV A;  1RI0 A;  4OB2 B;  2VC8 A;  3VYH B;  4L59 A;  2F69 A;  4QVC A;  4JS5 A;  2HAX A;  4M7D D;  4M77 D;  1KC8 U;  3ER0 A;  3PFS A;  3V8K A;  2EFI A;  4NS5 A;  4FT2 A;  4N4H A;  3JCM Q;  2RI2 A;  4TVR A;  1M5Q 1;  4FM4 B;  3I56 A;  3JB9 H;  2X4J A;  4HCB A;  2DXB A;  3ZEH A;  1K9M C;  3QDR B;  4ELY C;  3N5B B;  5DY9 A;  2IG0 A;  2YLC A;  1S72 T;  2OTL A;  4II1 A;  2VGM A;  5KCO A;  2PVG B;  5CAI A;  3JCM h;  4C5H A;  3JCM f;  4EMG A;  5A0D A;  4EMK A;  3SFM A;  2B8A A;  1NPP A;  3SB2 A;  3CCU T;  2XDD A;  2O01 E;  2L89 A;  2V8J A;  3MP6 A;  4C5G A;  3CC7 A;  5LJ3 f;  3CCQ A;  3CCE T;  3FC3 A;  2EAY A;  5CVI A;  4M7A B;  1QVG A;  3L1A A;  2LQ8 A;  4A53 A;  2O4X B;  5GAN 3;  4KUD K;  2R5A A;  2LVM A;  4M75 E;  1QP2 A;  4LDY A;  5L8R E;  2MWP A;  4MDW A;  2DO3 A;  4JRK A;  4BE1 A;  3WXM B;  3CBO A;  1O9S A;  2F5T X;  2GFU A;  1LOJ A;  4ME7 A;  3CD6 T;  3DLL A;  4E7I A;  2VXE A;  3M56 A;  2KQW A;  3A8G B;  1UGS B;  4RCB A;  3DLM A;  3FB9 A;  4C8Q E;  4EMH A;  3OS1 A;  1Q7Y U;  1QVF S;  3X24 B;  1N27 A;  4BB7 A;  2ZCF B;  4QQG A;  1IRE B;  3CCM A;  3JB9 F;  3CCJ T;  4C92 A;  4M7A D;  4RKU E;  2HQX A;  2LT1 A;  3V8L A;  3UWN A;  1R8O B;  4J7I A;  4XU2 A;  2P0K A;  3VUZ A;  2LNV A;  5CCA A;  3PTA A;  4JDS A;  3MEA A;  2DPP B;  3JCM g;  1EIF A;  1UB4 A;  2K5L A;  4BY6 C;  3C95 A;  4X34 A;  3OSV A;  3JCM d;  3Q1J A;  5M9O A;  3CME T;  2YHT A;  3FIF A;  1D3B A;  5LJ5 j;  4FIB A;  1G3T A;  4JUV A;  3QJ6 A;  2LC4 A;  4OP0 A;  3CCV T;  4GY5 A;  3JB9 I;  3M4Y A;  1VQP A;  2RK2 A;  5CIU A;  4IUR A;  5IT9 E;  3JB9 G;  2DEQ A;  4L6V 5;  4PL6 A;  1KC8 C;  1KQ1 A;  2RHU A;  5FRO A;  5GAN 4;  3JCM V;  3OYN A;  1NJI C;  4LDX A;  4M77 B;  4C8Q G;  4FU6 A;  2PU9 B;  1NE8 A;  1YIJ A;  1BKB A;  3OA6 A;  3JCM W;  1KHC A;  2ZGW A;  4ZGJ B;  3FRN A;  1QVF A;  3L2Q A;  2LCC A;  4LDU A;  3OYL A;  1U1T A;  3GIB A;  2WSE E;  3CCV A;  2PUO B;  2RHZ A;  4C0F A;  4M75 D;  3A8O B;  4M75 A;  4DOW A;  4E7L A;  1Q81 U;  2HBP A;  2KVQ G;  1VQ5 A;  3QSU A;  4C8Q F;  2DKG A;  4IUT A;  3E9G A;  3OS2 A;  5GMK h;  2EWN A;  3ASK A;  3QZ5 B;  4C92 G;  2V8K A;  2QQB A;  3GF5 A;  4XTV A;  1MGQ A;  2JTF A;  4C8Q C;  2XHC A;  1KQ2 A;  1VQ7 A;  4BDY A;  3M54 A;  3ZFJ A;  4XTX A;  3I56 T;  2KMT A;  4B9W A;  1QVG S;  4EMK C;  3EAE A;  3QPH A;  4M78 C;  1I81 A;  5GAM h;  1YHQ T;  5GAM f;  5I21 A;  4M7D C;  4IKF A;  5J26 A;  3RUX A;  4IUP A;  5KE2 A;  1BI0 A;  3ME9 A;  2E5Q A;  3NTI A;  4PJO C;  2BUD A;  5LJ3 j;  3PIO A;  2WSC E;  2OAU A;  5CKB A;  2X4Y A;  3X28 B;  2LTO A;  3JCM X;  4PJO B;  4RG2 A;  2XDP A;  4KT0 E;  5GMK i;  2EQM A;  3MCA B;  2RHX A;  3QBY A;  4N4I A;  4A54 A;  1YJN T;  1M8V A;  1K73 C;  2QQA A;  3M59 A;  4A4G A;  2DXU A;  3H6Z A;  4M78 B;  5LJ3 d;  3VU3 C;  3OYH A;  2Y4X A;  2XID A;  4EMK B;  4R55 A;  1VQL A;  4XTU A;  5CQY A;  1OYX A;  4GLK A;  3G7Z A;  3HKS A;  5I2M A;  3GLX A;  2MF2 A;  4QVZ A;  4M7D G;  4M77 G;  4C8Q B;  4QQD A;  1BI3 A;  4BUG A;  2QEX T;  4KUI A;  1HXD A;  2FL7 A;  4J7F A;  4F7U B;  2P4T A;  4J8O A;  1VQL T;  2CYZ B;  3CCR A;  2XU8 A;  3OYC A;  3OY9 A;  5GAM d;  3A8H B;  1VQN T;  4M7D A;  4UC4 A;  5GAN g;  4M7A E;  2DJZ A;  2WSF E;  3M57 A;  3QZ9 B;  4A4H A;  1VQ6 T;  3QYG B;  1VQO A;  3R6O A;  4C92 E;  2E10 A;  3CBM A;  4M78 A;  2QA4 T;  3OS5 A;  4IUU A;  5LJ5 f;  1UGQ B;  3JCM b;  1YHQ A;  1N9S A;  5GAN 6;  3BW1 A;  5CK9 A;  2QEX A;  3CBP A;  3FDR A;  4D6W A;  4N0A A;  5CKD A;  3G71 T;  1JJ2 A;  1WJR A;  3M55 A;  1BYM A;  4F7U G;  3OMG A;  1G3Y A;  3C94 A;  1YJ9 A;  4PJO F;  4OB3 B;  2K3X A;  3VYG A;  3ZBD A;  4M7D B;  3J81 E;  3JCM P;  1Y7X A;  3GNF B;  3MO8 A;  4Y28 E;  3I55 A;  5FRN A;  3CMA T;  3V8J A;  1FX7 A;  4BY6 B;  1M1F A;  2CKK A;  5FU6 B;  1M90 C;  4M7A G;  3CCL A;  4X9C A;  5GMK e;  1K9M U;  1WQ7 A;  1YCY A;  2KSS A;  4MMK A;  2EQJ A;  4VUB A;  5CO7 A;  3CPF A;  2D0Q B;  4C0Z A;  1U8R A;  1YBY A;  1VIF A;  3LW5 E;  4HKE A;  3QKJ A;  4R56 A;  3CCE A;  4M7D E;  2YLB A;  3A8L B;  1WNL A;  2F5K A;  3E19 A;  3HP9 A;  4HA8 A;  1TH7 A;  3J80 E;  1Q86 U;  1N6A A;  5IAY A;  1WJS A;  1H3Z A;  2QQ9 A;  2X35 A;  1V29 B;  3E9F A;  4JRP A;  1NJI U;  4J5Y A;  1BI2 A;  2M1H A;  2VYT A;  4C8Q A;  3LX7 A;  4C8Q D;  5GAN 2;  4Y91 A;  3RER A;  4O6J A;  4ZN1 A;  5EG2 A;  2JUF A;  1Q82 C;  3G4S T;  2OTJ T;  4M77 C;  2E65 A;  1B34 A;  1FXX A;  1WQW A;  1ZQ1 A;  3C12 A;  3CC4 A;  2K4Y A;  4J6W A;  3P8B B;  3T9N A;  3X20 B;  3OYB A;  5GAN j;  4N0A C;  2GF7 A;  2O4X A;  3VJP A;  3L2W A;  1YJN A;  2A7Y A;  1WJQ A;  2RB6 A;  3E1S A;  4M77 F;  4A4K A;  1GXI E;  5LJ5 g;  3OW2 S;  3OYY A;  2BKD N;  2DXT A;  3VKI A;  3OBW A;  1PSE A;  2DTI A;  2QXF A;  3OYJ A;  4M75 C;  3OS0 A;  3CCU A;  3V7S A;  5D6W A;  4RG8 A;  1XNI A;  4NL3 A;  4JJN K;  4XTY A;  2XIC A;  2E12 A;  3H8Z A;  3UT1 A;  1X6O A;  1VQM A;  3OYM A;  2DZC A;  4MZP A;  5CKH A;  5AYF A;  3X26 B;  1VQ7 T;  1M9S A;  4C0D B;  1BIB A;  3KBG A;  2V8I A;  2RI5 A;  3HL8 A;  1X75 C;  4XTZ A;  3CPW A;  1VQO T;  2RI3 A;  1Q82 U;  2CZ0 B;  2WAC A;  3CXC A;  2K57 A;  1SSF A;  1KHI A;  2CZ6 B;  2PVD B;  3L42 A;  3CXC S;  1KG1 A;  1JRI A;  2IVW A;  2LQK A;  2E41 A;  3OYK A;  4PJO D;  3G6E A;  1BIA A;  3M4G A;  3V7R A;  4M7A C;  3V7C A;  2C06 A;  3HRU A;  4OB0 B;  5KCH A;  3MP8 A;  5FRM A;  2MAM A;  2PQW A;  1YJ9 T;  4PKC C;  4JRQ A;  3FJP A;  1WPY A;  3WVE B;  2ZPE B;  3TU4 K;  4C92 C;  4LD6 A;  4NOY A;  3CCM T;  2E1H A;  1YIT T;  3F70 A;  1P92 A;  4M77 E;  1XQH A;  3SWN B;  5KH6 A;  5C0M A;  3AHU A;  1NZ9 A;  3EFS A;  1Q7Y C;  4NL2 A;  2RHY A;  3DKM A;  3GPL A;  1VQ8 T;  4FL6 A;  3A8M B;  2G3R A;  5FU7 B;  2A3L A;  3L2V A;  3OYD A;  3CCQ T;  3OYA A;  3PMT A;  1W4S A;  3L2R A;  1Q81 C;  4QQ6 A;  4ZGE B;  2M0O A;  1M1K C;  4J6X A;  4QW2 A;  3PNW C;  4XQ3 A;  5HK0 A;  4B9X A;  1JJ2 S;  2D9T A;  2RJE A;  1N9R A;  3JSC A;  1JB0 E;  3CCR T;  4JS4 A;  1Q86 C;  5GAO r;  3PT9 A;  4F7U E;  1VQK A;  2MI6 A;  1AHJ B;  3MHX A;  2FYK A;  3M53 A;  3S3M A;  1YIT A;  4L5G A;  4MML A;  3LWH A;  1LNX A;  2DTH A;  4J6Y A;  4BDZ A;  5LL6 S;  4RMO A;  2RA2 A;  4BAC A;  3JB9 J;  2HNI A;  1KQS S;  1ZBX A;  5CKE A;  3UDC A;  2EYQ A;  2M9U A;  4FSX A;  1FWZ A;  1KQS A;  4OF1 A;  3PMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...