5DY9A

Y68t hfq from methanococcus jannaschii in complex with amp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDTIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Rna binding protein
molecule keywords Hfq-like protein
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dy9A00
4M75B 4M77C 4M78F 4EMGA 3M4GA 3HFOA 1WQWA 5GANj 3JCMc 4M78B 5GAMg 3SWNC 1X01A 3AHUA 1N9SA 4HT9A 5LJ5h 3JCMf 1B34B 4X9CA 2VXEA 3EFSA 4PJOB 3JCMQ 1Y96A 1U1TA 3V7RA 3V8KA 4M7DF 4PJOC 2JN0A 5LJ5f 4M77A 2QTXA 4MMKA 4C8QE 5GANf 5GAN4 5GAOl 5GAOm 4F7UB 3RUXA 4C8QB 4M7AA 4M75A 2DXTA 4Y91A 5LJ3j 4XTXA 3JB9J 4RCCA 4C8QC 5LJ5j 4M75G 4EMKC 4J6XA 4PJOE 5GAMh 3JB9I 2Y90A 4NL3A 4M78G 5LJ3f 5I21A 5GMKj 4M78E 2YLCA 3JCMg 4J5YA 4J6WA 3BFMA 3GIBA 2RA2A 3V7CA 4JUVA 4M7AC 1BIBA 2CGHA 5LJ3e 4M75E 3V8JA 2RD1A 4NOYA 5LJ3h 4HA8A 3JCMX 5LJ5e 2E10A 3JCMJ 1WNLA 4C8QG 4C92E 3RERA 4M7DE 2DXUA 2VXFA 2HNIA 1LJOA 5GAOq 5GAMf 3FB9A 1I8FA 5GMKl 4XTUA 5GAOp 4M7AD 5LJ3d 1YCYA 4JRIA 2FYKA 1U1SA 2RM4A 3JB9G 4EMKB 3V8LA 4XU2A 5GAMj 4XTVA 5GANe 4M7DA 5GAN3 1D3BB 2EJ9A 2DTOA 2EWNA 5GAOn 3QUIA 4XTZA 3V7SA 5GMKi 2K57A 5LJ5d 4XTYA 3JCMb 2I2LA 5GANd 4XU0A 4M7AF 2EJGA 3RKWA 1LOJA 4J6YA 4M77E 4M7AB 4EMHA 4M7DC 2FB7A 2E1HA 3L1AA 4QVCA 4N0AA 5DY9A 3JCMV 1JRIA 1WQ7A 3VU3C 3SB2A 4C8QF 5GAOr 5GAMe 4C92F 2DJZA 3JB9F 1LNXA 1M5Q1 2E64A 5CAIA 4M77G 4N0AC 3BDUA 3FJPA 1N9RA 3EFRA 2VC8A 1H641 4PJOF 4EMKA 2ZGWA 4NL2A 2E65A 4OP0A 4XU1A 2E41A 1D3BA 2DZ9A 3JB9D 4JRKA 5GMKe 3RKYA 4V2SA 4F7UF 4M7AG 2RB6A 3QO3A 3FIFA 4M75D 1WPYA 1HK9A 4M78A 3RKXA 5GAMd 4M7DB 2DKGA 4XU3A 4A53A 1BIAA 3BY7A 4C92B 1I5LA 4C8QD 5GMKh 5GAN2 2YHTA 1I81A 2DEQA 4XQ3A 4C92D 1HXDA 3QHSA 3JCMW 3RESA 2EAYA 4WF2A 3HSBA 3INZA 4MMLA 4A54A 4M77B 4QVDA 4M7AE 4PJOD 1TH7A 1I4K1 4JLIA 5GANg 4RCBA 4DQ2A 3L2ZA 1KQ1A 4M78C 4M77F 2YLBA 3SWNB 1M8VA 4HT8A 4M78D 3RIRA 1JBMA 3HFNA 4M75F 4C8QA 3JCMe 1MGQA 5GAN5 3QSUA 4C92A 2DVEA 3JB9H 3PGGA 4M7DG 4M77D 2EJFA 4PJOG 3JCMh 4C92G 5LJ5g 1B34A 4F7UE 3JCMd 5GAN7 2DTHA 5GMKm 4PJOA 4PNOA 1Y96B 4C92C 4M7DD 4XTWA 2DZCA 5LJ3g 3JCMP 4F7UG 5GAN6 5GANh 4M75C 1KQ2A 4F7UA 5GAN8 3BW1A 4X9DA 3SWNA 2DTIA
chains in the Genus database with same CATH superfamily
2OTJQ 2GFAA 4M78F 3HFOA 1SHFA 2HEQA 2XDPA 4J9GA 1VQKQ 3AT1B 4ZN1A 1QWFA 2DD5A 3QG1A 1MV3A 5CKBA 3TU4K 2YDLA 5GAOl 4F7UB 3VJPA 4C5EA 2XK0A 4YTLA 2GNCA 2MYSA 3FJ5A 1BKBA 3JCMg 1WX6A 2E6NA 5CQXA 1W1FA 4QT7A 3ER0A 1VIFA 5LJ3h 3EG9B 3DB3A 4DEXA 3UATA 1QKWA 4QVZA 4AFSC 4NS5A 5GAMf 2MOXA 2D6FA 1UGSB 5GAOp 2QTVA 4JRIA 2FYKA 3JB9G 2RI3A 4M7DA 3U23A 2DTOA 2KDSA 2HCKA 2ENMA 3CMAQ 3QWYA 4PJLA 3VU3C 2F69A 4C5IA 3OYMA 1TSFA 2P4TA 4LDXA 1N9RA 4NL2A 3LH0A 2WSCE 4HXJA 2QDLA 2EKOA 1WPYA 4IIOA 3EGXA 2CP5A 4FU6A 5ECAA 3OS5A 4KH0B 1UJ0A 3HSBA 2RK1A 1SF9A 4A54A 4BE1A 1AWJA 4M77F 2R5AA 2RHYA 2WSFE 2DMOA 4M77D 1B34A 5KYXA 1M2VB 2E6ZA 1D0XA 1BBZA 3PMIA 4XTWA 5M9OA 3I56Q 2FHDA 4X9DA 5CKDA 4ZGDB 2FRWA 3ZL7C 1BB9A 2VGMA 1YIJQ 5GAMg 3S3OA 4CRIA 1B34B 4C0GA 1VQ4A 1S72Q 2HQEA 1D1AA 2E5QA 1EIFA 2JTEA 2W0ZA 4Y91A 2KBTA 2ESWA 2M02A 3HPWA 1VQ7T 2QI2A 1QP3A 5FU6B 2EGEA 4PJJA 2J06A 4LDUA 5IXBA 1BYMA 3BFMA 2JS0A 5D6YA 3J81E 2RH2A 1MUZA 1VQ9Q 1YBYA 1X6GA 4HCZA 4ME7A 5GMKl 3I56A 4XTUA 1KD1R 1Z9QA 2J6FA 3S3NA 1Q7YR 4FT4A 1YN8A 2O01E 1WLPB 2LJ0A 1YIJA 1NG2A 3A98A 2D8JA 1NEGA 1OV3A 4OMPA 4N0AA 1RAEB 3VYGA 2OTLQ 1FXXA 3KBGA 1NLOC 3RMQA 2CT3A 5FW9A 1M30A 2NWMA 1K9MC 3VS2A 1JO8A 3HHTB 2KI7A 4XU1A 1OYXA 2LQ8A 3JB9D 2YUOA 3CCUT 4OGEA 1HK9A 3RKXA 2LQKA 3CBMA 4C92B 3BY7A 3M5AA 2EQJA 2AT1B 2E3IA 1VQ9A 4WF2A 1TH7A 1I4K1 4JLIA 2C0IA 4LN2A 3DKMA 3CXCP 3OQ5A 4J8OA 1M27C 3X28B 3P8HA 4C92A 3OS2A 5LJ5g 3LLRA 1YHQQ 4D6WA 1K8AR 1Q81R 4PJOA 2WACA 4J7FA 4FSSA 1VQ6Q 1VQNQ 5CKHA 5D7UA 3HTRA 3CBOA 5GAN8 4C0FA 1J3TA 3OBYA 4HVUA 2F2WA 1T0JA 3A8OB 1TG0A 4X9CA 3EFSA 5EG2A 4PJOB 1JQQA 3MKDA 2KSSA 3V7RA 1AT1B 4MMKA 2QA4T 4LDWA 5A2QE 5I11A 2K3XA 2L3SA 2BTTA 2V26A 1QLYA 2RN8A 4JDSA 1NJIC 3NTIA 3M0UA 4M78G 1KC8R 1M2VA 3G71Q 1SRMA 1I0CA 2K9GA 2SRCA 3JCMJ 3RERA 2D9TA 1NPPA 2CP6A 1RAGB 3CCUA 1JB0E 4JZ3A 1W2BS 1KQSP 3CCMQ 2RQRA 2Y4XA 2RK2A 1FWZA 1OI1A 4A4KA 4A4HA 3CMEA 1VQ7A 1WQ7A 2OJ2A 4BUGA 2L3QA 5GAOr 3M54A 4JJCA 2QEXQ 3VV0A 3CCVQ 1NLPC 2VC8A 1Q7YC 2E41A 3LWHA 3CCRA 3QZ9B 3WVDB 3KFVA 3KXTA 3S3MA 4MZMA 1KHIA 4M7DB 1CKBA 1WIEA 4C92D 1YJWQ 4KBMB 4M7AE 1RAAB 3CCMT 2V8IA 1M8VA 3RIRA 1W70A 1JJ2A 1MV0B 3QSUA 3J80E 1YITA 2DXCA 2PTKA 4QQ6A 4E7JA 2ED0A 1W2BP 4PK4A 3CCLQ 4K11A 1BK2A 2X4XA 5CO7A 2LMJA 4PFPA 3BW1A 3GOXA 4M75B 2KK4A 3LX7A 3CD6A 3UT1A 4A4EA 4F14A 3ME9A 2JTMA 3OYCA 3CCVT 2GBQA 4RTTA 4JJDA 8AT1B 3FEOA 3V8KA 3CMAA 2JN0A 2CREA 1YJ9Q 3C95A 1YJWA 3OYFA 4M75A 2DXTA 2QAZA 5IT9E 5LJ5j 5GJVB 4J6XA 5GAMh 5KYWA 1MMNA 3X26B 2J05A 1IGUA 2X4YA 4OMNA 4DA4A 3EH2A 1M1KC 1BIBA 4M75E 4NOYA 4PFOA 2K79A 1HD3A 1WHHA 2AZVA 4C92E 2LCLA 3OYBA 2HNIA 4BB7A 1AZEA 1RABB 4ATOA 1NZ9A 3J7AF 1UB4A 4XU2A 5GAMj 1FMWA 5GAN3 1VQ5T 1UGRB 2M0OA 3SHWA 2O9VA 2OX7A 3X20B 3OW2S 4D8KA 3DB4A 1GBQA 4OMQA 4OMOA 2KQWA 4O6JA 4J9HA 3BDUA 5IHNA 2XI9A 1RAFB 2E65A 2H3EB 2AHJB 5FROA 2D0QB 2HAXA 1AD5A 1KQSS 2COYA 4XU3A 4XQ3A 2MAMA 3OY9A 3H0IA 4LD6A 1Q82U 4PKCC 1K9AA 1WJQA 1YHQT 2VASA 4RTWA 1K4US 4HT8A 2A3LA 4BDZA 1VQPQ 2QQ9A 4EDUA 4CC3A 3G6EA 2DF6A 3UF4A 2HD0A 1WHJA 3JCMd 1M1KU 1QVFA 2BKDN 4KGXB 2FZCB 3MP6A 1WDXA 2DTIA 3UWNA 4OVAA 5KCOA 2WSEE 1M90C 4IURA 1NYGA 1I07A 1XOVA 3EG9A 2K2VA 3H0FA 1VQLQ 3H0HA 5GAN4 4AMCA 1QCFA 2DX1A 4XTXA 4KUDK 4JLGA 2YT6A 1E7OA 2EGCA 2QASA 4IUUA 2Z0WA 2D0NA 4OB2B 2M16A 3TSZA 4HA8A 1IB8A 1AWOA 3M59A 5LJ5e 2CUBA 2GCXA 2LJ1A 4FL6A 7AT1B 1WHGA 2PVGB 2VUBA 2M1HA 4IUTA 2XMFA 1WFWA 4CC4B 3T9NA 2MMPA 3M55A 4JJNK 1GCQC 3QIIA 2M9UA 4M7AF 3CCJA 2V1RA 1W6XA 2BZ8A 4M7DC 1UDLA 3EGXB 1ZSGA 4WCIA 3EGUA 3M58A 5KYWB 4FM4B 1OEBA 1VQNA 3PTAA 1VQ6A 2O4XA 1UFFA 2E64A 5CQYA 2IG0A 4N0AC 4A4GA 2V1QA 2ZGWA 2DXBA 4V2SA 4E7KA 3ZFJA 2EPDA 1RLQC 1FYNA 2KY9A 2CP7A 4PJNA 1VQ4Q 2XG8D 3MEAA 5FRNA 1CKAA 2DEQA 1K8AU 3OS1A 5FWBA 4QVDA 4BE0A 3M0TA 2L8DA 3L2ZA 2EQMA 4IUPA 4J7IA 3EG0A 2E4HA 1RL2A 3OYKA 3I56T 1F1BB 4PFZA 2JW4A 4GLKA 1N5ZA 2XICA 3JB9H 2YUNA 4OF1A 3MEWA 2CS7A 2VGNA 4P5NA 3MJXA 2G6FX 3L2RA 1OU8A 2O31A 2CZ0B 2LCCA 4DBHA 4KGZB 2KR3A 2K5FA 2XKOC 4II1A 4M77C 2DILA 3JSCA 5D6WA 5GANj 2YSQA 3I5RA 2Y4YA 2YRDA 2K5IA 4JZ4A 1I5OB 3ASKA 4ZGJB 1VQ7Q 3C12A 2D1XA 2COWA 3OYAA 4E7LA 2GTJA 3FC3A 1Y7XA 1IHWA 2FVUA 3MPUB 3VKIA 2DAQA 1N8RR 2DD4A 1S72T 1VQLT 2ZZDA 2YLCA 5FRMA 3REBB 2K5LA 1IREB 2RPNA 3M56A 4E7IA 2ZPGB 4ZGEB 1WNLA 1ZBXA 3I55Q 2KNBB 1IXDA 2CDTA 2KEAA 1X43A 4MZTA 3V8LA 1D1BA 3TREA 5GANe 2EQKA 4DOWA 2BIVA 1QVPA 1FX7A 2KT8A 3V7SA 3JCMb 2F5KA 1YITQ 1YFNA 4J6YA 1MNDA 2AK5A 4QVCA 2JMAA 2JVVA 4N4IA 3MO8A 4ZNXA 3CCJT 1B7TA 3NHNA 4BI3A 4FYXB 2ROLA 4MZPA 3QDRB 3QZ5B 3LH5A 4F7UF 1N8RU 3EG1A 4M78A 1MHNA 3VS5A 5GMKh 2MCNA 1AVZC 1I81A 3JCMW 3CCRT 2QQRA 2AZSA 1Y57A 2P0PA 3TVTA 1KD1U 4XAXB 2HMAA 2RHZA 1YWPA 2K3YA 3NFCA 4GLMA 4MDWA 2ZPIB 2O4XB 2ABLA 1KK7A 3JCMP 1OULA 2LX7A 4EMGA 1O9SA 2ZPFB 1KSWA 2L5QA 4LNPA 3M57A 4C0DC 2O2OA 1PG5B 4O5VA 3I9QA 4M7DF 1IHVA 2LNHB 2MWPA 3FRNA 1VYTA 5A0LA 3PVQA 2QEXA 3WXMB 4RG2A 1KC8C 2Y90A 4LD9K 2VKNA 2O88A 1FMVA 3CCRQ 2IIMA 1Y07A 2HKNA 2RD1A 2KVQG 3G4SA 1BU1A 2E10A 2ATCB 4AFQC 1UUEA 3PVLA 1VUBA 1VQOT 4AG2C 1M1FA 1ZUYA 1D1CA 4XTVA 3X24B 4FCYA 3A8GB 1KIKA 2DLPA 3G6EQ 2I2LA 5L23A 4A63B 3C0CA 2EJGA 5KE2A 5KYUA 3GPLA 2NUPB 2RQUA 4ELYC 1JRIA 2OAUA 1N8RC 1PC0A 3CCQT 3OYLA 2X35A 2DJZA 2CH4W 2OTJA 1YNZA 3OYEA 3OW2P 5CAIA 2V8JA 1D0YA 1RI9A 2RNAA 3META 1WZOA 2KMTA 2M51A 1UGQB 1VQKA 4M7AG 3QO3A 2NUPA 1CSKA 2KRMA 2ZPHB 1PWTA 4A53A 3F70A 2KXCA 4ESRA 1ARKA 1X2KA 2A0FB 2NYSA 3HRSA 3MEVA 1KQ1A 3LW5E 5IHIA 1SSHA 5KH6A 3JCMe 4TVRA 4C8QA 4HCCA 3VS6A 1NBEB 2DRKA 4PJOG 4DEYA 2CP0A 2DTHA 2KYBA 2LX9A 3FDRA 3HL8A 1UEBA 2A7YA 3GNFB 2RHXA 2OAWA 2DIGA 1TWBA 1NYFA 1IZ6A 4M78B 3UDCA 4R0KA 2X4JA 4ANJA 2JOYA 5J3BA 1HJDA 3MHXA 2DL8A 5LJ5f 3BE3A 2EYQA 3JB9J 1ABOA 3CXCS 1BI1A 3MEUA 3RR6A 2YUQA 3WVEB 4BY6B 4M78E 1M1KR 4J5YA 1PM3A 3PNWC 2BUDA 4LUDA 1K73U 1OPLA 1VQ4T 1WYXA 1U3OA 1RADB 1PSEA 3VS4A 1X6BA 3SEMA 1QP2A 1G8XA 5FLXE 3MP8A 3VS7A 3FB9A 2L3PA 1WI7A 1G3WA 4FYYB 4KGVB 3QWXX 1K9MR 4LDVA 1ZSZC 3EG2A 5FU7C 4BACA 1B3QA 2EYXA 2PZ1A 1TUGB 4C92F 2LQWA 3A1PA 4KH1B 3E1SA 3D7SB 2JM9A 4PJOF 4EMKA 3CCSQ 1C1AA 1BCOA 4WTOB 1T3SA 4JRKA 3H9NA 2VYTA 1X27A 3CPWA 1BIAA 5CKEA 4C8QD 4HKEA 1UGPB 2YHTA 2QQSA 2DFUA 1V29B 1WXBA 3ULRB 4EPCA 3JRZA 2HL5C 3QBYA 2QYZA 3VYHB 3E2UA 2YWWA 3ZEHA 4JJBA 2DYBA 2J6KA 2A08A 1YJNT 1IO6A 1Q82R 3C94A 2XU8A 3UPUA 1PRMC 3G1JA 4QKUA 3M4GA 3CCST 1WHKA 2CUDA 2XDDA 3AHUA 3GF5A 1MNEA 1H8KA 1SKUB 2CT4A 1ZBJA 4KT0E 1AOJA 4E6RA 3A8HB 2HL3A 1T0HA 1TS9A 3TQ7P 5DM7R 1GXIE 5IH2A 3NTHA 2MIOA 2KRSA 1N6AA 2ZPEB 3MCAB 1UECA 1SG5A 1M90U 2KYMA 4ELZC 5CVIA 2NUZA 2O9SA 3L2QA 5GAOq 4R55A 3VUBA 2KT1A 4RTYA 2DETA 4M7AD 2K4YA 1OPKA 2QGFB 1PHTA 1QKXA 4OB3B 2DEUA 1VYUA 5GAOn 3CC2T 2CZ7B 1LOJA 1H3HA 1TUCA 2QQAA 2HBPA 2KRNA 2AIRB 4FSXA 5D6XA 2XHCA 3MP1A 3RBBB 2JMCA 1D3BA 4XK8E 2DRMA 3RDVA 2JT4A 2E3HA 3FIFA 3NGPA 2DPPB 3UA6A 1PCXA 1I1JA 3RESA 2BZYA 3OBWA 1ABQA 5KYUB 5GANg 1TU0B 1M8MA 4M75F 2PUOB 5KCHA 5GAN5 2K3BA 3JCMh 1OX9A 3CC4Q 4ZTJA 5KE3A 1Y96B 1VQ6T 1VQNT 1B07A 3OMCA 3L42A 2RI2A 3QDFA 3OSSC 2RHIA 2P0KA 2E5KA 2EYYA 1QCOA 1C0MA 2VXEA 3CCQQ 1X6OA 1Y96A 1U1TA 3SDZA 2EBPA 1ZQ1A 2F2VA 4C8QB 1R77A 3PE0A 1KC8U 1K76A 2A36A 2CP3A 4Z89A 4RKUE 3A8LB 1RAHB 5CCAA 2JUFA 1VQMQ 5FU6C 4J6WA 1GCPA 5LJ3e 1O75A 4FW1A 4QQDA 3GNGA 4HVWA 4PJMA 3CC4A 3JCMX 2MK5A 4Z8AA 1M1GA 3E9GA 4N4HA 2ZCFB 2W10A 4KULA 1AWWA 4BY6C 5GANd 1UE9A 4XU0A 4F16A 3RKWA 4EMHA 2FB7A 1K9MU 4L5GA 1G2BA 3Q1JA 2LVMA 3CCLA 5GJWB 3JB9F 1LNXA 1PKSA 2BE7D 2KXDA 2RJEA 1VIEA 4LUEA 3CD6Q 3EFRA 1MMGA 4E7ZA 3OYHA 4KUIA 1SEMA 1XNIA 1VQMA 3QPHA 1GCQA 2FZKB 1YJ9A 1G3YA 4BI8B 3QHSA 4AT1B 1WXTA 2AKKA 2COZA 2G3RA 3INZA 4M77B 1KQSA 3S6WA 1SSFA 2BE9B 3GBQA 4ZTFA 3CXCA 1YJWT 1YI2A 1M90R 4RMOA 2RO0A 5EC7A 2CSQA 5GAN7 2F5TX 4B9WA 2DZCA 2FL7A 5GANh 1Q81U 2LQNA 4X1VA 4E2FB 5IAYA 2EVRA 1WQWA 1GL5A 4HT9A 4F04B 2PVDB 3M0RA 4OMLA 2JS2A 1C6VX 1Q95G 2VVKA 4M7AA 5IN1A 1TXQA 5L8RE 2RMOA 3JB9I 2PVOB 4EIKA 5LJ3f 5FWCA 1K73C 1SRLA 2RA2A 2PQWA 2LJ3A 4J9DA 1M4ZA 1HYOA 5J39A 1KD1C 2RI5A 2DA9A 5C6SA 3P8DA 3H6ZA 2QA4A 1TTHB 4C8QG 1PD1A 2VWFA 4M7DE 2RHUA 1LJOA 4A4FA 1Q82C 3TCJA 5LJ3d 4LDYA 2DYIA 1G5VA 1QWEA 2DK3A 5CK9A 1K73R 3CCEA 1VQPA 2EWNA 1X75C 3M9QA 3CQTA 1M3AA 3CMET 1XQHA 2D8HA 4B6MA 2FPEA 2LCSA 3REAB 5AYFA 3VS3A 3M0SA 1MMDA 2IVWA 2KAFA 2P4RA 1AHJB 3HRTA 3CC7T 3M0QA 1G3TA 4OB0B 3NMZC 2DO3A 1NJIR 1VQLA 3BDLA 2QA4Q 1Q7YU 2L89A 2HSPA 1FMKA 1YP5A 1ACMB 2L3RA 1Q81C 1MGQA 3R6OA 4C0DB 4IIMA 1KG1A 2H3JA 5HK3A 4ZN3A 2NUTB 1EFNA 2L2PA 4M7DD 2LC4A 1R0CB 2F2XA 2F1LA 1WGSA 2B86A 5KYNA 4M75C 3O5ZA 1S1NA 5LJ5h 3CCJQ 2GQVA 3EHQA 1VQ8A 3EHRA 1TUDA 2RF0A 4CI0C 1H92A 2EGAA 4PJOC 4M77A 5GANf 5IHKA 3CBPA 5LJ3j 3PT9A 2JXBA 2GGRA 3OYJA 4Y92A 5I22A 2EYZA 4CC2A 5J26A 3URGA 5KYYA 2ED1A 3PIPA 2DXUA 2MPXC 1JJ2S 3OYDA 4C0ZA 1N27A 2YRVA 2K6DA 2C0TA 2DL3A 4J83A 3OYNA 1T3LA 4EMKB 3CPWP 1Q86U 2DL7A 2EJ9A 1OZ2A 4HCKA 1P92A 3M53A 3NTKA 2K57A 5GMKi 4XTYA 1U06A 4M7AB 2R5MA 3FLGA 2X51A 2OTLT 2LDMA 1LVKA 1OQKA 3VRYA 5HK0A 4FYVB 1VA7A 4PLLA 1KHCA 1VQ8T 3CC7Q 2QK0A 2PNIA 2DKGA 4IUVA 4Z88A 4LXCA 1VQ9T 3A5ZB 3O8VA 2PUKB 4M78C 2YLBA 3G7ZA 1AZGB 2JTFA 2ECZA 2DVEA 1RI0A 3H8ZA 3I55A 2OI3A 1G83A 5I2SA 3CPWS 2P0QA 4IUQA 4F17A 2QXFA 3CCVA 2YRCA 3JCMf 3JAME 2I0NA 5CIUA 3CD6T 2HBWA 3E19A 4D8DA 4QW2A 2EIFA 2CP2A 3QKJA 4J9BA 2A37A 3OSVA 1IGQA 4UC4A 4EMKC 4J9FA 3E9FA 1ZUUA 1EZZB 4QQGA 3M0PA 5GMKj 2LT1A 3V7CA 2RJFA 1WJRA 4M7AC 1QMCA 3EH1A 2M0YA 1G3SA 1ZSZA 2FRYA 1EX4A 2R58A 5HCKA 2KGTA 2VV5A 1W4SA 1I8FA 2JM8A 2LZ6B 1D09B 1U1SA 2DL4A 4E47A 1AEYA 1SPKA 1D3BB 4JS4A 2ZAEA 5LL6S 4XTZA 3I55T 3CEYA 1YI2Q 2DERA 1BI2A 3SD4A 1ZLMA 1ZSZB 1M2OA 2RQTA 2X9HA 5DY9A 3CMAT 3JCMV 4C8QF 5GAMe 2FPFA 3VS1A 1R8OB 2C06A 4RTXA 4AFUC 4J9CA 4RUGA 5KYYB 2CZ1B 2LNVA 2J7IA 2X3XD 3HRUA 2DL5A 3OB9A 1E6GA 5GAN2 8ATCB 3L2WA 2HKQB 6AT1B 4HCBA 3EFOA 2J6OA 1LCKA 1TOVA 2HQXA 1WHMA 3LYIA 1ZX6A 4M78D 1DJ7B 2DNUA 1Y0MA 4OB1B 4FW2A 4IKFA 3X25B 3G4SQ 4C92G 4F7UE 2CKKA 3CC4T 2LTOA 4PNOA 4R56A 1QVGS 5LJ3g 2HZYA 1X2QA 3PFSA 1KQ2A 3OA6A 1ZA2B 1JEGA 4AG1C 1BI3A 1H3ZA 3SWNC 1K0XA 2QEXT 2JNGA 4X34A 4CC7A 1Y71A 1GFDA 3RNJA 1PSFA 5KYXB 3N5BB 5GAOm 3RUXA 5DLOA 2GTOA 4FIBA 4DBQA 5A0DA 1UJYA 2NUTA 2XIDA 2EW3A 2IPOB 1ZUKA 3GIBA 1VQOQ 2BZXA 3G71T 2CGHA 3V8JA 1X69A 1GFCA 4BDYA 5A0GA 1Z9ZA 2JJ9A 4ORZA 1YWOA 2MF2A 4OMMA 1UHFA 2GF7A 2K2MA 3EAEA 4C5GA 1U5SA 3A8MB 1RUWA 1NEBA 3QUIA 2JZ2A 5LJ5d 1QCNA 1QVGP 2OTJT 1QVFP 1YJNA 2E1HA 2MWOA 2RQVA 2K7AA 1M5Q1 1VQKT 3LGLA 3OW2A 1R0BG 2EFIA 2DVJA 3P8BB 2P84A 1K0SA 4RG8A 1VQ5A 3EG3A 1WA7A 4J9EA 5GMKe 1A0NB 5HY6A 3R6NA 4Y28E 4M75D 3NPFA 3OS0A 2QDYB 1QVFS 1PNJA 2A28A 1NJIU 3DLMA 2XDBA 1QQJA 1AWXA 1SHGA 2DIQA 3SWNB 3CC2Q 2E70A 2YXYA 3OMGA 2FEIA 1WJSA 3GP8A 3PGGA 4M7DG 2EJFA 2YUPA 1YJNQ 1XJWB 4FYWB 1KJWA 4Q5WA 1UTIA 1RLPC 2ROTA 4BI4A 3SWNA 1RAIB 5AT1B 1LPLA 1PRLC 3I5SA 3ZBDA 2B8AA 1YIJT 3VRZA 3CCEQ 1VQ5Q 1X01A 1N9SA 1E6HA 4OMFB 2RJDA 3QYHB 3EFOB 4J9IA 3HP9A 3LWIA 5DLQE 4RTZA 2KROA 3M4YA 4RCCA 4C8QC 2R57A 9ATCB 4M75G 4PJOE 3CPFA 2FO0A 4NL3A 4JRPA 3CCSA 1WHLA 1MMAA 3CC7A 1VQPT 4PL6A 3CC2A 4N4GA 4E7SA 3JV3A 4JUVA 1Q86R 3QYGB 1YHQA 2GQIA 3EGDB 2CH4A 4GBQA 4GY5A 2VXFA 1BI0A 1GRIA 2AKLA 4RTVA 1YITT 4L59A 4E7HA 2RM4A 3RMSA 3VUZA 3CCET 1V1CA 1YI2T 2LRQA 3OYYA 3EGDA 4JRQA 5FU7B 2X3WD 4M77E 1U8RA 1S72A 4FT2A 3L1AA 2HSEB 4OGCA 2XD0A 1JXOA 1OOTA 3SB2A 2QQBA 3SFMA 4DBRA 4M77G 1JU5C 1OZ3A 3FJPA 1H641 4OP0A 3HKSA 1WXUA 3RKYA 1VQ8Q 1NE8A 4Z02A 4BE2A 2RQWA 5GAMd 2DM1A 2EQUA 1QVGA 4C5HA 1VQMT 3L2UA 1K1ZA 2E12A 1HXDA 4KRTA 2EAYA 3KUFA 3VS0A 1JJ2P 1QW1A 2V8KA 4MMLA 1HSQA 1M9SA 4PJOD 2CSIA 2DBMA 4L6V5 5I2MA 2H8HA 3CCMA 1YCSB 4BD3A 2EQIA 4DOVA 3CCLT 4M4ZA 4VUBA 2GFUA 1UG1A 3C4SA 5CKFA 2OTLA 4F7UG 2CZ6B 3TEEA 1K8AC 4DBFA 3JCMc 3TSWA 2HQHA 3THKA 3LGFA 3QXEB 4JPBW 1ZA1B 3JCMQ 2DE0X 3I35A 1ZHIA 2C0OA 2QTXA 4C8QE 1YJ9T 2FZGB 1M3BA 4JS5A 3OYIA 5I21A 1XTDA 1W2BA 2RJCA 2LP5A 1IRXA 2X4WA 2MI6A 3H41A 3G6ET 3GLXA 1GBRA 4HVVA 3G4ST 1PD0A 1YCYA 2DBKA 4B9XA 1UHCA 2FPDA 2NLUA 4AFZC 2ZPBB 1OU9A 3PMTA 1D0ZA 3DLLA 5IXFA 1UGVA 3UA7A 1VYVA 2EKHA 5CR2A 1NM7A 1OX8A 1NPRA 1PKTA 1V76A 2CYZB 2L0AA 2DJQA 3IQLA 2DZ9A 3QJYA 4MDXA 3G71A 3CCQA 2QG9B 2RB6A 1Q86C 1I5LA 4RTUA 2KE9A 2HDAA 2SEMA 2FG0A 1RACB 5HKCA 4PLIA 3CCUQ 2PU9B 1VOMA 4RCBA 4DQ2A 1KFZA 2EYWA 1JBMA 3HFNA 3OYGA 1VQOA 3QJ6A 1JXMA 3L2VA 3CMEQ 5GMKm 1BCMA 3PIOA 2QGGA 4C92C 2VB6A 1M3CA 5C0MA 2LT4A 4LE9A 5GAN6 4F7UA
chains in the Genus database with same CATH topology
2QXFA 3UWNA 2GFAA 4M78F 3CCVA 3M4GA 3CCST 3HFOA 4OVAA 2XDPA 5KCOA 2WSEE 1M90C 4IURA 2XDDA 3AHUA 3GF5A 3JCMf 3JAME 4ZN1A 1XOVA 5CIUA 3CD6T 2DD5A 3E19A 2K2VA 3QG1A 4KT0E 4QW2A 5CKBA 3TU4K 2EIFA 3A8HB 5GAN4 5GAOl 4F7UB 3QKJA 3VJPA 5DM7R 1GXIE 3OSVA 4XTXA 4UC4A 4C5EA 2XK0A 4EMKC 4KUDK 4JLGA 3E9FA 4YTLA 3NTHA 4QQGA 5GMKj 1BKBA 1N6AA 3JCMg 2E6NA 2LT1A 4IUUA 3V7CA 2RJFA 1WJRA 5CQXA 4M7AC 4OB2B 2M16A 2ZPEB 1VIFA 3ER0A 3MCAB 5LJ3h 1M90U 3DB3A 4HA8A 4ELZC 4QVZA 3M59A 5CVIA 5LJ5e 1G3SA 3L2QA 2GCXA 4NS5A 2R58A 4FL6A 5GAOq 5GAMf 4R55A 2VV5A 1W4SA 1I8FA 2PVGB 3VUBA 1UGSB 5GAOp 2D6FA 4M7AD 2K4YA 4JRIA 2FYKA 1U1SA 2M1HA 2VUBA 4IUTA 3JB9G 2RI3A 4E47A 4M7DA 3T9NA 1D3BB 2MMPA 3M55A 2DTOA 4OB3B 4JJNK 4JS4A 3QIIA 5GAOn 5LL6S 4XTZA 3I55T 3CC2T 2M9UA 4M7AF 3CEYA 3CCJA 2CZ7B 2KDSA 1BI2A 4M7DC 1LOJA 3SD4A 2QQAA 2HBPA 4FSXA 5DY9A 3M58A 5D6XA 3JCMV 3CMAT 2XHCA 4FM4B 1VQNA 3VU3C 3PTAA 2F69A 4C8QF 1VQ6A 3MP1A 4C5IA 5GAMe 3OYMA 2O4XA 2E64A 5CQYA 2P4TA 2IG0A 4N0AC 4LDXA 4A4GA 1N9RA 1R8OB 2C06A 2ZGWA 4NL2A 3LH0A 1D3BA 4XK8E 2WSCE 2DXBA 4V2SA 2CZ1B 4E7KA 3ZFJA 2KY9A 2EKOA 2LNVA 3FIFA 1WPYA 2XG8D 3MEAA 3HRUA 3OB9A 5FRNA 5GAN2 2DPPB 4FU6A 3OS5A 3L2WA 2DEQA 3RESA 1K8AU 3OBWA 3OS1A 4HCBA 3HSBA 2RK1A 4QVDA 4A54A 4BE1A 4BE0A 5GANg 2HQXA 2L8DA 3L2ZA 4M77F 2EQMA 2R5AA 4IUPA 2RHYA 4J7IA 3LYIA 4M78D 2WSFE 1DJ7B 1RL2A 3OYKA 4M75F 4OB1B 3I56T 2PUOB 4IKFA 5KCHA 5GAN5 4GLKA 2XICA 3JB9H 3X25B 4OF1A 3MEWA 2CS7A 2VGNA 4M77D 4P5NA 3JCMh 4C92G 1B34A 4F7UE 4ZTJA 5KE3A 2CKKA 3L2RA 2E6ZA 3CC4T 2LTOA 4PNOA 1Y96B 1VQ6T 1VQNT 3PMIA 4R56A 1QVGS 4XTWA 2CZ0B 2LCCA 3OMCA 5LJ3g 5M9OA 3L42A 2K5FA 2RI2A 3OSSC 2RHIA 3PFSA 2P0KA 2FHDA 4X9DA 3OA6A 2XKOC 5CKDA 4ZGDB 4II1A 4M77C 3JSCA 5D6WA 2VGMA 1BI3A 5GANj 1H3ZA 2Y4YA 5GAMg 3SWNC 3S3OA 2K5IA 4CRIA 1B34B 2VXEA 2JNGA 4C0GA 2QEXT 3ASKA 1X6OA 4X34A 4ZGJB 1Y96A 1U1TA 1VQ4A 1Y71A 3C12A 3SDZA 3OYAA 1PSFA 2HQEA 2E5QA 4E7LA 1ZQ1A 3N5BB 1EIFA 5GAOm 3FC3A 3RUXA 4C8QB 5DLOA 1Y7XA 4FIBA 4Y91A 2FVUA 1KC8U 3VKIA 2DAQA 5A0DA 3HPWA 2DD4A 2QI2A 1S72T 1QP3A 1VQ7T 2XIDA 5FU6B 1VQLT 4RKUE 3A8LB 5CCAA 2ZZDA 2YLCA 4LDUA 2JUFA 5FRMA 5FU6C 2K5LA 1IREB 3BFMA 4J6WA 3GIBA 1BYMA 3G71T 2CGHA 1O75A 3M56A 5LJ3e 4QQDA 4E7IA 3V8JA 5D6YA 2ZPGB 3GNGA 1KQ2A 3CC4A 4BDYA 4ZGEB 3JCMX 5A0GA 3J81E 2RH2A 1WNLA 1ZBXA 1YBYA 4HCZA 4ME7A 2MF2A 5GMKl 3I56A 4XTUA 2GF7A 3EAEA 4C5GA 4MZTA 3S3NA 3V8LA 1M1GA 4FT4A 3TREA 5GANe 2O01E 3A8MB 3E9GA 4N4HA 2ZCFB 1YIJA 2EQKA 4DOWA 2BIVA 1QVPA 1FX7A 3QUIA 4KULA 2JZ2A 3V7SA 2F5KA 4BY6C 5LJ5d 3JCMb 5GANd 4XU0A 2OTJT 3RKWA 4J6YA 4EMHA 2FB7A 1YJNA 2E1HA 1K9MU 2MWOA 4L5GA 4QVCA 2JVVA 4N0AA 4N4IA 3VYGA 3MO8A 3CCJT 1FXXA 2LVMA 3Q1JA 3KBGA 3CCLA 4M7DD 3JB9F 1LNXA 1M5Q1 2RJEA 3RMQA 4BI3A 3LGLA 1VIEA 1VQKT 3OW2A 2EFIA 3EFRA 3MP6A 1K9MC 3P8BB 3OYHA 3HHTB 4XU1A 4RG8A 4KUIA 1VQ5A 4MZPA 3QDRB 1XNIA 1OYXA 2LQ8A 3QZ5B 5GMKe 3JB9D 1VQMA 5HY6A 3QPHA 4F7UF 4Y28E 1N8RU 4M75D 3CCUT 4OGEA 1HK9A 4M78A 3RKXA 2LQKA 2QDYB 3CBMA 3OS0A 4C92B 3BY7A 1QVFS 1MHNA 3M5AA 5GMKh 2EQJA 1G3YA 4BI8B 1YJ9A 1NJIU 1I81A 3JCMW 1VQ9A 3QHSA 3CCRT 2QQRA 3DLMA 2XDBA 4WF2A 2G3RA 3INZA 4M77B 1KQSA 1TH7A 3S6WA 1I4K1 1SSFA 2P0PA 4JLIA 1KD1U 2DIQA 4XAXB 3SWNB 2RHZA 4ZTFA 3DKMA 3CXCA 2K3YA 2E70A 3OQ5A 1YJWT 4J8OA 3OMGA 3NFCA 3X28B 1WJSA 3P8HA 3GP8A 4C92A 4RMOA 1YI2A 4MDWA 3PGGA 3OS2A 2RO0A 4M7DG 2EJFA 5LJ5g 3LLRA 2ZPIB 4D6WA 2O4XB 5GAN7 2F5TX 4PJOA 2WACA 4J7FA 4B9WA 2DZCA 3JCMP 5CKHA 4Q5WA 2FL7A 5GANh 1Q81U 3CBOA 5GAN8 4BI4A 3SWNA 5IAYA 4C0FA 3ZBDA 1O9SA 2B8AA 2ZPFB 3OBYA 4EMGA 1YIJT 1WQWA 1X01A 3A8OB 1N9SA 2L5QA 4HT9A 2PVDB 4OMFB 4X9CA 3EFSA 3M57A 5EG2A 2RJDA 4C0DC 3QYHB 4PJOB 4O5VA 2KSSA 3V7RA 4M7DF 4MMKA 2QA4T 3HP9A 4LDWA 3LWIA 2MWPA 5DLQE 3FRNA 5A0LA 4M7AA 2QEXA 3M4YA 5IN1A 5A2QE 4RCCA 4C8QC 2R57A 5L8RE 4M75G 3WXMB 4PJOE 4RG2A 3JB9I 1KC8C 2K3XA 3CPFA 2PVOB 2Y90A 4LD9K 4NL3A 4JDSA 3CCSA 4JRPA 3NTIA 4M78G 1NJIC 5LJ3f 3CC7A 1VQPT 4PL6A 3CC2A 4N4GA 1K73C 2RA2A 2PQWA 4JUVA 1Y07A 2RD1A 3QYGB 1KD1C 1M4ZA 2KVQG 5J39A 3G4SA 1YHQA 2RI5A 5C6SA 3P8DA 3H6ZA 2E10A 4GY5A 4C8QG 2QA4A 3JCMJ 3RERA 4M7DE 2VXFA 1BI0A 2RHUA 1LJOA 2D9TA 1NPPA 4A4FA 1VUBA 1YITT 1VQOT 1Q82C 3TCJA 4L59A 5LJ3d 1JB0E 1M1FA 3CCUA 4E7HA 4LDYA 1W2BS 2RM4A 3RMSA 1G5VA 2DK3A 3VUZA 2Y4XA 4XTVA 5CK9A 3CCET 2RK2A 3X24B 3CCEA 1VQPA 2EWNA 1X75C 3A8GB 1FWZA 1YI2T 1OI1A 2LRQA 3OYYA 4A4KA 2I2LA 4A4HA 3M9QA 4JRQA 2EJGA 5FU7B 4M77E 5KE2A 3CMEA 1U8RA 1S72A 1VQ7A 4FT2A 3CMET 3L1AA 3GPLA 1XQHA 4OGCA 4ELYC 2XD0A 1JRIA 1WQ7A 2OAUA 1N8RC 4BUGA 3SB2A 5GAOr 3M54A 2QQBA 3CCQT 3VV0A 5AYFA 3SFMA 2X35A 2DJZA 3OYLA 2IVWA 2OTJA 2KAFA 3OYEA 5CAIA 4M77G 2V8JA 1OZ3A 3FJPA 2VC8A 1H641 3META 1AHJB 3HRTA 4OP0A 1Q7YC 3CC7T 2E41A 2KMTA 3LWHA 3CCRA 1G3TA 3QZ9B 3WVDB 1UGQB 3HKSA 3KXTA 3S3MA 3RKYA 4OB0B 1NE8A 1VQKA 4Z02A 4BE2A 4M7AG 3QO3A 2DO3A 4MZMA 1KHIA 5GAMd 2ZPHB 4M7DB 2EQUA 1VQLA 4A53A 1QVGA 3BDLA 3F70A 4C5HA 1VQMT 3L2UA 4C92D 1Q7YU 2E12A 2L89A 1HXDA 4KBMB 2EAYA 3KUFA 1QW1A 2V8KA 4MMLA 4M7AE 1M9SA 4PJOD 3HRSA 2L3RA 3MEVA 3CCMT 2V8IA 4L6V5 3CCMA 1KQ1A 5I2MA 1Q81C 1M8VA 3LW5E 4BD3A 3RIRA 4DOVA 5KH6A 3CCLT 3JCMe 4TVRA 4C8QA 1MGQA 3R6OA 1JJ2A 4C0DB 4HCCA 3QSUA 4VUBA 1KG1A 2H3JA 5HK3A 2GFUA 3J80E 1YITA 4PJOG 4ZN3A 2DXCA 2DTHA 2LX9A 3FDRA 4QQ6A 4E7JA 3HL8A 1UEBA 2A7YA 2LC4A 3GNFB 2RHXA 3C4SA 5CKFA 1WGSA 2OTLA 4F7UG 4M75C 2X4XA 5CO7A 2CZ6B 3GOXA 3BW1A 2DIGA 3TEEA 4M75B 1K8AC 2KK4A 3LX7A 3CD6A 3JCMc 3UT1A 1IZ6A 4M78B 4A4EA 3UDCA 5LJ5h 2GQVA 2X4JA 1VQ8A 3LGFA 3ME9A 2JTMA 3QXEB 3OYCA 3JCMQ 3CCVT 2JOYA 5J3BA 4CI0C 3FEOA 3V8KA 3CMAA 1ZHIA 2JN0A 3MHXA 5LJ5f 4M77A 2QTXA 5GANf 4C8QE 4PJOC 3C95A 1YJ9T 1YJWA 3CBPA 3OYFA 4M75A 2DXTA 2EYQA 5LJ3j 5IT9E 3JB9J 5LJ5j 3CXCS 4JS5A 4J6XA 3PT9A 1BI1A 3MEUA 5GAMh 3OYIA 3OYJA 5I21A 3WVEB 3X26B 4BY6B 4M78E 4J5YA 1XTDA 2X4YA 3PNWC 2BUDA 4DA4A 1W2BA 2RJCA 1M1KC 1BIBA 1K73U 4M75E 4NOYA 1VQ4T 1PSEA 5J26A 3URGA 1QP2A 2X4WA 4C92E 5FLXE 3MP8A 2LCLA 2DXUA 2MI6A 2HNIA 3PIPA 3OYBA 3G6ET 3FB9A 3GLXA 4BB7A 4C0ZA 3OYDA 1JJ2S 1N27A 4ATOA 3G4ST 2YRVA 1NZ9A 3J7AF 1UB4A 1YCYA 4J83A 3OYNA 1G3WA 4EMKB 4XU2A 5GAMj 1Q86U 5GAN3 2EJ9A 1OZ2A 4B9XA 1VQ5T 1UGRB 2M0OA 1P92A 3M53A 4LDVA 3NTKA 2K57A 5GMKi 4XTYA 2NLUA 2ZPBB 4M7AB 3X20B 3PMTA 2R5MA 3OW2S 3FLGA 3DLLA 5FU7C 2OTLT 4BACA 3DB4A 2LDMA 5CR2A 4C92F 2KQWA 4O6JA 5HK0A 3E1SA 3BDUA 4PJOF 4EMKA 2XI9A 4PLLA 1NPRA 2E65A 1KHCA 2AHJB 1VQ8T 2CYZB 4MDXA 2DZ9A 3QJYA 4JRKA 5FROA 3G71A 2D0QB 2HAXA 3CCQA 2VYTA 2RB6A 1Q86C 1KQSS 2DKGA 4XU3A 3CPWA 1BIAA 4IUVA 5CKEA 1I5LA 4C8QD 4HKEA 1UGPB 3A5ZB 1VQ9T 2YHTA 2QQSA 4XQ3A 1V29B 2MAMA 3OY9A 4LD6A 4EPCA 3JRZA 3O8VA 5HKCA 1Q82U 4PKCC 1WJQA 3QBYA 4PLIA 1YHQT 2PUKB 2PU9B 4RCBA 3VYHB 4M78C 4DQ2A 2YLBA 3G7ZA 4HT8A 2A3LA 1JBMA 3HFNA 3ZEHA 4BDZA 2QQ9A 4EDUA 3OYGA 2JTFA 1VQOA 3G6EA 2DVEA 2HD0A 3QJ6A 3L2VA 1YJNT 1RI0A 3JCMd 1M1KU 3H8ZA 5GMKm 3C94A 3PIOA 4C92C 3I55A 2XU8A 3UPUA 1QVFA 5C0MA 2LT4A 2BKDN 5I2SA 5GAN6 2P0QA 3CPWS 4F7UA 4IUQA 2DTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 B;  4M77 C;  4M78 F;  4EMG A;  3M4G A;  3HFO A;  1WQW A;  5GAN j;  3JCM c;  4M78 B;  5GAM g;  3SWN C;  1X01 A;  3AHU A;  1N9S A;  4HT9 A;  5LJ5 h;  3JCM f;  1B34 B;  4X9C A;  2VXE A;  3EFS A;  4PJO B;  3JCM Q;  1Y96 A;  1U1T A;  3V7R A;  3V8K A;  4M7D F;  4PJO C;  2JN0 A;  5LJ5 f;  4M77 A;  2QTX A;  4MMK A;  4C8Q E;  5GAN f;  5GAN 4;  5GAO l;  5GAO m;  4F7U B;  3RUX A;  4C8Q B;  4M7A A;  4M75 A;  2DXT A;  4Y91 A;  5LJ3 j;  4XTX A;  3JB9 J;  4RCC A;  4C8Q C;  5LJ5 j;  4M75 G;  4EMK C;  4J6X A;  4PJO E;  5GAM h;  3JB9 I;  2Y90 A;  4NL3 A;  4M78 G;  5LJ3 f;  5I21 A;  5GMK j;  4M78 E;  2YLC A;  3JCM g;  4J5Y A;  4J6W A;  3BFM A;  3GIB A;  2RA2 A;  3V7C A;  4JUV A;  4M7A C;  1BIB A;  2CGH A;  5LJ3 e;  4M75 E;  3V8J A;  2RD1 A;  4NOY A;  5LJ3 h;  4HA8 A;  3JCM X;  5LJ5 e;  2E10 A;  3JCM J;  1WNL A;  4C8Q G;  4C92 E;  3RER A;  4M7D E;  2DXU A;  2VXF A;  2HNI A;  1LJO A;  5GAO q;  5GAM f;  3FB9 A;  1I8F A;  5GMK l;  4XTU A;  5GAO p;  4M7A D;  5LJ3 d;  1YCY A;  4JRI A;  2FYK A;  1U1S A;  2RM4 A;  3JB9 G;  4EMK B;  3V8L A;  4XU2 A;  5GAM j;  4XTV A;  5GAN e;  4M7D A;  5GAN 3;  1D3B B;  2EJ9 A;  2DTO A;  2EWN A;  5GAO n;  3QUI A;  4XTZ A;  3V7S A;  5GMK i;  2K57 A;  5LJ5 d;  4XTY A;  3JCM b;  2I2L A;  5GAN d;  4XU0 A;  4M7A F;  2EJG A;  3RKW A;  1LOJ A;  4J6Y A;  4M77 E;  4M7A B;  4EMH A;  4M7D C;  2FB7 A;  2E1H A;  3L1A A;  4QVC A;  4N0A A;  5DY9 A;  3JCM V;  1JRI A;  1WQ7 A;  3VU3 C;  3SB2 A;  4C8Q F;  5GAO r;  5GAM e;  4C92 F;  2DJZ A;  3JB9 F;  1LNX A;  1M5Q 1;  2E64 A;  5CAI A;  4M77 G;  4N0A C;  3BDU A;  3FJP A;  1N9R A;  3EFR A;  2VC8 A;  1H64 1;  4PJO F;  4EMK A;  2ZGW A;  4NL2 A;  2E65 A;  4OP0 A;  4XU1 A;  2E41 A;  1D3B A;  2DZ9 A;  3JB9 D;  4JRK A;  5GMK e;  3RKY A;  4V2S A;  4F7U F;  4M7A G;  2RB6 A;  3QO3 A;  3FIF A;  4M75 D;  1WPY A;  1HK9 A;  4M78 A;  3RKX A;  5GAM d;  4M7D B;  2DKG A;  4XU3 A;  4A53 A;  1BIA A;  3BY7 A;  4C92 B;  1I5L A;  4C8Q D;  5GMK h;  5GAN 2;  2YHT A;  1I81 A;  2DEQ A;  4XQ3 A;  4C92 D;  1HXD A;  3QHS A;  3JCM W;  3RES A;  2EAY A;  4WF2 A;  3HSB A;  3INZ A;  4MML A;  4A54 A;  4M77 B;  4QVD A;  4M7A E;  4PJO D;  1TH7 A;  1I4K 1;  4JLI A;  5GAN g;  4RCB A;  4DQ2 A;  3L2Z A;  1KQ1 A;  4M78 C;  4M77 F;  2YLB A;  3SWN B;  1M8V A;  4HT8 A;  4M78 D;  3RIR A;  1JBM A;  3HFN A;  4M75 F;  4C8Q A;  3JCM e;  1MGQ A;  5GAN 5;  3QSU A;  4C92 A;  2DVE A;  3JB9 H;  3PGG A;  4M7D G;  4M77 D;  2EJF A;  4PJO G;  3JCM h;  4C92 G;  5LJ5 g;  1B34 A;  4F7U E;  3JCM d;  5GAN 7;  2DTH A;  5GMK m;  4PJO A;  4PNO A;  1Y96 B;  4C92 C;  4M7D D;  4XTW A;  2DZC A;  5LJ3 g;  3JCM P;  4F7U G;  5GAN 6;  5GAN h;  4M75 C;  1KQ2 A;  4F7U A;  5GAN 8;  3BW1 A;  4X9D A;  3SWN A;  2DTI A; 
#chains in the Genus database with same CATH topology
 2OTJ Q;  2GFA A;  4M78 F;  3HFO A;  1SHF A;  2HEQ A;  2XDP A;  4J9G A;  1VQK Q;  3AT1 B;  4ZN1 A;  1QWF A;  2DD5 A;  3QG1 A;  1MV3 A;  5CKB A;  3TU4 K;  2YDL A;  5GAO l;  4F7U B;  3VJP A;  4C5E A;  2XK0 A;  4YTL A;  2GNC A;  2MYS A;  3FJ5 A;  1BKB A;  3JCM g;  1WX6 A;  2E6N A;  5CQX A;  1W1F A;  4QT7 A;  3ER0 A;  1VIF A;  5LJ3 h;  3EG9 B;  3DB3 A;  4DEX A;  3UAT A;  1QKW A;  4QVZ A;  4AFS C;  4NS5 A;  5GAM f;  2MOX A;  2D6F A;  1UGS B;  5GAO p;  2QTV A;  4JRI A;  2FYK A;  3JB9 G;  2RI3 A;  4M7D A;  3U23 A;  2DTO A;  2KDS A;  2HCK A;  2ENM A;  3CMA Q;  3QWY A;  4PJL A;  3VU3 C;  2F69 A;  4C5I A;  3OYM A;  1TSF A;  2P4T A;  4LDX A;  1N9R A;  4NL2 A;  3LH0 A;  2WSC E;  4HXJ A;  2QDL A;  2EKO A;  1WPY A;  4IIO A;  3EGX A;  2CP5 A;  4FU6 A;  5ECA A;  3OS5 A;  4KH0 B;  1UJ0 A;  3HSB A;  2RK1 A;  1SF9 A;  4A54 A;  4BE1 A;  1AWJ A;  4M77 F;  2R5A A;  2RHY A;  2WSF E;  2DMO A;  4M77 D;  1B34 A;  5KYX A;  1M2V B;  2E6Z A;  1D0X A;  1BBZ A;  3PMI A;  4XTW A;  5M9O A;  3I56 Q;  2FHD A;  4X9D A;  5CKD A;  4ZGD B;  2FRW A;  3ZL7 C;  1BB9 A;  2VGM A;  1YIJ Q;  5GAM g;  3S3O A;  4CRI A;  1B34 B;  4C0G A;  1VQ4 A;  1S72 Q;  2HQE A;  1D1A A;  2E5Q A;  1EIF A;  2JTE A;  2W0Z A;  4Y91 A;  2KBT A;  2ESW A;  2M02 A;  3HPW A;  1VQ7 T;  2QI2 A;  1QP3 A;  5FU6 B;  2EGE A;  4PJJ A;  2J06 A;  4LDU A;  5IXB A;  1BYM A;  3BFM A;  2JS0 A;  5D6Y A;  3J81 E;  2RH2 A;  1MUZ A;  1VQ9 Q;  1YBY A;  1X6G A;  4HCZ A;  4ME7 A;  5GMK l;  3I56 A;  4XTU A;  1KD1 R;  1Z9Q A;  2J6F A;  3S3N A;  1Q7Y R;  4FT4 A;  1YN8 A;  2O01 E;  1WLP B;  2LJ0 A;  1YIJ A;  1NG2 A;  3A98 A;  2D8J A;  1NEG A;  1OV3 A;  4OMP A;  4N0A A;  1RAE B;  3VYG A;  2OTL Q;  1FXX A;  3KBG A;  1NLO C;  3RMQ A;  2CT3 A;  5FW9 A;  1M30 A;  2NWM A;  1K9M C;  3VS2 A;  1JO8 A;  3HHT B;  2KI7 A;  4XU1 A;  1OYX A;  2LQ8 A;  3JB9 D;  2YUO A;  3CCU T;  4OGE A;  1HK9 A;  3RKX A;  2LQK A;  3CBM A;  4C92 B;  3BY7 A;  3M5A A;  2EQJ A;  2AT1 B;  2E3I A;  1VQ9 A;  4WF2 A;  1TH7 A;  1I4K 1;  4JLI A;  2C0I A;  4LN2 A;  3DKM A;  3CXC P;  3OQ5 A;  4J8O A;  1M27 C;  3X28 B;  3P8H A;  4C92 A;  3OS2 A;  5LJ5 g;  3LLR A;  1YHQ Q;  4D6W A;  1K8A R;  1Q81 R;  4PJO A;  2WAC A;  4J7F A;  4FSS A;  1VQ6 Q;  1VQN Q;  5CKH A;  5D7U A;  3HTR A;  3CBO A;  5GAN 8;  4C0F A;  1J3T A;  3OBY A;  4HVU A;  2F2W A;  1T0J A;  3A8O B;  1TG0 A;  4X9C A;  3EFS A;  5EG2 A;  4PJO B;  1JQQ A;  3MKD A;  2KSS A;  3V7R A;  1AT1 B;  4MMK A;  2QA4 T;  4LDW A;  5A2Q E;  5I11 A;  2K3X A;  2L3S A;  2BTT A;  2V26 A;  1QLY A;  2RN8 A;  4JDS A;  1NJI C;  3NTI A;  3M0U A;  4M78 G;  1KC8 R;  1M2V A;  3G71 Q;  1SRM A;  1I0C A;  2K9G A;  2SRC A;  3JCM J;  3RER A;  2D9T A;  1NPP A;  2CP6 A;  1RAG B;  3CCU A;  1JB0 E;  4JZ3 A;  1W2B S;  1KQS P;  3CCM Q;  2RQR A;  2Y4X A;  2RK2 A;  1FWZ A;  1OI1 A;  4A4K A;  4A4H A;  3CME A;  1VQ7 A;  1WQ7 A;  2OJ2 A;  4BUG A;  2L3Q A;  5GAO r;  3M54 A;  4JJC A;  2QEX Q;  3VV0 A;  3CCV Q;  1NLP C;  2VC8 A;  1Q7Y C;  2E41 A;  3LWH A;  3CCR A;  3QZ9 B;  3WVD B;  3KFV A;  3KXT A;  3S3M A;  4MZM A;  1KHI A;  4M7D B;  1CKB A;  1WIE A;  4C92 D;  1YJW Q;  4KBM B;  4M7A E;  1RAA B;  3CCM T;  2V8I A;  1M8V A;  3RIR A;  1W70 A;  1JJ2 A;  1MV0 B;  3QSU A;  3J80 E;  1YIT A;  2DXC A;  2PTK A;  4QQ6 A;  4E7J A;  2ED0 A;  1W2B P;  4PK4 A;  3CCL Q;  4K11 A;  1BK2 A;  2X4X A;  5CO7 A;  2LMJ A;  4PFP A;  3BW1 A;  3GOX A;  4M75 B;  2KK4 A;  3LX7 A;  3CD6 A;  3UT1 A;  4A4E A;  4F14 A;  3ME9 A;  2JTM A;  3OYC A;  3CCV T;  2GBQ A;  4RTT A;  4JJD A;  8AT1 B;  3FEO A;  3V8K A;  3CMA A;  2JN0 A;  2CRE A;  1YJ9 Q;  3C95 A;  1YJW A;  3OYF A;  4M75 A;  2DXT A;  2QAZ A;  5IT9 E;  5LJ5 j;  5GJV B;  4J6X A;  5GAM h;  5KYW A;  1MMN A;  3X26 B;  2J05 A;  1IGU A;  2X4Y A;  4OMN A;  4DA4 A;  3EH2 A;  1M1K C;  1BIB A;  4M75 E;  4NOY A;  4PFO A;  2K79 A;  1HD3 A;  1WHH A;  2AZV A;  4C92 E;  2LCL A;  3OYB A;  2HNI A;  4BB7 A;  1AZE A;  1RAB B;  4ATO A;  1NZ9 A;  3J7A F;  1UB4 A;  4XU2 A;  5GAM j;  1FMW A;  5GAN 3;  1VQ5 T;  1UGR B;  2M0O A;  3SHW A;  2O9V A;  2OX7 A;  3X20 B;  3OW2 S;  4D8K A;  3DB4 A;  1GBQ A;  4OMQ A;  4OMO A;  2KQW A;  4O6J A;  4J9H A;  3BDU A;  5IHN A;  2XI9 A;  1RAF B;  2E65 A;  2H3E B;  2AHJ B;  5FRO A;  2D0Q B;  2HAX A;  1AD5 A;  1KQS S;  2COY A;  4XU3 A;  4XQ3 A;  2MAM A;  3OY9 A;  3H0I A;  4LD6 A;  1Q82 U;  4PKC C;  1K9A A;  1WJQ A;  1YHQ T;  2VAS A;  4RTW A;  1K4U S;  4HT8 A;  2A3L A;  4BDZ A;  1VQP Q;  2QQ9 A;  4EDU A;  4CC3 A;  3G6E A;  2DF6 A;  3UF4 A;  2HD0 A;  1WHJ A;  3JCM d;  1M1K U;  1QVF A;  2BKD N;  4KGX B;  2FZC B;  3MP6 A;  1WDX A;  2DTI A;  3UWN A;  4OVA A;  5KCO A;  2WSE E;  1M90 C;  4IUR A;  1NYG A;  1I07 A;  1XOV A;  3EG9 A;  2K2V A;  3H0F A;  1VQL Q;  3H0H A;  5GAN 4;  4AMC A;  1QCF A;  2DX1 A;  4XTX A;  4KUD K;  4JLG A;  2YT6 A;  1E7O A;  2EGC A;  2QAS A;  4IUU A;  2Z0W A;  2D0N A;  4OB2 B;  2M16 A;  3TSZ A;  4HA8 A;  1IB8 A;  1AWO A;  3M59 A;  5LJ5 e;  2CUB A;  2GCX A;  2LJ1 A;  4FL6 A;  7AT1 B;  1WHG A;  2PVG B;  2VUB A;  2M1H A;  4IUT A;  2XMF A;  1WFW A;  4CC4 B;  3T9N A;  2MMP A;  3M55 A;  4JJN K;  1GCQ C;  3QII A;  2M9U A;  4M7A F;  3CCJ A;  2V1R A;  1W6X A;  2BZ8 A;  4M7D C;  1UDL A;  3EGX B;  1ZSG A;  4WCI A;  3EGU A;  3M58 A;  5KYW B;  4FM4 B;  1OEB A;  1VQN A;  3PTA A;  1VQ6 A;  2O4X A;  1UFF A;  2E64 A;  5CQY A;  2IG0 A;  4N0A C;  4A4G A;  2V1Q A;  2ZGW A;  2DXB A;  4V2S A;  4E7K A;  3ZFJ A;  2EPD A;  1RLQ C;  1FYN A;  2KY9 A;  2CP7 A;  4PJN A;  1VQ4 Q;  2XG8 D;  3MEA A;  5FRN A;  1CKA A;  2DEQ A;  1K8A U;  3OS1 A;  5FWB A;  4QVD A;  4BE0 A;  3M0T A;  2L8D A;  3L2Z A;  2EQM A;  4IUP A;  4J7I A;  3EG0 A;  2E4H A;  1RL2 A;  3OYK A;  3I56 T;  1F1B B;  4PFZ A;  2JW4 A;  4GLK A;  1N5Z A;  2XIC A;  3JB9 H;  2YUN A;  4OF1 A;  3MEW A;  2CS7 A;  2VGN A;  4P5N A;  3MJX A;  2G6F X;  3L2R A;  1OU8 A;  2O31 A;  2CZ0 B;  2LCC A;  4DBH A;  4KGZ B;  2KR3 A;  2K5F A;  2XKO C;  4II1 A;  4M77 C;  2DIL A;  3JSC A;  5D6W A;  5GAN j;  2YSQ A;  3I5R A;  2Y4Y A;  2YRD A;  2K5I A;  4JZ4 A;  1I5O B;  3ASK A;  4ZGJ B;  1VQ7 Q;  3C12 A;  2D1X A;  2COW A;  3OYA A;  4E7L A;  2GTJ A;  3FC3 A;  1Y7X A;  1IHW A;  2FVU A;  3MPU B;  3VKI A;  2DAQ A;  1N8R R;  2DD4 A;  1S72 T;  1VQL T;  2ZZD A;  2YLC A;  5FRM A;  3REB B;  2K5L A;  1IRE B;  2RPN A;  3M56 A;  4E7I A;  2ZPG B;  4ZGE B;  1WNL A;  1ZBX A;  3I55 Q;  2KNB B;  1IXD A;  2CDT A;  2KEA A;  1X43 A;  4MZT A;  3V8L A;  1D1B A;  3TRE A;  5GAN e;  2EQK A;  4DOW A;  2BIV A;  1QVP A;  1FX7 A;  2KT8 A;  3V7S A;  3JCM b;  2F5K A;  1YIT Q;  1YFN A;  4J6Y A;  1MND A;  2AK5 A;  4QVC A;  2JMA A;  2JVV A;  4N4I A;  3MO8 A;  4ZNX A;  3CCJ T;  1B7T A;  3NHN A;  4BI3 A;  4FYX B;  2ROL A;  4MZP A;  3QDR B;  3QZ5 B;  3LH5 A;  4F7U F;  1N8R U;  3EG1 A;  4M78 A;  1MHN A;  3VS5 A;  5GMK h;  2MCN A;  1AVZ C;  1I81 A;  3JCM W;  3CCR T;  2QQR A;  2AZS A;  1Y57 A;  2P0P A;  3TVT A;  1KD1 U;  4XAX B;  2HMA A;  2RHZ A;  1YWP A;  2K3Y A;  3NFC A;  4GLM A;  4MDW A;  2ZPI B;  2O4X B;  2ABL A;  1KK7 A;  3JCM P;  1OUL A;  2LX7 A;  4EMG A;  1O9S A;  2ZPF B;  1KSW A;  2L5Q A;  4LNP A;  3M57 A;  4C0D C;  2O2O A;  1PG5 B;  4O5V A;  3I9Q A;  4M7D F;  1IHV A;  2LNH B;  2MWP A;  3FRN A;  1VYT A;  5A0L A;  3PVQ A;  2QEX A;  3WXM B;  4RG2 A;  1KC8 C;  2Y90 A;  4LD9 K;  2VKN A;  2O88 A;  1FMV A;  3CCR Q;  2IIM A;  1Y07 A;  2HKN A;  2RD1 A;  2KVQ G;  3G4S A;  1BU1 A;  2E10 A;  2ATC B;  4AFQ C;  1UUE A;  3PVL A;  1VUB A;  1VQO T;  4AG2 C;  1M1F A;  1ZUY A;  1D1C A;  4XTV A;  3X24 B;  4FCY A;  3A8G B;  1KIK A;  2DLP A;  3G6E Q;  2I2L A;  5L23 A;  4A63 B;  3C0C A;  2EJG A;  5KE2 A;  5KYU A;  3GPL A;  2NUP B;  2RQU A;  4ELY C;  1JRI A;  2OAU A;  1N8R C;  1PC0 A;  3CCQ T;  3OYL A;  2X35 A;  2DJZ A;  2CH4 W;  2OTJ A;  1YNZ A;  3OYE A;  3OW2 P;  5CAI A;  2V8J A;  1D0Y A;  1RI9 A;  2RNA A;  3MET A;  1WZO A;  2KMT A;  2M51 A;  1UGQ B;  1VQK A;  4M7A G;  3QO3 A;  2NUP A;  1CSK A;  2KRM A;  2ZPH B;  1PWT A;  4A53 A;  3F70 A;  2KXC A;  4ESR A;  1ARK A;  1X2K A;  2A0F B;  2NYS A;  3HRS A;  3MEV A;  1KQ1 A;  3LW5 E;  5IHI A;  1SSH A;  5KH6 A;  3JCM e;  4TVR A;  4C8Q A;  4HCC A;  3VS6 A;  1NBE B;  2DRK A;  4PJO G;  4DEY A;  2CP0 A;  2DTH A;  2KYB A;  2LX9 A;  3FDR A;  3HL8 A;  1UEB A;  2A7Y A;  3GNF B;  2RHX A;  2OAW A;  2DIG A;  1TWB A;  1NYF A;  1IZ6 A;  4M78 B;  3UDC A;  4R0K A;  2X4J A;  4ANJ A;  2JOY A;  5J3B A;  1HJD A;  3MHX A;  2DL8 A;  5LJ5 f;  3BE3 A;  2EYQ A;  3JB9 J;  1ABO A;  3CXC S;  1BI1 A;  3MEU A;  3RR6 A;  2YUQ A;  3WVE B;  4BY6 B;  4M78 E;  1M1K R;  4J5Y A;  1PM3 A;  3PNW C;  2BUD A;  4LUD A;  1K73 U;  1OPL A;  1VQ4 T;  1WYX A;  1U3O A;  1RAD B;  1PSE A;  3VS4 A;  1X6B A;  3SEM A;  1QP2 A;  1G8X A;  5FLX E;  3MP8 A;  3VS7 A;  3FB9 A;  2L3P A;  1WI7 A;  1G3W A;  4FYY B;  4KGV B;  3QWX X;  1K9M R;  4LDV A;  1ZSZ C;  3EG2 A;  5FU7 C;  4BAC A;  1B3Q A;  2EYX A;  2PZ1 A;  1TUG B;  4C92 F;  2LQW A;  3A1P A;  4KH1 B;  3E1S A;  3D7S B;  2JM9 A;  4PJO F;  4EMK A;  3CCS Q;  1C1A A;  1BCO A;  4WTO B;  1T3S A;  4JRK A;  3H9N A;  2VYT A;  1X27 A;  3CPW A;  1BIA A;  5CKE A;  4C8Q D;  4HKE A;  1UGP B;  2YHT A;  2QQS A;  2DFU A;  1V29 B;  1WXB A;  3ULR B;  4EPC A;  3JRZ A;  2HL5 C;  3QBY A;  2QYZ A;  3VYH B;  3E2U A;  2YWW A;  3ZEH A;  4JJB A;  2DYB A;  2J6K A;  2A08 A;  1YJN T;  1IO6 A;  1Q82 R;  3C94 A;  2XU8 A;  3UPU A;  1PRM C;  3G1J A;  4QKU A;  3M4G A;  3CCS T;  1WHK A;  2CUD A;  2XDD A;  3AHU A;  3GF5 A;  1MNE A;  1H8K A;  1SKU B;  2CT4 A;  1ZBJ A;  4KT0 E;  1AOJ A;  4E6R A;  3A8H B;  2HL3 A;  1T0H A;  1TS9 A;  3TQ7 P;  5DM7 R;  1GXI E;  5IH2 A;  3NTH A;  2MIO A;  2KRS A;  1N6A A;  2ZPE B;  3MCA B;  1UEC A;  1SG5 A;  1M90 U;  2KYM A;  4ELZ C;  5CVI A;  2NUZ A;  2O9S A;  3L2Q A;  5GAO q;  4R55 A;  3VUB A;  2KT1 A;  4RTY A;  2DET A;  4M7A D;  2K4Y A;  1OPK A;  2QGF B;  1PHT A;  1QKX A;  4OB3 B;  2DEU A;  1VYU A;  5GAO n;  3CC2 T;  2CZ7 B;  1LOJ A;  1H3H A;  1TUC A;  2QQA A;  2HBP A;  2KRN A;  2AIR B;  4FSX A;  5D6X A;  2XHC A;  3MP1 A;  3RBB B;  2JMC A;  1D3B A;  4XK8 E;  2DRM A;  3RDV A;  2JT4 A;  2E3H A;  3FIF A;  3NGP A;  2DPP B;  3UA6 A;  1PCX A;  1I1J A;  3RES A;  2BZY A;  3OBW A;  1ABQ A;  5KYU B;  5GAN g;  1TU0 B;  1M8M A;  4M75 F;  2PUO B;  5KCH A;  5GAN 5;  2K3B A;  3JCM h;  1OX9 A;  3CC4 Q;  4ZTJ A;  5KE3 A;  1Y96 B;  1VQ6 T;  1VQN T;  1B07 A;  3OMC A;  3L42 A;  2RI2 A;  3QDF A;  3OSS C;  2RHI A;  2P0K A;  2E5K A;  2EYY A;  1QCO A;  1C0M A;  2VXE A;  3CCQ Q;  1X6O A;  1Y96 A;  1U1T A;  3SDZ A;  2EBP A;  1ZQ1 A;  2F2V A;  4C8Q B;  1R77 A;  3PE0 A;  1KC8 U;  1K76 A;  2A36 A;  2CP3 A;  4Z89 A;  4RKU E;  3A8L B;  1RAH B;  5CCA A;  2JUF A;  1VQM Q;  5FU6 C;  4J6W A;  1GCP A;  5LJ3 e;  1O75 A;  4FW1 A;  4QQD A;  3GNG A;  4HVW A;  4PJM A;  3CC4 A;  3JCM X;  2MK5 A;  4Z8A A;  1M1G A;  3E9G A;  4N4H A;  2ZCF B;  2W10 A;  4KUL A;  1AWW A;  4BY6 C;  5GAN d;  1UE9 A;  4XU0 A;  4F16 A;  3RKW A;  4EMH A;  2FB7 A;  1K9M U;  4L5G A;  1G2B A;  3Q1J A;  2LVM A;  3CCL A;  5GJW B;  3JB9 F;  1LNX A;  1PKS A;  2BE7 D;  2KXD A;  2RJE A;  1VIE A;  4LUE A;  3CD6 Q;  3EFR A;  1MMG A;  4E7Z A;  3OYH A;  4KUI A;  1SEM A;  1XNI A;  1VQM A;  3QPH A;  1GCQ A;  2FZK B;  1YJ9 A;  1G3Y A;  4BI8 B;  3QHS A;  4AT1 B;  1WXT A;  2AKK A;  2COZ A;  2G3R A;  3INZ A;  4M77 B;  1KQS A;  3S6W A;  1SSF A;  2BE9 B;  3GBQ A;  4ZTF A;  3CXC A;  1YJW T;  1YI2 A;  1M90 R;  4RMO A;  2RO0 A;  5EC7 A;  2CSQ A;  5GAN 7;  2F5T X;  4B9W A;  2DZC A;  2FL7 A;  5GAN h;  1Q81 U;  2LQN A;  4X1V A;  4E2F B;  5IAY A;  2EVR A;  1WQW A;  1GL5 A;  4HT9 A;  4F04 B;  2PVD B;  3M0R A;  4OML A;  2JS2 A;  1C6V X;  1Q95 G;  2VVK A;  4M7A A;  5IN1 A;  1TXQ A;  5L8R E;  2RMO A;  3JB9 I;  2PVO B;  4EIK A;  5LJ3 f;  5FWC A;  1K73 C;  1SRL A;  2RA2 A;  2PQW A;  2LJ3 A;  4J9D A;  1M4Z A;  1HYO A;  5J39 A;  1KD1 C;  2RI5 A;  2DA9 A;  5C6S A;  3P8D A;  3H6Z A;  2QA4 A;  1TTH B;  4C8Q G;  1PD1 A;  2VWF A;  4M7D E;  2RHU A;  1LJO A;  4A4F A;  1Q82 C;  3TCJ A;  5LJ3 d;  4LDY A;  2DYI A;  1G5V A;  1QWE A;  2DK3 A;  5CK9 A;  1K73 R;  3CCE A;  1VQP A;  2EWN A;  1X75 C;  3M9Q A;  3CQT A;  1M3A A;  3CME T;  1XQH A;  2D8H A;  4B6M A;  2FPE A;  2LCS A;  3REA B;  5AYF A;  3VS3 A;  3M0S A;  1MMD A;  2IVW A;  2KAF A;  2P4R A;  1AHJ B;  3HRT A;  3CC7 T;  3M0Q A;  1G3T A;  4OB0 B;  3NMZ C;  2DO3 A;  1NJI R;  1VQL A;  3BDL A;  2QA4 Q;  1Q7Y U;  2L89 A;  2HSP A;  1FMK A;  1YP5 A;  1ACM B;  2L3R A;  1Q81 C;  1MGQ A;  3R6O A;  4C0D B;  4IIM A;  1KG1 A;  2H3J A;  5HK3 A;  4ZN3 A;  2NUT B;  1EFN A;  2L2P A;  4M7D D;  2LC4 A;  1R0C B;  2F2X A;  2F1L A;  1WGS A;  2B86 A;  5KYN A;  4M75 C;  3O5Z A;  1S1N A;  5LJ5 h;  3CCJ Q;  2GQV A;  3EHQ A;  1VQ8 A;  3EHR A;  1TUD A;  2RF0 A;  4CI0 C;  1H92 A;  2EGA A;  4PJO C;  4M77 A;  5GAN f;  5IHK A;  3CBP A;  5LJ3 j;  3PT9 A;  2JXB A;  2GGR A;  3OYJ A;  4Y92 A;  5I22 A;  2EYZ A;  4CC2 A;  5J26 A;  3URG A;  5KYY A;  2ED1 A;  3PIP A;  2DXU A;  2MPX C;  1JJ2 S;  3OYD A;  4C0Z A;  1N27 A;  2YRV A;  2K6D A;  2C0T A;  2DL3 A;  4J83 A;  3OYN A;  1T3L A;  4EMK B;  3CPW P;  1Q86 U;  2DL7 A;  2EJ9 A;  1OZ2 A;  4HCK A;  1P92 A;  3M53 A;  3NTK A;  2K57 A;  5GMK i;  4XTY A;  1U06 A;  4M7A B;  2R5M A;  3FLG A;  2X51 A;  2OTL T;  2LDM A;  1LVK A;  1OQK A;  3VRY A;  5HK0 A;  4FYV B;  1VA7 A;  4PLL A;  1KHC A;  1VQ8 T;  3CC7 Q;  2QK0 A;  2PNI A;  2DKG A;  4IUV A;  4Z88 A;  4LXC A;  1VQ9 T;  3A5Z B;  3O8V A;  2PUK B;  4M78 C;  2YLB A;  3G7Z A;  1AZG B;  2JTF A;  2ECZ A;  2DVE A;  1RI0 A;  3H8Z A;  3I55 A;  2OI3 A;  1G83 A;  5I2S A;  3CPW S;  2P0Q A;  4IUQ A;  4F17 A;  2QXF A;  3CCV A;  2YRC A;  3JCM f;  3JAM E;  2I0N A;  5CIU A;  3CD6 T;  2HBW A;  3E19 A;  4D8D A;  4QW2 A;  2EIF A;  2CP2 A;  3QKJ A;  4J9B A;  2A37 A;  3OSV A;  1IGQ A;  4UC4 A;  4EMK C;  4J9F A;  3E9F A;  1ZUU A;  1EZZ B;  4QQG A;  3M0P A;  5GMK j;  2LT1 A;  3V7C A;  2RJF A;  1WJR A;  4M7A C;  1QMC A;  3EH1 A;  2M0Y A;  1G3S A;  1ZSZ A;  2FRY A;  1EX4 A;  2R58 A;  5HCK A;  2KGT A;  2VV5 A;  1W4S A;  1I8F A;  2JM8 A;  2LZ6 B;  1D09 B;  1U1S A;  2DL4 A;  4E47 A;  1AEY A;  1SPK A;  1D3B B;  4JS4 A;  2ZAE A;  5LL6 S;  4XTZ A;  3I55 T;  3CEY A;  1YI2 Q;  2DER A;  1BI2 A;  3SD4 A;  1ZLM A;  1ZSZ B;  1M2O A;  2RQT A;  2X9H A;  5DY9 A;  3CMA T;  3JCM V;  4C8Q F;  5GAM e;  2FPF A;  3VS1 A;  1R8O B;  2C06 A;  4RTX A;  4AFU C;  4J9C A;  4RUG A;  5KYY B;  2CZ1 B;  2LNV A;  2J7I A;  2X3X D;  3HRU A;  2DL5 A;  3OB9 A;  1E6G A;  5GAN 2;  8ATC B;  3L2W A;  2HKQ B;  6AT1 B;  4HCB A;  3EFO A;  2J6O A;  1LCK A;  1TOV A;  2HQX A;  1WHM A;  3LYI A;  1ZX6 A;  4M78 D;  1DJ7 B;  2DNU A;  1Y0M A;  4OB1 B;  4FW2 A;  4IKF A;  3X25 B;  3G4S Q;  4C92 G;  4F7U E;  2CKK A;  3CC4 T;  2LTO A;  4PNO A;  4R56 A;  1QVG S;  5LJ3 g;  2HZY A;  1X2Q A;  3PFS A;  1KQ2 A;  3OA6 A;  1ZA2 B;  1JEG A;  4AG1 C;  1BI3 A;  1H3Z A;  3SWN C;  1K0X A;  2QEX T;  2JNG A;  4X34 A;  4CC7 A;  1Y71 A;  1GFD A;  3RNJ A;  1PSF A;  5KYX B;  3N5B B;  5GAO m;  3RUX A;  5DLO A;  2GTO A;  4FIB A;  4DBQ A;  5A0D A;  1UJY A;  2NUT A;  2XID A;  2EW3 A;  2IPO B;  1ZUK A;  3GIB A;  1VQO Q;  2BZX A;  3G71 T;  2CGH A;  3V8J A;  1X69 A;  1GFC A;  4BDY A;  5A0G A;  1Z9Z A;  2JJ9 A;  4ORZ A;  1YWO A;  2MF2 A;  4OMM A;  1UHF A;  2GF7 A;  2K2M A;  3EAE A;  4C5G A;  1U5S A;  3A8M B;  1RUW A;  1NEB A;  3QUI A;  2JZ2 A;  5LJ5 d;  1QCN A;  1QVG P;  2OTJ T;  1QVF P;  1YJN A;  2E1H A;  2MWO A;  2RQV A;  2K7A A;  1M5Q 1;  1VQK T;  3LGL A;  3OW2 A;  1R0B G;  2EFI A;  2DVJ A;  3P8B B;  2P84 A;  1K0S A;  4RG8 A;  1VQ5 A;  3EG3 A;  1WA7 A;  4J9E A;  5GMK e;  1A0N B;  5HY6 A;  3R6N A;  4Y28 E;  4M75 D;  3NPF A;  3OS0 A;  2QDY B;  1QVF S;  1PNJ A;  2A28 A;  1NJI U;  3DLM A;  2XDB A;  1QQJ A;  1AWX A;  1SHG A;  2DIQ A;  3SWN B;  3CC2 Q;  2E70 A;  2YXY A;  3OMG A;  2FEI A;  1WJS A;  3GP8 A;  3PGG A;  4M7D G;  2EJF A;  2YUP A;  1YJN Q;  1XJW B;  4FYW B;  1KJW A;  4Q5W A;  1UTI A;  1RLP C;  2ROT A;  4BI4 A;  3SWN A;  1RAI B;  5AT1 B;  1LPL A;  1PRL C;  3I5S A;  3ZBD A;  2B8A A;  1YIJ T;  3VRZ A;  3CCE Q;  1VQ5 Q;  1X01 A;  1N9S A;  1E6H A;  4OMF B;  2RJD A;  3QYH B;  3EFO B;  4J9I A;  3HP9 A;  3LWI A;  5DLQ E;  4RTZ A;  2KRO A;  3M4Y A;  4RCC A;  4C8Q C;  2R57 A;  9ATC B;  4M75 G;  4PJO E;  3CPF A;  2FO0 A;  4NL3 A;  4JRP A;  3CCS A;  1WHL A;  1MMA A;  3CC7 A;  1VQP T;  4PL6 A;  3CC2 A;  4N4G A;  4E7S A;  3JV3 A;  4JUV A;  1Q86 R;  3QYG B;  1YHQ A;  2GQI A;  3EGD B;  2CH4 A;  4GBQ A;  4GY5 A;  2VXF A;  1BI0 A;  1GRI A;  2AKL A;  4RTV A;  1YIT T;  4L59 A;  4E7H A;  2RM4 A;  3RMS A;  3VUZ A;  3CCE T;  1V1C A;  1YI2 T;  2LRQ A;  3OYY A;  3EGD A;  4JRQ A;  5FU7 B;  2X3W D;  4M77 E;  1U8R A;  1S72 A;  4FT2 A;  3L1A A;  2HSE B;  4OGC A;  2XD0 A;  1JXO A;  1OOT A;  3SB2 A;  2QQB A;  3SFM A;  4DBR A;  4M77 G;  1JU5 C;  1OZ3 A;  3FJP A;  1H64 1;  4OP0 A;  3HKS A;  1WXU A;  3RKY A;  1VQ8 Q;  1NE8 A;  4Z02 A;  4BE2 A;  2RQW A;  5GAM d;  2DM1 A;  2EQU A;  1QVG A;  4C5H A;  1VQM T;  3L2U A;  1K1Z A;  2E12 A;  1HXD A;  4KRT A;  2EAY A;  3KUF A;  3VS0 A;  1JJ2 P;  1QW1 A;  2V8K A;  4MML A;  1HSQ A;  1M9S A;  4PJO D;  2CSI A;  2DBM A;  4L6V 5;  5I2M A;  2H8H A;  3CCM A;  1YCS B;  4BD3 A;  2EQI A;  4DOV A;  3CCL T;  4M4Z A;  4VUB A;  2GFU A;  1UG1 A;  3C4S A;  5CKF A;  2OTL A;  4F7U G;  2CZ6 B;  3TEE A;  1K8A C;  4DBF A;  3JCM c;  3TSW A;  2HQH A;  3THK A;  3LGF A;  3QXE B;  4JPB W;  1ZA1 B;  3JCM Q;  2DE0 X;  3I35 A;  1ZHI A;  2C0O A;  2QTX A;  4C8Q E;  1YJ9 T;  2FZG B;  1M3B A;  4JS5 A;  3OYI A;  5I21 A;  1XTD A;  1W2B A;  2RJC A;  2LP5 A;  1IRX A;  2X4W A;  2MI6 A;  3H41 A;  3G6E T;  3GLX A;  1GBR A;  4HVV A;  3G4S T;  1PD0 A;  1YCY A;  2DBK A;  4B9X A;  1UHC A;  2FPD A;  2NLU A;  4AFZ C;  2ZPB B;  1OU9 A;  3PMT A;  1D0Z A;  3DLL A;  5IXF A;  1UGV A;  3UA7 A;  1VYV A;  2EKH A;  5CR2 A;  1NM7 A;  1OX8 A;  1NPR A;  1PKT A;  1V76 A;  2CYZ B;  2L0A A;  2DJQ A;  3IQL A;  2DZ9 A;  3QJY A;  4MDX A;  3G71 A;  3CCQ A;  2QG9 B;  2RB6 A;  1Q86 C;  1I5L A;  4RTU A;  2KE9 A;  2HDA A;  2SEM A;  2FG0 A;  1RAC B;  5HKC A;  4PLI A;  3CCU Q;  2PU9 B;  1VOM A;  4RCB A;  4DQ2 A;  1KFZ A;  2EYW A;  1JBM A;  3HFN A;  3OYG A;  1VQO A;  3QJ6 A;  1JXM A;  3L2V A;  3CME Q;  5GMK m;  1BCM A;  3PIO A;  2QGG A;  4C92 C;  2VB6 A;  1M3C A;  5C0M A;  2LT4 A;  4LE9 A;  5GAN 6;  4F7U A; 
#chains in the Genus database with same CATH homology
 2QXF A;  3UWN A;  2GFA A;  4M78 F;  3CCV A;  3M4G A;  3CCS T;  3HFO A;  4OVA A;  2XDP A;  5KCO A;  2WSE E;  1M90 C;  4IUR A;  2XDD A;  3AHU A;  3GF5 A;  3JCM f;  3JAM E;  4ZN1 A;  1XOV A;  5CIU A;  3CD6 T;  2DD5 A;  3E19 A;  2K2V A;  3QG1 A;  4KT0 E;  4QW2 A;  5CKB A;  3TU4 K;  2EIF A;  3A8H B;  5GAN 4;  5GAO l;  4F7U B;  3QKJ A;  3VJP A;  5DM7 R;  1GXI E;  3OSV A;  4XTX A;  4UC4 A;  4C5E A;  2XK0 A;  4EMK C;  4KUD K;  4JLG A;  3E9F A;  4YTL A;  3NTH A;  4QQG A;  5GMK j;  1BKB A;  1N6A A;  3JCM g;  2E6N A;  2LT1 A;  4IUU A;  3V7C A;  2RJF A;  1WJR A;  5CQX A;  4M7A C;  4OB2 B;  2M16 A;  2ZPE B;  1VIF A;  3ER0 A;  3MCA B;  5LJ3 h;  1M90 U;  3DB3 A;  4HA8 A;  4ELZ C;  4QVZ A;  3M59 A;  5CVI A;  5LJ5 e;  1G3S A;  3L2Q A;  2GCX A;  4NS5 A;  2R58 A;  4FL6 A;  5GAO q;  5GAM f;  4R55 A;  2VV5 A;  1W4S A;  1I8F A;  2PVG B;  3VUB A;  1UGS B;  5GAO p;  2D6F A;  4M7A D;  2K4Y A;  4JRI A;  2FYK A;  1U1S A;  2M1H A;  2VUB A;  4IUT A;  3JB9 G;  2RI3 A;  4E47 A;  4M7D A;  3T9N A;  1D3B B;  2MMP A;  3M55 A;  2DTO A;  4OB3 B;  4JJN K;  4JS4 A;  3QII A;  5GAO n;  5LL6 S;  4XTZ A;  3I55 T;  3CC2 T;  2M9U A;  4M7A F;  3CEY A;  3CCJ A;  2CZ7 B;  2KDS A;  1BI2 A;  4M7D C;  1LOJ A;  3SD4 A;  2QQA A;  2HBP A;  4FSX A;  5DY9 A;  3M58 A;  5D6X A;  3JCM V;  3CMA T;  2XHC A;  4FM4 B;  1VQN A;  3VU3 C;  3PTA A;  2F69 A;  4C8Q F;  1VQ6 A;  3MP1 A;  4C5I A;  5GAM e;  3OYM A;  2O4X A;  2E64 A;  5CQY A;  2P4T A;  2IG0 A;  4N0A C;  4LDX A;  4A4G A;  1N9R A;  1R8O B;  2C06 A;  2ZGW A;  4NL2 A;  3LH0 A;  1D3B A;  4XK8 E;  2WSC E;  2DXB A;  4V2S A;  2CZ1 B;  4E7K A;  3ZFJ A;  2KY9 A;  2EKO A;  2LNV A;  3FIF A;  1WPY A;  2XG8 D;  3MEA A;  3HRU A;  3OB9 A;  5FRN A;  5GAN 2;  2DPP B;  4FU6 A;  3OS5 A;  3L2W A;  2DEQ A;  3RES A;  1K8A U;  3OBW A;  3OS1 A;  4HCB A;  3HSB A;  2RK1 A;  4QVD A;  4A54 A;  4BE1 A;  4BE0 A;  5GAN g;  2HQX A;  2L8D A;  3L2Z A;  4M77 F;  2EQM A;  2R5A A;  4IUP A;  2RHY A;  4J7I A;  3LYI A;  4M78 D;  2WSF E;  1DJ7 B;  1RL2 A;  3OYK A;  4M75 F;  4OB1 B;  3I56 T;  2PUO B;  4IKF A;  5KCH A;  5GAN 5;  4GLK A;  2XIC A;  3JB9 H;  3X25 B;  4OF1 A;  3MEW A;  2CS7 A;  2VGN A;  4M77 D;  4P5N A;  3JCM h;  4C92 G;  1B34 A;  4F7U E;  4ZTJ A;  5KE3 A;  2CKK A;  3L2R A;  2E6Z A;  3CC4 T;  2LTO A;  4PNO A;  1Y96 B;  1VQ6 T;  1VQN T;  3PMI A;  4R56 A;  1QVG S;  4XTW A;  2CZ0 B;  2LCC A;  3OMC A;  5LJ3 g;  5M9O A;  3L42 A;  2K5F A;  2RI2 A;  3OSS C;  2RHI A;  3PFS A;  2P0K A;  2FHD A;  4X9D A;  3OA6 A;  2XKO C;  5CKD A;  4ZGD B;  4II1 A;  4M77 C;  3JSC A;  5D6W A;  2VGM A;  1BI3 A;  5GAN j;  1H3Z A;  2Y4Y A;  5GAM g;  3SWN C;  3S3O A;  2K5I A;  4CRI A;  1B34 B;  2VXE A;  2JNG A;  4C0G A;  2QEX T;  3ASK A;  1X6O A;  4X34 A;  4ZGJ B;  1Y96 A;  1U1T A;  1VQ4 A;  1Y71 A;  3C12 A;  3SDZ A;  3OYA A;  1PSF A;  2HQE A;  2E5Q A;  4E7L A;  1ZQ1 A;  3N5B B;  1EIF A;  5GAO m;  3FC3 A;  3RUX A;  4C8Q B;  5DLO A;  1Y7X A;  4FIB A;  4Y91 A;  2FVU A;  1KC8 U;  3VKI A;  2DAQ A;  5A0D A;  3HPW A;  2DD4 A;  2QI2 A;  1S72 T;  1QP3 A;  1VQ7 T;  2XID A;  5FU6 B;  1VQL T;  4RKU E;  3A8L B;  5CCA A;  2ZZD A;  2YLC A;  4LDU A;  2JUF A;  5FRM A;  5FU6 C;  2K5L A;  1IRE B;  3BFM A;  4J6W A;  3GIB A;  1BYM A;  3G71 T;  2CGH A;  1O75 A;  3M56 A;  5LJ3 e;  4QQD A;  4E7I A;  3V8J A;  5D6Y A;  2ZPG B;  3GNG A;  1KQ2 A;  3CC4 A;  4BDY A;  4ZGE B;  3JCM X;  5A0G A;  3J81 E;  2RH2 A;  1WNL A;  1ZBX A;  1YBY A;  4HCZ A;  4ME7 A;  2MF2 A;  5GMK l;  3I56 A;  4XTU A;  2GF7 A;  3EAE A;  4C5G A;  4MZT A;  3S3N A;  3V8L A;  1M1G A;  4FT4 A;  3TRE A;  5GAN e;  2O01 E;  3A8M B;  3E9G A;  4N4H A;  2ZCF B;  1YIJ A;  2EQK A;  4DOW A;  2BIV A;  1QVP A;  1FX7 A;  3QUI A;  4KUL A;  2JZ2 A;  3V7S A;  2F5K A;  4BY6 C;  5LJ5 d;  3JCM b;  5GAN d;  4XU0 A;  2OTJ T;  3RKW A;  4J6Y A;  4EMH A;  2FB7 A;  1YJN A;  2E1H A;  1K9M U;  2MWO A;  4L5G A;  4QVC A;  2JVV A;  4N0A A;  4N4I A;  3VYG A;  3MO8 A;  3CCJ T;  1FXX A;  2LVM A;  3Q1J A;  3KBG A;  3CCL A;  4M7D D;  3JB9 F;  1LNX A;  1M5Q 1;  2RJE A;  3RMQ A;  4BI3 A;  3LGL A;  1VIE A;  1VQK T;  3OW2 A;  2EFI A;  3EFR A;  3MP6 A;  1K9M C;  3P8B B;  3OYH A;  3HHT B;  4XU1 A;  4RG8 A;  4KUI A;  1VQ5 A;  4MZP A;  3QDR B;  1XNI A;  1OYX A;  2LQ8 A;  3QZ5 B;  5GMK e;  3JB9 D;  1VQM A;  5HY6 A;  3QPH A;  4F7U F;  4Y28 E;  1N8R U;  4M75 D;  3CCU T;  4OGE A;  1HK9 A;  4M78 A;  3RKX A;  2LQK A;  2QDY B;  3CBM A;  3OS0 A;  4C92 B;  3BY7 A;  1QVF S;  1MHN A;  3M5A A;  5GMK h;  2EQJ A;  1G3Y A;  4BI8 B;  1YJ9 A;  1NJI U;  1I81 A;  3JCM W;  1VQ9 A;  3QHS A;  3CCR T;  2QQR A;  3DLM A;  2XDB A;  4WF2 A;  2G3R A;  3INZ A;  4M77 B;  1KQS A;  1TH7 A;  3S6W A;  1I4K 1;  1SSF A;  2P0P A;  4JLI A;  1KD1 U;  2DIQ A;  4XAX B;  3SWN B;  2RHZ A;  4ZTF A;  3DKM A;  3CXC A;  2K3Y A;  2E70 A;  3OQ5 A;  1YJW T;  4J8O A;  3OMG A;  3NFC A;  3X28 B;  1WJS A;  3P8H A;  3GP8 A;  4C92 A;  4RMO A;  1YI2 A;  4MDW A;  3PGG A;  3OS2 A;  2RO0 A;  4M7D G;  2EJF A;  5LJ5 g;  3LLR A;  2ZPI B;  4D6W A;  2O4X B;  5GAN 7;  2F5T X;  4PJO A;  2WAC A;  4J7F A;  4B9W A;  2DZC A;  3JCM P;  5CKH A;  4Q5W A;  2FL7 A;  5GAN h;  1Q81 U;  3CBO A;  5GAN 8;  4BI4 A;  3SWN A;  5IAY A;  4C0F A;  3ZBD A;  1O9S A;  2B8A A;  2ZPF B;  3OBY A;  4EMG A;  1YIJ T;  1WQW A;  1X01 A;  3A8O B;  1N9S A;  2L5Q A;  4HT9 A;  2PVD B;  4OMF B;  4X9C A;  3EFS A;  3M57 A;  5EG2 A;  2RJD A;  4C0D C;  3QYH B;  4PJO B;  4O5V A;  2KSS A;  3V7R A;  4M7D F;  4MMK A;  2QA4 T;  3HP9 A;  4LDW A;  3LWI A;  2MWP A;  5DLQ E;  3FRN A;  5A0L A;  4M7A A;  2QEX A;  3M4Y A;  5IN1 A;  5A2Q E;  4RCC A;  4C8Q C;  2R57 A;  5L8R E;  4M75 G;  3WXM B;  4PJO E;  4RG2 A;  3JB9 I;  1KC8 C;  2K3X A;  3CPF A;  2PVO B;  2Y90 A;  4LD9 K;  4NL3 A;  4JDS A;  3CCS A;  4JRP A;  3NTI A;  4M78 G;  1NJI C;  5LJ3 f;  3CC7 A;  1VQP T;  4PL6 A;  3CC2 A;  4N4G A;  1K73 C;  2RA2 A;  2PQW A;  4JUV A;  1Y07 A;  2RD1 A;  3QYG B;  1KD1 C;  1M4Z A;  2KVQ G;  5J39 A;  3G4S A;  1YHQ A;  2RI5 A;  5C6S A;  3P8D A;  3H6Z A;  2E10 A;  4GY5 A;  4C8Q G;  2QA4 A;  3JCM J;  3RER A;  4M7D E;  2VXF A;  1BI0 A;  2RHU A;  1LJO A;  2D9T A;  1NPP A;  4A4F A;  1VUB A;  1YIT T;  1VQO T;  1Q82 C;  3TCJ A;  4L59 A;  5LJ3 d;  1JB0 E;  1M1F A;  3CCU A;  4E7H A;  4LDY A;  1W2B S;  2RM4 A;  3RMS A;  1G5V A;  2DK3 A;  3VUZ A;  2Y4X A;  4XTV A;  5CK9 A;  3CCE T;  2RK2 A;  3X24 B;  3CCE A;  1VQP A;  2EWN A;  1X75 C;  3A8G B;  1FWZ A;  1YI2 T;  1OI1 A;  2LRQ A;  3OYY A;  4A4K A;  2I2L A;  4A4H A;  3M9Q A;  4JRQ A;  2EJG A;  5FU7 B;  4M77 E;  5KE2 A;  3CME A;  1U8R A;  1S72 A;  1VQ7 A;  4FT2 A;  3CME T;  3L1A A;  3GPL A;  1XQH A;  4OGC A;  4ELY C;  2XD0 A;  1JRI A;  1WQ7 A;  2OAU A;  1N8R C;  4BUG A;  3SB2 A;  5GAO r;  3M54 A;  2QQB A;  3CCQ T;  3VV0 A;  5AYF A;  3SFM A;  2X35 A;  2DJZ A;  3OYL A;  2IVW A;  2OTJ A;  2KAF A;  3OYE A;  5CAI A;  4M77 G;  2V8J A;  1OZ3 A;  3FJP A;  2VC8 A;  1H64 1;  3MET A;  1AHJ B;  3HRT A;  4OP0 A;  1Q7Y C;  3CC7 T;  2E41 A;  2KMT A;  3LWH A;  3CCR A;  1G3T A;  3QZ9 B;  3WVD B;  1UGQ B;  3HKS A;  3KXT A;  3S3M A;  3RKY A;  4OB0 B;  1NE8 A;  1VQK A;  4Z02 A;  4BE2 A;  4M7A G;  3QO3 A;  2DO3 A;  4MZM A;  1KHI A;  5GAM d;  2ZPH B;  4M7D B;  2EQU A;  1VQL A;  4A53 A;  1QVG A;  3BDL A;  3F70 A;  4C5H A;  1VQM T;  3L2U A;  4C92 D;  1Q7Y U;  2E12 A;  2L89 A;  1HXD A;  4KBM B;  2EAY A;  3KUF A;  1QW1 A;  2V8K A;  4MML A;  4M7A E;  1M9S A;  4PJO D;  3HRS A;  2L3R A;  3MEV A;  3CCM T;  2V8I A;  4L6V 5;  3CCM A;  1KQ1 A;  5I2M A;  1Q81 C;  1M8V A;  3LW5 E;  4BD3 A;  3RIR A;  4DOV A;  5KH6 A;  3CCL T;  3JCM e;  4TVR A;  4C8Q A;  1MGQ A;  3R6O A;  1JJ2 A;  4C0D B;  4HCC A;  3QSU A;  4VUB A;  1KG1 A;  2H3J A;  5HK3 A;  2GFU A;  3J80 E;  1YIT A;  4PJO G;  4ZN3 A;  2DXC A;  2DTH A;  2LX9 A;  3FDR A;  4QQ6 A;  4E7J A;  3HL8 A;  1UEB A;  2A7Y A;  2LC4 A;  3GNF B;  2RHX A;  3C4S A;  5CKF A;  1WGS A;  2OTL A;  4F7U G;  4M75 C;  2X4X A;  5CO7 A;  2CZ6 B;  3GOX A;  3BW1 A;  2DIG A;  3TEE A;  4M75 B;  1K8A C;  2KK4 A;  3LX7 A;  3CD6 A;  3JCM c;  3UT1 A;  1IZ6 A;  4M78 B;  4A4E A;  3UDC A;  5LJ5 h;  2GQV A;  2X4J A;  1VQ8 A;  3LGF A;  3ME9 A;  2JTM A;  3QXE B;  3OYC A;  3JCM Q;  3CCV T;  2JOY A;  5J3B A;  4CI0 C;  3FEO A;  3V8K A;  3CMA A;  1ZHI A;  2JN0 A;  3MHX A;  5LJ5 f;  4M77 A;  2QTX A;  5GAN f;  4C8Q E;  4PJO C;  3C95 A;  1YJ9 T;  1YJW A;  3CBP A;  3OYF A;  4M75 A;  2DXT A;  2EYQ A;  5LJ3 j;  5IT9 E;  3JB9 J;  5LJ5 j;  3CXC S;  4JS5 A;  4J6X A;  3PT9 A;  1BI1 A;  3MEU A;  5GAM h;  3OYI A;  3OYJ A;  5I21 A;  3WVE B;  3X26 B;  4BY6 B;  4M78 E;  4J5Y A;  1XTD A;  2X4Y A;  3PNW C;  2BUD A;  4DA4 A;  1W2B A;  2RJC A;  1M1K C;  1BIB A;  1K73 U;  4M75 E;  4NOY A;  1VQ4 T;  1PSE A;  5J26 A;  3URG A;  1QP2 A;  2X4W A;  4C92 E;  5FLX E;  3MP8 A;  2LCL A;  2DXU A;  2MI6 A;  2HNI A;  3PIP A;  3OYB A;  3G6E T;  3FB9 A;  3GLX A;  4BB7 A;  4C0Z A;  3OYD A;  1JJ2 S;  1N27 A;  4ATO A;  3G4S T;  2YRV A;  1NZ9 A;  3J7A F;  1UB4 A;  1YCY A;  4J83 A;  3OYN A;  1G3W A;  4EMK B;  4XU2 A;  5GAM j;  1Q86 U;  5GAN 3;  2EJ9 A;  1OZ2 A;  4B9X A;  1VQ5 T;  1UGR B;  2M0O A;  1P92 A;  3M53 A;  4LDV A;  3NTK A;  2K57 A;  5GMK i;  4XTY A;  2NLU A;  2ZPB B;  4M7A B;  3X20 B;  3PMT A;  2R5M A;  3OW2 S;  3FLG A;  3DLL A;  5FU7 C;  2OTL T;  4BAC A;  3DB4 A;  2LDM A;  5CR2 A;  4C92 F;  2KQW A;  4O6J A;  5HK0 A;  3E1S A;  3BDU A;  4PJO F;  4EMK A;  2XI9 A;  4PLL A;  1NPR A;  2E65 A;  1KHC A;  2AHJ B;  1VQ8 T;  2CYZ B;  4MDX A;  2DZ9 A;  3QJY A;  4JRK A;  5FRO A;  3G71 A;  2D0Q B;  2HAX A;  3CCQ A;  2VYT A;  2RB6 A;  1Q86 C;  1KQS S;  2DKG A;  4XU3 A;  3CPW A;  1BIA A;  4IUV A;  5CKE A;  1I5L A;  4C8Q D;  4HKE A;  1UGP B;  3A5Z B;  1VQ9 T;  2YHT A;  2QQS A;  4XQ3 A;  1V29 B;  2MAM A;  3OY9 A;  4LD6 A;  4EPC A;  3JRZ A;  3O8V A;  5HKC A;  1Q82 U;  4PKC C;  1WJQ A;  3QBY A;  4PLI A;  1YHQ T;  2PUK B;  2PU9 B;  4RCB A;  3VYH B;  4M78 C;  4DQ2 A;  2YLB A;  3G7Z A;  4HT8 A;  2A3L A;  1JBM A;  3HFN A;  3ZEH A;  4BDZ A;  2QQ9 A;  4EDU A;  3OYG A;  2JTF A;  1VQO A;  3G6E A;  2DVE A;  2HD0 A;  3QJ6 A;  3L2V A;  1YJN T;  1RI0 A;  3JCM d;  1M1K U;  3H8Z A;  5GMK m;  3C94 A;  3PIO A;  4C92 C;  3I55 A;  2XU8 A;  3UPU A;  1QVF A;  5C0M A;  2LT4 A;  2BKD N;  5I2S A;  5GAN 6;  2P0Q A;  3CPW S;  4F7U A;  4IUQ A;  2DTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...