2P4TA

Structure of the q67h mutant of r67 dihydrofolate reductase-nadp+ complex reveals a novel cofactor binding mode
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVHIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Q67H mutant of R67 dihydrofolate reductase-NADP+ complex reveals a novel cofactor binding mode.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p4tA00
1VIEA 2VV5A 2GQVA 3T9NA 2P4TA 2RK2A 1VIFA 2OAUA 2RK1A 3UDCA 2RH2A 3SFMA
chains in the Genus database with same CATH superfamily
4RMOA 4AFQC 4J9EA 3ME9A 3G71Q 2HMAA 1WXUA 2PZ1A 4M7AA 3T9NA 5D7UA 3QHSA 3ER0A 1T3SA 2YLBA 4M77C 3H9NA 1JB0E 3PVLA 4WCIA 1PSEA 1Y96A 5CK9A 1NJIU 3OS5A 1TWBA 2OAUA 4M77E 4ESRA 5DLQE 4RTWA 2KRSA 4FYXB 2DIGA 2QQSA 1YITQ 1OPKA 1Q7YU 2DVEA 4F7UF 2KRMA 4PJOD 4ZN1A 4J9CA 2ZPIB 3CCMA 2XDBA 2RMOA 1YJWQ 2F2WA 3G6EQ 4XTWA 1R0BG 3EAEA 5GANe 2L5QA 4KGVB 3CCRQ 1VQ6T 2RO0A 3GLXA 3FC3A 4GBQA 2MI6A 3CCLA 3LH5A 1AT1B 3INZA 1PKTA 2K57A 1RAGB 3A8GB 2EQKA 2EBPA 1TUDA 4C92B 4XU3A 1VQNA 2XKOC 4L59A 3CCQT 2D0NA 4CRIA 3C94A 2X9HA 4MDWA 4C8QA 5GJVB 2M16A 4Z89A 2MPXC 3M55A 2GGRA 4NL2A 1YIJT 3CD6T 3OY9A 2K4YA 1Q86U 3JV3A 1TUGB 3JAME 1KD1C 3HFOA 4J9GA 2B8AA 3SWNA 1H641 4ELYC 4IIMA 1BU1A 1R0CB 2CH4A 3EFSA 3OYBA 3OYHA 1LNXA 4EMKB 4M78E 1NPRA 4HCBA 4PL6A 3CD6Q 2COZA 1M2OA 1WA7A 1VQOQ 2DYBA 1QKWA 2OX7A 1RADB 1UGQB 1VIEA 3OQ5A 2HAXA 2KK4A 1AWWA 3JCMP 3EFRA 3CCEA 4A54A 5KYNA 2OJ2A 4XK8E 2RF0A 4C5HA 1WHLA 4E7SA 3J7AF 1I1JA 2ZAEA 4E2FB 1H8KA 3CCET 3VS6A 1I5LA 3WVEB 1M90U 4PNOA 3JCMV 1NJIC 4KT0E 1T0HA 2QA4T 3V7RA 1RI9A 5CKDA 2V8JA 3GF5A 5GANg 1X2KA 3LWIA 4HVUA 1B34B 3H0IA 5CR2A 1XQHA 4A4GA 1M1KR 4R56A 4YTLA 4XAXB 2DJQA 2DTHA 5LJ3f 2F1LA 3JCMg 5KH6A 2E41A 4ME7A 1UTIA 4OMQA 4ANJA 1YI2Q 2M02A 4FU6A 1VQ4Q 2EWNA 5FRNA 2KEAA 2P4TA 3EGDB 1GCQC 3PMIA 3JCMd 3M56A 2NUZA 2LX9A 1LOJA 5FU6B 1MGQA 1M2VB 1P92A 1QVGS 1YIJA 1LPLA 1BIAA 4JRPA 1M4ZA 5IHIA 3CC7T 2E12A 1C6VX 2DA9A 3VRZA 1WJQA 5KYWB 3JRZA 3UPUA 3M0PA 4PJOF 6AT1B 1GBRA 1VA7A 2C06A 4BUGA 2LQNA 3JB9D 3UATA 2RQTA 1MNDA 4BDYA 2E5KA 3HSBA 3OYNA 3AT1B 5KYUA 2LCSA 2J6FA 2PVOB 1GCPA 2WSEE 4DBQA 1YJNT 1OU9A 4UC4A 3QXEB 3OW2S 4JPBW 4ZGDB 2X4YA 2PUOB 4OMNA 3CC2A 2CUDA 2EQUA 1W2BS 1UHCA 4M77G 2LCCA 3FJPA 5GAMd 4RTVA 4LDUA 3VS4A 2HQXA 4M75F 4DBHA 4RTTA 2IVWA 1U3OA 3I35A 3L2WA 3TVTA 3DB3A 1NLPC 4Y28E 1PRLC 1RAFB 4C92E 2FEIA 4A4HA 1H3HA 1N8RC 1NEBA 2OTLA 2K6DA 2RD1A 1W4SA 2ED1A 2HSPA 2LJ3A 4M75G 1MMAA 2EYWA 2ATCB 1HD3A 4PJOG 3BE3A 3CQTA 2I2LA 5HY6A 1KQ2A 4JLGA 3CEYA 2Z0WA 1QQJA 3I55T 5GAMf 1WX6A 5GMKl 3HTRA 1WJRA 3UA6A 5GMKe 1K9MU 1VQKQ 2O9VA 3FIFA 5CVIA 2CZ1B 3QBYA 1M2VA 2RJCA 4EMKC 2JZ2A 4Q5WA 3CC7A 1S72T 1CKBA 1WHMA 2YT6A 5L23A 1VUBA 1IHWA 1D1BA 1RACB 2EJFA 2JUFA 2QTVA 3EGDA 1X2QA 4J6WA 2QA4A 5LJ5g 4C8QD 4J9IA 4F17A 1WHKA 1ABQA 1VQ6A 3M4GA 2DX1A 3VJPA 2JJ9A 1ZUYA 1AWJA 1JBMA 4M75C 2BUDA 4QQ6A 1OEBA 2VB6A 2OTJA 2R5AA 2JMCA 1AHJB 3ULRB 2CP6A 2K7AA 4C8QG 4C92C 2HBWA 2RNAA 2JN0A 3OSVA 1KQSA 3QPHA 4DOVA 1TXQA 2E10A 2DAQA 2YRCA 4J9DA 2DE0X 1KFZA 1K8AC 4Y92A 2EQIA 2KI7A 2HQEA 2A08A 1RLQC 3NHNA 2VGNA 2E5QA 1E7OA 2KNBB 5M9OA 1VQ4T 1RLPC 1ZA1B 3MP8A 5GAMe 2FZKB 4OB3B 4JJNK 2E6NA 1Z9QA 1Y57A 3DB4A 3RKYA 4HVWA 1R8OB 1IZ6A 3JCMc 9ATCB 1VOMA 2EW3A 5FW9A 2RQWA 1PD1A 2DYIA 1AZEA 3DLLA 1M5Q1 1FMKA 3CMET 4KH1B 3EHQA 1NLOC 2K5IA 3L2ZA 3UDCA 5D6YA 1OU8A 1VQ5Q 3OBWA 1UGVA 4J5YA 3I56Q 4II1A 2KT1A 4C8QB 3CCSQ 2DLPA 4RTYA 3I5RA 1U06A 4C92A 2QTXA 4D8KA 3RNJA 7AT1B 3OW2A 1JU5C 5GAMj 2FRWA 3JCMX 1D09B 4L6V5 3CCVT 2RQUA 2LDMA 2W10A 3NPFA 2X3WD 3MP1A 2DL4A 2KE9A 4M7AG 2COWA 4FW1A 2BZYA 3KBGA 4M75E 1BCMA 5LJ5f 1QVFA 3MPUB 2L3RA 1FWZA 4KH0B 1HK9A 2P0PA 3TREA 4FSXA 2HZYA 1QMCA 5LJ5e 4QQGA 4IKFA 2EAYA 2KXDA 2RB6A 4FSSA 4JZ3A 1BKBA 4KUIA 4E7IA 2RHIA 5GAN7 1G2BA 4LDVA 1GL5A 1NBEB 1K8AU 3ZEHA 2V8IA 4HT8A 3OYFA 4M7DG 2RH2A 1Q86R 1VQ9Q 3RMSA 3M0RA 3PFSA 2FPEA 2L89A 2YLCA 1IO6A 2CZ7B 1KQSP 4EDUA 2DFUA 2LJ0A 5C0MA 1WIEA 2QK0A 2OAWA 3EGXA 3AHUA 3OYJA 1VYVA 2KRNA 3CMAA 1YBYA 2NYSA 2RQVA 4RKUE 1YCSB 2CSIA 1BI0A 2HSEB 2LCLA 2CP2A 4IUVA 2VXFA 5EC7A 1JJ2S 4GY5A 3C95A 4X9CA 1TU0B 1D0ZA 4TVRA 1WQ7A 3QO3A 4BE2A 1O9SA 1SPKA 4J83A 4O5VA 4E7HA 4EMGA 2XI9A 2O01E 3CC4T 1VQ7Q 4L5GA 2BE7D 4LD9K 5GANf 5LL6S 1YJWA 2XG8D 1UE9A 2EVRA 3META 4V2SA 5KCHA 2XHCA 2QQRA 5LJ3g 2VXEA 2NUTA 2H3EB 1KSWA 1X6BA 4PK4A 2D6FA 4OB1B 2RK2A 1C0MA 1E6GA 4Z02A 2JTEA 3CCMT 3V8JA 4C0DC 2GFAA 4E6RA 2FB7A 1I4K1 2HQHA 5GMKm 2CREA 4ZN3A 3EG2A 3HHTB 4FT2A 1RL2A 5D6WA 1LCKA 1U5SA 2YRDA 3FEOA 1WLPB 2EJ9A 2JW4A 2HEQA 2K2MA 1VQ7T 3MKDA 3CXCS 2DIQA 3ZFJA 1AWXA 2IIMA 2AZSA 3DKMA 1WHJA 1M8VA 1PHTA 3A5ZB 3CXCA 3V8LA 4C92G 3I55Q 4ZTJA 4QW2A 2QGFB 2CT4A 1MNEA 2E65A 3M0SA 4JRQA 3NFCA 1I5OB 4QKUA 3H0HA 1PNJA 3VYHB 2X4JA 4MMLA 3H0FA 3P8DA 5I22A 4M78G 3FJ5A 1QP3A 4DBFA 3EG0A 4HXJA 3DLMA 3CBOA 3JB9H 2X51A 3V7CA 3CCEQ 1G3TA 2FO0A 3VS0A 2DBMA 4OMLA 4CI0C 4BDZA 1VQLQ 4J8OA 3OMCA 2LRQA 4OP0A 3IQLA 1M3AA 1NG2A 2PTKA 3F70A 5J26A 2YRVA 2HCKA 2ZPBB 2Y4YA 3EG9B 3NTHA 1W6XA 4OF1A 1WFWA 3GNFB 3V7SA 2YWWA 3A8HB 2KMTA 1XOVA 1FMWA 1N27A 3LH0A 4RG8A 3RERA 3X25B 4C5GA 1WDXA 5GAMg 2J6KA 2RHUA 3HRSA 3M53A 3VUBA 3G4SQ 3CCQQ 5J3BA 3EH2A 2KR3A 2K5FA 4LDWA 5A2QE 5GANj 2MOXA 3UA7A 1M27C 4VUBA 2FL7A 3CCUQ 1KC8R 1I81A 2X4WA 3L1AA 3OW2P 3VUZA 1ZQ1A 1YIJQ 1GFDA 1T3LA 5GANh 1B3QA 3QWXX 4DOWA 5GAN8 3TSWA 1MMDA 1F1BB 3PGGA 1YJNQ 1W2BP 1YWPA 3CCRT 3OYMA 4PFPA 2DTIA 4M7DA 3SWNC 2DILA 3VS3A 1ZUKA 3MEWA 5EG2A 1PCXA 3SDZA 4LDYA 2WSCE 1LJOA 1RAEB 1OV3A 1KQ1A 4C5EA 2OI3A 3EG9A 2M51A 3LX7A 1U1SA 1KD1U 2IG0A 1Q7YC 1B07A 4WTOB 2ROTA 2PVGB 3S6WA 1WI7A 3CC2Q 3ZBDA 3J81E 2XD0A 2CP0A 1PKSA 4JRKA 3JCMb 1YHQT 1D3BB 2ZCFB 4NL3A 2DKGA 2JMAA 2ZPEB 1OZ2A 4HT9A 5IT9E 2HKNA 3M9QA 2KYBA 3OYEA 3VYGA 4EIKA 1N9RA 4BACA 1Q86C 2L3PA 1JO8A 2JOYA 1WHHA 3M0TA 2J06A 2OTLQ 1KG1A 2DERA 4KGXB 2E70A 4EMHA 1K9MR 3CCJA 1T0JA 3QJ6A 4BY6C 1OX8A 2K79A 4OMFB 3RR6A 1S72Q 2QGGA 3TSZA 3RIRA 3OYLA 2X3XD 3PMTA 4B9WA 1VQKA 2HD0A 3ZL7C 5KYWA 1QKXA 3D7SB 2PNIA 1M1KC 5CKBA 1VQ8Q 2KQWA 2DF6A 2G6FX 5FWCA 2RI3A 4GLKA 1JXMA 3JCMW 2VV5A 4F04B 3QWYA 3JB9G 3GNGA 1G3YA 2MF2A 1TUCA 3QDFA 5FRMA 1O75A 1MMNA 5DM7R 1ZBXA 2JTMA 1SG5A 3CPWS 1Q82C 2R5MA 2GF7A 3G1JA 3QZ5B 4F7UB 2NUTB 4XTZA 1WZOA 3A8MB 2DXCA 2XDPA 4OGCA 5GAN5 1KD1R 2QDYB 5AT1B 1RAHB 3L2QA 3KFVA 2VYTA 1B34A 3C12A 3SB2A 2GNCA 1NEGA 3CCLT 5CKEA 3HKSA 2O88A 3MP6A 2DRMA 1FXXA 1SHGA 4QVZA 1C1AA 1D1CA 3CXCP 3J80E 4XTVA 5GANd 4ZGJB 1SRLA 4ZGEB 4MZMA 2H3JA 3HL8A 3JSCA 1WNLA 4FYYB 2FYKA 1IREB 4J7IA 2EKOA 2HNIA 3CCMQ 1VQNT 3VS7A 3S3OA 1QVFS 2EIFA 3JCMQ 4M75B 3U23A 1RUWA 1KC8U 3M58A 2MK5A 2LTOA 5KE3A 1YWOA 1WXBA 2A28A 2GCXA 1K9MC 4QT7A 4FW2A 4ELZC 3WXMB 1WGSA 2HL5C 2RM4A 1VQNQ 4MDXA 3SWNB 1Q81U 3CCUT 1JQQA 5GAN2 4XU1A 2RI5A 5CQXA 3CPWA 1X69A 1VQMQ 2HKQB 3I56A 2CKKA 4FL6A 1QVGA 3CCSA 1JJ2P 2DTOA 4OB2B 2ENMA 3CCVQ 1D0XA 1PG5B 3PIOA 4DEXA 2ZPGB 2M9UA 2MAMA 1ARKA 2MYSA 2MWOA 4LXCA 1UG1A 1Q95G 2A36A 2BZ8A 2YHTA 3P8BB 4M7DF 3JCMJ 2CP5A 3CPWP 4IUPA 1ACMB 4AG2C 4DQ2A 4J7FA 1G8XA 2XDDA 2DD4A 4XTUA 2NLUA 1UUEA 2FPDA 4A53A 3THKA 1D1AA 1JRIA 1KK7A 3G71A 4C0GA 1VQOA 1JJ2A 2O2OA 4MMKA 2FG0A 1J3TA 3MJXA 2QDLA 4Z8AA 5CKHA 3EH1A 4X1VA 2MWPA 4KBMB 4OVAA 1Y0MA 2M0OA 2MIOA 4HCKA 1YN8A 4D6WA 2JNGA 3CCJT 4B9XA 4J9HA 2V26A 1YITA 3OYDA 1VQPT 5KYXB 1VQLT 3G6ET 1G3SA 2K3BA 4AFSC 1KC8C 3TEEA 2F5TX 1QVGP 1X43A 4HCZA 5LJ3h 3UT1A 1Y96B 3NMZC 1OOTA 2Y4XA 5CQYA 3G4ST 3WVDB 5CCAA 4LDXA 2BIVA 4M7AB 1UEBA 5LJ3j 1X27A 3M5AA 2GQIA 3OS2A 3A1PA 3CMAQ 2KYMA 2DNUA 1RABB 1YJ9A 1YI2A 2QG9B 2DXBA 2D8JA 5FWBA 1ZLMA 5CO7A 2A0FB 2D0QB 5GAN3 5GMKh 1BCOA 1MV0B 1D0YA 2ROLA 4PFOA 4C8QF 1UJYA 4CC7A 3M0UA 3SD4A 3L42A 3JB9I 2AK5A 2DXUA 1SRMA 4HKEA 2JVVA 1UFFA 3CC4A 1VQ7A 2DZ9A 4HVVA 4PLLA 1M90C 1Q81C 5HKCA 2LQWA 4PJOB 3MEUA 1FYNA 3VU3C 1ZBJA 1PM3A 2DJZA 2X35A 2DO3A 1WXTA 3NGPA 5AYFA 1BYMA 2KXCA 4M4ZA 3QYHB 3R6NA 1QVFP 2JM9A 2BZXA 1TH7A 2QEXA 4F7UA 4R55A 1OI1A 1QWEA 4BI3A 2LZ6B 1X6OA 5L8RE 1AZGB 4HA8A 1KHIA 2PVDB 3OYAA 1VQPA 1YITT 1ABOA 2LX7A 1XNIA 1IGUA 4B6MA 2LC4A 4C5IA 3O8VA 5J39A 4RCBA 4QVDA 2SRCA 2KBTA 8AT1B 2JT4A 4BD3A 2BKDN 1M3CA 1M90R 1WYXA 1VIFA 1K8AR 1NM7A 1LVKA 4E7KA 2AZVA 2K2VA 4IUTA 5GMKi 3N5BB 4RCCA 3VS1A 1V1CA 1AEYA 3HRTA 5HCKA 2F5KA 1EFNA 2R57A 3E19A 1U8RA 3GIBA 2KAFA 1SHFA 1MHNA 4XU2A 4IURA 2DL3A 2B86A 1N6AA 1G5VA 1KQSS 1ZSZB 1U1TA 2GQVA 1KIKA 3MHXA 2ZPHB 2ZGWA 1X75C 1VYUA 5I2SA 1I07A 2V1RA 4ZNXA 5KYYB 1TS9A 5KYYA 2EYYA 2K5LA 1VQLA 3A8LB 1VQOT 2LQ8A 1D3BA 4LE9A 4PJOC 3A98A 1M1KU 2CZ0B 2DBKA 1ZSZA 2M1HA 3VV0A 2DXTA 3VRYA 4M77B 2E3HA 5KYUB 4PJMA 4XTYA 3EG3A 2VASA 2BTTA 1B7TA 2D9TA 4M77D 2V1QA 3LGLA 3JCMe 4WF2A 2JS0A 1OZ3A 2PUKB 3LW5E 3CBPA 4OMPA 1VQ5T 2M0YA 2GTOA 1JEGA 2LJ1A 3REAB 1YJ9T 2EGCA 1I0CA 1M1GA 4PJNA 3P8HA 3CMEQ 4C0DB 4MZPA 3CCUA 3PNWC 1HJDA 4A4KA 1UB4A 3V8KA 1BIBA 2ED0A 5GAOl 3HPWA 5HK3A 1UGSB 2GTJA 1PRMC 4KULA 1BK2A 3CMAT 2DL8A 2H8HA 5IN1A 2RJFA 1KJWA 2KT8A 3L2VA 2FPFA 2J7IA 3MO8A 1X01A 4J6YA 5IHKA 2AHJB 4BI8B 1W70A 2O4XB 3UF4A 1YHQQ 4PJOA 1PD0A 1VQMT 4CC2A 3ASKA 2EQJA 2P0QA 1OYXA 5GAOr 4ZTFA 3S3MA 4E47A 3QIIA 2F69A 1GRIA 3QZ9B 2RK1A 3RKWA 2ZZDA 4A4FA 2JS2A 4F16A 3BFMA 3CC7Q 2KY9A 4M7AD 4PJOE 2QEXT 4A63B 2A37A 3JB9J 5IH2A 3TCJA 1SSFA 2JTFA 4OB0B 4ATOA 3TU4K 1XTDA 1SEMA 4LN2A 4XQ3A 1N9SA 4DEYA 5GAMh 1NYGA 5GMKj 3OB9A 1ZHIA 2K9GA 4Y91A 5FU6C 2J05A 4PKCC 1V76A 5ECAA 4EMKA 4O6JA 2SEMA 2ABLA 4XU0A 1S1NA 2CYZB 2JM8A 1Y71A 2EKHA 1WQWA 3CCJQ 1K4US 2DM1A 2D8HA 3RESA 4BB7A 5GAN4 2OTJQ 2AT1B 4JJBA 4Z88A 2GBQA 4PJJA 2HBPA 2CSQA 3QG1A 1NJIR 4FM4B 3H8ZA 3HRUA 2XK0A 4MZTA 4FYWB 2F2XA 5KYXA 3I5SA 3TQ7P 4XTXA 5I21A 4DA4A 2CT3A 2ECZA 3L2RA 3MEVA 1N8RR 2FZCB 2O9SA 1QW1A 4JJDA 3C0CA 3OSSC 1VQKT 1ZX6A 5GAN6 1E6HA 3G6EA 1VQ9A 3QDRB 3CCRA 2C0OA 3M0QA 5IAYA 1QCNA 4BI4A 1GBQA 1ZUUA 2RHZA 2YXYA 3RBBB 4J9FA 2C0TA 3EFOB 4LNPA 1IRXA 2CDTA 3KXTA 3CCLQ 1VQ9T 3X26B 2W0ZA 5CAIA 1M3BA 1MUZA 2EYQA 4FIBA 5IXBA 2Y90A 2QXFA 1K0XA 1SKUB 2QYZA 3CPFA 2JXBA 4IUQA 3JCMh 3GP8A 4N4HA 1EZZB 1HSQA 1HYOA 1EX4A 2CS7A 2C0IA 2QQAA 2DPPB 2EYXA 1TSFA 2EQMA 1N5ZA 3PT9A 1XJWB 1OX9A 3HP9A 1UECA 4AT1B 2YDLA 2LNHB 4JS4A 2L3SA 2VC8A 1OQKA 3A8OB 3E9FA 1UHFA 2NUPB 4BE1A 4M75A 2VVKA 5A0DA 4JS5A 1V29B 2EYZA 1R77A 3FLGA 3CD6A 2F2VA 2G3RA 4KUDK 2EGEA 1RAIB 3VKIA 1BI2A 5FU7C 1TOVA 4AG1C 2CP7A 4LUDA 1M8MA 4RTUA 3NTIA 1VQMA 4K11A 2WSFE 2DRKA 4N0AC 2E3IA 3PE0A 3OS0A 2DETA 4M78D 1PC0A 1QLYA 2L8DA 3GOXA 1ZSZC 1OPLA 3QSUA 4M78B 4M7DC 4M77F 5GAOm 2I0NA 2RHXA 2IPOB 2KVQG 4RG2A 2RPNA 2RJEA 1FMVA 3C4SA 2DL5A 4AFZC 3G71T 3EFOA 4FCYA 1VQ4A 4RTXA 1G83A 3EGUA 3E9GA 3RKXA 4F7UG 2EFIA 4C8QE 3E1SA 3QYGB 3EHRA 2VWFA 1TG0A 1UJ0A 2RI2A 8ATCB 4IUUA 5GJWB 4JUVA 2DD5A 1JXOA 2FZGB 1A0NB 5C6SA 5FU7B 2PU9B 3OBYA 1VYTA 1KHCA 5KE2A 2FRYA 4HCCA 4NOYA 3HFNA 2WACA 4M78F 2RJDA 2R58A 1UGPB 2VGMA 1EIFA 1OULA 4LUEA 4AMCA 4N0AA 4RTZA 1Y7XA 3CBMA 3CC2T 3H41A 1YJ9Q 5LJ5d 3G4SA 3R6OA 4E7LA 1M9SA 3L2UA 2XU8A 5KCOA 2COYA 4OMOA 4PFZA 4KRTA 2A3LA 4M7DD 3OYIA 4ORZA 1UGRB 2DVJA 2QAZA 5DY9A 4C0FA 3OYCA 1W2BA 3S3NA 1NPPA 1VQ8T 1H3ZA 2DZCA 2FHDA 1PWTA 1YJNA 3CC4Q 3QUIA 2CUBA 1IGQA 4AFUC 4FYVB 3CCST 4RUGA 3RDVA 1WHGA 3URGA 5I11A 2LT4A 4PJLA 1DJ7B 3LLRA 1PSFA 3I55A 2KROA 2J6OA 4C92F 5A0GA 2DEQA 2GFUA 2O31A 2RQRA 2OTLT 2E64A 1W1FA 3X20B 1TTHB 5A0LA 2X4XA 1K9AA 4DBRA 2AKKA 2A7YA 4E7JA 2O4XA 3REBB 4M78C 4F7UE 4M7DB 1NYFA 2QEXQ 2QASA 3PVQA 2QI2A 2KDSA 3BW1A 4OGEA 2YUNA 1YJWT 2VKNA 3LYIA 1VQPQ 1I8FA 5IXFA 3RMQA 4C92D 4D8DA 2RN8A 3H6ZA 3FDRA 1ZSGA 3OS1A 2P0KA 2ZPFB 1G3WA 1AWOA 4X34A 4JDSA 1RI0A 2AIRB 3OYKA 1HXDA 2QA4Q 4C0ZA 5LJ5j 1CSKA 3E2UA 4M7AE 2NWMA 1K73C 1M1FA 2VUBA 1VQ6Q 2CZ6B 2LT1A 1AD5A 2YUQA 3OYGA 4X9DA 1QP2A 1N8RU 1SF9A 3LGFA 1Q81R 1X6GA 3FRNA 3UWNA 3CCQA 1S72A 5IHNA 5LJ3d 3OA6A 2XIDA 2LVMA 3G7ZA 3MEAA 1Q82R 1AVZC 1AOJA 5GAOp 1FX7A 4M77A 4FT4A 4M7AF 5LJ3e 1IB8A 4M7DE 3GBQA 4PLIA 4LD6A 1VQ8A 4BE0A 3M57A 2E6ZA 2XICA 2K3XA 5FLXE 5LJ5h 3PIPA 1K76A 1SSHA 2QQ9A 1MV3A 3O5ZA 1H92A 5GAOq 1NZ9A 1IHVA 1GXIE 1CKAA 4KGZB 3X24B 1WJSA 2CP3A 2YUPA 2XMFA 1BI3A 5I2MA 3NTKA 1K73R 4N4GA 3KUFA 2D1XA 2FVUA 3JCMf 3I9QA 5CKFA 3SFMA 4JRIA 3X28B 1YFNA 4J9BA 4EPCA 1BBZA 4N4IA 3VS5A 4IIOA 1QCFA 2RHYA 1IXDA 2LMJA 1GCQA 2CGHA 4QQDA 4F14A 1ZA2B 3CMEA 3VS2A 4JJCA 2V8KA 2K3YA 3EG1A 3MCAB 1VQ5A 2MCNA 1YNZA 4P5NA 3QKJA 2BE9B 3OMGA 2CH4W 2HDAA 2LNVA 1YCYA 2AKLA 1K73U 2DK3A 3FB9A 3M54A 1Y07A 2YUOA 1GFCA 1K1ZA 3M4YA 5CIUA 5FROA 3LWHA 4M7AC 3I56T 2PQWA 1YP5A 2LP5A 2DEUA 1M30A 2EPDA 2DL7A 2ESWA 1WPYA 4QVCA 4NS5A 4JZ4A 4A4EA 4JLIA 1YHQA 3BY7A 1QWFA 4CC4B 1Q82U 4M78A 3JB9F 2HL3A 1MMGA 2MMPA 3PTAA 1BB9A 1UDLA 3BDLA 1Z9ZA 4E7ZA 2E4HA 2LQKA 3SHWA 5D6XA 2L2PA 2EJGA 1BI1A 2KSSA 1NE8A 1RAAB 5DLOA 2L0AA 2P84A 3OYYA 3BDUA 2L3QA 2E1HA 1YI2T 2RA2A 3CCVA 4J6XA 2EGAA 2YSQA 2KGTA 4R0KA 2QQBA 4CC3A 1QVPA 5GAOn 4M75D 4GLMA 3RUXA 1QCOA 3Q1JA 4BY6B 2P4RA 3EGXB 5HK0A 2OTJT 2DMOA 2NUPA 4C8QC 4OMMA 3SEMA 1K0SA 3M59A 3QJYA 1Q7YR 3GPLA
chains in the Genus database with same CATH topology
3KBGA 4RMOA 4M75E 2EYQA 3ME9A 4FIBA 2GCXA 1K9MC 5LJ5f 4M7AA 2Y90A 4ELZC 1QVFA 3WXMB 2QXFA 2L3RA 1FWZA 1HK9A 1WGSA 2P0PA 2RM4A 3TREA 3T9NA 4MDXA 4FSXA 3QHSA 3ER0A 3SWNB 1Q81U 5LJ5e 3CCUT 4QQGA 2YLBA 4M77C 4IKFA 3CPFA 5GAN2 1JB0E 4XU1A 2EAYA 1PSEA 1Y96A 5CK9A 2RB6A 3OS5A 1NJIU 2RI5A 5CQXA 4IUQA 3JCMh 2OAUA 3GP8A 3CPWA 4M77E 1BKBA 4N4HA 5DLQE 4KUIA 4E7IA 2RHIA 2CS7A 5GAN7 3I56A 4LDVA 2CKKA 2DIGA 2QQSA 4FL6A 1QVGA 2QQAA 3CCSA 2DPPB 2DTOA 4OB2B 1Q7YU 1K8AU 3ZEHA 2V8IA 4HT8A 2DVEA 4F7UF 2EQMA 3PIOA 3OYFA 4PJOD 4ZN1A 4M7DG 3PT9A 2RH2A 2ZPGB 2M9UA 2ZPIB 3CCMA 2XDBA 3HP9A 2MAMA 2MWOA 3RMSA 2YHTA 4XTWA 3EAEA 3P8BB 5GANe 2L5QA 4JS4A 1VQ6T 3JCMJ 4M7DF 4IUPA 2VC8A 3PFSA 2L89A 2RO0A 2YLCA 3GLXA 2CZ7B 4DQ2A 3A8OB 3E9FA 3FC3A 4EDUA 4BE1A 4J7FA 2MI6A 4M75A 5A0DA 5C0MA 3CCLA 2XDDA 4JS5A 1V29B 2DD4A 4XTUA 2NLUA 3INZA 3AHUA 2K57A 3OYJA 4A53A 3FLGA 3CMAA 3A8GB 1YBYA 3CD6A 2EQKA 4RKUE 1JRIA 2G3RA 3G71A 4KUDK 4C0GA 1VQOA 1JJ2A 1BI0A 4C92B 4MMKA 4XU3A 3VKIA 2LCLA 1VQNA 1BI2A 4IUVA 2VXFA 5CKHA 2XKOC 4L59A 5FU7C 3CCQT 2MWPA 4KBMB 4CRIA 3C94A 4OVAA 1JJ2S 4MDWA 4GY5A 2M0OA 4C8QA 4D6WA 3C95A 4X9CA 3NTIA 2JNGA 3CCJT 4TVRA 1VQMA 4B9XA 2M16A 1WQ7A 2WSFE 3QO3A 4BE2A 1O9SA 4N0AC 4J83A 4O5VA 1YITA 3OYDA 3M55A 1VQPT 4E7HA 3G6ET 1G3SA 1VQLT 4EMGA 4NL2A 1YIJT 1KC8C 3CD6T 3OS0A 3TEEA 2F5TX 2XI9A 2O01E 3OY9A 4HCZA 4M78D 3CC4T 5LJ3h 4L5GA 2K4YA 2L8DA 1Q86U 3UT1A 5GANf 4LD9K 3GOXA 5LL6S 1YJWA 2XG8D 1Y96B 3JAME 1KD1C 3HFOA 3META 4V2SA 2Y4XA 5CQYA 5KCHA 3G4ST 3QSUA 3WVDB 5CCAA 2B8AA 2XHCA 4LDXA 4M78B 4M7DC 2QQRA 4M77F 3SWNA 5GAOm 2BIVA 5LJ3g 2VXEA 1H641 4ELYC 4M7AB 2D6FA 2RHXA 1UEBA 2KVQG 3EFSA 4OB1B 5LJ3j 3OYBA 4RG2A 1LNXA 4EMKB 4M78E 3OYHA 3M5AA 2RJEA 2RK2A 1NPRA 4HCBA 3C4SA 3OS2A 4Z02A 3CCMT 3V8JA 4C0DC 4PL6A 2GFAA 2FB7A 1I4K1 3G71T 1YJ9A 1YI2A 5GMKm 1VQ4A 4ZN3A 2DXBA 3HHTB 4FT2A 1RL2A 3E9GA 5D6WA 3RKXA 5CO7A 1UGQB 4F7UG 2EFIA 2D0QB 5GAN3 5GMKh 3FEOA 4C8QE 3E1SA 1VIEA 2EJ9A 3OQ5A 3QYGB 3J81E 2HAXA 2KK4A 1VQ7T 4C8QF 3JCMP 2RI2A 3EFRA 3CCEA 4A54A 4IUUA 4JUVA 2DD5A 3SD4A 3CXCS 2DIQA 3ZFJA 3L42A 5C6SA 3JB9I 2PU9B 2DXUA 3OBYA 4XK8E 5FU7B 4C5HA 3J7AF 4HKEA 2JVVA 3DKMA 1KHCA 5KE2A 3CCET 1I5LA 4HCCA 3WVEB 3CC4A 4NOYA 1VQ7A 1M90U 2DZ9A 3HFNA 4PNOA 1M8VA 2WACA 4M78F 2RJDA 3JCMV 3A5ZB 4PLLA 1NJIC 4KT0E 3CXCA 2QA4T 2R58A 3V7RA 3V8LA 5CKDA 1M90C 2V8JA 1Q81C 4C92G 4ZTJA 4M7DE 5HKCA 4PJOB 3GF5A 3MEUA 4QW2A 1UGPB 2VGMA 5GANg 1EIFA 3VU3C 3LWIA 2E65A 1B34B 2DJZA 4N0AA 2X35A 2DO3A 5CR2A 1XQHA 4A4GA 1Y7XA 4R56A 4YTLA 5AYFA 3NFCA 4XAXB 3CBMA 4JRQA 1BYMA 2DTHA 5LJ3f 3QYHB 3CC2T 3JCMg 3VYHB 2E41A 2X4JA 4ME7A 5KH6A 4MMLA 1TH7A 3P8DA 5LJ5d 3G4SA 3R6OA 2QEXA 4F7UA 4FU6A 4E7LA 1M9SA 4M78G 3L2UA 2EWNA 5FRNA 2XU8A 5KCOA 4R55A 2P4TA 3PMIA 1QP3A 1OI1A 3JCMd 4BI3A 3DLMA 3CBOA 3M56A 3JB9H 1X6OA 5L8RE 3V7CA 2A3LA 4HA8A 2LX9A 1KHIA 2PVDB 3OYAA 4M7DD 1VQPA 1LOJA 5FU6B 1MGQA 1G3TA 1P92A 3OYIA 1YITT 1UGRB 1QVGS 1XNIA 1YIJA 2LC4A 4C5IA 5DY9A 4CI0C 1BIAA 3O8VA 4C0FA 3OYCA 4JRPA 4BDZA 5J39A 4J8OA 1W2BA 3OMCA 3S3NA 2LRQA 1M4ZA 1NPPA 4OP0A 4RCBA 1VQ8T 3CC7T 1H3ZA 2DZCA 2E12A 2FHDA 4QVDA 3F70A 1YJNA 5J26A 2YRVA 3QUIA 4BD3A 2ZPBB 2Y4YA 2BKDN 1WJQA 3CCST 3NTHA 3JRZA 3URGA 3UPUA 4PJOF 2LT4A 1VIFA 4OF1A 1DJ7B 3LLRA 1PSFA 4E7KA 3GNFB 3V7SA 3I55A 2K2VA 4IUTA 3A8HB 5GMKi 3N5BB 2KMTA 4C92F 2C06A 4BUGA 4RCCA 2DEQA 2GFUA 5A0GA 1XOVA 3JB9D 3HRTA 1N27A 2F5KA 2E64A 2R57A 3LH0A 4RG8A 4BDYA 3E19A 3X20B 1U8RA 5A0LA 3X25B 3OYNA 3GIBA 4C5GA 3HSBA 2KAFA 2X4XA 2A7YA 1MHNA 5GAMg 4E7JA 2RHUA 3HRSA 2O4XA 2PVOB 2WSEE 3M53A 4IURA 4M78C 4XU2A 4F7UE 1YJNT 4M7DB 1N6AA 3VUBA 1KQSS 1G5VA 4UC4A 1U1TA 2QI2A 3QXEB 2GQVA 2KDSA 5J3BA 3BW1A 4OGEA 2K5FA 4LDWA 3MHXA 4ZGDB 5A2QE 2ZPHB 3OW2S 5GANj 2ZGWA 1X75C 1YJWT 2X4YA 2PUOB 5I2SA 3LYIA 4VUBA 2FL7A 1I81A 3CC2A 2X4WA 3L1AA 3VUZA 1I8FA 2EQUA 1ZQ1A 3RMQA 1W2BS 4M77G 2LCCA 4C92D 2K5LA 1VQLA 3A8LB 3FJPA 3H6ZA 1VQOT 5GAMd 2LQ8A 3FDRA 4LDUA 3OS1A 2P0KA 5GANh 1D3BA 2ZPFB 4PJOC 4DOWA 1G3WA 2HQXA 5GAN8 4X34A 4M75F 4JDSA 3PGGA 1RI0A 1M1KU 2CZ0B 2M1HA 2IVWA 3VV0A 2DXTA 3CCRT 3OYMA 3OYKA 3L2WA 1HXDA 4M77B 3DB3A 2DTIA 4Y28E 4M7DA 4C0ZA 3SWNC 5LJ5j 3MEWA 4XTYA 4C92E 5EG2A 4M7AE 4A4HA 1K73C 2D9TA 1N8RC 1M1FA 2VUBA 4M77D 3SDZA 2CZ6B 4LDYA 2OTLA 2LT1A 3LGLA 3OYGA 4X9DA 1QP2A 3JCMe 2PUKB 2RD1A 1OZ3A 1W4SA 2WSCE 1LJOA 3LW5E 3CBPA 4WF2A 3LGFA 1N8RU 1VQ5T 4M75G 1KQ1A 1YJ9T 4C5EA 3FRNA 4PJOG 3UWNA 1KQ2A 2I2LA 5HY6A 4JLGA 3CEYA 3CCQA 1S72A 3I55T 4M7AG 5GAMf 5GMKl 5LJ3d 3LX7A 3OA6A 1WJRA 5GMKe 2XIDA 2LVMA 1M1GA 1U1SA 3G7ZA 3MEAA 3P8HA 1KD1U 1K9MU 2IG0A 1Q7YC 3FIFA 5GAOp 1FX7A 4M77A 5CVIA 4C0DB 4FT4A 4MZPA 2CZ1B 2PVGB 3QBYA 3S6WA 5LJ3e 3CCUA 3PNWC 4M7AF 3ZBDA 4A4KA 1UB4A 2RJCA 2JZ2A 4PLIA 4EMKC 4Q5WA 4LD6A 1BIBA 3V8KA 3CC7A 4BE0A 4JRKA 1S72T 3JCMb 1YHQT 1VQ8A 5GAOl 3M57A 1D3BB 2ZCFB 4NL3A 2DKGA 2E6ZA 2ZPEB 1VUBA 2K3XA 2XICA 3HPWA 1OZ2A 5FLXE 1UGSB 5HK3A 2EJFA 5LJ5h 3PIPA 4HT9A 2JUFA 2QQ9A 4KULA 3CMAT 5GAOq 5IN1A 1NZ9A 2RJFA 4J6WA 5IT9E 1GXIE 3M9QA 3X24B 1WJSA 3OYEA 3VYGA 2QA4A 1BI3A 1N9RA 5LJ5g 5I2MA 3NTKA 4BACA 4N4GA 4C8QD 1Q86C 3KUFA 3L2VA 2FVUA 3MO8A 1X01A 3JCMf 4J6YA 5CKFA 3SFMA 2JOYA 3M4GA 4JRIA 3VJPA 2AHJB 4BI8B 1VQ6A 3X28B 1KG1A 4EPCA 2O4XB 1JBMA 4N4IA 4M75C 4PJOA 2E70A 4EMHA 3CCJA 3RERA 1VQMT 2BUDA 3QJ6A 4QQ6A 4BY6C 3ASKA 2EQJA 2RHYA 2P0QA 1OYXA 2R5AA 5GAOr 2OTJA 1AHJB 4ZTFA 3S3MA 4OMFB 4E47A 2CGHA 3QIIA 4QQDA 2F69A 3RIRA 4C8QG 3QZ9B 4C92C 2RK1A 3OYLA 3PMTA 3RKWA 2ZZDA 2JN0A 3OSVA 4B9WA 1VQKA 3CMEA 2HD0A 3QPHA 4A4FA 1KQSA 4DOVA 2V8KA 2E10A 2DAQA 2K3YA 2XD0A 3MCAB 1M1KC 1VQ5A 3BFMA 5CKBA 4P5NA 3QKJA 2KY9A 2KQWA 4M7AD 3OMGA 2LNVA 1K8AC 1YCYA 4PJOE 2QEXT 2RI3A 3JB9J 4GLKA 3TCJA 1SSFA 3JCMW 2DK3A 2VV5A 1K73U 2JTFA 3FB9A 3M54A 3GNGA 1Y07A 3JB9G 1G3YA 4OB0B 4ATOA 2MF2A 3M4YA 2HQEA 5CIUA 5FROA 3TU4K 1XTDA 2VGNA 2E5QA 4XQ3A 5FRMA 1N9SA 1O75A 5GAMh 5DM7R 3LWHA 5M9OA 4M7AC 3I56T 1ZBXA 2PQWA 1VQ4T 5GMKj 2JTMA 3OB9A 1ZHIA 3CPWS 3MP8A 2R5MA 2GF7A 5GAMe 1Q82C 4Y91A 5FU6C 4EMKA 4OB3B 4PKCC 3QZ5B 4O6JA 4F7UB 1WPYA 4QVCA 4NS5A 4A4EA 4JJNK 4JLIA 2CYZB 2E6NA 4XU0A 3BY7A 4XTZA 1YHQA 1Y71A 3A8MB 2DXCA 2XDPA 1WQWA 4OGCA 4M78A 5GAN5 1Q82U 3JB9F 2QDYB 2MMPA 3DB4A 3RKYA 3RESA 3PTAA 4BB7A 5GAN4 1R8OB 1IZ6A 3L2QA 2VYTA 1B34A 3BDLA 3JCMc 3C12A 3SB2A 2LQKA 2HBPA 3QG1A 5D6XA 3CCLT 2EJGA 1BI1A 2KSSA 3H8ZA 3HKSA 3HRUA 1NE8A 3MP6A 4FM4B 2XK0A 5CKEA 4MZTA 3DLLA 1FXXA 1M5Q1 5DLOA 3CMET 4QVZA 2K5IA 3L2ZA 4XTXA 3UDCA 5D6YA 5I21A 4DA4A 3OYYA 2OTLT 3BDUA 3OBWA 2E1HA 4J5YA 4II1A 3J80E 4C8QB 4XTVA 5GANd 1YI2T 4ZGJB 2RA2A 4ZGEB 3MEVA 4MZMA 3L2RA 3CCVA 2H3JA 3HL8A 3JSCA 1WNLA 4J6XA 2FYKA 1IREB 1QW1A 4J7IA 3OSSC 2EKOA 2HNIA 2QQBA 4C92A 2QTXA 1VQKT 1QVPA 1VQNT 5GAN6 5GAOn 3OW2A 4M75D 3G6EA 1VQ9A 3RUXA 5GAMj 3S3OA 3QDRB 3CCRA 1QVFS 2EIFA 3Q1JA 5IAYA 4BY6B 3JCMX 4L6V5 4BI4A 5HK0A 3JCMQ 3CCVT 2RHZA 2OTJT 2LDMA 4M75B 4C8QC 1KC8U 3M58A 3KXTA 1VQ9T 3X26B 3MP1A 2LTOA 5CAIA 3M59A 3QJYA 5KE3A 3GPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIE A;  2VV5 A;  2GQV A;  3T9N A;  2P4T A;  2RK2 A;  1VIF A;  2OAU A;  2RK1 A;  3UDC A;  2RH2 A;  3SFM A; 
#chains in the Genus database with same CATH topology
 4RMO A;  4AFQ C;  4J9E A;  3ME9 A;  3G71 Q;  2HMA A;  1WXU A;  2PZ1 A;  4M7A A;  3T9N A;  5D7U A;  3QHS A;  3ER0 A;  1T3S A;  2YLB A;  4M77 C;  3H9N A;  1JB0 E;  3PVL A;  4WCI A;  1PSE A;  1Y96 A;  5CK9 A;  1NJI U;  3OS5 A;  1TWB A;  2OAU A;  4M77 E;  4ESR A;  5DLQ E;  4RTW A;  2KRS A;  4FYX B;  2DIG A;  2QQS A;  1YIT Q;  1OPK A;  1Q7Y U;  2DVE A;  4F7U F;  2KRM A;  4PJO D;  4ZN1 A;  4J9C A;  2ZPI B;  3CCM A;  2XDB A;  2RMO A;  1YJW Q;  2F2W A;  3G6E Q;  4XTW A;  1R0B G;  3EAE A;  5GAN e;  2L5Q A;  4KGV B;  3CCR Q;  1VQ6 T;  2RO0 A;  3GLX A;  3FC3 A;  4GBQ A;  2MI6 A;  3CCL A;  3LH5 A;  1AT1 B;  3INZ A;  1PKT A;  2K57 A;  1RAG B;  3A8G B;  2EQK A;  2EBP A;  1TUD A;  4C92 B;  4XU3 A;  1VQN A;  2XKO C;  4L59 A;  3CCQ T;  2D0N A;  4CRI A;  3C94 A;  2X9H A;  4MDW A;  4C8Q A;  5GJV B;  2M16 A;  4Z89 A;  2MPX C;  3M55 A;  2GGR A;  4NL2 A;  1YIJ T;  3CD6 T;  3OY9 A;  2K4Y A;  1Q86 U;  3JV3 A;  1TUG B;  3JAM E;  1KD1 C;  3HFO A;  4J9G A;  2B8A A;  3SWN A;  1H64 1;  4ELY C;  4IIM A;  1BU1 A;  1R0C B;  2CH4 A;  3EFS A;  3OYB A;  3OYH A;  1LNX A;  4EMK B;  4M78 E;  1NPR A;  4HCB A;  4PL6 A;  3CD6 Q;  2COZ A;  1M2O A;  1WA7 A;  1VQO Q;  2DYB A;  1QKW A;  2OX7 A;  1RAD B;  1UGQ B;  1VIE A;  3OQ5 A;  2HAX A;  2KK4 A;  1AWW A;  3JCM P;  3EFR A;  3CCE A;  4A54 A;  5KYN A;  2OJ2 A;  4XK8 E;  2RF0 A;  4C5H A;  1WHL A;  4E7S A;  3J7A F;  1I1J A;  2ZAE A;  4E2F B;  1H8K A;  3CCE T;  3VS6 A;  1I5L A;  3WVE B;  1M90 U;  4PNO A;  3JCM V;  1NJI C;  4KT0 E;  1T0H A;  2QA4 T;  3V7R A;  1RI9 A;  5CKD A;  2V8J A;  3GF5 A;  5GAN g;  1X2K A;  3LWI A;  4HVU A;  1B34 B;  3H0I A;  5CR2 A;  1XQH A;  4A4G A;  1M1K R;  4R56 A;  4YTL A;  4XAX B;  2DJQ A;  2DTH A;  5LJ3 f;  2F1L A;  3JCM g;  5KH6 A;  2E41 A;  4ME7 A;  1UTI A;  4OMQ A;  4ANJ A;  1YI2 Q;  2M02 A;  4FU6 A;  1VQ4 Q;  2EWN A;  5FRN A;  2KEA A;  2P4T A;  3EGD B;  1GCQ C;  3PMI A;  3JCM d;  3M56 A;  2NUZ A;  2LX9 A;  1LOJ A;  5FU6 B;  1MGQ A;  1M2V B;  1P92 A;  1QVG S;  1YIJ A;  1LPL A;  1BIA A;  4JRP A;  1M4Z A;  5IHI A;  3CC7 T;  2E12 A;  1C6V X;  2DA9 A;  3VRZ A;  1WJQ A;  5KYW B;  3JRZ A;  3UPU A;  3M0P A;  4PJO F;  6AT1 B;  1GBR A;  1VA7 A;  2C06 A;  4BUG A;  2LQN A;  3JB9 D;  3UAT A;  2RQT A;  1MND A;  4BDY A;  2E5K A;  3HSB A;  3OYN A;  3AT1 B;  5KYU A;  2LCS A;  2J6F A;  2PVO B;  1GCP A;  2WSE E;  4DBQ A;  1YJN T;  1OU9 A;  4UC4 A;  3QXE B;  3OW2 S;  4JPB W;  4ZGD B;  2X4Y A;  2PUO B;  4OMN A;  3CC2 A;  2CUD A;  2EQU A;  1W2B S;  1UHC A;  4M77 G;  2LCC A;  3FJP A;  5GAM d;  4RTV A;  4LDU A;  3VS4 A;  2HQX A;  4M75 F;  4DBH A;  4RTT A;  2IVW A;  1U3O A;  3I35 A;  3L2W A;  3TVT A;  3DB3 A;  1NLP C;  4Y28 E;  1PRL C;  1RAF B;  4C92 E;  2FEI A;  4A4H A;  1H3H A;  1N8R C;  1NEB A;  2OTL A;  2K6D A;  2RD1 A;  1W4S A;  2ED1 A;  2HSP A;  2LJ3 A;  4M75 G;  1MMA A;  2EYW A;  2ATC B;  1HD3 A;  4PJO G;  3BE3 A;  3CQT A;  2I2L A;  5HY6 A;  1KQ2 A;  4JLG A;  3CEY A;  2Z0W A;  1QQJ A;  3I55 T;  5GAM f;  1WX6 A;  5GMK l;  3HTR A;  1WJR A;  3UA6 A;  5GMK e;  1K9M U;  1VQK Q;  2O9V A;  3FIF A;  5CVI A;  2CZ1 B;  3QBY A;  1M2V A;  2RJC A;  4EMK C;  2JZ2 A;  4Q5W A;  3CC7 A;  1S72 T;  1CKB A;  1WHM A;  2YT6 A;  5L23 A;  1VUB A;  1IHW A;  1D1B A;  1RAC B;  2EJF A;  2JUF A;  2QTV A;  3EGD A;  1X2Q A;  4J6W A;  2QA4 A;  5LJ5 g;  4C8Q D;  4J9I A;  4F17 A;  1WHK A;  1ABQ A;  1VQ6 A;  3M4G A;  2DX1 A;  3VJP A;  2JJ9 A;  1ZUY A;  1AWJ A;  1JBM A;  4M75 C;  2BUD A;  4QQ6 A;  1OEB A;  2VB6 A;  2OTJ A;  2R5A A;  2JMC A;  1AHJ B;  3ULR B;  2CP6 A;  2K7A A;  4C8Q G;  4C92 C;  2HBW A;  2RNA A;  2JN0 A;  3OSV A;  1KQS A;  3QPH A;  4DOV A;  1TXQ A;  2E10 A;  2DAQ A;  2YRC A;  4J9D A;  2DE0 X;  1KFZ A;  1K8A C;  4Y92 A;  2EQI A;  2KI7 A;  2HQE A;  2A08 A;  1RLQ C;  3NHN A;  2VGN A;  2E5Q A;  1E7O A;  2KNB B;  5M9O A;  1VQ4 T;  1RLP C;  1ZA1 B;  3MP8 A;  5GAM e;  2FZK B;  4OB3 B;  4JJN K;  2E6N A;  1Z9Q A;  1Y57 A;  3DB4 A;  3RKY A;  4HVW A;  1R8O B;  1IZ6 A;  3JCM c;  9ATC B;  1VOM A;  2EW3 A;  5FW9 A;  2RQW A;  1PD1 A;  2DYI A;  1AZE A;  3DLL A;  1M5Q 1;  1FMK A;  3CME T;  4KH1 B;  3EHQ A;  1NLO C;  2K5I A;  3L2Z A;  3UDC A;  5D6Y A;  1OU8 A;  1VQ5 Q;  3OBW A;  1UGV A;  4J5Y A;  3I56 Q;  4II1 A;  2KT1 A;  4C8Q B;  3CCS Q;  2DLP A;  4RTY A;  3I5R A;  1U06 A;  4C92 A;  2QTX A;  4D8K A;  3RNJ A;  7AT1 B;  3OW2 A;  1JU5 C;  5GAM j;  2FRW A;  3JCM X;  1D09 B;  4L6V 5;  3CCV T;  2RQU A;  2LDM A;  2W10 A;  3NPF A;  2X3W D;  3MP1 A;  2DL4 A;  2KE9 A;  4M7A G;  2COW A;  4FW1 A;  2BZY A;  3KBG A;  4M75 E;  1BCM A;  5LJ5 f;  1QVF A;  3MPU B;  2L3R A;  1FWZ A;  4KH0 B;  1HK9 A;  2P0P A;  3TRE A;  4FSX A;  2HZY A;  1QMC A;  5LJ5 e;  4QQG A;  4IKF A;  2EAY A;  2KXD A;  2RB6 A;  4FSS A;  4JZ3 A;  1BKB A;  4KUI A;  4E7I A;  2RHI A;  5GAN 7;  1G2B A;  4LDV A;  1GL5 A;  1NBE B;  1K8A U;  3ZEH A;  2V8I A;  4HT8 A;  3OYF A;  4M7D G;  2RH2 A;  1Q86 R;  1VQ9 Q;  3RMS A;  3M0R A;  3PFS A;  2FPE A;  2L89 A;  2YLC A;  1IO6 A;  2CZ7 B;  1KQS P;  4EDU A;  2DFU A;  2LJ0 A;  5C0M A;  1WIE A;  2QK0 A;  2OAW A;  3EGX A;  3AHU A;  3OYJ A;  1VYV A;  2KRN A;  3CMA A;  1YBY A;  2NYS A;  2RQV A;  4RKU E;  1YCS B;  2CSI A;  1BI0 A;  2HSE B;  2LCL A;  2CP2 A;  4IUV A;  2VXF A;  5EC7 A;  1JJ2 S;  4GY5 A;  3C95 A;  4X9C A;  1TU0 B;  1D0Z A;  4TVR A;  1WQ7 A;  3QO3 A;  4BE2 A;  1O9S A;  1SPK A;  4J83 A;  4O5V A;  4E7H A;  4EMG A;  2XI9 A;  2O01 E;  3CC4 T;  1VQ7 Q;  4L5G A;  2BE7 D;  4LD9 K;  5GAN f;  5LL6 S;  1YJW A;  2XG8 D;  1UE9 A;  2EVR A;  3MET A;  4V2S A;  5KCH A;  2XHC A;  2QQR A;  5LJ3 g;  2VXE A;  2NUT A;  2H3E B;  1KSW A;  1X6B A;  4PK4 A;  2D6F A;  4OB1 B;  2RK2 A;  1C0M A;  1E6G A;  4Z02 A;  2JTE A;  3CCM T;  3V8J A;  4C0D C;  2GFA A;  4E6R A;  2FB7 A;  1I4K 1;  2HQH A;  5GMK m;  2CRE A;  4ZN3 A;  3EG2 A;  3HHT B;  4FT2 A;  1RL2 A;  5D6W A;  1LCK A;  1U5S A;  2YRD A;  3FEO A;  1WLP B;  2EJ9 A;  2JW4 A;  2HEQ A;  2K2M A;  1VQ7 T;  3MKD A;  3CXC S;  2DIQ A;  3ZFJ A;  1AWX A;  2IIM A;  2AZS A;  3DKM A;  1WHJ A;  1M8V A;  1PHT A;  3A5Z B;  3CXC A;  3V8L A;  4C92 G;  3I55 Q;  4ZTJ A;  4QW2 A;  2QGF B;  2CT4 A;  1MNE A;  2E65 A;  3M0S A;  4JRQ A;  3NFC A;  1I5O B;  4QKU A;  3H0H A;  1PNJ A;  3VYH B;  2X4J A;  4MML A;  3H0F A;  3P8D A;  5I22 A;  4M78 G;  3FJ5 A;  1QP3 A;  4DBF A;  3EG0 A;  4HXJ A;  3DLM A;  3CBO A;  3JB9 H;  2X51 A;  3V7C A;  3CCE Q;  1G3T A;  2FO0 A;  3VS0 A;  2DBM A;  4OML A;  4CI0 C;  4BDZ A;  1VQL Q;  4J8O A;  3OMC A;  2LRQ A;  4OP0 A;  3IQL A;  1M3A A;  1NG2 A;  2PTK A;  3F70 A;  5J26 A;  2YRV A;  2HCK A;  2ZPB B;  2Y4Y A;  3EG9 B;  3NTH A;  1W6X A;  4OF1 A;  1WFW A;  3GNF B;  3V7S A;  2YWW A;  3A8H B;  2KMT A;  1XOV A;  1FMW A;  1N27 A;  3LH0 A;  4RG8 A;  3RER A;  3X25 B;  4C5G A;  1WDX A;  5GAM g;  2J6K A;  2RHU A;  3HRS A;  3M53 A;  3VUB A;  3G4S Q;  3CCQ Q;  5J3B A;  3EH2 A;  2KR3 A;  2K5F A;  4LDW A;  5A2Q E;  5GAN j;  2MOX A;  3UA7 A;  1M27 C;  4VUB A;  2FL7 A;  3CCU Q;  1KC8 R;  1I81 A;  2X4W A;  3L1A A;  3OW2 P;  3VUZ A;  1ZQ1 A;  1YIJ Q;  1GFD A;  1T3L A;  5GAN h;  1B3Q A;  3QWX X;  4DOW A;  5GAN 8;  3TSW A;  1MMD A;  1F1B B;  3PGG A;  1YJN Q;  1W2B P;  1YWP A;  3CCR T;  3OYM A;  4PFP A;  2DTI A;  4M7D A;  3SWN C;  2DIL A;  3VS3 A;  1ZUK A;  3MEW A;  5EG2 A;  1PCX A;  3SDZ A;  4LDY A;  2WSC E;  1LJO A;  1RAE B;  1OV3 A;  1KQ1 A;  4C5E A;  2OI3 A;  3EG9 A;  2M51 A;  3LX7 A;  1U1S A;  1KD1 U;  2IG0 A;  1Q7Y C;  1B07 A;  4WTO B;  2ROT A;  2PVG B;  3S6W A;  1WI7 A;  3CC2 Q;  3ZBD A;  3J81 E;  2XD0 A;  2CP0 A;  1PKS A;  4JRK A;  3JCM b;  1YHQ T;  1D3B B;  2ZCF B;  4NL3 A;  2DKG A;  2JMA A;  2ZPE B;  1OZ2 A;  4HT9 A;  5IT9 E;  2HKN A;  3M9Q A;  2KYB A;  3OYE A;  3VYG A;  4EIK A;  1N9R A;  4BAC A;  1Q86 C;  2L3P A;  1JO8 A;  2JOY A;  1WHH A;  3M0T A;  2J06 A;  2OTL Q;  1KG1 A;  2DER A;  4KGX B;  2E70 A;  4EMH A;  1K9M R;  3CCJ A;  1T0J A;  3QJ6 A;  4BY6 C;  1OX8 A;  2K79 A;  4OMF B;  3RR6 A;  1S72 Q;  2QGG A;  3TSZ A;  3RIR A;  3OYL A;  2X3X D;  3PMT A;  4B9W A;  1VQK A;  2HD0 A;  3ZL7 C;  5KYW A;  1QKX A;  3D7S B;  2PNI A;  1M1K C;  5CKB A;  1VQ8 Q;  2KQW A;  2DF6 A;  2G6F X;  5FWC A;  2RI3 A;  4GLK A;  1JXM A;  3JCM W;  2VV5 A;  4F04 B;  3QWY A;  3JB9 G;  3GNG A;  1G3Y A;  2MF2 A;  1TUC A;  3QDF A;  5FRM A;  1O75 A;  1MMN A;  5DM7 R;  1ZBX A;  2JTM A;  1SG5 A;  3CPW S;  1Q82 C;  2R5M A;  2GF7 A;  3G1J A;  3QZ5 B;  4F7U B;  2NUT B;  4XTZ A;  1WZO A;  3A8M B;  2DXC A;  2XDP A;  4OGC A;  5GAN 5;  1KD1 R;  2QDY B;  5AT1 B;  1RAH B;  3L2Q A;  3KFV A;  2VYT A;  1B34 A;  3C12 A;  3SB2 A;  2GNC A;  1NEG A;  3CCL T;  5CKE A;  3HKS A;  2O88 A;  3MP6 A;  2DRM A;  1FXX A;  1SHG A;  4QVZ A;  1C1A A;  1D1C A;  3CXC P;  3J80 E;  4XTV A;  5GAN d;  4ZGJ B;  1SRL A;  4ZGE B;  4MZM A;  2H3J A;  3HL8 A;  3JSC A;  1WNL A;  4FYY B;  2FYK A;  1IRE B;  4J7I A;  2EKO A;  2HNI A;  3CCM Q;  1VQN T;  3VS7 A;  3S3O A;  1QVF S;  2EIF A;  3JCM Q;  4M75 B;  3U23 A;  1RUW A;  1KC8 U;  3M58 A;  2MK5 A;  2LTO A;  5KE3 A;  1YWO A;  1WXB A;  2A28 A;  2GCX A;  1K9M C;  4QT7 A;  4FW2 A;  4ELZ C;  3WXM B;  1WGS A;  2HL5 C;  2RM4 A;  1VQN Q;  4MDX A;  3SWN B;  1Q81 U;  3CCU T;  1JQQ A;  5GAN 2;  4XU1 A;  2RI5 A;  5CQX A;  3CPW A;  1X69 A;  1VQM Q;  2HKQ B;  3I56 A;  2CKK A;  4FL6 A;  1QVG A;  3CCS A;  1JJ2 P;  2DTO A;  4OB2 B;  2ENM A;  3CCV Q;  1D0X A;  1PG5 B;  3PIO A;  4DEX A;  2ZPG B;  2M9U A;  2MAM A;  1ARK A;  2MYS A;  2MWO A;  4LXC A;  1UG1 A;  1Q95 G;  2A36 A;  2BZ8 A;  2YHT A;  3P8B B;  4M7D F;  3JCM J;  2CP5 A;  3CPW P;  4IUP A;  1ACM B;  4AG2 C;  4DQ2 A;  4J7F A;  1G8X A;  2XDD A;  2DD4 A;  4XTU A;  2NLU A;  1UUE A;  2FPD A;  4A53 A;  3THK A;  1D1A A;  1JRI A;  1KK7 A;  3G71 A;  4C0G A;  1VQO A;  1JJ2 A;  2O2O A;  4MMK A;  2FG0 A;  1J3T A;  3MJX A;  2QDL A;  4Z8A A;  5CKH A;  3EH1 A;  4X1V A;  2MWP A;  4KBM B;  4OVA A;  1Y0M A;  2M0O A;  2MIO A;  4HCK A;  1YN8 A;  4D6W A;  2JNG A;  3CCJ T;  4B9X A;  4J9H A;  2V26 A;  1YIT A;  3OYD A;  1VQP T;  5KYX B;  1VQL T;  3G6E T;  1G3S A;  2K3B A;  4AFS C;  1KC8 C;  3TEE A;  2F5T X;  1QVG P;  1X43 A;  4HCZ A;  5LJ3 h;  3UT1 A;  1Y96 B;  3NMZ C;  1OOT A;  2Y4X A;  5CQY A;  3G4S T;  3WVD B;  5CCA A;  4LDX A;  2BIV A;  4M7A B;  1UEB A;  5LJ3 j;  1X27 A;  3M5A A;  2GQI A;  3OS2 A;  3A1P A;  3CMA Q;  2KYM A;  2DNU A;  1RAB B;  1YJ9 A;  1YI2 A;  2QG9 B;  2DXB A;  2D8J A;  5FWB A;  1ZLM A;  5CO7 A;  2A0F B;  2D0Q B;  5GAN 3;  5GMK h;  1BCO A;  1MV0 B;  1D0Y A;  2ROL A;  4PFO A;  4C8Q F;  1UJY A;  4CC7 A;  3M0U A;  3SD4 A;  3L42 A;  3JB9 I;  2AK5 A;  2DXU A;  1SRM A;  4HKE A;  2JVV A;  1UFF A;  3CC4 A;  1VQ7 A;  2DZ9 A;  4HVV A;  4PLL A;  1M90 C;  1Q81 C;  5HKC A;  2LQW A;  4PJO B;  3MEU A;  1FYN A;  3VU3 C;  1ZBJ A;  1PM3 A;  2DJZ A;  2X35 A;  2DO3 A;  1WXT A;  3NGP A;  5AYF A;  1BYM A;  2KXC A;  4M4Z A;  3QYH B;  3R6N A;  1QVF P;  2JM9 A;  2BZX A;  1TH7 A;  2QEX A;  4F7U A;  4R55 A;  1OI1 A;  1QWE A;  4BI3 A;  2LZ6 B;  1X6O A;  5L8R E;  1AZG B;  4HA8 A;  1KHI A;  2PVD B;  3OYA A;  1VQP A;  1YIT T;  1ABO A;  2LX7 A;  1XNI A;  1IGU A;  4B6M A;  2LC4 A;  4C5I A;  3O8V A;  5J39 A;  4RCB A;  4QVD A;  2SRC A;  2KBT A;  8AT1 B;  2JT4 A;  4BD3 A;  2BKD N;  1M3C A;  1M90 R;  1WYX A;  1VIF A;  1K8A R;  1NM7 A;  1LVK A;  4E7K A;  2AZV A;  2K2V A;  4IUT A;  5GMK i;  3N5B B;  4RCC A;  3VS1 A;  1V1C A;  1AEY A;  3HRT A;  5HCK A;  2F5K A;  1EFN A;  2R57 A;  3E19 A;  1U8R A;  3GIB A;  2KAF A;  1SHF A;  1MHN A;  4XU2 A;  4IUR A;  2DL3 A;  2B86 A;  1N6A A;  1G5V A;  1KQS S;  1ZSZ B;  1U1T A;  2GQV A;  1KIK A;  3MHX A;  2ZPH B;  2ZGW A;  1X75 C;  1VYU A;  5I2S A;  1I07 A;  2V1R A;  4ZNX A;  5KYY B;  1TS9 A;  5KYY A;  2EYY A;  2K5L A;  1VQL A;  3A8L B;  1VQO T;  2LQ8 A;  1D3B A;  4LE9 A;  4PJO C;  3A98 A;  1M1K U;  2CZ0 B;  2DBK A;  1ZSZ A;  2M1H A;  3VV0 A;  2DXT A;  3VRY A;  4M77 B;  2E3H A;  5KYU B;  4PJM A;  4XTY A;  3EG3 A;  2VAS A;  2BTT A;  1B7T A;  2D9T A;  4M77 D;  2V1Q A;  3LGL A;  3JCM e;  4WF2 A;  2JS0 A;  1OZ3 A;  2PUK B;  3LW5 E;  3CBP A;  4OMP A;  1VQ5 T;  2M0Y A;  2GTO A;  1JEG A;  2LJ1 A;  3REA B;  1YJ9 T;  2EGC A;  1I0C A;  1M1G A;  4PJN A;  3P8H A;  3CME Q;  4C0D B;  4MZP A;  3CCU A;  3PNW C;  1HJD A;  4A4K A;  1UB4 A;  3V8K A;  1BIB A;  2ED0 A;  5GAO l;  3HPW A;  5HK3 A;  1UGS B;  2GTJ A;  1PRM C;  4KUL A;  1BK2 A;  3CMA T;  2DL8 A;  2H8H A;  5IN1 A;  2RJF A;  1KJW A;  2KT8 A;  3L2V A;  2FPF A;  2J7I A;  3MO8 A;  1X01 A;  4J6Y A;  5IHK A;  2AHJ B;  4BI8 B;  1W70 A;  2O4X B;  3UF4 A;  1YHQ Q;  4PJO A;  1PD0 A;  1VQM T;  4CC2 A;  3ASK A;  2EQJ A;  2P0Q A;  1OYX A;  5GAO r;  4ZTF A;  3S3M A;  4E47 A;  3QII A;  2F69 A;  1GRI A;  3QZ9 B;  2RK1 A;  3RKW A;  2ZZD A;  4A4F A;  2JS2 A;  4F16 A;  3BFM A;  3CC7 Q;  2KY9 A;  4M7A D;  4PJO E;  2QEX T;  4A63 B;  2A37 A;  3JB9 J;  5IH2 A;  3TCJ A;  1SSF A;  2JTF A;  4OB0 B;  4ATO A;  3TU4 K;  1XTD A;  1SEM A;  4LN2 A;  4XQ3 A;  1N9S A;  4DEY A;  5GAM h;  1NYG A;  5GMK j;  3OB9 A;  1ZHI A;  2K9G A;  4Y91 A;  5FU6 C;  2J05 A;  4PKC C;  1V76 A;  5ECA A;  4EMK A;  4O6J A;  2SEM A;  2ABL A;  4XU0 A;  1S1N A;  2CYZ B;  2JM8 A;  1Y71 A;  2EKH A;  1WQW A;  3CCJ Q;  1K4U S;  2DM1 A;  2D8H A;  3RES A;  4BB7 A;  5GAN 4;  2OTJ Q;  2AT1 B;  4JJB A;  4Z88 A;  2GBQ A;  4PJJ A;  2HBP A;  2CSQ A;  3QG1 A;  1NJI R;  4FM4 B;  3H8Z A;  3HRU A;  2XK0 A;  4MZT A;  4FYW B;  2F2X A;  5KYX A;  3I5S A;  3TQ7 P;  4XTX A;  5I21 A;  4DA4 A;  2CT3 A;  2ECZ A;  3L2R A;  3MEV A;  1N8R R;  2FZC B;  2O9S A;  1QW1 A;  4JJD A;  3C0C A;  3OSS C;  1VQK T;  1ZX6 A;  5GAN 6;  1E6H A;  3G6E A;  1VQ9 A;  3QDR B;  3CCR A;  2C0O A;  3M0Q A;  5IAY A;  1QCN A;  4BI4 A;  1GBQ A;  1ZUU A;  2RHZ A;  2YXY A;  3RBB B;  4J9F A;  2C0T A;  3EFO B;  4LNP A;  1IRX A;  2CDT A;  3KXT A;  3CCL Q;  1VQ9 T;  3X26 B;  2W0Z A;  5CAI A;  1M3B A;  1MUZ A;  2EYQ A;  4FIB A;  5IXB A;  2Y90 A;  2QXF A;  1K0X A;  1SKU B;  2QYZ A;  3CPF A;  2JXB A;  4IUQ A;  3JCM h;  3GP8 A;  4N4H A;  1EZZ B;  1HSQ A;  1HYO A;  1EX4 A;  2CS7 A;  2C0I A;  2QQA A;  2DPP B;  2EYX A;  1TSF A;  2EQM A;  1N5Z A;  3PT9 A;  1XJW B;  1OX9 A;  3HP9 A;  1UEC A;  4AT1 B;  2YDL A;  2LNH B;  4JS4 A;  2L3S A;  2VC8 A;  1OQK A;  3A8O B;  3E9F A;  1UHF A;  2NUP B;  4BE1 A;  4M75 A;  2VVK A;  5A0D A;  4JS5 A;  1V29 B;  2EYZ A;  1R77 A;  3FLG A;  3CD6 A;  2F2V A;  2G3R A;  4KUD K;  2EGE A;  1RAI B;  3VKI A;  1BI2 A;  5FU7 C;  1TOV A;  4AG1 C;  2CP7 A;  4LUD A;  1M8M A;  4RTU A;  3NTI A;  1VQM A;  4K11 A;  2WSF E;  2DRK A;  4N0A C;  2E3I A;  3PE0 A;  3OS0 A;  2DET A;  4M78 D;  1PC0 A;  1QLY A;  2L8D A;  3GOX A;  1ZSZ C;  1OPL A;  3QSU A;  4M78 B;  4M7D C;  4M77 F;  5GAO m;  2I0N A;  2RHX A;  2IPO B;  2KVQ G;  4RG2 A;  2RPN A;  2RJE A;  1FMV A;  3C4S A;  2DL5 A;  4AFZ C;  3G71 T;  3EFO A;  4FCY A;  1VQ4 A;  4RTX A;  1G83 A;  3EGU A;  3E9G A;  3RKX A;  4F7U G;  2EFI A;  4C8Q E;  3E1S A;  3QYG B;  3EHR A;  2VWF A;  1TG0 A;  1UJ0 A;  2RI2 A;  8ATC B;  4IUU A;  5GJW B;  4JUV A;  2DD5 A;  1JXO A;  2FZG B;  1A0N B;  5C6S A;  5FU7 B;  2PU9 B;  3OBY A;  1VYT A;  1KHC A;  5KE2 A;  2FRY A;  4HCC A;  4NOY A;  3HFN A;  2WAC A;  4M78 F;  2RJD A;  2R58 A;  1UGP B;  2VGM A;  1EIF A;  1OUL A;  4LUE A;  4AMC A;  4N0A A;  4RTZ A;  1Y7X A;  3CBM A;  3CC2 T;  3H41 A;  1YJ9 Q;  5LJ5 d;  3G4S A;  3R6O A;  4E7L A;  1M9S A;  3L2U A;  2XU8 A;  5KCO A;  2COY A;  4OMO A;  4PFZ A;  4KRT A;  2A3L A;  4M7D D;  3OYI A;  4ORZ A;  1UGR B;  2DVJ A;  2QAZ A;  5DY9 A;  4C0F A;  3OYC A;  1W2B A;  3S3N A;  1NPP A;  1VQ8 T;  1H3Z A;  2DZC A;  2FHD A;  1PWT A;  1YJN A;  3CC4 Q;  3QUI A;  2CUB A;  1IGQ A;  4AFU C;  4FYV B;  3CCS T;  4RUG A;  3RDV A;  1WHG A;  3URG A;  5I11 A;  2LT4 A;  4PJL A;  1DJ7 B;  3LLR A;  1PSF A;  3I55 A;  2KRO A;  2J6O A;  4C92 F;  5A0G A;  2DEQ A;  2GFU A;  2O31 A;  2RQR A;  2OTL T;  2E64 A;  1W1F A;  3X20 B;  1TTH B;  5A0L A;  2X4X A;  1K9A A;  4DBR A;  2AKK A;  2A7Y A;  4E7J A;  2O4X A;  3REB B;  4M78 C;  4F7U E;  4M7D B;  1NYF A;  2QEX Q;  2QAS A;  3PVQ A;  2QI2 A;  2KDS A;  3BW1 A;  4OGE A;  2YUN A;  1YJW T;  2VKN A;  3LYI A;  1VQP Q;  1I8F A;  5IXF A;  3RMQ A;  4C92 D;  4D8D A;  2RN8 A;  3H6Z A;  3FDR A;  1ZSG A;  3OS1 A;  2P0K A;  2ZPF B;  1G3W A;  1AWO A;  4X34 A;  4JDS A;  1RI0 A;  2AIR B;  3OYK A;  1HXD A;  2QA4 Q;  4C0Z A;  5LJ5 j;  1CSK A;  3E2U A;  4M7A E;  2NWM A;  1K73 C;  1M1F A;  2VUB A;  1VQ6 Q;  2CZ6 B;  2LT1 A;  1AD5 A;  2YUQ A;  3OYG A;  4X9D A;  1QP2 A;  1N8R U;  1SF9 A;  3LGF A;  1Q81 R;  1X6G A;  3FRN A;  3UWN A;  3CCQ A;  1S72 A;  5IHN A;  5LJ3 d;  3OA6 A;  2XID A;  2LVM A;  3G7Z A;  3MEA A;  1Q82 R;  1AVZ C;  1AOJ A;  5GAO p;  1FX7 A;  4M77 A;  4FT4 A;  4M7A F;  5LJ3 e;  1IB8 A;  4M7D E;  3GBQ A;  4PLI A;  4LD6 A;  1VQ8 A;  4BE0 A;  3M57 A;  2E6Z A;  2XIC A;  2K3X A;  5FLX E;  5LJ5 h;  3PIP A;  1K76 A;  1SSH A;  2QQ9 A;  1MV3 A;  3O5Z A;  1H92 A;  5GAO q;  1NZ9 A;  1IHV A;  1GXI E;  1CKA A;  4KGZ B;  3X24 B;  1WJS A;  2CP3 A;  2YUP A;  2XMF A;  1BI3 A;  5I2M A;  3NTK A;  1K73 R;  4N4G A;  3KUF A;  2D1X A;  2FVU A;  3JCM f;  3I9Q A;  5CKF A;  3SFM A;  4JRI A;  3X28 B;  1YFN A;  4J9B A;  4EPC A;  1BBZ A;  4N4I A;  3VS5 A;  4IIO A;  1QCF A;  2RHY A;  1IXD A;  2LMJ A;  1GCQ A;  2CGH A;  4QQD A;  4F14 A;  1ZA2 B;  3CME A;  3VS2 A;  4JJC A;  2V8K A;  2K3Y A;  3EG1 A;  3MCA B;  1VQ5 A;  2MCN A;  1YNZ A;  4P5N A;  3QKJ A;  2BE9 B;  3OMG A;  2CH4 W;  2HDA A;  2LNV A;  1YCY A;  2AKL A;  1K73 U;  2DK3 A;  3FB9 A;  3M54 A;  1Y07 A;  2YUO A;  1GFC A;  1K1Z A;  3M4Y A;  5CIU A;  5FRO A;  3LWH A;  4M7A C;  3I56 T;  2PQW A;  1YP5 A;  2LP5 A;  2DEU A;  1M30 A;  2EPD A;  2DL7 A;  2ESW A;  1WPY A;  4QVC A;  4NS5 A;  4JZ4 A;  4A4E A;  4JLI A;  1YHQ A;  3BY7 A;  1QWF A;  4CC4 B;  1Q82 U;  4M78 A;  3JB9 F;  2HL3 A;  1MMG A;  2MMP A;  3PTA A;  1BB9 A;  1UDL A;  3BDL A;  1Z9Z A;  4E7Z A;  2E4H A;  2LQK A;  3SHW A;  5D6X A;  2L2P A;  2EJG A;  1BI1 A;  2KSS A;  1NE8 A;  1RAA B;  5DLO A;  2L0A A;  2P84 A;  3OYY A;  3BDU A;  2L3Q A;  2E1H A;  1YI2 T;  2RA2 A;  3CCV A;  4J6X A;  2EGA A;  2YSQ A;  2KGT A;  4R0K A;  2QQB A;  4CC3 A;  1QVP A;  5GAO n;  4M75 D;  4GLM A;  3RUX A;  1QCO A;  3Q1J A;  4BY6 B;  2P4R A;  3EGX B;  5HK0 A;  2OTJ T;  2DMO A;  2NUP A;  4C8Q C;  4OMM A;  3SEM A;  1K0S A;  3M59 A;  3QJY A;  1Q7Y R;  3GPL A; 
#chains in the Genus database with same CATH homology
 3KBG A;  4RMO A;  4M75 E;  2EYQ A;  3ME9 A;  4FIB A;  2GCX A;  1K9M C;  5LJ5 f;  4M7A A;  2Y90 A;  4ELZ C;  1QVF A;  3WXM B;  2QXF A;  2L3R A;  1FWZ A;  1HK9 A;  1WGS A;  2P0P A;  2RM4 A;  3TRE A;  3T9N A;  4MDX A;  4FSX A;  3QHS A;  3ER0 A;  3SWN B;  1Q81 U;  5LJ5 e;  3CCU T;  4QQG A;  2YLB A;  4M77 C;  4IKF A;  3CPF A;  5GAN 2;  1JB0 E;  4XU1 A;  2EAY A;  1PSE A;  1Y96 A;  5CK9 A;  2RB6 A;  3OS5 A;  1NJI U;  2RI5 A;  5CQX A;  4IUQ A;  3JCM h;  2OAU A;  3GP8 A;  3CPW A;  4M77 E;  1BKB A;  4N4H A;  5DLQ E;  4KUI A;  4E7I A;  2RHI A;  2CS7 A;  5GAN 7;  3I56 A;  4LDV A;  2CKK A;  2DIG A;  2QQS A;  4FL6 A;  1QVG A;  2QQA A;  3CCS A;  2DPP B;  2DTO A;  4OB2 B;  1Q7Y U;  1K8A U;  3ZEH A;  2V8I A;  4HT8 A;  2DVE A;  4F7U F;  2EQM A;  3PIO A;  3OYF A;  4PJO D;  4ZN1 A;  4M7D G;  3PT9 A;  2RH2 A;  2ZPG B;  2M9U A;  2ZPI B;  3CCM A;  2XDB A;  3HP9 A;  2MAM A;  2MWO A;  3RMS A;  2YHT A;  4XTW A;  3EAE A;  3P8B B;  5GAN e;  2L5Q A;  4JS4 A;  1VQ6 T;  3JCM J;  4M7D F;  4IUP A;  2VC8 A;  3PFS A;  2L89 A;  2RO0 A;  2YLC A;  3GLX A;  2CZ7 B;  4DQ2 A;  3A8O B;  3E9F A;  3FC3 A;  4EDU A;  4BE1 A;  4J7F A;  2MI6 A;  4M75 A;  5A0D A;  5C0M A;  3CCL A;  2XDD A;  4JS5 A;  1V29 B;  2DD4 A;  4XTU A;  2NLU A;  3INZ A;  3AHU A;  2K57 A;  3OYJ A;  4A53 A;  3FLG A;  3CMA A;  3A8G B;  1YBY A;  3CD6 A;  2EQK A;  4RKU E;  1JRI A;  2G3R A;  3G71 A;  4KUD K;  4C0G A;  1VQO A;  1JJ2 A;  1BI0 A;  4C92 B;  4MMK A;  4XU3 A;  3VKI A;  2LCL A;  1VQN A;  1BI2 A;  4IUV A;  2VXF A;  5CKH A;  2XKO C;  4L59 A;  5FU7 C;  3CCQ T;  2MWP A;  4KBM B;  4CRI A;  3C94 A;  4OVA A;  1JJ2 S;  4MDW A;  4GY5 A;  2M0O A;  4C8Q A;  4D6W A;  3C95 A;  4X9C A;  3NTI A;  2JNG A;  3CCJ T;  4TVR A;  1VQM A;  4B9X A;  2M16 A;  1WQ7 A;  2WSF E;  3QO3 A;  4BE2 A;  1O9S A;  4N0A C;  4J83 A;  4O5V A;  1YIT A;  3OYD A;  3M55 A;  1VQP T;  4E7H A;  3G6E T;  1G3S A;  1VQL T;  4EMG A;  4NL2 A;  1YIJ T;  1KC8 C;  3CD6 T;  3OS0 A;  3TEE A;  2F5T X;  2XI9 A;  2O01 E;  3OY9 A;  4HCZ A;  4M78 D;  3CC4 T;  5LJ3 h;  4L5G A;  2K4Y A;  2L8D A;  1Q86 U;  3UT1 A;  5GAN f;  4LD9 K;  3GOX A;  5LL6 S;  1YJW A;  2XG8 D;  1Y96 B;  3JAM E;  1KD1 C;  3HFO A;  3MET A;  4V2S A;  2Y4X A;  5CQY A;  5KCH A;  3G4S T;  3QSU A;  3WVD B;  5CCA A;  2B8A A;  2XHC A;  4LDX A;  4M78 B;  4M7D C;  2QQR A;  4M77 F;  3SWN A;  5GAO m;  2BIV A;  5LJ3 g;  2VXE A;  1H64 1;  4ELY C;  4M7A B;  2D6F A;  2RHX A;  1UEB A;  2KVQ G;  3EFS A;  4OB1 B;  5LJ3 j;  3OYB A;  4RG2 A;  1LNX A;  4EMK B;  4M78 E;  3OYH A;  3M5A A;  2RJE A;  2RK2 A;  1NPR A;  4HCB A;  3C4S A;  3OS2 A;  4Z02 A;  3CCM T;  3V8J A;  4C0D C;  4PL6 A;  2GFA A;  2FB7 A;  1I4K 1;  3G71 T;  1YJ9 A;  1YI2 A;  5GMK m;  1VQ4 A;  4ZN3 A;  2DXB A;  3HHT B;  4FT2 A;  1RL2 A;  3E9G A;  5D6W A;  3RKX A;  5CO7 A;  1UGQ B;  4F7U G;  2EFI A;  2D0Q B;  5GAN 3;  5GMK h;  3FEO A;  4C8Q E;  3E1S A;  1VIE A;  2EJ9 A;  3OQ5 A;  3QYG B;  3J81 E;  2HAX A;  2KK4 A;  1VQ7 T;  4C8Q F;  3JCM P;  2RI2 A;  3EFR A;  3CCE A;  4A54 A;  4IUU A;  4JUV A;  2DD5 A;  3SD4 A;  3CXC S;  2DIQ A;  3ZFJ A;  3L42 A;  5C6S A;  3JB9 I;  2PU9 B;  2DXU A;  3OBY A;  4XK8 E;  5FU7 B;  4C5H A;  3J7A F;  4HKE A;  2JVV A;  3DKM A;  1KHC A;  5KE2 A;  3CCE T;  1I5L A;  4HCC A;  3WVE B;  3CC4 A;  4NOY A;  1VQ7 A;  1M90 U;  2DZ9 A;  3HFN A;  4PNO A;  1M8V A;  2WAC A;  4M78 F;  2RJD A;  3JCM V;  3A5Z B;  4PLL A;  1NJI C;  4KT0 E;  3CXC A;  2QA4 T;  2R58 A;  3V7R A;  3V8L A;  5CKD A;  1M90 C;  2V8J A;  1Q81 C;  4C92 G;  4ZTJ A;  4M7D E;  5HKC A;  4PJO B;  3GF5 A;  3MEU A;  4QW2 A;  1UGP B;  2VGM A;  5GAN g;  1EIF A;  3VU3 C;  3LWI A;  2E65 A;  1B34 B;  2DJZ A;  4N0A A;  2X35 A;  2DO3 A;  5CR2 A;  1XQH A;  4A4G A;  1Y7X A;  4R56 A;  4YTL A;  5AYF A;  3NFC A;  4XAX B;  3CBM A;  4JRQ A;  1BYM A;  2DTH A;  5LJ3 f;  3QYH B;  3CC2 T;  3JCM g;  3VYH B;  2E41 A;  2X4J A;  4ME7 A;  5KH6 A;  4MML A;  1TH7 A;  3P8D A;  5LJ5 d;  3G4S A;  3R6O A;  2QEX A;  4F7U A;  4FU6 A;  4E7L A;  1M9S A;  4M78 G;  3L2U A;  2EWN A;  5FRN A;  2XU8 A;  5KCO A;  4R55 A;  2P4T A;  3PMI A;  1QP3 A;  1OI1 A;  3JCM d;  4BI3 A;  3DLM A;  3CBO A;  3M56 A;  3JB9 H;  1X6O A;  5L8R E;  3V7C A;  2A3L A;  4HA8 A;  2LX9 A;  1KHI A;  2PVD B;  3OYA A;  4M7D D;  1VQP A;  1LOJ A;  5FU6 B;  1MGQ A;  1G3T A;  1P92 A;  3OYI A;  1YIT T;  1UGR B;  1QVG S;  1XNI A;  1YIJ A;  2LC4 A;  4C5I A;  5DY9 A;  4CI0 C;  1BIA A;  3O8V A;  4C0F A;  3OYC A;  4JRP A;  4BDZ A;  5J39 A;  4J8O A;  1W2B A;  3OMC A;  3S3N A;  2LRQ A;  1M4Z A;  1NPP A;  4OP0 A;  4RCB A;  1VQ8 T;  3CC7 T;  1H3Z A;  2DZC A;  2E12 A;  2FHD A;  4QVD A;  3F70 A;  1YJN A;  5J26 A;  2YRV A;  3QUI A;  4BD3 A;  2ZPB B;  2Y4Y A;  2BKD N;  1WJQ A;  3CCS T;  3NTH A;  3JRZ A;  3URG A;  3UPU A;  4PJO F;  2LT4 A;  1VIF A;  4OF1 A;  1DJ7 B;  3LLR A;  1PSF A;  4E7K A;  3GNF B;  3V7S A;  3I55 A;  2K2V A;  4IUT A;  3A8H B;  5GMK i;  3N5B B;  2KMT A;  4C92 F;  2C06 A;  4BUG A;  4RCC A;  2DEQ A;  2GFU A;  5A0G A;  1XOV A;  3JB9 D;  3HRT A;  1N27 A;  2F5K A;  2E64 A;  2R57 A;  3LH0 A;  4RG8 A;  4BDY A;  3E19 A;  3X20 B;  1U8R A;  5A0L A;  3X25 B;  3OYN A;  3GIB A;  4C5G A;  3HSB A;  2KAF A;  2X4X A;  2A7Y A;  1MHN A;  5GAM g;  4E7J A;  2RHU A;  3HRS A;  2O4X A;  2PVO B;  2WSE E;  3M53 A;  4IUR A;  4M78 C;  4XU2 A;  4F7U E;  1YJN T;  4M7D B;  1N6A A;  3VUB A;  1KQS S;  1G5V A;  4UC4 A;  1U1T A;  2QI2 A;  3QXE B;  2GQV A;  2KDS A;  5J3B A;  3BW1 A;  4OGE A;  2K5F A;  4LDW A;  3MHX A;  4ZGD B;  5A2Q E;  2ZPH B;  3OW2 S;  5GAN j;  2ZGW A;  1X75 C;  1YJW T;  2X4Y A;  2PUO B;  5I2S A;  3LYI A;  4VUB A;  2FL7 A;  1I81 A;  3CC2 A;  2X4W A;  3L1A A;  3VUZ A;  1I8F A;  2EQU A;  1ZQ1 A;  3RMQ A;  1W2B S;  4M77 G;  2LCC A;  4C92 D;  2K5L A;  1VQL A;  3A8L B;  3FJP A;  3H6Z A;  1VQO T;  5GAM d;  2LQ8 A;  3FDR A;  4LDU A;  3OS1 A;  2P0K A;  5GAN h;  1D3B A;  2ZPF B;  4PJO C;  4DOW A;  1G3W A;  2HQX A;  5GAN 8;  4X34 A;  4M75 F;  4JDS A;  3PGG A;  1RI0 A;  1M1K U;  2CZ0 B;  2M1H A;  2IVW A;  3VV0 A;  2DXT A;  3CCR T;  3OYM A;  3OYK A;  3L2W A;  1HXD A;  4M77 B;  3DB3 A;  2DTI A;  4Y28 E;  4M7D A;  4C0Z A;  3SWN C;  5LJ5 j;  3MEW A;  4XTY A;  4C92 E;  5EG2 A;  4M7A E;  4A4H A;  1K73 C;  2D9T A;  1N8R C;  1M1F A;  2VUB A;  4M77 D;  3SDZ A;  2CZ6 B;  4LDY A;  2OTL A;  2LT1 A;  3LGL A;  3OYG A;  4X9D A;  1QP2 A;  3JCM e;  2PUK B;  2RD1 A;  1OZ3 A;  1W4S A;  2WSC E;  1LJO A;  3LW5 E;  3CBP A;  4WF2 A;  3LGF A;  1N8R U;  1VQ5 T;  4M75 G;  1KQ1 A;  1YJ9 T;  4C5E A;  3FRN A;  4PJO G;  3UWN A;  1KQ2 A;  2I2L A;  5HY6 A;  4JLG A;  3CEY A;  3CCQ A;  1S72 A;  3I55 T;  4M7A G;  5GAM f;  5GMK l;  5LJ3 d;  3LX7 A;  3OA6 A;  1WJR A;  5GMK e;  2XID A;  2LVM A;  1M1G A;  1U1S A;  3G7Z A;  3MEA A;  3P8H A;  1KD1 U;  1K9M U;  2IG0 A;  1Q7Y C;  3FIF A;  5GAO p;  1FX7 A;  4M77 A;  5CVI A;  4C0D B;  4FT4 A;  4MZP A;  2CZ1 B;  2PVG B;  3QBY A;  3S6W A;  5LJ3 e;  3CCU A;  3PNW C;  4M7A F;  3ZBD A;  4A4K A;  1UB4 A;  2RJC A;  2JZ2 A;  4PLI A;  4EMK C;  4Q5W A;  4LD6 A;  1BIB A;  3V8K A;  3CC7 A;  4BE0 A;  4JRK A;  1S72 T;  3JCM b;  1YHQ T;  1VQ8 A;  5GAO l;  3M57 A;  1D3B B;  2ZCF B;  4NL3 A;  2DKG A;  2E6Z A;  2ZPE B;  1VUB A;  2K3X A;  2XIC A;  3HPW A;  1OZ2 A;  5FLX E;  1UGS B;  5HK3 A;  2EJF A;  5LJ5 h;  3PIP A;  4HT9 A;  2JUF A;  2QQ9 A;  4KUL A;  3CMA T;  5GAO q;  5IN1 A;  1NZ9 A;  2RJF A;  4J6W A;  5IT9 E;  1GXI E;  3M9Q A;  3X24 B;  1WJS A;  3OYE A;  3VYG A;  2QA4 A;  1BI3 A;  1N9R A;  5LJ5 g;  5I2M A;  3NTK A;  4BAC A;  4N4G A;  4C8Q D;  1Q86 C;  3KUF A;  3L2V A;  2FVU A;  3MO8 A;  1X01 A;  3JCM f;  4J6Y A;  5CKF A;  3SFM A;  2JOY A;  3M4G A;  4JRI A;  3VJP A;  2AHJ B;  4BI8 B;  1VQ6 A;  3X28 B;  1KG1 A;  4EPC A;  2O4X B;  1JBM A;  4N4I A;  4M75 C;  4PJO A;  2E70 A;  4EMH A;  3CCJ A;  3RER A;  1VQM T;  2BUD A;  3QJ6 A;  4QQ6 A;  4BY6 C;  3ASK A;  2EQJ A;  2RHY A;  2P0Q A;  1OYX A;  2R5A A;  5GAO r;  2OTJ A;  1AHJ B;  4ZTF A;  3S3M A;  4OMF B;  4E47 A;  2CGH A;  3QII A;  4QQD A;  2F69 A;  3RIR A;  4C8Q G;  3QZ9 B;  4C92 C;  2RK1 A;  3OYL A;  3PMT A;  3RKW A;  2ZZD A;  2JN0 A;  3OSV A;  4B9W A;  1VQK A;  3CME A;  2HD0 A;  3QPH A;  4A4F A;  1KQS A;  4DOV A;  2V8K A;  2E10 A;  2DAQ A;  2K3Y A;  2XD0 A;  3MCA B;  1M1K C;  1VQ5 A;  3BFM A;  5CKB A;  4P5N A;  3QKJ A;  2KY9 A;  2KQW A;  4M7A D;  3OMG A;  2LNV A;  1K8A C;  1YCY A;  4PJO E;  2QEX T;  2RI3 A;  3JB9 J;  4GLK A;  3TCJ A;  1SSF A;  3JCM W;  2DK3 A;  2VV5 A;  1K73 U;  2JTF A;  3FB9 A;  3M54 A;  3GNG A;  1Y07 A;  3JB9 G;  1G3Y A;  4OB0 B;  4ATO A;  2MF2 A;  3M4Y A;  2HQE A;  5CIU A;  5FRO A;  3TU4 K;  1XTD A;  2VGN A;  2E5Q A;  4XQ3 A;  5FRM A;  1N9S A;  1O75 A;  5GAM h;  5DM7 R;  3LWH A;  5M9O A;  4M7A C;  3I56 T;  1ZBX A;  2PQW A;  1VQ4 T;  5GMK j;  2JTM A;  3OB9 A;  1ZHI A;  3CPW S;  3MP8 A;  2R5M A;  2GF7 A;  5GAM e;  1Q82 C;  4Y91 A;  5FU6 C;  4EMK A;  4OB3 B;  4PKC C;  3QZ5 B;  4O6J A;  4F7U B;  1WPY A;  4QVC A;  4NS5 A;  4A4E A;  4JJN K;  4JLI A;  2CYZ B;  2E6N A;  4XU0 A;  3BY7 A;  4XTZ A;  1YHQ A;  1Y71 A;  3A8M B;  2DXC A;  2XDP A;  1WQW A;  4OGC A;  4M78 A;  5GAN 5;  1Q82 U;  3JB9 F;  2QDY B;  2MMP A;  3DB4 A;  3RKY A;  3RES A;  3PTA A;  4BB7 A;  5GAN 4;  1R8O B;  1IZ6 A;  3L2Q A;  2VYT A;  1B34 A;  3BDL A;  3JCM c;  3C12 A;  3SB2 A;  2LQK A;  2HBP A;  3QG1 A;  5D6X A;  3CCL T;  2EJG A;  1BI1 A;  2KSS A;  3H8Z A;  3HKS A;  3HRU A;  1NE8 A;  3MP6 A;  4FM4 B;  2XK0 A;  5CKE A;  4MZT A;  3DLL A;  1FXX A;  1M5Q 1;  5DLO A;  3CME T;  4QVZ A;  2K5I A;  3L2Z A;  4XTX A;  3UDC A;  5D6Y A;  5I21 A;  4DA4 A;  3OYY A;  2OTL T;  3BDU A;  3OBW A;  2E1H A;  4J5Y A;  4II1 A;  3J80 E;  4C8Q B;  4XTV A;  5GAN d;  1YI2 T;  4ZGJ B;  2RA2 A;  4ZGE B;  3MEV A;  4MZM A;  3L2R A;  3CCV A;  2H3J A;  3HL8 A;  3JSC A;  1WNL A;  4J6X A;  2FYK A;  1IRE B;  1QW1 A;  4J7I A;  3OSS C;  2EKO A;  2HNI A;  2QQB A;  4C92 A;  2QTX A;  1VQK T;  1QVP A;  1VQN T;  5GAN 6;  5GAO n;  3OW2 A;  4M75 D;  3G6E A;  1VQ9 A;  3RUX A;  5GAM j;  3S3O A;  3QDR B;  3CCR A;  1QVF S;  2EIF A;  3Q1J A;  5IAY A;  4BY6 B;  3JCM X;  4L6V 5;  4BI4 A;  5HK0 A;  3JCM Q;  3CCV T;  2RHZ A;  2OTJ T;  2LDM A;  4M75 B;  4C8Q C;  1KC8 U;  3M58 A;  3KXT A;  1VQ9 T;  3X26 B;  3MP1 A;  2LTO A;  5CAI A;  3M59 A;  3QJY A;  5KE3 A;  3GPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...