2P4TA

Structure of the q67h mutant of r67 dihydrofolate reductase-nadp+ complex reveals a novel cofactor binding mode
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVHIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
publication title Structure of the Q67H mutant of R67 dihydrofolate reductase-NADP+ complex reveals a novel cofactor binding mode.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p4tA00
2RK1A 3SFMA 2RH2A 2RK2A 3T9NA 3UDCA 2GQVA 1VIEA 1VIFA 2VV5A 2P4TA 2OAUA
chains in the Genus database with same CATH superfamily
3FIFA 4C0GA 4XK8E 2ROLA 4J9EA 3OYDA 3EGXB 1D1BA 1MV0B 3RERA 1UFFA 3INZA 3QJYA 2OTJT 1QQJA 2K5IA 1VQLT 3G1JA 4K11A 4X9CA 3G71A 4MDXA 4R0KA 1W4SA 3Q1JA 3FB9A 1VYUA 5C0MA 2DIQA 4CC3A 1M1FA 1S72Q 3VU3C 2QK0A 4ANJA 4TVRA 2LJ1A 5DM7R 2DJQA 3OW2S 4PNOA 1VQ8T 4LN2A 5LJ3e 4M7AF 5GAMh 3CCQQ 4HT8A 4Y91A 4JUVA 2NWMA 2VB6A 3QDFA 1GCQC 3MHXA 1QWEA 4PLIA 2EKOA 2HQHA 4KGVB 4Y92A 5KYNA 2CP3A 1RUWA 3QWYA 1GFDA 3CC7Q 5IHIA 3NTIA 3CCEA 2CUDA 5FU7B 3MEVA 2QTVA 2JN0A 1QCOA 3N5BB 1YP5A 4EMKB 4ZTFA 2ZPGB 5FROA 3L2QA 2NUZA 4UC4A 1T0HA 5I2MA 2E3HA 2EW3A 2XICA 2XK0A 1K9MU 1Y7XA 1TOVA 2DTOA 5KYXB 1UG1A 2QQAA 9ATCB 2WACA 2OTLT 2KRNA 2QEXT 2E12A 2YUQA 3KFVA 3L2UA 4HVUA 3GNGA 4A63B 1QWFA 4ZGJB 3JCMW 2HQEA 1RI0A 3QPHA 1JJ2S 1D0YA 3A8HB 3QBYA 5KE2A 3L2RA 2YUNA 1S72A 2PQWA 4PJOB 3CCET 1EX4A 2JOYA 4M7AC 4C92F 2G6FX 1OU8A 2RHZA 4OMFB 3V7RA 4N4HA 3CMEQ 3OS1A 3TSZA 4QT7A 3GP8A 2OAWA 4EIKA 2A3LA 2DXTA 4JJCA 3H6ZA 3GIBA 4X34A 2R57A 5GAN8 2WSCE 1RAFB 2P0QA 1HYOA 2X35A 3S6WA 2CZ6B 1IGUA 2PTKA 3HKSA 3JV3A 1X6GA 3TCJA 1M8MA 2HKQB 2X4JA 5LJ3g 4JJDA 3I35A 3PNWC 4EMKA 1XQHA 1P92A 5IHKA 5CR2A 4C5HA 4BDYA 5I2SA 3NHNA 2BZXA 4AFQC 3M0PA 3CC4T 2FB7A 2JTEA 2K9GA 1ZLMA 3M56A 5GAMj 2MK5A 2JXBA 4XAXB 1YJNA 2BE7D 4C92C 1WGSA 2FYKA 3H41A 2G3RA 1NJIC 1LJOA 2EYYA 5AYFA 3EGDA 2IG0A 3V8LA 3CCLA 2K3BA 4PJOA 4BE2A 3MEUA 3VS3A 3HPWA 2EYXA 2ZPIB 3OW2A 4OB0B 2RH2A 5DLOA 2DL4A 1GCPA 4E2FB 4RCBA 4A53A 1BKBA 4JRPA 4AMCA 1VQNQ 1FMWA 1KHCA 2C0IA 3WVDB 4Z02A 2DXCA 4M75E 3CBPA 1JU5C 1TUGB 2RI3A 4FM4B 1M2OA 3MEWA 1WFWA 1AT1B 5EG2A 3O8VA 2OI3A 2QA4A 3S3NA 4F7UG 2X4WA 1RAHB 2ZZDA 1VYTA 4QVDA 1YJ9Q 3JCMX 3CCLT 4DEXA 2E5KA 1YJWT 2VWFA 1AVZC 1IHVA 2F2VA 4MZTA 3RR6A 5I21A 2QQSA 4L59A 1HD3A 2EGAA 2DA9A 2M9UA 2PU9B 2KYMA 2DVJA 1D09B 1X2QA 1O9SA 3WXMB 5J39A 1QVFA 3HSBA 1BB9A 1BU1A 1JXOA 3M57A 1JJ2A 2RN8A 3OYBA 1JO8A 5FWCA 5FLXE 2DD4A 1YHQQ 3DKMA 2JW4A 4CC4B 1Q81U 2RF0A 2O01E 5GANg 2MPXC 2WSFE 4F14A 4FYVB 1VQPQ 5HK0A 4M7DF 3CPWS 2VUBA 4KUDK 2AHJB 2QA4T 5I22A 1N8RC 1QKWA 1HXDA 1VQNA 1BI0A 1VQMA 2F1LA 1KK7A 4ZGDB 2DIGA 1BYMA 4RKUE 3CD6Q 2JUFA 4B9XA 4FW1A 1VQ5Q 4PJOG 4J9FA 1QVGA 1WXUA 4PJOD 3JCMe 1WPYA 1WXBA 3RESA 1M90U 1W2BP 5A0DA 5KYWA 1KIKA 3AHUA 2E3IA 3CXCP 3CCUT 1YJ9A 1GXIE 2AKLA 2ZPFB 3V8KA 4OB1B 3QUIA 3OYJA 4OGCA 4LDUA 1V1CA 3MO8A 5FWBA 4XQ3A 2EJFA 4LXCA 5FRMA 4II1A 4ZN1A 1UGQB 1U06A 2COZA 1Y71A 2M0OA 3SFMA 3M0QA 2HL5C 2XDDA 2DD5A 2KRSA 4ZN3A 4Q5WA 4XU2A 2KROA 3VJPA 4JS4A 1PKSA 2LCSA 1YHQA 1VQMT 2EJGA 2VC8A 2XD0A 4JZ4A 1K73C 1ARKA 2EGCA 1KQSP 2RD1A 4M7DC 4OMQA 2V26A 1PD0A 4ELZC 2CP2A 4J9BA 1TSFA 1K8AC 1NEBA 3ZFJA 1VQOA 2CREA 4M78B 1SPKA 1SRLA 1WHJA 2FG0A 1RABB 2EYQA 1DJ7B 3CCSA 4F04B 2D8JA 3G4SQ 1M3CA 4A54A 3T9NA 1N6AA 2LJ0A 2RMOA 3HRUA 2QQRA 2DRKA 3CD6A 1UJ0A 3X25B 4FT2A 4J9GA 1M3AA 1K9MR 1RLPC 1YCSB 1X27A 1ZSZC 3SEMA 4OMOA 1M27C 5KYUB 4C0FA 1LCKA 4JJNK 1PM3A 1W1FA 4J7IA 2NYSA 3RKWA 1ZUYA 1ZBXA 2ECZA 2SRCA 2PZ1A 2QGGA 4XTZA 4XU3A 2V1RA 1I81A 3AT1B 1VQOT 2RQWA 2P4RA 4C0DB 1IHWA 1BIAA 1YITA 1LOJA 4DEYA 3DLLA 3CCST 1M5Q1 3HP9A 1OPKA 3JCMg 4ELYC 2DXBA 5KYYB 1VIFA 2FEIA 2NUTA 3SWNA 1TUCA 1K76A 1WQ7A 2VKNA 1XOVA 4IUVA 1MMAA 3PFSA 2CH4A 4DBHA 2EPDA 3MP1A 4IUPA 1Q82U 2DL8A 2XHCA 3RBBB 4M78A 1VQLQ 1TWBA 3OYCA 5KCHA 5GAN4 3A8MB 4HCCA 4VUBA 1WYXA 1YITT 3BY7A 2HBWA 3OSVA 2NUPA 3QO3A 5IAYA 4QW2A 4MZPA 2EBPA 1UHFA 5KYUA 5LL6S 2R5MA 4PKCC 3LGFA 2L89A 3M58A 2DAQA 1N8RR 1TU0B 3JB9H 2DERA 4PFZA 3I55T 3I56T 3X24B 5LJ3h 1X01A 2D9TA 3A5ZB 1K9AA 2KXCA 3FRNA 1Q7YR 3EG0A 3JCMQ 1QW1A 5LJ3f 1PSEA 3QZ5B 1RL2A 2F2XA 4XTUA 4IIOA 3R6NA 1Q86C 4BDZA 3JCMc 4DOWA 2ESWA 4BE0A 3TQ7P 3OY9A 2J6OA 2F69A 2FZKB 2C06A 2VGNA 3OSSC 4C8QF 4RCCA 2CUBA 1TS9A 1C0MA 3FC3A 2RPNA 2KY9A 3G71Q 3ZEHA 4EMGA 3CCRT 3SB2A 1ZUUA 5KE3A 3KXTA 1PRMC 1R0CB 3G7ZA 2O4XB 2DL5A 3TREA 5LJ5d 1OX9A 2HDAA 2OTJA 4Z88A 2KK4A 3PMIA 1VQLA 2V8JA 1KC8U 2C0OA 4OP0A 2M51A 2CH4W 3FJ5A 4FYYB 1I8FA 3PMTA 4D8DA 3EG1A 1XJWB 1MGQA 2BUDA 1K8AR 2E41A 2LT4A 3SHWA 2QI2A 3CCEQ 4KT0E 1VQ8A 3OYNA 4JPBW 3C4SA 1KQ2A 4KGXB 4M78G 2OAUA 4M78D 3QSUA 3J7AF 2KXDA 3EAEA 1WHLA 2LJ3A 3G6ET 5FU6C 3E1SA 2CYZB 1JB0E 1ACMB 2HNIA 3PT9A 4C8QC 2LT1A 3V8JA 3NGPA 2W0ZA 3M0RA 1FXXA 1O75A 1T0JA 2KNBB 3ZL7C 3CMAT 2VGMA 2B8AA 1FMVA 2HQXA 4IKFA 2HEQA 4C5EA 5GANh 2OTLA 3CC4Q 4MMKA 5GAN2 2QEXA 2JJ9A 3L1AA 2MWPA 2ZPBB 2K3XA 4F7UB 1SG5A 2O4XA 2E4HA 1N27A 5KH6A 5GANf 1LVKA 4EPCA 2JVVA 3BDUA 3RKXA 5LJ3j 2A28A 2ED0A 2Y90A 3LWHA 1JJ2P 4BB7A 4X1VA 2RM4A 2FPFA 1OEBA 1M1KU 3LH5A 3FJPA 3MEAA 2YLCA 2RQRA 3FLGA 3OYKA 4V2SA 3MPUB 1OI1A 4M75C 1BBZA 4HKEA 3H0FA 3PE0A 1PWTA 3A8GB 2X9HA 5FU6B 3UT1A 1VA7A 2HSEB 4HCBA 2V8IA 3EFOA 3UPUA 4C8QB 4HT9A 3REBB 3QWXX 3TSWA 4PK4A 1UECA 3EGXA 1HSQA 1EFNA 1NJIU 5CVIA 2DKGA 3VS6A 1QVFS 4DOVA 3THKA 3SD4A 3SDZA 5CQYA 1R0BG 2XU8A 3MP6A 2KVQG 5GMKe 1YJNQ 2ZPEB 4IUQA 1SSHA 1KD1U 1XTDA 3OS0A 2EAYA 1C1AA 3RIRA 3CC4A 5GMKj 1Q86R 4FCYA 3CCLQ 1X75C 3DB4A 3MP8A 4HXJA 1YJWQ 4LUEA 3ULRB 1YBYA 1WHMA 4KUIA 2XDBA 1RAGB 4F7UA 1M2VB 2L5QA 1WIEA 5DLQE 2COYA 4N0AC 3C95A 4BI8B 1WHHA 2LDMA 3VS4A 2K57A 1U3OA 2E5QA 1QVGS 3J80E 4GBQA 2LCCA 4RTVA 1KJWA 4F7UE 1G8XA 3IQLA 1WJQA 3J81E 2F5TX 3BE3A 3GF5A 2FZCB 3FEOA 3NPFA 3OYHA 4J9CA 1UJYA 1PD1A 2QA4Q 5GANe 2LMJA 5IT9E 1G3WA 1HJDA 1AWWA 5KYXA 5GANj 2RJEA 1H3ZA 4IIMA 5IXFA 4R55A 2QYZA 4LDXA 1M30A 2RQTA 1VQKT 2PNIA 5CKEA 4M7AB 3JB9J 2MIOA 3OBWA 5CQXA 3JCMh 4ESRA 1JXMA 3VUZA 3OQ5A 2CP6A 1AD5A 2CP5A 4C5GA 3CCUQ 5J3BA 2NLUA 1K9MC 2ABLA 3FDRA 3JCMf 1X2KA 1YJWA 3HRTA 1VQ7A 4RTYA 2ED1A 2YXYA 2D0NA 4BACA 1GCQA 2ROTA 2SEMA 2VXFA 2VYTA 1H92A 4M77F 5GMKm 2FRYA 5A2QE 4OB2B 2JT4A 4LDVA 4PJOE 2QASA 1BI1A 2ZPHB 2JM8A 4FT4A 3M59A 1SF9A 3TU4K 2MAMA 2YRVA 1VQMQ 1Z9QA 2CP0A 1TXQA 5FRNA 1M3BA 2DVEA 5IXBA 1MMDA 4QQ6A 3QIIA 3CCVA 2DZCA 1RI9A 3CPWP 1WQWA 4F16A 3EG3A 3D7SB 4FIBA 1T3LA 4E7IA 2LQ8A 3HFNA 1VQ7T 3META 4FU6A 1Y0MA 1OQKA 1WI7A 2MI6A 4N4IA 4C92B 4IUTA 4L6V5 1VQ4A 3CCMA 2MYSA 2JMCA 1VOMA 2OJ2A 4C5IA 3LWIA 1NYGA 2IIMA 2FHDA 5D6WA 2FVUA 3UF4A 1B07A 2DX1A 4M7AA 3CCUA 1NZ9A 1NLPC 3REAB 2DM1A 2QAZA 2AZVA 1VUBA 5GMKl 2PVGB 1BI3A 4XTYA 4A4HA 4C8QG 2AIRB 4C8QD 5GAN3 2DMOA 5D6XA 3CCVT 4M77C 1VQOQ 2EGEA 2VXEA 3GBQA 2RHXA 1RAAB 4M7AE 4YTLA 2H3EB 2CT3A 3VRZA 1AWOA 2ZGWA 2A36A 1MV3A 3CCSQ 4LE9A 1YI2A 1IRXA 1Q7YC 3JB9G 3JB9D 2JNGA 3M4GA 5GAMg 1VQ4T 3CCMT 3OYGA 4EMHA 2YHTA 1PSFA 2LX7A 2EWNA 3KUFA 2EYZA 4BD3A 2LNHB 1YN8A 3OYMA 2FPEA 2K2MA 4A4FA 2KDSA 4Z89A 1E7OA 5GAMd 2HCKA 2DLPA 3QJ6A 3LYIA 1JRIA 1FWZA 2CP7A 1VQ6T 2DYBA 4RG2A 3CBMA 3ER0A 1UGSB 1YITQ 4C92A 2I0NA 4KGZB 1IZ6A 3EH1A 5GMKi 3EG2A 4RTXA 1B34B 1I0CA 2DBKA 1YI2T 1G83A 2CDTA 4M77B 2DILA 6AT1B 3JCMP 3JCMb 4KULA 3PIPA 1X69A 2DYIA 2P84A 1M1KR 4FL6A 4C92E 2DK3A 4ZNXA 2KEAA 4JRQA 5CKBA 2CT4A 3I5RA 4PJMA 1G3TA 1I5OB 4A4EA 4OB3B 4M7AG 1UDLA 4M7AD 5KCOA 3CCRQ 2A7YA 1I4K1 1Q81C 1G5VA 3M54A 1M1GA 2GBQA 1IGQA 5GAOn 1VIEA 4X9DA 1WA7A 3A1PA 2LQWA 3HHTB 1WLPB 3GOXA 1SEMA 3M0UA 3R6OA 1KQ1A 4E7SA 3A8OB 1BCOA 1RAEB 1AWXA 3CCJA 4O5VA 1KD1R 2V8KA 2WSEE 2F5KA 2KQWA 3UDCA 2M0YA 4RTTA 4JLIA 4OMLA 2M1HA 2Y4XA 4BI4A 4OVAA 3NTHA 3GLXA 3L2WA 1M90C 2AKKA 4M7DB 4JRIA 3S3MA 5L8RE 3I55A 3I56A 2GFUA 2IVWA 3EHRA 1FX7A 3QDRB 1VQPT 1V76A 2E64A 3C0CA 2GTOA 3NFCA 2PVOB 3CEYA 4FSXA 2EKHA 2RHYA 3JB9I 1PRLC 2HSPA 2XKOC 3C94A 2M02A 2OTJQ 3X20B 2LQNA 4C92G 4C92D 1QCFA 1OZ3A 1ZSZB 2FRWA 5IH2A 3CC2T 1GL5A 2MWOA 4RMOA 2DTHA 3CCJT 2PUOB 3OMGA 4Y28E 3EFRA 1BIBA 3CCRA 3CMAQ 1I07A 2X4XA 3OB9A 1LPLA 2RI2A 2XIDA 1AOJA 4N4GA 3E9GA 4ATOA 4PFPA 3JCMV 3VS2A 4M78E 1YIJA 1ABOA 2XMFA 4HVVA 5CKHA 1VQ8Q 4CC7A 3X26B 1NE8A 4KH0B 2M16A 2KT8A 2DF6A 5D6YA 2YRDA 2CS7A 2O31A 1WJSA 3LGLA 3VYHB 2J6FA 2ATCB 2KMTA 2C0TA 3VUBA 3H9NA 4A4KA 3EG9B 1GFCA 4J6XA 3NTKA 2JS2A 4M4ZA 1TTHB 1MNDA 4OF1A 3BFMA 1SHGA 5LJ5g 2DETA 3JSCA 1RLQC 4JS5A 4M7DA 1J3TA 2LRQA 2IPOB 5KYYA 3RNJA 2E1HA 1F1BB 3HFOA 1H8KA 1YIJT 2ZAEA 1ZSGA 5CIUA 3G6EA 1OV3A 3LW5E 2OTLQ 4J9IA 1G3SA 3M5AA 2QEXQ 1ZX6A 1T3SA 2YUPA 1WHKA 4IURA 5EC7A 2DL7A 2LQKA 4M7DE 4WF2A 4J9DA 2KR3A 2JMAA 3CMAA 1AWJA 4R56A 3ME9A 1ZSZA 4QQGA 1K1ZA 2YT6A 3MCAB 5GMKh 1K0XA 1W2BA 3RMSA 2B86A 2LP5A 2YUOA 4M77G 5HY6A 3LX7A 2DPPB 3OW2P 4PJOF 4AG2C 2D1XA 3TEEA 1Q82C 4M75F 3L2ZA 3JRZA 3A98A 3M55A 2FO0A 4JZ3A 2LNVA 2P4TA 2BIVA 4KRTA 4E7JA 1ZHIA 2JM9A 1Q81R 2AT1B 4DBQA 4E7HA 2EQKA 2HL3A 5CO7A 1WDXA 4LD9K 3CBOA 2JS0A 5FU7C 3EG9A 3HRSA 1JQQA 2L3SA 2FZGB 2LZ6B 5A0LA 1QP2A 1TG0A 3L2VA 4EMKC 5A0GA 1KQSA 1W6XA 1VQ9T 1GBRA 4GLMA 2E10A 3ASKA 4J6YA 4J6WA 1X6BA 2LTOA 3OS2A 5L23A 1UUEA 2D8HA 1H3HA 4FSSA 2P0KA 4O6JA 5GAN5 1M90R 4PLLA 4HCKA 2QDLA 2K7AA 4LDWA 3EGUA 3E19A 2KE9A 1VQKQ 1QVFP 4BE1A 3VRYA 3M0SA 2BZYA 2MOXA 2J06A 4E7LA 4M7DG 4M7DD 3OYFA 4PJOC 1I1JA 1D0ZA 3OYIA 1E6GA 2EQUA 2DRMA 5GAN6 1BCMA 4WCIA 4CC2A 2A08A 4QKUA 5GAMf 4GLKA 1SKUB 2E70A 1KC8C 5HKCA 1E6HA 1AHJB 4OMPA 1X6OA 5GJVB 2D0QB 4FYXB 1YWOA 5HCKA 3UWNA 2DO3A 4E7ZA 1MHNA 4OGEA 3OYAA 2J6KA 2ENMA 3OA6A 2RJFA 2QDYB 3G71T 1UGVA 4ME7A 1QVGP 1IB8A 3VS7A 4E47A 2AZSA 2BE9B 2EYWA 5GAOp 2O2OA 1OPLA 3I5SA 3HL8A 2O9VA 4JDSA 3H0HA 1NEGA 1VQ7Q 1W70A 2KAFA 1H641 4L5GA 4Z8AA 1X43A 1VQKA 3EGDB 1ABQA 2R58A 3RKYA 3OS5A 5I11A 1D0XA 1CSKA 2W10A 4M75B 4NL3A 3CCQA 2XDPA 1NPPA 2KYBA 4CRIA 2RNAA 2K79A 1IO6A 1I5LA 1WXTA 1Q95G 1ZA1B 3CCVQ 3CC7A 1MMGA 3MJXA 4DBRA 3NMZC 3PVQA 2L0AA 4C8QA 3QYGB 2E6NA 5M9OA 2R5AA 1SSFA 4KH1B 3KBGA 3BDLA 1M1KC 1N9RA 3EHQA 2ZCFB 4QVZA 1VQ4Q 1KSWA 3CCMQ 1M8VA 1S72T 1BI2A 3OYLA 1N9SA 1Q82R 2L3RA 4RTZA 3DLMA 5ECAA 3E2UA 2DEUA 5GAMe 4C8QE 2QXFA 3CCQT 1BK2A 1GRIA 4RTUA 1MMNA 5LJ3d 1N8RU 7AT1B 1G3YA 2EQIA 2EJ9A 1VQ6Q 2FL7A 3EFSA 4A4GA 3C12A 1Q7YU 3CC7T 2HKNA 2HD0A 1QLYA 4J5YA 4XU0A 3PIOA 1RAIB 5J26A 2XG8D 1M2VA 3HTRA 1KG1A 1QP3A 1YI2Q 2MMPA 1KD1C 2GTJA 3CMEA 4M75A 3PTAA 2QG9B 3M0TA 4D8KA 3OMCA 4XU1A 4HCZA 3ZBDA 4RUGA 2E6ZA 1PC0A 2L2PA 1RACB 2L8DA 4J8OA 4JLGA 1JBMA 5CAIA 4M78F 3DB3A 1IXDA 2CZ0B 5HK3A 3QKJA 4GY5A 3UA6A 4AFUC 5GAOm 3CPFA 2HBPA 5KYWB 1SRMA 4AG1C 3VS1A 1YJNT 1UTIA 1K0SA 1NG2A 1K73U 2K5LA 2K3YA 2P0PA 2PVDB 2VASA 5LJ5h 1KC8R 4HVWA 2EQJA 1K8AU 1ZQ1A 2RQUA 3CMET 2X3WD 2MF2A 5LJ5f 3H8ZA 2DE0X 1R8OB 1KFZA 5CKDA 2KSSA 3JAME 2DXUA 3TVTA 2GFAA 3H0IA 3V7SA 1VQ6A 4AFSC 3M53A 1LNXA 2F2WA 2RJDA 2RB6A 4WTOB 4N0AA 5GAOr 2EQMA 4ZTJA 2J05A 3M9QA 4PL6A 1MNEA 3SWNC 1U5SA 4QVCA 2OX7A 1UGPB 5IN1A 5C6SA 4FW2A 1K4US 1KHIA 2DFUA 2QTXA 2JTMA 2QQBA 1N5ZA 2RHIA 3VV0A 4DA4A 1U1SA 3L42A 2RI5A 2A37A 5GAOl 4P5NA 1NPRA 3P8DA 2X3XD 4M78C 2EVRA 5GANd 2DL3A 2X51A 2O88A 3X28B 2YDLA 1NBEB 1AZEA 4D6WA 3LLRA 4QQDA 3CC2Q 4C0ZA 2CSQA 3CCJQ 1RADB 1FMKA 3MKDA 4M75G 3S3OA 4M75D 3BW1A 4LD6A 2YLBA 1HK9A 1Y07A 2AK5A 2LCLA 3URGA 3CQTA 3I55Q 3I56Q 2KI7A 8ATCB 1GBQA 2DJZA 1PHTA 4J7FA 2CKKA 2GCXA 1MUZA 3RDVA 2LX9A 2NUTB 3F70A 3SWNB 4C0DC 1VQNT 2H3JA 1OX8A 4XTWA 2PUKB 1PKTA 8AT1B 2FPDA 3VS0A 1CKAA 4DQ2A 2JZ2A 1W2BS 2RQVA 1VQPA 1Z9ZA 2KT1A 3CXCS 1ZBJA 1C6VX 2K4YA 2RHUA 5LJ5e 1YJ9T 1WJRA 1OYXA 3QZ9B 1YIJQ 2RJCA 2RA2A 3A8LB 1NJIR 5CCAA 1NLOC 3P8BB 3VYGA 4JRKA 5LJ5j 2Y4YA 3PGGA 1VQ5A 2NUPB 2QGFB 1Q86U 2GF7A 2H8HA 5DY9A 3CC2A 1A0NB 4RTWA 1WNLA 2A0FB 1UHCA 3VKIA 2CGHA 4ZGEB 2I2LA 4CI0C 1SHFA 2BTTA 2E65A 1PNJA 3M4YA 5IHNA 1YHQT 3LH0A 1KQSS 1WZOA 4LNPA 2KRMA 3U23A 1QMCA 2CSIA 4RG8A 4MDWA 5CK9A 3O5ZA 2VVKA 1B34A 2DNUA 2O9SA 2KGTA 5GJWB 2CZ7B 4M77A 5AT1B 3E9FA 5CKFA 1UGRB 4E6RA 1D1AA 3OYEA 2LVMA 3G6EQ 1AEYA 4XTVA 3CD6T 5GAN7 4NL2A 3UATA 1VQ5T 3RMQA 4FYWB 1B3QA 3OYYA 3GPLA 2L3QA 1OZ2A 4HA8A 4BUGA 1IREB 4OMNA 2GNCA 4M77E 4MZMA 1EZZB 2YWWA 1OULA 2EFIA 1VQ9Q 1M4ZA 1M9SA 1JEGA 2QQ9A 1UB4A 4J9HA 4BI3A 3JCMd 1S1NA 1Y96B 3G4SA 4DBFA 4AT1B 3CPWA 1Y57A 1B7TA 1NM7A 1XNIA 4J83A 1UE9A 2V1QA 5FW9A 4PJJA 1D1CA 5GAOq 1D3BB 2DTIA 1ZUKA 2EIFA 4F7UF 3VS5A 3GNFB 1FYNA 1QKXA 4PJLA 2CZ1B 2MCNA 4OMMA 4NS5A 4LDYA 4NOYA 1TH7A 1V29B 2Z0WA 2DBMA 4PFOA 1EIFA 1YFNA 2GQIA 1PCXA 4BY6C 2K2VA 3I9QA 2YRCA 3QG1A 3QXEB 4ORZA 1R77A 2XI9A 2DZ9A 3G4ST 2D6FA 1TUDA 1ZA2B 3RUXA 3EH2A 4MMLA 2K5FA 2HZYA 2JTFA 2LC4A 2GQVA 2X4YA 2RO0A 2RK1A 4F17A 1UEBA 1WX6A 2RK2A 4B9WA 1OOTA 1PG5B 1YWPA 3UA7A 2KBTA 1VQ9A 3P8HA 2BZ8A 4E7KA 1YNZA 4B6MA 2HMAA 4JJBA 3WVEB 3JB9F 1AZGB 1OU9A 4AFZC 3CXCA 4M77D 1WHGA 1VYVA 2COWA 1Y96A 1YCYA 2K6DA 1U8RA 1CKBA 1QCNA 1K73R 2L3PA 1U1TA 2J7IA 2BKDN 3QHSA 1D3BA 4LUDA 5D7UA 4EDUA 4IUUA 2HAXA 3QYHB 4KBMB 4BY6B 1G2BA 3PVLA 2YSQA 2GGRA 3EFOB 1QVPA 4PJNA 2DEQA 1NYFA 4XTXA 3JCMJ 3OBYA 3V7CA 2VV5A
chains in the Genus database with same CATH topology
3SWNA 3CC7A 1WQ7A 3FIFA 4C0GA 1XOVA 1YI2A 4XK8E 3OYDA 4IUVA 1Q7YC 3JB9G 3JB9D 3RERA 2JNGA 3M4GA 5GAMg 3INZA 3QJYA 1VQ4T 2OTJT 4C8QA 3QYGB 3PFSA 2E6NA 5M9OA 2R5AA 1SSFA 3OYGA 4EMHA 3CCMT 2YHTA 3KBGA 3BDLA 1PSFA 2K5IA 1M1KC 1VQLT 3MP1A 1N9RA 2EWNA 3KUFA 4IUPA 2ZCFB 2XHCA 4QVZA 1Q82U 4X9CA 4M78A 3G71A 4MDXA 1M8VA 1S72T 1BI2A 1W4SA 3OYLA 1N9SA 3Q1JA 4BD3A 3FB9A 2L3RA 3OYMA 5C0MA 5KCHA 3OYCA 2DIQA 4A4FA 2KDSA 3DLMA 5GAN4 1M1FA 5GAMd 5GAMe 4C8QE 3VU3C 3QJ6A 3LYIA 4TVRA 2QXFA 3A8MB 3CCQT 4HCCA 4VUBA 5DM7R 1JRIA 3OW2S 4PNOA 1FWZA 1YITT 3BY7A 1VQ8T 3OSVA 3QO3A 5IAYA 1VQ6T 5LJ3d 5LJ3e 4RG2A 1N8RU 4QW2A 4M7AF 4MZPA 5GAMh 3CBMA 1G3YA 3ER0A 5LL6S 2R5MA 1UGSB 4PKCC 3LGFA 4JUVA 2L89A 4Y91A 3M58A 2DAQA 4HT8A 3JB9H 4C92A 2EJ9A 3MHXA 2FL7A 3I55T 3I56T 1IZ6A 3EFSA 3X24B 3C12A 4A4GA 5LJ3h 1X01A 5GMKi 1Q7YU 2D9TA 3A5ZB 3CC7T 1B34B 4PLIA 2EKOA 2HD0A 1YI2T 4J5YA 4XU0A 3FRNA 3PIOA 5J26A 2XG8D 1KG1A 1QP3A 3NTIA 1QW1A 4M77B 3JCMQ 3CCEA 3JCMP 5LJ3f 1PSEA 3JCMb 4KULA 3PIPA 2MMPA 3QZ5B 1RL2A 4XTUA 5FU7B 1KD1C 3MEVA 4FL6A 3CMEA 4M75A 3JCMc 4C92E 2JN0A 2DK3A 4DOWA 3PTAA 3N5BB 4BDZA 4EMKB 4BE0A 3OMCA 4XU1A 4ZTFA 2ZPGB 4HCZA 5FROA 3ZBDA 4JRQA 3OY9A 3L2QA 5CKBA 2E6ZA 2F69A 2C06A 2VGNA 3OSSC 4UC4A 5I2MA 4C8QF 4RCCA 3FC3A 2KY9A 2XICA 2XK0A 3ZEHA 1G3TA 4EMGA 3CCRT 1K9MU 3SB2A 2L8DA 4J8OA 1Y7XA 4JLGA 4A4EA 2DTOA 4OB3B 4M7AG 2QQAA 1JBMA 5CAIA 5KE3A 2WACA 2OTLT 4M78F 3DB3A 4M7AD 3KXTA 2QEXT 2CZ0B 5KCOA 5HK3A 3QKJA 4GY5A 2A7YA 2E12A 5GAOm 3CPFA 1I4K1 2HBPA 3G7ZA 3GNGA 3L2UA 1Q81C 2O4XB 3M54A 1G5VA 1M1GA 3TREA 4ZGJB 2HQEA 1RI0A 3QPHA 5LJ5d 3JCMW 5GAOn 2OTJA 1YJNT 1VIEA 4X9DA 1JJ2S 2KK4A 3PMIA 1VQLA 2V8JA 1KC8U 3HHTB 1K73U 2K5LA 3A8HB 3GOXA 3R6OA 4OP0A 2K3YA 1KQ1A 3QBYA 2P0PA 2PVDB 5KE2A 5LJ5h 3L2RA 3A8OB 1S72A 1I8FA 2PQWA 4PJOB 3PMTA 3CCET 2EQJA 2JOYA 4M7AC 1K8AU 4C92F 1ZQ1A 3CCJA 4O5VA 2RHZA 4OMFB 2V8KA 3CMET 2MF2A 1MGQA 2BUDA 5LJ5f 1YJNA 2E41A 2LT4A 3H8ZA 1R8OB 2QI2A 2WSEE 3V7RA 5CKDA 2KSSA 4KT0E 1VQ8A 3JAME 2DXUA 2F5KA 4N4HA 3OYNA 2KQWA 3UDCA 2GFAA 3V7SA 1VQ6A 4JLIA 3M53A 2M1HA 2Y4XA 3C4SA 4BI4A 1LNXA 4OVAA 3OS1A 1KQ2A 3GP8A 2RJDA 3NTHA 2RB6A 3GLXA 3L2WA 4N0AA 5GAOr 2A3LA 2DXTA 2EQMA 4M78G 4ZTJA 4JRIA 1M90C 3S3MA 4M7DB 2OAUA 3M9QA 4M78D 5L8RE 3I55A 3I56A 2GFUA 3J7AF 4PL6A 3QSUA 2IVWA 3SWNC 1FX7A 3H6ZA 3QDRB 3EAEA 1VQPT 3GIBA 4X34A 2R57A 4QVCA 1UGPB 5IN1A 3NFCA 2E64A 5C6SA 1KHIA 5GAN8 2WSCE 2P0QA 3G6ET 5FU6C 3E1SA 2QTXA 2CYZB 2X35A 2JTMA 2QQBA 2CZ6B 2PVOB 1JB0E 2RHIA 3CEYA 2HNIA 3PT9A 3S6WA 4FSXA 3VV0A 2LT1A 3HKSA 1U1SA 3V8JA 3TCJA 2RHYA 4C8QC 4DA4A 3L42A 2RI5A 2X4JA 5LJ3g 3JB9I 2XKOC 3C94A 5GAOl 1FXXA 1O75A 4P5NA 3PNWC 3X20B 1NPRA 1XQHA 1P92A 3P8DA 4EMKA 4C92G 4M78C 5CR2A 4C92D 4C5HA 3CMAT 4BDYA 2VGMA 1OZ3A 5GANd 5I2SA 3CC2T 2B8AA 2MWOA 4RMOA 2DTHA 3CC4T 2FB7A 3CCJT 2HQXA 2PUOB 3OMGA 4Y28E 4IKFA 3EFRA 3X28B 1BIBA 3CCRA 4C5EA 2X4XA 3OB9A 4D6WA 3LLRA 4QQDA 2RI2A 2XIDA 4N4GA 5GANh 4C0ZA 2OTLA 4MMKA 5GAN2 3E9GA 2QEXA 4ATOA 3L1AA 3JCMV 3M56A 4M78E 2MWPA 5GAMj 2ZPBB 2K3XA 4M75G 4F7UB 1YIJA 3S3OA 4M75D 2O4XA 3BW1A 5CKHA 1N27A 3X26B 4LD6A 2YLBA 5KH6A 1HK9A 1Y07A 4XAXB 4EPCA 5GANf 2JVVA 3BDUA 4C92C 1WGSA 2FYKA 3RKXA 2G3RA 1NE8A 2LCLA 3URGA 5LJ3j 1NJIC 2Y90A 1LJOA 3LWHA 2M16A 4BB7A 5D6YA 2RM4A 5AYFA 2CS7A 2IG0A 3V8LA 1WJSA 1M1KU 3LGLA 3CCLA 4PJOA 3VYHB 4BE2A 3FJPA 2KMTA 2YLCA 3FLGA 3MEAA 3MEUA 3VUBA 2DJZA 3HPWA 2ZPIB 3OYKA 4A4KA 4J7FA 3OW2A 4V2SA 4J6XA 1OI1A 3NTKA 4OB0B 2CKKA 2RH2A 2GCXA 2LX9A 4M75C 4HKEA 5DLOA 3F70A 3SWNB 4OF1A 4C0DC 3BFMA 1VQNT 2H3JA 5LJ5g 4RCBA 3A8GB 3JSCA 4A53A 1BKBA 5FU6B 3UT1A 4JRPA 4XTWA 4JS5A 4HCBA 2PUKB 2V8IA 3UPUA 4M7DA 2LRQA 1KHCA 4C8QB 4HT9A 3WVDB 2E1HA 4Z02A 4DQ2A 2DXCA 2JZ2A 4M75E 1W2BS 3CBPA 3HFOA 1VQPA 2RI3A 3CXCS 1YIJT 2K4YA 4FM4B 5CIUA 3G6EA 2RHUA 3LW5E 3MEWA 5CVIA 2DKGA 5LJ5e 1NJIU 1G3SA 3M5AA 1YJ9T 1QVFS 1WJRA 4DOVA 1OYXA 5EG2A 3QZ9B 3SD4A 3SDZA 4IURA 2RJCA 2RA2A 3A8LB 3O8VA 5CCAA 2LQKA 2QA4A 3P8BB 3S3NA 4M7DE 4F7UG 2X4WA 2ZZDA 2XU8A 5CQYA 3MP6A 2KVQG 4WF2A 3VYGA 4JRKA 4QVDA 5GMKe 5LJ5j 1Q86C 2Y4YA 2ZPEB 4IUQA 3PGGA 1VQ5A 3JCMX 3CMAA 3CCLT 1KD1U 4R56A 1XTDA 3ME9A 1Q86U 2GF7A 4QQGA 3OS0A 1YJWT 2EAYA 5DY9A 3CC2A 3RIRA 3CC4A 1WNLA 5GMKj 3MCAB 5GMKh 4MZTA 5I21A 3VKIA 2CGHA 4ZGEB 2QQSA 4L59A 1X75C 2I2LA 1W2BA 4CI0C 3RMSA 2E65A 2M9UA 2PU9B 3DB4A 3MP8A 4M77G 5HY6A 1YBYA 4KUIA 3LX7A 3M4YA 2DPPB 1YHQT 2XDBA 4PJOF 1O9SA 3WXMB 4F7UA 3LH0A 5J39A 1QVFA 3HSBA 1KQSS 3M57A 1JJ2A 3TEEA 2L5QA 1Q82C 5DLQE 3OYBA 4M75F 4N0AC 3C95A 4RG8A 2DD4A 4MDWA 4BI8B 5FLXE 5CK9A 3DKMA 3L2ZA 3JRZA 3M55A 2LDMA 1B34A 1Q81U 2LNVA 2P4TA 2BIVA 2O01E 5GANg 2K57A 4E7JA 2E5QA 1QVGS 1ZHIA 2WSFE 2CZ7B 3J80E 4E7HA 4M77A 2LCCA 2EQKA 3E9FA 5CO7A 5HK0A 4M7DF 5CKFA 4F7UE 3CPWS 4LD9K 1UGRB 2VUBA 3CBOA 4KUDK 1WJQA 5FU7C 2AHJB 2QA4T 3HRSA 2LVMA 3J81E 3OYEA 1N8RC 1HXDA 2F5TX 5A0LA 4XTVA 3GF5A 1QP2A 3FEOA 3OYHA 5GAN7 3L2VA 3CD6T 4NL2A 4EMKC 5A0GA 1VQ5T 1VQNA 3RMQA 1KQSA 1BI0A 5GANe 3OYYA 1VQ9T 1VQMA 3GPLA 1OZ2A 4HA8A 2DIGA 1IREB 4BUGA 4RKUE 4ZGDB 2JUFA 5IT9E 2E10A 3ASKA 1BYMA 4M77E 4B9XA 1G3WA 4J6YA 4MZMA 4J6WA 2EFIA 4PJOG 1M4ZA 1M9SA 5GANj 1QVGA 2QQ9A 4PJOD 1UB4A 2RJEA 2LTOA 4BI3A 3JCMd 3JCMe 1WPYA 3RESA 1Y96B 3OS2A 1M90U 4R55A 1H3ZA 3G4SA 2P0KA 5A0DA 4LDXA 3AHUA 1VQKT 3CPWA 5CKEA 4O6JA 4M7AB 5GAN5 4PLLA 3CCUT 1YJ9A 1XNIA 3JB9J 1GXIE 4J83A 4LDWA 3OBWA 5CQXA 3JCMh 3E19A 2ZPFB 3V8KA 3VUZA 4OB1B 3OQ5A 3QUIA 4BE1A 3OYJA 4OGCA 5GAOq 1D3BB 2DTIA 4LDUA 4C5GA 3MO8A 2EIFA 4XQ3A 5J3BA 2NLUA 4E7LA 2EJFA 4M7DG 1K9MC 4F7UF 5FRMA 4II1A 3FDRA 4ZN1A 4M7DD 3JCMf 1UGQB 3GNFB 1YJWA 3HRTA 3OYFA 1VQ7A 4PJOC 1Y71A 3OYIA 4BACA 2M0OA 3SFMA 2EQUA 2CZ1B 5GAN6 2XDDA 2DD5A 4NS5A 4ZN3A 2VXFA 4LDYA 4NOYA 1TH7A 1V29B 4Q5WA 4XU2A 2VYTA 3VJPA 4JS4A 1EIFA 5GAMf 1YHQA 4GLKA 4M77F 5GMKm 1VQMT 2EJGA 5A2QE 2VC8A 2E70A 1KC8C 4BY6C 2K2VA 4OB2B 4LDVA 5HKCA 2XD0A 1AHJB 4PJOE 1K73C 1BI1A 2ZPHB 4FT4A 3M59A 1X6OA 3TU4K 2MAMA 2RD1A 2D0QB 3QG1A 4M7DC 2YRVA 3UWNA 2DO3A 4ELZC 3QXEB 1MHNA 4OGEA 2XI9A 1K8AC 3ZFJA 3OYAA 1VQOA 2DVEA 5FRNA 2DZ9A 3OA6A 2RJFA 3G4ST 4M78B 2QDYB 3G71T 4ME7A 2D6FA 4QQ6A 3QIIA 3RUXA 3CCVA 2DZCA 4E47A 2EYQA 1DJ7B 3CCSA 4MMLA 2K5FA 2JTFA 2LC4A 2GQVA 2X4YA 2RO0A 4A54A 3T9NA 2RK1A 1N6AA 1UEBA 1WQWA 2QQRA 3HRUA 3CD6A 2RK2A 4B9WA 3X25B 5GAOp 4FT2A 4FIBA 4E7IA 1VQ9A 3P8HA 2LQ8A 3HFNA 3HL8A 1VQ7T 4E7KA 3META 4FU6A 4JDSA 4C0FA 2MI6A 4N4IA 3WVEB 4IUTA 4L6V5 4C92B 1VQ4A 4JJNK 3JB9F 3CCMA 3CXCA 4M77D 2KAFA 1H641 4L5GA 1Y96A 1YCYA 4C5IA 3LWIA 4J7IA 3RKWA 2FHDA 1ZBXA 1VQKA 5D6WA 2FVUA 1U8RA 2R58A 4M7AA 3RKYA 1U1TA 3OS5A 3CCUA 4XTZA 1NZ9A 4XU3A 2BKDN 3QHSA 1I81A 1VUBA 4M75B 5GMKl 2PVGB 4NL3A 1D3BA 1VQOT 1BI3A 4C0DB 4EDUA 3CCQA 2XDPA 1NPPA 4IUUA 2HAXA 1BIAA 4XTYA 4CRIA 4A4HA 1YITA 4C8QG 3QYHB 4KBMB 4C8QD 5GAN3 5D6XA 1LOJA 3CCVT 4M77C 4BY6B 3DLLA 3CCST 1M5Q1 3HP9A 2VXEA 2RHXA 4M7AE 1I5LA 3JCMg 1QVPA 4YTLA 2DEQA 4XTXA 4ELYC 3JCMJ 3OBYA 2DXBA 1VIFA 3V7CA 2VV5A 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RK1 A;  3SFM A;  2RH2 A;  2RK2 A;  3T9N A;  3UDC A;  2GQV A;  1VIE A;  1VIF A;  2VV5 A;  2P4T A;  2OAU A; 
#chains in the Genus database with same CATH topology
 3FIF A;  4C0G A;  4XK8 E;  2ROL A;  4J9E A;  3OYD A;  3EGX B;  1D1B A;  1MV0 B;  3RER A;  1UFF A;  3INZ A;  3QJY A;  2OTJ T;  1QQJ A;  2K5I A;  1VQL T;  3G1J A;  4K11 A;  4X9C A;  3G71 A;  4MDX A;  4R0K A;  1W4S A;  3Q1J A;  3FB9 A;  1VYU A;  5C0M A;  2DIQ A;  4CC3 A;  1M1F A;  1S72 Q;  3VU3 C;  2QK0 A;  4ANJ A;  4TVR A;  2LJ1 A;  5DM7 R;  2DJQ A;  3OW2 S;  4PNO A;  1VQ8 T;  4LN2 A;  5LJ3 e;  4M7A F;  5GAM h;  3CCQ Q;  4HT8 A;  4Y91 A;  4JUV A;  2NWM A;  2VB6 A;  3QDF A;  1GCQ C;  3MHX A;  1QWE A;  4PLI A;  2EKO A;  2HQH A;  4KGV B;  4Y92 A;  5KYN A;  2CP3 A;  1RUW A;  3QWY A;  1GFD A;  3CC7 Q;  5IHI A;  3NTI A;  3CCE A;  2CUD A;  5FU7 B;  3MEV A;  2QTV A;  2JN0 A;  1QCO A;  3N5B B;  1YP5 A;  4EMK B;  4ZTF A;  2ZPG B;  5FRO A;  3L2Q A;  2NUZ A;  4UC4 A;  1T0H A;  5I2M A;  2E3H A;  2EW3 A;  2XIC A;  2XK0 A;  1K9M U;  1Y7X A;  1TOV A;  2DTO A;  5KYX B;  1UG1 A;  2QQA A;  9ATC B;  2WAC A;  2OTL T;  2KRN A;  2QEX T;  2E12 A;  2YUQ A;  3KFV A;  3L2U A;  4HVU A;  3GNG A;  4A63 B;  1QWF A;  4ZGJ B;  3JCM W;  2HQE A;  1RI0 A;  3QPH A;  1JJ2 S;  1D0Y A;  3A8H B;  3QBY A;  5KE2 A;  3L2R A;  2YUN A;  1S72 A;  2PQW A;  4PJO B;  3CCE T;  1EX4 A;  2JOY A;  4M7A C;  4C92 F;  2G6F X;  1OU8 A;  2RHZ A;  4OMF B;  3V7R A;  4N4H A;  3CME Q;  3OS1 A;  3TSZ A;  4QT7 A;  3GP8 A;  2OAW A;  4EIK A;  2A3L A;  2DXT A;  4JJC A;  3H6Z A;  3GIB A;  4X34 A;  2R57 A;  5GAN 8;  2WSC E;  1RAF B;  2P0Q A;  1HYO A;  2X35 A;  3S6W A;  2CZ6 B;  1IGU A;  2PTK A;  3HKS A;  3JV3 A;  1X6G A;  3TCJ A;  1M8M A;  2HKQ B;  2X4J A;  5LJ3 g;  4JJD A;  3I35 A;  3PNW C;  4EMK A;  1XQH A;  1P92 A;  5IHK A;  5CR2 A;  4C5H A;  4BDY A;  5I2S A;  3NHN A;  2BZX A;  4AFQ C;  3M0P A;  3CC4 T;  2FB7 A;  2JTE A;  2K9G A;  1ZLM A;  3M56 A;  5GAM j;  2MK5 A;  2JXB A;  4XAX B;  1YJN A;  2BE7 D;  4C92 C;  1WGS A;  2FYK A;  3H41 A;  2G3R A;  1NJI C;  1LJO A;  2EYY A;  5AYF A;  3EGD A;  2IG0 A;  3V8L A;  3CCL A;  2K3B A;  4PJO A;  4BE2 A;  3MEU A;  3VS3 A;  3HPW A;  2EYX A;  2ZPI B;  3OW2 A;  4OB0 B;  2RH2 A;  5DLO A;  2DL4 A;  1GCP A;  4E2F B;  4RCB A;  4A53 A;  1BKB A;  4JRP A;  4AMC A;  1VQN Q;  1FMW A;  1KHC A;  2C0I A;  3WVD B;  4Z02 A;  2DXC A;  4M75 E;  3CBP A;  1JU5 C;  1TUG B;  2RI3 A;  4FM4 B;  1M2O A;  3MEW A;  1WFW A;  1AT1 B;  5EG2 A;  3O8V A;  2OI3 A;  2QA4 A;  3S3N A;  4F7U G;  2X4W A;  1RAH B;  2ZZD A;  1VYT A;  4QVD A;  1YJ9 Q;  3JCM X;  3CCL T;  4DEX A;  2E5K A;  1YJW T;  2VWF A;  1AVZ C;  1IHV A;  2F2V A;  4MZT A;  3RR6 A;  5I21 A;  2QQS A;  4L59 A;  1HD3 A;  2EGA A;  2DA9 A;  2M9U A;  2PU9 B;  2KYM A;  2DVJ A;  1D09 B;  1X2Q A;  1O9S A;  3WXM B;  5J39 A;  1QVF A;  3HSB A;  1BB9 A;  1BU1 A;  1JXO A;  3M57 A;  1JJ2 A;  2RN8 A;  3OYB A;  1JO8 A;  5FWC A;  5FLX E;  2DD4 A;  1YHQ Q;  3DKM A;  2JW4 A;  4CC4 B;  1Q81 U;  2RF0 A;  2O01 E;  5GAN g;  2MPX C;  2WSF E;  4F14 A;  4FYV B;  1VQP Q;  5HK0 A;  4M7D F;  3CPW S;  2VUB A;  4KUD K;  2AHJ B;  2QA4 T;  5I22 A;  1N8R C;  1QKW A;  1HXD A;  1VQN A;  1BI0 A;  1VQM A;  2F1L A;  1KK7 A;  4ZGD B;  2DIG A;  1BYM A;  4RKU E;  3CD6 Q;  2JUF A;  4B9X A;  4FW1 A;  1VQ5 Q;  4PJO G;  4J9F A;  1QVG A;  1WXU A;  4PJO D;  3JCM e;  1WPY A;  1WXB A;  3RES A;  1M90 U;  1W2B P;  5A0D A;  5KYW A;  1KIK A;  3AHU A;  2E3I A;  3CXC P;  3CCU T;  1YJ9 A;  1GXI E;  2AKL A;  2ZPF B;  3V8K A;  4OB1 B;  3QUI A;  3OYJ A;  4OGC A;  4LDU A;  1V1C A;  3MO8 A;  5FWB A;  4XQ3 A;  2EJF A;  4LXC A;  5FRM A;  4II1 A;  4ZN1 A;  1UGQ B;  1U06 A;  2COZ A;  1Y71 A;  2M0O A;  3SFM A;  3M0Q A;  2HL5 C;  2XDD A;  2DD5 A;  2KRS A;  4ZN3 A;  4Q5W A;  4XU2 A;  2KRO A;  3VJP A;  4JS4 A;  1PKS A;  2LCS A;  1YHQ A;  1VQM T;  2EJG A;  2VC8 A;  2XD0 A;  4JZ4 A;  1K73 C;  1ARK A;  2EGC A;  1KQS P;  2RD1 A;  4M7D C;  4OMQ A;  2V26 A;  1PD0 A;  4ELZ C;  2CP2 A;  4J9B A;  1TSF A;  1K8A C;  1NEB A;  3ZFJ A;  1VQO A;  2CRE A;  4M78 B;  1SPK A;  1SRL A;  1WHJ A;  2FG0 A;  1RAB B;  2EYQ A;  1DJ7 B;  3CCS A;  4F04 B;  2D8J A;  3G4S Q;  1M3C A;  4A54 A;  3T9N A;  1N6A A;  2LJ0 A;  2RMO A;  3HRU A;  2QQR A;  2DRK A;  3CD6 A;  1UJ0 A;  3X25 B;  4FT2 A;  4J9G A;  1M3A A;  1K9M R;  1RLP C;  1YCS B;  1X27 A;  1ZSZ C;  3SEM A;  4OMO A;  1M27 C;  5KYU B;  4C0F A;  1LCK A;  4JJN K;  1PM3 A;  1W1F A;  4J7I A;  2NYS A;  3RKW A;  1ZUY A;  1ZBX A;  2ECZ A;  2SRC A;  2PZ1 A;  2QGG A;  4XTZ A;  4XU3 A;  2V1R A;  1I81 A;  3AT1 B;  1VQO T;  2RQW A;  2P4R A;  4C0D B;  1IHW A;  1BIA A;  1YIT A;  1LOJ A;  4DEY A;  3DLL A;  3CCS T;  1M5Q 1;  3HP9 A;  1OPK A;  3JCM g;  4ELY C;  2DXB A;  5KYY B;  1VIF A;  2FEI A;  2NUT A;  3SWN A;  1TUC A;  1K76 A;  1WQ7 A;  2VKN A;  1XOV A;  4IUV A;  1MMA A;  3PFS A;  2CH4 A;  4DBH A;  2EPD A;  3MP1 A;  4IUP A;  1Q82 U;  2DL8 A;  2XHC A;  3RBB B;  4M78 A;  1VQL Q;  1TWB A;  3OYC A;  5KCH A;  5GAN 4;  3A8M B;  4HCC A;  4VUB A;  1WYX A;  1YIT T;  3BY7 A;  2HBW A;  3OSV A;  2NUP A;  3QO3 A;  5IAY A;  4QW2 A;  4MZP A;  2EBP A;  1UHF A;  5KYU A;  5LL6 S;  2R5M A;  4PKC C;  3LGF A;  2L89 A;  3M58 A;  2DAQ A;  1N8R R;  1TU0 B;  3JB9 H;  2DER A;  4PFZ A;  3I55 T;  3I56 T;  3X24 B;  5LJ3 h;  1X01 A;  2D9T A;  3A5Z B;  1K9A A;  2KXC A;  3FRN A;  1Q7Y R;  3EG0 A;  3JCM Q;  1QW1 A;  5LJ3 f;  1PSE A;  3QZ5 B;  1RL2 A;  2F2X A;  4XTU A;  4IIO A;  3R6N A;  1Q86 C;  4BDZ A;  3JCM c;  4DOW A;  2ESW A;  4BE0 A;  3TQ7 P;  3OY9 A;  2J6O A;  2F69 A;  2FZK B;  2C06 A;  2VGN A;  3OSS C;  4C8Q F;  4RCC A;  2CUB A;  1TS9 A;  1C0M A;  3FC3 A;  2RPN A;  2KY9 A;  3G71 Q;  3ZEH A;  4EMG A;  3CCR T;  3SB2 A;  1ZUU A;  5KE3 A;  3KXT A;  1PRM C;  1R0C B;  3G7Z A;  2O4X B;  2DL5 A;  3TRE A;  5LJ5 d;  1OX9 A;  2HDA A;  2OTJ A;  4Z88 A;  2KK4 A;  3PMI A;  1VQL A;  2V8J A;  1KC8 U;  2C0O A;  4OP0 A;  2M51 A;  2CH4 W;  3FJ5 A;  4FYY B;  1I8F A;  3PMT A;  4D8D A;  3EG1 A;  1XJW B;  1MGQ A;  2BUD A;  1K8A R;  2E41 A;  2LT4 A;  3SHW A;  2QI2 A;  3CCE Q;  4KT0 E;  1VQ8 A;  3OYN A;  4JPB W;  3C4S A;  1KQ2 A;  4KGX B;  4M78 G;  2OAU A;  4M78 D;  3QSU A;  3J7A F;  2KXD A;  3EAE A;  1WHL A;  2LJ3 A;  3G6E T;  5FU6 C;  3E1S A;  2CYZ B;  1JB0 E;  1ACM B;  2HNI A;  3PT9 A;  4C8Q C;  2LT1 A;  3V8J A;  3NGP A;  2W0Z A;  3M0R A;  1FXX A;  1O75 A;  1T0J A;  2KNB B;  3ZL7 C;  3CMA T;  2VGM A;  2B8A A;  1FMV A;  2HQX A;  4IKF A;  2HEQ A;  4C5E A;  5GAN h;  2OTL A;  3CC4 Q;  4MMK A;  5GAN 2;  2QEX A;  2JJ9 A;  3L1A A;  2MWP A;  2ZPB B;  2K3X A;  4F7U B;  1SG5 A;  2O4X A;  2E4H A;  1N27 A;  5KH6 A;  5GAN f;  1LVK A;  4EPC A;  2JVV A;  3BDU A;  3RKX A;  5LJ3 j;  2A28 A;  2ED0 A;  2Y90 A;  3LWH A;  1JJ2 P;  4BB7 A;  4X1V A;  2RM4 A;  2FPF A;  1OEB A;  1M1K U;  3LH5 A;  3FJP A;  3MEA A;  2YLC A;  2RQR A;  3FLG A;  3OYK A;  4V2S A;  3MPU B;  1OI1 A;  4M75 C;  1BBZ A;  4HKE A;  3H0F A;  3PE0 A;  1PWT A;  3A8G B;  2X9H A;  5FU6 B;  3UT1 A;  1VA7 A;  2HSE B;  4HCB A;  2V8I A;  3EFO A;  3UPU A;  4C8Q B;  4HT9 A;  3REB B;  3QWX X;  3TSW A;  4PK4 A;  1UEC A;  3EGX A;  1HSQ A;  1EFN A;  1NJI U;  5CVI A;  2DKG A;  3VS6 A;  1QVF S;  4DOV A;  3THK A;  3SD4 A;  3SDZ A;  5CQY A;  1R0B G;  2XU8 A;  3MP6 A;  2KVQ G;  5GMK e;  1YJN Q;  2ZPE B;  4IUQ A;  1SSH A;  1KD1 U;  1XTD A;  3OS0 A;  2EAY A;  1C1A A;  3RIR A;  3CC4 A;  5GMK j;  1Q86 R;  4FCY A;  3CCL Q;  1X75 C;  3DB4 A;  3MP8 A;  4HXJ A;  1YJW Q;  4LUE A;  3ULR B;  1YBY A;  1WHM A;  4KUI A;  2XDB A;  1RAG B;  4F7U A;  1M2V B;  2L5Q A;  1WIE A;  5DLQ E;  2COY A;  4N0A C;  3C95 A;  4BI8 B;  1WHH A;  2LDM A;  3VS4 A;  2K57 A;  1U3O A;  2E5Q A;  1QVG S;  3J80 E;  4GBQ A;  2LCC A;  4RTV A;  1KJW A;  4F7U E;  1G8X A;  3IQL A;  1WJQ A;  3J81 E;  2F5T X;  3BE3 A;  3GF5 A;  2FZC B;  3FEO A;  3NPF A;  3OYH A;  4J9C A;  1UJY A;  1PD1 A;  2QA4 Q;  5GAN e;  2LMJ A;  5IT9 E;  1G3W A;  1HJD A;  1AWW A;  5KYX A;  5GAN j;  2RJE A;  1H3Z A;  4IIM A;  5IXF A;  4R55 A;  2QYZ A;  4LDX A;  1M30 A;  2RQT A;  1VQK T;  2PNI A;  5CKE A;  4M7A B;  3JB9 J;  2MIO A;  3OBW A;  5CQX A;  3JCM h;  4ESR A;  1JXM A;  3VUZ A;  3OQ5 A;  2CP6 A;  1AD5 A;  2CP5 A;  4C5G A;  3CCU Q;  5J3B A;  2NLU A;  1K9M C;  2ABL A;  3FDR A;  3JCM f;  1X2K A;  1YJW A;  3HRT A;  1VQ7 A;  4RTY A;  2ED1 A;  2YXY A;  2D0N A;  4BAC A;  1GCQ A;  2ROT A;  2SEM A;  2VXF A;  2VYT A;  1H92 A;  4M77 F;  5GMK m;  2FRY A;  5A2Q E;  4OB2 B;  2JT4 A;  4LDV A;  4PJO E;  2QAS A;  1BI1 A;  2ZPH B;  2JM8 A;  4FT4 A;  3M59 A;  1SF9 A;  3TU4 K;  2MAM A;  2YRV A;  1VQM Q;  1Z9Q A;  2CP0 A;  1TXQ A;  5FRN A;  1M3B A;  2DVE A;  5IXB A;  1MMD A;  4QQ6 A;  3QII A;  3CCV A;  2DZC A;  1RI9 A;  3CPW P;  1WQW A;  4F16 A;  3EG3 A;  3D7S B;  4FIB A;  1T3L A;  4E7I A;  2LQ8 A;  3HFN A;  1VQ7 T;  3MET A;  4FU6 A;  1Y0M A;  1OQK A;  1WI7 A;  2MI6 A;  4N4I A;  4C92 B;  4IUT A;  4L6V 5;  1VQ4 A;  3CCM A;  2MYS A;  2JMC A;  1VOM A;  2OJ2 A;  4C5I A;  3LWI A;  1NYG A;  2IIM A;  2FHD A;  5D6W A;  2FVU A;  3UF4 A;  1B07 A;  2DX1 A;  4M7A A;  3CCU A;  1NZ9 A;  1NLP C;  3REA B;  2DM1 A;  2QAZ A;  2AZV A;  1VUB A;  5GMK l;  2PVG B;  1BI3 A;  4XTY A;  4A4H A;  4C8Q G;  2AIR B;  4C8Q D;  5GAN 3;  2DMO A;  5D6X A;  3CCV T;  4M77 C;  1VQO Q;  2EGE A;  2VXE A;  3GBQ A;  2RHX A;  1RAA B;  4M7A E;  4YTL A;  2H3E B;  2CT3 A;  3VRZ A;  1AWO A;  2ZGW A;  2A36 A;  1MV3 A;  3CCS Q;  4LE9 A;  1YI2 A;  1IRX A;  1Q7Y C;  3JB9 G;  3JB9 D;  2JNG A;  3M4G A;  5GAM g;  1VQ4 T;  3CCM T;  3OYG A;  4EMH A;  2YHT A;  1PSF A;  2LX7 A;  2EWN A;  3KUF A;  2EYZ A;  4BD3 A;  2LNH B;  1YN8 A;  3OYM A;  2FPE A;  2K2M A;  4A4F A;  2KDS A;  4Z89 A;  1E7O A;  5GAM d;  2HCK A;  2DLP A;  3QJ6 A;  3LYI A;  1JRI A;  1FWZ A;  2CP7 A;  1VQ6 T;  2DYB A;  4RG2 A;  3CBM A;  3ER0 A;  1UGS B;  1YIT Q;  4C92 A;  2I0N A;  4KGZ B;  1IZ6 A;  3EH1 A;  5GMK i;  3EG2 A;  4RTX A;  1B34 B;  1I0C A;  2DBK A;  1YI2 T;  1G83 A;  2CDT A;  4M77 B;  2DIL A;  6AT1 B;  3JCM P;  3JCM b;  4KUL A;  3PIP A;  1X69 A;  2DYI A;  2P84 A;  1M1K R;  4FL6 A;  4C92 E;  2DK3 A;  4ZNX A;  2KEA A;  4JRQ A;  5CKB A;  2CT4 A;  3I5R A;  4PJM A;  1G3T A;  1I5O B;  4A4E A;  4OB3 B;  4M7A G;  1UDL A;  4M7A D;  5KCO A;  3CCR Q;  2A7Y A;  1I4K 1;  1Q81 C;  1G5V A;  3M54 A;  1M1G A;  2GBQ A;  1IGQ A;  5GAO n;  1VIE A;  4X9D A;  1WA7 A;  3A1P A;  2LQW A;  3HHT B;  1WLP B;  3GOX A;  1SEM A;  3M0U A;  3R6O A;  1KQ1 A;  4E7S A;  3A8O B;  1BCO A;  1RAE B;  1AWX A;  3CCJ A;  4O5V A;  1KD1 R;  2V8K A;  2WSE E;  2F5K A;  2KQW A;  3UDC A;  2M0Y A;  4RTT A;  4JLI A;  4OML A;  2M1H A;  2Y4X A;  4BI4 A;  4OVA A;  3NTH A;  3GLX A;  3L2W A;  1M90 C;  2AKK A;  4M7D B;  4JRI A;  3S3M A;  5L8R E;  3I55 A;  3I56 A;  2GFU A;  2IVW A;  3EHR A;  1FX7 A;  3QDR B;  1VQP T;  1V76 A;  2E64 A;  3C0C A;  2GTO A;  3NFC A;  2PVO B;  3CEY A;  4FSX A;  2EKH A;  2RHY A;  3JB9 I;  1PRL C;  2HSP A;  2XKO C;  3C94 A;  2M02 A;  2OTJ Q;  3X20 B;  2LQN A;  4C92 G;  4C92 D;  1QCF A;  1OZ3 A;  1ZSZ B;  2FRW A;  5IH2 A;  3CC2 T;  1GL5 A;  2MWO A;  4RMO A;  2DTH A;  3CCJ T;  2PUO B;  3OMG A;  4Y28 E;  3EFR A;  1BIB A;  3CCR A;  3CMA Q;  1I07 A;  2X4X A;  3OB9 A;  1LPL A;  2RI2 A;  2XID A;  1AOJ A;  4N4G A;  3E9G A;  4ATO A;  4PFP A;  3JCM V;  3VS2 A;  4M78 E;  1YIJ A;  1ABO A;  2XMF A;  4HVV A;  5CKH A;  1VQ8 Q;  4CC7 A;  3X26 B;  1NE8 A;  4KH0 B;  2M16 A;  2KT8 A;  2DF6 A;  5D6Y A;  2YRD A;  2CS7 A;  2O31 A;  1WJS A;  3LGL A;  3VYH B;  2J6F A;  2ATC B;  2KMT A;  2C0T A;  3VUB A;  3H9N A;  4A4K A;  3EG9 B;  1GFC A;  4J6X A;  3NTK A;  2JS2 A;  4M4Z A;  1TTH B;  1MND A;  4OF1 A;  3BFM A;  1SHG A;  5LJ5 g;  2DET A;  3JSC A;  1RLQ C;  4JS5 A;  4M7D A;  1J3T A;  2LRQ A;  2IPO B;  5KYY A;  3RNJ A;  2E1H A;  1F1B B;  3HFO A;  1H8K A;  1YIJ T;  2ZAE A;  1ZSG A;  5CIU A;  3G6E A;  1OV3 A;  3LW5 E;  2OTL Q;  4J9I A;  1G3S A;  3M5A A;  2QEX Q;  1ZX6 A;  1T3S A;  2YUP A;  1WHK A;  4IUR A;  5EC7 A;  2DL7 A;  2LQK A;  4M7D E;  4WF2 A;  4J9D A;  2KR3 A;  2JMA A;  3CMA A;  1AWJ A;  4R56 A;  3ME9 A;  1ZSZ A;  4QQG A;  1K1Z A;  2YT6 A;  3MCA B;  5GMK h;  1K0X A;  1W2B A;  3RMS A;  2B86 A;  2LP5 A;  2YUO A;  4M77 G;  5HY6 A;  3LX7 A;  2DPP B;  3OW2 P;  4PJO F;  4AG2 C;  2D1X A;  3TEE A;  1Q82 C;  4M75 F;  3L2Z A;  3JRZ A;  3A98 A;  3M55 A;  2FO0 A;  4JZ3 A;  2LNV A;  2P4T A;  2BIV A;  4KRT A;  4E7J A;  1ZHI A;  2JM9 A;  1Q81 R;  2AT1 B;  4DBQ A;  4E7H A;  2EQK A;  2HL3 A;  5CO7 A;  1WDX A;  4LD9 K;  3CBO A;  2JS0 A;  5FU7 C;  3EG9 A;  3HRS A;  1JQQ A;  2L3S A;  2FZG B;  2LZ6 B;  5A0L A;  1QP2 A;  1TG0 A;  3L2V A;  4EMK C;  5A0G A;  1KQS A;  1W6X A;  1VQ9 T;  1GBR A;  4GLM A;  2E10 A;  3ASK A;  4J6Y A;  4J6W A;  1X6B A;  2LTO A;  3OS2 A;  5L23 A;  1UUE A;  2D8H A;  1H3H A;  4FSS A;  2P0K A;  4O6J A;  5GAN 5;  1M90 R;  4PLL A;  4HCK A;  2QDL A;  2K7A A;  4LDW A;  3EGU A;  3E19 A;  2KE9 A;  1VQK Q;  1QVF P;  4BE1 A;  3VRY A;  3M0S A;  2BZY A;  2MOX A;  2J06 A;  4E7L A;  4M7D G;  4M7D D;  3OYF A;  4PJO C;  1I1J A;  1D0Z A;  3OYI A;  1E6G A;  2EQU A;  2DRM A;  5GAN 6;  1BCM A;  4WCI A;  4CC2 A;  2A08 A;  4QKU A;  5GAM f;  4GLK A;  1SKU B;  2E70 A;  1KC8 C;  5HKC A;  1E6H A;  1AHJ B;  4OMP A;  1X6O A;  5GJV B;  2D0Q B;  4FYX B;  1YWO A;  5HCK A;  3UWN A;  2DO3 A;  4E7Z A;  1MHN A;  4OGE A;  3OYA A;  2J6K A;  2ENM A;  3OA6 A;  2RJF A;  2QDY B;  3G71 T;  1UGV A;  4ME7 A;  1QVG P;  1IB8 A;  3VS7 A;  4E47 A;  2AZS A;  2BE9 B;  2EYW A;  5GAO p;  2O2O A;  1OPL A;  3I5S A;  3HL8 A;  2O9V A;  4JDS A;  3H0H A;  1NEG A;  1VQ7 Q;  1W70 A;  2KAF A;  1H64 1;  4L5G A;  4Z8A A;  1X43 A;  1VQK A;  3EGD B;  1ABQ A;  2R58 A;  3RKY A;  3OS5 A;  5I11 A;  1D0X A;  1CSK A;  2W10 A;  4M75 B;  4NL3 A;  3CCQ A;  2XDP A;  1NPP A;  2KYB A;  4CRI A;  2RNA A;  2K79 A;  1IO6 A;  1I5L A;  1WXT A;  1Q95 G;  1ZA1 B;  3CCV Q;  3CC7 A;  1MMG A;  3MJX A;  4DBR A;  3NMZ C;  3PVQ A;  2L0A A;  4C8Q A;  3QYG B;  2E6N A;  5M9O A;  2R5A A;  1SSF A;  4KH1 B;  3KBG A;  3BDL A;  1M1K C;  1N9R A;  3EHQ A;  2ZCF B;  4QVZ A;  1VQ4 Q;  1KSW A;  3CCM Q;  1M8V A;  1S72 T;  1BI2 A;  3OYL A;  1N9S A;  1Q82 R;  2L3R A;  4RTZ A;  3DLM A;  5ECA A;  3E2U A;  2DEU A;  5GAM e;  4C8Q E;  2QXF A;  3CCQ T;  1BK2 A;  1GRI A;  4RTU A;  1MMN A;  5LJ3 d;  1N8R U;  7AT1 B;  1G3Y A;  2EQI A;  2EJ9 A;  1VQ6 Q;  2FL7 A;  3EFS A;  4A4G A;  3C12 A;  1Q7Y U;  3CC7 T;  2HKN A;  2HD0 A;  1QLY A;  4J5Y A;  4XU0 A;  3PIO A;  1RAI B;  5J26 A;  2XG8 D;  1M2V A;  3HTR A;  1KG1 A;  1QP3 A;  1YI2 Q;  2MMP A;  1KD1 C;  2GTJ A;  3CME A;  4M75 A;  3PTA A;  2QG9 B;  3M0T A;  4D8K A;  3OMC A;  4XU1 A;  4HCZ A;  3ZBD A;  4RUG A;  2E6Z A;  1PC0 A;  2L2P A;  1RAC B;  2L8D A;  4J8O A;  4JLG A;  1JBM A;  5CAI A;  4M78 F;  3DB3 A;  1IXD A;  2CZ0 B;  5HK3 A;  3QKJ A;  4GY5 A;  3UA6 A;  4AFU C;  5GAO m;  3CPF A;  2HBP A;  5KYW B;  1SRM A;  4AG1 C;  3VS1 A;  1YJN T;  1UTI A;  1K0S A;  1NG2 A;  1K73 U;  2K5L A;  2K3Y A;  2P0P A;  2PVD B;  2VAS A;  5LJ5 h;  1KC8 R;  4HVW A;  2EQJ A;  1K8A U;  1ZQ1 A;  2RQU A;  3CME T;  2X3W D;  2MF2 A;  5LJ5 f;  3H8Z A;  2DE0 X;  1R8O B;  1KFZ A;  5CKD A;  2KSS A;  3JAM E;  2DXU A;  3TVT A;  2GFA A;  3H0I A;  3V7S A;  1VQ6 A;  4AFS C;  3M53 A;  1LNX A;  2F2W A;  2RJD A;  2RB6 A;  4WTO B;  4N0A A;  5GAO r;  2EQM A;  4ZTJ A;  2J05 A;  3M9Q A;  4PL6 A;  1MNE A;  3SWN C;  1U5S A;  4QVC A;  2OX7 A;  1UGP B;  5IN1 A;  5C6S A;  4FW2 A;  1K4U S;  1KHI A;  2DFU A;  2QTX A;  2JTM A;  2QQB A;  1N5Z A;  2RHI A;  3VV0 A;  4DA4 A;  1U1S A;  3L42 A;  2RI5 A;  2A37 A;  5GAO l;  4P5N A;  1NPR A;  3P8D A;  2X3X D;  4M78 C;  2EVR A;  5GAN d;  2DL3 A;  2X51 A;  2O88 A;  3X28 B;  2YDL A;  1NBE B;  1AZE A;  4D6W A;  3LLR A;  4QQD A;  3CC2 Q;  4C0Z A;  2CSQ A;  3CCJ Q;  1RAD B;  1FMK A;  3MKD A;  4M75 G;  3S3O A;  4M75 D;  3BW1 A;  4LD6 A;  2YLB A;  1HK9 A;  1Y07 A;  2AK5 A;  2LCL A;  3URG A;  3CQT A;  3I55 Q;  3I56 Q;  2KI7 A;  8ATC B;  1GBQ A;  2DJZ A;  1PHT A;  4J7F A;  2CKK A;  2GCX A;  1MUZ A;  3RDV A;  2LX9 A;  2NUT B;  3F70 A;  3SWN B;  4C0D C;  1VQN T;  2H3J A;  1OX8 A;  4XTW A;  2PUK B;  1PKT A;  8AT1 B;  2FPD A;  3VS0 A;  1CKA A;  4DQ2 A;  2JZ2 A;  1W2B S;  2RQV A;  1VQP A;  1Z9Z A;  2KT1 A;  3CXC S;  1ZBJ A;  1C6V X;  2K4Y A;  2RHU A;  5LJ5 e;  1YJ9 T;  1WJR A;  1OYX A;  3QZ9 B;  1YIJ Q;  2RJC A;  2RA2 A;  3A8L B;  1NJI R;  5CCA A;  1NLO C;  3P8B B;  3VYG A;  4JRK A;  5LJ5 j;  2Y4Y A;  3PGG A;  1VQ5 A;  2NUP B;  2QGF B;  1Q86 U;  2GF7 A;  2H8H A;  5DY9 A;  3CC2 A;  1A0N B;  4RTW A;  1WNL A;  2A0F B;  1UHC A;  3VKI A;  2CGH A;  4ZGE B;  2I2L A;  4CI0 C;  1SHF A;  2BTT A;  2E65 A;  1PNJ A;  3M4Y A;  5IHN A;  1YHQ T;  3LH0 A;  1KQS S;  1WZO A;  4LNP A;  2KRM A;  3U23 A;  1QMC A;  2CSI A;  4RG8 A;  4MDW A;  5CK9 A;  3O5Z A;  2VVK A;  1B34 A;  2DNU A;  2O9S A;  2KGT A;  5GJW B;  2CZ7 B;  4M77 A;  5AT1 B;  3E9F A;  5CKF A;  1UGR B;  4E6R A;  1D1A A;  3OYE A;  2LVM A;  3G6E Q;  1AEY A;  4XTV A;  3CD6 T;  5GAN 7;  4NL2 A;  3UAT A;  1VQ5 T;  3RMQ A;  4FYW B;  1B3Q A;  3OYY A;  3GPL A;  2L3Q A;  1OZ2 A;  4HA8 A;  4BUG A;  1IRE B;  4OMN A;  2GNC A;  4M77 E;  4MZM A;  1EZZ B;  2YWW A;  1OUL A;  2EFI A;  1VQ9 Q;  1M4Z A;  1M9S A;  1JEG A;  2QQ9 A;  1UB4 A;  4J9H A;  4BI3 A;  3JCM d;  1S1N A;  1Y96 B;  3G4S A;  4DBF A;  4AT1 B;  3CPW A;  1Y57 A;  1B7T A;  1NM7 A;  1XNI A;  4J83 A;  1UE9 A;  2V1Q A;  5FW9 A;  4PJJ A;  1D1C A;  5GAO q;  1D3B B;  2DTI A;  1ZUK A;  2EIF A;  4F7U F;  3VS5 A;  3GNF B;  1FYN A;  1QKX A;  4PJL A;  2CZ1 B;  2MCN A;  4OMM A;  4NS5 A;  4LDY A;  4NOY A;  1TH7 A;  1V29 B;  2Z0W A;  2DBM A;  4PFO A;  1EIF A;  1YFN A;  2GQI A;  1PCX A;  4BY6 C;  2K2V A;  3I9Q A;  2YRC A;  3QG1 A;  3QXE B;  4ORZ A;  1R77 A;  2XI9 A;  2DZ9 A;  3G4S T;  2D6F A;  1TUD A;  1ZA2 B;  3RUX A;  3EH2 A;  4MML A;  2K5F A;  2HZY A;  2JTF A;  2LC4 A;  2GQV A;  2X4Y A;  2RO0 A;  2RK1 A;  4F17 A;  1UEB A;  1WX6 A;  2RK2 A;  4B9W A;  1OOT A;  1PG5 B;  1YWP A;  3UA7 A;  2KBT A;  1VQ9 A;  3P8H A;  2BZ8 A;  4E7K A;  1YNZ A;  4B6M A;  2HMA A;  4JJB A;  3WVE B;  3JB9 F;  1AZG B;  1OU9 A;  4AFZ C;  3CXC A;  4M77 D;  1WHG A;  1VYV A;  2COW A;  1Y96 A;  1YCY A;  2K6D A;  1U8R A;  1CKB A;  1QCN A;  1K73 R;  2L3P A;  1U1T A;  2J7I A;  2BKD N;  3QHS A;  1D3B A;  4LUD A;  5D7U A;  4EDU A;  4IUU A;  2HAX A;  3QYH B;  4KBM B;  4BY6 B;  1G2B A;  3PVL A;  2YSQ A;  2GGR A;  3EFO B;  1QVP A;  4PJN A;  2DEQ A;  1NYF A;  4XTX A;  3JCM J;  3OBY A;  3V7C A;  2VV5 A; 
#chains in the Genus database with same CATH homology
 3SWN A;  3CC7 A;  1WQ7 A;  3FIF A;  4C0G A;  1XOV A;  1YI2 A;  4XK8 E;  3OYD A;  4IUV A;  1Q7Y C;  3JB9 G;  3JB9 D;  3RER A;  2JNG A;  3M4G A;  5GAM g;  3INZ A;  3QJY A;  1VQ4 T;  2OTJ T;  4C8Q A;  3QYG B;  3PFS A;  2E6N A;  5M9O A;  2R5A A;  1SSF A;  3OYG A;  4EMH A;  3CCM T;  2YHT A;  3KBG A;  3BDL A;  1PSF A;  2K5I A;  1M1K C;  1VQL T;  3MP1 A;  1N9R A;  2EWN A;  3KUF A;  4IUP A;  2ZCF B;  2XHC A;  4QVZ A;  1Q82 U;  4X9C A;  4M78 A;  3G71 A;  4MDX A;  1M8V A;  1S72 T;  1BI2 A;  1W4S A;  3OYL A;  1N9S A;  3Q1J A;  4BD3 A;  3FB9 A;  2L3R A;  3OYM A;  5C0M A;  5KCH A;  3OYC A;  2DIQ A;  4A4F A;  2KDS A;  3DLM A;  5GAN 4;  1M1F A;  5GAM d;  5GAM e;  4C8Q E;  3VU3 C;  3QJ6 A;  3LYI A;  4TVR A;  2QXF A;  3A8M B;  3CCQ T;  4HCC A;  4VUB A;  5DM7 R;  1JRI A;  3OW2 S;  4PNO A;  1FWZ A;  1YIT T;  3BY7 A;  1VQ8 T;  3OSV A;  3QO3 A;  5IAY A;  1VQ6 T;  5LJ3 d;  5LJ3 e;  4RG2 A;  1N8R U;  4QW2 A;  4M7A F;  4MZP A;  5GAM h;  3CBM A;  1G3Y A;  3ER0 A;  5LL6 S;  2R5M A;  1UGS B;  4PKC C;  3LGF A;  4JUV A;  2L89 A;  4Y91 A;  3M58 A;  2DAQ A;  4HT8 A;  3JB9 H;  4C92 A;  2EJ9 A;  3MHX A;  2FL7 A;  3I55 T;  3I56 T;  1IZ6 A;  3EFS A;  3X24 B;  3C12 A;  4A4G A;  5LJ3 h;  1X01 A;  5GMK i;  1Q7Y U;  2D9T A;  3A5Z B;  3CC7 T;  1B34 B;  4PLI A;  2EKO A;  2HD0 A;  1YI2 T;  4J5Y A;  4XU0 A;  3FRN A;  3PIO A;  5J26 A;  2XG8 D;  1KG1 A;  1QP3 A;  3NTI A;  1QW1 A;  4M77 B;  3JCM Q;  3CCE A;  3JCM P;  5LJ3 f;  1PSE A;  3JCM b;  4KUL A;  3PIP A;  2MMP A;  3QZ5 B;  1RL2 A;  4XTU A;  5FU7 B;  1KD1 C;  3MEV A;  4FL6 A;  3CME A;  4M75 A;  3JCM c;  4C92 E;  2JN0 A;  2DK3 A;  4DOW A;  3PTA A;  3N5B B;  4BDZ A;  4EMK B;  4BE0 A;  3OMC A;  4XU1 A;  4ZTF A;  2ZPG B;  4HCZ A;  5FRO A;  3ZBD A;  4JRQ A;  3OY9 A;  3L2Q A;  5CKB A;  2E6Z A;  2F69 A;  2C06 A;  2VGN A;  3OSS C;  4UC4 A;  5I2M A;  4C8Q F;  4RCC A;  3FC3 A;  2KY9 A;  2XIC A;  2XK0 A;  3ZEH A;  1G3T A;  4EMG A;  3CCR T;  1K9M U;  3SB2 A;  2L8D A;  4J8O A;  1Y7X A;  4JLG A;  4A4E A;  2DTO A;  4OB3 B;  4M7A G;  2QQA A;  1JBM A;  5CAI A;  5KE3 A;  2WAC A;  2OTL T;  4M78 F;  3DB3 A;  4M7A D;  3KXT A;  2QEX T;  2CZ0 B;  5KCO A;  5HK3 A;  3QKJ A;  4GY5 A;  2A7Y A;  2E12 A;  5GAO m;  3CPF A;  1I4K 1;  2HBP A;  3G7Z A;  3GNG A;  3L2U A;  1Q81 C;  2O4X B;  3M54 A;  1G5V A;  1M1G A;  3TRE A;  4ZGJ B;  2HQE A;  1RI0 A;  3QPH A;  5LJ5 d;  3JCM W;  5GAO n;  2OTJ A;  1YJN T;  1VIE A;  4X9D A;  1JJ2 S;  2KK4 A;  3PMI A;  1VQL A;  2V8J A;  1KC8 U;  3HHT B;  1K73 U;  2K5L A;  3A8H B;  3GOX A;  3R6O A;  4OP0 A;  2K3Y A;  1KQ1 A;  3QBY A;  2P0P A;  2PVD B;  5KE2 A;  5LJ5 h;  3L2R A;  3A8O B;  1S72 A;  1I8F A;  2PQW A;  4PJO B;  3PMT A;  3CCE T;  2EQJ A;  2JOY A;  4M7A C;  1K8A U;  4C92 F;  1ZQ1 A;  3CCJ A;  4O5V A;  2RHZ A;  4OMF B;  2V8K A;  3CME T;  2MF2 A;  1MGQ A;  2BUD A;  5LJ5 f;  1YJN A;  2E41 A;  2LT4 A;  3H8Z A;  1R8O B;  2QI2 A;  2WSE E;  3V7R A;  5CKD A;  2KSS A;  4KT0 E;  1VQ8 A;  3JAM E;  2DXU A;  2F5K A;  4N4H A;  3OYN A;  2KQW A;  3UDC A;  2GFA A;  3V7S A;  1VQ6 A;  4JLI A;  3M53 A;  2M1H A;  2Y4X A;  3C4S A;  4BI4 A;  1LNX A;  4OVA A;  3OS1 A;  1KQ2 A;  3GP8 A;  2RJD A;  3NTH A;  2RB6 A;  3GLX A;  3L2W A;  4N0A A;  5GAO r;  2A3L A;  2DXT A;  2EQM A;  4M78 G;  4ZTJ A;  4JRI A;  1M90 C;  3S3M A;  4M7D B;  2OAU A;  3M9Q A;  4M78 D;  5L8R E;  3I55 A;  3I56 A;  2GFU A;  3J7A F;  4PL6 A;  3QSU A;  2IVW A;  3SWN C;  1FX7 A;  3H6Z A;  3QDR B;  3EAE A;  1VQP T;  3GIB A;  4X34 A;  2R57 A;  4QVC A;  1UGP B;  5IN1 A;  3NFC A;  2E64 A;  5C6S A;  1KHI A;  5GAN 8;  2WSC E;  2P0Q A;  3G6E T;  5FU6 C;  3E1S A;  2QTX A;  2CYZ B;  2X35 A;  2JTM A;  2QQB A;  2CZ6 B;  2PVO B;  1JB0 E;  2RHI A;  3CEY A;  2HNI A;  3PT9 A;  3S6W A;  4FSX A;  3VV0 A;  2LT1 A;  3HKS A;  1U1S A;  3V8J A;  3TCJ A;  2RHY A;  4C8Q C;  4DA4 A;  3L42 A;  2RI5 A;  2X4J A;  5LJ3 g;  3JB9 I;  2XKO C;  3C94 A;  5GAO l;  1FXX A;  1O75 A;  4P5N A;  3PNW C;  3X20 B;  1NPR A;  1XQH A;  1P92 A;  3P8D A;  4EMK A;  4C92 G;  4M78 C;  5CR2 A;  4C92 D;  4C5H A;  3CMA T;  4BDY A;  2VGM A;  1OZ3 A;  5GAN d;  5I2S A;  3CC2 T;  2B8A A;  2MWO A;  4RMO A;  2DTH A;  3CC4 T;  2FB7 A;  3CCJ T;  2HQX A;  2PUO B;  3OMG A;  4Y28 E;  4IKF A;  3EFR A;  3X28 B;  1BIB A;  3CCR A;  4C5E A;  2X4X A;  3OB9 A;  4D6W A;  3LLR A;  4QQD A;  2RI2 A;  2XID A;  4N4G A;  5GAN h;  4C0Z A;  2OTL A;  4MMK A;  5GAN 2;  3E9G A;  2QEX A;  4ATO A;  3L1A A;  3JCM V;  3M56 A;  4M78 E;  2MWP A;  5GAM j;  2ZPB B;  2K3X A;  4M75 G;  4F7U B;  1YIJ A;  3S3O A;  4M75 D;  2O4X A;  3BW1 A;  5CKH A;  1N27 A;  3X26 B;  4LD6 A;  2YLB A;  5KH6 A;  1HK9 A;  1Y07 A;  4XAX B;  4EPC A;  5GAN f;  2JVV A;  3BDU A;  4C92 C;  1WGS A;  2FYK A;  3RKX A;  2G3R A;  1NE8 A;  2LCL A;  3URG A;  5LJ3 j;  1NJI C;  2Y90 A;  1LJO A;  3LWH A;  2M16 A;  4BB7 A;  5D6Y A;  2RM4 A;  5AYF A;  2CS7 A;  2IG0 A;  3V8L A;  1WJS A;  1M1K U;  3LGL A;  3CCL A;  4PJO A;  3VYH B;  4BE2 A;  3FJP A;  2KMT A;  2YLC A;  3FLG A;  3MEA A;  3MEU A;  3VUB A;  2DJZ A;  3HPW A;  2ZPI B;  3OYK A;  4A4K A;  4J7F A;  3OW2 A;  4V2S A;  4J6X A;  1OI1 A;  3NTK A;  4OB0 B;  2CKK A;  2RH2 A;  2GCX A;  2LX9 A;  4M75 C;  4HKE A;  5DLO A;  3F70 A;  3SWN B;  4OF1 A;  4C0D C;  3BFM A;  1VQN T;  2H3J A;  5LJ5 g;  4RCB A;  3A8G B;  3JSC A;  4A53 A;  1BKB A;  5FU6 B;  3UT1 A;  4JRP A;  4XTW A;  4JS5 A;  4HCB A;  2PUK B;  2V8I A;  3UPU A;  4M7D A;  2LRQ A;  1KHC A;  4C8Q B;  4HT9 A;  3WVD B;  2E1H A;  4Z02 A;  4DQ2 A;  2DXC A;  2JZ2 A;  4M75 E;  1W2B S;  3CBP A;  3HFO A;  1VQP A;  2RI3 A;  3CXC S;  1YIJ T;  2K4Y A;  4FM4 B;  5CIU A;  3G6E A;  2RHU A;  3LW5 E;  3MEW A;  5CVI A;  2DKG A;  5LJ5 e;  1NJI U;  1G3S A;  3M5A A;  1YJ9 T;  1QVF S;  1WJR A;  4DOV A;  1OYX A;  5EG2 A;  3QZ9 B;  3SD4 A;  3SDZ A;  4IUR A;  2RJC A;  2RA2 A;  3A8L B;  3O8V A;  5CCA A;  2LQK A;  2QA4 A;  3P8B B;  3S3N A;  4M7D E;  4F7U G;  2X4W A;  2ZZD A;  2XU8 A;  5CQY A;  3MP6 A;  2KVQ G;  4WF2 A;  3VYG A;  4JRK A;  4QVD A;  5GMK e;  5LJ5 j;  1Q86 C;  2Y4Y A;  2ZPE B;  4IUQ A;  3PGG A;  1VQ5 A;  3JCM X;  3CMA A;  3CCL T;  1KD1 U;  4R56 A;  1XTD A;  3ME9 A;  1Q86 U;  2GF7 A;  4QQG A;  3OS0 A;  1YJW T;  2EAY A;  5DY9 A;  3CC2 A;  3RIR A;  3CC4 A;  1WNL A;  5GMK j;  3MCA B;  5GMK h;  4MZT A;  5I21 A;  3VKI A;  2CGH A;  4ZGE B;  2QQS A;  4L59 A;  1X75 C;  2I2L A;  1W2B A;  4CI0 C;  3RMS A;  2E65 A;  2M9U A;  2PU9 B;  3DB4 A;  3MP8 A;  4M77 G;  5HY6 A;  1YBY A;  4KUI A;  3LX7 A;  3M4Y A;  2DPP B;  1YHQ T;  2XDB A;  4PJO F;  1O9S A;  3WXM B;  4F7U A;  3LH0 A;  5J39 A;  1QVF A;  3HSB A;  1KQS S;  3M57 A;  1JJ2 A;  3TEE A;  2L5Q A;  1Q82 C;  5DLQ E;  3OYB A;  4M75 F;  4N0A C;  3C95 A;  4RG8 A;  2DD4 A;  4MDW A;  4BI8 B;  5FLX E;  5CK9 A;  3DKM A;  3L2Z A;  3JRZ A;  3M55 A;  2LDM A;  1B34 A;  1Q81 U;  2LNV A;  2P4T A;  2BIV A;  2O01 E;  5GAN g;  2K57 A;  4E7J A;  2E5Q A;  1QVG S;  1ZHI A;  2WSF E;  2CZ7 B;  3J80 E;  4E7H A;  4M77 A;  2LCC A;  2EQK A;  3E9F A;  5CO7 A;  5HK0 A;  4M7D F;  5CKF A;  4F7U E;  3CPW S;  4LD9 K;  1UGR B;  2VUB A;  3CBO A;  4KUD K;  1WJQ A;  5FU7 C;  2AHJ B;  2QA4 T;  3HRS A;  2LVM A;  3J81 E;  3OYE A;  1N8R C;  1HXD A;  2F5T X;  5A0L A;  4XTV A;  3GF5 A;  1QP2 A;  3FEO A;  3OYH A;  5GAN 7;  3L2V A;  3CD6 T;  4NL2 A;  4EMK C;  5A0G A;  1VQ5 T;  1VQN A;  3RMQ A;  1KQS A;  1BI0 A;  5GAN e;  3OYY A;  1VQ9 T;  1VQM A;  3GPL A;  1OZ2 A;  4HA8 A;  2DIG A;  1IRE B;  4BUG A;  4RKU E;  4ZGD B;  2JUF A;  5IT9 E;  2E10 A;  3ASK A;  1BYM A;  4M77 E;  4B9X A;  1G3W A;  4J6Y A;  4MZM A;  4J6W A;  2EFI A;  4PJO G;  1M4Z A;  1M9S A;  5GAN j;  1QVG A;  2QQ9 A;  4PJO D;  1UB4 A;  2RJE A;  2LTO A;  4BI3 A;  3JCM d;  3JCM e;  1WPY A;  3RES A;  1Y96 B;  3OS2 A;  1M90 U;  4R55 A;  1H3Z A;  3G4S A;  2P0K A;  5A0D A;  4LDX A;  3AHU A;  1VQK T;  3CPW A;  5CKE A;  4O6J A;  4M7A B;  5GAN 5;  4PLL A;  3CCU T;  1YJ9 A;  1XNI A;  3JB9 J;  1GXI E;  4J83 A;  4LDW A;  3OBW A;  5CQX A;  3JCM h;  3E19 A;  2ZPF B;  3V8K A;  3VUZ A;  4OB1 B;  3OQ5 A;  3QUI A;  4BE1 A;  3OYJ A;  4OGC A;  5GAO q;  1D3B B;  2DTI A;  4LDU A;  4C5G A;  3MO8 A;  2EIF A;  4XQ3 A;  5J3B A;  2NLU A;  4E7L A;  2EJF A;  4M7D G;  1K9M C;  4F7U F;  5FRM A;  4II1 A;  3FDR A;  4ZN1 A;  4M7D D;  3JCM f;  1UGQ B;  3GNF B;  1YJW A;  3HRT A;  3OYF A;  1VQ7 A;  4PJO C;  1Y71 A;  3OYI A;  4BAC A;  2M0O A;  3SFM A;  2EQU A;  2CZ1 B;  5GAN 6;  2XDD A;  2DD5 A;  4NS5 A;  4ZN3 A;  2VXF A;  4LDY A;  4NOY A;  1TH7 A;  1V29 B;  4Q5W A;  4XU2 A;  2VYT A;  3VJP A;  4JS4 A;  1EIF A;  5GAM f;  1YHQ A;  4GLK A;  4M77 F;  5GMK m;  1VQM T;  2EJG A;  5A2Q E;  2VC8 A;  2E70 A;  1KC8 C;  4BY6 C;  2K2V A;  4OB2 B;  4LDV A;  5HKC A;  2XD0 A;  1AHJ B;  4PJO E;  1K73 C;  1BI1 A;  2ZPH B;  4FT4 A;  3M59 A;  1X6O A;  3TU4 K;  2MAM A;  2RD1 A;  2D0Q B;  3QG1 A;  4M7D C;  2YRV A;  3UWN A;  2DO3 A;  4ELZ C;  3QXE B;  1MHN A;  4OGE A;  2XI9 A;  1K8A C;  3ZFJ A;  3OYA A;  1VQO A;  2DVE A;  5FRN A;  2DZ9 A;  3OA6 A;  2RJF A;  3G4S T;  4M78 B;  2QDY B;  3G71 T;  4ME7 A;  2D6F A;  4QQ6 A;  3QII A;  3RUX A;  3CCV A;  2DZC A;  4E47 A;  2EYQ A;  1DJ7 B;  3CCS A;  4MML A;  2K5F A;  2JTF A;  2LC4 A;  2GQV A;  2X4Y A;  2RO0 A;  4A54 A;  3T9N A;  2RK1 A;  1N6A A;  1UEB A;  1WQW A;  2QQR A;  3HRU A;  3CD6 A;  2RK2 A;  4B9W A;  3X25 B;  5GAO p;  4FT2 A;  4FIB A;  4E7I A;  1VQ9 A;  3P8H A;  2LQ8 A;  3HFN A;  3HL8 A;  1VQ7 T;  4E7K A;  3MET A;  4FU6 A;  4JDS A;  4C0F A;  2MI6 A;  4N4I A;  3WVE B;  4IUT A;  4L6V 5;  4C92 B;  1VQ4 A;  4JJN K;  3JB9 F;  3CCM A;  3CXC A;  4M77 D;  2KAF A;  1H64 1;  4L5G A;  1Y96 A;  1YCY A;  4C5I A;  3LWI A;  4J7I A;  3RKW A;  2FHD A;  1ZBX A;  1VQK A;  5D6W A;  2FVU A;  1U8R A;  2R58 A;  4M7A A;  3RKY A;  1U1T A;  3OS5 A;  3CCU A;  4XTZ A;  1NZ9 A;  4XU3 A;  2BKD N;  3QHS A;  1I81 A;  1VUB A;  4M75 B;  5GMK l;  2PVG B;  4NL3 A;  1D3B A;  1VQO T;  1BI3 A;  4C0D B;  4EDU A;  3CCQ A;  2XDP A;  1NPP A;  4IUU A;  2HAX A;  1BIA A;  4XTY A;  4CRI A;  4A4H A;  1YIT A;  4C8Q G;  3QYH B;  4KBM B;  4C8Q D;  5GAN 3;  5D6X A;  1LOJ A;  3CCV T;  4M77 C;  4BY6 B;  3DLL A;  3CCS T;  1M5Q 1;  3HP9 A;  2VXE A;  2RHX A;  4M7A E;  1I5L A;  3JCM g;  1QVP A;  4YTL A;  2DEQ A;  4XTX A;  4ELY C;  3JCM J;  3OBY A;  2DXB A;  1VIF A;  3V7C A;  2VV5 A;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...