2P4TA

Structure of the q67h mutant of r67 dihydrofolate reductase-nadp+ complex reveals a novel cofactor binding mode
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVHIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
publication title Structure of the Q67H mutant of R67 dihydrofolate reductase-NADP+ complex reveals a novel cofactor binding mode.
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p4tA00
2RK1A 2GQVA 1VIEA 2RK2A 3T9NA 2VV5A 3SFMA 2RH2A 3UDCA 2P4TA 1VIFA 2OAUA
chains in the Genus database with same CATH superfamily
2J6OA 3EGDA 7AT1B 2GFUA 3MP6A 2QAZA 3O5ZA 4J6XA 1YITT 3CPFA 3RKYA 5J26A 3T9NA 1SSHA 4M78E 2DEQA 3P8DA 1Q82C 4BD3A 1M1KR 2PU9B 1TU0B 2J6FA 3ULRB 3L2UA 3M54A 3QUIA 2QQSA 2OJ2A 3C4SA 2ZPEB 3LYIA 5HCKA 1VQMA 1VQ5T 2FHDA 4KUIA 3M0TA 1LOJA 3I55T 4C8QD 4KUDK 2DVJA 2HL3A 4RUGA 2A0FB 2DTHA 4C5GA 1GCQC 1PHTA 4FW1A 3RNJA 1MMGA 1R77A 3QXEB 4LXCA 2RI3A 3JCMP 5C6SA 4PJNA 4OMOA 4XTVA 4C0FA 4ANJA 1YJNT 1NG2A 1AWOA 3PNWC 3CCSQ 3E9FA 1C1AA 4F7UA 4N0AA 1W2BP 2MMPA 1PKSA 4C8QF 1UFFA 1VIFA 1YP5A 2R58A 5CVIA 2MIOA 2QK0A 1ZBJA 2DK3A 2LTOA 3RR6A 3MJXA 1KC8C 1Y71A 4HCCA 4LN2A 4XAXB 1MMDA 1VQ7Q 3A8GB 1OI1A 2KXCA 4LUEA 1U06A 3G1JA 4E7HA 2COZA 2ROTA 4HVUA 2K3BA 2GNCA 2QDYB 2VKNA 2LT4A 4OMMA 3FC3A 2E6NA 3PMTA 1SSFA 2VASA 3A8OB 1H92A 2F1LA 3OYLA 1YWPA 4E7JA 4E47A 2M0YA 8AT1B 3EFRA 3LH0A 3CCJT 4FSXA 4X34A 4DBQA 1GFDA 4LD6A 5KE2A 4GLKA 2HQEA 1WLPB 1KSWA 2D9TA 1BKBA 3VS7A 2CP5A 4MDWA 2XK0A 2QA4T 1YHQT 1HD3A 1NPRA 1C0MA 1X01A 3OSSC 2ED0A 1MUZA 3OS5A 2LDMA 3V8KA 2DRKA 5GAMh 3ZEHA 2PZ1A 2DKGA 2RO0A 3SDZA 2NUPB 4LUDA 1Q7YC 2AHJB 1ZSGA 4LDYA 4C92D 5KYWB 4C8QG 2KRSA 1BB9A 3WVDB 4FSSA 2LCLA 3CXCA 2K9GA 2QGGA 1S72T 2FPDA 3VS3A 1K73R 3H41A 5KYYA 2A7YA 5CQXA 3A8LB 1IXDA 1M8VA 4N0AC 1QP2A 4KGZB 2BKDN 4F04B 1MV3A 4C92F 5LJ3f 3FB9A 4HVVA 2XIDA 4C8QE 2DZ9A 3HPWA 1Y7XA 1YJWA 2D8HA 1WJSA 4ZN3A 2X51A 2RB6A 2EBPA 5IHKA 1UUEA 2CP7A 2J06A 2MK5A 4TVRA 2B8AA 4KBMB 2HMAA 1MNEA 5AYFA 1MMAA 4IURA 3G6EA 1U5SA 1ARKA 3A8MB 1N5ZA 1Z9QA 1WZOA 4A63B 2DXBA 2MWPA 4PK4A 3H6ZA 2LJ1A 4DEYA 4IUUA 1GL5A 2KGTA 4F7UB 3CCLA 1MHNA 1IHWA 2NWMA 4M7DD 2HNIA 2J05A 3ZBDA 1G5VA 1IHVA 2KEAA 3FJ5A 1ZBXA 2PUKB 3SHWA 2H3EB 4BDZA 4C5HA 4PLLA 2O4XA 3MEUA 3OW2S 3LX7A 2HSPA 2VWFA 3L1AA 3OYAA 1JBMA 2F2VA 5DLOA 2NUZA 2M1HA 4L6V5 4C92G 3EG1A 3UT1A 4J9HA 3CXCP 1D09B 4IUQA 1VQOQ 2A3LA 5FLXE 4RTWA 4A4FA 1X2QA 2RPNA 1RI9A 3M56A 4M75C 1ZX6A 2VGNA 1WHMA 2CREA 2ZPFB 1VYTA 3QO3A 2SEMA 1PRMC 2NLUA 3SEMA 2G3RA 1M90R 4HCBA 3PT9A 4BE0A 1TUDA 2LNVA 1T0HA 3CMAQ 4LDWA 4HT8A 2JM9A 4J83A 4C92E 1BI1A 1RAIB 2AKLA 3INZA 5KE3A 4BACA 3RKWA 2P4RA 3P8BB 4BUGA 1WHHA 3JB9J 3MCAB 2XD0A 4ME7A 2OX7A 3CCQT 4N4IA 2EYQA 2ZAEA 2BZYA 3GF5A 5I2SA 1XJWB 4RTTA 3FDRA 2CS7A 3BDLA 4JZ3A 1UJ0A 1QKWA 4CC3A 5DY9A 4O6JA 5KYYB 1Q81U 1FMVA 4OGCA 3HRTA 1IGQA 2FRYA 1Y0MA 3FRNA 4V2SA 4BI3A 3CC2T 4AT1B 4EMKA 1VQNT 2EKOA 4JRQA 5LJ5d 1I1JA 1O75A 4IKFA 3OS2A 2QEXA 1Q86R 3S3NA 1U3OA 3CQTA 3GP8A 3QPHA 1RL2A 2RA2A 3L2VA 3CCEA 1YI2Q 9ATCB 2NYSA 2RH2A 3CCRQ 4FU6A 1IREB 4WF2A 5ECAA 2QGFB 1UE9A 3TVTA 4FW2A 1TWBA 2HKNA 3EFOA 3GPLA 2EGEA 2JTEA 3EG2A 4JRPA 1YIJT 1HK9A 4E7ZA 2EWNA 1VQKA 2DA9A 4FT2A 4DA4A 2RNAA 4NL2A 2F69A 2JM8A 1VQ6Q 4F16A 4JDSA 3M59A 4Z8AA 1LCKA 4ATOA 2O4XB 3M4YA 1AT1B 1E6HA 4M7AD 1VQ8Q 1UGQB 3MHXA 1GXIE 2FZGB 2LJ3A 3DB3A 5FU6C 1GRIA 2RI2A 1JJ2S 2OTJA 4F17A 2DL8A 5EG2A 4CRIA 1KIKA 2EJGA 1YJ9Q 3OBWA 4XK8E 1W6XA 2HQXA 3BE3A 4EIKA 1VQ9A 2LT1A 5FWBA 1BYMA 1BBZA 2ZPGB 3HRSA 2JN0A 1W1FA 3WVEB 3KUFA 1AVZC 2BZ8A 1VQPA 2KAFA 2X9HA 3CPWA 1QCNA 3V7CA 2DFUA 3PVQA 4M7AF 2YSQA 1K0XA 2CP3A 5IHIA 1Q82R 3OYCA 4EMKC 2DL4A 2VUBA 5GAN5 3OS1A 4R55A 1KHIA 4HA8A 2JS0A 5KCHA 1S1NA 3JSCA 1QVGP 1JEGA 4X1VA 1VQ4A 1VQMT 4CC2A 5FU6B 4GBQA 5CK9A 4KULA 4E7KA 2D6FA 1OZ3A 3DKMA 1D1BA 4PKCC 2DBKA 1CSKA 2BUDA 1M27C 5IH2A 2M9UA 3JCMe 3M53A 4PJOG 2BZXA 1D0YA 2GGRA 2RJDA 2YHTA 2JUFA 1K9MC 4FIBA 5KCOA 1WHKA 3X26B 1RAEB 1GBRA 4ORZA 3CBMA 5GMKm 2EVRA 4RTXA 1JXMA 3OQ5A 3CC7Q 2K4YA 4EPCA 1M2VA 4FL6A 3M0UA 2P84A 4N4HA 2AT1B 2K2VA 1W2BS 1M4ZA 1KC8R 2K3XA 1AWWA 1BI2A 4M7AG 1OV3A 4PJOE 3I5RA 3BDUA 2YWWA 4RTYA 1FMWA 2LQWA 3NTKA 3EFOB 3N5BB 3UWNA 2YUNA 3HHTB 1B3QA 1WPYA 2HD0A 1GCQA 4A4EA 1ZSZB 3C95A 3G4SQ 3OYBA 1Q95G 1JQQA 2RK1A 2YUQA 4J9IA 4M78C 2X35A 1IRXA 1Y07A 1UJYA 3PE0A 3FIFA 4J5YA 4J9FA 3CD6A 2DL3A 3CMEA 3JRZA 4Z89A 2MAMA 2RF0A 3VS1A 2QASA 4PFZA 3CCMQ 4M7AE 2DJQA 2NUTB 3CCUA 2ZPIB 2VC8A 2FZKB 2RM4A 3EG3A 2PTKA 2XHCA 5CR2A 3RBBB 2E4HA 4R0KA 3QWYA 2K5LA 3GBQA 3VUZA 3OYHA 1Q7YR 1PD0A 4Y28E 4J7IA 4AG2C 1X2KA 2EFIA 3VRZA 2KRNA 4XTWA 1UTIA 6AT1B 4HCKA 1QMCA 2M51A 2JMAA 2DXCA 1I0CA 1K73U 4BY6C 2ABLA 2GFAA 3OYIA 5FWCA 2JOYA 3LGLA 1HXDA 2I0NA 2K7AA 1NEGA 4L5GA 2CSQA 4M77A 2OTLQ 3G71A 3JV3A 2DTOA 2PNIA 3P8HA 4OGEA 2E10A 3M5AA 4QVDA 4C8QA 2JT4A 5GAN8 1T3LA 2FG0A 2R5AA 1RAGB 4ZGEB 3MEAA 3V7RA 4E6RA 1W70A 4OMFB 3TU4K 1YJWT 2BE9B 2Z0WA 3JCMX 1H641 3SD4A 2HKQB 4LD9K 3G4SA 2GQIA 5D6YA 4BY6B 2KYBA 3G6ET 1I4K1 2X4YA 3I56Q 3JAME 5FRMA 1QWEA 2MPXC 1GFCA 2O9VA 5LJ5j 2G6FX 4PL6A 3SB2A 3X24B 4MZMA 1ABOA 3CCLT 2CGHA 3CCVQ 1VQLA 3QDFA 4KT0E 2JW4A 1QCOA 3M58A 4ELYC 5LJ5e 2RHUA 1OEBA 2X4XA 1ZLMA 2AZSA 2C0TA 1WHJA 2DM1A 3QJ6A 5GANe 2AKKA 2LQ8A 4OVAA 1YITQ 4QW2A 2QG9B 1K1ZA 3I5SA 1SHGA 2KT1A 3CXCS 2OTLA 1RADB 2CSIA 5CO7A 3FEOA 1UB4A 4PJMA 2X3XD 1TXQA 4PJJA 4QQ6A 2EQMA 4M77C 2QQRA 1M90U 2KE9A 3OY9A 1G8XA 4ZTFA 3PFSA 1LPLA 3JCMc 3PVLA 1I5LA 2A08A 1VQ5Q 2CT4A 4C8QC 4KRTA 1XQHA 3I55Q 1NM7A 4FYXB 2FVUA 1QWFA 1G2BA 1NE8A 4E2FB 2K79A 2JXBA 2K2MA 5LJ5g 3OBYA 2ATCB 5CIUA 2KROA 3META 4Y92A 2CH4A 2EGAA 2QXFA 4F7UF 5GANg 5M9OA 1BU1A 5A0GA 3JCMd 1EIFA 3HL8A 3L42A 1AWJA 1YJNQ 3EGDB 1U8RA 4BDYA 2C0IA 2AIRB 3EG0A 1BIAA 3EH2A 1OPKA 4M77B 2E65A 1N9SA 2RJFA 1SEMA 3CCSA 3JCMf 3VJPA 2M16A 4JZ4A 4M75A 2EQIA 4JLIA 1SRLA 4J9DA 1Q86U 2JTMA 3U23A 5FRNA 1FXXA 1WI7A 4RMOA 1VQ7A 2QEXT 4JJDA 1D0XA 4QT7A 1NPPA 1AWXA 3MP8A 1UECA 2YRVA 5GMKh 2L3SA 1YITA 2XI9A 3CCET 3WXMB 1RI0A 5KYNA 3CCJQ 3J7AF 2EQUA 3VS4A 1AOJA 3HTRA 2K5FA 1X43A 2P0QA 1NYGA 1E6GA 4K11A 1OULA 2ZPBB 3QZ9B 4C5EA 1WXUA 1ABQA 3VYGA 2HBWA 2QA4Q 1YHQQ 3GNGA 1X75C 1VQKT 4F7UG 2E12A 1X6GA 2EAYA 3MP1A 1PSEA 2EYYA 3M0PA 4JJBA 2WSCE 1RABB 4DOVA 2KK4A 2PUOB 1N8RC 3OYYA 3OYEA 3QKJA 2LP5A 2CDTA 3VKIA 4IIMA 3OYDA 4HCZA 4J9BA 5GMKl 3PTAA 2RJCA 1PWTA 3OS0A 1KD1C 2OTJT 2JMCA 3C12A 1S72Q 2H8HA 2CYZB 2PVDB 3A1PA 3QWXX 4OMPA 1OYXA 2CZ0B 3MPUB 2RHYA 4F7UE 4FYWB 4EDUA 2VVKA 4Y91A 1VQ9T 3RESA 4AFUC 1QVFA 1KK7A 4M7DF 1K0SA 3H0HA 1Q82U 1R8OB 1VQPT 5CKDA 3BFMA 4D8KA 1P92A 2CUBA 1UDLA 3OMCA 4Z88A 4ZGJB 5GMKj 1Y57A 2KR3A 4Q5WA 3NPFA 3VS0A 2HL5C 2E5KA 4JRKA 2HDAA 2A36A 1ZA1B 2YUPA 1VQ4T 2V26A 1WA7A 5CCAA 2VB6A 1PD1A 5GMKe 1QVGS 3QDRB 1JO8A 2YUOA 1X6OA 4PFOA 5IT9E 2DETA 3QYGB 2EPDA 1BIBA 2RK2A 4IUTA 2ZCFB 1RAFB 3CC4T 4XTZA 4FYYB 2QA4A 3PIOA 1TH7A 2L3PA 4B6MA 2FB7A 1K9MR 3OB9A 4B9XA 2RQWA 5A0LA 4JS4A 4M75B 2A28A 1OOTA 5L23A 4AFZC 4E7LA 2KDSA 3SWNA 1KC8U 1UEBA 4MMLA 2CZ1B 1H3HA 4M7DG 3JCMb 1NEBA 5LL6S 2F5KA 3D7SB 4DBHA 1H8KA 5GMKi 4PJOA 2BE7D 1MNDA 1N27A 2EGCA 2J7IA 2DL7A 3M4GA 1JU5C 5CKHA 5GANd 1VQOA 2DIGA 1PCXA 3C0CA 3PMIA 5LJ5f 2LCSA 5AT1B 1RAAB 2DE0X 1PG5B 3BY7A 1QVFP 3A98A 3L2ZA 3JCMh 1ZHIA 3OMGA 5GANf 4DBRA 2JZ2A 5HK3A 3CD6T 4M7DE 1M1FA 3CBOA 3CMET 3REAB 2E3IA 1JRIA 3M9QA 5CAIA 4M7AA 2FYKA 2HAXA 2KI7A 1AZEA 1PM3A 4RG8A 3REBB 3CCUT 3CMAA 2E64A 1Q7YU 2JS2A 4A4HA 3CCQQ 2KQWA 2COWA 2FPFA 2JTFA 2P0PA 2YXYA 2L2PA 1YCSB 2KYMA 1YCYA 1DJ7B 5GAOl 1G3YA 4FT4A 5KYUA 3VYHB 1R0BG 2XMFA 1AHJB 1EFNA 5CKBA 3X20B 3TQ7P 2RQTA 3R6OA 2AZVA 3CC2Q 3EG9A 2LMJA 2MWOA 3UPUA 1VQNQ 2DBMA 5GAN7 2L8DA 4M78A 2EIFA 2PQWA 1J3TA 3EHQA 1SF9A 4X9DA 2D0QB 2EQKA 3G71T 4FCYA 3SWNC 3F70A 2QQ9A 1I07A 1B07A 3UA6A 2RQRA 3DB4A 1Y96A 2OAUA 4IIOA 1TOVA 1YFNA 2V1QA 2DO3A 3H9NA 4PJOC 2XDBA 1YI2A 4E7IA 4CI0C 4R56A 5GAOr 1UG1A 3L2RA 3CCRA 5GJVB 4PLIA 3G4ST 5IAYA 3THKA 1YIJQ 3VS6A 3JCMQ 1HJDA 4XTUA 2VV5A 2RHIA 2V8KA 3M0QA 3QSUA 3O8VA 2ROLA 5KH6A 2Y90A 2XDPA 2JJ9A 1VQ6A 3SWNB 2L89A 4M7AC 2W10A 2DMOA 5D6WA 2VYTA 1VQLT 4EMKB 5CKEA 2JVVA 2DILA 3GNFB 5GAN6 2MI6A 1VQ8A 1K8AC 4PJOB 2OI3A 2RD1A 4LDXA 4NL3A 5LJ3e 4KGXB 3LLRA 1YJ9A 4DEXA 2ENMA 3HP9A 3OYKA 3MKDA 2DIQA 1RLQC 4JRIA 1VQNA 1WNLA 1NJIC 3JCMg 3E2UA 2OTLT 1F1BB 3CPWP 1RUWA 4J6WA 4OB1B 1WQWA 1M2OA 1EX4A 5C0MA 1BI0A 2O88A 2GTOA 1VQMQ 5J3BA 1T3SA 5D6XA 5A2QE 3GLXA 2DL5A 2D0NA 4D8DA 2LQKA 1OU9A 3MEVA 3VS5A 2HSEB 4NS5A 3L2WA 2HBPA 5LJ5h 3UDCA 3S3OA 2FRWA 1O9SA 2LCCA 4QKUA 4AFSC 2MYSA 2KT8A 1QVPA 4QQGA 1HSQA 1PSFA 1V1CA 5GAOp 5GANh 5GAN4 4JS5A 2V8JA 3EG9B 1BCMA 2WSEE 3H8ZA 1K9AA 1YNZA 4M78B 3NGPA 4PJLA 3CC7A 3CCST 2IIMA 1WX6A 2X4WA 1KQSA 2DNUA 1D0ZA 2NUPA 4HKEA 1Y96B 2YLCA 3H0IA 2MOXA 1WHLA 1N6AA 2LX7A 5HKCA 4JUVA 4XU0A 3RKXA 1VQ7T 4MZTA 4J9GA 2DXTA 3JCMJ 2D1XA 4J6YA 4VUBA 5HY6A 3UA7A 4QVCA 3JB9H 4XU1A 3VS2A 2P0KA 3VV0A 5GAOn 3CBPA 1M3BA 4KH0B 1QKXA 1ZQ1A 4A54A 2SRCA 2DF6A 1YBYA 3FJPA 2IPOB 3QZ5B 3S6WA 4M77D 3EH1A 2LC4A 3QBYA 2E70A 2H3JA 1BCOA 4DBFA 3I35A 2EJFA 3NTIA 3CCMA 1X69A 1M2VB 4AMCA 1RACB 1TG0A 4PFPA 2VXEA 1B34A 5GAN2 1OX8A 3IQLA 2Y4XA 4XQ3A 1N8RR 5GAOm 5GANj 1AEYA 2ZZDA 1EZZB 5GJWB 1OPLA 1Z9ZA 2ZPHB 4M4ZA 3ZL7C 1NYFA 4RTVA 3HRUA 2QQAA 5D7UA 4Z02A 4ZNXA 1TSFA 1G3TA 2F2WA 4M77F 2K57A 1KD1R 3AHUA 2A37A 1IB8A 2CP6A 1KQ1A 1FWZA 4NOYA 3C94A 1Q81C 5CKFA 1BI3A 4ELZC 1G3WA 3TEEA 1NZ9A 1N9RA 3TSWA 1ZUUA 1ZUYA 1TUCA 1XTDA 4JJNK 1KQSP 2KMTA 1QCFA 2K3YA 4J9EA 2DERA 3J80E 4MZPA 3LH5A 4OB0B 1M30A 1G83A 1WXBA 1IZ6A 2C06A 1YJWQ 4L59A 3QG1A 4CC7A 5FROA 5IXBA 4WTOB 1M5Q1 3M55A 4C92A 2O31A 4LDVA 1SPKA 1WYXA 3BW1A 2WACA 2RHZA 3G6EQ 3QIIA 1KHCA 2DX1A 3JCMV 2L3QA 4ZGDB 1K9MU 1M3AA 3I56A 1QW1A 2QQBA 4HXJA 4LE9A 2XU8A 3CCLQ 3M0RA 4M77G 2EKHA 1FX7A 3CCVA 4RTUA 3OYJA 4BB7A 1K8AU 1B7TA 5KYXA 1R0CB 2PVOB 2YLBA 3LW5E 5DLQE 1WGSA 4C8QB 3V7SA 4AG1C 3JB9I 1X6BA 2E3HA 2X3WD 5IHNA 4DQ2A 2KSSA 5DM7R 4WCIA 3M0SA 5LJ3d 1WDXA 4BI8B 2RQVA 3RUXA 1NJIU 1VQOT 4B9WA 1W4SA 2V1RA 4M77E 1UGRB 2HEQA 3ASKA 1KFZA 3J81E 3GIBA 3EAEA 2CP2A 3M57A 1M1KC 5IN1A 1GBQA 4LNPA 1PKTA 3RMSA 3UF4A 4M75D 1QVFS 4ZTJA 4M7DA 4RG2A 1B34B 4A53A 1VQ5A 3ER0A 4XU3A 1T0JA 1XOVA 3I55A 1AD5A 2M02A 1RAHB 2O2OA 3E9GA 3CMAT 2K5IA 4P5NA 2GBQA 1U1SA 4C92C 1OZ2A 2EW3A 1E7OA 2DLPA 4DOWA 5I22A 1HYOA 2D8JA 1D3BA 3JCMW 4RKUE 2GTJA 3PGGA 3KXTA 5GAMj 1SHFA 4GY5A 4ESRA 3A8HB 2QTXA 2DVEA 2RN8A 1FYNA 4RCBA 2E41A 2RHXA 4M75F 3G7ZA 8ATCB 2YRCA 1YJNA 2F2XA 2VGMA 2I2LA 3HFNA 3VU3C 4IUPA 2EQJA 5I11A 2DPPB 3KBGA 5GAMe 1VIEA 4QVZA 5FU7C 3RIRA 3OSVA 4KH1B 2FL7A 2VXFA 2QEXQ 3NFCA 2DXUA 2CUDA 2RQUA 2W0ZA 3QYHB 5L8RE 4X9CA 5EC7A 4IUVA 2XICA 1GCPA 4C92B 4FYVB 3PIPA 3CCEQ 4JPBW 2WSFE 4OF1A 2XKOC 3HSBA 4II1A 1YI2T 4A4KA 3CCRT 3JB9D 2HQHA 3CCJA 3FLGA 4HT9A 2ED1A 1U1TA 3DLLA 1PC0A 4OMNA 3EGUA 1VQKQ 1VYVA 5J39A 2JNGA 2LZ6B 2IG0A 5I2MA 2EYXA 2DEUA 1YHQA 2P4TA 5FU7B 2DJZA 3TSZA 4M7DC 5GAMg 4M75G 2MCNA 2KRMA 2LVMA 1OQKA 4C5IA 3HFOA 3OW2A 1VQ6T 1WIEA 1JXOA 5KYXB 3ME9A 3H0FA 2DAQA 4O5VA 3VUBA 2CT3A 4ZN1A 2PVGB 3RDVA 3JB9F 2HZYA 3R6NA 1TTHB 1I5OB 1PRLC 1YWOA 2ECZA 4J7FA 1VQ8T 2OTJQ 1K8AR 3EGXA 1M9SA 4LDUA 2B86A 1TUGB 3EHRA 4GLMA 1I8FA 3OYNA 1WXTA 1OU8A 1IO6A 1S72A 2IVWA 2DRMA 1VQ9Q 4FM4B 1K73C 2MF2A 1YJ9T 3ZFJA 4J8OA 3AT1B 2RI5A 1VQPQ 2R5MA 3MEWA 4M75E 4YTLA 3VRYA 4MDXA 1NJIR 2V8IA 1QQJA 4M7DB 1SKUB 3TREA 2ZGWA 4PNOA 1QVGA 3OYGA 3OYMA 3LWIA 1A0NB 3X25B 4BE2A 2XG8D 3CPWS 1VQ4Q 2KY9A 2EYWA 2YDLA 1M8MA 4C0GA 1VUBA 3A5ZB 4XU2A 1IGUA 1SG5A 4PJOD 2BTTA 2ESWA 2RJEA 4BE1A 1D3BB 3LWHA 1WJRA 2E6ZA 3CC4Q 1UGVA 2KXDA 3HKSA 2FZCB 1ZUKA 1ZSZA 3TCJA 3I9QA 3JB9G 5LJ3h 2OAWA 3NTHA 1D1CA 2O01E 2C0OA 1WQ7A 1CKBA 2CKKA 2J6KA 4CC4B 4OB3B 2LQNA 1LVKA 5I21A 5IXFA 2X4JA 3DLMA 2NUTA 4KGVB 3OW2P 4J9CA 4PJOF 3SFMA 4A4GA 2L5QA 3CC7T 2DTIA 2CH4W 2FEIA 1JB0E 1VA7A 2XDDA 2FO0A 2EYZA 4BI4A 1AZGB 3E19A 4OB2B 1UGSB 1LNXA 3RMQA 2EJ9A 2L3RA 2RMOA 2LNHB 3GOXA 1MGQA 1ZA2B 1UGPB 2HCKA 1RLPC 1M1KU 2KVQG 2BIVA 3EFSA 1BK2A 4XTYA 1UHCA 3CD6Q 3CMEQ 1H3ZA 1OX9A 3S3MA 2QYZA 4M78D 1KG1A 2DYBA 1M90C 2LRQA 2YRDA 3CCUQ 1XNIA 1UHFA 4OMLA 1N8RU 3NMZC 1KQ2A 5CQYA 3CCMT 1JJ2A 2QI2A 4F14A 2R57A 3Q1JA 1V76A 2CZ6B 3URGA 5LJ3j 2DZCA 3CCQA 3EGXB 5HK0A 3CEYA 2KBTA 3LGFA 5GAN3 3OYFA 3CC4A 3V8JA 2LX9A 1WHGA 1KD1U 1D1AA 2FPEA 1C6VX 1VOMA 3X28B 3MO8A 1ZSZC 4N4GA 4MMKA 2GQVA 4RTZA 4M78F 2K6DA 4RCCA 3V8LA 2CP0A 2CZ7B 2GF7A 3QJYA 1ACMB 1Q81R 1QP3A 2QDLA 3CC2A 3G71Q 5FW9A 5GAMd 4C0DC 1K76A 1QLYA 4UC4A 1Q86C 4EMHA 3KFVA 1M3CA 4M7AB 1VYUA 1KQSS 2M0OA 3NHNA 2YT6A 5GAMf 1K4US 1M1GA 1NLPC 2E5QA 4D6WA 1V29B 1FMKA 4EMGA 4AFQC 3RERA 1LJOA 3E1SA 3L2QA 4JLGA 1KJWA 2DD5A 1TS9A 4JJCA 1CKAA 1X27A 1G3SA 2L0AA 4E7SA 1YIJA 4HVWA 2AK5A 2DD4A 4OMQA 5LJ3g 5KYUB 3UATA 1YN8A 4QQDA 1NLOC 3I56T 2F5TX 2Y4YA 5A0DA 4C0DB 1W2BA 4M78G 1VQLQ 4C0ZA 2E1HA 1NBEB 4XTXA 3CCVT 1WJQA 1JJ2P 2O9SA 1WFWA 2DYIA 3OA6A 1PNJA 2QTVA 4OP0A 2COYA 2GCXA 2LJ0A 5KYWA 1MMNA 5GAOq 3QHSA 2KNBB 1MV0B 1SRMA 1I81A
chains in the Genus database with same CATH topology
2VUBA 3QYGB 5GAN5 3OS1A 1BIBA 4R55A 4BB7A 3OYJA 1K8AU 2RK2A 1KHIA 4IUTA 2ZCFB 2GFUA 4HA8A 3MP6A 3CC4T 5KCHA 2PVOB 2YLBA 3JSCA 4J6XA 4XTZA 3LW5E 5DLQE 2QA4A 3CPFA 1YITT 3RKYA 5J26A 1WGSA 3T9NA 3PIOA 4C8QB 1TH7A 1VQ4A 4M78E 1VQMT 2FB7A 5FU6B 3V7SA 5CK9A 4KULA 2DEQA 3JB9I 3OB9A 4B9XA 3P8DA 1Q82C 4BD3A 5A0LA 4JS4A 4E7KA 2D6FA 1OZ3A 2PU9B 4M75B 4DQ2A 2KSSA 5DM7R 3DKMA 3L2UA 4PKCC 3M54A 3QUIA 2QQSA 2BUDA 5LJ3d 4E7LA 4BI8B 2M9UA 3JCMe 3M53A 2KDSA 4PJOG 3RUXA 3SWNA 1KC8U 1NJIU 1VQOT 1UEBA 3C4SA 2CZ1B 2RJDA 4MMLA 4B9WA 1W4SA 2ZPEB 3LYIA 2YHTA 1VQMA 4M77E 1VQ5T 2JUFA 1UGRB 3JCMb 1K9MC 4M7DG 4FIBA 2FHDA 4KUIA 1LOJA 3I55T 5KCOA 4C8QD 3ASKA 3X26B 5LL6S 3J81E 4KUDK 3EAEA 2F5KA 3GIBA 3M57A 1M1KC 2DTHA 3CBMA 5IN1A 4C5GA 5GMKi 4PJOA 5GMKm 3RMSA 1N27A 4M75D 3OQ5A 3M4GA 1QVFS 4ZTJA 2K4YA 4M7DA 4EPCA 5CKHA 4FL6A 5GANd 1VQOA 2DIGA 3PMIA 3QXEB 4RG2A 5LJ5f 1B34B 4N4HA 2RI3A 4A53A 1VQ5A 3ER0A 4XU3A 3JCMP 5C6SA 1XOVA 3I55A 2K2VA 1W2BS 1M4ZA 3BY7A 3L2ZA 3JCMh 3E9GA 2K3XA 3CMAT 1BI2A 4XTVA 1ZHIA 2K5IA 4C0FA 4M7AG 1YJNT 4P5NA 3OMGA 1U1SA 5GANf 4C92C 4PJOE 3PNWC 1OZ2A 3E9FA 3BDUA 4F7UA 4N0AA 4DOWA 2MMPA 3NTKA 2JZ2A 4C8QF 5HK3A 1D3BA 3JCMW 1VIFA 3CD6T 1M1FA 2R58A 3CBOA 3N5BB 3PGGA 4RKUE 5CVIA 1JRIA 3UWNA 5GAMj 3M9QA 3KXTA 5CAIA 3HHTB 4GY5A 4M7AA 2FYKA 3A8HB 2HD0A 1WPYA 2DK3A 2QTXA 2HAXA 2LTOA 2DVEA 1KC8C 4RCBA 4A4EA 2E41A 2RHXA 4M75F 3G7ZA 4RG8A 3CCUT 3CMAA 1Y71A 2E64A 3C95A 4HCCA 1Q7YU 3OYBA 4XAXB 1YJNA 3A8GB 1OI1A 4A4HA 2RK1A 4E7HA 4M78C 2X35A 2KQWA 1Y07A 2JTFA 2P0PA 2VGMA 2I2LA 3HFNA 3VU3C 4IUPA 2EQJA 2QDYB 3FIFA 4J5YA 3CD6A 2LT4A 3CMEA 2DPPB 3KBGA 3JRZA 5GAMe 3FC3A 1VIEA 2E6NA 3PMTA 2MAMA 4QVZA 1SSFA 3A8OB 1YCYA 5FU7C 3RIRA 3OYLA 3OSVA 4M7AE 4E7JA 4E47A 3CCUA 1DJ7B 2ZPIB 5GAOl 2FL7A 3EFRA 2VXFA 1G3YA 4FT4A 3LH0A 3NFCA 2VC8A 2DXUA 3VYHB 3CCJT 2RM4A 1AHJB 3QYHB 4FSXA 5CKBA 4X34A 5L8RE 4X9CA 2XHCA 3X20B 5CR2A 4LD6A 4IUVA 2XICA 3R6OA 2K5LA 3VUZA 4C92B 3OYHA 5KE2A 3PIPA 4GLKA 2HQEA 4Y28E 2WSFE 4J7IA 2D9TA 1BKBA 2EFIA 2MWOA 3UPUA 4MDWA 2XK0A 4OF1A 5GAN7 2L8DA 2XKOC 3HSBA 4II1A 4M78A 2QA4T 4M7DE 2EIFA 1NPRA 2PQWA 4XTWA 1YHQT 1YI2T 1X01A 4X9DA 2D0QB 2EQKA 3OSSC 4A4KA 3G71T 3CCRT 3JB9D 3SWNC 3CCJA 3OS5A 2LDMA 3V8KA 5GAMh 2DXCA 3F70A 3FLGA 2QQ9A 3ZEHA 1K73U 2DKGA 4BY6C 4HT9A 1U1TA 3DB4A 3DLLA 2GFAA 2RO0A 3SDZA 1Y96A 2OAUA 1Q7YC 2AHJB 4LDYA 3OYIA 2JOYA 2DO3A 3LGLA 4C92D 5J39A 2JNGA 1HXDA 2IG0A 5I2MA 4C8QG 4PJOC 2XDBA 1YHQA 4L5GA 4M77A 1YI2A 4E7IA 4CI0C 2P4TA 5FU7B 2DJZA 4R56A 3L2RA 3G71A 3CCRA 5GAOr 4M7DC 2DTOA 3P8HA 3WVDB 5GAMg 4OGEA 4M75G 2LCLA 4C5IA 2LVMA 3CXCA 3HFOA 2E10A 3OW2A 3M5AA 1VQ6T 3ME9A 4QVDA 4PLIA 3G4ST 2DAQA 5IAYA 4C8QA 1S72T 3JCMQ 5GAN8 4O5VA 3VUBA 2R5AA 4ZGEB 3MEAA 4ZN1A 2PVGB 3V7RA 3JB9F 4OMFB 3TU4K 4XTUA 2VV5A 2A7YA 2RHIA 2V8KA 1YJWT 3QSUA 3O8VA 1VQ8T 5CQXA 4J7FA 3A8LB 5KH6A 3JCMX 1M9SA 4LDUA 1M8VA 4N0AC 2Y90A 1H641 1QP2A 2XDPA 3SD4A 2BKDN 1VQ6A 1I8FA 4C92F 4LD9K 5LJ3f 3SWNB 2L89A 3OYNA 3G4SA 4M7AC 1S72A 3FB9A 5D6WA 5D6YA 4BY6B 2VYTA 2IVWA 2XIDA 4FM4B 4C8QE 1VQLT 2DZ9A 3G6ET 4EMKB 1I4K1 2MF2A 3HPWA 1Y7XA 5CKEA 1YJ9T 1K73C 2JVVA 2X4YA 3ZFJA 4J8OA 3GNFB 3JAME 5FRMA 1YJWA 5GAN6 1WJSA 2MI6A 1VQ8A 4ZN3A 2RI5A 1K8AC 4PJOB 2R5MA 3MEWA 4M75E 4YTLA 2RB6A 5LJ5j 4PL6A 3SB2A 3X24B 4MZMA 4MDXA 2V8IA 4M7DB 4TVRA 2RD1A 4LDXA 2B8AA 4KBMB 4NL3A 3CCLT 2CGHA 5LJ3e 5AYFA 3TREA 1VQLA 4IURA 3G6EA 2ZGWA 4PNOA 3LLRA 1QVGA 3OYGA 1YJ9A 3OYMA 3LWIA 4KT0E 3A8MB 3HP9A 3X25B 4BE2A 2DXBA 2XG8D 3M58A 4ELYC 3OYKA 3CPWS 2MWPA 2KY9A 2DIQA 3H6ZA 5LJ5e 4JRIA 4C0GA 1VQNA 2RHUA 1WNLA 1VUBA 4IUUA 3A5ZB 4XU2A 1NJIC 2X4XA 3JCMg 4PJOD 4F7UB 2RJEA 2OTLT 4BE1A 3CCLA 1MHNA 1D3BB 3LWHA 4M7DD 2HNIA 3QJ6A 1WJRA 4J6WA 5GANe 3ZBDA 2E6ZA 4OB1B 2LQ8A 3HKSA 4OVAA 1G5VA 3TCJA 1WQWA 4QW2A 1ZBXA 3JB9G 5C0MA 1BI0A 2PUKB 5LJ3h 3NTHA 5J3BA 4BDZA 4C5HA 5D6XA 5A2QE 4PLLA 2O4XA 2O01E 3GLXA 3CXCS 3MEUA 1WQ7A 3OW2S 2OTLA 3LX7A 2CKKA 2LQKA 3MEVA 3FEOA 5CO7A 3L1AA 3OYAA 1UB4A 4OB3B 1JBMA 5DLOA 4NS5A 4QQ6A 5I21A 3L2WA 2EQMA 2HBPA 2M1HA 2X4JA 4L6V5 2QQRA 4M77C 4C92G 3UDCA 3DLMA 3UT1A 5LJ5h 3S3OA 1M90U 2LCCA 1O9SA 3OY9A 4ZTFA 4IUQA 3PFSA 2A3LA 4PJOF 1QVPA 5FLXE 4QQGA 3SFMA 3JCMc 4A4GA 2L5QA 1I5LA 4A4FA 1PSFA 3CC7T 2DTIA 5GAOp 4C8QC 1JB0E 1XQHA 2XDDA 5GANh 5GAN4 4JS5A 4BI4A 3M56A 2V8JA 2FVUA 1NE8A 4M75C 5LJ5g 2WSEE 2VGNA 3E19A 3OBYA 4OB2B 3H8ZA 2ZPFB 1UGSB 1LNXA 4M78B 3RMQA 2EJ9A 3QO3A 2L3RA 5CIUA 3META 2NLUA 3GOXA 1MGQA 3CC7A 2G3RA 3CCST 1KQSA 2X4WA 1UGPB 2QXFA 4F7UF 5GANg 4HCBA 4HKEA 5M9OA 3PT9A 5A0GA 4BE0A 1Y96B 3JCMd 1EIFA 2LNVA 2YLCA 3HL8A 3L42A 4LDWA 1M1KU 4J83A 4HT8A 4C92E 1BI1A 2KVQG 3INZA 1U8RA 5KE3A 1N6AA 2BIVA 4BACA 4BDYA 3EFSA 3RKWA 5HKCA 3P8BB 4BUGA 4JUVA 3JB9J 4XU0A 3RKXA 4XTYA 1BIAA 3MCAB 4M77B 1VQ7T 2E65A 1N9SA 2XD0A 4MZTA 3JCMJ 2DXTA 2RJFA 4ME7A 3CCQT 1H3ZA 4N4IA 3S3MA 3CCSA 3JCMf 3VJPA 4M78D 1KG1A 2EYQA 4J6YA 4VUBA 2LRQA 1M90C 5HY6A 2M16A 3GF5A 5I2SA 4M75A 1XNIA 4QVCA 4XU1A 3JB9H 2P0KA 4JLIA 3VV0A 1Q86U 3FDRA 2CS7A 2JTMA 5GAOn 3BDLA 3CBPA 5FRNA 1FXXA 1N8RU 5DY9A 1ZQ1A 1KQ2A 5CQYA 3CCMT 4O6JA 4A54A 1JJ2A 2QI2A 1Q81U 2R57A 1YBYA 3Q1JA 3FJPA 2CZ6B 4OGCA 4RMOA 3URGA 5LJ3j 3QZ5B 2QEXT 1VQ7A 2DZCA 3HRTA 3S6WA 3CCQA 5HK0A 3CEYA 1NPPA 3LGFA 4M77D 5GAN3 3OYFA 3CC4A 2LC4A 3MP8A 3QBYA 2LX9A 3V8JA 2YRVA 5GMKh 2E70A 2H3JA 3FRNA 1YITA 4V2SA 4BI3A 2XI9A 1KD1U 3WXMB 1RI0A 3CC2T 3CCET 3X28B 4EMKA 3MO8A 4EMKC 3J7AF 2EJFA 2EQUA 2EKOA 3NTIA 4MMKA 4N4GA 4JRQA 3CCMA 2GQVA 1VQNT 5LJ5d 4M78F 1O75A 2K5FA 4IKFA 2VXEA 1B34A 4RCCA 5GAN2 3OS2A 3V8LA 2QEXA 3S3NA 2CZ7B 2GF7A 2P0QA 2Y4XA 4XQ3A 3GP8A 3QJYA 3QPHA 5GAOm 1RL2A 5GANj 2ZPBB 3QZ9B 4C5EA 2ZZDA 2RA2A 3VYGA 2ZPHB 1QP3A 3CMET 3L2VA 3CCEA 3CC2A 2RH2A 3GNGA 4FU6A 1X75C 1IREB 4WF2A 4F7UG 1VQKT 2E12A 3HRUA 2QQAA 2EAYA 3MP1A 5GAMd 1PSEA 4C0DC 4Z02A 2WSCE 4DOVA 1G3TA 4M77F 2K57A 4UC4A 3GPLA 1Q86C 3AHUA 4EMHA 2KK4A 2PUOB 1KQ1A 1FWZA 4NOYA 3C94A 1N8RC 4M7AB 3OYYA 4JRPA 3OYEA 3QKJA 1KQSS 2M0OA 1Q81C 1YIJT 5CKFA 5GAMf 1BI3A 1M1GA 4ELZC 1G3WA 1HK9A 2EWNA 1VQKA 3TEEA 2E5QA 4FT2A 1NZ9A 1N9RA 1V29B 4D6WA 3OYDA 4DA4A 4HCZA 4NL2A 5GMKl 2F69A 3PTAA 2RJCA 4EMGA 1XTDA 3OS0A 4JJNK 3RERA 1LJOA 3E1SA 3L2QA 2KMTA 4JDSA 3C12A 4JLGA 1KD1C 2OTJT 2K3YA 2DD5A 2CYZB 3J80E 2PVDB 3M59A 4MZPA 1G3SA 4OB0B 4ATOA 2O4XB 3M4YA 1IZ6A 1OYXA 2CZ0B 1YIJA 2RHYA 2C06A 4M7AD 4F7UE 4EDUA 2DD4A 4Y91A 1VQ9T 3RESA 5LJ3g 4L59A 1UGQB 3MHXA 3QG1A 5FROA 1QVFA 4QQDA 1GXIE 4M7DF 3I56T 3DB3A 2F5TX 5FU6C 1Q82U 2Y4YA 1M5Q1 3M55A 4C92A 1R8OB 2RI2A 1JJ2S 4LDVA 1VQPT 2OTJA 5A0DA 5CKDA 3BFMA 5EG2A 3BW1A 4C0DB 1P92A 4CRIA 1W2BA 4M78G 3OMCA 2WACA 2RHZA 4ZGJB 3QIIA 2EJGA 5GMKj 1KHCA 3OBWA 4Q5WA 4C0ZA 2E1HA 4XK8E 4XTXA 2HQXA 1WJQA 3CCVT 1VQ9A 2LT1A 1BYMA 2ZPGB 3JCMV 3OA6A 4ZGDB 1K9MU 3HRSA 2JN0A 4JRKA 3I56A 1QW1A 3WVEB 3KUFA 2QQBA 4OP0A 2GCXA 1VQPA 2KAFA 3CPWA 1VQ4T 2XU8A 5CCAA 3V7CA 4M7AF 4M77G 5GAOq 5GMKe 3QHSA 1QVGS 3QDRB 1FX7A 1X6OA 3OYCA 3VKIA 1I81A 3CCVA 5IT9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RK1 A;  2GQV A;  1VIE A;  2RK2 A;  3T9N A;  2VV5 A;  3SFM A;  2RH2 A;  3UDC A;  2P4T A;  1VIF A;  2OAU A; 
#chains in the Genus database with same CATH topology
 2J6O A;  3EGD A;  7AT1 B;  2GFU A;  3MP6 A;  2QAZ A;  3O5Z A;  4J6X A;  1YIT T;  3CPF A;  3RKY A;  5J26 A;  3T9N A;  1SSH A;  4M78 E;  2DEQ A;  3P8D A;  1Q82 C;  4BD3 A;  1M1K R;  2PU9 B;  1TU0 B;  2J6F A;  3ULR B;  3L2U A;  3M54 A;  3QUI A;  2QQS A;  2OJ2 A;  3C4S A;  2ZPE B;  3LYI A;  5HCK A;  1VQM A;  1VQ5 T;  2FHD A;  4KUI A;  3M0T A;  1LOJ A;  3I55 T;  4C8Q D;  4KUD K;  2DVJ A;  2HL3 A;  4RUG A;  2A0F B;  2DTH A;  4C5G A;  1GCQ C;  1PHT A;  4FW1 A;  3RNJ A;  1MMG A;  1R77 A;  3QXE B;  4LXC A;  2RI3 A;  3JCM P;  5C6S A;  4PJN A;  4OMO A;  4XTV A;  4C0F A;  4ANJ A;  1YJN T;  1NG2 A;  1AWO A;  3PNW C;  3CCS Q;  3E9F A;  1C1A A;  4F7U A;  4N0A A;  1W2B P;  2MMP A;  1PKS A;  4C8Q F;  1UFF A;  1VIF A;  1YP5 A;  2R58 A;  5CVI A;  2MIO A;  2QK0 A;  1ZBJ A;  2DK3 A;  2LTO A;  3RR6 A;  3MJX A;  1KC8 C;  1Y71 A;  4HCC A;  4LN2 A;  4XAX B;  1MMD A;  1VQ7 Q;  3A8G B;  1OI1 A;  2KXC A;  4LUE A;  1U06 A;  3G1J A;  4E7H A;  2COZ A;  2ROT A;  4HVU A;  2K3B A;  2GNC A;  2QDY B;  2VKN A;  2LT4 A;  4OMM A;  3FC3 A;  2E6N A;  3PMT A;  1SSF A;  2VAS A;  3A8O B;  1H92 A;  2F1L A;  3OYL A;  1YWP A;  4E7J A;  4E47 A;  2M0Y A;  8AT1 B;  3EFR A;  3LH0 A;  3CCJ T;  4FSX A;  4X34 A;  4DBQ A;  1GFD A;  4LD6 A;  5KE2 A;  4GLK A;  2HQE A;  1WLP B;  1KSW A;  2D9T A;  1BKB A;  3VS7 A;  2CP5 A;  4MDW A;  2XK0 A;  2QA4 T;  1YHQ T;  1HD3 A;  1NPR A;  1C0M A;  1X01 A;  3OSS C;  2ED0 A;  1MUZ A;  3OS5 A;  2LDM A;  3V8K A;  2DRK A;  5GAM h;  3ZEH A;  2PZ1 A;  2DKG A;  2RO0 A;  3SDZ A;  2NUP B;  4LUD A;  1Q7Y C;  2AHJ B;  1ZSG A;  4LDY A;  4C92 D;  5KYW B;  4C8Q G;  2KRS A;  1BB9 A;  3WVD B;  4FSS A;  2LCL A;  3CXC A;  2K9G A;  2QGG A;  1S72 T;  2FPD A;  3VS3 A;  1K73 R;  3H41 A;  5KYY A;  2A7Y A;  5CQX A;  3A8L B;  1IXD A;  1M8V A;  4N0A C;  1QP2 A;  4KGZ B;  2BKD N;  4F04 B;  1MV3 A;  4C92 F;  5LJ3 f;  3FB9 A;  4HVV A;  2XID A;  4C8Q E;  2DZ9 A;  3HPW A;  1Y7X A;  1YJW A;  2D8H A;  1WJS A;  4ZN3 A;  2X51 A;  2RB6 A;  2EBP A;  5IHK A;  1UUE A;  2CP7 A;  2J06 A;  2MK5 A;  4TVR A;  2B8A A;  4KBM B;  2HMA A;  1MNE A;  5AYF A;  1MMA A;  4IUR A;  3G6E A;  1U5S A;  1ARK A;  3A8M B;  1N5Z A;  1Z9Q A;  1WZO A;  4A63 B;  2DXB A;  2MWP A;  4PK4 A;  3H6Z A;  2LJ1 A;  4DEY A;  4IUU A;  1GL5 A;  2KGT A;  4F7U B;  3CCL A;  1MHN A;  1IHW A;  2NWM A;  4M7D D;  2HNI A;  2J05 A;  3ZBD A;  1G5V A;  1IHV A;  2KEA A;  3FJ5 A;  1ZBX A;  2PUK B;  3SHW A;  2H3E B;  4BDZ A;  4C5H A;  4PLL A;  2O4X A;  3MEU A;  3OW2 S;  3LX7 A;  2HSP A;  2VWF A;  3L1A A;  3OYA A;  1JBM A;  2F2V A;  5DLO A;  2NUZ A;  2M1H A;  4L6V 5;  4C92 G;  3EG1 A;  3UT1 A;  4J9H A;  3CXC P;  1D09 B;  4IUQ A;  1VQO Q;  2A3L A;  5FLX E;  4RTW A;  4A4F A;  1X2Q A;  2RPN A;  1RI9 A;  3M56 A;  4M75 C;  1ZX6 A;  2VGN A;  1WHM A;  2CRE A;  2ZPF B;  1VYT A;  3QO3 A;  2SEM A;  1PRM C;  2NLU A;  3SEM A;  2G3R A;  1M90 R;  4HCB A;  3PT9 A;  4BE0 A;  1TUD A;  2LNV A;  1T0H A;  3CMA Q;  4LDW A;  4HT8 A;  2JM9 A;  4J83 A;  4C92 E;  1BI1 A;  1RAI B;  2AKL A;  3INZ A;  5KE3 A;  4BAC A;  3RKW A;  2P4R A;  3P8B B;  4BUG A;  1WHH A;  3JB9 J;  3MCA B;  2XD0 A;  4ME7 A;  2OX7 A;  3CCQ T;  4N4I A;  2EYQ A;  2ZAE A;  2BZY A;  3GF5 A;  5I2S A;  1XJW B;  4RTT A;  3FDR A;  2CS7 A;  3BDL A;  4JZ3 A;  1UJ0 A;  1QKW A;  4CC3 A;  5DY9 A;  4O6J A;  5KYY B;  1Q81 U;  1FMV A;  4OGC A;  3HRT A;  1IGQ A;  2FRY A;  1Y0M A;  3FRN A;  4V2S A;  4BI3 A;  3CC2 T;  4AT1 B;  4EMK A;  1VQN T;  2EKO A;  4JRQ A;  5LJ5 d;  1I1J A;  1O75 A;  4IKF A;  3OS2 A;  2QEX A;  1Q86 R;  3S3N A;  1U3O A;  3CQT A;  3GP8 A;  3QPH A;  1RL2 A;  2RA2 A;  3L2V A;  3CCE A;  1YI2 Q;  9ATC B;  2NYS A;  2RH2 A;  3CCR Q;  4FU6 A;  1IRE B;  4WF2 A;  5ECA A;  2QGF B;  1UE9 A;  3TVT A;  4FW2 A;  1TWB A;  2HKN A;  3EFO A;  3GPL A;  2EGE A;  2JTE A;  3EG2 A;  4JRP A;  1YIJ T;  1HK9 A;  4E7Z A;  2EWN A;  1VQK A;  2DA9 A;  4FT2 A;  4DA4 A;  2RNA A;  4NL2 A;  2F69 A;  2JM8 A;  1VQ6 Q;  4F16 A;  4JDS A;  3M59 A;  4Z8A A;  1LCK A;  4ATO A;  2O4X B;  3M4Y A;  1AT1 B;  1E6H A;  4M7A D;  1VQ8 Q;  1UGQ B;  3MHX A;  1GXI E;  2FZG B;  2LJ3 A;  3DB3 A;  5FU6 C;  1GRI A;  2RI2 A;  1JJ2 S;  2OTJ A;  4F17 A;  2DL8 A;  5EG2 A;  4CRI A;  1KIK A;  2EJG A;  1YJ9 Q;  3OBW A;  4XK8 E;  1W6X A;  2HQX A;  3BE3 A;  4EIK A;  1VQ9 A;  2LT1 A;  5FWB A;  1BYM A;  1BBZ A;  2ZPG B;  3HRS A;  2JN0 A;  1W1F A;  3WVE B;  3KUF A;  1AVZ C;  2BZ8 A;  1VQP A;  2KAF A;  2X9H A;  3CPW A;  1QCN A;  3V7C A;  2DFU A;  3PVQ A;  4M7A F;  2YSQ A;  1K0X A;  2CP3 A;  5IHI A;  1Q82 R;  3OYC A;  4EMK C;  2DL4 A;  2VUB A;  5GAN 5;  3OS1 A;  4R55 A;  1KHI A;  4HA8 A;  2JS0 A;  5KCH A;  1S1N A;  3JSC A;  1QVG P;  1JEG A;  4X1V A;  1VQ4 A;  1VQM T;  4CC2 A;  5FU6 B;  4GBQ A;  5CK9 A;  4KUL A;  4E7K A;  2D6F A;  1OZ3 A;  3DKM A;  1D1B A;  4PKC C;  2DBK A;  1CSK A;  2BUD A;  1M27 C;  5IH2 A;  2M9U A;  3JCM e;  3M53 A;  4PJO G;  2BZX A;  1D0Y A;  2GGR A;  2RJD A;  2YHT A;  2JUF A;  1K9M C;  4FIB A;  5KCO A;  1WHK A;  3X26 B;  1RAE B;  1GBR A;  4ORZ A;  3CBM A;  5GMK m;  2EVR A;  4RTX A;  1JXM A;  3OQ5 A;  3CC7 Q;  2K4Y A;  4EPC A;  1M2V A;  4FL6 A;  3M0U A;  2P84 A;  4N4H A;  2AT1 B;  2K2V A;  1W2B S;  1M4Z A;  1KC8 R;  2K3X A;  1AWW A;  1BI2 A;  4M7A G;  1OV3 A;  4PJO E;  3I5R A;  3BDU A;  2YWW A;  4RTY A;  1FMW A;  2LQW A;  3NTK A;  3EFO B;  3N5B B;  3UWN A;  2YUN A;  3HHT B;  1B3Q A;  1WPY A;  2HD0 A;  1GCQ A;  4A4E A;  1ZSZ B;  3C95 A;  3G4S Q;  3OYB A;  1Q95 G;  1JQQ A;  2RK1 A;  2YUQ A;  4J9I A;  4M78 C;  2X35 A;  1IRX A;  1Y07 A;  1UJY A;  3PE0 A;  3FIF A;  4J5Y A;  4J9F A;  3CD6 A;  2DL3 A;  3CME A;  3JRZ A;  4Z89 A;  2MAM A;  2RF0 A;  3VS1 A;  2QAS A;  4PFZ A;  3CCM Q;  4M7A E;  2DJQ A;  2NUT B;  3CCU A;  2ZPI B;  2VC8 A;  2FZK B;  2RM4 A;  3EG3 A;  2PTK A;  2XHC A;  5CR2 A;  3RBB B;  2E4H A;  4R0K A;  3QWY A;  2K5L A;  3GBQ A;  3VUZ A;  3OYH A;  1Q7Y R;  1PD0 A;  4Y28 E;  4J7I A;  4AG2 C;  1X2K A;  2EFI A;  3VRZ A;  2KRN A;  4XTW A;  1UTI A;  6AT1 B;  4HCK A;  1QMC A;  2M51 A;  2JMA A;  2DXC A;  1I0C A;  1K73 U;  4BY6 C;  2ABL A;  2GFA A;  3OYI A;  5FWC A;  2JOY A;  3LGL A;  1HXD A;  2I0N A;  2K7A A;  1NEG A;  4L5G A;  2CSQ A;  4M77 A;  2OTL Q;  3G71 A;  3JV3 A;  2DTO A;  2PNI A;  3P8H A;  4OGE A;  2E10 A;  3M5A A;  4QVD A;  4C8Q A;  2JT4 A;  5GAN 8;  1T3L A;  2FG0 A;  2R5A A;  1RAG B;  4ZGE B;  3MEA A;  3V7R A;  4E6R A;  1W70 A;  4OMF B;  3TU4 K;  1YJW T;  2BE9 B;  2Z0W A;  3JCM X;  1H64 1;  3SD4 A;  2HKQ B;  4LD9 K;  3G4S A;  2GQI A;  5D6Y A;  4BY6 B;  2KYB A;  3G6E T;  1I4K 1;  2X4Y A;  3I56 Q;  3JAM E;  5FRM A;  1QWE A;  2MPX C;  1GFC A;  2O9V A;  5LJ5 j;  2G6F X;  4PL6 A;  3SB2 A;  3X24 B;  4MZM A;  1ABO A;  3CCL T;  2CGH A;  3CCV Q;  1VQL A;  3QDF A;  4KT0 E;  2JW4 A;  1QCO A;  3M58 A;  4ELY C;  5LJ5 e;  2RHU A;  1OEB A;  2X4X A;  1ZLM A;  2AZS A;  2C0T A;  1WHJ A;  2DM1 A;  3QJ6 A;  5GAN e;  2AKK A;  2LQ8 A;  4OVA A;  1YIT Q;  4QW2 A;  2QG9 B;  1K1Z A;  3I5S A;  1SHG A;  2KT1 A;  3CXC S;  2OTL A;  1RAD B;  2CSI A;  5CO7 A;  3FEO A;  1UB4 A;  4PJM A;  2X3X D;  1TXQ A;  4PJJ A;  4QQ6 A;  2EQM A;  4M77 C;  2QQR A;  1M90 U;  2KE9 A;  3OY9 A;  1G8X A;  4ZTF A;  3PFS A;  1LPL A;  3JCM c;  3PVL A;  1I5L A;  2A08 A;  1VQ5 Q;  2CT4 A;  4C8Q C;  4KRT A;  1XQH A;  3I55 Q;  1NM7 A;  4FYX B;  2FVU A;  1QWF A;  1G2B A;  1NE8 A;  4E2F B;  2K79 A;  2JXB A;  2K2M A;  5LJ5 g;  3OBY A;  2ATC B;  5CIU A;  2KRO A;  3MET A;  4Y92 A;  2CH4 A;  2EGA A;  2QXF A;  4F7U F;  5GAN g;  5M9O A;  1BU1 A;  5A0G A;  3JCM d;  1EIF A;  3HL8 A;  3L42 A;  1AWJ A;  1YJN Q;  3EGD B;  1U8R A;  4BDY A;  2C0I A;  2AIR B;  3EG0 A;  1BIA A;  3EH2 A;  1OPK A;  4M77 B;  2E65 A;  1N9S A;  2RJF A;  1SEM A;  3CCS A;  3JCM f;  3VJP A;  2M16 A;  4JZ4 A;  4M75 A;  2EQI A;  4JLI A;  1SRL A;  4J9D A;  1Q86 U;  2JTM A;  3U23 A;  5FRN A;  1FXX A;  1WI7 A;  4RMO A;  1VQ7 A;  2QEX T;  4JJD A;  1D0X A;  4QT7 A;  1NPP A;  1AWX A;  3MP8 A;  1UEC A;  2YRV A;  5GMK h;  2L3S A;  1YIT A;  2XI9 A;  3CCE T;  3WXM B;  1RI0 A;  5KYN A;  3CCJ Q;  3J7A F;  2EQU A;  3VS4 A;  1AOJ A;  3HTR A;  2K5F A;  1X43 A;  2P0Q A;  1NYG A;  1E6G A;  4K11 A;  1OUL A;  2ZPB B;  3QZ9 B;  4C5E A;  1WXU A;  1ABQ A;  3VYG A;  2HBW A;  2QA4 Q;  1YHQ Q;  3GNG A;  1X75 C;  1VQK T;  4F7U G;  2E12 A;  1X6G A;  2EAY A;  3MP1 A;  1PSE A;  2EYY A;  3M0P A;  4JJB A;  2WSC E;  1RAB B;  4DOV A;  2KK4 A;  2PUO B;  1N8R C;  3OYY A;  3OYE A;  3QKJ A;  2LP5 A;  2CDT A;  3VKI A;  4IIM A;  3OYD A;  4HCZ A;  4J9B A;  5GMK l;  3PTA A;  2RJC A;  1PWT A;  3OS0 A;  1KD1 C;  2OTJ T;  2JMC A;  3C12 A;  1S72 Q;  2H8H A;  2CYZ B;  2PVD B;  3A1P A;  3QWX X;  4OMP A;  1OYX A;  2CZ0 B;  3MPU B;  2RHY A;  4F7U E;  4FYW B;  4EDU A;  2VVK A;  4Y91 A;  1VQ9 T;  3RES A;  4AFU C;  1QVF A;  1KK7 A;  4M7D F;  1K0S A;  3H0H A;  1Q82 U;  1R8O B;  1VQP T;  5CKD A;  3BFM A;  4D8K A;  1P92 A;  2CUB A;  1UDL A;  3OMC A;  4Z88 A;  4ZGJ B;  5GMK j;  1Y57 A;  2KR3 A;  4Q5W A;  3NPF A;  3VS0 A;  2HL5 C;  2E5K A;  4JRK A;  2HDA A;  2A36 A;  1ZA1 B;  2YUP A;  1VQ4 T;  2V26 A;  1WA7 A;  5CCA A;  2VB6 A;  1PD1 A;  5GMK e;  1QVG S;  3QDR B;  1JO8 A;  2YUO A;  1X6O A;  4PFO A;  5IT9 E;  2DET A;  3QYG B;  2EPD A;  1BIB A;  2RK2 A;  4IUT A;  2ZCF B;  1RAF B;  3CC4 T;  4XTZ A;  4FYY B;  2QA4 A;  3PIO A;  1TH7 A;  2L3P A;  4B6M A;  2FB7 A;  1K9M R;  3OB9 A;  4B9X A;  2RQW A;  5A0L A;  4JS4 A;  4M75 B;  2A28 A;  1OOT A;  5L23 A;  4AFZ C;  4E7L A;  2KDS A;  3SWN A;  1KC8 U;  1UEB A;  4MML A;  2CZ1 B;  1H3H A;  4M7D G;  3JCM b;  1NEB A;  5LL6 S;  2F5K A;  3D7S B;  4DBH A;  1H8K A;  5GMK i;  4PJO A;  2BE7 D;  1MND A;  1N27 A;  2EGC A;  2J7I A;  2DL7 A;  3M4G A;  1JU5 C;  5CKH A;  5GAN d;  1VQO A;  2DIG A;  1PCX A;  3C0C A;  3PMI A;  5LJ5 f;  2LCS A;  5AT1 B;  1RAA B;  2DE0 X;  1PG5 B;  3BY7 A;  1QVF P;  3A98 A;  3L2Z A;  3JCM h;  1ZHI A;  3OMG A;  5GAN f;  4DBR A;  2JZ2 A;  5HK3 A;  3CD6 T;  4M7D E;  1M1F A;  3CBO A;  3CME T;  3REA B;  2E3I A;  1JRI A;  3M9Q A;  5CAI A;  4M7A A;  2FYK A;  2HAX A;  2KI7 A;  1AZE A;  1PM3 A;  4RG8 A;  3REB B;  3CCU T;  3CMA A;  2E64 A;  1Q7Y U;  2JS2 A;  4A4H A;  3CCQ Q;  2KQW A;  2COW A;  2FPF A;  2JTF A;  2P0P A;  2YXY A;  2L2P A;  1YCS B;  2KYM A;  1YCY A;  1DJ7 B;  5GAO l;  1G3Y A;  4FT4 A;  5KYU A;  3VYH B;  1R0B G;  2XMF A;  1AHJ B;  1EFN A;  5CKB A;  3X20 B;  3TQ7 P;  2RQT A;  3R6O A;  2AZV A;  3CC2 Q;  3EG9 A;  2LMJ A;  2MWO A;  3UPU A;  1VQN Q;  2DBM A;  5GAN 7;  2L8D A;  4M78 A;  2EIF A;  2PQW A;  1J3T A;  3EHQ A;  1SF9 A;  4X9D A;  2D0Q B;  2EQK A;  3G71 T;  4FCY A;  3SWN C;  3F70 A;  2QQ9 A;  1I07 A;  1B07 A;  3UA6 A;  2RQR A;  3DB4 A;  1Y96 A;  2OAU A;  4IIO A;  1TOV A;  1YFN A;  2V1Q A;  2DO3 A;  3H9N A;  4PJO C;  2XDB A;  1YI2 A;  4E7I A;  4CI0 C;  4R56 A;  5GAO r;  1UG1 A;  3L2R A;  3CCR A;  5GJV B;  4PLI A;  3G4S T;  5IAY A;  3THK A;  1YIJ Q;  3VS6 A;  3JCM Q;  1HJD A;  4XTU A;  2VV5 A;  2RHI A;  2V8K A;  3M0Q A;  3QSU A;  3O8V A;  2ROL A;  5KH6 A;  2Y90 A;  2XDP A;  2JJ9 A;  1VQ6 A;  3SWN B;  2L89 A;  4M7A C;  2W10 A;  2DMO A;  5D6W A;  2VYT A;  1VQL T;  4EMK B;  5CKE A;  2JVV A;  2DIL A;  3GNF B;  5GAN 6;  2MI6 A;  1VQ8 A;  1K8A C;  4PJO B;  2OI3 A;  2RD1 A;  4LDX A;  4NL3 A;  5LJ3 e;  4KGX B;  3LLR A;  1YJ9 A;  4DEX A;  2ENM A;  3HP9 A;  3OYK A;  3MKD A;  2DIQ A;  1RLQ C;  4JRI A;  1VQN A;  1WNL A;  1NJI C;  3JCM g;  3E2U A;  2OTL T;  1F1B B;  3CPW P;  1RUW A;  4J6W A;  4OB1 B;  1WQW A;  1M2O A;  1EX4 A;  5C0M A;  1BI0 A;  2O88 A;  2GTO A;  1VQM Q;  5J3B A;  1T3S A;  5D6X A;  5A2Q E;  3GLX A;  2DL5 A;  2D0N A;  4D8D A;  2LQK A;  1OU9 A;  3MEV A;  3VS5 A;  2HSE B;  4NS5 A;  3L2W A;  2HBP A;  5LJ5 h;  3UDC A;  3S3O A;  2FRW A;  1O9S A;  2LCC A;  4QKU A;  4AFS C;  2MYS A;  2KT8 A;  1QVP A;  4QQG A;  1HSQ A;  1PSF A;  1V1C A;  5GAO p;  5GAN h;  5GAN 4;  4JS5 A;  2V8J A;  3EG9 B;  1BCM A;  2WSE E;  3H8Z A;  1K9A A;  1YNZ A;  4M78 B;  3NGP A;  4PJL A;  3CC7 A;  3CCS T;  2IIM A;  1WX6 A;  2X4W A;  1KQS A;  2DNU A;  1D0Z A;  2NUP A;  4HKE A;  1Y96 B;  2YLC A;  3H0I A;  2MOX A;  1WHL A;  1N6A A;  2LX7 A;  5HKC A;  4JUV A;  4XU0 A;  3RKX A;  1VQ7 T;  4MZT A;  4J9G A;  2DXT A;  3JCM J;  2D1X A;  4J6Y A;  4VUB A;  5HY6 A;  3UA7 A;  4QVC A;  3JB9 H;  4XU1 A;  3VS2 A;  2P0K A;  3VV0 A;  5GAO n;  3CBP A;  1M3B A;  4KH0 B;  1QKX A;  1ZQ1 A;  4A54 A;  2SRC A;  2DF6 A;  1YBY A;  3FJP A;  2IPO B;  3QZ5 B;  3S6W A;  4M77 D;  3EH1 A;  2LC4 A;  3QBY A;  2E70 A;  2H3J A;  1BCO A;  4DBF A;  3I35 A;  2EJF A;  3NTI A;  3CCM A;  1X69 A;  1M2V B;  4AMC A;  1RAC B;  1TG0 A;  4PFP A;  2VXE A;  1B34 A;  5GAN 2;  1OX8 A;  3IQL A;  2Y4X A;  4XQ3 A;  1N8R R;  5GAO m;  5GAN j;  1AEY A;  2ZZD A;  1EZZ B;  5GJW B;  1OPL A;  1Z9Z A;  2ZPH B;  4M4Z A;  3ZL7 C;  1NYF A;  4RTV A;  3HRU A;  2QQA A;  5D7U A;  4Z02 A;  4ZNX A;  1TSF A;  1G3T A;  2F2W A;  4M77 F;  2K57 A;  1KD1 R;  3AHU A;  2A37 A;  1IB8 A;  2CP6 A;  1KQ1 A;  1FWZ A;  4NOY A;  3C94 A;  1Q81 C;  5CKF A;  1BI3 A;  4ELZ C;  1G3W A;  3TEE A;  1NZ9 A;  1N9R A;  3TSW A;  1ZUU A;  1ZUY A;  1TUC A;  1XTD A;  4JJN K;  1KQS P;  2KMT A;  1QCF A;  2K3Y A;  4J9E A;  2DER A;  3J80 E;  4MZP A;  3LH5 A;  4OB0 B;  1M30 A;  1G83 A;  1WXB A;  1IZ6 A;  2C06 A;  1YJW Q;  4L59 A;  3QG1 A;  4CC7 A;  5FRO A;  5IXB A;  4WTO B;  1M5Q 1;  3M55 A;  4C92 A;  2O31 A;  4LDV A;  1SPK A;  1WYX A;  3BW1 A;  2WAC A;  2RHZ A;  3G6E Q;  3QII A;  1KHC A;  2DX1 A;  3JCM V;  2L3Q A;  4ZGD B;  1K9M U;  1M3A A;  3I56 A;  1QW1 A;  2QQB A;  4HXJ A;  4LE9 A;  2XU8 A;  3CCL Q;  3M0R A;  4M77 G;  2EKH A;  1FX7 A;  3CCV A;  4RTU A;  3OYJ A;  4BB7 A;  1K8A U;  1B7T A;  5KYX A;  1R0C B;  2PVO B;  2YLB A;  3LW5 E;  5DLQ E;  1WGS A;  4C8Q B;  3V7S A;  4AG1 C;  3JB9 I;  1X6B A;  2E3H A;  2X3W D;  5IHN A;  4DQ2 A;  2KSS A;  5DM7 R;  4WCI A;  3M0S A;  5LJ3 d;  1WDX A;  4BI8 B;  2RQV A;  3RUX A;  1NJI U;  1VQO T;  4B9W A;  1W4S A;  2V1R A;  4M77 E;  1UGR B;  2HEQ A;  3ASK A;  1KFZ A;  3J81 E;  3GIB A;  3EAE A;  2CP2 A;  3M57 A;  1M1K C;  5IN1 A;  1GBQ A;  4LNP A;  1PKT A;  3RMS A;  3UF4 A;  4M75 D;  1QVF S;  4ZTJ A;  4M7D A;  4RG2 A;  1B34 B;  4A53 A;  1VQ5 A;  3ER0 A;  4XU3 A;  1T0J A;  1XOV A;  3I55 A;  1AD5 A;  2M02 A;  1RAH B;  2O2O A;  3E9G A;  3CMA T;  2K5I A;  4P5N A;  2GBQ A;  1U1S A;  4C92 C;  1OZ2 A;  2EW3 A;  1E7O A;  2DLP A;  4DOW A;  5I22 A;  1HYO A;  2D8J A;  1D3B A;  3JCM W;  4RKU E;  2GTJ A;  3PGG A;  3KXT A;  5GAM j;  1SHF A;  4GY5 A;  4ESR A;  3A8H B;  2QTX A;  2DVE A;  2RN8 A;  1FYN A;  4RCB A;  2E41 A;  2RHX A;  4M75 F;  3G7Z A;  8ATC B;  2YRC A;  1YJN A;  2F2X A;  2VGM A;  2I2L A;  3HFN A;  3VU3 C;  4IUP A;  2EQJ A;  5I11 A;  2DPP B;  3KBG A;  5GAM e;  1VIE A;  4QVZ A;  5FU7 C;  3RIR A;  3OSV A;  4KH1 B;  2FL7 A;  2VXF A;  2QEX Q;  3NFC A;  2DXU A;  2CUD A;  2RQU A;  2W0Z A;  3QYH B;  5L8R E;  4X9C A;  5EC7 A;  4IUV A;  2XIC A;  1GCP A;  4C92 B;  4FYV B;  3PIP A;  3CCE Q;  4JPB W;  2WSF E;  4OF1 A;  2XKO C;  3HSB A;  4II1 A;  1YI2 T;  4A4K A;  3CCR T;  3JB9 D;  2HQH A;  3CCJ A;  3FLG A;  4HT9 A;  2ED1 A;  1U1T A;  3DLL A;  1PC0 A;  4OMN A;  3EGU A;  1VQK Q;  1VYV A;  5J39 A;  2JNG A;  2LZ6 B;  2IG0 A;  5I2M A;  2EYX A;  2DEU A;  1YHQ A;  2P4T A;  5FU7 B;  2DJZ A;  3TSZ A;  4M7D C;  5GAM g;  4M75 G;  2MCN A;  2KRM A;  2LVM A;  1OQK A;  4C5I A;  3HFO A;  3OW2 A;  1VQ6 T;  1WIE A;  1JXO A;  5KYX B;  3ME9 A;  3H0F A;  2DAQ A;  4O5V A;  3VUB A;  2CT3 A;  4ZN1 A;  2PVG B;  3RDV A;  3JB9 F;  2HZY A;  3R6N A;  1TTH B;  1I5O B;  1PRL C;  1YWO A;  2ECZ A;  4J7F A;  1VQ8 T;  2OTJ Q;  1K8A R;  3EGX A;  1M9S A;  4LDU A;  2B86 A;  1TUG B;  3EHR A;  4GLM A;  1I8F A;  3OYN A;  1WXT A;  1OU8 A;  1IO6 A;  1S72 A;  2IVW A;  2DRM A;  1VQ9 Q;  4FM4 B;  1K73 C;  2MF2 A;  1YJ9 T;  3ZFJ A;  4J8O A;  3AT1 B;  2RI5 A;  1VQP Q;  2R5M A;  3MEW A;  4M75 E;  4YTL A;  3VRY A;  4MDX A;  1NJI R;  2V8I A;  1QQJ A;  4M7D B;  1SKU B;  3TRE A;  2ZGW A;  4PNO A;  1QVG A;  3OYG A;  3OYM A;  3LWI A;  1A0N B;  3X25 B;  4BE2 A;  2XG8 D;  3CPW S;  1VQ4 Q;  2KY9 A;  2EYW A;  2YDL A;  1M8M A;  4C0G A;  1VUB A;  3A5Z B;  4XU2 A;  1IGU A;  1SG5 A;  4PJO D;  2BTT A;  2ESW A;  2RJE A;  4BE1 A;  1D3B B;  3LWH A;  1WJR A;  2E6Z A;  3CC4 Q;  1UGV A;  2KXD A;  3HKS A;  2FZC B;  1ZUK A;  1ZSZ A;  3TCJ A;  3I9Q A;  3JB9 G;  5LJ3 h;  2OAW A;  3NTH A;  1D1C A;  2O01 E;  2C0O A;  1WQ7 A;  1CKB A;  2CKK A;  2J6K A;  4CC4 B;  4OB3 B;  2LQN A;  1LVK A;  5I21 A;  5IXF A;  2X4J A;  3DLM A;  2NUT A;  4KGV B;  3OW2 P;  4J9C A;  4PJO F;  3SFM A;  4A4G A;  2L5Q A;  3CC7 T;  2DTI A;  2CH4 W;  2FEI A;  1JB0 E;  1VA7 A;  2XDD A;  2FO0 A;  2EYZ A;  4BI4 A;  1AZG B;  3E19 A;  4OB2 B;  1UGS B;  1LNX A;  3RMQ A;  2EJ9 A;  2L3R A;  2RMO A;  2LNH B;  3GOX A;  1MGQ A;  1ZA2 B;  1UGP B;  2HCK A;  1RLP C;  1M1K U;  2KVQ G;  2BIV A;  3EFS A;  1BK2 A;  4XTY A;  1UHC A;  3CD6 Q;  3CME Q;  1H3Z A;  1OX9 A;  3S3M A;  2QYZ A;  4M78 D;  1KG1 A;  2DYB A;  1M90 C;  2LRQ A;  2YRD A;  3CCU Q;  1XNI A;  1UHF A;  4OML A;  1N8R U;  3NMZ C;  1KQ2 A;  5CQY A;  3CCM T;  1JJ2 A;  2QI2 A;  4F14 A;  2R57 A;  3Q1J A;  1V76 A;  2CZ6 B;  3URG A;  5LJ3 j;  2DZC A;  3CCQ A;  3EGX B;  5HK0 A;  3CEY A;  2KBT A;  3LGF A;  5GAN 3;  3OYF A;  3CC4 A;  3V8J A;  2LX9 A;  1WHG A;  1KD1 U;  1D1A A;  2FPE A;  1C6V X;  1VOM A;  3X28 B;  3MO8 A;  1ZSZ C;  4N4G A;  4MMK A;  2GQV A;  4RTZ A;  4M78 F;  2K6D A;  4RCC A;  3V8L A;  2CP0 A;  2CZ7 B;  2GF7 A;  3QJY A;  1ACM B;  1Q81 R;  1QP3 A;  2QDL A;  3CC2 A;  3G71 Q;  5FW9 A;  5GAM d;  4C0D C;  1K76 A;  1QLY A;  4UC4 A;  1Q86 C;  4EMH A;  3KFV A;  1M3C A;  4M7A B;  1VYU A;  1KQS S;  2M0O A;  3NHN A;  2YT6 A;  5GAM f;  1K4U S;  1M1G A;  1NLP C;  2E5Q A;  4D6W A;  1V29 B;  1FMK A;  4EMG A;  4AFQ C;  3RER A;  1LJO A;  3E1S A;  3L2Q A;  4JLG A;  1KJW A;  2DD5 A;  1TS9 A;  4JJC A;  1CKA A;  1X27 A;  1G3S A;  2L0A A;  4E7S A;  1YIJ A;  4HVW A;  2AK5 A;  2DD4 A;  4OMQ A;  5LJ3 g;  5KYU B;  3UAT A;  1YN8 A;  4QQD A;  1NLO C;  3I56 T;  2F5T X;  2Y4Y A;  5A0D A;  4C0D B;  1W2B A;  4M78 G;  1VQL Q;  4C0Z A;  2E1H A;  1NBE B;  4XTX A;  3CCV T;  1WJQ A;  1JJ2 P;  2O9S A;  1WFW A;  2DYI A;  3OA6 A;  1PNJ A;  2QTV A;  4OP0 A;  2COY A;  2GCX A;  2LJ0 A;  5KYW A;  1MMN A;  5GAO q;  3QHS A;  2KNB B;  1MV0 B;  1SRM A;  1I81 A; 
#chains in the Genus database with same CATH homology
 2VUB A;  3QYG B;  5GAN 5;  3OS1 A;  1BIB A;  4R55 A;  4BB7 A;  3OYJ A;  1K8A U;  2RK2 A;  1KHI A;  4IUT A;  2ZCF B;  2GFU A;  4HA8 A;  3MP6 A;  3CC4 T;  5KCH A;  2PVO B;  2YLB A;  3JSC A;  4J6X A;  4XTZ A;  3LW5 E;  5DLQ E;  2QA4 A;  3CPF A;  1YIT T;  3RKY A;  5J26 A;  1WGS A;  3T9N A;  3PIO A;  4C8Q B;  1TH7 A;  1VQ4 A;  4M78 E;  1VQM T;  2FB7 A;  5FU6 B;  3V7S A;  5CK9 A;  4KUL A;  2DEQ A;  3JB9 I;  3OB9 A;  4B9X A;  3P8D A;  1Q82 C;  4BD3 A;  5A0L A;  4JS4 A;  4E7K A;  2D6F A;  1OZ3 A;  2PU9 B;  4M75 B;  4DQ2 A;  2KSS A;  5DM7 R;  3DKM A;  3L2U A;  4PKC C;  3M54 A;  3QUI A;  2QQS A;  2BUD A;  5LJ3 d;  4E7L A;  4BI8 B;  2M9U A;  3JCM e;  3M53 A;  2KDS A;  4PJO G;  3RUX A;  3SWN A;  1KC8 U;  1NJI U;  1VQO T;  1UEB A;  3C4S A;  2CZ1 B;  2RJD A;  4MML A;  4B9W A;  1W4S A;  2ZPE B;  3LYI A;  2YHT A;  1VQM A;  4M77 E;  1VQ5 T;  2JUF A;  1UGR B;  3JCM b;  1K9M C;  4M7D G;  4FIB A;  2FHD A;  4KUI A;  1LOJ A;  3I55 T;  5KCO A;  4C8Q D;  3ASK A;  3X26 B;  5LL6 S;  3J81 E;  4KUD K;  3EAE A;  2F5K A;  3GIB A;  3M57 A;  1M1K C;  2DTH A;  3CBM A;  5IN1 A;  4C5G A;  5GMK i;  4PJO A;  5GMK m;  3RMS A;  1N27 A;  4M75 D;  3OQ5 A;  3M4G A;  1QVF S;  4ZTJ A;  2K4Y A;  4M7D A;  4EPC A;  5CKH A;  4FL6 A;  5GAN d;  1VQO A;  2DIG A;  3PMI A;  3QXE B;  4RG2 A;  5LJ5 f;  1B34 B;  4N4H A;  2RI3 A;  4A53 A;  1VQ5 A;  3ER0 A;  4XU3 A;  3JCM P;  5C6S A;  1XOV A;  3I55 A;  2K2V A;  1W2B S;  1M4Z A;  3BY7 A;  3L2Z A;  3JCM h;  3E9G A;  2K3X A;  3CMA T;  1BI2 A;  4XTV A;  1ZHI A;  2K5I A;  4C0F A;  4M7A G;  1YJN T;  4P5N A;  3OMG A;  1U1S A;  5GAN f;  4C92 C;  4PJO E;  3PNW C;  1OZ2 A;  3E9F A;  3BDU A;  4F7U A;  4N0A A;  4DOW A;  2MMP A;  3NTK A;  2JZ2 A;  4C8Q F;  5HK3 A;  1D3B A;  3JCM W;  1VIF A;  3CD6 T;  1M1F A;  2R58 A;  3CBO A;  3N5B B;  3PGG A;  4RKU E;  5CVI A;  1JRI A;  3UWN A;  5GAM j;  3M9Q A;  3KXT A;  5CAI A;  3HHT B;  4GY5 A;  4M7A A;  2FYK A;  3A8H B;  2HD0 A;  1WPY A;  2DK3 A;  2QTX A;  2HAX A;  2LTO A;  2DVE A;  1KC8 C;  4RCB A;  4A4E A;  2E41 A;  2RHX A;  4M75 F;  3G7Z A;  4RG8 A;  3CCU T;  3CMA A;  1Y71 A;  2E64 A;  3C95 A;  4HCC A;  1Q7Y U;  3OYB A;  4XAX B;  1YJN A;  3A8G B;  1OI1 A;  4A4H A;  2RK1 A;  4E7H A;  4M78 C;  2X35 A;  2KQW A;  1Y07 A;  2JTF A;  2P0P A;  2VGM A;  2I2L A;  3HFN A;  3VU3 C;  4IUP A;  2EQJ A;  2QDY B;  3FIF A;  4J5Y A;  3CD6 A;  2LT4 A;  3CME A;  2DPP B;  3KBG A;  3JRZ A;  5GAM e;  3FC3 A;  1VIE A;  2E6N A;  3PMT A;  2MAM A;  4QVZ A;  1SSF A;  3A8O B;  1YCY A;  5FU7 C;  3RIR A;  3OYL A;  3OSV A;  4M7A E;  4E7J A;  4E47 A;  3CCU A;  1DJ7 B;  2ZPI B;  5GAO l;  2FL7 A;  3EFR A;  2VXF A;  1G3Y A;  4FT4 A;  3LH0 A;  3NFC A;  2VC8 A;  2DXU A;  3VYH B;  3CCJ T;  2RM4 A;  1AHJ B;  3QYH B;  4FSX A;  5CKB A;  4X34 A;  5L8R E;  4X9C A;  2XHC A;  3X20 B;  5CR2 A;  4LD6 A;  4IUV A;  2XIC A;  3R6O A;  2K5L A;  3VUZ A;  4C92 B;  3OYH A;  5KE2 A;  3PIP A;  4GLK A;  2HQE A;  4Y28 E;  2WSF E;  4J7I A;  2D9T A;  1BKB A;  2EFI A;  2MWO A;  3UPU A;  4MDW A;  2XK0 A;  4OF1 A;  5GAN 7;  2L8D A;  2XKO C;  3HSB A;  4II1 A;  4M78 A;  2QA4 T;  4M7D E;  2EIF A;  1NPR A;  2PQW A;  4XTW A;  1YHQ T;  1YI2 T;  1X01 A;  4X9D A;  2D0Q B;  2EQK A;  3OSS C;  4A4K A;  3G71 T;  3CCR T;  3JB9 D;  3SWN C;  3CCJ A;  3OS5 A;  2LDM A;  3V8K A;  5GAM h;  2DXC A;  3F70 A;  3FLG A;  2QQ9 A;  3ZEH A;  1K73 U;  2DKG A;  4BY6 C;  4HT9 A;  1U1T A;  3DB4 A;  3DLL A;  2GFA A;  2RO0 A;  3SDZ A;  1Y96 A;  2OAU A;  1Q7Y C;  2AHJ B;  4LDY A;  3OYI A;  2JOY A;  2DO3 A;  3LGL A;  4C92 D;  5J39 A;  2JNG A;  1HXD A;  2IG0 A;  5I2M A;  4C8Q G;  4PJO C;  2XDB A;  1YHQ A;  4L5G A;  4M77 A;  1YI2 A;  4E7I A;  4CI0 C;  2P4T A;  5FU7 B;  2DJZ A;  4R56 A;  3L2R A;  3G71 A;  3CCR A;  5GAO r;  4M7D C;  2DTO A;  3P8H A;  3WVD B;  5GAM g;  4OGE A;  4M75 G;  2LCL A;  4C5I A;  2LVM A;  3CXC A;  3HFO A;  2E10 A;  3OW2 A;  3M5A A;  1VQ6 T;  3ME9 A;  4QVD A;  4PLI A;  3G4S T;  2DAQ A;  5IAY A;  4C8Q A;  1S72 T;  3JCM Q;  5GAN 8;  4O5V A;  3VUB A;  2R5A A;  4ZGE B;  3MEA A;  4ZN1 A;  2PVG B;  3V7R A;  3JB9 F;  4OMF B;  3TU4 K;  4XTU A;  2VV5 A;  2A7Y A;  2RHI A;  2V8K A;  1YJW T;  3QSU A;  3O8V A;  1VQ8 T;  5CQX A;  4J7F A;  3A8L B;  5KH6 A;  3JCM X;  1M9S A;  4LDU A;  1M8V A;  4N0A C;  2Y90 A;  1H64 1;  1QP2 A;  2XDP A;  3SD4 A;  2BKD N;  1VQ6 A;  1I8F A;  4C92 F;  4LD9 K;  5LJ3 f;  3SWN B;  2L89 A;  3OYN A;  3G4S A;  4M7A C;  1S72 A;  3FB9 A;  5D6W A;  5D6Y A;  4BY6 B;  2VYT A;  2IVW A;  2XID A;  4FM4 B;  4C8Q E;  1VQL T;  2DZ9 A;  3G6E T;  4EMK B;  1I4K 1;  2MF2 A;  3HPW A;  1Y7X A;  5CKE A;  1YJ9 T;  1K73 C;  2JVV A;  2X4Y A;  3ZFJ A;  4J8O A;  3GNF B;  3JAM E;  5FRM A;  1YJW A;  5GAN 6;  1WJS A;  2MI6 A;  1VQ8 A;  4ZN3 A;  2RI5 A;  1K8A C;  4PJO B;  2R5M A;  3MEW A;  4M75 E;  4YTL A;  2RB6 A;  5LJ5 j;  4PL6 A;  3SB2 A;  3X24 B;  4MZM A;  4MDX A;  2V8I A;  4M7D B;  4TVR A;  2RD1 A;  4LDX A;  2B8A A;  4KBM B;  4NL3 A;  3CCL T;  2CGH A;  5LJ3 e;  5AYF A;  3TRE A;  1VQL A;  4IUR A;  3G6E A;  2ZGW A;  4PNO A;  3LLR A;  1QVG A;  3OYG A;  1YJ9 A;  3OYM A;  3LWI A;  4KT0 E;  3A8M B;  3HP9 A;  3X25 B;  4BE2 A;  2DXB A;  2XG8 D;  3M58 A;  4ELY C;  3OYK A;  3CPW S;  2MWP A;  2KY9 A;  2DIQ A;  3H6Z A;  5LJ5 e;  4JRI A;  4C0G A;  1VQN A;  2RHU A;  1WNL A;  1VUB A;  4IUU A;  3A5Z B;  4XU2 A;  1NJI C;  2X4X A;  3JCM g;  4PJO D;  4F7U B;  2RJE A;  2OTL T;  4BE1 A;  3CCL A;  1MHN A;  1D3B B;  3LWH A;  4M7D D;  2HNI A;  3QJ6 A;  1WJR A;  4J6W A;  5GAN e;  3ZBD A;  2E6Z A;  4OB1 B;  2LQ8 A;  3HKS A;  4OVA A;  1G5V A;  3TCJ A;  1WQW A;  4QW2 A;  1ZBX A;  3JB9 G;  5C0M A;  1BI0 A;  2PUK B;  5LJ3 h;  3NTH A;  5J3B A;  4BDZ A;  4C5H A;  5D6X A;  5A2Q E;  4PLL A;  2O4X A;  2O01 E;  3GLX A;  3CXC S;  3MEU A;  1WQ7 A;  3OW2 S;  2OTL A;  3LX7 A;  2CKK A;  2LQK A;  3MEV A;  3FEO A;  5CO7 A;  3L1A A;  3OYA A;  1UB4 A;  4OB3 B;  1JBM A;  5DLO A;  4NS5 A;  4QQ6 A;  5I21 A;  3L2W A;  2EQM A;  2HBP A;  2M1H A;  2X4J A;  4L6V 5;  2QQR A;  4M77 C;  4C92 G;  3UDC A;  3DLM A;  3UT1 A;  5LJ5 h;  3S3O A;  1M90 U;  2LCC A;  1O9S A;  3OY9 A;  4ZTF A;  4IUQ A;  3PFS A;  2A3L A;  4PJO F;  1QVP A;  5FLX E;  4QQG A;  3SFM A;  3JCM c;  4A4G A;  2L5Q A;  1I5L A;  4A4F A;  1PSF A;  3CC7 T;  2DTI A;  5GAO p;  4C8Q C;  1JB0 E;  1XQH A;  2XDD A;  5GAN h;  5GAN 4;  4JS5 A;  4BI4 A;  3M56 A;  2V8J A;  2FVU A;  1NE8 A;  4M75 C;  5LJ5 g;  2WSE E;  2VGN A;  3E19 A;  3OBY A;  4OB2 B;  3H8Z A;  2ZPF B;  1UGS B;  1LNX A;  4M78 B;  3RMQ A;  2EJ9 A;  3QO3 A;  2L3R A;  5CIU A;  3MET A;  2NLU A;  3GOX A;  1MGQ A;  3CC7 A;  2G3R A;  3CCS T;  1KQS A;  2X4W A;  1UGP B;  2QXF A;  4F7U F;  5GAN g;  4HCB A;  4HKE A;  5M9O A;  3PT9 A;  5A0G A;  4BE0 A;  1Y96 B;  3JCM d;  1EIF A;  2LNV A;  2YLC A;  3HL8 A;  3L42 A;  4LDW A;  1M1K U;  4J83 A;  4HT8 A;  4C92 E;  1BI1 A;  2KVQ G;  3INZ A;  1U8R A;  5KE3 A;  1N6A A;  2BIV A;  4BAC A;  4BDY A;  3EFS A;  3RKW A;  5HKC A;  3P8B B;  4BUG A;  4JUV A;  3JB9 J;  4XU0 A;  3RKX A;  4XTY A;  1BIA A;  3MCA B;  4M77 B;  1VQ7 T;  2E65 A;  1N9S A;  2XD0 A;  4MZT A;  3JCM J;  2DXT A;  2RJF A;  4ME7 A;  3CCQ T;  1H3Z A;  4N4I A;  3S3M A;  3CCS A;  3JCM f;  3VJP A;  4M78 D;  1KG1 A;  2EYQ A;  4J6Y A;  4VUB A;  2LRQ A;  1M90 C;  5HY6 A;  2M16 A;  3GF5 A;  5I2S A;  4M75 A;  1XNI A;  4QVC A;  4XU1 A;  3JB9 H;  2P0K A;  4JLI A;  3VV0 A;  1Q86 U;  3FDR A;  2CS7 A;  2JTM A;  5GAO n;  3BDL A;  3CBP A;  5FRN A;  1FXX A;  1N8R U;  5DY9 A;  1ZQ1 A;  1KQ2 A;  5CQY A;  3CCM T;  4O6J A;  4A54 A;  1JJ2 A;  2QI2 A;  1Q81 U;  2R57 A;  1YBY A;  3Q1J A;  3FJP A;  2CZ6 B;  4OGC A;  4RMO A;  3URG A;  5LJ3 j;  3QZ5 B;  2QEX T;  1VQ7 A;  2DZC A;  3HRT A;  3S6W A;  3CCQ A;  5HK0 A;  3CEY A;  1NPP A;  3LGF A;  4M77 D;  5GAN 3;  3OYF A;  3CC4 A;  2LC4 A;  3MP8 A;  3QBY A;  2LX9 A;  3V8J A;  2YRV A;  5GMK h;  2E70 A;  2H3J A;  3FRN A;  1YIT A;  4V2S A;  4BI3 A;  2XI9 A;  1KD1 U;  3WXM B;  1RI0 A;  3CC2 T;  3CCE T;  3X28 B;  4EMK A;  3MO8 A;  4EMK C;  3J7A F;  2EJF A;  2EQU A;  2EKO A;  3NTI A;  4MMK A;  4N4G A;  4JRQ A;  3CCM A;  2GQV A;  1VQN T;  5LJ5 d;  4M78 F;  1O75 A;  2K5F A;  4IKF A;  2VXE A;  1B34 A;  4RCC A;  5GAN 2;  3OS2 A;  3V8L A;  2QEX A;  3S3N A;  2CZ7 B;  2GF7 A;  2P0Q A;  2Y4X A;  4XQ3 A;  3GP8 A;  3QJY A;  3QPH A;  5GAO m;  1RL2 A;  5GAN j;  2ZPB B;  3QZ9 B;  4C5E A;  2ZZD A;  2RA2 A;  3VYG A;  2ZPH B;  1QP3 A;  3CME T;  3L2V A;  3CCE A;  3CC2 A;  2RH2 A;  3GNG A;  4FU6 A;  1X75 C;  1IRE B;  4WF2 A;  4F7U G;  1VQK T;  2E12 A;  3HRU A;  2QQA A;  2EAY A;  3MP1 A;  5GAM d;  1PSE A;  4C0D C;  4Z02 A;  2WSC E;  4DOV A;  1G3T A;  4M77 F;  2K57 A;  4UC4 A;  3GPL A;  1Q86 C;  3AHU A;  4EMH A;  2KK4 A;  2PUO B;  1KQ1 A;  1FWZ A;  4NOY A;  3C94 A;  1N8R C;  4M7A B;  3OYY A;  4JRP A;  3OYE A;  3QKJ A;  1KQS S;  2M0O A;  1Q81 C;  1YIJ T;  5CKF A;  5GAM f;  1BI3 A;  1M1G A;  4ELZ C;  1G3W A;  1HK9 A;  2EWN A;  1VQK A;  3TEE A;  2E5Q A;  4FT2 A;  1NZ9 A;  1N9R A;  1V29 B;  4D6W A;  3OYD A;  4DA4 A;  4HCZ A;  4NL2 A;  5GMK l;  2F69 A;  3PTA A;  2RJC A;  4EMG A;  1XTD A;  3OS0 A;  4JJN K;  3RER A;  1LJO A;  3E1S A;  3L2Q A;  2KMT A;  4JDS A;  3C12 A;  4JLG A;  1KD1 C;  2OTJ T;  2K3Y A;  2DD5 A;  2CYZ B;  3J80 E;  2PVD B;  3M59 A;  4MZP A;  1G3S A;  4OB0 B;  4ATO A;  2O4X B;  3M4Y A;  1IZ6 A;  1OYX A;  2CZ0 B;  1YIJ A;  2RHY A;  2C06 A;  4M7A D;  4F7U E;  4EDU A;  2DD4 A;  4Y91 A;  1VQ9 T;  3RES A;  5LJ3 g;  4L59 A;  1UGQ B;  3MHX A;  3QG1 A;  5FRO A;  1QVF A;  4QQD A;  1GXI E;  4M7D F;  3I56 T;  3DB3 A;  2F5T X;  5FU6 C;  1Q82 U;  2Y4Y A;  1M5Q 1;  3M55 A;  4C92 A;  1R8O B;  2RI2 A;  1JJ2 S;  4LDV A;  1VQP T;  2OTJ A;  5A0D A;  5CKD A;  3BFM A;  5EG2 A;  3BW1 A;  4C0D B;  1P92 A;  4CRI A;  1W2B A;  4M78 G;  3OMC A;  2WAC A;  2RHZ A;  4ZGJ B;  3QII A;  2EJG A;  5GMK j;  1KHC A;  3OBW A;  4Q5W A;  4C0Z A;  2E1H A;  4XK8 E;  4XTX A;  2HQX A;  1WJQ A;  3CCV T;  1VQ9 A;  2LT1 A;  1BYM A;  2ZPG B;  3JCM V;  3OA6 A;  4ZGD B;  1K9M U;  3HRS A;  2JN0 A;  4JRK A;  3I56 A;  1QW1 A;  3WVE B;  3KUF A;  2QQB A;  4OP0 A;  2GCX A;  1VQP A;  2KAF A;  3CPW A;  1VQ4 T;  2XU8 A;  5CCA A;  3V7C A;  4M7A F;  4M77 G;  5GAO q;  5GMK e;  3QHS A;  1QVG S;  3QDR B;  1FX7 A;  1X6O A;  3OYC A;  3VKI A;  1I81 A;  3CCV A;  5IT9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...