2P4TA

Structure of the q67h mutant of r67 dihydrofolate reductase-nadp+ complex reveals a novel cofactor binding mode
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVHIYPVAALERIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
publication title Structure of the Q67H mutant of R67 dihydrofolate reductase-NADP+ complex reveals a novel cofactor binding mode.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p4tA00
2RH2A 2OAUA 2RK2A 2RK1A 1VIEA 3SFMA 2GQVA 1VIFA 2P4TA 2VV5A 3UDCA 3T9NA
chains in the Genus database with same CATH superfamily
4F17A 2DETA 1VQNT 2F5KA 4V2SA 3M57A 4F7UB 1QP3A 2VASA 2LDMA 4BI3A 2DERA 1LCKA 1QLYA 1E6GA 2KXCA 3QDFA 1KHIA 2RHZA 1NJIC 4JS5A 1WYXA 3O5ZA 4HCZA 4HXJA 4KT0E 3QXEB 1VQMA 3QJ6A 4Y92A 1AWWA 2RMOA 4PL6A 5L23A 3JB9H 1WHGA 1UG1A 2IPOB 1CKBA 2QDYB 4ANJA 1X75C 3VS2A 3RKXA 1VQ9A 2JTMA 3JCMg 5GANd 4FW1A 2PUKB 2EYQA 2QQBA 1Q7YU 2CP6A 3HSBA 4PJOE 3X28B 2YHTA 3TU4K 3OSVA 2K5LA 1AVZC 4OGEA 1PSEA 3VS1A 3OMGA 2K2VA 4BI4A 5GAOn 1V1CA 1AOJA 2P0KA 4LDVA 1VQ8A 5LJ3g 4IUUA 1RAEB 3CCEQ 1W70A 1VQ9Q 2X3WD 5GMKj 2RM4A 4HKEA 1YHQT 4PFOA 2LRQA 3OS5A 1VQNA 4E7IA 2DM1A 3P8BB 1QVFP 3S3MA 3FJPA 3IQLA 1Y07A 2QGGA 4AFQC 4LXCA 2MWPA 3NTKA 3C94A 3QZ9B 4BACA 4IIOA 4JRPA 1MUZA 5CQXA 3CBOA 1N8RU 3SD4A 2NYSA 2LQ8A 1R77A 2E10A 3EH1A 2DBKA 4IURA 4HCKA 2LQKA 1KD1C 4GBQA 3QKJA 1KG1A 2BIVA 2KT8A 2CZ0B 2FPDA 3CCRT 1YWPA 1UDLA 2DL5A 1UECA 1AEYA 2FVUA 5IXFA 2F2VA 5KE3A 2PZ1A 1VQ7T 2FEIA 3CQTA 3QZ5B 2JOYA 2EQMA 1G3WA 3RMQA 5FROA 2E41A 5GMKm 2MAMA 4XTYA 4PJMA 4M7DD 2X4XA 1SKUB 1VQKT 2X9HA 3JB9F 2GTOA 4AG2C 3ZFJA 2KBTA 3HPWA 3I9QA 4BE1A 1YHQA 1G3SA 2LCCA 2RQTA 4JDSA 5IXBA 2VB6A 3I5SA 1QVGA 1VQLT 3A5ZB 4JLIA 2LVMA 2O4XB 2YWWA 1UFFA 1QKXA 1D0ZA 1M4ZA 5IH2A 4AG1C 2K57A 4C8QB 1W4SA 2R5MA 5FRNA 1W2BP 1BI0A 2HBWA 3WVEB 2YDLA 1AWXA 3LH5A 2RO0A 2QA4T 4FL6A 4ZN3A 1RI9A 2D6FA 3VRZA 2JMCA 1MMAA 1YHQQ 3VUZA 1D3BA 2MI6A 4HA8A 1B34B 3CCRA 4M78D 4L6V5 5KYYB 4CC3A 1JRIA 4JLGA 4DBFA 5GANg 3EG9B 1VQ7A 3SHWA 3UDCA 2FL7A 4PJOB 2D1XA 4RTWA 4C0DB 1MMGA 4ELYC 3JRZA 4M77G 5FRMA 4XU3A 2VYTA 2DAQA 5LJ5g 1VQKA 1ZUUA 3ULRB 4N4GA 2KQWA 5FW9A 2E6ZA 2DTHA 2OX7A 3MP8A 4J6YA 1QCOA 1TH7A 4D8KA 4HCBA 2DNUA 2ECZA 1VA7A 2O9SA 3HRTA 3JCMJ 3QBYA 1VQ7Q 4M7DA 2JM8A 1QVGP 2KEAA 3RESA 1VQLA 1VQ4Q 4LDYA 4C0FA 2FZGB 1JXOA 4QVCA 3PTAA 2V1QA 3BDUA 5KE2A 2DKGA 3V8KA 1YITT 1JJ2P 2B86A 1VQKQ 4DBHA 1RL2A 1RACB 4AFSC 2K3BA 4JPBW 2MIOA 3H8ZA 3EHRA 4J9IA 3CC4T 2QA4A 4M7DC 2BZXA 1Y96B 3KUFA 2H3EB 1E6HA 3TSZA 3C12A 2XDPA 4M77F 1NPPA 1Q81R 2BZYA 1VQLQ 1NEGA 3A1PA 3TVTA 3MEVA 3C95A 2NUPB 1WHHA 1H92A 1UE9A 3Q1JA 3RNJA 3OYJA 2YRCA 1YJNT 4FW2A 2HBPA 5FU6B 3FIFA 2QA4Q 4WTOB 3CBMA 3UWNA 2M0YA 3V8JA 4RG2A 2CGHA 4ME7A 1K73U 4PNOA 3H41A 4M78A 3M0QA 2EAYA 2EYXA 3PMIA 5C6SA 3UT1A 4LUDA 2WSCE 4HVVA 3OYLA 1WHMA 1OOTA 1Z9QA 1ZHIA 2A28A 1YJWT 4XQ3A 1PSFA 3O8VA 5AT1B 4OB0B 1QCFA 4C5EA 1G5VA 2VVKA 1G3TA 2AZSA 2YRDA 3EGXA 3E19A 2EBPA 2KR3A 1BU1A 1M2VA 4J6WA 1AZEA 1YITA 1G8XA 3CPWS 2E70A 1AD5A 1O9SA 1CSKA 1XTDA 4B6MA 3FB9A 2DE0X 1U06A 2CUDA 3KFVA 1GFCA 3AT1B 3CC4A 2MF2A 4OB1B 3VV0A 4CC4B 2Y90A 3OQ5A 3MEWA 3CC7T 2X35A 2FG0A 1ARKA 3I56Q 1Q7YR 1HD3A 1EZZB 4PJOG 4C92G 3OS2A 1YJNA 1WX6A 3EHQA 2EIFA 4C8QD 4RTZA 5KYWA 2P0PA 4OMNA 3JCMe 3G71T 5CKEA 1ZUKA 4RCCA 1K9MC 4EMKA 2LZ6B 4JRKA 1U1SA 2CP3A 3PT9A 1QMCA 1BIAA 1PWTA 1YJWA 1VQ6Q 4DQ2A 1H641 2P84A 2RJCA 4QQGA 1BI3A 4K11A 2EYZA 1U5SA 2JN0A 1SPKA 4BDYA 1ZA1B 3VYGA 1YJNQ 1X6OA 1Y7XA 2QQRA 4XTVA 3SWNC 5LJ3e 1WLPB 4X9DA 3R6OA 5A2QE 4CC2A 3MHXA 5EC7A 1N8RR 3DKMA 2FZKB 5D6XA 1I81A 1N9SA 4E7SA 1YJWQ 1NM7A 3BE3A 4C92F 1K0SA 3L2RA 2EKOA 1NLOC 1GBRA 2QQ9A 2YRVA 4M75D 4A63B 2CSIA 5I2MA 5GAN6 2RHXA 2DTOA 4TVRA 2X4YA 3CC7A 4J9GA 1RAFB 4PJLA 2KT1A 4F14A 2FYKA 1K0XA 1OX9A 4A4KA 3CBPA 4BB7A 2ABLA 2W0ZA 5GMKh 3EFOB 2DVEA 5GAN3 4OVAA 3G71A 2L89A 2R5AA 1Q86C 3BDLA 1UJ0A 5CIUA 4DOWA 5GAN7 3X26B 1D09B 2NLUA 3DB4A 2CSQA 4LDUA 4LN2A 1KIKA 1HJDA 4C8QA 4Y28E 3QPHA 4QVDA 2E6NA 4ZGEB 2QASA 1M90U 1KK7A 4MZMA 4J9DA 1Q95G 2DXUA 5GAN2 2XKOC 2CP0A 4JRIA 3REAB 4M77E 4OB2B 3G6ET 1EIFA 3G71Q 4RMOA 1H3HA 1M1KU 2H3JA 5KYYA 4HVWA 2QYZA 1YCSB 3L2ZA 5GJWB 3NMZC 5GAMg 2HNIA 4DA4A 1I5OB 2RQUA 1VQOT 1LOJA 4Z89A 3PVLA 2JS2A 3JCMb 3NTIA 1UHFA 1B07A 1W1FA 4M75A 4XU1A 4FT2A 2XK0A 2DK3A 3M5AA 1JB0E 4ZNXA 1TOVA 4AFUC 2DF6A 2WACA 3GPLA 3CCET 5D6YA 2LT4A 1ABOA 2EGAA 2J6FA 2DZ9A 5M9OA 2KRSA 3I5RA 3C4SA 1RLQC 1IGQA 2O9VA 2QTVA 2HL3A 5GAOp 3OYCA 5LJ5e 2DYBA 1NZ9A 4RG8A 3HFNA 2QDLA 2QAZA 2EQJA 5CO7A 2A0FB 3A8MB 3RERA 3G6EA 5GAN5 3CC2Q 4M7AD 2K5IA 2G6FX 5HK0A 2M51A 1UJYA 1QVFS 2ATCB 4ZN1A 2VUBA 4ATOA 4RTUA 4ELZC 2CT3A 4EDUA 2LT1A 2LNHB 2JMAA 2M9UA 2DJQA 2M02A 1M1GA 3H0HA 1N6AA 2K79A 3VS4A 2MOXA 1Y71A 1VQOA 2FB7A 1A0NB 3G6EQ 2ENMA 1OX8A 3PIOA 2C0TA 2GCXA 3NPFA 1K73R 5GAOq 3SEMA 2COWA 2HQXA 4DOVA 2YXYA 5CKHA 2P0QA 1PD1A 2YT6A 2FHDA 3LLRA 1P92A 2FRWA 3CCEA 1WJQA 3JCMP 5CKBA 4CC7A 2OI3A 1UGSB 2DX1A 4C5HA 2K7AA 2Y4YA 1VQOQ 3M0RA 2X4WA 1ZSZA 4OMPA 2EW3A 1NJIU 4RCBA 4IIMA 4NL2A 4C92E 4KUIA 4BD3A 2DL8A 2I2LA 3EGDA 3M4GA 1BYMA 1VQ5Q 8ATCB 4M77B 1SHGA 2RJEA 3GBQA 1X01A 5KH6A 3NFCA 1WXBA 1D0YA 1OEBA 2HDAA 3QG1A 4FIBA 5LJ3j 1BCMA 2L2PA 1ZSZC 1OPKA 2HCKA 3QWYA 4BE0A 2DXTA 3HKSA 1YJ9Q 2HD0A 3E2UA 1IB8A 3SFMA 4RTTA 1HK9A 1WIEA 5FWCA 5FU7B 3TSWA 2XD0A 1ZBXA 4PKCC 4XTUA 3JB9G 3META 2E65A 1WPYA 1W2BS 1RI0A 4M7AA 3M54A 2AIRB 1MHNA 2DXBA 2GFUA 2LQNA 3UF4A 3GF5A 1WQWA 2LP5A 4J5YA 4XTXA 2NWMA 1PKTA 2ROTA 3L2UA 3JCMW 3RMSA 2C0OA 3OW2S 3M0PA 1WZOA 3QWXX 3EAEA 1HXDA 1D0XA 4X34A 4M7DG 2CP2A 1O75A 3X24B 3L1AA 4D8DA 2KVQG 4E7KA 4M7AC 4AT1B 2HSEB 2DL7A 3CD6T 1ZA2B 3LWHA 3MP6A 3DLMA 1VYVA 1ZX6A 2P4TA 1AZGB 4IUTA 1AWOA 1C6VX 3RKYA 3OYIA 1YIJT 2XMFA 3MPUB 3OYYA 2NUTA 1VQ4T 3X20B 3OYAA 2JT4A 4FSSA 1K8AC 3GP8A 2F2WA 1M9SA 1KD1U 3I35A 1H8KA 4QW2A 2LCSA 3M58A 5KYUA 3SDZA 3JB9I 3I55Q 2V1RA 2W10A 2V8IA 3MJXA 5FLXE 2KNBB 4M7DF 1JJ2S 2DD5A 5ECAA 5HK3A 3OMCA 2BUDA 1FWZA 1NBEB 3QUIA 1K76A 3EFOA 1GCPA 3V7CA 2PVOB 1OU8A 2ZPIB 1K1ZA 4R0KA 1SRLA 1JXMA 2GFAA 1W6XA 1GXIE 3MEAA 2ROLA 3LX7A 4II1A 4E7HA 2RB6A 4A53A 3INZA 1JBMA 4L5GA 1JO8A 1QWEA 3MCAB 3CD6A 3OYMA 2RI3A 2E64A 3JCMX 4NOYA 1M90R 5J26A 4JRQA 1YP5A 4P5NA 4HT9A 2RJDA 1BCOA 4BY6C 1PRMC 1YIJA 4C92B 1VQ4A 1R0BG 3A98A 2A36A 1U8RA 2RH2A 1U3OA 2HSPA 4KH0B 2VKNA 2QGFB 1KFZA 2CT4A 4M78F 5LJ5j 1Q82C 1M1KR 1FX7A 2BE9B 1CKAA 2IVWA 2BE7D 3CD6Q 4E6RA 1S72Q 4M7AE 3VUBA 3CCJT 3L2VA 3JCMf 1YIJQ 1K9AA 3RKWA 2DVJA 2E3HA 5CKDA 3ZEHA 3EFSA 3I56T 1MMDA 3QHSA 4J9HA 3FEOA 8AT1B 3PIPA 1NPRA 1V76A 1YFNA 3OYDA 2HL5C 3LWIA 4J8OA 2V26A 1X6BA 3NGPA 1MV3A 2ESWA 2DRKA 5GAN4 4NL3A 5GAMe 1Q82U 3GIBA 3EG3A 5LJ3f 3S6WA 4KGVB 1NE8A 1JQQA 5AYFA 5KYXA 4MMKA 1D1CA 3H0FA 1VQ6T 2YSQA 4BUGA 3M4YA 3JCMV 5CVIA 2QK0A 2O2OA 5IT9E 2L3SA 2RPNA 4PJJA 1ZSGA 1PNJA 1IXDA 2YUQA 4XK8E 3OYEA 3H9NA 1M30A 2IIMA 2LJ3A 2XHCA 3LW5E 2ZPFB 2GF7A 3GOXA 2OTLQ 5L8RE 4A4EA 3CXCS 4Q5WA 1S1NA 3THKA 4F7UA 1X6GA 2C06A 2ZPHB 4O6JA 2J6OA 5CCAA 2JZ2A 1MMNA 2A7YA 2DZCA 4FYWB 1QCNA 2VC8A 4M78C 3CCJA 2NUZA 4GLMA 1YN8A 1GFDA 4E7ZA 2OAWA 1OU9A 3I56A 5FWBA 2SEMA 3VRYA 1M1FA 2PUOB 1R0CB 1B7TA 3HRUA 3CCST 4KBMB 2MWOA 2R58A 4A4HA 3MP1A 2OTJQ 3OYGA 3CCJQ 4RUGA 4PFPA 1J3TA 1M3CA 1H3ZA 3OYKA 1IREB 4X1VA 4YTLA 1VQ6A 3CPWA 5I2SA 5A0GA 1KC8C 4IUVA 1NJIR 2ZZDA 1FMKA 4WCIA 3CCQT 4JJNK 3RIRA 3FRNA 3GNGA 1IO6A 3L42A 2E4HA 1AWJA 1QKWA 2YUNA 1UEBA 1X43A 4BE2A 2DIGA 4A4FA 4M7DE 2X51A 3RUXA 1NYFA 3FLGA 4J9BA 1WXTA 2P4RA 2RHYA 4RTXA 2OAUA 1XQHA 4OMQA 2ED0A 1YI2Q 2XIDA 4HCCA 2K3XA 2PVDB 5J3BA 1SRMA 4M4ZA 2FRYA 2KI7A 1KC8U 4C8QF 1B3QA 4FCYA 2PQWA 2ZPEB 2DYIA 4XU2A 4EMKC 3GLXA 3OYHA 4L59A 3N5BB 2JW4A 5GAOr 4KH1B 2JTEA 4PJOD 2RF0A 4ZTJA 2VGNA 2MK5A 3S3OA 3CCSA 4OMOA 2KY9A 1K9MU 5LJ5f 2DD4A 3A8LB 1PG5B 2EJGA 4EPCA 2KRMA 3JV3A 5CR2A 4Z02A 2F69A 2RHUA 1JEGA 1D1AA 5C0MA 2QEXQ 2DEUA 3HFOA 1FYNA 1OV3A 4F04B 2COYA 2LC4A 2ED1A 4M78E 1GRIA 3M53A 1RABB 2CP5A 5LL6S 2CDTA 3CCSQ 2CH4A 3CCQA 1I07A 4F7UE 3VJPA 4OB3B 4AMCA 2F2XA 3PNWC 4M75F 1KD1R 3MO8A 1M27C 3CC2T 1IRXA 2KYMA 5D6WA 3TREA 1SHFA 4F16A 1G83A 1KQSS 2EJ9A 3D7SB 2O4XA 4R55A 1R8OB 2KRNA 1M3AA 3LYIA 3JSCA 3CCQQ 2RNAA 3JCMd 3VYHB 1PKSA 2LX7A 3QYGB 1T3SA 4DEXA 3R6NA 1OQKA 3P8DA 4Z8AA 2DFUA 1D3BB 4RKUE 4C8QC 1B34A 3OYFA 2KYBA 1Q86U 2RI5A 1LJOA 5HY6A 3QSUA 5LJ3d 3EG9A 1VUBA 2BKDN 2FPEA 2WSFE 4PJOA 4FYXB 3UPUA 5GAMj 4UC4A 3V7RA 2LJ1A 4PLLA 3MKDA 2JXBA 1YBYA 2KROA 3FDRA 4QT7A 4N0AA 1WHLA 2LJ0A 3OS1A 2L3RA 2PTKA 1BBZA 4D6WA 1UB4A 2KXDA 2CP7A 2FPFA 3VS0A 1VQPA 3QO3A 2R57A 3KXTA 1Q81C 1VQ5T 4JJBA 1WQ7A 2BTTA 3M55A 4LD9K 6AT1B 4C0DC 4NS5A 1E7OA 2XDDA 4M7DB 3CC2A 1IZ6A 1OYXA 5GANe 1MGQA 4QVZA 2EQUA 4E2FB 1YJ9T 4N0AC 3L2QA 3JAME 4M7AG 2BZ8A 3SB2A 4M75C 1G2BA 4E7JA 1VQPQ 3J80E 2KGTA 2RQWA 4KRTA 1I8FA 1JU5C 4XAXB 1Y96A 1FMWA 4PLIA 1SG5A 3M0UA 2FZCB 1Q82R 4O5VA 3OB9A 2RK2A 2VGMA 2COZA 2NUPA 2KE9A 1WA7A 3HTRA 1QP2A 1I5LA 4KUDK 4QKUA 2D8HA 1GCQA 2JVVA 2CH4W 3QJYA 2RN8A 1NYGA 2QQSA 3M59A 3KBGA 2M1HA 4M78B 3P8HA 3DLLA 4LD6A 3M0SA 1FMVA 2HQHA 2KAFA 4M7AF 4OF1A 1QVFA 4BDZA 5LJ5h 1VQ5A 1GCQC 4X9CA 2F5TX 7AT1B 1C0MA 5FU6C 1Q7YC 4C8QE 3BY7A 1D1BA 3CMEQ 3I55T 3EGXB 3X25B 1YJ9A 2K2MA 1DJ7B 2GBQA 2YUPA 4IUPA 1M2VB 2DJZA 4EMHA 1N27A 2ZPGB 2M0OA 2SRCA 4J7IA 2L5QA 1TXQA 4IUQA 3L2WA 2MPXC 5CAIA 3RR6A 5J39A 1ZBJA 2J06A 1M2OA 1T0HA 2J6KA 1RAAB 4Y91A 1AHJB 1VQMQ 3EG2A 5LJ5d 2RJFA 3RDVA 1WI7A 2JM9A 3QDRB 4ESRA 1N8RC 2EPDA 5CKFA 3ME9A 1TU0B 4EIKA 4M75E 2EYWA 2DILA 5KYWB 1KHCA 1LPLA 1TUDA 2GNCA 1OZ3A 1X2KA 2RD1A 3SWNB 1QWFA 1ACMB 3PFSA 4PK4A 2EWNA 2XU8A 2EGCA 4EMKB 2KDSA 3REBB 4GLKA 4OMFB 2J7IA 1XNIA 3CCUT 1VOMA 5GAOl 3HP9A 4HVUA 2X3XD 3EH2A 1VQ8Q 2EVRA 2XICA 1W2BA 2DXCA 2XI9A 1Y0MA 1HYOA 3I55A 3JCMc 2K6DA 2E12A 3QYHB 5GAMf 1S72T 1KC8R 1RAHB 4MMLA 1V29B 2L8DA 1QW1A 1VQNQ 3OW2A 2Z0WA 3G4ST 5D7UA 3JB9D 1OPLA 2E1HA 3F70A 1UGRB 1M3BA 3HL8A 1K9MR 4CI0C 1BKBA 1C1AA 1KJWA 2O01E 5I22A 1MNDA 2ZPBB 1QVGS 2DRMA 2DTIA 2GQIA 2G3RA 2L0AA 3FC3A 4RTVA 1YNZA 1VIEA 3CCVT 4M78G 2KMTA 1BI1A 1VYUA 1K8AU 1K4US 1WJSA 4FT4A 1TWBA 4C5IA 4F7UG 2O31A 2HQEA 2I0NA 3UA6A 1MNEA 1X27A 4FYYB 2AT1B 1N5ZA 2EYYA 2OTLT 1VYTA 2DPPB 3CCUA 2K9GA 3NHNA 4JJDA 4MZTA 4N4HA 1TSFA 2F1LA 4N4IA 4JJCA 1JJ2A 5IAYA 2CS7A 3VKIA 5I11A 3LGLA 3HRSA 3WVDB 3OYBA 4QQ6A 3CPFA 2QXFA 1UGQB 1S72A 3OW2P 5GANj 3MEUA 2CUBA 3G4SA 1WFWA 3TQ7P 1PD0A 3CCUQ 2K5FA 2HEQA 3E9FA 2LMJA 2PU9B 4OP0A 1Q86R 4EMGA 2GTJA 4FU6A 1TS9A 1PRLC 2OTJT 2CYZB 4F7UF 2E5KA 5IHKA 2D0NA 1BIBA 4XTZA 1YWOA 2Y4XA 4JZ4A 4KGZB 5IHIA 5DLQE 2KSSA 2ZAEA 3G4SQ 2MYSA 4M75B 3CCRQ 3M9QA 4ORZA 3CCVA 1UGVA 4C0ZA 2VXFA 4AFZC 2ZGWA 4OMLA 3H6ZA 4FM4B 2EJFA 3S3NA 2J05A 2AK5A 4J9FA 1U1TA 4M77D 3TCJA 4A4GA 4PJNA 9ATCB 4XU0A 2D8JA 2OTLA 2JTFA 1IGUA 3CCMT 2PNIA 1YI2T 4E7LA 2K4YA 3CCVQ 3PE0A 3VS3A 3GNFB 2DEQA 2IG0A 1K73C 2ZCFB 2DA9A 4KGXB 1I0CA 1QVPA 4OGCA 1QQJA 3T9NA 4LNPA 2EGEA 1VIFA 2HMAA 2AKLA 2DLPA 2VWFA 1FXXA 4A54A 1I1JA 2DIQA 3ASKA 4JUVA 1TG0A 1LNXA 2H8HA 2HZYA 2A37A 1SF9A 4LDWA 4GY5A 3CMAT 2OTJA 5GAMh 1UTIA 3EG0A 2B8AA 2PVGB 2QEXT 2LQWA 1Y57A 2HAXA 1GBQA 1ZLMA 4MDWA 2M16A 5KCOA 3CXCA 3UATA 5HCKA 5GMKl 3OY9A 1F1BB 1SSHA 5DY9A 2QI2A 1BK2A 2E3IA 1IHVA 3H0IA 3OA6A 1TUGB 1MV0B 3VS6A 4C8QG 2LCLA 3A8HB 1T0JA 2RQVA 1WNLA 1XOVA 4JS4A 3BFMA 1ZSZB 1X69A 4LE9A 2DL3A 3A8OB 2RK1A 3CCMA 4VUBA 4B9WA 3EGDB 1YI2A 2CZ1B 1NG2A 1TTHB 2RA2A 4M77A 3QIIA 3VS5A 5GAMd 5IN1A 4JZ3A 3M0TA 3EGUA 3J81E 1PM3A 2JNGA 5GMKi 3RBBB 4FYVB 4R56A 5CK9A 1YITQ 4LDXA 4KULA 2QG9B 3CCMQ 3PGGA 3G7ZA 4M77C 4QQDA 3HHTB 2JS0A 2JJ9A 2GGRA 4M7AB 3CC4Q 3CMAA 2A08A 4M75G 3SWNA 1OI1A 2CZ7B 2V8JA 1RADB 2EFIA 5GANf 3NTHA 2QEXA 3OYNA 1GL5A 5FU7C 3CXCP 2YLCA 2D9TA 1M8VA 1M8MA 4BI8B 4C92D 2EQKA 1UUEA 1NLPC 1TUCA 1RLPC 3CCLT 1I4K1 4HT8A 2XDBA 1WJRA 4DEYA 2DO3A 5IHNA 5GMKe 3CMAQ 3JCMh 3ZL7C 5GJVB 2NUTB 4XTWA 2LX9A 1WGSA 2CREA 4DBQA 1KQ2A 1WHJA 5HKCA 3CPWP 1OULA 3M56A 2VV5A 4PJOF 1RUWA 2JUFA 3BW1A 1VQPT 5I21A 1ZQ1A 3U23A 4LUEA 2QTXA 1EX4A 1RAIB 2MMPA 1SEMA 2GQVA 4OMMA 3V8LA 4DBRA 2DMOA 5KYUB 1IHWA 5LJ3h 2VXEA 4E47A 1M90C 2AKKA 3J7AF 1N9RA 1ZUYA 2L3PA 1AT1B 1WXUA 1YCYA 2LTOA 1SSFA 4FSXA 2CZ6B 2X4JA 1NEBA 2DBMA 3EG1A 1UHCA 2L3QA 2EQIA 1BI2A 1G3YA 1PCXA 3LH0A 4WF2A 5EG2A 2AZVA 1Z9ZA 3VS7A 2RQRA 2V8KA 1T3LA 1EFNA 1K8AR 1M1KC 2HKQB 3CC7Q 2RHIA 4BY6B 1XJWB 1KQSA 2C0IA 3E9GA 3CEYA 2HKNA 3EFRA 3C0CA 4ZGJB 4IKFA 5DM7R 1KQ1A 3URGA 3ZBDA 1M5Q1 3CCLA 1PC0A 4RTYA 1X2QA 4J7FA 4J9EA 3CMET 1WHKA 3FJ5A 4PFZA 3JB9J 2EKHA 4C92A 5GAOm 3A8GB 3PMTA 3E1SA 2YUOA 4J6XA 3V7SA 2E5QA 2OJ2A 3LGFA 2YLBA 2KK4A 4MZPA 2D0QB 3WXMB 5KYNA 3CCLQ 4PJOC 5DLOA 5A0LA 1PHTA 4ZTFA 4C92C 3AHUA 4ZGDB 2CKKA 1WDXA 3OBYA 1OZ2A 1UGPB 1VQMT 2XG8D 4J9CA 5GAN8 4Z88A 2O88A 2AHJB 3OBWA 1KSWA 4C0GA 1RAGB 1VQ9T 1BB9A 3OS0A 1HSQA 1Q81U 3VU3C 2DL4A 2MCNA 2A3LA 2QQAA 1KQSP 2FO0A 2WSEE 3TEEA 5A0DA 4CRIA 5KYXB 4J83A 4C5GA 2LNVA 5CQYA 5KCHA 3G1JA 1LVKA 1VQ8T 3OSSC 4MDXA 3ER0A 1ABQA 3CMEA 2RI2A 5GANh 3DB3A 3JCMQ 4B9XA 3PVQA 3UA7A 2K3YA
chains in the Genus database with same CATH topology
1VQNT 2GF7A 3GOXA 5L8RE 2F5KA 4A4EA 2FYKA 4V2SA 3CXCS 4Q5WA 3FC3A 3M57A 4F7UA 4F7UB 2C06A 1QP3A 1VIEA 2ZPHB 2LDMA 3CCVT 4O6JA 4BI3A 4M78G 4A4KA 2KMTA 1BI1A 3CBPA 4BB7A 5CCAA 1K8AU 2JZ2A 1WJSA 2A7YA 4FT4A 5GMKh 1KHIA 2DZCA 2RHZA 2DVEA 5GAN3 4C5IA 2VC8A 4OVAA 4F7UG 3G71A 1NJIC 2HQEA 4M78C 4JS5A 3CCJA 2L89A 2R5AA 1Q86C 3BDLA 4HCZA 4KT0E 5CIUA 4DOWA 3QXEB 5GAN7 3X26B 2NLUA 3DB4A 1VQMA 3QJ6A 4LDUA 2OTLT 3I56A 2DPPB 3CCUA 4PL6A 1M1FA 4C8QA 2PUOB 3JB9H 4MZTA 4Y28E 4N4HA 3QPHA 4N4IA 3HRUA 4QVDA 3CCST 1JJ2A 5IAYA 2QDYB 2E6NA 4ZGEB 1M90U 2CS7A 3VKIA 4MZMA 3LGLA 4KBMB 3HRSA 1X75C 3WVDB 3OYBA 2MWOA 2R58A 3RKXA 4A4HA 1VQ9A 2DXUA 2JTMA 3JCMg 5GANd 4QQ6A 3MP1A 5GAN2 2XKOC 3CPFA 2QXFA 1UGQB 4JRIA 1S72A 4M77E 2PUKB 2EYQA 1EIFA 4OB2B 3OYGA 3G6ET 2QQBA 1Q7YU 4RMOA 5GANj 3MEUA 3HSBA 1H3ZA 4PJOE 3X28B 3OYKA 1IREB 2YHTA 3G4SA 3TU4K 3OSVA 2K5LA 4OGEA 4YTLA 1M1KU 1PSEA 2H3JA 2K2VA 3OMGA 4BI4A 3CPWA 1VQ6A 5I2SA 5GAOn 2K5FA 5A0GA 3E9FA 2P0KA 4LDVA 1KC8C 1VQ8A 4IUVA 3L2ZA 2ZZDA 2PU9B 4OP0A 5GAMg 5LJ3g 3CCQT 4JJNK 4IUUA 3RIRA 4EMGA 3FRNA 3GNGA 2HNIA 4FU6A 3L42A 4DA4A 2OTJT 5GMKj 2CYZB 2RM4A 1UEBA 4F7UF 1VQOT 4HKEA 1YHQT 1LOJA 1BIBA 4XTZA 4BE2A 2Y4XA 2DIGA 2LRQA 3JCMb 3NTIA 4A4FA 3OS5A 1VQNA 5DLQE 4E7IA 4M7DE 3P8BB 3RUXA 3S3MA 2KSSA 3FJPA 3FLGA 4M75A 4M75B 1Y07A 2RHYA 4XU1A 3M9QA 2OAUA 3CCVA 4FT2A 2XK0A 1XQHA 2DK3A 2MWPA 3NTKA 4C0ZA 2XIDA 4HCCA 2K3XA 3M5AA 1JB0E 2VXFA 2PVDB 5J3BA 2ZGWA 2WACA 3C94A 3H6ZA 3QZ9B 4BACA 4FM4B 2EJFA 3GPLA 1KC8U 3CCET 5D6YA 2LT4A 3S3NA 4M7DA 4C8QF 4JRPA 1U1TA 5CQXA 3CBOA 1N8RU 2PQWA 2DZ9A 4M77D 5M9OA 2ZPEB 3TCJA 4A4GA 3SD4A 2LQ8A 2E10A 4XU2A 4EMKC 3GLXA 4XU0A 4IURA 3OYHA 4L59A 3N5BB 2OTLA 2LQKA 5GAOr 1KD1C 4M7DC 3C4SA 3QKJA 4PJOD 1KG1A 2JTFA 4ZTJA 2VGNA 2BIVA 3CCMT 4NL3A 5GAOp 3S3OA 2CZ0B 3CCRT 3OYCA 3CCSA 5LJ5e 2KY9A 1K9MU 1YI2T 1NZ9A 5LJ5f 4E7LA 2K4YA 4RG8A 3GNFB 3HFNA 2DD4A 3A8LB 2DEQA 2IG0A 1K73C 2FVUA 2EQJA 2ZCFB 5KE3A 2EJGA 5CO7A 4EPCA 3A8MB 1VQ7T 5CR2A 3RERA 4Z02A 3G6EA 4M7DB 5GAN5 3QZ5B 2F69A 2RHUA 2JOYA 4KUDK 1QVPA 2EQMA 1G3WA 4OGCA 5C0MA 3RMQA 4M7AD 5FROA 2K5IA 2E41A 5GMKm 2MAMA 4XTYA 3T9NA 5HK0A 3HFOA 4M7DD 2X4XA 1VIFA 1QVFS 2LC4A 4ZN1A 2VUBA 4M78E 1VQKT 4ATOA 4ELZC 1FXXA 4A54A 3JB9F 2DIQA 4EDUA 3ASKA 3M53A 2LT1A 4JUVA 1Q81U 5LL6S 1LNXA 2M9UA 3CCQA 1M1GA 1N6AA 4F7UE 3VJPA 4OB3B 3ZFJA 4LDWA 4GY5A 3CMAT 2OTJA 3HPWA 1Y71A 5GAMh 3PNWC 4M75F 4BE1A 3MO8A 1VQOA 2FB7A 1YHQA 1G3SA 2LCCA 4JDSA 3CC2T 2B8AA 5D6WA 3TREA 2PVGB 1KQSS 1QVGA 1VQLT 3PIOA 2QEXT 3A5ZB 2EJ9A 4JLIA 2LVMA 2GCXA 2HAXA 2O4XA 2O4XB 4MDWA 4R55A 1R8OB 1M4ZA 2M16A 5GAOq 2HQXA 4DOVA 5KCOA 5CKHA 2K57A 3CXCA 4C8QB 5GMKl 2P0QA 3OY9A 1W4SA 2R5MA 5FRNA 1BI0A 3LYIA 5DY9A 2QI2A 2FHDA 3LLRA 3WVEB 3OA6A 3JSCA 1P92A 3CCEA 1WJQA 3JCMP 2QA4T 2RO0A 5CKBA 4FL6A 3VYHB 3JCMd 4ZN3A 1UGSB 2D6FA 3QYGB 4C5HA 4C8QG 2LCLA 3A8HB 2Y4YA 1WNLA 1XOVA 4JS4A 3P8DA 3BFMA 3VUZA 2X4WA 3A8OB 2RK1A 1D3BA 1NJIU 1D3BB 2MI6A 4RCBA 4RKUE 1B34A 4HA8A 1B34B 4NL2A 4VUBA 4C8QC 4KUIA 4C92E 4BD3A 3OYFA 2RI5A 3CCRA 2I2LA 4M78D 1Q86U 4B9WA 4L6V5 3M4GA 1YI2A 2CZ1B 1BYMA 1JRIA 1LJOA 4JLGA 5HY6A 2RA2A 4M77A 3QIIA 4M77B 2RJEA 3QSUA 5GAMd 5LJ3d 5IN1A 5GANg 1X01A 5KH6A 3NFCA 1VQ7A 1VUBA 2BKDN 2WSFE 3UDCA 4PJOA 3QG1A 2FL7A 3UPUA 4PJOB 3J81E 4FIBA 4C0DB 5LJ3j 5GAMj 2JNGA 4UC4A 4ELYC 3V7RA 3GIBA 3JRZA 5GMKi 4PLLA 4BE0A 2DXTA 3HKSA 4M77G 4XU3A 4R56A 5FRMA 2VYTA 5CK9A 1YBYA 2HD0A 3FDRA 2DAQA 4N0AA 3SFMA 5LJ5g 1HK9A 4LDXA 3OS1A 1VQKA 5FU7B 2L3RA 4KULA 4D6WA 2XD0A 1UB4A 1ZBXA 1VQPA 3PGGA 3G7ZA 3QO3A 4M77C 4N4GA 2R57A 2KQWA 3HHTB 4PKCC 4QQDA 4XTUA 3META 3KXTA 3JB9G 2E65A 1Q81C 1VQ5T 1WPYA 2E6ZA 1W2BS 1WQ7A 1RI0A 2DTHA 3MP8A 4M7AA 4J6YA 3M54A 4M7AB 1MHNA 1TH7A 2DXBA 2GFUA 3M55A 3CMAA 4LD9K 4C0DC 4HCBA 3HRTA 3GF5A 4NS5A 1WQWA 2XDDA 3QBYA 3JCMJ 4J5YA 4XTXA 4M75G 3SWNA 3CC2A 1IZ6A 1OI1A 2CZ7B 1OYXA 2V8JA 5GANe 1MGQA 4QVZA 3L2UA 2EQUA 3RESA 3JCMW 2EFIA 3LW5E 3NTHA 5GANf 3RMSA 4N0AC 4LDYA 4C0FA 3OYNA 2QEXA 1YJ9T 3L2QA 3JAME 3OW2S 4M7AG 5FU7C 3EAEA 4QVCA 1HXDA 3PTAA 2YLCA 2D9TA 3BDUA 3SB2A 2DKGA 4M75C 3V8KA 5KE2A 4BI8B 1YITT 1M8VA 4X34A 4M7DG 4C92D 1O75A 4E7JA 3X24B 2EQKA 1RL2A 3L1AA 4E7KA 2KVQG 4M7AC 3J80E 3CCLT 3H8ZA 3CD6T 1I4K1 1I8FA 3CC4T 1WJRA 3LWHA 2QA4A 2DO3A 3MP6A 4HT8A 3DLMA 2XDBA 4XAXB 5GMKe 1Y96A 3KUFA 1Y96B 2P4TA 4PLIA 4IUTA 3JCMh 3RKYA 3OYIA 1YIJT 3C12A 2XDPA 3OYYA 4XTWA 4M77F 1NPPA 2LX9A 1VQ4T 1WGSA 3X20B 1KQ2A 4O5VA 3OYAA 3OB9A 2RK2A 2VGMA 5HKCA 3M56A 2VV5A 1K8AC 4PJOF 3MEVA 3C95A 2JUFA 3BW1A 1QP2A 3Q1JA 3GP8A 1VQPT 5I21A 1ZQ1A 3OYJA 1I5LA 1M9SA 1KD1U 2QTXA 2JVVA 1YJNT 2HBPA 2MMPA 3QJYA 4QW2A 5FU6B 2GQVA 3V8LA 3FIFA 3M58A 3CBMA 2QQSA 3SDZA 3M59A 3JB9I 5LJ3h 3UWNA 3KBGA 3V8JA 4RG2A 2M1HA 2CGHA 4ME7A 1K73U 4M78A 4PNOA 4M78B 2V8IA 2EAYA 2VXEA 4E47A 3P8HA 3PMIA 5C6SA 4LD6A 3UT1A 3DLLA 2KAFA 4M7AF 2WSCE 5FLXE 1M90C 3OYLA 3J7AF 1N9RA 1ZHIA 4OF1A 1YCYA 2LTOA 1SSFA 4FSXA 1QVFA 4M7DF 2CZ6B 4BDZA 1YJWT 2X4JA 5LJ5h 1JJ2S 2DD5A 1VQ5A 4X9CA 4XQ3A 2F5TX 5HK3A 1PSFA 3O8VA 3OMCA 4OB0B 5FU6C 2BUDA 1FWZA 1Q7YC 4C5EA 1BI2A 1G3YA 3QUIA 4C8QE 1G5VA 3BY7A 3LH0A 4WF2A 5EG2A 3V7CA 2PVOB 2V8KA 3I55T 2ZPIB 1G3TA 1M1KC 3X25B 3E19A 1YJ9A 2RHIA 4BY6B 2GFAA 1DJ7B 1KQSA 3MEAA 1GXIE 4IUPA 3E9GA 4J6WA 3CEYA 3LX7A 2DJZA 4EMHA 4II1A 1YITA 1N27A 3EFRA 4E7HA 3CPWS 2E70A 2RB6A 1O9SA 2ZPGB 4A53A 2M0OA 3INZA 1JBMA 4L5GA 4ZGJB 1XTDA 4J7IA 4IKFA 3FB9A 2L5QA 5DM7R 1KQ1A 3URGA 3ZBDA 1M5Q1 3MCAB 3CCLA 3CD6A 3OYMA 3CC4A 2RI3A 2E64A 3JCMX 4IUQA 3L2WA 4J7FA 4NOYA 2MF2A 5J26A 3CMET 4JRQA 5CAIA 4P5NA 4OB1B 3VV0A 5J39A 4HT9A 2RJDA 4BY6C 3JB9J 2Y90A 3OQ5A 1YIJA 4C92A 4C92B 3MEWA 1VQ4A 3CC7T 2X35A 5GAOm 3A8GB 3PMTA 3E1SA 1U8RA 2RH2A 4Y91A 1AHJB 4J6XA 5LJ5d 2RJFA 3V7SA 4PJOG 4C92G 4M78F 3OS2A 2E5QA 5LJ5j 3CCMA 3LGFA 1Q82C 3QDRB 2YLBA 1FX7A 2KK4A 1N8RC 5CKFA 1YJNA 3ME9A 4MZPA 2D0QB 3WXMB 2IVWA 4M75E 2EIFA 4C8QD 4PJOC 5DLOA 5A0LA 4ZTFA 4C92C 2P0PA 1KHCA 3AHUA 4ZGDB 1OZ3A 2CKKA 2RD1A 3JCMe 3VUBA 3SWNB 3G71T 3CCJT 4M7AE 3L2VA 3OBYA 3PFSA 5CKEA 3JCMf 1OZ2A 1UGPB 2EWNA 3RKWA 2XU8A 4RCCA 1K9MC 4EMKA 5CKDA 4EMKB 3ZEHA 2KDSA 3EFSA 1VQMT 4JRKA 1U1SA 2XG8D 4GLKA 4OMFB 3I56T 3QHSA 3FEOA 1XNIA 3PT9A 3CCUT 1BIAA 1YJWA 4DQ2A 1H641 5GAOl 3HP9A 5GAN8 2RJCA 4QQGA 3PIPA 1NPRA 2AHJB 3OYDA 1BI3A 2XICA 3LWIA 4J8OA 3OBWA 1W2BA 2DXCA 4C0GA 2JN0A 4BDYA 3VYGA 2XI9A 1X6OA 1VQ9T 5GAN4 1Y7XA 2QQRA 4XTVA 3SWNC 5GAMe 3JCMc 5LJ3e 2E12A 3QYHB 3VU3C 3OS0A 3I55A 1Q82U 1VQLA 2A3LA 2QQAA 5LJ3f 3S6WA 5GAMf 1S72T 4X9DA 1NE8A 2WSEE 3R6OA 5AYFA 5A2QE 3TEEA 3MHXA 5A0DA 4MMLA 1V29B 2L8DA 1QW1A 4CRIA 4MMKA 3OW2A 3DKMA 4J83A 3G4ST 5D6XA 1I81A 3JB9D 1N9SA 1VQ6T 4C5GA 2LNVA 5CQYA 5KCHA 2E1HA 4C92F 3F70A 3L2RA 1UGRB 1VQ8T 2EKOA 4BUGA 3M4YA 3JCMV 2QQ9A 2YRVA 3OSSC 5CVIA 3HL8A 4MDXA 3ER0A 4M75D 3CMEA 4CI0C 5IT9E 5I2MA 1BKBA 5GAN6 2RHXA 2RI2A 5GANh 2DTOA 2O01E 3DB3A 4TVRA 2X4YA 4B9XA 3JCMQ 4XK8E 3OYEA 3CC7A 2ZPBB 1QVGS 2XHCA 2DTIA 2K3YA 2ZPFB 2G3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RH2 A;  2OAU A;  2RK2 A;  2RK1 A;  1VIE A;  3SFM A;  2GQV A;  1VIF A;  2P4T A;  2VV5 A;  3UDC A;  3T9N A; 
#chains in the Genus database with same CATH topology
 4F17 A;  2DET A;  1VQN T;  2F5K A;  4V2S A;  3M57 A;  4F7U B;  1QP3 A;  2VAS A;  2LDM A;  4BI3 A;  2DER A;  1LCK A;  1QLY A;  1E6G A;  2KXC A;  3QDF A;  1KHI A;  2RHZ A;  1NJI C;  4JS5 A;  1WYX A;  3O5Z A;  4HCZ A;  4HXJ A;  4KT0 E;  3QXE B;  1VQM A;  3QJ6 A;  4Y92 A;  1AWW A;  2RMO A;  4PL6 A;  5L23 A;  3JB9 H;  1WHG A;  1UG1 A;  2IPO B;  1CKB A;  2QDY B;  4ANJ A;  1X75 C;  3VS2 A;  3RKX A;  1VQ9 A;  2JTM A;  3JCM g;  5GAN d;  4FW1 A;  2PUK B;  2EYQ A;  2QQB A;  1Q7Y U;  2CP6 A;  3HSB A;  4PJO E;  3X28 B;  2YHT A;  3TU4 K;  3OSV A;  2K5L A;  1AVZ C;  4OGE A;  1PSE A;  3VS1 A;  3OMG A;  2K2V A;  4BI4 A;  5GAO n;  1V1C A;  1AOJ A;  2P0K A;  4LDV A;  1VQ8 A;  5LJ3 g;  4IUU A;  1RAE B;  3CCE Q;  1W70 A;  1VQ9 Q;  2X3W D;  5GMK j;  2RM4 A;  4HKE A;  1YHQ T;  4PFO A;  2LRQ A;  3OS5 A;  1VQN A;  4E7I A;  2DM1 A;  3P8B B;  1QVF P;  3S3M A;  3FJP A;  3IQL A;  1Y07 A;  2QGG A;  4AFQ C;  4LXC A;  2MWP A;  3NTK A;  3C94 A;  3QZ9 B;  4BAC A;  4IIO A;  4JRP A;  1MUZ A;  5CQX A;  3CBO A;  1N8R U;  3SD4 A;  2NYS A;  2LQ8 A;  1R77 A;  2E10 A;  3EH1 A;  2DBK A;  4IUR A;  4HCK A;  2LQK A;  1KD1 C;  4GBQ A;  3QKJ A;  1KG1 A;  2BIV A;  2KT8 A;  2CZ0 B;  2FPD A;  3CCR T;  1YWP A;  1UDL A;  2DL5 A;  1UEC A;  1AEY A;  2FVU A;  5IXF A;  2F2V A;  5KE3 A;  2PZ1 A;  1VQ7 T;  2FEI A;  3CQT A;  3QZ5 B;  2JOY A;  2EQM A;  1G3W A;  3RMQ A;  5FRO A;  2E41 A;  5GMK m;  2MAM A;  4XTY A;  4PJM A;  4M7D D;  2X4X A;  1SKU B;  1VQK T;  2X9H A;  3JB9 F;  2GTO A;  4AG2 C;  3ZFJ A;  2KBT A;  3HPW A;  3I9Q A;  4BE1 A;  1YHQ A;  1G3S A;  2LCC A;  2RQT A;  4JDS A;  5IXB A;  2VB6 A;  3I5S A;  1QVG A;  1VQL T;  3A5Z B;  4JLI A;  2LVM A;  2O4X B;  2YWW A;  1UFF A;  1QKX A;  1D0Z A;  1M4Z A;  5IH2 A;  4AG1 C;  2K57 A;  4C8Q B;  1W4S A;  2R5M A;  5FRN A;  1W2B P;  1BI0 A;  2HBW A;  3WVE B;  2YDL A;  1AWX A;  3LH5 A;  2RO0 A;  2QA4 T;  4FL6 A;  4ZN3 A;  1RI9 A;  2D6F A;  3VRZ A;  2JMC A;  1MMA A;  1YHQ Q;  3VUZ A;  1D3B A;  2MI6 A;  4HA8 A;  1B34 B;  3CCR A;  4M78 D;  4L6V 5;  5KYY B;  4CC3 A;  1JRI A;  4JLG A;  4DBF A;  5GAN g;  3EG9 B;  1VQ7 A;  3SHW A;  3UDC A;  2FL7 A;  4PJO B;  2D1X A;  4RTW A;  4C0D B;  1MMG A;  4ELY C;  3JRZ A;  4M77 G;  5FRM A;  4XU3 A;  2VYT A;  2DAQ A;  5LJ5 g;  1VQK A;  1ZUU A;  3ULR B;  4N4G A;  2KQW A;  5FW9 A;  2E6Z A;  2DTH A;  2OX7 A;  3MP8 A;  4J6Y A;  1QCO A;  1TH7 A;  4D8K A;  4HCB A;  2DNU A;  2ECZ A;  1VA7 A;  2O9S A;  3HRT A;  3JCM J;  3QBY A;  1VQ7 Q;  4M7D A;  2JM8 A;  1QVG P;  2KEA A;  3RES A;  1VQL A;  1VQ4 Q;  4LDY A;  4C0F A;  2FZG B;  1JXO A;  4QVC A;  3PTA A;  2V1Q A;  3BDU A;  5KE2 A;  2DKG A;  3V8K A;  1YIT T;  1JJ2 P;  2B86 A;  1VQK Q;  4DBH A;  1RL2 A;  1RAC B;  4AFS C;  2K3B A;  4JPB W;  2MIO A;  3H8Z A;  3EHR A;  4J9I A;  3CC4 T;  2QA4 A;  4M7D C;  2BZX A;  1Y96 B;  3KUF A;  2H3E B;  1E6H A;  3TSZ A;  3C12 A;  2XDP A;  4M77 F;  1NPP A;  1Q81 R;  2BZY A;  1VQL Q;  1NEG A;  3A1P A;  3TVT A;  3MEV A;  3C95 A;  2NUP B;  1WHH A;  1H92 A;  1UE9 A;  3Q1J A;  3RNJ A;  3OYJ A;  2YRC A;  1YJN T;  4FW2 A;  2HBP A;  5FU6 B;  3FIF A;  2QA4 Q;  4WTO B;  3CBM A;  3UWN A;  2M0Y A;  3V8J A;  4RG2 A;  2CGH A;  4ME7 A;  1K73 U;  4PNO A;  3H41 A;  4M78 A;  3M0Q A;  2EAY A;  2EYX A;  3PMI A;  5C6S A;  3UT1 A;  4LUD A;  2WSC E;  4HVV A;  3OYL A;  1WHM A;  1OOT A;  1Z9Q A;  1ZHI A;  2A28 A;  1YJW T;  4XQ3 A;  1PSF A;  3O8V A;  5AT1 B;  4OB0 B;  1QCF A;  4C5E A;  1G5V A;  2VVK A;  1G3T A;  2AZS A;  2YRD A;  3EGX A;  3E19 A;  2EBP A;  2KR3 A;  1BU1 A;  1M2V A;  4J6W A;  1AZE A;  1YIT A;  1G8X A;  3CPW S;  2E70 A;  1AD5 A;  1O9S A;  1CSK A;  1XTD A;  4B6M A;  3FB9 A;  2DE0 X;  1U06 A;  2CUD A;  3KFV A;  1GFC A;  3AT1 B;  3CC4 A;  2MF2 A;  4OB1 B;  3VV0 A;  4CC4 B;  2Y90 A;  3OQ5 A;  3MEW A;  3CC7 T;  2X35 A;  2FG0 A;  1ARK A;  3I56 Q;  1Q7Y R;  1HD3 A;  1EZZ B;  4PJO G;  4C92 G;  3OS2 A;  1YJN A;  1WX6 A;  3EHQ A;  2EIF A;  4C8Q D;  4RTZ A;  5KYW A;  2P0P A;  4OMN A;  3JCM e;  3G71 T;  5CKE A;  1ZUK A;  4RCC A;  1K9M C;  4EMK A;  2LZ6 B;  4JRK A;  1U1S A;  2CP3 A;  3PT9 A;  1QMC A;  1BIA A;  1PWT A;  1YJW A;  1VQ6 Q;  4DQ2 A;  1H64 1;  2P84 A;  2RJC A;  4QQG A;  1BI3 A;  4K11 A;  2EYZ A;  1U5S A;  2JN0 A;  1SPK A;  4BDY A;  1ZA1 B;  3VYG A;  1YJN Q;  1X6O A;  1Y7X A;  2QQR A;  4XTV A;  3SWN C;  5LJ3 e;  1WLP B;  4X9D A;  3R6O A;  5A2Q E;  4CC2 A;  3MHX A;  5EC7 A;  1N8R R;  3DKM A;  2FZK B;  5D6X A;  1I81 A;  1N9S A;  4E7S A;  1YJW Q;  1NM7 A;  3BE3 A;  4C92 F;  1K0S A;  3L2R A;  2EKO A;  1NLO C;  1GBR A;  2QQ9 A;  2YRV A;  4M75 D;  4A63 B;  2CSI A;  5I2M A;  5GAN 6;  2RHX A;  2DTO A;  4TVR A;  2X4Y A;  3CC7 A;  4J9G A;  1RAF B;  4PJL A;  2KT1 A;  4F14 A;  2FYK A;  1K0X A;  1OX9 A;  4A4K A;  3CBP A;  4BB7 A;  2ABL A;  2W0Z A;  5GMK h;  3EFO B;  2DVE A;  5GAN 3;  4OVA A;  3G71 A;  2L89 A;  2R5A A;  1Q86 C;  3BDL A;  1UJ0 A;  5CIU A;  4DOW A;  5GAN 7;  3X26 B;  1D09 B;  2NLU A;  3DB4 A;  2CSQ A;  4LDU A;  4LN2 A;  1KIK A;  1HJD A;  4C8Q A;  4Y28 E;  3QPH A;  4QVD A;  2E6N A;  4ZGE B;  2QAS A;  1M90 U;  1KK7 A;  4MZM A;  4J9D A;  1Q95 G;  2DXU A;  5GAN 2;  2XKO C;  2CP0 A;  4JRI A;  3REA B;  4M77 E;  4OB2 B;  3G6E T;  1EIF A;  3G71 Q;  4RMO A;  1H3H A;  1M1K U;  2H3J A;  5KYY A;  4HVW A;  2QYZ A;  1YCS B;  3L2Z A;  5GJW B;  3NMZ C;  5GAM g;  2HNI A;  4DA4 A;  1I5O B;  2RQU A;  1VQO T;  1LOJ A;  4Z89 A;  3PVL A;  2JS2 A;  3JCM b;  3NTI A;  1UHF A;  1B07 A;  1W1F A;  4M75 A;  4XU1 A;  4FT2 A;  2XK0 A;  2DK3 A;  3M5A A;  1JB0 E;  4ZNX A;  1TOV A;  4AFU C;  2DF6 A;  2WAC A;  3GPL A;  3CCE T;  5D6Y A;  2LT4 A;  1ABO A;  2EGA A;  2J6F A;  2DZ9 A;  5M9O A;  2KRS A;  3I5R A;  3C4S A;  1RLQ C;  1IGQ A;  2O9V A;  2QTV A;  2HL3 A;  5GAO p;  3OYC A;  5LJ5 e;  2DYB A;  1NZ9 A;  4RG8 A;  3HFN A;  2QDL A;  2QAZ A;  2EQJ A;  5CO7 A;  2A0F B;  3A8M B;  3RER A;  3G6E A;  5GAN 5;  3CC2 Q;  4M7A D;  2K5I A;  2G6F X;  5HK0 A;  2M51 A;  1UJY A;  1QVF S;  2ATC B;  4ZN1 A;  2VUB A;  4ATO A;  4RTU A;  4ELZ C;  2CT3 A;  4EDU A;  2LT1 A;  2LNH B;  2JMA A;  2M9U A;  2DJQ A;  2M02 A;  1M1G A;  3H0H A;  1N6A A;  2K79 A;  3VS4 A;  2MOX A;  1Y71 A;  1VQO A;  2FB7 A;  1A0N B;  3G6E Q;  2ENM A;  1OX8 A;  3PIO A;  2C0T A;  2GCX A;  3NPF A;  1K73 R;  5GAO q;  3SEM A;  2COW A;  2HQX A;  4DOV A;  2YXY A;  5CKH A;  2P0Q A;  1PD1 A;  2YT6 A;  2FHD A;  3LLR A;  1P92 A;  2FRW A;  3CCE A;  1WJQ A;  3JCM P;  5CKB A;  4CC7 A;  2OI3 A;  1UGS B;  2DX1 A;  4C5H A;  2K7A A;  2Y4Y A;  1VQO Q;  3M0R A;  2X4W A;  1ZSZ A;  4OMP A;  2EW3 A;  1NJI U;  4RCB A;  4IIM A;  4NL2 A;  4C92 E;  4KUI A;  4BD3 A;  2DL8 A;  2I2L A;  3EGD A;  3M4G A;  1BYM A;  1VQ5 Q;  8ATC B;  4M77 B;  1SHG A;  2RJE A;  3GBQ A;  1X01 A;  5KH6 A;  3NFC A;  1WXB A;  1D0Y A;  1OEB A;  2HDA A;  3QG1 A;  4FIB A;  5LJ3 j;  1BCM A;  2L2P A;  1ZSZ C;  1OPK A;  2HCK A;  3QWY A;  4BE0 A;  2DXT A;  3HKS A;  1YJ9 Q;  2HD0 A;  3E2U A;  1IB8 A;  3SFM A;  4RTT A;  1HK9 A;  1WIE A;  5FWC A;  5FU7 B;  3TSW A;  2XD0 A;  1ZBX A;  4PKC C;  4XTU A;  3JB9 G;  3MET A;  2E65 A;  1WPY A;  1W2B S;  1RI0 A;  4M7A A;  3M54 A;  2AIR B;  1MHN A;  2DXB A;  2GFU A;  2LQN A;  3UF4 A;  3GF5 A;  1WQW A;  2LP5 A;  4J5Y A;  4XTX A;  2NWM A;  1PKT A;  2ROT A;  3L2U A;  3JCM W;  3RMS A;  2C0O A;  3OW2 S;  3M0P A;  1WZO A;  3QWX X;  3EAE A;  1HXD A;  1D0X A;  4X34 A;  4M7D G;  2CP2 A;  1O75 A;  3X24 B;  3L1A A;  4D8D A;  2KVQ G;  4E7K A;  4M7A C;  4AT1 B;  2HSE B;  2DL7 A;  3CD6 T;  1ZA2 B;  3LWH A;  3MP6 A;  3DLM A;  1VYV A;  1ZX6 A;  2P4T A;  1AZG B;  4IUT A;  1AWO A;  1C6V X;  3RKY A;  3OYI A;  1YIJ T;  2XMF A;  3MPU B;  3OYY A;  2NUT A;  1VQ4 T;  3X20 B;  3OYA A;  2JT4 A;  4FSS A;  1K8A C;  3GP8 A;  2F2W A;  1M9S A;  1KD1 U;  3I35 A;  1H8K A;  4QW2 A;  2LCS A;  3M58 A;  5KYU A;  3SDZ A;  3JB9 I;  3I55 Q;  2V1R A;  2W10 A;  2V8I A;  3MJX A;  5FLX E;  2KNB B;  4M7D F;  1JJ2 S;  2DD5 A;  5ECA A;  5HK3 A;  3OMC A;  2BUD A;  1FWZ A;  1NBE B;  3QUI A;  1K76 A;  3EFO A;  1GCP A;  3V7C A;  2PVO B;  1OU8 A;  2ZPI B;  1K1Z A;  4R0K A;  1SRL A;  1JXM A;  2GFA A;  1W6X A;  1GXI E;  3MEA A;  2ROL A;  3LX7 A;  4II1 A;  4E7H A;  2RB6 A;  4A53 A;  3INZ A;  1JBM A;  4L5G A;  1JO8 A;  1QWE A;  3MCA B;  3CD6 A;  3OYM A;  2RI3 A;  2E64 A;  3JCM X;  4NOY A;  1M90 R;  5J26 A;  4JRQ A;  1YP5 A;  4P5N A;  4HT9 A;  2RJD A;  1BCO A;  4BY6 C;  1PRM C;  1YIJ A;  4C92 B;  1VQ4 A;  1R0B G;  3A98 A;  2A36 A;  1U8R A;  2RH2 A;  1U3O A;  2HSP A;  4KH0 B;  2VKN A;  2QGF B;  1KFZ A;  2CT4 A;  4M78 F;  5LJ5 j;  1Q82 C;  1M1K R;  1FX7 A;  2BE9 B;  1CKA A;  2IVW A;  2BE7 D;  3CD6 Q;  4E6R A;  1S72 Q;  4M7A E;  3VUB A;  3CCJ T;  3L2V A;  3JCM f;  1YIJ Q;  1K9A A;  3RKW A;  2DVJ A;  2E3H A;  5CKD A;  3ZEH A;  3EFS A;  3I56 T;  1MMD A;  3QHS A;  4J9H A;  3FEO A;  8AT1 B;  3PIP A;  1NPR A;  1V76 A;  1YFN A;  3OYD A;  2HL5 C;  3LWI A;  4J8O A;  2V26 A;  1X6B A;  3NGP A;  1MV3 A;  2ESW A;  2DRK A;  5GAN 4;  4NL3 A;  5GAM e;  1Q82 U;  3GIB A;  3EG3 A;  5LJ3 f;  3S6W A;  4KGV B;  1NE8 A;  1JQQ A;  5AYF A;  5KYX A;  4MMK A;  1D1C A;  3H0F A;  1VQ6 T;  2YSQ A;  4BUG A;  3M4Y A;  3JCM V;  5CVI A;  2QK0 A;  2O2O A;  5IT9 E;  2L3S A;  2RPN A;  4PJJ A;  1ZSG A;  1PNJ A;  1IXD A;  2YUQ A;  4XK8 E;  3OYE A;  3H9N A;  1M30 A;  2IIM A;  2LJ3 A;  2XHC A;  3LW5 E;  2ZPF B;  2GF7 A;  3GOX A;  2OTL Q;  5L8R E;  4A4E A;  3CXC S;  4Q5W A;  1S1N A;  3THK A;  4F7U A;  1X6G A;  2C06 A;  2ZPH B;  4O6J A;  2J6O A;  5CCA A;  2JZ2 A;  1MMN A;  2A7Y A;  2DZC A;  4FYW B;  1QCN A;  2VC8 A;  4M78 C;  3CCJ A;  2NUZ A;  4GLM A;  1YN8 A;  1GFD A;  4E7Z A;  2OAW A;  1OU9 A;  3I56 A;  5FWB A;  2SEM A;  3VRY A;  1M1F A;  2PUO B;  1R0C B;  1B7T A;  3HRU A;  3CCS T;  4KBM B;  2MWO A;  2R58 A;  4A4H A;  3MP1 A;  2OTJ Q;  3OYG A;  3CCJ Q;  4RUG A;  4PFP A;  1J3T A;  1M3C A;  1H3Z A;  3OYK A;  1IRE B;  4X1V A;  4YTL A;  1VQ6 A;  3CPW A;  5I2S A;  5A0G A;  1KC8 C;  4IUV A;  1NJI R;  2ZZD A;  1FMK A;  4WCI A;  3CCQ T;  4JJN K;  3RIR A;  3FRN A;  3GNG A;  1IO6 A;  3L42 A;  2E4H A;  1AWJ A;  1QKW A;  2YUN A;  1UEB A;  1X43 A;  4BE2 A;  2DIG A;  4A4F A;  4M7D E;  2X51 A;  3RUX A;  1NYF A;  3FLG A;  4J9B A;  1WXT A;  2P4R A;  2RHY A;  4RTX A;  2OAU A;  1XQH A;  4OMQ A;  2ED0 A;  1YI2 Q;  2XID A;  4HCC A;  2K3X A;  2PVD B;  5J3B A;  1SRM A;  4M4Z A;  2FRY A;  2KI7 A;  1KC8 U;  4C8Q F;  1B3Q A;  4FCY A;  2PQW A;  2ZPE B;  2DYI A;  4XU2 A;  4EMK C;  3GLX A;  3OYH A;  4L59 A;  3N5B B;  2JW4 A;  5GAO r;  4KH1 B;  2JTE A;  4PJO D;  2RF0 A;  4ZTJ A;  2VGN A;  2MK5 A;  3S3O A;  3CCS A;  4OMO A;  2KY9 A;  1K9M U;  5LJ5 f;  2DD4 A;  3A8L B;  1PG5 B;  2EJG A;  4EPC A;  2KRM A;  3JV3 A;  5CR2 A;  4Z02 A;  2F69 A;  2RHU A;  1JEG A;  1D1A A;  5C0M A;  2QEX Q;  2DEU A;  3HFO A;  1FYN A;  1OV3 A;  4F04 B;  2COY A;  2LC4 A;  2ED1 A;  4M78 E;  1GRI A;  3M53 A;  1RAB B;  2CP5 A;  5LL6 S;  2CDT A;  3CCS Q;  2CH4 A;  3CCQ A;  1I07 A;  4F7U E;  3VJP A;  4OB3 B;  4AMC A;  2F2X A;  3PNW C;  4M75 F;  1KD1 R;  3MO8 A;  1M27 C;  3CC2 T;  1IRX A;  2KYM A;  5D6W A;  3TRE A;  1SHF A;  4F16 A;  1G83 A;  1KQS S;  2EJ9 A;  3D7S B;  2O4X A;  4R55 A;  1R8O B;  2KRN A;  1M3A A;  3LYI A;  3JSC A;  3CCQ Q;  2RNA A;  3JCM d;  3VYH B;  1PKS A;  2LX7 A;  3QYG B;  1T3S A;  4DEX A;  3R6N A;  1OQK A;  3P8D A;  4Z8A A;  2DFU A;  1D3B B;  4RKU E;  4C8Q C;  1B34 A;  3OYF A;  2KYB A;  1Q86 U;  2RI5 A;  1LJO A;  5HY6 A;  3QSU A;  5LJ3 d;  3EG9 A;  1VUB A;  2BKD N;  2FPE A;  2WSF E;  4PJO A;  4FYX B;  3UPU A;  5GAM j;  4UC4 A;  3V7R A;  2LJ1 A;  4PLL A;  3MKD A;  2JXB A;  1YBY A;  2KRO A;  3FDR A;  4QT7 A;  4N0A A;  1WHL A;  2LJ0 A;  3OS1 A;  2L3R A;  2PTK A;  1BBZ A;  4D6W A;  1UB4 A;  2KXD A;  2CP7 A;  2FPF A;  3VS0 A;  1VQP A;  3QO3 A;  2R57 A;  3KXT A;  1Q81 C;  1VQ5 T;  4JJB A;  1WQ7 A;  2BTT A;  3M55 A;  4LD9 K;  6AT1 B;  4C0D C;  4NS5 A;  1E7O A;  2XDD A;  4M7D B;  3CC2 A;  1IZ6 A;  1OYX A;  5GAN e;  1MGQ A;  4QVZ A;  2EQU A;  4E2F B;  1YJ9 T;  4N0A C;  3L2Q A;  3JAM E;  4M7A G;  2BZ8 A;  3SB2 A;  4M75 C;  1G2B A;  4E7J A;  1VQP Q;  3J80 E;  2KGT A;  2RQW A;  4KRT A;  1I8F A;  1JU5 C;  4XAX B;  1Y96 A;  1FMW A;  4PLI A;  1SG5 A;  3M0U A;  2FZC B;  1Q82 R;  4O5V A;  3OB9 A;  2RK2 A;  2VGM A;  2COZ A;  2NUP A;  2KE9 A;  1WA7 A;  3HTR A;  1QP2 A;  1I5L A;  4KUD K;  4QKU A;  2D8H A;  1GCQ A;  2JVV A;  2CH4 W;  3QJY A;  2RN8 A;  1NYG A;  2QQS A;  3M59 A;  3KBG A;  2M1H A;  4M78 B;  3P8H A;  3DLL A;  4LD6 A;  3M0S A;  1FMV A;  2HQH A;  2KAF A;  4M7A F;  4OF1 A;  1QVF A;  4BDZ A;  5LJ5 h;  1VQ5 A;  1GCQ C;  4X9C A;  2F5T X;  7AT1 B;  1C0M A;  5FU6 C;  1Q7Y C;  4C8Q E;  3BY7 A;  1D1B A;  3CME Q;  3I55 T;  3EGX B;  3X25 B;  1YJ9 A;  2K2M A;  1DJ7 B;  2GBQ A;  2YUP A;  4IUP A;  1M2V B;  2DJZ A;  4EMH A;  1N27 A;  2ZPG B;  2M0O A;  2SRC A;  4J7I A;  2L5Q A;  1TXQ A;  4IUQ A;  3L2W A;  2MPX C;  5CAI A;  3RR6 A;  5J39 A;  1ZBJ A;  2J06 A;  1M2O A;  1T0H A;  2J6K A;  1RAA B;  4Y91 A;  1AHJ B;  1VQM Q;  3EG2 A;  5LJ5 d;  2RJF A;  3RDV A;  1WI7 A;  2JM9 A;  3QDR B;  4ESR A;  1N8R C;  2EPD A;  5CKF A;  3ME9 A;  1TU0 B;  4EIK A;  4M75 E;  2EYW A;  2DIL A;  5KYW B;  1KHC A;  1LPL A;  1TUD A;  2GNC A;  1OZ3 A;  1X2K A;  2RD1 A;  3SWN B;  1QWF A;  1ACM B;  3PFS A;  4PK4 A;  2EWN A;  2XU8 A;  2EGC A;  4EMK B;  2KDS A;  3REB B;  4GLK A;  4OMF B;  2J7I A;  1XNI A;  3CCU T;  1VOM A;  5GAO l;  3HP9 A;  4HVU A;  2X3X D;  3EH2 A;  1VQ8 Q;  2EVR A;  2XIC A;  1W2B A;  2DXC A;  2XI9 A;  1Y0M A;  1HYO A;  3I55 A;  3JCM c;  2K6D A;  2E12 A;  3QYH B;  5GAM f;  1S72 T;  1KC8 R;  1RAH B;  4MML A;  1V29 B;  2L8D A;  1QW1 A;  1VQN Q;  3OW2 A;  2Z0W A;  3G4S T;  5D7U A;  3JB9 D;  1OPL A;  2E1H A;  3F70 A;  1UGR B;  1M3B A;  3HL8 A;  1K9M R;  4CI0 C;  1BKB A;  1C1A A;  1KJW A;  2O01 E;  5I22 A;  1MND A;  2ZPB B;  1QVG S;  2DRM A;  2DTI A;  2GQI A;  2G3R A;  2L0A A;  3FC3 A;  4RTV A;  1YNZ A;  1VIE A;  3CCV T;  4M78 G;  2KMT A;  1BI1 A;  1VYU A;  1K8A U;  1K4U S;  1WJS A;  4FT4 A;  1TWB A;  4C5I A;  4F7U G;  2O31 A;  2HQE A;  2I0N A;  3UA6 A;  1MNE A;  1X27 A;  4FYY B;  2AT1 B;  1N5Z A;  2EYY A;  2OTL T;  1VYT A;  2DPP B;  3CCU A;  2K9G A;  3NHN A;  4JJD A;  4MZT A;  4N4H A;  1TSF A;  2F1L A;  4N4I A;  4JJC A;  1JJ2 A;  5IAY A;  2CS7 A;  3VKI A;  5I11 A;  3LGL A;  3HRS A;  3WVD B;  3OYB A;  4QQ6 A;  3CPF A;  2QXF A;  1UGQ B;  1S72 A;  3OW2 P;  5GAN j;  3MEU A;  2CUB A;  3G4S A;  1WFW A;  3TQ7 P;  1PD0 A;  3CCU Q;  2K5F A;  2HEQ A;  3E9F A;  2LMJ A;  2PU9 B;  4OP0 A;  1Q86 R;  4EMG A;  2GTJ A;  4FU6 A;  1TS9 A;  1PRL C;  2OTJ T;  2CYZ B;  4F7U F;  2E5K A;  5IHK A;  2D0N A;  1BIB A;  4XTZ A;  1YWO A;  2Y4X A;  4JZ4 A;  4KGZ B;  5IHI A;  5DLQ E;  2KSS A;  2ZAE A;  3G4S Q;  2MYS A;  4M75 B;  3CCR Q;  3M9Q A;  4ORZ A;  3CCV A;  1UGV A;  4C0Z A;  2VXF A;  4AFZ C;  2ZGW A;  4OML A;  3H6Z A;  4FM4 B;  2EJF A;  3S3N A;  2J05 A;  2AK5 A;  4J9F A;  1U1T A;  4M77 D;  3TCJ A;  4A4G A;  4PJN A;  9ATC B;  4XU0 A;  2D8J A;  2OTL A;  2JTF A;  1IGU A;  3CCM T;  2PNI A;  1YI2 T;  4E7L A;  2K4Y A;  3CCV Q;  3PE0 A;  3VS3 A;  3GNF B;  2DEQ A;  2IG0 A;  1K73 C;  2ZCF B;  2DA9 A;  4KGX B;  1I0C A;  1QVP A;  4OGC A;  1QQJ A;  3T9N A;  4LNP A;  2EGE A;  1VIF A;  2HMA A;  2AKL A;  2DLP A;  2VWF A;  1FXX A;  4A54 A;  1I1J A;  2DIQ A;  3ASK A;  4JUV A;  1TG0 A;  1LNX A;  2H8H A;  2HZY A;  2A37 A;  1SF9 A;  4LDW A;  4GY5 A;  3CMA T;  2OTJ A;  5GAM h;  1UTI A;  3EG0 A;  2B8A A;  2PVG B;  2QEX T;  2LQW A;  1Y57 A;  2HAX A;  1GBQ A;  1ZLM A;  4MDW A;  2M16 A;  5KCO A;  3CXC A;  3UAT A;  5HCK A;  5GMK l;  3OY9 A;  1F1B B;  1SSH A;  5DY9 A;  2QI2 A;  1BK2 A;  2E3I A;  1IHV A;  3H0I A;  3OA6 A;  1TUG B;  1MV0 B;  3VS6 A;  4C8Q G;  2LCL A;  3A8H B;  1T0J A;  2RQV A;  1WNL A;  1XOV A;  4JS4 A;  3BFM A;  1ZSZ B;  1X69 A;  4LE9 A;  2DL3 A;  3A8O B;  2RK1 A;  3CCM A;  4VUB A;  4B9W A;  3EGD B;  1YI2 A;  2CZ1 B;  1NG2 A;  1TTH B;  2RA2 A;  4M77 A;  3QII A;  3VS5 A;  5GAM d;  5IN1 A;  4JZ3 A;  3M0T A;  3EGU A;  3J81 E;  1PM3 A;  2JNG A;  5GMK i;  3RBB B;  4FYV B;  4R56 A;  5CK9 A;  1YIT Q;  4LDX A;  4KUL A;  2QG9 B;  3CCM Q;  3PGG A;  3G7Z A;  4M77 C;  4QQD A;  3HHT B;  2JS0 A;  2JJ9 A;  2GGR A;  4M7A B;  3CC4 Q;  3CMA A;  2A08 A;  4M75 G;  3SWN A;  1OI1 A;  2CZ7 B;  2V8J A;  1RAD B;  2EFI A;  5GAN f;  3NTH A;  2QEX A;  3OYN A;  1GL5 A;  5FU7 C;  3CXC P;  2YLC A;  2D9T A;  1M8V A;  1M8M A;  4BI8 B;  4C92 D;  2EQK A;  1UUE A;  1NLP C;  1TUC A;  1RLP C;  3CCL T;  1I4K 1;  4HT8 A;  2XDB A;  1WJR A;  4DEY A;  2DO3 A;  5IHN A;  5GMK e;  3CMA Q;  3JCM h;  3ZL7 C;  5GJV B;  2NUT B;  4XTW A;  2LX9 A;  1WGS A;  2CRE A;  4DBQ A;  1KQ2 A;  1WHJ A;  5HKC A;  3CPW P;  1OUL A;  3M56 A;  2VV5 A;  4PJO F;  1RUW A;  2JUF A;  3BW1 A;  1VQP T;  5I21 A;  1ZQ1 A;  3U23 A;  4LUE A;  2QTX A;  1EX4 A;  1RAI B;  2MMP A;  1SEM A;  2GQV A;  4OMM A;  3V8L A;  4DBR A;  2DMO A;  5KYU B;  1IHW A;  5LJ3 h;  2VXE A;  4E47 A;  1M90 C;  2AKK A;  3J7A F;  1N9R A;  1ZUY A;  2L3P A;  1AT1 B;  1WXU A;  1YCY A;  2LTO A;  1SSF A;  4FSX A;  2CZ6 B;  2X4J A;  1NEB A;  2DBM A;  3EG1 A;  1UHC A;  2L3Q A;  2EQI A;  1BI2 A;  1G3Y A;  1PCX A;  3LH0 A;  4WF2 A;  5EG2 A;  2AZV A;  1Z9Z A;  3VS7 A;  2RQR A;  2V8K A;  1T3L A;  1EFN A;  1K8A R;  1M1K C;  2HKQ B;  3CC7 Q;  2RHI A;  4BY6 B;  1XJW B;  1KQS A;  2C0I A;  3E9G A;  3CEY A;  2HKN A;  3EFR A;  3C0C A;  4ZGJ B;  4IKF A;  5DM7 R;  1KQ1 A;  3URG A;  3ZBD A;  1M5Q 1;  3CCL A;  1PC0 A;  4RTY A;  1X2Q A;  4J7F A;  4J9E A;  3CME T;  1WHK A;  3FJ5 A;  4PFZ A;  3JB9 J;  2EKH A;  4C92 A;  5GAO m;  3A8G B;  3PMT A;  3E1S A;  2YUO A;  4J6X A;  3V7S A;  2E5Q A;  2OJ2 A;  3LGF A;  2YLB A;  2KK4 A;  4MZP A;  2D0Q B;  3WXM B;  5KYN A;  3CCL Q;  4PJO C;  5DLO A;  5A0L A;  1PHT A;  4ZTF A;  4C92 C;  3AHU A;  4ZGD B;  2CKK A;  1WDX A;  3OBY A;  1OZ2 A;  1UGP B;  1VQM T;  2XG8 D;  4J9C A;  5GAN 8;  4Z88 A;  2O88 A;  2AHJ B;  3OBW A;  1KSW A;  4C0G A;  1RAG B;  1VQ9 T;  1BB9 A;  3OS0 A;  1HSQ A;  1Q81 U;  3VU3 C;  2DL4 A;  2MCN A;  2A3L A;  2QQA A;  1KQS P;  2FO0 A;  2WSE E;  3TEE A;  5A0D A;  4CRI A;  5KYX B;  4J83 A;  4C5G A;  2LNV A;  5CQY A;  5KCH A;  3G1J A;  1LVK A;  1VQ8 T;  3OSS C;  4MDX A;  3ER0 A;  1ABQ A;  3CME A;  2RI2 A;  5GAN h;  3DB3 A;  3JCM Q;  4B9X A;  3PVQ A;  3UA7 A;  2K3Y A; 
#chains in the Genus database with same CATH homology
 1VQN T;  2GF7 A;  3GOX A;  5L8R E;  2F5K A;  4A4E A;  2FYK A;  4V2S A;  3CXC S;  4Q5W A;  3FC3 A;  3M57 A;  4F7U A;  4F7U B;  2C06 A;  1QP3 A;  1VIE A;  2ZPH B;  2LDM A;  3CCV T;  4O6J A;  4BI3 A;  4M78 G;  4A4K A;  2KMT A;  1BI1 A;  3CBP A;  4BB7 A;  5CCA A;  1K8A U;  2JZ2 A;  1WJS A;  2A7Y A;  4FT4 A;  5GMK h;  1KHI A;  2DZC A;  2RHZ A;  2DVE A;  5GAN 3;  4C5I A;  2VC8 A;  4OVA A;  4F7U G;  3G71 A;  1NJI C;  2HQE A;  4M78 C;  4JS5 A;  3CCJ A;  2L89 A;  2R5A A;  1Q86 C;  3BDL A;  4HCZ A;  4KT0 E;  5CIU A;  4DOW A;  3QXE B;  5GAN 7;  3X26 B;  2NLU A;  3DB4 A;  1VQM A;  3QJ6 A;  4LDU A;  2OTL T;  3I56 A;  2DPP B;  3CCU A;  4PL6 A;  1M1F A;  4C8Q A;  2PUO B;  3JB9 H;  4MZT A;  4Y28 E;  4N4H A;  3QPH A;  4N4I A;  3HRU A;  4QVD A;  3CCS T;  1JJ2 A;  5IAY A;  2QDY B;  2E6N A;  4ZGE B;  1M90 U;  2CS7 A;  3VKI A;  4MZM A;  3LGL A;  4KBM B;  3HRS A;  1X75 C;  3WVD B;  3OYB A;  2MWO A;  2R58 A;  3RKX A;  4A4H A;  1VQ9 A;  2DXU A;  2JTM A;  3JCM g;  5GAN d;  4QQ6 A;  3MP1 A;  5GAN 2;  2XKO C;  3CPF A;  2QXF A;  1UGQ B;  4JRI A;  1S72 A;  4M77 E;  2PUK B;  2EYQ A;  1EIF A;  4OB2 B;  3OYG A;  3G6E T;  2QQB A;  1Q7Y U;  4RMO A;  5GAN j;  3MEU A;  3HSB A;  1H3Z A;  4PJO E;  3X28 B;  3OYK A;  1IRE B;  2YHT A;  3G4S A;  3TU4 K;  3OSV A;  2K5L A;  4OGE A;  4YTL A;  1M1K U;  1PSE A;  2H3J A;  2K2V A;  3OMG A;  4BI4 A;  3CPW A;  1VQ6 A;  5I2S A;  5GAO n;  2K5F A;  5A0G A;  3E9F A;  2P0K A;  4LDV A;  1KC8 C;  1VQ8 A;  4IUV A;  3L2Z A;  2ZZD A;  2PU9 B;  4OP0 A;  5GAM g;  5LJ3 g;  3CCQ T;  4JJN K;  4IUU A;  3RIR A;  4EMG A;  3FRN A;  3GNG A;  2HNI A;  4FU6 A;  3L42 A;  4DA4 A;  2OTJ T;  5GMK j;  2CYZ B;  2RM4 A;  1UEB A;  4F7U F;  1VQO T;  4HKE A;  1YHQ T;  1LOJ A;  1BIB A;  4XTZ A;  4BE2 A;  2Y4X A;  2DIG A;  2LRQ A;  3JCM b;  3NTI A;  4A4F A;  3OS5 A;  1VQN A;  5DLQ E;  4E7I A;  4M7D E;  3P8B B;  3RUX A;  3S3M A;  2KSS A;  3FJP A;  3FLG A;  4M75 A;  4M75 B;  1Y07 A;  2RHY A;  4XU1 A;  3M9Q A;  2OAU A;  3CCV A;  4FT2 A;  2XK0 A;  1XQH A;  2DK3 A;  2MWP A;  3NTK A;  4C0Z A;  2XID A;  4HCC A;  2K3X A;  3M5A A;  1JB0 E;  2VXF A;  2PVD B;  5J3B A;  2ZGW A;  2WAC A;  3C94 A;  3H6Z A;  3QZ9 B;  4BAC A;  4FM4 B;  2EJF A;  3GPL A;  1KC8 U;  3CCE T;  5D6Y A;  2LT4 A;  3S3N A;  4M7D A;  4C8Q F;  4JRP A;  1U1T A;  5CQX A;  3CBO A;  1N8R U;  2PQW A;  2DZ9 A;  4M77 D;  5M9O A;  2ZPE B;  3TCJ A;  4A4G A;  3SD4 A;  2LQ8 A;  2E10 A;  4XU2 A;  4EMK C;  3GLX A;  4XU0 A;  4IUR A;  3OYH A;  4L59 A;  3N5B B;  2OTL A;  2LQK A;  5GAO r;  1KD1 C;  4M7D C;  3C4S A;  3QKJ A;  4PJO D;  1KG1 A;  2JTF A;  4ZTJ A;  2VGN A;  2BIV A;  3CCM T;  4NL3 A;  5GAO p;  3S3O A;  2CZ0 B;  3CCR T;  3OYC A;  3CCS A;  5LJ5 e;  2KY9 A;  1K9M U;  1YI2 T;  1NZ9 A;  5LJ5 f;  4E7L A;  2K4Y A;  4RG8 A;  3GNF B;  3HFN A;  2DD4 A;  3A8L B;  2DEQ A;  2IG0 A;  1K73 C;  2FVU A;  2EQJ A;  2ZCF B;  5KE3 A;  2EJG A;  5CO7 A;  4EPC A;  3A8M B;  1VQ7 T;  5CR2 A;  3RER A;  4Z02 A;  3G6E A;  4M7D B;  5GAN 5;  3QZ5 B;  2F69 A;  2RHU A;  2JOY A;  4KUD K;  1QVP A;  2EQM A;  1G3W A;  4OGC A;  5C0M A;  3RMQ A;  4M7A D;  5FRO A;  2K5I A;  2E41 A;  5GMK m;  2MAM A;  4XTY A;  3T9N A;  5HK0 A;  3HFO A;  4M7D D;  2X4X A;  1VIF A;  1QVF S;  2LC4 A;  4ZN1 A;  2VUB A;  4M78 E;  1VQK T;  4ATO A;  4ELZ C;  1FXX A;  4A54 A;  3JB9 F;  2DIQ A;  4EDU A;  3ASK A;  3M53 A;  2LT1 A;  4JUV A;  1Q81 U;  5LL6 S;  1LNX A;  2M9U A;  3CCQ A;  1M1G A;  1N6A A;  4F7U E;  3VJP A;  4OB3 B;  3ZFJ A;  4LDW A;  4GY5 A;  3CMA T;  2OTJ A;  3HPW A;  1Y71 A;  5GAM h;  3PNW C;  4M75 F;  4BE1 A;  3MO8 A;  1VQO A;  2FB7 A;  1YHQ A;  1G3S A;  2LCC A;  4JDS A;  3CC2 T;  2B8A A;  5D6W A;  3TRE A;  2PVG B;  1KQS S;  1QVG A;  1VQL T;  3PIO A;  2QEX T;  3A5Z B;  2EJ9 A;  4JLI A;  2LVM A;  2GCX A;  2HAX A;  2O4X A;  2O4X B;  4MDW A;  4R55 A;  1R8O B;  1M4Z A;  2M16 A;  5GAO q;  2HQX A;  4DOV A;  5KCO A;  5CKH A;  2K57 A;  3CXC A;  4C8Q B;  5GMK l;  2P0Q A;  3OY9 A;  1W4S A;  2R5M A;  5FRN A;  1BI0 A;  3LYI A;  5DY9 A;  2QI2 A;  2FHD A;  3LLR A;  3WVE B;  3OA6 A;  3JSC A;  1P92 A;  3CCE A;  1WJQ A;  3JCM P;  2QA4 T;  2RO0 A;  5CKB A;  4FL6 A;  3VYH B;  3JCM d;  4ZN3 A;  1UGS B;  2D6F A;  3QYG B;  4C5H A;  4C8Q G;  2LCL A;  3A8H B;  2Y4Y A;  1WNL A;  1XOV A;  4JS4 A;  3P8D A;  3BFM A;  3VUZ A;  2X4W A;  3A8O B;  2RK1 A;  1D3B A;  1NJI U;  1D3B B;  2MI6 A;  4RCB A;  4RKU E;  1B34 A;  4HA8 A;  1B34 B;  4NL2 A;  4VUB A;  4C8Q C;  4KUI A;  4C92 E;  4BD3 A;  3OYF A;  2RI5 A;  3CCR A;  2I2L A;  4M78 D;  1Q86 U;  4B9W A;  4L6V 5;  3M4G A;  1YI2 A;  2CZ1 B;  1BYM A;  1JRI A;  1LJO A;  4JLG A;  5HY6 A;  2RA2 A;  4M77 A;  3QII A;  4M77 B;  2RJE A;  3QSU A;  5GAM d;  5LJ3 d;  5IN1 A;  5GAN g;  1X01 A;  5KH6 A;  3NFC A;  1VQ7 A;  1VUB A;  2BKD N;  2WSF E;  3UDC A;  4PJO A;  3QG1 A;  2FL7 A;  3UPU A;  4PJO B;  3J81 E;  4FIB A;  4C0D B;  5LJ3 j;  5GAM j;  2JNG A;  4UC4 A;  4ELY C;  3V7R A;  3GIB A;  3JRZ A;  5GMK i;  4PLL A;  4BE0 A;  2DXT A;  3HKS A;  4M77 G;  4XU3 A;  4R56 A;  5FRM A;  2VYT A;  5CK9 A;  1YBY A;  2HD0 A;  3FDR A;  2DAQ A;  4N0A A;  3SFM A;  5LJ5 g;  1HK9 A;  4LDX A;  3OS1 A;  1VQK A;  5FU7 B;  2L3R A;  4KUL A;  4D6W A;  2XD0 A;  1UB4 A;  1ZBX A;  1VQP A;  3PGG A;  3G7Z A;  3QO3 A;  4M77 C;  4N4G A;  2R57 A;  2KQW A;  3HHT B;  4PKC C;  4QQD A;  4XTU A;  3MET A;  3KXT A;  3JB9 G;  2E65 A;  1Q81 C;  1VQ5 T;  1WPY A;  2E6Z A;  1W2B S;  1WQ7 A;  1RI0 A;  2DTH A;  3MP8 A;  4M7A A;  4J6Y A;  3M54 A;  4M7A B;  1MHN A;  1TH7 A;  2DXB A;  2GFU A;  3M55 A;  3CMA A;  4LD9 K;  4C0D C;  4HCB A;  3HRT A;  3GF5 A;  4NS5 A;  1WQW A;  2XDD A;  3QBY A;  3JCM J;  4J5Y A;  4XTX A;  4M75 G;  3SWN A;  3CC2 A;  1IZ6 A;  1OI1 A;  2CZ7 B;  1OYX A;  2V8J A;  5GAN e;  1MGQ A;  4QVZ A;  3L2U A;  2EQU A;  3RES A;  3JCM W;  2EFI A;  3LW5 E;  3NTH A;  5GAN f;  3RMS A;  4N0A C;  4LDY A;  4C0F A;  3OYN A;  2QEX A;  1YJ9 T;  3L2Q A;  3JAM E;  3OW2 S;  4M7A G;  5FU7 C;  3EAE A;  4QVC A;  1HXD A;  3PTA A;  2YLC A;  2D9T A;  3BDU A;  3SB2 A;  2DKG A;  4M75 C;  3V8K A;  5KE2 A;  4BI8 B;  1YIT T;  1M8V A;  4X34 A;  4M7D G;  4C92 D;  1O75 A;  4E7J A;  3X24 B;  2EQK A;  1RL2 A;  3L1A A;  4E7K A;  2KVQ G;  4M7A C;  3J80 E;  3CCL T;  3H8Z A;  3CD6 T;  1I4K 1;  1I8F A;  3CC4 T;  1WJR A;  3LWH A;  2QA4 A;  2DO3 A;  3MP6 A;  4HT8 A;  3DLM A;  2XDB A;  4XAX B;  5GMK e;  1Y96 A;  3KUF A;  1Y96 B;  2P4T A;  4PLI A;  4IUT A;  3JCM h;  3RKY A;  3OYI A;  1YIJ T;  3C12 A;  2XDP A;  3OYY A;  4XTW A;  4M77 F;  1NPP A;  2LX9 A;  1VQ4 T;  1WGS A;  3X20 B;  1KQ2 A;  4O5V A;  3OYA A;  3OB9 A;  2RK2 A;  2VGM A;  5HKC A;  3M56 A;  2VV5 A;  1K8A C;  4PJO F;  3MEV A;  3C95 A;  2JUF A;  3BW1 A;  1QP2 A;  3Q1J A;  3GP8 A;  1VQP T;  5I21 A;  1ZQ1 A;  3OYJ A;  1I5L A;  1M9S A;  1KD1 U;  2QTX A;  2JVV A;  1YJN T;  2HBP A;  2MMP A;  3QJY A;  4QW2 A;  5FU6 B;  2GQV A;  3V8L A;  3FIF A;  3M58 A;  3CBM A;  2QQS A;  3SDZ A;  3M59 A;  3JB9 I;  5LJ3 h;  3UWN A;  3KBG A;  3V8J A;  4RG2 A;  2M1H A;  2CGH A;  4ME7 A;  1K73 U;  4M78 A;  4PNO A;  4M78 B;  2V8I A;  2EAY A;  2VXE A;  4E47 A;  3P8H A;  3PMI A;  5C6S A;  4LD6 A;  3UT1 A;  3DLL A;  2KAF A;  4M7A F;  2WSC E;  5FLX E;  1M90 C;  3OYL A;  3J7A F;  1N9R A;  1ZHI A;  4OF1 A;  1YCY A;  2LTO A;  1SSF A;  4FSX A;  1QVF A;  4M7D F;  2CZ6 B;  4BDZ A;  1YJW T;  2X4J A;  5LJ5 h;  1JJ2 S;  2DD5 A;  1VQ5 A;  4X9C A;  4XQ3 A;  2F5T X;  5HK3 A;  1PSF A;  3O8V A;  3OMC A;  4OB0 B;  5FU6 C;  2BUD A;  1FWZ A;  1Q7Y C;  4C5E A;  1BI2 A;  1G3Y A;  3QUI A;  4C8Q E;  1G5V A;  3BY7 A;  3LH0 A;  4WF2 A;  5EG2 A;  3V7C A;  2PVO B;  2V8K A;  3I55 T;  2ZPI B;  1G3T A;  1M1K C;  3X25 B;  3E19 A;  1YJ9 A;  2RHI A;  4BY6 B;  2GFA A;  1DJ7 B;  1KQS A;  3MEA A;  1GXI E;  4IUP A;  3E9G A;  4J6W A;  3CEY A;  3LX7 A;  2DJZ A;  4EMH A;  4II1 A;  1YIT A;  1N27 A;  3EFR A;  4E7H A;  3CPW S;  2E70 A;  2RB6 A;  1O9S A;  2ZPG B;  4A53 A;  2M0O A;  3INZ A;  1JBM A;  4L5G A;  4ZGJ B;  1XTD A;  4J7I A;  4IKF A;  3FB9 A;  2L5Q A;  5DM7 R;  1KQ1 A;  3URG A;  3ZBD A;  1M5Q 1;  3MCA B;  3CCL A;  3CD6 A;  3OYM A;  3CC4 A;  2RI3 A;  2E64 A;  3JCM X;  4IUQ A;  3L2W A;  4J7F A;  4NOY A;  2MF2 A;  5J26 A;  3CME T;  4JRQ A;  5CAI A;  4P5N A;  4OB1 B;  3VV0 A;  5J39 A;  4HT9 A;  2RJD A;  4BY6 C;  3JB9 J;  2Y90 A;  3OQ5 A;  1YIJ A;  4C92 A;  4C92 B;  3MEW A;  1VQ4 A;  3CC7 T;  2X35 A;  5GAO m;  3A8G B;  3PMT A;  3E1S A;  1U8R A;  2RH2 A;  4Y91 A;  1AHJ B;  4J6X A;  5LJ5 d;  2RJF A;  3V7S A;  4PJO G;  4C92 G;  4M78 F;  3OS2 A;  2E5Q A;  5LJ5 j;  3CCM A;  3LGF A;  1Q82 C;  3QDR B;  2YLB A;  1FX7 A;  2KK4 A;  1N8R C;  5CKF A;  1YJN A;  3ME9 A;  4MZP A;  2D0Q B;  3WXM B;  2IVW A;  4M75 E;  2EIF A;  4C8Q D;  4PJO C;  5DLO A;  5A0L A;  4ZTF A;  4C92 C;  2P0P A;  1KHC A;  3AHU A;  4ZGD B;  1OZ3 A;  2CKK A;  2RD1 A;  3JCM e;  3VUB A;  3SWN B;  3G71 T;  3CCJ T;  4M7A E;  3L2V A;  3OBY A;  3PFS A;  5CKE A;  3JCM f;  1OZ2 A;  1UGP B;  2EWN A;  3RKW A;  2XU8 A;  4RCC A;  1K9M C;  4EMK A;  5CKD A;  4EMK B;  3ZEH A;  2KDS A;  3EFS A;  1VQM T;  4JRK A;  1U1S A;  2XG8 D;  4GLK A;  4OMF B;  3I56 T;  3QHS A;  3FEO A;  1XNI A;  3PT9 A;  3CCU T;  1BIA A;  1YJW A;  4DQ2 A;  1H64 1;  5GAO l;  3HP9 A;  5GAN 8;  2RJC A;  4QQG A;  3PIP A;  1NPR A;  2AHJ B;  3OYD A;  1BI3 A;  2XIC A;  3LWI A;  4J8O A;  3OBW A;  1W2B A;  2DXC A;  4C0G A;  2JN0 A;  4BDY A;  3VYG A;  2XI9 A;  1X6O A;  1VQ9 T;  5GAN 4;  1Y7X A;  2QQR A;  4XTV A;  3SWN C;  5GAM e;  3JCM c;  5LJ3 e;  2E12 A;  3QYH B;  3VU3 C;  3OS0 A;  3I55 A;  1Q82 U;  1VQL A;  2A3L A;  2QQA A;  5LJ3 f;  3S6W A;  5GAM f;  1S72 T;  4X9D A;  1NE8 A;  2WSE E;  3R6O A;  5AYF A;  5A2Q E;  3TEE A;  3MHX A;  5A0D A;  4MML A;  1V29 B;  2L8D A;  1QW1 A;  4CRI A;  4MMK A;  3OW2 A;  3DKM A;  4J83 A;  3G4S T;  5D6X A;  1I81 A;  3JB9 D;  1N9S A;  1VQ6 T;  4C5G A;  2LNV A;  5CQY A;  5KCH A;  2E1H A;  4C92 F;  3F70 A;  3L2R A;  1UGR B;  1VQ8 T;  2EKO A;  4BUG A;  3M4Y A;  3JCM V;  2QQ9 A;  2YRV A;  3OSS C;  5CVI A;  3HL8 A;  4MDX A;  3ER0 A;  4M75 D;  3CME A;  4CI0 C;  5IT9 E;  5I2M A;  1BKB A;  5GAN 6;  2RHX A;  2RI2 A;  5GAN h;  2DTO A;  2O01 E;  3DB3 A;  4TVR A;  2X4Y A;  4B9X A;  3JCM Q;  4XK8 E;  3OYE A;  3CC7 A;  2ZPB B;  1QVG S;  2XHC A;  2DTI A;  2K3Y A;  2ZPF B;  2G3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...