3A5ZB

Crystal structure of escherichia coli genx in complex with elongation factor p
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
134
Chain Sequence
TYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Putative lysyl-tRNA synthetase
publication title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
pubmed doi rcsb
source organism Escherichia coli
total genus 17
structure length 134
sequence length 134
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01132 EFP Elongation factor P (EF-P) OB domain
B PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
B PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a5zB01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5zB02
4TVRA 3CCUA 2LXKA 2RF4A 2L15A 1I5FA 3CC7T 4JI3Q 1XNQQ 1KD1U 1W2BA 1E1OA 4A3GH 5LMUL 3OTOQ 1SN8A 1YJNA 2JE6I 3PO3H 3UDXA 5IP9H 4DV7L 1KC8U 1MKHA 1UE1A 4OX9L 2A1AA 4ALPA 2ZTCA 4GN4B 4JI0Q 4A3BG 4BXXG 1BVSA 1ASZA 3CCLA 3I56A 1KD1C 1KL9A 1I3QH 4OO1G 3G71T 3VDYA 4P75A 2EXDA 4A76A 3G4SA 4DR3L 4DR1Q 1IL2A 1D8LA 1NMGA 2PI2A 1KC8C 3CC2T 2QA4A 1KQSA 1X3EA 4QY7A 1KRSA 5BR8Q 4GOPC 5FLMG 4APVA 3DLLA 1OXSC 2KCMA 2Q2TA 2XTIA 4B3RQ 1S72T 4LFAL 3OYYA 1V9PA 3AQQA 2ID0A 2D0OA 4O2DA 3ULLA 3CCET 1VQ5T 2JJQA 3RN5A 1NZ9A 2MO0A 4TVAB 1E22A 2LCLA 3M3YH 4DV1Q 5GROA 3F2BA 4BY1G 4DUYQ 1GKHA 1YEZA 1TWHH 4X62Q 3DB3A 4UPAA 5C44G 1TXYA 4JG2A 5E7NA 4IJLA 2CWPA 1FJGL 4BBSG 3W1BA 4DR5Q 1UE6A 3L0OA 4B3SL 4A3JG 1N33L 1YBYA 1IYJB 1SLJA 2F52A 4A3KH 1IBLL 1K8GA 1XNRQ 1PA6A 1TWAH 2AWNA 3BZCA 3HOYG 1VQ6T 1NY4A 5JEAG 4JI6L 4LF9Q 4B3TL 1WFQA 2JEAI 2VUMG 3TS2A 3NBHB 4B3ML 4DV2Q 5FLXE 4RG2A 2ZM6Q 2E8GA 1C7YA 1U5KA 1HNZL 2UUCQ 3T1YQ 4PZ8A 1K83H 2UXBQ 4HJ8A 3HOWH 2MWOA 1IXRA 2ZJRA 1VQOT 3FP9A 3CC7A 5IYDG 4AQYL 4DR7L 1Y1WG 2OQKA 4DV0Q 3CXCA 1XNIA 1IBMQ 1Q86U 1VQ8A 4KHZA 4Y7NH 2A19A 4GKKL 1EQQA 3KF8B 3A74A 4PG3A 2K14A 3K8AA 4DR6L 3CCST 1K3RA 1FGUA 2JA6G 4HIKA 2JA8G 3CC4T 1SR3A 5GAGC 2JA7G 3G71A 4HJ9A 1G291 4X64L 5JJKA 1VS0A 3CCJT 1Q86C 1XPRA 2UUAL 1MJEA 4HJ7A 4DV4Q 3RN2A 2UXDL 1BBWA 4YWKA 3CC2A 3M85A 2KHIA 5ELNA 1BBUA 1VQAA 2D62A 2NVXH 4MZ9A 4JBMA 3OW2A 2BA1A 5FJ8G 3CW2C 3M7NA 3S2DH 3CPFA 1A8VA 1S72A 4EX5A 4A3MH 1I94Q 3F2CA 1NBWA 3K7UC 1Q12A 1YNXA 1VQ5A 5LMNQ 1WYDA 2QEXT 2YTXA 1IBKL 4DPGA 2N78A 1E3PA 4HIOA 4BBRH 2I0QA 2NVYH 4GKJQ 4LFCL 1EFWA 1W2BS 5IYBH 1XMOL 4DV5L 4LW1A 3WWVA 2OTLA 5M5XH 3J81c 4MTNA 4LF7L 4LNQA 1VQ6A 3BZKA 4PZ7A 3SGIA 1WJJA 3L7ZC 1PH5A 4LF4Q 4KLKA 3CMAT 1AE2A 3HOUH 4DUZQ 3FKIG 3CD6A 4A3EH 2LQ8A 4JC0A 4YCUA 4DAYB 1PH2A 2E5LQ 2F4VL 2VL6A 3AFPA 4JI1L 2JUFA 1YHQT 1A63A 2UXCL 1N32L 3TRZA 1VQOA 3D31A 2PNHA 1YHAA 1GD7A 3CF5A 4NXNQ 3EN2A 1NJIU 4BY7H 1JE5A 2VQEQ 3UDFA 3AFQA 1KQSS 1PH1A 3K0XA 1K9MU 4IJHA 2UU9L 4DAMA 2K5NA 2NN6I 2WB1G 2IHEA 5LMUQ 2VZAA 3I4NG 5J3BA 4A3IG 1HJPA 4R1JA 3CCSA 1HNWQ 3KDFA 3TQYA 3F2DA 1Y14B 1KRTA 3H0GG 3PSIA 4C3JH 1NJIC 2HIXA 2HHHL 1TWCH 1UE5A 4KI0A 2Q2HA 1V1QA 4A3BH 3CQZH 4DR2L 1P16A 5IT9c 1K9MC 1J5EL 1I50H 2K5VA 4AH6A 2Z6KA 3HOXH 4IOCA 1VQHA 1HNXQ 3STBC 3KDFB 2R7DA 4GLAC 3AEVA 1Q82U 3I4OA 3S17H 3M9BA 3E9IA 1YI2T 4LFBL 4P72A 2K50A 2EIFA 1SE8A 3M4QA 2MQHA 4GNXC 1PH3A 4DR4L 2ZTEA 1H95A 1LYLA 2BA0A 4POGA 1Z47A 3ER0A 5FLMH 4KHPL 2KDSA 4QQDA 2AMCB 3CCMT 1L1OA 2QEXA 1YVCA 3K80C 4QGUA 4IOAA 1Q82C 2KCTA 3ICEA 2AWOA 2IT1A 4H02A 5AJ3L 3PIPA 1V43A 2R92G 2VQFQ 2ATWA 1PFSA 1LM0A 4L5RC 3KJPA 3CXCS 3A5UA 4X34A 3TREA 1JB7A 3GTOH 2WP8J 4IPGA 1HH2P 1FJGQ 1L1OB 1OXUA 2HT1A 2JA9A 1HR0W 5C44H 4A3DG 1RIPA 4BBSH 4A3FG 5JJLA 4JI4Q 1VQNA 4R4CA 4JBKA 4A3JH 3CMAA 5EAYA 1N34Q 4NPSA 1PYSB 3HOYH 1EWIA 3A5ZB 2GVAA 1YHQA 2MO1A 1QZGA 1HNZQ 3I55T 5JEAJ 1N36L 2YTVA 4ME3A 2DUDA 1VQKT 1VQ7A 3B6YA 5IWAL 4OO1I 3CMET 2NZHA 4YY3L 2H5XA 1VQ4A 1VQJA 1PH8A 3OW2S 2Y0SE 1Y1WH 4JI7Q 3PUYA 5M3MG 3TS0A 4GKKQ 4JV5L 2MNAA 1Q7YU 4A4IA 4A93G 2OCEA 4X66Q 3PUVA 4Y52H 2WFWA 5K36G 3KF6A 4DR6Q 2FXQA 4JCVE 2NVTH 2HIVA 5FLXc 2UUBL 1EIFA 3I4MG 5C0XG 2JA6H 3HKZE 4HJAA 4UP9A 5DM7R 5H1SE 4X65L 2JA7H 1DGSA 4IFDJ 4LF8L 1YJ9A 2VY3A 3KF6B 1Q7YC 4P74A 3RZOH 1VQEA 4ZN3A 1M90U 2CFMA 1XTDA 3CCVT 1VQFA 5IY0A 4JI3L 4GS3A 1ASYA 5GQOA 1XNQL 3I7FA 3GO5A 4OWXB 4DV6Q 4GOPA 1EOVA 1D7QA 4GN3B 3OTOL 2ALYB 5FJ8H 2JA5G 3GTKH 4UP8A 3CCMA 3HKSA 1PH9A 4NXMQ 2JOYA 4JI2L 1YIJT 1XJVA 3RLOA 4JI0L 3E9HA 4JOIC 4R4OA 1JJGA 3NEMA 1M90C 4GOPB 3CCRT 3UDGA 5C4XH 2ASBA 3ZJYC 1A0IA 3CAMA 4DR1L 1VQMT 1IZ6A 2LSSA 4YCVA 1WOCA 2MFIA 4LF7Q 4CRIA 4LF6Q 4P71A 2WAQG 1YJWT 4YHHQ 1CSQA 1VQPT 4AYBE 5BR8L 1S40A 2QGQA 4O0AA 5GAHC 4B3RL 3F1ZA 1MJCA 3FKIH 2E2HH 3S15H 1O7IA 1VQKA 4DV3Q 4IFDI 1Q8KA 4C2MH 2CKZB 2XGTA 1VQLT 3AYHB 4JYAQ 1K8AU 3H3VH 3CCEA 1YITT 4YCWA 2ZJPA 4DV1L 4X62L 1CKMA 3ERSX 4LWCA 1R9TH 3H3VI 2R7ZG 1VQBA 4K0KL 4JI8L 3BJUA 1Q81U 3M4PA 2KENA 1CUKA 2IX0A 3J7A5 1Q46A 3S1NH 2YTYA 2GN5A 3I4NH 1Q1EA 5IE8A 1XNRL 1QVGA 1Y1VG 2Z0SA 4A3IH 3S1RH 3S16H 4BA2I 1VQ9T 1K8AC 4JI5Q 2ZTDA 4R4TA 1VQIA 2ZM6L 1SFOH 3H0GH 2UUCL 3LGJA 3T1YL 3IRBA 5LL6S 3LGFA 1E7ZA 2RHQB 2OWOA 2UXBL 1Q81C 5LMNW 3LGLA 4C3IH 3J7ZC 3K7AH 1WCMG 4LUVA 3CCUT 1XMQQ 1OXXK 2B63G 3HOVG 2PQAA 3PGZA 1XPUA 4JBJA 1NPPA 3RZDH 2I5HA 2KVQG 2RHSB 1YIJA 1YJNT 4HIDA 5IYCG 4ZN1A 1X3GA 4DKAC 1UEBA 2HHHQ 3S1QH 3S2HH 1RL2A 2PQAB 2IX1A 4LF5L 1EUJA 1HZBA 1PYBA 2EQSA 4DV7Q 4OX9Q 2R92H 2CQOA 3CC4A 4DV4L 2E70A 1VQMA 3FHWA 3U4ZA 2XHCA 3CCJA 2DGYA 1XPOA 4A3DH 2NN6G 1VQPA 5IP7G 1UWVA 4L5QA 4DR3Q 4A3FH 1X9NA 1I94L 3HOZG 1OXVA 4QL5A 1T9HA 4YWMA 1C9OA 3RLFA 3JC66 2B3GA 5LMNL 2BH8A 1SRUA 1VQLA 1FL0A 2CKKA 4RG1A 1QZHA 3W1GA 1X54A 4A3LG 5C3EG 4LFAQ 1M1GA 2R7FA 4YY3Q 3HOXG 2N8NA 3GTLH 1TWGH 2OQ0A 3T1HL 4QIWE 3PO2G 3CPWA 1SROA 4QJFA 2JEBI 3JAMi 1X56A 3A0JA 2K5HA 4YWLA 4JV5Q 1N9WA 3PCOB 4PMWA 5M3MH 1VQ9A 4BY1H 1JMCA 4LF4L 4A93H 1JJ2A 2R93G 3PF5A 4DUZL 1QVFA 5DLQE 4B3SQ 1N33Q 2PMZE 1IBLQ 2E5LL 3KOJA 4K0KQ 4BXXH 3I4MH 4JI6Q 1EYGA 1E24A 1PHJA 4B3TQ 2MI6A 5C0XJ 4B3MQ 4LF8Q 1TWFH 4NXNL 3UE1A 4LUOA 2VUMH 2K52A 2VQEL 2GVBA 2KBNA 1BKBA 2HQLA 3NENA 4GNXA 4A3CG 2OTJT 3S14H 5M3FG 2IY5B 1VQ8T 1X55A 3W5OA 2A8VA 4DR7Q 1NTGA 4AQYQ 3M4OH 1FVIA 1HNWL 1QUQA 4JI2Q 5M5YH 1UE7A 3JAMc 2JA5H 5IYDH 1OXTA 4OXPA 1PV4A 3ULPA 1YZ6A 4YTLA 2LVMA 4GNXB 1P8LA 3J7AF 3RNUA 4A75A 1S3OA 4C3HH 3GDEA 2CWAA 3JAME 2N49A 3HFZB 1QUQB 1HNXL 4OONA 3U4VA 1GO3E 2AKWB 1X6OA 3Q8DA 4X64Q 4IO9A 2JA8H 3J80i 2UUAQ 2DO3A 3CCQT 1VQCA 1N8RU 1HR0L 1K73U 2PI2E 1QVGS 2E2JH 3GTQH 2UXDQ 1B70B 1U0LA 5JJIA 1YI2A 2JK8A 2G3RA 4A3GG 2IHFA 2Q2IA 3MXNB 3PO3G 5IP9G 5C0XI 3TEHB 2CCZA 2L3RA 1LUZA 5M5WH 2VQFL 2YU9H 5IAYA 1N8RC 1E1TA 1K73C 4HIMA 2MWPA 5ELOA 2WB1E 3BU2A 1IBKQ 1KAWA 3K81C 3H15A 4JI8Q 5A2QE 4AIMA 2R7ZH 2K4KA 1VQDA 2ES2A 2OTLT 2JQOA 3D0FA 4JI4L 1AE3A 3DM3A 3S24A 1HZAA 4POFA 1XMOQ 4LFCQ 3J80c 4DV5Q 1N34L 3PF4A 1C0AA 1G51A 1VQGA 1Y1VH 4UY8C 3UE0A 3CD6T 1L2FA 4LUZA 1PH4A 3KBGA 1HZ9A 1W3SA 3J80E 1EIYB 4WJ3M 3NELA 3GTGH 3I55A 5HGQA 2F4VQ 3U58A 4JI1Q 1VCIA 2D0PA 2UXCQ 2OTJA 1A62A 1WCMH 4RMFA 3GTPH 1N32Q 4JI7L 3CMEA 4IPCA 1X3FA 2I5MX 4DNIA 2B63H 2NVQH 3HOVH 5HY6A 1JT8A 1I6HH 4DUYL 4X66L 4WJ4A 3PIOA 2UU9Q 1CKNA 3F8TA 4JOIA 3STBD 5IYCH 4P73A 4HJ5A 4DR5L 3G48A 4DK6C 4A3KG 1PH7A 4IFDG 2VW9A 4LF5Q 3P8BB 2N3SA 3RR5A 4XTCS 1L0WA 1CKOA 3G6ET 4LF9L 1QVCA 3E0EA 2B29A 4L5TA 5C4JH 3J81i 4DV2L 3CPWS 1CKNB 1OTCA 1Q1BA 1GVPA 1SMXA 4XIGS 2IG0A 3MEFA 3CCQA 2I5LX 3CP0A 4DR2Q 4DK3C 1J5EQ 1NPRA 4IPDA 4L5SA 3HOWG 3L2PA 5J26A 3KLWA 4X6AH 1AH9A 4DV6L 4R4QA 1WI5A 1YHBA 5IP7H 1JJ2S 3CCVA 1QVFS 4QQBX 2KHJA 2C35B 4DV0L 2E2IH 4NXML 1PH6A 1IBML 3HOZH 4DR4Q 4LFBQ 1G6PA 3DB4A 3U50C 3KJOA 3S1MH 2VS1A 2Y0SG 5C4XG 2ZJQA 4KHPQ 1EQRA 1KHIA 3LH0A 1B7YB 4GLVB 4A3LH 5C3EH 4MNOA 3T1HQ 1NE3A 3CCRA 1LTLA 2RCNA 1M1KU 4UP7A 5AJ3Q 3J81j 3PV0A 3UDIA 2YV5A 3CCLT 4OWWB 2R6GA 2Z6KC 3PO2H 3I56T 3ULJA 3HKZG 4LF6L 3GD7A 2JVVA 3I2ZA 4TQUS 1CSPA 3RLNA 4YHHL 1KXLA 1VQNT 1B8AA 1X65A 3PUXA 3G4ST 1HZCA 4GLXA 1KIXA 2E6ZA 1YJWA 3J81E 2BH2A 5GADC 1PVOA 2K75A 2V1CC 3PUZA 2R93H 2QA4T 1Z9FA 4R4IA 4A3MG 2NZOA 1M1KC 4DV3L 4PZ6A 3KFUA 4JYAL 1VQ7T 2AHOB 3EIVA 4FDBA 2LXJA 1L1OC 1NMFA 4IPHA 1N36Q 1VQ4T 3GTMH 4BBRG 5IWAQ 4J15A 1YITA 4A3CH 5IYBG 5M3FH 4GKJL 2VNUD 1JJCB 4NB3A 1J6QA 4EQ5A 4JI5L 1SSFA 4JBWA 2F3IA 3G6EA 3GTJH 2YYZA 3EBEA 4GN5A 4A3EG 3HOUG 1GM5A 4OWTB 4AYBG 2Q2UA 1MIUA 2UUBQ 1YJ9T 1K0RA 2WAQE 5GAEC 4BA1I 5IT9E 3PUWA 4X65Q 1XMQL 2JNGA 1HR0Q 4BY7G 3KYHC
chains in the Genus database with same CATH superfamily
4TVRA 1K76A 1I5FA 1NR2A 2K5QA 5GMKl 1W2BA 3AHUA 1M8VA 2EY6A 2CGHA 3EHRA 5CV9A 5C3XA 3PO3H 3SEBA 2OAWA 2FINB 1DYQA 1E2VA 4C3JG 2MF2A 2FO0A 1K4US 2LS01 4ALPA 4GN4B 4BXXG 3S9WA 5CV8A 1BVSA 1LTID 1YWPA 3CCLA 1TVXA 1KD1C 4KUDK 2L11A 4BY6B 2MPXC 3MFGA 1NMGA 1SYGA 3JCMb 3JCMW 1MMAA 2F0NA 3F2UA 2DY7A 5FO8B 2J4XA 1Y1VB 3MXGA 2AUKA 4C92C 2KCCA 1MUZA 3DLLA 2DBMA 4E7HA 2KCMA 3M0UA 3CCJQ 3GTGB 4LFAL 5GJVB 3AQQA 2ID0A 5EGTA 4ZYSA 2E2HB 1QWFA 1JBMA 4BI8B 3SEMA 1VQ5T 3CCET 2JJQA 1NZ9A 1AFPA 4TVAB 2E6NA 1I4GA 3GOXA 2PU9B 4QW2A 2K33A 3U9OA 1I8FA 2BE5C 4BY1G 1GKHA 2DBKA 1I6HB 1G3SA 1AZQA 5C44G 1TXYA 1R9TB 1FJGL 2CWPA 1VQLQ 2VGNA 1PDQA 1X27A 3LNNA 1G6PA 1YBYA 2J7IA 2JM9A 1IBLL 1NAPA 1JOKA 2B2UC 4U68A 1F9QA 3T16A 1PA6A 1XNRQ 3A8IE 4RTZA 1RUWA 4JI6L 4IFDJ 4KY7A 4B3TL 3JCMf 4OMMA 5FLXE 2HMAA 4RG2A 2ZM6Q 1SFOB 4HVVA 1C7YA 3K5OA 2UUCQ 2EYLA 1ZSZC 3A8OB 3SB2A 1WTOA 1T5EA 1VQ9Q 3D4DA 3KF8A 3HOWH 1IXRA 4XT1B 4RCCA 3CC7A 5IYDG 4OB3B 3HHTB 1EY4A 1I4HA 4C92E 1IBMQ 2RSNA 5CVIA 4IQZA 2K9GA 1STBA 2A19A 3QHSA 2JZ2A 2RQWA 1LPLA 3KF8B 2K14A 3R93A 1OO9B 4TKOB 1ENCA 4EMGA 2KEDA 4K8IA 3M59A 1RJTA 3OB9A 5KYNA 3CC4T 1KDCA 2MGSA 5C3EB 2JA8G 1PZJD 3A8MB 4HJ9A 4M75B 5JJKA 3NQIA 4X64L 5C6SA 2RQUA 4XQ3A 1F2YA 4HJ7A 2R92B 2K5DA 5D6YA 1WHJA 1GFCA 1LVKA 3GV3A 2UXDL 4YWKA 3M85A 1LACA 1ZBXA 2JM8A 1BBUA 4C56C 3QG1A 4MZ9A 4JBMA 3EG0A 1WHHA 3CW2C 1RTNA 2R93B 4K2LA 4UDUC 3M7NA 3CPFA 1A8VA 4A3MH 3F2CA 2MYSA 4K5XA 2EYOA 3PQIA 4BS9A 2LQNA 1T3SA 1IBKL 4RTUA 3GTMB 1BR9A 4DPGA 2KRMA 1E3PA 5FOBB 1NEBA 3QDRB 4E7SA 1K9AA 3CHBD 2EFIA 1U4LA 2NYSA 2O2LD 4DAYA 2O31A 4LW1A 1DXMA 3JCMc 3JSCA 2PCFB 1EWCA 2NUCA 2QKIC 4CJ2C 2Z0WA 4PZ7A 3SGIA 4QT7A 3TSWA 1SSOA 1WJJA 3L7ZC 4CDCC 1PH5A 1KTKA 3FKIG 1GHJA 4JC0A 4DAYB 1AT1B 3AFPA 1YHQT 1EU3A 2K5FA 4EQNA 2DXCA 3TRZA 2VGMA 3D31A 3GNFB 3FPPA 3S3NA 2VQEQ 3AFQA 3JCMX 4M77C 5F2DA 3OYMA 3VS7A 1K9MU 2H1EA 1TS9A 4CI0C 1F1BB 4C5IA 2NN6I 4J6XA 5LMUQ 5KGUA 4FW1A 1VIFA 3I55Q 4R1JA 3KDFA 1ARKA 2FPDA 2OTJQ 1Y14B 2GBQA 1ML0D 1TWCH 2ED0A 1Z9ZA 2K79A 1TS5A 1V1QA 3E9FA 2Q2HA 2IL8A 3CQZH 4DR2L 1GUNA 1I50H 3RESA 2RA2A 4IOCA 1VQHA 4ZGEB 3R2IA 4JRPA 3KDFB 4GLAC 4PNYA 3STBC 2HD0A 3AEVA 4K5VA 4LXCA 3S17H 3M9BA 2QI2A 3NTHA 3QBYA 1PH3A 3A8HB 3M4QA 1FNUA 2E12A 3RMQA 1LYLA 2IPOB 3GBQA 1K73R 4XU1A 3BDOA 2R5MA 2QEXA 1YVCA 4ILWA 2KCTA 3ICEA 2AWOA 4H02A 3REAB 5AJ3L 3PIPA 1VYVA 4M77E 4R8IA 2VQFQ 2EWNA 1LM0A 4L5RC 1JB7A 3CXCS 3GTOH 1W6XA 1TWHB 4A3DG 2R57A 3JV3A 4ID6A 3MP1A 4M4ZA 1RIPA 3V7CA 4A3FG 1W6JA 2EYJA 4A54A 1V76A 3CMAA 2LT4A 5EAYA 4M78D 1BCPF 4A3JH 3THKA 1PYSB 2QQRA 1FYCA 2HDLA 3HOYH 2CW0D 1ZSGA 2EYHA 2DUDA 1QCOA 1VQ7A 4WTOB 4QF4A 5IWAL 3JCMh 4OO1I 2F2WA 1NEGA 2LDMA 3CD6Q 4NOYA 1KHCA 5DAUA 3S3MA 1TSFA 3SK8A 4OMQA 5DEHA 5IN1A 1EU4A 4B9WA 1RTOA 4CC4B 5CMDA 2PZTA 4JV5L 1QP2A 4S3SA 2WFWA 2FG0A 4KBMB 3KF6A 2EQMA 4DR6Q 3OS1A 4JCVE 3HRSA 3KUFA 5FLXc 2F5TX 2VVKA 3QWXX 4ME7A 1EIFA 3I4MG 3AT1B 3NWSA 4HJAA 1PFBA 2E5QA 1DGSA 2IVWA 1BI0A 3KF6B 1WX6A 2XRQD 1VIEA 3DUZA 4HT9A 4N4HA 1ASYA 4JBKA 1CTMA 3MXUA 2FPEA 4DV6Q 2LP5A 2V1RA 4GN3B 2ALYB 3OTOL 4P5NA 3JCMe 1Q95G 3GTKH 2CSQA 4F7UA 4JJNK 2B2VC 4CDEC 4N4IA 1W4SA 3VR6A 1AD5A 4HEDA 4R4OA 3NTIA 5LJ3j 3CCRT 1BI1A 2FZCB 3ERQA 3UDGA 1NM7A 2DNCA 5ELBA 2F0LA 4F7UB 3ZBDA 3H6MA 1A0IA 2M0YA 3JB9F 1SSHA 2C0OA 4X3UA 4LF7Q 2WAQG 1YJWT 3RMHA 1CSQA 1SPKA 4AFSC 2X4YA 5IGCA 2EYYA 5GAHC 1UGQB 1MNEA 2EW3A 2V8JA 3LW5E 2VC8A 3HPWA 3PVQA 3HRZC 2E2HH 1O7IA 1VQKA 3D4WA 3G6JB 2DX1A 3C1FA 2L55A 4DF7A 1BK2A 4JYAQ 5GANj 4DV1L 1YITT 2VXWA 3BVMA 3MXPA 4BY7B 4X62L 4A4HA 1D6EC 4M78A 1CKMA 3MPUB 1R9TH 3H3VI 2R7ZG 1VQBA 4N9PA 4JI8L 2PW5A 4M7AE 1JEGA 1DOKA 3VS2A 4F17A 2AIRB 3R6NA 5KE2A 1K9MR 4OEMB 4O1NA 4EGVA 3I4NH 1WJSA 4A3IH 4M78B 4JI5Q 3SK4A 1SFOH 4BE0A 3H0GH 3LGJA 3T1YL 1UUEA 4M7DA 4IUUA 5LL6S 3SDZA 1EIHA 3LGLA 2KAFA 2K3YA 4DEYA 3WOFA 3I73A 4C1NK 1WCMG 1F9PA 1PD0A 4C8QC 4DK0A 2B63G 2PQAA 3PGZA 1LTBD 2O5JC 2A5HA 3C4SA 2XDBA 4M7DB 2X4XA 1I4PA 3KBXA 1SJHD 1Z6HA 4PFZA 4J9FA 4Y92A 1ILQA 1GXDC 1DOMA 4KY6A 1GBQA 1D1KA 2HCCA 1X75C 4ZN1A 3Q22A 2PTKA 2D9UA 2EAYA 1HTLD 2IJ0A 1VMCA 5GAN2 1STHA 2PQAB 2RJDA 4DBFA 3QYGB 2K32A 1HZBA 1XWEA 2EQSA 2K05A 4ZTFA 5KRUA 2R92H 5HK3A 4RFBA 3HRTA 4XYOA 4KH0B 1SEMA 1QWYA 2RSOA 1QKWA 3CCJA 5LJ5d 1EY0A 1SYFA 4U673 1I3QB 1SKUB 2DM1A 4RGOS 4XU3A 1IYUA 1X9NA 4QVCA 1LT6D 4QL5A 3QYHB 3VS3A 1JQQA 1C9OA 1LTRD 1T9HA 3VYUA 4ELZC 5LMNL 1CZGA 2HSPA 4C92G 1IKLA 1VQLA 1FL0A 2CKKA 1X54A 4BY6C 4DNTB 4LFAQ 5KYXB 4YY3Q 2H8HA 1KABA 2OQ0A 4BDZA 3CPWA 1U8RA 2VWFA 1Y1WB 4PJOD 2JEBI 3SVMA 2ZAEA 4F16A 4PMWA 5M3MH 2K3BA 1VQ5Q 1VQ9A 4BY1H 1K8MA 2E75C 4LF4L 3A54A 1TU2B 1JJ2A 3E2UA 4FCYA 4DUZL 1QG7A 5DLQE 5LJ3f 1IBLQ 4LN2A 2DEUA 4K0KQ 1M3AA 2CP2A 4FP5D 4JI6Q 1ZHIA 4XU2A 4B3TQ 4EMHA 4LF8Q 4KGVB 2K5LA 4R55A 3JCMJ 3PIP3 3RZOB 1HUMA 2DJGC 1X2QA 2HQLA 4NS5A 3A98A 5GAMg 2PYKA 3WDNA 1VQ8T 4KTAA 1K28A 5FU6B 1FVIA 2JA5H 3MFYA 5EPLA 5IYDH 1PHTA 2BZ8A 1OXTA 2ICIA 4OXPA 2JYOA 5GAN4 3ULPA 1CI3M 2CT4A 5M9OA 4PQXA 2B8GA 5I4DA 4C5EA 1WTPA 5C4XB 4JDSA 4J9GA 1MBYA 1HNXL 4LUDA 4DA2A 1ZQ1A 1R77A 3LLRA 3ZYYX 4IO9A 3Q8DA 4X64Q 2JA8H 2L2PA 3J80i 5KE3A 1N8RU 2NUZA 4A53A 3L2VA 3GTQH 4RTXA 1PRMC 1B70B 2NZ1D 2VB3X 2UXDQ 4MDXA 2PZUA 4OGQC 1SNDA 1LT3D 2Q2IA 3PO3G 1BCPD 5C0XI 1JB3A 1WI7A 2KXCA 3TEHB 2XVSA 4M1UB 1G3YA 2ENMA 4E7IA 1K73C 5KCHA 3VR5A 4XTYA 2P0QA 1U06A 1IBKQ 3K81C 1X43A 3H15A 1PD1A 4AIMA 5IODA 1UFFA 2C06A 2QAZA 2FEIA 2C9OA 1P92A 1SHFA 5FWBA 4EDUA 2F0UA 3NTKA 4XTWA 3S1RB 5M5XB 2E65A 2J0TD 4XDXA 1PKSA 4AFZC 2B2WA 1MMNA 4LUZA 3RNJA 1H3HA 3J80E 1EIYB 1RAIB 4PJOA 3I55A 3E1SA 1KQSP 3OSSC 3E0JA 2D0PA 1WIEA 1JXMA 2YWWA 4K6LA 4J9IA 2OTJA 4FXDA 3SK6A 3P1HA 4IPCA 2I5MX 3TN2A 4DNIA 3MZ5A 2L3PA 1X01A 4PJOB 1U5SA 4M77G 1YHQQ 2DTHA 4WCIA 2SRCA 1X6BA 3PIOA 1CKNA 1QNKA 1EY5A 1OEBA 3VRYA 3STBD 4P73A 2F0VA 4HAEA 3UF4A 2N3SA 3RR5A 3N6RA 5D3IB 1CKOA 3G6ET 1FX7A 4KY5A 5LJ5f 2D8JA 1CKNB 3SE0A 2KT8A 4DR2Q 1RD9D 5IXBA 2NB0A 3MEFA 1E0BA 3HOWG 2QQAA 2RDGA 1D09B 3L2PA 1IO6A 2NN6H 3P7JA 4HCEA 1NSNS 1WI5A 1JU5C 3MEHA 5ELEA 4QQBX 1M2OA 1IBML 4JW0A 4HR7B 5BN5A 1OV3A 1WYXA 1NYGA 3DB4A 1X32A 3U50C 5IIFA 3KJOA 1YJ9Q 2ZJQA 1WXTA 2FZKB 1KHIA 1S5BD 2YUPA 3QO2A 4MNOA 1TWGB 3D6CA 3HOXH 1LTLA 3V8LA 3LX0A 4UP7A 5AJ3Q 2XG8D 3OBWA 4OWWB 1S1NA 1TG0A 1TU0B 1GRIA 1WGSA 3G1JA 4LF6L 3I2ZA 3RLNA 4YHHL 4WF2A 1X65A 3G4ST 1HZCA 3VR3A 4GLXA 4L6TB 4LDVA 3V2TA 2BH2A 1PVOA 2DKGA 2K75A 2EPBA 2V1CC 1F77A 3VR2A 2QA4T 1JORA 4A3MG 1UB4A 2OT2A 1BCPB 2FJ2A 3EIVA 5LJ3h 2R58A 2CZ7B 1DONA 2QYZA 5IWAQ 5GMKi 2OJ2A 2RDHA 4OMNA 1X3PA 1I0CA 2Y4YA 3FEOA 1ZKOA 3D6WA 1X69A 4NB3A 1EFNA 3H8ZA 4N0AA 4EPCA 1K0SA 4LD6A 4NMZA 3SK5A 2DRMA 4A63B 2F3IA 2QQ9A 2YYZA 2KUMA 5A2QL 4QIWB 4Z89A 4OWTB 4CKCA 1Q7YR 1SRMA 2L3QA 2E10A 1E2ZA 4ZKBB 1KIKA 3VA5A 3CBPA 1K0RA 3S6WA 5GAEC 3QUIA 5GANh 5IT9E 3PUWA 4II1A 4MHEA 4D8KA 1HR0Q 2RJFA 5ECAA 4DOWA 2E2JB 5GMKj 3CCUA 5J1ZA 3CBMA 2RF4A 1BO0A 3VS4A 5LJ3e 1SMYD 1HFGA 4OIJA 1E1OA 4A3GH 4MZPA 5LMUL 3OTOQ 3UA6A 1D0ZA 1SAPA 5KYUA 1YJNA 1TY0A 3UDXA 5IP9H 2E5KA 2XICA 4M7AG 4KKSA 1UE1A 1TKWB 4CC3A 2YRDA 2A1AA 1G8ZD 1ONLA 2K04A 2ZTCA 2DVEA 1JQYD 4JS5A 1ASZA 1JRIA 5GJWB 3VS6A 4HKEA 3HGBA 1Z9QA 1I3QH 3G71T 5KYUB 3LWHA 1AZGB 2RNAA 4DR3L 2E2DC 3CCRQ 1KC8C 1PYWD 2AZSA 3CC2T 5GANe 1WTQA 3MP8A 1OZ3A 1YNJD 1KRSA 2Q2TA 1BIAA 3TSSA 2JN0A 3OIPA 1S72T 3OYYA 1V9PA 2EPDA 1EY7A 5KNDA 3H0IA 1RLQC 2D0OA 2M9UA 2MO0A 3GTPB 4JPBW 1E22A 3FDTA 1C6VX 2LCLA 3QSUA 3HOVB 1F2LA 3MKDA 2J06A 3LWEA 3F2BA 4DV1Q 2KRNA 1YEZA 4X62Q 1QILA 5J39A 1PRTF 2RBMA 2DETA 3CQTA 2WIIB 2QDYB 2RO0A 4XXEA 3W1BA 1PSEA 4A3JG 2O5IC 2F52A 4A3KH 2QG9B 3HOYG 3BZCA 4FIBA 2YRCA 1VQ6T 4LF9Q 2JEAI 3GF5A 4KJNA 2J6FA 3RERA 2KQ3A 2E8GA 2DK3A 4HXJA 2Y4XA 3BZDB 4RHSA 2Y90A 4BACA 3T1YQ 4PZ8A 2CP6A 1K83H 1WLPB 5CC4A 3J81L 4KKTA 4FO2A 2L12A 1V29B 1BBZA 1SYEA 4DR7L 3FMCA 1CT1D 1IGUA 3OHXC 5FW9A 3CXCA 4M78C 2EXZA 4Y7NH 1E6GA 2ED1A 2CW0C 3E5SA 3RZDB 1JWMD 2NWGA 1EQQA 1KJWA 2EKHA 3TEEA 4O5VA 4DR6L 3CCST 2RDFA 3C3LA 4IUQA 2DIQA 4JK1C 2AUJD 2ROLA 1VS0A 1Q86C 1UUPA 4M7DC 3E6ZX 1M8AA 2UUAL 2X69A 3TU4K 5IXFA 2HAXA 3L2UA 1Y71A 2FYKA 2J6OA 1BBWA 2K5IA 1JWSD 2KHIA 1BI2A 1VQAA 2D62A 1N27A 1D1AA 2BA1A 4X1VA 3PGGA 3S2DH 4EX5A 4KRTA 2EE1A 4H7BA 3K7UC 4HTHA 1VQ5A 1UTIA 5LMNQ 3BDUA 1WYDA 2YTXA 4F8MA 1WNLA 1FMVA 4IUTA 4AFQC 1YI2Q 2A69C 2DL3A 4M78E 1EYAA 2I0QA 1BB9A 4ZNXA 4GKJQ 5C0MA 2K7VA 2M2LA 1ICFB 1EFWA 1PTOF 2D0QB 4DV5L 3X26B 2A73B 5M5XH 2KT1A 4HN7A 1RAEB 4MTNA 2E41A 3OYNA 3K5MA 3BZKA 4LF7L 3R8BA 2RN8A 5ISRA 2QASA 5CK9A 3GTJB 4LF4Q 1PNJA 5I11A 3BYYB 2DXTA 1JWUD 4DUZQ 1PH2A 4ULLA 2F4VL 1OOTA 2VL6A 4BWGB 4TSSA 3MC0B 3M0RA 2UXCL 3WXMB 2EZVA 1S5FD 2AQ3B 3TDQA 4PKCC 2ATCB 2B2TC 1AHJB 1GD7A 1NJIU 4FNFA 1TWFB 3TZUA 5JEAG 1KQSS 1GUSA 3K0XA 2VB6A 4IJHA 2UU9L 4DAMA 3I4NG 3GP8A 1IRXA 4FSSA 2EQIA 2IHEA 2VZAA 3FPUB 5J3BA 2AKLA 4A3IG 4RKLA 2JN4A 3F2DA 1PM3A 2LJ0A 4RAUC 2MHVA 3H0GG 2HHHL 4A3BH 3CMEQ 1LOJA 2CH4A 4WORA 3L2ZA 2DN8A 1UJ0A 3NK9A 5IT9c 1M1FA 3H3VC 2C0IA 2H3JA 2K5VA 2Z6KA 3QIIA 4JJCA 1HNXQ 2RD1A 3DLMA 4M75D 5FU6C 3OYKA 1PFNA 2KYMA 1Q82U 5G3LD 1MHWC 4OL7A 4FVMA 3MEAA 4P72A 1SE8A 4RH6A 4X3KA 2CZ6B 1GBRA 3EFXD 2ABLA 2RCFA 2BA0A 2ZTEA 2ZXPA 2QQSA 1DD2A 1Z47A 1H95A 3EG2A 3OYAA 4IUNA 2CP0A 4QQDA 2EJFA 2Q8RE 2AMCB 3CCMT 3A8KE 4QGUA 4IOAA 1ACMB 1PRLC 3PFSA 1V43A 3CCVQ 1UE9A 2KEAA 1A3UA 1QOHA 1MHNA 1ZUYA 4L59A 1PFSA 3QIAA 3M3YB 1O75A 3A5UA 2O9VA 2WP8J 1BCMA 1HH2P 1EZ8A 4IPGA 1OXUA 2HT1A 1ESRA 1EZ6A 2JA9A 3NWTA 5KCOA 4BBSH 3H6ZA 2V8KA 4PLLA 2ESWA 2X9HA 1TWAB 2CREA 3KXTA 4I65A 2CDTA 2GVAA 3P8HA 4V0BA 1YHQA 2KI7A 5D6WA 4JJBA 1N36L 1UG1A 2MAMA 3VJPA 4I7AA 1MGQA 2EYPA 2JXBA 3EQLC 2EVBA 2EVRA 4YY3L 2EGAA 4JUVA 4AFUC 1QCNA 5CGKA 1QE6A 3TP5A 1OI1A 3RD4A 5M3MG 4F14A 2VYTA 3K6OA 3QR8A 4AG2C 5I9PA 2NVTH 1SXTA 5KIXA 1Q3LA 2KSSA 1QCBD 2HQHA 2EJGA 1I5LA 2JA6H 3HKZE 2B2WC 3DXJC 4UP9A 2COZA 5DM7R 5H1SE 2JA7H 1STYA 1YJ9A 4PJOC 2VY3A 1QVFP 2RPNA 1Q7YC 3K0YA 4LF8L 1I81A 2A6HD 4ZN3A 1M90U 1C48A 5IY0A 1D5MC 3G6EQ 2IX3A 2KGTA 1RABB 2NUTA 2RQXA 3RBBB 3L2RA 4RTWA 4FW2A 5IHIA 2JA5G 1PH9A 1TOVA 2XU8A 3I8ZA 1TS2A 4JI0L 1OX9A 4M75A 3QJ6A 1JJGA 4Y91A 2NUTB 4J5YA 3X25B 2O88A 1R4PB 2QF7A 4LJZC 4DBHA 3X24B 5FO9B 5AFWA 1VQMT 3T9NA 3OQ5A 1ZUKA 3PNWC 5GMKh 2MFIA 4LF6Q 4YHHQ 5CIUA 1VQPT 1PRTD 4RHRA 5BR8L 4O0AA 5I2MA 3HOUB 3F1ZA 2KQWA 3MP6A 4LDXA 2O2OA 3OYLA 2GA4B 5I6YA 4PJOE 1B50A 3MVVA 3BDCA 3L2WA 3G4SQ 4C2MH 4FT4A 4FYWB 1K8AU 1MNDA 1EL0A 4P2CB 3WVEB 1A0NB 1J9OA 3ULRB 2QA4Q 2NTSA 4YCWA 3ERSX 2A36A 2MP1A 3HEJA 4K0KL 2E4HA 1K8OA 3S1NH 8ATCB 2IX0A 2ZPFB 5M3FB 3EH2A 5IE8A 2TMPA 1BCPC 4BA2I 5L23A 1WD0A 3S16H 1C4QA 2A74C 2ZTDA 2QDBA 4A4FA 1VQIA 3D7SB 4JJDA 5GMKe 3T51B 4LMQD 1AP0A 2OWOA 3LGFA 1E7ZA 1PSFA 2RHQB 4WJWA 2RJEA 1Q81C 4C3IH 3J7ZC 2M02A 1QJOA 1BOSA 1YWOA 1OXXK 4RGMA 5CCAA 1HA5A 3TBIB 1Q82R 4ORZA 5KYWB 2L9HA 1NPPA 3RZDH 1IREB 3QPHA 2GFAA 1KNAA 4HIDA 3CBOA 2DD5A 4N0AC 2DL5A 3W3AA 1RL2A 3S2HH 1LT5D 2C5CA 2YXYA 2IWHA 2CQOA 1TUCA 4XU0A 3EG3A 1Y8PB 4M8AA 5DM73 1PFMA 2DGYA 1KK7A 5C44B 2NN6G 4GZYC 5JJZA 4GLMA 4L5QA 2K57A 5GAMd 3T56B 4DR3Q 1V8QA 1I94L 3M58A 4QVDA 5EKIA 3VR4A 3G71Q 3ONAB 1SDFA 3RLFA 2B3GA 2X3XD 2CUBA 4KGXB 4IALA 2HKQB 1QZHA 3W1GA 5CKEA 1WXUA 1M30A 3CC2Q 4OF1A 1M1GA 1OULA 4E47A 3HOXG 2N8NA 1W70A 1CA5A 1M2VA 1GUOA 2DXBA 2RA4A 4QIWE 1B1ZA 1S72Q 1X56A 1NNXA 5DY9A 2FZGB 3PCOB 3C94A 3OS5A 4A93H 1DM0B 5K5PA 3RMSA 2GQIA 1JMCA 1ZUUA 1PRTB 4HMJA 1M2VB 3EG9A 2Z4IA 4FSXA 2DZCA 3MCAB 2DLPA 4Z02A 1B07A 2L0AA 1FGBD 1EYGA 1E24A 2MI6A 4IKFA 3V96A 1TWFH 2OTLQ 4LUOA 2K52A 2YSQA 2KBNA 1BKBA 3EG9B 5HCKA 2F0TA 1VQ6Q 5IGGA 3J80L 1ZEQX 2IY5B 2A8VA 3ZEHA 4DR7Q 1NTGA 4JI2Q 5M5YH 4M78G 4M7DD 1UE7A 2SNSA 3SHWA 2K01A 2DPPB 1YZ6A 3OA6A 2HQXA 3A56A 3AB9A 5CBEE 3M57A 3RNUA 4A75A 2B86A 1GCPA 3EG1A 4FYYB 2D8HA 2ZZDA 2N49A 3HFZB 4KT0E 2MPMA 3U4VA 2RK1A 3TVTA 2A37A 3OOCA 2F0MA 2DO3A 3CCQT 2WACA 3CCSQ 1VQCA 4C1NI 1HR0L 2UUAQ 1WQWA 2DJZA 3K5LA 1U4PA 1MD2D 1U0LA 1YI2A 2BCOA 2JK8A 2LMCB 5JJIA 1IKMA 2A69D 3A8JE 4A3GG 1SNQA 2NVXB 2RHZA 4KD3A 5ELDA 4F04B 3D4RA 3FKIB 3OMGA 4C0DB 5IP9G 1WHKA 3VS1A 1F9SA 3OYJA 1T5XD 2DA9A 1KSWA 1ABOA 4M77F 2WB1E 1K3BC 1KAWA 1K8AR 3AMUA 1D2BA 5JOBA 1SMYC 1HJDA 1WXBA 3D0FA 4DFAA 3S24A 2RI5A 3DM3A 4JI4L 2DJFC 1FMWA 4POFA 4DV5Q 2YUQA 1N34L 1J3TA 2F1MA 1EY6A 1PTOB 1VQGA 1Y1VH 1HXDA 2Z4HA 1LV9A 2LNVA 2YDLA 3OYBA 2XDDA 1PH4A 4B6MA 1Y7XA 4JZ4A 1HZ9A 1W3SA 4GBQA 1HSQA 3GTGH 4A3EB 2F4VQ 1GCQA 4A4GA 2UXCQ 4FF2A 1VQNQ 1A62A 4RMFA 2X51A 4JI7L 5GAN7 1X2KA 3CMEA 1JT8A 5HY6A 4Y28E 1KDBA 1I6HH 1G91A 1YNJC 4N8FA 4X66L 1MSGA 4KMUC 1SE2A 4CDDC 2UU9Q 5DLOA 4JOIA 1B3AA 4MMLA 1C1AA 2AZVA 2CYZB 4A3KG 3S1QB 2EYWA 2VW9A 3P8BB 2R92G 2F0SA 1VQ4Q 4RA8A 3M55A 1I5OB 3RKWA 4X3TA 4LF9L 4XQQA 4L5TA 2HHHQ 2B29A 2GTJA 5IGFA 5CR2A 1GVPA 2PVOB 1U4MA 5GAMf 4A3DB 2K4YA 3KLWA 1AH9A 1ET6A 2JSOA 1YHBA 2XNAC 4A3FB 3CCVA 1JOOA 2ZGWA 4RUGA 1QVFS 4Q5VA 2KHJA 4NXML 2DIGA 4L6V5 1EWHA 1A6XA 1NG2A 3S3OA 4RGNA 2SDFA 5CYUA 1V1PB 4CDFC 2WKCA 1BU1A 1HD3A 5C4XG 1DZ1A 2KE9A 1UJYA 3EROA 3A7LA 1B7YB 3GTLB 1Y96A 5C3EH 1JCKB 2RCNA 1M1KU 4V2SA 1V1OA 3CCMQ 2R6GA 2R5AA 2F69A 2GNCA 2M1HA 3I56T 2Z6KC 2JVVA 3PTAA 2DD4A 3NHNA 1CSPA 3HKZG 5TSSA 4CGYB 1Y96B 5EBDA 1KIXA 2HKNA 3JAML 4V190 2R93H 2RJCA 2EYMA 4FXGC 1RLPC 2JT4A 3OS0A 4KK7A 4DV3L 5KYXA 4ZGJB 1VQ7T 1DJRD 3J7YW 1D1CA 2AHOB 2EJFC 4FDBA 3OW2P 4ESRA 2VUMB 2LXJA 4IPHA 5IHNA 1N36Q 4OELB 3GTMH 4C8QE 1WJRA 3S14B 1HQRD 2A6EC 2EGEA 1AEYA 3SXHA 5M3FH 3O5ZA 4GKJL 3M4OB 2VNUD 5LJ5j 4M7AF 1J6QA 1WHLA 2XD0A 4J9BA 3URGA 3FC3A 1QVPA 3G6EA 3CCEQ 2L5QA 1GM5A 4JZ3A 2Q2UA 1R0BG 2LFNA 4R8NA 2D5DA 2O4XA 1AZPA 4C5HA 1D5ZC 4H13C 4BA1I 4FXKC 2VV5A 1XMQL 3JCMP 3M54A 2EYQA 4J6HA 4PJOG 2FB7A 3OBYA 3KYHC 3NQTA 2LXKA 2PMZB 1TWBA 2WAQB 3I91A 2VXFA 2N55A 3BVZA 2O4XB 1KD1U 1Y8OB 4R56A 1UNSA 3T53B 2QXFA 2XDPA 4ZUIA 3GPLA 2JE6I 2JP1A 4ZLTF 5JVG3 2RH2A 4DV7L 5CAIA 1TUDA 4A3BG 2YU9B 5KYIA 2F0EA 4JI0Q 2F5KA 4L5GA 3VA7A 1UGPB 2EJGC 3C1EA 1NBEB 1CSKA 2R7ZB 1TH7A 3VDYA 4P75A 1CKBA 4A76A 3G4SA 1G2BA 2XK0A 1Y8NB 1PKTA 1Y57A 1IL2A 2G6FX 2QA4A 1KQSA 4ZKCB 4J83A 1X3EA 3GLXA 1DCZA 2N88A 2XWBB 3E3XA 1B9MA 2EY1A 3CC4Q 5BR8Q 1VQMQ 2G5DA 2RMOA 3ME9A 2QTVA 4ZAIA 1HYOA 3H91A 5T1GA 1KLGD 2WV6D 2HZYA 3NP8A 1VQPQ 3ULLA 1WTRA 4M75C 1IXDA 2B63B 2COYA 3GV6A 5GROA 3X3MA 1EYDA 4DUYQ 1TWHH 1LCKA 2YUNA 3DB3A 2WSFE 1ZLMA 4UPAA 2EQUA 4BBSG 1VYTA 1UE6A 3ZL7C 3L0OA 1IHWA 2DYBA 3RKYA 2CH4W 4EMKA 3TS2A 1M5Q1 1JJ2P 5C4JB 2HDAA 1EEID 1UECA 1MMGA 1U5KA 4XQJA 3M56A 3META 1BDOA 1G83A 4HJ8A 5DNFA 1I6VC 4J9EA 2FPFA 1M3CA 4EMKB 3QZ9B 3A8LB 5D6XA 4XTVA 5AT1B 1VQOT 4LD9K 1RODA 1KFZA 1U9RA 2R61A 4R9WA 2OQKA 5C3WA 4AQYL 1XNIA 1PXUA 1OU9A 2E2IB 1X6GA 3HOZB 4KHZA 2L8DA 3U23A 4CKEA 3A74A 3REBB 4M75E 3K8AA 5CQXA 1G8XA 3OYEA 1FGUA 2JA6G 5CKBA 3RKXA 2BKDN 2VASA 2F0JA 2F0IA 4HIKA 5GAGC 2JA7G 4C5GA 3G71A 1G291 3BG3A 3FEWX 4KJOA 2IIMA 3CCJT 4JRQA 2QDLA 3BW1A 4QQGA 2H3EB 1ZXTA 2D6FA 4NKLA 2KHSA 3CC2A 5ELNA 5I9OA 2NVXH 3VYTA 2HBPA 1D3BA 1SBBB 2QGFB 3JB9D 1FNWA 1S72A 1I94Q 1JB0E 1FR3A 3QJYA 4G4KA 3D8GA 1TIID 3JB9I 1NBWA 4L63B 1QNUA 1YNXA 2PNIA 3R6OA 4KV6A 3M5AA 2N78A 2A6HC 1D3BB 4A4EA 1CM9A 3PVLA 1ZA2B 4LFCL 2LQKA 2M0OA 1T0JA 2FHTA 1ZX6A 3H9NA 3WWVA 2BTTA 2OTLA 2ZXRA 3I90A 1R0CB 1N6AA 4LNQA 1VQ6A 1AN8A 4J9DA 4EIKA 4KLKA 5GANg 1AE2A 4A3EH 3CD6A 4LNPA 1M9SA 2RF0A 1MV0B 3R2TA 1AW7A 3V8KA 4FM4B 2PQEA 2JUFA 3KLSA 3N5BB 5EPKA 3OPOA 3HS0C 1ABQA 3CF5A 2CUDA 1YHAA 1KQ1A 1ZYRD 3EA6A 4BY7H 3UDFA 2EBPA 2LQWA 4FYXB 1JC7A 1MV3A 1PRTC 3PMIA 2KROA 1SNMA 3NPFA 1LJOA 3QOLA 2LTOA 2K5NA 1S5ED 2WSCE 2WB1G 1B2TA 1T0HA 2MCNA 1E2WA 3PO3B 1U4RA 3CCSA 3RUXA 4UHVA 3X28B 1VUBA 4IIOA 1A63A 2HIXA 1UE5A 4KI0A 4CC2A 2VXEA 3I35A 1K9MC 4C3IG 4C3HB 1R8OB 2E76C 1QVGP 4F88A 4WFN3 4QKUA 1O7ZA 3I72A 5GAN8 4DXGA 4OO1H 4XK8E 1TUGB 4AT1B 1G6ZA 1HA6A 3HFOA 3E9IA 2JTMA 4LFBL 1KG1A 2QILA 5FLXL 3VS5A 1UGVA 5FRNA 2PUKB 1KDAA 1FNVA 1S4ZA 1XJWB 3BY7A 1ESFA 1N8RR 5FLMH 3CCQQ 5D14A 5C5MA 1BXTA 3NMZC 2F0PA 3K80C 3TP8A 4J6WA 1EY8A 4HCZA 2IT1A 3ND9A 2O01E 1H9SA 3UDCA 2ATWA 5M5WB 2KA7A 1YCYA 3FJ5A 1CKAA 2K7AA 2RI3A 3TREA 5IGBA 3KJPA 4UC4A 1WHGA 4DQ2A 4M77B 1HR0W 2V8IA 3DEOA 1H9RA 3Q23A 1D5XC 1M4VA 1H9SB 4JI4Q 1VQNA 4R4CA 4UAIA 1N34Q 3OSVA 4NPSA 4DOVA 1STGA 3FIFA 2MO1A 3A5ZB 2M9VA 3I55T 1SYBA 2X35A 1HNZQ 1YP5A 2A0FB 2YTVA 2DILA 2CZ1B 3HOWB 1R4QB 2NZHA 1YJWQ 5EPJA 1VQ4A 4OMOA 1SEBD 4JRIA 3OW2S 3Q0AA 1PTOC 3L42A 5GAOm 4OVAA 1Y1WH 2ZXOA 4JI7Q 2P84A 1RAFB 3TS0A 1U3OA 4GKKQ 2MNAA 2ROTA 4A4IA 4A93G 2CVRA 2OCEA 4X66Q 2I07B 4CKBA 4OB1B 3CEYA 3VU3C 3HG9A 1RI9A 1UEAB 2A68D 3ZFJA 1YITQ 2AQ1B 2MMPA 1A2TA 1SNOA 2SOBA 2XMFA 2LY7A 2F2XA 2RHUA 3RZOH 3O8VA 1SNPA 4KKUA 1GCQC 1XTDA 2CFMA 1VQFA 2I0NA 4JI3L 2F0QA 3LH5A 1XNQL 3V7RA 3H3VH 4GOPA 5LJ5h 2YLCA 5FJ8H 2KVMA 2LT1A 4C8QG 4A3MB 3CCMA 3HKSA 4NXMQ 2JOYA 4JI2L 2X4JA 3LYIA 4HCKA 1YIJT 1XJVA 4B9XA 3RLOA 2M16A 4F7UE 4JOIC 2DNEA 3DWQA 3GQBA 3OW7A 4DK1A 3S1MB 3CRKC 4GOPB 4E7KA 1H3ZA 4PJJA 5C4XH 1AOJA 1O78A 5DM63 3TCJA 1M27C 1JR0D 3CAMA 5KEEA 4DR1L 1VA7A 5GAOn 1IZ6A 3M53A 1G5VA 1LABA 3O13A 5HGTA 4CRIA 3K57A 3PO2B 3OSOA 1IHZA 1AWXA 3OYDA 2A6ED 1TS3A 4B3RL 1KNEA 2FVUA 3I56Q 1XOVA 3HRUA 1MJCA 1LO5D 2RK2A 4ZQ3A 5FWCA 2AQ2B 4DV3Q 2ZPHB 4IFDI 1NLPC 4LE9A 5LJ5e 1Q8KA 2CKZB 2L4NA 2XGTA 5ELCA 3AYHB 1H8KA 2I46A 3CCEA 1M8MA 1QB5D 1WD1A 2B2VA 1WZOA 4PJNA 5FU7B 4M7AA 3DMUA 4RKUE 1RADB 1W1FA 2KENA 3UPUA 5D3DA 3EAEA 3V7SA 2YTYA 3K58A 2GN5A 1HUNA 2ZPGB 1OU8A 1G2SA 1TQOA 4K14A 1Y1VG 3TP6A 3OWEB 2PVDB 2HSEB 3S1RH 1Y69U 4M7AB 5D7UA 1ICWA 2EDGA 1YNND 1TWCB 4RTVA 3CQZB 4OGCA 3JCMd 1I50B 3IRBA 2UXBL 2PO4A 5LMNW 1CFMA 2FMCA 1QLYA 3BDLA 4M7DE 1GL5A 4RKBA 1BCOA 3S17B 1JOQA 4KN4C 3CCUT 1PG5B 1XMQQ 4OP0A 3HP9A 4Z9CB 4DXFA 4FF1A 4PK4A 1STNA 2NVQB 4OHJA 5IHKA 2DRKA 2DMOA 2I5HA 2PZ1A 5I2SA 2P0PA 2RHSB 3OYFA 5C4ZA 1YJNT 2PPBC 1B34A 1X3GA 1U1TA 2DJQA 1UEBA 3I5SA 2W0ZA 4FYVB 4BI3A 1EUJA 2B2YA 4DV7Q 4ZCKA 5GAOq 3CC4A 3OIQA 4DV4L 2E70A 1PWTA 1VQMA 1VQ8Q 2FRYA 3GTOB 1B34B 3W2DA 1HFNA 2P4TA 2XHCA 3Q6SA 1SHGA 1VQPA 1UWVA 2JTFA 2K2MA 4A3JB 3L3OC 2F3WA 3LX7A 1SE3A 3ND8A 4YWMA 1BUVT 4HSPA 3X20B 3EFOA 2DEQA 4LUEA 4N9TA 1VF5C 4RG1A 4QCLA 1EIGA 2DNUA 5C3EG 1WA7A 1TWGH 4M75G 2EYFA 3EFOB 2HUGA 4PFPA 3TQ7P 4QJFA 3MHXA 2EY2A 2E3HA 2K5HA 5IH2A 2J05A 3NPPA 1YN8A 2HDMA 3WVDB 5K36H 2F0WA 2R93G 9ATCB 3PF5A 1QVFA 2L3SA 1AWJA 2PMZE 2GCXA 2E5LL 1UGRB 5C0XH 1PZKD 2XKOC 4EVOA 5EKKA 3PE0A 1GXIE 5CV5A 4NXNL 4J6YA 3QXEB 3RR6A 2GVBA 2CP3A 2MIOA 4X9CA 3H09A 1OX8A 4GNXA 3JCMQ 3LWUA 5M3FG 2BE7D 4OIKA 4G7HC 1X55A 4KUIA 1DOLA 2Z6BA 4AQYQ 4DA4A 3GTKB 1LLRD 1QUQA 5HKCA 3JAMc 1B3QA 1HCZA 1HNWL 4QUCA 1VQOQ 4XQNA 4GNXB 3J7AF 3DEPA 1Y07A 1GFDA 3X3NA 3GDEA 2Y0SB 4C3HH 4EMKC 2JTEA 1QUQB 2JW4A 3NUCA 4OONA 4B08A 2AKWB 1ZA1B 3MXNA 4RMOA 2OAUA 3KFVA 2ENBA 3EFRA 4FF3A 2NUPA 2RB6A 3M0QA 1K73U 2E2JH 1QVGS 5E4XA 1MSHA 4E6RA 3I3CA 2IHFA 3MHBA 3MXNB 3VYSA 2EYZA 1H641 2NUPB 3VUBA 2JMCA 3M9QA 2LCSA 4X3SA 1QP3A 2L3RA 3IKJA 5M5WH 4ME5A 5IAYA 1N8RC 1E1TA 3HSBA 3UT1A 1W2BP 4HIMA 2MWPA 5ELOA 4R0KA 1WJQA 5A2QE 2ZPBB 1OYXA 1UGSB 1VQDA 4D6WA 4BBRB 5HK0A 2JQOA 2NVYB 1ENAA 4LFCQ 3DWPA 3C46A 3I4NB 4OMPA 1HZAA 1WTVA 3PF4A 1K0XA 4DU9A 1SG5A 4A3IB 4HMIA 3JB9H 2JXMB 4VUBA 4MN3A 1L2FA 3H0GB 2RKSA 3KBGA 1BBXC 2QGGA 4MDWA 1UAPA 4WJ3M 3NELA 3BS1A 2A28A 3U58A 1FMKA 4AYBB 2QTXA 2BOSA 3GTPH 1YNZA 2LZ6B 2V26A 3NFCA 1MI2A 1FYNA 3KUPA 3NSWA 1WTHA 5COYA 2NWMA 4BE1A 3HOVH 4HCCA 4DUYL 4OB2B 3EH1A 4WJ4A 3C95A 3F8TA 2HEQA 1NJIR 4HJ5A 1B7TA 2D0NA 4KGZB 4E7JA 2KJXA 3DHQA 4DK6C 5IYCH 5EKLA 1BF4A 2DYIA 4LF5Q 3SWNA 3UATA 1XXGA 1O7LA 4PJMA 2B8AA 2L89A 3VYGA 4XTCS 1WHMA 1AZEA 3QOJA 3J81i 4C3JB 1OTCA 2IG0A 3CCQA 2I5LX 1EEFD 3VYHB 1UHFA 5KYWA 3OS2A 1CQVA 1ET9A 3CP0A 4O6JA 5J26A 4IPDA 4X6AH 3SWNB 1HXYD 1H9MA 4R4QA 5IP7H 4LDWA 2AK5A 2QEJC 5GAN3 4FT2A 4MMKA 4J1MA 3VUZA 4MTKA 1I4XA 1PH6A 4LFBQ 1VDZA 1EFID 2M00A 4QB4A 3OYCA 3S1MH 4C92F 3F70A 4ZUJA 1EQRA 2DVJA 4IIMA 3JCMV 3L2QA 4GLVB 4A3LH 2L0CA 5GAN6 2HCIA 3T1HQ 2KNBB 4LK1C 3H0HA 3CCRA 1PMRA 3J81j 3PV0A 3UDIA 2L5TA 3PT9A 5CO7A 5GAOl 3CCLT 3CRLC 4FF4A 3PO2H 3GD7A 4TQUS 5M3MB 1M4ZA 4BY1B 2GF7A 1YJWA 3J81E 5EJWA 4XTXA 3KK7A 2XIWA 1GOZA 4R4IA 3V8JA 2NZOA 1PTOD 3J7AV 2DAQA 4PZ6A 3AU7A 3KFUA 4ABNA 4PJOF 2RI2A 2PZWA 4H0LC 5EBCA 3JCMg 4BD3A 1NMFA 3QKJA 1STEA 4J15A 1G3TA 4F7UG 1YITA 4A3CH 1SYCA 2WKDA 5KNBA 2J6KA 1NUCA 4BDYA 2X6LA 1I1JA 1JJCB 2J7ZA 4PFOA 2JA5B 1OPLA 3DKMA 1BQQT 3CKIB 1WTWA 4QUFA 5A0LA 2Z8LA 8AT1B 5GAMj 1CK1A 4EQ5A 1SSFA 4JBWA 4N8X1 4NP5A 3GTJH 4GN5A 4A3EG 2X6GA 2AHJB 1QKXA 2F0FA 1YJ9T 5EQ0A 3QB3A 2JA8B 4CHTB 4JLIA 3HFNA 2R3ZA 2NVQH 4BY7G 2KYBA 4E2FB 1CA6A 5CR3A 1WPYA 3RDVA 3GTQB 2K03A 1WFWA 4JS4A 2L15A 2E64A 2JS2A 3CC7T 3T4AC 4JI3Q 1XNQQ 1M90R 1SN8A 3OYGA 3N52A 2BDNA 4HT8A 3MJXA 3HP3A 1KC8U 1MKHA 4A4KA 4OX9L 2P0KA 4I7ZC 1ZYRC 5I21A 3I56A 4DGZA 1JXOA 1KL9A 2NYZD 4OO1G 1YIJQ 2EXDA 4FYDA 3M0SA 4DR1Q 2DXUA 2NLUA 1D8LA 2ICEC 2PI2A 4QQ6A 4M7DG 2IPKD 4QY7A 1LTGD 4GOPC 2BZXA 4IURA 2FFKB 4APVA 5FLMG 2SNMA 1OXSC 3G7ZA 1FWZA 2XTIA 5FRMA 2JS0A 3A7AB 4B3RQ 1L0XB 2LKVA 1NYFA 1QQJA 2KK4A 3M0TA 3A55A 3S15B 4O2DA 2RQRA 4KULA 5A0DA 3RN5A 2EOTA 4XTUA 2E3IA 2DZ9A 4CJ0B 3M3YH 4RG8A 1GHKA 1AWOA 2XN9C 3NBHA 4ODGA 4JG2A 5E7NA 4IJLA 5LHY1 5CV7A 2Q8IB 2PVGB 2BDOA 3WOEA 4DR5Q 1AWWA 1N33L 1PC0A 4B3SL 2DERA 1IYJB 1SLJA 4Q0FA 1K8GA 1JE4A 4IFDH 1TWAH 2AWNA 3EGXA 1NY4A 2KXDA 2WSEE 1T3LA 5LJ3d 5GAN5 1WFQA 4XT3B 5JPNC 3NBHB 4B3ML 4DV2Q 1WQ7A 7AT1B 2VUMG 5FU7C 1Q90A 3TMEA 5EC7A 3DM1A 5L8RE 2M51A 5IGEA 1HNZL 1JICA 1IW7D 2B39A 2UXBQ 2A3LA 4FU6A 1HQMC 2MWOA 2ZJRA 3EGXB 3P75A 1X3QA 3FP9A 4BI4A 2ZT9C 2F1LA 3K7AB 1Y1WG 1I4QA 4DV0Q 2DTIA 4M7AC 1HTPA 1Q86U 1VQ8A 2XRSD 2XI9A 3FDRA 2XWJB 2VB2X 2B8FA 3QZ5B 2YUOA 5CKFA 4GKKL 3CCUQ 4PG3A 2MOXA 2HD3A 3EJIA 5D65A 1K3RA 5GANd 1SYDA 2P5ZX 2F2VA 1SR3A 3HOXB 1DJ7B 2YHTA 3G7LA 1YJNQ 1XPRA 1MJEA 4DV4Q 3RN2A 2F0KA 1QWEA 1M3BA 4G7OC 1V1PA 1NE8A 4JLGA 3OW2A 5FJ8G 3DWAA 1EQTA 4KD4A 1WDXA 2A68C 2RQVA 3PMTA 3GP7A 5IT9L 4XTZA 1Q12A 1KAAA 3MEVA 1F2ZA 3QDFA 2QEXT 1TY2A 4NL2A 1ZBJA 1OZ2A 4HIOA 2B2YC 4BBRH 2F4IA 1GUTA 2NVYH 5FK9C 2DL4A 1RDPD 1W2BS 5IYBH 1XMOL 1G2TA 4QVZA 3C0CA 3J81c 1RKNA 1E6HA 1KQ2A 3CMAT 3HOUH 3LWIA 2LQ8A 1B4OA 3VKIA 4YCUA 2E5LQ 2YLBA 4JI1L 1N5ZA 3SR1A 2RHXA 2KEEA 3I4MB 1N32L 2BZYA 2PUOB 1VQOA 1TR5A 4X9DA 2PNHA 4LAAA 4NXNQ 3EN2A 2HL3A 1HRJA 1JE5A 1PH1A 1B9NA 4J8QA 3OWFA 1XQHA 5EG2A 1N9SA 4A3GB 3FRPB 3MEUA 1I07A 1EYCA 3KLSX 1IYVA 1HJPA 1HNWQ 3TQYA 1CZWA 1KRTA 3PSIA 4C3JH 2KRSA 4C92D 1NJIC 2OXPA 3MA2B 1KC8R 4BXXH 1P16A 2LCCA 1J5EL 4AH6A 4ZK9B 2R7DA 4ZRZA 2O9SA 3I4OA 2SEMA 1J8IA 2Z9HA 2HQEA 1Q8IA 1YI2T 3Q1JA 3P20A 2K50A 1TTHB 2EIFA 2BE5D 2MQHA 5CBAE 4GNXC 1WTXA 4DR4L 4POGA 2KBTA 4KH1B 2CZ0B 1YNNC 2B2TA 1IHVA 4E7ZA 1I4K1 3ER0A 1Z7TA 2KDSA 4HA8A 4KHPL 1RACB 3D3RA 2KECA 1GJXA 1RAHB 1L1OA 1Q82C 1RAGB 3EVQA 2VUBA 3NBIA 4G7ZC 5KNCA 4X34A 2DFUA 4PMBA 3EGDA 2PNRC 2CQAA 2A7YA 1FJGQ 4ELYC 1L1OB 4EQOA 5C44H 2QCPX 5JJLA 3M7GA 4A3KB 5IGDA 3M4YA 5CKDA 3I5RA 2AT1B 1RHPA 3EGDB 1HHVA 1EWIA 3T13A 1QZGA 1JO8A 1LNXA 5JEAJ 1HK9A 4ATOA 4ME3A 4IN3A 1K83B 1VQKT 3B6YA 2EY5A 3CU7A 4C0ZA 2QK0A 3CMET 2K1BA 2H5XA 1VQJA 4NDXA 3UWNA 4C8QF 1RAAB 1PH8A 1SRLA 1WCMB 2A08A 1EQVA 2Y0SE 4DNRB 3SFMA 3MO8A 3NHHA 3PUYA 2G9DA 4Y7NB 1NLOC 2YT6A 1Q7YU 3PMFA 1Q86R 4RCOA 5GANf 2OEOA 3PUVA 5K36G 3BE3A 2EJ9A 2XSCA 5CV4A 2FXQA 1BIBA 3CPWP 1A3TA 4BUGA 2HIVA 2UUBL 5C5LA 4CJ1B 5C0XG 2L1BA 5CORA 4HSVA 4X65L 3E9GA 2F0OA 2EKOA 2OI3A 2D1XA 4QMGA 2LMJA 1SJED 4P74A 1VQEA 3HKZB 2AKKA 4RTYA 3A8GB 4DEXA 4PV1C 4Y52H 3CCVT 3RUZA 2KR3A 4GS3A 2JMAA 5GQOA 3I7FA 3GO5A 1GUGA 4GY5A 4OWXB 1EOVA 1D7QA 2K6DA 4C92A 2MK5A 3S2DB 5GAOr 3TP7A 2TSSA 4UP8A 5GAMh 2CHBD 2DL8A 4C0FA 3E9HA 4XAXB 4C3HG 1EX4A 1M90C 3NEMA 4KHVA 2Q8TA 5A35A 4C92B 3SWNC 1SE4A 4LDYA 4RCBA 2SEBD 4LDUA 3ZJYC 2ASBA 4OB0B 5C6AA 4PJLA 3MTSA 2LSSA 2LJ3A 4YCVA 1WOCA 4Z88A 4DBRA 4P71A 2B2UA 1M1KR 2Z1CA 4M77D 5CV6A 4AYBE 4PL6A 1XTCD 1S40A 2QGQA 3IAYA 5GMKm 4XYQA 2D2CC 1TXQA 3CCLQ 1CHQD 2GGRA 3FKIH 3S15H 4AMCA 1F2MA 3RIRA 1ZSZA 2RQTA 4ZTJA 2MUYA 5LJ3g 1VMPA 2H4OA 4CBVA 3QWYA 1VQLT 2NBFA 4G57A 2K28A 5GAMe 3NXWA 2RM4A 2ZJPA 3UI2A 1YFNA 4NL3A 3Q24A 4LWCA 1GUWA 4J8OA 2K6AA 4L8JA 2COWA 1ZSZB 3BJUA 1RCVD 1Q81U 2RVLA 3M4PA 1CUKA 1Q46A 3R3OA 3FJPA 1Q1EA 1MMDA 2KMTA 5A0GA 4D8DA 4K11A 3JB9G 1QVGA 2Z0SA 4F7XA 1XNRL 1U1SA 1PTOH 2CS7A 5KH6A 1N9RA 1VQ9T 2D9TA 1K8AC 2V4DA 4R4TA 4IUPA 2ZM6L 3OYIA 4A3BB 5E3FA 2UUCL 1QMCA 2BE9B 2X3WD 4E7LA 1MGSA 4RWSC 2BIVA 1FXXA 2LRQA 3K7AH 4K8JA 3I9QA 1LTTD 4LUVA 3L9AX 3QWNA 3K5NA 2LX7A 3HOVG 1LT4D 1XPUA 4J9CA 2HCKA 5IOCA 1BNZA 4JBJA 2KVQG 1YIJA 4K6DA 5IYCG 4DKAC 3H0FA 3FRNA 3S1QH 3UA7A 1O80A 4M75F 5G3LF 2IX1A 1KD1R 4LF5L 3CC7Q 1PYBA 1VOMA 2GQVA 4HCSA 2C0TA 4OX9Q 3TSZA 5CKHA 3I4LA 3FHWA 2F03A 1XYIA 3U4ZA 2ZCFB 4KN7C 1PZID 1H9KA 1NCVA 3BVGA 4YIJA 4JRKA 4PNOA 1XPOA 4A3DH 4J7IA 5IP7G 4BBSB 2V1QA 4RTTA 4DN4M 1OQKA 4A3FH 2NTTA 1S5DD 1OXVA 3C2PA 4OGEA 5JAVA 2LJ1A 3JC66 4OMLA 2E1HA 2BH8A 1SRUA 2EQJA 2P4RA 2CP7A 4F87A 4DAVA 4N4GA 3HZXA 5KYLA 4J7FA 4A3LG 2R7FA 3GTLH 5I2XA 4M77A 3SD4A 3T1HL 3BFMA 1IGQA 4FL6A 3PO2G 1SROA 1O9SA 5HURA 3JAMi 3A0JA 5BN4A 4JV5Q 4YWLA 4C0GA 3OYHA 2F3VA 1N9WA 1IL8A 2ECZA 5L37A 5KYYA 2NVTB 3HTRA 4HVUA 1N33Q 4B3SQ 1TS4A 4C0DC 3QO3A 3MWYW 3KOJA 2XIDA 2JA6B 3I4MH 4M7AD 2KCNA 1C8CA 1LTSD 2LNHB 2JA7B 1PHJA 3H41A 5FROA 5C0XJ 4B3MQ 5JEAH 3UE1A 2CP5A 5KYYB 5LL6X 2VUMH 2VQEL 5LJ5g 2FL7A 4WRDA 2K5WA 4ZGDB 4MZTA 1PCXA 3NENA 4A3CG 1QW1A 2OTJT 3IL8A 3IQLA 1QCFA 3S14H 3W5OA 5J22A 3H94A 5T1IA 3M4OH 4E6IA 4H44C 2BUDA 3FLGA 2OF1A 1PV4A 2LC4A 1VF7A 1HPCA 1IB8A 2RHYA 4YTLA 2LVMA 3ASKA 1P8LA 3K59A 1I4RA 2FHDA 1S3OA 4TRDA 1S5CD 2CWAA 3JAME 1ILPA 2KY9A 4HVWA 4Q5WA 2DY8A 5AYFA 3NGPA 3VYRA 1VYUA 1GO3E 1L0YB 1X6OA 4DBQA 1B53A 1ENFA 3IFTA 2DTOA 5FKAC 1RF2D 2G9HD 4RGTA 4PLIA 2PI2E 1H92A 3JRZA 2G3RA 2CSIA 2PW7A 2ZPEB 3HOZG 5I6WA 4O42A 3EFSA 5I2YA 3E19A 2CCZA 4C2MB 2EYXA 4BE2A 1LUZA 2VQFL 1CQFA 5JPMC 2YU9H 5ELFA 1F9RA 2CT3A 1A2UA 1UHCA 2EGCA 4K2KA 3BU2A 4RCNA 4J9HA 4JI8Q 2R7ZH 2K4KA 1EZZB 2ES2A 3S1NB 2OX7A 2OTLT 1A15A 2HBWA 4C8QD 1AE3A 2WB1B 1K1ZA 2FRWA 3GNGA 2QEXQ 1Q81R 1O7YA 3J80c 1XMOQ 1C0AA 1G51A 3S16B 3IFDA 4UY8C 3TZDA 3UE0A 3VV0A 3CD6T 2FMMA 3JB9J 2PQWA 3FB9A 3MEWA 2IW3A 3C12A 2K2VA 4C3IB 2WINB 5HGQA 2E74C 1D1BA 4JI1Q 2MJ8A 1VCIA 4IZ8A 2HL5C 4HCBA 1A3VA 1II3A 1N32Q 1WCMH 1XX8A 2JJ9A 2W10A 3CMAQ 1SNCA 2EJMA 1X3FA 2B63H 4MZMA 1G3WA 3VS0A 1EY9A 3I70A 1YCSB 5I22A 3EHQA 1TT2A 1KLUD 1VQ7Q 4DR5L 3G48A 1PH7A 4IFDG 3S2HB 1FD7D 1H9JA 1L0WA 3HL8A 1D0YA 4EQPA 1QVCA 3E0EA 5C4JH 3J7A5 4DV2L 3INZA 3CPWS 1STAA 1Q1BA 1SMXA 4XIGS 1CHPD 5E4WC 1J5EQ 2DL7A 4DK3C 1NPRA 2F0HA 4L5SA 1BYMA 2KOLA 3PIO3 2LX9A 4DV6L 4Z8AA 1NR4A 3A1PA 1JJ2S 5NUCA 3MAQA 5GAOp 4JVZA 3EGUA 2C35B 4DV0L 1RI0A 2GFUA 2E2IH 2K3XA 3HOZH 3VRZA 4DR4Q 5C4HA 3L1AA 6AT1B 3URYA 2VS1A 2Y0SG 3BYTB 3KLRA 4KHPQ 4CC7A 4F7UF 3CXCP 1UDLA 3LH0A 3M4GA 3OMCA 4OMFB 1IW7C 2VKNA 1AEXA 1NE3A 1D0XA 2F0GA 2YV5A 3V05A 3OY9A 5CQYA 3ULJA 2GTOA 1Y0MA 2HNIA 1KXLA 1VQNT 1B8AA 4A93B 3PUXA 3GIBA 1C0MA 2E6ZA 1OPKA 4NW2A 5E1FA 5GADC 3PUZA 1B44D 4BB7A 2DF6A 1Z9FA 1M1KC 2F0DA 1AVZC 1EOTA 4GLKA 3HOYB 5BN3A 4JYAL 2RHIA 4C8QA 3M0PA 1L1OC 2X4WA 3NE5B 2YRVA 1VQ4T 1W6KA 4BBRG 3U9SA 1V1CA 5IYBG 2ZPIB 2QW7A 1WVLA 5M5YB 1SF9A 1VQKQ 4M78F 4C8QB 4ANJA 3P8DA 2DE0X 2I2LA 4IUVA 3FVQA 1BI3A 4JI5L 1D1IA 4DAPA 4PMCA 5FO7B 3SHLA 4MIUA 3EBEA 5JVH3 3HOUG 1E7OA 4AYBG 2EQKA 1MIUA 2UUBQ 2QQBA 2WAQE 1LTAD 4X65Q 2JNGA 4AG1C 4M7DF 3ITPA 1PLFA 4K5WA
chains in the Genus database with same CATH topology
4TVRA 1I5FA 5GMKl 1W2BA 3AHUA 1M8VA 2CGHA 3PO3H 2MF2A 4ALPA 4GN4B 4BXXG 1BVSA 3CCLA 1KD1C 4KUDK 4BY6B 1NMGA 3JCMb 3JCMW 4C92C 4E7HA 3DLLA 2KCMA 4LFAL 3AQQA 2ID0A 1JBMA 4BI8B 1VQ5T 3CCET 2JJQA 1NZ9A 4TVAB 2E6NA 3GOXA 2PU9B 4QW2A 1I8FA 4BY1G 1GKHA 1G3SA 5C44G 1TXYA 1FJGL 2CWPA 2VGNA 1G6PA 1YBYA 1IBLL 4K0KL 1XNRQ 1PA6A 4JI6L 4IFDJ 4B3TL 3JCMf 5FLXE 4RG2A 2ZM6Q 1C7YA 2UUCQ 3SB2A 3A8OB 3HOWH 1IXRA 4RCCA 3CC7A 5IYDG 4OB3B 3HHTB 4C92E 1IBMQ 5CVIA 2A19A 3QHSA 2JZ2A 3KF8B 2K14A 4EMGA 3M59A 3OB9A 3CC4T 2JA8G 3A8MB 4HJ9A 4M75B 5JJKA 4X64L 5C6SA 4XQ3A 4HJ7A 5D6YA 2UXDL 4YWKA 3M85A 1ZBXA 1BBUA 3QG1A 4MZ9A 4JBMA 3CW2C 3M7NA 3CPFA 1A8VA 4A3MH 3F2CA 1IBKL 4DPGA 1E3PA 3QDRB 2EFIA 4LW1A 3JCMc 3JSCA 4PZ7A 3SGIA 1WJJA 3L7ZC 1PH5A 3FKIG 4JC0A 4DAYB 3AFPA 1YHQT 2K5FA 2DXCA 3TRZA 2VGMA 3D31A 3GNFB 3S3NA 2VQEQ 3AFQA 3JCMX 4M77C 3OYMA 1K9MU 4CI0C 4C5IA 2NN6I 4J6XA 5LMUQ 1VIFA 4R1JA 3KDFA 1Y14B 1TWCH 2Q2HA 1V1QA 3CQZH 3E9FA 4DR2L 1I50H 3RESA 2RA2A 4IOCA 1VQHA 4ZGEB 4JRPA 3KDFB 4GLAC 3STBC 2HD0A 3AEVA 3S17H 3M9BA 2QI2A 3NTHA 3QBYA 1PH3A 3A8HB 3M4QA 2E12A 3RMQA 1LYLA 4XU1A 2R5MA 2QEXA 1YVCA 2KCTA 3ICEA 2AWOA 4H02A 5AJ3L 3PIPA 4M77E 2VQFQ 2EWNA 1LM0A 4L5RC 1JB7A 3CXCS 3GTOH 4A3DG 2R57A 3MP1A 1RIPA 3V7CA 4A3FG 4JBKA 4A54A 4A3JH 3CMAA 2LT4A 5EAYA 4M78D 1PYSB 2QQRA 3HOYH 2DUDA 1VQ7A 5IWAL 3JCMh 4OO1I 2LDMA 4NOYA 1KHCA 3S3MA 5IN1A 4B9WA 4JV5L 1QP2A 2WFWA 4KBMB 3KF6A 4DR6Q 2EQMA 3OS1A 4JCVE 3HRSA 3KUFA 5FLXc 2F5TX 4ME7A 1EIFA 3I4MG 4HJAA 2E5QA 1DGSA 2IVWA 1BI0A 3KF6B 1VIEA 4HT9A 4N4HA 1ASYA 4DV6Q 4GN3B 3OTOL 2ALYB 4P5NA 3JCMe 3GTKH 4F7UA 4JJNK 4N4IA 1W4SA 4R4OA 3NTIA 5LJ3j 3CCRT 1BI1A 3UDGA 4F7UB 3ZBDA 1A0IA 3JB9F 4LF7Q 2WAQG 1YJWT 1CSQA 2X4YA 5GAHC 1UGQB 2V8JA 3LW5E 2VC8A 3HPWA 2E2HH 1O7IA 1VQKA 4JYAQ 5GANj 4DV1L 1YITT 4X62L 4A4HA 4M78A 1CKMA 1R9TH 3H3VI 2R7ZG 1VQBA 4JI8L 4M7AE 5KE2A 3I4NH 1WJSA 4A3IH 4M78B 4JI5Q 1SFOH 4BE0A 3H0GH 3LGJA 3T1YL 4M7DA 4IUUA 5LL6S 3SDZA 3LGLA 2KAFA 2K3YA 1WCMG 4C8QC 2B63G 2PQAA 3PGZA 3C4SA 2XDBA 4M7DB 2X4XA 1X75C 4ZN1A 2EAYA 5GAN2 2PQAB 2RJDA 3QYGB 1HZBA 2EQSA 4ZTFA 2R92H 5HK3A 3HRTA 3CCJA 5LJ5d 4XU3A 1X9NA 4QVCA 3HOZG 4QL5A 3QYHB 1T9HA 1C9OA 4ELZC 5LMNL 4C92G 1VQLA 1FL0A 2CKKA 1X54A 4BY6C 4LFAQ 4YY3Q 2OQ0A 4BDZA 3CPWA 1U8RA 4PJOD 2JEBI 4PMWA 5M3MH 1VQ9A 4BY1H 4LF4L 1JJ2A 4DUZL 5DLQE 5LJ3f 1IBLQ 4K0KQ 4JI6Q 1ZHIA 4XU2A 4B3TQ 4EMHA 4LF8Q 2K5LA 4R55A 3JCMJ 2HQLA 4NS5A 5GAMg 1VQ8T 5FU6B 1FVIA 2JA5H 5IYDH 1OXTA 4OXPA 5GAN4 3ULPA 5M9OA 4C5EA 4JDSA 1HNXL 1ZQ1A 3LLRA 4IO9A 2JA8H 3Q8DA 4X64Q 3J80i 5KE3A 1N8RU 4A53A 3L2VA 3GTQH 2UXDQ 1B70B 4MDXA 2Q2IA 3PO3G 5C0XI 3TEHB 1G3YA 4E7IA 1K73C 5KCHA 4XTYA 2P0QA 1IBKQ 3K81C 3H15A 4AIMA 2C06A 1P92A 4EDUA 3NTKA 4XTWA 2E65A 4LUZA 3J80E 1EIYB 4PJOA 3I55A 3E1SA 3OSSC 2D0PA 2OTJA 4IPCA 2I5MX 4DNIA 1X01A 4PJOB 4M77G 2DTHA 3PIOA 1CKNA 3STBD 4P73A 2N3SA 3RR5A 1CKOA 3G6ET 1FX7A 5LJ5f 1CKNB 4DR2Q 3MEFA 3HOWG 2QQAA 3L2PA 1WI5A 4QQBX 1IBML 3DB4A 3U50C 3KJOA 2ZJQA 1KHIA 4MNOA 3HOXH 1LTLA 3V8LA 4UP7A 5AJ3Q 2XG8D 3OBWA 4OWWB 4LF6L 1WGSA 3I2ZA 3RLNA 4YHHL 4WF2A 1X65A 3G4ST 1HZCA 4GLXA 4LDVA 2BH2A 1PVOA 2DKGA 2K75A 2V1CC 2QA4T 4A3MG 1UB4A 3EIVA 5LJ3h 2R58A 2CZ7B 5IWAQ 5GMKi 2Y4YA 3FEOA 4NB3A 3H8ZA 4N0AA 4EPCA 4LD6A 2F3IA 2QQ9A 2YYZA 4OWTB 2E10A 3CBPA 1K0RA 3S6WA 5GAEC 3QUIA 5GANh 5IT9E 3PUWA 4II1A 1HR0Q 2RJFA 4DOWA 5GMKj 3CCUA 3CBMA 2RF4A 5LJ3e 1E1OA 4A3GH 4MZPA 5LMUL 3OTOQ 1YJNA 3UDXA 5IP9H 2XICA 4M7AG 1UE1A 2A1AA 2ZTCA 2DVEA 4JS5A 1ASZA 1JRIA 4HKEA 1I3QH 3G71T 3LWHA 4DR3L 1KC8C 3CC2T 5GANe 3MP8A 1OZ3A 1KRSA 2Q2TA 1BIAA 2JN0A 1S72T 3OYYA 1V9PA 2D0OA 2M9UA 2MO0A 1E22A 2LCLA 3QSUA 4DV1Q 3F2BA 1YEZA 4X62Q 5J39A 3W1BA 2QDYB 2RO0A 1PSEA 4A3JG 2F52A 4A3KH 3HOYG 3BZCA 4FIBA 1VQ6T 4LF9Q 2JEAI 3GF5A 3RERA 2E8GA 2DK3A 2Y4XA 2Y90A 4BACA 3T1YQ 4PZ8A 1K83H 1V29B 4DR7L 3CXCA 4M78C 4Y7NH 1EQQA 3TEEA 4O5VA 4DR6L 3CCST 4IUQA 2DIQA 1VS0A 1Q86C 4M7DC 2UUAL 3TU4K 2HAXA 3L2UA 1Y71A 2FYKA 1BBWA 2K5IA 2KHIA 1BI2A 1VQAA 2D62A 1N27A 2BA1A 3S2DH 3PGGA 4EX5A 3K7UC 1VQ5A 5LMNQ 3BDUA 1WYDA 2YTXA 1WNLA 4IUTA 4M78E 2I0QA 4GKJQ 5C0MA 1EFWA 4DV5L 2D0QB 3X26B 5M5XH 4MTNA 4LF7L 2E41A 3OYNA 3BZKA 4LF4Q 5CK9A 2DXTA 4DUZQ 1PH2A 2F4VL 2VL6A 2UXCL 3WXMB 4PKCC 1AHJB 1GD7A 1NJIU 1KQSS 3K0XA 4IJHA 2UU9L 4DAMA 3I4NG 3GP8A 2IHEA 2VZAA 5J3BA 4A3IG 3F2DA 3H0GG 2HHHL 4A3BH 1LOJA 3L2ZA 5IT9c 1M1FA 2H3JA 2K5VA 2Z6KA 3QIIA 1HNXQ 2RD1A 3DLMA 4M75D 5FU6C 3OYKA 1Q82U 3MEAA 4P72A 1SE8A 2CZ6B 2ZTEA 1H95A 2BA0A 2QQSA 1Z47A 3OYAA 4QQDA 2EJFA 2AMCB 3CCMT 4QGUA 4IOAA 3PFSA 1V43A 2R92G 1MHNA 1PFSA 4L59A 1O75A 3A5UA 2WP8J 4IPGA 1HH2P 2HT1A 1OXUA 2JA9A 5KCOA 4BBSH 3H6ZA 2V8KA 4PLLA 3KXTA 2GVAA 3P8HA 1YHQA 5D6WA 1N36L 2MAMA 3VJPA 1MGQA 4YY3L 4JUVA 1OI1A 5M3MG 2VYTA 2NVTH 2KSSA 2EJGA 1I5LA 2JA6H 3HKZE 4UP9A 5DM7R 5H1SE 2JA7H 4LF8L 1YJ9A 4PJOC 2VY3A 1Q7YC 1I81A 4ZN3A 1M90U 5IY0A 3L2RA 2JA5G 1PH9A 2XU8A 4JI0L 4M75A 3QJ6A 1JJGA 4Y91A 4J5YA 3X25B 3X24B 1VQMT 3T9NA 3OQ5A 5GMKh 3PNWC 2MFIA 4LF6Q 4YHHQ 5CIUA 1VQPT 5BR8L