3A5ZB

Crystal structure of escherichia coli genx in complex with elongation factor p
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
134
Chain Sequence
TYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Putative lysyl-tRNA synthetase
total genus 17
structure length 134
sequence length 134
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01132 EFP Elongation factor P (EF-P) OB domain
B PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
B PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a5zB01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5zB02
2Q2UA 2VY3A 2DUDA 4P74A 4LFAQ 2IT1A 3GD7A 4GN3B 3I4NH 1E1TA 4P75A 1MIUA 1SRUA 3W1GA 4DPGA 3HOZG 2ZJRA 4LUZA 1KAWA 5BR8L 2JEBI 3HFZB 4DV2Q 4KLKA 3STBD 4A93H 3HOXH 4XTCS 4P73A 4PZ6A 4DR5Q 1Q8KA 3MEFA 1IBKL 2H5XA 1N8RU 3CMAT 1O7IA 1X9NA 1WOCA 4LF7Q 3CC2T 1QVGA 1TXYA 1KC8C 3S16H 4GLVB 3Q8DA 4YWMA 4ME3A 1A62A 3KDFA 3CCVT 3ULPA 3HOWH 4BXXG 3E0EA 4UP9A 2E5LL 3HOYH 2YTXA 3OYYA 1VQ5A 2R92H 4L5SA 3HOYG 4LF6L 4NXML 2OTJT 3M85A 3HOWG 1UWVA 4POFA 2NVTH 1Z9FA 3CCMT 1AE2A 4B3RL 1HJPA 4GN5A 4DV6Q 4AQYL 2PQAB 3UDGA 4KHPQ 2R93H 1GO3E 3OTOQ 1OXSC 5C4JH 1CUKA 2YTYA 1ASYA 5C4XG 1U5KA 4LF4Q 3GTKH 4R4IA 2I5HA 3HOXG 2BA0A 4JI2Q 1YITT 1K73C 1N9WA 4JG2A 3CW2C 4R4CA 3GTGH 1KIXA 1M1KU 5GAEC 4A3GH 2OTLT 3M7NA 3JAMc 1J5EL 4HIOA 1T9HA 4YCVA 3S15H 1VQ5T 1CKMA 1JE5A 3D31A 5JEAJ 4GNXC 4DR7L 4RG1A 4IFDJ 1SMXA 1HZBA 2HIXA 3RN5A 4UP7A 3NELA 5E7NA 1YJNA 3OTOL 2UXCL 3CCQA 1WFQA 1X3GA 2JA8G 1EOVA 1VQ9T 1VQ4T 1QVCA 4BBSG 3J81E 3HKSA 1EUJA 1BBWA 3UDXA 2WB1E 5IYCH 1Q82U 2OTLA 3UE1A 5C0XI 3M4OH 2N49A 1XNQQ 3PUXA 4X65L 3B6YA 4R4OA 3T1YQ 1PH7A 3AFPA 1I6HH 3CCJA 1PHJA 1JB7A 2LXJA 3GTPH 3LGLA 4YHHQ 2KCTA 1HNWQ 1G291 3CP0A 4DR2Q 2WP8J 4BA1I 2JA5G 1K8AC 3CD6A 1XMOL 1CSQA 5FLXE 1KL9A 1PV4A 2IHEA 2K52A 1WJJA 5LMNW 4NXNQ 4A75A 2VNUD 5A2QE 2A1AA 2KBNA 1CKNB 3S1MH 2CKZB 2AWOA 4ZN1A 2CFMA 3PUWA 4AYBE 4Y7NH 4JI0L 4LF8L 3UDFA 3KF8B 1NPPA 1GKHA 1VQMT 2NVYH 4LF4L 2F4VL 2N78A 5IYDH 4A3GG 1KD1U 5EAYA 3G71A 2YYZA 3PUYA 3CCMA 4OWWB 3CPWA 2G3RA 5IP7G 4DV5Q 2Y0SG 3K7UC 2ES2A 3CPWS 3CCUT 1YJWT 2HQLA 1VQOA 2E2IH 3GTQH 1NTGA 4J15A 2K4KA 1A8VA 5IAYA 1VQ8A 2RF4A 4L5RC 2NVQH 3FKIG 4GNXB 3J80E 3T1HL 4JI0Q 2PNHA 2ZTEA 4A3MG 1N33Q 1JJ2S 1Y1VH 1UE6A 5GROA 3RLOA 4YY3Q 5IYBH 4DV7Q 3A5UA 4DR4L 3PCOB 2IY5B 4Y52H 1K9MU 4HIKA 4DR1L 3CQZH 4X66L 3PGZA 1HNZQ 4EQ5A 3EN2A 1PH6A 5IP7H 3HOUH 1EIYB 4JBKA 4K0KL 4DR7Q 3MXNB 2E6ZA 3IRBA 4JI3Q 3P8BB 1Q46A 1XNIA 1QVGS 3ULJA 3UDIA 5GAHC 5GADC 4DV4L 4BY7H 3D0FA 1S3OA 2RHQB 2KCMA 4IO9A 4EX5A 2VZAA 1YIJA 3KF6A 3KJPA 1VQLA 2VS1A 2BH2A 3G6EA 1H95A 5IY0A 5IP9H 2EQSA 2N8NA 1PH3A 2D0PA 1Q86C 3U4VA 1IBLL 4LNQA 1PYBA 4POGA 4R4TA 2PI2E 2MQHA 4MNOA 2HIVA 4L5TA 4LFAL 4IPGA 1JT8A 3LGJA 1K83H 4JV5Q 4QQDA 2JK8A 3KJOA 2HT1A 2F3IA 2WFWA 3DB4A 3GTMH 3PO3H 2UUCL 3J81j 4LF9Q 3BU2A 3U50C 5IT9E 1UEBA 1VQHA 4X62Q 1IXRA 1N36Q 1SROA 5IYCG 1PH8A 1QZGA 4JV5L 1YI2A 4UPAA 3NEMA 1I50H 1KRTA 1X6OA 3NENA 1VQCA 3K8AA 2YV5A 4DV0Q 2UUAQ 5C3EG 3CMAA 1M90C 4JI8L 1VQIA 2LXKA 3BZKA 4ALPA 4LF5L 4DUYQ 2MO0A 4DR4Q 4A3EG 4JI1Q 4BBRH 3CCRA 4DV2L 4LF6Q 3K81C 4C3JH 4NXMQ 5IT9c 4GLXA 1K8GA 3CCST 2B63H 1HNWL 1VQNT 1Q81C 1N32L 1Y1WG 1DGSA 1TWGH 1W3SA 1YI2T 4LF7L 4WJ4A 2KHJA 3RR5A 2QGQA 4DUZQ 4X62L 3PUZA 3A5ZB 3G48A 2JA6H 1L1OC 2Q2IA 2N3SA 1TWAH 4DKAC 4OX9L 5C4XH 1TWHH 5M5XH 2MFIA 2JE6I 4UP8A 4IOAA 4JI5L 1X56A 2I5LX 1HR0Q 1TWCH 2ZTCA 2Y0SE 3EBEA 3KOJA 2R92G 3PO2H 4A3FH 1VQNA 1RIPA 2LSSA 4A3CH 1PVOA 1CKOA 2A8VA 2V1CC 1VQKA 1BKBA 1EWIA 3M4PA 4QJFA 4AYBG 1VQLT 3J80c 4A3JH 4B3SQ 3ICEA 4A3DG 2K50A 4JOIC 3ULLA 4DV3L 3TRZA 1B7YB 4YWLA 3CPFA 2OCEA 1A0IA 2PMZE 2E2HH 4A93G 5LL6S 4PG3A 3DLLA 1X54A 1NMGA 5M3FG 1IBML 4X6AH 1X55A 1XPRA 4H02A 1YVCA 4LW1A 4P71A 1VQOT 1M1GA 4DAYB 2MWOA 2PI2A 5FLMH 4DR1Q 3UE0A 3CC7T 1YEZA 4LUOA 4LF5Q 4A3LG 1L2FA 1GVPA 2GN5A 2KHIA 5FJ8H 2UXCQ 2YTVA 5JJKA 2JA7H 1K8AU 1KQSS 4TQUS 1PH9A 4DV1Q 2YU9H 4A76A 1KQSA 3HOVH 4JYAQ 3M3YH 2JEAI 4TVRA 2KVQG 1SE8A 1BVSA 4JI7L 1NY4A 4DV5L 1SFOH 2ID0A 3S1NH 3BJUA 4IFDG 3GO5A 2NZHA 4BY1G 1D7QA 4DUYL 3CXCS 2CQOA 3S1QH 5LMUL 1W2BA 4L5QA 3G4ST 2Q2TA 1UE7A 1XPOA 1VQAA 3K0XA 1N8RC 4QL5A 2D0OA 4KHZA 4GN4B 3CCUA 3S24A 3I56A 3BZCA 4A3KG 2K5HA 4B3RQ 2D62A 1VQ9A 1VQ7A 3I2ZA 1TWFH 1AH9A 4B3TQ 3PIPA 3I4OA 1EYGA 3GDEA 3CCVA 3KF6B 1U0LA 4JI3L 3RLFA 5M3MG 3ER0A 1WCMH 2IX0A 1GM5A 1Q7YU 2R7ZH 3J7A5 3CCJT 4LFCQ 3S1RH 4A4IA 1P8LA 1NZ9A 2RCNA 2HHHL 4WJ3M 5FLXc 1OXUA 2KDSA 1MJEA 3STBC 4DK6C 2CCZA 1QVFA 1KRSA 2NN6G 2JUFA 3F1ZA 1YHQT 4LFBL 1LM0A 3I56T 4HJAA 4JI4L 1KD1C 5JJIA 1OXTA 1YITA 1E7ZA 5IWAQ 4YHHL 1Y14B 3U4ZA 4GOPB 3I4MH 2E2JH 3CCSA 4JI6Q 3H3VI 4B3TL 4QIWE 4YTLA 5DLQE 3M4QA 1VQPT 4PMWA 1FVIA 3PV0A 4X64Q 1V43A 1QUQB 3CAMA 3E9IA 1PA6A 3H3VH 4ZN3A 2R7FA 4GKJL 4JI6L 3J7ZC 5C44G 4QQBX 2EXDA 2HHHQ 2ATWA 4DR6Q 1WYDA 2MWPA 2L3RA 2F52A 2JQOA 4GOPC 3GTJH 2F4VQ 4JOIA 2R6GA 4P72A 1C9OA 5FJ8G 4O0AA 2VUMG 3CC2A 3CXCA 4HJ8A 1FJGL 1WI5A 3FP9A 4GKJQ 1Q82C 4A3IH 1D8LA 4GKKL 2K5VA 1J6QA 3RNUA 2XGTA 2VL6A 2JJQA 1VQPA 2I0QA 1QUQA 1Z47A 2AMCB 5M3FH 2E5LQ 1M90U 4CRIA 4B3MQ 3AEVA 2AKWB 3PF5A 4DAMA 5IWAL 1OXXK 3S2DH 1B8AA 1IBLQ 4NB3A 3TREA 1S72A 1IBKQ 4A3JG 1IZ6A 4A3DH 2A19A 1LUZA 1VQ7T 3ERSX 1HZCA 1UE5A 5M5YH 2QEXA 2ZJPA 4GNXA 1YHBA 3KDFB 1HNXL 1YIJT 1SSFA 1M1KC 2NVXH 1I94L 1B70B 1K73U 4YCUA 3A0JA 1FJGQ 2GVBA 4IOCA 2IX1A 4JBMA 1V9PA 1UE1A 3K80C 1FGUA 3DB3A 1XNQL 1VQJA 2NN6I 5ELOA 4NPSA 1VS0A 2IG0A 4A3BG 2RHSB 3JC66 4X64L 5AJ3L 3ZJYC 4OO1G 4JBJA 3KLWA 1E24A 1JMCA 2Z6KA 3TEHB 4AH6A 4A3BH 4PZ8A 4A3EH 1HR0L 1IBMQ 2E70A 3G4SA 3PUVA 1K9MC 1XMQQ 2ZJQA 3W5OA 5LMUQ 3H0GG 2ZM6L 2ASBA 3FHWA 1HNXQ 2VQFQ 1XNRQ 1J5EQ 2K14A 1NE3A 1VQDA 1VQEA 2VQEL 3U58A 4B3SL 3S17H 4DR2L 1ASZA 5M5WH 1XMQL 1EFWA 4A3CG 1N34L 1YBYA 4JYAL 3VDYA 5ELNA 3CMET 1G51A 1Q81U 1HNZL 1VCIA 3G6ET 3I55T 2UUBL 4JI1L 1Q1EA 1GD7A 3EIVA 4C3HH 3CCQT 3H15A 1RL2A 2CKKA 1X65A 1VQ8T 1Q7YC 1OXVA 5LMNQ 4MZ9A 4DR3Q 3S2HH 1C7YA 1HZAA 3WWVA 5H1SE 2KENA 3OW2S 2E8GA 5FLMG 4DV1L 4A3IG 1S40A 1VQ6T 3J81i 1CKNA 2CWPA 1R9TH 4JI4Q 2VUMH 3AFQA 4JBWA 4IPCA 2UUCQ 2VQFL 2QA4A 1PFSA 3DM3A 4R1JA 3W1BA 4JI7Q 3CD6T 3I55A 1XNRL 3JAMi 3CCET 3KBGA 1LYLA 1PYSB 1JJCB 1SLJA 3T1HQ 3HOUG 4AIMA 3TS0A 2DO3A 3GTOH 1NJIU 1PH5A 5J26A 2Z0SA 5DM7R 2MNAA 2OQKA 3RN2A 2LQ8A 1YHAA 1LTLA 2IHFA 2I5MX 1Y1VG 4LUVA 2ZTDA 4XIGS 4R4QA 5IYBG 3L2PA 4AQYQ 4A3MH 3PF4A 4KHPL 1KXLA 4DV3Q 3FKIH 3PO2G 1NPRA 4OXPA 3RZOH 3F8TA 1XTDA 2NZOA 4QY7A 4JC0A 4GOPA 4O2DA 4RG2A 1HH2P 3HKZE 1KC8U 3H0GH 2WAQE 4DR3L 1YJ9A 2WB1G 3KFUA 4C3IH 4LF9L 1PH4A 4MTNA 1HZ9A 2JA6G 1MKHA 4X66Q 1I94Q 3RLNA 4DR5L 5GQOA 2B29A 4C2MH 4DV7L 1W2BS 1WCMG 2UUBQ 1EQRA 1SN8A 1V1QA 2ZM6Q 1IYJB 3L0OA 1IL2A 2R7ZG 4JI8Q 5IE8A 3I7FA 4DV4Q 2B63G 3CMEA 4BBRG 4X34A 4K0KQ 1KHIA 3CCLA 3J80i 1E22A 4A3KH 2CWAA 2UXDQ 5HY6A 2JNGA 2PQAA 4IPHA 5C3EH 2JA5H 2JOYA 3CCRT 1I3QH 4UY8C 4HJ5A 1E1OA 4GKKQ 4HJ9A 3GTLH 5C0XG 1EQQA 4RMFA 1G6PA 1AE3A 4JI2L 3OW2A 1K3RA 4BY1H 4BXXH 2ALYB 1X3FA 4HJ7A 3J81c 4DR6L 4BBSH 3LH0A 3KYHC 1MJCA 4IJHA 1YZ6A 1N36L 4LF8Q 2R7DA 2QA4T 1PH2A 4GLAC 1PH1A 4YY3L 3PSIA 1EIFA 4DUZL 1YJNT 3S14H 1S72T 5IP9G 2OWOA 1NMFA 3CC4T 1FL0A 4IPDA 1NBWA 4A3LH 1C0AA 1VQFA 4BY7G 2UXBQ 4JI5Q 3F2CA 1P16A 2BH8A 1OTCA 4LFBQ 4KI0A 2DGYA 5C0XJ 2EIFA 5C44H 1L1OB 1QVFS 1XJVA 2UXBL 2OQ0A 3JAME 1CSPA 3A74A 4LFCL 4PZ7A 4APVA 2R93G 4FDBA 1Q12A 3T1YL 2K75A 3CC4A 1JJGA 2MI6A 3E9HA 4B3ML 2AWNA 3I4MG 2LVMA 4A3FG 2VQEQ 1XPUA 1VQBA 2WAQG 4YCWA 4OX9Q 3SGIA 1L0WA 3CC7A 5JJLA 1VQ6A 3G71T 1YNXA 5HGQA 2K5NA 3CCLT 1L1OA 2AHOB 3F2DA 5K36G 2FXQA 1N32Q 2XHCA 4HIDA 2C35B 1K0RA 3F2BA 1A63A 2UU9L 1Q86U 1YJWA 1BBUA 3K7AH 2MO1A 1JJ2A 3M9BA 5IYDG 4DV6L 5M3MH 1QZHA 3HOZH 1Y1WH 2L15A 2QEXT 2OTJA 1XMOQ 4OO1I 1VQKT 4NXNL 3I4NG 2VW9A 5GAGC 4OWTB 3L7ZC 1NJIC 1E3PA 1YJ9T 5LMNL 4X65Q 2UXDL 2Q2HA 4TVAB 4HIMA 4QGUA 4OONA 3AQQA 3LGFA 2XTIA 4BA2I 3HKZG 4OWXB 2Z6KC 1N33L 1Q1BA 2JVVA 5BR8Q 2B3GA 1X3EA 2UU9Q 1SR3A 4GS3A 4DV0L 2UUAL 2LCLA 3PO3G 5JEAG 3CF5A 4IJLA 1VQMA 2BA1A 4DNIA 2JA9A 4LWCA 1N34Q 2JA8H 3CCEA 4IFDI 3HOVG 3RZDH 5J3BA 3TQYA 1HR0W 1YHQA 1I5FA 4YWKA 4DK3C 1VQGA 5AJ3Q 3AYHB 3J7AF 3NBHB 3PIOA 1VQ4A 4JCVE 2GVAA 2JA7G 3TS2A
chains in the Genus database with same CATH superfamily
1FNUA 2DFUA 3W2DA 2FZKB 5IIFA 3E5SA 2KRMA 2B2UC 2EOTA 4K6LA 1RTNA 4P75A 1I8FA 4QVDA 2A74C 4MMKA 4MZMA 1PD1A 4M7DE 2HNIA 3HOWB 2BE9B 3CCLQ 4ZCKA 4EMHA 1ZYRC 3MWYW 2IPOB 1GL5A 4KUIA 4KLKA 3STBD 3K5LA 4OGCA 1RDPD 4XTCS 1QMCA 2JTEA 4M75G 4Z89A 1X01A 5ELEA 5IGFA 3I56Q 1X9NA 4A3IB 1PSEA 3CC2T 3S16H 4YWMA 1A62A 3HOWH 3CCVT 3ULPA 4ZYSA 5D3DA 3HOYH 3I55Q 2YTXA 1V1PA 2EY2A 2R92H 4NXML 1UWVA 4POFA 3A8GB 1AE2A 4DV6Q 3C2PA 2R93H 3IQLA 3VUBA 1STBA 2YUPA 1I6VC 2FJ2A 3OTOQ 4IZ8A 5C4XG 2QDYB 4E7ZA 4KKTA 4U68A 4LF4Q 1UNSA 5L37A 2GBQA 4R4IA 1PYWD 3OBWA 5DEHA 1EY5A 1N9WA 3FRNA 4JG2A 3CW2C 1M1KU 4A4KA 2E74C 5GAEC 2OTLT 3CCUQ 4A3GH 3CCRQ 2HCIA 3JAMc 3S15H 2F3VA 4YCVA 1CKMA 1JE5A 2R93B 2SNMA 4AYBB 5GAN7 4LDVA 4M78B 3DXJC 4IFDJ 2DBMA 3BVGA 2F0NA 1GHKA 3CRLC 1IO6A 2C06A 2A0FB 2EYOA 4J7FA 5E7NA 1SE3A 3OTOL 1SJED 2UXCL 2JA8G 1UFFA 4J9FA 4BBSG 4N9PA 1BBWA 3UDXA 1AWOA 2WB1E 2PZWA 5IYCH 3JB9H 3UE1A 5C0XI 4PJJA 1EQVA 5GAMj 2PUKB 3T9NA 1XNQQ 4X65L 4C92E 5IGGA 1DOMA 3OYDA 5CGKA 1G291 4QVZA 4DR2Q 1ZQ1A 4BA1I 3S17B 3TSSA 4J9DA 1KL9A 5FLXE 4NXNQ 3F70A 2K52A 4EQNA 4IKFA 2YLCA 4Y91A 1RAAB 4JJDA 1U4LA 5EGTA 1KDBA 3OHXC 3PUWA 1YP5A 4WTOB 1NPPA 4ILWA 2SEMA 3H94A 3NPPA 1GKHA 4OB0B 2N78A 4A3GG 5EAYA 1UG1A 3G71A 2JW4A 4OWWB 2NYSA 3OSSC 4BE1A 5IP7G 5GANj 4BBRB 4AG1C 2KEDA 3BW1A 2Y0SG 4XU1A 4C5EA 1YJWT 2A69C 5T1IA 1IB8A 1VYVA 3GTKB 2E41A 1VQ8A 1LCKA 5LHY1 3PQIA 1JU5C 1MBYA 1FXXA 2FMCA 5HGTA 4JI0Q 5AYFA 1JJ2S 1Y1VH 5IYBH 5GROA 4DV7Q 3HZXA 1M3CA 3LX0A 3PGZA 1HNZQ 4JRKA 3EN2A 1PWTA 1W1FA 2YRVA 1KC8R 1AEXA 5GAN3 4DR7Q 3MXNB 2E6ZA 1NBEB 2KXCA 2E5KA 3OPOA 3ULJA 4IN3A 1FX7A 1LLRD 3D0FA 2RHQB 1VQLA 2QQSA 2BH2A 4M7AA 2DNCA 3VR6A 1H95A 3MPUB 2D0PA 1Q86C 1TU0B 3TP5A 1PDQA 1PYBA 2K5LA 1JT8A 2VXEA 2CUDA 2RPNA 4RUGA 3RKXA 2F0IA 2JSOA 3TZDA 4C3HB 4JV5Q 4F04B 4C92G 4QQDA 2ZAEA 2F3IA 5C0MA 2YSQA 4JPBW 2DY7A 3J81j 1W2BP 2FPEA 2M0OA 3JCMe 3BU2A 1VQHA 2RQRA 4AFQC 1IXRA 1GXDC 2KQ3A 1N36Q 4JV5L 1MMDA 1LV9A 3RUZA 1G91A 1B1ZA 2GA4B 1BB9A 5JOBA 4DF7A 4ME5A 3SFMA 4XTXA 1T5XD 5LJ3h 4ELZC 1WJRA 2E10A 2M9UA 4KH1B 4FYXB 1M90C 2BE5C 3A7AB 1VQIA 2LXKA 1JR0D 4ZLTF 3S1NB 5GAOm 2HQHA 2AUKA 4DR4Q 3THKA 3R3OA 1TTHB 4XQJA 3K81C 3RMSA 5IT9c 1K8GA 1FMVA 2RO0A 2PQWA 4HA8A 1TWGH 1X43A 4K11A 1YI2T 4J83A 2R57A 2QGQA 2NWMA 2RQUA 3KF8A 1WTOA 2LKVA 4BI3A 3PUZA 4G57A 2FZCB 2JA6H 4DKAC 2N3SA 2CYZB 2XICA 1KG1A 1IGQA 4WORA 2MFIA 2CUBA 5I2YA 2E12A 3H0IA 4V2SA 1DONA 3WDNA 2QTVA 1C48A 1EFID 2Y0SE 4M7DB 3EBEA 3KOJA 2DYBA 3JCMQ 4JUVA 4NW2A 1RIPA 4A3CH 1PVOA 1UUEA 2YT6A 4CI0C 1Y8PB 3EGDA 3VYHB 3ICEA 4X9DA 5HURA 1BCPF 4DV3L 5KYXA 1GCQA 2OCEA 1U1SA 3KXTA 2A73B 2E2HH 5LL6S 4PG3A 1LTID 2DILA 1NMGA 5EPLA 5M3FG 1LJOA 3MEWA 1X55A 2Y4XA 1XPRA 1VDZA 2E2JB 4GY5A 1VQOT 1Q81R 3E9FA 3GLXA 4IUVA 3UE0A 3JAML 1FGBD 2KR3A 4E7SA 1OOTA 3N6RA 4QF4A 4RCCA 2GN5A 4C5IA 4JS4A 2H1EA 5JJKA 2JA7H 3CMEQ 1GCQC 1PH9A 2YU9H 2EW3A 5M9OA 2EPDA 4JJBA 3HS0C 1KJWA 2RSNA 4M77F 2K5FA 4C8QD 1LT6D 3OYLA 2KVQG 4HVUA 1QVGP 4JI7L 3KUPA 5JEAH 4A53A 3S3OA 2ID0A 3BJUA 2LQWA 3T53B 2NZHA 1X32A 2A69D 4DUYL 4CJ0B 4OB2B 4KGXB 1HJDA 2HBWA 3HPWA 3QPHA 1WYXA 4PFOA 2K3BA 2MCNA 2A68C 1UHFA 2EJFA 4KHZA 3QOLA 4GN4B 5FOBB 3S24A 2YUOA 1RI9A 4L59A 3I56A 3ONAB 4B3RQ 3MJXA 1EYGA 3U23A 3SD4A 4OO1H 4XQQA 3I91A 2F0KA 3ER0A 2IX0A 1EYDA 2DL3A 4LFCQ 1OI1A 4FW2A 1P8LA 1RKNA 5C4JB 2R5MA 1AZGB 5FLXc 2EJFC 1VQ6Q 5CV4A 1E2VA 1TY0A 4DAVA 1ENFA 1KRSA 2JUFA 3TZUA 2CGHA 1PFBA 4X3SA 1OZ3A 1K8MA 3V05A 2K5DA 5TSSA 3CRKC 1CZGA 4YHHL 4M77E 5FRMA 1RHPA 3JCMh 5KIXA 3CCSA 4YTLA 2JM8A 1VQPT 4PMWA 3PV0A 1PA6A 2RNAA 3ME9A 3SHWA 2B2TC 2I07B 1RACB 2QI2A 3E1SA 3UT1A 3OYJA 4EGVA 2O5JC 1PCXA 2M02A 2KA7A 4JI6L 4QQBX 4D8KA 2EXDA 1O7LA 3BYYB 2HHHQ 4DR6Q 3FJ5A 4M77D 4JOIA 4P72A 5JJZA 2F0DA 2VUMG 2AIRB 2FO0A 3H0FA 3UATA 3CXCA 3O13A 1WI5A 2D9TA 2HMAA 1QWEA 3R2TA 4HT8A 3P7JA 2HKNA 1WA7A 3FB9A 1X2KA 2A68D 3IKJA 1PTOC 1VQPA 3OYAA 4C92B 1QUQA 2KOLA 3S1MB 2P0KA 2EXZA 1EY6A 1EFNA 1WDXA 3CPWP 4PJOC 2OT2A 3PF5A 4B3MQ 3GTGB 2RQTA 5IWAL 3CD6Q 3JCMP 1JEGA 1OXXK 3S2DH 1D1CA 3URGA 2JMAA 4B9XA 2NYZD 5DM73 3KLSX 4GNXA 5CKDA 3UWNA 1D1KA 1I4K1 1HNXL 3S1QH 1BIBA 1TQOA 1YHBA 1SSFA 1M1KC 4HKEA 1W6JA 1JE4A 2ZPFB 2COZA 1FJGQ 2ICIA 5FWBA 3PIP3 1O9SA 3S1RB 2A36A 4CC7A 1VQJA 2NN6I 4R56A 3OYHA 2WKCA 2CT3A 1E6GA 3JC66 3TQ7P 2Z4HA 3RMQA 2RHIA 5FLXL 3MEVA 1B9NA 1K9AA 2EY1A 1G2BA 5C5LA 3TEHB 4A3BH 2G6FX 4M78F 4MTKA 2E70A 2OJ2A 1A2TA 1OV3A 1GOZA 3DWQA 1GUTA 2ZJQA 2ZM6L 4RHSA 2KYBA 4DK0A 2VQFQ 5IXBA 1NE3A 1VQDA 2VQEL 4B3SL 4A63B 4DR2L 1K76A 3OYEA 2DL7A 5E1FA 1EFWA 2PVOB 1YBYA 4MZPA 4JYAL 3C0CA 3MKDA 4J6HA 3META 2Q8RE 4RFBA 4A3KB 5KGUA 1QWFA 1G51A 1GXIE 1WHGA 4J6YA 3OYBA 3G6ET 2L11A 4ZUIA 1KLGD 2HKQB 2DTHA 3I55T 4MDXA 3CC7Q 4DA2A 3CQTA 3GV3A 3HSBA 3DKMA 4M7DA 4K5WA 4FNFA 1VQ7Q 4Z9CB 4PFPA 5CR2A 1SXTA 4RGNA 3RBBB 3CCQQ 1NJIR 4MZ9A 4OGQC 5E3FA 2IX3A 3S2HH 5CV7A 1QNKA 4N9TA 4A3IG 1HA6A 1WQWA 3TEEA 5IXFA 5FO8B 1CI3M 1CKNA 3HEJA 3JB9J 5I2XA 1R9TH 1D2BA 1EL0A 3RZOB 3DUZA 4M1UB 4X3UA 3W1BA 3NP8A 4EMKB 2XN9C 3JAMi 3D3RA 1PYSB 3X20B 2O88A 2CP2A 4RTWA 3TS0A 3NFCA 1PH5A 2Z0SA 1AOJA 2OQKA 3MFYA 1YHAA 4CHTB 3RN2A 4LUVA 4R4QA 3PF4A 3MA2B 5ELDA 1YWPA 4PJLA 4AFUC 1WTPA 3HRUA 2B2WC 2EWNA 3ND8A 1XTDA 2DMOA 1PHTA 2CSQA 4GOPA 4RG2A 1HH2P 3E9GA 3BFMA 3H0GH 3HKZE 2HBPA 2V1QA 2DZ9A 1ET6A 2MP1A 2WB1G 3I72A 4HCSA 4DR3L 4C3IH 5IT9L 4HN7A 4ORZA 2DF6A 2V26A 4HCEA 3KFUA 1IYVA 2R3ZA 4ZTFA 4X66Q 5D3IB 3TP6A 3URYA 1X27A 4C2MH 5IODA 1IL2A 3GTLB 1IYJB 1D3BA 3L0OA 3I9QA 1TS9A 5IE8A 3EHQA 2JMCA 1PZID 2EYQA 4ZKBB 3R2IA 1JB3A 1E22A 2CWAA 3LW5E 3K6OA 2D8JA 5HY6A 4M75B 1EWHA 1OZ2A 1S5DD 4JLIA 5LJ5h 2OEOA 2PQAA 1ZYRD 1QQJA 2JA5H 2X35A 1I3QH 1I4XA 3JB9F 2Z8LA 4OHJA 4PMBA 3M0RA 4A4HA 4GKKQ 3VR3A 4HJ9A 1N8RR 1EQQA 1A3UA 2GF7A 4PJNA 3OW2A 3PO3B 1SE2A 3H9NA 1VQ8Q 2K04A 2RI2A 1O78A 1U1TA 2NUPA 2LZ6B 4LF8Q 1A2UA 1PH2A 2VUMB 1QLYA 5GAOp 2JP1A 4YY3L 1W70A 1O7YA 2F0QA 1K9MR 3WOFA 1YJNT 4JZ4A 3CC4T 1FL0A 2DERA 4P5NA 1NBWA 4LDUA 1TS4A 1NAPA 4IUPA 4OMQA 4JRQA 1QCFA 1X6BA 2EYFA 2PW5A 4BY7G 1BUVT 2YWWA 4LFBQ 4KI0A 4MMLA 3A8MB 2RJCA 4V0BA 3C12A 1ZHIA 3I5SA 1H92A 1IW7C 1QVFS 2XSCA 1XJVA 2FB7A 2UXBL 3MXNA 3MP6A 1CSPA 4N0AA 5FO7B 4FDBA 4RTYA 4H0LC 2BZYA 1O7ZA 3E9HA 4B3ML 2YHTA 1WTXA 5NUCA 4N4IA 4A4EA 4EIKA 4DBRA 1TWBA 4NS5A 3L2WA 1XQHA 4OMPA 1VQBA 2WAQG 4YCWA 4OX9Q 1XPUA 1T3SA 4BY6C 4MDWA 4RA8A 1I07A 1Z6HA 4HXJA 1CKAA 4F17A 3G71T 2G5DA 4HEDA 4F87A 2XRQD 2H4OA 2C35B 4HMIA 1K0RA 1HCZA 1BIAA 2HDLA 3RD4A 3F2BA 1BBUA 1RLQC 4D6WA 2MO1A 3LWIA 3K7AH 5C5MA 1HFGA 1A3TA 2FRYA 1JXMA 3CXCP 1ABQA 2G9HD 2Q8TA 2EBPA 3K5NA 1XMOQ 4NXNL 1CHQD 3I4MB 4C5HA 1M90R 1MGQA 1PRTD 4EMGA 1E3PA 1Q7YR 1YJ9T 1SHGA 1N9RA 2A6EC 1PZJD 4X65Q 4TVAB 1QB5D 4HIMA 2QAZA 1NG2A 3K7AB 4BA2I 2XTIA 4N8X1 2GQIA 2WACA 4FSSA 3HKZG 3D6WA 4NMZA 3KUFA 1Q1BA 4OWXB 2RI3A 1Y1WB 1VQ5Q 1ZSZC 5HK3A 2K33A 5CAIA 1X3EA 2UU9Q 4DV0L 2DRKA 2EJGA 2UUAL 3OA6A 1F9RA 4IJLA 1I5LA 2QYZA 4M7AF 2BA1A 3JCMc 1IGUA 2GNCA 2DJQA 5J3BA 4HCZA 3TQYA 1NLPC 3RZDH 4YWKA 4DK3C 2PZ1A 3LWHA 1VQGA 2HSPA 4OIKA 1EY8A 5CKFA 2D8HA 3PTAA 1FNWA 3M55A 2MPMA 4LFAQ 2DUDA 5M5YB 2RJEA 1GBQA 1E1TA 3C1FA 5GANd 1SRUA 3HOZG 1OULA 4DBQA 1LTBD 1KAWA 4LUZA 2P4RA 3K59A 1K8OA 4IQZA 4A93H 3HOXH 2NUZA 1UGPB 2V8KA 5DLOA 1M4VA 4RKLA 3MEFA 1IBKL 2H5XA 2MUYA 1EYCA 4HVVA 1H3ZA 4GLVB 3Q8DA 1VMCA 4M75F 1KXLA 4BXXG 3KDFA 3E0EA 3JSCA 2NTTA 1UGQB 5M3FB 3OYYA 3C3LA 3HOYG 4L5SA 1DZ1A 4LF6L 3AMUA 3M85A 3HOWG 2OX7A 4CKCA 3V7SA 4ZGDB 1Z9FA 5M3MB 1HJPA 1K28A 2ATCB 4LN2A 3OYKA 2PQAB 1PMRA 1GO3E 4KHPQ 4KJNA 1ZA2B 2YTYA 5GAMd 1ASYA 5GANh 4KMUC 2MOXA 1E2WA 1ESFA 2BA0A 1YITT 1K73C 4DEXA 4KHVA 2KI7A 3VYTA 3M0UA 1STGA 3M7NA 1VQ5T 2VUBA 3VUZA 1AT1B 1K8AR 4A3DB 1T5EA 1WTWA 1MI2A 2DJFC 4GNXC 4DR7L 4RG1A 4TKOB 3GTPB 4J9IA 1D5XC 1SMXA 3EJIA 4KKUA 1UGSB 2QILA 1V29B 2DKGA 3LWUA 5CKBA 3TCJA 2CW0C 1Y8NB 3VYGA 5I11A 1X3GA 3NBHA 1IHVA 3BDUA 2XMFA 1VQ9T 3EGXB 2KEAA 1X6GA 2JTMA 2X4XA 3OWFA 4R4OA 2QTXA 1I6HH 1QP3A 2UXDQ 4MHEA 3J81L 2LXJA 3GTPH 3LGLA 5ELCA 5I9PA 4R0KA 2JA5G 1Z9QA 2ROLA 1YCSB 5HKCA 1XMOL 1E2ZA 3MHXA 1WJJA 2EKHA 1OQKA 1CKNB 3MP1A 4M7AG 4Y7NH 4LF8L 3AU7A 1BBXC 3HRTA 2RDHA 2E75C 2L89A 2HDMA 5IYDH 3QIIA 3WXMB 4AMCA 2PZTA 5CBAE 3RKWA 2EYPA 1DJ7B 4ABNA 2G3RA 2A5HA 1IREB 2E64A 4DV5Q 4M77C 4I65A 1BI2A 3HP3A 2ES2A 3CCUT 2HQLA 4FYYB 1A6XA 1NTGA 1BK2A 4V190 3BS1A 4CJ2C 2RF4A 2ROTA 2NVQH 4DGZA 3FKIG 4GNXB 2A6HC 3J7AV 1M9SA 3GNFB 1BCPD 1CA6A 3OW2P 2ZZDA 3CCEQ 5C4XB 3EAEA 4RGTA 3A5UA 5JVG3 1S5CD 3PCOB 5K5PA 2L3PA 4Y52H 1PFMA 4DR1L 2WV6D 4X66L 4XU3A 3G7LA 5COYA 5IP7H 1PH6A 1TUGB 3A8KE 4K0KL 4LK1C 2MGSA 1EIHA 1EIGA 3G6JB 1KSWA 1Q46A 1QVGS 4C1NK 3OS5A 1KIKA 3VKIA 3M0QA 5D6YA 1S3OA 1JQQA 1RADB 2VZAA 3KF6A 4F7UG 1JORA 4GBQA 2KT1A 3G6EA 5EG2A 1STHA 4CKEA 5IY0A 2EQSA 2X3XD 1PH3A 5KNCA 3VR2A 1IHZA 3U4VA 4LNQA 2EYYA 3G1JA 3VS4A 1GCPA 2FG0A 4MNOA 3ZL7C 3LGJA 1K83H 1AVZC 1WQ7A 1Y07A 3ZEHA 3F2UA 1G6ZA 2K1BA 3QDFA 3X24B 3TVTA 2RA2A 3QBYA 3I90A 3A8LB 2V1RA 3MCAB 1UEAB 5C0XH 4UPAA 1WHKA 2A3LA 4PJMA 2NVYB 3P20A 2MF2A 2O5IC 1BI1A 2YV5A 4IIOA 5C3EG 3HTRA 3CMAA 4JI8L 4N0AC 4NP5A 2F0PA 3M54A 1T3LA 4HSPA 4K2KA 2O9VA 5ISRA 1BCPC 1OEBA 2O4XA 3CCRA 3I3CA 4J7IA 5D65A 2OTJQ 5C6SA 4LF6Q 2B63H 3WVEB 1VQNT 3H09A 1F77A 4IUUA 2A6ED 3A1PA 1BO0A 4M78D 1H9SA 2BKDN 4KK7A 4LF7L 2KHJA 1RAFB 2F0VA 5CORA 1TWAH 4OX9L 2F2XA 3EQLC 2P84A 5GMKe 1YJ9Q 1C8CA 4IOAA 3VRZA 1CQVA 1CHPD 1EX4A 1TWCH 1EZZB 1MD2D 2VWFA 4RTVA 1SNQA 5BN3A 2R92G 1EY0A 3C1EA 3A56A 2A8VA 1BR9A 4O6JA 4E7LA 1AZEA 1BKBA 4QJFA 2IY5B 3J80c 2BZ8A 3EROA 4RGOS 4M78A 3MFGA 3ULLA 3TRZA 1RD9D 1JICA 3TU4K 4GLKA 5DNFA 2PMZE 5C3EB 2YU9B 1SYBA 1IBML 4F7UE 3DLLA 3VR5A 1D7QA 5CQYA 2QXFA 2EYWA 3PO2B 1M1GA 1VQPQ 4DR1Q 5GANf 2ESWA 4LUOA 1CQFA 4RTXA 3GTMB 2B2VC 2CP6A 1FYCA 1HSQA 2YTVA 1LT3D 1ESRA 2JZ2A 1QILA 1K8AU 4C3HG 5KYXB 1EOTA 2IJ0A 2YRCA 1VA7A 2CREA 4JYAQ 1WXTA 2B2WA 2X69A 1S5BD 5GAOl 2I2LA 4TVRA 1FNVA 3QYGB 4KGZB 5LJ3d 3CMAQ 2C0OA 4DV5L 3FMCA 1K0XA 2CQOA 1XTCD 4EDUA 5LMUL 3JCMg 3QYHB 1QWYA 2DY8A 3L2QA 4L5QA 3RMHA 2YRDA 4HT9A 2RD1A 1P92A 1VQAA 4QUFA 1RLPC 4KULA 1N8RC 1EY4A 4QL5A 5C44B 4XYOA 5EJWA 3RR6A 3S1QB 3IFDA 2K5HA 1PTOF 2IWHA 4MIUA 4WFN3 4M75A 3GV6A 2JA8B 2RHUA 1VQLQ 1KDCA 4B9WA 1KQ1A 3GDEA 1IL8A 4FSXA 2K01A 3RLFA 1LABA 2LT1A 2L9HA 1G3WA 1Q7YU 2Z0WA 1WPYA 1F9SA 3H91A 4A4IA 4R9WA 2RCNA 2QF7A 1ML0D 5GJVB 1PRTB 3OSVA 1Y8OB 3MEUA 4XXEA 3STBC 1QVFA 2KVMA 3H8ZA 2I0NA 2P0QA 3U9SA 4HJAA 5JJIA 3P8HA 2V8JA 1XXGA 1YITA 3VS6A 2FHTA 3EH2A 5IWAQ 2R7ZB 4GOPB 4KD4A 3I4MH 4ZRZA 2DIQA 1LTGD 2F0LA 4QIWE 3M4QA 5EKKA 3MC0B 4LF9L 3I4NB 1D5ZC 1V43A 1PXUA 1E0BA 2KK4A 4LDYA 4C8QF 4ZN3A 2Z1CA 4WRDA 1SPKA 3QWYA 3J7ZC 5C44G 4PJOA 1BYMA 4UDUC 2K32A 3L2ZA 3GTJH 1DYQA 1W6XA 2M0YA 4K5VA 5DAUA 5JVH3 3VU3C 2AK5A 3FP9A 2E4HA 4A3IH 3CCMQ 5D7UA 4GKKL 6AT1B 1ILQA 1Z47A 3OMCA 1GUWA 5JAVA 1T0JA 3REAB 3OS1A 5GANe 3JCMd 3CBPA 1HA5A 1WI7A 2K5WA 1FMWA 3GTJB 2P5ZX 1B8AA 3SK8A 4J9CA 3Q22A 1ENCA 1IBKQ 4A3JG 1PTOB 3M58A 2A19A 1VQ7T 1VQ9Q 1Z7TA 5M5YH 2QGFB 4XTUA 3VS2A 1MV3A 3UA6A 2SOBA 1KAAA 4M78E 3VS7A 4OB3B 2ENMA 2GVBA 2IX1A 4ZK9B 5GJWB 2D2CC 5LJ5j 1JWUD 2D0NA 1UE1A 1V9PA 3K80C 4C8QG 1KQ2A 4M7AB 3GTQB 1VS0A 4A3BG 4DOWA 4RCBA 4PLLA 2CW0D 5I2MA 2HD0A 2WSEE 5GAMe 4BE0A 1Z9ZA 3A8IE 2EDGA 3QKJA 4JBJA 2NUTB 3KLWA 1E24A 4HMJA 1EEID 2EZVA 4KH0B 1SNOA 2JN4A 4U673 3PUVA 3VS5A 3HOUB 4ATOA 3FHWA 1HNXQ 3OYFA 4KV6A 1VQEA 3U58A 1C6VX 1QNUA 2M2LA 3S17H 1ASZA 1XMQL 2A08A 2LMCB 3VDYA 5ELNA 1NR2A 3NE5B 1M5Q1 3CEYA 2HQXA 3PNWC 3A7LA 5GAOr 1UJ0A 2X4WA 1VCIA 1ZBXA 1VUBA 4LJZC 1AW7A 1OU9A 4C8QC 1R4PB 1GD7A 3EIVA 5EPKA 3CCQT 3EG0A 2ZPGB 2CKKA 1D1IA 1X65A 1Q7YC 4DR3Q 2FYKA 5GAMg 4HAEA 1FYNA 1YJWQ 2RQVA 2IPKD 3WWVA 2KENA 3I5RA 2N88A 5FLMG 4C92D 5KYUA 3MEHA 2VUMH 2CS7A 2D6FA 2A6HD 4LUEA 2RKSA 1E6HA 4CC4B 1IHWA 3AFQA 2QEXQ 3DMUA 4JBWA 2VQFL 2NVXB 3V7CA 4LUDA 3T1HQ 4AG2C 3HOUG 2KQWA 2FRWA 3EFRA 3GTOH 1NJIU 4NL2A 5J26A 3ZFJA 5DM7R 2DJGC 2IHFA 1LTLA 1YN8A 1Y1VG 2ZTDA 5IYBG 3L2PA 4AQYQ 1M3AA 5GMKi 4A3MH 1KABA 4LD6A 2ZPBB 4F88A 2KT8A 4C0DC 5CQXA 1NPRA 2F5KA 1PM3A 1G3TA 4QY7A 2IVWA 1EU4A 3C46A 4OB1B 8AT1B 3NTHA 3TN2A 1SNMA 3GTOB 2J6FA 1VQOQ 1PH4A 1JQYD 1HZ9A 2KCNA 1K3BC 1RAHB 4DR5L 5GQOA 4Q5VA 4FU6A 2B29A 1W2BS 1WCMG 2J05A 5D14A 1WD1A 1ZSZA 1PNJA 1AD5A 3MP8A 3I7FA 4DV4Q 4C3JG 2C0IA 2K2VA 5DY9A 1SNDA 4QCLA 2KCCA 2ED1A 4PNOA 3NUCA 1GUNA 2Z9HA 1I50B 2RBMA 2RDGA 2JOYA 2B86A 5I21A 3CCRT 4TSSA 2MJ8A 2BE7D 2VVKA 1E1OA 2X3WD 5GAOq 2PMZB 4FW1A 1B44D 3UI2A 1TY2A 1U06A 3M0TA 1KDAA 3TP7A 1N27A 4IFDH 2CP0A 2ALYB 4A4GA 1TXQA 2KGTA 2B2YA 4DXFA 4BBSH 2KBTA 5A0LA 4IJHA 3GP7A 2R7DA 2QA4T 3VA7A 4GLAC 1YITQ 4IUTA 3SEMA 2ENBA 1PH1A 4FYDA 1H9MA 4BE2A 2JJ9A 2C9OA 1EYAA 3PSIA 4DUZL 1PRLC 1K83B 5IP9G 1QG7A 1LACA 4IPDA 5IN1A 3SVMA 3VYUA 1F2LA 1CTMA 4PMCA 3NXWA 2UXBQ 1SKUB 2BH8A 4K2LA 3SR1A 2HAXA 2WIIB 2WKDA 3ND9A 4CBVA 2X9HA 5C0XJ 2QK0A 3FKIB 4KY6A 3T51B 4M7DG 2XIDA 1L1OB 4FF4A 1Q95G 2L0AA 2K03A 2OQ0A 2CQAA 1QVFP 2HSEB 3JAME 2FFKB 2CZ6B 3A74A 4LFCL 4APVA 2ICEC 2R93G 1Q12A 3T1YL 2K75A 3CC4A 2MI6A 2X6GA 1NYFA 5BN4A 2B63B 5LJ5d 5CV8A 1RUWA 2A7YA 1GHJA 3I4LA 4XT1B 4IUQA 1L0WA 2DNUA 2PPBC 3HOVB 2XKOC 4PFZA 1YNXA 5HGQA 3PMFA 1V76A 2DL4A 2K5NA 2AHOB 2AQ2B 4RTUA 2X51A 2XHCA 4M7AC 1JC7A 1A63A 3OYNA 3BDOA 1UAPA 2UU9L 1B2TA 4NDXA 2JTFA 2ZPIB 1CK1A 4DV6L 4OP0A 2L15A 1Y1WH 3R8BA 2LRQA 2VB6A 1Q82R 4BDYA 2LFNA 4RCNA 2VW9A 3VS3A 2LDMA 1SFOB 3NQTA 3OQ5A 1NJIC 4PJOD 3JCMV 2P0PA 1NEBA 2EJMA 2KHSA 4M7DF 1SYFA 4L63B 1M1KR 4QGUA 4OONA 2KNBB 4RH6A 3S15B 1UB4A 2Z6KC 1N33L 2KMTA 2LTOA 2B3GA 3CU7A 4ZUJA 2LCLA 4HR7B 3PO3G 1TU2B 3QR8A 1GFDA 3HRZC 2JA9A 1EEFD 1TH7A 1YNZA 1GUGA 3HOVG 5FU6C 1YHQA 1I5FA 2L0CA 3HOXB 4LDWA 2RK1A 5LJ5e 3J7AF 3BZDB 1SMYC 4JCVE 3HFOA 5KYNA 4M77A 1TIID 2F1MA 3NHHA 5J22A 2YLBA 3NSWA 3M9QA 2Q2UA 3SWNC 4QVCA 2WSFE 3OYMA 4GN3B 4LMQD 4DPGA 4KTAA 2HL3A 2LQKA 3V8KA 4ZKCB 4NOYA 3HFZB 3QDRB 1MHWC 4EPCA 4DV2Q 1I4HA 2DVEA 2EY5A 4P73A 4PZ6A 5I6WA 1Q8KA 4XTVA 1KQSP 2F0WA 4OEMB 2DVJA 1N8RU 1O7IA 2AHJB 2CSIA 4LF7Q 2PCFB 1ZBJA 4FT4A 1UHCA 1F2ZA 3PT9A 1QVGA 1KC8C 1TXYA 2NZ1D 1UUPA 4DFAA 1FR3A 4M78C 1RF2D 4ME3A 4UP9A 2XK0A 4JJNK 1LOJA 1VQ5A 4PNYA 1ZA1B 4BXXH 3X26B 2K28A 3HOZB 3JCMJ 4GZYC 4I7ZC 3UDGA 3WVDB 5C4JH 4XTYA 3SXHA 1WGSA 1U5KA 4I7AA 1WX6A 5CCAA 2QGGA 3GTKH 2OAWA 4IIMA 2DD5A 2VV5A 3HOXG 1QJOA 2EYZA 2ZPHB 1YNJD 4C0DB 2LQNA 2YUQA 1G2SA 5IOCA 5M5WB 2W0ZA 1KIXA 3GTGH 3O8VA 1LVKA 5KYWB 3L42A 4M4ZA 1HTLD 1WJQA 1T9HA 1H8KA 2QG9B 4LNPA 3D31A 5JEAJ 3QWNA 3X3NA 4IUNA 2DXCA 4F7XA 2HL5C 4ZNXA 1UJYA 1HZBA 2ABLA 2HIXA 3HKZB 4UP7A 1I5OB 3X25B 1YJNA 1QW1A 3CCQA 3SHLA 4N4GA 2DN8A 1EOVA 1QVCA 1LO5D 1U4RA 2AT1B 3HKSA 2FHDA 2ZT9C 1EUJA 3O5ZA 3AB9A 3FPPA 5LJ3f 1Q82U 2OTLA 5IGCA 1BF4A 3M4OH 3OS2A 2N49A 3OS0A 3PUXA 3T1YQ 2L3QA 1NCVA 1SSOA 1PHJA 3Q6SA 4AFSC 4M7AE 1N5ZA 2E2DC 1PV4A 1KHCA 3S1MH 2LCCA 2IHEA 5LMNW 1CA5A 2VNUD 2A1AA 4ULLA 2CKZB 2EKOA 2AWOA 4ZN1A 4AYBE 1OYXA 4CDCC 1OX8A 1MSHA 2QQAA 4M7AD 3MTSA 2VYTA 3UDFA 1F1BB 3QZ5B 5F2DA 2FINB 4LXCA 5IHNA 1VQMT 4LF4L 1KD1U 2F0JA 3QO3A 2RJDA 4KBMB 2YYZA 3FJPA 3PUYA 3OWEB 4H13C 3CPWA 2XDBA 1Y96B 1AP0A 3NTIA 1STYA 1VQOA 4AT1B 3AHUA 2E2IH 5IGEA 4FM4B 4J15A 3C95A 4EMKC 1LTTD 2M51A 2K4KA 1A8VA 5IAYA 2ZXPA 4L5RC 4FL6A 3REBB 1RJTA 1YI2Q 1QKXA 3J80E 2OTLQ 2FMMA 2LNHB 2PNHA 2ZTEA 4A3MG 1M2VB 1HFNA 1UE6A 3RLOA 4FIBA 3GIBA 2EYXA 2RF0A 1BCPB 3IL8A 1K1ZA 3HOUH 3M59A 4FYVB 5CKEA 3I8ZA 2JM9A 3QG1A 3TBIB 4DNTB 4PV1C 3IRBA 4R8IA 5GAHC 4ZTJA 3UDIA 4DV4L 5GADC 2PVGB 2RMOA 4BY7H 2DM1A 2E1HA 4EX5A 1YIJA 3KJPA 3N52A 3OOCA 1AHJB 4Z88A 2G9DA 4XU2A 3BY7A 2EE1A 2VB3X 2RH2A 2LCSA 2K7VA 4POGA 1X75C 1MSGA 3CCJQ 3X28B 1HXYD 2MQHA 3L9AX 4PJOF 3FEOA 2H3EB 2HT1A 4DOVA 2WFWA 2F03A 3GTMH 2K57A 3EG9A 3PO3H 1LPLA 4J6XA 1RAGB 4R55A 1WHHA 1HTPA 1QZGA 1YI2A 4KY5A 1SG5A 2F0FA 3NEMA 1KRTA 3FIFA 2JA5B 2EYJA 1VQCA 3H6MA 1RTOA 3SWNB 4DV0Q 2UUAQ 3PMTA 1ET9A 3BZKA 2DPPB 4ALPA 2PU9B 1O80A 4LF5L 4DUYQ 2K79A 4BY6B 1MMNA 4OMLA 1KTKA 2BE5D 4A3EG 5DM63 4NXMQ 2A37A 1C4QA 3PE0A 3CCST 2Z4IA 1JCKB 2NBFA 2KXDA 1Y1WG 1N32L 1DGSA 2DEUA 2SRCA 5D6WA 2OAUA 1R8OB 3IAYA 4HSVA 4WJ4A 3RR5A 2MYSA 1CKBA 2L12A 4MN3A 2K9GA 1PRTC 1VYTA 2GTOA 3EFOA 3QWXX 1TWHH 5M5XH 1VOMA 4M77G 4C3IB 4QQ6A 2I5LX 1WFWA 3MO8A 4C92C 1CZWA 1F9QA 1STEA 4KT0E 3DHQA 4A3FH 3PO2H 1VQNA 2LSSA 4O1NA 3FEWX 3NGPA 3JV3A 2V1CC 3M4PA 2CZ7B 4KGVB 4AYBG 4A3JH 1VQLT 2E3HA 4BS9A 4FF3A 4EMKA 1AWXA 2K50A 1MNDA 4JOIC 3V7RA 1B7YB 1M27C 3OW7A 3EFOB 2GTJA 4A93G 3NQIA 1X54A 3OYCA 4X6AH 4LAAA 2XDDA 4C56C 4EQOA 2EGEA 2AUJD 4LW1A 4P71A 3Q24A 4F7UF 3CC7T 1YEZA 1RODA 4A3LG 3P1HA 1L2FA 4C0ZA 2KHIA 5FJ8H 5CV5A 1V8QA 1SYDA 4TQUS 2M9VA 4A76A 3SK4A 3MZ5A 1KQSA 2NTSA 5LJ3j 2JEAI 1DCZA 4J9HA 1SE8A 1NY4A 5FU7B 2KEEA 2F1LA 3S1NH 4IFDG 4BY1G 5FWCA 4KJOA 1BDOA 3BYTB 2DTOA 3PMIA 3G4ST 2EJ9A 3M53A 1WCMB 1UE7A 1XPOA 3UA7A 1FMKA 1Q8IA 2EYMA 3DWPA 5BN5A 2N55A 1BCMA 3K0XA 1OO9B 3S2DB 3A8HB 1WTQA 2D0OA 2CH4A 5A0DA 3CCUA 3I73A 4A3KG 2PYKA 2D62A 4PLIA 2C5CA 1VQ7A 3I2ZA 1TWFH 1K73R 1B9MA 1SRLA 4OVAA 4ESRA 5GAOn 3I4OA 4DAYA 1D0XA 2RN8A 4DU9A 3HOYB 4VUBA 4JI3L 1U0LA 5M3MG 2R7ZH 1WCMH 4ELYC 4JDSA 4QUCA 2VXWA 4G7ZC 4QKUA 2E6NA 3CCJT 2LS01 3S1RH 3BG3A 1NZ9A 1SRMA 5GAN5 1I4RA 4WJ3M 1OXUA 3K58A 4DK6C 2CCZA 2CHBD 4NKLA 2NN6G 3F1ZA 4LFBL 1LM0A 3I56T 1TWFB 4JI4L 5CIUA 1OXTA 1HK9A 2DAQA 2E3IA 3U9OA 1KNAA 3U4ZA 1U5SA 2ED0A 2E2JH 1PC0A 2V8IA 4HCCA 1NSNS 3H3VI 2LX7A 3LYIA 1RI0A 3CBOA 5DLQE 1FVIA 4C92A 4E6RA 1KNEA 4QQGA 1QUQB 2NB0A 3CAMA 3H3VH 3L2VA 1XX8A 4RHRA 4DK1A 1Q90A 4DBFA 1RABB 2R7FA 4GKJL 2ATWA 2F4VQ 1XOVA 2JQOA 4DEYA 2R6GA 1C9OA 4RCOA 3CC2A 4HJ8A 1B07A 1FJGL 1I4PA 1Q82C 1D8LA 3G71Q 4FVMA 5A0GA 1J6QA 3RNUA 2XGTA 2VL6A 2JJQA 1VQMQ 2I0QA 4M7DC 2AMCB 3AT1B 3ULRB 3QHSA 1M90U 4CRIA 7AT1B 3RZDB 3AEVA 2M1HA 5IH2A 4DAMA 1RAEB 2O4XB 4CDEC 2GQVA 5GMKh 4KD3A 1M2OA 4KRTA 8ATCB 1IBLQ 4M78G 3TREA 4P2CB 4A3DH 3ERQA 4L5GA 2HCCA 1UE5A 2RVLA 3ERSX 2QEXA 5KEEA 2X4YA 4G7HC 1K73U 4YCUA 1PG5B 2DX1A 4IOCA 2GCXA 2JN0A 1JO8A 2O2OA 3BE3A 1B34A 3DB3A 4B08A 1XNQL 3EFXD 2KE9A 3TSZA 1GBRA 2L1BA 3UDCA 4NPSA 5CO7A 2F0SA 2RHSB 1EWCA 2IL8A 2DXUA 5AJ3L 1BCOA 3OIQA 2ZXOA 2COYA 1VQ4Q 4RKBA 4OO1G 3LX7A 3C4SA 1S5FD 4E7HA 3T4AC 4J5YA 4AH6A 4M77B 4PZ8A 3CQZB 5JPNC 3OYGA 1IBMQ 4J8OA 2GFAA 5KCHA 1B3AA 3D4RA 3H0GG 2ASBA 2ZPEB 1XNRQ 1IKMA 2BIVA 1D6EC 1R0BG 5M5WH 1WD0A 3EHRA 3M57A 4PJOE 4DQ2A 3CMET 2EGAA 4CC3A 2O31A 4XU0A 4JVZA 2Y4YA 4RKUE 4JI1L 2DD4A 1Q1EA 2UUBL 1R77A 3JCMf 3KFVA 2NVQB 1W6KA 4J9BA 1PTOD 1JOQA 3M5AA 4Y92A 1RL2A 1DOKA 1WHMA 2EJGC 1I4GA 3CCSQ 2JYOA 1OXVA 1I0CA 3A8OB 4IURA 1C7YA 2R61A 4BBSB 1HZAA 3OW2S 2LJ3A 3K5MA 1S40A 1VQ6T 3J81i 2CWPA 1I4QA 3VV0A 1I6HB 3FDRA 2VXFA 5IGDA 4QT7A 2UUCQ 1QVPA 1PFSA 5LJ3e 4JI7Q 3CD6T 4WJWA 3JB9D 3KBGA 3CCET 1CM9A 1DXMA 3EGDB 1JJCB 1LYLA 2K5QA 4DNRB 3LNNA 2MNAA 2QCPX 4XIGS 4M75E 4E7IA 5CR3A 1WVLA 1YFNA 3JRZA 4K8JA 3SWNA 2C0TA 4DV3Q 1N6AA 1EY9A 1S4ZA 3FKIH 3PO2G 2K3YA 3F8TA 3T56B 1DJRD 3MVVA 4JC0A 4Q5WA 1UE9A 4O2DA 4C8QB 4EVOA 2DXTA 2KSSA 1KC8U 2WAQE 4A3BB 2OF1A 5LJ5g 4MTNA 4A3EB 2JA6G 4EQPA 1ZXTA 1MKHA 1WLPB 2E2IB 5I22A 1UDLA 2BTTA 1QOHA 3I35A 1TKWB 5G3LD 4DV7L 3OBYA 3HRSA 1V1CA 1V1QA 5E4WC 4JZ3A 5FU7C 1WHJA 4M75D 1VF7A 4C1NI 4X34A 2BZXA 5T1GA 1KHIA 3CCLA 3J80i 1AZQA 4K0KQ 5FO9B 4RAUC 4QIWB 1UECA 1M30A 1UTIA 4PJOG 1ICWA 3V2TA 3S6WA 4CJ1B 1MHNA 3H3VC 2HZYA 1BI3A 4ZQ3A 3NHNA 4AFZC 1SYEA 1PD0A 4BI4A 1IKLA 4RMFA 2YDLA 1G83A 1AE3A 3EVQA 5CV6A 5C3XA 3ASKA 1KK7A 1EZ8A 4HJ7A 4HVWA 1F9PA 4L6TB 3J81c 4DR6L 1TOVA 3LH0A 3E0JA 3KYHC 5EQ0A 4CKBA 1N36L 3Q0AA 1TG0A 4RG8A 3QJ6A 5I6YA 4A54A 2R5AA 1BU1A 4JLGA 5FW9A 2RQXA 4RWSC 3M3YB 4ID6A 2TSSA 5ECAA 2JA6B 1U3OA 1NMFA 4C0FA 4JK1C 1ZSZB 1Y96A 1C0AA 1S72Q 4S3SA 4E47A 1JOOA 4OL7A 1VQFA 2J06A 1F2YA 4JI5Q 1TT2A 1P16A 1IW7D 4KN4C 2DGYA 2PTKA 1H9RA 2EQMA 4C5GA 2K5IA 2F3WA 3W3AA 1U4MA 4PZ7A 4FXKC 3ZYYX 1L0YB 2B2VA 2VGMA 4C0GA 1YWOA 1KD1R 1YCYA 2AWNA 3GBQA 1BI0A 2LY7A 3LLRA 1VIFA 1TS3A 4C2MB 3Q1JA 2JXMB 3CC7A 2RK2A 3NBIA 4O42A 1B4OA 1VQ6A 1SAPA 1MNEA 5KYLA 5JJLA 4M8AA 4R8NA 2DXBA 3CBMA 3SK6A 3CCLT 4PKCC 3F2DA 2H8HA 5K36G 1A0NB 4HIDA 2K3XA 3NTKA 1SBBB 2TMPA 1XYIA 1Q86U 1YJWA 1RAIB 3M9BA 1QZHA 5IHKA 5M3MH 3HOZH 2CP5A 2KROA 2OTJA 5GAMh 1QE6A 4OO1I 5ELBA 3BDCA 3I4NG 4OWTB 1TS2A 1WHLA 1BQQT 3L7ZC 3D6CA 2B8GA 1TR5A 4N8FA 2CDTA 2Q2HA 1X3QA 5CBEE 3JB9I 2XWJB 2Q8IB 2K6DA 1JXOA 4FCYA 3PFSA 1PKTA 4XTWA 1M8MA 3PVLA 3CC4Q 1SR3A 3JB9G 4GS3A 5JEAG 3CF5A 3P8DA 3QSUA 2DNEA 4E2FB 4DNIA 4XAXB 1II3A 2JA8H 1DOLA 4IFDI 3CCEA 4G4KA 5IGBA 1H9SB 2L4NA 1Y69U 2FVUA 1HR0W 1YJNQ 2O01E 2DL5A 4J6WA 3GQBA 3AYHB 2NLUA 3PIOA 2JA7G 2E65A 3TS2A 3E3XA 3E6ZX 1ILPA 2QEJC 2HQEA 1TUDA 4OELB 4A4FA 2VY3A 4P74A 3I4NH 2IT1A 3GD7A 1D1BA 1EZ6A 4ZGEB 3EA6A 1MIUA 3W1GA 1SNPA 2ZJRA 1NM7A 2AQ3B 3S9WA 2JEBI 5BR8L 1AZPA 3DEOA 3A54A 3CKIB 2EVRA 3V96A 5KYWA 2SEBD 2JS0A 4DR5Q 2QDBA 1AWWA 3CMAT 2AZSA 1ENAA 3JCMW 1WOCA 2CP7A 1J8IA 1WJSA 2L2PA 3MEAA 1SYCA 1C1AA 1D0ZA 5GAN6 3JCMX 5C6AA 2E5LL 1K4US 3RNJA 2OTJT 2NWGA 4QMGA 5EKIA 2NVTH 4B3RL 3CCMT 3BVZA 4GN5A 4AQYL 1ZSGA 3EFSA 1BXTA 1OXSC 3KBXA 5AT1B 1CUKA 1PRMC 3M4YA 1Y0MA 4FP5D 5A35A 2LJ0A 3S16B 2AKKA 2I5HA 2KJXA 4JI2Q 1QCOA 2MIOA 4R4CA 1DM0B 2WINB 2DL8A 5EBDA 5CC4A 4JJCA 2R92B 2NUTA 1JJ2P 3PIO3 1J5EL 1JB0E 3BDLA 4HIOA 2NVTB 2V4DA 1ABOA 3A8JE 4K14A 1HHVA 1HUNA 2YUNA 4K5XA 5LJ3g 4C8QA 3RN5A 4UHVA 2YXYA 3EG2A 3NELA 1ZEQX 2DEQA 1SDFA 1WFQA 1ZUKA 1AEYA 3R93A 1VQ4T 2EQKA 3J81E 2MAMA 2CT4A 2IW3A 5KRUA 2J7ZA 2XI9A 4F7UA 1BBZA 2I46A 2F0UA 3B6YA 1SHFA 1PH7A 1H641 3GOXA 2DETA 3CCJA 2XRSD 3AFPA 1JB7A 2FZGB 1AFPA 4DAPA 4YHHQ 2KCTA 1HNWQ 3CP0A 4DXGA 2CH4W 2WP8J 3L3OC 1K8AC 3CD6A 1CSQA 4A75A 3CCVQ 5A2QE 4A93B 1WTHA 2B2YC 2KBNA 2CFMA 3SK5A 1STNA 4JI0L 3P75A 3M0PA 1HPCA 1OU8A 3NMZC 1WNLA 3KF8B 4JS5A 2NVYH 2F4VL 1UGRB 4BI8B 4WCIA 2L5QA 2AQ1B 4Q0FA 2FEIA 2XIWA 4II1A 3CCMA 1TVXA 3TDQA 4RMOA 1R0CB 1GFCA 5IHIA 3K7UC 1Y7XA 4RTZA 5GANg 3CPWS 2RA4A 2JT4A 2KECA 3GTQH 2MHVA 3FDTA 4MZTA 3HGBA 3T1HL 3V8JA 1TWAB 4YY3Q 1N33Q 4DR4L 1VYUA 1TWHB 5M5XB 3JCMb 4OMNA 1K9MU 1LT4D 2CZ0B 1NUCA 3CQZH 3DEPA 4HIKA 3FPUB 4EQ5A 1TWCB 1EIYB 4JBKA 3QIAA 4A3FB 4JI3Q 3P8BB 1XNIA 1PLFA 2DJZA 1V1OA 4WF2A 2SDFA 4IO9A 2KCMA 2ZXRA 1OX9A 1CFMA 1PSFA 2VS1A 2EYHA 2PO4A 1S1NA 3VJPA 4A3MB 5IP9H 2N8NA 4H7BA 1SMYD 2D9UA 4C92F 3FRPB 1IBLL 1QKWA 1M2VA 2EGCA 5EKLA 1TUCA 4X1VA 2PI2E 4R4TA 2XD0A 4LFAL 2HIVA 5GAMf 1BOSA 1D5MC 3C94A 4IPGA 4L5TA 3S14B 2DA9A 3RESA 2F2VA 2QQRA 3KJOA 5CK9A 3ZBDA 2JK8A 2DTIA 1PRTF 3DB4A 4X9CA 2BDOA 2UUCL 2KYMA 4LF9Q 5HCKA 4B6MA 5IT9E 1UEBA 4L8JA 3RKYA 2XWBB 2LP5A 3U50C 1SROA 3UF4A 5FKAC 5IYCG 4X62Q 1QP2A 1PH8A 3TP8A 1G8XA 1I50H 4XQNA 1X6OA 1Q3LA 1B53A 3NENA 1GUSA 3K8AA 3VRYA 1SE4A 4FYWB 5CMDA 1Y71A 1HD3A 1EY7A 1G3YA 4Z02A 2MO0A 3E19A 2K7AA 3G7ZA 3OB9A 4HCBA 4LD9K 3D4DA 3IFTA 4JI1Q 4BBRH 4C3JH 5FROA 4DV2L 4GLXA 1HNWL 1LTRD 2K4YA 2EQIA 3H0HA 1Q81C 1IRXA 1E7OA 1WIEA 1W3SA 3HFNA 1SNCA 1NR4A 5GAN2 2QQ9A 4DUZQ 5D6XA 2EQJA 4X62L 4BD3A 1D09B 2Y90A 3A5ZB 1VF5C 1L1OC 3G48A 2Q2IA 1G8ZD 3MHBA 5K36H 5C4XH 2AKLA 1LT5D 2ECZA 2JE6I 3MAQA 1GJXA 4NL3A 4UP8A 4JI5L 3NWSA 1X56A 3PVQA 1YNND 1HR0Q 4JRPA 2ZTCA 2BOSA 3DWAA 1NYGA 2F2WA 2O9SA 5EBCA 4FF1A 1CKOA 4FF2A 1G2TA 2KAFA 1VQKA 1EWIA 4A3DG 4B3SQ 3D7SB 5I4DA 2CP3A 2F5TX 4E7JA 1FD7D 2EPBA 5E4XA 2KY9A 2J4XA 4YWLA 3CPFA 5KH6A 3D4WA 1A0IA 1YNNC 1MV0B 3TSWA 3OMGA 4RGMA 2EQUA 2QASA 4H02A 1U4PA 1YVCA 1PZKD 3RERA 1JWMD 4DAYB 2MWOA 2PI2A 5FLMH 3SEBA 3K0YA 1PKSA 1UGVA 4LF5Q 4PQXA 4C8QE 3R6NA 1GVPA 2UXCQ 4CDDC 2J6KA 4OMOA 1KQSS 4DV1Q 1TSFA 2D5DA 1HQRD 1PFNA 3Q23A 1SEBD 2E2HB 1JBMA 3HOVH 4KY7A 3M3YH 4G7OC 2E5QA 1BVSA 1EQTA 1SFOH 5KCOA 2GFUA 4F14A 4F16A 3GO5A 3KK7A 4N4HA 3CXCS 1HXDA 4LE9A 1W2BA 2QA4Q 2Q2TA 2VASA 1A15A 2K6AA 5EPJA 3M0SA 1TWGB 3RDVA 2NN6H 1AWJA 3VYRA 4BACA 1Q86R 3INZA 3BZCA 4HCKA 4JRIA 5LL6X 5KE3A 4X3KA 4DBHA 1X69A 1VQ9A 1KLUD 1AH9A 4B3TQ 3PIPA 1ZUUA 3CCVA 3KF6B 3MXUA 3M56A 3PGGA 1GM5A 2EAYA 3J7A5 2JS2A 2WAQB 2NUPB 1M3BA 3MXGA 2FL7A 2PVDB 2HHHL 4J9EA 3RUXA 5J1ZA 2KDSA 1MJEA 4C3IG 1HRJA 3A98A 3OYIA 1J9OA 2PNRC 1YHQT 2J7IA 2GGRA 1U8RA 1KD1C 4A3GB 1H9JA 3VYSA 3X3MA 2CVRA 3QOJA 3EGXA 1E7ZA 1H3HA 1Y14B 5GMKl 1OPKA 3EG9B 1V1PB 5CVIA 2J0TD 2SNSA 1MMAA 3QZ9B 2XU8A 4J8QA 4B3TL 4JI6Q 4XTZA 2DZCA 5GAN4 1MUZA 1NLOC 5KNBA 3FVQA 4X64Q 3E9IA 5CYUA 3SE0A 4X3TA 2B8AA 2K05A 1WYDA 2MWPA 2L3RA 2F52A 4GOPC 3FC3A 5FU6B 2XDPA 4FO2A 5FJ8G 2DLPA 4O0AA 2F0GA 1YNJC 3N5BB 4E7KA 4GKJQ 3S3NA 2NUCA 2XVSA 5HK0A 2K5VA 2EVBA 2EY6A 3J7YW 1ZUYA 2CZ1B 1S5ED 5G3LF 2RI5A 5M3FH 2E5LQ 3H6ZA 3GPLA 3G4SQ 1ICFB 2KRNA 3CC2Q 2AKWB 3KLSA 4PJOB 2B8FA 4XYQA 4Y7NB 3GNGA 4NB3A 2D0QB 1S72A 1IZ6A 1LUZA 3L2RA 2ZJPA 1HZCA 3SB2A 3M7GA 2NVXH 2KRSA 4A3CG 3KDFB 3UPUA 1YIJT 1IXDA 2COWA 3NPFA 2DE0X 2L55A 1B70B 1I94L 1B7TA 4OMMA 1JWSD 3A0JA 3J80L 5KYYB 1WXBA 3LWEA 4JBMA 1SYGA 3VA5A 1FGUA 2LMJA 1MMGA 3M4GA 1A3VA 1I1JA 5ELOA 2Z6BA 3MXPA 2M00A 5C4ZA 2IG0A 1G5VA 2WB1B 1LNXA 1H9KA 4X64L 5GMKj 2VGNA 1OPLA 4OF1A 1MGSA 3ZJYC 1ARKA 2F0TA 4XT3B 4ODGA 1Y1VB 1JMCA 2Z6KA 4GLMA 2XNAC 4M75C 4KN7C 4A3EH 1HR0L 5FRNA 3G4SA 3M4OB 2L8DA 2XG8D 1AN8A 1K9MC 5JPMC 2EFIA 2F0MA 3DM1A 3W5OA 1XMQQ 5LMUQ 2QW7A 1SF9A 1J5EQ 4FT2A 1SSHA 2K14A 2FPFA 1HYOA 2JXBA 1WZOA 5GAN8 4K8IA 1N34L 5I2SA 2IIMA 5A2QL 3G6EQ 5CKHA 1STAA 4XDXA 1L0XB 3EH1A 1QCBD 1Q81U 4ZAIA 1HNZL 4DA4A 2RB6A 2BCOA 1Y57A 4QW2A 2X6LA 3ITPA 2MK5A 1HQMC 3TMEA 2VKNA 2HCKA 3EG1A 4Y28E 2L5TA 4C3HH 2R58A 3H15A 1KFZA 1C0MA 1D1AA 2RJFA 3LH5A 4PL6A 1JRIA 1VQ8T 2RSOA 5C3WA 2X4JA 5KNDA 5LMNQ 5KYIA 1CT1D 4BUGA 1NEGA 2RQWA 1JOKA 1XJWB 5H1SE 4DV1L 4PK4A 2E8GA 2F0HA 1T0HA 2PQEA 1O75A 1DD2A 3GF5A 4JI4Q 4J1MA 3I70A 3HL8A 9ATCB 1ONLA 2QA4A 4IPCA 3DM3A 4R1JA 1XNRL 2QKIC 3I55A 1GRIA 1M4ZA 3NWTA 3QB3A 1SLJA 4BB7A 4K6DA 3CHBD 4ANJA 3T16A 4AIMA 1J3TA 1B34B 2DO3A 2OI3A 2Y0SB 4TRDA 4O5VA 1ZKOA 3S2HB 2LQ8A 2LX9A 3R6OA 2I5MX 4KUDK 2HEQA 4KHPL 3H41A 3HG9A 5I9OA 4OIJA 4IALA 2ZGWA 4OXPA 4UC4A 3RZOH 1SEMA 1XWEA 1VIEA 2NZOA 2HUGA 3FLGA 2D1XA 4CC2A 1VMPA 5KYUB 2MMPA 1YJ9A 1GUOA 1U9RA 1WXUA 4CGYB 3D8GA 1WTVA 4ZGJB 1I94Q 1CSKA 2HDAA 2QQBA 1HUMA 3RLNA 2BUDA 2PW7A 3QXEB 2K2MA 5C4HA 2UUBQ 2PNIA 1EQRA 1SN8A 2ZM6Q 2R7ZG 1RCVD 1EU3A 4JI8Q 1VQNQ 2B63G 2O2LD 3CMEA 3OIPA 4BBRG 4BY1B 1VQKQ 3H0GB 2RM4A 1K0SA 2VB2X 4A3KH 1D0YA 2JNGA 3HHTB 4IPHA 5C3EH 4ME7A 1ZX6A 1NNXA 2LT4A 4H44C 4RTTA 1I81A 4UY8C 4HJ5A 1ACMB 2L3SA 3SDZA 3VS1A 1F2MA 2EYLA 3WOEA 3GTLH 4OMFB 5C0XG 1FWZA 3V8LA 4BY7B 1G6PA 4JI2L 1K3RA 4M7DD 2BDNA 2LJ1A 4BY1H 1X3FA 2DBKA 1W4SA 2QDLA 3DLMA 1M8VA 2F0OA 2JA7B 4L6V5 5GMKm 1MJCA 3A55A 5L8RE 1YZ6A 4FXDA 1R9TB 2F0EA 1I3QB 4J9GA 2MPXC 4HTHA 2PUOB 1EIFA 3S14H 2J6OA 1S72T 1IYUA 2OWOA 2M16A 4A3JB 4A3LH 3BVMA 1D3BB 5KE2A 3QO2A 1G3SA 4JW0A 5AFWA 3F2CA 1OTCA 2RDFA 2F4IA 3K5OA 4DN4M 1M1FA 2RCFA 2EIFA 2F69A 1YIJQ 5C44H 3HP9A 2B39A 3S3MA 2FPDA 4UAIA 3L1AA 2E76C 5CV9A 4QB4A 2W10A 3QUIA 2DIGA 4F7UB 3KLRA 1JJGA 3I4MG 4C3JB 3E2UA 1N9SA 3QJYA 4XQ3A 2LVMA 2LNVA 1ZLMA 4A3FG 2VQEQ 1SJHD 1NE8A 3SGIA 5FK9C 2WSCE 4BDZA 2RHZA 2DRMA 1L1OA 4D8DA 2FXQA 1N32Q 3GP8A 1BNZA 4Z8AA 3VR4A 4E6IA 3RIRA 3EGUA 1JJ2A 4OGEA 1R4QB 5IYDG 2QEXT 1VQKT 2A28A 2PZUA 5GAGC 5L23A 3EG3A 1WTRA 1LTAD 1TS5A 2B2TA 3L2UA 4CDFC 4F8MA 2ZCFB 5LMNL 3OY9A 2UXDL 2OXPA 2H3JA 1X2QA 3NK9A 3AQQA 1QCNA 2P4TA 3LGFA 5KYYA 5EC7A 2RHXA 1YHQQ 4FXGC 4KKSA 3T13A 3OSOA 2JVVA 5BR8Q 4YIJA 5LJ5f 1LTSD 2B2UA 1B3QA 2LC4A 5ELFA 1VQMA 2AZVA 2DK3A 2HD3A 2RHYA 4LDXA 4LWCA 1N34Q 1B50A 4XK8E 2VC8A 5AJ3Q 3K57A 3VS0A 2KUMA 5J39A 3NBHB 1VQ4A 2GVAA 4BWGB 1X3PA 2DYIA 1PTOH 1M8AA
chains in the Genus database with same CATH topology
4P75A 1I8FA 4QVDA 4MMKA 4MZMA 4M7DE 2HNIA 4EMHA 4KUIA 4KLKA 3STBD 4OGCA 4XTCS 4M75G 1X01A 1X9NA 1PSEA 3CC2T 3S16H 4YWMA 1A62A 3HOWH 3CCVT 3ULPA 3HOYH 2YTXA 2R92H 4NXML 1UWVA 4POFA 3A8GB 1AE2A 4DV6Q 2R93H 3VUBA 3OTOQ 5C4XG 2QDYB 4LF4Q 4R4IA 3OBWA 1N9WA 3FRNA 4JG2A 3CW2C 1M1KU 4A4KA 5GAEC 4A3GH 2OTLT 3JAMc 3S15H 4YCVA 1CKMA 1JE5A 5GAN7 4LDVA 4M78B 4IFDJ 2C06A 4J7FA 5E7NA 3OTOL 2UXCL 2JA8G 4BBSG 1BBWA 3UDXA 2WB1E 5IYCH 5C0XI 3JB9H 3UE1A 5GAMj 2PUKB 3T9NA 1XNQQ 4X65L 4C92E 3OYDA 1G291 4QVZA 4DR2Q 1ZQ1A 4BA1I 1KL9A 5FLXE 4NXNQ 3F70A 2K52A 4IKFA 2YLCA 4Y91A 3PUWA 1NPPA 1GKHA 4OB0B 2N78A 4A3GG 5EAYA 3G71A 4OWWB 4BE1A 3OSSC 5IP7G 5GANj 3BW1A 2Y0SG 4XU1A 4C5EA 1YJWT 2E41A 1VQ8A 1FXXA 4JI0Q 5AYFA 1JJ2S 1Y1VH 5IYBH 5GROA 4DV7Q 3PGZA 1HNZQ 4JRKA 3EN2A 2YRVA 5GAN3 4DR7Q 3MXNB 2E6ZA 3ULJA 1FX7A 3D0FA 2RHQB 1VQLA 2QQSA 2BH2A 4M7AA 1H95A 2D0PA 1Q86C 1PYBA 2K5LA 1JT8A 2VXEA 3RKXA 4JV5Q 4C92G 4QQDA 2F3IA 5C0MA 3J81j 2M0OA 3BU2A 3JCMe 1VQHA 1IXRA 1N36Q 4JV5L 3SFMA 4XTXA 5LJ3h 4ELZC 1WJRA 2E10A 2M9UA 1M90C 1VQIA 2LXKA 5GAOm 4DR4Q 3K81C 3RMSA 5IT9c 1K8GA 2RO0A 2PQWA 4HA8A 1TWGH 1YI2T 4J83A 2R57A 2QGQA 4BI3A 3PUZA 2JA6H 4DKAC 2N3SA 2CYZB 2XICA 1KG1A 2MFIA 2E12A 4V2SA 2Y0SE 4M7DB 3EBEA 3KOJA 3JCMQ 4JUVA 1RIPA 4A3CH 1PVOA 4CI0C 3VYHB 3ICEA 4X9DA 4DV3L 2OCEA 1U1SA 3KXTA 2E2HH 5LL6S 4PG3A 5M3FG 1NMGA 1LJOA 3MEWA 1X55A 2Y4XA 1XPRA 4GY5A 1VQOT 3E9FA 3GLXA 4IUVA 3UE0A 4RCCA 2GN5A 4C5IA 4JS4A 5JJKA 2JA7H 1PH9A 2YU9H 5M9OA 4M77F 2K5FA 4C8QD 3OYLA 2KVQG 4JI7L 4A53A 3S3OA 2ID0A 3BJUA 2NZHA 4DUYL 4OB2B 3HPWA 3QPHA 2EJFA 4KHZA 4GN4B 3S24A 4L59A 3I56A 4B3RQ 1EYGA 3SD4A 3ER0A 2IX0A 4LFCQ 1OI1A 1P8LA 2R5MA 5FLXc 1KRSA 2JUFA 2CGHA 1OZ3A 4YHHL 4M77E 5FRMA 3JCMh 3CCSA 4YTLA 1VQPT 4PMWA 1PA6A 3PV0A 3ME9A 2QI2A 3E1SA 3UT1A 3OYJA 4QQBX 4JI6L 2EXDA 2HHHQ 4DR6Q 4M77D 4JOIA 4P72A 2VUMG 3CXCA 1WI5A 2D9TA 4HT8A 3FB9A 1VQPA 3OYAA 4C92B 1QUQA 2P0KA 4B3MQ 4PJOC 3PF5A 5IWAL 3JCMP 1OXXK 3S2DH 3URGA 4B9XA 4GNXA 5CKDA 3UWNA 1HNXL 1I4K1 3S1QH 1BIBA 1YHBA 1SSFA 1M1KC 4HKEA 2ZPFB 1FJGQ 1O9SA 1VQJA 2NN6I 4R56A 3OYHA 3JC66 3RMQA 2RHIA 3MEVA 3TEHB 4A3BH 4M78F 2E70A 2ZJQA 2ZM6L 2VQFQ 1NE3A 1VQDA 2VQEL 4B3SL 4DR2L 3OYEA 1EFWA 2PVOB 1YBYA 4MZPA 4JYAL 3META 1G51A 1GXIE 4J6YA 3OYBA 3G6ET 4MDXA 2DTHA 3I55T 3HSBA 3DKMA 4M7DA 5CR2A 4MZ9A 3S2HH 4A3IG 1WQWA 3TEEA 1CKNA 1R9TH 3JB9J 3W1BA 4EMKB 3JAMi 1PYSB 3X20B 3TS0A 3NFCA 1PH5A 2Z0SA 2OQKA 3RN2A 1YHAA 4LUVA 4R4QA 3PF4A 3HRUA 2EWNA 1XTDA 4GOPA 4RG2A 1HH2P 3E9GA 3BFMA 3H0GH 3HKZE 2HBPA 4DR3L 2DZ9A 2WB1G 3KFUA 4C3IH 4ZTFA 4X66Q 4C2MH 1IL2A 1IYJB 1D3BA 3L0OA 5IE8A 2EYQA 1E22A 2CWAA 3LW5E 5HY6A 4M75B 1OZ2A 2PQAA 4JLIA 5LJ5h 2JA5H 2X35A 1I3QH 3JB9F 4A4HA 4GKKQ 4HJ9A 1EQQA 2GF7A 3OW2A 2RI2A 1U1TA 4LF8Q 1PH2A 5GAOp 4YY3L 1YJNT 3CC4T 1FL0A 4P5NA 1NBWA 4LDUA 4IUPA 4JRQA 4BY7G 4LFBQ 4KI0A 4MMLA 3A8MB 2RJCA 3C12A 1ZHIA 1QVFS 1XJVA 2UXBL 2FB7A 3MP6A 1CSPA 4N0AA 4FDBA 4B3ML 3E9HA 2YHTA 4N4IA 4A4EA 4NS5A 3L2WA 1VQBA 1XQHA 2WAQG 4YCWA 4OX9Q 1XPUA 4BY6C 4MDWA 3G71T 2C35B 1K0RA 1BIAA 3F2BA 1BBUA 4D6WA 2MO1A 3K7AH 3LWIA 1XMOQ 4NXNL 4C5HA 1MGQA 4EMGA 1E3PA 1YJ9T 1N9RA 4X65Q 4TVAB 4HIMA 4BA2I 2XTIA 2WACA 3HKZG 4OWXB 3KUFA 1Q1BA 2RI3A 5HK3A 5CAIA 1X3EA 2UU9Q 4DV0L 2EJGA 2UUAL 3OA6A 4IJLA 1I5LA 4M7AF 2BA1A 3JCMc 3RZDH 5J3BA 4HCZA 3TQYA 4YWKA 4DK3C 1VQGA 3LWHA 5CKFA 3PTAA 3M55A 4LFAQ 2DUDA 2RJEA 1E1TA 5GANd 1SRUA 3HOZG 4LUZA 1KAWA 4A93H 3HOXH 1UGPB 2V8KA 5DLOA 3MEFA 1IBKL 2H5XA 1H3ZA 4GLVB 3Q8DA 4M75F 1KXLA 4BXXG 3KDFA 3E0EA 3JSCA 1UGQB 3HOYG 3OYYA 4L5SA 4LF6L 3HOWG 3M85A 3V7SA 4ZGDB 1Z9FA 1HJPA 4KHPQ 2PQAB 3OYKA 1GO3E 2YTYA 5GAMd 1ASYA 5GANh 2BA0A 1YITT 1K73C 3M7NA 1VQ5T 2VUBA 3VUZA 4GNXC 4DR7L 4RG1A 1SMXA 1UGSB 1V29B 2DKGA 5CKBA 3TCJA 3VYGA 1X3GA 3BDUA 1VQ9T 2JTMA 2X4XA 4R4OA 1I6HH 2QTXA 2UXDQ 1QP3A 2LXJA 3GTPH 3LGLA 2JA5G 5HKCA 1XMOL 3MHXA 1WJJA 1CKNB 3MP1A 4M7AG 4Y7NH 4LF8L 3HRTA 2L89A 5IYDH 3QIIA 3WXMB 3RKWA 1DJ7B 2G3RA 1IREB 2E64A 4DV5Q 4M77C 1BI2A 2ES2A 3CCUT 2HQLA 1NTGA 2RF4A 2NVQH 3FKIG 4GNXB 1M9SA 3GNFB 2ZZDA 3EAEA 3A5UA 3PCOB 4Y52H 4DR1L 4X66L 4XU3A 1PH6A 5IP7H 4K0KL 1Q46A 1QVGS 3OS5A 3VKIA 5D6YA 1S3OA 2VZAA 3KF6A 4F7UG 3G6EA 5EG2A 5IY0A 2EQSA 1PH3A 3U4VA 4LNQA 4MNOA 3LGJA 1K83H 1Y07A 1WQ7A 3ZEHA 3X24B 2RA2A 3QBYA 3A8LB 3MCAB 4UPAA 2A3LA 2MF2A 1BI1A 2YV5A 5C3EG 3CMAA 4JI8L 4N0AC 3M54A 2O4XA 3CCRA 4LF6Q 4J7IA 2B63H 5C6SA 3WVEB 1VQNT 4IUUA 4M78D 2BKDN 4LF7L 2KHJA 1TWAH 4OX9L 5GMKe 4IOAA 1TWCH 2R92G 2A8VA 4O6JA 4E7LA 4QJFA 1BKBA 2IY5B 3J80c 4M78A 3ULLA 3TRZA 3TU4K 4GLKA 2PMZE 1D7QA 1IBML 4F7UE 3DLLA 5CQYA 2QXFA 1M1GA 4DR1Q 5GANf 4LUOA 2YTVA 2JZ2A 1K8AU 4JYAQ 5GAOl 2I2LA 4TVRA 3QYGB 5LJ3d 4DV5L 2CQOA 4EDUA 5LMUL 3JCMg 3QYHB 4L5QA 3L2QA 4HT9A 2RD1A 1P92A 1VQAA 1N8RC 4KULA 4QL5A 2K5HA 4M75A 2RHUA 3GDEA 4B9WA 1KQ1A 4FSXA 3RLFA 2LT1A 1G3WA 1Q7YU 1WPYA 4A4IA 2RCNA 3OSVA 3MEUA 3STBC 1QVFA 3H8ZA 2P0QA 4HJAA 5JJIA 3P8HA 2V8JA 1YITA 5IWAQ 4GOPB 3I4MH 2DIQA 4QIWE 3M4QA 4LF9L 1V43A 2KK4A 4LDYA 4C8QF 4ZN3A 3J7ZC