3A5ZB

Crystal structure of escherichia coli genx in complex with elongation factor p
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
134
Chain Sequence
b'TYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lysyl-tRNA synthetase
publication title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 17
structure length 134
sequence length 134
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01132 EFP Elongation factor P (EF-P) OB domain
B PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
B PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a5zB01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5zB02
2R93H 1YZ6A 4HJAA 1HNXL 2PNHA 1K9MU 1AE2A 1N9WA 1N34L 1VQMT 2PI2E 1VQEA 3RR5A 4BY7H 1KC8U 1ASYA 2K5VA 3CMAA 3CCMA 3I56T 3DB4A 3U50C 3KLWA 1HNZL 1NMGA 1BVSA 1MJCA 4JI3Q 2NVYH 4GOPC 2PQAB 3P8BB 1EIYB 1VQDA 3BJUA 1OXUA 2I0QA 4DR6Q 5ELNA 2JE6I 1VQKT 2IX0A 3EIVA 4JI1Q 3RLNA 1KIXA 4C3HH 1YI2A 4O2DA 3CCQT 3G4ST 4JBKA 4DV1Q 4XTCS 2HHHL 4X66Q 5DLQE 4QY7A 2VNUD 1WJJA 1I3QH 4DR1Q 2G3RA 1M1KU 3CD6A 3T1HL 4LF9Q 1TWAH 1CKNB 1GM5A 1X55A 4QQBX 4B3SQ 3JAMi 1WCMH 3D0FA 3PO2H 2RHSB 3UE1A 1EOVA 3CF5A 4DV4L 1RIPA 3KDFA 2OWOA 3S1NH 1K3RA 3PGZA 1XMOL 4YWKA 5M5WH 2E5LL 2I5LX 4DK3C 4X64L 2YYZA 3J81c 3E9IA 4DUZQ 2LSSA 3KF6B 2WAQE 4PZ6A 4RMFA 4DUYQ 5E7NA 1HZAA 1W2BA 1M90U 1KQSA 2GVAA 2MO0A 4GLAC 4AYBG 2ES2A 3UDIA 1B8AA 1S40A 1D8LA 1YIJT 1Q86C 4WJ3M 1G291 4HIDA 3GTOH 3S1MH 4WJ4A 3CC7A 1SE8A 2R7FA 3G71A 1UE6A 2A1AA 2BH8A 1Q8KA 1K8GA 4HIMA 5FLMG 1X65A 1IBML 2UU9L 1OXXK 4JI8L 1PH8A 4A3MG 3CCST 1VQMA 1FGUA 3CW2C 4DNIA 4APVA 4A3FH 3K80C 5IT9E 4AH6A 1XPUA 1HR0L 4B3ML 2Q2UA 2A8VA 1X56A 3K0XA 3KJPA 3GTKH 3GTQH 4JYAQ 4K0KL 2ZTEA 1HZ9A 4DPGA 1IL2A 4DV2L 1L0WA 5BR8Q 4DV0L 2LQ8A 4IPHA 1M1GA 1E3PA 2VQFQ 4LF6L 3HOUG 1X3GA 2UXCQ 3T1YQ 3TS0A 2I5HA 1TXYA 2RCNA 4BA1I 1N8RC 1YHAA 5GQOA 4DV3Q 2C35B 2IT1A 1VQKA 4JI0Q 1YITT 2F4VQ 1Q82U 1VQ7T 3CC2A 5IYBG 2NVQH 2IHEA 4ME3A 3J81i 4A93H 1MIUA 4GKJQ 5FLMH 2UUBL 2E6ZA 4A3MH 1VQGA 1PH5A 4JC0A 3H3VI 3LGJA 1N34Q 3TRZA 5IYDG 2XHCA 4POGA 2CQOA 1IBLL 1X54A 1VQ8T 4YY3L 4JBMA 3PO3H 4AIMA 3S2DH 4JI2L 1UEBA 1LYLA 4P75A 1CKMA 4HJ7A 1XPOA 5LL6S 3LGFA 1XNRQ 3HOUH 2L15A 3CMET 2FXQA 2R7DA 4R4TA 4ZN1A 3W1BA 5C0XJ 3M85A 3M3YH 2Z6KA 4OXPA 2VUMH 1VQNT 2ID0A 1FVIA 4JI7L 5IYBH 2BH2A 1Y14B 2KCMA 1YIJA 2DO3A 3K8AA 3HOXH 1XNQQ 4LFAQ 2AWOA 4LW1A 2YTXA 2BA0A 4A3KG 2K50A 4C3JH 1K73C 5LMNL 1J5EL 1EYGA 4LFCQ 1EQQA 2WAQG 3CCSA 2K75A 3BZKA 4A3GH 4LNQA 4ALPA 1QUQB 5M5YH 1QZHA 1QVFA 5AJ3L 1EFWA 2JA8G 5IT9c 3LH0A 4BBRG 3CXCA 3HKZE 1XNIA 5HGQA 2JA6H 2WP8J 1XPRA 2ASBA 1EIFA 4DV6L 1N33L 1VQBA 4NXML 4HIKA 2UXBL 3BZCA 1XMOQ 3CPWA 4X64Q 5J26A 2ZJQA 2LVMA 3I55T 1CKOA 4A4IA 1G6PA 1JT8A 2UUCQ 3M4PA 1YITA 1WYDA 1E24A 1YHQA 1VQ7A 5JEAJ 4JI4L 1A8VA 2Y0SE 2JUFA 5IP7G 1L2FA 1N32L 2E2HH 1PH1A 4IPDA 2UUAL 4DR5Q 2OTLA 4JOIC 3RLFA 1PFSA 4LUOA 4JV5L 1Q81U 4PZ8A 2WB1E 4FDBA 4JI8Q 3J7AF 2ZJRA 3RNUA 1IBMQ 1C7YA 5IP9G 1XMQQ 4Y7NH 1VQ8A 3ULLA 4R4IA 3VDYA 4YWLA 1PH7A 1X6OA 2ZTDA 3STBD 1HR0Q 5IE8A 2NVXH 1L1OC 1L1OB 1UE1A 3AFPA 4B3MQ 5GAEC 5LMUQ 3LGLA 1GKHA 4QL5A 5C44G 1PV4A 4A3DG 3CCLA 3CMEA 1NJIC 4POFA 2ZJPA 1Y1WH 3CCJA 5C3EG 1JJ2A 4DV0Q 2IX1A 1VQNA 3MEFA 2E70A 1N8RU 3GTLH 4YCVA 2GVBA 3L0OA 1K8AU 5IP7H 3CCUT 4L5TA 2AWNA 3A5UA 2KVQG 1X3FA 2R6GA 3FHWA 4OWTB 3UDFA 1PH6A 4A3BG 1VQ4T 4GKKQ 3PUXA 1A63A 1Q46A 1Z9FA 1E1OA 4R1JA 3GO5A 4Y52H 1KD1C 2I5MX 2E2JH 1Q7YU 3CC4A 3CCRT 5IP9H 4A3IG 2B63G 4LFBQ 4A3BH 4IPCA 4GOPB 4GN4B 1IBLQ 4AQYQ 3RN5A 4X65L 4X34A 1BKBA 1WOCA 5C0XI 4JI2Q 4A3DH 4A76A 3CC2T 4PMWA 1KXLA 4OO1I 4NXNL 5C3EH 1R9TH 1TWFH 4IJHA 2KBNA 3I55A 2JEBI 1VCIA 1AH9A 1VQHA 3S1RH 4DR7Q 1HH2P 2HIVA 2D62A 1EWIA 1I94Q 1SN8A 4YWMA 1KRSA 4DV7L 4JI7Q 1HNWQ 1NTGA 2XTIA 5GAHC 3DB3A 3KYHC 3PV0A 4NPSA 5H1SE 4P73A 4GNXA 3OW2A 1HJPA 1OXSC 3PUWA 4DR2Q 1OTCA 2B63H 1LM0A 2VQEL 4IOCA 1MJEA 3AQQA 2VL6A 3RLOA 4EQ5A 3PUVA 4HJ5A 4BBSG 3I4MG 2OCEA 3BU2A 3ULJA 4LF8Q 1HR0W 4HIOA 5IWAL 1N36L 5FJ8G 1LTLA 2IHFA 3U58A 4OO1G 2UXBQ 4DV6Q 2WB1G 3GDEA 1XJVA 4R4CA 2KDSA 3J7A5 2JOYA 2CKZB 2VZAA 3TS2A 3CCUA 2PI2A 1B7YB 4A3CG 3ICEA 3J80E 4DR4L 1NY4A 2HQLA 2VS1A 1PHJA 3RZDH 1VQ4A 1JE5A 2MI6A 4DV5L 3CQZH 2UUAQ 3PCOB 2AKWB 4IO9A 4IJLA 2Q2IA 2N49A 1VQJA 3CCRA 2Q2HA 2DGYA 5FLXE 1TWGH 3KOJA 3CAMA 1HZBA 4GS3A 2JA9A 4BBSH 2CCZA 4LF5L 1S3OA 4JBJA 3AFQA 4X62L 3J81j 4TQUS 1PH4A 4BXXG 2MWPA 3FP9A 5FJ8H 1YHQT 2PQAA 1Q1BA 1YNXA 3CCVT 5JEAG 3OTOQ 4B3RQ 2OTLT 4JI6L 4BY1G 3S24A 2JJQA 3NENA 1PH3A 4YHHL 2JA5G 4A3CH 3S2HH 1C0AA 1D7QA 4GLXA 1QVCA 3AEVA 1HNXQ 4O0AA 1B70B 3DM3A 3PF5A 1PYSB 3RN2A 1CKNA 3DLLA 2K5HA 3UDXA 5HY6A 4R4OA 3A0JA 2UXDL 3OW2S 2K4KA 4KLKA 1OXVA 4R4QA 2CWPA 3CCLT 2KENA 3F8TA 1HNZQ 3CCJT 4LUVA 4RG1A 4BXXH 1K9MC 5GADC 5J3BA 4EX5A 4BA2I 1S72T 5JJLA 1G51A 2N78A 2AMCB 3KF6A 1W2BS 1KQSS 3M4QA 2CFMA 1KC8C 1CSQA 3U4ZA 1YHBA 3PSIA 1VQCA 2HHHQ 4MZ9A 3T1HQ 5IAYA 1GD7A 5IYDH 3CC4T 2IY5B 1VQ6T 1VQFA 4DR6L 2NVTH 3JAME 3J80c 4H02A 4JI1L 4DV4Q 4MTNA 1KL9A 2NN6I 3UE0A 5ELOA 4DV1L 4DR3L 1JMCA 2VQEQ 4DR1L 1VQPA 1E22A 4LF9L 2LCLA 4L5SA 2L3RA 4HJ8A 2E5LQ 4YCWA 5FLXc 1YJNT 1C9OA 1LUZA 1W3SA 3HOYG 1SRUA 1Q86U 3KJOA 3HOZG 2K52A 4A3KH 3RZOH 1N36Q 4A3EG 3CCVA 1V43A 1U5KA 1X3EA 2EIFA 2YTVA 4UP7A 5M3FG 1CSPA 3J7ZC 2JA7G 4DUZL 3H3VH 1Q12A 3M7NA 3PUZA 3AYHB 2BA1A 4J15A 4QGUA 2UU9Q 4DUYL 1NPPA 2JA8H 4JG2A 3TQYA 2B29A 4BBRH 1M90C 3I4NG 1SR3A 2KCTA 2N3SA 2Z0SA 5GAGC 2NN6G 4DV5Q 4K0KQ 3ULPA 4DV2Q 3NELA 1I5FA 1YBYA 3W1GA 4PZ7A 3J80i 2MFIA 2JVVA 4GNXC 4LF6Q 3KDFB 4QQDA 4A3JG 3ERSX 1S72A 2R93G 2JNGA 4OONA 1SLJA 4L5RC 2YU9H 2ZM6L 4JYAL 2NZOA 1YJWT 4GN5A 3WWVA 4UY8C 1SSFA 3CPFA 4OX9L 2EQSA 3A74A 5BR8L 2ALYB 2XGTA 2UUBQ 1NPRA 1IXRA 5IYCG 4JI6Q 2UXCL 2DUDA 4YHHQ 2VQFL 4HJ9A 1IBKL 3T1YL 3B6YA 1VQ6A 5DM7R 2MQHA 4JCVE 3GTMH 4QIWE 3I4NH 4CRIA 3EBEA 2PMZE 4GN3B 3U4VA 4YY3Q 1FL0A 1Q82C 5C44H 1QVFS 4UP8A 2UXDQ 3KBGA 1QUQA 3H15A 3CXCS 3M9BA 1CUKA 1IYJB 1VQLA 1YVCA 1YJNA 3F1ZA 3CCET 2WFWA 3MXNB 2OQKA 4QJFA 4A3JH 4IFDJ 1EQRA 1Y1VG 2V1CC 3CPWS 5M5XH 1HZCA 1WCMG 1WFQA 3TREA 2D0OA 3HKZG 3PO2G 3F2DA 3I2ZA 1K73U 5IYCH 3F2CA 3EN2A 5LMNQ 1J5EQ 4YTLA 1XNRL 1JJGA 1J6QA 3IRBA 4A3IH 4LF4L 4JOIA 2HIXA 3STBC 4GLVB 2Y0SG 3HFZB 1XNQL 4JI5L 4JBWA 5AJ3Q 4LFAL 3PIOA 2NZHA 5GROA 1QVGA 2MNAA 5C0XG 4P71A 1JB7A 4TVAB 3D31A 1V9PA 4LFCL 4DR3Q 1N33Q 4NXMQ 1L1OA 1Y1VH 4LF7L 4OWXB 1VQIA 1JJ2S 3E0EA 2E8GA 1X9NA 1VQOT 2VW9A 2JQOA 1V1QA 3OYYA 3K7UC 1YJWA 4A3FG 4B3TL 2CKKA 4JI4Q 1WI5A 2B3GA 3GD7A 4KHPQ 2JK8A 3G6EA 2OQ0A 2QGQA 4DAMA 1N32Q 1PVOA 4TVRA 2QA4T 1GO3E 2Z6KC 1T9HA 3I4OA 2RHQB 2EXDA 3S14H 2N8NA 1UE5A 1PH2A 5JJIA 1YJ9T 3KF8B 2LXJA 4JV5Q 1FJGL 1VQPT 1VQ9T 4MNOA 2UUCL 3I4MH 3H0GG 4UP9A 1K83H 1PA6A 3TEHB 3PIPA 2QEXA 1UWVA 3F2BA 4DR5L 1A62A 3KFUA 4GOPA 4A93G 1NJIU 1E7ZA 4ZN3A 2K5NA 3G48A 1YEZA 5K36G 3CCEA 1U0LA 1TWCH 1Q81C 3I7FA 3S17H 1XMQL 1NZ9A 2ZTCA 3L2PA 1KHIA 4RG2A 2ZM6Q 3S1QH 5LMUL 1VQ5T 3PO3G 1GVPA 3I56A 3UDGA 4OX9Q 2MWOA 2CWAA 1KD1U 4C3IH 5LMNW 3GTGH 3HKSA 2OTJT 5JJKA 1H95A 1IZ6A 3H0GH 3A5ZB 1IBKQ 2F52A 4A3LG 3M4OH 3JC66 4NB3A 3SGIA 4XIGS 5A2QE 2A19A 2E2IH 2R7ZG 5M3MG 2VUMG 4LUZA 1K8AC 1K0RA 2F3IA 2YV5A 3CCQA 3G4SA 2K14A 4LWCA 4X65Q 3HOXG 4IFDI 4GKKL 1QVGS 4NXNQ 4BY1H 1SMXA 2JA5H 5EAYA 4LFBL 3NEMA 1VQOA 1Q7YC 4JI3L 4DK6C 4P74A 4DV7Q 1PYBA 2Q2TA 2H5XA 4A3GG 4AQYL 4KHZA 4IPGA 1VQAA 2QA4A 1DGSA 2KHIA 1NBWA 2JEAI 1VS0A 1YJ9A 1SFOH 4X66L 4DKAC 2ATWA 1VQ9A 1BBWA 2LXKA 2MO1A 4PG3A 2R7ZH 3E9HA 4LF4Q 4DR7L 1M1KC 1VQLT 5M3MH 1I94L 4B3SL 1HNWL 4JI5Q 2RF4A 1QZGA 2R92G 4IFDG 5IWAQ 1I6HH 3S15H 1Q1EA 4YCUA 1KRTA 4DR2L 1KAWA 3CMAT 1A0IA 1UE7A 3CCMT 3PUYA 4A75A 3HOVG 1NE3A 1EUJA 4LF7Q 2HT1A 3ER0A 2AHOB 4LF8L 1BBUA 4X6AH 4DR4Q 1VQ5A 4B3TQ 1TWHH 1P8LA 2YTYA 1P16A 2JA6G 1NMFA 3NBHB 3W5OA 4P72A 3HOWG 2OTJA 1YI2T 3S16H 4A3LH 5C4XG 4OWWB 2IG0A 1Y1WG 3FKIG 1FJGQ 3CD6T 4C2MH 4LF5Q 4GNXB 1RL2A 2KHJA 1I50H 2R92H 3HOYH 4X62Q 1SROA 3HOZH 1O7IA 3GTJH 4A3EH 3PF4A 1E1TA 4AYBE 2JA7H 5M3FH 1Z47A 1AE3A 3K7AH 5C4JH 2D0PA 3G6ET 3Q8DA 4DAYB 1XTDA 3HOVH 4BY7G 3J81E 4KI0A 4L5QA 2GN5A 3GTPH 1JJCB 1ASZA 4KHPL 2VY3A 4DV3L 2F4VL 4JI0L 3ZJYC 3L7ZC 4IOAA 1MKHA 3CP0A 3K81C 1PH9A 3HOWH 1OXTA 5C4XH 3JAMc 4GKJL 2QEXT 3OTOL 4B3RL 4UPAA 3FKIH 5IY0A 3CC7T 3G71T
chains in the Genus database with same CATH superfamily
2RK2A 1UHFA 1BUVT 4HJAA 2RI2A 1PSEA 1KHCA 2PNHA 2K04A 2X4YA 1AE2A 2E12A 2CUBA 3Q6SA 2V8KA 4DV0Q 1M8VA 1LT6D 3IAYA 4U673 4JUVA 1JE4A 2JSOA 4PLLA 3PTAA 4C8QA 1KC8R 3A8HB 3FEWX 4IALA 1WGSA 4L6TB 1HNZL 1NMGA 2L1BA 1JJ2P 1X69A 4M75G 3RKXA 3ERQA 3MA2B 2C0OA 5GAOn 1YHQQ 5IGFA 1OXUA 2I0QA 2JE6I 4RCNA 4JI1Q 2F3VA 3CCVQ 4DBQA 3FRPB 4XTCS 2IX3A 5DLQE 2VNUD 3M4YA 3GQBA 4LF9Q 2DRMA 5FOBB 4QQBX 1ZUUA 2EYOA 4DGZA 3JAMi 2HCKA 1ZYRD 5DAUA 1PKTA 4M7AD 5GMKi 1WZOA 4DV4L 1Y96A 2CDTA 2YLCA 3H3VC 4TKOB 4KH1B 3PGZA 2XI9A 4YWKA 1XMOL 1U1SA 2M9UA 2LSSA 3KF6B 2WAQE 3NMZC 1WJQA 1I4HA 2F0IA 4RMFA 1K8OA 1M90U 2GVAA 1JORA 3EGDA 2E5KA 1B8AA 1HQRD 3OYHA 1U5SA 1DM0B 1SE8A 1U8RA 1UE6A 1V8QA 2F69A 2A1AA 5LJ5f 1X65A 2LQNA 1IBML 4QT7A 3CC4Q 1G2TA 1S1NA 2F0EA 1OU8A 3MKDA 2P0PA 3K80C 4AH6A 4A3FH 5M9OA 1Y1WH 5KYIA 4JYAQ 2EPBA 4AFQC 1HZ9A 5GAN4 3HRZC 5D3IB 1SYFA 2LT1A 2RI3A 4PJOF 1Z6HA 3K6OA 4LDUA 2LQ8A 1AZEA 1YJNQ 2RQTA 4M75D 1IW7C 3A8KE 4IPHA 4EGVA 5IHNA 2VQFQ 4BA1I 4NDXA 1RTOA 4KHPQ 3H0FA 2JXMB 1NLOC 5C44B 4M78G 2IT1A 2WSFE 4C5EA 4A93H 2MCNA 3IKJA 1PWTA 3QBYA 2BDNA 1Q82R 3OYDA 1TWFB 1RLPC 4DA2A 1XOVA 5K36H 1D3BB 2AUJD 3VS5A 2ESWA 1AZPA 3R3OA 1QE6A 2IW3A 5DEHA 2BKDN 4LD6A 3LGJA 1SBBB 3D6WA 2K5FA 2CQOA 2E2DC 1IBLL 1VQ8T 1GUGA 4JBMA 3H9NA 4AIMA 1E2VA 3MCAB 1UEBA 1LYLA 2F0LA 1HQMC 1X3PA 2JN0A 1CKMA 1HTPA 2FINB 4Z9CB 5IHIA 3HOUH 3QB3A 1TUCA 5C0XJ 5HK0A 3NPFA 2Z6KA 4MZPA 4OXPA 2NUTA 2ID0A 1YNND 2BH2A 3A8OB 4F16A 2DETA 1YCSB 2V26A 2CP6A 2Z4IA 5LL6X 2C9OA 3MTSA 2X51A 1F2YA 1YNJD 1X6BA 1GBRA 2K50A 1J5EL 1Y1VB 2FMMA 1EYGA 3O13A 4LFCQ 4ELZC 2WAQG 2K75A 4KJNA 1B3AA 3TP6A 4A3GH 1AWWA 3ITPA 1RD9D 5FW9A 3VYSA 3RZDB 5M5YH 1QZHA 1EFWA 5IT9c 5KCHA 1XNIA 5HGQA 1CKBA 2P0KA 1AHJB 1ZX6A 3X25B 4KY5A 1N33L 1TWGB 1VQBA 5IGCA 2ASBA 3MO8A 1BO0A 3BZCA 1XMOQ 3PVQA 3CPWA 5J26A 1K83B 3SD4A 5JAVA 1JT8A 4R55A 4KTAA 3SR1A 1WYDA 4IIMA 1OPKA 1YHQA 3QKJA 4DQ2A 4IFDH 2CREA 2LQWA 2ZCFB 5CV9A 1WX6A 2E2HH 2R5MA 2EYZA 3PFSA 2OTLA 4LXCA 1DOKA 4JOIC 2L9HA 5FU7B 4HT8A 4MDXA 1TXQA 1IBMQ 4DOWA 1OX8A 2JZ2A 3MFYA 5CMDA 2ECZA 1VQ8A 2HAXA 1WIEA 4R4IA 4Y7NH 3OYKA 1X6OA 1PH7A 2H3EB 2JA6H 1UAPA 1L1OC 3AFPA 3QJYA 4JW0A 2G6FX 3K0YA 2DTIA 1WA7A 4J6HA 3TP8A 3MXGA 2ZJPA 1XYIA 1A2TA 5GAOl 2QAZA 5GAMe 1BNZA 4M75A 4PFZA 3JRZA 1MGQA 4OMPA 2HQXA 2KVQG 1G2SA 2R6GA 1U4RA 4HAEA 1VQ4T 2DILA 4QF4A 1TS9A 1F77A 3PUXA 1PH6A 4OGEA 5LHY1 4QMGA 4R1JA 3NUCA 4X3UA 1VQPQ 1KD1C 2I5MX 3VA7A 1K9AA 1Q7YU 3CC4A 5IP9H 2E2JH 2B63G 3BYTB 4L8JA 4A3BH 1O75A 3TU4K 3UA6A 4IPCA 5IH2A 2Z1CA 3RMHA 1IBLQ 4AQYQ 4C92C 1UE9A 1BKBA 3CBOA 4DFAA 1SFOB 3FEOA 4PMWA 5C3EH 1PTOD 1TWFH 1EY6A 2JEBI 1VCIA 2F0UA 1AH9A 2DKGA 2HIVA 1EWIA 4YWMA 1HNWQ 1SNCA 2XTIA 1WQWA 3MZ5A 3DB3A 4ULLA 4QVZA 3OSSC 3VUBA 4RG8A 5EGTA 5GAHC 2ZPBB 1HJPA 1OXSC 2A68D 3VA5A 2K2VA 2CGHA 3FDRA 4DR2Q 1O9SA 1OEBA 3FRNA 2VQEL 1BDOA 2VL6A 4HJ5A 4DAYA 3FPUB 3I4MG 1GHKA 4K2LA 3ULJA 2AK5A 3LW5E 1K76A 2DTHA 1N36L 4Y28E 3JB9I 3QO2A 1JRIA 2EW3A 4C92F 4S3SA 4R4CA 4J8OA 2XVSA 3K5OA 1K0SA 5E4WC 3HOYB 2OT2A 1SRLA 2JTEA 3JCMJ 2K7AA 2XDDA 1U4PA 3TS2A 1B7YB 3GTJB 3ICEA 3LWUA 2GCXA 1NY4A 4X3KA 4J9CA 2EJFA 2DXUA 4M78A 4XTWA 1VQ4A 3RZDH 5JPMC 4HMIA 2MI6A 3C4SA 4HEDA 3Q1JA 4KUDK 1DD2A 1VDZA 3NFCA 4J6XA 5FLXE 1TWGH 2DX1A 2QXFA 2Y4XA 5CKDA 1F2LA 5A0GA 1SYEA 2NZ1D 4TQUS 3Q24A 4ME7A 5GAMg 4OGQC 1FNVA 3TBIB 2A73B 2PQAA 3MHBA 3TP5A 4NS5A 2R93B 3OTOQ 3CQTA 4WFN3 4QVDA 1ZYRC 4ZCKA 1PH3A 4A3CH 5GANh 4GLXA 3AEVA 2NUPA 4M7AC 1LJOA 3PF5A 1PYSB 4BY7B 2L11A 1KNEA 2OAUA 2VKNA 1JB0E 3JCMW 1EFID 1I5OB 4BE2A 3OW2S 2YUPA 1OXVA 5IGDA 4XXEA 2I46A 2C0TA 3OYNA 5IT9L 4LUVA 4BXXH 5J3BA 1ZSZA 1S72T 5FU6C 3DHQA 4C3HB 2AMCB 5GANf 3M4QA 4RHRA 2R58A 2CP2A 2QDBA 5GJVB 2CFMA 1CSQA 1EOTA 4MZ9A 1WCMB 5IAYA 4QKUA 5A2QL 4MMLA 1GD7A 3PO2B 5IYDH 5KYYB 2KI7A 2PVGB 1CQFA 4K2KA 2DY8A 2XRQD 4OB0B 3JAME 1Y7XA 1JO8A 2MAMA 2GTOA 4IN3A 4DV1L 1LNXA 1Z9ZA 4M75C 3CC7Q 2ED0A 1JMCA 3PMTA 2VQEQ 1AZGB 4C0ZA 1VQPA 2LCLA 2Y0SB 4HSPA 5CAIA 2V1RA 4YCWA 3A8IE 1MD2D 4KBMB 4ZLTF 1LUZA 1W3SA 3QR8A 3BDOA 2E5QA 4C8QB 1Q86U 1GHJA 1JQYD 1NR2A 4A3KH 3GTOB 1N36Q 1PSFA 3S1MB 4A3EG 3A98A 1M1FA 5KGUA 1AWJA 3ZL7C 4J9GA 2EVBA 4J6WA 3H3VH 1UUEA 2UU9Q 2EGCA 5F2DA 4LD9K 2F1LA 3CC2Q 4QW2A 1WHLA 2SEMA 3CCQQ 2KCTA 1ABOA 1SHFA 1FR3A 4K11A 2ZPGB 3ULPA 1WQ7A 1WTHA 4DV2Q 4RWSC 3W1GA 5CIUA 1YNNC 3J80i 2LT4A 4DNRB 1HK9A 2MFIA 5GAOr 1Y96B 4A54A 2DM1A 2ENMA 1S72A 1PFBA 2BOSA 1YNJC 3WDNA 3GNFB 3VJPA 2JXBA 1PM3A 3A55A 2CP0A 1FX7A 1M8MA 2L89A 3UA7A 1S4ZA 4QB4A 4A3MB 4QIWB 2V4DA 2ALYB 2UUBQ 4ZNXA 4ZYSA 1QOHA 1HFGA 2HZYA 3EGDB 5KE3A 2YDLA 1IBKL 2MQHA 3CU7A 1I6VC 3PO3B 3S2DB 4FYVB 2EKOA 2M00A 3MXUA 3GTMH 3E3XA 3I4NH 1BK2A 3BDLA 1B50A 4TRDA 1PRTB 3H41A 2H3JA 2EQMA 3A8MB 1F9QA 2DJGC 2KEAA 4JPBW 5LJ3f 5HKCA 2FJ2A 3G7ZA 2EJFC 3CCSQ 3K59A 2YRDA 4FO2A 4IFDJ 3OIPA 2VUMB 1W70A 1Y1VG 3H6MA 3ND9A 3LH5A 2O2OA 3CPWS 5KNDA 1KLGD 5M5XH 1WFQA 2D0OA 4IQZA 4C3JB 2FHDA 1K73U 3OYAA 5IYCH 1VA7A 3EN2A 3LNNA 1XNRL 3FJPA 1KFZA 1J6QA 4JVZA 3PMIA 2K4YA 4GLVB 5AJ3Q 2E64A 2ZT9C 1QVGA 3AB9A 4BE0A 2QF7A 4H0LC 2K57A 2DJZA 5CK9A 1WTXA 3UATA 5CC4A 3EG1A 3OQ5A 4HVWA 4LF7L 4WORA 3QXEB 4WTOB 3FDTA 3U9SA 5CV7A 2E8GA 3PIP3 2E74C 5CYUA 2VW9A 3M0QA 3K7UC 4B3TL 4JI4Q 3G6EA 4CGYB 3NBIA 1PVOA 1OYXA 1GO3E 4M7DG 1BCOA 2AQ1B 2NUTB 4XTXA 5HGTA 4JV5Q 4RHSA 4PJOE 2Q8RE 2COZA 4L63B 1B07A 1PA6A 4CBVA 4K5XA 3UI2A 2QQRA 3ZEHA 3PIPA 2QEXA 1PTOC 4OO1H 1Y1WB 4GOPA 1E7ZA 1NYFA 1RTNA 4E7KA 1U0LA 1Q81C 4HCEA 4QQGA 3TVTA 2CP7A 3S17H 1XMQL 1NZ9A 4G7ZC 1EZ8A 2A68C 1KHIA 2ZXPA 4F04B 1K28A 3Q22A 1IXDA 5DNFA 4HVVA 1U06A 1LTSD 4H7BA 2DIQA 3I55Q 4WJWA 2NVYB 2EZVA 4MN3A 3H0GH 1IBKQ 2F52A 1QP2A 3L9AX 1NLPC 3QO3A 1R4PB 3IL8A 4OIKA 2E2IH 5M3MG 4LUZA 1GUSA 3JSCA 3HTRA 4BDYA 4OB3B 3CCQA 4X65Q 4CC2A 4F7UB 4M77G 2DD5A 1I3QB 4NXNQ 1PTOF 2QW7A 3EROA 2CUDA 5A35A 2HSEB 1WJSA 3NEMA 1RJTA 2K03A 1STAA 4FYYB 1PYBA 2KGTA 4CC3A 4J8QA 4KHZA 1D5MC 1WTVA 1VQAA 4GBQA 4M7DD 3FB9A 2VWFA 4RTTA 4EMKC 1NBWA 1SJHD 1VS0A 2LJ3A 5M5WB 2COWA 4OP0A 3C0CA 3PE0A 2GFUA 1WTPA 1I94L 3EA6A 4B3SL 2R57A 1HA6A 5CV4A 2MPMA 1GOZA 2RBMA 1QZGA 4IKFA 3JB9D 4XQJA 2R92G 2CZ7B 1JXOA 3S15H 1WHGA 2RH2A 4LDYA 4YCUA 1KAWA 2DERA 1F9SA 4PJOG 3THKA 1UE7A 3L42A 3CCMT 1EWHA 2X69A 4E6RA 1NE3A 1SNQA 4LF7Q 3ND8A 3ER0A 3QJ6A 1EYDA 2MIOA 3OYBA 2HDMA 3I70A 1M9SA 1U4LA 1IRXA 1BBUA 3M5AA 4LF8L 4B3TQ 5I9OA 3GTQB 1P8LA 2A6EC 2YTYA 4X6AH 1STBA 4KGZB 1NMFA 1M3BA 3L1AA 2EDGA 4RTUA 1VIEA 2K5QA 1TTHB 3TZDA 3FKIG 2KVMA 4RGTA 4ZUIA 3CD6T 4LF5Q 1RAHB 3A8GB 2PQEA 3IQLA 3W2DA 1QVFP 3SK8A 2BE5D 5GAN8 1FWZA 2D0QB 2VC8A 1BYMA 4RKUE 3OPOA 4ODGA 2L0AA 3SE0A 2B2YA 5M3FH 2P4TA 2D0PA 2KRMA 4DAYB 1XTDA 4LE9A 3HOVH 3J81E 4BY7G 3S2HB 3LWEA 3MFGA 2GN5A 2XWJB 1S5CD 4Q0FA 1UJYA 1JJCB 5COYA 2F4VL 2QDLA 2JTFA 1J8IA 4IOAA 1MKHA 3CP0A 3K81C 1TKWB 2W10A 3DM1A 4EVOA 2LZ6B 4GKJL 1EU3A 4N8X1 2OXPA 3G71T 4M78B 4AMCA 1YZ6A 3H0IA 2K5WA 4FYDA 1HNXL 3OSVA 3M0RA 4QUCA 1N34L 1VQMT 1CTMA 1K9MR 2KE9A 2K2MA 4O1NA 1B44D 4JZ4A 1KC8U 3I9QA 1K1ZA 1T3LA 2HQEA 3CCMA 2YUQA 1BB9A 1D0ZA 2M16A 1EEID 3V05A 3HG9A 1I1JA 2XICA 2RN8A 3NTHA 5D6YA 2NVYH 2DL3A 2PQAB 5H1SE 4GOPC 1VQDA 4BDZA 1EIYB 5IGEA 2NVTB 1G8XA 2M02A 5E1FA 3INZA 4DR6Q 2IX0A 4J7IA 5LJ5e 3EIVA 3DXJC 4HCBA 3I4LA 4O2DA 4M7DA 4H44C 2NUPB 2HHHL 2OF1A 4JBKA 3PVLA 5A0LA 1I3QH 3BW1A 1M1KU 1WJJA 3CD6A 4C92E 3T1HL 3KLSA 4LK1C 4B3SQ 2EWNA 1KIKA 3JCMe 1XXGA 3T56B 3CF5A 2DY7A 2WAQB 3KDFA 3Q23A 5I4DA 2OWOA 3S1NH 4JJNK 4FVMA 5M5WH 1ZSZB 4DUZQ 4KT0E 2YYZA 2B2VA 4PZ6A 1D1IA 4DUYQ 5E7NA 1QKXA 3BYYB 4RAUC 2ES2A 5FK9C 3UDIA 1WNLA 1D8LA 1YIJT 1D0XA 4WJ3M 2DPPB 4EDUA 1A15A 4HIDA 1N9RA 2YHTA 3G71A 1EY4A 1K8GA 2KBTA 3HZXA 1OXXK 4JI8L 5C4HA 1PH8A 4A3MG 2NUCA 1VQ6Q 1VQMA 3I91A 4DNIA 1SAPA 2YU9B 1K0XA 4APVA 5CQXA 4CI0C 3UF4A 4HVUA 2Q2UA 2VB3X 4BWGB 3GTQH 3KJPA 2VVKA 4K0KL 4M77A 1NEBA 2ZTEA 2KCCA 2DEUA 5J39A 3RKYA 1O7YA 1VQLQ 4FXKC 2XK0A 2P0QA 1M1GA 2UXCQ 2DBMA 3T1YQ 2KROA 4RCOA 3TS0A 3OS0A 1RAEB 1N8RC 2F4VQ 4A4KA 4GZYC 2C35B 1HFNA 2FRWA 4Q5WA 4DOVA 1MMAA 1Q82U 1VQ7T 1IHWA 5IYBG 1FYNA 3S3OA 2OAWA 4C8QD 4C5IA 3V8KA 4GKJQ 3X3NA 4RTYA 3OIQA 1B2TA 1WYXA 2EQIA 3O5ZA 2BE9B 1YWPA 4FF3A 1N34Q 3NP8A 3IFDA 1F9RA 4YY3L 1IKMA 1FNUA 4JI2L 2B63B 4HJ7A 1G3TA 5LL6S 1GL5A 5LJ5g 4PJOA 1NR4A 3M85A 4R4TA 2FO0A 3W1BA 1Y8OB 3DWQA 2NTSA 1VQNT 3LWIA 3GV3A 4JI7L 4I7ZC 2JA7H 1D2BA 1XNQQ 1YIJA 2DO3A 1YJWQ 3K8AA 3HOXH 3KK7A 3I5SA 4E7JA 3OWFA 1QQJA 3A8LB 2HBWA 2VXFA 3HRSA 3MP6A 3JCMg 2BA0A 1X6GA 4LW1A 4UAIA 2EYFA 5LMNL 5GMKl 3A7AB 2BZ8A 1F2ZA 5EBCA 3HS0C 3BZKA 4LNQA 3OBWA 3E0JA 4CHTB 3BVZA 5ELCA 1OQKA 4KY6A 2PYKA 2JA8G 1SDFA 4RGOS 4BBRG 3CXCA 3HKZE 1BI1A 4D8DA 3IFTA 3BS1A 1XPRA 2UXBL 5CKBA 1PMRA 4NXML 4HIKA 1PRTD 3CCEQ 3I4MB 1Q3LA 2B2UA 3EQLC 1TG0A 2RJFA 2ZJQA 2LVMA 3RMQA 1M4VA 1GCQC 5GAMj 2UUCQ 5JEAJ 1VQ7A 3D4DA 2JUFA 5IP7G 3EFRA 1ACMB 5FU7C 1EZ6A 2ENBA 4LUOA 1HRJA 4FDBA 4JI8Q 3J7AF 2NYSA 1C7YA 1UG1A 4RMOA 4M7DC 4MHEA 3ULLA 3VV0A 2PW7A 5IE8A 5LMUQ 1CFMA 4V190 3GBQA 2EJGC 2DZCA 4QL5A 1PTOH 3EHQA 1NJIC 4POFA 4F7UG 2BZYA 2LCCA 4NL3A 2E70A 2DAQA 1VQNA 3GTLH 5NUCA 1TS3A 1OX9A 3CCUT 3E5SA 4L5TA 2AWNA 3A5UA 1K8AR 1X3FA 3FHWA 5HK3A 1KABA 1Y07A 3C12A 4AFZC 4JS4A 1BOSA 3TMEA 5C6SA 4GKKQ 1Q46A 1A63A 4CC4B 1C6VX 3OBYA 4EIKA 4OB2B 3LWHA 1VQ9Q 4Y52H 3M0SA 3CCRT 2B39A 2KHSA 2DF6A 2FL7A 4A3IG 1RAFB 4QQ6A 3E9FA 3I90A 4GOPB 3AHUA 2RNAA 4BE1A 1ENCA 4GN4B 1H9KA 3RN5A 2L4NA 4X34A 1LTTD 4JI2Q 3HSBA 1K4US 3LX0A 2R7ZB 1YCYA 3M0UA 1U4MA 3I8ZA 4DR7Q 1HH2P 4M77C 2D62A 1EZZB 4XTZA 1M1KR 1C48A 2BE5C 4CDEC 4DV7L 4JI7Q 1VQ5Q 2F0GA 4N0AC 4ID6A 4NKLA 3JCMX 1EQVA 2X3XD 4GNXA 2EOTA 3OW2A 4JLGA 3PUWA 2WACA 2M51A 2OTJQ 2B63H 1LM0A 2JS0A 3R2IA 1MJEA 1X75C 1M3CA 4RTXA 2RM4A 4MDWA 4FIBA 4A4EA 3MC0B 1IGUA 1VF7A 1MBYA 4HIOA 5IWAL 2C06A 1JB3A 4IUUA 3U23A 1LTLA 2KRNA 1Z9QA 4ZQ3A 5FJ8G 3U58A 2UXBQ 1XJVA 1JWUD 2RDHA 4EPCA 1BXTA 1EWCA 4X3TA 2KDSA 1NCVA 1WLPB 3CCUA 5L37A 5GMKe 3D6CA 4OL7A 4A3EB 2HQLA 1PHJA 2J4XA 3BVMA 1VOMA 3K7AB 4FF2A 4MZTA 1RAAB 2CSQA 2HBPA 3CQZH 5KYWB 4PV1C 3QZ9B 4IJLA 2LJ0A 3CCRA 1PZKD 1VQJA 2DGYA 1KSWA 1PHTA 4AFUC 4LUEA 4GS3A 2FPEA 2CCZA 4U68A 3OYMA 3AFQA 1X27A 2GF7A 4X62L 4ZGEB 2F5TX 3J81j 3BG3A 5D14A 3V2TA 2A37A 1PH4A 4FW2A 3HOWB 3G7LA 5GAOm 1UGRB 1YHQT 2GGRA 1V1OA 3CMAQ 4C56C 3CCVT 2KAFA 4PKCC 2OTLT 3D3RA 1Y69U 2JJQA 1I4K1 1RODA 1A0NB 3NTKA 2PNRC 3DM3A 4KGVB 2F0TA 2F0HA 2K3YA 5JOBA 2B2UC 2P5ZX 4R4OA 4PL6A 1UHCA 3A0JA 1YI2Q 3RNUA 2UXDL 1ZUYA 5KNBA 2K4KA 2Z9HA 4WRDA 3PT9A 2RCFA 4J9BA 4R4QA 4XT3B 1I4RA 1HNZQ 1WHMA 2Y4YA 4PJMA 5KYXA 1IL8A 1STGA 2B2WA 3GP7A 1D5XC 4MIUA 4RG1A 4XQQA 1M2VA 5JJLA 4HN7A 1G51A 5IN1A 3JCMV 2DXTA 1CZWA 3SEMA 3U4ZA 3RDVA 2JTMA 2E3HA 1RCVD 1QP3A 2QCPX 2MHVA 1B9MA 3ZBDA 2NBFA 3BVGA 3KUPA 4PJJA 3CC4T 3NE5B 5FROA 3CBPA 1E7OA 4ZTJA 4CJ0B 1TY0A 4H02A 1HUMA 4DV4Q 4MTNA 4DR1L 4R8NA 1LTBD 2EQKA 1N27A 1SE3A 1BI3A 5FLXc 1YJNT 1QWFA 1QCNA 4M78D 4LDVA 1CKAA 5HCKA 2DN8A 2NTTA 1MMNA 4C8QC 3HOZG 2NWMA 4DAVA 5I2SA 3CCVA 3I56Q 2YTVA 1CSPA 3J7ZC 3M7NA 4A53A 4F7UA 4J15A 2CYZB 1LVKA 3M54A 3OYIA 2AUKA 3C1EA 2WSEE 5IODA 4Y92A 1VQKQ 4M7DB 3GTKB 1M90C 2GFAA 4GLKA 4J83A 3G4SQ 1SR3A 2N3SA 3QOLA 1YP5A 2NN6G 1STHA 3P75A 1UGVA 1C1AA 2K1BA 1I5FA 2BE7D 2JVVA 1D6EC 3E6ZX 3KDFB 4QQDA 4GNXC 2NVQB 2JNGA 1STYA 1X2QA 4OONA 4L5RC 2XN9C 2BTTA 2F0FA 1J9OA 1SSFA 2SDFA 4IUPA 1RAGB 2R5AA 4C8QF 1H9SA 3CKIB 5BR8L 2XGTA 3R2TA 1IXRA 3DUZA 2Z6BA 2DUDA 2KK4A 4CC7A 4NW2A 5DM7R 4AFSC 1PRLC 2JT4A 2SNMA 3EBEA 3X24B 4PJLA 3FIFA 3OW7A 3U4VA 5C44H 1PRTC 1OI1A 4UP8A 2UXDQ 5EKLA 1WD0A 4XQ3A 1PC0A 3CXCS 4PNYA 5CV5A 1IYJB 3M3YB 5M3MB 1YJNA 2WFWA 4IURA 2DXBA 1EQRA 2O5JC 2EYLA 2V1CC 1YWOA 4M77B 2F0MA 3F2DA 2FZCB 3I2ZA 1LTRD 2AHJB 1MV0B 3JCMQ 1GRIA 2V8JA 1H641 1J5EQ 4YTLA 1HJDA 2BDOA 3IRBA 4ANJA 4FF1A 4LF4L 4XU2A 1YITQ 5KEEA 3HFZB 5EC7A 1XTCD 3NHNA 2DFUA 1UDLA 4F87A 4LFAL 2NZHA 1QILA 3M4GA 4TVAB 4K6DA 2KNBB 1V9PA 2EE1A 5IXBA 4RCBA 3OY9A 2HCCA 5E3FA 1N33Q 3URGA 2LNVA 3X20B 1Y1VH 3JCMd 2BCOA 2R92B 1A3VA 3OYGA 1X9NA 5IGGA 1QLYA 3OYYA 2F0DA 4A3FG 3MEUA 3BDCA 2QQAA 1WI5A 4PJOB 1M4ZA 3ONAB 1II3A 3RKWA 1SYCA 1E2ZA 4G4KA 1ZHIA 1BIBA 2Z6KC 1EFNA 1TQOA 2RHQB 3CMEQ 5LJ3g 2N8NA 1UE5A 2RKSA 1PH2A 1WFWA 1FJGL 5CVIA 1VQPT 4BS9A 2YXYA 2VB2X 4UP9A 1K83H 2NVXB 2L3QA 3TEHB 2ZPFB 4CKCA 2HUGA 4EMHA 1ESRA 5ELFA 1R0BG 2WKDA 3RD4A 2LKVA 4A93G 4DR5L 1PRMC 1CQVA 1LV9A 3FKIB 4ZN3A 2K5NA 5K36G 1B53A 1EU4A 3LLRA 4KHVA 4RKBA 5C6AA 2N88A 1XQHA 3E1SA 4FT4A 3GIBA 1S5ED 1HYOA 2GTJA 3M7GA 4OF1A 3S1QH 4KGXB 3PGGA 2M0YA 3I56A 2A6ED 2MWOA 4LAAA 5TSSA 5JJKA 3OYJA 2RD1A 3HKSA 1SE2A 1TU2B 1H95A 2PUOB 1HA5A 1KD1R 1WXTA 5GMKh 3MEWA 1O80A 3SGIA 4XIGS 5A2QE 2R7ZG 1SYBA 4CDCC 4A3DB 3X28B 2M2LA 5JPNC 1NAPA 3JB9H 2F3IA 3G4SA 4LWCA 4OVAA 1R9TB 1MHNA 1BQQT 4K6LA 4XTUA 4NMZA 2A7YA 3M57A 4BY1H 3NWTA 1SMXA 1TWAB 2JA5H 2RHXA 4J1MA 3EGXA 4Y91A 2VV5A 4HSVA 1Q7YC 4KN7C 4LFBL 4DK6C 4X1VA 2H5XA 1G2BA 3ME9A 4RCCA 5IHKA 2QGGA 4A3GG 2PCFB 3GD7A 3OOCA 1DGSA 1TSFA 4M7AF 2KHIA 3K5MA 4L59A 2D8HA 2HMAA 1EX4A 3UDCA 4X66L 4DKAC 2MYSA 4DNTB 1SFOH 2ATWA 3FJ5A 3M4OB 2LXKA 3M56A 2K5DA 4LF4Q 5M3MH 3OSOA 1CM9A 1ZUKA 1I4XA 4IFDG 2DZ9A 1R8OB 1WJRA 1KRTA 2WIIB 1LT3D 2AZVA 3PUYA 4A75A 3TEEA 1EUJA 2HT1A 5EKKA 4P5NA 1PKSA 2L0CA 1FGBD 2E76C 1P16A 2JA6G 2FPDA 3OYCA 2YWWA 4P2CB 3HOWG 3EVQA 4BBSB 4OWWB 2E10A 3CHBD 3S3NA 1FJGQ 3J7AV 2DK3A 4M75F 2RJDA 2RHUA 1RL2A 4RTVA 4OGCA 1JWMD 4GNXB 2CHBD 2R92H 3HOYH 1DONA 1G83A 4IIOA 2V1QA 1O7IA 3GTJH 2ZXRA 3RNJA 4AYBE 1SPKA 4JJBA 4J9FA 3GOXA 3G6ET 1IHZA 5GAOq 5CCAA 1D5ZC 3TN2A 4BI3A 1ZBXA 2EYXA 3CPWP 1ASZA 2K28A 2VY3A 1O7ZA 3AU7A 1FXXA 1WXUA 2IIMA 5FRNA 3L7ZC 3ZJYC 3HP9A 2VB6A 5LJ5j 2E65A 3QZ5B 4JRIA 1JEGA 2FZGB 2PZUA 5AFWA 1ZSGA 2QEXT 3VYRA 4UPAA 2HCIA 1PD1A 3FKIH 4B3RL 3CC7T 1X55A 4M78C 4XAXB 2R93H 2L3SA 1K9MU 2O4XA 5CKHA 5GAN6 1N9WA 1G6ZA 3MHXA 1RUWA 1QW1A 4ZKBB 5IIFA 4QUFA 1QNUA 4BY7H 1P92A 2K5VA 1ZXTA 4J9HA 4BUGA 4ZRZA 1C8CA 2E4HA 2DL8A 1EY0A 1BVSA 1MJCA 4DF7A 5GAMh 1JQQA 1RI0A 3OB9A 4C0FA 3S3MA 3NQIA 3P8BB 2DEQA 2P84A 3BJUA 1OOTA 5ELNA 1JOKA 2OJ2A 1MNDA 3RLNA 4L5GA 3QYGB 1KIXA 4C3HH 1PYWD 3CCQT 5IXFA 4DV1Q 2HL3A 4C5GA 4X66Q 2KUMA 1BBZA 1HD3A 1VYUA 2G3RA 4FW1A 1TWAH 2XNAC 2E75C 1WCMH 1AT1B 4M78F 3D0FA 4KD4A 3RZOB 3PO2H 2RHSB 3UE1A 1D1CA 1EOVA 2D9TA 2K5LA 2DVEA 3HEJA 3HPWA 4K5VA 4KKUA 5KYXB 4JLIA 2J7IA 3CCLQ 1M2VB 3TP7A 1ZSZC 3CCJQ 2E5LL 4DK3C 4RTWA 3MXPA 5EQ0A 2QTXA 3E9IA 4X64L 3CRKC 3J81c 2JA8B 4BBRB 1FMKA 1QG7A 1HZAA 2A5HA 1W2BA 1KQSA 2RHIA 4AYBG 4XTYA 1X01A 2NB0A 1OPLA 3D8GA 4E6IA 1S40A 1XJWB 1I07A 1Q86C 2JMCA 1G291 3F2UA 3PMFA 3EGUA 3GTOH 3S1MH 2VUBA 5DLOA 3CC7A 4JK1C 3VYTA 3UPUA 4WJ4A 1Q8KA 1LCKA 5FLMG 3N5BB 4OMNA 3NGPA 2X6GA 3CCST 3T4AC 1FGUA 3CW2C 1NM7A 2AIRB 1LPLA 4DEXA 2CW0D 2Q8IB 2A6HD 3MXNA 5G3LD 1HR0L 1RLQC 2KECA 1X56A 4KULA 1Y57A 2J06A 5KRUA 1LT4D 4LDWA 3MVVA 1BIAA 4DV0L 1JCKB 2K05A 4LF6L 4F17A 1EY7A 3PQIA 1R77A 2DXCA 2I5HA 2RCNA 3A7LA 5GQOA 3OYFA 1HHVA 3CC2A 1CZGA 5C3WA 3EG2A 1MIUA 1Y8PB 1VF5C 1HXDA 4A3JB 2PU9B 1GUTA 4IUNA 3S1RB 3K5LA 5EPLA 4A3MH 1C0MA 4OMFB 1PH5A 4CDDC 5I9PA 3P7JA 3BFMA 3QDRB 5IYDG 1GCPA 1Q8IA 1DOLA 1QVPA 1X54A 4FNFA 3VR3A 4DAPA 1CA6A 3PO3H 3S2DH 2DNCA 4P75A 4A3IB 2DYIA 1KK7A 3LGFA 3HP3A 4DK1A 1TH7A 1SJED 1V1PA 2FXQA 2L15A 2R3ZA 2R7DA 2IL8A 2RQXA 4A3LH 1CI3M 1Z7TA 2DMOA 4V2SA 5KYWA 4KN4C 2VUMH 2K9GA 1MMGA 2PVOB 1FVIA 4N8FA 1H9SB 5IYBH 2J6FA 3VS1A 2DIGA 2AWOA 4DXGA 4A3KG 4C3JH 1K73C 4ZK9B 1EQQA 1UNSA 3CCSA 1WTQA 1BU1A 1RF2D 1S5DD 1G91A 1OULA 4M1UB 2HKQB 5FO7B 1E0BA 4ALPA 1X2KA 4N4HA 4IUTA 3S14B 4DV6L 5KH6A 3NK9A 3WOFA 1IYUA 2F0NA 2EYHA 5JVH3 2ZPEB 2X35A 6AT1B 3JB9J 4X64Q 3I55T 1CKOA 2LS01 1WTOA 4FXGC 2F2VA 2RF0A 1SF9A 4GLMA 5CKFA 1A8VA 4M77D 2Y0SE 1N32L 1LABA 1PH1A 4IPDA 2MPXC 2KT8A 4PFOA 2JM8A 1PFSA 1TWCB 1IREB 4XU3A 3VS3A 2WB1E 4MTKA 2D5DA 2ZJRA 4C5HA 3R6OA 4O6JA 4BI4A 5KYUA 1ESFA 2EJ9A 1Q81R 5KIXA 3VR5A 2LDMA 3VDYA 1XMQQ 4BY1B 2ZPHB 3STBD 1HR0Q 4CJ1B 2COYA 4J9EA 3GTGB 2BUDA 2X4WA 3CCLA 4JDSA 4A3DG 4IUVA 3WXMB 1FYCA 2FEIA 1G5VA 1WHJA 2CSIA 4PJNA 5GAMd 3CCJA 1JJ2A 1PZID 2F0WA 3TSWA 2G5DA 2KOLA 1N8RU 1VQOQ 1ZQ1A 3GP8A 4ME5A 1Y71A 4YCVA 2F2WA 3L0OA 1K8AU 1LTID 5IP7H 1LOJA 1QWEA 1DOMA 2RMOA 2OI3A 2QA4Q 2HEQA 3UDFA 3SHWA 1YJ9Q 4PJOD 1Z9FA 1E1OA 4KY7A 1EY9A 3GO5A 4J7FA 2YSQA 1CT1D 4RGMA 4DBHA 2LFNA 1JXMA 1W6XA 1SEBD 3GNGA 4HKEA 1LT5D 1AFPA 1AN8A 4OHJA 2W0ZA 3H09A 4MZMA 4BI8B 1WOCA 5C0XI 2K79A 4HCZA 1KXLA 3DWPA 1SKUB 5K5PA 2EYYA 2ROTA 3I55A 2KBNA 2SEBD 4KMUC 3S1RH 4Z02A 3VU3C 1I94Q 3EG9A 1SN8A 5CR3A 3V8LA 5GMKj 1I6HB 5GMKm 3EAEA 3KYHC 5CQYA 3SFMA 3D4RA 3S6WA 4KKTA 3VYGA 3E19A 1OTCA 1QKWA 4FT2A 5D6XA 2D0NA 1HTLD 1LACA 4KJOA 2K32A 4IOCA 2I07B 1EEFD 3RLOA 2FZKB 1L0XB 3PUVA 4EQ5A 1UTIA 2K7VA 1WPYA 4BBSG 3AMUA 2OCEA 3BU2A 1H9JA 4CJ2C 3L2RA 4HTHA 4LF8Q 2PTKA 4F8MA 2A0FB 1M8AA 1HR0W 1I4GA 3S16B 1HPCA 3EGXB 4OO1G 2C0IA 4DV6Q 1RACB 2WB1G 2YRCA 4IZ8A 3J7A5 1R0CB 1ICWA 2CKZB 4K14A 1H3HA 4N9PA 4RA8A 3HOZB 2B2TA 4FYWB 3J80E 4DR4L 1AD5A 1RAIB 4II1A 1JE5A 1SHGA 5C4JB 2ROLA 4M4ZA 1DXMA 1WI7A 2VYTA 3H8ZA 4FM4B 1QVGP 4DV5L 1TUGB 3PCOB 2AKWB 4IO9A 5KYNA 5ELDA 3KOJA 4JJCA 2Q2HA 4G57A 2PVDB 1GBQA 5KCOA 2JA9A 2GNCA 3OHXC 4XDXA 2K5IA 2LJ1A 4X9CA 9ATCB 1ICFB 2FMCA 5FJ8H 2LRQA 1TS2A 1PFNA 3NSWA 1Q1BA 1YNXA 5JEAG 2HDLA 3S24A 3META 1XNQL 2CH4W 2DRKA 2JM9A 1ARKA 3S2HH 2PZTA 4OB1B 1SSHA 4O0AA 1HNXQ 1JC7A 2QGFB 3V7SA 1CKNA 3UDXA 5HY6A 2HD0A 1YN8A 2KT1A 4M7AE 4C92G 4A4FA 3EFSA 1FD7D 1LLRD 4KLKA 2KENA 1SXTA 3HFOA 1X3QA 2D8JA 4GY5A 1PLFA 3K57A 5GADC 2B2YC 4BA2I 2G9DA 3MPUB 3QUIA 1W2BS 1KQSS 1HUNA 5CKEA 2EVRA 1KC8C 2E1HA 1A2UA 5I21A 2HHHQ 1CHQD 3VR4A 3NQTA 3T1HQ 1RABB 1G3SA 2K6DA 2CW0C 2A6HC 3T53B 2IY5B 1VQ6T 1VQFA 3UT1A 2YT6A 2L8DA 2OEOA 3SEBA 2NVTH 5LJ3j 4JI1L 3HGBA 1KL9A 2NN6I 3UE0A 2EXZA 4DR3L 4BY6B 2XSCA 2O4XB 1E22A 4LF9L 2RB6A 1ZKOA 4L5SA 4Z88A 1I81A 1GJXA 1C9OA 2LX7A 2PW5A 4M75E 4E7ZA 1SRUA 2D6FA 2HSPA 4JRQA 2CP3A 4C1NK 2X6LA 3HRTA 1V43A 4PQXA 1U5KA 1U9RA 2EIFA 5DY9A 2F0PA 2FHTA 4UP7A 5M3FG 1PXUA 2JA7G 2M1HA 3PUZA 3REAB 2BA1A 4E2FB 3AYHB 4QGUA 4A3FB 4HCSA 1B4OA 4LJZC 3RERA 1VIFA 1SNPA 1QMCA 3SVMA 2F0VA 4DV5Q 4K0KQ 2Z4HA 1YBYA 4OMOA 3JCMc 1DCZA 4R8IA 2QEJC 2LNHB 2DNEA 3H6ZA 3ERSX 3G6JB 4A3JG 2QASA 2LQKA 4A93B 1JR0D 1N8RR 1SLJA 2YU9H 2KYMA 1S5FD 1M5Q1 2ZM6L 2EYWA 2L55A 1YJWT 4GN5A 4M7AG 3WWVA 2EQJA 4UY8C 2B2VC 5CBAE 4OX9L 3V7RA 2EQSA 3T9NA 1TWBA 2VQFL 2DLPA 4HJ9A 1SMYD 2DBKA 1VQ6A 4CRIA 2PMZE 4GN3B 3QIIA 4YY3Q 1FL0A 1Q82C 1KDCA 1E6HA 4M7DF 1MGSA 2A3LA 3KBGA 1QUQA 2JA5B 1E2WA 1QB5D 1NE8A 5EJWA 1VQLA 5CBEE 3FLGA 3CCET 1QWYA 3AT1B 3MXNB 4YIJA 1YNZA 4OMLA 3T13A 3DWAA 1QJOA 1SG5A 5IOCA 3PIO3 2F4IA 1JWSD 1HZCA 3HKZG 3TREA 4XQNA 2QKIC 4M78E 1TOVA 2O5IC 3JB9F 3P1HA 1H8KA 3KLRA 2AT1B 2DYBA 5LMNQ 3ZFJA 2KRSA 2YLBA 2ED1A 4E7LA 4A3GB 3H94A 2KXDA 4X9DA 2K01A 5M5YB 4JOIA 3STBC 1AP0A 4KKSA 3BZDB 1TWHB 4C0DB 4JI5L 1R4QB 2J6KA 2LMJA 3VUZA 3PIOA 4DXFA 4AT1B 5C0XG 3S9WA 2O9VA 4P71A 2OTLQ 1JB7A 2X4JA 4DR3Q 4LFCL 2ICIA 4NXMQ 4O42A 1L1OA 3DLMA 3M59A 4C2MB 4VUBA 1A3TA 2IJ0A 4OWXB 4DBRA 1I50B 1SNMA 1VQIA 3N52A 2O9SA 1JJ2S 1KNAA 3E0EA 1VQ8Q 2JQOA 2E2HB 4PFPA 1YJWA 2XIWA 2CKKA 2HL5C 2B3GA 1JBMA 2RQVA 2VASA 4M77F 5LJ5h 2XDBA 1N6AA 4PJOC 1V1PB 2JK8A 4TVRA 2OQ0A 3I4OA 4DAMA 3L3OC 1OZ2A 1RI9A 2A36A 4RUGA 2EXDA 2F0KA 5JJIA 3KF8B 4C3IG 5KYLA 3EG0A 3M9QA 4Y7NB 1VQ9T 3I4MH 1JOQA 5GANe 2JA6B 3JCMh 2C5CA 2DL7A 1GFCA 1CHPD 4DK0A 2GBQA 1EIHA 1UWVA 3F2BA 4DN4M 5D65A 5ELEA 5EPKA 1QCOA 3G48A 3CCEA 4C92A 5EBDA 1PFMA 1NJIR 3HRUA 2PUKB 3I7FA 1NNXA 4LDXA 2ZTCA 2F0QA 4NOYA 2MGSA 4RG2A 3TSZA 2ZM6Q 1VQ5T 5ELBA 4N4GA 3UDGA 3JCMf 5GAN7 1MHWC 4OX9Q 2E2JB 5LMNW 1KD1U 4MMKA 1BCPB 2OTJT 4A3BB 1IZ6A 2F3WA 3A5ZB 1KG1A 2YRVA 1GFDA 1FNWA 2A74C 4AG1C 1RDPD 4ATOA 3NHHA 3CBMA 1K0RA 2YV5A 2K14A 4FSXA 5C3EB 3HOXG 4IFDI 1G3WA 2CZ6B 5KYUB 1FMVA 4R9WA 4ILWA 3ASKA 5EAYA 3SWNB 4JI3L 4XYOA 3SK5A 1AOJA 2DNUA 4FU6A 3VS7A 4P74A 4DV7Q 1CA5A 2Q2TA 2MK5A 4AG2C 4AQYL 2K6AA 4IPGA 1WXBA 3EJIA 1C4QA 4ELYC 2JEAI 4DBFA 1B34A 2KEDA 5J22A 4DEYA 2K33A 5FRMA 3M58A 1VQ9A 3L2ZA 1BBWA 2CVRA 2R7ZH 3E9HA 4HT9A 5GAN2 4LMQD 2EYQA 2LC4A 1HNWL 2B8FA 2F0OA 4JI5Q 2FFKB 1VQ4Q 2F0JA 5IWAQ 2EY1A 2RSOA 1G3YA 4CDFC 1WTWA 4DR2L 2WKCA 1I8FA 2EGEA 3CMAT 3BDUA 1A0IA 1ENAA 3J7YW 1J3TA 3DMUA 2XDPA 2KR3A 3FPPA 1MUZA 2AHOB 1VQ5A 1F9PA 1TWHH 2L5TA 2JS2A 4EMGA 3RIRA 2X4XA 1MMDA 3QDFA 5LJ3e 5GANg 1IB8A 1ET9A 1QCFA 4M7AA 1ZEQX 3OWEB 3W5OA 2OTJA 2F5KA 3EG9B 1YI2T 1B1ZA 3QWNA 5C4XG 2G9HD 2IG0A 5D7UA 2Q8TA 4AYBB 4ZAIA 4C2MH 7AT1B 2KHJA 1I50H 4X62Q 1UFFA 2B8AA 2AQ3B 4A3EH 1E1TA 4CKBA 1NBEB 3CXCP 3K7AH 2DVJA 3Q8DA 4IUQA 2RQRA 2L12A 4L5QA 1STEA 4K8JA 2JJ9A 2YUOA 4L6V5 3C46A 1EYCA 4DV3L 4JI0L 5CV6A 1M27C 2KQWA 3HOWH 3JAMc 4I65A 2JP1A 3VS4A 2MOXA 2QDYB 4B08A 4DU9A 5AYFA 5IY0A 3OTOL 1XX8A 3HHTB 1Q90A 4KV6A 3H0HA 1X32A 4OMMA 3E9GA 3KFVA 2PI2E 3JCMb 1VQEA 5FO8B 1EQTA 4PNOA 1ABQA 3RR5A 2R61A 1ASYA 3CMAA 1EY5A 1D1AA 4WF2A 3I56T 3DB4A 2AQ2B 3U50C 3KLWA 3F70A 2O2LD 2PQWA 4JI3Q 1Q95G 3EG3A 3EFOA 3VKIA 5LJ5d 2JMAA 3Q0AA 3EHRA 2EY5A 4TSSA 3I5RA 1VQKT 4NP5A 1HCZA 1YI2A 1PZJD 3G4ST 3L2QA 4QY7A 5I6WA 4DR1Q 1PRTF 1XNRQ 2EY6A 2RSNA 4BACA 3R6NA 3L2WA 1CKNB 1GM5A 3V8JA 4Z8AA 4E7HA 2EY2A 4XYQA 4A3KB 4OMQA 5GAOp 1I4QA 8AT1B 3PNWC 1TS5A 4H13C 1RIPA 2DA9A 2QTVA 2B2WC 2DTOA 4K5WA 1AWXA 5I6YA 2FPFA 3L2UA 1SMYC 3C94A 3O8VA 3DEOA 1K3RA 4XU1A 2B8GA 5A0DA 4KRTA 2I5LX 2QG9B 1D1BA 3H91A 4B9WA 2EJMA 1YFNA 1S72Q 2MO0A 2N55A 4GLAC 3ZYYX 4RFBA 2LCSA 1M90R 4D8KA 2IPKD 1KLUD 3OW2P 2R7FA 2BH8A 4HIMA 2CT3A 2UU9L 2XD0A 1QCBD 4I7AA 1AEYA 2A69D 5IT9E 3N6RA 1IHVA 4HXJA 1XPUA 2A8VA 4B3ML 5FWCA 3LX7A 3K0XA 3GTKH 3TCJA 2ZZDA 2YUNA 4DA4A 4DPGA 1IL2A 4ZUJA 4DV2L 1ET6A 1L0WA 5I2MA 5C0MA 5BR8Q 3RBBB 4FF4A 2K3XA 1E3PA 2RA4A 3HOUG 3GTMB 1X3GA 3I4NB 4LN2A 4QVCA 3X3MA 1ZA2B 1T0HA 1TXYA 4EQPA 1ZBJA 3VS6A 1YHAA 2FRYA 4DV3Q 1VQKA 1NYGA 1YITT 3QWXX 1AWOA 2J7ZA 4JI0Q 2O01E 2NVQH 2IHEA 4ME3A 3J81i 5FLXL 3MEAA 2CZ1B 5FLMH 2UUBL 3SXHA 2E6ZA 2PPBC 1VQGA 2AZSA 5M5XB 1BCMA 4JC0A 1TS4A 3H3VI 4V0BA 1JICA 1Y8NB 2ICEC 1BBXC 4PMBA 2XHCA 3FVQA 3QHSA 1CK1A 4POGA 3TRZA 2Z8LA 1IYVA 2DJQA 4XT1B 4OIJA 3WVDB 2JN4A 1RADB 2L5QA 2MMPA 2I0NA 3RR6A 4NL2A 3KLSX 5CV8A 1XPOA 5L23A 1DZ1A 3CMET 2H1EA 2M0OA 4ZN1A 3M3YH 2P4RA 4G7HC 1PD0A 2E41A 1GXIE 3SK4A 1Y14B 2KCMA 2TSSA 2J05A 1VMPA 4LFAQ 4FSSA 3G6EQ 2YTXA 5D6WA 3I73A 4BD3A 1B7TA 3MJXA 3TZUA 4C1NI 2EGAA 1B3QA 4A4GA 4JRKA 2KYBA 4F7UF 5GJWB 3S1QB 2OX7A 3QWYA 3C1FA 1KQ1A 1BR9A 1QUQB 1QVFA 1MI2A 5AJ3L 3LH0A 2NWGA 2QEXQ 1UGQB 2JW4A 2RHYA 1SYGA 3VR6A 2WP8J 4CKEA 1EIFA 1D09B 1F1BB 1IGQA 1N5ZA 5C5MA 4PK4A 1SRMA 2GQVA 3OMCA 1G6PA 4BB7A 4A4IA 2EBPA 4PLIA 1YITA 3M4PA 1E24A 3JAML 4J5YA 2HKNA 4HCCA 2WB1B 4JI4L 3TDQA 5EG2A 1L2FA 1HXYD 1KTKA 2UUAL 2AKKA 4DR5Q 2X3WD 3RLFA 3QSUA 1CSKA 3KXTA 3S17B 1L0YB 1Q81U 4PZ8A 1NEGA 4LNPA 5HURA 3JV3A 1UUPA 4JV5L 2MUYA 1ML0D 1T3SA 5IP9G 2CT4A 3D4WA 4A3BG 2RQUA 4ESRA 4YWLA 2ZTDA 3GF5A 5EPJA 3WOEA 1BF4A 2H4OA 1L1OB 1UE1A 2NVXH 2CP5A 5GAEC 4B3MQ 3LGLA 1GKHA 5C44G 1PV4A 3M55A 3CMEA 3H0GB 4M7DE 5C3EG 1KQ2A 2RPNA 4EMKA 3MEFA 2E2IB 3SHLA 2EQUA 2GVBA 2XRSD 3K5NA 2LMCB 5LJ3h 4OWTB 3C3LA 2WSCE 2XIDA 1DJRD 4KD3A 2ZAEA 1NSNS 1V29B 2EYJA 1RKNA 4UHVA 3V7CA 4D6WA 2WINB 2VGNA 1GUNA 3RMSA 2PNIA 4LFBQ 1Q7YR 4XK8E 4RKLA 5AT1B 2LTOA 4C92B 4X65L 4A3DH 1KDAA 4A76A 2QK0A 4JZ3A 3CC2T 5C4ZA 4E7SA 2Y90A 2LP5A 2KCNA 2PO4A 4NXNL 1R9TH 4IJHA 4OO1I 2HDAA 3VS2A 4ZGJB 2EAYA 1SE4A 4A4HA 1VQHA 1K8MA 3NBHA 1UJ0A 1AVZC 2MF2A 5EKIA 1KRSA 1NTGA 3A1PA 4K8IA 3S15B 2O31A 3PV0A 2E6NA 4NPSA 5GAMf 2LY7A 4P73A 3WVEB 5IGBA 1WDXA 4M77E 4M8AA 3SB2A 2KA7A 4B9XA 3AQQA 2RQWA 5FKAC 2A08A 2D1XA 1BCPD 5J1ZA 1Y0MA 3TSSA 4FYXB 5C3XA 2HNIA 4Q5VA 1PDQA 3UWNA 2DL5A 4ZTFA 2KMTA 2IHFA 4ZKCB 3A54A 1AZQA 2DJFC 3GDEA 3GLXA 4X3SA 1DJ7B 4FCYA 2DD4A 2JOYA 4J9DA 2VZAA 3VYHB 2PI2A 5KE2A 4A3CG 1B34B 2VS1A 2GA4B 2JA7B 3MP1A 2CQAA 5M3FB 1UB4A 3HOVB 4FXDA 2WV6D 1KAAA 2QQBA 2UUAQ 5ISRA 4G7OC 4RTZA 2Q2IA 1T0JA 2N49A 5GANd 3MEHA 1MV3A 3CAMA 1HZBA 4BBSH 3G1JA 4R56A 4LF5L 3EH1A 1S3OA 3NWSA 4JBJA 2IPOB 4BXXG 2MWPA 3FP9A 4OELB 3HFNA 3JB9G 1W6KA 4FL6A 2QILA 1A6XA 3CCMQ 4B3RQ 4JI6L 1OU9A 4BY1G 3NENA 2JA5G 1C0AA 4YHHL 2FVUA 1D7QA 1QVCA 1TUDA 5I11A 4M7AB 3E2UA 1B70B 2KJXA 5CORA 3RN2A 3DLLA 2RA2A 2K5HA 4J9IA 4LUDA 1OV3A 3KUFA 1QNKA 4KUIA 3MAQA 1VYVA 2LX9A 2IX1A 4ZGDB 2EFIA 1G8ZD 1SNOA 3CCLT 3CD6Q 1VUBA 2CWPA 3F8TA 2EPDA 3CCJT 2TMPA 2F03A 1K9MC 2A28A 3P8DA 4EX5A 3KF8A 5FU6B 1LTAD 2N78A 3KF6A 2RO0A 1ZLMA 5JEAH 4E7IA 2DL4A 2K3BA 1H3ZA 3T51B 1S5BD 4N4IA 1YHBA 2RDFA 1VQCA 3PSIA 3W3AA 2XKOC 1K3BC 2A69C 5CGKA 3HKZB 1KDBA 1EYAA 3M0TA 5C5LA 3M9BA 5BN5A 3NPPA 2I2LA 4DR6L 1V1CA 3J80c 3QIAA 1F2MA 2L3PA 3S1NB 1UGSB 1UECA 5ELOA 3CEYA 4M75B 4BY6C 3G71Q 4A63B 5I22A 3OYEA 2B86A 2L3RA 5CO7A 4HJ8A 2E5LQ 4O5VA 1VQMQ 1TIID 5KNCA 2SOBA 4N9TA 3HOYG 3V96A 3QYHB 3KJOA 1WTRA 2K52A 3RZOH 2F0SA 2FB7A 2L2PA 1I0CA 1Q86R 1O78A 3VS0A 5D3DA 1X3EA 1EL0A 1ILQA 1WHKA 3EFOB 3CRLC 1A3UA 1PCXA 4DUZL 1Q12A 4C8QE 1D1KA 2VXWA 1PG5B 4DUYL 1D3BA 1NPPA 3NTIA 5LJ3d 5GAN3 4JRPA 4JG2A 3TQYA 2B29A 5BN4A 4BBRH 3LYIA 2JA8H 2NUZA 3HL8A 2F2XA 2ZPIB 3SWNA 2Z0SA 1MNEA 2MJ8A 5GAGC 4C3IB 3I4NG 2PZWA 1UEAB 1N9SA 4WCIA 3K58A 3NELA 5FO9B 2J6OA 5FWBA 4PZ7A 4QCLA 2EYPA 3EFXD 2DE0X 4LF6Q 2R93G 1H92A 3I72A 2AKLA 3FC3A 3I35A 2F1MA 2NZOA 4XTVA 3CPFA 3GV6A 2QI2A 3A74A 3JCMP 2PMZB 3VR2A 1NPRA 5IYCG 4JI6Q 5DM63 2UXCL 2ABLA 4YHHQ 5T1GA 3B6YA 1UGPB 4HR7B 4E47A 4JCVE 3T1YL 4QIWE 2HQHA 1YIJQ 2XG8D 1PNJA 2IVWA 3BY7A 1LO5D 3FMCA 3MWYW 2CZ0B 1W4SA 1QVFS 3J81L 3SK6A 1H9MA 3VYUA 4C3HG 4FP5D 3H15A 1CUKA 4XU0A 1YVCA 5ECAA 3F1ZA 4QJFA 2ATCB 4A3JH 2OQKA 1WHHA 1HSQA 1E6GA 3HOXB 4PMCA 2X9HA 1NUCA 2ZGWA 1WCMG 2KSSA 4RGNA 3URYA 3PO2G 1GCQA 1OZ3A 1AW7A 4C0GA 2BZXA 4R0KA 4JJDA 1O7LA 3F2CA 1K73R 1JJGA 2VGMA 4A3IH 2CS7A 3KBXA 3QPHA 3OMGA 2HIXA 3A56A 3DKMA 5GANj 1IW7D 2FG0A 4C0DC 2EKHA 1VQ7Q 1W1FA 2Y0SG 2FYKA 2RJEA 3I3CA 4JBWA 2EYMA 3VRZA 5GAN5 3QG1A 1H9RA 5GROA 1IKLA 2MNAA 1X43A 2QYZA 2VXEA 3D31A 3SDZA 3U9OA 4C8QG 1FMWA 4UDUC 3ULRB 1T5XD 1TU0B 2EJGA 1VQOT 2JYOA 1V1QA 3P8HA 5L8RE 1TVXA 2QGQA 3BE3A 1N32Q 2QA4T 8ATCB 5JVG3 1T9HA 1ENFA 3S14H 2E3IA 2RDGA 1YJ9T 2LXJA 3DEPA 4HA8A 3GTPB 1VQNQ 2RI5A 4MNOA 3L2VA 3A8JE 3R8BA 3T16A 2UUCL 3H0GG 5BN3A 3OA6A 5C0XH 5T1IA 1TT2A 1KJWA 5C4XB 1PTOB 1A62A 3KFUA 1NJIU 2KEEA 1YEZA 1ZA1B 2XMFA 2Z0WA 2RVLA 3REBB 3GTLB 4UC4A 4JYAL 1D0YA 1TWCH 2GQIA 1VMCA 3L2PA 4F14A 1NG2A 3NXWA 1LTGD 4HMJA 1W2BP 1KQSP 3C2PA 5LMUL 2NYZD 3PO3G 2O88A 1GVPA 4C3IH 1I4PA 4N0AA 2CWAA 1BCPC 3GTGH 3J80L 4A3LG 3M4OH 3JC66 1JOOA 4NB3A 1WVLA 2A19A 2VUMG 1M3AA 1K8AC 2QQSA 4RH6A 2V8IA 1AEXA 4GKKL 1B9NA 1TR5A 1DYQA 1VYTA 1QVGS 4EQNA 4C3JG 1SEMA 1V76A 3SWNC 1VQOA 4F7UE 2HD3A 3QOJA 4KH0B 1EY8A 2IWHA 5I2YA 2KQ3A 4OEMB 2QA4A 3D7SB 4EMKB 3OYLA 1YJ9A 2MO1A 1GUOA 4PG3A 4DR7L 3P20A 1MSGA 2QQ9A 3MEVA 4ORZA 1JU5C 1M1KC 2RHZA 3CCUQ 1VQLT 1BCPF 5DM73 4JS5A 2D2CC 2H8HA 2RF4A 3M53A 1SSOA 3GPLA 1I6HH 2RK1A 4J6YA 1Q1EA 4EQOA 5I2XA 4ABNA 3R93A 3RUXA 2SRCA 3CCRQ 2BIVA 1I5LA 1XWEA 3HOVG 2MP1A 2CH4A 2M9VA 3RUZA 2KXCA 4DR4Q 1SNDA 3CQZB 1BI0A 5G3LF 4HCKA 4KK7A 4B6MA 1MSHA 3NBHB 4P72A 4C92D 5JJZA 3S16H 3OS5A 1GUWA 2ZXOA 1STNA 5E4XA 1Y1WG 2KY9A 1W6JA 1ILPA 2J0TD 2SNSA 3EH2A 3TQ7P 1SROA 3HOZH 1WD1A 3PF4A 1T5EA 2XU8A 1GXDC 1M30A 1SYDA 1Z47A 1AE3A 1IO6A 4F88A 3C95A 5C4JH 2RJCA 1U3OA 3M0PA 3VRYA 1ONLA 1RHPA 4KI0A 2PZ1A 3X26B 1OO9B 4Z89A 2D9UA 3GTPH 3MP8A 4KHPL 1U1TA 2NLUA 5CR2A 4F7XA 2NN6H 1PH9A 3OS2A 5KYYA 3RESA 3OS1A 1BI2A 1OXTA 5C4XH 3HOUB 1TY2A 1EIGA 2B2TC 1M2OA 2XWBB
chains in the Genus database with same CATH topology
2RK2A 4HJAA 2RI2A 1PSEA 1KHCA 2PNHA 2X4YA 1AE2A 2E12A 2V8KA 1M8VA 4JUVA 4PLLA 3PTAA 4C8QA 3A8HB 1WGSA 1HNZL 1NMGA 4M75G 3RKXA 5GAOn 1OXUA 2I0QA 2JE6I 4JI1Q 4XTCS 5DLQE 2VNUD 3M4YA 4LF9Q 4QQBX 3JAMi 4M7AD 5GMKi 4DV4L 1Y96A 2YLCA 3PGZA 2XI9A 4YWKA 1XMOL 1U1SA 2M9UA 2LSSA 3KF6B 2WAQE 4RMFA 1WJQA 1M90U 2GVAA 1B8AA 3OYHA 1SE8A 1U8RA 1UE6A 2A1AA 2F69A 5LJ5f 1X65A 1IBML 4A3FH 3K80C 2P0PA 4AH6A 5M9OA 4JYAQ 1HZ9A 5GAN4 2LT1A 2RI3A 4PJOF 4LDUA 2LQ8A 4IPHA 4M75D 2VQFQ 4BA1I 4KHPQ 4M78G 2IT1A 2WSFE 4C5EA 4A93H 3QBYA 3OYDA 1XOVA 1D3BB 2BKDN 4LD6A 3LGJA 2K5FA 2CQOA 1IBLL 1VQ8T 4JBMA 4AIMA 3MCAB 1UEBA 1LYLA 2JN0A 1CKMA 3HOUH 5C0XJ 5HK0A 2Z6KA 4MZPA 4OXPA 2ID0A 2BH2A 3A8OB 2K50A 1J5EL 1EYGA 4LFCQ 4ELZC 2WAQG 2K75A 4A3GH 1QZHA 5M5YH 1EFWA 5IT9c 5KCHA 1XNIA 5HGQA 2P0KA 1AHJB 3X25B 1N33L 2ASBA 1VQBA 3MO8A 3BZCA 1XMOQ 3CPWA 5J26A 3SD4A 1JT8A 4R55A 1WYDA 1YHQA 3QKJA 4DQ2A 2ZCFB 2E2HH 2R5MA 3PFSA 2OTLA 4JOIC 5FU7B 4HT8A 4MDXA 1IBMQ 4DOWA 2JZ2A 4Y7NH 1VQ8A 2HAXA 4R4IA 3OYKA 1X6OA 1PH7A 2JA6H 1L1OC 3AFPA 3QJYA 2DTIA 2ZJPA 5GAOl 5GAMe 4M75A 3JRZA 1MGQA 2HQXA 2KVQG 2R6GA 1PH6A 1VQ4T 3PUXA 4OGEA 4R1JA 1KD1C 2I5MX 2E2JH 1Q7YU 3CC4A 5IP9H 2B63G 4A3BH 1O75A 3TU4K 4IPCA 1IBLQ 4AQYQ 4C92C 3CBOA 1BKBA 3FEOA 4PMWA 5C3EH 1TWFH 2JEBI 1VCIA 1AH9A 2DKGA 2HIVA 1EWIA 4YWMA 1HNWQ 2XTIA 1WQWA 5GAHC 3DB3A 4QVZA 3OSSC 3VUBA 4RG8A 2ZPBB 1HJPA 1OXSC 2K2VA 2CGHA 3FDRA 4DR2Q 1O9SA 3FRNA 2VQEL 2VL6A 4HJ5A 3I4MG 3ULJA 3LW5E 2DTHA 1N36L 4Y28E 3JB9I 1JRIA 4C92F 4R4CA 4J8OA 3JCMJ 2XDDA 3TS2A 1B7YB 3ICEA 2GCXA 1NY4A 4M78A 2EJFA 2DXUA 4XTWA 3RZDH 1VQ4A 2MI6A 3C4SA 3Q1JA 4KUDK 3NFCA 4J6XA 5FLXE 1TWGH 2QXFA 2Y4XA 5CKDA 5A0GA 4TQUS 4ME7A 5GAMg 2PQAA 4NS5A 3OTOQ 1PH3A 4QVDA 4A3CH 5GANh 4GLXA 3AEVA 4M7AC 1LJOA 3PF5A 1PYSB 2OAUA 1JB0E 3JCMW 4BE2A 3OW2S 1OXVA 3OYNA 4LUVA 4BXXH 5J3BA 1S72T 5FU6C 2AMCB 5GANf 3M4QA 2R58A 2CFMA 1CSQA 4MZ9A 5IAYA 4MMLA 1GD7A 5IYDH 2PVGB 4OB0B 3JAME 1Y7XA 2MAMA 4DV1L 1LNXA 4M75C 1JMCA 3PMTA 2VQEQ 4C0ZA 1VQPA 2LCLA 5CAIA 4YCWA 4KBMB 1LUZA 1W3SA 2E5QA 4C8QB 1Q86U 4A3KH 1N36Q 1PSFA 4A3EG 1M1FA 4J6WA 3H3VH 2UU9Q 4LD9K 4QW2A 2KCTA 2ZPGB 3ULPA 1WQ7A 4DV2Q 3W1GA 5CIUA 3J80i 2LT4A 1HK9A 2MFIA 5GAOr 1Y96B 4A54A 1S72A 3GNFB 3VJPA 1FX7A 2L89A 2ALYB 2UUBQ 5KE3A 1IBKL 2MQHA 2EKOA 3GTMH 3I4NH 3BDLA 2H3JA 2EQMA 3A8MB 3M9BA 5LJ3f 5HKCA 3G7ZA 4IFDJ 1Y1VG 3CPWS 5M5XH 1WFQA 2D0OA 2FHDA 1K73U 3OYAA 5IYCH 3EN2A 1XNRL 3FJPA 1J6QA 3PMIA 2K4YA 4GLVB 5AJ3Q 2E64A 1QVGA 4BE0A 2K57A 2DJZA 5CK9A 3OQ5A 4LF7L 3QXEB 2E8GA 2VW9A 3K7UC 4B3TL 4JI4Q 3G6EA 1PVOA 1OYXA 1GO3E 4M7DG 4XTXA 4JV5Q 4PJOE 1PA6A 2QQRA 3ZEHA 3PIPA 2QEXA 4GOPA 1E7ZA 4E7KA 1U0LA 1Q81C 4QQGA 3S17H 1XMQL 1NZ9A 1KHIA 2DIQA 3H0GH 1IBKQ 2F52A 1QP2A 3QO3A 2E2IH 5M3MG 4LUZA 3JSCA 4BDYA 3CCQA 4OB3B 4X65Q 4F7UB 4M77G 2DD5A 4NXNQ 1WJSA 3NEMA 1PYBA 4KHZA 1VQAA 4M7DD 3FB9A 4EMKC 1NBWA 1VS0A 4OP0A 2GFUA 1I94L 4B3SL 2R57A 1QZGA 4IKFA 3JB9D 2R92G 2CZ7B 3S15H 2RH2A 4LDYA 4YCUA 1KAWA 4PJOG 1UE7A 3L42A 3CCMT 1NE3A 4LF7Q 3ER0A 3QJ6A 3OYBA 1M9SA 4LF8L 1BBUA 3M5AA 4X6AH 4B3TQ 1P8LA 2YTYA 1NMFA 3L1AA 1VIEA 3FKIG 3CD6T 4LF5Q 3A8GB 5GAN8 1FWZA 2D0QB 2VC8A 1BYMA 4RKUE 5M3FH 2JA7H 3HOVH 2P4TA 2D0PA 4DAYB 4BY7G 1XTDA 3J81E 2GN5A 1JJCB 2F4VL 2JTFA 4IOAA 1MKHA 3CP0A 3K81C 4GKJL 3G71T 4M78B 1YZ6A 1HNXL 3OSVA 1N34L 1VQMT 1KC8U 2HQEA 3CCMA 2M16A 2XICA 3NTHA 5D6YA 2NVYH 4GOPC 2PQAB 1EIYB 1VQDA 4BDZA 4DR6Q 3INZA 2IX0A 4J7IA 5LJ5e 3EIVA 4HCBA 4O2DA 4M7DA 4JBKA 2HHHL 5A0LA 1WJJA 1I3QH 3BW1A 1M1KU 3T1HL 3CD6A 4C92E 4B3SQ 2EWNA 3JCMe 3CF5A 3KDFA 2OWOA 3S1NH 4JJNK 5M5WH 4DUZQ 4KT0E 2YYZA 4PZ6A 4DUYQ 5E7NA 2ES2A 3UDIA 1WNLA 1D8LA 1YIJT 4WJ3M 2DPPB 4EDUA 4HIDA 1N9RA 2YHTA 3G71A 1K8GA 1OXXK 4JI8L 1PH8A 4A3MG 1VQMA 4DNIA 4APVA 5CQXA 4CI0C 2Q2UA 3GTQH 3KJPA 4K0KL 4M77A 2ZTEA 5J39A 3RKYA 2XK0A 2P0QA 1M1GA 2UXCQ 3T1YQ 3TS0A 3OS0A 1N8RC 2F4VQ 4A4KA 2C35B 4Q5WA 4DOVA 1Q82U 1VQ7T 5IYBG 3S3OA 4C8QD 4C5IA 3V8KA 4GKJQ 1N34Q 4YY3L 4JI2L 4HJ7A 1G3TA 5LL6S 5LJ5g 4PJOA 3M85A 4R4TA 3W1BA 1VQNT 3LWIA 4JI7L 1XNQQ 1YIJA 2DO3A 3K8AA 3HOXH 4E7JA 3A8LB 3HRSA 2VXFA 4LW1A 3MP6A 3JCMg 2BA0A 5LMNL 5GMKl 3BZKA 4LNQA 3OBWA 2JA8G 4BBRG 3CXCA 3HKZE 1BI1A 1XPRA 2UXBL 5CKBA 4NXML 4HIKA 2RJFA 2ZJQA 2LVMA 3RMQA 5GAMj 2UUCQ 5JEAJ 1VQ7A 2JUFA 5IP7G 3EFRA 5FU7C 4LUOA 4FDBA 4JI8Q 3J7AF 1C7YA 4RMOA 4M7DC 3ULLA 3VV0A 5IE8A 5LMUQ 4QL5A 2DZCA 1NJIC 4POFA 4F7UG 2LCCA 4NL3A 2E70A 2DAQA 1VQNA 3GTLH 3CCUT 4L5TA 2AWNA 3A5UA 1X3FA 3FHWA 5HK3A 1Y07A 3C12A 4JS4A 4GKKQ 5C6SA 1A63A 1Q46A 3OBYA 4OB2B 3LWHA 4Y52H 3CCRT 4A3IG 2FL7A 4QQ6A 3E9FA 4GOPB 3AHUA 4BE1A 4GN4B 3RN5A 4X34A 4JI2Q 3HSBA 1YCYA 4DR7Q 1HH2P 4M77C 2D62A 4XTZA 4DV7L 4JI7Q 4N0AC 3JCMX 4GNXA 3OW2A 4JLGA 3PUWA 2WACA 2B63H 1LM0A 1MJEA 1X75C 2RM4A 4MDWA 4FIBA 4A4EA 4HIOA 5IWAL 2C06A 4IUUA 5FJ8G 1LTLA 3U58A 2UXBQ 1XJVA 4EPCA 2KDSA 3CCUA 5GMKe 2HQLA 1PHJA 4MZTA 2HBPA 3CQZH 3QZ9B 4IJLA 1VQJA 3CCRA 2DGYA 4GS3A 2CCZA 3OYMA 3AFQA 2GF7A 4X62L 4ZGEB 2F5TX 3J81j 1PH4A 5GAOm 1UGRB 1YHQT 3CCVT 2KAFA 4PKCC