3A5ZB

Crystal structure of escherichia coli genx in complex with elongation factor p
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
134
Chain Sequence
TYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lysyl-tRNA synthetase
publication title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 17
structure length 134
sequence length 134
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01132 EFP Elongation factor P (EF-P) OB domain
B PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
B PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a5zB01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5zB02
4JI4Q 4YTLA 4A3GG 1VQ5A 4DR4L 3H15A 4JBMA 1NTGA 4QGUA 3J7A5 1FGUA 3FKIG 1JJ2A 4GS3A 4QIWE 1NMGA 3ZJYC 2H5XA 4C3HH 4LFCQ 4FDBA 3PO2G 4MZ9A 4JG2A 4OO1I 2MO0A 1W3SA 4X65Q 1PYSB 2HQLA 4GNXC 4A3CH 1Q46A 4A75A 1HZAA 4NXML 4PZ6A 5LMUL 1WJJA 5IAYA 4A3JG 5H1SE 4IOAA 4X62Q 2YTYA 1AE2A 3S15H 2Y0SE 2QEXT 5C0XI 4UP9A 2KCMA 3OYYA 4JI1Q 1VQ4A 4H02A 1PV4A 3GTKH 2YU9H 1VQAA 2K50A 2NVQH 2I5MX 4DR5L 1UE6A 1VQ8A 3K7AH 2IG0A 3W5OA 4A3IH 1XTDA 1B7YB 5DM7R 1P8LA 3TREA 1XMOL 3G6EA 2D0OA 2E70A 1FVIA 3GTMH 3DM3A 3I2ZA 1VQ7A 1VQKT 1GM5A 4JYAL 1MKHA 4HIKA 1YJWA 1TWFH 2A1AA 3F2CA 3CAMA 5M3FG 1K73C 1QVFA 3HOWG 2VQEQ 3J7ZC 1XPOA 1N36Q 5HGQA 3H3VH 2VQFQ 4HJ5A 5ELNA 1C7YA 5IYCG 4L5SA 2R7ZG 1M90U 2F3IA 2NZHA 2DUDA 3CP0A 3RNUA 4IOCA 4YCWA 4WJ4A 1WCMH 4OWWB 3J81j 1UEBA 4ZN1A 4IO9A 2AHOB 3F1ZA 4GKKL 5IP7G 1WFQA 5GAHC 1PA6A 1SLJA 1PH7A 4DV7L 4X66L 4A76A 3GTJH 3EN2A 4CRIA 1K8AU 3ULJA 4BY1H 1VQEA 3HOYH 3CMAA 2GVAA 3I4NG 2MFIA 1NBWA 2K4KA 3D0FA 1EIFA 4B3TQ 1CKOA 5J3BA 5JJLA 3JC66 2MNAA 1PH1A 3K0XA 3KDFB 2IX0A 3CPWS 3OTOQ 3CCUT 2UU9Q 4OX9Q 1PH6A 3EIVA 3S24A 3PUVA 2VNUD 3Q8DA 1GVPA 1PFSA 4TVRA 2CKZB 4AH6A 4DK6C 5IP9G 2R7FA 4LF5L 3M4OH 4LUOA 2YV5A 5IYDH 4YCUA 2JA7G 3W1BA 3A0JA 2JA8G 4GOPC 3RLFA 3GTQH 1N9WA 4BY7H 4DV4L 1PH4A 1HNZQ 3CCRA 4BXXH 4A93H 2UUAL 1HR0L 3SGIA 3DLLA 1B70B 3CCQT 1UE5A 1TWAH 1Q1BA 3MXNB 4R4OA 2KCTA 1Y1WH 3JAME 1G51A 3OW2S 3KDFA 1JE5A 1SFOH 2WB1E 4LFBQ 1YITT 1S3OA 2QA4A 1S72A 1RIPA 5IWAL 4HJ7A 4DR4Q 5C0XJ 3HOXH 3U4ZA 1Q12A 3NENA 3RLNA 1EQQA 2R7DA 1W2BA 1MJCA 1NJIU 3BU2A 2NVYH 2Z0SA 1VQJA 3CPFA 1QVCA 1NPPA 2CQOA 2CWPA 4J15A 2AWNA 3JAMc 2ATWA 1KXLA 3IRBA 4NXMQ 1X56A 1E22A 2Y0SG 5LMUQ 1I94L 2CCZA 3K7UC 4P74A 1QZGA 2LXKA 2AMCB 2N8NA 2NZOA 4A3IG 3CD6A 3BZKA 1XMQL 3I4OA 3KFUA 1VQPA 1J6QA 1S40A 3S14H 4JYAQ 4ME3A 5EAYA 4QQDA 1E3PA 1T9HA 4A3FG 2L15A 3ERSX 5LL6S 1VQNA 3MEFA 1EQRA 4APVA 4DR5Q 1LUZA 2RF4A 4DR2L 2UUBL 1VQ4T 3CCSA 3RZDH 1Q86U 2OCEA 4JI5L 4ALPA 1M90C 4GLVB 4JI8L 1XMOQ 1V9PA 1O7IA 1CUKA 2BH8A 2PMZE 1L1OA 1K83H 5HY6A 1Z9FA 3WWVA 1VQ8T 2K52A 1IL2A 2LQ8A 4LUZA 3F2DA 1VQIA 3ICEA 4R4IA 3G6ET 1V1QA 5FJ8H 3TS2A 1KQSS 4IPGA 3S2HH 1VQ6A 1SN8A 1VQ7T 1YEZA 4PMWA 1YJWT 1B8AA 4P72A 1GKHA 4L5QA 4PZ8A 3KOJA 4GLXA 2B63G 4DR6L 4BY1G 4DR7L 4IFDG 2C35B 2AWOA 4YWLA 4QQBX 4GKKQ 3M85A 4JI3L 4YHHL 3HOUH 5GQOA 5GROA 1PHJA 1DGSA 4GLAC 4BBRH 4X66Q 3K81C 4DV7Q 1KRSA 1VQ9A 2QGQA 4YWKA 4UY8C 2LSSA 2IY5B 1PH8A 3GTPH 3PO3G 1YIJA 1M1KU 1VQHA 5IYBH 2KBNA 5GADC 4HJ9A 4BBSH 5IYDG 2R93H 4LF9L 5LMNL 1CKNA 3GD7A 4KLKA 1HNXL 3CMAT 1JT8A 3H0GH 4EX5A 2I0QA 4IJLA 4DV1L 1NE3A 2JA6G 1TWHH 2UXCQ 4LF5Q 3CC4T 1EWIA 2D0PA 4QL5A 4DV3L 1Q1EA 4B3SL 3S2DH 3F2BA 4JI7L 4JBJA 4DV2L 1CSPA 3ULPA 2VUMH 2MO1A 4DUYL 3CCEA 4DV4Q 1X9NA 1NJIC 4JBWA 4A3KG 2UUAQ 1HR0Q 4DK3C 2WB1G 2IHEA 3RN2A 1VQOA 3CCRT 2UXBL 5E7NA 5IWAQ 4K0KL 2JUFA 3CCLA 4QY7A 3CPWA 4AYBE 3BJUA 1K9MC 4BA1I 4DR1L 5GAEC 3CCVA 1A8VA 3TRZA 2VW9A 3L0OA 1PH2A 4A3MH 2QA4T 1YI2A 1S72T 1KAWA 2B3GA 3S1RH 1WI5A 1I6HH 1L1OC 1OXXK 2L3RA 4YWMA 4X6AH 2ZTCA 1Q86C 3CQZH 4OONA 2OQKA 4XTCS 3S16H 3T1HL 1EYGA 1C9OA 4JI2L 5JJKA 1I94Q 4GN3B 2WP8J 1HZBA 4WJ3M 4XIGS 1HJPA 2R92G 3J81i 2E5LL 1XMQQ 2IT1A 2VL6A 4AQYL 3OW2A 2R6GA 1CSQA 4JI0L 2ID0A 2Z6KA 2UUBQ 3CD6T 1UWVA 4DR2Q 1XPRA 4X34A 1FJGL 4A3BG 1VQPT 5FJ8G 4JI5Q 1BBWA 1L0WA 4JI8Q 4DV6L 4LF6L 5FLMG 2KDSA 4DPGA 3HOVH 1VQNT 2WFWA 3U50C 4LF4L 3HOZH 2DO3A 1IBKL 3CCST 1Q7YU 1QUQB 2JEAI 3GTOH 4HIDA 3CC4A 3HKZE 1PH3A 5M3MG 1WOCA 2UUCL 4Y7NH 1PH9A 1CKMA 2XHCA 1K3RA 4A3EG 3F8TA 5JEAG 2F4VL 2I5LX 4BBRG 5C4XH 3PF4A 3PUWA 3KYHC 1KIXA 4DR6Q 2MWPA 1VQ6T 3AYHB 3PV0A 4DR7Q 1G6PA 2JA5H 1EOVA 2IHFA 4IPCA 4UP7A 3UDIA 4YHHQ 3PIOA 4HJ8A 4JI3Q 4BBSG 2LVMA 4JOIA 3KF6B 3A5UA 2R93G 5A2QE 1U0LA 1K8GA 2PQAB 2AKWB 4NXNQ 3H0GG 1QUQA 1U5KA 1N32L 4DUZL 4O0AA 4LFAL 2IX1A 2PI2E 4Y52H 1J5EL 1VQ9T 4POFA 4LF9Q 5LMNQ 3FHWA 1KQSA 1HNXQ 2NVTH 3PUXA 3S1MH 4A3DH 4A3CG 4GKJL 1ASYA 1YIJT 3W1GA 3TEHB 3AEVA 1M1GA 3HFZB 4DV1Q 3KF8B 1OXUA 5IY0A 3RLOA 5K36G 4DV3Q 3FKIH 4B3SQ 3AFPA 4GNXB 1OXSC 3EBEA 2JQOA 3RR5A 3PO2H 1YNXA 4B3ML 4JI7Q 4DV2Q 2A19A 2ALYB 2PQAA 2LCLA 2CFMA 4DUYQ 5C44H 1TWCH 2BA1A 3G4SA 4O2DA 1YVCA 1Q82U 1A62A 2E2JH 3E9HA 2DGYA 1PYBA 4C3IH 4DAYB 1IBML 3CCET 4A3JH 3CXCS 4AYBG 3J80i 4A3MG 2UXBQ 3E0EA 1MIUA 2ASBA 2N3SA 4K0KQ 4DR1Q 3CMEA 2Z6KC 1NZ9A 4UP8A 5M5YH 5C4JH 4POGA 3S1QH 3PCOB 5JJIA 1VQOT 3S1NH 1EUJA 5C3EH 5ELOA 2UXDL 1G291 4KI0A 3LH0A 2Q2HA 1AH9A 3CCLT 1Q81U 1E1TA 2NVXH 3KJOA 3CCVT 3G71A 2RCNA 4UPAA 1WCMG 1K8AC 4KHPL 1YI2T 3T1HQ 1OXVA 4JI2Q 4GN5A 1HZCA 4DNIA 3M9BA 1TXYA 3K80C 1Q7YC 1MJEA 2E5LQ 3I56A 3HOWH 3DB3A 1YJ9A 1JJCB 3LGLA 1YZ6A 2HIXA 4AQYQ 1X55A 3T1YL 2Q2IA 3U58A 3CCMA 3I7FA 4KHZA 1VQBA 3HOVG 4JI0Q 3HOZG 4BA2I 1XNRL 3NEMA 3K8AA 3CC7A 2K5VA 4R4QA 1FJGQ 3CCJA 4R4CA 4DV6Q 4LF6Q 1WYDA 2JVVA 4P73A 4LF4Q 3NBHB 4C2MH 3CC2A 3HKZG 1X3EA 1YHBA 1IBKQ 3PF5A 1C0AA 5C4XG 3UE0A 1SR3A 1Y1VH 2YTVA 1K0RA 1BKBA 1I5FA 3PSIA 4DV0L 4BY7G 1HZ9A 3L2PA 3VDYA 2UUCQ 2E6ZA 1I50H 2E8GA 2HIVA 4NPSA 2NN6G 3H3VI 2F4VQ 4BXXG 4A93G 3A5ZB 1X3FA 2WAQE 2V1CC 1YBYA 4JI6L 1LM0A 2VS1A 4IJHA 4GN4B 5M5XH 1Y1WG 3GTLH 3G48A 4GOPB 3PUYA 5AJ3L 3CW2C 2MWOA 3KJPA 1P16A 4PZ7A 5IP9H 4DR3L 2E2IH 4OWTB 3HOXG 4A3DG 4IFDI 3UDGA 4L5TA 2JA7H 2ZJQA 3M7NA 1KD1U 1N32Q 4LFAQ 4DUZQ 2PI2A 1VQLA 2LXJA 5JEAJ 3ULLA 3PIPA 1VS0A 1J5EQ 4DV5L 5LMNW 1Q82C 1QVGS 2ZTEA 5BR8L 4GKJQ 2EIFA 1YHQA 4X64L 3GDEA 5C44G 1R9TH 5IE8A 4JV5L 4GOPA 1QZHA 2N78A 1N8RU 3CF5A 3B6YA 3E9IA 4R1JA 4B3MQ 2PNHA 4YY3L 1UE1A 2BA0A 2NN6I 3TQYA 3U4VA 1XJVA 1IBLL 2BH2A 1E7ZA 1JJGA 4LF7L 1Q81C 3UDXA 3ER0A 2ZJPA 1PH5A 1XNQL 5C3EG 1IBMQ 3GO5A 2CWAA 2JA9A 3G4ST 5M5WH 3STBC 4B3RL 3M3YH 4MNOA 1H95A 1KHIA 4JBKA 5GAGC 2OTLA 1SMXA 1I3QH 4A3FH 2UXDQ 1KC8U 4LW1A 4OXPA 3CMET 1UE7A 1LYLA 2OTJA 4NB3A 1X6OA 3S17H 1JJ2S 3J81E 1SE8A 1A0IA 2HHHL 3I55A 3FP9A 1Q8KA 4KHPQ 2ZTDA 4LF8L 3HOUG 1YJNA 1M1KC 1N33L 3G71T 1AE3A 4LUVA 4IPDA 1VQMA 3LGFA 3BZCA 2E2HH 2YTXA 3CXCA 2VY3A 4HJAA 3T1YQ 3D31A 2ZM6L 1TWGH 5IYBG 3J7AF 1N34L 1XNRQ 1YHAA 5IT9E 4RG2A 1HNWL 2A8VA 2MQHA 3I56T 1Y1VG 3J81c 1YJ9T 2B63H 2KHIA 2Q2UA 4DKAC 3CCMT 1V43A 1EFWA 2EQSA 4QJFA 4NXNL 4JC0A 2ZJRA 4JI4L 1X3GA 2UXCL 2KVQG 3CC7T 1VQFA 1NMFA 3CCJT 4P75A 4LFCL 3I4MH 1GO3E 4IFDJ 3JAMi 1L2FA 1VQCA 3PUZA 4DV0Q 4A3LH 4L5RC 5DLQE 2VUMG 3PO3H 5IT9c 1NPRA 3CC2T 1KD1C 2B29A 2WAQG 3AFQA 4X65L 4A3GH 1IXRA 4PG3A 2QEXA 1VCIA 4LWCA 1QVFS 2GVBA 4TQUS 3TS0A 4JI6Q 3KF6A 2XTIA 5AJ3Q 5J26A 4X62L 2JA6H 1PVOA 3KBGA 4DR3Q 3RN5A 4JI1L 2JNGA 1LTLA 4R4TA 1HR0W 2JE6I 1N8RC 2YYZA 3HOYG 1VQKA 4IPHA 1EIYB 3L7ZC 1XNIA 4A3KH 4DV5Q 2ES2A 3RZOH 2FXQA 3A74A 3KLWA 2KHJA 5BR8Q 2K14A 1VQGA 1VQLT 4TVAB 1VQ5T 1X65A 1KL9A 4X64Q 4GNXA 3AQQA 3M4QA 1GD7A 4JV5Q 1L1OB 1NY4A 3STBD 2F52A 3LGJA 2VQEL 1BVSA 1YHQT 1N36L 4HIMA 1A63A 4YY3Q 2VQFL 2Q2TA 1IBLQ 2K5NA 3J80E 1K9MU 2JEBI 2RHQB 1VQDA 2GN5A 4P71A 1KC8C 5M3FH 2G3RA 4LF7Q 1XPUA 3HKSA 4RG1A 1Z47A 2I5HA 1BBUA 4JCVE 4HIOA 4ZN3A 2CKKA 1XNQQ 2EXDA 1D8LA 3DB4A 5IYCH 1K73U 1IYJB 2R7ZH 4B3RQ 1ASZA 2R92H 4DAMA 1QVGA 2HT1A 3UE1A 2OWOA 4JOIC 3CCUA 1SRUA 1IZ6A 1D7QA 3J80c 4AIMA 1JB7A 1OTCA 4OO1G 1KRTA 4A4IA 4B3TL 5IP7H 3UDFA 4A3BH 2OQ0A 2JK8A 4C3JH 4YCVA 3OTOL 2UU9L 4OX9L 2OTLT 1W2BS 3NELA 5FLMH 1E24A 2HHHQ 2JA5G 5FLXE 3I4NH 1CKNB 2K75A 4EQ5A 4LF8Q 2KENA 4MTNA 2VZAA 2OTJT 1E1OA 5C0XG 1JMCA 1N33Q 1Y14B 2XGTA 3GTGH 3I55T 1X54A 1SSFA 3CCQA 3PGZA 5M3MH 3P8BB 1YJNT 1OXTA 2N49A 2RHSB 2ZM6Q 4A3EH 1N34Q 1HNZL 2MI6A 1SROA 1HNWQ 1YITA 4OWXB 1FL0A 3M4PA 1VQMT 2JOYA 1RL2A 2K5HA 4RMFA 1HH2P 4LNQA 3I4MG 5FLXc 4A3LG 2JA8H 2D62A 2JJQA 4LFBL
chains in the Genus database with same CATH superfamily
4DFAA 1ZUUA 3V8LA 1VQ5A 3OOCA 1B53A 3MVVA 4DU9A 4JBMA 4DR4L 4QGUA 1XJWB 2HL5C 1FGUA 5C4JB 4QIWE 1SNQA 4OIKA 4UP7A 1AVZC 4OO1I 2MO0A 5K5PA 1PWTA 1JE4A 2WSFE 5IGBA 1A3UA 3CD6Q 1PYSB 4GY5A 4IALA 1LTAD 3S3NA 4GNXC 1VQPQ 1BDOA 1Q46A 3AB9A 2LZ6B 1NAPA 3JCMg 2MHVA 5LMUL 5E1FA 5H1SE 4A3JG 3SXHA 1SG5A 1BIBA 2KCMA 3JCMV 4M78E 1PV4A 2YU9H 4I65A 4NL2A 2K50A 1NCVA 3H9NA 4XQJA 4DR5L 2NVQH 2R7ZB 1S5ED 4A3IH 1XTDA 1OEBA 1Y57A 1P8LA 4L59A 4A54A 2K4YA 3TREA 2D0OA 2E70A 2O88A 4JS5A 3DM3A 3QWYA 1BO0A 1GM5A 1RDPD 4JRQA 1MKHA 1U5SA 4K6LA 4HIKA 1OX8A 2QCPX 2YRVA 1D2BA 3F2CA 3FB9A 2PVOB 3QXEB 3OS2A 3NBIA 1W4SA 2HBWA 1K28A 1UGSB 2A37A 3KLSA 5ELNA 4L5SA 3H3VH 2R7ZG 3JB9G 3RNUA 3M4GA 4N4IA 4PJMA 4LJZC 4YCWA 1E6HA 4J9DA 3K5MA 1K8OA 3IL8A 4Z89A 3F1ZA 3C4SA 1SYBA 2WAQB 1R8OB 1IL8A 5GAHC 1G5VA 3M7GA 4DV7L 4A76A 2BOSA 3J7YW 4Y92A 4CRIA 3OIQA 4BY1H 2HDAA 3HOYH 3CMAA 3P8DA 3U9SA 1Y8OB 1S1NA 1NBWA 2F2VA 1CKOA 4M77C 1M4ZA 5J3BA 3OYHA 2MNAA 1TQOA 2K57A 3K0XA 3CCUT 1PH6A 1BF4A 2MPMA 1V29B 1WJSA 2LS01 1R9TB 4LF5L 2CKZB 4DK6C 5J22A 4EPCA 2NTSA 1UTIA 4OVAA 4YCUA 2ENBA 4BY7H 4PJOF 3RLFA 5KGUA 3P7JA 2GTOA 5NUCA 2QI2A 2QQSA 3VYRA 3TP5A 3HL8A 1HNZQ 3CCRA 1LLRD 1TS2A 3JB9I 1X3QA 4BXXH 2UUAL 1HR0L 3F2UA 3ULRB 3SGIA 3CCVQ 5IGEA 3VYSA 4CC7A 4N0AA 2E12A 2L89A 3JAME 1YI2Q 2CVRA 1KDAA 2NYZD 4M7DF 2YLCA 2WB1E 1WLPB 2EYWA 3M3YB 4DR4Q 2HSEB 2KOLA 2PVDB 3OS1A 3GTMB 4J6HA 5GANd 3L2VA 1I3QB 5LJ5g 4F14A 4A3FB 1MJCA 1CA6A 1BIAA 1QP3A 1SYEA 1VQJA 3HGBA 2DBKA 1FXXA 2EJFA 4F16A 2CQOA 4LDXA 4IZ8A 4J15A 4X3TA 3JAMc 3CXCP 2Y0SG 5LMUQ 3BYYB 1I94L 3K7UC 1OOTA 2D8HA 3M5AA 2AMCB 4DK0A 5COYA 3EHRA 3T9NA 1Q95G 1DJRD 3KFUA 1A0NB 4ME3A 5EAYA 4QQDA 2NB0A 3RMHA 4A3FG 1EU4A 1U06A 3ERSX 4DR5Q 4FF4A 2RF4A 4DR2L 3VU3C 2X4WA 1AWWA 3RZDH 1Q86U 4EDUA 2KUMA 3IFDA 4C92G 1V9PA 3H0IA 3OYJA 2ZXOA 5CV9A 1K83H 5HY6A 3QOJA 3WWVA 1VQ8T 4LUZA 3CKIB 1SJHD 2SEBD 4R4IA 3I4MB 3ZYYX 3G6ET 5FJ8H 5FK9C 1NG2A 1KQSS 3TS2A 1CQVA 1ILPA 1TOVA 1X43A 3X3NA 4ANJA 3M0SA 1B8AA 1GHJA 4L5QA 4GLXA 3GIBA 4DR6L 3PT9A 4DR7L 5IYBG 1ZHIA 2C35B 4YWLA 4FYYB 1WIEA 1BU1A 4F04B 5JEAH 4DV7Q 2A5HA 1OX9A 3H41A 5GJVB 2JW4A 1UJYA 1QCNA 2X51A 2COWA 2ZAEA 4C5EA 1EY7A 1SEBD 2VGNA 2R93H 1QE6A 2A74C 4LF9L 1Q86R 1CKNA 3GD7A 1JT8A 3NK9A 1BOSA 1BI0A 4HA8A 3K6OA 2KGTA 4IJLA 4DBQA 1U1SA 4JLIA 4LF5Q 3D8GA 3CC4T 2Q8RE 1RAAB 2KQWA 2E1HA 1V1CA 3UATA 4H7BA 1MSGA 1WA7A 4JI7L 5HURA 3SWNC 4BUGA 2OF1A 4PQXA 1GUWA 2Y90A 1V1OA 5CVIA 1X9NA 4QVZA 4JBWA 5M3FB 4QMGA 2UUAQ 1MBYA 1HR0Q 4OF1A 4E2FB 3Q0AA 4NKLA 5E3FA 1XWEA 3VS0A 5GAMe 3BDCA 1B1ZA 1NUCA 3CPWA 4BA1I 3OWFA 2DL4A 1G3TA 4Z8AA 2FJ2A 2VW9A 1GFCA 1PH2A 3EG9B 2M1HA 1WI5A 1L1OC 2CSIA 3RD4A 2QAZA 4YWMA 3PNWC 3HPWA 4N4HA 4X6AH 1NBEB 1Q86C 1K4US 3CQZH 2OQKA 3CCMQ 2M02A 1FNWA 4OONA 3JCMd 1EYGA 2FO0A 3CRKC 2ENMA 4J9HA 4CDEC 2JS2A 2PQEA 2RK2A 3QIIA 1I94Q 1MMDA 3OMGA 3LX7A 3TSSA 1RKNA 2JXBA 2F0IA 1XXGA 2DL5A 1N9RA 2K5QA 4C0FA 5D65A 1KJWA 2DRKA 4DR2Q 4X34A 3EG9A 2GTJA 4QVCA 3UWNA 1L0WA 2JA8B 4RGNA 2LC4A 1KIKA 2DNCA 3TBIB 2KDSA 4FF1A 1VQNT 1DXMA 1N34L 4BBSB 4KMUC 3RNJA 3TSZA 3CCST 1QUQB 1IW7C 3LLRA 1I4GA 4OEMB 3MAQA 3BDOA 3HEJA 1UB4A 2RHIA 1WOCA 5G3LD 2YXYA 5GMKj 1ARKA 1UG1A 4BBRG 3PF4A 3RDVA 1AZPA 4DR6Q 3KYHC 3SHLA 1KIXA 4DR7Q 3AYHB 1NLPC 2EYLA 4HAEA 2H4OA 3SB2A 3PIP3 1HA6A 1RF2D 2EXZA 1MI2A 4BBSG 3PIOA 2NN6H 4K6DA 4AFUC 3H94A 3OYLA 4JOIA 3A5UA 1SNDA 5C0XH 1U0LA 3NTHA 3E2UA 1HCZA 2AQ2B 1B9MA 1PTOC 2YU9B 1QUQA 5GAN5 4E7JA 2YUNA 4LFAL 3JCMb 4PJOB 4Y52H 4A3IB 1J5EL 2D1XA 4IURA 1TS3A 4LF9Q 4HT8A 4HVUA 2NVTH 3NWTA 2ED0A 3PUXA 4NW2A 1ASYA 1YIJT 4GLMA 5CO7A 3AEVA 3HFZB 1OXUA 1GL5A 1G3SA 3OS5A 3NP8A 2EKHA 4M7DB 3FKIH 4XT3B 5IN1A 3V8KA 3QWNA 3MC0B 4ZTFA 3PO2H 3DWAA 4B3ML 4JI7Q 2F0DA 4PJOG 2CS7A 2NUTB 1TWCH 1Q82U 2E2JH 1B50A 1ZBXA 2AQ3B 3JSCA 4C3IH 1EFID 3CXCS 1PFBA 3NTKA 4PFZA 2V1RA 2F0HA 3TP8A 3P8HA 4BY1B 4M7DG 1NZ9A 4POGA 3HOYB 1W6KA 2X9HA 1VQOT 1LT6D 5LJ5d 1EUJA 3HP9A 1JOOA 3MXPA 1K0SA 4E7ZA 2MK5A 4D8KA 2GQVA 2O01E 2P84A 2NUTA 1S5FD 5IGGA 4KHPL 2QYZA 2L0CA 2D8JA 3BY7A 2EAYA 1OXVA 1KG1A 3HKZB 4LAAA 2FRYA 3V7RA 4XDXA 1MJEA 4WFN3 3I56A 1S5CD 1SNCA 4BY7B 4ZUJA 1ET9A 1YZ6A 2HIXA 3HOYG 3OSSC 4DOWA 3I7FA 2LCSA 2F0PA 4BA2I 2RNAA 2RSNA 2DLPA 4FL6A 3OYBA 4HR7B 1Q82R 2X4YA 1TKWB 2BTTA 1HTPA 4JJDA 5KYXB 1QWYA 3CCJA 3K58A 3A1PA 3NGPA 3QJYA 4LUEA 2JVVA 1KLGD 3MWYW 3CC2A 3HKZG 2FFKB 4UHVA 5C4XG 4WORA 1SR3A 1Y1VH 1WFWA 2WB1B 3PSIA 4BY7G 5FO9B 1O80A 4DQ2A 2EYXA 2F0QA 1JORA 1K1ZA 5FWCA 4M75E 4ZGEB 4FCYA 2E8GA 3FJ5A 2H1EA 3NQTA 5KNBA 2DEQA 5IXFA 3VR6A 4BXXG 1EY5A 3HRUA 3L2WA 5GANf 3QDRB 5M5XH 2E3HA 1PLFA 1SMYC 3G48A 5AJ3L 4J83A 2MWOA 1JCKB 4ME5A 4DGZA 1WTWA 5IP9H 4DR3L 1BCMA 4OWTB 3C12A 2P0QA 4AG2C 4M7AC 2A69C 2C9OA 2ZXPA 5FOBB 2G9DA 4FYDA 3OB9A 4LFAQ 1AN8A 2B2TC 5JEAJ 3TDQA 5CKEA 3RZDB 4DV5L 1J5EQ 3S1QB 1Q82C 1QVGS 2DILA 3DMUA 4RH6A 5BR8L 1K83B 1YHQA 4K5VA 1TY0A 2ZPGB 3HRZC 1KABA 3MEAA 1HPCA 5IE8A 1QZHA 1TUDA 3GP8A 2JMAA 1UHCA 4J9FA 1N8RU 4X3SA 3CF5A 2ZZDA 1ZX6A 1WYXA 4LNPA 5GAOl 4B3MQ 2BH2A 2MGSA 2MUYA 3TQYA 5IOCA 1E7ZA 2RQUA 4Z88A 2MOXA 3L2RA 4LF7L 2K5LA 3LW5E 2I07B 4I7ZC 5L37A 4BE0A 1RJTA 3VS2A 1UGVA 3CCUQ 3FMCA 3IQLA 1RI0A 4Q5VA 2D9TA 4O5VA 2DJZA 4PMCA 2DL3A 3CC2Q 4KY7A 1KLUD 1D5XC 5I4DA 2LCCA 1EZ8A 2Z8LA 1H95A 2ASBA 5GAGC 1A6XA 2DF6A 2R93B 3C1EA 4OXPA 3AT1B 3PE0A 4RKBA 5KE3A 4L63B 2HHHL 1IB8A 3I55A 5GAN3 1FWZA 1QVPA 2J7IA 5GAMg 4KHPQ 2A6ED 4XU1A 2RDHA 3R2IA 1M1KC 3WDNA 1LJOA 2K05A 4LUVA 1N8RR 4U68A 3LGFA 4XQNA 3D4WA 2EJ9A 2E2HH 5IHNA 3M0RA 4HJAA 2VY3A 1HNWL 2NBFA 4RTYA 4JDSA 4XU2A 1J9OA 1EQVA 3CPWP 2MQHA 3V2TA 2QTVA 5HK3A 2EQIA 5GAN7 1YJ9T 4EMKC 2CP7A 4ZYSA 1EFWA 4HCEA 4PNOA 5C5MA 3SR1A 1X3GA 2FZKB 5ELCA 1I4K1 1QG7A 5GAOm 3CC7T 1ICFB 1VQFA 2WKDA 1GCQC 1NMFA 2DZ9A 3UF4A 2BE5D 4P75A 4LFCL 1YCSB 1E2VA 5GMKh 1SYDA 4A3LH 4HVWA 3PO3H 4R55A 1K76A 5CR3A 2J6KA 3AFQA 1SJED 4M78D 3NSWA 4PG3A 4ME7A 2OAWA 3TVTA 2O4XA 5A0DA 2M00A 3CQZB 1GUGA 3KF6A 5AJ3Q 5CV8A 3FEOA 1VQ8Q 2ED1A 1IGQA 5I22A 4DR3Q 3G6EQ 3GLXA 3EJIA 1SHGA 1RODA 5C5LA 1HR0W 1STYA 1N8RC 2EYPA 5GANh 3JCMf 2V8IA 4IPHA 1EIYB 2K3XA 3FJPA 1XNIA 4DV5Q 3I4LA 5DM63 3RZOH 3H09A 3I55Q 3KLWA 5BR8Q 2NLUA 3VKIA 2DJGC 1VQLT 1VQ5T 1X65A 1WTXA 1QB5D 4DF7A 2XDPA 2K1BA 3QJ6A 2RDGA 2F52A 3MP8A 1LT5D 4JJNK 1LTGD 4HIMA 3V96A 3A98A 1H641 1ET6A 2JEBI 1K9MU 4P71A 2RHQB 1VQDA 2GN5A 4LF7Q 1XPUA 3QZ5B 3HKSA 1FMWA 2HQEA 2B2YA 4KBMB 4ZN3A 1BR9A 4J9EA 3TSWA 4F8MA 3DB4A 2R7ZH 1K73U 4QVDA 2DNEA 1NEGA 2KI7A 3A54A 2HT1A 1Q90A 1XOVA 3JCMe 1R4QB 1IZ6A 1FX7A 4FT2A 4OHJA 1IO6A 1I8FA 4ELZC 3KK7A 4HCBA 5L8RE 1H3ZA 2NVTB 1U9RA 2LMCB 4TKOB 4OX9L 2UU9L 2DJQA 1LTBD 3A8JE 3NELA 5FLMH 3LX0A 2HHHQ 2KCNA 1LABA 2JXMB 4EQ5A 3RBBB 2K75A 2KENA 1CKAA 1E1OA 3FKIB 5C0XG 3U23A 2SRCA 2F0NA 3PO2B 3PGZA 2X3WD 1DZ1A 5FU7C 3FLGA 1YJNT 1CFMA 1OXTA 3GNGA 4A3EH 1TWCB 4UAIA 2MI6A 2EPBA 1K9MR 2K2MA 1HNWQ 2E2JB 2NUPB 3JCMQ 2GF7A 3I8ZA 4RMFA 1BUVT 1HH2P 4C3IB 1JR0D 2A28A 2D62A 4G4KA 3HSBA 4LFBL 4YTLA 3WOEA 1K73R 1YNJC 1EFNA 2WACA 3META 1NTGA 3FKIG 4LFCQ 1JJ2A 4C3HH 4JJBA 1DOLA 3PO2G 4MZ9A 1CZGA 1C48A 4DNRB 2J6FA 4FM4B 2KCCA 2XICA 3IAYA 4A3CH 1RAIB 4O1NA 5J39A 4C3IG 4C0GA 2LT1A 2FEIA 2F3VA 4PZ6A 5LJ5f 1VQNQ 4IOAA 1RI9A 5K36H 1QCFA 4PL6A 3CCSQ 2Y0SE 3LWUA 5C0XI 1ZSGA 1VQ4A 1WQ7A 1MSHA 2LJ0A 2HL3A 4HKEA 2C0IA 2E5QA 2QDLA 3ZFJA 2KEEA 2MCNA 1VQAA 2PPBC 1UE6A 3K7AH 2IG0A 2YLBA 3OYAA 1CTMA 1B7YB 1PRTD 1LTRD 1L0XB 3GTMH 4J7FA 4LE9A 3I2ZA 3S9WA 3EFSA 2B2VC 1RAEB 4C92E 1YJWA 4UDUC 2VUBA 1L0YB 1Y1VB 4KV6A 2SEMA 2X4XA 1K73C 3SK4A 4J7IA 3RR6A 2RKSA 3NHHA 4HCSA 4DBHA 1RLPC 2F2XA 3I72A 1BB9A 2CUDA 2RA4A 2F3IA 2DUDA 5EPKA 3M57A 5M5XB 4WJ4A 4RTXA 4J8QA 2B2UC 4ZN1A 4IO9A 1YIJQ 2AHOB 4GKKL 2QASA 4DXGA 1H9SA 1ZKOA 4EQPA 5IP7G 1PH7A 2E2IB 4X66L 5GAOr 3ASKA 4FU6A 2PZ1A 1K8AU 2L3SA 2AK5A 1VQEA 3EN2A 1X27A 2RDFA 2O2LD 4GBQA 2HDLA 3MKDA 3D0FA 2DZCA 2BZ8A 1WTRA 2HEQA 5JJLA 4XXEA 5HCKA 1HFGA 5I2XA 2RI3A 3VYUA 2Y4XA 1G83A 4C8QF 3CPWS 1TU2B 2IX0A 4EQNA 1QILA 1O9SA 2UU9Q 3EIVA 3O13A 3S24A 4DN4M 1DJ7B 3EGDA 3HRTA 4OB3B 5GAMd 4BI4A 3Q8DA 1PFSA 4NP5A 2K5FA 5IP9G 4AFQC 2YV5A 4LUOA 4QF4A 4CKCA 1U4RA 1D1BA 2L2PA 2ABLA 3DWQA 4BDZA 2HUGA 1ESRA 4GOPC 1VQOQ 5GAOn 1DD2A 1I1JA 2DY7A 1I81A 4A93H 2CGHA 1WTHA 1B70B 1VF7A 1TWAH 4S3SA 5BN5A 1KAAA 4PJJA 5JAVA 2YHTA 1G51A 1OZ3A 2PW5A 5KYNA 2EYMA 1SFOH 4OGCA 1YITT 2CZ0B 4LFBQ 2QA4A 2Z9HA 4HJ7A 2HD3A 3HOXH 1Q12A 1K8AR 3NENA 3RLNA 2CH4A 3L9AX 4I7AA 2WINB 3PQIA 2NVYH 1AZQA 1TWFB 2Z0SA 4ORZA 3TEEA 4E6RA 5FWBA 4L6TB 1LPLA 2AWNA 1LACA 3ZL7C 4CHTB 1EQTA 2R3ZA 2CCZA 2XMFA 2K32A 2N8NA 3OS0A 3CD6A 1TT2A 3BZKA 1XMQL 3I3CA 1RAHB 2E2HB 3L3OC 1VQPA 2QGGA 4ZKBB 4J9BA 4KY6A 4APVA 1NEBA 4QT7A 5LJ5h 3U9OA 1T0JA 2FL7A 2DVJA 4XU3A 4ZKCB 1EY8A 4JI5L 4GLVB 2RD1A 2COZA 1Z9FA 1NM7A 1IL2A 2DXTA 1T5EA 2J06A 3TZUA 4OMOA 2FZCB 2NUCA 1CQFA 4ELYC 4RCOA 4F88A 1VQ7T 1SDFA 3PO3B 4N8X1 4HSPA 5TSSA 3VR3A 1X6BA 1GKHA 4PZ8A 3A8LB 1STNA 4IFDG 4FO2A 2HAXA 4JZ4A 3H0HA 5CORA 4QQBX 3LWEA 2FVUA 4ATOA 4GKKQ 1JO8A 4M77F 4JI3L 1BCOA 2J7ZA 5GROA 4BBRH 3R6NA 3K81C 4X66Q 1KRSA 4UY8C 2IY5B 2LSSA 4ZQ3A 5FO8B 4KH1B 1M8MA 1G2TA 1PH8A 1CSKA 1B07A 3GTPH 3PO3G 5CQXA 1VQHA 1TVXA 1HUNA 5IYBH 2EQKA 2KBNA 2HCIA 4HJ9A 3RKYA 4N0AC 4BBSH 2L3QA 3JB9J 3BFMA 5JPNC 4Z9CB 3MO8A 3RZOB 2KXCA 1D09B 1KQ1A 2BE9B 3DWPA 3A7LA 3HHTB 2I0QA 3EFOA 1IGUA 2L3PA 2P0KA 4PKCC 2EYJA 1ENAA 2G6FX 4B3SL 2QG9B 4K14A 4FYXB 1HRJA 1M9SA 3N6RA 2EJFC 4DV2L 2F0MA 1OZ2A 2MO1A 3J7AV 3RERA 3FVQA 3G6JB 2PZWA 4XYQA 4JPBW 3FP9A 4PJOE 2QTXA 1EYCA 1SYFA 4JRIA 2F0JA 2PCFB 2IHEA 1T3SA 3RN2A 4K0KL 2JUFA 4QY7A 1U4PA 3EG2A 2FPDA 2RM4A 1Z6HA 3CCVA 1A8VA 2SNSA 2A68D 1SSOA 3L0OA 1M1FA 3UDCA 4M7DE 2LKVA 1YI2A 1S72T 1KAWA 1T5XD 3MHXA 4OGEA 1A15A 5F2DA 3GV3A 1YJ9Q 2DX1A 4FT4A 3M0UA 4CKEA 3OSOA 5GJWB 4JI2L 1RD9D 2LP5A 4WJ3M 4XIGS 2PUKB 2QQRA 3WVDB 4KGXB 1XMQQ 1NNXA 2IWHA 1OULA 3HS0C 3TP7A 1CSQA 3M0TA 4A3EB 3HZXA 1JWUD 1JJ2P 1CZWA 1F9QA 4JI5Q 1GJXA 4M75D 4XTYA 4IN3A 4LF6L 5FLMG 2RQTA 2WFWA 2F3WA 1MGSA 1S5BD 1KSWA 3VV0A 4C5IA 1FNVA 3GTOH 3E9FA 2Z0WA 2KSSA 6AT1B 1JBMA 4HIDA 2CZ1B 1QKWA 3HKZE 3PTAA 2E4HA 1PH3A 4AMCA 2UUCL 1PH9A 1CKMA 4KT0E 4A3EG 3Q24A 5LJ3g 1AP0A 5KIXA 1X32A 5C4XH 4QUCA 3T4AC 1Y69U 1G6PA 1VQ6T 4NS5A 2CZ7B 1SAPA 1PDQA 4Z02A 2PZTA 4P5NA 2A73B 4IPCA 4LDUA 4HJ8A 4JI3Q 2V4DA 1VYUA 2F5TX 2HCCA 2KEDA 3M59A 2BE7D 3PFSA 3JCMW 5JVG3 2QILA 3H0GG 5KEEA 3RKWA 1U5KA 1G6ZA 3OA6A 4JVZA 2Y0SB 1N32L 4DUZL 2RPNA 2CZ6B 2PUOB 4OMNA 2J4XA 2QKIC 2P4TA 3K7AB 2IX1A 1QW1A 1VQ9T 3R3OA 4POFA 5EC7A 2RN8A 3FHWA 5CBAE 4A3CG 4DAVA 4GKJL 5IGCA 5CV7A 1ZQ1A 5CCAA 3UPUA 4C8QG 5C4ZA 5IY0A 5K36G 1X3PA 4LN2A 4B3SQ 4GNXB 1D3BB 1GUOA 2RH2A 4C92B 4WTOB 1OXSC 1Q3LA 3EBEA 3RR5A 2KRMA 2A19A 4DV2Q 2LCLA 4RTZA 1WZOA 2V26A 4PMBA 4O2DA 1KDCA 3M53A 2O5IC 3GP7A 2Z4IA 4CC3A 4DAYB 2KA7A 3CCET 4A3MG 1RHPA 4ZAIA 4UC4A 2BZYA 4DXFA 2CT4A 2NWMA 1MIUA 4K0KQ 1C4QA 4UP8A 2FRWA 3S1QH 1YNZA 4R4OA 1IKMA 3S1NH 1D3BA 4C92A 4KI0A 1SRMA 3EQLC 5GAN2 3CCLT 1Q81U 4RTTA 1ZSZC 1E1TA 2EQMA 2LJ1A 3KJOA 4PLLA 2HDMA 2NVXH 1AWOA 2RCNA 3BW1A 1TG0A 2LTOA 3KLSX 2GFAA 4JI2Q 3QYGB 1VIFA 4DAYA 5D3DA 5A2QL 3R2TA 1RTOA 3K80C 5DNFA 5D6YA 4DEXA 1Z9QA 3DB3A 4LDWA 4FXDA 3LGLA 4XT1B 3HOVG 3D4RA 3CCMA 1VQBA 5GAMf 4LUDA 1AOJA 2H3JA 1GRIA 4VUBA 2A36A 1GUNA 3NEMA 4RA8A 1XNRL 1ENCA 4R4QA 4A93B 1SNPA 1TWAB 1JXOA 2F03A 1EIHA 4X3UA 4LF6Q 2DL7A 1LTSD 3X24B 2A6EC 1SFOB 3NBHB 4C2MH 3E19A 1X3EA 3HOXB 4M77B 1LO5D 1C0AA 2VVKA 3UE0A 2E64A 3W3AA 1I5FA 1VA7A 4ZGJB 2PO4A 2FB7A 3VA5A 4KH0B 4FNFA 2NVYB 3K5LA 4AFSC 3VDYA 2HIVA 2UUCQ 4IUTA 1LTID 2LRQA 1Q81R 1BCPB 4A4GA 3GPLA 1PTOF 3A8OB 3VS1A 3A5ZB 2RA2A 3IKJA 4A93G 3I5RA 2V1CC 3NPPA 3GTLH 1XTCD 1HUMA 5LL6X 3KJPA 5M9OA 1P16A 4PZ7A 3EHQA 2M0OA 1PKTA 2BE5C 3E5SA 4HVVA 4M77G 1VIEA 3HOXG 2EZVA 3Q6SA 1KD1U 1N32Q 2VYTA 4DUZQ 4M78C 2PI2A 4K5WA 4OIJA 3PIPA 1PRMC 1W6XA 4GKJQ 3FPPA 4KUIA 4NDXA 4X64L 3MTSA 5GAN6 3S3MA 1F9RA 4DEYA 3JB9D 3MZ5A 1WTOA 1EY6A 4EIKA 3QDFA 2DTOA 2XD0A 2PNHA 4KTAA 3SK6A 3H8ZA 4DBFA 2XIDA 3OIPA 1UE1A 2BA0A 1PSFA 4YY3L 2PNRC 3U4VA 2DEUA 3JCMc 3OYFA 4FSSA 3OYKA 3OPOA 5C6AA 3EG3A 1Q81C 1STAA 1FMVA 1I4HA 1XNQL 3EH2A 3SFMA 5C3EG 3GO5A 3G4ST 4XU0A 3L2QA 4BBRB 5M5WH 4B3RL 3NXWA 2CYZB 3SD4A 4MNOA 1KHIA 2YDLA 3GTPB 1KD1R 2KRNA 3QSUA 2EJGC 2F4IA 3Q23A 1XQHA 2VXEA 1KC8U 4LW1A 3CMET 1B9NA 1UE7A 4NB3A 2CDTA 3S17H 1LOJA 1JOKA 1JJ2S 1MUZA 2XRQD 2VB6A 3THKA 2KBTA 4LF8L 3H91A 7AT1B 1YITQ 3MHBA 2D5DA 3G71T 2JJ9A 3BZCA 2RB6A 2RBMA 1KDBA 2EY1A 5IODA 1TWGH 1GFDA 3SHWA 3J7AF 1SYCA 1YHAA 2F0FA 5CYUA 3T56B 2JYOA 2CUBA 2A8VA 1XNRQ 2E76C 4OL7A 5C0MA 1V43A 1W1FA 1EY0A 4JC0A 2KQ3A 2J0TD 5GAMh 2ESWA 4BDYA 2M9UA 2RF0A 5GANj 2PNIA 1GO3E 1A2UA 5I2SA 2FINB 1VQCA 2LQWA 4LK1C 4L5RC 3EG1A 1FMKA 3M54A 1KD1C 1KHCA 1T0HA 4M7AF 1KC8R 2JN0A 1EYAA 1FNUA 4F7UF 2F0UA 2F0SA 4X65L 1CHQD 2X6LA 4TQUS 2CP6A 5FW9A 5CR2A 2FMCA 1GBRA 2X4JA 4RKUE 3SWNB 3QO3A 2H8HA 3H6MA 2WKCA 1AD5A 3RN5A 2JNGA 5BN3A 4PJOA 3SEBA 2JE6I 4C92D 1G91A 2M16A 1VQ7Q 4EMGA 2Z1CA 4ZTJA 5CAIA 1TH7A 1C1AA 4A3KH 2QEJC 1WD0A 4ZRZA 4NMZA 4RHSA 3J81L 2DXBA 2VASA 2BDOA 4M7DA 1VQGA 4X64Q 3AQQA 1WHHA 3GTOB 2E10A 4A63B 5CKDA 1L1OB 1NY4A 3STBD 2VQEL 1AWXA 4WF2A 1N36L 3PGGA 4YY3Q 2Q2TA 3OYGA 2QQ9A 2RI5A 1PRTC 2LNVA 5C4XB 5KYYB 1BBXC 1KC8C 4DBRA 2G3RA 3I70A 2L1BA 4JCVE 1V76A 1XNQQ 2CKKA 3KXTA 2EYQA 2K5IA 4B3RQ 1QWFA 2PZUA 2JS0A 4DAMA 4V190 4C5GA 3CCUA 1SRUA 1BI2A 2LX7A 1JB7A 3P1HA 5IP7H 3UDFA 1MGQA 4A3BH 2DE0X 1UHFA 2NUZA 2JK8A 4C3JH 5EKIA 1AZGB 2OTLT 2NTTA 3X25B 5KYYA 2XIWA 1PVOA 2PYKA 1E24A 2IPOB 4LF8Q 2OTJT 2HMAA 4RHRA 2PW7A 1Y14B 2XGTA 4BB7A 3BDUA 3GTGH 2YRDA 2RVLA 4DA2A 5M3MH 5FRNA 4KUDK 2PU9B 5KYXA 1S72Q 2RHSB 3VS5A 4RGTA 4PJNA 1SROA 2XU8A 3I91A 1BCPD 3M4PA 1VQMT 1RL2A 1EOTA 3BZDB 2O9VA 4XK8E 2K04A 5FO7B 2JSOA 2B39A 1G2BA 1X01A 1OU8A 1PTOB 1PZKD 2F0LA 3EVQA 2JJQA 3W2DA 1IHWA 5HKCA 4CJ1B 4A3GG 4HEDA 3J7A5 3ZJYC 2H5XA 4EMHA 4FDBA 3K0YA 1WGSA 3S1NB 4MMLA 4J6XA 3J80L 2X69A 4X65Q 2KT8A 1AW7A 2NVXB 2HQLA 2L12A 2ROLA 3MA2B 2A0FB 3C1FA 4C5HA 2E75C 5GAN8 3L2ZA 4F17A 2QEXT 4G57A 4UP9A 2LJ3A 4H02A 5CV4A 1A3TA 5EPLA 5EKKA 3M0PA 2I5MX 5GMKe 3ZEHA 1VQ8A 2QQAA 2QDYB 1CM9A 1GOZA 4KKTA 3W5OA 5DM7R 3X26B 1PNJA 1JXMA 3G6EA 1VQ6Q 2ICEC 1PCXA 1QWEA 2XK0A 1HJDA 5FLXL 4J8OA 1M2OA 1VQKT 4JYAL 3K5OA 4C2MB 5T1IA 1GUSA 1TWFH 1ZYRD 2BCOA 3CAMA 4R8IA 1QVFA 2VQEQ 2BDNA 1BXTA 1QJOA 3T13A 3J7ZC 1XPOA 2GCXA 2KJXA 8AT1B 1N36Q 4JUVA 1QLYA 1JU5C 2DBMA 4C0ZA 1C7YA 5IYCG 9ATCB 4JS4A 1VQ9Q 4YIJA 1U4MA 4BACA 3CP0A 3GTLB 1WCMH 2AUJD 2EE1A 3BE3A 4C1NI 1WFQA 1PA6A 1SLJA 5KH6A 2X35A 2EDGA 4MHEA 1PD0A 5AFWA 2XDBA 3GTJH 2ECZA 4IFDH 2FYKA 5IIFA 3QUIA 5I2MA 4R56A 1MD2D 2GVAA 5J1ZA 3I4NG 2EW3A 1EIFA 1VMPA 3JRZA 3VA7A 1ZXTA 1PH1A 5I21A 3G7ZA 3KDFB 3E9GA 2DVEA 2GQIA 2G5DA 2VV5A 1CA5A 2GFUA 3CCEQ 1GVPA 4PJOD 4AH6A 1SYGA 2R7FA 3M4OH 2LQNA 2ZPBB 3W1BA 5ISRA 2DD5A 1N9WA 4QKUA 2DXCA 3VR5A 1KQ2A 4J9CA 5D14A 1PH4A 5GAN4 3CCLQ 4F87A 3GNFB 1R0CB 1HXYD 4C3HG 3O5ZA 4M7AB 3RESA 3CCQT 2DD4A 4M7DD 1DOKA 4F7UB 3VUBA 1Q1BA 1STGA 1UAPA 1UE5A 2KCTA 3KDFA 4C1NK 4ZK9B 3RUXA 1OQKA 2BIVA 1S3OA 1VMCA 4RGMA 5M5WB 5C0XJ 1EQQA 1K3BC 4E7LA 2R61A 2R7DA 5LJ5j 3IFTA 2KY9A 5FU6C 4IUNA 3BU2A 2MAMA 2YT6A 5JJZA 3SK5A 1I4QA 1E6GA 1NPPA 1RTNA 3R6OA 3S17B 5KYLA 2K2VA 4M7AG 1KXLA 1B7TA 4F7UG 1X56A 1TS5A 4M7AA 3MXNA 2AKKA 2DTHA 4F7UA 3GQBA 4P74A 2NZOA 1QZGA 3X20B 1TUGB 1VYVA 3I4OA 2A68C 2B2WA 1HXDA 4AT1B 1J6QA 1SSHA 2B2TA 2FHDA 4A4HA 4H0LC 2IL8A 1T9HA 1TWGB 2L15A 5LL6S 3F70A 3VS3A 2RJDA 3LWIA 1VQNA 1BK2A 1OV3A 5KE2A 1HQRD 3CC4Q 1LUZA 3CCSA 2OI3A 1SNOA 1LT4D 2F0KA 3DHQA 4ALPA 1B4OA 4OB2B 2N55A 3H3VI 3I90A 1CUKA 2BH8A 3D3RA 1H9KA 3CU7A 4JYAQ 2K52A 2LQ8A 4KK7A 3F2DA 1VQIA 1JQYD 4OMFB 2Y4YA 1UGQB 1V1QA 2MIOA 3S2HH 2K6AA 3X28B 1G3WA 2COYA 3A8KE 1WJRA 1YEZA 4PMWA 5ECAA 2PTKA 2CW0D 3CQTA 1YP5A 5FROA 2B8FA 4P72A 4M75C 1AEXA 4TSSA 5EBDA 2O31A 1STBA 2AWOA 1B44D 4HT9A 2K28A 4YHHL 2C5CA 4HCCA 4X1VA 5GQOA 4GLAC 4C0DC 1V1PB 2NZ1D 2DETA 2W0ZA 4EMKB 4MDXA 1OI1A 1YIJA 5ELBA 4R9WA 4A3KB 1MHNA 5IYDG 3E0JA 4OELB 2DAQA 1D0ZA 3CMAT 1SE3A 3H0GH 4EX5A 4QQGA 2RHUA 4DV1L 1SE2A 1PHTA 2F0OA 3G4SQ 1JOQA 1D1CA 3CHBD 1MMNA 2J6OA 4J6WA 4J6YA 3URGA 4C8QE 3F2BA 2RHYA 4KKSA 4A53A 1V1PA 4JBJA 3V7SA 2NUPA 3HRSA 3ULPA 2VUMH 4LMQD 4DUYL 4EMKA 4A3KG 2XDDA 1GHKA 3CMEQ 2B8GA 1C0MA 1RABB 1VQOA 2RK1A 3CCRT 5LJ3e 1YWPA 5E7NA 2DRMA 5EPJA 3TQ7P 5KYWB 4DR1L 3G71Q 3BJUA 1K9MC 2E2IH 5GAEC 3G1JA 2D9UA 2E6NA 4ZGDB 1MMGA 4A3MH 5I9PA 2B3GA 3JCMh 4X9DA 4A3BB 1OXXK 4C3JB 2L3RA 2KYBA 1ZA2B 4Q5WA 5EBCA 2F2WA 2LNHB 1C9OA 3HG9A 4GN3B 2EGEA 2KXDA 5I11A 1HZBA 1HJPA 2M9VA 4MZTA 1E7OA 2K3BA 1F2YA 3J81i 4GLKA 1ZBJA 1F1BB 2EBPA 3GTGB 4ULLA 2IT1A 2VL6A 5M3MB 2L4NA 3RMSA 3OW2A 4AQYL 2R6GA 2M0YA 5JVH3 1MV0B 3ME9A 3E6ZX 1IRXA 5IHKA 2ID0A 2Z6KA 3ERQA 4JI0L 1WHKA 4K2LA 1TIID 3FEWX 4C3JG 4A3BG 1D1AA 1BBWA 1STEA 3K57A 2OJ2A 3HOVH 3U50C 3EFXD 3RIRA 2DO3A 3A55A 4HMIA 4R0KA 1II3A 2IPKD 1ZUKA 3WOFA 4U673 4XYOA 1H9MA 2XRSD 5M3MG 2X3XD 1SNMA 4EGVA 5I2YA 1P92A 2XHCA 1K3RA 4ILWA 1WXUA 5G3LF 4BE1A 1GBQA 4DOVA 3QG1A 2JA5H 5CGKA 4OX9Q 2K3YA 5FU7B 2IHFA 3BYTB 3UDIA 4YHHQ 1SXTA 1JICA 2OAUA 4EVOA 2LVMA 4BY6B 5A2QE 2R57A 2KHSA 1E2ZA 2PQAB 2QW7A 5CV5A 4M77E 4O0AA 2PI2E 1QCBD 4OMLA 1QVFP 3OYIA 4ZCKA 1BI3A 4FXKC 3S1MH 3TMEA 4D8DA 3W1GA 3TEHB 1M1GA 4DV1Q 1M30A 3OBWA 2AQ1B 2A08A 3RLOA 3NUCA 5KYIA 4XTZA 1UE9A 3AFPA 1UEAB 2JQOA 3EAEA 1YNXA 1I4RA 1YN8A 2CFMA 2PQAA 2D6FA 4DUYQ 1I0CA 2DXUA 4X9CA 2SDFA 5CKBA 1A62A 1EX4A 4CDFC 4OP0A 1PYBA 1SEMA 2OTLQ 1WCMB 2D2CC 4N4GA 1IBML 2LFNA 4AYBG 2ZCFB 3J80i 4IQZA 1WHGA 2C0TA 2F69A 3E0EA 3I73A 3GTJB 3KFVA 2OTJQ 3D6WA 3QR8A 4DR1Q 5M5YH 2ZPEB 5C3EH 2F5KA 5ELOA 1G291 3LH0A 1AH9A 4RUGA 1VQMQ 2RHZA 4CDCC 1Y07A 1EZ6A 2EGCA 3PVQA 1K8AC 1WCMG 4G7HC 3REBB 1YNND 1HZCA 4RWSC 3M4OB 3NFCA 4JK1C 2RJCA 3UI2A 3M9BA 1TXYA 3HOWH 1PKSA 1F2ZA 1YJ9A 1JJCB 4AQYQ 1X55A 3T1YL 4KHZA 3HOZG 4JI0Q 1DM0B 2K7VA 3X3MA 2IJ0A 3JCMP 1TXQA 3CC7A 3K8AA 1OU9A 4JZ3A 5L23A 1GXIE 2E5KA 4JW0A 4K2KA 4R4CA 2P0PA 1WYDA 1IHZA 3M0QA 2OX7A 4P73A 4BWGB 4V2SA 3OWEB 2D0NA 1YHBA 1ML0D 2DJFC 2QEXQ 3PF5A 2VGMA 2YTVA 1K0RA 1W6JA 4FXGC 4IUPA 1G8XA 1Y7XA 2JMCA 2E6ZA 1I50H 2VB3X 2EY5A 2XKOC 3OMCA 1DOMA 2B2UA 2KROA 4XQ3A 1X3FA 4R8NA 1YBYA 1D0YA 5CBEE 4QCLA 4GN4B 2JZ2A 5JJKA 4GOPB 4II1A 1VQKQ 1JWSD 1N6AA 3L42A 1PZJD 2K03A 3URYA 4HCKA 3FIFA 4A3DG 1GCPA 1FYCA 2G9HD 3NE5B 4IFDI 2JA7H 5CC4A 2FMMA 1A3VA 4O42A 1O78A 1M8AA 1QP2A 3M7NA 2R58A 2HZYA 4KN7C 4BD3A 1VQLA 1JB3A 1F2MA 2KYMA 3ULLA 4IIMA 1LNXA 4JLGA 1YCYA 5LMNW 3S3OA 3O8VA 2EWNA 4DA4A 4DK1A 1XYIA 1KFZA 1SKUB 1RCVD 2KECA 3GDEA 1SRLA 1FGBD 1OYXA 5C44G 4JV5L 1UGRB 4GOPA 2Q8TA 2DYIA 5IH2A 1Y0MA 4C92C 3S2HB 1AEYA 1EYDA 3REAB 4MIUA 1WD1A 2EVRA 3R8BA 5EG2A 3OQ5A 1IBLL 4FYVB 3VRZA 1U8RA 3UA6A 2BKDN 3CC7Q 1R4PB 2CHBD 3UDXA 2ZJPA 2QDBA 3ND9A 1WNLA 3TP6A 4L8JA 1PH5A 3P20A 3MFYA 3WXMB 4IUUA 1IBMQ 3CBPA 2JA9A 2F0EA 1Z7TA 5CKFA 2KR3A 3STBC 1X75C 3DM1A 4B9XA 5C3XA 1RACB 2EKOA 4JBKA 1SPKA 2RMOA 2VC8A 4IUQA 4B9WA 4WCIA 2W10A 3RKXA 4MMKA 2QQBA 1EEID 4KY5A 4FSXA 1UDLA 4XTVA 3CCQQ 3H0GB 3J81E 3QHSA 2DPPB 4CDDC 5HGTA 5GAMj 5D3IB 1YJNA 2BZXA 3NWSA 3MJXA 1R77A 1AE3A 4IPDA 2FZGB 2IVWA 5KYUB 3SE0A 3EFRA 2VUMB 3FDTA 3T1YQ 4C8QB 4A4EA 1VQLQ 1VQ5Q 1E0BA 1D1KA 3D6CA 3GV6A 4FVMA 3VYHB 4RG2A 1STHA 3AU7A 4CKBA 3J81c 3I56T 4M8AA 2B63H 5I6YA 2KHIA 4DKAC 1KNAA 4QJFA 2UXCL 2ZJRA 4JI4L 4LDVA 2L9HA 2KVQG 5C3WA 2AT1B 2AIRB 2E3IA 4H13C 3CCJT 3VYGA 3PUZA 1KTKA 2VUMG 4A3MB 1CHPD 1NPRA 3CC2T 1BCPC 5KYUA 3HTRA 1PMRA 2F0GA 2WAQG 2HQXA 4A3GH 1X2KA 2DK3A 4C8QA 1YNJD 3DEOA 4LWCA 4M1UB 2F1LA 2EYYA 3OW2P 1QVFS 2SOBA 2CREA 4M78F 4XTWA 3CRLC 1RAFB 2XWBB 3OW7A 2JA6H 4X62L 2KT1A 4OMQA 2DL8A 2MF2A 2QGFB 3KBGA 1G8ZD 1H9JA 3FDRA 4JI1L 2JN4A 2CP2A 2A6HD 4ID6A 1HYOA 2PVGB 4PLIA 1H3HA 1B3QA 1MV3A 2YYZA 1CI3M 1PTOH 3OBYA 2DIQA 4IUVA 4IKFA 2YUPA 2DY8A 1SE4A 2EYZA 2FXQA 3A74A 1SBBB 3HOVB 2K14A 3EA6A 2KMTA 4P2CB 3MEHA 2R5MA 1YJNQ 1KL9A 2E2DC 4GNXA 1GD7A 3QPHA 4JV5Q 1I5LA 1A2TA 3CEYA 1Y8PB 3LGJA 1BVSA 2ZGWA 4FW1A 1YHQT 2MYSA 2VQFL 5IT9L 4K8JA 1IBLQ 2L5TA 5JOBA 3J80E 2KAFA 3T16A 3E1SA 3GBQA 2EGAA 4RG1A 3CMAQ 1Z47A 2JA5B 1BBUA 4RKLA 1ZYRC 1NYFA 4RTUA 1D8LA 1ICWA 1S5DD 3QWXX 5IYCH 3A8GB 2R92H 2MP1A 2DMOA 4KGVB 3UE1A 1BQQT 4JOIC 2LT4A 2XSCA 2DIGA 2YRCA 3QOLA 1D7QA 1PXUA 4AIMA 3J80c 1OTCA 4B3TL 1M27C 3C94A 4J1MA 2OQ0A 5ELEA 3DUZA 4YCVA 3I5SA 1IXDA 3OTOL 2EY6A 3S1MB 1UUPA 3PMIA 4JJCA 2JA5G 3I4NH 5FLXE 1CKNB 4QQ6A 3I35A 3CCRQ 1K8MA 2M2LA 2K6DA 2VZAA 1JMCA 2EY2A 3I55T 1X54A 1SSFA 2C06A 3D4DA 2MJ8A 3P8BB 3T51B 1AHJB 2N49A 1VF5C 2ZM6Q 1N34Q 5GMKl 1YITA 1FL0A 2JOYA 3BS1A 2K5HA 1C8CA 3KUPA 3NBHA 3I4MG 5FLXc 5KNDA 4M77A 4OMMA 1WXTA 4PJOC 3UA7A 3LH5A 2UXCQ 4JI4Q 1DYQA 3L1AA 3H15A 1WVLA 2F0WA 2DNUA 5M5YB 4GS3A 3OYCA 2I0NA 3M55A 4E7IA 3CBMA 1NMGA 1HK9A 2JP1A 1F77A 3MXGA 4ZUIA 3R93A 4JG2A 5C3EB 1W3SA 2IIMA 1UJ0A 4RTWA 4M7DC 5EKLA 1IYVA 2FPEA 4A75A 3HFNA 1HZAA 2QF7A 3MEVA 4KHVA 2VXWA 4NXML 3H3VC 5GAOq 2FHTA 1DONA 1WJJA 5IAYA 4M7AE 1K9AA 4BI3A 4X62Q 2YTYA 4F7UE 1AE2A 1QNUA 1QVGP 3S15H 1CK1A 3HOWB 3BDLA 3OYYA 4JI1Q 2KVMA 2VB2X 3GTKH 3GOXA 4CBVA 1ILQA 4BE2A 4GZYC 5DLOA 4KJNA 2ATCB 4KN4C 3BVMA 1B2TA 1IYUA 1XMOL 4OGQC 1VOMA 4FYWB 1FVIA 1PRTF 1M3AA 2GA4B 1VQ7A 4LD9K 1MNDA 3QBYA 2A1AA 5M3FG 1ZSZB 1TU0B 5GMKm 3OSVA 3HOWG 1EEFD 4HTHA 3K5NA 3KBXA 1I50B 5HGQA 1EWHA 1AZEA 2VQFQ 1I4XA 4HJ5A 5EJWA 1AWJA 2YSQA 1M90U 2NZHA 4IOCA 1ZA1B 5DEHA 3J81j 1UEBA 1EY9A 1D0XA 4RCCA 2B86A 5IGFA 3ZBDA 3ULJA 2JA7B 3V8JA 1ZSZA 2MFIA 1VDZA 1PC0A 2E65A 1J3TA 2CW0C 2K4KA 4XQQA 4C8QD 4B3TQ 3S6WA 3JC66 3TN2A 1WPYA 1C6VX 3OTOQ 4K5XA 2VNUD 3PUVA 2NWGA 2O5JC 4QIWB 4EQOA 3M56A 4TVRA 4N9PA 4JRKA 5IYDH 1FYNA 5LJ3d 4RG8A 2E41A 2L11A 2JA7G 5EQ0A 3A0JA 2JA8G 3GTQH 1TS9A 2RCFA 1D1IA 4DV4L 1WI7A 2GNCA 2P5ZX 3DEPA 1M90R 2SNMA 2F1MA 2CH4W 3DLLA 1Y1WH 1ESFA 2K7AA 2K9GA 2WSEE 2NVQB 3OW2S 1JE5A 1WHMA 4M78B 3HP3A 5CMDA 1S72A 1RIPA 5IWAL 3U4ZA 3EGXB 1WDXA 1W2BA 2JT4A 3H6ZA 1JEGA 1WXBA 1NJIU 5AYFA 1PM3A 3GF5A 4ESRA 8ATCB 2ROTA 1BBZA 3CPFA 1QVCA 1GUTA 2KNBB 2CWPA 3SWNA 2ATWA 1EWCA 3IRBA 2HBPA 4NXMQ 1E22A 2VXFA 2DFUA 1N9SA 4M78G 1QMCA 2LXKA 4A3IG 3AHUA 2J05A 1S4ZA 4M78A 1D5MC 1DCZA 3K59A 1S40A 1WJQA 3S14H 3EGXA 1E3PA 1EU3A 3ONAB 3MXUA 1BI1A 1EQRA 2XWJB 2UUBL 2B63B 2R5AA 1VQ4T 1M2VB 2OCEA 2V1QA 1M90C 2TMPA 4JI8L 1XMOQ 4IIOA 1O7IA 2PMZE 1L1OA 1LTTD 3ICEA 1MMAA 2X6GA 4HXJA 3TZDA 2GBQA 1ONLA 1LVKA 1JRIA 4E7SA 3SDZA 4IPGA 1F9SA 1VQ6A 1SN8A 4RGOS 3PIO3 1NJIR 3VS7A 3TCJA 1YJWT 5JPMC 3C3LA 2JTFA 4A3GB 3NMZC 2B63G 2GGRA 4M77D 3KOJA 1WTVA 4QB4A 4BY1G 3JAML 1M2VA 4RCBA 2JA6B 3M85A 3HOUH 4XAXB 1PHJA 1DGSA 4OWWB 1YFNA 2V8JA 5LHY1 2XI9A 1VQ9A 2QGQA 4YWKA 4K11A 2EJGA 1ABQA 1EIGA 5C6SA 1FR3A 1M1KU 4TRDA 5GADC 3FRNA 2Z6BA 2I2LA 1EZZB 3M58A 4FF3A 4C56C 5LMNL 3NQIA 4KLKA 1HNXL 3VS6A 2RSOA 3N5BB 1U3OA 1NE3A 4PV1C 2JA6G 1TWHH 3ITPA 1F9PA 1Z9ZA 1EWIA 2D0PA 4QL5A 4DV3L 3OYEA 1Q1EA 3S2DH 2O2OA 2OEOA 5EGTA 4DNTB 4MZMA 4X3KA 1CSPA 4DV4Q 3CCEA 1EL0A 1NJIC 4LXCA 3MFGA 2RQRA 4O6JA 4QW2A 5D7UA 3FPUB 2HD0A 2LQKA 4DK3C 2WB1G 4MTKA 1IREB 1TTHB 2B2WC 2UXBL 1TY2A 4G7OC 2B2YC 5IWAQ 2R92B 2A3LA 3CCLA 4AYBE 1JQQA 3DKMA 5ELFA 3FRPB 3TRZA 2P4RA 3BG3A 2O9SA 4MDWA 5KCOA 1M1KR 2QA4T 1EY4A 1VYTA 4V0BA 1M3CA 4A4KA 3S1RH 1I6HH 1RAGB 5CQYA 2PQWA 2CSQA 3I56Q 1O7YA 1WTQA 1NYGA 1W70A 2ZTCA 4ODGA 2QXFA 4CJ0B 4XTCS 3I4NB 3T1HL 4F7XA 3S16H 2EPDA 2HSPA 3NHNA 2WP8J 4OB0B 3JCMJ 1PRTB 4KJOA 3T53B 5GANe 2R92G 2E5LL 3CCJQ 4HSVA 5IXBA 1HQMC 3A8IE 2EYHA 3L2UA 1NE8A 4M4ZA 3CD6T 2UUBQ 1UWVA 2LY7A 2JM8A 2YUOA 3EG0A 1XPRA 1FJGL 1VQPT 5A35A 5D6WA 5FJ8G 2ZXRA 4JI8Q 1YNNC 4DV6L 3PMFA 4DPGA 4LF4L 3HOZH 3EROA 5CV6A 4M75F 2JTMA 1IKLA 1Q7YU 1IBKL 2VKNA 2DN8A 4N8FA 3WVEB 2JEAI 4C3HB 3CC4A 4NL3A 3LYIA 2HKQB 4ABNA 4CJ2C 1IHVA 4OO1H 4Y7NH 1YWOA 3BVZA 5LJ3j 2F4VL 3F8TA 5JEAG 2I5LX 2E74C 4Q0FA 3PUWA 4WRDA 1WQWA 2MWPA 1G2SA 3PV0A 3C46A 4J5YA 3MEUA 5IHIA 1SHFA 1EOVA 2O4XB 4J9IA 2DKGA 2JTEA 4AG1C 3C0CA 3PMTA 1NR4A 4HN7A 4K8IA 3KF6B 3S15B 2R93G 3FC3A 2L5QA 3A8MB 2L55A 1K8GA 2DM1A 2AKWB 3GTKB 1YHQQ 2KE9A 3A7AB 4AFZC 2QK0A 1Y8NB 1ZUYA 2KK4A 3MP6A 2AHJB 2Z4HA 1JC7A 5A0GA 2K5DA 5LMNQ 3OYNA 1KQSA 1HNXQ 4A3DH 2EYOA 2DTIA 2K33A 3E3XA 4G7ZC 4CGYB 1Y96B 2IW3A 3KF8B 1I5OB 1BYMA 1Q7YR 1UFFA 3VJPA 1TS4A 4KD4A 3VRYA 4DV3Q 5DAUA 1I4PA 3H0FA 2ALYB 5AT1B 5C44H 2BA1A 3G4SA 1YVCA 1O7ZA 3E9HA 2RQVA 2DGYA 3A8HB 3NTIA 3EH1A 2ICIA 1N5ZA 2HQHA 1PD1A 1Y71A 4A3JH 1D5ZC 1NSNS 2UXBQ 1AFPA 2AKLA 2DA9A 1Y96A 2N3SA 3KF8A 3CMEA 3SEMA 2Z6KC 5C4JH 1HFNA 3PCOB 5JJIA 4RCNA 2ZPFB 3TU4K 1PYWD 1QNKA 2RQXA 4Y28E 4Y91A 2UXDL 3BVGA 2Q2HA 4KD3A 3MXNB 1B3AA 3DLMA 3Q22A 2HKNA 1K0XA 4WJWA 3VR2A 3CCVT 3G71A 1QQJA 4UPAA 1JB0E 3G7LA 2RHXA 1LT3D 1YI2T 3T1HQ 4L5GA 1ZLMA 3MCAB 2K79A 4GN5A 1NR2A 1M3BA 4RFBA 4DNIA 1HSQA 4PNYA 4NOYA 1Q7YC 3QB3A 3M4YA 2AUKA 5FKAC 2E5LQ 4ZNXA 1IW7D 1B34B 3OYDA 3GTQB 2C0OA 3U58A 3UT1A 2Q2IA 4QUFA 3KUFA 2IX3A 1H92A 3JB9H 1HHVA 5LJ3f 2K5VA 1FJGQ 1NLOC 1W2BP 2WIIB 2WSCE 4PFOA 1U4LA 5KRUA 2XG8D 4DV6Q 1Y1WB 4LF4Q 3PVLA 2H3EB 3MEWA 1JWMD 5C4HA 1IBKQ 5CKHA 4JRPA 3A56A 4KULA 1UECA 3P75A 1BKBA 1WHLA 5ELDA 4DV0L 1TUCA 1HZ9A 1PTOD 3L2PA 4NPSA 1B34A 2NN6G 3OYMA 2F4VQ 4RTVA 2EJMA 5KCHA 5I9OA 2WAQE 4JI6L 1LM0A 2VS1A 4IJHA 1Y1WG 5KNCA 4LDYA 3PUYA 3CW2C 4PFPA 2DYBA 4BY6C 3LNNA 3UDGA 4L5TA 4MZPA 2XN9C 5E4XA 4XTXA 1OO9B 3S14B 4MN3A 2ZJQA 1UNSA 1GCQA 2A7YA 1PG5B 2LXJA 1VS0A 3I9QA 1KK7A 1QKXA 3JCMX 1RADB 5BN4A 1G3YA 2M51A 4OMPA 2ZTEA 4E6IA 4HCZA 2EIFA 2I46A 5FU6B 5A0LA 4H44C 3C95A 1R9TH 3V7CA 2A6HC 5D6XA 4FF2A 2PMZB 1H9RA 1XX8A 2N78A 1MHWC 5E4WC 4ZLTF 3B6YA 3E9IA 4R1JA 1OPLA 3JB9F 1M4VA 1QCOA 2NN6I 4E7HA 1XJVA 2RJEA 3OY9A 1JJGA 1ACMB 3CBOA 2LMJA 1X2QA 2KEAA 2L8DA 3ER0A 1QOHA 5KYWA 1TR5A 4IFDJ 2HNIA 3HOUB 3RMQA 2CP3A 2CWAA 3C2PA 1VUBA 2K5WA 1E2WA 5I6WA 3M3YH 2BUDA 1ENFA 3INZA 2AZVA 3JV3A 1LCKA 1H9SB 4CI0C 1ABOA 2OTLA 2RQWA 1SMXA 1I3QH 4N9TA 4A3FH 3QKJA 3AMUA 2XVSA 2UXDQ 4KRTA 2N88A 1LYLA 2OTJA 1X6OA 1SE8A 1A0IA 4FP5D 1FD7D 5HK0A 5GMKi 1MNEA 2EQJA 1Q8KA 2K01A 1UGPB 1TWHB 2ZTDA 3VYTA 3MEFA 3HOUG 3S2DB 2NYSA 1V8QA 1N33L 3EGDB 4M75B 3SK8A 3N52A 4PJLA 1VQMA 1CT1D 5LJ5e 3V05A 1O7LA 5DM73 1H8KA 3CXCA 2YUQA 2YTXA 3D31A 4PK4A 2EOTA 1CKBA 1M8VA 3MPUB 5IT9E 4CC4B 4C0DB 1Y1VG 4A4FA 2VWFA 4E47A 4FIBA 2Q2UA 2DERA 3CCMT 2EQSA 4CC2A 4NXNL 1SMYD 1PSEA 2MMPA 3OHXC 2ZM6L 3M9QA 3DXJC 2F0TA 3I4MH 2XNAC 1M5Q1 5LJ3h 4M75G 5GANg 4M7AD 4RAUC 1L2FA 2KRSA 2A69D 2CP0A 3JAMi 4DV0Q 5DLQE 2CP5A 4M75A 4AYBB 5IT9c 2B29A 3S1RB 2ZPHB 2TSSA 1I6HB 1IXRA 1VQ4Q 3D7SB 2QEXA 1VCIA 3MP1A 2GVBA 3TS0A 4JI6Q 1TWBA 3S16B 2XTIA 2YWWA 5J26A 5CIUA 2B8AA 2EYFA 1LTLA 1SF9A 4R4TA 1U1TA 2LDMA 2RJFA 3QZ9B 4KGZB 1N27A 1GXDC 1YJWQ 1VQKA 4C92F 2CT3A 3L7ZC 4LD6A 4D6WA 2FG0A 2ES2A 4KKUA 2HCKA 1PRLC 2CQAA 2KHJA 3HOZB 4TVAB 1PFNA 1KNEA 4FW2A 1ZEQX 2F0VA 2MPXC 3M4QA 3QIAA 2Q8IB 2D0QB 2LX9A 1HTLD 2RO0A 1X69A 4OB1B 1D6EC 1HA5A 1A63A 3SVMA 4Y7NB 1X6GA 5CK9A 5DY9A 2OT2A 2K5NA 4BI8B 1TSFA 2RI2A 3HFOA 3VR4A 5M3FH 2V8KA 4J9GA 2WV6D 2I5HA 2EVBA 4HIOA 1F2LA 1RLQC 2EXDA 3EGUA 3LWHA 2AZSA 1IYJB 3QO2A 1WTPA 1KQSP 1ASZA 1AT1B 1I07A 1PFMA 1QVGA 1T3LA 2L0AA 2B2VA 2OWOA 2ZPIB 3VS4A 4OO1G 1KRTA 4A4IA 1WHJA 4A3DB 1O75A 1I6VC 3ND8A 4HMJA 5T1GA 4L6V5 1PZID 3RUZA 1W2BS 2JM9A 3KLRA 5FRMA 1Q8IA 4MTNA 2ZT9C 2EQUA 4B6MA 3EFOB 3VUZA 1OPKA 1LV9A 1N33Q 4DAPA 3CCQA 4E7KA 5IGDA 4C8QC 4RMOA 1RUWA 2QA4Q 1UUEA 3QYHB 5C44B 1HNZL 4BS9A 4OWXB 5GAOp 3NPFA 2OXPA 4B08A 2FPFA 4LNQA 1R0BG 4XTUA 1WX6A 1J8IA 4A3LG 2JA8H 1BCPF 3Q1JA 2EFIA 4A3JB 1HD3A 4NXNQ 1BNZA
chains in the Genus database with same CATH topology
3V8LA 1VQ5A 4DR4L 4JBMA 4QGUA 1FGUA 4QIWE 4OO1I 2MO0A 2WSFE 1PYSB 4GY5A 3S3NA 4GNXC 1Q46A 3JCMg 5LMUL 4A3JG 5H1SE 1BIBA 2KCMA 3JCMV 4M78E 1PV4A 2YU9H 4NL2A 2K50A 2NVQH 4DR5L 4A3IH 1XTDA 1P8LA 4L59A 4A54A 2K4YA 3TREA 2D0OA 2E70A 4JS5A 3DM3A 1GM5A 4JRQA 1MKHA 4HIKA 2YRVA 3F2CA 3FB9A 2PVOB 3QXEB 3OS2A 1W4SA 3H3VH 1UGSB 5ELNA 4L5SA 2R7ZG 3JB9G 3RNUA 3M4GA 4N4IA 4YCWA 3F1ZA 3C4SA 1R8OB 5GAHC 1G5VA 4DV7L 4A76A 4CRIA 4BY1H 3HOYH 3CMAA 3P8DA 1NBWA 1CKOA 4M77C 1M4ZA 5J3BA 3OYHA 2MNAA 2K57A 3K0XA 3CCUT 1PH6A 1V29B 1WJSA 4LF5L 2CKZB 4DK6C 4EPCA 4OVAA 4YCUA 4BY7H 4PJOF 3RLFA 2QI2A 2QQSA 3HL8A 1HNZQ 3CCRA 3JB9I 4BXXH 2UUAL 1HR0L 3SGIA 4N0AA 2E12A 2L89A 3JAME 4M7DF 2YLCA 2WB1E 4DR4Q 2PVDB 3OS1A 5GANd 3L2VA 5LJ5g 1MJCA 1BIAA 1QP3A 1VQJA 1FXXA 2EJFA 2CQOA 4LDXA 4J15A 3JAMc 2Y0SG 5LMUQ 1I94L 3K7UC 3M5AA 2AMCB 3KFUA 3T9NA 4ME3A 5EAYA 4QQDA 4A3FG 3ERSX 4DR5Q 2RF4A 4DR2L 3VU3C 2X4WA 3RZDH 1Q86U 4EDUA 4C92G 1V9PA 3OYJA 1K83H 5HY6A 3WWVA 1VQ8T 4LUZA 4R4IA 3G6ET 5FJ8H 3TS2A 1KQSS 1B8AA 4GLXA 4L5QA 4DR6L 3GIBA 4DR7L 3PT9A 1ZHIA 2C35B 4YWLA 4DV7Q 4C5EA 2VGNA 2R93H 4LF9L 1JT8A 1CKNA 3GD7A 1BI0A 4HA8A 4IJLA 1U1SA 4JLIA 4LF5Q 3CC4T 2KQWA 2E1HA 4JI7L 3SWNC 4BUGA 2Y90A 1X9NA 5CVIA 4QVZA 4JBWA 2UUAQ 1HR0Q 4OF1A 5GAMe 3CPWA 4BA1I 1G3TA 2VW9A 1PH2A 2M1HA 1WI5A 1L1OC 4YWMA 3PNWC 3HPWA 4N4HA 4X6AH 1Q86C 3CQZH 4OONA 2OQKA 1EYGA 3JCMd 5JJKA 1I94Q 2RK2A 3QIIA 3OMGA 3LX7A 1N9RA 4C0FA 4DR2Q 4X34A 4QVCA 3UWNA 1L0WA 2LC4A 2KDSA 1VQNT 3CCST 1QUQB 3LLRA 1UB4A 2RHIA 1WOCA 5GMKj 4BBRG 3PF4A 4DR6Q 3KYHC 1KIXA 4DR7Q 3AYHB 3SB2A 4BBSG 3PIOA 3OYLA 4JOIA 3A5UA 1U0LA 3NTHA 1QUQA 5GAN5 4E7JA 4LFAL 3JCMb 4PJOB 4Y52H 1J5EL 4IURA 4LF9Q 4HT8A 2NVTH 3PUXA 1ASYA 1YIJT 3AEVA 5CO7A 3HFZB 1OXUA 1G3SA 3OS5A 4M7DB 3FKIH 5IN1A 3V8KA 4ZTFA 3PO2H 4JI7Q 4B3ML 4PJOG 2CS7A 1TWCH 1Q82U 2E2JH 1ZBXA 3JSCA 4C3IH 3CXCS 3NTKA 3P8HA 4POGA 4M7DG 1NZ9A 1VQOT 5LJ5d 1EUJA 3HP9A 2GQVA 2O01E 4KHPL 3BY7A 2EAYA 1OXVA 1KG1A 3V7RA 1MJEA 3I56A 1YZ6A 2HIXA 3HOYG 3OSSC 4DOWA 3I7FA 4BA2I 4FL6A 3OYBA 2X4YA 3CCJA 3QJYA 2JVVA 3CC2A 3HKZG 5C4XG 1SR3A 1Y1VH 3PSIA 4BY7G 4DQ2A 4ZGEB 4M75E 2E8GA 3H3VI 2DEQA 4BXXG 3HRUA 3L2WA 5GANf 3QDRB 5M5XH 3G48A 5AJ3L 4J83A 2MWOA 5IP9H 4DR3L 2E2IH 4OWTB 3C12A 2P0QA 4M7AC 3OB9A 4LFAQ 5JEAJ 5CKEA 1J5EQ 4DV5L 1Q82C 1QVGS 5BR8L 1YHQA 2ZPGB 3MEAA 5IE8A 1QZHA 3GP8A 1N8RU 3CF5A 2ZZDA 4B3MQ 5GAOl 2BH2A 3TQYA 1E7ZA 3L2RA 4LF7L 2K5LA 3LW5E 4BE0A 1RI0A 2D9TA 4O5VA 2DJZA 2LCCA 1H95A 5GAGC 4OXPA 5KE3A 2HHHL 3I55A 4KHPQ 5GAN3 1FWZA 1QVPA 5GAMg 4XU1A 1M1KC 1LJOA 4LUVA 3LGFA 2E2HH 2EJ9A 4HJAA 2VY3A 1HNWL 4JDSA 4XU2A 2MQHA 1YJ9T 5HK3A 5GAN7 4EMKC 1EFWA 4PNOA 1X3GA 1I4K1 5GAOm 3CC7T 1VQFA 1NMFA 2DZ9A 4P75A 4LFCL 5GMKh 4A3LH 3PO3H 4R55A 3AFQA 4M78D 4PG3A 4ME7A 2O4XA 5A0DA 3KF6A 5AJ3Q 3FEOA 4DR3Q 3GLXA 1HR0W 1N8RC 5GANh 3JCMf 2V8IA 4IPHA 1EIYB 2K3XA 3FJPA 1XNIA 4DV5Q 3RZOH 3KLWA 5BR8Q 2NLUA 3VKIA 1VQLT 1VQ5T 1X65A 2XDPA 3QJ6A 2F52A 3MP8A 4JJNK 4HIMA 1H641 2JEBI 1K9MU 4P71A 2RHQB 1VQDA 2GN5A 4LF7Q 1XPUA 3QZ5B 3HKSA 2HQEA 4KBMB 4ZN3A 3DB4A 2R7ZH 1K73U 4QVDA 2HT1A 1XOVA 3JCMe 1IZ6A 1FX7A 4FT2A 4ELZC 1I8FA 4HCBA 5L8RE 1H3ZA 4OX9L 2UU9L 3NELA 5FLMH 2HHHQ 4EQ5A 2K75A 2KENA 1E1OA 5C0XG 3PGZA 5FU7C 3FLGA 1YJNT 1OXTA 3GNGA 4A3EH 1HNWQ 2MI6A 3JCMQ 2GF7A 4RMFA 1HH2P 2D62A 3HSBA 4LFBL 4YTLA 2WACA 3META 1NTGA 3FKIG 4LFCQ 1JJ2A 3PO2G 4MZ9A 4FM4B 2XICA 4A3CH 5J39A 4C0GA 2LT1A 4PZ6A 5LJ5f 4IOAA 4PL6A 2Y0SE 5C0XI 1VQ4A 1WQ7A 4HKEA 3ZFJA 2E5QA 1VQAA 1UE6A 3K7AH 2IG0A 2YLBA 3OYAA 1B7YB 3GTMH 4J7FA 3I2ZA 3EFSA 4C92E 1YJWA 2VUBA 2X4XA 1K73C 4J7IA 2F3IA 2DUDA 3M57A 4WJ4A 4ZN1A 4IO9A 4GKKL 2AHOB 5IP7G 1PH7A 4X66L 5GAOr 3ASKA 4FU6A 1K8AU 3EN2A 1VQEA 3D0FA 2DZCA 5JJLA 2RI3A 2Y4XA 4C8QF 3CPWS 2IX0A 2UU9Q 4OX9Q 1O9SA 3EIVA 3S24A 1DJ7B 3HRTA 4OB3B 5GAMd 4BI4A 3Q8DA 1PFSA 2K5FA 5IP9G 4LUOA 2YV5A 4BDZA 4GOPC 5GAOn 1I81A 4A93H 2CGHA 1B70B 1TWAH 2YHTA 1G51A 1OZ3A 1SFOH 4OGCA 1YITT 2CZ0B 4LFBQ 2QA4A 4HJ7A 3HOXH 1Q12A 3NENA 3RLNA 2NVYH 2Z0SA 3TEEA 2AWNA 2CCZA 2N8NA 3OS0A 3CD6A 3BZKA 1XMQL 1VQPA 4APVA 5LJ5h 2FL7A 4XU3A 4JI5L 4GLVB 2RD1A 1Z9FA 2DXTA 4ELYC 1VQ7T 1GKHA 4PZ8A 3A8LB 4IFDG 2HAXA 4QQBX 2FVUA 4ATOA 4GKKQ 4M77F 4JI3L 5GROA 4BBRH 4X66Q 3K81C 1KRSA 4UY8C 2IY5B 2LSSA 1PH8A 3GTPH 3PO3G 5CQXA 1VQHA 5IYBH 2EQKA 2KBNA 4HJ9A 4BBSH 3RKYA 4N0AC 3JB9J 3BFMA 3MO8A 1KQ1A 3HHTB 2I0QA 2P0KA 4PKCC 4B3SL 1M9SA 4DV2L 1OZ2A 2MO1A 3RERA 4PJOE 2QTXA 4JRIA 2IHEA 3RN2A 4K0KL 2JUFA 4QY7A 2RM4A 3CCVA 1A8VA 3L0OA 1M1FA 3UDCA 4M7DE 1YI2A 1S72T 1KAWA 3MHXA 4OGEA 4FT4A 4JI2L 4WJ3M 4XIGS 2PUKB 2QQRA 3WVDB 1XMQQ 1CSQA 4JI5Q 4M75D 4XTYA 4LF6L 5FLMG 2WFWA 3VV0A 4C5IA 3GTOH 3E9FA 2KSSA 4HIDA 1JBMA 2CZ1B 3HKZE 3PTAA 1PH3A 2UUCL 1PH9A 1CKMA 4KT0E 4A3EG 5LJ3g 5C4XH 1G6PA 1VQ6T 4NS5A 2CZ7B 4Z02A 4P5NA 4IPCA 4LDUA 4HJ8A 4JI3Q 2F5TX 3M59A 3PFSA 3JCMW 3H0GG 3RKWA 1U5KA 3OA6A 1N32L 4DUZL 2CZ6B 2PUOB 2IX1A 2P4TA 1QW1A 1VQ9T 4POFA 3FHWA 4A3CG 4GKJL 1ZQ1A 5CCAA 3UPUA 4C8QG 5IY0A 5K36G 4B3SQ 4GNXB 1D3BB 1OXSC 2RH2A