3A5ZB

Crystal structure of escherichia coli genx in complex with elongation factor p
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
134
Chain Sequence
TYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Putative lysyl-tRNA synthetase
total genus 17
structure length 134
sequence length 134
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01132 EFP Elongation factor P (EF-P) OB domain
B PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
B PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a5zB01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5zB02
3CMET 2GVAA 1V1QA 1EQRA 1I3QH 4YHHQ 1CKOA 1YITA 4DR4L 4NXNL 4LF9L 1PVOA 4JBKA 4R4IA 1UE1A 3RLOA 4JCVE 1N8RC 1B8AA 3CCRT 3CC2A 3A5ZB 1EUJA 3RZDH 1KC8C 3L2PA 1WJJA 1B70B 2UU9L 4GKJQ 4HJ8A 2PQAA 2MQHA 4DK6C 1QVGS 2Z6KA 3GTOH 1Q7YC 4EQ5A 1KHIA 3I55T 1VCIA 1QVFA 1PYBA 1HNXQ 1KC8U 5FLXE 3K0XA 5LL6S 4DK3C 2N78A 3KF6A 4JOIA 1T9HA 5C3EH 1XMQL 4LF5L 3OW2S 1JJGA 3KYHC 3PO2G 1I6HH 1M1KC 2DO3A 1IBLL 4MTNA 3TEHB 1IL2A 4X66L 2R7DA 1W2BS 2OTJA 1DGSA 2MO0A 4YWKA 4DPGA 2K52A 5LMNL 2OQKA 1IXRA 4UP8A 4A3JH 4JBMA 2LXKA 4QQDA 2YYZA 1NZ9A 2BH2A 5HY6A 1Z47A 5JJKA 1CKNA 2BH8A 2RHSB 2I0QA 3F1ZA 1IBKL 3S15H 2EXDA 3A5UA 4A3DG 5M5WH 1XMOL 1KL9A 4GNXA 2PMZE 3J80E 2R93H 4LF7L 5GAHC 1VQ7T 3PF4A 4IPDA 1M90U 4O0AA 2KBNA 1FJGL 2VUMG 4NXML 4X34A 4LFBQ 2XGTA 2ZJPA 3VDYA 1HNXL 1FL0A 1SRUA 2OWOA 2IX1A 4OX9L 1NMGA 4DAYB 4JBJA 4ALPA 5GAEC 5M5YH 1QVGA 1VQMA 1TWAH 4RMFA 4DUYQ 1VQNA 3H3VI 1SLJA 4IO9A 2K5NA 3CXCS 4ZN1A 4JI5Q 4LF8L 1A0IA 3ULLA 1SMXA 1IBML 4DUZL 1C9OA 3T1HL 4GS3A 2UUBQ 1E1TA 2E5LQ 1K9MC 1E1OA 2JEBI 1K8GA 2N8NA 3J81i 1N32Q 1YJWT 3UDXA 5C0XG 4B3RQ 3HOYH 4DV4Q 1KRSA 1NMFA 3FHWA 1EOVA 1QVCA 3K80C 4LUVA 5J3BA 1VQ6T 2A1AA 2B3GA 3NENA 4JI1Q 5C4XH 4A3IH 1SE8A 4JI3L 4A3BG 5BR8L 4JI3Q 1VQ5A 4A93G 1JJ2A 2OQ0A 1HZAA 4GKKL 5JJIA 1VQKT 2OTJT 1WOCA 3RLNA 4DNIA 4LF4Q 5EAYA 3BZCA 3F2BA 2ES2A 3PO2H 4LFCQ 4A3CG 4DV5Q 1VQPA 5JEAG 1XPUA 4A3CH 3U50C 4BY7G 1UEBA 1TWFH 1WCMH 2UUAQ 3HOZH 3I4OA 2Y0SG 1IBMQ 3ULPA 3FKIH 3KF8B 3HOVH 1VQ4T 2BA1A 1N32L 3CD6T 3PF5A 4UY8C 3CMEA 1HNZL 3S2DH 1AE3A 1CSPA 1KRTA 5C0XJ 1HZCA 1RIPA 2JA7H 1Y1VG 3CC4A 2JA8G 1VQLT 3CC7A 2KENA 2ZM6L 3G4SA 2ZTEA 2Q2TA 4BBSG 4A3GH 1A63A 1G51A 2C35B 1K8AU 1Q81C 1U0LA 2R6GA 1V43A 3JAMi 2LCLA 5M5XH 2IT1A 2D62A 5IP9G 3GTJH 3S1NH 1JB7A 4LF4L 1N36L 4OXPA 4DV6L 4OWWB 5IYDG 3CPWA 2D0OA 2NN6I 3U58A 2KCTA 5E7NA 1YNXA 3F2CA 3G4ST 4BY7H 1EIFA 2HHHQ 3CCSA 4GLAC 5FLXc 5AJ3Q 2I5LX 1YJWA 3CPWS 2JNGA 1P16A 2F4VL 3I4NH 3RN2A 4JG2A 2YTVA 4DV2L 4JI5L 2I5HA 2EIFA 3HOXH 1YIJA 4PZ6A 4DV4L 1PH9A 1VQDA 2K5HA 1VQKA 1NY4A 3M4QA 2R92H 3G71A 1U5KA 4NB3A 4A3BH 3F8TA 5IYBH 5GQOA 1I94Q 2UUBL 4OO1G 2L15A 2PI2A 4C3HH 4GOPA 1KD1C 2QEXT 1OXSC 5IWAQ 4ME3A 4P71A 1O7IA 4LFAQ 3U4VA 4YY3L 1VQ5T 1HH2P 2N49A 1XPRA 2MO1A 1PH2A 4BXXG 5FLMG 4L5TA 4X62L 4LFBL 2KVQG 3TREA 1VQBA 4GLXA 1KQSS 3KF6B 1TWHH 3S17H 1X3GA 3SGIA 4OWTB 2KHJA 4BBRG 2CFMA 1VQMT 1KAWA 2JQOA 3CCEA 5GADC 1HR0L 4X64Q 3TQYA 3T1YL 1VQOT 1X3FA 3T1YQ 2E2HH 1SROA 2IY5B 1YHAA 2LQ8A 4AH6A 4H02A 1M1GA 4BBSH 4A3GG 2CKZB 1BBUA 1CKNB 1TWGH 3BJUA 3KLWA 4OONA 1YVCA 4L5RC 2OTLA 3M9BA 1NE3A 3PIPA 3S24A 1FGUA 5M3MH 4GNXB 4JI1L 3NELA 2NVYH 3A0JA 2EQSA 2UXCL 1VQOA 4YTLA 2AMCB 2B63H 3HFZB 3K8AA 4EX5A 3CXCA 2KHIA 4POFA 2K50A 1E7ZA 5IP7G 2YU9H 1L2FA 1OXUA 4DR5Q 3JAMc 3JC66 4DR3Q 3GTMH 1PFSA 1S40A 4C3IH 4R4QA 4B3SL 4C2MH 1PYSB 2JJQA 2OTLT 1QUQA 4PZ7A 4O2DA 3PO3G 2ZTCA 3I2ZA 2A8VA 1VQPT 1X3EA 3PO3H 1IZ6A 5IT9E 4DAMA 5IYDH 3CAMA 1KQSA 4AYBG 3GTPH 4AQYL 1NTGA 3GO5A 4R4OA 1JMCA 1MJCA 3K7AH 3RLFA 4IOCA 2E2JH 4OO1I 1ASZA 4DR7Q 1JE5A 3G6ET 3CC7T 1L1OB 1CSQA 5LMUL 3J81j 1QZGA 1UWVA 4DV1L 1A8VA 1W3SA 4JV5L 1VQCA 1PH8A 3GTQH 2VL6A 1XPOA 3EN2A 4P75A 1B7YB 2QA4A 4P74A 2R7ZG 2R7FA 1I5FA 2JOYA 1VQAA 3CCJT 1BVSA 1E24A 3W1BA 4BBRH 2RHQB 3H3VH 1KD1U 4A3MH 4HJAA 2LSSA 1WCMG 4DUYL 4IJHA 1X65A 3HKZE 4MNOA 4JI8L 3DB3A 1N8RU 4AIMA 1RL2A 5JJLA 3CCET 1BBWA 1HZ9A 3CCST 2WAQE 3IRBA 2UXDL 1GD7A 2F3IA 2RF4A 3KJPA 4XTCS 4BXXH 1HNZQ 4JOIC 3P8BB 4A3DH 5C4XG 1S72A 2R92G 2FXQA 1Y14B 2IHEA 3FP9A 3CCQA 4PZ8A 2B29A 4DV2Q 1PH6A 4NXNQ 2B63G 4GKKQ 1YZ6A 1VQ4A 4KHZA 1NPPA 3PUVA 1Q1EA 1PH4A 4APVA 4IFDG 1IBKQ 2I5MX 4YCVA 2A19A 4QL5A 1XMOQ 1PHJA 3ULJA 4DV6Q 1VQ9A 2ALYB 1C7YA 3I4NG 1HZBA 5C3EG 1YJNA 1K8AC 4YY3Q 1L1OC 2UXDQ 3CCQT 4KHPL 4LF8Q 3AQQA 1YHQA 1CKMA 4JI8Q 1WI5A 3AYHB 4B3RL 1SN8A 4TVRA 1VQ7A 2VS1A 4HIDA 4B3TL 4B3TQ 3CCLT 5M3FH 2R7ZH 5DLQE 4A3KH 5HGQA 2V1CC 2NN6G 1N34L 3ERSX 3A74A 1VQHA 4B3MQ 3S2HH 3CCRA 3CC2T 3AEVA 1VS0A 4GOPB 1ASYA 2L3RA 3UDIA 4PG3A 2UU9Q 3HOVG 3JAME 2CCZA 1Q86C 1X56A 2JA7G 3GD7A 2JA8H 4CRIA 3KFUA 1Q86U 2JUFA 5AJ3L 2KDSA 1YI2A 3RZOH 3D31A 4JI4L 3I55A 1N36Q 4HIOA 3RN5A 1PH1A 3FKIG 3HOZG 2CWPA 2XHCA 2LXJA 3PGZA 3S16H 3KOJA 4LF9Q 1HR0Q 4A75A 5IP7H 2IHFA 1LM0A 4R1JA 2PNHA 1GM5A 4JYAQ 2ZM6Q 2NVTH 4XIGS 4BA1I 1X6OA 1I94L 1SR3A 2VQEL 2UUCQ 4IJLA 2VQEQ 1TWCH 3PUXA 2QA4T 1A62A 1S3OA 2K75A 3RR5A 1PH3A 4DR6L 4QQBX 5K36G 3PUZA 3UE1A 3HOWH 3E9IA 1MIUA 3OTOL 1XMQQ 3M4OH 2VW9A 4KHPQ 2CKKA 3PUWA 4MZ9A 1M90C 4DV3Q 1QZHA 3GTKH 3CC4T 4POGA 5FJ8H 1D8LA 4JI7Q 4L5QA 1QUQB 2F4VQ 4YHHL 3OW2A 5FJ8G 1Q82U 4DR4Q 3J81c 2AHOB 3L0OA 4A3FH 3HKZG 4DV7Q 4DV7L 2JEAI 2UXBL 1NJIC 4NPSA 2CWAA 1JJ2S 1GVPA 1OXTA 2HQLA 3BU2A 4B3ML 3EIVA 4WJ3M 1D7QA 3PIOA 1NJIU 1AE2A 3S1RH 1L1OA 1VQJA 5IYBG 4DUZQ 1SFOH 3I56T 1M1KU 3LGFA 5DM7R 4A93H 4ZN3A 1Q82C 5LMNW 1UE7A 1J6QA 2Y0SE 1PH5A 4BY1H 5M3MG 4RG2A 4DR6Q 1VQ6A 2WB1E 2NVQH 1KIXA 4DV0Q 3TS0A 3G6EA 4P73A 4DV0L 1R9TH 1OTCA 3B6YA 4B3SQ 3H15A 1Q46A 4LF5Q 3WWVA 2ZTDA 4JBWA 4UP7A 3J80i 4DR3L 3W5OA 3GTLH 3I56A 1Q1BA 4DV5L 3J81E 4DR1L 1XTDA 4LFCL 1VQ9T 3G71T 1YEZA 1X54A 1VQGA 4LUOA 4AYBE 5H1SE 2AKWB 5C44G 2HT1A 1SSFA 4X65L 2PI2E 5GROA 3ICEA 1VQ8T 3TS2A 4LF6Q 1XNIA 4JI2Q 4HJ5A 4A3MG 4A76A 3CCJA 2Z6KC 3UDGA 2UXBQ 5IAYA 1CUKA 4BA2I 4KLKA 3ER0A 3AFPA 1XNQL 1GKHA 4JI0Q 4K0KQ 2G3RA 3I7FA 1XNQQ 2JK8A 5LMUQ 3RNUA 3CMAT 1WYDA 2RCNA 4L5SA 2BA0A 4TQUS 1MKHA 1K73C 3DM3A 1LYLA 1HNWQ 4TVAB 1YHBA 1EQQA 3CCMA 4LW1A 2HIVA 1JT8A 1S72T 4X62Q 2ZJRA 1I50H 5C4JH 4A3JG 1XNRL 3MEFA 2H5XA 2K5VA 3KDFB 4QY7A 3EBEA 4LFAL 5GAGC 4FDBA 4DR5L 1GO3E 1OXVA 2K4KA 3PV0A 4J15A 4UPAA 1NPRA 1QVFS 2JA9A 3W1GA 2VQFQ 2UUAL 3HOUG 3I4MH 3KJOA 3KBGA 2GN5A 5FLMH 1E3PA 2NZOA 1E22A 2VNUD 4IFDJ 3HOWG 2N3SA 3OYYA 4DR2L 4DV1Q 4YWLA 2VY3A 1YJNT 3HOYG 2GVBA 1OXXK 3DB4A 4BY1G 3M85A 2MWOA 4IFDI 1EWIA 2K14A 5JEAJ 1MJEA 4DR7L 1FVIA 2E6ZA 2E2IH 4DKAC 3CCLA 4LF7Q 1VQEA 2LVMA 2YTYA 2QEXA 3E0EA 4P72A 1J5EL 1J5EQ 4UP9A 1EYGA 1C0AA 1G6PA 4JC0A 3LH0A 2JE6I 3CD6A 2PQAB 1Y1VH 3TRZA 3E9HA 2D0PA 2Q2IA 3H0GH 4A3EH 1EIYB 3J7ZC 3STBD 4JI4Q 1K83H 4JI7L 3K81C 3PCOB 1H95A 3S1QH 3LGLA 4GLVB 3L7ZC 5ELNA 4DR2Q 4QGUA 3UE0A 1X9NA 3UDFA 1IBLQ 5A2QE 4AQYQ 2Z0SA 1VQ8A 4A3EG 5IP9H 2MWPA 3CQZH 4HJ7A 4WJ4A 2DGYA 2QGQA 4GN5A 3K7UC 2F52A 4IPGA 1HJPA 1Q12A 2MI6A 4HIMA 4GKJL 4JI6Q 2AWOA 5IYCG 4R4TA 3DLLA 1PA6A 1K3RA 1K0RA 1Q7YU 4LUZA 1AH9A 2ID0A 1Z9FA 3U4ZA 1YBYA 2WB1G 3HOXG 3M4PA 4JV5Q 3D0FA 2AWNA 4OWXB 3STBC 1P8LA 1VQNT 2CQOA 3PSIA 1XJVA 1N9WA 1PV4A 5ELOA 4DV3L 5BR8Q 1Q81U 1L0WA 4X66Q 2WAQG 1TXYA 4IPCA 2IG0A 2E8GA 3CCUA 4LF6L 5IT9c 4RG1A 4X64L 3J7A5 5J26A 2MFIA 3CP0A 4GOPC 1N33L 3MXNB 3F2DA 3BZKA 3S14H 4LWCA 3T1HQ 3CMAA 2E70A 3NBHB 4A3IG 1JJCB 2ASBA 1HR0W 1VQIA 2UUCL 3M7NA 3OTOQ 2DUDA 5C0XI 1VQFA 2MNAA 3AFQA 4HIKA 2Q2UA 1YHQT 3LGJA 5IYCH 3M3YH 2WFWA 1WFQA 4GN4B 1HNWL 2UXCQ 3CCUT 1PH7A 1Q8KA 3J80c 3CPFA 1LUZA 2YV5A 5M3FG 4A3FG 2VZAA 3CW2C 4YCUA 3CCMT 4QIWE 4A3KG 1W2BA 4X6AH 4Y52H 2OCEA 4C3JH 3Q8DA 2JA5H 1BKBA 3CF5A 4R4CA 4JYAL 3NEMA 1UE6A 3CCVT 1VQLA 3H0GG 4YWMA 5LMNQ 3GTGH 5IE8A 1K9MU 1X55A 3PUYA 4X65Q 5C44H 1UE5A 4JI2L 2KCMA 2VUMH 2JA6H 4GN3B 2HHHL 4JI6L 4JI0L 2VQFL 2WP8J 4LNQA 4IOAA 1YI2T 1N34Q 4YCWA 2YTXA 4A3LH 2R93G 4NXMQ 2E5LL 1YJ9A 4A3LG 2ATWA 3GDEA 3CCVA 1LTLA 1IYJB 2JVVA 2HIXA 2IX0A 3G48A 3HKSA 2NZHA 5IWAL 2NVXH 3ZJYC 4DR1Q 4A4IA 1YITT 4KI0A 4OX9Q 3HOUH 3I4MG 1KXLA 2Q2HA 2JA6G 4PMWA 5IY0A 1EFWA 1XNRQ 1NBWA 2XTIA 3KDFA 4GNXC 1YIJT 1K73U 4HJ9A 2JA5G 2ZJQA 3S1MH 1YJ9T 1FJGQ 4IPHA 1G291 1N33Q 1V9PA 3J7AF 4QJFA 4Y7NH 1Y1WH 4K0KL 1Y1WG
chains in the Genus database with same CATH superfamily
4KULA 1SNOA 2GVAA 2ESWA 2VVKA 1SJHD 4LF9L 1KDBA 3GP8A 1MMGA 2WSCE 3JV3A 4R4IA 3TDQA 4AT1B 3HG9A 4BS9A 1QCFA 1N8RC 1FD7D 2KECA 1EUJA 4A4GA 3K6OA 2DTHA 4J9DA 2A74C 3L2PA 4M7AC 3L2RA 1S5BD 5LL6X 2R93B 1KABA 4G7HC 1JEGA 1U4MA 4DK6C 4PMCA 3GTOH 4HVVA 2LY7A 4RGNA 3JB9I 1PYBA 4EVOA 4OWWB 2WKDA 2N78A 1H9KA 4JOIA 1WPYA 3OW2S 1Q3LA 3F2UA 2EJGC 2JXMB 1EEFD 3PO2G 2IPKD 4ZTJA 3CCEQ 3G6JB 4CKCA 3HSBA 1PHTA 1A15A 3V8KA 1DGSA 1DOMA 1HXYD 2K52A 3VA7A 2OQKA 4UP8A 4AFQC 2F03A 2DEQA 2LXKA 3C46A 4G7ZC 1U1SA 4K2KA 5C6AA 3OIQA 4M75D 5KNDA 3VUBA 2E5QA 2RB6A 1KD1R 1STEA 4EIKA 2O4XB 2EXDA 1XMOL 5LJ3g 4B3ML 1MD2D 4JW0A 2ROLA 1Y96B 1VQ7T 4FIBA 1V76A 1RHPA 1G3WA 1BCPD 2KBNA 5J22A 1FJGL 1D1IA 4J9HA 2ZJPA 1IRXA 1YFNA 1SRUA 1C8CA 1UGSB 2ZXRA 3TZDA 4DAYB 1VQLQ 4JBJA 4ALPA 1EFNA 5M5YH 4ZCKA 3J80L 1TWAH 2KA7A 3CXCS 1X69A 2BE9B 3EG0A 3VS4A 2RSOA 4JI5Q 5IOCA 2K5FA 3SK6A 3BZDB 1E1TA 2KE9A 4M78G 3RDVA 5LJ5h 1O78A 2E5LQ 1E1OA 3Q22A 1S72Q 1BO0A 2R58A 2N8NA 1V8QA 3WVDB 2NTTA 4XU0A 5GAOm 3BS1A 4DV4Q 3HOYH 2KK4A 1WLPB 4JI1Q 5J3BA 2DY7A 4OMLA 3D4DA 1JJ2A 3RESA 1TS3A 3RUXA 2EVBA 4IUQA 3MA2B 2BH2A 2OTJT 2HNIA 4DNIA 3P20A 2MYSA 5LJ3f 3QWXX 5FROA 4DBRA 4DV5Q 4A3IB 4L8JA 1UEBA 1O7YA 1TWFH 3MKDA 1ZEQX 1EU4A 2UUAQ 3UF4A 2F5TX 3F70A 1G3SA 3FKIH 1QMCA 4NL3A 1VDZA 3M0UA 2XVSA 3V8LA 1BBZA 3U9OA 4M7DD 4CBVA 1N32L 1QQJA 3CMEA 5KYYB 1HNZL 1STAA 1AE3A 4XXEA 5C0XJ 2SRCA 1F2MA 1FMKA 4MDXA 1HZCA 4N4HA 3MXUA 1VQLT 5C3WA 4F7UG 2KENA 3G4SA 2RM4A 1A2UA 1A63A 2C35B 2B2TC 2R6GA 2HSPA 2JZ2A 2XNAC 4E7SA 3L2VA 2DJGC 1K9MR 1PRTF 5DNFA 2LCLA 5M5XH 2D62A 3V05A 2PQWA 3KFVA 2EJMA 4K6DA 2CH4W 4V190 1N36L 5J1ZA 3A55A 2K4YA 3CPWA 4QKUA 5CV9A 2EYHA 3S14B 3MVVA 4CJ0B 5KYIA 2I5LX 1PRLC 2BE7D 3OW2P 5CC4A 2JNGA 2F4VL 3RN2A 2C9OA 3U9SA 4IFDH 1MSHA 4OB3B 1S5ED 2E2HB 2H3JA 1PH9A 2D8HA 1GHJA 3JB9D 2F0FA 1WQ7A 2B2WC 2K03A 1U5KA 2DMOA 2ZT9C 2R92H 1V1OA 2HMAA 3P1HA 5ELEA 1GXDC 2KJXA 5GQOA 4HSPA 5IYBH 3X26B 4KD4A 4M78F 1W6KA 4KKSA 2EDGA 4P71A 4LFAQ 3U4VA 1VQ5T 2KYMA 3ZYYX 3EFOA 5FWBA 5JJZA 5GAN2 2QYZA 2YLBA 3AT1B 1BCPB 1BUVT 3S17H 4J6YA 4QT7A 4BBRG 2CFMA 2KHSA 2JQOA 2HBPA 4OMNA 3JB9F 4HAEA 4N9PA 3V8JA 1X3FA 1VQ6Q 4ESRA 2KQ3A 1MV0B 4KH1B 3RKXA 5KH6A 1ZQ1A 1SROA 1U8RA 1JOKA 1SXTA 1KNAA 1YHAA 4AH6A 2XRSD 4H02A 1FX7A 4BBSH 1ICWA 1BCPF 2KCCA 4OONA 4RTVA 1VQKQ 3KLWA 3GTOB 2OTLA 3M9BA 1NE3A 3TP5A 2ZPEB 3T9NA 3K5LA 2AHJB 4JI1L 5CVIA 1YCSB 1UJYA 1ET6A 3QDFA 2B63H 3HFZB 3CXCA 4C5HA 2KHIA 2RO0A 1K76A 3JAMc 1M2OA 1PFSA 3I55Q 3ASKA 4R4QA 2DLPA 4C3IH 4CDFC 1B34B 3OYKA 2JJQA 3CCQQ 2A8VA 3PO3H 1IZ6A 3OS5A 3GTPH 4R4OA 4M7DE 1TS9A 1X27A 1MJCA 3RLFA 4QUFA 2E2JH 1UGVA 4CHTB 2EYLA 2MK5A 4HCKA 3G6ET 4M75C 1CSQA 5LMUL 1B44D 4KKTA 2NLUA 3EFXD 4J9FA 3QR8A 1BNZA 4LD9K 4GZYC 2KGTA 4FYYB 3K58A 3HP9A 2JJ9A 4G57A 1BCPC 3CRLC 2QA4A 4FF2A 2DKGA 2QXFA 4P74A 1QJOA 2R7ZG 2R7FA 4MZMA 2JYOA 1D5MC 2PZWA 1B3QA 4X3KA 3LH5A 1KG1A 1E24A 1UECA 2WSFE 5I2MA 1KD1U 2RHQB 2PQEA 4A3MH 2LSSA 4KJNA 1BCOA 4HT9A 2NB0A 2J6KA 1CTMA 4RKBA 1ONLA 4DUYL 4MNOA 1N8RU 3CCSQ 4AIMA 1ZX6A 4C8QE 3MEVA 1BBWA 5G3LD 3VYSA 4EQNA 2UXDL 2CP0A 3GTGB 4A3BB 2LX7A 1H9RA 4X1VA 4C0DB 3WOFA 5C4XG 1MMNA 2NZ1D 4JOIC 4BXXH 3NTIA 4C0FA 2X4XA 4CDEC 2FXQA 4OEMB 3FP9A 3R8BA 4IUTA 2B29A 2NWMA 4KV6A 2EYFA 3OSVA 1TKWB 2OT2A 1VQ4A 1PTOF 1PH4A 1HTPA 2F0LA 3RZOB 4APVA 1EY5A 3G6EQ 1NEGA 2I5MX 2DIQA 2K2VA 2F2VA 3NK9A 3G7LA 4DBQA 5KNCA 4C8QC 1C4QA 3DM1A 1C7YA 4CKBA 1HZBA 1EYDA 1LTAD 1IW7D 1H641 4M75B 1S5DD 3CCQT 3DEOA 4LF8Q 4KHPL 4Q5VA 1YHQA 1KQSP 1CKMA 1TQOA 4ZAIA 3D7SB 4BD3A 2L11A 1QB5D 4JJDA 4B3TL 2R7ZH 5A35A 2V8IA 4DA2A 1SPKA 5HGQA 2MOXA 3I90A 1SJED 1M8MA 1FMVA 3ZBDA 1D1BA 4FSXA 1SNQA 2MPXC 2AUKA 2QDYB 3ERSX 1I81A 3CCRA 3CC2T 4IN3A 1O75A 4KBMB 5D3IB 2XKOC 5I2SA 4PG3A 4EQPA 2UU9Q 1CKBA 4E6RA 2CCZA 1Q86C 4DXFA 3MWYW 3KLSX 4CC2A 4K5VA 4XU1A 2YWWA 4CRIA 2JUFA 3QO2A 2KDSA 1YI2A 1EZ6A 4Z9CB 5AJ3L 3I55A 4JI4L 3M53A 2EYWA 3RN5A 1Y71A 1EWHA 2XHCA 3SDZA 4QMGA 3PGZA 4E7KA 4F88A 3HHTB 1B1ZA 2K6AA 4MZTA 1JQYD 4R1JA 1IHWA 4JYAQ 4C92A 2H8HA 2NVTH 3HRSA 4C1NI 3M9QA 3JCMe 2Q8RE 5C3EB 2AK5A 1TUDA 2VQEL 1NNXA 1K1ZA 2A7YA 1SNMA 2V4DA 3PUXA 5DM73 4FF4A 4KGZB 4A3MB 4DR6L 1OO9B 3UE1A 3HOWH 1MIUA 5C4JB 3OYMA 1XMQQ 3CCJQ 1G3TA 4FU6A 1K0XA 1I4K1 2OAUA 3N6RA 4MZ9A 3JSCA 1X75C 3AB9A 3GTQB 1H92A 5FJ8H 3V7CA 5KNBA 4JI7Q 2O5IC 1QUQB 2L0AA 3J81c 2AHOB 2RQUA 2WIIB 1M3CA 1VQOQ 2PMZB 1T0HA 3I5SA 1NJIC 1JJ2S 1F9RA 1GVPA 3FDTA 3MXNA 5C3XA 2YT6A 2C0IA 1NJIU 1T5EA 1VQJA 1PTOC 2F0NA 3NBHA 1WHLA 4C1NK 1I4GA 4NS5A 2CT3A 3LGFA 4OMPA 3SB2A 5DM7R 1Q82C 1EZ8A 5L23A 1R4PB 1S5FD 1K73R 1J6QA 3OMGA 1H3HA 4C3IB 3EVQA 4X9CA 3KXTA 4DV0Q 1R9TH 2K33A 4LF5Q 5CKDA 2RQXA 3V96A 2F0MA 1U4PA 2JN0A 1ZSZB 3E9FA 3GTLH 2O9VA 3I56A 5C4XB 1RAEB 2FO0A 4FXDA 2O2OA 1YEZA 4LUOA 1PDQA 4M7AB 1M4VA 2MGSA 2N88A 4F7XA 3FDRA 5C44G 5IODA 1MGQA 2RKSA 3ND9A 2Z6KC 3Q23A 4OMOA 1CUKA 4BA2I 1OV3A 2K5IA 3K57A 4KLKA 3NFCA 3AFPA 5CMDA 4JI0Q 1XNQL 4HMIA 1B53A 1XNQQ 2P0KA 1I6HB 4XYOA 3CMAT 4C92D 4XTWA 2RCNA 2EKOA 4J9CA 3EAEA 2JW4A 4F7UF 3DM3A 2PVGB 2V1RA 1J8IA 1WTRA 2L2PA 1GUSA 2QK0A 2F2XA 4TVAB 5AT1B 1XQHA 1LOJA 5GANh 1WTPA 4PL6A 4OP0A 2D6FA 1OPKA 3I3CA 4X62Q 1B9MA 2ZJRA 3KDFB 4LFAL 4FYXB 2NVYB 3GTJB 1RABB 2CP2A 2E65A 1GO3E 3DWAA 4BY7H 5BN3A 1QVFS 2BIVA 3BDUA 2VQFQ 3EQLC 4C92F 3A8JE 2GN5A 1HHVA 3OBYA 2N3SA 3P7JA 2V8KA 1AEYA 1I07A 1YJNT 1Q81R 3MP6A 3OYAA 2COZA 2QTVA 3DHQA 2JMCA 4DR7L 2YDLA 3I5RA 2FG0A 3QO3A 1F77A 3CCLA 3R93A 1YNJD 2LVMA 2HAXA 2QEXA 2YTYA 4P72A 1LTRD 5EPKA 1J5EL 1J5EQ 5IHKA 1G6PA 4JC0A 5I9OA 3CMAQ 2BOSA 2A6HD 2D0PA 3H0GH 4RHRA 3STBD 2AZVA 2K6DA 1M4ZA 1AVZC 2K05A 1X2KA 1QWEA 5ELNA 2MIOA 3UE0A 5IGCA 4QGUA 2RDGA 3E0JA 5E4XA 3UDFA 1AWXA 5A2QE 4HCCA 4QVZA 5I4DA 4AQYQ 1IBLQ 1PSEA 4IKFA 2AUJD 5IP9H 3S16B 2PZUA 1G3YA 2F52A 3ULRB 4KKUA 3PO2H 5M3FB 3IAYA 1YI2Q 1DJ7B 2MI6A 2F0SA 2FHTA 3OIPA 3GBQA 2E1HA 5D6WA 2AWOA 5GAN7 1FR3A 5GAMj 2RJCA 2H3EB 3A8LB 4NP5A 5GMKe 2L3QA 1YBYA 4ZTFA 3M4PA 2AWNA 2FPDA 3STBC 1PV4A 3CMEQ 4AG2C 3PSIA 1XJVA 1RUWA 1HRJA 5ELOA 3FEOA 2PVDB 4DV3L 3QBYA 1Q81U 2ZPFB 4X66Q 2ZGWA 5KYWA 1YJ9Q 2FFKB 3UATA 4D6WA 2IG0A 3PT9A 1UAPA 2E8GA 5HGTA 4RG1A 2DF6A 1LT4D 1N33L 2A69D 1SSHA 4Y7NB 1CA5A 5FKAC 1M3BA 3NPPA 2UUCL 5CORA 2MF2A 3PTAA 2CSIA 2KEEA 1Y7XA 3AHUA 2A5HA 2VB3X 1GFCA 5C0XI 2XG8D 3LGJA 1KQ1A 2WFWA 2SNMA 3CCUT 2F0IA 1PH7A 4PFZA 2EJGA 4DEYA 1BIBA 4M7DG 3HTRA 3A8KE 3OYEA 2EWNA 4DR5L 3GNGA 1EWCA 2F69A 1EIGA 4NDXA 1W2BA 5FK9C 4J7FA 3Q8DA 4C3JH 2M0OA 4RCOA 3CF5A 3VUZA 3NHHA 2RJEA 1VQLA 3H0GG 5LMNQ 4IURA 2DK3A 4OB1B 1Q7YR 1PG5B 4KGVB 1K9MU 1ENFA 1I4XA 4HSVA 4RTZA 4X65Q 5C44H 2EJ9A 4JI2L 1E6GA 4C8QD 5I2XA 5GAOl 2RVLA 4ZUJA 5EC7A 5CV7A 1N34Q 2JS2A 1PRTD 1NAPA 4JJNK 4MN3A 1MMAA 2LCCA 1SRMA 3MEUA 1LTLA 1IYJB 4Q0FA 1MNEA 1HUNA 3HKSA 4HEDA 3QYHB 3SK8A 1JRIA 3M3YB 3HKZB 1RI9A 2CP5A 1KXLA 4N8X1 2SNSA 2ZPBB 1EFWA 2ATCB 3EHQA 1XNRQ 4PNOA 1I5LA 2ZJQA 3FIFA 1MNDA 4RKUE 4DK1A 1N33Q 2RQRA 5HKCA 3CCRQ 4QJFA 1AOJA 4R56A 2X69A 4JZ3A 2DXCA 3EGXB 1VQNQ 4LJZC 3M0RA 1V1QA 1X6BA 1CKOA 4IUUA 1AWWA 4DR4L 5DEHA 1AP0A 2CS7A 1B8AA 1ZSZC 2HL3A 3A5ZB 2V26A 3SHWA 1DOLA 1KC8C 3D3RA 3M4OB 2K5WA 2MJ8A 1KDCA 3JCMV 4DN4M 3H0GB 4HJ8A 4L5GA 3URGA 2X4WA 2MQHA 5KRUA 2Z1CA 4XTXA 2EAYA 4NMZA 3EFOB 2F0QA 1LO5D 1HNXQ 2AKKA 1D0XA 2XRQD 3P75A 1XMQL 3K0XA 4O6JA 1U4RA 3VR6A 1EX4A 4PMBA 3CPWP 1F9QA 2NVTB 2VV5A 1M1KC 1K9AA 3TEHB 4XQ3A 2R7DA 1W2BS 4YWKA 1WXTA 2YRCA 1WHJA 3FLGA 5LMNL 2ZZDA 1IXRA 4A3JH 4JBMA 1GBRA 3OSOA 4FNFA 5HY6A 2BZXA 5KYXA 3WXMB 3I9QA 1Z47A 4M8AA 5CBEE 2I0QA 4RKLA 2KMTA 5JPMC 4A3DG 2EYQA 2PMZE 5GJVB 5GAN3 2ZXPA 3PF4A 1M90U 2RQTA 4OGQC 3Q24A 5KCHA 2LX9A 1SYFA 4NXML 2K7VA 4X34A 5EBCA 4B08A 3VDYA 3LWHA 2J7IA 4ZGJB 1B34A 1SE3A 4RTUA 3JCMJ 1QWYA 4A93B 2L3PA 1XX8A 2CVRA 4OB0B 4RMFA 5KCOA 1RAAB 4A3DB 1VQNA 2RD1A 3HGBA 4KT0E 4Z88A 1HSQA 4MDWA 1A0IA 1VIEA 3H09A 3T1HL 4OF1A 2UUBQ 5GAMh 1XXGA 2ABLA 5K5PA 2VXEA 1O80A 2K32A 3UDXA 3FHWA 3K80C 2YSQA 1QVCA 4LUVA 1TY2A 5EPLA 3SVMA 3VRYA 2A1AA 3NENA 1VMPA 4XTYA 4RMOA 1A2TA 1ZXTA 1UE9A 3ZEHA 4JI3Q 4A93G 1FYNA 2G6FX 3GIBA 2E75C 2DA9A 1VQKT 4MHEA 1K8AC 1JWSD 1RKNA 3OWEB 3RLNA 2K3XA 4J9EA 1TS2A 3BZCA 3F2BA 4K14A 4QF4A 4F04B 4HCZA 1WGSA 1VQPA 1NSNS 1DOKA 3U50C 5JEAG 4A3CH 2NUTA 2K5QA 1KTKA 3I4OA 1YWOA 4H0LC 1Z9QA 1TIID 1ZA1B 2XDDA 4M4ZA 3R3OA 3HOVH 1VQ4T 3HRUA 3NWSA 3PF5A 4PNYA 4UY8C 4HKEA 4B3RQ 2RI2A 2E5KA 5KE3A 3CC4A 6AT1B 1TWAB 3GTPB 4ZQ3A 3CC7A 1ABQA 4C92E 2Q2TA 4A3GH 2X35A 1NR2A 1LABA 1D7QA 2SEMA 1K0SA 2ROTA 2J0TD 5EKKA 3JAMi 3THKA 2IT1A 3HOYB 1QWFA 2DX1A 3GTJH 3S1NH 3JCMQ 2ED0A 4OXPA 4QVDA 2D5DA 3AU7A 2JTMA 4X3UA 2NN6I 5IYDG 3NTKA 3G4ST 5EQ0A 3X3NA 5JEAH 4GLAC 4P5NA 1F9PA 5FLXc 2WACA 1P16A 3T53B 3MP8A 3EJIA 3OTOQ 2YUNA 2EQIA 1FNWA 1JWUD 1OX8A 2I5HA 4OO1H 2EIFA 4DGZA 4PZ6A 5CV5A 3QPHA 1NY4A 3HFNA 3TZUA 1M3AA 3G71A 1X2QA 4A3BH 2M02A 1SEMA 2YU9B 2E6NA 1ACMB 2UUBL 4OO1G 1CM9A 1V1PA 2L15A 1Y0MA 2QEXT 1I50B 1TS5A 2VXWA 4ME3A 4M78D 1O7IA 2XU8A 2RJDA 3HEJA 1K3BC 4H13C 1PH2A 1BXTA 2L9HA 2PW5A 5FLMG 4X62L 1G2TA 1OEBA 3UT1A 2B39A 3KF6B 1TWHH 1M1KR 2EYOA 4OWTB 2DJFC 2KHJA 3K5MA 1VQMT 2BKDN 2ICEC 2E41A 1KAWA 3TP7A 3CCEA 5KE2A 1HR0L 3T1YL 3T1YQ 2HDAA 3GNFB 2IY5B 3OYBA 2LNHB 4XDXA 2R5AA 1GUNA 1ZUYA 3UWNA 3BJUA 4JRKA 3UA7A 1KC8R 1Y8NB 1N9SA 2A6ED 1FYCA 4C3JB 3MP1A 4I7AA 4DAPA 4F87A 2AMCB 1YITQ 3KFUA 2R57A 4ZNXA 5LJ5d 5IP7G 1OXUA 1KAAA 4PK4A 3JCMd 3GTMH 3PQIA 2EQUA 3J7AV 1GFDA 2EYPA 5J39A 4C2MH 1PLFA 1GUWA 4C5GA 5GMKh 1QUQA 3J81L 5CIUA 2K57A 2F2WA 2ZTCA 3I2ZA 1VQPT 5IT9E 3CAMA 5CKEA 5IIFA 4AQYL 3GO5A 4LUEA 2FZKB 4C8QB 4KD3A 4ODGA 1E2ZA 4MIUA 4IOCA 1I4RA 1SMYD 4DQ2A 1SYBA 1JE5A 4JK1C 4IIOA 1ASZA 3CC7T 2AKLA 3VS2A 1SNDA 3FPPA 3CC7Q 2F0WA 3ITPA 3J81j 1DJRD 1UWVA 2I2LA 1A8VA 3S1NB 3EG9B 1VQCA 2JS0A 3NQIA 3GTQH 2VL6A 3EN2A 1VQ7Q 4P75A 5EGTA 1U5SA 3D8GA 4M7DC 1LLRD 3TMEA 1PNJA 1ZSGA 3GTLB 1JOQA 2F0PA 1I5FA 1I6VC 2JOYA 2NWGA 1T3SA 1BVSA 1ZSZA 3LWUA 2EQMA 3H3VH 1SG5A 1PRTB 1TR5A 2LKVA 4X3SA 3G1JA 2I46A 4E7LA 1X65A 3LWEA 4N9TA 4QQ6A 4HXJA 1SNCA 1Y69U 2ZAEA 3HOVB 2K04A 4QUCA 3KF8A 1HZ9A 1BI2A 5CKBA 2RNAA 1GD7A 4X3TA 2BE5D 3KJPA 3C1EA 1HNZQ 2C0OA 1KJWA 1IHVA 4FO2A 1MHWC 3LX7A 4DV2Q 3H41A 1EY9A 2VYTA 1F1BB 1YZ6A 1RODA 3LX0A 4IFDG 3NP8A 5CBAE 4BACA 4YCVA 2A19A 4GY5A 1NYGA 4QL5A 1XMOQ 2RK1A 3VS0A 3R2IA 1W70A 5LJ3e 1BDOA 2ALYB 1VUBA 1Y8PB 4DV6Q 4F8MA 1HJDA 1CHPD 5C3EG 1QE6A 4N4GA 5GANe 1L1OC 4FXGC 1YHQQ 1STYA 3Q0AA 1WTXA 1WI5A 3CCUQ 3AYHB 4FT2A 2VS1A 4HIDA 1QNUA 1BB9A 2EGEA 3CCLT 4EMKC 3VRZA 1AZQA 2DXBA 5DLQE 4M7DF 4A3KH 5D14A 2YUPA 2GFUA 2NN6G 2HZYA 1N34L 1CKAA 2K3BA 1UHFA 5LJ5j 2QAZA 1VQHA 1Y8OB 4B3MQ 4E2FB 2JA6B 3H6MA 4ZGEB 1AD5A 1ESRA 1JOOA 4GOPB 1ASYA 2L3RA 5ISRA 1E0BA 2NVXB 4K5WA 3RZOH 2M9VA 2HCKA 1XOVA 1BI1A 2MP1A 2FB7A 4BE0A 4DNRB 5CQXA 3CCVQ 3S16H 5GAOp 1BK2A 4A75A 2C5CA 2IHFA 1RCVD 2H4OA 4KHVA 1E6HA 3FEWX 1CA6A 4C3IG 1UJ0A 2RQWA 1HA5A 4BA1I 3L2WA 2DXUA 1I94L 4O5VA 2IPOB 2R7ZB 4IJLA 3KUFA 3OQ5A 1NYFA 1TWCH 2IJ0A 3RR5A 1A62A 1PTOH 3RR6A 1PH3A 1XYIA 3S1MB 3PUZA 2A37A 3E9IA 3ND8A 2CZ7B 2DY8A 1WD1A 1CSKA 3UA6A 2CKKA 1PFBA 2R3ZA 3PUWA 1QCOA 2DZ9A 1QZHA 4DV3Q 2CQAA 3A8HB 1TTHB 2ZPIB 1D8LA 4L5QA 5IGDA 5KYWB 4YHHL 4L63B 1Q82U 4LD6A 4DR4Q 1VMCA 1EFID 3ZFJA 4PJLA 3HKZG 3AMUA 3BFMA 4K11A 4RTWA 4HR7B 2LQNA 2L89A 3VYHB 4KRTA 1M8VA 2HQLA 1L0YB 1PCXA 3EIVA 3JCMh 5GMKm 3PIOA 1AE2A 3A8GB 5KIXA 5IYBG 4DUZQ 1M1KU 2X6GA 2EKHA 1W2BP 4FXKC 3BDLA 3EGUA 3OS2A 4ME5A 4CKEA 5HURA 1UE7A 1LT3D 1CHQD 4EMKA 2M00A 2Y0SE 4LK1C 3SK4A 4C2MB 5M3MG 4BY1H 2KQWA 1KQ2A 2EQJA 1NR4A 1UUPA 3G6EA 2QTXA 5CKFA 1ZBXA 2RI5A 1VQ5Q 1VOMA 1TWHB 3B6YA 3H15A 1ICFB 3J80i 4DR3L 1VYTA 4DXGA 4WRDA 2NVQB 2F0JA 4DV5L 4F14A 2A6HC 2LMJA 5H1SE 4AYBE 1TT2A 1R0CB 4R8IA 2PI2E 2Z0WA 1VQ8T 2L0CA 4LF6Q 5GAN4 4JI2Q 1HD3A 4KGXB 5GAMg 2UXBQ 3H3VC 3S2HB 2YRVA 4PJNA 1D5ZC 3RIRA 1KDAA 2EPBA 2JK8A 2LCSA 4HTHA 2P4TA 5GANf 4C0ZA 1WYDA 5EKIA 2CZ1B 1IREB 2A68C 4C5EA 1K73C 2OF1A 1GHKA 1LYLA 1Q82R 5DM63 2PNIA 3CCMA 3CKIB 4OL7A 2RN8A 2PVOB 3IFDA 2DIGA 4A3JG 1XNRL 3M5AA 3QXEB 3MEFA 5KEEA 2Z6BA 2K5VA 1K8OA 1PWTA 1OXVA 1JU5C 1OPLA 2E3IA 2KT1A 2K4KA 1MV3A 3SXHA 5GAN8 5FLMH 3EGXA 2FPEA 2NZOA 4KJOA 5G3LF 5FWCA 3HOWG 2P4RA 5IGGA 4DV1Q 2PW7A 4YWLA 3HOYG 2HDMA 4OB2B 2KXDA 3SWNC 1TS4A 1EWIA 4ORZA 5GAMf 4II1A 2NBFA 2E6ZA 2AQ3B 4DKAC 2E2IH 3V2TA 5A0GA 4DFAA 4LF7Q 4ZYSA 1EYGA 3E0EA 5FRMA 1GL5A 2EY1A 2FYKA 1LTSD 3J7YW 3BYYB 1IYVA 2DVJA 2JE6I 3CD6A 5M5WB 5GANg 1CT1D 3TRZA 4PJOG 2KBTA 5I11A 4JI4Q 4HMJA 3ERQA 2BE5C 3J7ZC 4XT3B 2BDNA 1C1AA 2JM8A 3MCAB 1RD9D 3K81C 1W6XA 3PCOB 4RCBA 3S1QH 3JCMc 5C0MA 4DR2Q 3S1QB 4EMGA 2M51A 3QJ6A 1VQ8A 5CKHA 1AZPA 5M3FG 1JE4A 3CQZH 4HJ7A 2KR3A 4XAXB 3BG3A 3JRZA 3K7UC 4BUGA 1HJPA 3BVZA 4GN5A 5C4HA 3KK7A 5KYXB 1SE4A 4GKJL 4JI6Q 3H0HA 4R4TA 2F5KA 1WTWA 2A08A 1PA6A 1PSFA 1R8OB 1KLUD 1SMYC 1K0RA 4LUZA 3GLXA 1N9RA 2IL8A 4AYBB 3QOLA 4J9BA 1QVGP 2CP7A 3M4GA 3D0FA 4J1MA 3URYA 1P8LA 8ATCB 1PYWD 4DF7A 2O01E 2PZ1A 1IKMA 1L0WA 1G8XA 2EXZA 2P0PA 3MXGA 2K01A 3NPFA 5IT9c 2E4HA 2FMCA 4CDCC 2D0NA 3ME9A 5J26A 3Q1JA 3RBBB 1TWCB 4AFUC 2D9UA 3CP0A 1WQWA 3BZKA 4NKLA 3S14H 1WFWA 1JJCB 1TVXA 2DTIA 1F9SA 2FEIA 2DUDA 1YHQT 5I22A 3QIAA 4GN4B 2W0ZA 2JA5B 5C4ZA 2CT4A 5IT9L 3REAB 4DA4A 1QCNA 4F7UB 1HTLD 2YV5A 2B63B 3CW2C 3SWNA 4XQQA 4L6V5 1PMRA 1W1FA 4K8JA 5I9PA 5GANd 3OYGA 1RTNA 1Y1VB 4R4CA 2EY5A 2DN8A 1R77A 1UE6A 4YWMA 2NUTB 4R9WA 1PD0A 1UE5A 3DXJC 2HCCA 3N52A 2JA6H 4J6WA 2CHBD 4KY6A 2VUMH 4C8QF 4JI6L 4PJMA 2J4XA 2RSNA 2WP8J 3T13A 2JTFA 2K7AA 2R93G 2YTXA 2ZCFB 4I65A 2E5LL 4IUVA 2AIRB 4A3LG 2CGHA 1LPLA 3GDEA 1WJQA 3VS3A 3SE0A 1WD0A 3D4RA 2HIXA 1JBMA 3BVGA 2NZHA 1RAFB 3BVMA 3I70A 4DR1Q 3GTMB 4LE9A 2DNEA 4C8QG 4RUGA 4XTUA 4LAAA 2IWHA 3HOUH 3I4MG 1QP2A 2PZTA 4C3HB 4PMWA 1RAHB 4ZRZA 4OIKA 1YIJT 1K73U 2QI2A 4HJ9A 4QIWB 5FLXL 2L3SA 5GAMe 3S3MA 1FJGQ 3HPWA 3J7AF 3A56A 1M9SA 2EGAA 1NLPC 2GBQA 5IN1A 1B7TA 1QKXA 1Y1WG 2KRMA 3D6WA 2JM9A 3CMET 2D0QB 1EQRA 1I3QH 1WTHA 2SEBD 1TU0B 1AFPA 1ZBJA 1YITA 1PVOA 4JBKA 3RLOA 3NUCA 4JCVE 5IGFA 2JXBA 2KROA 4CI0C 3CCRT 5GAN5 3VJPA 3CC2A 1QNKA 3WVEB 3RZDH 4IZ8A 1CFMA 1V1PB 1W6JA 3HRZC 1MBYA 1U06A 3M57A 3CD6Q 2ICIA 2PQAA 2PYKA 4BE1A 3QOJA 3PVQA 1SBBB 1V1CA 1QVGS 1WJRA 1TUGB 1SHFA 1WNLA 3I55T 4JRQA 1Q7YC 1QVFA 1IYUA 3HOZG 3I4NG 5FLXE 2MPMA 3KF6A 4BI8B 4LF5L 1T9HA 4AMCA 1H9MA 1R9TB 3EGDB 3KYHC 1OOTA 4VUBA 1IBLL 4MTNA 1IL2A 4X66L 2O88A 2MO0A 4DPGA 3MPUB 4MMKA 3S17B 1FWZA 3E2UA 3E9GA 4QQDA 1I1JA 3O5ZA 3L9AX 2RHSB 2BH8A 2FZCB 2DNCA 4A4HA 5JJKA 3OSSC 3I4MB 1OU9A 2KXCA 3A5UA 5M5WH 4LDWA 2R93H 2LJ3A 4LF7L 5GAHC 4IUNA 3OY9A 1DCZA 2HQHA 4PLIA 1NCVA 3JCMg 2J05A 1JB3A 3H91A 1ET9A 4LFBQ 2XGTA 1HNXL 3JB9J 5T1IA 3IKJA 2OWOA 2IX1A 2F0OA 4OX9L 2BTTA 1NMGA 2EJFA 5GAEC 4UC4A 2EVRA 1TWBA 4DUYQ 4C8QA 4DEXA 1SLJA 4IO9A 4B3SQ 4ZN1A 2CP6A 2DL4A 2KYBA 1IBML 4Y28E 4PV1C 1K9MC 2JEBI 3EFSA 4C0GA 3PO3B 1N32Q 1YJWT 5C0XG 3HOUB 3NQTA 3EG9A 1WTVA 4S3SA 1NMFA 1U3OA 5FO8B 4A3IH 2B3GA 2DD5A 1VQ8Q 2F3WA 3EG1A 5BR8L 1VQ5A 4NL2A 5CK9A 3A1PA 1SYGA 4Y91A 4C92C 1SYCA 4LF4Q 2QDBA 4J9GA 2ES2A 3L42A 4LFCQ 1SYDA 1YJNQ 1FGBD 4FP5D 1WCMH 3OPOA 3OHXC 2F1MA 2Y0SG 1IBMQ 3ULPA 4J6HA 3KF8B 2QA4Q 2XMFA 2DD4A 2BA1A 4OIJA 1L0XB 1HCZA 2PPBC 1U9RA 2HD0A 3M56A 2QW7A 1Z6HA 1RIPA 2JA7H 3S2DH 3FC3A 3SD4A 1G2SA 4A3FB 1HQMC 1B3AA 4OMQA 4L59A 2KOLA 4BBSG 2DFUA 3C4SA 1TU2B 1Q81C 1BBXC 3P8DA 1H9SA 4I7ZC 1JXOA 1UDLA 3E6ZX 1Y1WB 1AHJB 2Y4YA 5IP9G 2FRWA 4N8FA 5EJWA 2L5QA 1QCBD 4FT4A 4DV6L 1UNSA 1PTOD 2D0OA 2KCTA 3M7GA 1IGUA 2FINB 2YUOA 5E4WC 3F2CA 1AWJA 2HHHQ 9ATCB 1PKTA 5AJ3Q 1ZA2B 1UGPB 2J6FA 2OI3A 1KIKA 4RCCA 3CPWS 3A7LA 3W3AA 4WTOB 3KUPA 4WF2A 4DV2L 1K4US 1QLYA 4JI5L 1KHCA 4LDVA 4A63B 1MUZA 3S3OA 1F2ZA 1NUCA 3BE3A 1VQDA 1VIFA 2K5HA 4DV4L 2CZ0B 1VQKA 2L5TA 4BY7B 3QB3A 1YNNC 1U4LA 2AQ1B 3GOXA 3TEEA 2GF7A 1VQ4Q 2Z8LA 3SR1A 1DONA 4GOPA 4C3HH 1KD1C 5IWAQ 4IIMA 1FNUA 4N0AC 3PIP3 2EPDA 1LJOA 2KSSA 3H6ZA 2CP3A 1D6EC 1M30A 1EY4A 4L5TA 4LFBL 2KVQG 3TREA 3GPLA 4QQGA 2UXCL 5GMKl 4M7DA 1C6VX 5GADC 4X64Q 1VQOT 5E1FA 2F0VA 1D3BA 1E2VA 4CGYB 2E2HH 1SKUB 1PRTC 2COYA 2LQ8A 3CXCP 3H94A 1QP3A 3M58A 2CKZB 2MCNA 5JOBA 4RG8A 5AYFA 1CKNB 1TWGH 2EE1A 2E12A 1YVCA 4L5RC 2RHYA 3S24A 3PIPA 5HCKA 1FGUA 1TG0A 1Y07A 1SDFA 4GNXB 1Q95G 3A0JA 2L8DA 1EY8A 2CDTA 2NYZD 3VS5A 1N8RR 4YTLA 2VGMA 2TSSA 1NJIR 3HZXA 2YRDA 5GMKi 3K8AA 1F2LA 3K5OA 4POFA 4IQZA 1L2FA 1DYQA 2YU9H 3TN2A 2WKCA 1GCQC 4N4IA 4NW2A 4B3SL 3L2QA 1M8AA 4GBQA 2E74C 3PO3G 3OOCA 4PZ7A 1FXXA 3LYIA 3TCJA 4RGMA 1X3EA 5LJ5g 5IYDH 5C5MA 4AYBG 1PKSA 1STGA 3VR2A 1NTGA 1JMCA 4OO1I 5JVH3 4U673 2KNBB 2RI3A 1EU3A 2JSOA 4QCLA 4JRPA 3TBIB 1H9JA 4XYQA 4WORA 1NEBA 2R61A 3WOEA 3C2PA 1CZWA 1QZGA 4C56C 4DV1L 1FMWA 5M9OA 2LC4A 4FL6A 5JVG3 1I0CA 4LN2A 4MMLA 4EMKB 2A68D 2LP5A 1XPOA 3GTKB 1B7YB 1GUTA 5D7UA 1EQVA 2QEJC 3C1FA 5ECAA 3H9NA 4A3GB 3HRTA 1VF7A 3A8OB 4RTTA 2NYSA 3CCJT 1DM0B 2B2WA 1RADB 4E7JA 3TSWA 3W1BA 4BBRH 2XIWA 4JZ4A 4PQXA 3HKZE 4K8IA 3VR3A 1RL2A 1WDXA 1GXIE 1IHZA 2B8GA 2WAQE 1MI2A 1M2VB 2E2IB 1Q86R 2F3IA 2RF4A 4R8NA 1D0ZA 2LZ6B 1T3LA 1TY0A 4XTCS 4A3DH 2O9SA 5K36H 1HA6A 1OU8A 2E3HA 1S72A 4UHVA 3MHXA 1JXMA 1Y14B 2M1HA 2R5MA 1PH6A 3NMZC 3I4NB 2RHUA 3QKJA 3GP7A 3PNWC 4KHZA 3SK5A 1NPPA 5CGKA 1RI0A 1ESFA 1IBKQ 2EJFC 1LNXA 1UGQB 5CR2A 1PHJA 1SSOA 2Z4IA 3ULJA 3C12A 3S9WA 2EY6A 3X25B 5C5LA 4YY3Q 1PZKD 1SFOB 2UXDQ 3FRNA 1RLPC 1IGQA 4E47A 1PZID 4JI8Q 4TVRA 1TWGB 4B3TQ 3QWNA 2QGGA 4KY5A 1VYUA 4O42A 1IO6A 4J9IA 4ATOA 3OA6A 2WINB 4O1NA 3TU4K 4QB4A 1OQKA 1MSGA 2KEAA 2V1CC 1TXQA 3JCMX 5KGUA 3A74A 1LT6D 3S2HH 3RNJA 1CK1A 3AEVA 2EYMA 2BUDA 5IHNA 3UDIA 5JAVA 4M7AG 3UI2A 2DBMA 4M77D 2JA7G 5HK3A 1STNA 1VYVA 1Q86U 3NSWA 4IUPA 3E5SA 1Y57A 3BDOA 1N36Q 4HIOA 1PH1A 3FKIG 5KYUA 2CWPA 2RA2A 2OAWA 3G71Q 3KOJA 1HR0Q 2X6LA 3VR4A 5IP7H 5CV8A 2YLCA 3NBIA 2PNHA 3K0YA 3RUZA 2B2TA 3CCMQ 3TQYA 2Y90A 1CI3M 2QASA 4KMUC 2ZM6Q 1GM5A 5LHY1 4M75G 1LT5D 1AT1B 2DL7A 2UUCQ 4HA8A 2VQEQ 1G8ZD 1SYEA 2M2LA 2VXFA 3HFOA 5ELDA 2PNRC 2QA4T 2GFAA 1S3OA 2K75A 2VASA 3GV6A 5K36G 4BY6C 3MFGA 4TSSA 4D8KA 2DVEA 3OTOL 3M4OH 4J6XA 2CUDA 2F0UA 4KHPQ 3NTHA 3OYLA 1M90C 2DPPB 3CC4T 2RJFA 1TUCA 3OW2A 5FJ8G 2KI7A 1V29B 2EW3A 4GLMA 3LWIA 4ZKCB 4A3FH 3I35A 1I4PA 3KBXA 3SHLA 2JEAI 1EL0A 2UXBL 4PJOF 4NPSA 1K28A 2RDHA 1OXTA 1EOTA 4WJ3M 1OI1A 4M78C 4ID6A 1L1OA 3S1RH 5GANj 4A3JB 4A93H 4HVUA 3BY7A 3A54A 3CQZB 4HCEA 4RGTA 1WXBA 3A98A 4LDXA 1RF2D 5ELFA 4ZKBB 5LMNW 4LMQD 1PH5A 3PVLA 3OYHA 4RG2A 2NVQH 1EY6A 2OEOA 1ZYRC 1PD1A 3M0TA 4KH0B 3TQ7P 4KUDK 1UEAB 4P73A 4F7UA 5KYNA 3WWVA 2RQVA 2K79A 3SWNB 4B6MA 2XD0A 3W5OA 3ZL7C 2CW0C 2F0DA 4P2CB 1LACA 1Q1BA 3RD4A 4ZLTF 3J81E 2FRYA 3EG2A 4LFCL 3Q6SA 3X20B 5L37A 3G71T 3HOVG 1X54A 1VQGA 1AZGB 1ABOA 5LJ5f 2AKWB 4N0AA 2DZCA 2CUBA 2DETA 1NM7A 3T51B 2HT1A 3TS2A 4DBHA 1XNIA 4HJ5A 8AT1B 3CQTA 1N5ZA 4A76A 4A3FG 3UDGA 3HOZB 2DJZA 5IAYA 2TMPA 1M27C 1GKHA 3I7FA 5LMUQ 3EH1A 3RNUA 2A6EC 4L5SA 1BI3A 1VF5C 3S15B 2BA0A 4TQUS 1MKHA 1DD2A 3L3OC 1II3A 5D65A 1ENAA 3E3XA 2RH2A 3H0FA 1YHBA 4OMMA 2FZGB 2M16A 2G9HD 1ZLMA 1I50H 1ZUUA 4KN4C 2H5XA 4M77A 2EY2A 3EBEA 4BDYA 5GAGC 3MXPA 2Z9HA 2RHIA 3RKYA 1SHGA 3X24B 2BZYA 2JMAA 5D6YA 2JA9A 4UPAA 2UUAL 2GTJA 3HOUG 3I4MH 3KJOA 3KBGA 2VNUD 2DJQA 1E3PA 1E22A 2AZSA 2LT1A 2HCIA 4ZUIA 5GAN6 4IFDJ 3C95A 2KY9A 4Z8AA 3INZA 2VY3A 1BU1A 1Q8IA 2GVBA 2A69C 2BCOA 3KLSA 2HL5C 2GCXA 3DB4A 4Y92A 2DYBA 5JEAJ 2QCPX 1MJEA 1FVIA 4MTKA 5FO7B 2HKNA 2NUCA 2OX7A 3OW7A 2GQVA 2Y0SB 4UP9A 1G2BA 1RLQC 1STBA 1O7LA 2PQAB 4PLLA 4CC3A 1Y1VH 2Q2IA 3TSSA 1QKWA 4A3EH 1EIYB 2CSQA 3VS7A 2HDLA 1K83H 4JI7L 1H95A 2E64A 4JRIA 4GLKA 3L7ZC 4GLVB 1X9NA 3EGDA 4UDUC 4A3EG 4PJOA 2Z0SA 4PJJA 1B9NA 3QDRB 3FRPB 4E6IA 3VYRA 1GJXA 2MWPA 2HBWA 2VB6A 2IIMA 2DGYA 2I0NA 3RMSA 4RFBA 1Q12A 1D1CA 3RMHA 5C44B 1WJSA 1RJTA 2F0GA 4EQOA 4C5IA 5DAUA 4DAVA 5I6YA 4HIMA 2LFNA 3K7AB 3D6CA 5IYCG 1BI0A 3VS6A 1E7OA 1K3RA 1PRMC 1JC7A 1C48A 4MZPA 4M7AE 1Z9FA 3U4ZA 5BN5A 2WB1G 3DWQA 3HOXG 2DL8A 5BN4A 2K28A 4X9DA 5C6SA 3EHRA 1N9WA 1EYAA 3OS1A 4WCIA 2G9DA 2LNVA 2QKIC 2ZXOA 1VA7A 5FU6B 4ABNA 4ME7A 1B2TA 4X64L 3J7A5 2RA4A 2DYIA 1GUOA 1D2BA 4GOPC 2LJ1A 4C3JG 3F2DA 1J3TA 4LWCA 2P5ZX 3CMAA 4M7AF 2E70A 4M77G 4A3IG 2ASBA 1HR0W 1VQIA 2D2CC 3M7NA 2YUQA 2X3WD 4HIKA 2MNAA 2B2VC 2B86A 2VUBA 4Z02A 3QYGB 3CCLQ 5IYCH 5M5XB 1WA7A 4FYWB 1EIHA 2ED1A 1QOHA 3BDCA 4BBRB 1BCMA 3VYUA 5IGEA 3CBOA 2G5DA 3CBPA 2GQIA 2V8JA 2LQKA 5IXFA 3K5NA 4A3KG 4X6AH 1UB4A 4Y52H 1SNPA 4KTAA 1BKBA 2I07B 1O7ZA 3NEMA 2JA8B 3X3MA 1A6XA 3CCVT 1HUMA 5IE8A 3PUYA 3MAQA 3PE0A 2KAFA 2YXYA 4JDSA 5A0LA 4GN3B 2LMCB 4B9WA 4BY6B 2J7ZA 3PFSA 2B2UA 4LNQA 4IOAA 2HEQA 4YCWA 2EGCA 2F0TA 5AFWA 3DWPA 1YJ9A 1UHCA 2ATWA 4XK8E 5A0DA 2SOBA 2LRQA 1H9SB 2JVVA 3CBMA 3FPUB 3ZJYC 4XTZA 1XJWB 1YITT 2DXTA 4KI0A 3TVTA 3QSUA 4A4IA 4BY1B 5I2YA 2KEDA 3LNNA 1JB0E 4HVWA 1E2WA 3M0QA 4J8OA 2F0KA 1NBWA 3OYCA 2XTIA 2GA4B 2EYZA 3MTSA 3PIO3 3GF5A 4GNXC 3S1MH 1G291 2KUMA 1V9PA 1WHGA 1OYXA 4Y7NH 5FW9A 1WXUA 4XU2A 1X3QA 3MHBA 3NWTA 4BBSB 1BOSA 3M0PA 4YHHQ 3KLRA 4NXNL 2W10A 4A53A 1WYXA 1UE1A 1SF9A 3VU3C 3MEAA 2ENBA 3D4WA 3EA6A 4RA8A 2KRSA 3OYFA 2QQBA 3H8ZA 4BI4A 4JS4A 1N6AA 5D3DA 1M5Q1 1WJJA 2WV6D 2V1QA 4F17A 1B70B 1BYMA 4RH6A 2UU9L 4GKJQ 4M77E 1LTGD 1LTBD 4EQ5A 1KHIA 1VCIA 2B2UC 1QG7A 1KC8U 1LVKA 5LL6S 3EG3A 4DK3C 4K2LA 3G7ZA 5C3EH 4FM4B 2PO4A 4M7DB 1JJGA 1UTIA 3M0SA 4RAUC 2J06A 1I6HH 2KT8A 2DO3A 1EYCA 5COYA 2JA7B 1Q90A 2OTJQ 2OTJA 1D3BB 4ANJA 3JAML 2CW0D 3IL8A 1KFZA 4HCSA 1RAIB 2B8AA 4WJWA 2YYZA 1NZ9A 3FVQA 4FYDA 1CKNA 2F0EA 3F1ZA 4A3EB 1IBKL 1KK7A 1Z9ZA 3S15H 2DRKA 1TSFA 5CO7A 1KL9A 3E19A 3J80E 3EROA 3R2TA 4GNXA 1YN8A 5FOBB 4IPDA 3W2DA 4O0AA 4AFSC 4EDUA 1SE2A 1NBEB 3T4AC 2C06A 3MEHA 3VS1A 4OHJA 2CH4A 4FYVB 3RZDB 2VUMG 3DKMA 2Q8IB 1G83A 2RHZA 3A7AB 1FL0A 1LTTD 4OELB 1VQPQ 4L6TB 4B9XA 2F3VA 4XT1B 1GRIA 1QVGA 1VQMA 1J9OA 3S1RB 3H3VI 3OBWA 2K5NA 1HK9A 4E7IA 2XDBA 1GUGA 4LF8L 1BR9A 1IXDA 3ULLA 1SMXA 4DUZL 3FJPA 1C9OA 4GS3A 4ZK9B 3EFRA 4BI3A 5M5YB 3UDCA 2E10A 4H44C 3J81i 1K8GA 4JJCA 1H3ZA 2DM1A 2PUOB 1X43A 1KRSA 1EOVA 2K2MA 1QVPA 1VQ6T 1AWOA 5C4XH 1ML0D 5GAOq 4A3BG 1SE8A 4JI3L 1SRLA 2CREA 1CZGA 1HZAA 2OQ0A 4GKKL 1A0NB 1QVFP 5JJIA 1WOCA 4PKCC 2ZPGB 2PUKB 3QZ9B 4C92G 3PMIA 1WI7A 4EMHA 3IQLA 4RTYA 4DBFA 5EAYA 1WVLA 5IGBA 1XPUA 4FW1A 2EYXA 2O31A 5E3FA 4BY7G 1RACB 1YNZA 5I21A 3PGGA 3HOZH 4IALA 4XQJA 2LTOA 1M2VA 3CD6T 1TWFB 5CV4A 1CSPA 2JA8G 1KRTA 2LT4A 1Z7TA 1D09B 3RERA 1Y1VG 1ARKA 4LXCA 4F7UE 2ZM6L 2AT1B 2ZTEA 3GQBA 4DU9A 2Y4XA 1G51A 1K8AU 1S1NA 3QUIA 1U0LA 1V43A 1NE8A 4FSSA 3MZ5A 4HT8A 2E2DC 2M0YA 1B07A 2DRMA 2XICA 1JB7A 3V7RA 4LF4L 3M4YA 3CC4Q 5LJ3j 2VGNA 2L4NA 3U58A 1X01A 4M78A 5FU7C 2XN9C 1YNXA 2NUPA 5E7NA 1DZ1A 1EIFA 3CCSA 3HL8A 3MFYA 3K59A 1YJWA 4XQNA 3I4NH 4JG2A 2YTVA 1P92A 3DLMA 5F2DA 1R4QB 1YIJA 1VQ9Q 1ZYRD 3EH2A 3I4LA 3HOXH 1JCKB 2XWJB 1UUEA 2RPNA 3M4QA 3DUZA 2COWA 4NB3A 5GAOr 3F8TA 5TSSA 2Z6KA 1I94Q 3I73A 1ILPA 2PI2A 1OXSC 5C0XH 2QQ9A 1DXMA 2QQSA 2X9HA 4IFDI 5IHIA 1HH2P 1PTOB 3L2ZA 2F4IA 2MO1A 2N49A 4YY3L 1XPRA 4BXXG 4K6LA 1PXUA 1ILQA 2B2YC 2MMPA 2B2VA 1OZ2A 4Q5WA 4LUDA 2D8JA 3I56Q 5KYUB 1KQSS 1VQBA 4GLXA 1X3GA 2NTSA 3VYGA 4V0BA 3SGIA 3UPUA 4XTVA 1CQFA 4PJOD 2RF0A 3REBB 1A3VA 3TSZA 3I72A 1GBQA 1TOVA 1K8MA 1HXDA 1M1GA 4A3GG 3OYNA 1A3UA 1BBUA 3I8ZA 1EQTA 4A3CG 3U23A 5CCAA 2O4XA 1JQQA 2F1LA 5M3MH 5FU7B 2X4JA 4OGEA 2NVYH 1Y96A 2LQWA 1CQVA 1D1KA 2EQSA 3NELA 4TKOB 3OYIA 1VQOA 4HN7A 4EX5A 2K50A 4OGCA 3JCMW 1E7ZA 2GGRA 4KY7A 3CHBD 4DR5Q 3JC66 4DR3Q 2A3LA 2FMMA 4A54A 3M54A 3OYDA 1S40A 5DY9A 4A4FA 1PYSB 2OTLT 3GV3A 3X28B 4O2DA 4RCNA 2X3XD 4DAYA 4PFOA 5KYLA 4TRDA 4DAMA 1WHMA 1QILA 1KQSA 2VWFA 2RHXA 1NLOC 2JTEA 2XI9A 3K7AH 4DR7Q 2NUZA 1RDPD 4M77C 3CRKC 4KK7A 4A4KA 1L1OB 2DERA 4FCYA 2XDPA 1W3SA 4JV5L 2RCFA 3E1SA 4EPCA 1PH8A 3WDNA 1IKLA 1S4ZA 2H1EA 2EYYA 4FF1A 1AEXA 2MAMA 1O9SA 1VQAA 1YP5A 1K83B 4J8QA 4KN7C 4HJAA 1WCMG 4LDYA 4R0KA 4IJHA 3O13A 4JI8L 3DB3A 5JJLA 3CCET 3C3LA 1JJ2P 3CCST 3IRBA 2WSEE 2CZ6B 3VV0A 5GAMd 4M78E 5KYYA 4AG1C 3P8BB 2VKNA 1F2YA 1M1FA 2R92G 4A3KB 4J7IA 3LLRA 3SFMA 2IHEA 3CCQA 4PZ8A 2B63G 4NXNQ 3QHSA 2LJ0A 4QVCA 4GKKQ 4JUVA 2O2LD 3PUVA 1Q1EA 1KSWA 2FPFA 2HQEA 1VQMQ 1OX9A 2EZVA 2VB2X 1R0BG 2L55A 4G4KA 2HKQB 4RGOS 1YIJQ 1VQ9A 4M77B 2C0TA 1YJNA 2YHTA 2XK0A 4OVAA 3S3NA 3L2UA 3C0CA 2FVUA 1K8AR 2OTLQ 3AQQA 3OB9A 5FO9B 3OMCA 3MO8A 1PM3A 4B3RL 3P8HA 4CC7A 4ELZC 3CEYA 1SN8A 1VQ7A 2A36A 4RWSC 4ILWA 5A2QL 2OJ2A 5M3FH 3N5BB 2DEUA 2QILA 2CYZB 1UFFA 2IVWA 3OYJA 3QJYA 3A8MB 1I4QA 4BWGB 3O8VA 4H7BA 5I6WA 4J83A 1PC0A 2JN4A 4C3HG 3HP3A 4YIJA 1VS0A 4UAIA 4M77F 1BIAA 1T0JA 3JAME 2IW3A 1X56A 2JA8H 3GD7A 1N27A 2DBKA 3JCMb 5CV6A 3D31A 5GJWB 2X51A 2DNUA 2LXJA 2D9TA 5GAOn 4LF9Q 1LTID 2FL7A 1XTCD 3DMUA 1LCKA 4PJOB 3RMQA 1LM0A 2Z4HA 3GTGH 2DE0X 4E7HA 2L12A 1WZOA 4M7AD 1LV9A 4XIGS 3TP6A 1X6OA 1SR3A 1I3QB 2LDMA 2GNCA 4WFN3 1NG2A 3QWYA 4JLIA 2EOTA 1I5OB 3DEPA 3CU7A 3R6NA 1SAPA 1C0MA 4QQBX 1G5VA 1WX6A 1JORA 3VKIA 2VW9A 1D1AA 1YWPA 4RHSA 2R92B 3GTKH 4FW2A 4DK0A 2QGFB 4D8DA 3JB9G 4POGA 3JCMP 3VA5A 1GOZA 2F4VQ 1OULA 3G4SQ 4R55A 2PCFB 5LJ5e 1EY7A 1T5XD 3H0IA 1HQRD 3L0OA 1WTQA 4DV7Q 2DILA 4DV7L 4F16A 5M3MB 1X32A 7AT1B 3L1AA 2CWAA 1JO8A 3BU2A 3HS0C 2EFIA 4DV0L 5CQYA 5HK0A 3R6OA 1OTCA 1SFOH 2VC8A 3JCMf 3V7SA 3I56T 2VUMB 3M59A 1X3PA 2PU9B 1A3TA 2EYJA 4ZN3A 2BDOA 3MJXA 2F0HA 5LJ3h 5EPJA 3A8IE 4DR6Q 1VQ6A 2QEXQ 5FRNA 2MHVA 2WB1E 3MC0B 3TS0A 1KIXA 1KNEA 2D1XA 1Q46A 1PFNA 1XWEA 2ZTDA 4JBWA 2DL3A 4UP7A 4BB7A 5NUCA 1D0YA 1S5CD 4DR1L 1XTDA 4Z89A 1TH7A 1VQ9T 2RK2A 3FMCA 3VR5A 3C94A 2BZ8A 4JS5A 1SSFA 4X65L 5GROA 2XSCA 3ICEA 2EBPA 1WHKA 3NHNA 4A3MG 1MMDA 3CCJA 1UGRB 1WCMB 1QW1A 4CJ1B 3ER0A 4K0KQ 2KRNA 5ELBA 2G3RA 1ZKOA 3PMFA 1WIEA 2ECZA 2K1BA 2L1BA 1HNWQ 3VYTA 1FNVA 4CDDC 1YNJC 1W4SA 4LW1A 1AN8A 5ELCA 1EQQA 4ELYC 1JWMD 2HIVA 3META 1JT8A 1S72T 4M75E 5C4JH 2LS01 1BF4A 1AW7A 4QY7A 4LDUA 4PFPA 3T56B 3T16A 4G7OC 4M75A 1IL8A 4FDBA 4K5XA 2E76C 2P84A 4JJBA 3PV0A 4J15A 4NXMQ 1NPRA 3W1GA 2JP1A 2WB1B 2FHDA 3HOXB 1GCPA 3RKWA 2HSEB 4LNPA 4CJ2C 3BW1A 3OYYA 1M90R 3M55A 4DR2L 4BDZA 1GCQA 4DOVA 1ZUKA 1OXXK 2AQ2B 2KVMA 4BY1G 2MWOA 3M85A 3S2DB 1JICA 5EBDA 2K14A 4ULLA 1YNND 2QDLA 1VQEA 5EKLA 4FF3A 2X4YA 2JT4A 3IFTA 3OS0A 4HCBA 1C0AA 3LH0A 3TP8A 2GTOA 3E9HA 2O5JC 1RTOA 4DOWA 2HD3A 5DLOA 4C0DC 1HPCA 1SEBD 1MHNA 3FB9A 3LGLA 2B8FA 4JPBW 5JPNC 3MEWA 2QG9B 3FJ5A 2XWBB 4C92B 2K3YA 4WJ4A 2QQAA 2ZPHB 2QGQA 2N55A 3SEMA 4NOYA 2RMOA 1PZJD 2A0FB 1EZZB 3FKIB 4IPGA 3NE5B 1G6ZA 4RTXA 3NXWA 4JLGA 1HYOA 2A28A 2ENMA 4AFZC 1WHHA 2E2JB 2KCNA 3DLLA 1ENCA 1Q7YU 1AH9A 2ID0A 4M75F 4JV5Q 4QW2A 4A4EA 1MGSA 4V2SA 4OWXB 2Q8TA 1VQNT 2CQOA 4JVZA 5BR8Q 3I91A 1H8KA 1PFMA 2HUGA 2MUYA 2WAQG 3BYTB 3NGPA 2DTOA 1TXYA 4IPCA 5CR3A 4PJOE 2J6OA 2XIDA 3CCUA 4LF6L 5CAIA 1G91A 2MFIA 3MXNB 3OWFA 3T1HQ 1IW7C 4CC4B 3NBHB 2IX3A 4ZGDB 2K5LA 2M9UA 2QQRA 2B2YA 1VQFA 2FJ2A 2SDFA 3AFQA 4M1UB 2Q2UA 3M3YH 1HFGA 2NN6H 1WFQA 1X6GA 1HNWL 2A73B 2UXCQ 5EG2A 2EQKA 2RBMA 3S6WA 2RDFA 4DNTB 3PO2B 4OMFB 1Q8KA 3J80c 3CPFA 4KUIA 2P0QA 4PJOC 1LUZA 1OZ3A 1KLGD 2PTKA 2VZAA 4YCUA 4EGVA 1I4HA 3CCMT 4E7ZA 4FVMA 4QIWE 2DAQA 2OCEA 2JA5H 5IH2A 4JYAL 4M7AA 2HQXA 3QIIA 1AZEA 1X55A 3PMTA 1STHA 2KCMA 5T1GA 1B4OA 1B50A 3LW5E 2HHHL 3QG1A 2QF7A 2VQFL 2K9GA 4JI0L 3SEBA 1YI2T 4A3LH 1RAGB 5LJ3d 1JR0D 1D5XC 1I8FA 1U1TA 2DL5A 3CC2Q 3CCVA 1YJWQ 1ZHIA 5IWAL 5IXBA 5FU6C 2IX0A 3QZ5B 1IB8A 4XU3A 2WAQB 3G48A 2NVXH 4U68A 5GMKj 1EEID 5CYUA 4OX9Q 5D6XA 2Q2HA 1HFNA 2JA6G 5IY0A 1EY0A 5L8RE 3HOWB 3KDFA 1YCYA 4J5YA 3ONAB 4M78B 1WTOA 1BQQT 2JA5G 2NUPB 1YJ9T 4IPHA 1UG1A 2K5DA 1Y1WH 3JB9H 4K0KL 2OXPA 4BE2A
chains in the Genus database with same CATH topology
4KULA 2GVAA 4LF9L 3GP8A 2WSCE 4R4IA 1N8RC 1EUJA 4A4GA 2DTHA 3L2PA 4M7AC 3L2RA 4DK6C 3GTOH 3JB9I 1PYBA 4OWWB 2N78A 4JOIA 1WPYA 3OW2S 3PO2G 4ZTJA 3HSBA 1DGSA 3V8KA 2K52A 2OQKA 4UP8A 2DEQA 2LXKA 1U1SA 4M75D 3VUBA 2E5QA 2RB6A 2O4XB 2EXDA 1XMOL 5LJ3g 1Y96B 1VQ7T 4FIBA 2KBNA 1G3WA 1FJGL 2ZJPA 1SRUA 1UGSB 4DAYB 4JBJA 4ALPA 5M5YH 1TWAH 3CXCS 2K5FA 1E1TA 4M78G 5LJ5h 2E5LQ 1E1OA 2R58A 2N8NA 3WVDB 4XU0A 5GAOm 3HOYH 4DV4Q 2KK4A 4JI1Q 5J3BA 1JJ2A 3RESA 3RUXA 4IUQA 2OTJT 2HNIA 4DNIA 5LJ3f 5FROA 4DV5Q 1UEBA 1TWFH 2UUAQ 2F5TX 3F70A 1G3SA 3FKIH 4NL3A 3V8LA 4M7DD 1N32L 3CMEA 1HNZL 1AE3A 5C0XJ 1HZCA 4MDXA 4N4HA 1VQLT 4F7UG 2KENA 3G4SA 2RM4A 1A63A 2C35B 2R6GA 2JZ2A 3L2VA 2LCLA 5M5XH 2D62A 2PQWA 1N36L 2K4YA 3CPWA 2I5LX 2JNGA 2F4VL 3RN2A 4OB3B 2H3JA 1PH9A 3JB9D 2R92H 1WQ7A 1U5KA 5IYBH 5GQOA 3X26B 4M78F 4P71A 4LFAQ 3U4VA 1VQ5T 5GAN2 2YLBA 3S17H 4J6YA 4BBRG 2CFMA 2JQOA 2HBPA 3JB9F 3TQYA 3V8JA 1X3FA 3RKXA 5KH6A 1ZQ1A 1SROA 1U8RA 1YHAA 4AH6A 4H02A 1FX7A 4BBSH 4OONA 3KLWA 2OTLA 3M9BA 1NE3A 2ZPEB 3T9NA 2AHJB 4JI1L 5CVIA 2B63H 3HFZB 2KHIA 4C5HA 3CXCA 2RO0A 3JAMc 1PFSA 4C3IH 3ASKA 4R4QA 1B34B 3OYKA 2JJQA 2A8VA 3PO3H 1IZ6A 3OS5A 3GTPH 4R4OA 4M7DE 1MJCA 3RLFA 2E2JH 3G6ET 4M75C 1CSQA 5LMUL 2NLUA 4LD9K 3HP9A 2QA4A 2DKGA 2QXFA 4P74A 2R7ZG 2R7FA 4MZMA 1KG1A 1E24A 2WSFE 5I2MA 1KD1U 2RHQB 4A3MH 2LSSA 4DUYL 4HT9A 4MNOA 1N8RU 4AIMA 4C8QE 3MEVA 1BBWA 2UXDL 4C0DB 5C4XG 4BXXH 4JOIC 3NTIA 4C0FA 2X4XA 2FXQA 3FP9A 4IUTA 2B29A 3OSVA 1VQ4A 1PH4A 4APVA 2I5MX 2DIQA 2K2VA 4C8QC 1C7YA 1HZBA 1H641 4M75B 3CCQT 4KHPL 4LF8Q 1YHQA 1CKMA 4BD3A 4B3TL 2R7ZH 2V8IA 5HGQA 3ZBDA 4FSXA 3ERSX 2QDYB 1I81A 3CCRA 3CC2T 1O75A 4KBMB 2XKOC 5I2SA 4PG3A 2UU9Q 3HOVG 2CCZA 1Q86C 4XU1A 4CRIA 2JUFA 5AJ3L 2KDSA 1YI2A 4JI4L 3I55A 3M53A 3RN5A 1Y71A 2XHCA 3SDZA 3PGZA 4E7KA 3HHTB 4MZTA 4R1JA 4JYAQ 4C92A 2NVTH 3HRSA 3M9QA 3JCMe 2VQEL 2A7YA 3PUXA 4DR6L 3UE1A 3HOWH 1MIUA 3OYMA 1XMQQ 1G3TA 4FU6A 1I4K1 2OAUA 4MZ9A 3JSCA 1X75C 5FJ8H 3V7CA 4JI7Q 1QUQB 3J81c 2AHOB 1NJIC 1JJ2S 1GVPA 1NJIU 1VQJA 4NS5A 3LGFA 3SB2A 5DM7R 1Q82C 1J6QA 3OMGA 4X9CA 3KXTA 4DV0Q 1R9TH 4LF5Q 5CKDA 2JN0A 3E9FA 3GTLH 3I56A 1YEZA 4LUOA 4M7AB 5C44G 3FDRA 1MGQA 2Z6KC 1CUKA 4BA2I 2K5IA 4KLKA 3NFCA 3AFPA 1XNQL 4JI0Q 1XNQQ 2P0KA 3CMAT 4C92D 4XTWA 2RCNA 2EKOA 3EAEA 4F7UF 3DM3A 2PVGB 4TVAB 1LOJA 1XQHA 5GANh 4PL6A 4OP0A 2D6FA 4X62Q 2ZJRA 3KDFB 4LFAL 2E65A 1GO3E 4BY7H 1QVFS 2BIVA 3BDUA 2VQFQ 4C92F 2GN5A 3OBYA 2N3SA 2V8KA 1YJNT 3MP6A 3OYAA 4DR7L 3QO3A 3CCLA 2LVMA 2HAXA 2QEXA 2YTYA 4P72A 1J5EL 1J5EQ 1G6PA 4JC0A 2D0PA 3H0GH 3STBD 1M4ZA 5ELNA 4QGUA 3UE0A 3UDFA 1IBLQ 5A2QE 4HCCA 4AQYQ 4QVZA 1PSEA 4IKFA 5IP9H 1G3YA 2F52A 1DJ7B 2MI6A 2E1HA 5D6WA 2AWOA 5GAN7 5GAMj 2RJCA 3A8LB 5GMKe 1YBYA 4ZTFA 3M4PA 2AWNA 1PV4A 3STBC 3PSIA 1XJVA 5ELOA 3FEOA 2PVDB 4DV3L 3QBYA 1Q81U 2ZPFB 4X66Q 2ZGWA 4D6WA 2IG0A 3PT9A 2E8GA 4RG1A 1N33L 2UUCL 2MF2A 3PTAA 3OTOQ 5C0XI 1Y7XA 3AHUA 4JI5Q 2XG8D 3LGJA 1KQ1A 2WFWA 3CCUT 1PH7A 2EJGA 1BIBA 4M7DG 3OYEA 2EWNA 3GNGA 2F69A 1W2BA 4J7FA 3Q8DA 4C3JH 2M0OA 3CF5A 3VUZA 2RJEA 1VQLA 3H0GG 5LMNQ 4IURA 2DK3A 4OB1B 3GTGH 1K9MU 5C44H 4X65Q 4JI2L 2EJ9A 4C8QD 5GAOl 1N34Q 4JJNK 2LCCA 3MEUA 1LTLA 1IYJB 3HKSA 3QYHB 1JRIA 1KXLA 2ZPBB 1EFWA 1XNRQ 4PNOA 1I5LA 2ZJQA 3FIFA 4RKUE 1N33Q 4QJFA 5HKCA 4R56A 2DXCA 1V1QA 1CKOA 4IUUA 4DR4L 2CS7A 1B8AA 3A5ZB 1KC8C 3JCMV 4HJ8A 4L5GA 3URGA 2X4WA 2MQHA 4XTXA 2EAYA 1HNXQ 1XMQL 3K0XA 4O6JA 2VV5A 1M1KC 3TEHB 4XQ3A 2R7DA 1W2BS 4YWKA 3FLGA 5LMNL 2ZZDA 1IXRA 4A3JH 4JBMA 2BH2A 5HY6A 1Z47A 3WXMB 2I0QA 2KMTA 4A3DG 2EYQA 2PMZE 5GAN3 3PF4A 1M90U 5KCHA 2LX9A 4NXML 4X34A 3VDYA 3LWHA 4ZGJB 1B34A 3JCMJ 4OB0B 4RMFA 5KCOA 1VQNA 2RD1A 4KT0E 4MDWA 1A0IA 1VIEA 3T1HL 4OF1A 2UUBQ 5GAMh 2VXEA 3UDXA 3FHWA 3K80C 4LUVA 1QVCA 2A1AA 3NENA 4XTYA 4RMOA 3ZEHA 4JI3Q 4A93G 3GIBA 1VQKT 3RLNA 2K3XA 3BZCA 3F2BA 4HCZA 1WGSA 1VQPA 5JEAG 4A3CH 3U50C 3I4OA 2XDDA 3HOVH 1VQ4T 3HRUA 3PF5A 4UY8C 4HKEA 4B3RQ 2RI2A 5KE3A 3CC4A 3CC7A 4C92E 2Q2TA 4A3GH 2X35A 3JAMi 2IT1A 3GTJH 3S1NH 3JCMQ 4OXPA 4QVDA 2JTMA 5IYDG 2NN6I 3NTKA 3G4ST 4GLAC 4P5NA 5FLXc 2WACA 1P16A 3MP8A 2I5HA 2EIFA 4PZ6A 3QPHA 1NY4A 3HFNA 3G71A 4A3BH 2E6NA 2UUBL 4OO1G 2L15A 2QEXT 4ME3A 4M78D 1O7IA 2XU8A 2RJDA 1PH2A 5FLMG 4X62L 3UT1A 3KF6B 1TWHH 4OWTB 2KHJA 1VQMT 2BKDN 2E41A 1KAWA 3CCEA 5KE2A 1HR0L 3T1YL 3T1YQ 3GNFB 2IY5B 3OYBA 2R5AA 3UWNA 3BJUA 4JRKA 1N9SA 3MP1A 2AMCB 3KFUA 2R57A 5LJ5d 5IP7G 1OXUA 3JCMd 3GTMH 2EQUA 5J39A 4C2MH 4C5GA 5GMKh 1QUQA 5CIUA 2K57A 2ZTCA 3I2ZA 1VQPT 5IT9E 3CAMA 5CKEA 4AQYL 3GO5A 4C8QB 4IOCA 4DQ2A 1ASZA 1JE5A 3CC7T 3J81j 1UWVA 2I2LA 1A8VA 1VQCA 3GTQH 2VL6A 3EN2A 4P75A 4M7DC 1I5FA 2JOYA 1BVSA 3H3VH 2EQMA 4E7LA 1X65A 4QQ6A 1HZ9A 1BI2A 5CKBA 1GD7A 3KJPA 1HNZQ 3LX7A 4DV2Q 2VYTA 1YZ6A 4IFDG 4BACA 4YCVA 2A19A 4GY5A 4QL5A 1XMOQ 2RK1A 5LJ3e 4DV6Q 2ALYB 1VUBA 5C3EG 4N4GA 5GANe 1L1OC 1WI5A 3AYHB 4FT2A 2VS1A 4HIDA 3CCLT 4EMKC 2DXBA 5DLQE 4M7DF 4A3KH 2GFUA 2NN6G 1N34L 5LJ5j 1VQHA 4B3MQ 4ZGEB 4GOPB 1ASYA 2L3RA 3RZOH 1XOVA 1BI1A 2FB7A 4BE0A