3A5ZB

Crystal structure of escherichia coli genx in complex with elongation factor p
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
134
Chain Sequence
TYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Putative lysyl-tRNA synthetase
total genus 17
structure length 134
sequence length 134
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01132 EFP Elongation factor P (EF-P) OB domain
B PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
B PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a5zB01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5zB02
1N36L 4DR6Q 5GQOA 4DR5Q 1NTGA 4POGA 3K8AA 1XMOQ 4IPCA 4NXNL 1UE5A 1S3OA 1N9WA 4DV7L 2A8VA 1CUKA 4LUVA 2Q2HA 4A3KG 2JOYA 2WAQG 5C3EG 1Y14B 3CCET 4JI4Q 4UP7A 2YTVA 4BBRG 4K0KQ 4A75A 1G291 5J26A 3G6ET 1VQ5T 5IP9H 5IYCG 2UXBL 1XTDA 3E9HA 2YTYA 3E0EA 4QGUA 3ULJA 3RR5A 3S24A 1KC8C 2E2HH 1N8RU 1VQHA 4BXXG 1J5EL 4CRIA 3H0GH 4BA2I 1XNQL 5IT9E 3DLLA 3CD6T 1CSQA 2RF4A 1PFSA 1XNRQ 1PH9A 4PZ8A 1NZ9A 1QVFS 3GTOH 4OWXB 3H3VI 1C0AA 4HIOA 1A63A 2R6GA 3RLFA 3CCVA 4DV2L 4A76A 1EIYB 4GLVB 1LUZA 2HT1A 1X56A 2Z0SA 5GADC 1MJCA 3FKIG 1IBKQ 1E22A 1S40A 4KHPL 4A3LH 1HNWL 3MEFA 3PIOA 2DO3A 1X6OA 2R92G 4JI8Q 3PGZA 3PO2G 4HJAA 2MI6A 3G6EA 4JYAQ 3J7A5 3H15A 2UXCL 2MO0A 2JA8H 1V9PA 1KIXA 4IOCA 4JI5Q 5HGQA 4HJ5A 3KLWA 3OW2S 4LUOA 4AH6A 3KOJA 3HOXG 1HJPA 4JI2Q 2JA6G 3HOWG 2LCLA 1KQSA 4BBSG 4UP8A 4LFCQ 4DNIA 1KAWA 4EX5A 2ZJPA 2E2JH 1NMGA 1O7IA 1PH2A 1IBML 2R7ZH 2D0PA 4MNOA 2V1CC 2PMZE 3KF6B 3BZCA 4GN3B 4JI3L 5JEAG 1NJIU 5IYDG 4DV5L 4DV3L 1IBMQ 2JA6H 4UP9A 3L7ZC 1JJGA 3W1GA 1VQOT 4GOPC 2NVTH 3I55T 1W2BA 2NZHA 4YWMA 1QZHA 3A74A 4IJLA 4Y7NH 1GM5A 1GVPA 2VUMG 1AE3A 3G4SA 2JA9A 3HFZB 4JOIC 4JI7Q 2I5LX 1VQ9A 1YIJA 4YCWA 2N8NA 4P71A 2XHCA 1EQRA 4IO9A 1TXYA 1JJ2S 4YWKA 2K5HA 1XPRA 4K0KL 3K7AH 4DV4Q 4AQYL 4BY7H 4LFBL 1Q1BA 4QQBX 5JJKA 2K52A 1M90U 2ZTDA 3PUWA 4FDBA 1KC8U 5IP7G 3PIPA 1PH7A 2I5HA 4YCUA 2ATWA 1GD7A 1M1GA 2ZTCA 2ZM6Q 5DM7R 1XPUA 1T9HA 2AWOA 4P74A 3F2DA 5LMUL 3F8TA 4DUYQ 2EXDA 4DR2Q 5IYDH 3JAME 1WCMG 2Q2IA 2Z6KC 1VQNA 3CAMA 2R7ZG 4GKKQ 5DLQE 1VQJA 1IZ6A 2IHEA 2MQHA 3CCLA 1QVCA 4DUZQ 1Z47A 2Q2UA 5K36G 1NPPA 1I50H 1UE7A 4OX9L 1FVIA 4O2DA 3HKZE 1N33L 2CKZB 3HOWH 4KHPQ 4ZN1A 1Y1VH 5E7NA 1YITT 2L3RA 4DV0L 1TWHH 2IX0A 3TS0A 2B63H 4PZ6A 1K73U 3Q8DA 1VQOA 3CPFA 1MJEA 4LF4Q 2R93G 1Q7YC 3CC2T 2VS1A 5C0XI 3PO2H 1EIFA 2EIFA 1SRUA 3BZKA 4C3HH 3G4ST 4OO1I 4DAYB 1Y1WH 4GKKL 1Q86C 2XGTA 2CWAA 4TQUS 1X55A 1IYJB 5A2QE 1XMQL 4NXML 1K9MC 2NN6I 4C3JH 3F1ZA 4GLXA 2R93H 2AWNA 1I5FA 3M9BA 4B3MQ 1E3PA 2BH2A 3KYHC 1K3RA 2QGQA 3I4OA 4X65L 4LF9Q 2VL6A 4L5QA 1EFWA 1YJ9T 2K75A 1VQ7A 3G71T 3PUXA 1S72T 4DR1Q 3K7UC 2UUBQ 4GKJQ 1B70B 3ULLA 5FLXc 4OONA 4DV5Q 3KBGA 3W5OA 1K9MU 3GO5A 5M3MH 3K80C 2LVMA 4P75A 1PYBA 2MWPA 1NMFA 4JI0Q 4LNQA 4LF7L 1C7YA 1IXRA 2OTJA 2K50A 4DR6L 1YJNT 2VUMH 1OXUA 2K4KA 3CC2A 2Y0SE 5IWAL 4YWLA 3I4NG 1SMXA 3KDFA 4X64Q 1PVOA 1UE6A 2E8GA 3RLNA 4Y52H 4NXNQ 3CQZH 3PUYA 4DKAC 2N78A 4IPGA 3CCMT 3LGLA 1CKMA 3H0GG 4RG2A 4BBSH 3ZJYC 3I55A 5LL6S 2D62A 2KHIA 5LMUQ 2WB1E 4DV6Q 4LF6Q 1YZ6A 4GOPB 2K5VA 1A0IA 1YIJT 4X62Q 5C0XG 4BA1I 4JBWA 2PQAA 1UEBA 2PI2A 2VQEQ 4HIKA 1N8RC 1OXTA 4JI4L 5LMNL 2JA7H 2AMCB 3FHWA 2F52A 4YY3L 2HHHQ 1VQFA 3S2DH 3RLOA 3J81j 1YJWT 1Q81C 5IAYA 1K83H 2A19A 2K5NA 1Q12A 2QEXT 3D0FA 3MXNB 3STBD 4LF5L 1QVGA 4L5SA 5J3BA 2BH8A 4DAMA 2F4VL 1NBWA 3JC66 4A3JG 1PH1A 2Q2TA 4P73A 4IPHA 4A3EG 3RN5A 2ZJRA 2VQFQ 3NEMA 4YCVA 3CMET 3CXCA 1YJNA 1SLJA 2H5XA 4R1JA 4BXXH 4X66Q 4JYAL 3WWVA 1YVCA 4DV1L 4OWTB 3RZDH 4LFBQ 4R4TA 1WFQA 2YTXA 3HOUG 3T1YL 4LFAQ 3OTOL 1YHAA 1IBKL 1I94Q 2JNGA 3CCQT 1YITA 2RCNA 1PH3A 2ALYB 5C4XG 4UY8C 4IOAA 4JI1Q 4LW1A 1J6QA 4BBRH 4A3MG 2EQSA 5AJ3L 4AYBE 2NVYH 1YHQA 2PQAB 3S1MH 1Q86U 2CCZA 2VQFL 5GROA 3HOUH 5GAHC 1Q81U 1N32L 1VQGA 1Q7YU 3UDIA 4LF7Q 5JJIA 3I4MG 1XMOL 1GO3E 2Y0SG 3J81i 1AH9A 3LGJA 3HKZG 1YEZA 2YYZA 3DM3A 5FLMH 3F2CA 2R92H 4IFDG 1VQ4T 2Z6KA 1FJGL 1JT8A 1TWFH 4HIDA 2ID0A 3CCST 3G71A 4A3DH 4A3MH 1RL2A 2MFIA 1PV4A 2QA4A 1CSPA 2IT1A 2GVAA 3T1HL 1TWGH 1EOVA 2R7FA 3M4QA 2CWPA 2MO1A 3GTJH 1VQCA 2E5LL 3S14H 1Z9FA 2KVQG 4OO1G 1VQKA 1N32Q 3I7FA 1XNQQ 1E1TA 4KLKA 4JI7L 1YHQT 4NPSA 4X62L 1SE8A 4A3CG 5IYBG 3M7NA 4DR2L 2VW9A 4PG3A 4A93G 1LTLA 4QQDA 3CD6A 3OYYA 3CCRT 4X65Q 4B3RQ 2K14A 4YHHQ 1PH5A 4LF5Q 4A3CH 2HIVA 3AFPA 4A3JH 4LWCA 3I4MH 3TS2A 1M1KU 5FLXE 1KL9A 1OXSC 3PUVA 1ASZA 3HOVG 2WP8J 3U4VA 5C0XJ 1CKNB 1MIUA 2JA7G 4QL5A 3RN2A 1HNXQ 3EN2A 3IRBA 4A3DG 1KD1U 3HKSA 1YBYA 1C9OA 2LQ8A 1OXVA 1QVGS 1E24A 1JB7A 1X3FA 5IT9c 1XNIA 1VQLT 4JBMA 3OTOQ 3ER0A 1EUJA 2JEAI 4RG1A 3HOYG 5H1SE 1U0LA 4DV4L 1X3GA 4QY7A 4EQ5A 5M3FH 2XTIA 1KD1C 2E70A 1FGUA 1P16A 2UUCQ 4LF4L 2KDSA 3S15H 1JJCB 5BR8Q 1JE5A 3HOZH 1HNWQ 2JQOA 1Q1EA 3I4NH 2OTLA 4BY1G 2KCMA 4DR3L 5C4XH 1TWAH 1UE1A 4NXMQ 3I2ZA 1M1KC 4C3IH 4X6AH 3PV0A 4JI0L 4DR7L 5EAYA 2AKWB 4HJ9A 4AQYQ 3CCRA 1V43A 3ICEA 1HH2P 3TEHB 4DUZL 1X9NA 1L0WA 1L1OA 4XIGS 5M3MG 5M5WH 1HR0W 1I6HH 3NBHB 3PUZA 1G6PA 3CCVT 1K73C 2OTLT 4LF8Q 2ZM6L 2VY3A 3CCJT 3CCUT 2JA5G 3CCLT 1VQBA 3STBC 3S1RH 2UUAL 4B3TL 5HY6A 1H95A 1D8LA 3CC7T 3CMAA 1KRTA 1BKBA 4DV7Q 1WCMH 4JG2A 3ERSX 1EQQA 1HR0Q 3PCOB 2UXDQ 2HQLA 3K0XA 4YTLA 2ES2A 1JJ2A 4JV5L 1QUQA 2VQEL 3UDFA 1YNXA 4IPDA 5FJ8G 4DV0Q 1B8AA 1AE2A 1ASYA 2B63G 2AHOB 5IE8A 4DV3Q 2F4VQ 5C44H 1QUQB 3A5ZB 1IL2A 3H3VH 4A3LG 2YV5A 2OCEA 4GN5A 3DB4A 3EBEA 1W2BS 2RHSB 4JI6Q 1L1OC 4AIMA 4JI8L 2OQKA 3PO3H 4IFDI 1A8VA 5C44G 3CCUA 1YJ9A 4MZ9A 4A3BH 5LMNQ 4DV2Q 2C35B 3I56A 5ELNA 1PH4A 4L5RC 1P8LA 2VNUD 1VQ9T 1VCIA 3AEVA 1HZBA 2F3IA 4B3SQ 3RNUA 4GLAC 4J15A 2JE6I 1PH6A 1Y1WG 2NVQH 1VQMT 2JUFA 1HNZL 1G51A 5IP7H 1K8GA 3L2PA 3J80E 3CCJA 2DUDA 3TQYA 5M5XH 2IY5B 3P8BB 3JAMc 3B6YA 1RIPA 3EIVA 4AYBG 4BY7G 2NN6G 4R4CA 5LMNW 3KF6A 1LYLA 5AJ3Q 4A3GH 3J81c 4DR3Q 1PHJA 3HOXH 1SN8A 4A3IH 1IBLQ 1VQ5A 2WB1G 4P72A 1VQDA 3SGIA 4JI2L 1SROA 2JEBI 5IWAQ 1HZAA 3F2BA 3K81C 1HZ9A 3CF5A 4A3GG 1GKHA 4JC0A 4OX9Q 3U4ZA 1N33Q 1XNRL 1PYSB 4LFAL 1E1OA 1VQ7T 1S72A 1QVFA 4HJ8A 3D31A 4JCVE 1EYGA 3M3YH 2KHJA 2ASBA 4L5TA 1FL0A 3S16H 3KFUA 3CC4T 4DR1L 2B29A 4GKJL 4A4IA 1VQPT 1VQMA 1WYDA 4GOPA 4DK3C 2JA5H 1VS0A 1XJVA 1KRSA 2LXJA 1IBLL 1BBWA 1WI5A 1Y1VG 3GDEA 1XMQQ 3G48A 4LUZA 4A3IG 2LSSA 4DR4L 4B3ML 3I56T 4YY3Q 2HHHL 1W3SA 1NY4A 1TWCH 3J7ZC 5JEAJ 4X66L 2KCTA 3OW2A 4UPAA 2CKKA 1EWIA 2BA0A 4DV1Q 4ALPA 2WFWA 1OTCA 2UUBL 1NPRA 2PI2E 1XPOA 3CCMA 1MKHA 2IHFA 1YHBA 2ZTEA 4JBKA 2NZOA 3KDFB 2WAQE 3CW2C 4R4OA 5IP9G 3GTKH 5FJ8H 2D0OA 1SFOH 2KENA 1KHIA 1K8AU 2OQ0A 5BR8L 1M90C 3M4OH 1VQ6A 2IG0A 2PNHA 4JI5L 1VQEA 3CMAT 1KXLA 2LXKA 4A3BG 2ZJQA 3CC4A 4WJ4A 2RHQB 3CPWA 3J81E 1OXXK 3J7AF 1YI2A 1Q82U 2FXQA 4C2MH 3M85A 3PO3G 1J5EQ 1VQPA 4KHZA 3KF8B 5M3FG 3TRZA 3S1QH 4DR7Q 3A0JA 3UE1A 2VZAA 2I0QA 4B3RL 3UE0A 4YHHL 4POFA 3GTMH 3GTQH 5FLMG 4JI1L 3CCEA 1NJIC 2JA8G 2UXDL 4LF8L 3PSIA 1FJGQ 4LF9L 4X34A 5IYBH 3TREA 4TVRA 1QZGA 1X65A 1X54A 2R7DA 2UU9L 2MWOA 3RZOH 3CMEA 2G3RA 4R4QA 4DV6L 2HIXA 4ME3A 4LF6L 4A3KH 3BJUA 2KBNA 4A3FH 3J80i 3S2HH 1BBUA 1L1OB 2B3GA 3CXCS 1E7ZA 4OXPA 3A5UA 4DUYL 2GN5A 2YU9H 1PH8A 4BY1H 1K8AC 5ELOA 1VQAA 4IJHA 4TVAB 4GNXB 4DPGA 3BU2A 3CCQA 1I3QH 4JV5Q 2CQOA 3U58A 1K0RA 2JK8A 4RMFA 2OTJT 3AQQA 1Q46A 3AFQA 1VQNT 4R4IA 4DK6C 5IY0A 2CFMA 3HOYH 2UUCL 1VQIA 2E2IH 2QEXA 1VQ6T 4JBJA 3J80c 1R9TH 4JI3Q 4JI6L 1SSFA 1A62A 4JOIA 4O0AA 3U50C 3ULPA 2L15A 1YI2T 1N34Q 3FKIH 1UWVA 1X3EA 2GVBA 1VQ8T 5M5YH 1WOCA 2UUAQ 4MTNA 4B3TQ 1VQKT 1CKOA 3PF5A 3VDYA 4DR4Q 3AYHB 4GNXC 3DB3A 3FP9A 3T1YQ 1WJJA 4NB3A 3CCSA 2JJQA 1I94L 3KJOA 4XTCS 3HOZG 4QIWE 1HR0L 1L2FA 1DGSA 3HOVH 3S1NH 4ZN3A 3NENA 1HNZQ 5JJLA 3CC7A 1SR3A 2BA1A 3NELA 2N3SA 3CP0A 3W1BA 3GTGH 1D7QA 3M4PA 5C4JH 3E9IA 2E6ZA 1KQSS 5GAGC 2IX1A 3LH0A 2MNAA 3KJPA 4OWWB 1NE3A 4A93H 1CKNA 1N36Q 2DGYA 1HNXL 3PF4A 1YJWA 4IFDJ 1VQLA 4DR5L 1PA6A 5IYCH 4APVA 5GAEC 3UDGA 4A3EH 1N34L 2OWOA 2A1AA 3LGFA 2UXCQ 4GS3A 3GTLH 1V1QA 3GD7A 4GN4B 1Q8KA 3GTPH 1LM0A 5C3EH 4WJ3M 3L0OA 4A3FG 1Q82C 2JVVA 4HIMA 4PMWA 1VQ8A 4KI0A 4PZ7A 4HJ7A 3JAMi 1HZCA 4X64L 4LFCL 3S17H 3T1HQ 4GNXA 1U5KA 1VQ4A 2NVXH 2E5LQ 3UDXA 2UU9Q 3CPWS 4B3SL 1B7YB 4QJFA 2UXBQ 1JMCA 1BVSA 2N49A 2I5MX 4H02A 2QA4T
chains in the Genus database with same CATH superfamily
3NTHA 2MMPA 3M4YA 2B2YC 3ND8A 4DR6Q 4DR5Q 1QB5D 4QCLA 2NUPB 1ACMB 3E0JA 2EJMA 3SXHA 4E7SA 3K8AA 2K1BA 1WX6A 2TMPA 2VB2X 5EQ0A 2PNRC 1XMOQ 4B9WA 4DV7L 1OOTA 1X69A 1Y8NB 2A8VA 1NSNS 4FF4A 4K0KQ 4L63B 5C3WA 4F7UF 4J9CA 1QP2A 2YTVA 1D1AA 2DE0X 1JWSD 4NKLA 5CYUA 3G6ET 5CO7A 2ZPGB 1VQ5T 2C0TA 2DXBA 3X3MA 5IP9H 5IYCG 1XTDA 1RI0A 1XQHA 2UXBL 3RKYA 3ULJA 4FYDA 5M5WB 2GGRA 3LW5E 1RJTA 2E2HH 4IKFA 1N8RU 1KDAA 1B34B 1VQHA 2B2TA 5GMKl 1ZHIA 4ID6A 2OJ2A 4RHRA 4HTHA 3OSVA 4V0BA 2XSCA 1PFSA 2FHTA 2K5QA 4EQOA 1K28A 1H641 1Y57A 3GTOH 2K9GA 1C0AA 4A54A 3CXCP 2R6GA 3CCVA 1ZBJA 2YT6A 4QB4A 3ZEHA 1WJRA 1C6VX 2JMCA 4A76A 2IJ0A 1RAEB 2I07B 1IBKQ 4BE1A 3QWXX 1MJCA 1BB9A 1AEXA 3CRKC 1EEFD 4MN3A 1S40A 4A3LH 1STYA 4JS4A 3PIOA 4BS9A 1X6OA 2BCOA 2GBQA 4J7IA 1A3UA 4JI8Q 2MI6A 4JYAQ 4X9CA 5A35A 5GANf 1Q82R 5C0XH 2ENMA 2A3LA 1KTKA 1QVFP 4FXKC 2JA8H 1V9PA 2EYWA 4IOCA 1KIXA 3K5LA 3HOWG 1GUWA 4JI2Q 2E3IA 2EWNA 4V190 4BBSG 2QKIC 2J6OA 3P8HA 1G5VA 5I21A 4OIJA 1OV3A 3R2TA 1KDBA 5CORA 5HKCA 1EOTA 1O7IA 1YNJD 3S1MB 2A6EC 1RHPA 2D0PA 2V1CC 4IIOA 3KF6B 1Q86R 5CQYA 4GN3B 4ZQ3A 4DV5L 4XU1A 2ZPHB 1RABB 3M59A 3AT1B 2ED0A 2LNVA 1GFDA 2OAUA 1VQOT 3SHWA 3I55T 4KY6A 3NTIA 4FF3A 1EZ8A 1GM5A 2VUMG 1GVPA 1PRMC 4RCBA 4YCWA 1VQ9A 1YIJA 5AT1B 1SDFA 2XHCA 2ROLA 4IO9A 1JJ2S 1B44D 2K5HA 2X4YA 2JA5B 1GRIA 3Q23A 3EG9A 1ZYRC 1VQNQ 5M3MB 3I70A 3QHSA 2MIOA 1GD7A 2ZTCA 1PTOB 1EFID 1T9HA 4P74A 3PMTA 3BDLA 4DUYQ 1YCYA 3QBYA 1Q90A 2Z6KC 3CAMA 2IHEA 1O80A 3MVVA 2MQHA 2H8HA 4LUEA 2MYSA 1QWFA 2PW5A 2ZZDA 1D5XC 4PJOB 4OX9L 2JM8A 1N33L 1D0XA 3MP1A 1ZLMA 2RI2A 1AEYA 1Y1VH 2M2LA 3HOYB 2FPDA 4DV0L 3TS0A 2IL8A 1G3WA 2AHJB 3WVEB 3KUFA 3Q8DA 5IT9L 1VQOA 1Y1VB 4OIKA 3PO2H 5EPLA 1JC7A 5IGDA 3H9NA 3TZUA 2Y90A 5D6YA 1AP0A 1HXYD 4GKKL 2XGTA 2CWAA 2DF6A 1IYJB 2LQNA 3BVGA 5GAMg 5LJ5f 4NXML 4R9WA 5KYIA 4PJOC 2I0NA 1E3PA 4RTXA 2QGQA 4LF9Q 3S14B 2EYHA 2MPMA 1YJ9T 4B08A 1A2TA 5C4JB 2LZ6B 1KLGD 4XU3A 1ZX6A 2DX1A 4J9BA 2XDPA 3KBGA 2AIRB 1UNSA 4DV5Q 4P75A 4ATOA 5KNDA 4RG8A 4MMLA 5CV7A 5D3IB 1GXIE 4LF7L 4K2KA 2RKSA 2RHXA 2K50A 5IGCA 4DR6L 1KIKA 2ZXOA 3FVQA 2VUMH 2DIGA 1QMCA 2RJEA 1BIBA 4C1NI 5I2XA 3JB9D 2RBMA 1CA6A 5FK9C 3LWUA 3MA2B 4NXNQ 4H13C 1TU0B 1KJWA 2N78A 3NQTA 3FB9A 3LGLA 3GP8A 8ATCB 3RDVA 2K28A 3FEWX 4BBSH 2A0FB 1BIAA 5KYNA 4BD3A 2E5QA 1E0BA 1STEA 2EYMA 2E75C 2KHIA 4DV6Q 4Z9CB 3MJXA 4A4FA 4M7AA 3N52A 2LJ0A 4JBWA 1CM9A 1W70A 2DL8A 1UEBA 4OGCA 4A4GA 1CK1A 1OXTA 2RQUA 2WSEE 2PI2A 4H0LC 1PSFA 3EFXD 1VQKQ 5L23A 3FHWA 4FP5D 5DM73 5LMNL 3RLOA 4E7KA 1S5DD 3MXNB 2A19A 1GOZA 4LF5L 5L8RE 1KLUD 1PKTA 4ZTJA 1SPKA 4RUGA 3L2WA 2Q2TA 3RN5A 4WORA 1D1BA 4PJOF 1QJOA 1IKMA 5GAOr 3CMET 1M30A 1EY9A 5GAN2 2RJFA 3CXCA 1BYMA 1SLJA 1SKUB 3VRZA 2PVDB 4X66Q 4JYAL 3WWVA 2GTOA 4KV6A 2L5QA 2I2LA 2GTJA 2WSCE 1WD0A 1QG7A 1EU4A 2YTXA 2IIMA 2KI7A 1YHAA 1IBKL 4PJNA 4GLKA 5GAOm 3CCQT 2HDLA 1TWBA 4KKUA 4UC4A 1WVLA 2H3EB 3QUIA 4HEDA 4JI1Q 2EQSA 3PT9A 1Q86U 2R61A 2CCZA 4M75G 3EFOB 5GAHC 2RSNA 1FWZA 3OW7A 3G4SQ 1EY4A 2VVKA 5IGBA 1TWAB 2OF1A 4L5RC 1AH9A 2MAMA 4HSVA 4WCIA 2YYZA 3X3NA 3VS2A 4HT9A 3F2CA 2DL7A 3EGUA 3X24B 3OYMA 1FNWA 2LDMA 3G71A 4OVAA 1BI1A 4IUNA 1F77A 2MFIA 2PO4A 5GMKm 1CSPA 2GVAA 1UE9A 2QDBA 2N88A 1SHGA 4YIJA 1EOVA 2A6HC 2CWPA 2MO1A 1VQCA 1SNMA 2KVQG 1SNPA 3I7FA 2CT4A 1YHQT 4HCZA 3A56A 4A3CG 4NL2A 4IN3A 2LFNA 1PKSA 2DY7A 2HCCA 5KH6A 2VW9A 2JS2A 4EMGA 4QQDA 3VR3A 3VJPA 3CMEQ 4M7DG 2IPOB 1TUGB 1PH5A 3JB9H 2NVXB 4BBSB 2VASA 3I4MH 1M1KU 3SEMA 1PMRA 1ASZA 1AT1B 2DLPA 4ZK9B 1VF7A 3EAEA 3OYBA 3BG3A 1HD3A 1NNXA 2WINB 3HS0C 2IPKD 3RN2A 3H0GB 2J0TD 3OS5A 3EGDB 4D8DA 2Z0WA 2K7AA 2LQ8A 1AZEA 2B8FA 1OXVA 5L37A 1QVGS 2L11A 1X3FA 3N6RA 5IT9c 2VXEA 5M5YB 1EUJA 1DONA 1U0LA 2LT4A 1X3GA 4DV4L 3JB9F 5E1FA 3S1NB 1CZWA 1WDXA 3NBIA 3OQ5A 1G2BA 1WJQA 1FGUA 1P16A 2AQ1B 2KDSA 2UUCQ 2VXFA 4LF4L 1HNWQ 3JAML 2F2XA 2D0QB 2YRVA 1AW7A 2Z4HA 4C0DC 3C1FA 3QIAA 3CEYA 1TWAH 1UE1A 2QW7A 4NXMQ 4M7AG 2FPEA 2KE9A 1M1KC 4DR7L 2AKWB 4F14A 2A68D 4ZKBB 1V43A 1R8OB 2RVLA 1LABA 1Y69U 4DUZL 3OMCA 1E2ZA 2A7YA 4AFSC 1L0WA 4FIBA 5J22A 5M5WH 1HR0W 1HYOA 3JCMJ 1WHLA 2DD5A 5COYA 3H3VC 3KBXA 2LTOA 2OTLT 1D5MC 1YITQ 3K7AB 4ZUJA 3TU4K 1U1SA 2B8GA 1KNEA 4X9DA 3CCUT 1TWCB 1VQBA 5D3DA 4B3TL 2E12A 2HZYA 3PIP3 1D8LA 3M9QA 4M75C 2X35A 5ELDA 3FMCA 4CJ1B 1W2BP 1BKBA 2CREA 2DRMA 4M8AA 3ERSX 3MXPA 1HR0Q 3PCOB 1AZQA 1EY6A 2W10A 1VQMQ 2HQLA 2F3VA 2V4DA 4BI8B 3A7AB 2F0MA 3K0XA 1JJ2A 5FLXL 4PJOA 3CC2Q 2E76C 2VQEL 2B39A 3UDFA 1SG5A 1B8AA 1EWCA 1R9TB 3NWTA 4RWSC 5HK0A 1KQ1A 2B2UA 4PQXA 5C44H 1QUQB 4WFN3 3A5ZB 1IL2A 1B34A 1ZA1B 3TSWA 1QCFA 2KEEA 3CCVQ 1W2BS 4E7IA 1IO6A 1CTMA 2XWJB 3NE5B 1ZBXA 2YDLA 3QKJA 4JI8L 4JI6Q 2RO0A 1TUCA 1A8VA 3URYA 4IQZA 4C56C 2HMAA 1OU9A 1K0XA 1FNVA 2JW4A 2PTKA 2EKHA 3G1JA 2C35B 5C6AA 2E65A 4DV2Q 2EW3A 5ELNA 2EYZA 5GANg 1PLFA 1VCIA 2SRCA 3GNGA 3RNUA 4HKEA 2EY6A 2NVQH 5KYYA 2JUFA 1RKNA 1ESRA 1G51A 4OB1B 2DUDA 4KHVA 2CT3A 2A36A 4XTVA 3VV0A 1RIPA 5D6WA 2B2VC 1X6GA 1E2VA 3RERA 1FX7A 3QZ5B 1EY0A 5AJ3Q 1WTRA 1A3TA 4OMQA 2DY8A 2JA6H 4F17A 2QK0A 1VQ5A 4OP0A 1SMYC 4P72A 3SGIA 3F2BA 4JI2L 3JCMW 1WIEA 2KBTA 1GKHA 3G7LA 4JC0A 1VYUA 1G2TA 2EYOA 1M3AA 4IUUA 4C5GA 2QTVA 1E1OA 3FLGA 3MC0B 4HJ8A 3HOXB 3FDTA 5ELBA 4JCVE 3M3YH 2KHJA 3KFUA 1HUNA 1SSHA 3S3NA 2B29A 5IN1A 3D6CA 4DK0A 4GOPA 3HTRA 4J9GA 2JM9A 1NBEB 4QQGA 1VS0A 1DM0B 1WI5A 1AZPA 1JB0E 1S5FD 4DR4L 4B3ML 1AHJB 5JVH3 4YY3Q 4ULLA 3LX7A 1W6XA 3J7ZC 1SNCA 1PH6A 4X66L 2KCTA 4UPAA 2BA0A 3E9FA 3DKMA 2HSPA 3I9QA 1MKHA 1QNUA 2OTJQ 3S16B 4JBKA 3GV3A 2UXDQ 2NUTA 2QQRA 3TS2A 3D4RA 1SFOH 3OYEA 1K8AU 1RD9D 2GQVA 5BR8L 2QI2A 1VQ6A 3SK6A 2EPBA 1VQEA 4J8QA 1RUWA 4WJ4A 2GCXA 2NUTB 1GFCA 3J7AF 1M2OA 1F9RA 2L8DA 3TRZA 1VQPA 4DBRA 5M3FG 5ECAA 1STBA 4F16A 2D8JA 5GAMh 3RIRA 1WQWA 1TWGB 3GTMH 1GHJA 4J6HA 5DM63 2VWFA 1FMWA 4ZAIA 1HSQA 3TREA 1X65A 1X54A 2R7DA 2B2TC 3CMEA 4R4QA 4GZYC 2PPBC 1JOKA 3ULRB 1MHNA 4M78C 2QXFA 5JPNC 5CMDA 2H1EA 4A3FH 3PGGA 5I4DA 3H6MA 3CXCS 2A68C 2K04A 1V76A 1UGPB 4BY1H 1UEAB 4OB0B 2Z6BA 2O2OA 3K59A 4GNXB 3CCQA 1I3QH 1YIJQ 3U58A 4RMFA 2Q8RE 3NUCA 3OBYA 3G6JB 4N9TA 2QEXA 2CS7A 1O7LA 1VQ6T 4M78B 1SYCA 5GAOp 3J80c 1XYIA 4JI6L 1BQQT 3HHTB 3ULPA 3EVQA 5DAUA 2L15A 2X3WD 3OPOA 2ZXPA 1N34Q 3FKIH 2GVBA 2EYPA 3C1EA 1NAPA 1CKOA 2EYFA 3VDYA 2OTLQ 4KH0B 2EY1A 3AYHB 3BYYB 3DB3A 1WJJA 2PZ1A 1IHVA 3HOZB 2CUBA 2HQHA 3KJOA 1JQQA 3CD6Q 4A3IB 1KC8R 4QIWE 4FO2A 3HOZG 4ZN3A 2CSIA 5JJLA 1LLRD 1FMKA 4LE9A 5C4JH 3D7SB 4BY6B 2DJQA 3KJPA 1Z9QA 5FU7C 1NE3A 5GMKi 1CFMA 1SRMA 4OWWB 4A93H 3S1QB 1HNXL 1VQLA 3VYUA 4QVCA 4DR5L 5GJVB 3UDGA 4A3EH 2DL5A 2CDTA 2A1AA 2AUKA 2UXCQ 4GS3A 3GD7A 3TBIB 1X2QA 4QIWB 4KN7C 1C0MA 5C3EH 3M4OB 1AWJA 1Q82C 1AWWA 3OWFA 1HJDA 4KI0A 1RACB 2FJ2A 2X4XA 4J9HA 2WSFE 2Y4XA 1TY2A 4J6XA 2SOBA 1VYVA 2E5LQ 3REAB 3DUZA 3CPWS 5ELEA 1BOSA 2UXBQ 3I8ZA 1N9RA 2QA4T 2KUMA 1G2SA 1N36L 4DBHA 1RLPC 5GQOA 2P0KA 1B7TA 4EMKB 2HDMA 4PJLA 4IPCA 5BN3A 4CC2A 1UE5A 1S3OA 2G5DA 1SE3A 1N9WA 2XD0A 3EGDA 3DWPA 3MXUA 2RHIA 5EKLA 4JI4Q 2HNIA 4UP7A 5CV6A 3VRYA 1Y96A 5D7UA 2EYLA 5J26A 1VQ9Q 2NBFA 3EFOA 4ZYSA 2HD0A 5IHIA 1BCPF 3HGBA 2XIDA 4JDSA 1JICA 1HA5A 1EL0A 1Y71A 2DKGA 2X3XD 4HCEA 4PLLA 1A3VA 1KC8C 4XT3B 1ZKOA 1KQ2A 3SHLA 3H0GH 1UUPA 4BA2I 1YWPA 3KXTA 3DLLA 2BE5C 3S6WA 1UECA 3OYFA 1NZ9A 2CZ7B 2E5KA 1F9SA 4OWXB 2XVSA 1I4RA 3ME9A 3EG3A 3HRSA 3VR4A 2F3WA 1OO9B 2W0ZA 1BCPC 3FRPB 1LUZA 2RA4A 4X3TA 2EJGC 2Z0SA 1I6HB 4RTWA 4E6IA 1WXTA 2X4WA 4V2SA 3MEFA 2E10A 3TN2A 5EKKA 2EQMA 3E6ZX 3TQ7P 1B9MA 4HJAA 4LK1C 3G6EA 4XU0A 3J7A5 3VS4A 4M77E 2UXCL 3M54A 5EKIA 2C0OA 3DEPA 3QZ9B 3SVMA 3A8HB 1K0SA 4LUOA 2K2VA 1HJPA 1SJHD 5LL6X 3HOXG 1KQSA 2X6GA 2K4YA 4QF4A 1JOOA 2KXCA 3M56A 4UP8A 4DNIA 1STHA 3OYHA 1KAWA 4EX5A 1TSFA 1PH2A 1SFOB 1ZSZA 2A69D 1NR4A 2PMZE 1Y96B 1IBMQ 1JJGA 4MZPA 5GAN7 3W1GA 4GOPC 2A73B 1II3A 3E9GA 1W2BA 2NVTH 4F7UG 4YWMA 2M9VA 3HRZC 2FPFA 2DXCA 3ZFJA 2KQWA 3PMFA 3HFZB 4JOIC 4JI7Q 2XICA 2I5LX 2N8NA 1EQRA 5GAN8 3JRZA 2LX9A 4QKUA 3HZXA 2NN6H 4AQYL 1BDOA 4ZNXA 1Q1BA 3H91A 4C92A 1G3TA 2FFKB 5JJKA 4FDBA 4PKCC 5I2SA 4I65A 4CI0C 3HKZB 1JEGA 2I5HA 2ATWA 2Z9HA 5FRMA 1M1GA 2EDGA 2ZM6Q 2O01E 2EJGA 3CHBD 3OBWA 5IYDH 2B86A 5LMUL 4QVZA 4KN4C 2MGSA 1Y0MA 1OU8A 5KYUB 4GKKQ 2DBMA 1VQNA 3VR5A 2R7ZG 3CCLA 1QVCA 1Z47A 4ME5A 4KBMB 3AMUA 1NPPA 1MMAA 4HCCA 3JV3A 4J9DA 1SEBD 2KHSA 4O2DA 3S1RB 2QEJC 1K83B 4ZN1A 1VQ5Q 3F70A 2L3RA 2DZ9A 1E7OA 3NMZC 2B63H 5IGEA 4RCOA 1WA7A 1M5Q1 1Q7YC 1M27C 3BZKA 4C3HH 1K9AA 4DAYB 1Y1WH 4RTZA 1K9MC 2R93H 2K57A 5CR3A 2AWNA 3M9BA 3QOLA 4B3MQ 2BH2A 2LQKA 2NLUA 3OYGA 1K3RA 2Y0SB 4OMNA 2VL6A 3SWNB 3CCSQ 4M7AB 1YWOA 3G71T 1JWUD 4CDFC 4GKJQ 3K7UC 2KR3A 2JTEA 3W5OA 1K9MU 4B6MA 2LVMA 2RSOA 3K80C 2FRWA 3M4GA 4Y91A 2FHDA 1NMFA 4JI0Q 4LNQA 4OEMB 1QCOA 1YJNT 1UGRB 1OXUA 2EYYA 3I55Q 2Y0SE 3OWEB 2KRNA 1LCKA 3VUZA 1YNND 1SMXA 5GAOq 4YWLA 3I4NG 2L89A 4X64Q 1ZXTA 1PVOA 1OEBA 3WXMB 3SWNC 1A6XA 3CQZH 4GBQA 1Q8IA 4DKAC 3GLXA 1YI2Q 3VA5A 1QNKA 2F1MA 3CCMT 2DMOA 2DA9A 3H0GG 1JBMA 3NP8A 2K5LA 3C3LA 5KYXA 3ZJYC 1AZGB 3NPPA 4AFZC 3EFSA 2HAXA 2E2HB 5LMUQ 1YNNC 1BUVT 3MEAA 5I6YA 4LF6Q 4UDUC 3INZA 2K5VA 2LS01 4X62Q 5C0XG 2FZGB 1M2VA 2A74C 5FU6B 1GJXA 2PQAA 2AK5A 2LC4A 2JA7H 1VA7A 2F52A 4YY3L 3TEEA 5CK9A 1K8OA 3I5SA 4FXDA 4C8QF 4EMKC 5IAYA 1Q81C 1ZQ1A 2JP1A 5TSSA 2QEXT 3D0FA 1ET6A 2K03A 2LRQA 4J1MA 1DJ7B 2QF7A 4D8KA 4DAMA 1NBWA 3JC66 4A3JG 1PH1A 3M3YB 4P73A 1C48A 4IPHA 5CKDA 3NQIA 2L3QA 2ZJRA 3EA6A 3NEMA 4RCCA 1CT1D 1HTLD 4YCVA 3J80L 4Q5VA 4K6LA 4C92D 5CV8A 4M75E 1N6AA 4DEXA 2RHUA 3FC3A 1YJNA 3FKIB 4FYXB 4C8QC 3X28B 2NUPA 4M7AD 3VUBA 1DOMA 2Q8IB 4LFAQ 3OTOL 1WPYA 3OYDA 1YITA 3OYLA 3S2DB 5C4XG 1HFGA 3RUZA 4IOAA 4KGVB 1J6QA 4LW1A 4BBRH 5AJ3L 4A3MG 3C2PA 2QGFB 1NJIR 2YLCA 2JYOA 3NPFA 2NVYH 2FYKA 3UWNA 2VQFL 4M75B 5KYLA 5DNFA 1Q81U 2V1QA 1Q7YU 5JJIA 2EGAA 1BU1A 2CP6A 4DBFA 1B53A 1GO3E 1XMOL 4F7UE 1RDPD 2V8KA 3J81i 4F04B 2B8AA 3LGJA 1GUOA 4BB7A 3GOXA 2KCNA 4IFDG 1JT8A 3VS3A 3KFVA 1SBBB 4JRKA 3VS7A 3E19A 2PU9B 3A8JE 4DNTB 1HXDA 2QA4A 5BN4A 1AN8A 3SFMA 1DYQA 2E5LL 1K1ZA 3GTJH 3MFYA 3VR6A 4Y92A 1N32Q 1XNQQ 4KLKA 2ZAEA 4LXCA 4C92C 3CCLQ 1SE8A 4A63B 1D0ZA 4E47A 4M77C 4FXGC 4M75F 1K8MA 4MHEA 4QUFA 4DR2L 2F03A 4ILWA 2BKDN 2RI5A 1B1ZA 1QP3A 5FOBB 1JJ2P 3RKWA 5GAN4 4LWCA 3PUVA 3MKDA 3HOVG 1I4HA 4HN7A 2J05A 1GL5A 1Q7YR 2QCPX 5E4XA 5C3EB 1CKNB 1MIUA 5KYYB 4C0FA 4QL5A 2K5DA 3EN2A 1KG1A 4DV1Q 3PO2B 3IRBA 1E6HA 2F0LA 1E24A 4EPCA 2X51A 1CKBA 3CBPA 1PRLC 2M51A 3RR6A 3P1HA 4XQJA 4LDVA 1XOVA 4JBMA 3S15B 2JEAI 2F0JA 3HOYG 2JSOA 3MEHA 4QY7A 5M3FH 4M77G 1Y7XA 1KD1C 4PJOG 2E70A 2IW3A 2O9VA 1JJCB 1JE5A 4WJWA 4CC4B 2JQOA 1Q1EA 2VYTA 1I4GA 3VS5A 2RJCA 3SR1A 4DR3L 2K32A 5C4XH 2DIQA 2D8HA 4XTXA 3BY7A 1L0YB 3PV0A 5EAYA 3QIIA 2DNUA 2WACA 2CVRA 4MZMA 3R3OA 2YRCA 5LJ3j 2O9SA 3JB9I 2YLBA 1U4LA 1SMYD 2A69C 2F0KA 4XIGS 2P0QA 2NVYB 2QQSA 5IGGA 5M3MG 1I07A 4HVVA 1LTRD 4K2LA 1PG5B 1K73C 2ZM6L 3CCJT 1D1CA 5JAVA 2KRMA 2JA5G 2RMOA 4J9IA 3S1RH 2CP7A 3HP9A 2CZ1B 5HY6A 3JCMV 4FF2A 2JTFA 1TS3A 3NBHA 2E3HA 4EDUA 1JXOA 1QCNA 1GCQA 5FRNA 3O13A 4PJOD 1WCMH 2VUMB 3F2UA 4QT7A 3M58A 2FMMA 1W4SA 4BI3A 4NP5A 5CQXA 1FYCA 1ET9A 4VUBA 1QUQA 1WD1A 3M57A 4Q5WA 2KYMA 1AE2A 2DBKA 1UB4A 1CZGA 2AHOB 4FSSA 4HVWA 3ONAB 5IE8A 1M4VA 3GPLA 1VIEA 1MSHA 4C8QA 2LCCA 1EY8A 2OCEA 1OULA 2LMCB 5LJ3f 5EJWA 1ZUYA 1NEBA 5K36H 2F1LA 3NHNA 4KJNA 3MAQA 3CCUA 1VQ7Q 3TSZA 1VQLQ 4XXEA 4A3BH 1MNDA 5LMNQ 1LACA 3K5OA 1TKWB 5CKEA 3AEVA 2F3IA 5CC4A 1STGA 4B9XA 4FNFA 1SNQA 2E2DC 4DA2A 1Y1WG 2DJZA 5KE2A 1TWHB 5IP7H 1HNZL 3J80E 5A0LA 3CCJA 1H9RA 3JAMc 3KK7A 4BY7G 2DAQA 2XKOC 3MEWA 5LMNW 3CBOA 4IIMA 3FIFA 4C3IB 3J81c 1PHJA 2R58A 4A3IH 2DTHA 3K5MA 2JEBI 5IWAQ 4ZLTF 2XU8A 4A3GG 3N5BB 3TP7A 1PYSB 4LFAL 1HA6A 2ESWA 3JCMb 2EZVA 4JLGA 3D31A 4KTAA 4S3SA 2P5ZX 4OHJA 4A3GB 2HCIA 4HXJA 3SE0A 2IX3A 4F7UA 3PQIA 2ASBA 4IZ8A 1ZA2B 3C95A 4ZUIA 1UHFA 4XQQA 1E2WA 1F2MA 4ESRA 1WYDA 4BY7B 5GMKj 4DK3C 1VF5C 4K8IA 1G8ZD 1IBLL 1XMQQ 3GDEA 2HKNA 3O5ZA 1UJYA 4C0DB 1Y1WB 3OHXC 4FYVB 3UATA 5LJ3h 2MK5A 5C0MA 2JJ9A 2PUOB 3CU7A 2CKKA 3E2UA 1OTCA 2RQRA 3CCRQ 1MUZA 1XPOA 9ATCB 5EPKA 3CCMA 1YHBA 2RA2A 2WAQE 3CW2C 1SYBA 4JZ3A 2D0OA 5GANh 2KENA 2TSSA 2OQ0A 3G7ZA 1KSWA 2RDHA 3MPUB 1TS5A 1WI7A 1WYXA 2PNHA 3QWNA 2HBWA 2LXKA 4P2CB 4JRQA 1HCZA 1OXXK 2FXQA 4EGVA 2GF7A 1Q82U 1QILA 3PO3G 5A0DA 1J5EQ 3A0JA 4C5EA 3H09A 3FJPA 2I0QA 1P92A 5LHY1 2EPDA 4CGYB 4JK1C 2D1XA 2XN9C 4JI1L 1NJIC 4RAUC 2K5IA 3JSCA 4LF8L 1FJGQ 4LF9L 5FU6C 4LJZC 1HTPA 4LD6A 1PM3A 1U4MA 2UU9L 1G8XA 2GFAA 3RZOH 3FJ5A 1DOLA 4LF6L 1TIID 2PZTA 3RBBB 3VYHB 4A3KH 1SNOA 2ABLA 2KBNA 2PW7A 3VKIA 3S2HH 2B3GA 2IWHA 1E7ZA 4DUYL 2WKCA 4QVDA 4AT1B 1K8AC 3V8JA 4IJHA 2MPXC 4TVAB 5KEEA 3JB9J 3E3XA 1BCPB 3EHRA 4DPGA 4ZKCB 2AKKA 4IUTA 4JV5Q 2PQWA 4QQ6A 2F0DA 1K0RA 3A54A 2C0IA 1RLQC 2HSEB 1WXBA 3AQQA 4BE0A 1VQNT 4R4IA 4DK6C 5IY0A 2CFMA 3M0PA 3I72A 1S5BD 1LPLA 4LDYA 2UUCL 1VQIA 2E2IH 4PNOA 1LTTD 1SSFA 4JOIA 3U50C 1N5ZA 1PRTD 3MXGA 4KGXB 2RJDA 2KMTA 3A8GB 4OMMA 1RAFB 5M5YH 2BTTA 1VQ8T 1SSOA 1WOCA 2ZT9C 4B3TQ 3L2VA 3E1SA 3I73A 3FRNA 4Z88A 2F0TA 4KY7A 4DAYA 1IXDA 4HAEA 4NB3A 4DF7A 4DXGA 4XTCS 4OF1A 2V8JA 4ZTFA 4ZGDB 3Q0AA 1U9RA 2C06A 2MHVA 3KLSA 5IODA 1QVPA 3OS2A 2BA1A 3GTGH 2N3SA 2SNSA 3CP0A 3W1BA 1I0CA 2VXWA 3LYIA 3MXNA 5GAGC 3LH0A 3KLSX 3VYSA 1A15A 5I9PA 4ABNA 1PA6A 4C1NK 4RTTA 1QKWA 3Q1JA 4JUVA 5C6SA 5IYCH 1B3QA 4PNYA 4R8IA 3LGFA 1N34L 4M7AF 1V1QA 4GN4B 5IXBA 1Q8KA 2COWA 2RCFA 1K76A 5FWBA 3GTPH 5GAMj 2RDGA 3L0OA 3JCMf 1D1KA 4BE2A 1XX8A 1I6VC 1U1TA 2B63B 5CCAA 2HQEA 1HZCA 4X64L 4LFCL 3W2DA 2AKLA 5CKFA 3MEUA 1U5KA 2NVXH 3UDXA 4CBVA 3M0SA 1NYFA 4MZTA 3EHQA 1JMCA 2N49A 4M77F 2I5MX 3EROA 4H02A 2V8IA 4AIMA 4IUVA 4BWGB 3BS1A 1J8IA 1PSEA 1WXUA 1NTGA 1SF9A 4POGA 1WQ7A 3EG1A 1S1NA 1ABOA 2CH4W 3R8BA 4M1UB 4TKOB 4NXNL 4KGZB 4LUVA 4A3KG 2JOYA 2WAQG 5C3EG 1OPLA 4A75A 4XT1B 3PE0A 3C46A 1G91A 4E7ZA 4LUDA 3VYGA 1I4K1 3H0HA 5GANj 2QASA 4IUQA 1PRTB 1Y07A 4OGQC 2V26A 2XWBB 3OIPA 3E9HA 5C5LA 2I46A 1NCVA 2MOXA 2RQWA 4C3JB 3RR5A 3S24A 2VV5A 4PMCA 5IHNA 4BXXG 3P8DA 1J5EL 2YUNA 1XNQL 5IT9E 3C4SA 2ATCB 4LAAA 1PH9A 1BBZA 1VOMA 1HQRD 3BDCA 1JWMD 4N8FA 1EIYB 1NM7A 2RQXA 1ZYRD 4ELYC 3UPUA 3FKIG 1E22A 1HNWL 2PUKB 3JCMh 2DO3A 4HR7B 1JRIA 2EAYA 4BUGA 3TP5A 3PGZA 5CV5A 5EBCA 3LNNA 2YHTA 1UGQB 3HFNA 2MO0A 2OT2A 1MMNA 2K3BA 4FW2A 5CV4A 4KD4A 2G6FX 5HGQA 1KFZA 3KLWA 3U9OA 3EGXB 1JO8A 2Y4YA 3H0IA 1F1BB 3THKA 4KKTA 2BDNA 3QO3A 2YUQA 2EGEA 3H8ZA 1ICFB 1DCZA 1CKAA 2J7IA 1SYDA 4PLIA 2R7ZH 4PFPA 2FVUA 4A53A 2ZJPA 4MMKA 4MNOA 4DGZA 5FO7B 1NE8A 4JI3L 1B50A 5JEAG 5IYDG 5KGUA 4UP9A 1A2UA 3E5SA 4L6V5 3T9NA 4C5IA 2EXZA 3A74A 3LX0A 4IJLA 5E3FA 1OZ3A 4Y7NH 3GTPB 3G4SA 2JA9A 1OX8A 1LOJA 4EMKA 3HEJA 3S1MH 3CC4Q 2LMJA 4OMOA 3V7CA 3HG9A 4Z8AA 4PJMA 4DQ2A 6AT1B 1XPRA 2EE1A 4DV4Q 2K01A 3I4NB 4BY7H 4LFBL 2FB7A 2QGGA 4ME7A 2K52A 1M90U 2DRKA 3G71Q 2RD1A 4PJOE 4JLIA 4R56A 3PIPA 3V05A 1EZZB 1PH7A 5M3FB 5KYWA 2NTTA 5DM7R 2AWOA 3F2DA 2NYSA 3LLRA 2EXDA 3I3CA 4G4KA 2A28A 1EX4A 1WTOA 1WCMG 2Q2IA 2LT1A 4I7AA 4EQPA 1D3BA 5DLQE 2KA7A 1K3BC 2Q2UA 4C0ZA 1H9SB 2RHZA 2F0NA 1ESFA 1R4QB 3A8MB 3A8OB 2CKZB 3HOUB 1WHGA 4P5NA 1GBRA 4KHPQ 2E2IB 1X75C 2J4XA 5E7NA 1YITT 3DWQA 4F88A 1TWHH 3S17B 2IX0A 1Z9ZA 1SNDA 3CPFA 3IKJA 2XMFA 3CC2T 2VS1A 5D65A 2EIFA 3G4ST 1ONLA 1Q86C 1LNXA 4J83A 4TQUS 3V96A 1X55A 4A3EB 1XMQL 3SK5A 5IGFA 3NWSA 4O6JA 1EYDA 4LD9K 3F1ZA 4C3JH 5T1IA 2E6NA 4DK1A 1EU3A 2M00A 1U5SA 3KYHC 1UUEA 4X65L 1LV9A 2JZ2A 2XI9A 2ZXRA 4L5QA 1UFFA 4ZGEB 1G3SA 3CCUQ 1VQ7A 4CKBA 4FYYB 1XTCD 1LT4D 4DR1Q 2UUBQ 1B70B 1MGQA 1RTOA 5FLXc 4OONA 3GTQB 5M3MH 3M53A 4KH1B 1WZOA 2F5KA 5GAMf 3GO5A 2CGHA 3T53B 4JRIA 2M16A 3OYCA 1C4QA 2O5JC 1C7YA 1IXRA 4RKBA 2ZPIB 2OTJA 1K4US 2F0QA 1PWTA 1SYEA 4UAIA 5GAN3 2JXMB 1UE6A 2E8GA 4Y52H 2JMAA 1T3LA 1E6GA 3PUYA 2LY7A 4DNRB 2CZ0B 2O5IC 3JCMd 2CP3A 1KAAA 4XYQA 4RG2A 4RTYA 2ED1A 5KCHA 2DTOA 4R55A 2FZKB 5LL6S 2BDOA 2D62A 1YZ6A 4KK7A 5C4ZA 4GOPB 2QA4Q 2DNEA 4EIKA 4BA1I 2AT1B 2P0PA 4A3FB 2VQEQ 3EGXA 2K5WA 2HHHQ 3AU7A 1IHZA 3S2DH 2M9UA 1YJWT 2K5NA 1K83H 1XJVA 1Q12A 3HFOA 1IGQA 1QVGA 2IVWA 5J3BA 1EY5A 3I35A 3Q24A 1BCOA 1SE2A 2BE5D 2KRSA 4A3EG 2L12A 1VMPA 5FW9A 2VQFQ 1IGUA 2RM4A 4RH6A 1VUBA 3RKXA 5EPJA 4LMQD 5GAOn 4FU6A 2CW0D 1O9SA 2H5XA 4BXXH 2L0AA 1H9MA 2A08A 1T0JA 2NWMA 1PXUA 4RTUA 2OAWA 2KXDA 1SHFA 1HPCA 5EGTA 2FL7A 1H3ZA 3RZDH 3VYRA 2L0CA 2F0UA 1WHHA 1J9OA 1WFQA 3OYNA 2NTSA 4DAPA 2KGTA 3PVLA 3T1YL 3HOUG 1FGBD 4MTKA 4DA4A 1PH3A 2ALYB 3QG1A 1YJNQ 3GP7A 4K5WA 1G6ZA 5IOCA 1SXTA 2PQAB 4MDWA 5D6XA 2OEOA 4R0KA 4C8QG 3HOUH 1WTXA 3BFMA 3V8KA 2XDBA 2P84A 1VQGA 1O78A 4LF7Q 1KQSP 5CBAE 3I4MG 2JN4A 3GTLB 2ROTA 3DLMA 3HSBA 2NVTB 1NG2A 2HCKA 1EZ6A 1QLYA 3GNFB 1EIHA 2BZ8A 3OSOA 2CHBD 1WHKA 2O88A 1JE4A 4AFUC 1YEZA 1T5XD 2A5HA 3DM3A 4N9PA 5FLMH 2R92H 2Z6KA 1FJGL 2QILA 4KJOA 4HIDA 1VYTA 3OB9A 1OX9A 4A3MH 2O4XB 1RL2A 1PV4A 3TDQA 4M7AC 4HCSA 3T1HL 1TUDA 1YN8A 2KJXA 1TR5A 2B2WA 2R7FA 5CV9A 2DNCA 2RK1A 3CCQQ 1SRLA 1Z9FA 2DJGC 2WV6D 3A8IE 3SB2A 2E4HA 4BDZA 4J9EA 3OY9A 1CQFA 1VMCA 4RGOS 4XYOA 1OI1A 2FZCB 4X62L 4RKLA 4XTZA 2EY5A 2J06A 4PG3A 5BN5A 4X65Q 3OYJA 4B3RQ 2K14A 2EGCA 4JZ4A 1QVGP 2KOLA 1V29B 3SK8A 1BBXC 4LF5Q 4A3CH 2FRYA 3AFPA 2D5DA 2EFIA 5FLXE 2E2JH 2XRSD 2WP8J 5C0XJ 3S3MA 1LVKA 5EC7A 4C3HB 1OQKA 1HNXQ 2QQAA 5KYXB 4RMOA 5T1GA 3NTKA 3QSUA 4E6RA 4FYWB 2L1BA 3BVZA 2L5TA 3META 2JN0A 1VQ8Q 1XNIA 2VUBA 1VQLT 1ICWA 2CUDA 3OS1A 1IREB 4EQNA 2YXYA 2XTIA 4L59A 3DM1A 3S15H 1JOQA 1BI3A 3BDOA 4M7DD 2CZ6B 2OTLA 2F0FA 4HSPA 4C3JG 4M78D 1ZSZB 5DY9A 1IRXA 1BI0A 5CBEE 2EBPA 4C3IH 3S9WA 1WTQA 1JU5C 3CCEQ 4JI0L 3X26B 4AQYQ 4X6AH 2K7VA 3BE3A 2HKQB 3SWNA 1HH2P 2KEDA 3VS1A 4X3SA 3TEHB 1X9NA 1L1OA 4PFOA 2M0YA 3GQBA 1G6PA 1LTSD 4JJCA 2YUOA 3GBQA 5C3XA 4A3KB 3J7AV 1K8AR 2EVRA 2KT1A 3M5AA 2VB6A 2RHYA 3TCJA 4ORZA 4N4HA 3STBC 1H95A 4CDEC 1YFNA 5LJ3d 3CQTA 3HL8A 1GUSA 2PZWA 3MZ5A 5F2DA 1WTVA 1ENCA 4DV7Q 2COZA 2DJFC 4JG2A 4K14A 2DPPB 2MUYA 1BR9A 1H9SA 3J81L 4YTLA 1FXXA 3EG2A 2MJ8A 1MGSA 3H6ZA 4M78G 1AWXA 1ASYA 5FJ8G 2B63G 1Z7TA 1QOHA 2A37A 1IL8A 1YP5A 2B2YA 1JR0D 1PHTA 4DAVA 2LP5A 3H3VH 1TWFB 2YV5A 3JCMc 3EBEA 5GAMe 2RHSB 1UGSB 2MP1A 2OQKA 2RK2A 3PO3H 5KYWB 2YWWA 4AG2C 5C44G 1YJ9A 2GNCA 2QDYB 1WTPA 3MHXA 3DXJC 2YU9B 4NW2A 2VNUD 1PH4A 3M55A 1KHCA 1M3BA 3G6EQ 4E7JA 1HZBA 3LH5A 5IXFA 3WOEA 4RGMA 3KUPA 1MV3A 2JE6I 4GLAC 4QUCA 1VQPQ 4DN4M 1VQMT 2HBPA 4F8MA 4CJ0B 1K8GA 4A4HA 2F0PA 3L2PA 4FW1A 2RH2A 2OXPA 1I3QB 3RMHA 1M1KR 3SEBA 3EIVA 1RADB 1N8RR 3I56Q 4A3GH 2DL3A 2QTXA 4DR3Q 1MMGA 1IKLA 1SN8A 1X3QA 2PMZB 1IBLQ 1VQDA 1SROA 3FPPA 3CF5A 1HZAA 3K81C 4JS5A 1HZ9A 4OB2B 3RNJA 1MHWC 1Q95G 1WJSA 2DETA 1VQ7T 3NK9A 1ZUKA 3RUXA 2DVEA 1HK9A 4M77D 2VC8A 2EKOA 3FDRA 1EYGA 1TS9A 1QWEA 2KEAA 4L5TA 3S16H 3CC4T 2ZCFB 1UHCA 5LJ5d 3RD4A 2CYZB 3KLRA 4DR1L 1HHVA 3D4DA 4A4IA 1QE6A 4JW0A 3C12A 5EG2A 2LXJA 1X3PA 5KRUA 1Y1VG 3M0TA 4PFZA 1X2KA 2H3JA 4DFAA 2ZGWA 1TXQA 1WLPB 5ELCA 1TWCH 2L3SA 5E4WC 1V8QA 5JEAJ 1EY7A 3MTSA 2DXTA 1Q3LA 1XJWB 1PCXA 2OI3A 3H0FA 1NPRA 2PI2E 4FVMA 4RGTA 1DOKA 2ZTEA 4R4OA 3GTKH 3UDCA 3MFGA 1Y8PB 3RZOB 5FJ8H 2E2JB 4CKCA 1KHIA 1VDZA 3FPUB 1M90C 3M4OH 2F5TX 1W1FA 2K3XA 5JJZA 2L3PA 3RZDB 2IG0A 2YUPA 4JI5L 1KXLA 3CMAT 4A3BG 2ZJQA 2AQ3B 2RHQB 3CPWA 3J81E 1YI2A 4E7HA 4KHZA 2RNAA 3S1QH 4DR7Q 4A93B 2GA4B 3UE1A 4IUPA 3UE0A 4O1NA 4LDWA 3GTJB 1TT2A 2X6LA 4POFA 2X69A 4FM4B 3CKIB 1IHWA 2JA8G 3L2QA 1MSGA 1W6JA 3FEOA 3PSIA 3MP6A 2Z8LA 2L9HA 4X34A 4WTOB 1LTID 3O8VA 1X32A 2O2LD 1FD7D 2F4IA 4L6TB 2CP5A 5CKHA 4J6YA 5HCKA 4DV6L 4M7AE 1PC0A 1GHKA 2F2VA 1FMVA 1BBUA 2COYA 3BZDB 1L1OB 2YU9H 1DXMA 4QW2A 2AUJD 3M0QA 4WRDA 3A5UA 4IURA 1K73R 2KQ3A 5ELOA 4PK4A 4RCNA 1GUGA 4LNPA 3PO3B 1QWYA 3MHBA 3MCAB 1RF2D 2JK8A 4NOYA 2F4VQ 3AFQA 4KY5A 3V2TA 2F0GA 1YCSB 2NZ1D 1OZ2A 3Q6SA 3HOWB 1RAHB 5LJ5h 1YJWQ 5KE3A 1R9TH 5KYUA 4DBQA 2DM1A 1PNJA 1A62A 4N0AA 3ZYYX 4C3IG 1YI2T 4G57A 4A3LG 1UWVA 2UUAQ 3LWEA 3QDFA 4MTNA 3PF5A 3EJIA 4GNXC 3PNWC 2JJQA 1F9PA 1TTHB 2X4JA 1LTBD 2X9HA 4M7DE 1DGSA 3HOVH 3NENA 2LX7A 1HNZQ 3CC7A 1SR3A 4M78E 3JCMX 4XTYA 3M4PA 2BE7D 3SD4A 1KQSS 1S4ZA 2IX1A 5IHKA 2QG9B 1N36Q 2DGYA 2LJ3A 4GY5A 2FO0A 3PF4A 4IFDJ 1VQOQ 3OS0A 4APVA 5GAEC 1UTIA 3GTLH 4ZCKA 4JPBW 1EYCA 1R4PB 4A3BB 1XWEA 5GMKe 1RODA 4M7DB 2HD3A 3PFSA 4HIMA 2JVVA 3JCMe 1JCKB 1VQ8A 3HP3A 3IL8A 2XK0A 3OSSC 4XDXA 3WDNA 1MMDA 2C9OA 3JAMi 2EYXA 1I4PA 3NHHA 2L2PA 3T1HQ 4A4EA 4GNXA 3S17H 1VQ4A 2CP0A 2D0NA 2UU9Q 2F0EA 1B3AA 4QJFA 2BE9B 1MD2D 2R57A 2N55A 5FLMG 1I8FA 2B2UC 4FT4A 2LQWA 2R92G 1V1PB 4UHVA 7AT1B 2O4XA 3R6NA 2KVMA 4JJNK 2XNAC 2K2MA 1MNEA 1YNJC 4KKSA 1H8KA 2XG8D 5FROA 5GAOl 5KNCA 2RPNA 1CUKA 1PTOH 2Q2HA 4LN2A 1Y14B 4C92E 3CCET 4MIUA 5I6WA 4BBRG 4M77A 4CKEA 1I5LA 1G291 4JI4L 3J7YW 2QQ9A 1TY0A 1PFMA 3BYTB 1WGSA 1PTOF 4L8JA 1Z6HA 2YTYA 3E0EA 1U4PA 3IFDA 4QGUA 5HK3A 5AYFA 4CRIA 1PD1A 2RDFA 1IW7D 3CD6T 2RF4A 1CSQA 3L3OC 3URGA 4AMCA 1XNRQ 4PZ8A 1LT5D 3L2RA 1QVFS 5GANd 1LTAD 2EVBA 3MWYW 3H3VI 1FNUA 4HIOA 1A63A 5DLOA 3RLFA 2JTMA 5FO8B 4DV2L 2QEXQ 3D3RA 4GLVB 2HT1A 1X56A 4H44C 4HMIA 5GADC 4KHPL 1D2BA 1SE4A 2DZCA 2P4RA 1M8VA 4AG1C 1YNZA 3A7LA 1R77A 2AZVA 4C5HA 3PO2G 1SEMA 4J8OA 1EQTA 3H15A 3V7SA 1M8MA 3M0RA 1D09B 3U23A 2PNIA 2EQIA 5CAIA 4JI5Q 4HJ5A 4AH6A 3OW2S 2JA6G 1PFBA 1S5ED 3KOJA 2KAFA 2LCLA 2M1HA 4OMLA 1TG0A 1LT3D 4LFCQ 4K6DA 1SAPA 3VS0A 2DN8A 4F87A 2XIWA 2DILA 2DXUA 4C92F 2LNHB 1NMGA 1PZID 1U4RA 2PYKA 3CCMQ 3CRLC 4UY8C 3BZCA 1NJIU 4M77B 1B9NA 2F0HA 4DV3L 4KUIA 4XTUA 3L7ZC 4O42A 3P20A 1T0HA 1WTHA 2D2CC 3JCMQ 2NZHA 1STNA 1IW7C 4KT0E 1QZHA 1AWOA 4LDXA 1AE3A 4PMBA 1AD5A 2KECA 3AB9A 4P71A 4II1A 1TXYA 1M3CA 2FG0A 2VGMA 1L0XB 4YWKA 4K0KL 3K7AH 2FEIA 4RKUE 1V1PA 4QMGA 4QQBX 1MV0B 2PCFB 2KK4A 3K6OA 2ZTDA 3PUWA 1BK2A 1KC8U 3DWAA 5IP7G 1STAA 5JPMC 3VU3C 4YCUA 2BUDA 4DOWA 1C8CA 3HOVB 1EEID 4M75A 1WHMA 2SNMA 4CC7A 1M8AA 1XPUA 1I81A 4RTVA 3F8TA 3HRUA 4DR2Q 3JCMg 4OL7A 4N4GA 3JAME 3D4WA 2CW0C 1VQJA 1IZ6A 4DUZQ 2JA6B 1J3TA 3L1AA 5K36G 1I50H 4OB3B 1EIGA 1UE7A 5JOBA 4NMZA 1BO0A 1IYUA 3L2UA 3PTAA 1FVIA 2NB0A 3HKZE 3HOWH 3QXEB 4K8JA 4G7ZC 3NGPA 1KD1R 5I22A 1M90R 3K58A 4ELZC 1WHJA 1K73U 4PZ6A 1KK7A 1MJEA 4LF4Q 2EYJA 2R93G 5C0XI 1KDCA 1JB3A 1EIFA 3A8LB 1SRUA 5C4HA 1DD2A 5LJ5j 4OO1I 1CI3M 1TS2A 3HPWA 2SDFA 4C3HG 1RAGB 1ML0D 5A2QE 2NN6I 2BZYA 4GLXA 4E2FB 2A6ED 1I5FA 4OELB 1TVXA 2KCCA 2PQEA 5I9OA 3I4OA 3WVDB 1EFWA 2DYBA 2K75A 3GV6A 3PUXA 3GTGB 1S72T 1PYWD 3OYAA 1X6BA 3ULLA 1EQVA 2P4TA 4KD3A 1IBML 1IYVA 1K9MR 5LJ3e 4A3MB 1PYBA 3CQZB 5C4XB 1NEGA 1NLOC 2MWPA 1ENFA 3ERQA 2RQVA 1BCPD 4J9FA 1MBYA 2FMCA 5FU7B 2BIVA 2K4KA 3L42A 3CC2A 3OIQA 1SYGA 4FCYA 3P7JA 5AFWA 3OYKA 2D6FA 5IWAL 2OX7A 1BNZA 2KY9A 1EYAA 1PZJD 3KDFA 5JEAH 3RLNA 2DTIA 1RAAB 1BXTA 3QB3A 4IPGA 4M7DC 2R92B 1CKMA 3TVTA 1NYGA 4A3JB 4XQNA 4TRDA 2WIIB 2O31A 1JQYD 3I55A 1ILPA 1AOJA 2LCSA 2E41A 3RESA 3SDZA 3UA6A 4AFQC 3CPWP 1Q81R 2DEUA 2WB1E 3KF8A 3UF4A 1A0IA 2LJ1A 1YIJT 4GLMA 2DFUA 2HL3A 2K3YA 4PL6A 3ZL7C 2G9HD 3M7GA 4K5VA 4X3KA 3TSSA 4HIKA 1BI2A 1N8RC 3OOCA 1D1IA 2AMCB 1VQFA 4PV1C 3J81j 3STBD 4L5SA 1M2VB 2BH8A 3IFTA 1JORA 2F4VL 3ICEA 5IIFA 1SYFA 3JB9G 2Z4IA 5JVG3 4Z02A 1X27A 4A4KA 5G3LD 4KULA 1LO5D 4RHSA 5A2QL 5CKBA 1ZSZC 1HRJA 1U8RA 2F0VA 4R1JA 2Z1CA 4R8NA 1YVCA 4DV1L 4XAXB 4OWTB 1KABA 4LFBQ 4R4TA 5I11A 5C5MA 2HQXA 1D3BB 1U06A 3R2IA 4PJJA 4DXFA 1LJOA 1I94Q 1GBQA 1M1FA 2JNGA 2D9UA 2K05A 4LDUA 2LKVA 1VQ4Q 1R0BG 2RCNA 2SEBD 4TSSA 3I4MB 2M02A 2DEQA 4AYBE 1YHQA 1OPKA 2M0OA 4H7BA 5D14A 2R7ZB 5GROA 3ASKA 3ZBDA 4IFDH 1GCQC 1N32L 4G7HC 4BY1B 2L4NA 1QCBD 5G3LF 3UDIA 3OA6A 1A0NB 4Y7NB 2BOSA 4XU2A 4M7DF 2Y0SG 4C92B 4BY6C 3T13A 4HMJA 2G9DA 5ISRA 4FL6A 3HKZG 3GIBA 3S3OA 2ZPEB 1VQ4T 2DERA 1RAIB 2ENBA 1TWFH 1R0CB 2MF2A 5CVIA 3CCST 2HUGA 2ID0A 4A3DH 5KCOA 3QOJA 2KSSA 1D0YA 1TU2B 2NUCA 1WNLA 4BACA 2FINB 1I50B 2IT1A 3P75A 4FF1A 1FYNA 1TWGH 2VB3X 3M4QA 4J5YA 3D8GA 3S14H 4OO1G 1VQKA 4F7UB 4KUDK 2JA8B 5LJ5g 2JA7B 1E1TA 1FR3A 1W6KA 4J6WA 4NPSA 4JI7L 2K33A 5IYBG 1O75A 5I2MA 3PIO3 1DZ1A 3L9AX 3M7NA 3H94A 2ZPBB 4WF2A 4C8QD 3I4LA 3T4AC 4A93G 2CSQA 1LTLA 3CD6A 3OYYA 1JXMA 3NFCA 5GJWB 3CCRT 1H9JA 5LJ3g 4YHHQ 4I7ZC 5GAN5 8AT1B 2HIVA 4A3JH 3A98A 1D6EC 2EJ9A 1KL9A 3UI2A 1OXSC 3ITPA 3SK4A 1AFPA 1BF4A 2E64A 5HGTA 3U4VA 1SJED 3TMEA 2J6FA 3V8LA 1TS4A 4RGNA 2JA7G 1GUTA 5I2YA 2WKDA 2KT8A 1XXGA 3QYGB 2A6HD 4A3DG 2BZXA 3HKSA 1YBYA 3PMIA 5LJ5e 3MO8A 1KD1U 1ZUUA 1C9OA 5EBDA 1JB7A 1CSKA 1ENAA 4XK8E 2RN8A 5FKAC 3OTOQ 3IAYA 2QAZA 3ER0A 2B2VA 4RG1A 4HCBA 2DK3A 5H1SE 2F0SA 5CGKA 4EQ5A 3QYHB 1TH7A 1H3HA 1ABQA 3UA7A 4X3UA 1CA5A 3TP6A 1X01A 1QW1A 3A1PA 4M78A 2CP2A 4C92G 4F7XA 4KMUC 5A0GA 5BR8Q 5K5PA 3HOZH 2XRQD 3I4NH 4BY1G 3NXWA 2KCMA 1LTGD 1V1CA 1WCMB 3I2ZA 2EYQA 4M7DA 4NS5A 2B2WC 3OMGA 3X20B 4HJ9A 3CCRA 3QJYA 1UJ0A 1QQJA 2CQAA 1PFNA 3DMUA 3QO2A 1I6HH 3I5RA 4O5VA 4CC3A 3NBHB 3PUZA 2ICIA 2L55A 4J7FA 1IB8A 3CCVT 4LF8Q 1UDLA 1CHQD 2VY3A 4DU9A 2Q8TA 3Q22A 2HL5C 2F2WA 3CCLT 1CQVA 1KNAA 1ZEQX 3NSWA 2UUAL 4CDDC 3LWHA 3CC7T 4DEYA 3GTMB 4L5GA 2EQUA 1VIFA 3CMAA 3VR2A 1KRTA 3HRTA 2RB6A 4OMFB 1EQQA 2YSQA 5IH2A 1S72Q 1DJRD 2ES2A 4JV5L 5NUCA 5C44B 1RI9A 4ANJA 2EQKA 5CR2A 1YNXA 4IPDA 4DV0Q 1AVZC 2AZSA 3QPHA 2PVGB 3CBMA 3M0UA 1PRTF 5HURA 2YRDA 4DV3Q 2PZUA 2RQTA 3T51B 4GN5A 4M4ZA 1X43A 3DB4A 1F9QA 3GTKB 3VS6A 1N9SA 1L1OC 1B07A 4MDXA 2E74C 3CCJQ 4EVOA 4IFDI 1EFNA 1WFWA 3CMAQ 4MZ9A 2VGNA 3I56A 4JJDA 3EG9B 4N8X1 1PRTC 3QWYA 1P8LA 2KNBB 1VQ9T 2HEQA 4XTWA 1PTOC 2C5CA 5GANe 2K6AA 4B3SQ 3S2HB 4J15A 2DD4A 2EJFA 2QDLA 2K79A 3T56B 2NUZA 5KIXA 2F0WA 3GF5A 3TQYA 5M5XH 1N27A 3P8BB 2IY5B 3B6YA 1ARKA 4AYBG 1LT6D 2NN6G 4R4CA 4G7OC 3KF6A 1LYLA 3DEOA 2J6KA 4K11A 3HOXH 5GAN6 4JJBA 2WB1G 2EY2A 1M9SA 1Y8OB 1HFNA 1O7YA 2JXBA 2DVJA 1F2ZA 3U4ZA 4FT2A 4OX9Q 1N33Q 3MP8A 1XNRL 3R93A 4K5XA 1PD0A 1S72A 1QVFA 3DHQA 3VYTA 2GQIA 4XQ3A 3H41A 3EFRA 1S5CD 2KROA 4M75D 2HDAA 4Y28E 4EMHA 1ZSGA 1PZKD 4N0AC 1FL0A 4BI4A 2WB1B 2WAQB 3T16A 4GKJL 2R5AA 1B4OA 1VQPT 4HVUA 1VQMA 3IQLA 1NLPC 2CH4A 4HA8A 2JA5H 4ODGA 4HCKA 3OW2P 3TP8A 3QDRB 1KRSA 2R93B 3R6OA 4E7LA 1BBWA 3BDUA 1YHQQ 1RCVD 3G48A 3I90A 4LUZA 4A3IG 2LSSA 3I56T 4RA8A 2HHHL 1G3YA 1VQ6Q 1F2LA 1NY4A 1W3SA 3OW2A 1EWIA 4NDXA 2EOTA 4ALPA 1BCMA 2WFWA 3A8KE 2UUBL 1PTOD 1RTNA 3UT1A 2IHFA 2NZOA 3KDFB 2QQBA 5IP9G 5CIUA 1TQOA 3K57A 4U68A 2F0IA 1PDQA 2KYBA 5J39A 1I5OB 3EQLC 2ECZA 3CC4A 5FWCA 1F2YA 4C2MH 3M85A 2DL4A 4BDYA 4DOVA 3KF8B 4NL3A 1NUCA 1NR2A 3VA7A 4Q0FA 2V1RA 1V1OA 2VZAA 4CHTB 4B3RL 4M78F 4YHHL 4AYBB 4OGEA 5ELFA 2ZPFB 4JVZA 3GTQH 4Z89A 3CCEA 3ND9A 2AQ2B 2UXDL 1OYXA 4OMPA 4TVRA 5IYBH 5M5XB 4C0GA 1ILQA 1QZGA 2MWOA 2D9TA 2G3RA 3C0CA 2HIXA 4ME3A 4C8QE 1WTWA 1CHPD 3BJUA 4OO1H 3GTOB 4ZRZA 2K6DA 3K0YA 1D5ZC 3J80i 2DYIA 4FSXA 3X25B 1I1JA 1H92A 3A55A 3I91A 2GN5A 4OXPA 3PVQA 1GCPA 3W3AA 1PH8A 4JRPA 1VQAA 2RF0A 2VKNA 2XDDA 3BU2A 4U673 1T5EA 5FO9B 3D6WA 2CQOA 3AHUA 3OYIA 1GXDC 2OTJT 3EG0A 1Q46A 3MEVA 2ICEC 3HOYH 4C8QB 1H9KA 3WOFA 5DEHA 5M9OA 4CJ2C 3LWIA 4JBJA 1EWHA 1I4XA 1I4QA 1UGVA 4JI3Q 4O0AA 2JS0A 2MCNA 3QJ6A 2PVOB 1X3EA 2R5MA 3TZDA 5J1ZA 2J7ZA 4DR4Q 1VQKT 1GUNA 3JCMP 3EH2A 4ZGJB 3QR8A 5GMKh 3FP9A 3T1YQ 4HT8A 4IALA 3CCSA 5KNBA 1I94L 3K5NA 2NWGA 1HR0L 2E1HA 2EQJA 1T3SA 1L2FA 2R3ZA 3S1NH 3L2ZA 3NELA 4A3DB 1D7QA 1HUMA 3U9SA 3BW1A 2E6ZA 3RMSA 3E9IA 2K5FA 2MNAA 1B2TA 1U3OA 4N4IA 2RI3A 2NVQB 1CKNA 1G83A 1YJWA 2EJFC 4C2MB 2F69A 2SEMA 1YJ9Q 1UG1A 2OWOA 1C1AA 1O7ZA 2QYZA 4X1VA 4CDCC 1LM0A 3EH1A 4WJ3M 4RFBA 3V7RA 4A3FG 4PMWA 4PZ7A 4HJ7A 3C94A 2H4OA 1MI2A 4BBRB 5GAMd 1M4ZA 4D6WA 2GFUA 1HQMC 2F0OA 3REBB 4KRTA 2NYZD 3RMQA 3BVMA 4B3SL 3CC7Q 1B7YB 1UAPA 1BVSA 2JT4A 1QKXA 1TOVA
chains in the Genus database with same CATH topology
3NTHA 2MMPA 3M4YA 4DR6Q 4DR5Q 3K8AA 1XMOQ 4B9WA 4DV7L 2A8VA 4K0KQ 4F7UF 2YTVA 1QP2A 3G6ET 5CO7A 2ZPGB 1VQ5T 2DXBA 5IP9H 5IYCG 2UXBL 1XTDA 1RI0A 1XQHA 3RKYA 3ULJA 3LW5E 2E2HH 4IKFA 1N8RU 1B34B 1VQHA 5GMKl 1ZHIA 3OSVA 1PFSA 1H641 3GTOH 1C0AA 4A54A 2R6GA 3CCVA 3ZEHA 1WJRA 4A76A 1IBKQ 4BE1A 1MJCA 4A3LH 1S40A 4JS4A 3PIOA 1X6OA 4J7IA 4JI8Q 2MI6A 4JYAQ 4X9CA 5GANf 2A3LA 2JA8H 1V9PA 1KIXA 4IOCA 3HOWG 4JI2Q 2EWNA 4BBSG 3P8HA 1G5VA 5I21A 5HKCA 1O7IA 2D0PA 2V1CC 3KF6B 4GN3B 5CQYA 4DV5L 4XU1A 2ZPHB 3M59A 2LNVA 2OAUA 1VQOT 3I55T 3NTIA 2VUMG 1GM5A 1GVPA 4RCBA 4YCWA 1VQ9A 1YIJA 2XHCA 4IO9A 1JJ2S 2K5HA 2X4YA 3QHSA 1GD7A 2ZTCA 1T9HA 4P74A 3PMTA 3BDLA 4DUYQ 1YCYA 3QBYA 2Z6KC 3CAMA 2IHEA 2MQHA 2ZZDA 4PJOB 4OX9L 1N33L 3MP1A 2RI2A 1Y1VH 4DV0L 3TS0A 1G3WA 2AHJB 3WVEB 3KUFA 3Q8DA 1VQOA 3PO2H 2Y90A 5D6YA 4GKKL 2XGTA 2CWAA 1IYJB 4NXML 5GAMg 5LJ5f 4PJOC 1E3PA 2QGQA 4LF9Q 1YJ9T 4XU3A 4DV5Q 2XDPA 3KBGA 4P75A 4ATOA 4RG8A 4MMLA 1GXIE 4LF7L 2RHXA 2K50A 4DR6L 2VUMH 2DIGA 2RJEA 1BIBA 3JB9D 4NXNQ 2N78A 3FB9A 3LGLA 3GP8A 4BBSH 1BIAA 4BD3A 2E5QA 2KHIA 4DV6Q 4A4FA 4M7AA 4JBWA 1UEBA 4OGCA 4A4GA 2PI2A 1OXTA 2WSEE 4JI4L 1PSFA 5LMNL 3FHWA 3RLOA 4E7KA 3MXNB 2A19A 4LF5L 5L8RE 4ZTJA 3L2WA 2Q2TA 3RN5A 4PJOF 5GAOr 3CMET 5GAN2 2RJFA 3CXCA 1BYMA 1SLJA 2PVDB 4X66Q 4JYAL 3WWVA 2L5QA 2I2LA 2WSCE 2YTXA 1YHAA 1IBKL 4GLKA 5GAOm 3CCQT 4UC4A 3QUIA 4JI1Q 2EQSA 3PT9A 1Q86U 2CCZA 4M75G 5GAHC 1FWZA 1AH9A 2MAMA 2YYZA 4HT9A 3F2CA 3OYMA 3X24B 2LDMA 3G71A 4OVAA 1BI1A 2MFIA 5GMKm 1CSPA 2GVAA 1EOVA 2CWPA 2MO1A 1VQCA 2KVQG 3I7FA 1YHQT 4HCZA 4A3CG 4NL2A 5KH6A 2VW9A 4EMGA 4QQDA 3VJPA 4M7DG 1PH5A 3JB9H 3I4MH 1M1KU 1ASZA 3EAEA 3OYBA 3RN2A 3OS5A 2LQ8A 1OXVA 1QVGS 1X3FA 5IT9c 2VXEA 1EUJA 1U0LA 2LT4A 1X3GA 4DV4L 3JB9F 3OQ5A 1WJQA 1FGUA 1P16A 2UUCQ 4LF4L 2KDSA 1HNWQ 2VXFA 2D0QB 2YRVA 4C0DC 3CEYA 1TWAH 1UE1A 4NXMQ 4M7AG 1M1KC 4DR7L 2AKWB 1V43A 1R8OB 4DUZL 3OMCA 1L0WA 2A7YA 1HR0W 4FIBA 5M5WH 3JCMJ 2DD5A 2LTOA 2OTLT 3TU4K 1U1SA 4X9DA 3CCUT 1VQBA 4B3TL 2E12A 1D8LA 3M9QA 4M75C 2X35A 1BKBA 3ERSX 1HR0Q 3PCOB 2HQLA 3K0XA 4BI8B 1JJ2A 4PJOA 2VQEL 3UDFA 1B8AA 5HK0A 1KQ1A 5C44H 1QUQB 3A5ZB 1IL2A 1B34A 1W2BS 4E7IA 4JI6Q 1ZBXA 4JI8L 3QKJA 2RO0A 1A8VA 4DV2Q 2C35B 2E65A 5ELNA 5GANg 1VCIA 3GNGA 3RNUA 4HKEA 2NVQH 2JUFA 1G51A 4OB1B 2DUDA 4XTVA 3VV0A 1RIPA 5D6WA 5AJ3Q 3RERA 1FX7A 3QZ5B 2JA6H 1VQ5A 3SGIA 4P72A 4OP0A 4JI2L 3F2BA 3JCMW 1GKHA 4JC0A 1E1OA 4IUUA 4C5GA 3FLGA 4HJ8A 4JCVE 3M3YH 2KHJA 3KFUA 3S3NA 2B29A 5IN1A 4GOPA 4QQGA 1VS0A 1WI5A 1JB0E 4DR4L 4B3ML 1AHJB 4YY3Q 3LX7A 3J7ZC 1PH6A 4X66L 2KCTA 4UPAA 2BA0A 3E9FA 3DKMA 1MKHA 4JBKA 2UXDQ 3TS2A 2QQRA 1SFOH 3OYEA 1K8AU 2GQVA 5BR8L 2QI2A 1VQ6A 1VQEA 4WJ4A 2GCXA 3J7AF 2L8DA 3TRZA 1VQPA 5M3FG 5GAMh 3RIRA 1WQWA 3GTMH 3TREA 2R7DA 1X65A 1X54A 3CMEA 4R4QA 1MHNA 4M78C 2QXFA 4A3FH 3PGGA 3CXCS 1UGPB 4BY1H 4OB0B 4GNXB 3CCQA 1I3QH 3U58A 4RMFA 3OBYA 2QEXA 2CS7A 1VQ6T 4M78B 3J80c 5GAOp 4JI6L 3HHTB 3ULPA 2L15A 1N34Q 3FKIH 2GVBA 1CKOA 3VDYA 3AYHB 3DB3A 1WJJA 3KJOA 3HOZG 4QIWE 4ZN3A 5JJLA 5C4JH 4BY6B 3KJPA 4OWWB 5FU7C 1NE3A 5GMKi 4A93H 1HNXL 1VQLA 4DR5L 4QVCA 3UDGA 4A3EH 2A1AA 2UXCQ 4GS3A 3GD7A 5C3EH 1Q82C 4KI0A 2X4XA 2WSFE 2Y4XA 4J6XA 2E5LQ 3CPWS 2UXBQ 1N9RA 2QA4T 1N36L 5GQOA 2P0KA 4EMKB 4IPCA 1UE5A 1S3OA 1N9WA 2XD0A 2RHIA 4JI4Q 2HNIA 4UP7A 1Y96A 5J26A 2HD0A 2XIDA 4JDSA 1Y71A 2DKGA 4PLLA 1KC8C 1KQ2A 3H0GH 4BA2I 3KXTA 3DLLA 3S6WA 3OYFA 1NZ9A 2CZ7B 4OWXB 3ME9A 3HRSA 1LUZA 2Z0SA 4V2SA 2X4WA 3MEFA 2E10A 2EQMA 4HJAA 3G6EA 4XU0A 3J7A5 4M77E 2UXCL 3M54A 3QZ9B 3A8HB 4LUOA 2K2VA 1HJPA 3HOXG 1KQSA 2K4YA 4UP8A 3M56A 4DNIA 3OYHA 1KAWA 4EX5A 1PH2A 2PMZE 1Y96B 1IBMQ 1JJGA 4MZPA 5GAN7 3W1GA 4GOPC 2NVTH 3E9GA 1W2BA 4F7UG 4YWMA 2DXCA 3ZFJA 2KQWA 4JOIC 3HFZB 4JI7Q 2XICA 2I5LX 2N8NA 1EQRA 5GAN8 3JRZA 2LX9A 4AQYL 1Q1BA 4C92A 1G3TA 5JJKA 4FDBA 4PKCC 5I2SA 4CI0C 2I5HA 2ATWA 5FRMA 1M1GA 2ZM6Q 2O01E 2EJGA 3OBWA 5IYDH 5LMUL 4QVZA 4GKKQ 1VQNA 2R7ZG 3CCLA 1QVCA 1Z47A 4KBMB 1NPPA 4HCCA 4O2DA 4ZN1A 3F70A 2L3RA 2DZ9A 2B63H 1M5Q1 1Q7YC 3BZKA 4C3HH 4DAYB 1Y1WH 1K9MC 2R93H 2K57A 2AWNA 3M9BA 4B3MQ 2BH2A 2LQKA 2NLUA 3OYGA 1K3RA 2VL6A 3SWNB 4M7AB 3G71T 4GKJQ 3K7UC 3W5OA 1K9MU 3K80C 2LVMA 3M4GA 4Y91A 2FHDA 1NMFA 4JI0Q 4LNQA 1YJNT 1UGRB 1OXUA 2Y0SE 4YWLA 3VUZA 3I4NG 1SMXA 5GAOq 2L89A 4X64Q 1PVOA 3WXMB 3SWNC 3CQZH 4DKAC 3GLXA 3CCMT 3H0GG 1JBMA 2K5LA 3ZJYC 3EFSA 2HAXA 5LMUQ 3MEAA 4LF6Q 3INZA 2K5VA 4X62Q 5C0XG 5FU6B 2PQAA 2LC4A 2JA7H 2F52A 4YY3L 3TEEA 5CK9A 4C8QF 4EMKC 5IAYA 1Q81C 1ZQ1A 2QEXT 3D0FA 2LRQA 1DJ7B 4DAMA 1NBWA 3JC66 4A3JG 1PH1A 4P73A 4IPHA 5CKDA 2ZJRA 3NEMA 4RCCA 4YCVA 4C92D 4M75E 1N6AA 3FC3A 2RHUA 1YJNA 4C8QC 3X28B 4M7AD 3VUBA 4LFAQ 3OTOL 1WPYA 3OYDA 1YITA 3OYLA 5C4XG 4IOAA 4LW1A 1J6QA 4BBRH 4A3MG 5AJ3L 3S1MH 2NVYH 2YLCA 2FYKA 3UWNA 2VQFL 4M75B 1Q81U 1Q7YU 5JJIA 1XMOL 1GO3E 4F7UE 2V8KA 3J81i 2B8AA 3LGJA 4BB7A 3GOXA 4IFDG 1JT8A 4JRKA 3E19A 2PU9B 1HXDA 2QA4A 3SFMA 2E5LL 3GTJH 1N32Q 1XNQQ 4KLKA 4C92C 1SE8A 4E47A 4M77C 4M75F 4DR2L 2BKDN 2RI5A 1QP3A 3RKWA