1AOJA

The sh3 domain of eps8 exists as a novel intertwined dimer
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPS8
publication title The SH3 domain of Eps8 exists as a novel intertwined dimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction
total genus 6
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aojA00
1WFWA 3LH5A 1XOVA 2DL7A 2C0OA 1PRMC 2EPDA 2EGEA 1MUZA 1RUWA 1WX6A 2D8JA 3M0UA 1VA7A 2HDAA 3VS6A 2L3PA 1M3CA 2EBPA 2XMFA 3EHRA 1JU5C 2RNAA 4EIKA 2DX1A 2J6FA 2C0IA 4Z89A 2VVKA 2LCSA 1OEBA 3REAB 1ZUYA 3SEMA 2MIOA 4HCKA 3H0IA 2LJ0A 2K2MA 1JEGA 4LN2A 2PTKA 3KFVA 1RLPC 1W6XA 1NG2A 1CKAA 4ZNXA 1ZUKA 4CC2A 2CH4W 1X43A 2JS0A 2DBMA 1SHFA 2ED1A 1NLOC 1BU1A 2NWMA 4J9BA 2YDLA 2AKLA 1GCQA 4RTYA 1U3OA 4AFUC 1RI9A 2LJ3A 2RMOA 2JM8A 2F2VA 1J3TA 2OI3A 1PNJA 1NEGA 3PE0A 1UG1A 4ORZA 2F2WA 5IXFA 1UJYA 3H0HA 4AFZC 2GQIA 2X3XD 2CT3A 3UA6A 1AZGB 4M4ZA 4OMLA 2H8HA 2K9GA 5GJVB 1UGVA 4JZ4A 1PHTA 2CSQA 2KYBA 1K9AA 4RTWA 1NM7A 2JMAA 5IXBA 1T0HA 2BZ8A 2J05A 4RUGA 1SRMA 4OMNA 5IH2A 4F17A 2O9VA 2YUPA 1SRLA 1JXOA 2JW4A 2RQRA 1JQQA 1MV3A 1A0NB 4F14A 2K79A 4J9IA 2EGCA 2BZXA 5GJWB 2JS2A 1AWJA 1Z9ZA 2KT8A 2EGAA 3ZL7C 1PKTA 1M8MA 1GFCA 2M0YA 2RPNA 2L3SA 2SEMA 2LMJA 2W0ZA 3M0QA 3VS7A 4HVVA 2EW3A 2K3BA 4CC4B 1UDLA 2DILA 2CUBA 2RQVA 2AZVA 4J9GA 2CSIA 2I0NA 4KRTA 4D8KA 1PRLC 3PVLA 1M3BA 4QT7A 2HEQA 2DE0X 2ABLA 2HBWA 4LUDA 4DEXA 1TG0A 4D8DA 2KT1A 2ROTA 1X69A 2GGRA 1ARKA 1AZEA 1OV3A 3THKA 2CDTA 1CSKA 5EC7A 1NYGA 1U5SA 2AZSA 2DRKA 4AFSC 1T3LA 3SHWA 2CUDA 5FW9A 2PZ1A 2FPDA 3H41A 2O9SA 2YUQA 2RN8A 2LJ1A 2FRYA 1H92A 1WXBA 2D0NA 1GRIA 4HVWA 4Y92A 2YUNA 2ESWA 4JZ3A 1QWFA 2P4RA 1X6GA 2ENMA 1OOTA 4J9EA 1OPLA 2RQUA 2BZYA 1QKWA 1AWWA 1KFZA 1SEMA 2GNCA 2EQIA 1LCKA 1QCFA 1Y0MA 3CQTA 1N5ZA 3RNJA 2D8HA 2EYWA 2L0AA 3A98A 2RQTA 4RTXA 1QWEA 4LUEA 1RLQC 3VS0A 1BBZA 2O2OA 4ESRA 3EG3A 4K11A 3I5RA 1K4US 2J6OA 2PNIA 3VRYA 4AFQC 1WXTA 2EKHA 1KIKA 3NHNA 2EYZA 3GBQA 2RF0A 3I9QA 1IO6A 1ZSGA 2L3QA 2CH4A 2KRNA 3TSZA 2IIMA 3EG2A 4JJDA 2K7AA 4X1VA 5I11A 1UHFA 2C0TA 1UECA 3H0FA 2EYXA 4CC3A 2F2XA 2DJQA 1BB9A 2RQWA 2CT4A 1QKXA 3JV3A 1CKBA 3NMZC 2V1RA 2VWFA 4A63B 2KROA 2DNUA 1ZX6A 1HSQA 1GCPA 2FPEA 2GBQA 1I07A 4CC7A 4F16A 1E7OA 1WLPB 2JMCA 2E5KA 1K76A 4OMMA 1GCQC 2FRWA 5L23A 1E6GA 2MOXA 2ROLA 5IHIA 3UATA 1WIEA 2A08A 4AG2C 1B07A 1Z9QA 3EGUA 1TUCA 1NYFA 2YT6A 3U23A 1UTIA 1AVZC 2ED0A 3R6NA 2HSPA 2DL3A 1JXMA 1X27A 1YNZA 1H8KA 1SHGA 4RTTA 1K1ZA 2OJ2A 2DM1A 1YCSB 1ZLMA 1SPKA 3O5ZA 1ABQA 1SSHA 1WDXA 1WA7A 1GBQA 4J9CA 1G83A 2BTTA 1OPKA 1KSWA 3M0PA 1AOJA 1YWOA 3M0TA 2A37A 1E6HA 1AEYA 2A28A 2DBKA 2KRMA 4GLMA 3PVQA 2L2PA 2LQWA 1G2BA 2YUOA 1M27C 1X6BA 2GTJA 2DVJA 2HCKA 4GBQA 1UFFA 1UUEA 3IQLA 3VS2A 3UA7A 3NPFA 3TVTA 2KXCA 1TUDA 1K0SA 2EVRA 3VS5A 2K6DA 1AWOA 2DYBA 2B86A 2JT4A 2LP5A 3NGPA 2VKNA 2J7IA 1GBRA 4DEYA 1ABOA 4IIMA 4HVUA 2J06A 1W1FA 1M30A 2JM9A 2FEIA 2O31A 3ULRB 3VRZA 2CREA 4RTZA 3QWYA 4J9FA 4RTUA 1PKSA 3EG0A 1MV0B 1FMKA 4FSSA 3I5SA 1YP5A 4JJBA 1S1NA 2DL5A 4J9HA 4HXJA 2KXDA 5IHKA 1UHCA 2YSQA 2KGTA 2W10A 2AKKA 2FPFA 2JXBA 1AD5A 2DMOA 1M3AA 1FYNA 2DL8A 3TSWA 4R0KA 2NUZA 2MCNA 2D1XA 3VS4A 3QWXX 1KJWA 1UJ0A 1NLPC 2GTOA 1HD3A 3EG1A 4OMOA 3M0SA 1GL5A 2KNBB 2KYMA 1Y57A 1I0CA 2KE9A 5HCKA 4WCIA 2KR3A 2X3WD 1VYVA 4JJCA 2FO0A 2QDLA 1EFNA 4JPBW 2A36A 1ZBJA 1H3HA 2DLPA 1T3SA 2KEAA 1WI7A 4LE9A 5IHNA 1VYTA 1B3QA 3REBB 2DF6A 3EHQA 1UE9A 1HJDA 3M0RA 4J9DA 4Z8AA 1YN8A 2JTEA 3RBBB 2J6KA 5I22A 2DA9A 1YWPA 3I35A 5ECAA 2AK5A 2LZ6B 3C0CA 1PWTA 1JO8A 1T0JA 4Z88A 5FWCA 4E6RA 4OMQA 1GFDA 4LNPA 3UF4A 3VS3A 2EYYA 1I1JA 4AG1C 1W70A 1WXUA 1VYUA 2ECZA 2KRSA 2SRCA 2M51A 4IIOA 4RTVA 1WYXA 1BK2A 1U06A 3FJ5A 2KBTA 2LQNA 3VS1A 1NEBA 1X2KA 1X2QA 1QLYA 2DRMA 1ZUUA 2G6FX 2OAWA 2LNHB 1V1CA 2DL4A 4OMPA 1K0XA 2FG0A 2V1QA 1AWXA 2O88A 2LX7A 5FWBA
chains in the Genus database with same CATH superfamily
2COZA 1D1BA 3LH5A 1W2BP 4MZTA 2EGEA 2CP2A 1SKUB 3F70A 2GF7A 1I4K1 1VA7A 2HDAA 2E5QA 2HQEA 2KK4A 2EBPA 3TU4K 2XMFA 2RNAA 3PTAA 4C5HA 5LJ3h 4XTXA 3CCRQ 2YRDA 2PU9B 2C0IA 4Z89A 2LCSA 5LJ5g 3SEMA 1YHQA 4M75G 4HCKA 1IZ6A 1OZ2A 1YI2Q 3RUXA 3OW2S 3OS0A 3KFVA 2EJFA 2QQAA 3LGLA 5GAOq 1C0MA 5KYXA 1X43A 2QTVA 4PFPA 2EQJA 2ED1A 5CR2A 2K5LA 2FL7A 2DXCA 2HAXA 4WTOB 4M7DF 1U3OA 1O75A 2F2VA 3G7ZA 2M1HA 2OI3A 2RB6A 4M78G 3PE0A 3RKWA 3H0HA 4AFZC 5GANj 4M7DE 4EMGA 2JJ9A 3JCMd 2VXFA 1PD1A 2H8HA 3E9FA 1UGVA 2CSQA 2RHIA 2JOYA 2WACA 5IH2A 2KAFA 1D3BB 3QUIA 1SRLA 1BCMA 2QAZA 4OB2B 4M75D 1I8FA 4F14A 3CMAA 4J9IA 2EGCA 4C92A 1IREB 1IB8A 1KD1U 3OS5A 4WF2A 2V8JA 1ZQ1A 4M75B 1VQ7Q 3JCMV 1P92A 4FW1A 2A0FB 4RCCA 3CCUT 4CC4B 2DILA 3GIBA 2BIVA 3M5AA 3JB9I 1XNIA 5FRNA 3S6WA 2I0NA 1PRLC 1KQSP 1WJRA 4MZMA 4DEXA 4ZGDB 4M7AD 2ZPHB 4RG2A 4FM4B 2GGRA 3SWNA 2L5QA 4N0AC 1OV3A 1NZ9A 2WSFE 1MNDA 3OA6A 4M7AB 2VC8A 2OTLQ 1U5SA 2AZSA 4ELYC 1RAGB 2DRKA 3CCRT 1T3LA 1LOJA 5FW9A 3VU3C 1BI3A 3FLGA 4HCBA 1YCYA 2QXFA 1YI2T 4QVCA 1N6AA 1VQ4Q 1VQPQ 1H92A 5KYUB 2D0NA 1KHCA 4HVWA 4Y92A 3L2WA 2ESWA 1TWBA 1X6GA 5FRMA 3VV0A 3V8LA 5J39A 4NL3A 4PJOF 2YRVA 1QKWA 2JTFA 3G4SQ 1SEMA 3CCET 5GAN5 3I55Q 1N5ZA 1M8VA 3H8ZA 4NOYA 4PJOE 2RQTA 2CP6A 4C5EA 1QWEA 4LUEA 1MMGA 3I5RA 5GAMh 3AT1B 1WGSA 3VRYA 4P5NA 2EKHA 3QHSA 1W2BS 2EYZA 1WJSA 3QZ9B 3GBQA 5FU7C 2RF0A 2DK3A 1TH7A 3OMGA 2F5TX 1G3YA 2CH4A 2KRNA 3TSZA 3DKMA 5I11A 2DXUA 1D1AA 2NUTB 2EYXA 2QEXQ 5KH6A 2F2XA 1QCNA 2DJQA 1BB9A 3CCMA 2MK5A 2CT4A 1QMCA 3OYBA 1RAFB 3LWHA 4TVRA 3VKIA 2ZPFB 1YJ9A 1HSQA 2FPEA 3TCJA 4BD3A 5LJ3e 4JUVA 2YLBA 2M16A 2JMCA 1YHQQ 1K76A 4OMMA 2MOXA 1UGPB 3QDFA 2OX7A 4FYXB 5IT9E 1Z9QA 3EGUA 2E10A 4MZPA 2QK0A 3U23A 1UTIA 3A5ZB 3R6NA 1JJ2A 5C6SA 3QXEB 2DL3A 9ATCB 4FYYB 1X27A 3PT9A 3CXCP 1SHGA 5FLXE 3OMCA 1YCSB 3UPUA 3P8DA 2VUBA 1VUBA 3JSCA 1RAIB 2PVDB 2I2LA 1GBQA 1YITA 1K8AU 2BTTA 4QQGA 3AHUA 1VQ4T 2ATCB 3L1AA 1VQPT 1YWOA 3QPHA 3OYDA 2IPOB 4KUDK 2MWOA 1B7TA 2A28A 1VIFA 4ZTJA 5GAMf 2MF2A 4R56A 2L2PA 2LQWA 2DAQA 2JTMA 2QGFB 3EAEA 2HCKA 1VQ5T 3UA7A 4PJJA 3I55T 3TVTA 3E2UA 1G3WA 3CMAQ 5GANh 2LVMA 2JT4A 1HYOA 4HVUA 1SSFA 2RI5A 5KYXB 5HK0A 2HL3A 2O01E 3M4GA 3MEVA 1YIJT 1IXDA 4J9FA 1Q82U 4RTUA 3EG0A 3QZ5B 1M1KC 1FMKA 1S1NA 4BE1A 2LT4A 2NYSA 2DL5A 4HXJA 5IHKA 3VUZA 2XIDA 4RKUE 2AKKA 4ZGEB 1AD5A 3G71A 2DMOA 2XI9A 1YFNA 2DL8A 2NUZA 2MCNA 2D1XA 5GMKh 3JCMb 3MEAA 4C0ZA 3CC4T 1F1BB 5AT1B 3QBYA 1VQMA 1XQHA 4C92D 1C1AA 5D6YA 2LX9A 4E7KA 1Q81U 4C8QC 5LJ3j 3M0SA 3CD6A 1TU0B 2KYMA 1Y57A 2D9TA 4WCIA 1YHQT 2X3WD 4E7ZA 1ZSZB 4VUBA 2DFUA 2YXYA 4JPBW 3V7RA 1MMAA 2KEAA 1ZA1B 1WI7A 4LDXA 5A2QE 3I56Q 1B3QA 3REBB 3EHQA 4LXCA 3C95A 3S3OA 2CZ1B 4BE2A 3M0RA 4J9DA 5HKCA 4Z8AA 3QIIA 2DA9A 4HCCA 1YWPA 2ZPEB 3I35A 2AK5A 3C0CA 5CQYA 1JO8A 4OMQA 2P0QA 4M75A 5FU6C 5GANf 1WHMA 2P0KA 1I1JA 4M77C 5GAMe 2WSEE 3SWNB 2E1HA 1Q7YC 2OTJQ 4IIOA 3LW5E 1VQ9T 1MHNA 1BK2A 5CKEA 2KBTA 3HKSA 1TUGB 2M9UA 1NJIR 3JCMh 1LJOA 2XD0A 1D0ZA 4X34A 4JDSA 3CMAT 1H3ZA 3QSUA 1X75C 4HCZA 4M78A 3CCMQ 4XTWA 2V1QA 1AWXA 1NPRA 2DXBA 3LYIA 1AHJB 1IHWA 5FWBA 2LC4A 4OB1B 2DL7A 2LDMA 1PRMC 2QGGA 2DD5A 2FHDA 1MUZA 3META 1PC0A 3VS6A 1YJNA 2EJ9A 3MP8A 3CXCS 4A53A 2QQ9A 3J7AF 4EIKA 4F7UG 2KDSA 2DX1A 2J6FA 2EQKA 1IRXA 2DTOA 4OB0B 2VVKA 1OEBA 4DA4A 3H9NA 2K2MA 2E64A 4NS5A 1BI2A 5M9OA 4X9DA 3MJXA 5EG2A 4CC2A 2L8DA 1B34A 2DBMA 4FCYA 4RMOA 4X9CA 3EFOA 1BU1A 2LTOA 2NWMA 4EMKC 1S72A 4J7IA 3ER0A 1YITQ 2AKLA 1GCQA 2DO3A 4N4IA 4AFUC 2LJ3A 2RMOA 4E7LA 2XDDA 3I56T 1UG1A 1TS9A 5IXFA 3JB9G 2CT3A 3UA6A 1AZGB 4M4ZA 4FSXA 1TSFA 4OMLA 2KSSA 2K9GA 1PHTA 1K9AA 4J6YA 2NUTA 3ME9A 5IXBA 2BZ8A 4M7DA 4RUGA 2G3RA 2CZ7B 3LGFA 1M1KR 2EQMA 1C6VX 2X4JA 2RQRA 1KC8U 2HZYA 2BZXA 1VQ8A 3M58A 2K3YA 2OTJT 4F7UB 2FB7A 3CCVA 1NPPA 2EGAA 1PKTA 3LX7A 1WPYA 2M0YA 3EH2A 4B6MA 1TOVA 4GLKA 4E2FB 3JCMX 4ATOA 2W0ZA 3VS7A 5KCHA 4HVVA 2EW3A 2YRCA 3V7SA 2RQVA 2CYZB 2AZVA 2MYSA 3CCMT 4JRQA 4J9GA 3CC7A 4QT7A 2HEQA 5GMKe 3CPWA 2ABLA 2HBWA 3QDRB 3JB9D 1TG0A 5LJ5d 2KT1A 1VQMQ 3OYNA 1OYXA 4PFOA 2X4WA 1ARKA 3CD6Q 1Y96A 1K73U 5D6XA 1WNLA 4KH1B 4C8QF 4C92C 3X25B 3V8KA 3CBPA 5GANg 2FPDA 5A0GA 1M90U 2YUQA 2LJ1A 4C8QE 1WXBA 4L6V5 1D0YA 3J81E 1GRIA 2DIGA 3CCQA 2RJCA 4JZ3A 3CCST 1QWFA 2XHCA 2EKOA 4PLLA 2ENMA 4IUPA 1OOTA 2HBPA 4J9EA 4LDUA 2RHZA 1Q7YR 4C0DB 1N8RU 3PNWC 2RQUA 2BZYA 8ATCB 1YITT 3GF5A 1AWWA 3JRZA 2GNCA 2COWA 2EQIA 1LCKA 4BACA 1M2VA 1Y0MA 2CS7A 2HKQB 1ZA2B 1U8RA 3RNJA 2D8HA 2OAUA 4QW2A 2L0AA 3GNGA 1RLQC 3RMQA 3VS0A 1BBZA 2HL5C 4M77F 4K11A 1Y07A 4AFQC 3L2VA 1H641 1WXTA 2RK1A 5CKBA 1YJWT 1R0CB 1KIKA 1PCXA 3JCMe 2MWPA 4M77E 3JB9H 1IO6A 4J7FA 4JJDA 2K7AA 4X1VA 1SF9A 1UECA 3H0FA 4OF1A 4A4HA 3PIOA 3CCLA 4IKFA 3V8JA 2RQWA 1I5LA 5DLQE 3ASKA 3HRSA 4HKEA 2R57A 4A63B 3OYGA 4A4EA 2CP0A 1ZSZA 1YJNQ 2BE7D 1GCPA 1EZZB 3HHTB 1WQWA 4DOVA 1QVGA 1OULA 5DM7R 5CVIA 3P8HA 2E4HA 1I07A 5GAN4 3QO3A 1K9MU 4L5GA 2E5KA 5GMKj 1R8OB 1QVFP 1E6GA 3UATA 1WIEA 1QP3A 3OYHA 1VQLA 4FYVB 1TUCA 4JS4A 2QDYB 5LJ3f 3TEEA 1AVZC 2ED0A 4M78D 3M57A 3QJYA 1YNZA 1K73R 1H8KA 2ZAEA 3X26B 2FVUA 1S72Q 3L2UA 2K57A 2FZGB 1SPKA 5J26A 4M78B 3OYJA 2L3RA 3O5ZA 1SSHA 1RACB 1G83A 3OYAA 3X28B 1BIBA 3NTKA 3M0PA 4M77G 1AOJA 2PUKB 3M0TA 3ZEHA 2LRQA 4M7DG 3CC2A 2RHYA 1AEYA 5A0LA 3PVQA 1M27C 1X6BA 3CMEQ 1LNXA 4GBQA 4FIBA 3IQLA 3VS2A 3FDRA 4A4FA 5GAOp 2EVRA 2HQHA 1VQ8Q 2B86A 3NGPA 4ZTFA 4KH0B 2XDBA 2DZCA 2JM9A 3JB9J 4YTLA 3HRUA 1B34B 1VQNQ 1PKSA 3EFOB 3NTHA 4FSSA 4PJNA 2CZ6B 2PVOB 3MP1A 4E7SA 2PQWA 3CC7Q 2YSQA 4HT9A 2COYA 2EAYA 4M7DD 4OGCA 4BY6C 2CZ0B 4XU2A 1X6OA 3LH0A 4QVZA 3PGGA 3CPFA 4M7DB 1DJ7B 3O8VA 1HD3A 1KD1R 5CK9A 1NJIC 4JRKA 3CCJA 2KNBB 5FROA 1GL5A 1VQ7T 2KE9A 2ZGWA 1QW1A 4C92F 4JJCA 2IG0A 2QDLA 4QQDA 1EFNA 2QQSA 7AT1B 1X01A 2A36A 1ZBJA 3OW2A 2DLPA 4AMCA 1IGQA 1AT1B 3CCQQ 2K3XA 1KG1A 2RHXA 4FT4A 4C92E 1VQOA 1HJDA 1R77A 3JAME 3UT1A 1S72T 3RKYA 1G3TA 4N4HA 3OYKA 3LLRA 4OVAA 1ZHIA 5AYFA 2GCXA 3WVDB 5ECAA 3X24B 3PFSA 1PWTA 4F7UA 5GAOr 3OB9A 3OQ5A 4Z88A 5FWCA 4PJOG 1GFDA 2OTLT 4II1A 1WXUA 2HKNA 1VYUA 5L8RE 1RAEB 4QQ6A 4RTVA 4C5IA 1WYXA 1Y96B 1U06A 3SFMA 3CMET 4RCBA 2P0PA 4OP0A 2FZCB 5HY6A 2ZPGB 1NEBA 4XK8E 1X2KA 1X2QA 1QLYA 3OS1A 1ZUUA 2HD0A 3PIPA 3CCLQ 5HK3A 4MDWA 5I2MA 2OAWA 2DL4A 3G4ST 2NUPA 3EFSA 2FG0A 1QVFS 3WVEB 2O88A 2LX7A 3A8GB 1QVGP 5LJ3g 1VQNT 1XOVA 1LPLA 2C0OA 2EPDA 2M0OA 3PMTA 2QQBA 5CO7A 1WX6A 1RUWA 3BFMA 2D8JA 2C06A 3CBMA 3M0UA 1KQSS 2QYZA 1OZ3A 2L3PA 1W4SA 2YHTA 3CC7T 1M3CA 4M75C 1M2VB 1Q86U 1JU5C 4PNOA 2DETA 4PJOD 4A54A 3REAB 3A1PA 2GFUA 4JJNK 1VQLQ 1M9SA 3H0IA 2LJ0A 2PTKA 4PJOB 2XDPA 3FRNA 1KHIA 2QEXT 1CKAA 2GQVA 1KK7A 2CH4W 4BDYA 5LJ5h 2JS0A 1NE8A 1SHFA 1IHVA 2VXEA 1NLOC 4M78C 3GOXA 4J9BA 2YDLA 5I2SA 4RTYA 4M7AC 2JM8A 3L42A 1PNJA 3CCQT 3CC2Q 1NEGA 1WZOA 1UJYA 3SB2A 2GQIA 2X3XD 2PVGB 3FEOA 4JZ4A 3OYIA 1QCOA 4RTWA 3EFRA 2JMAA 2J05A 4FYWB 3WXMB 1SRMA 2DPPB 4OMNA 3E19A 4V2SA 1G8XA 2O9VA 3MPUB 1KQ1A 2JW4A 1MV3A 1A0NB 4XQ3A 2K79A 2ZPBB 4FU6A 4CI0C 5CKFA 2JS2A 2QI2A 2KT8A 2CP3A 5IAYA 2EFIA 3ZL7C 1W2BA 4B9XA 1M8MA 3NTIA 3JCMQ 1K8AR 1GFCA 2RPNA 3M0QA 3KXTA 3CCRA 2K3BA 2K4YA 4O6JA 2EQUA 3OSSC 1UDLA 2K5FA 5D7UA 2M02A 3RERA 1WHLA 1WHKA 3D7SB 4KULA 3PVLA 3Q1JA 2DE0X 3X20B 2Y4XA 5GAN6 2D0QB 1RABB 4D8DA 1MMNA 2KQWA 1AZEA 4C5GA 2RO0A 5GAOm 3CCJQ 2DTIA 3CCEA 5EC7A 1Q82R 1YJ9Q 4PL6A 2CUDA 2PZ1A 4EPCA 3N5BB 1VQLT 3H41A 3GP8A 2O9SA 1VQ6A 2YWWA 3S3MA 4DBRA 1VQOQ 1JB0E 2O4XA 1M4ZA 2CP5A 3OBWA 1JJ2P 4C8QA 1D1CA 1VIEA 1G3SA 5GAMg 3QG1A 1KFZA 5CAIA 2RJDA 3RMSA 3TQ7P 2EYWA 1Q81R 3CC2T 4BI4A 3DLMA 1ZBXA 4CRIA 5KYWA 2O2OA 3EG3A 4XTUA 1K4US 2J6OA 2KMTA 4A4GA 3SD4A 1R0BG 3NHNA 5KYYA 3DB4A 1U1SA 1K73C 3GLXA 1ZSGA 2JZ2A 3A8MB 2L3QA 1VQKA 3G1JA 1UHFA 2C0TA 1N9RA 1FMWA 4CC3A 2K5IA 2EYQA 4M77A 3PMIA 3JCMf 1QKXA 4OGEA 1CKBA 5CCAA 2V1RA 5KYNA 2VWFA 5GMKm 2DNUA 3M54A 2HMAA 4DBHA 3TREA 4F04B 2GBQA 1E7OA 4M75F 3OYLA 3HL8A 1VQ4A 2E65A 1VQPA 2FRWA 5IHIA 2DKGA 2A08A 4M75E 3G71Q 1OX9A 2E70A 2YT6A 3A8OB 5IN1A 3V7CA 1VQ5A 1MMDA 2HNIA 1QQJA 5LJ5e 3CCJT 1JXMA 1FWZA 2DD4A 5A0DA 3I55A 4RTTA 4RG8A 2LQKA 2P84A 2OJ2A 1YJ9T 3HRTA 1ZLMA 3BE3A 4BI8B 2LCCA 2E12A 2VB6A 3HFNA 2NUPB 1ABQA 1WDXA 1WA7A 4J9CA 8AT1B 4M7AF 1OPKA 1Q95G 2QA4A 2A37A 1ZSZC 1YIJA 1E6HA 4JLIA 2PUOB 5FU7B 3HPWA 4J83A 3C94A 4PFZA 4M7AE 2YUOA 1G2BA 4FW2A 1JRIA 2GTJA 4IUUA 2X35A 4PK4A 3M56A 3VJPA 1KD1C 2EJGA 4FL6A 3NPFA 4J6WA 4BUGA 1TUDA 5GAN2 1K9MC 3VS5A 3BDLA 4XU0A 2DYBA 2LP5A 2AIRB 2VKNA 4DEYA 1ABOA 2QASA 2J06A 3CC4A 3VRZA 3EGXA 4QKUA 4RTZA 4PJMA 4IURA 2R5MA 4KUIA 1XJWB 3QWYA 2Y4YA 3BW1A 1Y71A 1WQ7A 3SWNC 4N4GA 3I5SA 4NL2A 4LD9K 1YP5A 2VGNA 3URGA 4J9HA 3QYHB 3RR6A 1UGRB 2KGTA 2W10A 4UC4A 4PJOA 1BYMA 1UEBA 4BE0A 2GFAA 1M1FA 3JCMJ 1M3AA 1FYNA 4R0KA 4IUTA 4LDWA 1IGUA 3QWXX 4EMHA 3EH1A 1FX7A 1D09B 3C4SA 1KC8R 1NLPC 4HA8A 4E7HA 3CCEQ 3C12A 1JJ2S 1PG5B 3CXCA 2DIQA 1O9SA 2Z0WA 4KGZB 1G5VA 1QP2A 1I0CA 1EX4A 1EIFA 4DQ2A 4M7AG 1WHGA 1OU8A 2FO0A 1VQ6Q 2JN0A 3BY7A 4Y91A 4C8QG 1BCOA 3G71T 3OYEA 6AT1B 1VYTA 4MMKA 1VQ9A 4J6XA 2JNGA 2DF6A 5LJ5j 1LVKA 3FIFA 4JRPA 1HK9A 3RBBB 1VQMT 1XTDA 2LZ6B 2KI7A 3CD6T 1T0JA 3R6OA 2IVWA 4LNPA 5CKHA 3VS3A 1HXDA 3JCMg 5GAN3 1YBYA 2R5AA 2ECZA 2KRSA 2SRCA 4EDUA 2M51A 2LT1A 2JVVA 2LQ8A 3FJ5A 3ZFJA 1M90R 4XU3A 1RAAB 3OY9A 3LWIA 2JUFA 2RI2A 1VQKQ 3J80E 4PJLA 2G6FX 2LNHB 5LL6S 4C8QD 1N8RR 2KY9A 1K0XA 2O4XB 4ANJA 1JBMA 1RAHB 2H3JA 4XTVA 3FB9A 1WFWA 4J8OA 1PSFA 3EGDB 4JLGA 4C8QB 3BDUA 3T9NA 3CCVQ 5GAN8 2DTHA 4XTYA 1V29B 3EHRA 3MEWA 4KGXB 3H6ZA 4LD6A 3CEYA 5GAOl 1ZUYA 3I56A 3G6EA 3CPWP 5KYWB 2MIOA 3EG9A 1JEGA 1MGQA 4LN2A 2ZCFB 1VQ5Q 1RLPC 1W6XA 5KYYB 1NG2A 4ZNXA 1ZUKA 1K8AC 2V26A 4M77D 2RK2A 4O5VA 1M2OA 3S3NA 2LNVA 5GAN7 5FU6B 3HTRA 1YJNT 4M77B 1VQ6T 4XAXB 3RESA 4C0FA 2QA4Q 1RI9A 1BKBA 2OTJA 1J3TA 1WHJA 3MKDA 1YIJQ 2XU8A 4ORZA 1K9MR 2DEQA 2F2WA 2RJFA 3VYGA 2VYTA 3NFCA 3M9QA 3MCAB 1UB4A 5GJVB 4OMFB 2KYBA 1SG5A 2AT1B 3DB3A 1NM7A 5D6WA 1T0HA 1Q86C 4ZGJB 4N0AA 5GAOn 1Q82C 5DY9A 4F17A 4E47A 4C0DC 3OYFA 2YUPA 3L2QA 1JXOA 1JQQA 3CC4Q 2QQRA 2WSCE 4PLIA 4BDZA 5GJWB 4KGVB 1M5Q1 1AWJA 1Z9ZA 4ZN3A 4ZN1A 1FMVA 1UGSB 2E6ZA 2RJEA 1PM3A 2V8IA 4D6WA 2L3SA 2SEMA 2LMJA 1VQKT 5GMKl 5LJ3d 4LDVA 1TTHB 2YLCA 2CUBA 2CSIA 4KRTA 4D8KA 2X51A 5J3BA 1M3BA 2HQXA 1Q81C 1U1TA 3OSVA 4OB3B 4LUDA 3L2ZA 3HSBA 2CKKA 3CCSA 1VQ8T 1PD0A 1I5OB 2ROTA 2ZPIB 1QVPA 3CCVT 1X69A 4EMKB 3RKXA 2FYKA 3THKA 3HFOA 5KE3A 2CDTA 1CSKA 1NYGA 5DLOA 4AFSC 4IUVA 3SHWA 1VOMA 2X4YA 4FT2A 2RN8A 3EGXB 3RDVA 1VQ9Q 3JCMW 2FRYA 4C92G 2V8KA 1NJIU 1YJWA 3VYHB 2F69A 2YUNA 2P4RA 4ELZC 1OPLA 2VASA 3GPLA 2HSEB 2EIFA 1BIAA 2MAMA 4MDXA 2QA4T 3ZBDA 1QCFA 3CQTA 2MI6A 3DLLA 2DZ9A 5CKDA 2RA2A 1GXIE 3A98A 4BB7A 4RTXA 4JS5A 4Z02A 2MPXC 4ESRA 4A4KA 2PNIA 1OQKA 3OYCA 1M1GA 3VUBA 4Q5WA 1WJQA 3I9QA 2DYIA 2RM4A 2IIMA 1OX8A 3EG2A 2KVQG 3CCUA 4DBFA 2MMPA 3MO8A 2E6NA 4L59A 4XU1A 3CPWS 1ACMB 1N9SA 2CP7A 3A8LB 3JV3A 5I21A 3NMZC 1WHHA 2BKDN 2KROA 1RL2A 1ZX6A 3JCMP 4C92B 3M59A 4F7UF 1I81A 2AHJB 4IUQA 4CC7A 4F16A 3GNFB 3MEUA 3UDCA 2RH2A 1WLPB 3G6EQ 3HP9A 1OU9A 4JRIA 4F7UE 1GCQC 5L23A 2ROLA 2E3HA 1D3BA 5CIUA 1TXQA 3CCLT 4AG2C 1B07A 1MNEA 1YI2A 1NYFA 2K2VA 3CBOA 1BI1A 2DXTA 2HSPA 4PKCC 1M1KU 2NLUA 2VV5A 4KT0E 2DJZA 4QVDA 1K1ZA 3KUFA 2DM1A 2D6FA 4M7DC 3INZA 5KCOA 2B8AA 4HT8A 3JB9F 3M53A 5LJ5f 5GAMd 3OW2P 1KSWA 1Q86R 2BE9B 4ME7A 4DOWA 1KQ2A 2DBKA 2KRMA 2R58A 4GLMA 2DEUA 1KC8C 3M4YA 2RD1A 2H3EB 3E9GA 2RHUA 2DVJA 2A7YA 2E3IA 1UFFA 1UUEA 1PSEA 5KE2A 3QYGB 4M7AA 2KXCA 1K0SA 2K6DA 2ZZDA 1AWOA 3EGDA 3EG9B 2RI3A 1GBRA 2J7IA 4IIMA 1W1FA 1M30A 2O31A 2FEIA 4J5YA 3ULRB 2F5KA 2CREA 3FC3A 5KYUA 1MV0B 5C0MA 1VQ7A 4JJBA 4GY5A 1QVGS 2KXDA 1UHCA 4MMLA 2FPFA 2JXBA 1QVFA 3TSWA 3VS4A 3CCSQ 3P8BB 1RI0A 2QG9B 1KJWA 2CGHA 2F1LA 1Q7YU 3JCMc 5GMKi 1UJ0A 2P4TA 2DVEA 3OBYA 2XKOC 3OS2A 1KQSA 3OYYA 4C0GA 1M90C 2XICA 5CQXA 2E41A 2GTOA 1UGQB 4LDYA 2XK0A 3EG1A 4OMOA 3MP6A 3G6ET 5HCKA 2OTLA 2KR3A 3A8HB 1VYVA 1OI1A 2A3LA 1N8RC 1H3HA 3RIRA 3UWNA 1T3SA 1YJWQ 4LE9A 5IHNA 1N27A 3CMEA 4AT1B 4DBQA 1UE9A 3SDZA 5GANe 1V76A 4KBMB 4PJOC 1YN8A 2JTEA 1BI0A 2J6KA 5I22A 2BUDA 3L2RA 5GAMj 5GANd 1D0XA 2X4XA 1NBEB 4B9WA 4E6RA 1Y7XA 3G4SA 2FZKB 2X9HA 2EYYA 3UF4A 2EWNA 4AG1C 1W70A 4XTZA 2L89A 3E1SA 4R55A 1VQNA 2DERA 3QKJA 3FJPA 4M78F 4E7JA 3OYMA 3KBGA 1VQOT 2LQNA 4E7IA 3VS1A 2Y90A 4M78E 3QJ6A 1FXXA 3CCUQ 2DRMA 3MHXA 2QTXA 4BY6B 4BI3A 1RADB 3M55A 1V1CA 4EMKA 4OMPA 2XG8D 2QEXA 2VGMA 2LCLA 4Y28E
chains in the Genus database with same CATH topology
1WFWA 3LH5A 1XOVA 2DL7A 2C0OA 1PRMC 2EPDA 2EGEA 1MUZA 1RUWA 1WX6A 2D8JA 3M0UA 1VA7A 2HDAA 3VS6A 2L3PA 1M3CA 2EBPA 2XMFA 3EHRA 1JU5C 2RNAA 4EIKA 2DX1A 2J6FA 2C0IA 4Z89A 2VVKA 2LCSA 1OEBA 3REAB 1ZUYA 3SEMA 2MIOA 4HCKA 3H0IA 2LJ0A 2K2MA 1JEGA 4LN2A 2PTKA 3KFVA 1RLPC 1W6XA 1NG2A 1CKAA 4ZNXA 1ZUKA 4CC2A 2CH4W 1X43A 2JS0A 2DBMA 1SHFA 2ED1A 1NLOC 1BU1A 2NWMA 4J9BA 2YDLA 2AKLA 1GCQA 4RTYA 1U3OA 4AFUC 1RI9A 2LJ3A 2RMOA 2JM8A 2F2VA 1J3TA 2OI3A 1PNJA 1NEGA 3PE0A 1UG1A 4ORZA 2F2WA 5IXFA 1UJYA 3H0HA 4AFZC 2GQIA 2X3XD 2CT3A 3UA6A 1AZGB 4M4ZA 4OMLA 2H8HA 2K9GA 5GJVB 1UGVA 4JZ4A 1PHTA 2CSQA 2KYBA 1K9AA 4RTWA 1NM7A 2JMAA 5IXBA 1T0HA 2BZ8A 2J05A 4RUGA 1SRMA 4OMNA 5IH2A 4F17A 2O9VA 2YUPA 1SRLA 1JXOA 2JW4A 2RQRA 1JQQA 1MV3A 1A0NB 4F14A 2K79A 4J9IA 2EGCA 2BZXA 5GJWB 2JS2A 1AWJA 1Z9ZA 2KT8A 2EGAA 3ZL7C 1PKTA 1M8MA 1GFCA 2M0YA 2RPNA 2L3SA 2SEMA 2LMJA 2W0ZA 3M0QA 3VS7A 4HVVA 2EW3A 2K3BA 4CC4B 1UDLA 2DILA 2CUBA 2RQVA 2AZVA 4J9GA 2CSIA 2I0NA 4KRTA 4D8KA 1PRLC 3PVLA 1M3BA 4QT7A 2HEQA 2DE0X 2ABLA 2HBWA 4LUDA 4DEXA 1TG0A 4D8DA 2KT1A 2ROTA 1X69A 2GGRA 1ARKA 1AZEA 1OV3A 3THKA 2CDTA 1CSKA 5EC7A 1NYGA 1U5SA 2AZSA 2DRKA 4AFSC 1T3LA 3SHWA 2CUDA 5FW9A 2PZ1A 2FPDA 3H41A 2O9SA 2YUQA 2RN8A 2LJ1A 2FRYA 1H92A 1WXBA 2D0NA 1GRIA 4HVWA 4Y92A 2YUNA 2ESWA 4JZ3A 1QWFA 2P4RA 1X6GA 2ENMA 1OOTA 4J9EA 1OPLA 2RQUA 2BZYA 1QKWA 1AWWA 1KFZA 1SEMA 2GNCA 2EQIA 1LCKA 1QCFA 1Y0MA 3CQTA 1N5ZA 3RNJA 2D8HA 2EYWA 2L0AA 3A98A 2RQTA 4RTXA 1QWEA 4LUEA 1RLQC 3VS0A 1BBZA 2O2OA 4ESRA 3EG3A 4K11A 3I5RA 1K4US 2J6OA 2PNIA 3VRYA 4AFQC 1WXTA 2EKHA 1KIKA 3NHNA 2EYZA 3GBQA 2RF0A 3I9QA 1IO6A 1ZSGA 2L3QA 2CH4A 2KRNA 3TSZA 2IIMA 3EG2A 4JJDA 2K7AA 4X1VA 5I11A 1UHFA 2C0TA 1UECA 3H0FA 2EYXA 4CC3A 2F2XA 2DJQA 1BB9A 2RQWA 2CT4A 1QKXA 3JV3A 1CKBA 3NMZC 2V1RA 2VWFA 4A63B 2KROA 2DNUA 1ZX6A 1HSQA 1GCPA 2FPEA 2GBQA 1I07A 4CC7A 4F16A 1E7OA 1WLPB 2JMCA 2E5KA 1K76A 4OMMA 1GCQC 2FRWA 5L23A 1E6GA 2MOXA 2ROLA 5IHIA 3UATA 1WIEA 2A08A 4AG2C 1B07A 1Z9QA 3EGUA 1TUCA 1NYFA 2YT6A 3U23A 1UTIA 1AVZC 2ED0A 3R6NA 2HSPA 2DL3A 1JXMA 1X27A 1YNZA 1H8KA 1SHGA 4RTTA 1K1ZA 2OJ2A 2DM1A 1YCSB 1ZLMA 1SPKA 3O5ZA 1ABQA 1SSHA 1WDXA 1WA7A 1GBQA 4J9CA 1G83A 2BTTA 1OPKA 1KSWA 3M0PA 1AOJA 1YWOA 3M0TA 2A37A 1E6HA 1AEYA 2A28A 2DBKA 2KRMA 4GLMA 3PVQA 2L2PA 2LQWA 1G2BA 2YUOA 1M27C 1X6BA 2GTJA 2DVJA 2HCKA 4GBQA 1UFFA 1UUEA 3IQLA 3VS2A 3UA7A 3NPFA 3TVTA 2KXCA 1TUDA 1K0SA 2EVRA 3VS5A 2K6DA 1AWOA 2DYBA 2B86A 2JT4A 2LP5A 3NGPA 2VKNA 2J7IA 1GBRA 4DEYA 1ABOA 4IIMA 4HVUA 2J06A 1W1FA 1M30A 2JM9A 2FEIA 2O31A 3ULRB 3VRZA 2CREA 4RTZA 3QWYA 4J9FA 4RTUA 1PKSA 3EG0A 1MV0B 1FMKA 4FSSA 3I5SA 1YP5A 4JJBA 1S1NA 2DL5A 4J9HA 4HXJA 2KXDA 5IHKA 1UHCA 2YSQA 2KGTA 2W10A 2AKKA 2FPFA 2JXBA 1AD5A 2DMOA 1M3AA 1FYNA 2DL8A 3TSWA 4R0KA 2NUZA 2MCNA 2D1XA 3VS4A 3QWXX 1KJWA 1UJ0A 1NLPC 2GTOA 1HD3A 3EG1A 4OMOA 3M0SA 1GL5A 2KNBB 2KYMA 1Y57A 1I0CA 2KE9A 5HCKA 4WCIA 2KR3A 2X3WD 1VYVA 4JJCA 2FO0A 2QDLA 1EFNA 4JPBW 2A36A 1ZBJA 1H3HA 2DLPA 1T3SA 2KEAA 1WI7A 4LE9A 5IHNA 1VYTA 1B3QA 3REBB 2DF6A 3EHQA 1UE9A 1HJDA 3M0RA 4J9DA 4Z8AA 1YN8A 2JTEA 3RBBB 2J6KA 5I22A 2DA9A 1YWPA 3I35A 5ECAA 2AK5A 2LZ6B 3C0CA 1PWTA 1JO8A 1T0JA 4Z88A 5FWCA 4E6RA 4OMQA 1GFDA 4LNPA 3UF4A 3VS3A 2EYYA 1I1JA 4AG1C 1W70A 1WXUA 1VYUA 2ECZA 2KRSA 2SRCA 2M51A 4IIOA 4RTVA 1WYXA 1BK2A 1U06A 3FJ5A 2KBTA 2LQNA 3VS1A 1NEBA 1X2KA 1X2QA 1QLYA 2DRMA 1ZUUA 2G6FX 2OAWA 2LNHB 1V1CA 2DL4A 4OMPA 1K0XA 2FG0A 2V1QA 1AWXA 2O88A 2LX7A 5FWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFW A;  3LH5 A;  1XOV A;  2DL7 A;  2C0O A;  1PRM C;  2EPD A;  2EGE A;  1MUZ A;  1RUW A;  1WX6 A;  2D8J A;  3M0U A;  1VA7 A;  2HDA A;  3VS6 A;  2L3P A;  1M3C A;  2EBP A;  2XMF A;  3EHR A;  1JU5 C;  2RNA A;  4EIK A;  2DX1 A;  2J6F A;  2C0I A;  4Z89 A;  2VVK A;  2LCS A;  1OEB A;  3REA B;  1ZUY A;  3SEM A;  2MIO A;  4HCK A;  3H0I A;  2LJ0 A;  2K2M A;  1JEG A;  4LN2 A;  2PTK A;  3KFV A;  1RLP C;  1W6X A;  1NG2 A;  1CKA A;  4ZNX A;  1ZUK A;  4CC2 A;  2CH4 W;  1X43 A;  2JS0 A;  2DBM A;  1SHF A;  2ED1 A;  1NLO C;  1BU1 A;  2NWM A;  4J9B A;  2YDL A;  2AKL A;  1GCQ A;  4RTY A;  1U3O A;  4AFU C;  1RI9 A;  2LJ3 A;  2RMO A;  2JM8 A;  2F2V A;  1J3T A;  2OI3 A;  1PNJ A;  1NEG A;  3PE0 A;  1UG1 A;  4ORZ A;  2F2W A;  5IXF A;  1UJY A;  3H0H A;  4AFZ C;  2GQI A;  2X3X D;  2CT3 A;  3UA6 A;  1AZG B;  4M4Z A;  4OML A;  2H8H A;  2K9G A;  5GJV B;  1UGV A;  4JZ4 A;  1PHT A;  2CSQ A;  2KYB A;  1K9A A;  4RTW A;  1NM7 A;  2JMA A;  5IXB A;  1T0H A;  2BZ8 A;  2J05 A;  4RUG A;  1SRM A;  4OMN A;  5IH2 A;  4F17 A;  2O9V A;  2YUP A;  1SRL A;  1JXO A;  2JW4 A;  2RQR A;  1JQQ A;  1MV3 A;  1A0N B;  4F14 A;  2K79 A;  4J9I A;  2EGC A;  2BZX A;  5GJW B;  2JS2 A;  1AWJ A;  1Z9Z A;  2KT8 A;  2EGA A;  3ZL7 C;  1PKT A;  1M8M A;  1GFC A;  2M0Y A;  2RPN A;  2L3S A;  2SEM A;  2LMJ A;  2W0Z A;  3M0Q A;  3VS7 A;  4HVV A;  2EW3 A;  2K3B A;  4CC4 B;  1UDL A;  2DIL A;  2CUB A;  2RQV A;  2AZV A;  4J9G A;  2CSI A;  2I0N A;  4KRT A;  4D8K A;  1PRL C;  3PVL A;  1M3B A;  4QT7 A;  2HEQ A;  2DE0 X;  2ABL A;  2HBW A;  4LUD A;  4DEX A;  1TG0 A;  4D8D A;  2KT1 A;  2ROT A;  1X69 A;  2GGR A;  1ARK A;  1AZE A;  1OV3 A;  3THK A;  2CDT A;  1CSK A;  5EC7 A;  1NYG A;  1U5S A;  2AZS A;  2DRK A;  4AFS C;  1T3L A;  3SHW A;  2CUD A;  5FW9 A;  2PZ1 A;  2FPD A;  3H41 A;  2O9S A;  2YUQ A;  2RN8 A;  2LJ1 A;  2FRY A;  1H92 A;  1WXB A;  2D0N A;  1GRI A;  4HVW A;  4Y92 A;  2YUN A;  2ESW A;  4JZ3 A;  1QWF A;  2P4R A;  1X6G A;  2ENM A;  1OOT A;  4J9E A;  1OPL A;  2RQU A;  2BZY A;  1QKW A;  1AWW A;  1KFZ A;  1SEM A;  2GNC A;  2EQI A;  1LCK A;  1QCF A;  1Y0M A;  3CQT A;  1N5Z A;  3RNJ A;  2D8H A;  2EYW A;  2L0A A;  3A98 A;  2RQT A;  4RTX A;  1QWE A;  4LUE A;  1RLQ C;  3VS0 A;  1BBZ A;  2O2O A;  4ESR A;  3EG3 A;  4K11 A;  3I5R A;  1K4U S;  2J6O A;  2PNI A;  3VRY A;  4AFQ C;  1WXT A;  2EKH A;  1KIK A;  3NHN A;  2EYZ A;  3GBQ A;  2RF0 A;  3I9Q A;  1IO6 A;  1ZSG A;  2L3Q A;  2CH4 A;  2KRN A;  3TSZ A;  2IIM A;  3EG2 A;  4JJD A;  2K7A A;  4X1V A;  5I11 A;  1UHF A;  2C0T A;  1UEC A;  3H0F A;  2EYX A;  4CC3 A;  2F2X A;  2DJQ A;  1BB9 A;  2RQW A;  2CT4 A;  1QKX A;  3JV3 A;  1CKB A;  3NMZ C;  2V1R A;  2VWF A;  4A63 B;  2KRO A;  2DNU A;  1ZX6 A;  1HSQ A;  1GCP A;  2FPE A;  2GBQ A;  1I07 A;  4CC7 A;  4F16 A;  1E7O A;  1WLP B;  2JMC A;  2E5K A;  1K76 A;  4OMM A;  1GCQ C;  2FRW A;  5L23 A;  1E6G A;  2MOX A;  2ROL A;  5IHI A;  3UAT A;  1WIE A;  2A08 A;  4AG2 C;  1B07 A;  1Z9Q A;  3EGU A;  1TUC A;  1NYF A;  2YT6 A;  3U23 A;  1UTI A;  1AVZ C;  2ED0 A;  3R6N A;  2HSP A;  2DL3 A;  1JXM A;  1X27 A;  1YNZ A;  1H8K A;  1SHG A;  4RTT A;  1K1Z A;  2OJ2 A;  2DM1 A;  1YCS B;  1ZLM A;  1SPK A;  3O5Z A;  1ABQ A;  1SSH A;  1WDX A;  1WA7 A;  1GBQ A;  4J9C A;  1G83 A;  2BTT A;  1OPK A;  1KSW A;  3M0P A;  1AOJ A;  1YWO A;  3M0T A;  2A37 A;  1E6H A;  1AEY A;  2A28 A;  2DBK A;  2KRM A;  4GLM A;  3PVQ A;  2L2P A;  2LQW A;  1G2B A;  2YUO A;  1M27 C;  1X6B A;  2GTJ A;  2DVJ A;  2HCK A;  4GBQ A;  1UFF A;  1UUE A;  3IQL A;  3VS2 A;  3UA7 A;  3NPF A;  3TVT A;  2KXC A;  1TUD A;  1K0S A;  2EVR A;  3VS5 A;  2K6D A;  1AWO A;  2DYB A;  2B86 A;  2JT4 A;  2LP5 A;  3NGP A;  2VKN A;  2J7I A;  1GBR A;  4DEY A;  1ABO A;  4IIM A;  4HVU A;  2J06 A;  1W1F A;  1M30 A;  2JM9 A;  2FEI A;  2O31 A;  3ULR B;  3VRZ A;  2CRE A;  4RTZ A;  3QWY A;  4J9F A;  4RTU A;  1PKS A;  3EG0 A;  1MV0 B;  1FMK A;  4FSS A;  3I5S A;  1YP5 A;  4JJB A;  1S1N A;  2DL5 A;  4J9H A;  4HXJ A;  2KXD A;  5IHK A;  1UHC A;  2YSQ A;  2KGT A;  2W10 A;  2AKK A;  2FPF A;  2JXB A;  1AD5 A;  2DMO A;  1M3A A;  1FYN A;  2DL8 A;  3TSW A;  4R0K A;  2NUZ A;  2MCN A;  2D1X A;  3VS4 A;  3QWX X;  1KJW A;  1UJ0 A;  1NLP C;  2GTO A;  1HD3 A;  3EG1 A;  4OMO A;  3M0S A;  1GL5 A;  2KNB B;  2KYM A;  1Y57 A;  1I0C A;  2KE9 A;  5HCK A;  4WCI A;  2KR3 A;  2X3W D;  1VYV A;  4JJC A;  2FO0 A;  2QDL A;  1EFN A;  4JPB W;  2A36 A;  1ZBJ A;  1H3H A;  2DLP A;  1T3S A;  2KEA A;  1WI7 A;  4LE9 A;  5IHN A;  1VYT A;  1B3Q A;  3REB B;  2DF6 A;  3EHQ A;  1UE9 A;  1HJD A;  3M0R A;  4J9D A;  4Z8A A;  1YN8 A;  2JTE A;  3RBB B;  2J6K A;  5I22 A;  2DA9 A;  1YWP A;  3I35 A;  5ECA A;  2AK5 A;  2LZ6 B;  3C0C A;  1PWT A;  1JO8 A;  1T0J A;  4Z88 A;  5FWC A;  4E6R A;  4OMQ A;  1GFD A;  4LNP A;  3UF4 A;  3VS3 A;  2EYY A;  1I1J A;  4AG1 C;  1W70 A;  1WXU A;  1VYU A;  2ECZ A;  2KRS A;  2SRC A;  2M51 A;  4IIO A;  4RTV A;  1WYX A;  1BK2 A;  1U06 A;  3FJ5 A;  2KBT A;  2LQN A;  3VS1 A;  1NEB A;  1X2K A;  1X2Q A;  1QLY A;  2DRM A;  1ZUU A;  2G6F X;  2OAW A;  2LNH B;  1V1C A;  2DL4 A;  4OMP A;  1K0X A;  2FG0 A;  2V1Q A;  1AWX A;  2O88 A;  2LX7 A;  5FWB A; 
#chains in the Genus database with same CATH topology
 2COZ A;  1D1B A;  3LH5 A;  1W2B P;  4MZT A;  2EGE A;  2CP2 A;  1SKU B;  3F70 A;  2GF7 A;  1I4K 1;  1VA7 A;  2HDA A;  2E5Q A;  2HQE A;  2KK4 A;  2EBP A;  3TU4 K;  2XMF A;  2RNA A;  3PTA A;  4C5H A;  5LJ3 h;  4XTX A;  3CCR Q;  2YRD A;  2PU9 B;  2C0I A;  4Z89 A;  2LCS A;  5LJ5 g;  3SEM A;  1YHQ A;  4M75 G;  4HCK A;  1IZ6 A;  1OZ2 A;  1YI2 Q;  3RUX A;  3OW2 S;  3OS0 A;  3KFV A;  2EJF A;  2QQA A;  3LGL A;  5GAO q;  1C0M A;  5KYX A;  1X43 A;  2QTV A;  4PFP A;  2EQJ A;  2ED1 A;  5CR2 A;  2K5L A;  2FL7 A;  2DXC A;  2HAX A;  4WTO B;  4M7D F;  1U3O A;  1O75 A;  2F2V A;  3G7Z A;  2M1H A;  2OI3 A;  2RB6 A;  4M78 G;  3PE0 A;  3RKW A;  3H0H A;  4AFZ C;  5GAN j;  4M7D E;  4EMG A;  2JJ9 A;  3JCM d;  2VXF A;  1PD1 A;  2H8H A;  3E9F A;  1UGV A;  2CSQ A;  2RHI A;  2JOY A;  2WAC A;  5IH2 A;  2KAF A;  1D3B B;  3QUI A;  1SRL A;  1BCM A;  2QAZ A;  4OB2 B;  4M75 D;  1I8F A;  4F14 A;  3CMA A;  4J9I A;  2EGC A;  4C92 A;  1IRE B;  1IB8 A;  1KD1 U;  3OS5 A;  4WF2 A;  2V8J A;  1ZQ1 A;  4M75 B;  1VQ7 Q;  3JCM V;  1P92 A;  4FW1 A;  2A0F B;  4RCC A;  3CCU T;  4CC4 B;  2DIL A;  3GIB A;  2BIV A;  3M5A A;  3JB9 I;  1XNI A;  5FRN A;  3S6W A;  2I0N A;  1PRL C;  1KQS P;  1WJR A;  4MZM A;  4DEX A;  4ZGD B;  4M7A D;  2ZPH B;  4RG2 A;  4FM4 B;  2GGR A;  3SWN A;  2L5Q A;  4N0A C;  1OV3 A;  1NZ9 A;  2WSF E;  1MND A;  3OA6 A;  4M7A B;  2VC8 A;  2OTL Q;  1U5S A;  2AZS A;  4ELY C;  1RAG B;  2DRK A;  3CCR T;  1T3L A;  1LOJ A;  5FW9 A;  3VU3 C;  1BI3 A;  3FLG A;  4HCB A;  1YCY A;  2QXF A;  1YI2 T;  4QVC A;  1N6A A;  1VQ4 Q;  1VQP Q;  1H92 A;  5KYU B;  2D0N A;  1KHC A;  4HVW A;  4Y92 A;  3L2W A;  2ESW A;  1TWB A;  1X6G A;  5FRM A;  3VV0 A;  3V8L A;  5J39 A;  4NL3 A;  4PJO F;  2YRV A;  1QKW A;  2JTF A;  3G4S Q;  1SEM A;  3CCE T;  5GAN 5;  3I55 Q;  1N5Z A;  1M8V A;  3H8Z A;  4NOY A;  4PJO E;  2RQT A;  2CP6 A;  4C5E A;  1QWE A;  4LUE A;  1MMG A;  3I5R A;  5GAM h;  3AT1 B;  1WGS A;  3VRY A;  4P5N A;  2EKH A;  3QHS A;  1W2B S;  2EYZ A;  1WJS A;  3QZ9 B;  3GBQ A;  5FU7 C;  2RF0 A;  2DK3 A;  1TH7 A;  3OMG A;  2F5T X;  1G3Y A;  2CH4 A;  2KRN A;  3TSZ A;  3DKM A;  5I11 A;  2DXU A;  1D1A A;  2NUT B;  2EYX A;  2QEX Q;  5KH6 A;  2F2X A;  1QCN A;  2DJQ A;  1BB9 A;  3CCM A;  2MK5 A;  2CT4 A;  1QMC A;  3OYB A;  1RAF B;  3LWH A;  4TVR A;  3VKI A;  2ZPF B;  1YJ9 A;  1HSQ A;  2FPE A;  3TCJ A;  4BD3 A;  5LJ3 e;  4JUV A;  2YLB A;  2M16 A;  2JMC A;  1YHQ Q;  1K76 A;  4OMM A;  2MOX A;  1UGP B;  3QDF A;  2OX7 A;  4FYX B;  5IT9 E;  1Z9Q A;  3EGU A;  2E10 A;  4MZP A;  2QK0 A;  3U23 A;  1UTI A;  3A5Z B;  3R6N A;  1JJ2 A;  5C6S A;  3QXE B;  2DL3 A;  9ATC B;  4FYY B;  1X27 A;  3PT9 A;  3CXC P;  1SHG A;  5FLX E;  3OMC A;  1YCS B;  3UPU A;  3P8D A;  2VUB A;  1VUB A;  3JSC A;  1RAI B;  2PVD B;  2I2L A;  1GBQ A;  1YIT A;  1K8A U;  2BTT A;  4QQG A;  3AHU A;  1VQ4 T;  2ATC B;  3L1A A;  1VQP T;  1YWO A;  3QPH A;  3OYD A;  2IPO B;  4KUD K;  2MWO A;  1B7T A;  2A28 A;  1VIF A;  4ZTJ A;  5GAM f;  2MF2 A;  4R56 A;  2L2P A;  2LQW A;  2DAQ A;  2JTM A;  2QGF B;  3EAE A;  2HCK A;  1VQ5 T;  3UA7 A;  4PJJ A;  3I55 T;  3TVT A;  3E2U A;  1G3W A;  3CMA Q;  5GAN h;  2LVM A;  2JT4 A;  1HYO A;  4HVU A;  1SSF A;  2RI5 A;  5KYX B;  5HK0 A;  2HL3 A;  2O01 E;  3M4G A;  3MEV A;  1YIJ T;  1IXD A;  4J9F A;  1Q82 U;  4RTU A;  3EG0 A;  3QZ5 B;  1M1K C;  1FMK A;  1S1N A;  4BE1 A;  2LT4 A;  2NYS A;  2DL5 A;  4HXJ A;  5IHK A;  3VUZ A;  2XID A;  4RKU E;  2AKK A;  4ZGE B;  1AD5 A;  3G71 A;  2DMO A;  2XI9 A;  1YFN A;  2DL8 A;  2NUZ A;  2MCN A;  2D1X A;  5GMK h;  3JCM b;  3MEA A;  4C0Z A;  3CC4 T;  1F1B B;  5AT1 B;  3QBY A;  1VQM A;  1XQH A;  4C92 D;  1C1A A;  5D6Y A;  2LX9 A;  4E7K A;  1Q81 U;  4C8Q C;  5LJ3 j;  3M0S A;  3CD6 A;  1TU0 B;  2KYM A;  1Y57 A;  2D9T A;  4WCI A;  1YHQ T;  2X3W D;  4E7Z A;  1ZSZ B;  4VUB A;  2DFU A;  2YXY A;  4JPB W;  3V7R A;  1MMA A;  2KEA A;  1ZA1 B;  1WI7 A;  4LDX A;  5A2Q E;  3I56 Q;  1B3Q A;  3REB B;  3EHQ A;  4LXC A;  3C95 A;  3S3O A;  2CZ1 B;  4BE2 A;  3M0R A;  4J9D A;  5HKC A;  4Z8A A;  3QII A;  2DA9 A;  4HCC A;  1YWP A;  2ZPE B;  3I35 A;  2AK5 A;  3C0C A;  5CQY A;  1JO8 A;  4OMQ A;  2P0Q A;  4M75 A;  5FU6 C;  5GAN f;  1WHM A;  2P0K A;  1I1J A;  4M77 C;  5GAM e;  2WSE E;  3SWN B;  2E1H A;  1Q7Y C;  2OTJ Q;  4IIO A;  3LW5 E;  1VQ9 T;  1MHN A;  1BK2 A;  5CKE A;  2KBT A;  3HKS A;  1TUG B;  2M9U A;  1NJI R;  3JCM h;  1LJO A;  2XD0 A;  1D0Z A;  4X34 A;  4JDS A;  3CMA T;  1H3Z A;  3QSU A;  1X75 C;  4HCZ A;  4M78 A;  3CCM Q;  4XTW A;  2V1Q A;  1AWX A;  1NPR A;  2DXB A;  3LYI A;  1AHJ B;  1IHW A;  5FWB A;  2LC4 A;  4OB1 B;  2DL7 A;  2LDM A;  1PRM C;  2QGG A;  2DD5 A;  2FHD A;  1MUZ A;  3MET A;  1PC0 A;  3VS6 A;  1YJN A;  2EJ9 A;  3MP8 A;  3CXC S;  4A53 A;  2QQ9 A;  3J7A F;  4EIK A;  4F7U G;  2KDS A;  2DX1 A;  2J6F A;  2EQK A;  1IRX A;  2DTO A;  4OB0 B;  2VVK A;  1OEB A;  4DA4 A;  3H9N A;  2K2M A;  2E64 A;  4NS5 A;  1BI2 A;  5M9O A;  4X9D A;  3MJX A;  5EG2 A;  4CC2 A;  2L8D A;  1B34 A;  2DBM A;  4FCY A;  4RMO A;  4X9C A;  3EFO A;  1BU1 A;  2LTO A;  2NWM A;  4EMK C;  1S72 A;  4J7I A;  3ER0 A;  1YIT Q;  2AKL A;  1GCQ A;  2DO3 A;  4N4I A;  4AFU C;  2LJ3 A;  2RMO A;  4E7L A;  2XDD A;  3I56 T;  1UG1 A;  1TS9 A;  5IXF A;  3JB9 G;  2CT3 A;  3UA6 A;  1AZG B;  4M4Z A;  4FSX A;  1TSF A;  4OML A;  2KSS A;  2K9G A;  1PHT A;  1K9A A;  4J6Y A;  2NUT A;  3ME9 A;  5IXB A;  2BZ8 A;  4M7D A;  4RUG A;  2G3R A;  2CZ7 B;  3LGF A;  1M1K R;  2EQM A;  1C6V X;  2X4J A;  2RQR A;  1KC8 U;  2HZY A;  2BZX A;  1VQ8 A;  3M58 A;  2K3Y A;  2OTJ T;  4F7U B;  2FB7 A;  3CCV A;  1NPP A;  2EGA A;  1PKT A;  3LX7 A;  1WPY A;  2M0Y A;  3EH2 A;  4B6M A;  1TOV A;  4GLK A;  4E2F B;  3JCM X;  4ATO A;  2W0Z A;  3VS7 A;  5KCH A;  4HVV A;  2EW3 A;  2YRC A;  3V7S A;  2RQV A;  2CYZ B;  2AZV A;  2MYS A;  3CCM T;  4JRQ A;  4J9G A;  3CC7 A;  4QT7 A;  2HEQ A;  5GMK e;  3CPW A;  2ABL A;  2HBW A;  3QDR B;  3JB9 D;  1TG0 A;  5LJ5 d;  2KT1 A;  1VQM Q;  3OYN A;  1OYX A;  4PFO A;  2X4W A;  1ARK A;  3CD6 Q;  1Y96 A;  1K73 U;  5D6X A;  1WNL A;  4KH1 B;  4C8Q F;  4C92 C;  3X25 B;  3V8K A;  3CBP A;  5GAN g;  2FPD A;  5A0G A;  1M90 U;  2YUQ A;  2LJ1 A;  4C8Q E;  1WXB A;  4L6V 5;  1D0Y A;  3J81 E;  1GRI A;  2DIG A;  3CCQ A;  2RJC A;  4JZ3 A;  3CCS T;  1QWF A;  2XHC A;  2EKO A;  4PLL A;  2ENM A;  4IUP A;  1OOT A;  2HBP A;  4J9E A;  4LDU A;  2RHZ A;  1Q7Y R;  4C0D B;  1N8R U;  3PNW C;  2RQU A;  2BZY A;  8ATC B;  1YIT T;  3GF5 A;  1AWW A;  3JRZ A;  2GNC A;  2COW A;  2EQI A;  1LCK A;  4BAC A;  1M2V A;  1Y0M A;  2CS7 A;  2HKQ B;  1ZA2 B;  1U8R A;  3RNJ A;  2D8H A;  2OAU A;  4QW2 A;  2L0A A;  3GNG A;  1RLQ C;  3RMQ A;  3VS0 A;  1BBZ A;  2HL5 C;  4M77 F;  4K11 A;  1Y07 A;  4AFQ C;  3L2V A;  1H64 1;  1WXT A;  2RK1 A;  5CKB A;  1YJW T;  1R0C B;  1KIK A;  1PCX A;  3JCM e;  2MWP A;  4M77 E;  3JB9 H;  1IO6 A;  4J7F A;  4JJD A;  2K7A A;  4X1V A;  1SF9 A;  1UEC A;  3H0F A;  4OF1 A;  4A4H A;  3PIO A;  3CCL A;  4IKF A;  3V8J A;  2RQW A;  1I5L A;  5DLQ E;  3ASK A;  3HRS A;  4HKE A;  2R57 A;  4A63 B;  3OYG A;  4A4E A;  2CP0 A;  1ZSZ A;  1YJN Q;  2BE7 D;  1GCP A;  1EZZ B;  3HHT B;  1WQW A;  4DOV A;  1QVG A;  1OUL A;  5DM7 R;  5CVI A;  3P8H A;  2E4H A;  1I07 A;  5GAN 4;  3QO3 A;  1K9M U;  4L5G A;  2E5K A;  5GMK j;  1R8O B;  1QVF P;  1E6G A;  3UAT A;  1WIE A;  1QP3 A;  3OYH A;  1VQL A;  4FYV B;  1TUC A;  4JS4 A;  2QDY B;  5LJ3 f;  3TEE A;  1AVZ C;  2ED0 A;  4M78 D;  3M57 A;  3QJY A;  1YNZ A;  1K73 R;  1H8K A;  2ZAE A;  3X26 B;  2FVU A;  1S72 Q;  3L2U A;  2K57 A;  2FZG B;  1SPK A;  5J26 A;  4M78 B;  3OYJ A;  2L3R A;  3O5Z A;  1SSH A;  1RAC B;  1G83 A;  3OYA A;  3X28 B;  1BIB A;  3NTK A;  3M0P A;  4M77 G;  1AOJ A;  2PUK B;  3M0T A;  3ZEH A;  2LRQ A;  4M7D G;  3CC2 A;  2RHY A;  1AEY A;  5A0L A;  3PVQ A;  1M27 C;  1X6B A;  3CME Q;  1LNX A;  4GBQ A;  4FIB A;  3IQL A;  3VS2 A;  3FDR A;  4A4F A;  5GAO p;  2EVR A;  2HQH A;  1VQ8 Q;  2B86 A;  3NGP A;  4ZTF A;  4KH0 B;  2XDB A;  2DZC A;  2JM9 A;  3JB9 J;  4YTL A;  3HRU A;  1B34 B;  1VQN Q;  1PKS A;  3EFO B;  3NTH A;  4FSS A;  4PJN A;  2CZ6 B;  2PVO B;  3MP1 A;  4E7S A;  2PQW A;  3CC7 Q;  2YSQ A;  4HT9 A;  2COY A;  2EAY A;  4M7D D;  4OGC A;  4BY6 C;  2CZ0 B;  4XU2 A;  1X6O A;  3LH0 A;  4QVZ A;  3PGG A;  3CPF A;  4M7D B;  1DJ7 B;  3O8V A;  1HD3 A;  1KD1 R;  5CK9 A;  1NJI C;  4JRK A;  3CCJ A;  2KNB B;  5FRO A;  1GL5 A;  1VQ7 T;  2KE9 A;  2ZGW A;  1QW1 A;  4C92 F;  4JJC A;  2IG0 A;  2QDL A;  4QQD A;  1EFN A;  2QQS A;  7AT1 B;  1X01 A;  2A36 A;  1ZBJ A;  3OW2 A;  2DLP A;  4AMC A;  1IGQ A;  1AT1 B;  3CCQ Q;  2K3X A;  1KG1 A;  2RHX A;  4FT4 A;  4C92 E;  1VQO A;  1HJD A;  1R77 A;  3JAM E;  3UT1 A;  1S72 T;  3RKY A;  1G3T A;  4N4H A;  3OYK A;  3LLR A;  4OVA A;  1ZHI A;  5AYF A;  2GCX A;  3WVD B;  5ECA A;  3X24 B;  3PFS A;  1PWT A;  4F7U A;  5GAO r;  3OB9 A;  3OQ5 A;  4Z88 A;  5FWC A;  4PJO G;  1GFD A;  2OTL T;  4II1 A;  1WXU A;  2HKN A;  1VYU A;  5L8R E;  1RAE B;  4QQ6 A;  4RTV A;  4C5I A;  1WYX A;  1Y96 B;  1U06 A;  3SFM A;  3CME T;  4RCB A;  2P0P A;  4OP0 A;  2FZC B;  5HY6 A;  2ZPG B;  1NEB A;  4XK8 E;  1X2K A;  1X2Q A;  1QLY A;  3OS1 A;  1ZUU A;  2HD0 A;  3PIP A;  3CCL Q;  5HK3 A;  4MDW A;  5I2M A;  2OAW A;  2DL4 A;  3G4S T;  2NUP A;  3EFS A;  2FG0 A;  1QVF S;  3WVE B;  2O88 A;  2LX7 A;  3A8G B;  1QVG P;  5LJ3 g;  1VQN T;  1XOV A;  1LPL A;  2C0O A;  2EPD A;  2M0O A;  3PMT A;  2QQB A;  5CO7 A;  1WX6 A;  1RUW A;  3BFM A;  2D8J A;  2C06 A;  3CBM A;  3M0U A;  1KQS S;  2QYZ A;  1OZ3 A;  2L3P A;  1W4S A;  2YHT A;  3CC7 T;  1M3C A;  4M75 C;  1M2V B;  1Q86 U;  1JU5 C;  4PNO A;  2DET A;  4PJO D;  4A54 A;  3REA B;  3A1P A;  2GFU A;  4JJN K;  1VQL Q;  1M9S A;  3H0I A;  2LJ0 A;  2PTK A;  4PJO B;  2XDP A;  3FRN A;  1KHI A;  2QEX T;  1CKA A;  2GQV A;  1KK7 A;  2CH4 W;  4BDY A;  5LJ5 h;  2JS0 A;  1NE8 A;  1SHF A;  1IHV A;  2VXE A;  1NLO C;  4M78 C;  3GOX A;  4J9B A;  2YDL A;  5I2S A;  4RTY A;  4M7A C;  2JM8 A;  3L42 A;  1PNJ A;  3CCQ T;  3CC2 Q;  1NEG A;  1WZO A;  1UJY A;  3SB2 A;  2GQI A;  2X3X D;  2PVG B;  3FEO A;  4JZ4 A;  3OYI A;  1QCO A;  4RTW A;  3EFR A;  2JMA A;  2J05 A;  4FYW B;  3WXM B;  1SRM A;  2DPP B;  4OMN A;  3E19 A;  4V2S A;  1G8X A;  2O9V A;  3MPU B;  1KQ1 A;  2JW4 A;  1MV3 A;  1A0N B;  4XQ3 A;  2K79 A;  2ZPB B;  4FU6 A;  4CI0 C;  5CKF A;  2JS2 A;  2QI2 A;  2KT8 A;  2CP3 A;  5IAY A;  2EFI A;  3ZL7 C;  1W2B A;  4B9X A;  1M8M A;  3NTI A;  3JCM Q;  1K8A R;  1GFC A;  2RPN A;  3M0Q A;  3KXT A;  3CCR A;  2K3B A;  2K4Y A;  4O6J A;  2EQU A;  3OSS C;  1UDL A;  2K5F A;  5D7U A;  2M02 A;  3RER A;  1WHL A;  1WHK A;  3D7S B;  4KUL A;  3PVL A;  3Q1J A;  2DE0 X;  3X20 B;  2Y4X A;  5GAN 6;  2D0Q B;  1RAB B;  4D8D A;  1MMN A;  2KQW A;  1AZE A;  4C5G A;  2RO0 A;  5GAO m;  3CCJ Q;  2DTI A;  3CCE A;  5EC7 A;  1Q82 R;  1YJ9 Q;  4PL6 A;  2CUD A;  2PZ1 A;  4EPC A;  3N5B B;  1VQL T;  3H41 A;  3GP8 A;  2O9S A;  1VQ6 A;  2YWW A;  3S3M A;  4DBR A;  1VQO Q;  1JB0 E;  2O4X A;  1M4Z A;  2CP5 A;  3OBW A;  1JJ2 P;  4C8Q A;  1D1C A;  1VIE A;  1G3S A;  5GAM g;  3QG1 A;  1KFZ A;  5CAI A;  2RJD A;  3RMS A;  3TQ7 P;  2EYW A;  1Q81 R;  3CC2 T;  4BI4 A;  3DLM A;  1ZBX A;  4CRI A;  5KYW A;  2O2O A;  3EG3 A;  4XTU A;  1K4U S;  2J6O A;  2KMT A;  4A4G A;  3SD4 A;  1R0B G;  3NHN A;  5KYY A;  3DB4 A;  1U1S A;  1K73 C;  3GLX A;  1ZSG A;  2JZ2 A;  3A8M B;  2L3Q A;  1VQK A;  3G1J A;  1UHF A;  2C0T A;  1N9R A;  1FMW A;  4CC3 A;  2K5I A;  2EYQ A;  4M77 A;  3PMI A;  3JCM f;  1QKX A;  4OGE A;  1CKB A;  5CCA A;  2V1R A;  5KYN A;  2VWF A;  5GMK m;  2DNU A;  3M54 A;  2HMA A;  4DBH A;  3TRE A;  4F04 B;  2GBQ A;  1E7O A;  4M75 F;  3OYL A;  3HL8 A;  1VQ4 A;  2E65 A;  1VQP A;  2FRW A;  5IHI A;  2DKG A;  2A08 A;  4M75 E;  3G71 Q;  1OX9 A;  2E70 A;  2YT6 A;  3A8O B;  5IN1 A;  3V7C A;  1VQ5 A;  1MMD A;  2HNI A;  1QQJ A;  5LJ5 e;  3CCJ T;  1JXM A;  1FWZ A;  2DD4 A;  5A0D A;  3I55 A;  4RTT A;  4RG8 A;  2LQK A;  2P84 A;  2OJ2 A;  1YJ9 T;  3HRT A;  1ZLM A;  3BE3 A;  4BI8 B;  2LCC A;  2E12 A;  2VB6 A;  3HFN A;  2NUP B;  1ABQ A;  1WDX A;  1WA7 A;  4J9C A;  8AT1 B;  4M7A F;  1OPK A;  1Q95 G;  2QA4 A;  2A37 A;  1ZSZ C;  1YIJ A;  1E6H A;  4JLI A;  2PUO B;  5FU7 B;  3HPW A;  4J83 A;  3C94 A;  4PFZ A;  4M7A E;  2YUO A;  1G2B A;  4FW2 A;  1JRI A;  2GTJ A;  4IUU A;  2X35 A;  4PK4 A;  3M56 A;  3VJP A;  1KD1 C;  2EJG A;  4FL6 A;  3NPF A;  4J6W A;  4BUG A;  1TUD A;  5GAN 2;  1K9M C;  3VS5 A;  3BDL A;  4XU0 A;  2DYB A;  2LP5 A;  2AIR B;  2VKN A;  4DEY A;  1ABO A;  2QAS A;  2J06 A;  3CC4 A;  3VRZ A;  3EGX A;  4QKU A;  4RTZ A;  4PJM A;  4IUR A;  2R5M A;  4KUI A;  1XJW B;  3QWY A;  2Y4Y A;  3BW1 A;  1Y71 A;  1WQ7 A;  3SWN C;  4N4G A;  3I5S A;  4NL2 A;  4LD9 K;  1YP5 A;  2VGN A;  3URG A;  4J9H A;  3QYH B;  3RR6 A;  1UGR B;  2KGT A;  2W10 A;  4UC4 A;  4PJO A;  1BYM A;  1UEB A;  4BE0 A;  2GFA A;  1M1F A;  3JCM J;  1M3A A;  1FYN A;  4R0K A;  4IUT A;  4LDW A;  1IGU A;  3QWX X;  4EMH A;  3EH1 A;  1FX7 A;  1D09 B;  3C4S A;  1KC8 R;  1NLP C;  4HA8 A;  4E7H A;  3CCE Q;  3C12 A;  1JJ2 S;  1PG5 B;  3CXC A;  2DIQ A;  1O9S A;  2Z0W A;  4KGZ B;  1G5V A;  1QP2 A;  1I0C A;  1EX4 A;  1EIF A;  4DQ2 A;  4M7A G;  1WHG A;  1OU8 A;  2FO0 A;  1VQ6 Q;  2JN0 A;  3BY7 A;  4Y91 A;  4C8Q G;  1BCO A;  3G71 T;  3OYE A;  6AT1 B;  1VYT A;  4MMK A;  1VQ9 A;  4J6X A;  2JNG A;  2DF6 A;  5LJ5 j;  1LVK A;  3FIF A;  4JRP A;  1HK9 A;  3RBB B;  1VQM T;  1XTD A;  2LZ6 B;  2KI7 A;  3CD6 T;  1T0J A;  3R6O A;  2IVW A;  4LNP A;  5CKH A;  3VS3 A;  1HXD A;  3JCM g;  5GAN 3;  1YBY A;  2R5A A;  2ECZ A;  2KRS A;  2SRC A;  4EDU A;  2M51 A;  2LT1 A;  2JVV A;  2LQ8 A;  3FJ5 A;  3ZFJ A;  1M90 R;  4XU3 A;  1RAA B;  3OY9 A;  3LWI A;  2JUF A;  2RI2 A;  1VQK Q;  3J80 E;  4PJL A;  2G6F X;  2LNH B;  5LL6 S;  4C8Q D;  1N8R R;  2KY9 A;  1K0X A;  2O4X B;  4ANJ A;  1JBM A;  1RAH B;  2H3J A;  4XTV A;  3FB9 A;  1WFW A;  4J8O A;  1PSF A;  3EGD B;  4JLG A;  4C8Q B;  3BDU A;  3T9N A;  3CCV Q;  5GAN 8;  2DTH A;  4XTY A;  1V29 B;  3EHR A;  3MEW A;  4KGX B;  3H6Z A;  4LD6 A;  3CEY A;  5GAO l;  1ZUY A;  3I56 A;  3G6E A;  3CPW P;  5KYW B;  2MIO A;  3EG9 A;  1JEG A;  1MGQ A;  4LN2 A;  2ZCF B;  1VQ5 Q;  1RLP C;  1W6X A;  5KYY B;  1NG2 A;  4ZNX A;  1ZUK A;  1K8A C;  2V26 A;  4M77 D;  2RK2 A;  4O5V A;  1M2O A;  3S3N A;  2LNV A;  5GAN 7;  5FU6 B;  3HTR A;  1YJN T;  4M77 B;  1VQ6 T;  4XAX B;  3RES A;  4C0F A;  2QA4 Q;  1RI9 A;  1BKB A;  2OTJ A;  1J3T A;  1WHJ A;  3MKD A;  1YIJ Q;  2XU8 A;  4ORZ A;  1K9M R;  2DEQ A;  2F2W A;  2RJF A;  3VYG A;  2VYT A;  3NFC A;  3M9Q A;  3MCA B;  1UB4 A;  5GJV B;  4OMF B;  2KYB A;  1SG5 A;  2AT1 B;  3DB3 A;  1NM7 A;  5D6W A;  1T0H A;  1Q86 C;  4ZGJ B;  4N0A A;  5GAO n;  1Q82 C;  5DY9 A;  4F17 A;  4E47 A;  4C0D C;  3OYF A;  2YUP A;  3L2Q A;  1JXO A;  1JQQ A;  3CC4 Q;  2QQR A;  2WSC E;  4PLI A;  4BDZ A;  5GJW B;  4KGV B;  1M5Q 1;  1AWJ A;  1Z9Z A;  4ZN3 A;  4ZN1 A;  1FMV A;  1UGS B;  2E6Z A;  2RJE A;  1PM3 A;  2V8I A;  4D6W A;  2L3S A;  2SEM A;  2LMJ A;  1VQK T;  5GMK l;  5LJ3 d;  4LDV A;  1TTH B;  2YLC A;  2CUB A;  2CSI A;  4KRT A;  4D8K A;  2X51 A;  5J3B A;  1M3B A;  2HQX A;  1Q81 C;  1U1T A;  3OSV A;  4OB3 B;  4LUD A;  3L2Z A;  3HSB A;  2CKK A;  3CCS A;  1VQ8 T;  1PD0 A;  1I5O B;  2ROT A;  2ZPI B;  1QVP A;  3CCV T;  1X69 A;  4EMK B;  3RKX A;  2FYK A;  3THK A;  3HFO A;  5KE3 A;  2CDT A;  1CSK A;  1NYG A;  5DLO A;  4AFS C;  4IUV A;  3SHW A;  1VOM A;  2X4Y A;  4FT2 A;  2RN8 A;  3EGX B;  3RDV A;  1VQ9 Q;  3JCM W;  2FRY A;  4C92 G;  2V8K A;  1NJI U;  1YJW A;  3VYH B;  2F69 A;  2YUN A;  2P4R A;  4ELZ C;  1OPL A;  2VAS A;  3GPL A;  2HSE B;  2EIF A;  1BIA A;  2MAM A;  4MDX A;  2QA4 T;  3ZBD A;  1QCF A;  3CQT A;  2MI6 A;  3DLL A;  2DZ9 A;  5CKD A;  2RA2 A;  1GXI E;  3A98 A;  4BB7 A;  4RTX A;  4JS5 A;  4Z02 A;  2MPX C;  4ESR A;  4A4K A;  2PNI A;  1OQK A;  3OYC A;  1M1G A;  3VUB A;  4Q5W A;  1WJQ A;  3I9Q A;  2DYI A;  2RM4 A;  2IIM A;  1OX8 A;  3EG2 A;  2KVQ G;  3CCU A;  4DBF A;  2MMP A;  3MO8 A;  2E6N A;  4L59 A;  4XU1 A;  3CPW S;  1ACM B;  1N9S A;  2CP7 A;  3A8L B;  3JV3 A;  5I21 A;  3NMZ C;  1WHH A;  2BKD N;  2KRO A;  1RL2 A;  1ZX6 A;  3JCM P;  4C92 B;  3M59 A;  4F7U F;  1I81 A;  2AHJ B;  4IUQ A;  4CC7 A;  4F16 A;  3GNF B;  3MEU A;  3UDC A;  2RH2 A;  1WLP B;  3G6E Q;  3HP9 A;  1OU9 A;  4JRI A;  4F7U E;  1GCQ C;  5L23 A;  2ROL A;  2E3H A;  1D3B A;  5CIU A;  1TXQ A;  3CCL T;  4AG2 C;  1B07 A;  1MNE A;  1YI2 A;  1NYF A;  2K2V A;  3CBO A;  1BI1 A;  2DXT A;  2HSP A;  4PKC C;  1M1K U;  2NLU A;  2VV5 A;  4KT0 E;  2DJZ A;  4QVD A;  1K1Z A;  3KUF A;  2DM1 A;  2D6F A;  4M7D C;  3INZ A;  5KCO A;  2B8A A;  4HT8 A;  3JB9 F;  3M53 A;  5LJ5 f;  5GAM d;  3OW2 P;  1KSW A;  1Q86 R;  2BE9 B;  4ME7 A;  4DOW A;  1KQ2 A;  2DBK A;  2KRM A;  2R58 A;  4GLM A;  2DEU A;  1KC8 C;  3M4Y A;  2RD1 A;  2H3E B;  3E9G A;  2RHU A;  2DVJ A;  2A7Y A;  2E3I A;  1UFF A;  1UUE A;  1PSE A;  5KE2 A;  3QYG B;  4M7A A;  2KXC A;  1K0S A;  2K6D A;  2ZZD A;  1AWO A;  3EGD A;  3EG9 B;  2RI3 A;  1GBR A;  2J7I A;  4IIM A;  1W1F A;  1M30 A;  2O31 A;  2FEI A;  4J5Y A;  3ULR B;  2F5K A;  2CRE A;  3FC3 A;  5KYU A;  1MV0 B;  5C0M A;  1VQ7 A;  4JJB A;  4GY5 A;  1QVG S;  2KXD A;  1UHC A;  4MML A;  2FPF A;  2JXB A;  1QVF A;  3TSW A;  3VS4 A;  3CCS Q;  3P8B B;  1RI0 A;  2QG9 B;  1KJW A;  2CGH A;  2F1L A;  1Q7Y U;  3JCM c;  5GMK i;  1UJ0 A;  2P4T A;  2DVE A;  3OBY A;  2XKO C;  3OS2 A;  1KQS A;  3OYY A;  4C0G A;  1M90 C;  2XIC A;  5CQX A;  2E41 A;  2GTO A;  1UGQ B;  4LDY A;  2XK0 A;  3EG1 A;  4OMO A;  3MP6 A;  3G6E T;  5HCK A;  2OTL A;  2KR3 A;  3A8H B;  1VYV A;  1OI1 A;  2A3L A;  1N8R C;  1H3H A;  3RIR A;  3UWN A;  1T3S A;  1YJW Q;  4LE9 A;  5IHN A;  1N27 A;  3CME A;  4AT1 B;  4DBQ A;  1UE9 A;  3SDZ A;  5GAN e;  1V76 A;  4KBM B;  4PJO C;  1YN8 A;  2JTE A;  1BI0 A;  2J6K A;  5I22 A;  2BUD A;  3L2R A;  5GAM j;  5GAN d;  1D0X A;  2X4X A;  1NBE B;  4B9W A;  4E6R A;  1Y7X A;  3G4S A;  2FZK B;  2X9H A;  2EYY A;  3UF4 A;  2EWN A;  4AG1 C;  1W70 A;  4XTZ A;  2L89 A;  3E1S A;  4R55 A;  1VQN A;  2DER A;  3QKJ A;  3FJP A;  4M78 F;  4E7J A;  3OYM A;  3KBG A;  1VQO T;  2LQN A;  4E7I A;  3VS1 A;  2Y90 A;  4M78 E;  3QJ6 A;  1FXX A;  3CCU Q;  2DRM A;  3MHX A;  2QTX A;  4BY6 B;  4BI3 A;  1RAD B;  3M55 A;  1V1C A;  4EMK A;  4OMP A;  2XG8 D;  2QEX A;  2VGM A;  2LCL A;  4Y28 E; 
#chains in the Genus database with same CATH homology
 1WFW A;  3LH5 A;  1XOV A;  2DL7 A;  2C0O A;  1PRM C;  2EPD A;  2EGE A;  1MUZ A;  1RUW A;  1WX6 A;  2D8J A;  3M0U A;  1VA7 A;  2HDA A;  3VS6 A;  2L3P A;  1M3C A;  2EBP A;  2XMF A;  3EHR A;  1JU5 C;  2RNA A;  4EIK A;  2DX1 A;  2J6F A;  2C0I A;  4Z89 A;  2VVK A;  2LCS A;  1OEB A;  3REA B;  1ZUY A;  3SEM A;  2MIO A;  4HCK A;  3H0I A;  2LJ0 A;  2K2M A;  1JEG A;  4LN2 A;  2PTK A;  3KFV A;  1RLP C;  1W6X A;  1NG2 A;  1CKA A;  4ZNX A;  1ZUK A;  4CC2 A;  2CH4 W;  1X43 A;  2JS0 A;  2DBM A;  1SHF A;  2ED1 A;  1NLO C;  1BU1 A;  2NWM A;  4J9B A;  2YDL A;  2AKL A;  1GCQ A;  4RTY A;  1U3O A;  4AFU C;  1RI9 A;  2LJ3 A;  2RMO A;  2JM8 A;  2F2V A;  1J3T A;  2OI3 A;  1PNJ A;  1NEG A;  3PE0 A;  1UG1 A;  4ORZ A;  2F2W A;  5IXF A;  1UJY A;  3H0H A;  4AFZ C;  2GQI A;  2X3X D;  2CT3 A;  3UA6 A;  1AZG B;  4M4Z A;  4OML A;  2H8H A;  2K9G A;  5GJV B;  1UGV A;  4JZ4 A;  1PHT A;  2CSQ A;  2KYB A;  1K9A A;  4RTW A;  1NM7 A;  2JMA A;  5IXB A;  1T0H A;  2BZ8 A;  2J05 A;  4RUG A;  1SRM A;  4OMN A;  5IH2 A;  4F17 A;  2O9V A;  2YUP A;  1SRL A;  1JXO A;  2JW4 A;  2RQR A;  1JQQ A;  1MV3 A;  1A0N B;  4F14 A;  2K79 A;  4J9I A;  2EGC A;  2BZX A;  5GJW B;  2JS2 A;  1AWJ A;  1Z9Z A;  2KT8 A;  2EGA A;  3ZL7 C;  1PKT A;  1M8M A;  1GFC A;  2M0Y A;  2RPN A;  2L3S A;  2SEM A;  2LMJ A;  2W0Z A;  3M0Q A;  3VS7 A;  4HVV A;  2EW3 A;  2K3B A;  4CC4 B;  1UDL A;  2DIL A;  2CUB A;  2RQV A;  2AZV A;  4J9G A;  2CSI A;  2I0N A;  4KRT A;  4D8K A;  1PRL C;  3PVL A;  1M3B A;  4QT7 A;  2HEQ A;  2DE0 X;  2ABL A;  2HBW A;  4LUD A;  4DEX A;  1TG0 A;  4D8D A;  2KT1 A;  2ROT A;  1X69 A;  2GGR A;  1ARK A;  1AZE A;  1OV3 A;  3THK A;  2CDT A;  1CSK A;  5EC7 A;  1NYG A;  1U5S A;  2AZS A;  2DRK A;  4AFS C;  1T3L A;  3SHW A;  2CUD A;  5FW9 A;  2PZ1 A;  2FPD A;  3H41 A;  2O9S A;  2YUQ A;  2RN8 A;  2LJ1 A;  2FRY A;  1H92 A;  1WXB A;  2D0N A;  1GRI A;  4HVW A;  4Y92 A;  2YUN A;  2ESW A;  4JZ3 A;  1QWF A;  2P4R A;  1X6G A;  2ENM A;  1OOT A;  4J9E A;  1OPL A;  2RQU A;  2BZY A;  1QKW A;  1AWW A;  1KFZ A;  1SEM A;  2GNC A;  2EQI A;  1LCK A;  1QCF A;  1Y0M A;  3CQT A;  1N5Z A;  3RNJ A;  2D8H A;  2EYW A;  2L0A A;  3A98 A;  2RQT A;  4RTX A;  1QWE A;  4LUE A;  1RLQ C;  3VS0 A;  1BBZ A;  2O2O A;  4ESR A;  3EG3 A;  4K11 A;  3I5R A;  1K4U S;  2J6O A;  2PNI A;  3VRY A;  4AFQ C;  1WXT A;  2EKH A;  1KIK A;  3NHN A;  2EYZ A;  3GBQ A;  2RF0 A;  3I9Q A;  1IO6 A;  1ZSG A;  2L3Q A;  2CH4 A;  2KRN A;  3TSZ A;  2IIM A;  3EG2 A;  4JJD A;  2K7A A;  4X1V A;  5I11 A;  1UHF A;  2C0T A;  1UEC A;  3H0F A;  2EYX A;  4CC3 A;  2F2X A;  2DJQ A;  1BB9 A;  2RQW A;  2CT4 A;  1QKX A;  3JV3 A;  1CKB A;  3NMZ C;  2V1R A;  2VWF A;  4A63 B;  2KRO A;  2DNU A;  1ZX6 A;  1HSQ A;  1GCP A;  2FPE A;  2GBQ A;  1I07 A;  4CC7 A;  4F16 A;  1E7O A;  1WLP B;  2JMC A;  2E5K A;  1K76 A;  4OMM A;  1GCQ C;  2FRW A;  5L23 A;  1E6G A;  2MOX A;  2ROL A;  5IHI A;  3UAT A;  1WIE A;  2A08 A;  4AG2 C;  1B07 A;  1Z9Q A;  3EGU A;  1TUC A;  1NYF A;  2YT6 A;  3U23 A;  1UTI A;  1AVZ C;  2ED0 A;  3R6N A;  2HSP A;  2DL3 A;  1JXM A;  1X27 A;  1YNZ A;  1H8K A;  1SHG A;  4RTT A;  1K1Z A;  2OJ2 A;  2DM1 A;  1YCS B;  1ZLM A;  1SPK A;  3O5Z A;  1ABQ A;  1SSH A;  1WDX A;  1WA7 A;  1GBQ A;  4J9C A;  1G83 A;  2BTT A;  1OPK A;  1KSW A;  3M0P A;  1AOJ A;  1YWO A;  3M0T A;  2A37 A;  1E6H A;  1AEY A;  2A28 A;  2DBK A;  2KRM A;  4GLM A;  3PVQ A;  2L2P A;  2LQW A;  1G2B A;  2YUO A;  1M27 C;  1X6B A;  2GTJ A;  2DVJ A;  2HCK A;  4GBQ A;  1UFF A;  1UUE A;  3IQL A;  3VS2 A;  3UA7 A;  3NPF A;  3TVT A;  2KXC A;  1TUD A;  1K0S A;  2EVR A;  3VS5 A;  2K6D A;  1AWO A;  2DYB A;  2B86 A;  2JT4 A;  2LP5 A;  3NGP A;  2VKN A;  2J7I A;  1GBR A;  4DEY A;  1ABO A;  4IIM A;  4HVU A;  2J06 A;  1W1F A;  1M30 A;  2JM9 A;  2FEI A;  2O31 A;  3ULR B;  3VRZ A;  2CRE A;  4RTZ A;  3QWY A;  4J9F A;  4RTU A;  1PKS A;  3EG0 A;  1MV0 B;  1FMK A;  4FSS A;  3I5S A;  1YP5 A;  4JJB A;  1S1N A;  2DL5 A;  4J9H A;  4HXJ A;  2KXD A;  5IHK A;  1UHC A;  2YSQ A;  2KGT A;  2W10 A;  2AKK A;  2FPF A;  2JXB A;  1AD5 A;  2DMO A;  1M3A A;  1FYN A;  2DL8 A;  3TSW A;  4R0K A;  2NUZ A;  2MCN A;  2D1X A;  3VS4 A;  3QWX X;  1KJW A;  1UJ0 A;  1NLP C;  2GTO A;  1HD3 A;  3EG1 A;  4OMO A;  3M0S A;  1GL5 A;  2KNB B;  2KYM A;  1Y57 A;  1I0C A;  2KE9 A;  5HCK A;  4WCI A;  2KR3 A;  2X3W D;  1VYV A;  4JJC A;  2FO0 A;  2QDL A;  1EFN A;  4JPB W;  2A36 A;  1ZBJ A;  1H3H A;  2DLP A;  1T3S A;  2KEA A;  1WI7 A;  4LE9 A;  5IHN A;  1VYT A;  1B3Q A;  3REB B;  2DF6 A;  3EHQ A;  1UE9 A;  1HJD A;  3M0R A;  4J9D A;  4Z8A A;  1YN8 A;  2JTE A;  3RBB B;  2J6K A;  5I22 A;  2DA9 A;  1YWP A;  3I35 A;  5ECA A;  2AK5 A;  2LZ6 B;  3C0C A;  1PWT A;  1JO8 A;  1T0J A;  4Z88 A;  5FWC A;  4E6R A;  4OMQ A;  1GFD A;  4LNP A;  3UF4 A;  3VS3 A;  2EYY A;  1I1J A;  4AG1 C;  1W70 A;  1WXU A;  1VYU A;  2ECZ A;  2KRS A;  2SRC A;  2M51 A;  4IIO A;  4RTV A;  1WYX A;  1BK2 A;  1U06 A;  3FJ5 A;  2KBT A;  2LQN A;  3VS1 A;  1NEB A;  1X2K A;  1X2Q A;  1QLY A;  2DRM A;  1ZUU A;  2G6F X;  2OAW A;  2LNH B;  1V1C A;  2DL4 A;  4OMP A;  1K0X A;  2FG0 A;  2V1Q A;  1AWX A;  2O88 A;  2LX7 A;  5FWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...