1AOJA

The sh3 domain of eps8 exists as a novel intertwined dimer
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction
molecule keywords EPS8
publication title The SH3 domain of Eps8 exists as a novel intertwined dimer.
pubmed doi rcsb
source organism Mus musculus
total genus 6
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aojA00
2LZ6B 5FW9A 1ZUYA 1B07A 3VRZA 2OAWA 2RPNA 4JJCA 4D8KA 1HD3A 1OV3A 2DVJA 2J6KA 2DA9A 4Z8AA 2NWMA 3PVLA 2CDTA 1TUCA 1GRIA 1T3LA 3UA7A 2DL8A 1KSWA 2ED0A 1XOVA 1RI9A 2KRNA 2O9SA 4LUDA 1AWOA 3SEMA 1I0CA 2L3PA 4ZNXA 2C0OA 2M51A 2VVKA 4JJBA 1UHCA 2K6DA 4EIKA 2YUNA 4QT7A 2YUQA 4Z89A 2X3WD 2L3QA 2EQIA 2G6FX 3ZL7C 2FPFA 1MUZA 2KT1A 2CSQA 1AZGB 3M0PA 2KYMA 2LX7A 5FWCA 4JJDA 2A08A 1E6GA 3C0CA 3GBQA 2EVRA 1J3TA 2HBWA 2RQWA 4RTTA 2ENMA 2A36A 5IXBA 1BU1A 2L0AA 3QWXX 1W70A 1Y0MA 1PKSA 2JT4A 1K4US 1TUDA 2KT8A 4AFQC 2BZXA 2K9GA 4CC7A 4X1VA 3EG2A 4JZ3A 3M0UA 2P4RA 2ABLA 2EYXA 2EW3A 2W0ZA 3KFVA 3VRYA 4Z88A 1SHGA 1K9AA 1H8KA 2KE9A 4RTZA 4HVWA 4F16A 2PZ1A 3QWYA 4LUEA 1NG2A 1ZX6A 2YDLA 2DL3A 1RLPC 1KFZA 2JW4A 4JPBW 2DL7A 2AZVA 1NM7A 4CC2A 2J05A 4A63B 2F2WA 4RTYA 2F2XA 3VS5A 4J9IA 3PE0A 1GFCA 2KXDA 2GQIA 2YUPA 1BK2A 2SEMA 1PRLC 4OMNA 4GBQA 4ESRA 1PKTA 1WLPB 1UDLA 2J6FA 1PWTA 4M4ZA 1PHTA 2XMFA 1T0JA 2ROTA 2MOXA 1ZBJA 4OMOA 2QDLA 1M3BA 5L23A 2YSQA 2JXBA 1TG0A 2VKNA 2RMOA 1OOTA 2C0TA 3RBBB 1HJDA 3VS2A 4JZ4A 4HVUA 2LQNA 1CKBA 2RQUA 2LJ3A 2CT3A 1YWOA 1SRLA 3CQTA 3UA6A 2KR3A 2BZYA 2HEQA 2PNIA 2J6OA 1KIKA 1UTIA 4OMPA 1AWXA 1QKWA 2VWFA 2DNUA 2J7IA 1H3HA 2JM8A 4DEXA 5IHNA 5I22A 3M0TA 2O88A 2KNBB 5ECAA 3NPFA 2RQTA 2EYWA 1U06A 2D8HA 2FO0A 3NHNA 1MV0B 2EKHA 2CREA 2KROA 3M0SA 2PTKA 3NMZC 1VYTA 2F2VA 4ORZA 2HDAA 1M3AA 2J06A 4AG1C 2CUBA 1AVZC 1NYGA 4RTVA 2DL4A 4CC3A 3VS3A 1U3OA 2DRKA 3EG0A 5IHIA 3VS4A 5EC7A 2YT6A 3PVQA 3FJ5A 1M8MA 1ARKA 1AZEA 2DBKA 3THKA 1I07A 3UF4A 4E6RA 3I9QA 3M0RA 3IQLA 1UG1A 1YCSB 1VYVA 1JXOA 1WI7A 1NEBA 1NEGA 3M0QA 3REAB 2LNHB 1B3QA 4AFSC 1W6XA 1MV3A 1X6GA 1SEMA 2FRWA 2GTOA 2DBMA 2CH4W 2JM9A 2YUOA 4AFZC 1BB9A 1E7OA 2K3BA 1YN8A 2GNCA 1SHFA 1KJWA 3NGPA 1A0NB 1FYNA 4GLMA 1GCPA 3VS0A 2DMOA 2X3XD 3UATA 2AK5A 1GCQC 5I11A 2KEAA 1PRMC 2O31A 1X2QA 4J9BA 1YP5A 5FWBA 1VA7A 1GBRA 4LNPA 3H0FA 3EHRA 1WXUA 1BBZA 2DM1A 1GL5A 1OPLA 1CSKA 1QWFA 4D8DA 1ZSGA 2A37A 2CSIA 1X27A 3H0IA 1UECA 4AG2C 1JQQA 2FEIA 1QKXA 2FPEA 1RUWA 2LQWA 3LH5A 1UJYA 2GBQA 1UE9A 3A98A 4DEYA 2D8JA 1W1FA 1YNZA 1GCQA 2OI3A 1X2KA 4OMLA 1WXTA 2KGTA 2DF6A 1UHFA 4HXJA 5IXFA 1IO6A 1WA7A 2EGEA 2HSPA 3O5ZA 1WX6A 2MCNA 1I1JA 1AWWA 1ZLMA 2DE0X 3EHQA 1G83A 2SRCA 1LCKA 1Y57A 2K2MA 1ZUKA 3H41A 1AD5A 2LJ1A 1OPKA 2JS0A 3I35A 1FMKA 2O2OA 2OJ2A 2AZSA 2EGCA 1UGVA 1UJ0A 2L3SA 3VS7A 1AOJA 2GTJA 3I5RA 2JTEA 2HCKA 1GBQA 2AKLA 2JMCA 3EG3A 2K7AA 4HVVA 2L2PA 1JXMA 1E6HA 1K1ZA 2ROLA 2ED1A 2O9VA 2I0NA 4J9FA 2M0YA 5GJVB 5IHKA 1X43A 1WDXA 2C0IA 4J9EA 3VS6A 1SPKA 1M27C 4FSSA 2ESWA 4AFUC 1OEBA 1UUEA 3ULRB 4WCIA 1V1CA 2CUDA 2LP5A 2JS2A 3TSZA 2EGAA 2KYBA 4F14A 4RTUA 3RNJA 1WIEA 1X6BA 3JV3A 2AKKA 4HCKA 1SSHA 1SRMA 4IIOA 1K0SA 4J9GA 2D0NA 1X69A 1Z9QA 2V1RA 1GFDA 4K11A 3EGUA 3SHWA 2EPDA 1EFNA 2KRSA 1VYUA 2MIOA 2FG0A 2H8HA 1JU5C 2KXCA 2DL5A 1M30A 2A28A 4IIMA 3REBB 1T0HA 5HCKA 2DJQA 2RN8A 1S1NA 1AWJA 2DILA 2W10A 4J9HA 4RTWA 2LCSA 2GGRA 1K76A 2LJ0A 4J9CA 1HSQA 1M3CA 4KRTA 3I5SA 2CH4A 3U23A 1CKAA 1JEGA 1ABOA 4RTXA 5GJWB 1WXBA 4OMQA 1N5ZA 3TVTA 1H92A 1G2BA 1U5SA 2E5KA 1QWEA 1NYFA 1ZUUA 2BZ8A 3H0HA 4LN2A 1NLOC 3TSWA 2ECZA 1RLQC 2NUZA 2DRMA 1T3SA 2JMAA 2V1QA 2DX1A 1K0XA 2FPDA 4RUGA 2EYZA 2K79A 4LE9A 2EYYA 2FRYA 4CC4B 5IH2A 1YWPA 1ABQA 2DLPA 3VS1A 1WFWA 1NLPC 1QLYA 1PNJA 2RQVA 2RF0A 3R6NA 2D1XA 4F17A 4R0KA 2LMJA 2RNAA 2RQRA 4Y92A 1AEYA 1WYXA 1UFFA 2DYBA 2KRMA 1JO8A 2IIMA 3EG1A 2BTTA 4J9DA 2B86A 2KBTA 1Z9ZA 2CT4A 4OMMA 2EBPA 1QCFA
chains in the Genus database with same CATH superfamily
3JB9G 2RHYA 3C95A 2RI2A 4M75D 4FW2A 2HKQB 3VYHB 2RPNA 1C6VX 1HD3A 2DVJA 4Z8AA 5LJ5g 4BDYA 1I8FA 3BDUA 2LX9A 5KYYA 1AWOA 3SEMA 5CO7A 3QZ9B 1I0CA 4KULA 5DLOA 2CKKA 2K6DA 3BE3A 2QTVA 1Q7YC 4EIKA 3MEVA 1NBEB 4BI8B 4M7AD 4HA8A 3HRUA 3G6EA 2L3QA 1HK9A 1JBMA 1VQMT 3FEOA 2RO0A 2DJZA 2EQUA 3SB2A 4XTXA 2LX7A 2A08A 2YLBA 1E6GA 3C0CA 3DKMA 3UPUA 3OYAA 1X6OA 3A8GB 3CC2A 3QWXX 2KT8A 1XJWB 4AFQC 3E9FA 1Q82U 2OAUA 2CP2A 2RHUA 4JZ3A 3M0UA 2EYXA 4KUIA 2GCXA 2EW3A 2KQWA 2MMPA 3KFVA 2LC4A 3VRYA 3L2WA 1Y96A 2DTOA 4M78G 3G4SA 3OW2S 1H8KA 4RTZA 4QVCA 2PZ1A 5GAN2 2DL3A 5AT1B 2ZPGB 4JPBW 2DL7A 2YRVA 3Q1JA 4FU6A 1QVFA 1R8OB 1Q86C 3L42A 4A63B 3JCMX 4FCYA 3A5ZB 1RI0A 1VQ4T 3VS5A 1IHVA 4VUBA 4PL6A 2KK4A 2EWNA 1AT1B 2GQIA 3M4GA 1SG5A 1NPRA 1ZSZB 1PRLC 3QYHB 3CC4T 1VQKA 2FYKA 5CQYA 1M1FA 1Q7YU 4LDWA 4II1A 4C8QG 1EZZB 4KH1B 5LJ3d 2KDSA 2QEXQ 4KGXB 4BACA 2ROTA 2MOXA 4LDUA 1ZBJA 4C92C 2QA4A 4OMOA 2QDLA 2RMOA 2XHCA 3RBBB 1OU9A 3CMAQ 1HJDA 2LQNA 2G3RA 2E3IA 4PJNA 3P8BB 1FMWA 2CT3A 4C92E 1YWOA 2KMTA 4EDUA 2BZYA 2HEQA 2J6OA 1Q82R 1QKWA 2J7IA 1H3HA 1R77A 1BIAA 3BFMA 4DEXA 2DXCA 2X51A 4J7IA 1S72Q 4PJJA 3EGDA 2CYZB 3NHNA 1MV0B 1Q86U 2DTIA 4HKEA 2KROA 3M0SA 2Z0WA 1VQLQ 2L8DA 1RL2A 4AG1C 2HD0A 4QQDA 2CZ7B 1M1KC 4RCBA 1B7TA 2M02A 2DRKA 3EG0A 4PJOG 1C1AA 3QG1A 4J6XA 1M8MA 4BY6C 3UDCA 1ARKA 1AZEA 3C4SA 1Q7YR 2JJ9A 1VQOQ 5A0DA 4BE0A 3DB3A 5CCAA 1VQPT 3M0RA 3IQLA 4XTZA 2VXFA 2QQ9A 3C94A 1NEGA 2RJDA 1EX4A 2EQKA 2GTOA 2ZPEB 2CP0A 4AFZC 1QVFS 2LT4A 1YN8A 2K3BA 2GNCA 3NFCA 1KJWA 2VYTA 4DOVA 1YFNA 4FYWB 5IT9E 3CCJA 2VXEA 4M78F 4M75A 1WJRA 5LJ5d 1PRMC 2EJFA 3CXCA 4J9BA 4AMCA 3X20B 4LNPA 3PIOA 1M90C 3J7AF 3EH2A 5GAOm 2EAYA 1KQSP 1OPLA 1CSKA 4D8DA 2QG9B 1ZSGA 2H3JA 3OYHA 1F1BB 1VOMA 2VC8A 3V8JA 3G71Q 1D3BA 3H0IA 5CKDA 1Q86R 4IUUA 2HL3A 3GP8A 1QKXA 1G3TA 3L2ZA 3A98A 1VQNA 4DEYA 1W1FA 4OMLA 8ATCB 4J6YA 2JN0A 1M1KU 2DF6A 4HXJA 1IO6A 5CQXA 3GPLA 3ME9A 5HK0A 3RUXA 4IUTA 1YITT 3CBOA 2VV5A 3EHQA 3X26B 3M5AA 2LRQA 3JCMg 1PC0A 1JJ2P 2OX7A 3HRSA 2OJ2A 1WQWA 2XI9A 2WSEE 2EGCA 4GY5A 1UJ0A 2NUPB 3PIPA 4LDXA 3VU3C 4JLGA 3CBMA 4A4KA 2JTFA 3NTHA 2ZZDA 2LDMA 4DQ2A 1V29B 2JUFA 2JMCA 1RACB 4HVVA 1YITA 3VUBA 4PFZA 1E6HA 3LLRA 2RHZA 2XDPA 3QYGB 2M0YA 5IHKA 4NL3A 1X43A 2RA2A 1SPKA 1QCNA 1M27C 1U8RA 1M90U 2ESWA 1K8AC 2FL7A 4M75C 1UUEA 4XQ3A 1VQ8Q 2E10A 2Y90A 3A1PA 3RIRA 1OQKA 3JV3A 4RG8A 4PJOF 2QK0A 4J9GA 1VQ9Q 3EGUA 2OTJQ 1OZ3A 4C5HA 1YHQQ 2L89A 2E70A 1M1KR 2KRSA 5J26A 3LGLA 1DJ7B 5GAMg 5CKHA 2COYA 2I2LA 1G3WA 3CCQQ 2KXCA 2A28A 4EMHA 4M7AC 1X75C 3V7RA 5HCKA 1OYXA 1QMCA 3CCLQ 4J9HA 2GGRA 3CXCS 4XTWA 2JOYA 1HSQA 3UWNA 1Y96B 4M7AE 4A4EA 1WXBA 1G2BA 1QWEA 1YCYA 4LN2A 3NTKA 5DY9A 2ZGWA 2ECZA 3CCUT 2MK5A 2NUZA 2DRMA 2RHIA 5KYWA 3JCMP 1K0XA 3FJPA 4RUGA 2QTXA 3OYBA 2EYZA 3CC7Q 1KK7A 4LE9A 2EYYA 5HY6A 4QVDA 4A54A 1WFWA 1NLPC 3CCSA 2E41A 1RADB 1TXQA 2DYIA 4F17A 3EH1A 2LMJA 2F5KA 1AEYA 2X4WA 1WYXA 1D1CA 1UFFA 5EG2A 2KRMA 3CCUA 4ZN1A 1M5Q1 4HCCA 2X4YA 3FC3A 2VUBA 2ZPFB 3VYGA 5FW9A 2OAWA 2QASA 4JJCA 2QEXT 4M77E 3INZA 1KD1C 3FLGA 3JB9D 2HAXA 2DA9A 2NWMA 3PVLA 2EKOA 1GRIA 1OI1A 1MMNA 4J8OA 2KRNA 3MEUA 5FLXE 3CMAT 2C0OA 5CK9A 2DVEA 2L5QA 2K4YA 5LJ3g 3EGDB 2YUQA 4Z89A 3HPWA 2X3WD 4YTLA 2BKDN 2KT1A 1BYMA 2CSQA 1YJ9T 3OBYA 1VQ5Q 1TOVA 2LCLA 5FWCA 2A7YA 2E6ZA 1UGSB 3L2VA 2RQWA 4RTTA 1X01A 1BU1A 1S72T 3T9NA 3QKJA 1KQ2A 1UGPB 5KYUB 1QP3A 4X34A 2DKGA 4PLLA 2GF7A 1NPPA 4ZGEB 4IUQA 3LGFA 1PD0A 3MP1A 3BW1A 2W0ZA 2F5TX 5D6XA 1IB8A 2KE9A 3GOXA 1YJ9A 2WSFE 4LUEA 4M78D 2D6FA 1ZX6A 3RMQA 4FW1A 4C0DC 2JW4A 2AZVA 1NM7A 4D6WA 4KT0E 3I55Q 1VQOT 2PUKB 2F2WA 2F2XA 3CCMA 2R58A 1YJWQ 5FU7C 5HK3A 1KD1U 1IREB 1W2BP 4M75B 2YUPA 3CCEA 1M8VA 1BK2A 2SEMA 2YRDA 3META 1W4SA 1MHNA 1WJSA 1YIJT 4BI4A 2VASA 4E7LA 2QQRA 4J6WA 3UT1A 2ZAEA 1PKTA 3ASKA 3G7ZA 2J6FA 4QW2A 2FB7A 2YXYA 3JAME 1Q81C 1PHTA 4C8QD 3OYCA 2O4XA 5IAYA 4M7AB 3DLLA 2PVGB 4KUDK 4JLIA 1OOTA 2C0TA 3MP8A 5FROA 3VS2A 4JZ4A 3CCRQ 2RQUA 1YIJA 4J5YA 2LJ3A 1D0ZA 4M7DD 2YHTA 5GMKi 5GAMd 3P8HA 1OX8A 2M1HA 4FYVB 3G71T 2EYQA 3OA6A 1AWXA 4FYXB 1I5LA 2DNUA 1BI3A 2KY9A 2JM8A 2CZ6B 1KC8C 4XK8E 2E5QA 3TCJA 2KNBB 2HQXA 4C92A 5ECAA 3NPFA 1U06A 4ELYC 1XQHA 2D8HA 2FO0A 2DETA 1YJNQ 1MMGA 3NMZC 1VYTA 3L2RA 2XK0A 2HDAA 1KD1R 2X35A 2WACA 1AVZC 3OYDA 1MNDA 3X28B 3ZEHA 4EMGA 4CC3A 3VS3A 4P5NA 3JCMJ 1VIEA 1VQ7Q 2VGNA 1BI1A 3VS4A 2LCCA 2YT6A 2DBKA 4PJOD 3AT1B 1I07A 3RMSA 2QGGA 1Q81U 1VYVA 2RB6A 4UC4A 3DLMA 1NJIC 1TTHB 1VQMA 2OTLQ 1QP2A 5GANg 3REAB 2LNHB 3M59A 1W6XA 1MV3A 4KBMB 2FRWA 3PFSA 1PG5B 2DBMA 2CH4W 1BB9A 1E7OA 5KE3A 5CKEA 5I2MA 3OW2P 4J83A 2AIRB 4ZGJB 4GLMA 2NLUA 3EFRA 1VQ8T 1U1TA 2M0OA 1GCQC 4NOYA 5I11A 3O8VA 2O31A 1WHLA 4M77D 1KC8U 4OB3B 4N4GA 1VQ9T 1MMDA 5KYNA 1VA7A 1C0MA 3H9NA 1GBRA 3KUFA 2ATCB 4C92F 1YHQT 3H0FA 3OMCA 1WXUA 1BBZA 2E1HA 4BI3A 2D9TA 1D0YA 3BDLA 3CCLT 1UECA 4LDVA 4AG2C 1JQQA 1LOJA 2LVMA 1B34B 3LH5A 3MP6A 5KYWB 1VQ4A 1KQSA 2OI3A 3L2UA 1X2KA 1WXTA 2KGTA 5IXFA 4CRIA 1WA7A 4OGEA 2DK3A 1WX6A 1UB4A 3CC4A 1AWWA 5GAOp 1RAGB 4C0DB 5D6YA 4LD6A 2H3EB 1Q81R 1I5OB 1LCKA 1Y57A 3H41A 3I35A 4TVRA 1FMKA 1RAFB 4M75G 3CC7T 1GXIE 3EFOB 1UGVA 1V76A 3CD6Q 3VS7A 2P0KA 3QDFA 2JTEA 2K3XA 2HCKA 1GBQA 2K57A 2CP3A 1FX7A 2Y4XA 5CIUA 2K7AA 1JJ2A 5L8RE 3I56Q 2IG0A 1K1ZA 3TREA 4BE2A 5GJVB 1KC8R 1WDXA 2C0IA 4M7AG 3VS6A 2K3YA 4Q5WA 1WZOA 1M9SA 5KYUA 3OYIA 4WCIA 2QAZA 4ZTFA 2CUDA 1YI2Q 2LP5A 2EGAA 2KYBA 1G3SA 4RG2A 3RNJA 1OX9A 2EQJA 2AKKA 4LXCA 2HNIA 4IIOA 2NUTA 1Z9QA 4K11A 5GAMj 1VQ6Q 1EFNA 2LQKA 1HYOA 2MIOA 5CKBA 3MHXA 2H8HA 1JU5C 3QO3A 1TWBA 2DJQA 2RN8A 3VUZA 3OYMA 2DEQA 2W10A 1VQ5T 2RJCA 1K76A 2LJ0A 4LD9K 4DBRA 1WQ7A 4KRTA 1VQPA 1P92A 3L2QA 2JZ2A 3GLXA 1KHIA 1ABOA 1TH7A 4JRIA 4XAXB 5KH6A 3CEYA 2E5KA 1ZUUA 2XICA 4DBQA 3QXEB 5FU6C 2LTOA 1T3SA 2HL5C 3M55A 2YLCA 2FPDA 4HCZA 4M7AA 4HT8A 1WPYA 4XU0A 3OYFA 2YWWA 4CC4B 1ABQA 3FRNA 4M78C 5GAN3 3G6EQ 2RJEA 3PNWC 1ACMB 5CVIA 5FRNA 1N8RC 4MMLA 1IZ6A 4F04B 2Y4YA 4M78E 4OMFB 2O4XB 3CC2Q 5GAN5 2CP5A 5GANd 5KCOA 5GAOn 2CT4A 4C0ZA 2JVVA 3CMET 2E65A 3M57A 1N9SA 1ZUYA 2KVQG 3JB9I 3VRZA 2QGFB 2XKOC 1JJ2S 2IPOB 4D8KA 2EJGA 1OV3A 2J6KA 1D1AA 1WGSA 5C6SA 3G4SQ 2CDTA 4AT1B 3TQ7P 1D09B 1AHJB 1TUCA 1T3LA 2DL8A 4C8QC 1KSWA 3CBPA 2ED0A 4M75F 1WNLA 1RI9A 2O9SA 1D0XA 4LUDA 3OS1A 4NS5A 2L3PA 4ZNXA 2M51A 4JJBA 1UHCA 4C92B 4ZTJA 2E3HA 3PGGA 5LJ3j 1QW1A 1TSFA 3OBWA 2YUNA 4M77A 4C8QE 2HQEA 2COWA 4M7DC 3CMEA 3M56A 5CKFA 4HCBA 3MJXA 1G3YA 2EQIA 1XNIA 3ZL7C 3JB9H 2M16A 1MUZA 3AHUA 3M0PA 3GBQA 1VQKQ 4M7AF 1H3ZA 4M7DE 1J3TA 4XU2A 3V8KA 5CR2A 2ENMA 2A36A 3X25B 2X4XA 1W70A 4N0AC 1WHJA 1K9MC 2K9GA 4EMKA 1YJNT 4CC7A 4L6V5 2QA4Q 3H6ZA 2ABLA 2V8JA 5C0MA 3OSSC 4Z88A 1SHGA 1WHHA 3SWNC 1M4ZA 4N4HA 4F16A 2CZ1B 2QXFA 2PQWA 3QWYA 3S3MA 1VQ7T 2DD5A 4IURA 3M53A 1RLPC 2GFUA 1QVPA 3D7SB 2J05A 3RKWA 4A4GA 4RTYA 3P8DA 3ER0A 5LJ3f 4JRQA 4PJOC 2RD1A 2MWPA 3MPUB 4BY6B 2KXDA 1B34A 2OTLT 4E7IA 2XIDA 4FM4B 4PJOE 4C5IA 5J3BA 4ESRA 1XTDA 1BI0A 4Y28E 1Y7XA 5D6WA 1M90R 1W2BA 1K8AU 1IHWA 1M2OA 5GMKj 4XTVA 3A8HB 1SKUB 2PU9B 4PK4A 3CPFA 1M3BA 3PTAA 3EG9A 2YSQA 2JXBA 5I2SA 2VGMA 4M77C 2DTHA 1QVGA 5LJ5e 3EFOA 4HVUA 1CKBA 3CQTA 3LWIA 2PNIA 1OZ2A 1K9MU 3CPWA 4MDXA 5LJ5j 1UTIA 2DIQA 3HFOA 4JJNK 2E64A 4RCCA 2VWFA 3A8MB 3QPHA 5I22A 2JTMA 4ZGDB 1TS9A 2O88A 1HXDA 3FDRA 4EMKC 2KAFA 2RQTA 2E12A 2EYWA 3CCJQ 2X9HA 2GFAA 3JCMh 2AHJB 4Y91A 4OP0A 2EIFA 2F2VA 1I81A 3VKIA 2QEXA 1M3AA 2J06A 2P84A 3PMIA 2K5LA 3OYKA 4RTVA 4BE1A 1N27A 1BI2A 4WF2A 4DBHA 4DOWA 1KHCA 3CMAA 4E47A 3FJ5A 3GNFB 2LT1A 1MGQA 2R57A 3PMTA 3THKA 1ZSZC 4E2FB 3OB9A 5DM7R 1VQLT 1K8AR 1VQNQ 5GANj 3I56T 1O75A 1WI7A 1NEBA 1RAEB 4QQ6A 3SDZA 5LJ5f 1B3QA 1VUBA 2NUTB 2DO3A 2YUOA 5A2QE 3LWHA 4FL6A 3QSUA 3JCMQ 3QHSA 5J39A 3NGPA 4C92G 4ANJA 1S72A 1GCPA 1JRIA 3VS0A 5GMKl 2RK2A 1K9MR 1UEBA 2AK5A 3GIBA 4M7DB 2LNVA 1VQLA 3X24B 3OYJA 3J81E 2KI7A 5GAN8 4OGCA 5GAMh 1SSFA 1X2QA 2O01E 3OW2A 1YP5A 3EHRA 1W2BS 2DM1A 2HQHA 1H641 1QVGP 4ELZC 1YITQ 2V26A 4E7ZA 2WSCE 2MPXC 2MI6A 5I21A 1VQOA 2RI5A 3CPWP 2GBQA 1UE9A 4RKUE 2R5MA 2D8JA 4B9XA 1GCQA 3CCVQ 1UHFA 2DZ9A 2QYZA 2EGEA 2HSPA 2MCNA 4MZTA 3OS2A 2CP6A 2QQAA 2ZPHB 2D0QB 2DE0X 3RDVA 4A53A 1WHMA 1N9RA 2K2MA 3E9GA 2JS0A 3OSVA 3SFMA 2PUOB 1BIBA 2AZSA 2MYSA 2L3SA 3HSBA 3G6ET 1R0CB 1AOJA 2GTJA 3V8LA 5GAOq 2XU8A 1Q95G 4XTUA 4IUPA 2A3LA 4F7UE 4J7FA 3G71A 2L2PA 3G1JA 1JXMA 3CC2T 3QDRB 2ED1A 2O9VA 2I0NA 4J9FA 2XD0A 3GF5A 3TEEA 3JCMb 4IKFA 4FSSA 4M77B 2IVWA 4Z02A 3ULRB 3VV0A 3G4ST 2JS2A 3F70A 4F14A 3H8ZA 9ATCB 4QVZA 5KYXA 4HCKA 1K0SA 5LJ3h 2P0PA 4IUVA 1X69A 2V1RA 3CCSQ 1BCMA 3SHWA 7AT1B 2C06A 2DL5A 3REBB 2HBPA 2NYSA 4EMKB 1S1NA 3CCUQ 4DBFA 2DILA 4RTWA 2LCSA 2DXUA 1WJQA 1VQKT 3I5SA 2CH4A 3S3OA 1CKAA 3HHTB 1JEGA 5IN1A 4RTXA 2OTJT 3LYIA 4E7HA 1N5ZA 1H92A 4XTYA 3EGXA 3LH0A 3CCQT 1OULA 2QA4T 1M2VA 3TSWA 2CGHA 4PFPA 3HTRA 2COZA 3OYNA 2E6NA 2F1LA 1UGQB 2QQBA 3E2UA 1VQ8A 3LW5E 3M58A 2DFUA 1PM3A 2K79A 2FRYA 1YWPA 3JCMe 3EFSA 1VQ9A 2DERA 2OTJA 1PNJA 1YHQA 3ZBDA 4JRKA 3R6NA 3NTIA 2DXBA 3WVDB 1QQJA 1U1SA 1O9SA 3CCQA 4Y92A 2MAMA 5A0LA 1JO8A 3CCLA 3EG1A 1NJIU 3EG9B 5FU7B 4M7DG 2RI3A 4OB2B 2KBTA 2EBPA 2VB6A 1YBYA 2LZ6B 4MZPA 4V2SA 5GMKh 2MWOA 1B07A 4PJMA 1BKBA 3GNGA 4C5GA 1NZ9A 4M78A 3MO8A 1YJ9Q 3L1AA 3S6WA 3UA7A 3OS0A 1XOVA 3S3NA 3QUIA 2VVKA 3JB9F 4B9WA 4PKCC 2PVDB 1ZBXA 4QT7A 3CC7A 3M54A 1PCXA 3CCMQ 5LJ5h 2HMAA 4FT4A 4E7JA 2HKNA 2G6FX 3CCEQ 3TU4K 2FPFA 1TUGB 1AZGB 5GAMe 1PD1A 2KYMA 4JJDA 2R5AA 3R6OA 5HKCA 2EVRA 2HBWA 3HP9A 1UGRB 4C8QA 3JCMf 5IXBA 1LJOA 2L0AA 1Y0MA 1PKSA 2JT4A 5GAOl 1TUDA 1K4US 2DZCA 3CCJT 1KG1A 3JCMc 3MEAA 4F7UB 2BZXA 3OYEA 4KGZB 4X1VA 3EG2A 2GQVA 3WVEB 1QVFP 2P4RA 4XU1A 4M7DA 4DA4A 1K9AA 3HKSA 4HVWA 1YIJQ 4GLKA 1NJIR 4MZMA 1NG2A 2YDLA 3A8LB 1KFZA 1LVKA 2L3RA 2QDYB 4CC2A 2RJFA 2BE9B 1QCOA 5GANh 4N0AA 4M77G 4WTOB 1VQNT 1JB0E 1VIFA 4J9IA 3PE0A 1GFCA 1MMAA 1IGUA 2A0FB 1KQSS 5AYFA 4OMNA 4GBQA 1VQ5A 3SWNA 1G5VA 1WLPB 1UDLA 2CZ0B 5GAOr 3I55T 1Y71A 1PWTA 3MKDA 3MEWA 4M4ZA 1YJWT 5GAMf 2XMFA 3JCMW 1T0JA 3HL8A 2DAQA 2LQ8A 4A4FA 2DXTA 4PJOA 5L23A 1EIFA 3A8OB 1IGQA 1IRXA 1TG0A 2XDDA 2VKNA 3QJ6A 4ZN3A 4N4IA 4C8QF 4BB7A 1SRLA 2QQSA 3UA6A 2KR3A 4RMOA 1KIKA 4OMPA 2K2VA 3M4YA 1VQMQ 3QJYA 5M9OA 3I55A 3OY9A 5LJ3e 3MCAB 1YJWA 4M7DF 4A4HA 5IHNA 2JNGA 1BCOA 5FRMA 3M0TA 1SF9A 3CCVT 2YRCA 3V7CA 4O6JA 3CCRT 2K5IA 2EQMA 4JS4A 4ME7A 1G8XA 2EKHA 1R0BG 2CREA 2PTKA 4ORZA 3OYYA 2CUBA 5KYYB 1NYGA 2DL4A 4BUGA 4KGVB 3KXTA 4B6MA 1FMVA 1U3OA 4PJLA 1RABB 5IHIA 3QBYA 1Y07A 3JRZA 3CCVA 2FZCB 5EC7A 2ZPBB 3PVQA 4BDZA 3CCRA 3J80E 3UF4A 4E6RA 1N8RU 3I9QA 4JDSA 1VQ4Q 1UG1A 1YCSB 3V7SA 1ZA1B 1JXOA 3DB4A 1RAIB 4FT2A 3M0QA 3JSCA 4E7KA 5KYXB 4M75E 4AFSC 3FB9A 1X6GA 1SEMA 1K73C 2JM9A 3CC4Q 5D7UA 3CXCP 2KSSA 1SHFA 1OU8A 4BD3A 5DLQE 1A0NB 1FYNA 2RK1A 2DEUA 3RERA 2DMOA 2BIVA 2X3XD 3UATA 4C92D 1YJNA 1WHGA 1ZSZA 2PVOB 2KEAA 2FVUA 4CI0C 2FZKB 3RESA 2HZYA 2BUDA 5FWBA 3CCST 2CS7A 5GMKe 4OB1B 1WHKA 1RAAB 1GL5A 1VQ7A 1QWFA 3EGXB 4M77F 2A37A 2CSIA 1PSEA 3LX7A 1X27A 5GAN6 3QIIA 1M2VB 2XG8D 1LNXA 4F7UG 5LL6S 4FSXA 3EAEA 2FEIA 5KCHA 2FHDA 2FPEA 1RUWA 2LQWA 3RR6A 1UJYA 4R56A 4X9CA 1YNZA 2OTLA 1FWZA 1TU0B 3SD4A 3ZFJA 2V8IA 2AT1B 3O5ZA 1ZQ1A 2P4TA 1I1JA 4KH0B 4L5GA 4QKUA 3JB9J 4MDWA 1ZLMA 4R55A 4C0FA 1N8RR 1G83A 2SRCA 3E19A 1ZUKA 2K5FA 1AD5A 5FU6B 2LJ1A 1OPKA 4EPCA 1I4K1 2O2OA 4X9DA 2EFIA 3BY7A 1K73U 2DIGA 1IXDA 3I5RA 3QZ5B 1D1BA 2AKLA 3EG3A 4HT9A 4M78B 1VQPQ 3JCMV 3OS5A 2X4JA 2ROLA 4JUVA 2CP7A 3PT9A 3WXMB 2RM4A 4JRPA 2V8KA 2EJ9A 2E4HA 4J9EA 1LPLA 3KBGA 3CD6T 3URGA 5GANe 4AFUC 6AT1B 1OEBA 4F7UA 1RAHB 1V1CA 2F69A 4E7SA 3TSZA 4RTUA 2ZCFB 1WIEA 1X6BA 3HFNA 4C0GA 1ZA2B 1SSHA 3M9QA 1SRMA 1FXXA 2HSEB 4PFOA 2FZGB 3HRTA 2D0NA 2RH2A 4OVAA 1GFDA 4C8QB 4FYYB 3RKXA 2EPDA 5A0GA 1VYUA 5GAN4 3CCMT 2FG0A 1NE8A 3CD6A 1ZHIA 1M30A 4IIMA 2B8AA 3CCET 2QI2A 1T0HA 1YI2T 1AWJA 4O5VA 5KE2A 2XDBA 1N6AA 4J9CA 1M1GA 1M3CA 3JCMd 4L59A 5CAIA 4XU3A 3U23A 2DPPB 3I56A 3OQ5A 1PSFA 4FIBA 5GJWB 1VQ6T 4OMQA 3OYGA 3TVTA 1K73R 1U5SA 1NYFA 4QQGA 2BZ8A 3H0HA 1NLOC 4LDYA 1RLQC 4OB0B 1KQ1A 2JMAA 2V1QA 2DX1A 1YI2A 4MMKA 3RKYA 4JS5A 2ZPIB 1QVGS 1MNEA 3E1SA 5GANf 5IH2A 3CMEQ 2P0QA 2DLPA 3SWNB 3VS1A 5GAN7 4PNOA 4ATOA 3CPWS 1Q82C 1QLYA 2RQVA 1VQ6A 2RF0A 4F7UF 2D1XA 4R0KA 5GMKm 3OYLA 2RNAA 1D3BB 2RQRA 4C5EA 3C12A 2MF2A 2RHXA 3FIFA 2M9UA 2DYBA 2BE7D 8AT1B 2DD4A 2IIMA 2BTTA 4J9DA 4PJOB 3N5BB 4PLIA 2B86A 4OF1A 4NL2A 1Z9ZA 2NUPA 3OMGA 4OMMA 3VJPA 1QCFA
chains in the Genus database with same CATH topology
2LZ6B 5FW9A 1ZUYA 1B07A 3VRZA 2OAWA 2RPNA 4JJCA 4D8KA 1HD3A 1OV3A 2DVJA 2J6KA 2DA9A 4Z8AA 2NWMA 3PVLA 2CDTA 1TUCA 1GRIA 1T3LA 3UA7A 2DL8A 1KSWA 2ED0A 1XOVA 1RI9A 2KRNA 2O9SA 4LUDA 1AWOA 3SEMA 1I0CA 2L3PA 4ZNXA 2C0OA 2M51A 2VVKA 4JJBA 1UHCA 2K6DA 4EIKA 2YUNA 4QT7A 2YUQA 4Z89A 2X3WD 2L3QA 2EQIA 2G6FX 3ZL7C 2FPFA 1MUZA 2KT1A 2CSQA 1AZGB 3M0PA 2KYMA 2LX7A 5FWCA 4JJDA 2A08A 1E6GA 3C0CA 3GBQA 2EVRA 1J3TA 2HBWA 2RQWA 4RTTA 2ENMA 2A36A 5IXBA 1BU1A 2L0AA 3QWXX 1W70A 1Y0MA 1PKSA 2JT4A 1K4US 1TUDA 2KT8A 4AFQC 2BZXA 2K9GA 4CC7A 4X1VA 3EG2A 4JZ3A 3M0UA 2P4RA 2ABLA 2EYXA 2EW3A 2W0ZA 3KFVA 3VRYA 4Z88A 1SHGA 1K9AA 1H8KA 2KE9A 4RTZA 4HVWA 4F16A 2PZ1A 3QWYA 4LUEA 1NG2A 1ZX6A 2YDLA 2DL3A 1RLPC 1KFZA 2JW4A 4JPBW 2DL7A 2AZVA 1NM7A 4CC2A 2J05A 4A63B 2F2WA 4RTYA 2F2XA 3VS5A 4J9IA 3PE0A 1GFCA 2KXDA 2GQIA 2YUPA 1BK2A 2SEMA 1PRLC 4OMNA 4GBQA 4ESRA 1PKTA 1WLPB 1UDLA 2J6FA 1PWTA 4M4ZA 1PHTA 2XMFA 1T0JA 2ROTA 2MOXA 1ZBJA 4OMOA 2QDLA 1M3BA 5L23A 2YSQA 2JXBA 1TG0A 2VKNA 2RMOA 1OOTA 2C0TA 3RBBB 1HJDA 3VS2A 4JZ4A 4HVUA 2LQNA 1CKBA 2RQUA 2LJ3A 2CT3A 1YWOA 1SRLA 3CQTA 3UA6A 2KR3A 2BZYA 2HEQA 2PNIA 2J6OA 1KIKA 1UTIA 4OMPA 1AWXA 1QKWA 2VWFA 2DNUA 2J7IA 1H3HA 2JM8A 4DEXA 5IHNA 5I22A 3M0TA 2O88A 2KNBB 5ECAA 3NPFA 2RQTA 2EYWA 1U06A 2D8HA 2FO0A 3NHNA 1MV0B 2EKHA 2CREA 2KROA 3M0SA 2PTKA 3NMZC 1VYTA 2F2VA 4ORZA 2HDAA 1M3AA 2J06A 4AG1C 2CUBA 1AVZC 1NYGA 4RTVA 2DL4A 4CC3A 3VS3A 1U3OA 2DRKA 3EG0A 5IHIA 3VS4A 5EC7A 2YT6A 3PVQA 3FJ5A 1M8MA 1ARKA 1AZEA 2DBKA 3THKA 1I07A 3UF4A 4E6RA 3I9QA 3M0RA 3IQLA 1UG1A 1YCSB 1VYVA 1JXOA 1WI7A 1NEBA 1NEGA 3M0QA 3REAB 2LNHB 1B3QA 4AFSC 1W6XA 1MV3A 1X6GA 1SEMA 2FRWA 2GTOA 2DBMA 2CH4W 2JM9A 2YUOA 4AFZC 1BB9A 1E7OA 2K3BA 1YN8A 2GNCA 1SHFA 1KJWA 3NGPA 1A0NB 1FYNA 4GLMA 1GCPA 3VS0A 2DMOA 2X3XD 3UATA 2AK5A 1GCQC 5I11A 2KEAA 1PRMC 2O31A 1X2QA 4J9BA 1YP5A 5FWBA 1VA7A 1GBRA 4LNPA 3H0FA 3EHRA 1WXUA 1BBZA 2DM1A 1GL5A 1OPLA 1CSKA 1QWFA 4D8DA 1ZSGA 2A37A 2CSIA 1X27A 3H0IA 1UECA 4AG2C 1JQQA 2FEIA 1QKXA 2FPEA 1RUWA 2LQWA 3LH5A 1UJYA 2GBQA 1UE9A 3A98A 4DEYA 2D8JA 1W1FA 1YNZA 1GCQA 2OI3A 1X2KA 4OMLA 1WXTA 2KGTA 2DF6A 1UHFA 4HXJA 5IXFA 1IO6A 1WA7A 2EGEA 2HSPA 3O5ZA 1WX6A 2MCNA 1I1JA 1AWWA 1ZLMA 2DE0X 3EHQA 1G83A 2SRCA 1LCKA 1Y57A 2K2MA 1ZUKA 3H41A 1AD5A 2LJ1A 1OPKA 2JS0A 3I35A 1FMKA 2O2OA 2OJ2A 2AZSA 2EGCA 1UGVA 1UJ0A 2L3SA 3VS7A 1AOJA 2GTJA 3I5RA 2JTEA 2HCKA 1GBQA 2AKLA 2JMCA 3EG3A 2K7AA 4HVVA 2L2PA 1JXMA 1E6HA 1K1ZA 2ROLA 2ED1A 2O9VA 2I0NA 4J9FA 2M0YA 5GJVB 5IHKA 1X43A 1WDXA 2C0IA 4J9EA 3VS6A 1SPKA 1M27C 4FSSA 2ESWA 4AFUC 1OEBA 1UUEA 3ULRB 4WCIA 1V1CA 2CUDA 2LP5A 2JS2A 3TSZA 2EGAA 2KYBA 4F14A 4RTUA 3RNJA 1WIEA 1X6BA 3JV3A 2AKKA 4HCKA 1SSHA 1SRMA 4IIOA 1K0SA 4J9GA 2D0NA 1X69A 1Z9QA 2V1RA 1GFDA 4K11A 3EGUA 3SHWA 2EPDA 1EFNA 2KRSA 1VYUA 2MIOA 2FG0A 2H8HA 1JU5C 2KXCA 2DL5A 1M30A 2A28A 4IIMA 3REBB 1T0HA 5HCKA 2DJQA 2RN8A 1S1NA 1AWJA 2DILA 2W10A 4J9HA 4RTWA 2LCSA 2GGRA 1K76A 2LJ0A 4J9CA 1HSQA 1M3CA 4KRTA 3I5SA 2CH4A 3U23A 1CKAA 1JEGA 1ABOA 4RTXA 5GJWB 1WXBA 4OMQA 1N5ZA 3TVTA 1H92A 1G2BA 1U5SA 2E5KA 1QWEA 1NYFA 1ZUUA 2BZ8A 3H0HA 4LN2A 1NLOC 3TSWA 2ECZA 1RLQC 2NUZA 2DRMA 1T3SA 2JMAA 2V1QA 2DX1A 1K0XA 2FPDA 4RUGA 2EYZA 2K79A 4LE9A 2EYYA 2FRYA 4CC4B 5IH2A 1YWPA 1ABQA 2DLPA 3VS1A 1WFWA 1NLPC 1QLYA 1PNJA 2RQVA 2RF0A 3R6NA 2D1XA 4F17A 4R0KA 2LMJA 2RNAA 2RQRA 4Y92A 1AEYA 1WYXA 1UFFA 2DYBA 2KRMA 1JO8A 2IIMA 3EG1A 2BTTA 4J9DA 2B86A 2KBTA 1Z9ZA 2CT4A 4OMMA 2EBPA 1QCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LZ6 B;  5FW9 A;  1ZUY A;  1B07 A;  3VRZ A;  2OAW A;  2RPN A;  4JJC A;  4D8K A;  1HD3 A;  1OV3 A;  2DVJ A;  2J6K A;  2DA9 A;  4Z8A A;  2NWM A;  3PVL A;  2CDT A;  1TUC A;  1GRI A;  1T3L A;  3UA7 A;  2DL8 A;  1KSW A;  2ED0 A;  1XOV A;  1RI9 A;  2KRN A;  2O9S A;  4LUD A;  1AWO A;  3SEM A;  1I0C A;  2L3P A;  4ZNX A;  2C0O A;  2M51 A;  2VVK A;  4JJB A;  1UHC A;  2K6D A;  4EIK A;  2YUN A;  4QT7 A;  2YUQ A;  4Z89 A;  2X3W D;  2L3Q A;  2EQI A;  2G6F X;  3ZL7 C;  2FPF A;  1MUZ A;  2KT1 A;  2CSQ A;  1AZG B;  3M0P A;  2KYM A;  2LX7 A;  5FWC A;  4JJD A;  2A08 A;  1E6G A;  3C0C A;  3GBQ A;  2EVR A;  1J3T A;  2HBW A;  2RQW A;  4RTT A;  2ENM A;  2A36 A;  5IXB A;  1BU1 A;  2L0A A;  3QWX X;  1W70 A;  1Y0M A;  1PKS A;  2JT4 A;  1K4U S;  1TUD A;  2KT8 A;  4AFQ C;  2BZX A;  2K9G A;  4CC7 A;  4X1V A;  3EG2 A;  4JZ3 A;  3M0U A;  2P4R A;  2ABL A;  2EYX A;  2EW3 A;  2W0Z A;  3KFV A;  3VRY A;  4Z88 A;  1SHG A;  1K9A A;  1H8K A;  2KE9 A;  4RTZ A;  4HVW A;  4F16 A;  2PZ1 A;  3QWY A;  4LUE A;  1NG2 A;  1ZX6 A;  2YDL A;  2DL3 A;  1RLP C;  1KFZ A;  2JW4 A;  4JPB W;  2DL7 A;  2AZV A;  1NM7 A;  4CC2 A;  2J05 A;  4A63 B;  2F2W A;  4RTY A;  2F2X A;  3VS5 A;  4J9I A;  3PE0 A;  1GFC A;  2KXD A;  2GQI A;  2YUP A;  1BK2 A;  2SEM A;  1PRL C;  4OMN A;  4GBQ A;  4ESR A;  1PKT A;  1WLP B;  1UDL A;  2J6F A;  1PWT A;  4M4Z A;  1PHT A;  2XMF A;  1T0J A;  2ROT A;  2MOX A;  1ZBJ A;  4OMO A;  2QDL A;  1M3B A;  5L23 A;  2YSQ A;  2JXB A;  1TG0 A;  2VKN A;  2RMO A;  1OOT A;  2C0T A;  3RBB B;  1HJD A;  3VS2 A;  4JZ4 A;  4HVU A;  2LQN A;  1CKB A;  2RQU A;  2LJ3 A;  2CT3 A;  1YWO A;  1SRL A;  3CQT A;  3UA6 A;  2KR3 A;  2BZY A;  2HEQ A;  2PNI A;  2J6O A;  1KIK A;  1UTI A;  4OMP A;  1AWX A;  1QKW A;  2VWF A;  2DNU A;  2J7I A;  1H3H A;  2JM8 A;  4DEX A;  5IHN A;  5I22 A;  3M0T A;  2O88 A;  2KNB B;  5ECA A;  3NPF A;  2RQT A;  2EYW A;  1U06 A;  2D8H A;  2FO0 A;  3NHN A;  1MV0 B;  2EKH A;  2CRE A;  2KRO A;  3M0S A;  2PTK A;  3NMZ C;  1VYT A;  2F2V A;  4ORZ A;  2HDA A;  1M3A A;  2J06 A;  4AG1 C;  2CUB A;  1AVZ C;  1NYG A;  4RTV A;  2DL4 A;  4CC3 A;  3VS3 A;  1U3O A;  2DRK A;  3EG0 A;  5IHI A;  3VS4 A;  5EC7 A;  2YT6 A;  3PVQ A;  3FJ5 A;  1M8M A;  1ARK A;  1AZE A;  2DBK A;  3THK A;  1I07 A;  3UF4 A;  4E6R A;  3I9Q A;  3M0R A;  3IQL A;  1UG1 A;  1YCS B;  1VYV A;  1JXO A;  1WI7 A;  1NEB A;  1NEG A;  3M0Q A;  3REA B;  2LNH B;  1B3Q A;  4AFS C;  1W6X A;  1MV3 A;  1X6G A;  1SEM A;  2FRW A;  2GTO A;  2DBM A;  2CH4 W;  2JM9 A;  2YUO A;  4AFZ C;  1BB9 A;  1E7O A;  2K3B A;  1YN8 A;  2GNC A;  1SHF A;  1KJW A;  3NGP A;  1A0N B;  1FYN A;  4GLM A;  1GCP A;  3VS0 A;  2DMO A;  2X3X D;  3UAT A;  2AK5 A;  1GCQ C;  5I11 A;  2KEA A;  1PRM C;  2O31 A;  1X2Q A;  4J9B A;  1YP5 A;  5FWB A;  1VA7 A;  1GBR A;  4LNP A;  3H0F A;  3EHR A;  1WXU A;  1BBZ A;  2DM1 A;  1GL5 A;  1OPL A;  1CSK A;  1QWF A;  4D8D A;  1ZSG A;  2A37 A;  2CSI A;  1X27 A;  3H0I A;  1UEC A;  4AG2 C;  1JQQ A;  2FEI A;  1QKX A;  2FPE A;  1RUW A;  2LQW A;  3LH5 A;  1UJY A;  2GBQ A;  1UE9 A;  3A98 A;  4DEY A;  2D8J A;  1W1F A;  1YNZ A;  1GCQ A;  2OI3 A;  1X2K A;  4OML A;  1WXT A;  2KGT A;  2DF6 A;  1UHF A;  4HXJ A;  5IXF A;  1IO6 A;  1WA7 A;  2EGE A;  2HSP A;  3O5Z A;  1WX6 A;  2MCN A;  1I1J A;  1AWW A;  1ZLM A;  2DE0 X;  3EHQ A;  1G83 A;  2SRC A;  1LCK A;  1Y57 A;  2K2M A;  1ZUK A;  3H41 A;  1AD5 A;  2LJ1 A;  1OPK A;  2JS0 A;  3I35 A;  1FMK A;  2O2O A;  2OJ2 A;  2AZS A;  2EGC A;  1UGV A;  1UJ0 A;  2L3S A;  3VS7 A;  1AOJ A;  2GTJ A;  3I5R A;  2JTE A;  2HCK A;  1GBQ A;  2AKL A;  2JMC A;  3EG3 A;  2K7A A;  4HVV A;  2L2P A;  1JXM A;  1E6H A;  1K1Z A;  2ROL A;  2ED1 A;  2O9V A;  2I0N A;  4J9F A;  2M0Y A;  5GJV B;  5IHK A;  1X43 A;  1WDX A;  2C0I A;  4J9E A;  3VS6 A;  1SPK A;  1M27 C;  4FSS A;  2ESW A;  4AFU C;  1OEB A;  1UUE A;  3ULR B;  4WCI A;  1V1C A;  2CUD A;  2LP5 A;  2JS2 A;  3TSZ A;  2EGA A;  2KYB A;  4F14 A;  4RTU A;  3RNJ A;  1WIE A;  1X6B A;  3JV3 A;  2AKK A;  4HCK A;  1SSH A;  1SRM A;  4IIO A;  1K0S A;  4J9G A;  2D0N A;  1X69 A;  1Z9Q A;  2V1R A;  1GFD A;  4K11 A;  3EGU A;  3SHW A;  2EPD A;  1EFN A;  2KRS A;  1VYU A;  2MIO A;  2FG0 A;  2H8H A;  1JU5 C;  2KXC A;  2DL5 A;  1M30 A;  2A28 A;  4IIM A;  3REB B;  1T0H A;  5HCK A;  2DJQ A;  2RN8 A;  1S1N A;  1AWJ A;  2DIL A;  2W10 A;  4J9H A;  4RTW A;  2LCS A;  2GGR A;  1K76 A;  2LJ0 A;  4J9C A;  1HSQ A;  1M3C A;  4KRT A;  3I5S A;  2CH4 A;  3U23 A;  1CKA A;  1JEG A;  1ABO A;  4RTX A;  5GJW B;  1WXB A;  4OMQ A;  1N5Z A;  3TVT A;  1H92 A;  1G2B A;  1U5S A;  2E5K A;  1QWE A;  1NYF A;  1ZUU A;  2BZ8 A;  3H0H A;  4LN2 A;  1NLO C;  3TSW A;  2ECZ A;  1RLQ C;  2NUZ A;  2DRM A;  1T3S A;  2JMA A;  2V1Q A;  2DX1 A;  1K0X A;  2FPD A;  4RUG A;  2EYZ A;  2K79 A;  4LE9 A;  2EYY A;  2FRY A;  4CC4 B;  5IH2 A;  1YWP A;  1ABQ A;  2DLP A;  3VS1 A;  1WFW A;  1NLP C;  1QLY A;  1PNJ A;  2RQV A;  2RF0 A;  3R6N A;  2D1X A;  4F17 A;  4R0K A;  2LMJ A;  2RNA A;  2RQR A;  4Y92 A;  1AEY A;  1WYX A;  1UFF A;  2DYB A;  2KRM A;  1JO8 A;  2IIM A;  3EG1 A;  2BTT A;  4J9D A;  2B86 A;  2KBT A;  1Z9Z A;  2CT4 A;  4OMM A;  2EBP A;  1QCF A; 
#chains in the Genus database with same CATH topology
 3JB9 G;  2RHY A;  3C95 A;  2RI2 A;  4M75 D;  4FW2 A;  2HKQ B;  3VYH B;  2RPN A;  1C6V X;  1HD3 A;  2DVJ A;  4Z8A A;  5LJ5 g;  4BDY A;  1I8F A;  3BDU A;  2LX9 A;  5KYY A;  1AWO A;  3SEM A;  5CO7 A;  3QZ9 B;  1I0C A;  4KUL A;  5DLO A;  2CKK A;  2K6D A;  3BE3 A;  2QTV A;  1Q7Y C;  4EIK A;  3MEV A;  1NBE B;  4BI8 B;  4M7A D;  4HA8 A;  3HRU A;  3G6E A;  2L3Q A;  1HK9 A;  1JBM A;  1VQM T;  3FEO A;  2RO0 A;  2DJZ A;  2EQU A;  3SB2 A;  4XTX A;  2LX7 A;  2A08 A;  2YLB A;  1E6G A;  3C0C A;  3DKM A;  3UPU A;  3OYA A;  1X6O A;  3A8G B;  3CC2 A;  3QWX X;  2KT8 A;  1XJW B;  4AFQ C;  3E9F A;  1Q82 U;  2OAU A;  2CP2 A;  2RHU A;  4JZ3 A;  3M0U A;  2EYX A;  4KUI A;  2GCX A;  2EW3 A;  2KQW A;  2MMP A;  3KFV A;  2LC4 A;  3VRY A;  3L2W A;  1Y96 A;  2DTO A;  4M78 G;  3G4S A;  3OW2 S;  1H8K A;  4RTZ A;  4QVC A;  2PZ1 A;  5GAN 2;  2DL3 A;  5AT1 B;  2ZPG B;  4JPB W;  2DL7 A;  2YRV A;  3Q1J A;  4FU6 A;  1QVF A;  1R8O B;  1Q86 C;  3L42 A;  4A63 B;  3JCM X;  4FCY A;  3A5Z B;  1RI0 A;  1VQ4 T;  3VS5 A;  1IHV A;  4VUB A;  4PL6 A;  2KK4 A;  2EWN A;  1AT1 B;  2GQI A;  3M4G A;  1SG5 A;  1NPR A;  1ZSZ B;  1PRL C;  3QYH B;  3CC4 T;  1VQK A;  2FYK A;  5CQY A;  1M1F A;  1Q7Y U;  4LDW A;  4II1 A;  4C8Q G;  1EZZ B;  4KH1 B;  5LJ3 d;  2KDS A;  2QEX Q;  4KGX B;  4BAC A;  2ROT A;  2MOX A;  4LDU A;  1ZBJ A;  4C92 C;  2QA4 A;  4OMO A;  2QDL A;  2RMO A;  2XHC A;  3RBB B;  1OU9 A;  3CMA Q;  1HJD A;  2LQN A;  2G3R A;  2E3I A;  4PJN A;  3P8B B;  1FMW A;  2CT3 A;  4C92 E;  1YWO A;  2KMT A;  4EDU A;  2BZY A;  2HEQ A;  2J6O A;  1Q82 R;  1QKW A;  2J7I A;  1H3H A;  1R77 A;  1BIA A;  3BFM A;  4DEX A;  2DXC A;  2X51 A;  4J7I A;  1S72 Q;  4PJJ A;  3EGD A;  2CYZ B;  3NHN A;  1MV0 B;  1Q86 U;  2DTI A;  4HKE A;  2KRO A;  3M0S A;  2Z0W A;  1VQL Q;  2L8D A;  1RL2 A;  4AG1 C;  2HD0 A;  4QQD A;  2CZ7 B;  1M1K C;  4RCB A;  1B7T A;  2M02 A;  2DRK A;  3EG0 A;  4PJO G;  1C1A A;  3QG1 A;  4J6X A;  1M8M A;  4BY6 C;  3UDC A;  1ARK A;  1AZE A;  3C4S A;  1Q7Y R;  2JJ9 A;  1VQO Q;  5A0D A;  4BE0 A;  3DB3 A;  5CCA A;  1VQP T;  3M0R A;  3IQL A;  4XTZ A;  2VXF A;  2QQ9 A;  3C94 A;  1NEG A;  2RJD A;  1EX4 A;  2EQK A;  2GTO A;  2ZPE B;  2CP0 A;  4AFZ C;  1QVF S;  2LT4 A;  1YN8 A;  2K3B A;  2GNC A;  3NFC A;  1KJW A;  2VYT A;  4DOV A;  1YFN A;  4FYW B;  5IT9 E;  3CCJ A;  2VXE A;  4M78 F;  4M75 A;  1WJR A;  5LJ5 d;  1PRM C;  2EJF A;  3CXC A;  4J9B A;  4AMC A;  3X20 B;  4LNP A;  3PIO A;  1M90 C;  3J7A F;  3EH2 A;  5GAO m;  2EAY A;  1KQS P;  1OPL A;  1CSK A;  4D8D A;  2QG9 B;  1ZSG A;  2H3J A;  3OYH A;  1F1B B;  1VOM A;  2VC8 A;  3V8J A;  3G71 Q;  1D3B A;  3H0I A;  5CKD A;  1Q86 R;  4IUU A;  2HL3 A;  3GP8 A;  1QKX A;  1G3T A;  3L2Z A;  3A98 A;  1VQN A;  4DEY A;  1W1F A;  4OML A;  8ATC B;  4J6Y A;  2JN0 A;  1M1K U;  2DF6 A;  4HXJ A;  1IO6 A;  5CQX A;  3GPL A;  3ME9 A;  5HK0 A;  3RUX A;  4IUT A;  1YIT T;  3CBO A;  2VV5 A;  3EHQ A;  3X26 B;  3M5A A;  2LRQ A;  3JCM g;  1PC0 A;  1JJ2 P;  2OX7 A;  3HRS A;  2OJ2 A;  1WQW A;  2XI9 A;  2WSE E;  2EGC A;  4GY5 A;  1UJ0 A;  2NUP B;  3PIP A;  4LDX A;  3VU3 C;  4JLG A;  3CBM A;  4A4K A;  2JTF A;  3NTH A;  2ZZD A;  2LDM A;  4DQ2 A;  1V29 B;  2JUF A;  2JMC A;  1RAC B;  4HVV A;  1YIT A;  3VUB A;  4PFZ A;  1E6H A;  3LLR A;  2RHZ A;  2XDP A;  3QYG B;  2M0Y A;  5IHK A;  4NL3 A;  1X43 A;  2RA2 A;  1SPK A;  1QCN A;  1M27 C;  1U8R A;  1M90 U;  2ESW A;  1K8A C;  2FL7 A;  4M75 C;  1UUE A;  4XQ3 A;  1VQ8 Q;  2E10 A;  2Y90 A;  3A1P A;  3RIR A;  1OQK A;  3JV3 A;  4RG8 A;  4PJO F;  2QK0 A;  4J9G A;  1VQ9 Q;  3EGU A;  2OTJ Q;  1OZ3 A;  4C5H A;  1YHQ Q;  2L89 A;  2E70 A;  1M1K R;  2KRS A;  5J26 A;  3LGL A;  1DJ7 B;  5GAM g;  5CKH A;  2COY A;  2I2L A;  1G3W A;  3CCQ Q;  2KXC A;  2A28 A;  4EMH A;  4M7A C;  1X75 C;  3V7R A;  5HCK A;  1OYX A;  1QMC A;  3CCL Q;  4J9H A;  2GGR A;  3CXC S;  4XTW A;  2JOY A;  1HSQ A;  3UWN A;  1Y96 B;  4M7A E;  4A4E A;  1WXB A;  1G2B A;  1QWE A;  1YCY A;  4LN2 A;  3NTK A;  5DY9 A;  2ZGW A;  2ECZ A;  3CCU T;  2MK5 A;  2NUZ A;  2DRM A;  2RHI A;  5KYW A;  3JCM P;  1K0X A;  3FJP A;  4RUG A;  2QTX A;  3OYB A;  2EYZ A;  3CC7 Q;  1KK7 A;  4LE9 A;  2EYY A;  5HY6 A;  4QVD A;  4A54 A;  1WFW A;  1NLP C;  3CCS A;  2E41 A;  1RAD B;  1TXQ A;  2DYI A;  4F17 A;  3EH1 A;  2LMJ A;  2F5K A;  1AEY A;  2X4W A;  1WYX A;  1D1C A;  1UFF A;  5EG2 A;  2KRM A;  3CCU A;  4ZN1 A;  1M5Q 1;  4HCC A;  2X4Y A;  3FC3 A;  2VUB A;  2ZPF B;  3VYG A;  5FW9 A;  2OAW A;  2QAS A;  4JJC A;  2QEX T;  4M77 E;  3INZ A;  1KD1 C;  3FLG A;  3JB9 D;  2HAX A;  2DA9 A;  2NWM A;  3PVL A;  2EKO A;  1GRI A;  1OI1 A;  1MMN A;  4J8O A;  2KRN A;  3MEU A;  5FLX E;  3CMA T;  2C0O A;  5CK9 A;  2DVE A;  2L5Q A;  2K4Y A;  5LJ3 g;  3EGD B;  2YUQ A;  4Z89 A;  3HPW A;  2X3W D;  4YTL A;  2BKD N;  2KT1 A;  1BYM A;  2CSQ A;  1YJ9 T;  3OBY A;  1VQ5 Q;  1TOV A;  2LCL A;  5FWC A;  2A7Y A;  2E6Z A;  1UGS B;  3L2V A;  2RQW A;  4RTT A;  1X01 A;  1BU1 A;  1S72 T;  3T9N A;  3QKJ A;  1KQ2 A;  1UGP B;  5KYU B;  1QP3 A;  4X34 A;  2DKG A;  4PLL A;  2GF7 A;  1NPP A;  4ZGE B;  4IUQ A;  3LGF A;  1PD0 A;  3MP1 A;  3BW1 A;  2W0Z A;  2F5T X;  5D6X A;  1IB8 A;  2KE9 A;  3GOX A;  1YJ9 A;  2WSF E;  4LUE A;  4M78 D;  2D6F A;  1ZX6 A;  3RMQ A;  4FW1 A;  4C0D C;  2JW4 A;  2AZV A;  1NM7 A;  4D6W A;  4KT0 E;  3I55 Q;  1VQO T;  2PUK B;  2F2W A;  2F2X A;  3CCM A;  2R58 A;  1YJW Q;  5FU7 C;  5HK3 A;  1KD1 U;  1IRE B;  1W2B P;  4M75 B;  2YUP A;  3CCE A;  1M8V A;  1BK2 A;  2SEM A;  2YRD A;  3MET A;  1W4S A;  1MHN A;  1WJS A;  1YIJ T;  4BI4 A;  2VAS A;  4E7L A;  2QQR A;  4J6W A;  3UT1 A;  2ZAE A;  1PKT A;  3ASK A;  3G7Z A;  2J6F A;  4QW2 A;  2FB7 A;  2YXY A;  3JAM E;  1Q81 C;  1PHT A;  4C8Q D;  3OYC A;  2O4X A;  5IAY A;  4M7A B;  3DLL A;  2PVG B;  4KUD K;  4JLI A;  1OOT A;  2C0T A;  3MP8 A;  5FRO A;  3VS2 A;  4JZ4 A;  3CCR Q;  2RQU A;  1YIJ A;  4J5Y A;  2LJ3 A;  1D0Z A;  4M7D D;  2YHT A;  5GMK i;  5GAM d;  3P8H A;  1OX8 A;  2M1H A;  4FYV B;  3G71 T;  2EYQ A;  3OA6 A;  1AWX A;  4FYX B;  1I5L A;  2DNU A;  1BI3 A;  2KY9 A;  2JM8 A;  2CZ6 B;  1KC8 C;  4XK8 E;  2E5Q A;  3TCJ A;  2KNB B;  2HQX A;  4C92 A;  5ECA A;  3NPF A;  1U06 A;  4ELY C;  1XQH A;  2D8H A;  2FO0 A;  2DET A;  1YJN Q;  1MMG A;  3NMZ C;  1VYT A;  3L2R A;  2XK0 A;  2HDA A;  1KD1 R;  2X35 A;  2WAC A;  1AVZ C;  3OYD A;  1MND A;  3X28 B;  3ZEH A;  4EMG A;  4CC3 A;  3VS3 A;  4P5N A;  3JCM J;  1VIE A;  1VQ7 Q;  2VGN A;  1BI1 A;  3VS4 A;  2LCC A;  2YT6 A;  2DBK A;  4PJO D;  3AT1 B;  1I07 A;  3RMS A;  2QGG A;  1Q81 U;  1VYV A;  2RB6 A;  4UC4 A;  3DLM A;  1NJI C;  1TTH B;  1VQM A;  2OTL Q;  1QP2 A;  5GAN g;  3REA B;  2LNH B;  3M59 A;  1W6X A;  1MV3 A;  4KBM B;  2FRW A;  3PFS A;  1PG5 B;  2DBM A;  2CH4 W;  1BB9 A;  1E7O A;  5KE3 A;  5CKE A;  5I2M A;  3OW2 P;  4J83 A;  2AIR B;  4ZGJ B;  4GLM A;  2NLU A;  3EFR A;  1VQ8 T;  1U1T A;  2M0O A;  1GCQ C;  4NOY A;  5I11 A;  3O8V A;  2O31 A;  1WHL A;  4M77 D;  1KC8 U;  4OB3 B;  4N4G A;  1VQ9 T;  1MMD A;  5KYN A;  1VA7 A;  1C0M A;  3H9N A;  1GBR A;  3KUF A;  2ATC B;  4C92 F;  1YHQ T;  3H0F A;  3OMC A;  1WXU A;  1BBZ A;  2E1H A;  4BI3 A;  2D9T A;  1D0Y A;  3BDL A;  3CCL T;  1UEC A;  4LDV A;  4AG2 C;  1JQQ A;  1LOJ A;  2LVM A;  1B34 B;  3LH5 A;  3MP6 A;  5KYW B;  1VQ4 A;  1KQS A;  2OI3 A;  3L2U A;  1X2K A;  1WXT A;  2KGT A;  5IXF A;  4CRI A;  1WA7 A;  4OGE A;  2DK3 A;  1WX6 A;  1UB4 A;  3CC4 A;  1AWW A;  5GAO p;  1RAG B;  4C0D B;  5D6Y A;  4LD6 A;  2H3E B;  1Q81 R;  1I5O B;  1LCK A;  1Y57 A;  3H41 A;  3I35 A;  4TVR A;  1FMK A;  1RAF B;  4M75 G;  3CC7 T;  1GXI E;  3EFO B;  1UGV A;  1V76 A;  3CD6 Q;  3VS7 A;  2P0K A;  3QDF A;  2JTE A;  2K3X A;  2HCK A;  1GBQ A;  2K57 A;  2CP3 A;  1FX7 A;  2Y4X A;  5CIU A;  2K7A A;  1JJ2 A;  5L8R E;  3I56 Q;  2IG0 A;  1K1Z A;  3TRE A;  4BE2 A;  5GJV B;  1KC8 R;  1WDX A;  2C0I A;  4M7A G;  3VS6 A;  2K3Y A;  4Q5W A;  1WZO A;  1M9S A;  5KYU A;  3OYI A;  4WCI A;  2QAZ A;  4ZTF A;  2CUD A;  1YI2 Q;  2LP5 A;  2EGA A;  2KYB A;  1G3S A;  4RG2 A;  3RNJ A;  1OX9 A;  2EQJ A;  2AKK A;  4LXC A;  2HNI A;  4IIO A;  2NUT A;  1Z9Q A;  4K11 A;  5GAM j;  1VQ6 Q;  1EFN A;  2LQK A;  1HYO A;  2MIO A;  5CKB A;  3MHX A;  2H8H A;  1JU5 C;  3QO3 A;  1TWB A;  2DJQ A;  2RN8 A;  3VUZ A;  3OYM A;  2DEQ A;  2W10 A;  1VQ5 T;  2RJC A;  1K76 A;  2LJ0 A;  4LD9 K;  4DBR A;  1WQ7 A;  4KRT A;  1VQP A;  1P92 A;  3L2Q A;  2JZ2 A;  3GLX A;  1KHI A;  1ABO A;  1TH7 A;  4JRI A;  4XAX B;  5KH6 A;  3CEY A;  2E5K A;  1ZUU A;  2XIC A;  4DBQ A;  3QXE B;  5FU6 C;  2LTO A;  1T3S A;  2HL5 C;  3M55 A;  2YLC A;  2FPD A;  4HCZ A;  4M7A A;  4HT8 A;  1WPY A;  4XU0 A;  3OYF A;  2YWW A;  4CC4 B;  1ABQ A;  3FRN A;  4M78 C;  5GAN 3;  3G6E Q;  2RJE A;  3PNW C;  1ACM B;  5CVI A;  5FRN A;  1N8R C;  4MML A;  1IZ6 A;  4F04 B;  2Y4Y A;  4M78 E;  4OMF B;  2O4X B;  3CC2 Q;  5GAN 5;  2CP5 A;  5GAN d;  5KCO A;  5GAO n;  2CT4 A;  4C0Z A;  2JVV A;  3CME T;  2E65 A;  3M57 A;  1N9S A;  1ZUY A;  2KVQ G;  3JB9 I;  3VRZ A;  2QGF B;  2XKO C;  1JJ2 S;  2IPO B;  4D8K A;  2EJG A;  1OV3 A;  2J6K A;  1D1A A;  1WGS A;  5C6S A;  3G4S Q;  2CDT A;  4AT1 B;  3TQ7 P;  1D09 B;  1AHJ B;  1TUC A;  1T3L A;  2DL8 A;  4C8Q C;  1KSW A;  3CBP A;  2ED0 A;  4M75 F;  1WNL A;  1RI9 A;  2O9S A;  1D0X A;  4LUD A;  3OS1 A;  4NS5 A;  2L3P A;  4ZNX A;  2M51 A;  4JJB A;  1UHC A;  4C92 B;  4ZTJ A;  2E3H A;  3PGG A;  5LJ3 j;  1QW1 A;  1TSF A;  3OBW A;  2YUN A;  4M77 A;  4C8Q E;  2HQE A;  2COW A;  4M7D C;  3CME A;  3M56 A;  5CKF A;  4HCB A;  3MJX A;  1G3Y A;  2EQI A;  1XNI A;  3ZL7 C;  3JB9 H;  2M16 A;  1MUZ A;  3AHU A;  3M0P A;  3GBQ A;  1VQK Q;  4M7A F;  1H3Z A;  4M7D E;  1J3T A;  4XU2 A;  3V8K A;  5CR2 A;  2ENM A;  2A36 A;  3X25 B;  2X4X A;  1W70 A;  4N0A C;  1WHJ A;  1K9M C;  2K9G A;  4EMK A;  1YJN T;  4CC7 A;  4L6V 5;  2QA4 Q;  3H6Z A;  2ABL A;  2V8J A;  5C0M A;  3OSS C;  4Z88 A;  1SHG A;  1WHH A;  3SWN C;  1M4Z A;  4N4H A;  4F16 A;  2CZ1 B;  2QXF A;  2PQW A;  3QWY A;  3S3M A;  1VQ7 T;  2DD5 A;  4IUR A;  3M53 A;  1RLP C;  2GFU A;  1QVP A;  3D7S B;  2J05 A;  3RKW A;  4A4G A;  4RTY A;  3P8D A;  3ER0 A;  5LJ3 f;  4JRQ A;  4PJO C;  2RD1 A;  2MWP A;  3MPU B;  4BY6 B;  2KXD A;  1B34 A;  2OTL T;  4E7I A;  2XID A;  4FM4 B;  4PJO E;  4C5I A;  5J3B A;  4ESR A;  1XTD A;  1BI0 A;  4Y28 E;  1Y7X A;  5D6W A;  1M90 R;  1W2B A;  1K8A U;  1IHW A;  1M2O A;  5GMK j;  4XTV A;  3A8H B;  1SKU B;  2PU9 B;  4PK4 A;  3CPF A;  1M3B A;  3PTA A;  3EG9 A;  2YSQ A;  2JXB A;  5I2S A;  2VGM A;  4M77 C;  2DTH A;  1QVG A;  5LJ5 e;  3EFO A;  4HVU A;  1CKB A;  3CQT A;  3LWI A;  2PNI A;  1OZ2 A;  1K9M U;  3CPW A;  4MDX A;  5LJ5 j;  1UTI A;  2DIQ A;  3HFO A;  4JJN K;  2E64 A;  4RCC A;  2VWF A;  3A8M B;  3QPH A;  5I22 A;  2JTM A;  4ZGD B;  1TS9 A;  2O88 A;  1HXD A;  3FDR A;  4EMK C;  2KAF A;  2RQT A;  2E12 A;  2EYW A;  3CCJ Q;  2X9H A;  2GFA A;  3JCM h;  2AHJ B;  4Y91 A;  4OP0 A;  2EIF A;  2F2V A;  1I81 A;  3VKI A;  2QEX A;  1M3A A;  2J06 A;  2P84 A;  3PMI A;  2K5L A;  3OYK A;  4RTV A;  4BE1 A;  1N27 A;  1BI2 A;  4WF2 A;  4DBH A;  4DOW A;  1KHC A;  3CMA A;  4E47 A;  3FJ5 A;  3GNF B;  2LT1 A;  1MGQ A;  2R57 A;  3PMT A;  3THK A;  1ZSZ C;  4E2F B;  3OB9 A;  5DM7 R;  1VQL T;  1K8A R;  1VQN Q;  5GAN j;  3I56 T;  1O75 A;  1WI7 A;  1NEB A;  1RAE B;  4QQ6 A;  3SDZ A;  5LJ5 f;  1B3Q A;  1VUB A;  2NUT B;  2DO3 A;  2YUO A;  5A2Q E;  3LWH A;  4FL6 A;  3QSU A;  3JCM Q;  3QHS A;  5J39 A;  3NGP A;  4C92 G;  4ANJ A;  1S72 A;  1GCP A;  1JRI A;  3VS0 A;  5GMK l;  2RK2 A;  1K9M R;  1UEB A;  2AK5 A;  3GIB A;  4M7D B;  2LNV A;  1VQL A;  3X24 B;  3OYJ A;  3J81 E;  2KI7 A;  5GAN 8;  4OGC A;  5GAM h;  1SSF A;  1X2Q A;  2O01 E;  3OW2 A;  1YP5 A;  3EHR A;  1W2B S;  2DM1 A;  2HQH A;  1H64 1;  1QVG P;  4ELZ C;  1YIT Q;  2V26 A;  4E7Z A;  2WSC E;  2MPX C;  2MI6 A;  5I21 A;  1VQO A;  2RI5 A;  3CPW P;  2GBQ A;  1UE9 A;  4RKU E;  2R5M A;  2D8J A;  4B9X A;  1GCQ A;  3CCV Q;  1UHF A;  2DZ9 A;  2QYZ A;  2EGE A;  2HSP A;  2MCN A;  4MZT A;  3OS2 A;  2CP6 A;  2QQA A;  2ZPH B;  2D0Q B;  2DE0 X;  3RDV A;  4A53 A;  1WHM A;  1N9R A;  2K2M A;  3E9G A;  2JS0 A;  3OSV A;  3SFM A;  2PUO B;  1BIB A;  2AZS A;  2MYS A;  2L3S A;  3HSB A;  3G6E T;  1R0C B;  1AOJ A;  2GTJ A;  3V8L A;  5GAO q;  2XU8 A;  1Q95 G;  4XTU A;  4IUP A;  2A3L A;  4F7U E;  4J7F A;  3G71 A;  2L2P A;  3G1J A;  1JXM A;  3CC2 T;  3QDR B;  2ED1 A;  2O9V A;  2I0N A;  4J9F A;  2XD0 A;  3GF5 A;  3TEE A;  3JCM b;  4IKF A;  4FSS A;  4M77 B;  2IVW A;  4Z02 A;  3ULR B;  3VV0 A;  3G4S T;  2JS2 A;  3F70 A;  4F14 A;  3H8Z A;  9ATC B;  4QVZ A;  5KYX A;  4HCK A;  1K0S A;  5LJ3 h;  2P0P A;  4IUV A;  1X69 A;  2V1R A;  3CCS Q;  1BCM A;  3SHW A;  7AT1 B;  2C06 A;  2DL5 A;  3REB B;  2HBP A;  2NYS A;  4EMK B;  1S1N A;  3CCU Q;  4DBF A;  2DIL A;  4RTW A;  2LCS A;  2DXU A;  1WJQ A;  1VQK T;  3I5S A;  2CH4 A;  3S3O A;  1CKA A;  3HHT B;  1JEG A;  5IN1 A;  4RTX A;  2OTJ T;  3LYI A;  4E7H A;  1N5Z A;  1H92 A;  4XTY A;  3EGX A;  3LH0 A;  3CCQ T;  1OUL A;  2QA4 T;  1M2V A;  3TSW A;  2CGH A;  4PFP A;  3HTR A;  2COZ A;  3OYN A;  2E6N A;  2F1L A;  1UGQ B;  2QQB A;  3E2U A;  1VQ8 A;  3LW5 E;  3M58 A;  2DFU A;  1PM3 A;  2K79 A;  2FRY A;  1YWP A;  3JCM e;  3EFS A;  1VQ9 A;  2DER A;  2OTJ A;  1PNJ A;  1YHQ A;  3ZBD A;  4JRK A;  3R6N A;  3NTI A;  2DXB A;  3WVD B;  1QQJ A;  1U1S A;  1O9S A;  3CCQ A;  4Y92 A;  2MAM A;  5A0L A;  1JO8 A;  3CCL A;  3EG1 A;  1NJI U;  3EG9 B;  5FU7 B;  4M7D G;  2RI3 A;  4OB2 B;  2KBT A;  2EBP A;  2VB6 A;  1YBY A;  2LZ6 B;  4MZP A;  4V2S A;  5GMK h;  2MWO A;  1B07 A;  4PJM A;  1BKB A;  3GNG A;  4C5G A;  1NZ9 A;  4M78 A;  3MO8 A;  1YJ9 Q;  3L1A A;  3S6W A;  3UA7 A;  3OS0 A;  1XOV A;  3S3N A;  3QUI A;  2VVK A;  3JB9 F;  4B9W A;  4PKC C;  2PVD B;  1ZBX A;  4QT7 A;  3CC7 A;  3M54 A;  1PCX A;  3CCM Q;  5LJ5 h;  2HMA A;  4FT4 A;  4E7J A;  2HKN A;  2G6F X;  3CCE Q;  3TU4 K;  2FPF A;  1TUG B;  1AZG B;  5GAM e;  1PD1 A;  2KYM A;  4JJD A;  2R5A A;  3R6O A;  5HKC A;  2EVR A;  2HBW A;  3HP9 A;  1UGR B;  4C8Q A;  3JCM f;  5IXB A;  1LJO A;  2L0A A;  1Y0M A;  1PKS A;  2JT4 A;  5GAO l;  1TUD A;  1K4U S;  2DZC A;  3CCJ T;  1KG1 A;  3JCM c;  3MEA A;  4F7U B;  2BZX A;  3OYE A;  4KGZ B;  4X1V A;  3EG2 A;  2GQV A;  3WVE B;  1QVF P;  2P4R A;  4XU1 A;  4M7D A;  4DA4 A;  1K9A A;  3HKS A;  4HVW A;  1YIJ Q;  4GLK A;  1NJI R;  4MZM A;  1NG2 A;  2YDL A;  3A8L B;  1KFZ A;  1LVK A;  2L3R A;  2QDY B;  4CC2 A;  2RJF A;  2BE9 B;  1QCO A;  5GAN h;  4N0A A;  4M77 G;  4WTO B;  1VQN T;  1JB0 E;  1VIF A;  4J9I A;  3PE0 A;  1GFC A;  1MMA A;  1IGU A;  2A0F B;  1KQS S;  5AYF A;  4OMN A;  4GBQ A;  1VQ5 A;  3SWN A;  1G5V A;  1WLP B;  1UDL A;  2CZ0 B;  5GAO r;  3I55 T;  1Y71 A;  1PWT A;  3MKD A;  3MEW A;  4M4Z A;  1YJW T;  5GAM f;  2XMF A;  3JCM W;  1T0J A;  3HL8 A;  2DAQ A;  2LQ8 A;  4A4F A;  2DXT A;  4PJO A;  5L23 A;  1EIF A;  3A8O B;  1IGQ A;  1IRX A;  1TG0 A;  2XDD A;  2VKN A;  3QJ6 A;  4ZN3 A;  4N4I A;  4C8Q F;  4BB7 A;  1SRL A;  2QQS A;  3UA6 A;  2KR3 A;  4RMO A;  1KIK A;  4OMP A;  2K2V A;  3M4Y A;  1VQM Q;  3QJY A;  5M9O A;  3I55 A;  3OY9 A;  5LJ3 e;  3MCA B;  1YJW A;  4M7D F;  4A4H A;  5IHN A;  2JNG A;  1BCO A;  5FRM A;  3M0T A;  1SF9 A;  3CCV T;  2YRC A;  3V7C A;  4O6J A;  3CCR T;  2K5I A;  2EQM A;  4JS4 A;  4ME7 A;  1G8X A;  2EKH A;  1R0B G;  2CRE A;  2PTK A;  4ORZ A;  3OYY A;  2CUB A;  5KYY B;  1NYG A;  2DL4 A;  4BUG A;  4KGV B;  3KXT A;  4B6M A;  1FMV A;  1U3O A;  4PJL A;  1RAB B;  5IHI A;  3QBY A;  1Y07 A;  3JRZ A;  3CCV A;  2FZC B;  5EC7 A;  2ZPB B;  3PVQ A;  4BDZ A;  3CCR A;  3J80 E;  3UF4 A;  4E6R A;  1N8R U;  3I9Q A;  4JDS A;  1VQ4 Q;  1UG1 A;  1YCS B;  3V7S A;  1ZA1 B;  1JXO A;  3DB4 A;  1RAI B;  4FT2 A;  3M0Q A;  3JSC A;  4E7K A;  5KYX B;  4M75 E;  4AFS C;  3FB9 A;  1X6G A;  1SEM A;  1K73 C;  2JM9 A;  3CC4 Q;  5D7U A;  3CXC P;  2KSS A;  1SHF A;  1OU8 A;  4BD3 A;  5DLQ E;  1A0N B;  1FYN A;  2RK1 A;  2DEU A;  3RER A;  2DMO A;  2BIV A;  2X3X D;  3UAT A;  4C92 D;  1YJN A;  1WHG A;  1ZSZ A;  2PVO B;  2KEA A;  2FVU A;  4CI0 C;  2FZK B;  3RES A;  2HZY A;  2BUD A;  5FWB A;  3CCS T;  2CS7 A;  5GMK e;  4OB1 B;  1WHK A;  1RAA B;  1GL5 A;  1VQ7 A;  1QWF A;  3EGX B;  4M77 F;  2A37 A;  2CSI A;  1PSE A;  3LX7 A;  1X27 A;  5GAN 6;  3QII A;  1M2V B;  2XG8 D;  1LNX A;  4F7U G;  5LL6 S;  4FSX A;  3EAE A;  2FEI A;  5KCH A;  2FHD A;  2FPE A;  1RUW A;  2LQW A;  3RR6 A;  1UJY A;  4R56 A;  4X9C A;  1YNZ A;  2OTL A;  1FWZ A;  1TU0 B;  3SD4 A;  3ZFJ A;  2V8I A;  2AT1 B;  3O5Z A;  1ZQ1 A;  2P4T A;  1I1J A;  4KH0 B;  4L5G A;  4QKU A;  3JB9 J;  4MDW A;  1ZLM A;  4R55 A;  4C0F A;  1N8R R;  1G83 A;  2SRC A;  3E19 A;  1ZUK A;  2K5F A;  1AD5 A;  5FU6 B;  2LJ1 A;  1OPK A;  4EPC A;  1I4K 1;  2O2O A;  4X9D A;  2EFI A;  3BY7 A;  1K73 U;  2DIG A;  1IXD A;  3I5R A;  3QZ5 B;  1D1B A;  2AKL A;  3EG3 A;  4HT9 A;  4M78 B;  1VQP Q;  3JCM V;  3OS5 A;  2X4J A;  2ROL A;  4JUV A;  2CP7 A;  3PT9 A;  3WXM B;  2RM4 A;  4JRP A;  2V8K A;  2EJ9 A;  2E4H A;  4J9E A;  1LPL A;  3KBG A;  3CD6 T;  3URG A;  5GAN e;  4AFU C;  6AT1 B;  1OEB A;  4F7U A;  1RAH B;  1V1C A;  2F69 A;  4E7S A;  3TSZ A;  4RTU A;  2ZCF B;  1WIE A;  1X6B A;  3HFN A;  4C0G A;  1ZA2 B;  1SSH A;  3M9Q A;  1SRM A;  1FXX A;  2HSE B;  4PFO A;  2FZG B;  3HRT A;  2D0N A;  2RH2 A;  4OVA A;  1GFD A;  4C8Q B;  4FYY B;  3RKX A;  2EPD A;  5A0G A;  1VYU A;  5GAN 4;  3CCM T;  2FG0 A;  1NE8 A;  3CD6 A;  1ZHI A;  1M30 A;  4IIM A;  2B8A A;  3CCE T;  2QI2 A;  1T0H A;  1YI2 T;  1AWJ A;  4O5V A;  5KE2 A;  2XDB A;  1N6A A;  4J9C A;  1M1G A;  1M3C A;  3JCM d;  4L59 A;  5CAI A;  4XU3 A;  3U23 A;  2DPP B;  3I56 A;  3OQ5 A;  1PSF A;  4FIB A;  5GJW B;  1VQ6 T;  4OMQ A;  3OYG A;  3TVT A;  1K73 R;  1U5S A;  1NYF A;  4QQG A;  2BZ8 A;  3H0H A;  1NLO C;  4LDY A;  1RLQ C;  4OB0 B;  1KQ1 A;  2JMA A;  2V1Q A;  2DX1 A;  1YI2 A;  4MMK A;  3RKY A;  4JS5 A;  2ZPI B;  1QVG S;  1MNE A;  3E1S A;  5GAN f;  5IH2 A;  3CME Q;  2P0Q A;  2DLP A;  3SWN B;  3VS1 A;  5GAN 7;  4PNO A;  4ATO A;  3CPW S;  1Q82 C;  1QLY A;  2RQV A;  1VQ6 A;  2RF0 A;  4F7U F;  2D1X A;  4R0K A;  5GMK m;  3OYL A;  2RNA A;  1D3B B;  2RQR A;  4C5E A;  3C12 A;  2MF2 A;  2RHX A;  3FIF A;  2M9U A;  2DYB A;  2BE7 D;  8AT1 B;  2DD4 A;  2IIM A;  2BTT A;  4J9D A;  4PJO B;  3N5B B;  4PLI A;  2B86 A;  4OF1 A;  4NL2 A;  1Z9Z A;  2NUP A;  3OMG A;  4OMM A;  3VJP A;  1QCF A; 
#chains in the Genus database with same CATH homology
 2LZ6 B;  5FW9 A;  1ZUY A;  1B07 A;  3VRZ A;  2OAW A;  2RPN A;  4JJC A;  4D8K A;  1HD3 A;  1OV3 A;  2DVJ A;  2J6K A;  2DA9 A;  4Z8A A;  2NWM A;  3PVL A;  2CDT A;  1TUC A;  1GRI A;  1T3L A;  3UA7 A;  2DL8 A;  1KSW A;  2ED0 A;  1XOV A;  1RI9 A;  2KRN A;  2O9S A;  4LUD A;  1AWO A;  3SEM A;  1I0C A;  2L3P A;  4ZNX A;  2C0O A;  2M51 A;  2VVK A;  4JJB A;  1UHC A;  2K6D A;  4EIK A;  2YUN A;  4QT7 A;  2YUQ A;  4Z89 A;  2X3W D;  2L3Q A;  2EQI A;  2G6F X;  3ZL7 C;  2FPF A;  1MUZ A;  2KT1 A;  2CSQ A;  1AZG B;  3M0P A;  2KYM A;  2LX7 A;  5FWC A;  4JJD A;  2A08 A;  1E6G A;  3C0C A;  3GBQ A;  2EVR A;  1J3T A;  2HBW A;  2RQW A;  4RTT A;  2ENM A;  2A36 A;  5IXB A;  1BU1 A;  2L0A A;  3QWX X;  1W70 A;  1Y0M A;  1PKS A;  2JT4 A;  1K4U S;  1TUD A;  2KT8 A;  4AFQ C;  2BZX A;  2K9G A;  4CC7 A;  4X1V A;  3EG2 A;  4JZ3 A;  3M0U A;  2P4R A;  2ABL A;  2EYX A;  2EW3 A;  2W0Z A;  3KFV A;  3VRY A;  4Z88 A;  1SHG A;  1K9A A;  1H8K A;  2KE9 A;  4RTZ A;  4HVW A;  4F16 A;  2PZ1 A;  3QWY A;  4LUE A;  1NG2 A;  1ZX6 A;  2YDL A;  2DL3 A;  1RLP C;  1KFZ A;  2JW4 A;  4JPB W;  2DL7 A;  2AZV A;  1NM7 A;  4CC2 A;  2J05 A;  4A63 B;  2F2W A;  4RTY A;  2F2X A;  3VS5 A;  4J9I A;  3PE0 A;  1GFC A;  2KXD A;  2GQI A;  2YUP A;  1BK2 A;  2SEM A;  1PRL C;  4OMN A;  4GBQ A;  4ESR A;  1PKT A;  1WLP B;  1UDL A;  2J6F A;  1PWT A;  4M4Z A;  1PHT A;  2XMF A;  1T0J A;  2ROT A;  2MOX A;  1ZBJ A;  4OMO A;  2QDL A;  1M3B A;  5L23 A;  2YSQ A;  2JXB A;  1TG0 A;  2VKN A;  2RMO A;  1OOT A;  2C0T A;  3RBB B;  1HJD A;  3VS2 A;  4JZ4 A;  4HVU A;  2LQN A;  1CKB A;  2RQU A;  2LJ3 A;  2CT3 A;  1YWO A;  1SRL A;  3CQT A;  3UA6 A;  2KR3 A;  2BZY A;  2HEQ A;  2PNI A;  2J6O A;  1KIK A;  1UTI A;  4OMP A;  1AWX A;  1QKW A;  2VWF A;  2DNU A;  2J7I A;  1H3H A;  2JM8 A;  4DEX A;  5IHN A;  5I22 A;  3M0T A;  2O88 A;  2KNB B;  5ECA A;  3NPF A;  2RQT A;  2EYW A;  1U06 A;  2D8H A;  2FO0 A;  3NHN A;  1MV0 B;  2EKH A;  2CRE A;  2KRO A;  3M0S A;  2PTK A;  3NMZ C;  1VYT A;  2F2V A;  4ORZ A;  2HDA A;  1M3A A;  2J06 A;  4AG1 C;  2CUB A;  1AVZ C;  1NYG A;  4RTV A;  2DL4 A;  4CC3 A;  3VS3 A;  1U3O A;  2DRK A;  3EG0 A;  5IHI A;  3VS4 A;  5EC7 A;  2YT6 A;  3PVQ A;  3FJ5 A;  1M8M A;  1ARK A;  1AZE A;  2DBK A;  3THK A;  1I07 A;  3UF4 A;  4E6R A;  3I9Q A;  3M0R A;  3IQL A;  1UG1 A;  1YCS B;  1VYV A;  1JXO A;  1WI7 A;  1NEB A;  1NEG A;  3M0Q A;  3REA B;  2LNH B;  1B3Q A;  4AFS C;  1W6X A;  1MV3 A;  1X6G A;  1SEM A;  2FRW A;  2GTO A;  2DBM A;  2CH4 W;  2JM9 A;  2YUO A;  4AFZ C;  1BB9 A;  1E7O A;  2K3B A;  1YN8 A;  2GNC A;  1SHF A;  1KJW A;  3NGP A;  1A0N B;  1FYN A;  4GLM A;  1GCP A;  3VS0 A;  2DMO A;  2X3X D;  3UAT A;  2AK5 A;  1GCQ C;  5I11 A;  2KEA A;  1PRM C;  2O31 A;  1X2Q A;  4J9B A;  1YP5 A;  5FWB A;  1VA7 A;  1GBR A;  4LNP A;  3H0F A;  3EHR A;  1WXU A;  1BBZ A;  2DM1 A;  1GL5 A;  1OPL A;  1CSK A;  1QWF A;  4D8D A;  1ZSG A;  2A37 A;  2CSI A;  1X27 A;  3H0I A;  1UEC A;  4AG2 C;  1JQQ A;  2FEI A;  1QKX A;  2FPE A;  1RUW A;  2LQW A;  3LH5 A;  1UJY A;  2GBQ A;  1UE9 A;  3A98 A;  4DEY A;  2D8J A;  1W1F A;  1YNZ A;  1GCQ A;  2OI3 A;  1X2K A;  4OML A;  1WXT A;  2KGT A;  2DF6 A;  1UHF A;  4HXJ A;  5IXF A;  1IO6 A;  1WA7 A;  2EGE A;  2HSP A;  3O5Z A;  1WX6 A;  2MCN A;  1I1J A;  1AWW A;  1ZLM A;  2DE0 X;  3EHQ A;  1G83 A;  2SRC A;  1LCK A;  1Y57 A;  2K2M A;  1ZUK A;  3H41 A;  1AD5 A;  2LJ1 A;  1OPK A;  2JS0 A;  3I35 A;  1FMK A;  2O2O A;  2OJ2 A;  2AZS A;  2EGC A;  1UGV A;  1UJ0 A;  2L3S A;  3VS7 A;  1AOJ A;  2GTJ A;  3I5R A;  2JTE A;  2HCK A;  1GBQ A;  2AKL A;  2JMC A;  3EG3 A;  2K7A A;  4HVV A;  2L2P A;  1JXM A;  1E6H A;  1K1Z A;  2ROL A;  2ED1 A;  2O9V A;  2I0N A;  4J9F A;  2M0Y A;  5GJV B;  5IHK A;  1X43 A;  1WDX A;  2C0I A;  4J9E A;  3VS6 A;  1SPK A;  1M27 C;  4FSS A;  2ESW A;  4AFU C;  1OEB A;  1UUE A;  3ULR B;  4WCI A;  1V1C A;  2CUD A;  2LP5 A;  2JS2 A;  3TSZ A;  2EGA A;  2KYB A;  4F14 A;  4RTU A;  3RNJ A;  1WIE A;  1X6B A;  3JV3 A;  2AKK A;  4HCK A;  1SSH A;  1SRM A;  4IIO A;  1K0S A;  4J9G A;  2D0N A;  1X69 A;  1Z9Q A;  2V1R A;  1GFD A;  4K11 A;  3EGU A;  3SHW A;  2EPD A;  1EFN A;  2KRS A;  1VYU A;  2MIO A;  2FG0 A;  2H8H A;  1JU5 C;  2KXC A;  2DL5 A;  1M30 A;  2A28 A;  4IIM A;  3REB B;  1T0H A;  5HCK A;  2DJQ A;  2RN8 A;  1S1N A;  1AWJ A;  2DIL A;  2W10 A;  4J9H A;  4RTW A;  2LCS A;  2GGR A;  1K76 A;  2LJ0 A;  4J9C A;  1HSQ A;  1M3C A;  4KRT A;  3I5S A;  2CH4 A;  3U23 A;  1CKA A;  1JEG A;  1ABO A;  4RTX A;  5GJW B;  1WXB A;  4OMQ A;  1N5Z A;  3TVT A;  1H92 A;  1G2B A;  1U5S A;  2E5K A;  1QWE A;  1NYF A;  1ZUU A;  2BZ8 A;  3H0H A;  4LN2 A;  1NLO C;  3TSW A;  2ECZ A;  1RLQ C;  2NUZ A;  2DRM A;  1T3S A;  2JMA A;  2V1Q A;  2DX1 A;  1K0X A;  2FPD A;  4RUG A;  2EYZ A;  2K79 A;  4LE9 A;  2EYY A;  2FRY A;  4CC4 B;  5IH2 A;  1YWP A;  1ABQ A;  2DLP A;  3VS1 A;  1WFW A;  1NLP C;  1QLY A;  1PNJ A;  2RQV A;  2RF0 A;  3R6N A;  2D1X A;  4F17 A;  4R0K A;  2LMJ A;  2RNA A;  2RQR A;  4Y92 A;  1AEY A;  1WYX A;  1UFF A;  2DYB A;  2KRM A;  1JO8 A;  2IIM A;  3EG1 A;  2BTT A;  4J9D A;  2B86 A;  2KBT A;  1Z9Z A;  2CT4 A;  4OMM A;  2EBP A;  1QCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...