3P8DA

Crystal structure of the second tudor domain of human phf20 (homodimer form)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
SEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Medulloblastoma antigen MU-MB-50.72
total genus 12
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8dA00
3NTHA 2XK0A 3OYEA 1OYXA 3MO8A 4A4GA 4Z02A 3LGFA 3DB4A 2R5MA 2M16A 3M9QA 5KE3A 4IUTA 4BACA 3OYGA 1OZ3A 4GY5A 4II1A 5D6XA 4A4HA 1WJSA 3MP1A 4QQGA 3OYBA 4PL6A 3QIIA 3PNWC 2LVMA 1OZ2A 1SSFA 3OB9A 3MEVA 4L59A 4BE0A 4LD6A 4IKFA 2RO0A 4CRIA 4Q5WA 4X34A 4N4GA 4EDUA 3OYCA 2RHIA 5FRMA 5C6SA 3OS2A 2E6NA 3LX7A 2X4WA 3P8HA 2DAQA 3S3NA 2QQSA 2JTFA 4C5GA 2GFUA 2B8AA 2G3RA 4E7JA 4QW2A 2EKOA 3QKJA 2HQEA 3L2RA 2LDMA 3FLGA 5M9OA 4ZTFA 2EQUA 4C5HA 3ME9A 3MEWA 2IG0A 4N4IA 3CEYA 2MWPA 3L2VA 2JZ2A 4B9WA 2EQKA 3PMIA 2BUDA 3UWNA 5FRNA 5D6YA 3H8ZA 4BE2A 4IUPA 3MP8A 4C5IA 4IURA 2R58A 2X4YA 2DIGA 4B9XA 2RHZA 3NTIA 3PMTA 3META 2P0KA 3OYLA 3OYAA 2RHYA 4NS5A 5IN1A 3OYJA 2YRVA 3OYIA 4BD3A 2K3XA 1WJRA 3H6ZA 3LYIA 3OYNA 2RHUA 1XNIA 2RJCA 5D6WA 2LTOA 1WJQA 2EQMA 3MP6A 4QQDA 5IAYA 3OS1A 2LCCA 2X35A 3BDLA 4A4FA 4FL6A 3MEUA 1MHNA 2XDPA 2VYTA 4HCZA 3L2UA 3MEAA 2F5KA 2FHDA 3ZEHA 2DIQA 5J26A 2D9TA 3S3MA 2BIVA 1H3ZA 1OI1A 2RJDA 5KH6A 3UT1A 3QBYA 4IUUA 5FROA 4RG2A 3L2QA 2M1HA 5KCOA 3GOXA 4E7LA 3NTKA 3EAEA 2GFAA 3OYFA 4E7HA 2RI5A 4IUQA 2MWOA 3S6WA 2RJEA 3LGLA 1N27A 4C5EA 1G5VA 3SD4A 3OYMA 3Q1JA 2CKKA 2EQJA 2WACA 2RI3A 1KHCA 3DLMA 4PLIA 3KUFA 2EFIA 1WGSA 3LH0A 3OQ5A 5KCHA 2BKDN 4BDYA 3E9FA 2RJFA 3PFSA 3OS0A 4E7IA 2HQXA 2PQWA 2QQRA 2M0OA 2RHXA 3DB3A 2RI2A 4OVAA 2LRQA 3L42A 5C0MA 5J39A 3OYKA 4FU6A 3O8VA 5CIUA 2L89A 2O4XB 2O4XA 2GF7A 4IUVA 4A4EA 3ASKA 3E9GA 3FEOA 3QJ6A 3OY9A 4N4HA 2X4XA 4E7KA 3C4SA 3OMGA 2R5AA 3LLRA 2L8DA 2L3RA 2R57A 3F70A 3P8DA 2E5QA 3OA6A 3FC3A 4BDZA 3OYHA 3S3OA 2K3YA 4ZTJA 4PLLA 2NLUA 4QQ6A 4BE1A 4QVZA 5KE2A 3OMCA 3OYDA 4UC4A 1RI0A 3FDRA 3L2WA
chains in the Genus database with same CATH superfamily
4FT4A 4C0GA 1KQSP 5IXBA 5GMKm 4J9FA 2PUOB 1OZ3A 4II1A 4A4HA 3MP1A 3V7CA 3OYBA 1M1KC 1QCFA 4WTOB 5A0LA 1VQMT 4M7DG 4EDUA 2KY9A 3CCLT 1N6AA 2JTFA 1CKBA 5DY9A 5FLXE 2P0PA 4E47A 3I56Q 1WNLA 2FRWA 2HD0A 1X2KA 1GCPA 2KXCA 3G6ET 2DTIA 2ENMA 2D0NA 5GMKi 5EC7A 4BE2A 3JV3A 3AT1B 4D8DA 3VYHB 4HVWA 4PJJA 2BE9B 2EKHA 2NYSA 4XTUA 1YHQQ 1Q81U 3H6ZA 4RTVA 3CD6A 1B3QA 4M75B 2KI7A 2KR3A 3GNFB 3RMSA 4J9EA 1H92A 5KH6A 5FROA 2C06A 4K11A 5CKEA 2YUPA 1VQPT 1Z9QA 2EYWA 2XKOC 2RH2A 4O6JA 2JW4A 1N27A 4HCKA 1XJWB 1VIEA 2HAXA 2DL4A 4C0DC 4M78E 3RIRA 2YLBA 5GAOl 4F7UE 1AT1B 4C8QF 3N5BB 2BE7D 1TSFA 4D8KA 1H8KA 4XAXB 1VQ9Q 2KE9A 5HKCA 4FU6A 1E7OA 2YUQA 3EG1A 2GF7A 2GCXA 1D3BB 3CD6Q 4HVUA 1YHQA 2AHJB 2CH4A 3EH2A 3LW5E 3OA6A 2JXBA 5GAN2 1TS9A 1YI2Q 1E6GA 3HFOA 3D7SB 2K2MA 1RI0A 3CCMQ 2LC4A 3JCMg 3OBYA 3RKXA 2FPEA 2P4RA 3DB4A 3TEEA 3OYGA 4J9BA 3GF5A 4C0ZA 2LVMA 1QVGS 3CMAQ 5GAOm 1BK2A 1M8VA 1M1KR 5CKDA 2QEXT 3RERA 3L2ZA 1ZUUA 4XTYA 1N9RA 3FLGA 3A8LB 2XDDA 3CEYA 5FWCA 3UA6A 3CPWP 1I4K1 4M7DD 4FYWB 1S72A 2AZSA 2KYMA 2RHZA 1WXTA 2JOYA 2LCLA 2GNCA 3OYJA 4M7DA 1K76A 2RQUA 3TSZA 2RJCA 5FW9A 1D1CA 3ULRB 3JB9F 2KSSA 2WSFE 3HFNA 1T0HA 1ZSZA 1NLOC 2ZPGB 4J9CA 1OI1A 3DKMA 2QQAA 4Z8AA 4M75D 1WXUA 1NZ9A 1J3TA 2AT1B 2LX9A 2W10A 3NFCA 1I8FA 1K8AC 3OYMA 4KBMB 4PLIA 2Y4YA 5KCHA 3M59A 1R77A 1ZX6A 3GNGA 2DNUA 1LOJA 4RKUE 3I5SA 3EG3A 3CCLA 3OSSC 1NYGA 5CIUA 1OPLA 3CCST 2F2VA 3RKYA 2KRNA 2QA4T 1VQ5Q 2HQHA 2EYYA 1Y96A 2HEQA 2YWWA 4BUGA 3OYHA 1IHWA 4N0AC 1MMGA 4JS4A 1M8MA 1RAIB 1T3SA 5CKFA 1D3BA 3CCVQ 1K73U 3EFRA 3PGGA 2M16A 5GANf 2RQVA 3ZBDA 2LQNA 3OB9A 1DJ7B 4N0AA 3RBBB 1UJ0A 3JRZA 4Q5WA 1Y57A 1KC8U 1F1BB 3S3NA 3UATA 1ACMB 3OW2P 3G4SQ 1ZSZC 2J7IA 3A98A 4C92C 3VYGA 3CCLQ 3G7ZA 4M75G 4PK4A 2JUFA 3L2VA 4JRQA 4NL2A 1QWFA 2DRKA 3QWXX 2QQ9A 4CI0C 5GJWB 1G3WA 1Y71A 1VQ8T 1NJIC 3OYAA 1SRMA 1W4SA 1UHFA 4BD3A 3URGA 3M4GA 1MUZA 2RHUA 1XNIA 3HRSA 2LTOA 2A36A 2JS2A 5L8RE 5IAYA 2LCCA 3RR6A 1YN8A 4DBFA 1VQ8A 1MHNA 1TUDA 3KFVA 2EGEA 4JJDA 1M1FA 2F5KA 2K57A 2YHTA 2RJDA 3UT1A 3CCRQ 4RG2A 3JB9G 2M1HA 1OEBA 2OTLQ 5DLQE 2XIDA 1VQLT 1WI7A 4C5EA 4AG1C 2MYSA 5KYWB 5LJ3g 2RI3A 4ORZA 1PWTA 5GAOp 3TVTA 3WVEB 1MMAA 4LXCA 1KQ2A 1TH7A 3CC7A 2PQWA 2JVVA 3CBOA 4F16A 3CC2A 3PE0A 4OB1B 2DXTA 2EGAA 2RM4A 3E9GA 2EW3A 5A2QE 2E5KA 3PVLA 4OMOA 1QCNA 3HP9A 4QQ6A 4BE1A 4HKEA 2EBPA 4XTXA 4M7AB 2OJ2A 1CKAA 1EX4A 3CCMA 4OMLA 1WHGA 1IGQA 2VASA 4QQGA 1W70A 3EGUA 2E12A 2XG8D 1VQPQ 4X34A 4N4GA 1SF9A 1KIKA 1PD0A 1WYXA 1WPYA 2LT4A 1VQOA 2QI2A 4ATOA 1RAAB 2SEMA 2O88A 5GAN3 3L2RA 2LT1A 1VQ7A 2EQUA 1VQMA 2A7YA 2ZCFB 1VQOT 2NUTB 4C8QG 3ER0A 2PTKA 3HTRA 1WDXA 1WLPB 3V8LA 5L23A 5AYFA 3SHWA 1W2BS 4DQ2A 1RADB 3CCRT 1RLPC 1NBEB 1Q7YC 2AK5A 4PNOA 5GAMh 2DZCA 4QQDA 1KFZA 1X2QA 2M9UA 2FYKA 2D9TA 1D1AA 2RQWA 2DXUA 4BB7A 5AT1B 1IRXA 3GOXA 2OTJQ 5ECAA 1ZA1B 1GL5A 1PRLC 5CQXA 3I35A 4OB0B 1UECA 1MNDA 4CC4B 2JNGA 4PJOB 3G6EQ 1HK9A 1W1FA 2BKDN 1PCXA 4BDYA 2PVDB 2RJFA 3X26B 2K5IA 4E7IA 2VGMA 1ZSZB 3I55A 3CQTA 1YFNA 3P8BB 4FW2A 4P5NA 5GAMd 2DKGA 2LNVA 3I56A 1K9AA 3JB9I 3PTAA 2COWA 2X4XA 4RTZA 2KT1A 5I21A 3M0SA 5LJ5e 3ZFJA 1RABB 2DM1A 3JSCA 1P92A 4J9DA 4QVZA 2PVOB 4RTUA 1QVPA 2EVRA 3GLXA 2XMFA 1KQ1A 2XDBA 1ZBJA 1WJSA 4C8QC 1TG0A 1WHHA 2CP6A 1OZ2A 1UGRB 4CC2A 1UGVA 4LDXA 3QHSA 2JN0A 4KT0E 3JAME 4E7JA 2DEUA 4DA4A 4J7IA 4M78G 1VQLA 3CXCP 2CP2A 2HNIA 3MEWA 3EGDA 1R0CB 4OB3B 3SWNC 3MP8A 1JB0E 4XTVA 2YUOA 5GAN5 2FO0A 1VQNQ 4D6WA 1WHMA 2X4JA 3L1AA 4JRKA 3AHUA 1JXMA 2X35A 3GBQA 4FL6A 1UB4A 2VYTA 4HCZA 1S72T 3CC4A 3OS5A 2ZPBB 1VQKT 1UGPB 1EIFA 2E6ZA 1MMNA 3X24B 3CPWA 2MK5A 2C0OA 3SD4A 1WHKA 3EG9B 2CZ6B 2KDSA 4C8QB 3G71T 3EGXB 5GAMg 4R56A 2LQWA 1M90R 1JO8A 1BBZA 1RAEB 2RHXA 4OVAA 2KXDA 5I11A 5J39A 4MDXA 3VS6A 1VQ6Q 4IUVA 4A4EA 1GFDA 1QKWA 1BI0A 3QJ6A 4N4HA 3C4SA 3CCQT 3M0TA 3LLRA 1G3TA 2CGHA 1A0NB 2ZPIB 3ZL7C 4ZTJA 1PHTA 4PLLA 1HYOA 4EMGA 3VJPA 4M75A 3I9QA 2XK0A 3OYEA 2R5MA 2HKQB 2VV5A 4OF1A 2EGCA 1BKBA 4WF2A 3M54A 5KYUB 1Q82U 2E6NA 4KH1B 3EH1A 1YJWQ 2QQSA 5A0GA 2MAMA 2FPFA 4M75F 2EKOA 3O5ZA 4X9CA 1IREB 2HQEA 4F7UB 2CREA 5GAMe 2ROTA 4AT1B 2DFUA 2CP5A 5DM7R 1TWBA 2RN8A 1RI9A 3QSUA 4B9XA 4PJNA 3CCJQ 4FYVB 1KC8C 2K2VA 2DTHA 1M3CA 1XQHA 3JCMb 5LJ5d 1IZ6A 4A4FA 4GLMA 3EFOA 1NM7A 2WSCE 1QP3A 2D8JA 2CP7A 1H3ZA 1I5OB 1YBYA 5KCOA 1M30A 4IUQA 2MWOA 2MPXC 5CAIA 1AWJA 1K8AR 4A53A 2BTTA 1GBQA 4KUIA 3QDFA 4M7AA 2EQJA 5GMKe 4JZ3A 3QG1A 1KHCA 2F5TX 4F7UG 1WGSA 2DA9A 1Q86C 3CCMT 1VYUA 2E3HA 4OMPA 4DOWA 1VQNT 1XTDA 1NEGA 2M0OA 1GCQA 2K4YA 1RAHB 3THKA 3O8VA 4BI3A 2QK0A 1TUCA 5CKBA 3FEOA 2K79A 3JCMe 4E7KA 1NYFA 5GAN6 3OMGA 3CCJA 2BZYA 1VIFA 1B34A 4Y28E 3V8KA 3X20B 2HKNA 1YJ9Q 3CCSA 1WQWA 3J81E 1PG5B 4RG8A 4PJOE 2CYZB 5GAOr 2WSEE 4OP0A 2M0YA 2RA2A 1KK7A 4L59A 4JJBA 1M4ZA 2DMOA 4CC3A 2ECZA 5C6SA 3P8HA 3M0QA 2RPNA 1B34B 1I07A 1MMDA 5IHIA 4J83A 3MHXA 4BY6C 3CMEQ 3FJ5A 3ME9A 4M7DE 4J6XA 2BUDA 4AFZC 1PKTA 2O01E 3VS5A 5LJ5f 1MGQA 2VB6A 3OYLA 2RHYA 3QZ5B 5IN1A 4FSSA 2E64A 1PM3A 3MP6A 2OTJA 1YNZA 1IO6A 4F04B 2FHDA 3JCMh 4HT9A 1G83A 3S3MA 5KYWA 3HRUA 2PZ1A 1AOJA 3VKIA 5IHKA 4NL3A 3OYFA 3M55A 4Z88A 3EG2A 4PJOC 3CCET 3E19A 4LN2A 4M77E 4OGEA 2CKKA 1X27A 1BIAA 1Z9ZA 1MV0B 1X01A 5LJ5h 2HL3A 3FIFA 2KQWA 1YJ9T 4JUVA 4WCIA 1VQMQ 1K73R 4J9IA 3UA7A 1VYVA 4J9HA 3A8OB 2DD5A 2L89A 2O4XB 3VUBA 3JB9H 4ZN1A 4AFSC 3H0HA 1IXDA 2VXFA 8AT1B 3JCMd 2VVKA 5IT9E 1Q82C 3P8DA 2O9SA 4JLIA 3GPLA 3RNJA 1KG1A 4JRPA 2L3SA 3MCAB 4F7UA 3L2WA 2A08A 4JRIA 1BI2A 3M9QA 5KE3A 2OTJT 3MJXA 4BACA 4OMMA 3J80E 2DILA 1FYNA 1PNJA 4XU1A 2OTLT 3OYCA 2A3LA 2RHIA 2KAFA 2L2PA 1WX6A 2ED0A 1M27C 4M77F 2QAZA 4M77D 3GP8A 2DJQA 4L5GA 1KD1U 2OAUA 4M78F 4HA8A 1QMCA 3KXTA 1BYMA 1ZLMA 2MWPA 5D6YA 4EIKA 2J6KA 4IURA 3NTIA 4J7FA 5DLOA 1QP2A 3VRZA 2HSEB 5LJ3h 1Y0MA 1AZGB 1I81A 5GANj 1C0MA 5CKHA 2M51A 3CCJT 3A1PA 4A54A 1ABOA 2CSIA 3JCMV 4OB2B 2I2LA 1VQ8Q 1D09B 2FL7A 1NE8A 3G6EA 2Y4XA 4C92G 2E1HA 1U1SA 3Q1JA 1FX7A 1NEBA 2DF6A 2EYQA 2QASA 4RUGA 5GAMf 3LH0A 2ROLA 3G71A 1LNXA 4EPCA 1IB8A 3QUIA 2CT3A 3OYKA 1D0XA 5GAOn 4FCYA 4OGCA 2KRMA 4M7DC 4MMLA 2X9HA 1ZUKA 3G4ST 4BDZA 1YCSB 3WVDB 1U5SA 3CPWS 1M2VA 2QA4A 2QDYB 2VC8A 4HXJA 3LWHA 2D8HA 2DJZA 3I56T 1VQ7Q 1OULA 3CCVA 4M7AE 2H3EB 2XD0A 2DX1A 1VA7A 3QIIA 4HT8A 1TOVA 1K1ZA 4XU0A 3VUZA 4LD6A 2EPDA 1S1NA 2CUDA 5EG2A 1VQPA 2GFUA 2QTVA 3CXCA 1H641 3RKWA 3CCEA 3M4YA 1ARKA 2DL8A 2FZGB 2VWFA 5KYNA 4M77G 2AZVA 2EJ9A 1D0YA 5I22A 2EQKA 2NUZA 3UWNA 3RDVA 4XU3A 2A28A 5GMKl 4FT2A 5IXFA 2RB6A 2HBPA 4M7AG 2YDLA 3UPUA 1NJIU 1FMWA 4L6V5 3RESA 1VQ9T 3VS0A 3LYIA 3JCMW 5D6WA 1WJQA 4GBQA 3OS1A 2CZ1B 3CC2Q 1TXQA 3VS1A 2DIQA 1SHFA 2LQ8A 3VS2A 2IVWA 4M75C 3QBYA 1UEBA 2F2WA 4E7LA 2COZA 2RJEA 4AG2C 1G5VA 3LH5A 5LJ3j 2FEIA 4C92F 1JXOA 1N8RR 2C0IA 3A8GB 5HCKA 2K6DA 2GBQA 2HCKA 2OX7A 2E41A 4HCBA 3E2UA 1NLPC 4R55A 5C0MA 4C92E 1R8OB 3BDUA 1OPKA 2K7AA 2PU9B 4FIBA 3HHTB 4KGVB 1X43A 3ASKA 4QVDA 4PJOG 1M2OA 2CT4A 4DEXA 4DBRA 2LX7A 2HBWA 3CMAA 1SHGA 2FZCB 4A4KA 2RK2A 2X51A 2CS7A 2KMTA 3C0CA 2YXYA 1FMVA 3FDRA 1WHJA 2RD1A 3LGFA 3M0PA 1Q82R 2H8HA 1G3SA 4M77C 1YCYA 2MF2A 3G4SA 1R0BG 2MI6A 4IKFA 2J6FA 2DE0X 1YI2A 4F14A 2CP0A 3PT9A 3HRTA 1Y07A 4PJOA 2DAQA 4HCCA 1AWWA 2Z0WA 2KK4A 4C5GA 4RMOA 1KSWA 1SRLA 3REBB 1WHLA 2P84A 2LDMA 3NMZC 1OV3A 2DYIA 4C5HA 1ZHIA 2LMJA 2SRCA 1RLQC 2V8IA 1KD1C 4B9WA 5GAN4 2QA4Q 5FRNA 3R6OA 2DL3A 2ZPFB 4ZGJB 4LNPA 4RTYA 2X4YA 2DIGA 2QGFB 5KYXA 1TTHB 2E4HA 1OQKA 1VQ5A 2K5LA 1N5ZA 5GANe 2YRVA 1GRIA 3CCVT 4E2FB 1TUGB 1UUEA 4KH0B 4BI4A 2AIRB 2NWMA 4C92A 1YHQT 3JB9J 3BFMA 2NUTA 2L0AA 3SB2A 2RF0A 4IUUA 3L2QA 1VQ6T 3NHNA 3EAEA 2GFAA 4LUDA 5CVIA 3VRYA 1YJNA 2CDTA 4FYYB 3FJPA 3DLMA 3WXMB 1V76A 4LE9A 4M7DF 3TSWA 4C8QD 2RMOA 3U23A 2JMCA 2K5FA 1QVGP 2LRQA 1O9SA 3A5ZB 2GTJA 3M56A 1GFCA 1SEMA 4AFUC 1BCMA 2KROA 2R57A 4M7AD 1QVFP 1Y7XA 1VQ4A 2KBTA 2XI9A 3OMCA 4PJOF 2E3IA 1JU5C 4JLGA 1NG2A 1K0SA 1FMKA 2FG0A 3GIBA 1RACB 2YRDA 4AMCA 4JJCA 5FU6C 1HJDA 1YIJT 2OAWA 1VQ4Q 1NPPA 4CRIA 2KEAA 4O5VA 2XHCA 5KYUA 3LX7A 2X4WA 5CR2A 3VS7A 1U1TA 4QVCA 1NPRA 3QKJA 4M78D 4KGXB 3TCJA 3CXCS 2ZZDA 3BE3A 2QXFA 1M2VB 1V29B 2FB7A 5IH2A 3CC4T 3BW1A 2R58A 1OX9A 1YJNQ 2P0KA 2CP3A 1K8AU 4NS5A 1ZQ1A 3FRNA 2HMAA 1QW1A 1WFWA 3EGXA 2DPPB 1YP5A 1T0JA 4IIMA 5J3BA 2DO3A 4JDSA 3L2UA 2E10A 3VS3A 2V1QA 1VQ9A 5I2SA 3CPFA 4LD9K 1W2BP 3PVQA 2DD4A 2O9VA 2DETA 4FSXA 4PJOD 3NTKA 1HSQA 4E7HA 1ZBXA 2J05A 1H3HA 2V8JA 2DRMA 2DXBA 4E7ZA 2X3WD 5LJ3f 3QO3A 3RUXA 3H9NA 3EFSA 1C6VX 4F17A 3E9FA 3M53A 2ZGWA 4PFOA 2QQRA 1UGQB 2KRSA 7AT1B 8ATCB 4RCCA 3NGPA 3UF4A 1RAFB 2BZXA 3C12A 2DL7A 4A63B 1VOMA 1X6GA 2ZAEA 1QQJA 2DVEA 2EYXA 3J7AF 5HK3A 3C95A 2ATCB 2K3YA 4QT7A 2COYA 2HZYA 4UC4A 5LJ5g 4M77A 4PJLA 1VQ5T 1OYXA 4Z02A 5GMKh 2F2XA 3CMEA 4Y91A 2QGGA 3M57A 3PNWC 4ELYC 2JS0A 2DERA 4RTTA 5CCAA 5FU7B 2DTOA 3NPFA 2G3RA 1YI2T 5GMKj 2AKKA 2JJ9A 2QQBA 4N4IA 5CQYA 4BY6B 3HL8A 2K9GA 1UJYA 3H8ZA 1YJ9A 1WZOA 2VKNA 1AHJB 3UDCA 3MKDA 2PUKB 4XQ3A 2ED1A 3PMTA 4CC7A 1M3BA 1VQKQ 4V2SA 2KGTA 2PVGB 1FXXA 3KBGA 1M90C 1AEYA 2JM9A 1C1AA 2F69A 2VGNA 2KVQG 4DOVA 5J26A 3C94A 2IPOB 1JQQA 3JCMc 2Y90A 3EGDB 1WIEA 1JBMA 2EJFA 2KNBB 1N9SA 2L5QA 2DBKA 4E7SA 1UFFA 2DL5A 2ABLA 2X3XD 5A0DA 3REAB 2L3QA 3H41A 5GAMj 4DEYA 1I5LA 1UE9A 1Q81R 5KYYA 2P4TA 2J06A 1NJIR 5LL6S 4KRTA 2OI3A 3QPHA 1BI1A 2QEXQ 2YLCA 3FB9A 4LDYA 2IIMA 2H3JA 3SWNB 3TQ7P 3L42A 5LJ3e 3CCEQ 2P0QA 1YITQ 1AD5A 1WA7A 3CD6T 1QLYA 4OMFB 1D0ZA 3FC3A 1GBRA 2NUPA 5GAN7 4ESRA 2QG9B 3JCMf 1KHIA 2DK3A 3SFMA 1KD1R 2J6OA 2V8KA 2JTMA 1KQSS 4GY5A 5D6XA 2XU8A 3MEVA 2FVUA 4QKUA 1YJWA 1U8RA 2LJ3A 4F7UF 3OS2A 4ZNXA 1UGSB 4X1VA 2B8AA 2A0FB 4XTWA 4JPBW 2FPDA 2DXCA 2IG0A 5HK0A 3G71Q 1RAGB 3PMIA 4KGZB 1JRIA 1VYTA 2EIFA 1QVFS 4ZGEB 2CZ0B 4XU2A 2DLPA 1XOVA 1PSFA 1G2BA 3CCUA 1AWOA 1FWZA 1GXIE 1GCQC 4MDWA 1ZA2B 4BI8B 3CBPA 4TVRA 4EMKA 1QWEA 3ZEHA 4C0FA 2V1RA 2BIVA 2B86A 4AFQC 4MMKA 4JZ4A 3CMAT 1LCKA 1MV3A 1N8RU 3S6WA 3LGLA 3HKSA 4FYXB 1YIJA 1PD1A 1UHCA 1BU1A 3OQ5A 3H0FA 3JCMJ 4KUDK 2HQXA 2VXEA 1CSKA 5LJ3d 4EMKC 1JEGA 1SKUB 3JB9D 3JCMQ 4LDVA 1G8XA 1K9MU 3OSVA 1OX8A 2EJGA 2HSPA 3EG0A 1JJ2A 4XTZA 3OYDA 1WXBA 2VUBA 5LJ5j 3OY9A 1ABQA 3EFOB 2LNHB 3V7RA 2FRYA 2EAYA 3CCQA 5IHNA 1BI3A 1SSFA 2GGRA 4BE0A 4C8QE 1Q7YU 2RQRA 4FM4B 5FRMA 3V8JA 4M78B 2DZ9A 2YUNA 2RK1A 4RCBA 2O2OA 1JJ2S 3QDRB 1Y96B 2CH4W 1KJWA 4QW2A 1QVFA 3T9NA 1LVKA 4ME7A 3OW2A 3SWNA 4ZTFA 6AT1B 1D1BA 1V1CA 5HY6A 2MCNA 1K73C 2NUPB 2MMPA 4IUPA 1YIJQ 1QVGA 4EMKB 4C5IA 4RTWA 2QDLA 4Z89A 3MPUB 5GAOq 2K3XA 3OYNA 3QWYA 2EQMA 1AWXA 3PIOA 1RUWA 2JTEA 3MEUA 3HPWA 3I55Q 2GQIA 5KYYB 2I0NA 3VS4A 3TREA 1W6XA 1I0CA 3OYYA 3EG9A 4J5YA 1HD3A 1UG1A 1X6BA 4NOYA 3I55T 2EFIA 4M78C 2E70A 1SSHA 5GANh 3M0RA 4LUEA 1T3LA 3QZ9B 1PC0A 1YWOA 3M58A 2DBMA 2R5AA 4OMQA 3VV0A 3H0IA 5KE2A 4PJMA 4J6YA 1AVZC 1U3OA 5FWBA 3NTHA 3QXEB 3MO8A 1M5Q1 3A8HB 3I5RA 3M0UA 4C92D 3CCSQ 4M7AC 4B6MA 3X28B 1ZUYA 1SG5A 4PL6A 1VQOQ 4MZMA 3EHQA 4M77B 1W2BA 4M75E 3QYGB 5GANd 2QYZA 2MOXA 3CC7T 3CMET 1O75A 1LJOA 1PKSA 3CCQQ 1QKXA 4LDWA 1JJ2P 4IIOA 4MZPA 2JZ2A 4Y92A 2O31A 3EHRA 4GLKA 2JMAA 4M78A 3IQLA 4PFPA 3G1JA 4PFZA 1Q81C 3META 2K3BA 2RNAA 4E6RA 2M02A 1G3YA 1U06A 4M7DB 1X75C 2KT8A 2BZ8A 4YTLA 3JCMP 2EQIA 3MEAA 2PNIA 5FU6B 4XK8E 3VU3C 3CC7Q 4J6WA 4LDUA 2YT6A 3R6NA 2ESWA 3BY7A 1K4US 2RI5A 1QCOA 4C0DB 2D0QB 4KULA 2D6FA 1E6HA 2WACA 1VUBA 5CO7A 1VQ7T 4DBHA 2E65A 2LJ1A 3KUFA 2OTLA 4J8OA 1X69A 3CCRA 1K0XA 3A8MB 1MNEA 1UDLA 3OS0A 2RQTA 1AZEA 3V7SA 4EMHA 1B7TA 2F1LA 4J9GA 1UTIA 2DYBA 1YJNT 1Q86U 2GTOA 2V26A 3CCUQ 1YITT 2EYZA 1YWPA 2GQVA 2W0ZA 2L8DA 2DVJA 3F70A 1K9MC 1M9SA 2ZPEB 3S3OA 2LQKA 2CSQA 2NLUA 2L3PA 1M1KU 1IGUA 4C8QA 4A4GA 1PSEA 3CCUT 1X6OA 5I2MA 5GANg 4IUTA 4R0KA 4X9DA 1VQ4T 2LP5A 2RO0A 3DLLA 1HXDA 3HSBA 1K9MR 2CZ7B 3CC2T 4HVVA 4C92B 1IHVA 2D1XA 1N8RC 4RTXA 3PIPA 2FZKB 1VQ6A 1M1GA 1M3AA 2YRCA 3OBWA 5M9OA 1YJWT 2LZ6B 3M5AA 1OOTA 3JCMX 3QJYA 3INZA 4PKCC 4ANJA 3OW2S 1M90U 1I1JA 2MIOA 5GJVB 2A37A 1SPKA 2ZPHB 4ZN3A 2YSQA 2DEQA 1PRMC 3CBMA 1OU9A 3OYIA 1Q7YR 2HDAA 1WJRA 1BIBA 2JM8A 1LPLA 2JT4A 1YITA 3BDLA 3X25B 2XDPA 2LJ0A 4JJNK 1WQ7A 1RL2A 2QTXA 4ELZC 3TU4K 4MZTA 3CC4Q 2CUBA 2QEXA 4VUBA 4ZGDB 5FU7C 1Q86R 4JS5A 2G6FX 2HL5C 2EWNA 1EFNA 3E1SA 1VQNA 4DBQA 4M4ZA 2KYBA 2LCSA 2XICA 3QYHB 5KYXB 1BCOA 3PFSA 3DB3A 2RI2A 1EZZB 1VQLQ 1B07A 2O4XA 3SDZA 1TU0B 1Q95G 1OU8A 5D7UA 9ATCB 3RMQA 1VQKA 5CK9A 1KC8R 2L3RA 2E5QA 4M7AF 3LWIA 1BB9A 4FW1A 5GAN8 1S72Q 3SEMA 1ZSGA 1KQSA 2AKLA 2C0TA 4OMNA
chains in the Genus database with same CATH topology
4FT4A 3LWHA 1KHIA 2DK3A 3SFMA 4C0GA 2DJZA 3I56T 1KQ1A 2V8KA 3CCVA 4M7AE 2JTMA 5GMKm 2XDBA 2XD0A 1KQSS 2PUOB 1OZ3A 4GY5A 4II1A 5D6XA 2XU8A 1WJSA 3MP1A 3V7CA 4A4HA 4C8QC 3QIIA 3OYBA 1M1KC 4HT8A 1OZ2A 4XU0A 3MEVA 3VUZA 4LD6A 1UGRB 2FVUA 5A0LA 1VQMT 1YJWA 1U8RA 4M7DG 5EG2A 2KY9A 4EDUA 4LDXA 3QHSA 4F7UF 3OS2A 3CCLT 2JN0A 4KT0E 1N6AA 2JTFA 1UGSB 5DY9A 5FLXE 2P0PA 2GFUA 2B8AA 4E47A 3JAME 4E7JA 1VQPA 3CXCA 1H641 1WNLA 4XTWA 3RKWA 4DA4A 4J7IA 4M78G 2HD0A 3CCEA 1VQLA 3G6ET 3M4YA 2DTIA 2DXCA 2HNIA 3MEWA 2IG0A 4M77G 5HK0A 2EJ9A 2EQKA 3PMIA 3UWNA 4OB3B 5GMKl 4XU3A 5GMKi 1JRIA 2EIFA 4FT2A 3SWNC 4BE2A 2RB6A 2HBPA 3MP8A 1QVFS 1JB0E 4XTVA 4ZGEB 5GAN5 2CZ0B 4M7AG 4XU2A 3VYHB 1XOVA 4D6WA 3UPUA 1NJIU 4XTUA 1PSFA 2X4JA 1Q81U 3L1AA 4JRKA 4L6V5 3RESA 1VQ9T 3AHUA 3H6ZA 3CCUA 3LYIA 3JCMW 5D6WA 1FWZA 3CD6A 1WJQA 1GXIE 3OS1A 2X35A 4MDWA 2CZ1B 4FL6A 4BI8B 3CBPA 1UB4A 4TVRA 2VYTA 4HCZA 4M75B 4EMKA 1S72T 3CC4A 3OS5A 3ZEHA 4C0FA 2ZPBB 2DIQA 1VQKT 3GNFB 1UGPB 3RMSA 2LQ8A 2BIVA 1EIFA 2IVWA 5KH6A 4M75C 2E6ZA 3QBYA 4MMKA 5CKEA 5FROA 2C06A 3X24B 1UEBA 3CMAT 4E7LA 1VQPT 1N8RU 3S6WA 3CPWA 2XKOC 2RJEA 2RH2A 3LGLA 4O6JA 1N27A 1G5VA 3SD4A 4C8QB 3G71T 2CZ6B 2KDSA 3HKSA 5LJ3j 1VIEA 2HAXA 4C92F 3A8GB 4C0DC 4M78E 3RIRA 2YLBA 1YIJA 5GAOl 5GAMg 3OQ5A 4R56A 4F7UE 2E41A 4C8QF 3N5BB 3JCMJ 4KUDK 4HCBA 2HQXA 2VXEA 2RHXA 4OVAA 4XAXB 4R55A 5C0MA 4EMKC 5LJ3d 4C92E 1R8OB 3BDUA 4FU6A 5J39A 5HKCA 4MDXA 2PU9B 4FIBA 3HHTB 2GF7A 2GCXA 1D3BB 4IUVA 3ASKA 4A4EA 3JB9D 3JCMQ 1BI0A 4LDVA 3QJ6A 4QVDA 4N4HA 4PJOG 1YHQA 1K9MU 2AHJB 3C4SA 3OSVA 3CCQT 3LLRA 1G3TA 2CGHA 3LW5E 3OA6A 3CMAA 2EJGA 4A4KA 5GAN2 2RK2A 1JJ2A 2ZPIB 3HFOA 4XTZA 4ZTJA 4PLLA 2CS7A 2KMTA 4EMGA 3OYDA 3VJPA 2VUBA 1RI0A 3FDRA 5LJ5j 2RD1A 2LC4A 4M75A 3JCMg 3OY9A 2XK0A 3OYEA 3OBYA 3LGFA 3RKXA 3DB4A 2R5MA 3V7RA 3TEEA 2EAYA 3CCQA 1G3SA 4M77C 1YCYA 3OYGA 2MF2A 1BI3A 2VV5A 3GF5A 4C0ZA 2LVMA 1SSFA 2MI6A 3G4SA 4BE0A 4IKFA 4OF1A 4C8QE 1BKBA 4WF2A 1YI2A 1Q7YU 1QVGS 3PT9A 4FM4B 5FRMA 3HRTA 1Y07A 3M54A 3V8JA 1Q82U 2E6NA 4PJOA 2DAQA 4M78B 2DZ9A 4HCCA 2QQSA 5GAOm 2KK4A 2RK1A 4RCBA 4C5GA 5A0GA 3QDRB 1Y96B 4RMOA 1JJ2S 1M8VA 2MAMA 4QW2A 4M75F 5CKDA 2QEXT 1QVFA 2EKOA 3T9NA 3RERA 3L2ZA 4X9CA 1IREB 2HQEA 4F7UB 4ME7A 4XTYA 3OW2A 2LDMA 1N9RA 3FLGA 3SWNA 5GAMe 4ZTFA 4C5HA 1ZHIA 5HY6A 3A8LB 1K73C 2V8IA 2XDDA 2MMPA 3CEYA 1KD1C 4B9WA 5GAN4 5FRNA 3R6OA 2ZPFB 5DM7R 1I4K1 4ZGJB 4M7DD 4IUPA 1S72A 1QVGA 4EMKB 4C5IA 3QSUA 2X4YA 2DIGA 4B9XA 2RHZA 1VQ5A 2JOYA 2LCLA 2K5LA 5GAOq 1KC8C 3OYJA 5GANe 2YRVA 2K2VA 4M7DA 2K3XA 3OYNA 2DTHA 3CCVT 2RJCA 2EQMA 1XQHA 3JCMb 5LJ5d 4BI4A 1IZ6A 4A4FA 3PIOA 3JB9F 2KSSA 2WSFE 3MEUA 3HFNA 2WSCE 1QP3A 3HPWA 4C92A 1YHQT 3JB9J 2ZPGB 3BFMA 1H3ZA 1OI1A 3DKMA 2QQAA 3SB2A 4IUUA 3L2QA 1VQ6T 1YBYA 5KCOA 4M75D 3EAEA 2GFAA 1NZ9A 4IUQA 2LX9A 2MWOA 3NFCA 3TREA 5CAIA 1I8FA 3OYYA 1K8AC 4A53A 3OYMA 4J5YA 4KBMB 5CVIA 4KUIA 1YJNA 4M7AA 2EQJA 5GMKe 3QG1A 3FJPA 1KHCA 3DLMA 2F5TX 4PLIA 3WXMB 3I55T 4NOYA 2EFIA 1WGSA 4F7UG 2Y4YA 5KCHA 1Q86C 3CCMT 4M7DF 3M59A 4M78C 4DOWA 1VQNT 4C8QD 2E70A 3GNGA 1LOJA 1XTDA 4RKUE 2K5FA 2M0OA 2K4YA 2LRQA 5GANh 3CCLA 3OSSC 1O9SA 3A5ZB 3O8VA 5CIUA 4BI3A 3M56A 3QZ9B 5CKBA 3FEOA 3CCST 3M58A 3JCMe 3RKYA 4E7KA 5GAN6 3OMGA 3CCJA 2QA4T 2R5AA 1VIFA 2R57A 4M7AD 1Y96A 1Y7XA 1VQ4A 1B34A 4BUGA 3OYHA 3VV0A 4Y28E 3V8KA 4N0AC 3X20B 2XI9A 5KE2A 3OMCA 4JS4A 4PJOF 3CCSA 1WQWA 3J81E 4J6YA 4JLGA 3NTHA 5CKFA 1D3BA 3QXEB 4RG8A 3MO8A 1K73U 3EFRA 3GIBA 3PGGA 2M16A 4PJOE 1M5Q1 2CYZB 5GANf 3A8HB 5GAOr 2WSEE 4C92D 5FU6C 4M7AC 4OP0A 3X28B 3ZBDA 2RA2A 4PL6A 1YIJT 3OB9A 1DJ7B 4L59A 4N0AA 4MZMA 1M4ZA 1NPPA 3JRZA 4M77B 4Q5WA 4CRIA 1W2BA 4O5VA 4M75E 1KC8U 3QYGB 2XHCA 5C6SA 3LX7A 5GANd 2X4WA 3P8HA 3S3NA 5CR2A 3CC7T 1B34B 3CMET 1O75A 1LJOA 1U1TA 4J83A 3MHXA 4QVCA 1NPRA 4C92C 3QKJA 4BY6C 3VYGA 4LDWA 4M78D 3G7ZA 4MZPA 3ME9A 3TCJA 2ZZDA 3CXCS 4M75G 2JUFA 4J6XA 3L2VA 4M7DE 2JZ2A 4GLKA 4JRQA 2BUDA 4M78A 4NL2A 2QXFA 2FB7A 1V29B 2O01E 5LJ5f 1MGQA 2QQ9A 4CI0C 3CC4T 3BW1A 2R58A 1G3WA 1Y71A 1Q81C 1VQ8T 3META 2P0KA 3OYLA 1NJIC 3OYAA 2RHYA 3QZ5B 1ZQ1A 3FRNA 1W4SA 4NS5A 5IN1A 2E64A 1K8AU 1G3YA 1QW1A 4BD3A 3URGA 4M7DB 3M4GA 2RHUA 1XNIA 1X75C 3HRSA 2DPPB 2LTOA 3MP6A 5L8RE 2OTJA 5IAYA 2LCCA 5J3BA 4YTLA 2DO3A 3JCMP 1VQ8A 1MHNA 4JDSA 3L2UA 1M1FA 2F5KA 2E10A 2FHDA 3MEAA 2K57A 5FU6B 3JCMh 1VQ9A 4XK8E 5I2SA 4HT9A 3CPFA 3VU3C 3S3MA 4LD9K 4J6WA 2YHTA 4LDUA 2RJDA 3UT1A 4RG2A 3JB9G 3HRUA 2DD4A 2M1HA 3BY7A 4FSXA 3VKIA 3NTKA 4PJOD 4NL3A 3OYFA 1ZBXA 5DLQE 4E7HA 3M55A 2RI5A 2XIDA 4PJOC 1VQLT 3E19A 3CCET 4C0DB 4C5EA 4M77E 2D0QB 2V8JA 4KULA 4OGEA 2D6FA 2CKKA 2DXBA 1BIAA 2WACA 1VUBA 2RI3A 5CO7A 5LJ3f 5LJ3g 1VQ7T 3QO3A 2E65A 3KUFA 1X01A 3RUXA 5GAOp 5LJ5h 3EFSA 2OTLA 3WVEB 3E9FA 4J8OA 3M53A 3CCRA 1KQ2A 1TH7A 3A8MB 3FIFA 3CC7A 2ZGWA 2KQWA 3OS0A 2PQWA 1YJ9T 2JVVA 1UGQB 2QQRA 4JUVA 3V7SA 3CBOA 4EMHA 3CC2A 4OB1B 3A8OB 2DD5A 2L89A 4RCCA 2O4XB 3VUBA 1YJNT 2DXTA 1Q86U 3JB9H 4ZN1A 2RM4A 3E9GA 1YITT 2VXFA 3C12A 3JCMd 5IT9E 2GQVA 1Q82C 2DVEA 2L8DA 3F70A 3P8DA 5A2QE 3J7AF 1K9MC 4JLIA 1M9SA 3GPLA 2ZPEB 5HK3A 3C95A 2LQKA 3S3OA 2K3YA 3HP9A 2NLUA 4QQ6A 4BE1A 4HKEA 1KG1A 5LJ5g 4JRPA 4UC4A 1M1KU 3MCAB 4F7UA 4M77A 3L2WA 1VQ5T 4JRIA 4XTXA 4M7AB 1OYXA 1BI2A 4A4GA 4Z02A 4C8QA 1PSEA 5GMKh 3CCUT 1X6OA 3M9QA 5KE3A 3CMEA 2OTJT 5I2MA 5GANg 4IUTA 3CCMA 4Y91A 4BACA 4X9DA 4QQGA 3J80E 3M57A 3PNWC 4ELYC 1VQ4T 2E12A 2XG8D 2RO0A 3DLLA 1HXDA 4X34A 4N4GA 4XU1A 5CCAA 2A3LA 2RHIA 2CZ7B 3OYCA 2OTLT 3CC2T 5FU7B 2KAFA 4C92B 3HSBA 2DTOA 1WPYA 1N8RC 2LT4A 1VQOA 2G3RA 2QI2A 4ATOA 3PIPA 1YI2T 1VQ6A 4M77F 4M77D 1M1GA 5GMKj 5GAN3 3GP8A 3L2RA 2LT1A 4L5GA 1KD1U 2OAUA 2QQBA 3OBWA 5M9OA 4M78F 2EQUA 4HA8A 1YJWT 1VQMA 3KXTA 1VQ7A 2A7YA 4N4IA 2ZCFB 3M5AA 5CQYA 4BY6B 1BYMA 1VQOT 2MWPA 4C8QG 3JCMX 3ER0A 3QJYA 3HL8A 3INZA 4PKCC 3OW2S 1M90U 5D6YA 3V8LA 3H8ZA 5AYFA 1YJ9A 3UDCA 1W2BS 1AHJB 4DQ2A 2PUKB 2ZPHB 4IURA 4XQ3A 4ZN3A 3CCRT 2DEQA 3NTIA 4J7FA 3PMTA 5DLOA 1QP2A 3CBMA 5LJ3h 3OYIA 1Q7YC 1WJRA 1BIBA 4V2SA 4PNOA 5GAMh 1YITA 2DZCA 2PVGB 4QQDA 1I81A 1FXXA 3BDLA 3KBGA 1M90C 5GANj 3X25B 2XDPA 5CKHA 4JJNK 2QTXA 1RL2A 1WQ7A 3CCJT 2F69A 4ELZC 2VGNA 2KVQG 4DOVA 3TU4K 2M9UA 5J26A 4MZTA 4A54A 2FYKA 2D9TA 3C94A 3JCMc 2Y90A 3JCMV 4OB2B 2DXUA 2I2LA 1JBMA 2EJFA 2QEXA 1N9SA 2L5QA 4VUBA 4ZGDB 4BB7A 3GOXA 5FU7C 2FL7A 4JS5A 1NE8A 3G6EA 2Y4XA 5A0DA 5CQXA 4C92G 2EWNA 4OB0B 2E1HA 5GAMj 1I5LA 1U1SA 3E1SA 3Q1JA 1FX7A 1VQNA 2EYQA 2P4TA 5LL6S 2JNGA 4PJOB 1HK9A 5GAMf 3LH0A 3QPHA 2XICA 1BI1A 2BKDN 3QYHB 4BDYA 2PVDB 2RJFA 3X26B 2YLCA 3G71A 3PFSA 3FB9A 1LNXA 4LDYA 2K5IA 4E7IA 2VGMA 4EPCA 3I55A 2H3JA 3SWNB 3DB3A 2RI2A 3L42A 5LJ3e 3QUIA 3OYKA 3P8BB 4P5NA 5GAMd 2P0QA 2O4XA 3SDZA 2DKGA 5GAOn 2LNVA 4OGCA 3I56A 3PTAA 3JB9I 3CD6T 4M7DC 2X4XA 3RMQA 1VQKA 4OMFB 5CK9A 5I21A 4MMLA 5LJ5e 2L3RA 2E5QA 3FC3A 4M7AF 3G4ST 3ZFJA 3LWIA 4BDZA 3JSCA 3WVDB 5GAN8 5GAN7 1P92A 3CPWS 4QVZA 2PVOB 1KQSA 2QA4A 2QDYB 1QVPA 2VC8A 3JCMf 3GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTH A;  2XK0 A;  3OYE A;  1OYX A;  3MO8 A;  4A4G A;  4Z02 A;  3LGF A;  3DB4 A;  2R5M A;  2M16 A;  3M9Q A;  5KE3 A;  4IUT A;  4BAC A;  3OYG A;  1OZ3 A;  4GY5 A;  4II1 A;  5D6X A;  4A4H A;  1WJS A;  3MP1 A;  4QQG A;  3OYB A;  4PL6 A;  3QII A;  3PNW C;  2LVM A;  1OZ2 A;  1SSF A;  3OB9 A;  3MEV A;  4L59 A;  4BE0 A;  4LD6 A;  4IKF A;  2RO0 A;  4CRI A;  4Q5W A;  4X34 A;  4N4G A;  4EDU A;  3OYC A;  2RHI A;  5FRM A;  5C6S A;  3OS2 A;  2E6N A;  3LX7 A;  2X4W A;  3P8H A;  2DAQ A;  3S3N A;  2QQS A;  2JTF A;  4C5G A;  2GFU A;  2B8A A;  2G3R A;  4E7J A;  4QW2 A;  2EKO A;  3QKJ A;  2HQE A;  3L2R A;  2LDM A;  3FLG A;  5M9O A;  4ZTF A;  2EQU A;  4C5H A;  3ME9 A;  3MEW A;  2IG0 A;  4N4I A;  3CEY A;  2MWP A;  3L2V A;  2JZ2 A;  4B9W A;  2EQK A;  3PMI A;  2BUD A;  3UWN A;  5FRN A;  5D6Y A;  3H8Z A;  4BE2 A;  4IUP A;  3MP8 A;  4C5I A;  4IUR A;  2R58 A;  2X4Y A;  2DIG A;  4B9X A;  2RHZ A;  3NTI A;  3PMT A;  3MET A;  2P0K A;  3OYL A;  3OYA A;  2RHY A;  4NS5 A;  5IN1 A;  3OYJ A;  2YRV A;  3OYI A;  4BD3 A;  2K3X A;  1WJR A;  3H6Z A;  3LYI A;  3OYN A;  2RHU A;  1XNI A;  2RJC A;  5D6W A;  2LTO A;  1WJQ A;  2EQM A;  3MP6 A;  4QQD A;  5IAY A;  3OS1 A;  2LCC A;  2X35 A;  3BDL A;  4A4F A;  4FL6 A;  3MEU A;  1MHN A;  2XDP A;  2VYT A;  4HCZ A;  3L2U A;  3MEA A;  2F5K A;  2FHD A;  3ZEH A;  2DIQ A;  5J26 A;  2D9T A;  3S3M A;  2BIV A;  1H3Z A;  1OI1 A;  2RJD A;  5KH6 A;  3UT1 A;  3QBY A;  4IUU A;  5FRO A;  4RG2 A;  3L2Q A;  2M1H A;  5KCO A;  3GOX A;  4E7L A;  3NTK A;  3EAE A;  2GFA A;  3OYF A;  4E7H A;  2RI5 A;  4IUQ A;  2MWO A;  3S6W A;  2RJE A;  3LGL A;  1N27 A;  4C5E A;  1G5V A;  3SD4 A;  3OYM A;  3Q1J A;  2CKK A;  2EQJ A;  2WAC A;  2RI3 A;  1KHC A;  3DLM A;  4PLI A;  3KUF A;  2EFI A;  1WGS A;  3LH0 A;  3OQ5 A;  5KCH A;  2BKD N;  4BDY A;  3E9F A;  2RJF A;  3PFS A;  3OS0 A;  4E7I A;  2HQX A;  2PQW A;  2QQR A;  2M0O A;  2RHX A;  3DB3 A;  2RI2 A;  4OVA A;  2LRQ A;  3L42 A;  5C0M A;  5J39 A;  3OYK A;  4FU6 A;  3O8V A;  5CIU A;  2L89 A;  2O4X B;  2O4X A;  2GF7 A;  4IUV A;  4A4E A;  3ASK A;  3E9G A;  3FEO A;  3QJ6 A;  3OY9 A;  4N4H A;  2X4X A;  4E7K A;  3C4S A;  3OMG A;  2R5A A;  3LLR A;  2L8D A;  2L3R A;  2R57 A;  3F70 A;  3P8D A;  2E5Q A;  3OA6 A;  3FC3 A;  4BDZ A;  3OYH A;  3S3O A;  2K3Y A;  4ZTJ A;  4PLL A;  2NLU A;  4QQ6 A;  4BE1 A;  4QVZ A;  5KE2 A;  3OMC A;  3OYD A;  4UC4 A;  1RI0 A;  3FDR A;  3L2W A; 
#chains in the Genus database with same CATH topology
 4FT4 A;  4C0G A;  1KQS P;  5IXB A;  5GMK m;  4J9F A;  2PUO B;  1OZ3 A;  4II1 A;  4A4H A;  3MP1 A;  3V7C A;  3OYB A;  1M1K C;  1QCF A;  4WTO B;  5A0L A;  1VQM T;  4M7D G;  4EDU A;  2KY9 A;  3CCL T;  1N6A A;  2JTF A;  1CKB A;  5DY9 A;  5FLX E;  2P0P A;  4E47 A;  3I56 Q;  1WNL A;  2FRW A;  2HD0 A;  1X2K A;  1GCP A;  2KXC A;  3G6E T;  2DTI A;  2ENM A;  2D0N A;  5GMK i;  5EC7 A;  4BE2 A;  3JV3 A;  3AT1 B;  4D8D A;  3VYH B;  4HVW A;  4PJJ A;  2BE9 B;  2EKH A;  2NYS A;  4XTU A;  1YHQ Q;  1Q81 U;  3H6Z A;  4RTV A;  3CD6 A;  1B3Q A;  4M75 B;  2KI7 A;  2KR3 A;  3GNF B;  3RMS A;  4J9E A;  1H92 A;  5KH6 A;  5FRO A;  2C06 A;  4K11 A;  5CKE A;  2YUP A;  1VQP T;  1Z9Q A;  2EYW A;  2XKO C;  2RH2 A;  4O6J A;  2JW4 A;  1N27 A;  4HCK A;  1XJW B;  1VIE A;  2HAX A;  2DL4 A;  4C0D C;  4M78 E;  3RIR A;  2YLB A;  5GAO l;  4F7U E;  1AT1 B;  4C8Q F;  3N5B B;  2BE7 D;  1TSF A;  4D8K A;  1H8K A;  4XAX B;  1VQ9 Q;  2KE9 A;  5HKC A;  4FU6 A;  1E7O A;  2YUQ A;  3EG1 A;  2GF7 A;  2GCX A;  1D3B B;  3CD6 Q;  4HVU A;  1YHQ A;  2AHJ B;  2CH4 A;  3EH2 A;  3LW5 E;  3OA6 A;  2JXB A;  5GAN 2;  1TS9 A;  1YI2 Q;  1E6G A;  3HFO A;  3D7S B;  2K2M A;  1RI0 A;  3CCM Q;  2LC4 A;  3JCM g;  3OBY A;  3RKX A;  2FPE A;  2P4R A;  3DB4 A;  3TEE A;  3OYG A;  4J9B A;  3GF5 A;  4C0Z A;  2LVM A;  1QVG S;  3CMA Q;  5GAO m;  1BK2 A;  1M8V A;  1M1K R;  5CKD A;  2QEX T;  3RER A;  3L2Z A;  1ZUU A;  4XTY A;  1N9R A;  3FLG A;  3A8L B;  2XDD A;  3CEY A;  5FWC A;  3UA6 A;  3CPW P;  1I4K 1;  4M7D D;  4FYW B;  1S72 A;  2AZS A;  2KYM A;  2RHZ A;  1WXT A;  2JOY A;  2LCL A;  2GNC A;  3OYJ A;  4M7D A;  1K76 A;  2RQU A;  3TSZ A;  2RJC A;  5FW9 A;  1D1C A;  3ULR B;  3JB9 F;  2KSS A;  2WSF E;  3HFN A;  1T0H A;  1ZSZ A;  1NLO C;  2ZPG B;  4J9C A;  1OI1 A;  3DKM A;  2QQA A;  4Z8A A;  4M75 D;  1WXU A;  1NZ9 A;  1J3T A;  2AT1 B;  2LX9 A;  2W10 A;  3NFC A;  1I8F A;  1K8A C;  3OYM A;  4KBM B;  4PLI A;  2Y4Y A;  5KCH A;  3M59 A;  1R77 A;  1ZX6 A;  3GNG A;  2DNU A;  1LOJ A;  4RKU E;  3I5S A;  3EG3 A;  3CCL A;  3OSS C;  1NYG A;  5CIU A;  1OPL A;  3CCS T;  2F2V A;  3RKY A;  2KRN A;  2QA4 T;  1VQ5 Q;  2HQH A;  2EYY A;  1Y96 A;  2HEQ A;  2YWW A;  4BUG A;  3OYH A;  1IHW A;  4N0A C;  1MMG A;  4JS4 A;  1M8M A;  1RAI B;  1T3S A;  5CKF A;  1D3B A;  3CCV Q;  1K73 U;  3EFR A;  3PGG A;  2M16 A;  5GAN f;  2RQV A;  3ZBD A;  2LQN A;  3OB9 A;  1DJ7 B;  4N0A A;  3RBB B;  1UJ0 A;  3JRZ A;  4Q5W A;  1Y57 A;  1KC8 U;  1F1B B;  3S3N A;  3UAT A;  1ACM B;  3OW2 P;  3G4S Q;  1ZSZ C;  2J7I A;  3A98 A;  4C92 C;  3VYG A;  3CCL Q;  3G7Z A;  4M75 G;  4PK4 A;  2JUF A;  3L2V A;  4JRQ A;  4NL2 A;  1QWF A;  2DRK A;  3QWX X;  2QQ9 A;  4CI0 C;  5GJW B;  1G3W A;  1Y71 A;  1VQ8 T;  1NJI C;  3OYA A;  1SRM A;  1W4S A;  1UHF A;  4BD3 A;  3URG A;  3M4G A;  1MUZ A;  2RHU A;  1XNI A;  3HRS A;  2LTO A;  2A36 A;  2JS2 A;  5L8R E;  5IAY A;  2LCC A;  3RR6 A;  1YN8 A;  4DBF A;  1VQ8 A;  1MHN A;  1TUD A;  3KFV A;  2EGE A;  4JJD A;  1M1F A;  2F5K A;  2K57 A;  2YHT A;  2RJD A;  3UT1 A;  3CCR Q;  4RG2 A;  3JB9 G;  2M1H A;  1OEB A;  2OTL Q;  5DLQ E;  2XID A;  1VQL T;  1WI7 A;  4C5E A;  4AG1 C;  2MYS A;  5KYW B;  5LJ3 g;  2RI3 A;  4ORZ A;  1PWT A;  5GAO p;  3TVT A;  3WVE B;  1MMA A;  4LXC A;  1KQ2 A;  1TH7 A;  3CC7 A;  2PQW A;  2JVV A;  3CBO A;  4F16 A;  3CC2 A;  3PE0 A;  4OB1 B;  2DXT A;  2EGA A;  2RM4 A;  3E9G A;  2EW3 A;  5A2Q E;  2E5K A;  3PVL A;  4OMO A;  1QCN A;  3HP9 A;  4QQ6 A;  4BE1 A;  4HKE A;  2EBP A;  4XTX A;  4M7A B;  2OJ2 A;  1CKA A;  1EX4 A;  3CCM A;  4OML A;  1WHG A;  1IGQ A;  2VAS A;  4QQG A;  1W70 A;  3EGU A;  2E12 A;  2XG8 D;  1VQP Q;  4X34 A;  4N4G A;  1SF9 A;  1KIK A;  1PD0 A;  1WYX A;  1WPY A;  2LT4 A;  1VQO A;  2QI2 A;  4ATO A;  1RAA B;  2SEM A;  2O88 A;  5GAN 3;  3L2R A;  2LT1 A;  1VQ7 A;  2EQU A;  1VQM A;  2A7Y A;  2ZCF B;  1VQO T;  2NUT B;  4C8Q G;  3ER0 A;  2PTK A;  3HTR A;  1WDX A;  1WLP B;  3V8L A;  5L23 A;  5AYF A;  3SHW A;  1W2B S;  4DQ2 A;  1RAD B;  3CCR T;  1RLP C;  1NBE B;  1Q7Y C;  2AK5 A;  4PNO A;  5GAM h;  2DZC A;  4QQD A;  1KFZ A;  1X2Q A;  2M9U A;  2FYK A;  2D9T A;  1D1A A;  2RQW A;  2DXU A;  4BB7 A;  5AT1 B;  1IRX A;  3GOX A;  2OTJ Q;  5ECA A;  1ZA1 B;  1GL5 A;  1PRL C;  5CQX A;  3I35 A;  4OB0 B;  1UEC A;  1MND A;  4CC4 B;  2JNG A;  4PJO B;  3G6E Q;  1HK9 A;  1W1F A;  2BKD N;  1PCX A;  4BDY A;  2PVD B;  2RJF A;  3X26 B;  2K5I A;  4E7I A;  2VGM A;  1ZSZ B;  3I55 A;  3CQT A;  1YFN A;  3P8B B;  4FW2 A;  4P5N A;  5GAM d;  2DKG A;  2LNV A;  3I56 A;  1K9A A;  3JB9 I;  3PTA A;  2COW A;  2X4X A;  4RTZ A;  2KT1 A;  5I21 A;  3M0S A;  5LJ5 e;  3ZFJ A;  1RAB B;  2DM1 A;  3JSC A;  1P92 A;  4J9D A;  4QVZ A;  2PVO B;  4RTU A;  1QVP A;  2EVR A;  3GLX A;  2XMF A;  1KQ1 A;  2XDB A;  1ZBJ A;  1WJS A;  4C8Q C;  1TG0 A;  1WHH A;  2CP6 A;  1OZ2 A;  1UGR B;  4CC2 A;  1UGV A;  4LDX A;  3QHS A;  2JN0 A;  4KT0 E;  3JAM E;  4E7J A;  2DEU A;  4DA4 A;  4J7I A;  4M78 G;  1VQL A;  3CXC P;  2CP2 A;  2HNI A;  3MEW A;  3EGD A;  1R0C B;  4OB3 B;  3SWN C;  3MP8 A;  1JB0 E;  4XTV A;  2YUO A;  5GAN 5;  2FO0 A;  1VQN Q;  4D6W A;  1WHM A;  2X4J A;  3L1A A;  4JRK A;  3AHU A;  1JXM A;  2X35 A;  3GBQ A;  4FL6 A;  1UB4 A;  2VYT A;  4HCZ A;  1S72 T;  3CC4 A;  3OS5 A;  2ZPB B;  1VQK T;  1UGP B;  1EIF A;  2E6Z A;  1MMN A;  3X24 B;  3CPW A;  2MK5 A;  2C0O A;  3SD4 A;  1WHK A;  3EG9 B;  2CZ6 B;  2KDS A;  4C8Q B;  3G71 T;  3EGX B;  5GAM g;  4R56 A;  2LQW A;  1M90 R;  1JO8 A;  1BBZ A;  1RAE B;  2RHX A;  4OVA A;  2KXD A;  5I11 A;  5J39 A;  4MDX A;  3VS6 A;  1VQ6 Q;  4IUV A;  4A4E A;  1GFD A;  1QKW A;  1BI0 A;  3QJ6 A;  4N4H A;  3C4S A;  3CCQ T;  3M0T A;  3LLR A;  1G3T A;  2CGH A;  1A0N B;  2ZPI B;  3ZL7 C;  4ZTJ A;  1PHT A;  4PLL A;  1HYO A;  4EMG A;  3VJP A;  4M75 A;  3I9Q A;  2XK0 A;  3OYE A;  2R5M A;  2HKQ B;  2VV5 A;  4OF1 A;  2EGC A;  1BKB A;  4WF2 A;  3M54 A;  5KYU B;  1Q82 U;  2E6N A;  4KH1 B;  3EH1 A;  1YJW Q;  2QQS A;  5A0G A;  2MAM A;  2FPF A;  4M75 F;  2EKO A;  3O5Z A;  4X9C A;  1IRE B;  2HQE A;  4F7U B;  2CRE A;  5GAM e;  2ROT A;  4AT1 B;  2DFU A;  2CP5 A;  5DM7 R;  1TWB A;  2RN8 A;  1RI9 A;  3QSU A;  4B9X A;  4PJN A;  3CCJ Q;  4FYV B;  1KC8 C;  2K2V A;  2DTH A;  1M3C A;  1XQH A;  3JCM b;  5LJ5 d;  1IZ6 A;  4A4F A;  4GLM A;  3EFO A;  1NM7 A;  2WSC E;  1QP3 A;  2D8J A;  2CP7 A;  1H3Z A;  1I5O B;  1YBY A;  5KCO A;  1M30 A;  4IUQ A;  2MWO A;  2MPX C;  5CAI A;  1AWJ A;  1K8A R;  4A53 A;  2BTT A;  1GBQ A;  4KUI A;  3QDF A;  4M7A A;  2EQJ A;  5GMK e;  4JZ3 A;  3QG1 A;  1KHC A;  2F5T X;  4F7U G;  1WGS A;  2DA9 A;  1Q86 C;  3CCM T;  1VYU A;  2E3H A;  4OMP A;  4DOW A;  1VQN T;  1XTD A;  1NEG A;  2M0O A;  1GCQ A;  2K4Y A;  1RAH B;  3THK A;  3O8V A;  4BI3 A;  2QK0 A;  1TUC A;  5CKB A;  3FEO A;  2K79 A;  3JCM e;  4E7K A;  1NYF A;  5GAN 6;  3OMG A;  3CCJ A;  2BZY A;  1VIF A;  1B34 A;  4Y28 E;  3V8K A;  3X20 B;  2HKN A;  1YJ9 Q;  3CCS A;  1WQW A;  3J81 E;  1PG5 B;  4RG8 A;  4PJO E;  2CYZ B;  5GAO r;  2WSE E;  4OP0 A;  2M0Y A;  2RA2 A;  1KK7 A;  4L59 A;  4JJB A;  1M4Z A;  2DMO A;  4CC3 A;  2ECZ A;  5C6S A;  3P8H A;  3M0Q A;  2RPN A;  1B34 B;  1I07 A;  1MMD A;  5IHI A;  4J83 A;  3MHX A;  4BY6 C;  3CME Q;  3FJ5 A;  3ME9 A;  4M7D E;  4J6X A;  2BUD A;  4AFZ C;  1PKT A;  2O01 E;  3VS5 A;  5LJ5 f;  1MGQ A;  2VB6 A;  3OYL A;  2RHY A;  3QZ5 B;  5IN1 A;  4FSS A;  2E64 A;  1PM3 A;  3MP6 A;  2OTJ A;  1YNZ A;  1IO6 A;  4F04 B;  2FHD A;  3JCM h;  4HT9 A;  1G83 A;  3S3M A;  5KYW A;  3HRU A;  2PZ1 A;  1AOJ A;  3VKI A;  5IHK A;  4NL3 A;  3OYF A;  3M55 A;  4Z88 A;  3EG2 A;  4PJO C;  3CCE T;  3E19 A;  4LN2 A;  4M77 E;  4OGE A;  2CKK A;  1X27 A;  1BIA A;  1Z9Z A;  1MV0 B;  1X01 A;  5LJ5 h;  2HL3 A;  3FIF A;  2KQW A;  1YJ9 T;  4JUV A;  4WCI A;  1VQM Q;  1K73 R;  4J9I A;  3UA7 A;  1VYV A;  4J9H A;  3A8O B;  2DD5 A;  2L89 A;  2O4X B;  3VUB A;  3JB9 H;  4ZN1 A;  4AFS C;  3H0H A;  1IXD A;  2VXF A;  8AT1 B;  3JCM d;  2VVK A;  5IT9 E;  1Q82 C;  3P8D A;  2O9S A;  4JLI A;  3GPL A;  3RNJ A;  1KG1 A;  4JRP A;  2L3S A;  3MCA B;  4F7U A;  3L2W A;  2A08 A;  4JRI A;  1BI2 A;  3M9Q A;  5KE3 A;  2OTJ T;  3MJX A;  4BAC A;  4OMM A;  3J80 E;  2DIL A;  1FYN A;  1PNJ A;  4XU1 A;  2OTL T;  3OYC A;  2A3L A;  2RHI A;  2KAF A;  2L2P A;  1WX6 A;  2ED0 A;  1M27 C;  4M77 F;  2QAZ A;  4M77 D;  3GP8 A;  2DJQ A;  4L5G A;  1KD1 U;  2OAU A;  4M78 F;  4HA8 A;  1QMC A;  3KXT A;  1BYM A;  1ZLM A;  2MWP A;  5D6Y A;  4EIK A;  2J6K A;  4IUR A;  3NTI A;  4J7F A;  5DLO A;  1QP2 A;  3VRZ A;  2HSE B;  5LJ3 h;  1Y0M A;  1AZG B;  1I81 A;  5GAN j;  1C0M A;  5CKH A;  2M51 A;  3CCJ T;  3A1P A;  4A54 A;  1ABO A;  2CSI A;  3JCM V;  4OB2 B;  2I2L A;  1VQ8 Q;  1D09 B;  2FL7 A;  1NE8 A;  3G6E A;  2Y4X A;  4C92 G;  2E1H A;  1U1S A;  3Q1J A;  1FX7 A;  1NEB A;  2DF6 A;  2EYQ A;  2QAS A;  4RUG A;  5GAM f;  3LH0 A;  2ROL A;  3G71 A;  1LNX A;  4EPC A;  1IB8 A;  3QUI A;  2CT3 A;  3OYK A;  1D0X A;  5GAO n;  4FCY A;  4OGC A;  2KRM A;  4M7D C;  4MML A;  2X9H A;  1ZUK A;  3G4S T;  4BDZ A;  1YCS B;  3WVD B;  1U5S A;  3CPW S;  1M2V A;  2QA4 A;  2QDY B;  2VC8 A;  4HXJ A;  3LWH A;  2D8H A;  2DJZ A;  3I56 T;  1VQ7 Q;  1OUL A;  3CCV A;  4M7A E;  2H3E B;  2XD0 A;  2DX1 A;  1VA7 A;  3QII A;  4HT8 A;  1TOV A;  1K1Z A;  4XU0 A;  3VUZ A;  4LD6 A;  2EPD A;  1S1N A;  2CUD A;  5EG2 A;  1VQP A;  2GFU A;  2QTV A;  3CXC A;  1H64 1;  3RKW A;  3CCE A;  3M4Y A;  1ARK A;  2DL8 A;  2FZG B;  2VWF A;  5KYN A;  4M77 G;  2AZV A;  2EJ9 A;  1D0Y A;  5I22 A;  2EQK A;  2NUZ A;  3UWN A;  3RDV A;  4XU3 A;  2A28 A;  5GMK l;  4FT2 A;  5IXF A;  2RB6 A;  2HBP A;  4M7A G;  2YDL A;  3UPU A;  1NJI U;  1FMW A;  4L6V 5;  3RES A;  1VQ9 T;  3VS0 A;  3LYI A;  3JCM W;  5D6W A;  1WJQ A;  4GBQ A;  3OS1 A;  2CZ1 B;  3CC2 Q;  1TXQ A;  3VS1 A;  2DIQ A;  1SHF A;  2LQ8 A;  3VS2 A;  2IVW A;  4M75 C;  3QBY A;  1UEB A;  2F2W A;  4E7L A;  2COZ A;  2RJE A;  4AG2 C;  1G5V A;  3LH5 A;  5LJ3 j;  2FEI A;  4C92 F;  1JXO A;  1N8R R;  2C0I A;  3A8G B;  5HCK A;  2K6D A;  2GBQ A;  2HCK A;  2OX7 A;  2E41 A;  4HCB A;  3E2U A;  1NLP C;  4R55 A;  5C0M A;  4C92 E;  1R8O B;  3BDU A;  1OPK A;  2K7A A;  2PU9 B;  4FIB A;  3HHT B;  4KGV B;  1X43 A;  3ASK A;  4QVD A;  4PJO G;  1M2O A;  2CT4 A;  4DEX A;  4DBR A;  2LX7 A;  2HBW A;  3CMA A;  1SHG A;  2FZC B;  4A4K A;  2RK2 A;  2X51 A;  2CS7 A;  2KMT A;  3C0C A;  2YXY A;  1FMV A;  3FDR A;  1WHJ A;  2RD1 A;  3LGF A;  3M0P A;  1Q82 R;  2H8H A;  1G3S A;  4M77 C;  1YCY A;  2MF2 A;  3G4S A;  1R0B G;  2MI6 A;  4IKF A;  2J6F A;  2DE0 X;  1YI2 A;  4F14 A;  2CP0 A;  3PT9 A;  3HRT A;  1Y07 A;  4PJO A;  2DAQ A;  4HCC A;  1AWW A;  2Z0W A;  2KK4 A;  4C5G A;  4RMO A;  1KSW A;  1SRL A;  3REB B;  1WHL A;  2P84 A;  2LDM A;  3NMZ C;  1OV3 A;  2DYI A;  4C5H A;  1ZHI A;  2LMJ A;  2SRC A;  1RLQ C;  2V8I A;  1KD1 C;  4B9W A;  5GAN 4;  2QA4 Q;  5FRN A;  3R6O A;  2DL3 A;  2ZPF B;  4ZGJ B;  4LNP A;  4RTY A;  2X4Y A;  2DIG A;  2QGF B;  5KYX A;  1TTH B;  2E4H A;  1OQK A;  1VQ5 A;  2K5L A;  1N5Z A;  5GAN e;  2YRV A;  1GRI A;  3CCV T;  4E2F B;  1TUG B;  1UUE A;  4KH0 B;  4BI4 A;  2AIR B;  2NWM A;  4C92 A;  1YHQ T;  3JB9 J;  3BFM A;  2NUT A;  2L0A A;  3SB2 A;  2RF0 A;  4IUU A;  3L2Q A;  1VQ6 T;  3NHN A;  3EAE A;  2GFA A;  4LUD A;  5CVI A;  3VRY A;  1YJN A;  2CDT A;  4FYY B;  3FJP A;  3DLM A;  3WXM B;  1V76 A;  4LE9 A;  4M7D F;  3TSW A;  4C8Q D;  2RMO A;  3U23 A;  2JMC A;  2K5F A;  1QVG P;  2LRQ A;  1O9S A;  3A5Z B;  2GTJ A;  3M56 A;  1GFC A;  1SEM A;  4AFU C;  1BCM A;  2KRO A;  2R57 A;  4M7A D;  1QVF P;  1Y7X A;  1VQ4 A;  2KBT A;  2XI9 A;  3OMC A;  4PJO F;  2E3I A;  1JU5 C;  4JLG A;  1NG2 A;  1K0S A;  1FMK A;  2FG0 A;  3GIB A;  1RAC B;  2YRD A;  4AMC A;  4JJC A;  5FU6 C;  1HJD A;  1YIJ T;  2OAW A;  1VQ4 Q;  1NPP A;  4CRI A;  2KEA A;  4O5V A;  2XHC A;  5KYU A;  3LX7 A;  2X4W A;  5CR2 A;  3VS7 A;  1U1T A;  4QVC A;  1NPR A;  3QKJ A;  4M78 D;  4KGX B;  3TCJ A;  3CXC S;  2ZZD A;  3BE3 A;  2QXF A;  1M2V B;  1V29 B;  2FB7 A;  5IH2 A;  3CC4 T;  3BW1 A;  2R58 A;  1OX9 A;  1YJN Q;  2P0K A;  2CP3 A;  1K8A U;  4NS5 A;  1ZQ1 A;  3FRN A;  2HMA A;  1QW1 A;  1WFW A;  3EGX A;  2DPP B;  1YP5 A;  1T0J A;  4IIM A;  5J3B A;  2DO3 A;  4JDS A;  3L2U A;  2E10 A;  3VS3 A;  2V1Q A;  1VQ9 A;  5I2S A;  3CPF A;  4LD9 K;  1W2B P;  3PVQ A;  2DD4 A;  2O9V A;  2DET A;  4FSX A;  4PJO D;  3NTK A;  1HSQ A;  4E7H A;  1ZBX A;  2J05 A;  1H3H A;  2V8J A;  2DRM A;  2DXB A;  4E7Z A;  2X3W D;  5LJ3 f;  3QO3 A;  3RUX A;  3H9N A;  3EFS A;  1C6V X;  4F17 A;  3E9F A;  3M53 A;  2ZGW A;  4PFO A;  2QQR A;  1UGQ B;  2KRS A;  7AT1 B;  8ATC B;  4RCC A;  3NGP A;  3UF4 A;  1RAF B;  2BZX A;  3C12 A;  2DL7 A;  4A63 B;  1VOM A;  1X6G A;  2ZAE A;  1QQJ A;  2DVE A;  2EYX A;  3J7A F;  5HK3 A;  3C95 A;  2ATC B;  2K3Y A;  4QT7 A;  2COY A;  2HZY A;  4UC4 A;  5LJ5 g;  4M77 A;  4PJL A;  1VQ5 T;  1OYX A;  4Z02 A;  5GMK h;  2F2X A;  3CME A;  4Y91 A;  2QGG A;  3M57 A;  3PNW C;  4ELY C;  2JS0 A;  2DER A;  4RTT A;  5CCA A;  5FU7 B;  2DTO A;  3NPF A;  2G3R A;  1YI2 T;  5GMK j;  2AKK A;  2JJ9 A;  2QQB A;  4N4I A;  5CQY A;  4BY6 B;  3HL8 A;  2K9G A;  1UJY A;  3H8Z A;  1YJ9 A;  1WZO A;  2VKN A;  1AHJ B;  3UDC A;  3MKD A;  2PUK B;  4XQ3 A;  2ED1 A;  3PMT A;  4CC7 A;  1M3B A;  1VQK Q;  4V2S A;  2KGT A;  2PVG B;  1FXX A;  3KBG A;  1M90 C;  1AEY A;  2JM9 A;  1C1A A;  2F69 A;  2VGN A;  2KVQ G;  4DOV A;  5J26 A;  3C94 A;  2IPO B;  1JQQ A;  3JCM c;  2Y90 A;  3EGD B;  1WIE A;  1JBM A;  2EJF A;  2KNB B;  1N9S A;  2L5Q A;  2DBK A;  4E7S A;  1UFF A;  2DL5 A;  2ABL A;  2X3X D;  5A0D A;  3REA B;  2L3Q A;  3H41 A;  5GAM j;  4DEY A;  1I5L A;  1UE9 A;  1Q81 R;  5KYY A;  2P4T A;  2J06 A;  1NJI R;  5LL6 S;  4KRT A;  2OI3 A;  3QPH A;  1BI1 A;  2QEX Q;  2YLC A;  3FB9 A;  4LDY A;  2IIM A;  2H3J A;  3SWN B;  3TQ7 P;  3L42 A;  5LJ3 e;  3CCE Q;  2P0Q A;  1YIT Q;  1AD5 A;  1WA7 A;  3CD6 T;  1QLY A;  4OMF B;  1D0Z A;  3FC3 A;  1GBR A;  2NUP A;  5GAN 7;  4ESR A;  2QG9 B;  3JCM f;  1KHI A;  2DK3 A;  3SFM A;  1KD1 R;  2J6O A;  2V8K A;  2JTM A;  1KQS S;  4GY5 A;  5D6X A;  2XU8 A;  3MEV A;  2FVU A;  4QKU A;  1YJW A;  1U8R A;  2LJ3 A;  4F7U F;  3OS2 A;  4ZNX A;  1UGS B;  4X1V A;  2B8A A;  2A0F B;  4XTW A;  4JPB W;  2FPD A;  2DXC A;  2IG0 A;  5HK0 A;  3G71 Q;  1RAG B;  3PMI A;  4KGZ B;  1JRI A;  1VYT A;  2EIF A;  1QVF S;  4ZGE B;  2CZ0 B;  4XU2 A;  2DLP A;  1XOV A;  1PSF A;  1G2B A;  3CCU A;  1AWO A;  1FWZ A;  1GXI E;  1GCQ C;  4MDW A;  1ZA2 B;  4BI8 B;  3CBP A;  4TVR A;  4EMK A;  1QWE A;  3ZEH A;  4C0F A;  2V1R A;  2BIV A;  2B86 A;  4AFQ C;  4MMK A;  4JZ4 A;  3CMA T;  1LCK A;  1MV3 A;  1N8R U;  3S6W A;  3LGL A;  3HKS A;  4FYX B;  1YIJ A;  1PD1 A;  1UHC A;  1BU1 A;  3OQ5 A;  3H0F A;  3JCM J;  4KUD K;  2HQX A;  2VXE A;  1CSK A;  5LJ3 d;  4EMK C;  1JEG A;  1SKU B;  3JB9 D;  3JCM Q;  4LDV A;  1G8X A;  1K9M U;  3OSV A;  1OX8 A;  2EJG A;  2HSP A;  3EG0 A;  1JJ2 A;  4XTZ A;  3OYD A;  1WXB A;  2VUB A;  5LJ5 j;  3OY9 A;  1ABQ A;  3EFO B;  2LNH B;  3V7R A;  2FRY A;  2EAY A;  3CCQ A;  5IHN A;  1BI3 A;  1SSF A;  2GGR A;  4BE0 A;  4C8Q E;  1Q7Y U;  2RQR A;  4FM4 B;  5FRM A;  3V8J A;  4M78 B;  2DZ9 A;  2YUN A;  2RK1 A;  4RCB A;  2O2O A;  1JJ2 S;  3QDR B;  1Y96 B;  2CH4 W;  1KJW A;  4QW2 A;  1QVF A;  3T9N A;  1LVK A;  4ME7 A;  3OW2 A;  3SWN A;  4ZTF A;  6AT1 B;  1D1B A;  1V1C A;  5HY6 A;  2MCN A;  1K73 C;  2NUP B;  2MMP A;  4IUP A;  1YIJ Q;  1QVG A;  4EMK B;  4C5I A;  4RTW A;  2QDL A;  4Z89 A;  3MPU B;  5GAO q;  2K3X A;  3OYN A;  3QWY A;  2EQM A;  1AWX A;  3PIO A;  1RUW A;  2JTE A;  3MEU A;  3HPW A;  3I55 Q;  2GQI A;  5KYY B;  2I0N A;  3VS4 A;  3TRE A;  1W6X A;  1I0C A;  3OYY A;  3EG9 A;  4J5Y A;  1HD3 A;  1UG1 A;  1X6B A;  4NOY A;  3I55 T;  2EFI A;  4M78 C;  2E70 A;  1SSH A;  5GAN h;  3M0R A;  4LUE A;  1T3L A;  3QZ9 B;  1PC0 A;  1YWO A;  3M58 A;  2DBM A;  2R5A A;  4OMQ A;  3VV0 A;  3H0I A;  5KE2 A;  4PJM A;  4J6Y A;  1AVZ C;  1U3O A;  5FWB A;  3NTH A;  3QXE B;  3MO8 A;  1M5Q 1;  3A8H B;  3I5R A;  3M0U A;  4C92 D;  3CCS Q;  4M7A C;  4B6M A;  3X28 B;  1ZUY A;  1SG5 A;  4PL6 A;  1VQO Q;  4MZM A;  3EHQ A;  4M77 B;  1W2B A;  4M75 E;  3QYG B;  5GAN d;  2QYZ A;  2MOX A;  3CC7 T;  3CME T;  1O75 A;  1LJO A;  1PKS A;  3CCQ Q;  1QKX A;  4LDW A;  1JJ2 P;  4IIO A;  4MZP A;  2JZ2 A;  4Y92 A;  2O31 A;  3EHR A;  4GLK A;  2JMA A;  4M78 A;  3IQL A;  4PFP A;  3G1J A;  4PFZ A;  1Q81 C;  3MET A;  2K3B A;  2RNA A;  4E6R A;  2M02 A;  1G3Y A;  1U06 A;  4M7D B;  1X75 C;  2KT8 A;  2BZ8 A;  4YTL A;  3JCM P;  2EQI A;  3MEA A;  2PNI A;  5FU6 B;  4XK8 E;  3VU3 C;  3CC7 Q;  4J6W A;  4LDU A;  2YT6 A;  3R6N A;  2ESW A;  3BY7 A;  1K4U S;  2RI5 A;  1QCO A;  4C0D B;  2D0Q B;  4KUL A;  2D6F A;  1E6H A;  2WAC A;  1VUB A;  5CO7 A;  1VQ7 T;  4DBH A;  2E65 A;  2LJ1 A;  3KUF A;  2OTL A;  4J8O A;  1X69 A;  3CCR A;  1K0X A;  3A8M B;  1MNE A;  1UDL A;  3OS0 A;  2RQT A;  1AZE A;  3V7S A;  4EMH A;  1B7T A;  2F1L A;  4J9G A;  1UTI A;  2DYB A;  1YJN T;  1Q86 U;  2GTO A;  2V26 A;  3CCU Q;  1YIT T;  2EYZ A;  1YWP A;  2GQV A;  2W0Z A;  2L8D A;  2DVJ A;  3F70 A;  1K9M C;  1M9S A;  2ZPE B;  3S3O A;  2LQK A;  2CSQ A;  2NLU A;  2L3P A;  1M1K U;  1IGU A;  4C8Q A;  4A4G A;  1PSE A;  3CCU T;  1X6O A;  5I2M A;  5GAN g;  4IUT A;  4R0K A;  4X9D A;  1VQ4 T;  2LP5 A;  2RO0 A;  3DLL A;  1HXD A;  3HSB A;  1K9M R;  2CZ7 B;  3CC2 T;  4HVV A;  4C92 B;  1IHV A;  2D1X A;  1N8R C;  4RTX A;  3PIP A;  2FZK B;  1VQ6 A;  1M1G A;  1M3A A;  2YRC A;  3OBW A;  5M9O A;  1YJW T;  2LZ6 B;  3M5A A;  1OOT A;  3JCM X;  3QJY A;  3INZ A;  4PKC C;  4ANJ A;  3OW2 S;  1M90 U;  1I1J A;  2MIO A;  5GJV B;  2A37 A;  1SPK A;  2ZPH B;  4ZN3 A;  2YSQ A;  2DEQ A;  1PRM C;  3CBM A;  1OU9 A;  3OYI A;  1Q7Y R;  2HDA A;  1WJR A;  1BIB A;  2JM8 A;  1LPL A;  2JT4 A;  1YIT A;  3BDL A;  3X25 B;  2XDP A;  2LJ0 A;  4JJN K;  1WQ7 A;  1RL2 A;  2QTX A;  4ELZ C;  3TU4 K;  4MZT A;  3CC4 Q;  2CUB A;  2QEX A;  4VUB A;  4ZGD B;  5FU7 C;  1Q86 R;  4JS5 A;  2G6F X;  2HL5 C;  2EWN A;  1EFN A;  3E1S A;  1VQN A;  4DBQ A;  4M4Z A;  2KYB A;  2LCS A;  2XIC A;  3QYH B;  5KYX B;  1BCO A;  3PFS A;  3DB3 A;  2RI2 A;  1EZZ B;  1VQL Q;  1B07 A;  2O4X A;  3SDZ A;  1TU0 B;  1Q95 G;  1OU8 A;  5D7U A;  9ATC B;  3RMQ A;  1VQK A;  5CK9 A;  1KC8 R;  2L3R A;  2E5Q A;  4M7A F;  3LWI A;  1BB9 A;  4FW1 A;  5GAN 8;  1S72 Q;  3SEM A;  1ZSG A;  1KQS A;  2AKL A;  2C0T A;  4OMN A; 
#chains in the Genus database with same CATH homology
 4FT4 A;  3LWH A;  1KHI A;  2DK3 A;  3SFM A;  4C0G A;  2DJZ A;  3I56 T;  1KQ1 A;  2V8K A;  3CCV A;  4M7A E;  2JTM A;  5GMK m;  2XDB A;  2XD0 A;  1KQS S;  2PUO B;  1OZ3 A;  4GY5 A;  4II1 A;  5D6X A;  2XU8 A;  1WJS A;  3MP1 A;  3V7C A;  4A4H A;  4C8Q C;  3QII A;  3OYB A;  1M1K C;  4HT8 A;  1OZ2 A;  4XU0 A;  3MEV A;  3VUZ A;  4LD6 A;  1UGR B;  2FVU A;  5A0L A;  1VQM T;  1YJW A;  1U8R A;  4M7D G;  5EG2 A;  2KY9 A;  4EDU A;  4LDX A;  3QHS A;  4F7U F;  3OS2 A;  3CCL T;  2JN0 A;  4KT0 E;  1N6A A;  2JTF A;  1UGS B;  5DY9 A;  5FLX E;  2P0P A;  2GFU A;  2B8A A;  4E47 A;  3JAM E;  4E7J A;  1VQP A;  3CXC A;  1H64 1;  1WNL A;  4XTW A;  3RKW A;  4DA4 A;  4J7I A;  4M78 G;  2HD0 A;  3CCE A;  1VQL A;  3G6E T;  3M4Y A;  2DTI A;  2DXC A;  2HNI A;  3MEW A;  2IG0 A;  4M77 G;  5HK0 A;  2EJ9 A;  2EQK A;  3PMI A;  3UWN A;  4OB3 B;  5GMK l;  4XU3 A;  5GMK i;  1JRI A;  2EIF A;  4FT2 A;  3SWN C;  4BE2 A;  2RB6 A;  2HBP A;  3MP8 A;  1QVF S;  1JB0 E;  4XTV A;  4ZGE B;  5GAN 5;  2CZ0 B;  4M7A G;  4XU2 A;  3VYH B;  1XOV A;  4D6W A;  3UPU A;  1NJI U;  4XTU A;  1PSF A;  2X4J A;  1Q81 U;  3L1A A;  4JRK A;  4L6V 5;  3RES A;  1VQ9 T;  3AHU A;  3H6Z A;  3CCU A;  3LYI A;  3JCM W;  5D6W A;  1FWZ A;  3CD6 A;  1WJQ A;  1GXI E;  3OS1 A;  2X35 A;  4MDW A;  2CZ1 B;  4FL6 A;  4BI8 B;  3CBP A;  1UB4 A;  4TVR A;  2VYT A;  4HCZ A;  4M75 B;  4EMK A;  1S72 T;  3CC4 A;  3OS5 A;  3ZEH A;  4C0F A;  2ZPB B;  2DIQ A;  1VQK T;  3GNF B;  1UGP B;  3RMS A;  2LQ8 A;  2BIV A;  1EIF A;  2IVW A;  5KH6 A;  4M75 C;  2E6Z A;  3QBY A;  4MMK A;  5CKE A;  5FRO A;  2C06 A;  3X24 B;  1UEB A;  3CMA T;  4E7L A;  1VQP T;  1N8R U;  3S6W A;  3CPW A;  2XKO C;  2RJE A;  2RH2 A;  3LGL A;  4O6J A;  1N27 A;  1G5V A;  3SD4 A;  4C8Q B;  3G71 T;  2CZ6 B;  2KDS A;  3HKS A;  5LJ3 j;  1VIE A;  2HAX A;  4C92 F;  3A8G B;  4C0D C;  4M78 E;  3RIR A;  2YLB A;  1YIJ A;  5GAO l;  5GAM g;  3OQ5 A;  4R56 A;  4F7U E;  2E41 A;  4C8Q F;  3N5B B;  3JCM J;  4KUD K;  4HCB A;  2HQX A;  2VXE A;  2RHX A;  4OVA A;  4XAX B;  4R55 A;  5C0M A;  4EMK C;  5LJ3 d;  4C92 E;  1R8O B;  3BDU A;  4FU6 A;  5J39 A;  5HKC A;  4MDX A;  2PU9 B;  4FIB A;  3HHT B;  2GF7 A;  2GCX A;  1D3B B;  4IUV A;  3ASK A;  4A4E A;  3JB9 D;  3JCM Q;  1BI0 A;  4LDV A;  3QJ6 A;  4QVD A;  4N4H A;  4PJO G;  1YHQ A;  1K9M U;  2AHJ B;  3C4S A;  3OSV A;  3CCQ T;  3LLR A;  1G3T A;  2CGH A;  3LW5 E;  3OA6 A;  3CMA A;  2EJG A;  4A4K A;  5GAN 2;  2RK2 A;  1JJ2 A;  2ZPI B;  3HFO A;  4XTZ A;  4ZTJ A;  4PLL A;  2CS7 A;  2KMT A;  4EMG A;  3OYD A;  3VJP A;  2VUB A;  1RI0 A;  3FDR A;  5LJ5 j;  2RD1 A;  2LC4 A;  4M75 A;  3JCM g;  3OY9 A;  2XK0 A;  3OYE A;  3OBY A;  3LGF A;  3RKX A;  3DB4 A;  2R5M A;  3V7R A;  3TEE A;  2EAY A;  3CCQ A;  1G3S A;  4M77 C;  1YCY A;  3OYG A;  2MF2 A;  1BI3 A;  2VV5 A;  3GF5 A;  4C0Z A;  2LVM A;  1SSF A;  2MI6 A;  3G4S A;  4BE0 A;  4IKF A;  4OF1 A;  4C8Q E;  1BKB A;  4WF2 A;  1YI2 A;  1Q7Y U;  1QVG S;  3PT9 A;  4FM4 B;  5FRM A;  3HRT A;  1Y07 A;  3M54 A;  3V8J A;  1Q82 U;  2E6N A;  4PJO A;  2DAQ A;  4M78 B;  2DZ9 A;  4HCC A;  2QQS A;  5GAO m;  2KK4 A;  2RK1 A;  4RCB A;  4C5G A;  5A0G A;  3QDR B;  1Y96 B;  4RMO A;  1JJ2 S;  1M8V A;  2MAM A;  4QW2 A;  4M75 F;  5CKD A;  2QEX T;  1QVF A;  2EKO A;  3T9N A;  3RER A;  3L2Z A;  4X9C A;  1IRE B;  2HQE A;  4F7U B;  4ME7 A;  4XTY A;  3OW2 A;  2LDM A;  1N9R A;  3FLG A;  3SWN A;  5GAM e;  4ZTF A;  4C5H A;  1ZHI A;  5HY6 A;  3A8L B;  1K73 C;  2V8I A;  2XDD A;  2MMP A;  3CEY A;  1KD1 C;  4B9W A;  5GAN 4;  5FRN A;  3R6O A;  2ZPF B;  5DM7 R;  1I4K 1;  4ZGJ B;  4M7D D;  4IUP A;  1S72 A;  1QVG A;  4EMK B;  4C5I A;  3QSU A;  2X4Y A;  2DIG A;  4B9X A;  2RHZ A;  1VQ5 A;  2JOY A;  2LCL A;  2K5L A;  5GAO q;  1KC8 C;  3OYJ A;  5GAN e;  2YRV A;  2K2V A;  4M7D A;  2K3X A;  3OYN A;  2DTH A;  3CCV T;  2RJC A;  2EQM A;  1XQH A;  3JCM b;  5LJ5 d;  4BI4 A;  1IZ6 A;  4A4F A;  3PIO A;  3JB9 F;  2KSS A;  2WSF E;  3MEU A;  3HFN A;  2WSC E;  1QP3 A;  3HPW A;  4C92 A;  1YHQ T;  3JB9 J;  2ZPG B;  3BFM A;  1H3Z A;  1OI1 A;  3DKM A;  2QQA A;  3SB2 A;  4IUU A;  3L2Q A;  1VQ6 T;  1YBY A;  5KCO A;  4M75 D;  3EAE A;  2GFA A;  1NZ9 A;  4IUQ A;  2LX9 A;  2MWO A;  3NFC A;  3TRE A;  5CAI A;  1I8F A;  3OYY A;  1K8A C;  4A53 A;  3OYM A;  4J5Y A;  4KBM B;  5CVI A;  4KUI A;  1YJN A;  4M7A A;  2EQJ A;  5GMK e;  3QG1 A;  3FJP A;  1KHC A;  3DLM A;  2F5T X;  4PLI A;  3WXM B;  3I55 T;  4NOY A;  2EFI A;  1WGS A;  4F7U G;  2Y4Y A;  5KCH A;  1Q86 C;  3CCM T;  4M7D F;  3M59 A;  4M78 C;  4DOW A;  1VQN T;  4C8Q D;  2E70 A;  3GNG A;  1LOJ A;  1XTD A;  4RKU E;  2K5F A;  2M0O A;  2K4Y A;  2LRQ A;  5GAN h;  3CCL A;  3OSS C;  1O9S A;  3A5Z B;  3O8V A;  5CIU A;  4BI3 A;  3M56 A;  3QZ9 B;  5CKB A;  3FEO A;  3CCS T;  3M58 A;  3JCM e;  3RKY A;  4E7K A;  5GAN 6;  3OMG A;  3CCJ A;  2QA4 T;  2R5A A;  1VIF A;  2R57 A;  4M7A D;  1Y96 A;  1Y7X A;  1VQ4 A;  1B34 A;  4BUG A;  3OYH A;  3VV0 A;  4Y28 E;  3V8K A;  4N0A C;  3X20 B;  2XI9 A;  5KE2 A;  3OMC A;  4JS4 A;  4PJO F;  3CCS A;  1WQW A;  3J81 E;  4J6Y A;  4JLG A;  3NTH A;  5CKF A;  1D3B A;  3QXE B;  4RG8 A;  3MO8 A;  1K73 U;  3EFR A;  3GIB A;  3PGG A;  2M16 A;  4PJO E;  1M5Q 1;  2CYZ B;  5GAN f;  3A8H B;  5GAO r;  2WSE E;  4C92 D;  5FU6 C;  4M7A C;  4OP0 A;  3X28 B;  3ZBD A;  2RA2 A;  4PL6 A;  1YIJ T;  3OB9 A;  1DJ7 B;  4L59 A;  4N0A A;  4MZM A;  1M4Z A;  1NPP A;  3JRZ A;  4M77 B;  4Q5W A;  4CRI A;  1W2B A;  4O5V A;  4M75 E;  1KC8 U;  3QYG B;  2XHC A;  5C6S A;  3LX7 A;  5GAN d;  2X4W A;  3P8H A;  3S3N A;  5CR2 A;  3CC7 T;  1B34 B;  3CME T;  1O75 A;  1LJO A;  1U1T A;  4J83 A;  3MHX A;  4QVC A;  1NPR A;  4C92 C;  3QKJ A;  4BY6 C;  3VYG A;  4LDW A;  4M78 D;  3G7Z A;  4MZP A;  3ME9 A;  3TCJ A;  2ZZD A;  3CXC S;  4M75 G;  2JUF A;  4J6X A;  3L2V A;  4M7D E;  2JZ2 A;  4GLK A;  4JRQ A;  2BUD A;  4M78 A;  4NL2 A;  2QXF A;  2FB7 A;  1V29 B;  2O01 E;  5LJ5 f;  1MGQ A;  2QQ9 A;  4CI0 C;  3CC4 T;  3BW1 A;  2R58 A;  1G3W A;  1Y71 A;  1Q81 C;  1VQ8 T;  3MET A;  2P0K A;  3OYL A;  1NJI C;  3OYA A;  2RHY A;  3QZ5 B;  1ZQ1 A;  3FRN A;  1W4S A;  4NS5 A;  5IN1 A;  2E64 A;  1K8A U;  1G3Y A;  1QW1 A;  4BD3 A;  3URG A;  4M7D B;  3M4G A;  2RHU A;  1XNI A;  1X75 C;  3HRS A;  2DPP B;  2LTO A;  3MP6 A;  5L8R E;  2OTJ A;  5IAY A;  2LCC A;  5J3B A;  4YTL A;  2DO3 A;  3JCM P;  1VQ8 A;  1MHN A;  4JDS A;  3L2U A;  1M1F A;  2F5K A;  2E10 A;  2FHD A;  3MEA A;  2K57 A;  5FU6 B;  3JCM h;  1VQ9 A;  4XK8 E;  5I2S A;  4HT9 A;  3CPF A;  3VU3 C;  3S3M A;  4LD9 K;  4J6W A;  2YHT A;  4LDU A;  2RJD A;  3UT1 A;  4RG2 A;  3JB9 G;  3HRU A;  2DD4 A;  2M1H A;  3BY7 A;  4FSX A;  3VKI A;  3NTK A;  4PJO D;  4NL3 A;  3OYF A;  1ZBX A;  5DLQ E;  4E7H A;  3M55 A;  2RI5 A;  2XID A;  4PJO C;  1VQL T;  3E19 A;  3CCE T;  4C0D B;  4C5E A;  4M77 E;  2D0Q B;  2V8J A;  4KUL A;  4OGE A;  2D6F A;  2CKK A;  2DXB A;  1BIA A;  2WAC A;  1VUB A;  2RI3 A;  5CO7 A;  5LJ3 f;  5LJ3 g;  1VQ7 T;  3QO3 A;  2E65 A;  3KUF A;  1X01 A;  3RUX A;  5GAO p;  5LJ5 h;  3EFS A;  2OTL A;  3WVE B;  3E9F A;  4J8O A;  3M53 A;  3CCR A;  1KQ2 A;  1TH7 A;  3A8M B;  3FIF A;  3CC7 A;  2ZGW A;  2KQW A;  3OS0 A;  2PQW A;  1YJ9 T;  2JVV A;  1UGQ B;  2QQR A;  4JUV A;  3V7S A;  3CBO A;  4EMH A;  3CC2 A;  4OB1 B;  3A8O B;  2DD5 A;  2L89 A;  4RCC A;  2O4X B;  3VUB A;  1YJN T;  2DXT A;  1Q86 U;  3JB9 H;  4ZN1 A;  2RM4 A;  3E9G A;  1YIT T;  2VXF A;  3C12 A;  3JCM d;  5IT9 E;  2GQV A;  1Q82 C;  2DVE A;  2L8D A;  3F70 A;  3P8D A;  5A2Q E;  3J7A F;  1K9M C;  4JLI A;  1M9S A;  3GPL A;  2ZPE B;  5HK3 A;  3C95 A;  2LQK A;  3S3O A;  2K3Y A;  3HP9 A;  2NLU A;  4QQ6 A;  4BE1 A;  4HKE A;  1KG1 A;  5LJ5 g;  4JRP A;  4UC4 A;  1M1K U;  3MCA B;  4F7U A;  4M77 A;  3L2W A;  1VQ5 T;  4JRI A;  4XTX A;  4M7A B;  1OYX A;  1BI2 A;  4A4G A;  4Z02 A;  4C8Q A;  1PSE A;  5GMK h;  3CCU T;  1X6O A;  3M9Q A;  5KE3 A;  3CME A;  2OTJ T;  5I2M A;  5GAN g;  4IUT A;  3CCM A;  4Y91 A;  4BAC A;  4X9D A;  4QQG A;  3J80 E;  3M57 A;  3PNW C;  4ELY C;  1VQ4 T;  2E12 A;  2XG8 D;  2RO0 A;  3DLL A;  1HXD A;  4X34 A;  4N4G A;  4XU1 A;  5CCA A;  2A3L A;  2RHI A;  2CZ7 B;  3OYC A;  2OTL T;  3CC2 T;  5FU7 B;  2KAF A;  4C92 B;  3HSB A;  2DTO A;  1WPY A;  1N8R C;  2LT4 A;  1VQO A;  2G3R A;  2QI2 A;  4ATO A;  3PIP A;  1YI2 T;  1VQ6 A;  4M77 F;  4M77 D;  1M1G A;  5GMK j;  5GAN 3;  3GP8 A;  3L2R A;  2LT1 A;  4L5G A;  1KD1 U;  2OAU A;  2QQB A;  3OBW A;  5M9O A;  4M78 F;  2EQU A;  4HA8 A;  1YJW T;  1VQM A;  3KXT A;  1VQ7 A;  2A7Y A;  4N4I A;  2ZCF B;  3M5A A;  5CQY A;  4BY6 B;  1BYM A;  1VQO T;  2MWP A;  4C8Q G;  3JCM X;  3ER0 A;  3QJY A;  3HL8 A;  3INZ A;  4PKC C;  3OW2 S;  1M90 U;  5D6Y A;  3V8L A;  3H8Z A;  5AYF A;  1YJ9 A;  3UDC A;  1W2B S;  1AHJ B;  4DQ2 A;  2PUK B;  2ZPH B;  4IUR A;  4XQ3 A;  4ZN3 A;  3CCR T;  2DEQ A;  3NTI A;  4J7F A;  3PMT A;  5DLO A;  1QP2 A;  3CBM A;  5LJ3 h;  3OYI A;  1Q7Y C;  1WJR A;  1BIB A;  4V2S A;  4PNO A;  5GAM h;  1YIT A;  2DZC A;  2PVG B;  4QQD A;  1I81 A;  1FXX A;  3BDL A;  3KBG A;  1M90 C;  5GAN j;  3X25 B;  2XDP A;  5CKH A;  4JJN K;  2QTX A;  1RL2 A;  1WQ7 A;  3CCJ T;  2F69 A;  4ELZ C;  2VGN A;  2KVQ G;  4DOV A;  3TU4 K;  2M9U A;  5J26 A;  4MZT A;  4A54 A;  2FYK A;  2D9T A;  3C94 A;  3JCM c;  2Y90 A;  3JCM V;  4OB2 B;  2DXU A;  2I2L A;  1JBM A;  2EJF A;  2QEX A;  1N9S A;  2L5Q A;  4VUB A;  4ZGD B;  4BB7 A;  3GOX A;  5FU7 C;  2FL7 A;  4JS5 A;  1NE8 A;  3G6E A;  2Y4X A;  5A0D A;  5CQX A;  4C92 G;  2EWN A;  4OB0 B;  2E1H A;  5GAM j;  1I5L A;  1U1S A;  3E1S A;  3Q1J A;  1FX7 A;  1VQN A;  2EYQ A;  2P4T A;  5LL6 S;  2JNG A;  4PJO B;  1HK9 A;  5GAM f;  3LH0 A;  3QPH A;  2XIC A;  1BI1 A;  2BKD N;  3QYH B;  4BDY A;  2PVD B;  2RJF A;  3X26 B;  2YLC A;  3G71 A;  3PFS A;  3FB9 A;  1LNX A;  4LDY A;  2K5I A;  4E7I A;  2VGM A;  4EPC A;  3I55 A;  2H3J A;  3SWN B;  3DB3 A;  2RI2 A;  3L42 A;  5LJ3 e;  3QUI A;  3OYK A;  3P8B B;  4P5N A;  5GAM d;  2P0Q A;  2O4X A;  3SDZ A;  2DKG A;  5GAO n;  2LNV A;  4OGC A;  3I56 A;  3PTA A;  3JB9 I;  3CD6 T;  4M7D C;  2X4X A;  3RMQ A;  1VQK A;  4OMF B;  5CK9 A;  5I21 A;  4MML A;  5LJ5 e;  2L3R A;  2E5Q A;  3FC3 A;  4M7A F;  3G4S T;  3ZFJ A;  3LWI A;  4BDZ A;  3JSC A;  3WVD B;  5GAN 8;  5GAN 7;  1P92 A;  3CPW S;  4QVZ A;  2PVO B;  1KQS A;  2QA4 A;  2QDY B;  1QVP A;  2VC8 A;  3JCM f;  3GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...