3P8DA

Crystal structure of the second tudor domain of human phf20 (homodimer form)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
b'SEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Medulloblastoma antigen MU-MB-50.72
molecule tags Protein binding
source organism Homo sapiens
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
total genus 12
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8dA00
2R5MA 2X4XA 3OYNA 2E6NA 4QQDA 2RJEA 3LX7A 2F5KA 2E5QA 3NTHA 2DIQA 4E7HA 3LGLA 3CEYA 3OB9A 2QQRA 4A4GA 2XDPA 4FU6A 3MEWA 2PQWA 3EAEA 3OQ5A 3PMIA 4QW2A 3OS0A 3MEUA 5J39A 4IUVA 5J26A 3LGFA 1WGSA 4N4GA 3QIIA 3ZEHA 3MP1A 4BE0A 4IUTA 3L2RA 1G5VA 2DAQA 2HQXA 2LDMA 4E7KA 1OZ3A 5FRMA 4C5GA 3L2VA 4N4HA 2D9TA 2RHIA 2BUDA 4E7JA 4II1A 2NLUA 2XK0A 3M9QA 3OY9A 4LD6A 2LCCA 1OI1A 3Q1JA 3OMCA 5IAYA 3OYKA 2LVMA 5CIUA 3OYHA 4Q5WA 2RI3A 2RHXA 2R57A 3QBYA 3H8ZA 3E9FA 5D6WA 5KE2A 3NTIA 4L59A 3OYGA 4BACA 4BE2A 3PNWC 3S3OA 4C5IA 3H6ZA 3LYIA 3OYCA 3DLMA 2EKOA 5KCHA 2GF7A 3FDRA 1H3ZA 2VYTA 3MEAA 1N27A 3KUFA 5D6YA 3P8HA 5FRNA 2M0OA 3BDLA 4RG2A 2CKKA 3OYEA 1WJQA 3QJ6A 2IG0A 3F70A 4B9XA 3UWNA 3OA6A 3MEVA 2K3YA 2RJFA 3O8VA 3PFSA 1KHCA 4C5EA 5FROA 3C4SA 4UC4A 2M16A 2RI2A 3OYLA 2LTOA 4QQGA 3OYDA 2JTFA 3FLGA 1WJSA 2YRVA 3LLRA 4PLIA 2WACA 4BDZA 2EFIA 3QKJA 2LRQA 4IUUA 4IUPA 2EQKA 2BIVA 2X4WA 4NS5A 3OS2A 4Z02A 5KE3A 4IKFA 4A4FA 2JZ2A 5KH6A 3MP6A 3UT1A 3GOXA 3DB3A 3S3MA 2EQJA 5D6XA 2L8DA 3MP8A 3OMGA 4CRIA 2X4YA 5C6SA 4IURA 3OYIA 1OZ2A 4BD3A 2MWPA 3OYMA 3NTKA 4E7IA 4GY5A 4C5HA 4HCZA 3L2WA 3L2UA 3LH0A 3FEOA 3PMTA 2M1HA 2FHDA 3P8DA 3S6WA 1WJRA 1SSFA 2L3RA 2DIGA 2RHYA 4A4HA 2RHUA 3META 2GFAA 5M9OA 5C0MA 3L2QA 4N4IA 4OVAA 4PLLA 4BE1A 3FC3A 3MO8A 2HQEA 4BDYA 3ME9A 2RO0A 3OYAA 1XNIA 3ASKA 3SD4A 4PL6A 2EQMA 2P0KA 4ZTJA 2RJDA 2EQUA 4ZTFA 4B9WA 5KCOA 4QVZA 2RJCA 2MWOA 4IUQA 4FL6A 2O4XA 2RI5A 4QQ6A 4X34A 4A4EA 3E9GA 3S3NA 3DB4A 3OYBA 3L42A 4EDUA 2QQSA 1MHNA 2R58A 3OYFA 2G3RA 2BKDN 5IN1A 1RI0A 1OYXA 2R5AA 4E7LA 2L89A 3OS1A 2B8AA 2O4XB 3OYJA 2GFUA 2K3XA 2X35A 2RHZA
chains in the Genus database with same CATH superfamily
4C8QF 3PIOA 1OV3A 4RG8A 1VYTA 2E41A 2HAXA 3OQ5A 2DZ9A 3I5SA 1H92A 1VQPT 1M3AA 1KQSS 1XJWB 1QWEA 2RHIA 1R8OB 5GAMh 2ZPBB 2XDBA 1MGQA 4M7DA 3A8MB 4JUVA 2RI3A 1TH7A 1X6GA 1YCYA 2FO0A 2XIDA 5GAN4 1JJ2A 1K8AR 1RAAB 5KCHA 1GBRA 4HT9A 3JCMJ 1YCSB 2VGNA 3CCVA 2Z0WA 2CT3A 1WJQA 4XTYA 3HL8A 2OJ2A 1XQHA 2LTOA 4VUBA 1AD5A 2EKHA 4JLIA 1PHTA 3EH1A 5KYXB 4C0GA 5GANj 1EIFA 5DLOA 4A4FA 4JZ4A 2HKQB 2VUBA 3HRTA 2PUOB 2H3JA 2RQRA 3CCLA 4CC3A 4AFZC 4PFPA 5GAN7 2QEXQ 3S6WA 3CBMA 1M8VA 4KBMB 4J9CA 3META 3QYHB 3QDFA 4P5NA 4FYWB 3R6OA 4M77E 3UA6A 4CI0C 2SRCA 4M7AE 4O6JA 3WXMB 4ZN3A 1NEGA 2RJCA 1SF9A 2GQIA 2O4XA 1MNEA 3S3NA 3DB4A 1KD1U 2QQSA 3RKWA 3TU4K 1LNXA 1N8RC 3RKXA 1W1FA 1FX7A 2C06A 1Q86U 2HEQA 4RUGA 2FEIA 1M1FA 4E7HA 2A0FB 5GJVB 3MEWA 1WXUA 1GRIA 3OS0A 3VJPA 2K79A 3EGDA 5I22A 4F04B 1NPPA 4DOWA 5A0GA 3ZEHA 1M2VA 1G83A 4C5GA 5DY9A 2JMAA 4N4HA 3V7RA 1NBEB 1O75A 1T0JA 3CMET 2VKNA 2QTVA 4BB7A 1XTDA 3CMEA 3V7SA 1VQ7A 5CIUA 1BCMA 3E1SA 1NM7A 3JCMQ 3HSBA 1PCXA 4X9DA 3H6ZA 2LT1A 3VS0A 1UGQB 5FRNA 2A08A 3BDLA 3X20B 2GTOA 2ZZDA 3A98A 3MEVA 4D8DA 1KQ2A 1KHCA 1SRLA 1WPYA 1MMGA 4C92E 3C4SA 1IGUA 1HXDA 1AWOA 1C0MA 4HCCA 2F69A 4RKUE 2KQWA 3JAME 1A0NB 2FPFA 1UFFA 3TSWA 4J9DA 3KBGA 1N9RA 2X3XD 1VQMT 2J05A 4J9HA 1VQ9Q 2OI3A 2GBQA 3INZA 2D0QB 1D1BA 5D6XA 1VQ6T 4BD3A 1K9MC 5GAN3 1E6HA 2DBKA 3FEOA 2L3QA 1UHFA 1TU0B 2V8JA 5LL6S 2OTJQ 2HL3A 2X51A 1JB0E 3EGXA 4R0KA 2LX9A 2DVJA 3M55A 3QXEB 2ECZA 1N8RR 2RN8A 4Z89A 2PU9B 3M0QA 4C8QG 1PC0A 2Y4XA 2NUPB 3RERA 4PKCC 3M0SA 5I2SA 3OYBA 2MAMA 2DM1A 2VGMA 5AT1B 1WA7A 3D7SB 1QW1A 2X35A 4KGVB 4FIBA 4GLMA 2RJEA 1AHJB 2E5QA 2LJ1A 2RM4A 3VS2A 1QVPA 2EAYA 2CDTA 1QKXA 4IUVA 3CC7Q 3CC2A 5GAOm 4M78B 2COWA 1X75C 3M4GA 3T9NA 2XK0A 3JCMX 3H41A 2V8IA 2YHTA 3TREA 1W70A 5IXFA 2DX1A 1VQ4A 2WSCE 3E9FA 4J83A 1OX9A 3DLMA 1VA7A 2EKOA 3V8LA 3VS1A 1LPLA 2O2OA 2EYZA 4D8KA 1VQKT 1PKTA 3F70A 3OA6A 1TOVA 3QDRB 2LZ6B 1Y0MA 5HKCA 2JUFA 4QQGA 4C0DC 3I55A 1VQ6Q 4RCBA 2E12A 1CKBA 1BI2A 3QKJA 2WSEE 2BIVA 1M1KU 4Z02A 2RK2A 1V1CA 3RDVA 1M1KC 2IVWA 4MDWA 4C5HA 2OAWA 3MHXA 3BW1A 3FJPA 2OTJA 3P8DA 7AT1B 1SSFA 2L3RA 5GMKj 5GAN6 5GMKh 1QLYA 3HTRA 1KG1A 4FW2A 4OVAA 3FRNA 3M53A 2DA9A 2K7AA 2O31A 2D0NA 2K5IA 4JRPA 3M5AA 2PZ1A 3EG9A 4KH0B 1K73R 1BIBA 1WQWA 2BZXA 3CCLQ 4PFOA 3CCET 2KT1A 4ELYC 4LD9K 1JBMA 3PTAA 2RHZA 3ULRB 1RLPC 5KYYA 5IXBA 3GP8A 5CVIA 1NJIC 2YUPA 1W4SA 1I1JA 2XDPA 3PMIA 1IXDA 1UGSB 2OTLA 3CD6T 3M0RA 4M7AG 1JO8A 3L2ZA 5GAOq 1I8FA 5GANf 3IQLA 2A37A 4V2SA 2AKLA 2YLBA 5LJ3j 1AWJA 1WDXA 5KYWA 2DEUA 4LD6A 4M7AC 2KEAA 1ARKA 1Q81U 2RHXA 4J9IA 2QQ9A 2K2MA 4F16A 1RACB 4M78A 3VUZA 3UPUA 1YFNA 1KC8U 1TUGB 2QA4A 2RH2A 4B9XA 2K3YA 2K4YA 2A7YA 2CREA 4M4ZA 2K57A 2O88A 2J6KA 1WHJA 4QT7A 4UC4A 2P0QA 2RI2A 1VIEA 5FU6C 1PSFA 3VS4A 2HQHA 2MK5A 2XU8A 2X4WA 1QWFA 3SB2A 1WHGA 1VQLT 3SEMA 1RAGB 1IZ6A 2ZPFB 4DQ2A 1YI2T 4BI3A 3I35A 5EG2A 3FIFA 4CRIA 2YDLA 4GY5A 2RQUA 2JMCA 2KRMA 2WSFE 2DIGA 4C92G 1TTHB 1BI3A 4LDWA 2KGTA 1BBZA 2OTJT 3QO3A 3CMAT 3OW2S 3RNJA 1IHVA 1S72A 2ENMA 4YTLA 4J8OA 2XHCA 5I2MA 1PD0A 1QMCA 4X1VA 3DLLA 4X34A 1T3SA 1Y71A 3BY7A 3L42A 4M75G 1ZUYA 3VYHB 2BKDN 4RTTA 1VQPA 3CCJQ 2K5FA 2EGCA 1FYNA 1X6BA 2D1XA 2ED1A 4ZGJB 2X4XA 4JPBW 1BB9A 3QPHA 4AMCA 4JLGA 4M7DB 5KYWB 3CCMQ 5GANd 2QASA 1U1TA 1U3OA 2KVQG 3CXCA 2LP5A 4HA8A 4JRIA 2KY9A 2HQXA 1NYFA 2A36A 1VIFA 5IHKA 2LMJA 2DILA 3GLXA 3EH2A 3M9QA 1KC8C 1OI1A 5IAYA 2EYWA 3RESA 1M5Q1 4Q5WA 1M90R 3CC7T 4KH1B 4M75E 1RL2A 3G71T 3A8OB 4FSSA 2YUNA 4R56A 1F1BB 3CCRA 1YITQ 1OX8A 4J6XA 1KQSA 5CKDA 3VUBA 2ZPIB 3G1JA 2CYZB 2KAFA 5CAIA 3CCQA 3A8HB 5GAN5 4NOYA 2MF2A 2LX7A 4HVUA 3M4YA 1U06A 2RA2A 2DXBA 2BE9B 2MIOA 2QEXT 5GAOn 4KGZB 2CP0A 2EQJA 4C92A 3CPWP 1T0HA 3G4ST 2QYZA 3VS3A 2QDYB 5GMKl 1WLPB 3JCMh 3REAB 3JB9D 5CCAA 4ELZC 3TSZA 5M9OA 1IB8A 1KK7A 2JN0A 4KRTA 3JB9F 4BDYA 2EJGA 1Z9QA 2EQIA 4XU1A 1Q7YR 1YI2A 1TUDA 1C1AA 3CCUQ 2KNBB 4B9WA 2P4TA 2KYMA 2JM9A 1R0CB 2CZ1B 2MWOA 1NE8A 4Y28E 1S72T 1K1ZA 3GNGA 1OYXA 3BFMA 2X4JA 2GFUA 1H3HA 1NLOC 3PT9A 4IIOA 5CQYA 3KXTA 4ZNXA 1QQJA 3ZL7C 4E6RA 1WHLA 2FZGB 4LDXA 2XMFA 3UA7A 1YHQT 1G5VA 4MZMA 3QSUA 1ZUUA 2K3BA 4E7KA 1NEBA 5FRMA 1VOMA 2D9TA 4J9EA 2BUDA 1OEBA 4II1A 1D09B 4E47A 5A0DA 2W0ZA 2R57A 2RMOA 2QG9B 4LDYA 2J6OA 2P84A 1TUCA 2ROTA 1AT1B 1D0XA 3CPWA 1W6XA 2VYTA 1N27A 5CKBA 3CCRQ 2JJ9A 1HJDA 2YXYA 5KYNA 2XD0A 3OS5A 3MPUB 5FU7B 1VQNT 2HNIA 3GF5A 3JRZA 4C92D 3CCVT 1GXIE 1OOTA 1M90U 1VUBA 4M7AF 2RQWA 2EQKA 1Y7XA 3EGXB 3CCJT 1X2QA 1ZBXA 1NJIU 4M75F 4TVRA 4PJOC 1DJ7B 4IURA 4OP0A 2EGEA 3NTKA 2H3EB 1GCQC 2FPDA 3C94A 4N0AC 1PWTA 3PIPA 1KD1R 5AYFA 3CCEQ 2QQAA 2BZYA 4FYYB 1K9MR 3HPWA 4J6WA 1G3SA 4N4IA 1NPRA 2DEQA 4BE1A 3SWNC 1SRMA 4J9FA 1PD1A 4XU2A 3CXCP 4BY6B 1UE9A 3CXCS 3CCST 2X9HA 4PNOA 1H8KA 4EMKC 2KR3A 2YT6A 3UF4A 2CZ6B 1MV3A 1M8MA 3I56T 2L89A 2B8AA 3VV0A 1AOJA 2LJ3A 1VQ5A 1Z9ZA 1VQKA 3RMSA 1PKSA 2F5KA 2RQVA 2VB6A 1YJWQ 1VQ4T 1GL5A 2LQNA 3REBB 1X2KA 2ED0A 4PJOD 4PFZA 2LQWA 2DRKA 5GAOp 1ZA2B 2CZ0B 1PNJA 2BE7D 3DKMA 3Q1JA 2AKKA 4M75D 3EG9B 2CH4W 2DJQA 1YN8A 3H8ZA 2ZPGB 3NTIA 2KBTA 2L2PA 2EW3A 3LYIA 3QWYA 4WCIA 1SKUB 2DD4A 1QVGA 5CR2A 1NJIR 3OBWA 4B6MA 1IREB 3P8HA 5LJ3e 4HCBA 2RD1A 2LQKA 1Q7YC 1YITA 4FSXA 2X3WD 1GCPA 3JB9G 3VS7A 2Y90A 1JEGA 2EFIA 4IUPA 2MYSA 2HBWA 4XU0A 1M9SA 4C8QD 4KGXB 2OTLQ 2MWPA 1SHFA 4J5YA 5GANe 2KRNA 3LH0A 2PVOB 1SHGA 1UHCA 3G7ZA 2QQBA 4M75B 3JB9J 1VQOA 5KYYB 1QP3A 4KT0E 1YHQQ 1RLQC 2QA4Q 4RTVA 3RBBB 4N0AA 3I56Q 1QVFP 2KSSA 5LJ3d 3CCJA 3SD4A 2HSEB 2RJDA 2EQUA 3A8GB 5KYUA 1Q82C 3JV3A 3JCMg 4C92B 2DTOA 1MHNA 2V1RA 1H641 4DBFA 4RTXA 5DLQE 1M4ZA 4ESRA 2LCSA 3CC4T 2A28A 2OX7A 3I56A 3OSSC 1VQNQ 4BUGA 4M7DE 2AHJB 4C0DB 1QCFA 2CP6A 4JRKA 3JCMf 4F14A 1X27A 4M78C 3CPWS 4HVWA 2AZVA 3QIIA 3MP1A 4AFUC 2DL5A 3A1PA 1OZ3A 1EZZB 4JS5A 3SHWA 1PRMC 3VS6A 3SWNA 1NLPC 1VQPQ 3OYKA 4JZ3A 1UUEA 3GIBA 1UDLA 2RK1A 2DERA 1B07A 4A54A 2ZGWA 2PVGB 3FDRA 4A63B 1D1CA 1WFWA 1MV0B 3UWNA 3TQ7P 4C5EA 3V8KA 1YI2Q 4WTOB 5IH2A 2E5KA 3JCMc 1T3LA 3O5ZA 1WJSA 2YRVA 5LJ5h 1VQ9A 1FMKA 4ATOA 3M0TA 1VQ8Q 2HKNA 2JZ2A 2LC4A 4EPCA 2E64A 4M77B 3DB3A 2KE9A 1BKBA 1U8RA 1IO6A 2LT4A 4XTVA 1C6VX 2FG0A 4HT8A 1PM3A 2M51A 2M1HA 5LJ3f 1BK2A 1K76A 1RAFB 1Y96A 2RHUA 5FW9A 1PSEA 2QI2A 3PVQA 5CQXA 3RMQA 4RTUA 5EC7A 1VQOT 1WXTA 2E10A 2RO0A 2E4HA 2P0KA 2FRWA 5LJ3h 1YJNQ 1G3WA 1FWZA 2CUDA 3HP9A 4QVZA 4QQ6A 3C0CA 3BE3A 1VQ8T 4LDVA 1RAEB 1M2VB 2BTTA 1MMNA 3H9NA 3WVEB 2DJZA 1D1AA 5GAN2 3CCEA 1KQSP 3OW2A 1MMDA 3CC2Q 4LUDA 5L8RE 2JTMA 4ANJA 5GAMf 2YRCA 4EIKA 3MJXA 3MEUA 5J26A 2I0NA 3A8LB 4N4GA 1UJ0A 4IUTA 3L2RA 2DAQA 2QDLA 3A5ZB 2KT8A 2OAUA 2CP5A 1VQOQ 1AVZC 3M0UA 3J7AF 1G3TA 2DXUA 3KFVA 4OB3B 4K11A 4PJOE 3PVLA 4HKEA 4BY6C 2E70A 4A53A 3CBPA 1YIJT 4M78E 2HD0A 1Q7YU 3LH5A 3OYEA 2JNGA 2KDSA 2QEXA 1SEMA 4FCYA 1B34B 1UG1A 2M16A 1VQLA 2CSIA 4ME7A 4PLIA 4XQ3A 3OS2A 2QXFA 4O5VA 4L5GA 3J80E 2VV5A 3VYGA 1ZA1B 4Y91A 3NGPA 1X43A 2L8DA 4AG1C 4LUEA 4E7SA 3GPLA 2IIMA 5HY6A 1UJYA 1U5SA 3M56A 4HCZA 3UATA 3L2UA 2P0PA 2O01E 4RTWA 2GFAA 4LN2A 2FB7A 4C8QC 3QZ5B 3FC3A 1ZHIA 1GBQA 3JCMe 1TWBA 4D6WA 2E6ZA 2JS0A 5KCOA 2AK5A 3HFNA 2K5LA 2DYIA 3TVTA 5L23A 3VRZA 2JW4A 1NZ9A 2NYSA 3OS1A 3CMAQ 3ZBDA 5IHIA 1JQQA 2E6NA 3C12A 3G6ET 5GAMg 3CEYA 4ORZA 5GANg 1AZEA 2GQVA 1ZBJA 2BZ8A 2CGHA 3EHQA 4PJLA 4HXJA 2KK4A 3LGFA 1TS9A 4NL3A 2F2XA 4BE0A 1WHMA 2M02A 1HSQA 2YSQA 5KYUB 2LNHB 4OMQA 3CCRT 2IPOB 4GLKA 1Y57A 2OTLT 1JXOA 1W2BP 1Q81R 3S3OA 4BE2A 3QZ9B 2DMOA 2LQ8A 4XTZA 3HHTB 4PJJA 1D3BA 1H3ZA 5D6YA 2CKKA 3CCQT 3EGDB 2DTIA 1R0BG 4MZPA 4DBRA 1BIAA 2VASA 2DXCA 3G6EQ 1MUZA 2DRMA 1WYXA 1KJWA 1XOVA 1VQ7Q 2LRQA 2Y4YA 4LNPA 3TCJA 4C0ZA 4NS5A 1UGPB 1I4K1 3HKSA 1QP2A 5FU6B 3UT1A 3GOXA 2QA4T 2EYYA 2CUBA 2EIFA 3V8JA 1NG2A 3OYMA 1I5LA 2FPEA 3EFSA 1R77A 3G71Q 3CD6Q 5GAMd 4KULA 2JVVA 2L5QA 1RADB 4OMLA 4A4HA 2GGRA 2ZAEA 3E19A 1RABB 5C0MA 3NFCA 3EG1A 4LDUA 2P4RA 2KI7A 4XK8E 2QTXA 4J6YA 2DL4A 3EG0A 1FMVA 3R6NA 2EBPA 1RI9A 2XDDA 2E65A 3HFOA 1SG5A 2DF6A 1CSKA 2GNCA 4EDUA 5HK3A 4DBHA 1VQMQ 2O9SA 4E7LA 1I0CA 3OYJA 5A2QE 2F5TX 2MPXC 2L3PA 1OU9A 1Y96B 4QQDA 2ZPEB 3LX7A 4EMGA 3NTHA 5LJ5d 2D8JA 3LGLA 3OB9A 3SDZA 2MOXA 2QQRA 4QW2A 3EAEA 2QGGA 1QVFS 2FRYA 1SPKA 1WGSA 2F2WA 2COZA 1Q86C 1UGRB 2MCNA 4XAXB 2ZPHB 2EYQA 4M77A 1BCOA 3QWXX 1OPLA 1WZOA 3JCMb 3AT1B 3AHUA 1RUWA 4DA4A 1G2BA 3M58A 4BACA 1VQ8A 2CS7A 1EX4A 2DXTA 4LXCA 5CK9A 4FT2A 4RCCA 3GBQA 3EHRA 2XKOC 1E6GA 2ROLA 4RG2A 3CC4Q 4KUDK 3FB9A 9ATCB 2EJFA 2RJFA 2VXFA 3M54A 4ZGEB 2G6FX 5I21A 5DM7R 6AT1B 1E7OA 3QYGB 3JCMW 4FW1A 4EMKB 4IUUA 1UTIA 2FL7A 5LJ5j 3JCMd 2PUKB 1OU8A 1M1KR 2QK0A 1QVGS 2KXCA 2F1LA 2AZSA 4EMHA 2ATCB 3QUIA 3JB9I 3MP8A 3FJ5A 2CP7A 3SWNB 4C92C 3CC4A 5CKHA 1W2BA 3L2WA 4F7UE 1UEBA 5LJ5f 1M27C 1M90C 2M0YA 5IHNA 1OULA 1AWWA 4CC4B 2HZYA 1D3BB 1ABQA 3I9QA 2HCKA 4PK4A 3CC2T 2KYBA 2LCLA 2ABLA 2EWNA 2E3HA 1Q82U 1RAHB 4JRQA 1CKAA 1IRXA 1X6OA 2YUOA 1ZSGA 5CKEA 4Z8AA 1VQ7T 1WQ7A 2DL3A 2C0TA 1IGQA 4M77G 5LJ5e 2LDMA 4LE9A 1O9SA 3L2VA 3RR6A 2RQTA 2CSQA 5A0LA 3OMCA 4OB2B 4CC2A 1OQKA 2KRSA 1ZSZA 1V29B 4M77C 4C8QE 3OYCA 1TXQA 3VS5A 2GF7A 1YNZA 2XI9A 3KUFA 1K0SA 2IG0A 2MI6A 1BI0A 2FYKA 2DO3A 2XICA 3OYLA 4M78D 1I5OB 4C8QA 5ECAA 3RIRA 5GMKe 1N5ZA 3CPFA 1AWXA 4JDSA 5KH6A 5GMKm 3BDUA 4M78G 3G6EA 3S3MA 3OMGA 3RKYA 5C6SA 1WIEA 1OZ2A 4CC7A 2JTEA 2HDAA 4M78F 2V8KA 1FXXA 3PMTA 1Q82R 4XU3A 1WJRA 1X69A 3EG2A 3CCLT 3CC7A 2JXBA 2RNAA 3G4SQ 1YIJQ 4XTUA 1K9MU 2LJ0A 1LVKA 4FM4B 1J3TA 4WF2A 1UB4A 4ZTJA 3H0HA 3M59A 8ATCB 1M30A 1WXBA 2NUTA 3CCVQ 4J9BA 3CCUT 2J06A 2G3RA 3VKIA 1TSFA 2DZCA 1VQLQ 2I2LA 2YLCA 4F7UF 2D8HA 2F2VA 2RPNA 3LWIA 3I5RA 3NHNA 1BU1A 3OYYA 3OYNA 3CCSA 2DIQA 4PJOB 2PQWA 1KD1C 2EGAA 3ER0A 4RTYA 3ZFJA 3VU3C 2DETA 1WNLA 3NMZC 4JJCA 3OBYA 2D6FA 2VXEA 2DYBA 3CCMA 2LCCA 8AT1B 3LWHA 5KE2A 2XG8D 3THKA 4L59A 3X24B 2DNUA 1BI1A 5GMKi 4OMNA 3X28B 1Y07A 1LOJA 2M0OA 5IT9E 2VVKA 1QKWA 5HCKA 3CCMT 1QCNA 3PFSA 1ZSZC 4RTZA 4A4KA 3GNFB 3JB9H 2JTFA 4PJNA 4HCKA 5D7UA 4OB1B 1VQ4Q 1N8RU 5GAMe 3CBOA 2EYXA 1N6AA 5I11A 1LJOA 1WHKA 1Q95G 1B3QA 4DOVA 2CP3A 2VC8A 2AIRB 5CO7A 3PGGA 1VQMA 2NUPA 1X01A 1KIKA 3QJYA 4DEXA 2GTJA 2HBPA 2JT4A 2DL8A 3L1AA 1JXMA 2K9GA 3OYAA 1HD3A 1M2OA 1TG0A 1KQ1A 1YWOA 2YWWA 4IUQA 1KC8R 4OGEA 1VYVA 3CD6A 2R58A 2GCXA 1VYUA 1RI0A 1SSHA 1EFNA 3LW5E 2K3XA 5HK0A 4FT4A 4M75C 4PJOF 1OPKA 1GFDA 1D0YA 2L0AA 4FU6A 1U1SA 4F7UB 3RUXA 4AFQC 2VWFA 1YJNA 5GJWB 1K9AA 4JS4A 2J6FA 2NUZA 2NUTB 4E7JA 4M7AA 1ZSZB 1S1NA 1ZLMA 1BYMA 1KHIA 2B86A 1IHWA 3U23A 1B7TA 1YIJA 3OYGA 2RF0A 3PNWC 2PVDB 3EFOA 1N9SA 3MEAA 3G4SA 2PNIA 3QJ6A 1ZQ1A 3H0FA 1YJ9Q 3E2UA 1VQ5T 4FYVB 1Q86R 3TEEA 4M77F 1PG5B 2YRDA 3LLRA 4BDZA 4FYXB 4IKFA 1AEYA 3EFOB 1M1GA 4F7UG 3VRYA 1YBYA 2DPPB 2DVEA 2RB6A 2O9VA 3I55T 4XTWA 2V1QA 2X4YA 1B34A 3MCAB 1ABOA 1MMAA 4E7IA 3X26B 1YHQA 2FHDA 2KMTA 1K0XA 2DD5A 5GAOr 4RMOA 1I07A 4M7DF 3L2QA 3I55Q 3MO8A 1VQ6A 1YWPA 4C8QB 2HQEA 3J81E 4AT1B 5GAOl 1GFCA 2EVRA 1JRIA 2RI5A 1G3YA 4BI8B 3E9GA 1K8AC 2KXDA 3OYFA 4OMMA 5IN1A 2K6DA 2R5AA 1VQNA 4E7ZA 3CCQQ 2R5MA 1ACMB 4M77D 1LCKA 2ZCFB 4QVDA 4C0FA 4A4GA 4IIMA 4M7AD 5J39A 2FZKB 3JCMV 2DE0X 2DFUA 3JSCA 4M75A 4C92F 2EJ9A 3EFRA 4JJNK 2HL5C 2A3LA 2KROA 2C0OA 2J7IA 2MMPA 1UECA 2NLUA 4J7IA 1YJNT 4MZTA 2DBMA 1I81A 2COYA 4PJOA 1FMWA 2V26A 1M3CA 3OYHA 5D6WA 4KUIA 1GCQA 4ZN1A 2HMAA 1QVFA 3EG3A 1G8XA 3MKDA 3QHSA 4OMOA 1ZUKA 4XTXA 1VQ5Q 4J7FA 3O8VA 4L6V5 1ZX6A 4MMKA 4J9GA 4F17A 1P92A 1AZGB 2WACA 2NWMA 5FLXE 1KSWA 1NYGA 5KE3A 1JJ2S 1WI7A 3MP6A 4PJMA 5J3BA 4EMKA 4NL2A 3OYIA 2DLPA 2YUQA 4PJOG 4E2FB 3CMAA 2LNVA 4M7DG 2RHYA 4AFSC 5CKFA 3CCSQ 2FVUA 1QCOA 4OF1A 4X9CA 4DBQA 1VQ9T 4PLLA 2CZ7B 5KYXA 3SFMA 3ME9A 1YJ9A 3ASKA 4M7DC 4PL6A 2EQMA 1K73U 4MMLA 4Y92A 3X25B 4ZTFA 4HVVA 1Q81C 1W2BS 4FL6A 3CQTA 2CH4A 1YJWT 2DK3A 3C95A 2QGFB 1K73C 1YJWA 2JOYA 1WHHA 3QG1A 5FWCA 2O4XB 4AG2C 3V7CA 5GAN8 1VQKQ 2JM8A 1UGVA 4F7UA 1WX6A 2QAZA 1YJ9T 4OB0B 3HRUA 2H8HA 3M0PA 3JCMP 1S72Q 2K2VA 2W10A 4GBQA 4DEYA 1QVGP 1V76A 1KFZA 5FWBA 5GAMj 4OMFB 1YITT 3CMEQ 3OW2P 4QKUA 1HYOA 2DTHA 4OGCA 4JJDA 2M9UA 4R55A 3OY9A 2JS2A 2E3IA 2LVMA 3QBYA 4C5IA 1M3BA 2CT4A 3PE0A 1MNDA 3WVDB 4MDXA 4M7DD 2AT1B 5GANh 4QVCA 4ZGDB 1RAIB 3UDCA 3G71A 5FROA 1JU5C 2FZCB 3H0IA 3OYDA 3FLGA 4Z88A 5FU7C 4M7AB 1HK9A 3CCUA 5LJ3g 1K4US 2SEMA 2CP2A 3NPFA 2E1HA 3URGA 5LJ5g 3OSVA 2ESWA 3M57A 2DKGA 1YP5A 2C0IA 3EGUA 1JJ2P 4JJBA 3P8BB 1XNIA 2PTKA 1D0ZA 4OMPA 1K8AU 2L3SA 2DL7A 3N5BB 2HSPA 4A4EA 2EPDA 3HRSA 1PRLC 4BI4A
chains in the Genus database with same CATH topology
5GAN2 3CCEA 4ZGJB 4C8QF 3PIOA 2X4XA 3LWIA 3OYNA 3OYYA 3QPHA 3OW2A 3CCSA 4RG8A 4JLGA 4M7DB 2DIQA 5L8RE 2JTMA 4PJOB 5GANd 5GAMf 1U1TA 2E41A 2HAXA 2KVQG 2PQWA 3OQ5A 2DZ9A 3CXCA 3MEUA 1KD1C 4HA8A 4JRIA 5J26A 3ER0A 3ZFJA 3A8LB 4N4GA 1VQPT 3VU3C 2KY9A 4IUTA 1WNLA 3L2RA 2DAQA 2HQXA 1KQSS 3A5ZB 3OBYA 1VIFA 2D6FA 2OAUA 2VXEA 2RHIA 1R8OB 3CCMA 3J7AF 3GLXA 5GAMh 3M9QA 1KC8C 2ZPBB 1G3TA 1MGQA 2LCCA 2XDBA 1OI1A 2DXUA 5IAYA 4M7DA 3A8MB 3RESA 3LWHA 4JUVA 1M5Q1 4Q5WA 2RI3A 1TH7A 1YCYA 2XIDA 4M75E 4OB3B 2XG8D 5KE2A 3CC7T 4L59A 3X24B 4PJOE 1RL2A 3G71T 4HKEA 1BI1A 3A8OB 4BY6C 2E70A 4A53A 5GMKi 5GAN4 4R56A 5KCHA 1JJ2A 3CBPA 4HT9A 3CCRA 3JCMJ 1YIJT 4M78E 3X28B 1Y07A 2HD0A 2VGNA 1Q7YU 3CCVA 1LOJA 2M0OA 3OYEA 4J6XA 5IT9E 2JNGA 1WJQA 1KQSA 5CKDA 2KDSA 3VUBA 2QEXA 4XTYA 3HL8A 3CCMT 2ZPIB 3PFSA 2CYZB 1B34B 2KAFA 1XQHA 5CAIA 2M16A 3CCQA 1VQLA 2LTOA 4A4KA 3A8HB 3GNFB 4VUBA 4ME7A 3JB9H 2JTFA 5GAN5 4NOYA 4JLIA 2MF2A 4OB1B 4PLIA 4C0GA 5GANj 3M4YA 4XQ3A 2RA2A 1EIFA 3OS2A 2QXFA 5DLOA 4O5VA 4L5GA 4A4FA 3J80E 2VV5A 2DXBA 1N8RU 2QEXT 3VYGA 4Y91A 5GAMe 3HRTA 2VUBA 5GAOn 2EQJA 4C92A 2L8DA 2PUOB 3CBOA 2H3JA 3G4ST 1N6AA 3GPLA 1LJOA 5HY6A 3CCLA 3M56A 4HCZA 2QDYB 4DOVA 2VC8A 5GMKl 3L2UA 5CO7A 3PGGA 1VQMA 2P0PA 2O01E 1X01A 3JCMh 3S6WA 5GAN7 3CBMA 1M8VA 3QJYA 3JB9D 5CCAA 4KBMB 2HBPA 4ELZC 3META 3QYHB 2GFAA 4P5NA 5M9OA 2FB7A 4C8QC 3QZ5B 3R6OA 3L1AA 4M77E 3FC3A 2JN0A 1ZHIA 4CI0C 3JB9F 4BDYA 2EJGA 4XU1A 3JCMe 3OYAA 1YI2A 4O6JA 4M7AE 1KQ1A 3WXMB 4ZN3A 4D6WA 2E6ZA 4B9WA 2P4TA 5KCOA 2RJCA 2CZ1B 2MWOA 4IUQA 2O4XA 1NE8A 2K5LA 3HFNA 4Y28E 4OGEA 3S3NA 1S72T 3DB4A 1KD1U 2QQSA 3CD6A 2R58A 3GNGA 2GCXA 3RKWA 3TU4K 1RI0A 1OYXA 3BFMA 1LNXA 1N8RC 1NZ9A 2X4JA 3LW5E 3RKXA 3OS1A 2GFUA 2K3XA 1FX7A 3ZBDA 2C06A 5HK0A 4FT4A 4M75C 4PJOF 1Q86U 2E6NA 3C12A 3G6ET 3PT9A 5CQYA 1M1FA 5GAMg 3KXTA 4E7HA 3CEYA 5GANg 2GQVA 2CGHA 3MEWA 4FU6A 3OS0A 1U1SA 4F7UB 3VJPA 4LDXA 2KK4A 3LGFA 3RUXA 1NPPA 4DOWA 4NL3A 1YHQT 5A0GA 3ZEHA 4BE0A 1G5VA 4MZMA 3QSUA 1YJNA 4E7KA 5FRMA 4C5GA 5DY9A 4N4HA 4JS4A 2D9TA 3V7RA 2BUDA 4E7JA 4M7AA 4II1A 1O75A 3CMET 1BYMA 3CCRT 3CCUA 4BB7A 3CMEA 1XTDA 4E47A 1KHIA 4GLKA 5A0DA 3V7SA 1VQ7A 2OTLT 5CIUA 1YIJA 2R57A 4LDYA 3OYGA 3E1SA 3S3OA 3JCMQ 4BE2A 3PNWC 2PVDB 3HSBA 4X9DA 3QZ9B 3H6ZA 2LT1A 2LQ8A 4XTZA 3HHTB 1D3BA 3CPWA 1N9SA 1H3ZA 2VYTA 1UGQB 3MEAA 3G4SA 1N27A 5CKBA 5D6YA 5FRNA 3BDLA 2CKKA 3X20B 3CCQT 3QJ6A 2DTIA 4MZPA 2ZZDA 2XD0A 1BIAA 1ZQ1A 3OS5A 3MEVA 5FU7B 1KQ2A 1KHCA 1WPYA 2DXCA 1VQNT 2HNIA 3GF5A 3JRZA 4C92E 3C4SA 1VQ5T 1HXDA 4C92D 1XOVA 3TEEA 4M77F 3CCVT 4HCCA 2F69A 4RKUE 2KQWA 3JAME 3LLRA 1GXIE 1M90U 4BDZA 2Y4YA 2LRQA 1VUBA 3TCJA 2EQKA 4C0ZA 4NS5A 1Y7XA 4IKFA 4M7AF 1M1GA 1UGPB 4F7UG 3CCJT 1I4K1 3HKSA 1QP2A 1ZBXA 1NJIU 3KBGA 1N9RA 1YBYA 5FU6B 1VQMT 3UT1A 3GOXA 2DPPB 2DVEA 2RB6A 3INZA 4M75F 2D0QB 4TVRA 3I55T 4XTWA 5D6XA 2QA4T 4PJOC 1DJ7B 2X4YA 1VQ6T 4IURA 1B34A 2EIFA 3MCAB 4OP0A 3V8JA 3NTKA 4BD3A 3OYMA 1I5LA 4E7IA 3EFSA 1K9MC 3X26B 3C94A 4N0AC 5GAN3 1YHQA 3FEOA 3PIPA 5GAMd 4KULA 2FHDA 2JVVA 2KMTA 2L5QA 5AYFA 2V8JA 5LL6S 4A4HA 2DD5A 2QQAA 5GAOr 4RMOA 1JB0E 3HPWA 4J6WA 3E19A 5C0MA 4M7DF 1G3SA 3L2QA 2LX9A 3NFCA 4LDUA 1NPRA 4N4IA 2DEQA 3M55A 3MO8A 3SWNC 4BE1A 4C8QB 3QXEB 1VQ6A 2HQEA 4XK8E 2QTXA 3J81E 4J6YA 2PU9B 4XU2A 4C8QG 4BY6B 2Y4XA 3CXCS 3CCST 5GAOl 2XDDA 3RERA 1JRIA 4PKCC 2RI5A 4PNOA 1G3YA 2E65A 3E9GA 3HFOA 4BI8B 5I2SA 3OYBA 4EMKC 1K8AC 4EDUA 5HK3A 2MAMA 3OYFA 2CZ6B 5IN1A 2R5AA 2VGMA 4E7LA 3I56T 2L89A 1VQNA 2B8AA 3OYJA 3VV0A 2X35A 1QW1A 5A2QE 2F5TX 1VQ5A 2R5MA 4FIBA 1Y96B 1VQKA 4QQDA 3RMSA 4M77D 2RJEA 2ZPEB 3LX7A 4EMGA 1AHJB 2E5QA 2F5KA 2ZCFB 3NTHA 5LJ5d 3LGLA 3OB9A 2RM4A 3SDZA 4QVDA 4C0FA 2QQRA 1QVPA 4A4GA 2EAYA 4QW2A 3EAEA 4M7AD 1VQ4T 5J39A 4IUVA 1QVFS 3JCMV 3CC2A 1WGSA 3JSCA 4M75A 5GAOm 4C92F 1Q86C 4PJOD 1UGRB 4M78B 2EJ9A 4XAXB 5GAOp 2ZPHB 2EYQA 3EFRA 4M77A 4JJNK 1X75C 2A3LA 2CZ0B 2MMPA 3M4GA 3JCMb 3T9NA 3AHUA 2NLUA 2XK0A 3JCMX 3DKMA 4J7IA 1YJNT 2V8IA 2YHTA 3Q1JA 4MZTA 3TREA 4DA4A 1I81A 4M75D 1VQ4A 4PJOA 3OYHA 5D6WA 2WSCE 3E9FA 3H8ZA 2ZPGB 3NTIA 3M58A 4KUIA 4BACA 1VQ8A 4J83A 3LYIA 4ZN1A 3DLMA 2CS7A 2EKOA 3V8LA 1QVFA 2DD4A 2DXTA 1QVGA 5CR2A 5CK9A 4FT2A 3QHSA 4RCCA 3OBWA 5LJ3e 1IREB 3P8HA 4HCBA 4KUDK 2XKOC 4RG2A 1VQKT 2RD1A 2LQKA 3F70A 3FB9A 4XTXA 4J7FA 1Q7YC 3OA6A 2EJFA 2RJFA 2VXFA 3M54A 3O8VA 3QDRB 4FSXA 1YITA 4ZGEB 4L6V5 5I21A 5HKCA 5DM7R 2JUFA 4MMKA 3JB9G 4QQGA 4C0DC 3I55A 4RCBA 2E12A 3QYGB 3JCMW 1P92A 2Y90A 2WACA 4EMKB 1BI2A 2EFIA 3QKJA 2WSEE 4IUUA 2FL7A 4IUPA 2BIVA 5FLXE 5LJ5j 2PUKB 4Z02A 5KE3A 3JCMd 1M1KU 1JJ2S 2RK2A 1QVGS 3MP6A 4XU0A 4EMHA 1M9SA 5J3BA 4EMKA 4C8QD 3QUIA 3JB9I 3MP8A 4NL2A 3OYIA 1M1KC 2IVWA 4MDWA 2MWPA 3SWNB 3CC4A 4C92C 5CKHA 4C5HA 3MHXA 1W2BA 3L2WA 4J5YA 4F7UE 1UEBA 5GANe 3LH0A 3BW1A 4PJOG 5LJ5f 2PVOB 3CMAA 2LNVA 4M7DG 3FJPA 2OTJA 1M90C 3G7ZA 3P8DA 1SSFA 2L3RA 2RHYA 5GMKj 2QQBA 4M75B 5GAN6 3JB9J 1VQOA 5CKFA 1QP3A 2FVUA 4KT0E 5GMKh 1KG1A 1D3BB 4OF1A 4X9CA 4OVAA 3FRNA 3M53A 4PLLA 1VQ9T 2CZ7B 4N0AA 2KSSA 2K5IA 3SFMA 5LJ3d 3CCJA 3ME9A 3M5AA 4JRPA 1YJ9A 3ASKA 3SD4A 4PL6A 2EQMA 4M7DC 2RJDA 1K73U 2EQUA 3CC2T 4MMLA 3A8GB 3X25B 4ZTFA 1Q82C 1Q81C 1BIBA 1WQWA 2LCLA 1W2BS 4FL6A 3CCET 2EWNA 1Q82U 4ELYC 3JCMg 4C92B 2DTOA 2DK3A 1MHNA 3C95A 4JRQA 1JBMA 1YJWT 1YJWA 1K73C 4LD9K 1H641 2JOYA 5DLQE 1X6OA 1M4ZA 3QG1A 3PTAA 2O4XB 3V7CA 5GAN8 2RHZA 3CC4T 4F7UA 5CKEA 3GP8A 5CVIA 1NJIC 1YJ9T 4OB0B 3I56A 3OSSC 3HRUA 4BUGA 1W4SA 4M7DE 3JCMP 2AHJB 2XDPA 4C0DB 3PMIA 2K2VA 1UGSB 1VQ7T 2OTLA 3CD6T 4JRKA 1WQ7A 4M7AG 3JCMf 5GAMj 4M78C 3L2ZA 5GAOq 3CPWS 3QIIA 3MP1A 4OMFB 4M77G 5LJ5e 1YITT 2LDMA 1O9SA 1I8FA 1OZ3A 5GANf 3L2VA 4JS5A 4V2SA 2YLBA 5LJ3j 2DTHA 4OGCA 3SWNA 4R55A 2M9UA 3OY9A 4LD6A 5A0LA 3OMCA 4OB2B 4M7AC 3OYKA 2LVMA 1Q81U 2RHXA 3QBYA 2QQ9A 3GIBA 4M77C 1V29B 4C5IA 2RK1A 4A54A 4C8QE 3OYCA 2ZGWA 2PVGB 2GF7A 3FDRA 3UPUA 4M78A 2XI9A 3VUZA 3WVDB 4MDXA 3KUFA 1KC8U 2QA4A 2RH2A 4M7DD 2IG0A 4B9XA 5GANh 4QVCA 2MI6A 4ZGDB 3UWNA 1BI0A 3UDCA 2K3YA 2K4YA 2A7YA 3G71A 4C5EA 2FYKA 3V8KA 2K57A 2DO3A 5FROA 2XICA 4UC4A 2P0QA 2RI2A 1VIEA 4M78D 5FU6C 4C8QA 3RIRA 5GMKe 3OYLA 3OYDA 3FLGA 1PSFA 3JCMc 1WJSA 2YRVA 5LJ5h 1VQ9A 4ATOA 3CPFA 5FU7C 2XU8A 2X4WA 4M7AB 3SB2A 1HK9A 1VQLT 2JZ2A 2LC4A 4EPCA 4DQ2A 1IZ6A 2E64A 2ZPFB 4JDSA 5KH6A 5GMKm 5LJ3g 3BDUA 1YI2T 4M77B 4M78G 3G6EA 3DB3A 4BI3A 3S3MA 5EG2A 3FIFA 3OMGA 3RKYA 4CRIA 5C6SA 1BKBA 1U8RA 1OZ2A 4GY5A 2LT4A 4XTVA 4M78F 2E1HA 4HT8A 2V8KA 3URGA 1FXXA 5LJ5g 3OSVA 2M1HA 2WSFE 3PMTA 5LJ3f 3M57A 4XU3A 1WJRA 2DIGA 3CCLT 4C92G 1BI3A 1Y96A 2DKGA 2RHUA 3CC7A 1PSEA 4LDWA 1K9MU 4XTUA 2QI2A 4FM4B 2OTJT 5CQXA 3RMQA 3QO3A 3CMAT 3OW2S 1VQOT 4WF2A 2E10A 3P8BB 2RO0A 1XNIA 1UB4A 1S72A 2P0KA 4ZTJA 4YTLA 4J8OA 5LJ3h 3M59A 2XHCA 5I2MA 1K8AU 1G3WA 1FWZA 3HP9A 4QVZA 3DLLA 3N5BB 4X34A 1Y71A 4QQ6A 4A4EA 3BY7A 3CCUT 3HRSA 3L42A 4M75G 2G3RA 3VKIA 3VYHB 2BKDN 2DZCA 1VQ8T 2I2LA 4LDVA 2YLCA 1VQPA 4F7UF 2K5FA 3WVEB 4BI4A 2DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5M A;  2X4X A;  3OYN A;  2E6N A;  4QQD A;  2RJE A;  3LX7 A;  2F5K A;  2E5Q A;  3NTH A;  2DIQ A;  4E7H A;  3LGL A;  3CEY A;  3OB9 A;  2QQR A;  4A4G A;  2XDP A;  4FU6 A;  3MEW A;  2PQW A;  3EAE A;  3OQ5 A;  3PMI A;  4QW2 A;  3OS0 A;  3MEU A;  5J39 A;  4IUV A;  5J26 A;  3LGF A;  1WGS A;  4N4G A;  3QII A;  3ZEH A;  3MP1 A;  4BE0 A;  4IUT A;  3L2R A;  1G5V A;  2DAQ A;  2HQX A;  2LDM A;  4E7K A;  1OZ3 A;  5FRM A;  4C5G A;  3L2V A;  4N4H A;  2D9T A;  2RHI A;  2BUD A;  4E7J A;  4II1 A;  2NLU A;  2XK0 A;  3M9Q A;  3OY9 A;  4LD6 A;  2LCC A;  1OI1 A;  3Q1J A;  3OMC A;  5IAY A;  3OYK A;  2LVM A;  5CIU A;  3OYH A;  4Q5W A;  2RI3 A;  2RHX A;  2R57 A;  3QBY A;  3H8Z A;  3E9F A;  5D6W A;  5KE2 A;  3NTI A;  4L59 A;  3OYG A;  4BAC A;  4BE2 A;  3PNW C;  3S3O A;  4C5I A;  3H6Z A;  3LYI A;  3OYC A;  3DLM A;  2EKO A;  5KCH A;  2GF7 A;  3FDR A;  1H3Z A;  2VYT A;  3MEA A;  1N27 A;  3KUF A;  5D6Y A;  3P8H A;  5FRN A;  2M0O A;  3BDL A;  4RG2 A;  2CKK A;  3OYE A;  1WJQ A;  3QJ6 A;  2IG0 A;  3F70 A;  4B9X A;  3UWN A;  3OA6 A;  3MEV A;  2K3Y A;  2RJF A;  3O8V A;  3PFS A;  1KHC A;  4C5E A;  5FRO A;  3C4S A;  4UC4 A;  2M16 A;  2RI2 A;  3OYL A;  2LTO A;  4QQG A;  3OYD A;  2JTF A;  3FLG A;  1WJS A;  2YRV A;  3LLR A;  4PLI A;  2WAC A;  4BDZ A;  2EFI A;  3QKJ A;  2LRQ A;  4IUU A;  4IUP A;  2EQK A;  2BIV A;  2X4W A;  4NS5 A;  3OS2 A;  4Z02 A;  5KE3 A;  4IKF A;  4A4F A;  2JZ2 A;  5KH6 A;  3MP6 A;  3UT1 A;  3GOX A;  3DB3 A;  3S3M A;  2EQJ A;  5D6X A;  2L8D A;  3MP8 A;  3OMG A;  4CRI A;  2X4Y A;  5C6S A;  4IUR A;  3OYI A;  1OZ2 A;  4BD3 A;  2MWP A;  3OYM A;  3NTK A;  4E7I A;  4GY5 A;  4C5H A;  4HCZ A;  3L2W A;  3L2U A;  3LH0 A;  3FEO A;  3PMT A;  2M1H A;  2FHD A;  3P8D A;  3S6W A;  1WJR A;  1SSF A;  2L3R A;  2DIG A;  2RHY A;  4A4H A;  2RHU A;  3MET A;  2GFA A;  5M9O A;  5C0M A;  3L2Q A;  4N4I A;  4OVA A;  4PLL A;  4BE1 A;  3FC3 A;  3MO8 A;  2HQE A;  4BDY A;  3ME9 A;  2RO0 A;  3OYA A;  1XNI A;  3ASK A;  3SD4 A;  4PL6 A;  2EQM A;  2P0K A;  4ZTJ A;  2RJD A;  2EQU A;  4ZTF A;  4B9W A;  5KCO A;  4QVZ A;  2RJC A;  2MWO A;  4IUQ A;  4FL6 A;  2O4X A;  2RI5 A;  4QQ6 A;  4X34 A;  4A4E A;  3E9G A;  3S3N A;  3DB4 A;  3OYB A;  3L42 A;  4EDU A;  2QQS A;  1MHN A;  2R58 A;  3OYF A;  2G3R A;  2BKD N;  5IN1 A;  1RI0 A;  1OYX A;  2R5A A;  4E7L A;  2L89 A;  3OS1 A;  2B8A A;  2O4X B;  3OYJ A;  2GFU A;  2K3X A;  2X35 A;  2RHZ A; 
#chains in the Genus database with same CATH topology
 4C8Q F;  3PIO A;  1OV3 A;  4RG8 A;  1VYT A;  2E41 A;  2HAX A;  3OQ5 A;  2DZ9 A;  3I5S A;  1H92 A;  1VQP T;  1M3A A;  1KQS S;  1XJW B;  1QWE A;  2RHI A;  1R8O B;  5GAM h;  2ZPB B;  2XDB A;  1MGQ A;  4M7D A;  3A8M B;  4JUV A;  2RI3 A;  1TH7 A;  1X6G A;  1YCY A;  2FO0 A;  2XID A;  5GAN 4;  1JJ2 A;  1K8A R;  1RAA B;  5KCH A;  1GBR A;  4HT9 A;  3JCM J;  1YCS B;  2VGN A;  3CCV A;  2Z0W A;  2CT3 A;  1WJQ A;  4XTY A;  3HL8 A;  2OJ2 A;  1XQH A;  2LTO A;  4VUB A;  1AD5 A;  2EKH A;  4JLI A;  1PHT A;  3EH1 A;  5KYX B;  4C0G A;  5GAN j;  1EIF A;  5DLO A;  4A4F A;  4JZ4 A;  2HKQ B;  2VUB A;  3HRT A;  2PUO B;  2H3J A;  2RQR A;  3CCL A;  4CC3 A;  4AFZ C;  4PFP A;  5GAN 7;  2QEX Q;  3S6W A;  3CBM A;  1M8V A;  4KBM B;  4J9C A;  3MET A;  3QYH B;  3QDF A;  4P5N A;  4FYW B;  3R6O A;  4M77 E;  3UA6 A;  4CI0 C;  2SRC A;  4M7A E;  4O6J A;  3WXM B;  4ZN3 A;  1NEG A;  2RJC A;  1SF9 A;  2GQI A;  2O4X A;  1MNE A;  3S3N A;  3DB4 A;  1KD1 U;  2QQS A;  3RKW A;  3TU4 K;  1LNX A;  1N8R C;  3RKX A;  1W1F A;  1FX7 A;  2C06 A;  1Q86 U;  2HEQ A;  4RUG A;  2FEI A;  1M1F A;  4E7H A;  2A0F B;  5GJV B;  3MEW A;  1WXU A;  1GRI A;  3OS0 A;  3VJP A;  2K79 A;  3EGD A;  5I22 A;  4F04 B;  1NPP A;  4DOW A;  5A0G A;  3ZEH A;  1M2V A;  1G83 A;  4C5G A;  5DY9 A;  2JMA A;  4N4H A;  3V7R A;  1NBE B;  1O75 A;  1T0J A;  3CME T;  2VKN A;  2QTV A;  4BB7 A;  1XTD A;  3CME A;  3V7S A;  1VQ7 A;  5CIU A;  1BCM A;  3E1S A;  1NM7 A;  3JCM Q;  3HSB A;  1PCX A;  4X9D A;  3H6Z A;  2LT1 A;  3VS0 A;  1UGQ B;  5FRN A;  2A08 A;  3BDL A;  3X20 B;  2GTO A;  2ZZD A;  3A98 A;  3MEV A;  4D8D A;  1KQ2 A;  1KHC A;  1SRL A;  1WPY A;  1MMG A;  4C92 E;  3C4S A;  1IGU A;  1HXD A;  1AWO A;  1C0M A;  4HCC A;  2F69 A;  4RKU E;  2KQW A;  3JAM E;  1A0N B;  2FPF A;  1UFF A;  3TSW A;  4J9D A;  3KBG A;  1N9R A;  2X3X D;  1VQM T;  2J05 A;  4J9H A;  1VQ9 Q;  2OI3 A;  2GBQ A;  3INZ A;  2D0Q B;  1D1B A;  5D6X A;  1VQ6 T;  4BD3 A;  1K9M C;  5GAN 3;  1E6H A;  2DBK A;  3FEO A;  2L3Q A;  1UHF A;  1TU0 B;  2V8J A;  5LL6 S;  2OTJ Q;  2HL3 A;  2X51 A;  1JB0 E;  3EGX A;  4R0K A;  2LX9 A;  2DVJ A;  3M55 A;  3QXE B;  2ECZ A;  1N8R R;  2RN8 A;  4Z89 A;  2PU9 B;  3M0Q A;  4C8Q G;  1PC0 A;  2Y4X A;  2NUP B;  3RER A;  4PKC C;  3M0S A;  5I2S A;  3OYB A;  2MAM A;  2DM1 A;  2VGM A;  5AT1 B;  1WA7 A;  3D7S B;  1QW1 A;  2X35 A;  4KGV B;  4FIB A;  4GLM A;  2RJE A;  1AHJ B;  2E5Q A;  2LJ1 A;  2RM4 A;  3VS2 A;  1QVP A;  2EAY A;  2CDT A;  1QKX A;  4IUV A;  3CC7 Q;  3CC2 A;  5GAO m;  4M78 B;  2COW A;  1X75 C;  3M4G A;  3T9N A;  2XK0 A;  3JCM X;  3H41 A;  2V8I A;  2YHT A;  3TRE A;  1W70 A;  5IXF A;  2DX1 A;  1VQ4 A;  2WSC E;  3E9F A;  4J83 A;  1OX9 A;  3DLM A;  1VA7 A;  2EKO A;  3V8L A;  3VS1 A;  1LPL A;  2O2O A;  2EYZ A;  4D8K A;  1VQK T;  1PKT A;  3F70 A;  3OA6 A;  1TOV A;  3QDR B;  2LZ6 B;  1Y0M A;  5HKC A;  2JUF A;  4QQG A;  4C0D C;  3I55 A;  1VQ6 Q;  4RCB A;  2E12 A;  1CKB A;  1BI2 A;  3QKJ A;  2WSE E;  2BIV A;  1M1K U;  4Z02 A;  2RK2 A;  1V1C A;  3RDV A;  1M1K C;  2IVW A;  4MDW A;  4C5H A;  2OAW A;  3MHX A;  3BW1 A;  3FJP A;  2OTJ A;  3P8D A;  7AT1 B;  1SSF A;  2L3R A;  5GMK j;  5GAN 6;  5GMK h;  1QLY A;  3HTR A;  1KG1 A;  4FW2 A;  4OVA A;  3FRN A;  3M53 A;  2DA9 A;  2K7A A;  2O31 A;  2D0N A;  2K5I A;  4JRP A;  3M5A A;  2PZ1 A;  3EG9 A;  4KH0 B;  1K73 R;  1BIB A;  1WQW A;  2BZX A;  3CCL Q;  4PFO A;  3CCE T;  2KT1 A;  4ELY C;  4LD9 K;  1JBM A;  3PTA A;  2RHZ A;  3ULR B;  1RLP C;  5KYY A;  5IXB A;  3GP8 A;  5CVI A;  1NJI C;  2YUP A;  1W4S A;  1I1J A;  2XDP A;  3PMI A;  1IXD A;  1UGS B;  2OTL A;  3CD6 T;  3M0R A;  4M7A G;  1JO8 A;  3L2Z A;  5GAO q;  1I8F A;  5GAN f;  3IQL A;  2A37 A;  4V2S A;  2AKL A;  2YLB A;  5LJ3 j;  1AWJ A;  1WDX A;  5KYW A;  2DEU A;  4LD6 A;  4M7A C;  2KEA A;  1ARK A;  1Q81 U;  2RHX A;  4J9I A;  2QQ9 A;  2K2M A;  4F16 A;  1RAC B;  4M78 A;  3VUZ A;  3UPU A;  1YFN A;  1KC8 U;  1TUG B;  2QA4 A;  2RH2 A;  4B9X A;  2K3Y A;  2K4Y A;  2A7Y A;  2CRE A;  4M4Z A;  2K57 A;  2O88 A;  2J6K A;  1WHJ A;  4QT7 A;  4UC4 A;  2P0Q A;  2RI2 A;  1VIE A;  5FU6 C;  1PSF A;  3VS4 A;  2HQH A;  2MK5 A;  2XU8 A;  2X4W A;  1QWF A;  3SB2 A;  1WHG A;  1VQL T;  3SEM A;  1RAG B;  1IZ6 A;  2ZPF B;  4DQ2 A;  1YI2 T;  4BI3 A;  3I35 A;  5EG2 A;  3FIF A;  4CRI A;  2YDL A;  4GY5 A;  2RQU A;  2JMC A;  2KRM A;  2WSF E;  2DIG A;  4C92 G;  1TTH B;  1BI3 A;  4LDW A;  2KGT A;  1BBZ A;  2OTJ T;  3QO3 A;  3CMA T;  3OW2 S;  3RNJ A;  1IHV A;  1S72 A;  2ENM A;  4YTL A;  4J8O A;  2XHC A;  5I2M A;  1PD0 A;  1QMC A;  4X1V A;  3DLL A;  4X34 A;  1T3S A;  1Y71 A;  3BY7 A;  3L42 A;  4M75 G;  1ZUY A;  3VYH B;  2BKD N;  4RTT A;  1VQP A;  3CCJ Q;  2K5F A;  2EGC A;  1FYN A;  1X6B A;  2D1X A;  2ED1 A;  4ZGJ B;  2X4X A;  4JPB W;  1BB9 A;  3QPH A;  4AMC A;  4JLG A;  4M7D B;  5KYW B;  3CCM Q;  5GAN d;  2QAS A;  1U1T A;  1U3O A;  2KVQ G;  3CXC A;  2LP5 A;  4HA8 A;  4JRI A;  2KY9 A;  2HQX A;  1NYF A;  2A36 A;  1VIF A;  5IHK A;  2LMJ A;  2DIL A;  3GLX A;  3EH2 A;  3M9Q A;  1KC8 C;  1OI1 A;  5IAY A;  2EYW A;  3RES A;  1M5Q 1;  4Q5W A;  1M90 R;  3CC7 T;  4KH1 B;  4M75 E;  1RL2 A;  3G71 T;  3A8O B;  4FSS A;  2YUN A;  4R56 A;  1F1B B;  3CCR A;  1YIT Q;  1OX8 A;  4J6X A;  1KQS A;  5CKD A;  3VUB A;  2ZPI B;  3G1J A;  2CYZ B;  2KAF A;  5CAI A;  3CCQ A;  3A8H B;  5GAN 5;  4NOY A;  2MF2 A;  2LX7 A;  4HVU A;  3M4Y A;  1U06 A;  2RA2 A;  2DXB A;  2BE9 B;  2MIO A;  2QEX T;  5GAO n;  4KGZ B;  2CP0 A;  2EQJ A;  4C92 A;  3CPW P;  1T0H A;  3G4S T;  2QYZ A;  3VS3 A;  2QDY B;  5GMK l;  1WLP B;  3JCM h;  3REA B;  3JB9 D;  5CCA A;  4ELZ C;  3TSZ A;  5M9O A;  1IB8 A;  1KK7 A;  2JN0 A;  4KRT A;  3JB9 F;  4BDY A;  2EJG A;  1Z9Q A;  2EQI A;  4XU1 A;  1Q7Y R;  1YI2 A;  1TUD A;  1C1A A;  3CCU Q;  2KNB B;  4B9W A;  2P4T A;  2KYM A;  2JM9 A;  1R0C B;  2CZ1 B;  2MWO A;  1NE8 A;  4Y28 E;  1S72 T;  1K1Z A;  3GNG A;  1OYX A;  3BFM A;  2X4J A;  2GFU A;  1H3H A;  1NLO C;  3PT9 A;  4IIO A;  5CQY A;  3KXT A;  4ZNX A;  1QQJ A;  3ZL7 C;  4E6R A;  1WHL A;  2FZG B;  4LDX A;  2XMF A;  3UA7 A;  1YHQ T;  1G5V A;  4MZM A;  3QSU A;  1ZUU A;  2K3B A;  4E7K A;  1NEB A;  5FRM A;  1VOM A;  2D9T A;  4J9E A;  2BUD A;  1OEB A;  4II1 A;  1D09 B;  4E47 A;  5A0D A;  2W0Z A;  2R57 A;  2RMO A;  2QG9 B;  4LDY A;  2J6O A;  2P84 A;  1TUC A;  2ROT A;  1AT1 B;  1D0X A;  3CPW A;  1W6X A;  2VYT A;  1N27 A;  5CKB A;  3CCR Q;  2JJ9 A;  1HJD A;  2YXY A;  5KYN A;  2XD0 A;  3OS5 A;  3MPU B;  5FU7 B;  1VQN T;  2HNI A;  3GF5 A;  3JRZ A;  4C92 D;  3CCV T;  1GXI E;  1OOT A;  1M90 U;  1VUB A;  4M7A F;  2RQW A;  2EQK A;  1Y7X A;  3EGX B;  3CCJ T;  1X2Q A;  1ZBX A;  1NJI U;  4M75 F;  4TVR A;  4PJO C;  1DJ7 B;  4IUR A;  4OP0 A;  2EGE A;  3NTK A;  2H3E B;  1GCQ C;  2FPD A;  3C94 A;  4N0A C;  1PWT A;  3PIP A;  1KD1 R;  5AYF A;  3CCE Q;  2QQA A;  2BZY A;  4FYY B;  1K9M R;  3HPW A;  4J6W A;  1G3S A;  4N4I A;  1NPR A;  2DEQ A;  4BE1 A;  3SWN C;  1SRM A;  4J9F A;  1PD1 A;  4XU2 A;  3CXC P;  4BY6 B;  1UE9 A;  3CXC S;  3CCS T;  2X9H A;  4PNO A;  1H8K A;  4EMK C;  2KR3 A;  2YT6 A;  3UF4 A;  2CZ6 B;  1MV3 A;  1M8M A;  3I56 T;  2L89 A;  2B8A A;  3VV0 A;  1AOJ A;  2LJ3 A;  1VQ5 A;  1Z9Z A;  1VQK A;  3RMS A;  1PKS A;  2F5K A;  2RQV A;  2VB6 A;  1YJW Q;  1VQ4 T;  1GL5 A;  2LQN A;  3REB B;  1X2K A;  2ED0 A;  4PJO D;  4PFZ A;  2LQW A;  2DRK A;  5GAO p;  1ZA2 B;  2CZ0 B;  1PNJ A;  2BE7 D;  3DKM A;  3Q1J A;  2AKK A;  4M75 D;  3EG9 B;  2CH4 W;  2DJQ A;  1YN8 A;  3H8Z A;  2ZPG B;  3NTI A;  2KBT A;  2L2P A;  2EW3 A;  3LYI A;  3QWY A;  4WCI A;  1SKU B;  2DD4 A;  1QVG A;  5CR2 A;  1NJI R;  3OBW A;  4B6M A;  1IRE B;  3P8H A;  5LJ3 e;  4HCB A;  2RD1 A;  2LQK A;  1Q7Y C;  1YIT A;  4FSX A;  2X3W D;  1GCP A;  3JB9 G;  3VS7 A;  2Y90 A;  1JEG A;  2EFI A;  4IUP A;  2MYS A;  2HBW A;  4XU0 A;  1M9S A;  4C8Q D;  4KGX B;  2OTL Q;  2MWP A;  1SHF A;  4J5Y A;  5GAN e;  2KRN A;  3LH0 A;  2PVO B;  1SHG A;  1UHC A;  3G7Z A;  2QQB A;  4M75 B;  3JB9 J;  1VQO A;  5KYY B;  1QP3 A;  4KT0 E;  1YHQ Q;  1RLQ C;  2QA4 Q;  4RTV A;  3RBB B;  4N0A A;  3I56 Q;  1QVF P;  2KSS A;  5LJ3 d;  3CCJ A;  3SD4 A;  2HSE B;  2RJD A;  2EQU A;  3A8G B;  5KYU A;  1Q82 C;  3JV3 A;  3JCM g;  4C92 B;  2DTO A;  1MHN A;  2V1R A;  1H64 1;  4DBF A;  4RTX A;  5DLQ E;  1M4Z A;  4ESR A;  2LCS A;  3CC4 T;  2A28 A;  2OX7 A;  3I56 A;  3OSS C;  1VQN Q;  4BUG A;  4M7D E;  2AHJ B;  4C0D B;  1QCF A;  2CP6 A;  4JRK A;  3JCM f;  4F14 A;  1X27 A;  4M78 C;  3CPW S;  4HVW A;  2AZV A;  3QII A;  3MP1 A;  4AFU C;  2DL5 A;  3A1P A;  1OZ3 A;  1EZZ B;  4JS5 A;  3SHW A;  1PRM C;  3VS6 A;  3SWN A;  1NLP C;  1VQP Q;  3OYK A;  4JZ3 A;  1UUE A;  3GIB A;  1UDL A;  2RK1 A;  2DER A;  1B07 A;  4A54 A;  2ZGW A;  2PVG B;  3FDR A;  4A63 B;  1D1C A;  1WFW A;  1MV0 B;  3UWN A;  3TQ7 P;  4C5E A;  3V8K A;  1YI2 Q;  4WTO B;  5IH2 A;  2E5K A;  3JCM c;  1T3L A;  3O5Z A;  1WJS A;  2YRV A;  5LJ5 h;  1VQ9 A;  1FMK A;  4ATO A;  3M0T A;  1VQ8 Q;  2HKN A;  2JZ2 A;  2LC4 A;  4EPC A;  2E64 A;  4M77 B;  3DB3 A;  2KE9 A;  1BKB A;  1U8R A;  1IO6 A;  2LT4 A;  4XTV A;  1C6V X;  2FG0 A;  4HT8 A;  1PM3 A;  2M51 A;  2M1H A;  5LJ3 f;  1BK2 A;  1K76 A;  1RAF B;  1Y96 A;  2RHU A;  5FW9 A;  1PSE A;  2QI2 A;  3PVQ A;  5CQX A;  3RMQ A;  4RTU A;  5EC7 A;  1VQO T;  1WXT A;  2E10 A;  2RO0 A;  2E4H A;  2P0K A;  2FRW A;  5LJ3 h;  1YJN Q;  1G3W A;  1FWZ A;  2CUD A;  3HP9 A;  4QVZ A;  4QQ6 A;  3C0C A;  3BE3 A;  1VQ8 T;  4LDV A;  1RAE B;  1M2V B;  2BTT A;  1MMN A;  3H9N A;  3WVE B;  2DJZ A;  1D1A A;  5GAN 2;  3CCE A;  1KQS P;  3OW2 A;  1MMD A;  3CC2 Q;  4LUD A;  5L8R E;  2JTM A;  4ANJ A;  5GAM f;  2YRC A;  4EIK A;  3MJX A;  3MEU A;  5J26 A;  2I0N A;  3A8L B;  4N4G A;  1UJ0 A;  4IUT A;  3L2R A;  2DAQ A;  2QDL A;  3A5Z B;  2KT8 A;  2OAU A;  2CP5 A;  1VQO Q;  1AVZ C;  3M0U A;  3J7A F;  1G3T A;  2DXU A;  3KFV A;  4OB3 B;  4K11 A;  4PJO E;  3PVL A;  4HKE A;  4BY6 C;  2E70 A;  4A53 A;  3CBP A;  1YIJ T;  4M78 E;  2HD0 A;  1Q7Y U;  3LH5 A;  3OYE A;  2JNG A;  2KDS A;  2QEX A;  1SEM A;  4FCY A;  1B34 B;  1UG1 A;  2M16 A;  1VQL A;  2CSI A;  4ME7 A;  4PLI A;  4XQ3 A;  3OS2 A;  2QXF A;  4O5V A;  4L5G A;  3J80 E;  2VV5 A;  3VYG A;  1ZA1 B;  4Y91 A;  3NGP A;  1X43 A;  2L8D A;  4AG1 C;  4LUE A;  4E7S A;  3GPL A;  2IIM A;  5HY6 A;  1UJY A;  1U5S A;  3M56 A;  4HCZ A;  3UAT A;  3L2U A;  2P0P A;  2O01 E;  4RTW A;  2GFA A;  4LN2 A;  2FB7 A;  4C8Q C;  3QZ5 B;  3FC3 A;  1ZHI A;  1GBQ A;  3JCM e;  1TWB A;  4D6W A;  2E6Z A;  2JS0 A;  5KCO A;  2AK5 A;  3HFN A;  2K5L A;  2DYI A;  3TVT A;  5L23 A;  3VRZ A;  2JW4 A;  1NZ9 A;  2NYS A;  3OS1 A;  3CMA Q;  3ZBD A;  5IHI A;  1JQQ A;  2E6N A;  3C12 A;  3G6E T;  5GAM g;  3CEY A;  4ORZ A;  5GAN g;  1AZE A;  2GQV A;  1ZBJ A;  2BZ8 A;  2CGH A;  3EHQ A;  4PJL A;  4HXJ A;  2KK4 A;  3LGF A;  1TS9 A;  4NL3 A;  2F2X A;  4BE0 A;  1WHM A;  2M02 A;  1HSQ A;  2YSQ A;  5KYU B;  2LNH B;  4OMQ A;  3CCR T;  2IPO B;  4GLK A;  1Y57 A;  2OTL T;  1JXO A;  1W2B P;  1Q81 R;  3S3O A;  4BE2 A;  3QZ9 B;  2DMO A;  2LQ8 A;  4XTZ A;  3HHT B;  4PJJ A;  1D3B A;  1H3Z A;  5D6Y A;  2CKK A;  3CCQ T;  3EGD B;  2DTI A;  1R0B G;  4MZP A;  4DBR A;  1BIA A;  2VAS A;  2DXC A;  3G6E Q;  1MUZ A;  2DRM A;  1WYX A;  1KJW A;  1XOV A;  1VQ7 Q;  2LRQ A;  2Y4Y A;  4LNP A;  3TCJ A;  4C0Z A;  4NS5 A;  1UGP B;  1I4K 1;  3HKS A;  1QP2 A;  5FU6 B;  3UT1 A;  3GOX A;  2QA4 T;  2EYY A;  2CUB A;  2EIF A;  3V8J A;  1NG2 A;  3OYM A;  1I5L A;  2FPE A;  3EFS A;  1R77 A;  3G71 Q;  3CD6 Q;  5GAM d;  4KUL A;  2JVV A;  2L5Q A;  1RAD B;  4OML A;  4A4H A;  2GGR A;  2ZAE A;  3E19 A;  1RAB B;  5C0M A;  3NFC A;  3EG1 A;  4LDU A;  2P4R A;  2KI7 A;  4XK8 E;  2QTX A;  4J6Y A;  2DL4 A;  3EG0 A;  1FMV A;  3R6N A;  2EBP A;  1RI9 A;  2XDD A;  2E65 A;  3HFO A;  1SG5 A;  2DF6 A;  1CSK A;  2GNC A;  4EDU A;  5HK3 A;  4DBH A;  1VQM Q;  2O9S A;  4E7L A;  1I0C A;  3OYJ A;  5A2Q E;  2F5T X;  2MPX C;  2L3P A;  1OU9 A;  1Y96 B;  4QQD A;  2ZPE B;  3LX7 A;  4EMG A;  3NTH A;  5LJ5 d;  2D8J A;  3LGL A;  3OB9 A;  3SDZ A;  2MOX A;  2QQR A;  4QW2 A;  3EAE A;  2QGG A;  1QVF S;  2FRY A;  1SPK A;  1WGS A;  2F2W A;  2COZ A;  1Q86 C;  1UGR B;  2MCN A;  4XAX B;  2ZPH B;  2EYQ A;  4M77 A;  1BCO A;  3QWX X;  1OPL A;  1WZO A;  3JCM b;  3AT1 B;  3AHU A;  1RUW A;  4DA4 A;  1G2B A;  3M58 A;  4BAC A;  1VQ8 A;  2CS7 A;  1EX4 A;  2DXT A;  4LXC A;  5CK9 A;  4FT2 A;  4RCC A;  3GBQ A;  3EHR A;  2XKO C;  1E6G A;  2ROL A;  4RG2 A;  3CC4 Q;  4KUD K;  3FB9 A;  9ATC B;  2EJF A;  2RJF A;  2VXF A;  3M54 A;  4ZGE B;  2G6F X;  5I21 A;  5DM7 R;  6AT1 B;  1E7O A;  3QYG B;  3JCM W;  4FW1 A;  4EMK B;  4IUU A;  1UTI A;  2FL7 A;  5LJ5 j;  3JCM d;  2PUK B;  1OU8 A;  1M1K R;  2QK0 A;  1QVG S;  2KXC A;  2F1L A;  2AZS A;  4EMH A;  2ATC B;  3QUI A;  3JB9 I;  3MP8 A;  3FJ5 A;  2CP7 A;  3SWN B;  4C92 C;  3CC4 A;  5CKH A;  1W2B A;  3L2W A;  4F7U E;  1UEB A;  5LJ5 f;  1M27 C;  1M90 C;  2M0Y A;  5IHN A;  1OUL A;  1AWW A;  4CC4 B;  2HZY A;  1D3B B;  1ABQ A;  3I9Q A;  2HCK A;  4PK4 A;  3CC2 T;  2KYB A;  2LCL A;  2ABL A;  2EWN A;  2E3H A;  1Q82 U;  1RAH B;  4JRQ A;  1CKA A;  1IRX A;  1X6O A;  2YUO A;  1ZSG A;  5CKE A;  4Z8A A;  1VQ7 T;  1WQ7 A;  2DL3 A;  2C0T A;  1IGQ A;  4M77 G;  5LJ5 e;  2LDM A;  4LE9 A;  1O9S A;  3L2V A;  3RR6 A;  2RQT A;  2CSQ A;  5A0L A;  3OMC A;  4OB2 B;  4CC2 A;  1OQK A;  2KRS A;  1ZSZ A;  1V29 B;  4M77 C;  4C8Q E;  3OYC A;  1TXQ A;  3VS5 A;  2GF7 A;  1YNZ A;  2XI9 A;  3KUF A;  1K0S A;  2IG0 A;  2MI6 A;  1BI0 A;  2FYK A;  2DO3 A;  2XIC A;  3OYL A;  4M78 D;  1I5O B;  4C8Q A;  5ECA A;  3RIR A;  5GMK e;  1N5Z A;  3CPF A;  1AWX A;  4JDS A;  5KH6 A;  5GMK m;  3BDU A;  4M78 G;  3G6E A;  3S3M A;  3OMG A;  3RKY A;  5C6S A;  1WIE A;  1OZ2 A;  4CC7 A;  2JTE A;  2HDA A;  4M78 F;  2V8K A;  1FXX A;  3PMT A;  1Q82 R;  4XU3 A;  1WJR A;  1X69 A;  3EG2 A;  3CCL T;  3CC7 A;  2JXB A;  2RNA A;  3G4S Q;  1YIJ Q;  4XTU A;  1K9M U;  2LJ0 A;  1LVK A;  4FM4 B;  1J3T A;  4WF2 A;  1UB4 A;  4ZTJ A;  3H0H A;  3M59 A;  8ATC B;  1M30 A;  1WXB A;  2NUT A;  3CCV Q;  4J9B A;  3CCU T;  2J06 A;  2G3R A;  3VKI A;  1TSF A;  2DZC A;  1VQL Q;  2I2L A;  2YLC A;  4F7U F;  2D8H A;  2F2V A;  2RPN A;  3LWI A;  3I5R A;  3NHN A;  1BU1 A;  3OYY A;  3OYN A;  3CCS A;  2DIQ A;  4PJO B;  2PQW A;  1KD1 C;  2EGA A;  3ER0 A;  4RTY A;  3ZFJ A;  3VU3 C;  2DET A;  1WNL A;  3NMZ C;  4JJC A;  3OBY A;  2D6F A;  2VXE A;  2DYB A;  3CCM A;  2LCC A;  8AT1 B;  3LWH A;  5KE2 A;  2XG8 D;  3THK A;  4L59 A;  3X24 B;  2DNU A;  1BI1 A;  5GMK i;  4OMN A;  3X28 B;  1Y07 A;  1LOJ A;  2M0O A;  5IT9 E;  2VVK A;  1QKW A;  5HCK A;  3CCM T;  1QCN A;  3PFS A;  1ZSZ C;  4RTZ A;  4A4K A;  3GNF B;  3JB9 H;  2JTF A;  4PJN A;  4HCK A;  5D7U A;  4OB1 B;  1VQ4 Q;  1N8R U;  5GAM e;  3CBO A;  2EYX A;  1N6A A;  5I11 A;  1LJO A;  1WHK A;  1Q95 G;  1B3Q A;  4DOV A;  2CP3 A;  2VC8 A;  2AIR B;  5CO7 A;  3PGG A;  1VQM A;  2NUP A;  1X01 A;  1KIK A;  3QJY A;  4DEX A;  2GTJ A;  2HBP A;  2JT4 A;  2DL8 A;  3L1A A;  1JXM A;  2K9G A;  3OYA A;  1HD3 A;  1M2O A;  1TG0 A;  1KQ1 A;  1YWO A;  2YWW A;  4IUQ A;  1KC8 R;  4OGE A;  1VYV A;  3CD6 A;  2R58 A;  2GCX A;  1VYU A;  1RI0 A;  1SSH A;  1EFN A;  3LW5 E;  2K3X A;  5HK0 A;  4FT4 A;  4M75 C;  4PJO F;  1OPK A;  1GFD A;  1D0Y A;  2L0A A;  4FU6 A;  1U1S A;  4F7U B;  3RUX A;  4AFQ C;  2VWF A;  1YJN A;  5GJW B;  1K9A A;  4JS4 A;  2J6F A;  2NUZ A;  2NUT B;  4E7J A;  4M7A A;  1ZSZ B;  1S1N A;  1ZLM A;  1BYM A;  1KHI A;  2B86 A;  1IHW A;  3U23 A;  1B7T A;  1YIJ A;  3OYG A;  2RF0 A;  3PNW C;  2PVD B;  3EFO A;  1N9S A;  3MEA A;  3G4S A;  2PNI A;  3QJ6 A;  1ZQ1 A;  3H0F A;  1YJ9 Q;  3E2U A;  1VQ5 T;  4FYV B;  1Q86 R;  3TEE A;  4M77 F;  1PG5 B;  2YRD A;  3LLR A;  4BDZ A;  4FYX B;  4IKF A;  1AEY A;  3EFO B;  1M1G A;  4F7U G;  3VRY A;  1YBY A;  2DPP B;  2DVE A;  2RB6 A;  2O9V A;  3I55 T;  4XTW A;  2V1Q A;  2X4Y A;  1B34 A;  3MCA B;  1ABO A;  1MMA A;  4E7I A;  3X26 B;  1YHQ A;  2FHD A;  2KMT A;  1K0X A;  2DD5 A;  5GAO r;  4RMO A;  1I07 A;  4M7D F;  3L2Q A;  3I55 Q;  3MO8 A;  1VQ6 A;  1YWP A;  4C8Q B;  2HQE A;  3J81 E;  4AT1 B;  5GAO l;  1GFC A;  2EVR A;  1JRI A;  2RI5 A;  1G3Y A;  4BI8 B;  3E9G A;  1K8A C;  2KXD A;  3OYF A;  4OMM A;  5IN1 A;  2K6D A;  2R5A A;  1VQN A;  4E7Z A;  3CCQ Q;  2R5M A;  1ACM B;  4M77 D;  1LCK A;  2ZCF B;  4QVD A;  4C0F A;  4A4G A;  4IIM A;  4M7A D;  5J39 A;  2FZK B;  3JCM V;  2DE0 X;  2DFU A;  3JSC A;  4M75 A;  4C92 F;  2EJ9 A;  3EFR A;  4JJN K;  2HL5 C;  2A3L A;  2KRO A;  2C0O A;  2J7I A;  2MMP A;  1UEC A;  2NLU A;  4J7I A;  1YJN T;  4MZT A;  2DBM A;  1I81 A;  2COY A;  4PJO A;  1FMW A;  2V26 A;  1M3C A;  3OYH A;  5D6W A;  4KUI A;  1GCQ A;  4ZN1 A;  2HMA A;  1QVF A;  3EG3 A;  1G8X A;  3MKD A;  3QHS A;  4OMO A;  1ZUK A;  4XTX A;  1VQ5 Q;  4J7F A;  3O8V A;  4L6V 5;  1ZX6 A;  4MMK A;  4J9G A;  4F17 A;  1P92 A;  1AZG B;  2WAC A;  2NWM A;  5FLX E;  1KSW A;  1NYG A;  5KE3 A;  1JJ2 S;  1WI7 A;  3MP6 A;  4PJM A;  5J3B A;  4EMK A;  4NL2 A;  3OYI A;  2DLP A;  2YUQ A;  4PJO G;  4E2F B;  3CMA A;  2LNV A;  4M7D G;  2RHY A;  4AFS C;  5CKF A;  3CCS Q;  2FVU A;  1QCO A;  4OF1 A;  4X9C A;  4DBQ A;  1VQ9 T;  4PLL A;  2CZ7 B;  5KYX A;  3SFM A;  3ME9 A;  1YJ9 A;  3ASK A;  4M7D C;  4PL6 A;  2EQM A;  1K73 U;  4MML A;  4Y92 A;  3X25 B;  4ZTF A;  4HVV A;  1Q81 C;  1W2B S;  4FL6 A;  3CQT A;  2CH4 A;  1YJW T;  2DK3 A;  3C95 A;  2QGF B;  1K73 C;  1YJW A;  2JOY A;  1WHH A;  3QG1 A;  5FWC A;  2O4X B;  4AG2 C;  3V7C A;  5GAN 8;  1VQK Q;  2JM8 A;  1UGV A;  4F7U A;  1WX6 A;  2QAZ A;  1YJ9 T;  4OB0 B;  3HRU A;  2H8H A;  3M0P A;  3JCM P;  1S72 Q;  2K2V A;  2W10 A;  4GBQ A;  4DEY A;  1QVG P;  1V76 A;  1KFZ A;  5FWB A;  5GAM j;  4OMF B;  1YIT T;  3CME Q;  3OW2 P;  4QKU A;  1HYO A;  2DTH A;  4OGC A;  4JJD A;  2M9U A;  4R55 A;  3OY9 A;  2JS2 A;  2E3I A;  2LVM A;  3QBY A;  4C5I A;  1M3B A;  2CT4 A;  3PE0 A;  1MND A;  3WVD B;  4MDX A;  4M7D D;  2AT1 B;  5GAN h;  4QVC A;  4ZGD B;  1RAI B;  3UDC A;  3G71 A;  5FRO A;  1JU5 C;  2FZC B;  3H0I A;  3OYD A;  3FLG A;  4Z88 A;  5FU7 C;  4M7A B;  1HK9 A;  3CCU A;  5LJ3 g;  1K4U S;  2SEM A;  2CP2 A;  3NPF A;  2E1H A;  3URG A;  5LJ5 g;  3OSV A;  2ESW A;  3M57 A;  2DKG A;  1YP5 A;  2C0I A;  3EGU A;  1JJ2 P;  4JJB A;  3P8B B;  1XNI A;  2PTK A;  1D0Z A;  4OMP A;  1K8A U;  2L3S A;  2DL7 A;  3N5B B;  2HSP A;  4A4E A;  2EPD A;  3HRS A;  1PRL C;  4BI4 A; 
#chains in the Genus database with same CATH homology
 5GAN 2;  3CCE A;  4ZGJ B;  4C8Q F;  3PIO A;  2X4X A;  3LWI A;  3OYN A;  3OYY A;  3QPH A;  3OW2 A;  3CCS A;  4RG8 A;  4JLG A;  4M7D B;  2DIQ A;  5L8R E;  2JTM A;  4PJO B;  5GAN d;  5GAM f;  1U1T A;  2E41 A;  2HAX A;  2KVQ G;  2PQW A;  3OQ5 A;  2DZ9 A;  3CXC A;  3MEU A;  1KD1 C;  4HA8 A;  4JRI A;  5J26 A;  3ER0 A;  3ZFJ A;  3A8L B;  4N4G A;  1VQP T;  3VU3 C;  2KY9 A;  4IUT A;  1WNL A;  3L2R A;  2DAQ A;  2HQX A;  1KQS S;  3A5Z B;  3OBY A;  1VIF A;  2D6F A;  2OAU A;  2VXE A;  2RHI A;  1R8O B;  3CCM A;  3J7A F;  3GLX A;  5GAM h;  3M9Q A;  1KC8 C;  2ZPB B;  1G3T A;  1MGQ A;  2LCC A;  2XDB A;  1OI1 A;  2DXU A;  5IAY A;  4M7D A;  3A8M B;  3RES A;  3LWH A;  4JUV A;  1M5Q 1;  4Q5W A;  2RI3 A;  1TH7 A;  1YCY A;  2XID A;  4M75 E;  4OB3 B;  2XG8 D;  5KE2 A;  3CC7 T;  4L59 A;  3X24 B;  4PJO E;  1RL2 A;  3G71 T;  4HKE A;  1BI1 A;  3A8O B;  4BY6 C;  2E70 A;  4A53 A;  5GMK i;  5GAN 4;  4R56 A;  5KCH A;  1JJ2 A;  3CBP A;  4HT9 A;  3CCR A;  3JCM J;  1YIJ T;  4M78 E;  3X28 B;  1Y07 A;  2HD0 A;  2VGN A;  1Q7Y U;  3CCV A;  1LOJ A;  2M0O A;  3OYE A;  4J6X A;  5IT9 E;  2JNG A;  1WJQ A;  1KQS A;  5CKD A;  2KDS A;  3VUB A;  2QEX A;  4XTY A;  3HL8 A;  3CCM T;  2ZPI B;  3PFS A;  2CYZ B;  1B34 B;  2KAF A;  1XQH A;  5CAI A;  2M16 A;  3CCQ A;  1VQL A;  2LTO A;  4A4K A;  3A8H B;  3GNF B;  4VUB A;  4ME7 A;  3JB9 H;  2JTF A;  5GAN 5;  4NOY A;  4JLI A;  2MF2 A;  4OB1 B;  4PLI A;  4C0G A;  5GAN j;  3M4Y A;  4XQ3 A;  2RA2 A;  1EIF A;  3OS2 A;  2QXF A;  5DLO A;  4O5V A;  4L5G A;  4A4F A;  3J80 E;  2VV5 A;  2DXB A;  1N8R U;  2QEX T;  3VYG A;  4Y91 A;  5GAM e;  3HRT A;  2VUB A;  5GAO n;  2EQJ A;  4C92 A;  2L8D A;  2PUO B;  3CBO A;  2H3J A;  3G4S T;  1N6A A;  3GPL A;  1LJO A;  5HY6 A;  3CCL A;  3M56 A;  4HCZ A;  2QDY B;  4DOV A;  2VC8 A;  5GMK l;  3L2U A;  5CO7 A;  3PGG A;  1VQM A;  2P0P A;  2O01 E;  1X01 A;  3JCM h;  3S6W A;  5GAN 7;  3CBM A;  1M8V A;  3QJY A;  3JB9 D;  5CCA A;  4KBM B;  2HBP A;  4ELZ C;  3MET A;  3QYH B;  2GFA A;  4P5N A;  5M9O A;  2FB7 A;  4C8Q C;  3QZ5 B;  3R6O A;  3L1A A;  4M77 E;  3FC3 A;  2JN0 A;  1ZHI A;  4CI0 C;  3JB9 F;  4BDY A;  2EJG A;  4XU1 A;  3JCM e;  3OYA A;  1YI2 A;  4O6J A;  4M7A E;  1KQ1 A;  3WXM B;  4ZN3 A;  4D6W A;  2E6Z A;  4B9W A;  2P4T A;  5KCO A;  2RJC A;  2CZ1 B;  2MWO A;  4IUQ A;  2O4X A;  1NE8 A;  2K5L A;  3HFN A;  4Y28 E;  4OGE A;  3S3N A;  1S72 T;  3DB4 A;  1KD1 U;  2QQS A;  3CD6 A;  2R58 A;  3GNG A;  2GCX A;  3RKW A;  3TU4 K;  1RI0 A;  1OYX A;  3BFM A;  1LNX A;  1N8R C;  1NZ9 A;  2X4J A;  3LW5 E;  3RKX A;  3OS1 A;  2GFU A;  2K3X A;  1FX7 A;  3ZBD A;  2C06 A;  5HK0 A;  4FT4 A;  4M75 C;  4PJO F;  1Q86 U;  2E6N A;  3C12 A;  3G6E T;  3PT9 A;  5CQY A;  1M1F A;  5GAM g;  3KXT A;  4E7H A;  3CEY A;  5GAN g;  2GQV A;  2CGH A;  3MEW A;  4FU6 A;  3OS0 A;  1U1S A;  4F7U B;  3VJP A;  4LDX A;  2KK4 A;  3LGF A;  3RUX A;  1NPP A;  4DOW A;  4NL3 A;  1YHQ T;  5A0G A;  3ZEH A;  4BE0 A;  1G5V A;  4MZM A;  3QSU A;  1YJN A;  4E7K A;  5FRM A;  4C5G A;  5DY9 A;  4N4H A;  4JS4 A;  2D9T A;  3V7R A;  2BUD A;  4E7J A;  4M7A A;  4II1 A;  1O75 A;  3CME T;  1BYM A;  3CCR T;  3CCU A;  4BB7 A;  3CME A;  1XTD A;  4E47 A;  1KHI A;  4GLK A;  5A0D A;  3V7S A;  1VQ7 A;  2OTL T;  5CIU A;  1YIJ A;  2R57 A;  4LDY A;  3OYG A;  3E1S A;  3S3O A;  3JCM Q;  4BE2 A;  3PNW C;  2PVD B;  3HSB A;  4X9D A;  3QZ9 B;  3H6Z A;  2LT1 A;  2LQ8 A;  4XTZ A;  3HHT B;  1D3B A;  3CPW A;  1N9S A;  1H3Z A;  2VYT A;  1UGQ B;  3MEA A;  3G4S A;  1N27 A;  5CKB A;  5D6Y A;  5FRN A;  3BDL A;  2CKK A;  3X20 B;  3CCQ T;  3QJ6 A;  2DTI A;  4MZP A;  2ZZD A;  2XD0 A;  1BIA A;  1ZQ1 A;  3OS5 A;  3MEV A;  5FU7 B;  1KQ2 A;  1KHC A;  1WPY A;  2DXC A;  1VQN T;  2HNI A;  3GF5 A;  3JRZ A;  4C92 E;  3C4S A;  1VQ5 T;  1HXD A;  4C92 D;  1XOV A;  3TEE A;  4M77 F;  3CCV T;  4HCC A;  2F69 A;  4RKU E;  2KQW A;  3JAM E;  3LLR A;  1GXI E;  1M90 U;  4BDZ A;  2Y4Y A;  2LRQ A;  1VUB A;  3TCJ A;  2EQK A;  4C0Z A;  4NS5 A;  1Y7X A;  4IKF A;  4M7A F;  1M1G A;  1UGP B;  4F7U G;  3CCJ T;  1I4K 1;  3HKS A;  1QP2 A;  1ZBX A;  1NJI U;  3KBG A;  1N9R A;  1YBY A;  5FU6 B;  1VQM T;  3UT1 A;  3GOX A;  2DPP B;  2DVE A;  2RB6 A;  3INZ A;  4M75 F;  2D0Q B;  4TVR A;  3I55 T;  4XTW A;  5D6X A;  2QA4 T;  4PJO C;  1DJ7 B;  2X4Y A;  1VQ6 T;  4IUR A;  1B34 A;  2EIF A;  3MCA B;  4OP0 A;  3V8J A;  3NTK A;  4BD3 A;  3OYM A;  1I5L A;  4E7I A;  3EFS A;  1K9M C;  3X26 B;  3C94 A;  4N0A C;  5GAN 3;  1YHQ A;  3FEO A;  3PIP A;  5GAM d;  4KUL A;  2FHD A;  2JVV A;  2KMT A;  2L5Q A;  5AYF A;  2V8J A;  5LL6 S;  4A4H A;  2DD5 A;  2QQA A;  5GAO r;  4RMO A;  1JB0 E;  3HPW A;  4J6W A;  3E19 A;  5C0M A;  4M7D F;  1G3S A;  3L2Q A;  2LX9 A;  3NFC A;  4LDU A;  1NPR A;  4N4I A;  2DEQ A;  3M55 A;  3MO8 A;  3SWN C;  4BE1 A;  4C8Q B;  3QXE B;  1VQ6 A;  2HQE A;  4XK8 E;  2QTX A;  3J81 E;  4J6Y A;  2PU9 B;  4XU2 A;  4C8Q G;  4BY6 B;  2Y4X A;  3CXC S;  3CCS T;  5GAO l;  2XDD A;  3RER A;  1JRI A;  4PKC C;  2RI5 A;  4PNO A;  1G3Y A;  2E65 A;  3E9G A;  3HFO A;  4BI8 B;  5I2S A;  3OYB A;  4EMK C;  1K8A C;  4EDU A;  5HK3 A;  2MAM A;  3OYF A;  2CZ6 B;  5IN1 A;  2R5A A;  2VGM A;  4E7L A;  3I56 T;  2L89 A;  1VQN A;  2B8A A;  3OYJ A;  3VV0 A;  2X35 A;  1QW1 A;  5A2Q E;  2F5T X;  1VQ5 A;  2R5M A;  4FIB A;  1Y96 B;  1VQK A;  4QQD A;  3RMS A;  4M77 D;  2RJE A;  2ZPE B;  3LX7 A;  4EMG A;  1AHJ B;  2E5Q A;  2F5K A;  2ZCF B;  3NTH A;  5LJ5 d;  3LGL A;  3OB9 A;  2RM4 A;  3SDZ A;  4QVD A;  4C0F A;  2QQR A;  1QVP A;  4A4G A;  2EAY A;  4QW2 A;  3EAE A;  4M7A D;  1VQ4 T;  5J39 A;  4IUV A;  1QVF S;  3JCM V;  3CC2 A;  1WGS A;  3JSC A;  4M75 A;  5GAO m;  4C92 F;  1Q86 C;  4PJO D;  1UGR B;  4M78 B;  2EJ9 A;  4XAX B;  5GAO p;  2ZPH B;  2EYQ A;  3EFR A;  4M77 A;  4JJN K;  1X75 C;  2A3L A;  2CZ0 B;  2MMP A;  3M4G A;  3JCM b;  3T9N A;  3AHU A;  2NLU A;  2XK0 A;  3JCM X;  3DKM A;  4J7I A;  1YJN T;  2V8I A;  2YHT A;  3Q1J A;  4MZT A;  3TRE A;  4DA4 A;  1I81 A;  4M75 D;  1VQ4 A;  4PJO A;  3OYH A;  5D6W A;  2WSC E;  3E9F A;  3H8Z A;  2ZPG B;  3NTI A;  3M58 A;  4KUI A;  4BAC A;  1VQ8 A;  4J83 A;  3LYI A;  4ZN1 A;  3DLM A;  2CS7 A;  2EKO A;  3V8L A;  1QVF A;  2DD4 A;  2DXT A;  1QVG A;  5CR2 A;  5CK9 A;  4FT2 A;  3QHS A;  4RCC A;  3OBW A;  5LJ3 e;  1IRE B;  3P8H A;  4HCB A;  4KUD K;  2XKO C;  4RG2 A;  1VQK T;  2RD1 A;  2LQK A;  3F70 A;  3FB9 A;  4XTX A;  4J7F A;  1Q7Y C;  3OA6 A;  2EJF A;  2RJF A;  2VXF A;  3M54 A;  3O8V A;  3QDR B;  4FSX A;  1YIT A;  4ZGE B;  4L6V 5;  5I21 A;  5HKC A;  5DM7 R;  2JUF A;  4MMK A;  3JB9 G;  4QQG A;  4C0D C;  3I55 A;  4RCB A;  2E12 A;  3QYG B;  3JCM W;  1P92 A;  2Y90 A;  2WAC A;  4EMK B;  1BI2 A;  2EFI A;  3QKJ A;  2WSE E;  4IUU A;  2FL7 A;  4IUP A;  2BIV A;  5FLX E;  5LJ5 j;  2PUK B;  4Z02 A;  5KE3 A;  3JCM d;  1M1K U;  1JJ2 S;  2RK2 A;  1QVG S;  3MP6 A;  4XU0 A;  4EMH A;  1M9S A;  5J3B A;  4EMK A;  4C8Q D;  3QUI A;  3JB9 I;  3MP8 A;  4NL2 A;  3OYI A;  1M1K C;  2IVW A;  4MDW A;  2MWP A;  3SWN B;  3CC4 A;  4C92 C;  5CKH A;  4C5H A;  3MHX A;  1W2B A;  3L2W A;  4J5Y A;  4F7U E;  1UEB A;  5GAN e;  3LH0 A;  3BW1 A;  4PJO G;  5LJ5 f;  2PVO B;  3CMA A;  2LNV A;  4M7D G;  3FJP A;  2OTJ A;  1M90 C;  3G7Z A;  3P8D A;  1SSF A;  2L3R A;  2RHY A;  5GMK j;  2QQB A;  4M75 B;  5GAN 6;  3JB9 J;  1VQO A;  5CKF A;  1QP3 A;  2FVU A;  4KT0 E;  5GMK h;  1KG1 A;  1D3B B;  4OF1 A;  4X9C A;  4OVA A;  3FRN A;  3M53 A;  4PLL A;  1VQ9 T;  2CZ7 B;  4N0A A;  2KSS A;  2K5I A;  3SFM A;  5LJ3 d;  3CCJ A;  3ME9 A;  3M5A A;  4JRP A;  1YJ9 A;  3ASK A;  3SD4 A;  4PL6 A;  2EQM A;  4M7D C;  2RJD A;  1K73 U;  2EQU A;  3CC2 T;  4MML A;  3A8G B;  3X25 B;  4ZTF A;  1Q82 C;  1Q81 C;  1BIB A;  1WQW A;  2LCL A;  1W2B S;  4FL6 A;  3CCE T;  2EWN A;  1Q82 U;  4ELY C;  3JCM g;  4C92 B;  2DTO A;  2DK3 A;  1MHN A;  3C95 A;  4JRQ A;  1JBM A;  1YJW T;  1YJW A;  1K73 C;  4LD9 K;  1H64 1;  2JOY A;  5DLQ E;  1X6O A;  1M4Z A;  3QG1 A;  3PTA A;  2O4X B;  3V7C A;  5GAN 8;  2RHZ A;  3CC4 T;  4F7U A;  5CKE A;  3GP8 A;  5CVI A;  1NJI C;  1YJ9 T;  4OB0 B;  3I56 A;  3OSS C;  3HRU A;  4BUG A;  1W4S A;  4M7D E;  3JCM P;  2AHJ B;  2XDP A;  4C0D B;  3PMI A;  2K2V A;  1UGS B;  1VQ7 T;  2OTL A;  3CD6 T;  4JRK A;  1WQ7 A;  4M7A G;  3JCM f;  5GAM j;  4M78 C;  3L2Z A;  5GAO q;  3CPW S;  3QII A;  3MP1 A;  4OMF B;  4M77 G;  5LJ5 e;  1YIT T;  2LDM A;  1O9S A;  1I8F A;  1OZ3 A;  5GAN f;  3L2V A;  4JS5 A;  4V2S A;  2YLB A;  5LJ3 j;  2DTH A;  4OGC A;  3SWN A;  4R55 A;  2M9U A;  3OY9 A;  4LD6 A;  5A0L A;  3OMC A;  4OB2 B;  4M7A C;  3OYK A;  2LVM A;  1Q81 U;  2RHX A;  3QBY A;  2QQ9 A;  3GIB A;  4M77 C;  1V29 B;  4C5I A;  2RK1 A;  4A54 A;  4C8Q E;  3OYC A;  2ZGW A;  2PVG B;  2GF7 A;  3FDR A;  3UPU A;  4M78 A;  2XI9 A;  3VUZ A;  3WVD B;  4MDX A;  3KUF A;  1KC8 U;  2QA4 A;  2RH2 A;  4M7D D;  2IG0 A;  4B9X A;  5GAN h;  4QVC A;  2MI6 A;  4ZGD B;  3UWN A;  1BI0 A;  3UDC A;  2K3Y A;  2K4Y A;  2A7Y A;  3G71 A;  4C5E A;  2FYK A;  3V8K A;  2K57 A;  2DO3 A;  5FRO A;  2XIC A;  4UC4 A;  2P0Q A;  2RI2 A;  1VIE A;  4M78 D;  5FU6 C;  4C8Q A;  3RIR A;  5GMK e;  3OYL A;  3OYD A;  3FLG A;  1PSF A;  3JCM c;  1WJS A;  2YRV A;  5LJ5 h;  1VQ9 A;  4ATO A;  3CPF A;  5FU7 C;  2XU8 A;  2X4W A;  4M7A B;  3SB2 A;  1HK9 A;  1VQL T;  2JZ2 A;  2LC4 A;  4EPC A;  4DQ2 A;  1IZ6 A;  2E64 A;  2ZPF B;  4JDS A;  5KH6 A;  5GMK m;  5LJ3 g;  3BDU A;  1YI2 T;  4M77 B;  4M78 G;  3G6E A;  3DB3 A;  4BI3 A;  3S3M A;  5EG2 A;  3FIF A;  3OMG A;  3RKY A;  4CRI A;  5C6S A;  1BKB A;  1U8R A;  1OZ2 A;  4GY5 A;  2LT4 A;  4XTV A;  4M78 F;  2E1H A;  4HT8 A;  2V8K A;  3URG A;  1FXX A;  5LJ5 g;  3OSV A;  2M1H A;  2WSF E;  3PMT A;  5LJ3 f;  3M57 A;  4XU3 A;  1WJR A;  2DIG A;  3CCL T;  4C92 G;  1BI3 A;  1Y96 A;  2DKG A;  2RHU A;  3CC7 A;  1PSE A;  4LDW A;  1K9M U;  4XTU A;  2QI2 A;  4FM4 B;  2OTJ T;  5CQX A;  3RMQ A;  3QO3 A;  3CMA T;  3OW2 S;  1VQO T;  4WF2 A;  2E10 A;  3P8B B;  2RO0 A;  1XNI A;  1UB4 A;  1S72 A;  2P0K A;  4ZTJ A;  4YTL A;  4J8O A;  5LJ3 h;  3M59 A;  2XHC A;  5I2M A;  1K8A U;  1G3W A;  1FWZ A;  3HP9 A;  4QVZ A;  3DLL A;  3N5B B;  4X34 A;  1Y71 A;  4QQ6 A;  4A4E A;  3BY7 A;  3CCU T;  3HRS A;  3L42 A;  4M75 G;  2G3R A;  3VKI A;  3VYH B;  2BKD N;  2DZC A;  1VQ8 T;  2I2L A;  4LDV A;  2YLC A;  1VQP A;  4F7U F;  2K5F A;  3WVE B;  4BI4 A;  2DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...