3P8DA

Crystal structure of the second tudor domain of human phf20 (homodimer form)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
SEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Medulloblastoma antigen MU-MB-50.72
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8dA00
4Z02A 3QJ6A 2YRVA 2IG0A 4B9WA 2G3RA 3S3NA 5FRNA 2RJEA 2HQXA 4IUUA 3MEVA 3QKJA 4HCZA 4BDZA 2K3YA 3S3OA 3P8DA 4BD3A 1OI1A 3L42A 3PNWC 1G5VA 2RHUA 2LVMA 1N27A 2MWOA 2XK0A 3GOXA 3OYNA 3OYAA 2VYTA 2EQKA 3LGLA 2R5MA 3SD4A 4FL6A 4IURA 4A4EA 1OZ2A 3FC3A 3ME9A 2EKOA 2R57A 4BDYA 1KHCA 2NLUA 1OZ3A 2F5KA 2D9TA 3OYKA 4C5IA 3L2QA 2BUDA 4B9XA 4E7JA 4LD6A 3QBYA 4OVAA 3ZEHA 4E7LA 1MHNA 2LCCA 3OYLA 4GY5A 3KUFA 5IAYA 4NS5A 3PMTA 4UC4A 2X4WA 1WGSA 1XNIA 5M9OA 4IUVA 4IUQA 3OYMA 4A4HA 2P0KA 5C6SA 3PMIA 3OYJA 3FLGA 1OYXA 3LYIA 3NTKA 1WJRA 5KH6A 5J26A 4N4HA 1WJSA 4IUPA 3QIIA 3DB4A 4QQ6A 2EFIA 3FDRA 3OQ5A 3BDLA 3E9FA 4E7HA 2M0OA 4ZTFA 3OYFA 2RHIA 2K3XA 4QVZA 2RJFA 2BIVA 4BACA 2L8DA 3DLMA 4IKFA 2LRQA 3MP8A 4Q5WA 4C5EA 3OA6A 3E9GA 2BKDN 2HQEA 2E5QA 2L3RA 5KCOA 4BE2A 5KCHA 2MWPA 3NTIA 4EDUA 4N4IA 3OS0A 2R58A 2DAQA 2X4XA 2X4YA 4PLLA 3LH0A 2RJDA 2LTOA 3OYHA 4N4GA 5KE3A 2L89A 3NTHA 4QQGA 3C4SA 2GF7A 2RHYA 2RHXA 3L2VA 1WJQA 3MP1A 3Q1JA 4FU6A 3OS2A 2RO0A 3MP6A 5IN1A 4BE1A 2RI2A 2EQJA 3ASKA 1SSFA 3MEUA 4QQDA 4IUTA 2GFAA 3META 3MEWA 2O4XA 3MEAA 2CKKA 2M1HA 4A4GA 3OYCA 3S6WA 2X35A 3DB3A 2XDPA 5KE2A 2GFUA 3CEYA 5J39A 3OYEA 5CIUA 3H6ZA 2LDMA 4II1A 3OYDA 4ZTJA 3OB9A 3L2WA 3EAEA 2FHDA 4C5GA 4L59A 3OYIA 3P8HA 3UWNA 2B8AA 3M9QA 2DIQA 4PLIA 5D6YA 3PFSA 4C5HA 4QW2A 4BE0A 3OMGA 1RI0A 1H3ZA 4PL6A 3UT1A 5D6XA 2O4XB 3LGFA 2DIGA 2RHZA 3OS1A 3LX7A 3MO8A 3OYGA 2EQMA 3S3MA 5FROA 3O8VA 2QQSA 5D6WA 3L2UA 4CRIA 2WACA 2JTFA 3OMCA 2RJCA 2EQUA 3OYBA 3FEOA 2RI3A 2M16A 4X34A 4A4FA 3F70A 5FRMA 4RG2A 4E7KA 3OY9A 3L2RA 2RI5A 2R5AA 2PQWA 4E7IA 3LLRA 2QQRA 5C0MA 2E6NA 3H8ZA 2JZ2A
chains in the Genus database with same CATH superfamily
4M75D 4XTWA 1OEBA 2HQXA 1T0JA 5ECAA 1JO8A 1P92A 3HTRA 4JPBW 2RHUA 3SEMA 1N9RA 3GOXA 2YLCA 4FL6A 1MNDA 4A4EA 3LWHA 5IXFA 4J6XA 3CBOA 4F16A 1B34A 4E7LA 4QVDA 1LVKA 3FRNA 3JB9F 2HKQB 4E6RA 2BZXA 1XNIA 4A4HA 4M75E 4XK8E 2HKNA 1I07A 2DVEA 1D1CA 3FJPA 3QJYA 1FWZA 2JN0A 1BK2A 3TU4K 4CC7A 4RG8A 3E9FA 5L23A 3FJ5A 4RTUA 2KBTA 5CR2A 1QVGA 2RHIA 3RDVA 4OB1B 2X3XD 4LUEA 2X4YA 2VWFA 4M75G 2YUNA 6AT1B 3GF5A 1D3BB 1IREB 5KYYA 2RHXA 2CP0A 4DOVA 1VQ6Q 5FW9A 3H0IA 2E5KA 4QQDA 1VQ8T 2ED0A 3OYCA 2K7AA 2DLPA 1S72A 1TUCA 3CEYA 2M0YA 4FT4A 3MJXA 2HBWA 2LNHB 3M56A 1VQ7Q 3EFSA 1KFZA 3ZL7C 1IRXA 2FZKB 2RHZA 2EQMA 1PRMC 2I2LA 2GNCA 1M5Q1 3FEOA 1MV3A 3SDZA 2O88A 4RG2A 1E6GA 2PQWA 4ZN3A 3RESA 3ULRB 4GLMA 3CD6Q 3GNFB 2IIMA 1KIKA 2NWMA 9ATCB 1NBEB 4C0GA 1K9MC 3V8JA 1Q81C 2J6FA 2EQIA 2FL7A 3JCMX 1VQ4A 3RERA 2K5LA 2K9GA 4PJOF 1BU1A 1QWFA 1UHFA 4M78E 1WGSA 1VQNT 1WFWA 2P0KA 3M53A 1OYXA 2KROA 1VQ9Q 4AFZC 5J26A 1YI2T 1NJIR 3DB4A 4PJMA 3CCJQ 1T0HA 2HQHA 5GANd 4QVZA 1Y71A 2RJFA 1Y57A 3DLMA 2C0OA 4M75B 1WNLA 4DEYA 5KYUB 4EIKA 1WDXA 4BE2A 4C8QA 3JB9J 3WVDB 1D1BA 3C12A 3REAB 3RKXA 1G3SA 4M7DC 2CSIA 3ER0A 4XU1A 4LNPA 4J6YA 4OB2B 2JM9A 1KQSP 1BI2A 4AT1B 5KYXA 1KD1U 1ZHIA 5GAMg 2K5FA 3V8LA 2LT4A 2E4HA 4NOYA 1VYVA 3L2WA 3VS0A 4QW2A 1YWPA 1PSEA 2EGCA 3CCQQ 2O4XB 3J7AF 1YHQQ 2P0QA 2RQRA 2D8JA 3OW2A 1OOTA 5GAOq 3OYBA 2BE9B 4X34A 1JBMA 2L2PA 1WHJA 5GAMe 2QQRA 4HCCA 1DJ7B 2J06A 2MYSA 3VU3C 2YRVA 1VQ9A 1UUEA 1YJWQ 1HSQA 1HD3A 2NUPA 2QAZA 4AFQC 3CCJA 2W0ZA 1KQ2A 1K0XA 3LGLA 3PTAA 3CC2A 3EHRA 2EGAA 2QTVA 3CCRQ 1BIBA 2D8HA 4C5IA 3C0CA 4FIBA 1HYOA 2LCCA 4GY5A 3KUFA 4BB7A 8ATCB 5M9OA 5GAMj 4PFPA 1W6XA 1K73U 1C0MA 3UF4A 2P0PA 1S72T 4M7DE 1WHHA 1PNJA 4M78B 3BDLA 1QVFS 1M2VB 1QQJA 2E64A 3GNGA 2K3XA 2QG9B 5GMKe 2FG0A 1WXBA 4PKCC 1KD1C 2DPPB 2V8JA 1CKBA 2CYZB 2F2XA 5HKCA 1N8RC 2MWPA 3JCMc 1ZBJA 1RL2A 2DNUA 2PVDB 2RJDA 5CVIA 3CCQA 1XJWB 1YHQA 5FU7C 2C0IA 1OPLA 3C4SA 4M7DG 2RHYA 3X28B 2ZZDA 5GANg 3L2VA 1D0ZA 4R55A 2JXBA 1I5LA 1H3HA 2DO3A 4KRTA 3MEWA 2KEAA 2SRCA 1W70A 1JEGA 2CT4A 3CCUQ 4KULA 4Z88A 4OMFB 1B07A 1O75A 2YRCA 5GMKj 4DQ2A 1LJOA 2YSQA 3M4GA 3P8HA 3I55A 1UB4A 1ARKA 1I8FA 1RAIB 4C0ZA 3T9NA 1VQ4T 4OB0B 2EIFA 1I1JA 5CKEA 3CMAA 3ZFJA 3QUIA 5GANe 3NHNA 2ZPIB 5D6WA 3CCRA 3KFVA 2L5QA 4JRIA 2NUZA 3M0PA 2DL4A 3L2RA 2K6DA 4RCBA 1TS9A 1RABB 3QDFA 2JZ2A 1BCOA 3V7RA 2EJGA 2OTJQ 4Z02A 2JTMA 1VQMQ 3TSWA 2YUQA 5FRNA 1UE9A 2ED1A 2J6OA 3AT1B 1K73C 2K3YA 4JRKA 3X26B 1FXXA 1M3CA 5FU6C 2L3PA 1AWWA 4OMLA 1M27C 1ZSZB 3OYNA 5GANj 3CC7A 4FYYB 2ZPHB 1EFNA 2ROLA 3GPLA 2VB6A 2F5KA 1NEBA 4HVVA 3GBQA 1WA7A 3J81E 3VS5A 4UC4A 5GAN4 1VQLQ 3VYHB 1TSFA 2YWWA 4HVWA 4XU2A 3HSBA 1NLPC 3G4SA 3RIRA 1NYFA 3LYIA 4EMGA 1YIJA 2QTXA 3M0RA 1WIEA 2O31A 2CZ7B 2OAWA 1B34B 3X20B 2EBPA 1GCPA 3PE0A 1BYMA 3BW1A 3VRZA 2HD0A 3HRUA 4Y92A 1X6BA 5KCOA 4N4IA 1W1FA 4M7DB 2QEXA 1UHCA 2LQNA 4FSSA 2JTEA 1K9AA 2Y4YA 5KYUA 2XDBA 2ZPEB 1PD0A 2KXDA 3QDRB 3GIBA 3OS2A 2ABLA 5IN1A 3MEUA 4X1VA 3HPWA 2E12A 1K8AU 2D1XA 1VQ9T 4RTYA 1VQMA 2Y90A 1M90R 2AHJB 1QWEA 3G1JA 1KC8R 3OB9A 5KYYB 3CCJT 1QP3A 2EVRA 3OYIA 3UWNA 4PLIA 2PVOB 2CH4W 1JQQA 2CH4A 2NUTA 1ABOA 2MF2A 1VQPQ 2CUDA 3CC2T 5D6XA 2CP2A 4MDWA 3OYGA 1W2BS 7AT1B 1SHGA 4O6JA 2WACA 3JCMP 1K76A 4KT0E 2XHCA 3JB9D 5FRMA 2C0TA 3JSCA 2GQIA 1WX6A 2P84A 3LH5A 5GAN8 2XG8D 1SHFA 4EMHA 3V7CA 2EYZA 3CXCA 2EYYA 2CT3A 3P8DA 2LCLA 5CAIA 2J05A 4ZGEB 2VYTA 2EQKA 5GJVB 2PUOB 1IGUA 1YCSB 2KNBB 3D7SB 2HL5C 1NEGA 1A0NB 2NLUA 1FMKA 3CCQT 1YHQT 1MMDA 2FPEA 2KVQG 3EG1A 2EYWA 4NS5A 4JJBA 1ZUKA 1YJNA 2P4TA 4FSXA 2GCXA 4ESRA 1U8RA 3OYJA 2KR3A 8AT1B 4J6WA 1MGQA 3PT9A 4ELYC 4PJOC 2LP5A 1IO6A 1M90U 5LJ3h 1O9SA 1KC8U 2CP5A 2HBPA 2LQ8A 5LJ5h 3GP8A 4F7UF 3JB9G 3I55T 1WHMA 2DEQA 3JAME 1K8AC 3M54A 4NL2A 1VQKQ 2DD4A 1WHLA 2OAUA 2LT1A 4M78A 2F2VA 5KCHA 2LJ1A 3CMAT 1EIFA 2DTHA 1G3YA 1VQPA 3CCRT 3QSUA 2FPFA 3EG9A 3P8BB 3QHSA 4DBRA 2PZ1A 1Q82R 3MP6A 4OF1A 2EKHA 1QVFP 4CI0C 3META 1TWBA 2CKKA 5DM7R 2RM4A 3H0HA 1JJ2A 5CIUA 2LDMA 4II1A 2Z0WA 1R0CB 2DEUA 2FZGB 5D6YA 4JLIA 3CCVQ 2HSPA 4BE0A 1QCNA 5KYXB 1ZUUA 5CQXA 5FROA 1SEMA 1VQNA 4PJOD 2MMPA 1YBYA 1WI7A 1X69A 4DEXA 1AEYA 4MDXA 3U23A 3AHUA 4E7KA 2DXBA 1U5SA 2IPOB 1Q86U 2E6NA 1YIJT 3O5ZA 2A3LA 5DLQE 3HL8A 2MCNA 3MHXA 1FMWA 4LD9K 3CCUT 1NYGA 4WTOB 1Y7XA 2DD5A 4XTXA 3JCMV 4Z89A 2RA2A 2KQWA 1VQKA 4XTUA 4PJOE 2QEXT 2DX1A 1WYXA 2A08A 4OVAA 3CC4A 1ZSZA 1RAGB 2NUPB 4JJCA 5AT1B 3HRSA 1W4SA 1Q82U 4IIOA 1QKXA 4HVUA 1UGVA 2YLBA 3LWIA 1WJRA 2KE9A 3H0FA 2WSFE 2DE0X 2PUKB 3QIIA 1CKAA 2EFIA 4PJOG 1VQMT 2HCKA 1LPLA 2QI2A 2MIOA 4KH0B 1JB0E 1M1KU 3JRZA 2JOYA 2BKDN 2E5QA 3CCVA 1OU9A 2K2VA 2DL8A 3NTHA 2COZA 4C92F 4FYWB 4OGCA 2JT4A 4M7DA 1GRIA 2M51A 1WQ7A 2PNIA 3WVEB 4DBFA 3OYYA 4J9BA 1SSFA 2X35A 4M78C 1VQOQ 1WLPB 1Q86C 4HKEA 2NYSA 4J9HA 3VV0A 3CCEA 5LJ3d 2DL7A 2HL3A 1QP2A 5LJ5d 4D8KA 4RUGA 4J7FA 2JS0A 2EQUA 1H641 4DBQA 1YJNT 3EGDB 2RQWA 3NPFA 3G7ZA 3V8KA 1NPRA 1TUDA 4BDZA 3QZ9B 3S3OA 2DYIA 1W2BP 1M4ZA 1N27A 1TU0B 3TSZA 3OYAA 1ABQA 3NMZC 2A0FB 2R5MA 4J9CA 4DOWA 1G3WA 1VQPT 1M1KC 1R8OB 4M78D 2L3QA 1PRLC 1M30A 3I56Q 2YXYA 4IUQA 3VYGA 2QQBA 1YN8A 4PJOB 1D0XA 2X9HA 2FVUA 1V1CA 3V7SA 1PKTA 4ZN1A 2ZPBB 4AMCA 5L8RE 1YNZA 4F7UA 1ACMB 3QYHB 4ZTFA 3OSSC 1ZSZC 2BIVA 3MP8A 2FRWA 3CMEQ 2LJ3A 2FO0A 3RUXA 2RPNA 3NTIA 3FIFA 2K5IA 2W10A 1OU8A 4KBMB 3JCMd 1VQ6A 4KGXB 4JJNK 3E2UA 2A37A 4HT9A 4MMLA 2RO0A 4XQ3A 2RI2A 5I21A 1ZX6A 2M1HA 4C0DC 4A4GA 1AVZC 3M57A 3A8HB 5D7UA 4JLGA 1SG5A 3H6ZA 4M78G 3OYDA 2BZ8A 1R0BG 1VQ7A 1KQSA 1JXOA 1IHWA 2BZYA 1Q7YR 3CPWP 2YUPA 3OMGA 3PGGA 4HCBA 2QGFB 4J9GA 2DIGA 4NL3A 3OS1A 1VQKT 3KBGA 2JTFA 3OMCA 3CC4T 2DXUA 4A53A 1X6OA 2FPDA 3OY9A 3CD6A 2OTLQ 2NUTB 4M4ZA 3PIPA 2DILA 4KGZB 2RJEA 4IUUA 3SHWA 2QA4Q 4M75F 4PJLA 1OI1A 5GMKm 1G5VA 4OMQA 4KUDK 4M77F 5I22A 1FYNA 1T3SA 3CCVT 3R6OA 1KHCA 4E7JA 4R56A 3QBYA 1VYUA 5LJ3e 2RMOA 1NJIU 3X25B 3M0TA 4LE9A 2JVVA 1QKWA 2XMFA 3NTKA 5DLOA 3C95A 4M7DD 5GMKl 1B3QA 3A8MB 2XU8A 1BI0A 1IB8A 3KXTA 2EAYA 4VUBA 4JZ4A 2DVJA 1M8VA 3CCET 1AOJA 5GAN5 4EDUA 5LJ3f 3OS0A 4XTVA 1V29B 2LTOA 3QWXX 5LJ5f 4JZ3A 3BE3A 3EFOB 5IT9E 3OBWA 2OX7A 3CCMQ 4TVRA 1T3LA 2V8KA 1C1AA 4BE1A 4JUVA 3X24B 4LXCA 2GFAA 4PJNA 1Z9ZA 4FYVB 2COWA 5KE2A 4N0AA 3QPHA 3EG9B 4ZTJA 2X3WD 4BI4A 5HY6A 1RAFB 3EG0A 3VS6A 1YJ9Q 1EZZB 2LCSA 3SB2A 3L1AA 3TREA 5HK3A 1G3TA 2V1RA 2DZ9A 1MUZA 4RKUE 3RKWA 2WSEE 2DKGA 3M55A 2K4YA 2DERA 1VQ5Q 2RI5A 2R5AA 1KJWA 5HCKA 3JCMe 1QLYA 1PSFA 4B9WA 1YJWA 1NJIC 3N5BB 4L6V5 3TCJA 3EGDA 1BIAA 2ATCB 3PNWC 2E3HA 3I35A 5CKBA 2CP6A 1F1BB 3VS3A 2EKOA 3CCLQ 1OZ3A 3ZEHA 2CZ1B 2KMTA 2EYXA 1YFNA 1GBRA 3RNJA 1VQ6T 3JCMf 2X4WA 4OMMA 4JS5A 2QXFA 2E41A 2JMAA 2EYQA 3JCMQ 3HFNA 4Y28E 2H3EB 4QQ6A 3JCMJ 2VXEA 3OQ5A 4CC4B 4PJOA 1VQ7T 3OYFA 4F7UE 4IKFA 4Q5WA 2DJZA 5CCAA 4X9CA 2VC8A 4PK4A 1Y0MA 3M4YA 3RBBB 4N4GA 4OMPA 1WZOA 3TVTA 1N9SA 3Q1JA 4FU6A 3VRYA 2IVWA 4F7UG 3CD6T 4C0DB 2L0AA 2BTTA 3I56T 4RTVA 3CCUA 4F14A 1ZA2B 2VVKA 3A1PA 2ROTA 4WF2A 1SPKA 3H9NA 2COYA 3M59A 2YDLA 1UGRB 1N5ZA 2AT1B 3PVQA 1E7OA 1XOVA 3E19A 3HP9A 3MO8A 4MZPA 4RTZA 1AD5A 3CCLA 2JW4A 1IZ6A 4AFSC 2QGGA 5IH2A 2CP3A 4N0AC 4JRPA 4HT8A 2OTJA 2AKKA 5EC7A 2KYBA 3E1SA 3QZ5B 1VQ8Q 1UGQB 3JCMW 1G83A 2XI9A 4M77A 3UA6A 2GBQA 2RQTA 2DFUA 2R57A 4QVCA 1MV0B 1PWTA 3OYLA 3RKYA 1VQLA 4IUVA 4LDYA 4OMOA 5FWCA 4Y91A 1GFCA 1X2QA 4QT7A 2FRYA 1VOMA 2J7IA 1E6HA 4LDVA 1H92A 2K3BA 3TQ7P 1H8KA 2QA4T 1OX9A 2DBKA 2LX7A 2X51A 4J9FA 4OB3B 1TOVA 1FMVA 3OSVA 2HQEA 1M1FA 2AZVA 2DRMA 4PLLA 1I4K1 1BKBA 4L5GA 2CP7A 5KE3A 2L89A 3UATA 4F7UB 4BUGA 3SWNA 4C92E 1X27A 1RADB 1NM7A 4WCIA 1HK9A 1K1ZA 2AZSA 3EFOA 4IUTA 4J83A 2XICA 2F5TX 4MZTA 4FCYA 2CSQA 1VIEA 2HDAA 1YJWT 5I2MA 3FB9A 3OYEA 3M5AA 3RMSA 1WXUA 2FHDA 4ORZA 4D6WA 2L3SA 4C92G 2DJQA 4JRQA 3PFSA 1QVFA 4P5NA 2DM1A 3CPWS 2RF0A 3M0SA 4FW1A 4PL6A 3JB9H 5GAMh 2K57A 3S3MA 2G6FX 5EG2A 2E3IA 4A4FA 2KY9A 2HAXA 3CCMT 2D0NA 4B6MA 2J6KA 4X9DA 1V76A 1AZEA 3QJ6A 1RI9A 3MCAB 2C06A 1LCKA 2DF6A 3MEVA 2P4RA 2DBMA 1MMGA 4M7AF 4E7SA 2EJFA 3SD4A 2KYMA 2V8IA 4LUDA 3C94A 1G2BA 2D9TA 2BUDA 2VASA 1K0SA 4LD6A 4JS4A 4EMKA 5FLXE 5GAN2 2XDDA 1AHJB 4M77C 4C8QF 3A8GB 5CKHA 3REBB 3FLGA 4JJDA 2D0QB 1NE8A 1OX8A 5GMKh 5A2QE 1VQ5T 5KH6A 4FM4B 4N4HA 3TEEA 1AT1B 3M58A 1M90C 4PNOA 1KC8C 3G71Q 2ENMA 1K9MR 3UPUA 2L8DA 2QQAA 1Q81R 4J9EA 1Q95G 1ZQ1A 2L3RA 3OW2S 2ZGWA 5GAOn 3VUBA 3CCLT 4QKUA 5GJWB 4O5VA 1SRMA 1WJQA 2DA9A 4IIMA 2OTJT 2DXCA 3ASKA 1QCFA 4OP0A 3PVLA 1X2KA 2DETA 1NZ9A 3DB3A 2XDPA 3IQLA 4C92B 2DTIA 2KK4A 5GANh 4RTTA 5A0DA 3SWNC 4C5HA 4M77D 1RI0A 1BB9A 3UT1A 3HKSA 4JDSA 2YT6A 4C0FA 3HRTA 2RJCA 1PHTA 2ZAEA 1GBQA 2M16A 1VQLT 3CBMA 1I5OB 5C0MA 3JCMb 3VUZA 3ZBDA 2E65A 2LQWA 3EG2A 2EW3A 3QKJA 2E70A 4LDXA 1KK7A 1K9MU 5I2SA 1YITQ 1Q81U 3L42A 1PKSA 4M77E 2LVMA 3G71A 2XK0A 2VV5A 1TH7A 4GBQA 3EG3A 3CCSQ 1VQ4Q 2ZCFB 1KHIA 4F17A 3SFMA 1BCMA 1YWOA 1QVGP 1W2BA 4ELZC 2YHTA 1Q82C 5KYWA 5GAMd 1JXMA 4CC2A 5C6SA 4OMNA 4M77G 4F04B 3A8OB 4ZGJB 5IHKA 1M2OA 1UTIA 4BY6B 3PIOA 2M02A 1KSWA 1OULA 1OQKA 4ZGDB 4EMKC 1YP5A 2FZCB 1BBZA 4C5EA 3M0QA 1AWOA 2JNGA 1UGPB 2RK1A 2R58A 4LN2A 4K11A 3OYHA 2K2MA 1YCYA 2V1QA 1B7TA 1PCXA 5GAN6 2I0NA 1VQOA 2FB7A 1RLPC 3S6WA 4XU0A 2XKOC 5FWBA 1S1NA 5I11A 2B86A 4C5GA 1D1AA 5LL6S 2B8AA 2DIQA 1KD1R 1HJDA 1YITA 4FYXB 1N8RR 2CGHA 2CZ6B 4RTXA 5CO7A 2JS2A 1UECA 1K4US 3CCSA 3I5RA 3EGUA 1GCQA 3VS4A 3HFOA 2HSEB 1R77A 1AWXA 3MPUB 4AG2C 3CPWA 2F1LA 3LLRA 3RMQA 1M3BA 2IG0A 1PD1A 1U1TA 1OPKA 2G3RA 2QDYB 4E2FB 2BE7D 2KDSA 4PFZA 4M7AA 4OGEA 4LDUA 1FX7A 5GAN7 4A4KA 1UJ0A 1VIFA 1GL5A 5AYFA 3NGPA 4XAXB 1QVPA 5HK0A 1WHKA 2KRNA 2DL5A 2LJ0A 1UG1A 3CC2Q 4B9XA 2A28A 1MHNA 3A8LB 4ANJA 4M77B 5LJ3g 1G8XA 3I56A 5IAYA 5GAOm 5LJ5g 4PJJA 1ZBXA 3HHTB 2MI6A 2GGRA 5CQYA 4BI3A 1K73R 4MZMA 2M0OA 2X4JA 3CMEA 2VUBA 2RQVA 4BACA 1N8RU 2LRQA 2F69A 2ZPFB 3THKA 4XU3A 2YUOA 2QASA 5GAOl 3LH0A 1UEBA 5LJ5e 1SF9A 2MOXA 2O2OA 2FYKA 3I5SA 3CXCS 2EQJA 3A5ZB 5GAOp 1JU5C 1X75C 2GTJA 4EPCA 1Q7YU 3INZA 3BFMA 4R0KA 3OW2P 3SWNB 2E10A 3EAEA 2XD0A 5DY9A 3G71T 4C92A 2VKNA 5LJ3j 3I55Q 3CBPA 1H3ZA 2XIDA 5LJ5j 1VYTA 3CMAQ 2EJ9A 2KGTA 1UGSB 1IHVA 1UJYA 2OTLA 3BDUA 1M8MA 1VA7A 2VGNA 1TUGB 1UDLA 5IXBA 2RQUA 5GAMf 2RNAA 4PFOA 2M9UA 3JCMg 2QA4A 1WXTA 1RAAB 3G6EQ 4HCZA 1TXQA 2RN8A 4A63B 4GLKA 5GAN3 3L2ZA 1GCQC 1UFFA 2DL3A 4HCKA 4ME7A 2LNVA 4J9DA 4DBHA 5KYNA 1M1GA 1RAEB 1I81A 1WQWA 3GLXA 1XQHA 1D0YA 1Y96B 2FEIA 3CC7Q 3MKDA 2DYBA 1AZGB 1D09B 2CDTA 3EGXB 2MK5A 5A0GA 4M78F 4M7AC 1KQ1A 4XTYA 1HXDA 4RCCA 4D8DA 3PMIA 1JJ2S 4KUIA 3I9QA 2JMCA 2D6FA 1KG1A 1VQOT 3G4SQ 4HXJA 5CK9A 2PVGB 1YIJQ 4MMKA 1D3BA 3URGA 1WPYA 2O9SA 2WSCE 4EMKB 1QCOA 4C8QC 1PM3A 3LW5E 3OBYA 1ZUYA 1Q7YC 2DZCA 3E9GA 4YTLA 1YITT 2RD1A 1U3OA 3A98A 4DA4A 2DAQA 2K79A 3CCMA 2QEXQ 3CCST 1Z9QA 2CS7A 1MNEA 1TG0A 1TTHB 3EFRA 3UA7A 3MEAA 4J9IA 3VS2A 1RAHB 2GFUA 5A0LA 3OS5A 2F2WA 2KT1A 3G6EA 4L59A 3R6NA 1MMAA 2KT8A 3JB9I 1K8AR 1YJ9A 2LQKA 4M7AD 1XTDA 2LMJA 5GANf 2KI7A 3WXMB 2HZYA 3L2UA 4CRIA 2O01E 1GXIE 3J80E 2ZPGB 2AIRB 3H41A 1VQ5A 2ECZA 2RI3A 3F70A 4C8QD 2YRDA 3CQTA 3O8VA 3H8ZA 2PTKA 2CZ0B 4Z8AA 4C92C 2DRKA 1X6GA 1BI1A 1J3TA 3S3NA 2RK2A 2KSSA 1M3AA 2CREA 1QW1A 2AK5A 1NLOC 3EHQA 3CMET 1U1SA 4M7AE 1N6AA 2SEMA 4RMOA 4IURA 4A54A 1OZ2A 3ME9A 3VS1A 2VXFA 3L2QA 2EGEA 1AWJA 1LOJA 3RR6A 2QQ9A 2E6ZA 2CUBA 2QDLA 4RTWA 3PMTA 4C8QE 1QVGS 1WHGA 4M75A 2DMOA 2E1HA 1PG5B 4M7AG 1YJNQ 2QK0A 3BY7A 4IUPA 2HNIA 3QXEB 3FDRA 4M7DF 1OV3A 2QYZA 4J7IA 1Y07A 5J3BA 3VJPA 5KYWB 5IHIA 1RLQC 2DXTA 3OA6A 1ZA1B 4C8QG 5GAOr 2KAFA 1X43A 2X4XA 4C92D 1MMNA 2A36A 2GF7A 4XTZA 2EPDA 2A7YA 4J5YA 2OTLT 3MP1A 1NPPA 3JV3A 2AKLA 2EWNA 2O4XA 4BY6C 4KH1B 4AFUC 3VKIA 1X01A 4KGVB 3M9QA 1NG2A 1SRLA 4E47A 1RACB 1M9SA 2MPXC 3CXCP 2JJ9A 2DTOA 1VQNQ 2HEQA 1I0CA 4J8OA 2LX9A 1PC0A 3DKMA 1GFDA 4E7IA 4LDWA 1YI2Q 2JUFA 1VQ8A 4V2SA 4HA8A 3QYGB 1Q86R 2V26A 4BD3A 2GTOA 1IGQA 4FW2A 2RH2A 2O9VA 2MWOA 1U06A 1VUBA 3FC3A 2KRMA 4BDYA 5IHNA 4E7ZA 3OYKA 1QMCA 1SKUB 4M7AB 4FT2A 5GMKi 1M2VA 5CKDA 5FU7B 3CC4Q 1Y96A 3NFCA 3OYMA 2H3JA 2KXCA 4AG1C 3VS7A 1IXDA 3EGXA 1EX4A 1KQSS 1WJSA 3DLLA 2KRSA 4C8QB 4ATOA 4E7HA 3EH2A 4ZNXA 2VGMA 3G6ET 3QG1A 1YJ9T 3EH1A 4M75C 1M1KR 2RB6A 1JJ2P 1ZLMA 4QQGA 2JM8A 3CC7T 2OI3A 1LNXA 2LZ6B 1JRIA 2MAMA 2PU9B 1ZSGA 3M0UA 1YI2A 2H8HA 2OJ2A 4CC3A 5J39A 3G4ST 1C6VX 5CKFA 3QWYA 3QO3A 1RUWA 5FU6B 3CCEQ 2Y4XA 2LC4A 3LGFA 3LX7A 2QQSA 3JCMh 1CSKA 2ESWA 4BI8B 2GQVA 3CPFA 3UDCA 1BI3A 2DK3A 1SSHA 2HMAA 1S72Q
chains in the Genus database with same CATH topology
2XG8D 1PSFA 4M75D 2IG0A 4XTWA 1U1TA 2G3RA 3V7CA 2QDYB 4B9WA 2HQXA 4EMHA 3N5BB 3CXCA 4L6V5 2KDSA 3TCJA 4M7AA 4OGEA 3P8DA 4LDUA 1FX7A 1BIAA 5GAN7 4A4KA 2LCLA 3PNWC 1P92A 1VIFA 5CAIA 2RHUA 4ZGEB 1QVGA 1N9RA 5CKBA 5AYFA 3GOXA 2VYTA 2EQKA 2YLCA 4FL6A 2PUOB 4XAXB 4A4EA 3LWHA 1QVPA 5HK0A 2EKOA 4J6XA 2NLUA 3CBOA 1OZ3A 3CCQT 4B9XA 1B34A 1YHQT 3ZEHA 4E7LA 2CZ1B 2KVQG 4QVDA 1MHNA 3A8LB 2KMTA 4M77B 5LJ3g 3FRNA 3I56A 3JB9F 5IAYA 4NS5A 1VQ6T 3JCMf 2X4WA 5GAOm 1XNIA 1YJNA 5LJ5g 4A4HA 2P4TA 4FSXA 4JS5A 2GCXA 2E41A 2QXFA 1ZBXA 3HHTB 1U8RA 3OYJA 2EYQA 4M75E 4XK8E 2DVEA 3FJPA 3QJYA 4J6WA 1FWZA 1MGQA 2JN0A 2MI6A 3HFNA 3PT9A 4Y28E 4ELYC 3JCMQ 4PJOC 4QQ6A 1M90U 3TU4K 5LJ3h 5CQYA 2VXEA 1O9SA 4BI3A 3JCMJ 1KC8U 1YJWA 2HBPA 3OQ5A 2LQ8A 4MZMA 4RG8A 3E9FA 4PJOA 5LJ5h 2M0OA 5CR2A 3OYFA 2RHIA 2X4JA 4F7UE 3GP8A 3CMEA 2VUBA 4BACA 4F7UF 3JB9G 3I55T 2DEQA 4OB1B 3JAME 2LRQA 4Q5WA 2DJZA 3M54A 4NL2A 5CCAA 1N8RU 2F69A 4X9CA 1K8AC 2DD4A 2VC8A 2OAUA 2LT1A 2ZPFB 4M78A 5KCHA 4XU3A 3CMAT 1EIFA 2X4YA 2DTHA 3M4YA 4M75G 1G3YA 1UEBA 3LH0A 5GAOl 1VQPA 4N4GA 5LJ5e 3GF5A 3CCRT 3QSUA 1D3BB 3P8BB 1IREB 3QHSA 2RHXA 1N9SA 4DOVA 2FYKA 3Q1JA 4FU6A 2IVWA 3MP6A 4OF1A 4F7UG 4C0DB 3CXCS 3CD6T 2EQJA 4CI0C 3I56T 4QQDA 1VQ8T 3A5ZB 3OYCA 3META 3CCUA 2CKKA 5GAOp 1X75C 4EPCA 5DM7R 2RM4A 1S72A 1Q7YU 3INZA 3CEYA 1JJ2A 3BFMA 5CIUA 2LDMA 4II1A 4FT4A 3SWNB 4WF2A 2E10A 3EAEA 3M59A 2XD0A 3M56A 5DY9A 5D6YA 1UGRB 3EFSA 4JLIA 3G71T 4BE0A 4C92A 5LJ3j 3CBPA 1H3ZA 1XOVA 2XIDA 3E19A 5LJ5j 2RHZA 3HP9A 3MO8A 4MZPA 2EQMA 5CQXA 5FROA 1VQNA 2EJ9A 3CCLA 1IZ6A 4PJOD 2MMPA 2I2LA 1YBYA 1UGSB 4N0AC 4JRPA 1M5Q1 3FEOA 3SDZA 2OTLA 3BDUA 4MDXA 3AHUA 4RG2A 4E7KA 2DXBA 2VGNA 4HT8A 2OTJA 2PQWA 5GAMf 1Q86U 4ZN3A 3RESA 2E6NA 2M9UA 1YIJT 3JCMg 3E1SA 2QA4A 3QZ5B 5DLQE 2A3LA 1UGQB 3GNFB 3JCMW 3HL8A 2XI9A 4HCZA 3MHXA 4LD9K 3CCUT 4M77A 4GLKA 5GAN3 3L2ZA 4C0GA 1K9MC 3V8JA 1Y7XA 2DD5A 4ME7A 1Q81C 4XTXA 3JCMV 2LNVA 2FL7A 3JCMX 1M1GA 2RA2A 1VQ4A 1I81A 1WQWA 2KQWA 3GLXA 2R57A 1XQHA 4XTUA 2K5LA 1Y96B 1VQKA 3RERA 4PJOE 2QEXT 4QVCA 4PJOF 4OVAA 3CC4A 3OYLA 3RKYA 3HRSA 1W4SA 1Q82U 1VQLA 4M78E 1WGSA 4M78F 5A0GA 4M7AC 1KQ1A 4XTYA 4IUVA 4LDYA 1VQNT 1HXDA 4RCCA 2P0KA 3LWIA 2YLBA 3M53A 3PMIA 1JJ2S 1OYXA 4KUIA 4Y91A 1WJRA 2WSFE 2D6FA 1KG1A 1VQOT 5J26A 5CK9A 1YI2T 2PVGB 2PUKB 3QIIA 3DB4A 1VQ7T 1NJIC 4MMKA 2EFIA 4PJOG 1D3BA 1VQMT 3URGA 1WPYA 2QI2A 2WSCE 4LDVA 4EMKB 2QA4T 5GANd 4QVZA 1Y71A 2RJFA 4C8QC 3DLMA 1JB0E 1M1KU 1WNLA 3JRZA 3LW5E 4M75B 3OBYA 4OB3B 1Q7YC 2DZCA 3E9GA 2JOYA 4YTLA 2BKDN 1YITT 3OSVA 2HQEA 2E5QA 2RD1A 3CCVA 4BE2A 2K2VA 1M1FA 4C8QA 4DA4A 2DAQA 3JB9J 4PLLA 3WVDB 1I4K1 1BKBA 4L5GA 3C12A 3RKXA 1G3SA 3CCMA 5KE3A 3CCST 2L89A 3ER0A 4XU1A 4M7DC 4F7UB 3NTHA 4BUGA 2CS7A 3SWNA 4C92E 4J6YA 4OB2B 4C92F 4OGCA 4M7DA 1WQ7A 1HK9A 3WVEB 1BI2A 3EFRA 3OYYA 1SSFA 4IUTA 4J83A 3MEAA 2XICA 2F5TX 4MZTA 2X35A 1VIEA 4M78C 1YJWT 1KD1U 5I2MA 2GFUA 3FB9A 5A0LA 1ZHIA 3OS5A 5GAMg 3OYEA 2K5FA 3V8LA 2LT4A 3M5AA 1Q86C 4HKEA 4NOYA 3RMSA 3L2WA 2FHDA 3G6EA 4L59A 4D6WA 4C92G 4JRQA 3JB9I 1YJ9A 2LQKA 3PFSA 4QW2A 4M7AD 3VV0A 3CCEA 5LJ3d 1QVFA 4P5NA 1XTDA 3CPWS 1PSEA 4PL6A 2O4XB 1QP2A 3J7AF 5GAMh 3JB9H 2P0QA 5LJ5d 5GANf 2K57A 3S3MA 3WXMB 4J7FA 3L2UA 5EG2A 4CRIA 2O01E 3OW2A 1GXIE 3J80E 5GAOq 2ZPGB 2EQUA 3OYBA 1VQ5A 2RI3A 1H641 4X34A 2KY9A 1JBMA 4A4FA 3F70A 2HAXA 3CCMT 1YJNT 5GAMe 4C8QD 2QQRA 4X9DA 3O8VA 3H8ZA 3G7ZA 4HCCA 1DJ7B 3V8KA 2CZ0B 3VU3C 4C92C 3QJ6A 2YRVA 3MCAB 1BI1A 3S3NA 2RK2A 2KSSA 1VQ9A 2C06A 1NPRA 3MEVA 1QW1A 4BDZA 3QZ9B 3S3OA 3CCJA 4M7AE 3CMET 1U1SA 1N6AA 4M7AF 1M4ZA 1N27A 1KQ2A 3OYAA 2EJFA 3SD4A 3LGLA 4RMOA 2R5MA 3PTAA 4IURA 2V8IA 4A54A 3CC2A 1OZ2A 3ME9A 4DOWA 1G3WA 3C94A 1BIBA 2D9TA 2VXFA 4C5IA 3L2QA 2BUDA 1VQPT 1M1KC 1R8OB 4LD6A 1LOJA 4M78D 4FIBA 4JS4A 2LCCA 2QQ9A 4EMKA 2E6ZA 4GY5A 5FLXE 3KUFA 3PMTA 4BB7A 5GAN2 2XDDA 4C8QE 5M9OA 5GAMj 1AHJB 4M77C 4C8QF 4IUQA 4M75A 3A8GB 3VYGA 2QQBA 1QVGS 2E1HA 1K73U 4M7AG 5CKHA 3FLGA 4PJOB 2D0QB 1NE8A 5GMKh 2P0PA 5A2QE 3BY7A 2FVUA 1VQ5T 5KH6A 3V7SA 4FM4B 4ZN1A 2ZPBB 4N4HA 5L8RE 4IUPA 2HNIA 1S72T 3TEEA 4M7DE 3M58A 3QXEB 3FDRA 4M78B 4F7UA 3BDLA 1M90C 4M7DF 4PNOA 1QVFS 3QYHB 1KC8C 2E64A 3GNGA 1Y07A 4J7IA 3OSSC 5J3BA 2K3XA 4ZTFA 3VJPA 2BIVA 3UPUA 2L8DA 2QQAA 5GMKe 3MP8A 2DXTA 4PKCC 2DPPB 3OA6A 1KD1C 2V8JA 4C8QG 2CYZB 1N8RC 3RUXA 5HKCA 1ZQ1A 5GAOr 2L3RA 3OW2S 4IKFA 2KAFA 2MWPA 2ZGWA 3NTIA 3JCMc 2X4XA 1RL2A 3FIFA 5GAOn 2PVDB 2K5IA 2RJDA 4C92D 5CVIA 3CCQA 3VUBA 3CCLT 1YHQA 5FU7C 3C4SA 4KBMB 2GF7A 3JCMd 4XTZA 4M7DG 2RHYA 4O5VA 3X28B 1VQ6A 2A7YA 2ZZDA 5GANg 4J5YA 4R55A 1WJQA 3L2VA 4JJNK 1I5LA 2OTLT 3MP1A 4HT9A 4MMLA 2RO0A 2OTJT 4XQ3A 2DO3A 2DXCA 2RI2A 1NPPA 3ASKA 4OP0A 5I21A 3MEWA 2EWNA 2O4XA 2M1HA 4C0DC 4A4GA 3M57A 4BY6C 1NZ9A 3DB3A 2XDPA 3A8HB 4JLGA 4KULA 4C92B 2DTIA 2KK4A 3H6ZA 4M78G 5GANh 3OYDA 4OMFB 1O75A 3VKIA 1X01A 5GMKj 1VQ7A 4DQ2A 1KQSA 5A0DA 1LJOA 3M4GA 3SWNC 3P8HA 3I55A 1UB4A 3M9QA 1I8FA 4C5HA 4C0ZA 3OMGA 4M77D 3T9NA 3PGGA 1RI0A 1VQ4T 4OB0B 4E47A 4HCBA 2EIFA 3UT1A 3CMAA 3HKSA 5CKEA 1VQKT 2DIGA 3ZFJA 3QUIA 5GANe 4NL3A 3OS1A 2ZPIB 4JDSA 1M9SA 5D6WA 4C0FA 3CCRA 3HRTA 3KBGA 2JTFA 3OMCA 3CC4T 2DTOA 2DXUA 2L5QA 2RJCA 4A53A 4JRIA 2M16A 1X6OA 4J8OA 1VQLT 2LX9A 3DKMA 3OY9A 3L2RA 4RCBA 3CBMA 4E7IA 3CD6A 4LDWA 2JUFA 5C0MA 3JCMb 2JZ2A 3V7RA 3VUZA 2EJGA 3ZBDA 3PIPA 1VQ8A 4Z02A 4V2SA 2JTMA 4HA8A 2E65A 5FRNA 3QYGB 2RJEA 4IUUA 3QKJA 2E70A 4LDXA 1K73C 4M75F 2K3YA 4JRKA 4BD3A 1K9MU 5I2SA 3X26B 1OI1A 1FXXA 5GMKm 2RH2A 3L42A 5FU6C 1Q81U 1G5VA 4M77E 4KUDK 2LVMA 4M77F 2MWOA 3G71A 2XK0A 3OYNA 1VUBA 5GANj 2VV5A 3CCVT 1TH7A 3FC3A 3CC7A 3R6OA 4BDYA 2ZPHB 1KHCA 3GPLA 2ZCFB 1KHIA 2F5KA 3OYKA 4E7JA 4R56A 3QBYA 4M7AB 5LJ3e 4FT2A 3SFMA 5GMKi 3J81E 5CKDA 5FU7B 4UC4A 1NJIU 1W2BA 5GAN4 3X25B 4ELZC 1Y96A 2YHTA 3NFCA 5GAMd 2JVVA 1Q82C 3OYMA 3VYHB 5C6SA 4XU2A 3HSBA 2H3JA 4M77G 3G4SA 3RIRA 3A8OB 3LYIA 3NTKA 4EMGA 4ZGJB 3C95A 5DLOA 1YIJA 2QTXA 5GMKl 4M7DD 3A8MB 1KQSS 2XU8A 1WJSA 2CZ7B 3DLLA 1B34B 4BY6B 3PIOA 3X20B 1BI0A 3KXTA 4C8QB 2EAYA 1BYMA 4ATOA 4E7HA 3BW1A 2VGMA 4VUBA 3G6ET 2HD0A 4ZGDB 4EMKC 4C5EA 3QG1A 3HRUA 1YJ9T 1M8VA 3CCET 5KCOA 2JNGA 4M75C 1UGPB 5GAN5 4EDUA 5LJ3f 3OS0A 4N4IA 2RK1A 4XTVA 2R58A 4M7DB 1V29B 2QEXA 2LTOA 3OYHA 2RB6A 5LJ5f 4QQGA 5IT9E 1YCYA 2Y4YA 3OBWA 3CC7T 2XDBA 2ZPEB 4TVRA 1LNXA 3QDRB 3GIBA 2V8KA 3OS2A 1JRIA 5IN1A 4BE1A 4JUVA 2MAMA 2PU9B 3X24B 3MEUA 3HPWA 2GFAA 5GAN6 1VQOA 2FB7A 2E12A 1YI2A 3S6WA 1K8AU 4XU0A 2XKOC 5KE2A 4N0AA 1VQ9T 5J39A 3QPHA 1VQMA 2Y90A 2AHJB 3G4ST 4ZTJA 5CKFA 3OB9A 4C5GA 3QO3A 3CCJT 1QP3A 4BI4A 3OYIA 5HY6A 5LL6S 3UWNA 2B8AA 4PLIA 2DIQA 2PVOB 5FU6B 1YITA 2CGHA 2MF2A 2CZ6B 3CC2T 2Y4XA 2LC4A 3LGFA 5D6XA 3LX7A 5CO7A 4MDWA 3OYGA 1W2BS 2QQSA 3L1AA 3SB2A 3JCMh 3TREA 4O6JA 5HK3A 3CCSA 1G3TA 2WACA 3HFOA 2GQVA 3CPFA 4BI8B 3JCMP 2DZ9A 3UDCA 4RKUE 1BI3A 4KT0E 3RKWA 2WSEE 2XHCA 3JB9D 2DK3A 5FRMA 2DKGA 3M55A 2K4YA 2RI5A 2R5AA 3CPWA 3JSCA 3LLRA 5GAN8 3RMQA 3JCMe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z02 A;  3QJ6 A;  2YRV A;  2IG0 A;  4B9W A;  2G3R A;  3S3N A;  5FRN A;  2RJE A;  2HQX A;  4IUU A;  3MEV A;  3QKJ A;  4HCZ A;  4BDZ A;  2K3Y A;  3S3O A;  3P8D A;  4BD3 A;  1OI1 A;  3L42 A;  3PNW C;  1G5V A;  2RHU A;  2LVM A;  1N27 A;  2MWO A;  2XK0 A;  3GOX A;  3OYN A;  3OYA A;  2VYT A;  2EQK A;  3LGL A;  2R5M A;  3SD4 A;  4FL6 A;  4IUR A;  4A4E A;  1OZ2 A;  3FC3 A;  3ME9 A;  2EKO A;  2R57 A;  4BDY A;  1KHC A;  2NLU A;  1OZ3 A;  2F5K A;  2D9T A;  3OYK A;  4C5I A;  3L2Q A;  2BUD A;  4B9X A;  4E7J A;  4LD6 A;  3QBY A;  4OVA A;  3ZEH A;  4E7L A;  1MHN A;  2LCC A;  3OYL A;  4GY5 A;  3KUF A;  5IAY A;  4NS5 A;  3PMT A;  4UC4 A;  2X4W A;  1WGS A;  1XNI A;  5M9O A;  4IUV A;  4IUQ A;  3OYM A;  4A4H A;  2P0K A;  5C6S A;  3PMI A;  3OYJ A;  3FLG A;  1OYX A;  3LYI A;  3NTK A;  1WJR A;  5KH6 A;  5J26 A;  4N4H A;  1WJS A;  4IUP A;  3QII A;  3DB4 A;  4QQ6 A;  2EFI A;  3FDR A;  3OQ5 A;  3BDL A;  3E9F A;  4E7H A;  2M0O A;  4ZTF A;  3OYF A;  2RHI A;  2K3X A;  4QVZ A;  2RJF A;  2BIV A;  4BAC A;  2L8D A;  3DLM A;  4IKF A;  2LRQ A;  3MP8 A;  4Q5W A;  4C5E A;  3OA6 A;  3E9G A;  2BKD N;  2HQE A;  2E5Q A;  2L3R A;  5KCO A;  4BE2 A;  5KCH A;  2MWP A;  3NTI A;  4EDU A;  4N4I A;  3OS0 A;  2R58 A;  2DAQ A;  2X4X A;  2X4Y A;  4PLL A;  3LH0 A;  2RJD A;  2LTO A;  3OYH A;  4N4G A;  5KE3 A;  2L89 A;  3NTH A;  4QQG A;  3C4S A;  2GF7 A;  2RHY A;  2RHX A;  3L2V A;  1WJQ A;  3MP1 A;  3Q1J A;  4FU6 A;  3OS2 A;  2RO0 A;  3MP6 A;  5IN1 A;  4BE1 A;  2RI2 A;  2EQJ A;  3ASK A;  1SSF A;  3MEU A;  4QQD A;  4IUT A;  2GFA A;  3MET A;  3MEW A;  2O4X A;  3MEA A;  2CKK A;  2M1H A;  4A4G A;  3OYC A;  3S6W A;  2X35 A;  3DB3 A;  2XDP A;  5KE2 A;  2GFU A;  3CEY A;  5J39 A;  3OYE A;  5CIU A;  3H6Z A;  2LDM A;  4II1 A;  3OYD A;  4ZTJ A;  3OB9 A;  3L2W A;  3EAE A;  2FHD A;  4C5G A;  4L59 A;  3OYI A;  3P8H A;  3UWN A;  2B8A A;  3M9Q A;  2DIQ A;  4PLI A;  5D6Y A;  3PFS A;  4C5H A;  4QW2 A;  4BE0 A;  3OMG A;  1RI0 A;  1H3Z A;  4PL6 A;  3UT1 A;  5D6X A;  2O4X B;  3LGF A;  2DIG A;  2RHZ A;  3OS1 A;  3LX7 A;  3MO8 A;  3OYG A;  2EQM A;  3S3M A;  5FRO A;  3O8V A;  2QQS A;  5D6W A;  3L2U A;  4CRI A;  2WAC A;  2JTF A;  3OMC A;  2RJC A;  2EQU A;  3OYB A;  3FEO A;  2RI3 A;  2M16 A;  4X34 A;  4A4F A;  3F70 A;  5FRM A;  4RG2 A;  4E7K A;  3OY9 A;  3L2R A;  2RI5 A;  2R5A A;  2PQW A;  4E7I A;  3LLR A;  2QQR A;  5C0M A;  2E6N A;  3H8Z A;  2JZ2 A; 
#chains in the Genus database with same CATH topology
 4M75 D;  4XTW A;  1OEB A;  2HQX A;  1T0J A;  5ECA A;  1JO8 A;  1P92 A;  3HTR A;  4JPB W;  2RHU A;  3SEM A;  1N9R A;  3GOX A;  2YLC A;  4FL6 A;  1MND A;  4A4E A;  3LWH A;  5IXF A;  4J6X A;  3CBO A;  4F16 A;  1B34 A;  4E7L A;  4QVD A;  1LVK A;  3FRN A;  3JB9 F;  2HKQ B;  4E6R A;  2BZX A;  1XNI A;  4A4H A;  4M75 E;  4XK8 E;  2HKN A;  1I07 A;  2DVE A;  1D1C A;  3FJP A;  3QJY A;  1FWZ A;  2JN0 A;  1BK2 A;  3TU4 K;  4CC7 A;  4RG8 A;  3E9F A;  5L23 A;  3FJ5 A;  4RTU A;  2KBT A;  5CR2 A;  1QVG A;  2RHI A;  3RDV A;  4OB1 B;  2X3X D;  4LUE A;  2X4Y A;  2VWF A;  4M75 G;  2YUN A;  6AT1 B;  3GF5 A;  1D3B B;  1IRE B;  5KYY A;  2RHX A;  2CP0 A;  4DOV A;  1VQ6 Q;  5FW9 A;  3H0I A;  2E5K A;  4QQD A;  1VQ8 T;  2ED0 A;  3OYC A;  2K7A A;  2DLP A;  1S72 A;  1TUC A;  3CEY A;  2M0Y A;  4FT4 A;  3MJX A;  2HBW A;  2LNH B;  3M56 A;  1VQ7 Q;  3EFS A;  1KFZ A;  3ZL7 C;  1IRX A;  2FZK B;  2RHZ A;  2EQM A;  1PRM C;  2I2L A;  2GNC A;  1M5Q 1;  3FEO A;  1MV3 A;  3SDZ A;  2O88 A;  4RG2 A;  1E6G A;  2PQW A;  4ZN3 A;  3RES A;  3ULR B;  4GLM A;  3CD6 Q;  3GNF B;  2IIM A;  1KIK A;  2NWM A;  9ATC B;  1NBE B;  4C0G A;  1K9M C;  3V8J A;  1Q81 C;  2J6F A;  2EQI A;  2FL7 A;  3JCM X;  1VQ4 A;  3RER A;  2K5L A;  2K9G A;  4PJO F;  1BU1 A;  1QWF A;  1UHF A;  4M78 E;  1WGS A;  1VQN T;  1WFW A;  2P0K A;  3M53 A;  1OYX A;  2KRO A;  1VQ9 Q;  4AFZ C;  5J26 A;  1YI2 T;  1NJI R;  3DB4 A;  4PJM A;  3CCJ Q;  1T0H A;  2HQH A;  5GAN d;  4QVZ A;  1Y71 A;  2RJF A;  1Y57 A;  3DLM A;  2C0O A;  4M75 B;  1WNL A;  4DEY A;  5KYU B;  4EIK A;  1WDX A;  4BE2 A;  4C8Q A;  3JB9 J;  3WVD B;  1D1B A;  3C12 A;  3REA B;  3RKX A;  1G3S A;  4M7D C;  2CSI A;  3ER0 A;  4XU1 A;  4LNP A;  4J6Y A;  4OB2 B;  2JM9 A;  1KQS P;  1BI2 A;  4AT1 B;  5KYX A;  1KD1 U;  1ZHI A;  5GAM g;  2K5F A;  3V8L A;  2LT4 A;  2E4H A;  4NOY A;  1VYV A;  3L2W A;  3VS0 A;  4QW2 A;  1YWP A;  1PSE A;  2EGC A;  3CCQ Q;  2O4X B;  3J7A F;  1YHQ Q;  2P0Q A;  2RQR A;  2D8J A;  3OW2 A;  1OOT A;  5GAO q;  3OYB A;  2BE9 B;  4X34 A;  1JBM A;  2L2P A;  1WHJ A;  5GAM e;  2QQR A;  4HCC A;  1DJ7 B;  2J06 A;  2MYS A;  3VU3 C;  2YRV A;  1VQ9 A;  1UUE A;  1YJW Q;  1HSQ A;  1HD3 A;  2NUP A;  2QAZ A;  4AFQ C;  3CCJ A;  2W0Z A;  1KQ2 A;  1K0X A;  3LGL A;  3PTA A;  3CC2 A;  3EHR A;  2EGA A;  2QTV A;  3CCR Q;  1BIB A;  2D8H A;  4C5I A;  3C0C A;  4FIB A;  1HYO A;  2LCC A;  4GY5 A;  3KUF A;  4BB7 A;  8ATC B;  5M9O A;  5GAM j;  4PFP A;  1W6X A;  1K73 U;  1C0M A;  3UF4 A;  2P0P A;  1S72 T;  4M7D E;  1WHH A;  1PNJ A;  4M78 B;  3BDL A;  1QVF S;  1M2V B;  1QQJ A;  2E64 A;  3GNG A;  2K3X A;  2QG9 B;  5GMK e;  2FG0 A;  1WXB A;  4PKC C;  1KD1 C;  2DPP B;  2V8J A;  1CKB A;  2CYZ B;  2F2X A;  5HKC A;  1N8R C;  2MWP A;  3JCM c;  1ZBJ A;  1RL2 A;  2DNU A;  2PVD B;  2RJD A;  5CVI A;  3CCQ A;  1XJW B;  1YHQ A;  5FU7 C;  2C0I A;  1OPL A;  3C4S A;  4M7D G;  2RHY A;  3X28 B;  2ZZD A;  5GAN g;  3L2V A;  1D0Z A;  4R55 A;  2JXB A;  1I5L A;  1H3H A;  2DO3 A;  4KRT A;  3MEW A;  2KEA A;  2SRC A;  1W70 A;  1JEG A;  2CT4 A;  3CCU Q;  4KUL A;  4Z88 A;  4OMF B;  1B07 A;  1O75 A;  2YRC A;  5GMK j;  4DQ2 A;  1LJO A;  2YSQ A;  3M4G A;  3P8H A;  3I55 A;  1UB4 A;  1ARK A;  1I8F A;  1RAI B;  4C0Z A;  3T9N A;  1VQ4 T;  4OB0 B;  2EIF A;  1I1J A;  5CKE A;  3CMA A;  3ZFJ A;  3QUI A;  5GAN e;  3NHN A;  2ZPI B;  5D6W A;  3CCR A;  3KFV A;  2L5Q A;  4JRI A;  2NUZ A;  3M0P A;  2DL4 A;  3L2R A;  2K6D A;  4RCB A;  1TS9 A;  1RAB B;  3QDF A;  2JZ2 A;  1BCO A;  3V7R A;  2EJG A;  2OTJ Q;  4Z02 A;  2JTM A;  1VQM Q;  3TSW A;  2YUQ A;  5FRN A;  1UE9 A;  2ED1 A;  2J6O A;  3AT1 B;  1K73 C;  2K3Y A;  4JRK A;  3X26 B;  1FXX A;  1M3C A;  5FU6 C;  2L3P A;  1AWW A;  4OML A;  1M27 C;  1ZSZ B;  3OYN A;  5GAN j;  3CC7 A;  4FYY B;  2ZPH B;  1EFN A;  2ROL A;  3GPL A;  2VB6 A;  2F5K A;  1NEB A;  4HVV A;  3GBQ A;  1WA7 A;  3J81 E;  3VS5 A;  4UC4 A;  5GAN 4;  1VQL Q;  3VYH B;  1TSF A;  2YWW A;  4HVW A;  4XU2 A;  3HSB A;  1NLP C;  3G4S A;  3RIR A;  1NYF A;  3LYI A;  4EMG A;  1YIJ A;  2QTX A;  3M0R A;  1WIE A;  2O31 A;  2CZ7 B;  2OAW A;  1B34 B;  3X20 B;  2EBP A;  1GCP A;  3PE0 A;  1BYM A;  3BW1 A;  3VRZ A;  2HD0 A;  3HRU A;  4Y92 A;  1X6B A;  5KCO A;  4N4I A;  1W1F A;  4M7D B;  2QEX A;  1UHC A;  2LQN A;  4FSS A;  2JTE A;  1K9A A;  2Y4Y A;  5KYU A;  2XDB A;  2ZPE B;  1PD0 A;  2KXD A;  3QDR B;  3GIB A;  3OS2 A;  2ABL A;  5IN1 A;  3MEU A;  4X1V A;  3HPW A;  2E12 A;  1K8A U;  2D1X A;  1VQ9 T;  4RTY A;  1VQM A;  2Y90 A;  1M90 R;  2AHJ B;  1QWE A;  3G1J A;  1KC8 R;  3OB9 A;  5KYY B;  3CCJ T;  1QP3 A;  2EVR A;  3OYI A;  3UWN A;  4PLI A;  2PVO B;  2CH4 W;  1JQQ A;  2CH4 A;  2NUT A;  1ABO A;  2MF2 A;  1VQP Q;  2CUD A;  3CC2 T;  5D6X A;  2CP2 A;  4MDW A;  3OYG A;  1W2B S;  7AT1 B;  1SHG A;  4O6J A;  2WAC A;  3JCM P;  1K76 A;  4KT0 E;  2XHC A;  3JB9 D;  5FRM A;  2C0T A;  3JSC A;  2GQI A;  1WX6 A;  2P84 A;  3LH5 A;  5GAN 8;  2XG8 D;  1SHF A;  4EMH A;  3V7C A;  2EYZ A;  3CXC A;  2EYY A;  2CT3 A;  3P8D A;  2LCL A;  5CAI A;  2J05 A;  4ZGE B;  2VYT A;  2EQK A;  5GJV B;  2PUO B;  1IGU A;  1YCS B;  2KNB B;  3D7S B;  2HL5 C;  1NEG A;  1A0N B;  2NLU A;  1FMK A;  3CCQ T;  1YHQ T;  1MMD A;  2FPE A;  2KVQ G;  3EG1 A;  2EYW A;  4NS5 A;  4JJB A;  1ZUK A;  1YJN A;  2P4T A;  4FSX A;  2GCX A;  4ESR A;  1U8R A;  3OYJ A;  2KR3 A;  8AT1 B;  4J6W A;  1MGQ A;  3PT9 A;  4ELY C;  4PJO C;  2LP5 A;  1IO6 A;  1M90 U;  5LJ3 h;  1O9S A;  1KC8 U;  2CP5 A;  2HBP A;  2LQ8 A;  5LJ5 h;  3GP8 A;  4F7U F;  3JB9 G;  3I55 T;  1WHM A;  2DEQ A;  3JAM E;  1K8A C;  3M54 A;  4NL2 A;  1VQK Q;  2DD4 A;  1WHL A;  2OAU A;  2LT1 A;  4M78 A;  2F2V A;  5KCH A;  2LJ1 A;  3CMA T;  1EIF A;  2DTH A;  1G3Y A;  1VQP A;  3CCR T;  3QSU A;  2FPF A;  3EG9 A;  3P8B B;  3QHS A;  4DBR A;  2PZ1 A;  1Q82 R;  3MP6 A;  4OF1 A;  2EKH A;  1QVF P;  4CI0 C;  3MET A;  1TWB A;  2CKK A;  5DM7 R;  2RM4 A;  3H0H A;  1JJ2 A;  5CIU A;  2LDM A;  4II1 A;  2Z0W A;  1R0C B;  2DEU A;  2FZG B;  5D6Y A;  4JLI A;  3CCV Q;  2HSP A;  4BE0 A;  1QCN A;  5KYX B;  1ZUU A;  5CQX A;  5FRO A;  1SEM A;  1VQN A;  4PJO D;  2MMP A;  1YBY A;  1WI7 A;  1X69 A;  4DEX A;  1AEY A;  4MDX A;  3U23 A;  3AHU A;  4E7K A;  2DXB A;  1U5S A;  2IPO B;  1Q86 U;  2E6N A;  1YIJ T;  3O5Z A;  2A3L A;  5DLQ E;  3HL8 A;  2MCN A;  3MHX A;  1FMW A;  4LD9 K;  3CCU T;  1NYG A;  4WTO B;  1Y7X A;  2DD5 A;  4XTX A;  3JCM V;  4Z89 A;  2RA2 A;  2KQW A;  1VQK A;  4XTU A;  4PJO E;  2QEX T;  2DX1 A;  1WYX A;  2A08 A;  4OVA A;  3CC4 A;  1ZSZ A;  1RAG B;  2NUP B;  4JJC A;  5AT1 B;  3HRS A;  1W4S A;  1Q82 U;  4IIO A;  1QKX A;  4HVU A;  1UGV A;  2YLB A;  3LWI A;  1WJR A;  2KE9 A;  3H0F A;  2WSF E;  2DE0 X;  2PUK B;  3QII A;  1CKA A;  2EFI A;  4PJO G;  1VQM T;  2HCK A;  1LPL A;  2QI2 A;  2MIO A;  4KH0 B;  1JB0 E;  1M1K U;  3JRZ A;  2JOY A;  2BKD N;  2E5Q A;  3CCV A;  1OU9 A;  2K2V A;  2DL8 A;  3NTH A;  2COZ A;  4C92 F;  4FYW B;  4OGC A;  2JT4 A;  4M7D A;  1GRI A;  2M51 A;  1WQ7 A;  2PNI A;  3WVE B;  4DBF A;  3OYY A;  4J9B A;  1SSF A;  2X35 A;  4M78 C;  1VQO Q;  1WLP B;  1Q86 C;  4HKE A;  2NYS A;  4J9H A;  3VV0 A;  3CCE A;  5LJ3 d;  2DL7 A;  2HL3 A;  1QP2 A;  5LJ5 d;  4D8K A;  4RUG A;  4J7F A;  2JS0 A;  2EQU A;  1H64 1;  4DBQ A;  1YJN T;  3EGD B;  2RQW A;  3NPF A;  3G7Z A;  3V8K A;  1NPR A;  1TUD A;  4BDZ A;  3QZ9 B;  3S3O A;  2DYI A;  1W2B P;  1M4Z A;  1N27 A;  1TU0 B;  3TSZ A;  3OYA A;  1ABQ A;  3NMZ C;  2A0F B;  2R5M A;  4J9C A;  4DOW A;  1G3W A;  1VQP T;  1M1K C;  1R8O B;  4M78 D;  2L3Q A;  1PRL C;  1M30 A;  3I56 Q;  2YXY A;  4IUQ A;  3VYG A;  2QQB A;  1YN8 A;  4PJO B;  1D0X A;  2X9H A;  2FVU A;  1V1C A;  3V7S A;  1PKT A;  4ZN1 A;  2ZPB B;  4AMC A;  5L8R E;  1YNZ A;  4F7U A;  1ACM B;  3QYH B;  4ZTF A;  3OSS C;  1ZSZ C;  2BIV A;  3MP8 A;  2FRW A;  3CME Q;  2LJ3 A;  2FO0 A;  3RUX A;  2RPN A;  3NTI A;  3FIF A;  2K5I A;  2W10 A;  1OU8 A;  4KBM B;  3JCM d;  1VQ6 A;  4KGX B;  4JJN K;  3E2U A;  2A37 A;  4HT9 A;  4MML A;  2RO0 A;  4XQ3 A;  2RI2 A;  5I21 A;  1ZX6 A;  2M1H A;  4C0D C;  4A4G A;  1AVZ C;  3M57 A;  3A8H B;  5D7U A;  4JLG A;  1SG5 A;  3H6Z A;  4M78 G;  3OYD A;  2BZ8 A;  1R0B G;  1VQ7 A;  1KQS A;  1JXO A;  1IHW A;  2BZY A;  1Q7Y R;  3CPW P;  2YUP A;  3OMG A;  3PGG A;  4HCB A;  2QGF B;  4J9G A;  2DIG A;  4NL3 A;  3OS1 A;  1VQK T;  3KBG A;  2JTF A;  3OMC A;  3CC4 T;  2DXU A;  4A53 A;  1X6O A;  2FPD A;  3OY9 A;  3CD6 A;  2OTL Q;  2NUT B;  4M4Z A;  3PIP A;  2DIL A;  4KGZ B;  2RJE A;  4IUU A;  3SHW A;  2QA4 Q;  4M75 F;  4PJL A;  1OI1 A;  5GMK m;  1G5V A;  4OMQ A;  4KUD K;  4M77 F;  5I22 A;  1FYN A;  1T3S A;  3CCV T;  3R6O A;  1KHC A;  4E7J A;  4R56 A;  3QBY A;  1VYU A;  5LJ3 e;  2RMO A;  1NJI U;  3X25 B;  3M0T A;  4LE9 A;  2JVV A;  1QKW A;  2XMF A;  3NTK A;  5DLO A;  3C95 A;  4M7D D;  5GMK l;  1B3Q A;  3A8M B;  2XU8 A;  1BI0 A;  1IB8 A;  3KXT A;  2EAY A;  4VUB A;  4JZ4 A;  2DVJ A;  1M8V A;  3CCE T;  1AOJ A;  5GAN 5;  4EDU A;  5LJ3 f;  3OS0 A;  4XTV A;  1V29 B;  2LTO A;  3QWX X;  5LJ5 f;  4JZ3 A;  3BE3 A;  3EFO B;  5IT9 E;  3OBW A;  2OX7 A;  3CCM Q;  4TVR A;  1T3L A;  2V8K A;  1C1A A;  4BE1 A;  4JUV A;  3X24 B;  4LXC A;  2GFA A;  4PJN A;  1Z9Z A;  4FYV B;  2COW A;  5KE2 A;  4N0A A;  3QPH A;  3EG9 B;  4ZTJ A;  2X3W D;  4BI4 A;  5HY6 A;  1RAF B;  3EG0 A;  3VS6 A;  1YJ9 Q;  1EZZ B;  2LCS A;  3SB2 A;  3L1A A;  3TRE A;  5HK3 A;  1G3T A;  2V1R A;  2DZ9 A;  1MUZ A;  4RKU E;  3RKW A;  2WSE E;  2DKG A;  3M55 A;  2K4Y A;  2DER A;  1VQ5 Q;  2RI5 A;  2R5A A;  1KJW A;  5HCK A;  3JCM e;  1QLY A;  1PSF A;  4B9W A;  1YJW A;  1NJI C;  3N5B B;  4L6V 5;  3TCJ A;  3EGD A;  1BIA A;  2ATC B;  3PNW C;  2E3H A;  3I35 A;  5CKB A;  2CP6 A;  1F1B B;  3VS3 A;  2EKO A;  3CCL Q;  1OZ3 A;  3ZEH A;  2CZ1 B;  2KMT A;  2EYX A;  1YFN A;  1GBR A;  3RNJ A;  1VQ6 T;  3JCM f;  2X4W A;  4OMM A;  4JS5 A;  2QXF A;  2E41 A;  2JMA A;  2EYQ A;  3JCM Q;  3HFN A;  4Y28 E;  2H3E B;  4QQ6 A;  3JCM J;  2VXE A;  3OQ5 A;  4CC4 B;  4PJO A;  1VQ7 T;  3OYF A;  4F7U E;  4IKF A;  4Q5W A;  2DJZ A;  5CCA A;  4X9C A;  2VC8 A;  4PK4 A;  1Y0M A;  3M4Y A;  3RBB B;  4N4G A;  4OMP A;  1WZO A;  3TVT A;  1N9S A;  3Q1J A;  4FU6 A;  3VRY A;  2IVW A;  4F7U G;  3CD6 T;  4C0D B;  2L0A A;  2BTT A;  3I56 T;  4RTV A;  3CCU A;  4F14 A;  1ZA2 B;  2VVK A;  3A1P A;  2ROT A;  4WF2 A;  1SPK A;  3H9N A;  2COY A;  3M59 A;  2YDL A;  1UGR B;  1N5Z A;  2AT1 B;  3PVQ A;  1E7O A;  1XOV A;  3E19 A;  3HP9 A;  3MO8 A;  4MZP A;  4RTZ A;  1AD5 A;  3CCL A;  2JW4 A;  1IZ6 A;  4AFS C;  2QGG A;  5IH2 A;  2CP3 A;  4N0A C;  4JRP A;  4HT8 A;  2OTJ A;  2AKK A;  5EC7 A;  2KYB A;  3E1S A;  3QZ5 B;  1VQ8 Q;  1UGQ B;  3JCM W;  1G83 A;  2XI9 A;  4M77 A;  3UA6 A;  2GBQ A;  2RQT A;  2DFU A;  2R57 A;  4QVC A;  1MV0 B;  1PWT A;  3OYL A;  3RKY A;  1VQL A;  4IUV A;  4LDY A;  4OMO A;  5FWC A;  4Y91 A;  1GFC A;  1X2Q A;  4QT7 A;  2FRY A;  1VOM A;  2J7I A;  1E6H A;  4LDV A;  1H92 A;  2K3B A;  3TQ7 P;  1H8K A;  2QA4 T;  1OX9 A;  2DBK A;  2LX7 A;  2X51 A;  4J9F A;  4OB3 B;  1TOV A;  1FMV A;  3OSV A;  2HQE A;  1M1F A;  2AZV A;  2DRM A;  4PLL A;  1I4K 1;  1BKB A;  4L5G A;  2CP7 A;  5KE3 A;  2L89 A;  3UAT A;  4F7U B;  4BUG A;  3SWN A;  4C92 E;  1X27 A;  1RAD B;  1NM7 A;  4WCI A;  1HK9 A;  1K1Z A;  2AZS A;  3EFO A;  4IUT A;  4J83 A;  2XIC A;  2F5T X;  4MZT A;  4FCY A;  2CSQ A;  1VIE A;  2HDA A;  1YJW T;  5I2M A;  3FB9 A;  3OYE A;  3M5A A;  3RMS A;  1WXU A;  2FHD A;  4ORZ A;  4D6W A;  2L3S A;  4C92 G;  2DJQ A;  4JRQ A;  3PFS A;  1QVF A;  4P5N A;  2DM1 A;  3CPW S;  2RF0 A;  3M0S A;  4FW1 A;  4PL6 A;  3JB9 H;  5GAM h;  2K57 A;  3S3M A;  2G6F X;  5EG2 A;  2E3I A;  4A4F A;  2KY9 A;  2HAX A;  3CCM T;  2D0N A;  4B6M A;  2J6K A;  4X9D A;  1V76 A;  1AZE A;  3QJ6 A;  1RI9 A;  3MCA B;  2C06 A;  1LCK A;  2DF6 A;  3MEV A;  2P4R A;  2DBM A;  1MMG A;  4M7A F;  4E7S A;  2EJF A;  3SD4 A;  2KYM A;  2V8I A;  4LUD A;  3C94 A;  1G2B A;  2D9T A;  2BUD A;  2VAS A;  1K0S A;  4LD6 A;  4JS4 A;  4EMK A;  5FLX E;  5GAN 2;  2XDD A;  1AHJ B;  4M77 C;  4C8Q F;  3A8G B;  5CKH A;  3REB B;  3FLG A;  4JJD A;  2D0Q B;  1NE8 A;  1OX8 A;  5GMK h;  5A2Q E;  1VQ5 T;  5KH6 A;  4FM4 B;  4N4H A;  3TEE A;  1AT1 B;  3M58 A;  1M90 C;  4PNO A;  1KC8 C;  3G71 Q;  2ENM A;  1K9M R;  3UPU A;  2L8D A;  2QQA A;  1Q81 R;  4J9E A;  1Q95 G;  1ZQ1 A;  2L3R A;  3OW2 S;  2ZGW A;  5GAO n;  3VUB A;  3CCL T;  4QKU A;  5GJW B;  4O5V A;  1SRM A;  1WJQ A;  2DA9 A;  4IIM A;  2OTJ T;  2DXC A;  3ASK A;  1QCF A;  4OP0 A;  3PVL A;  1X2K A;  2DET A;  1NZ9 A;  3DB3 A;  2XDP A;  3IQL A;  4C92 B;  2DTI A;  2KK4 A;  5GAN h;  4RTT A;  5A0D A;  3SWN C;  4C5H A;  4M77 D;  1RI0 A;  1BB9 A;  3UT1 A;  3HKS A;  4JDS A;  2YT6 A;  4C0F A;  3HRT A;  2RJC A;  1PHT A;  2ZAE A;  1GBQ A;  2M16 A;  1VQL T;  3CBM A;  1I5O B;  5C0M A;  3JCM b;  3VUZ A;  3ZBD A;  2E65 A;  2LQW A;  3EG2 A;  2EW3 A;  3QKJ A;  2E70 A;  4LDX A;  1KK7 A;  1K9M U;  5I2S A;  1YIT Q;  1Q81 U;  3L42 A;  1PKS A;  4M77 E;  2LVM A;  3G71 A;  2XK0 A;  2VV5 A;  1TH7 A;  4GBQ A;  3EG3 A;  3CCS Q;  1VQ4 Q;  2ZCF B;  1KHI A;  4F17 A;  3SFM A;  1BCM A;  1YWO A;  1QVG P;  1W2B A;  4ELZ C;  2YHT A;  1Q82 C;  5KYW A;  5GAM d;  1JXM A;  4CC2 A;  5C6S A;  4OMN A;  4M77 G;  4F04 B;  3A8O B;  4ZGJ B;  5IHK A;  1M2O A;  1UTI A;  4BY6 B;  3PIO A;  2M02 A;  1KSW A;  1OUL A;  1OQK A;  4ZGD B;  4EMK C;  1YP5 A;  2FZC B;  1BBZ A;  4C5E A;  3M0Q A;  1AWO A;  2JNG A;  1UGP B;  2RK1 A;  2R58 A;  4LN2 A;  4K11 A;  3OYH A;  2K2M A;  1YCY A;  2V1Q A;  1B7T A;  1PCX A;  5GAN 6;  2I0N A;  1VQO A;  2FB7 A;  1RLP C;  3S6W A;  4XU0 A;  2XKO C;  5FWB A;  1S1N A;  5I11 A;  2B86 A;  4C5G A;  1D1A A;  5LL6 S;  2B8A A;  2DIQ A;  1KD1 R;  1HJD A;  1YIT A;  4FYX B;  1N8R R;  2CGH A;  2CZ6 B;  4RTX A;  5CO7 A;  2JS2 A;  1UEC A;  1K4U S;  3CCS A;  3I5R A;  3EGU A;  1GCQ A;  3VS4 A;  3HFO A;  2HSE B;  1R77 A;  1AWX A;  3MPU B;  4AG2 C;  3CPW A;  2F1L A;  3LLR A;  3RMQ A;  1M3B A;  2IG0 A;  1PD1 A;  1U1T A;  1OPK A;  2G3R A;  2QDY B;  4E2F B;  2BE7 D;  2KDS A;  4PFZ A;  4M7A A;  4OGE A;  4LDU A;  1FX7 A;  5GAN 7;  4A4K A;  1UJ0 A;  1VIF A;  1GL5 A;  5AYF A;  3NGP A;  4XAX B;  1QVP A;  5HK0 A;  1WHK A;  2KRN A;  2DL5 A;  2LJ0 A;  1UG1 A;  3CC2 Q;  4B9X A;  2A28 A;  1MHN A;  3A8L B;  4ANJ A;  4M77 B;  5LJ3 g;  1G8X A;  3I56 A;  5IAY A;  5GAO m;  5LJ5 g;  4PJJ A;  1ZBX A;  3HHT B;  2MI6 A;  2GGR A;  5CQY A;  4BI3 A;  1K73 R;  4MZM A;  2M0O A;  2X4J A;  3CME A;  2VUB A;  2RQV A;  4BAC A;  1N8R U;  2LRQ A;  2F69 A;  2ZPF B;  3THK A;  4XU3 A;  2YUO A;  2QAS A;  5GAO l;  3LH0 A;  1UEB A;  5LJ5 e;  1SF9 A;  2MOX A;  2O2O A;  2FYK A;  3I5S A;  3CXC S;  2EQJ A;  3A5Z B;  5GAO p;  1JU5 C;  1X75 C;  2GTJ A;  4EPC A;  1Q7Y U;  3INZ A;  3BFM A;  4R0K A;  3OW2 P;  3SWN B;  2E10 A;  3EAE A;  2XD0 A;  5DY9 A;  3G71 T;  4C92 A;  2VKN A;  5LJ3 j;  3I55 Q;  3CBP A;  1H3Z A;  2XID A;  5LJ5 j;  1VYT A;  3CMA Q;  2EJ9 A;  2KGT A;  1UGS B;  1IHV A;  1UJY A;  2OTL A;  3BDU A;  1M8M A;  1VA7 A;  2VGN A;  1TUG B;  1UDL A;  5IXB A;  2RQU A;  5GAM f;  2RNA A;  4PFO A;  2M9U A;  3JCM g;  2QA4 A;  1WXT A;  1RAA B;  3G6E Q;  4HCZ A;  1TXQ A;  2RN8 A;  4A63 B;  4GLK A;  5GAN 3;  3L2Z A;  1GCQ C;  1UFF A;  2DL3 A;  4HCK A;  4ME7 A;  2LNV A;  4J9D A;  4DBH A;  5KYN A;  1M1G A;  1RAE B;  1I81 A;  1WQW A;  3GLX A;  1XQH A;  1D0Y A;  1Y96 B;  2FEI A;  3CC7 Q;  3MKD A;  2DYB A;  1AZG B;  1D09 B;  2CDT A;  3EGX B;  2MK5 A;  5A0G A;  4M78 F;  4M7A C;  1KQ1 A;  4XTY A;  1HXD A;  4RCC A;  4D8D A;  3PMI A;  1JJ2 S;  4KUI A;  3I9Q A;  2JMC A;  2D6F A;  1KG1 A;  1VQO T;  3G4S Q;  4HXJ A;  5CK9 A;  2PVG B;  1YIJ Q;  4MMK A;  1D3B A;  3URG A;  1WPY A;  2O9S A;  2WSC E;  4EMK B;  1QCO A;  4C8Q C;  1PM3 A;  3LW5 E;  3OBY A;  1ZUY A;  1Q7Y C;  2DZC A;  3E9G A;  4YTL A;  1YIT T;  2RD1 A;  1U3O A;  3A98 A;  4DA4 A;  2DAQ A;  2K79 A;  3CCM A;  2QEX Q;  3CCS T;  1Z9Q A;  2CS7 A;  1MNE A;  1TG0 A;  1TTH B;  3EFR A;  3UA7 A;  3MEA A;  4J9I A;  3VS2 A;  1RAH B;  2GFU A;  5A0L A;  3OS5 A;  2F2W A;  2KT1 A;  3G6E A;  4L59 A;  3R6N A;  1MMA A;  2KT8 A;  3JB9 I;  1K8A R;  1YJ9 A;  2LQK A;  4M7A D;  1XTD A;  2LMJ A;  5GAN f;  2KI7 A;  3WXM B;  2HZY A;  3L2U A;  4CRI A;  2O01 E;  1GXI E;  3J80 E;  2ZPG B;  2AIR B;  3H41 A;  1VQ5 A;  2ECZ A;  2RI3 A;  3F70 A;  4C8Q D;  2YRD A;  3CQT A;  3O8V A;  3H8Z A;  2PTK A;  2CZ0 B;  4Z8A A;  4C92 C;  2DRK A;  1X6G A;  1BI1 A;  1J3T A;  3S3N A;  2RK2 A;  2KSS A;  1M3A A;  2CRE A;  1QW1 A;  2AK5 A;  1NLO C;  3EHQ A;  3CME T;  1U1S A;  4M7A E;  1N6A A;  2SEM A;  4RMO A;  4IUR A;  4A54 A;  1OZ2 A;  3ME9 A;  3VS1 A;  2VXF A;  3L2Q A;  2EGE A;  1AWJ A;  1LOJ A;  3RR6 A;  2QQ9 A;  2E6Z A;  2CUB A;  2QDL A;  4RTW A;  3PMT A;  4C8Q E;  1QVG S;  1WHG A;  4M75 A;  2DMO A;  2E1H A;  1PG5 B;  4M7A G;  1YJN Q;  2QK0 A;  3BY7 A;  4IUP A;  2HNI A;  3QXE B;  3FDR A;  4M7D F;  1OV3 A;  2QYZ A;  4J7I A;  1Y07 A;  5J3B A;  3VJP A;  5KYW B;  5IHI A;  1RLQ C;  2DXT A;  3OA6 A;  1ZA1 B;  4C8Q G;  5GAO r;  2KAF A;  1X43 A;  2X4X A;  4C92 D;  1MMN A;  2A36 A;  2GF7 A;  4XTZ A;  2EPD A;  2A7Y A;  4J5Y A;  2OTL T;  3MP1 A;  1NPP A;  3JV3 A;  2AKL A;  2EWN A;  2O4X A;  4BY6 C;  4KH1 B;  4AFU C;  3VKI A;  1X01 A;  4KGV B;  3M9Q A;  1NG2 A;  1SRL A;  4E47 A;  1RAC B;  1M9S A;  2MPX C;  3CXC P;  2JJ9 A;  2DTO A;  1VQN Q;  2HEQ A;  1I0C A;  4J8O A;  2LX9 A;  1PC0 A;  3DKM A;  1GFD A;  4E7I A;  4LDW A;  1YI2 Q;  2JUF A;  1VQ8 A;  4V2S A;  4HA8 A;  3QYG B;  1Q86 R;  2V26 A;  4BD3 A;  2GTO A;  1IGQ A;  4FW2 A;  2RH2 A;  2O9V A;  2MWO A;  1U06 A;  1VUB A;  3FC3 A;  2KRM A;  4BDY A;  5IHN A;  4E7Z A;  3OYK A;  1QMC A;  1SKU B;  4M7A B;  4FT2 A;  5GMK i;  1M2V A;  5CKD A;  5FU7 B;  3CC4 Q;  1Y96 A;  3NFC A;  3OYM A;  2H3J A;  2KXC A;  4AG1 C;  3VS7 A;  1IXD A;  3EGX A;  1EX4 A;  1KQS S;  1WJS A;  3DLL A;  2KRS A;  4C8Q B;  4ATO A;  4E7H A;  3EH2 A;  4ZNX A;  2VGM A;  3G6E T;  3QG1 A;  1YJ9 T;  3EH1 A;  4M75 C;  1M1K R;  2RB6 A;  1JJ2 P;  1ZLM A;  4QQG A;  2JM8 A;  3CC7 T;  2OI3 A;  1LNX A;  2LZ6 B;  1JRI A;  2MAM A;  2PU9 B;  1ZSG A;  3M0U A;  1YI2 A;  2H8H A;  2OJ2 A;  4CC3 A;  5J39 A;  3G4S T;  1C6V X;  5CKF A;  3QWY A;  3QO3 A;  1RUW A;  5FU6 B;  3CCE Q;  2Y4X A;  2LC4 A;  3LGF A;  3LX7 A;  2QQS A;  3JCM h;  1CSK A;  2ESW A;  4BI8 B;  2GQV A;  3CPF A;  3UDC A;  1BI3 A;  2DK3 A;  1SSH A;  2HMA A;  1S72 Q; 
#chains in the Genus database with same CATH homology
 2XG8 D;  1PSF A;  4M75 D;  2IG0 A;  4XTW A;  1U1T A;  2G3R A;  3V7C A;  2QDY B;  4B9W A;  2HQX A;  4EMH A;  3N5B B;  3CXC A;  4L6V 5;  2KDS A;  3TCJ A;  4M7A A;  4OGE A;  3P8D A;  4LDU A;  1FX7 A;  1BIA A;  5GAN 7;  4A4K A;  2LCL A;  3PNW C;  1P92 A;  1VIF A;  5CAI A;  2RHU A;  4ZGE B;  1QVG A;  1N9R A;  5CKB A;  5AYF A;  3GOX A;  2VYT A;  2EQK A;  2YLC A;  4FL6 A;  2PUO B;  4XAX B;  4A4E A;  3LWH A;  1QVP A;  5HK0 A;  2EKO A;  4J6X A;  2NLU A;  3CBO A;  1OZ3 A;  3CCQ T;  4B9X A;  1B34 A;  1YHQ T;  3ZEH A;  4E7L A;  2CZ1 B;  2KVQ G;  4QVD A;  1MHN A;  3A8L B;  2KMT A;  4M77 B;  5LJ3 g;  3FRN A;  3I56 A;  3JB9 F;  5IAY A;  4NS5 A;  1VQ6 T;  3JCM f;  2X4W A;  5GAO m;  1XNI A;  1YJN A;  5LJ5 g;  4A4H A;  2P4T A;  4FSX A;  4JS5 A;  2GCX A;  2E41 A;  2QXF A;  1ZBX A;  3HHT B;  1U8R A;  3OYJ A;  2EYQ A;  4M75 E;  4XK8 E;  2DVE A;  3FJP A;  3QJY A;  4J6W A;  1FWZ A;  1MGQ A;  2JN0 A;  2MI6 A;  3HFN A;  3PT9 A;  4Y28 E;  4ELY C;  3JCM Q;  4PJO C;  4QQ6 A;  1M90 U;  3TU4 K;  5LJ3 h;  5CQY A;  2VXE A;  1O9S A;  4BI3 A;  3JCM J;  1KC8 U;  1YJW A;  2HBP A;  3OQ5 A;  2LQ8 A;  4MZM A;  4RG8 A;  3E9F A;  4PJO A;  5LJ5 h;  2M0O A;  5CR2 A;  3OYF A;  2RHI A;  2X4J A;  4F7U E;  3GP8 A;  3CME A;  2VUB A;  4BAC A;  4F7U F;  3JB9 G;  3I55 T;  2DEQ A;  4OB1 B;  3JAM E;  2LRQ A;  4Q5W A;  2DJZ A;  3M54 A;  4NL2 A;  5CCA A;  1N8R U;  2F69 A;  4X9C A;  1K8A C;  2DD4 A;  2VC8 A;  2OAU A;  2LT1 A;  2ZPF B;  4M78 A;  5KCH A;  4XU3 A;  3CMA T;  1EIF A;  2X4Y A;  2DTH A;  3M4Y A;  4M75 G;  1G3Y A;  1UEB A;  3LH0 A;  5GAO l;  1VQP A;  4N4G A;  5LJ5 e;  3GF5 A;  3CCR T;  3QSU A;  1D3B B;  3P8B B;  1IRE B;  3QHS A;  2RHX A;  1N9S A;  4DOV A;  2FYK A;  3Q1J A;  4FU6 A;  2IVW A;  3MP6 A;  4OF1 A;  4F7U G;  4C0D B;  3CXC S;  3CD6 T;  2EQJ A;  4CI0 C;  3I56 T;  4QQD A;  1VQ8 T;  3A5Z B;  3OYC A;  3MET A;  3CCU A;  2CKK A;  5GAO p;  1X75 C;  4EPC A;  5DM7 R;  2RM4 A;  1S72 A;  1Q7Y U;  3INZ A;  3CEY A;  1JJ2 A;  3BFM A;  5CIU A;  2LDM A;  4II1 A;  4FT4 A;  3SWN B;  4WF2 A;  2E10 A;  3EAE A;  3M59 A;  2XD0 A;  3M56 A;  5DY9 A;  5D6Y A;  1UGR B;  3EFS A;  4JLI A;  3G71 T;  4BE0 A;  4C92 A;  5LJ3 j;  3CBP A;  1H3Z A;  1XOV A;  2XID A;  3E19 A;  5LJ5 j;  2RHZ A;  3HP9 A;  3MO8 A;  4MZP A;  2EQM A;  5CQX A;  5FRO A;  1VQN A;  2EJ9 A;  3CCL A;  1IZ6 A;  4PJO D;  2MMP A;  2I2L A;  1YBY A;  1UGS B;  4N0A C;  4JRP A;  1M5Q 1;  3FEO A;  3SDZ A;  2OTL A;  3BDU A;  4MDX A;  3AHU A;  4RG2 A;  4E7K A;  2DXB A;  2VGN A;  4HT8 A;  2OTJ A;  2PQW A;  5GAM f;  1Q86 U;  4ZN3 A;  3RES A;  2E6N A;  2M9U A;  1YIJ T;  3JCM g;  3E1S A;  2QA4 A;  3QZ5 B;  5DLQ E;  2A3L A;  1UGQ B;  3GNF B;  3JCM W;  3HL8 A;  2XI9 A;  4HCZ A;  3MHX A;  4LD9 K;  3CCU T;  4M77 A;  4GLK A;  5GAN 3;  3L2Z A;  4C0G A;  1K9M C;  3V8J A;  1Y7X A;  2DD5 A;  4ME7 A;  1Q81 C;  4XTX A;  3JCM V;  2LNV A;  2FL7 A;  3JCM X;  1M1G A;  2RA2 A;  1VQ4 A;  1I81 A;  1WQW A;  2KQW A;  3GLX A;  2R57 A;  1XQH A;  4XTU A;  2K5L A;  1Y96 B;  1VQK A;  3RER A;  4PJO E;  2QEX T;  4QVC A;  4PJO F;  4OVA A;  3CC4 A;  3OYL A;  3RKY A;  3HRS A;  1W4S A;  1Q82 U;  1VQL A;  4M78 E;  1WGS A;  4M78 F;  5A0G A;  4M7A C;  1KQ1 A;  4XTY A;  4IUV A;  4LDY A;  1VQN T;  1HXD A;  4RCC A;  2P0K A;  3LWI A;  2YLB A;  3M53 A;  3PMI A;  1JJ2 S;  1OYX A;  4KUI A;  4Y91 A;  1WJR A;  2WSF E;  2D6F A;  1KG1 A;  1VQO T;  5J26 A;  5CK9 A;  1YI2 T;  2PVG B;  2PUK B;  3QII A;  3DB4 A;  1VQ7 T;  1NJI C;  4MMK A;  2EFI A;  4PJO G;  1D3B A;  1VQM T;  3URG A;  1WPY A;  2QI2 A;  2WSC E;  4LDV A;  4EMK B;  2QA4 T;  5GAN d;  4QVZ A;  1Y71 A;  2RJF A;  4C8Q C;  3DLM A;  1JB0 E;  1M1K U;  1WNL A;  3JRZ A;  3LW5 E;  4M75 B;  3OBY A;  4OB3 B;  1Q7Y C;  2DZC A;  3E9G A;  2JOY A;  4YTL A;  2BKD N;  1YIT T;  3OSV A;  2HQE A;  2E5Q A;  2RD1 A;  3CCV A;  4BE2 A;  2K2V A;  1M1F A;  4C8Q A;  4DA4 A;  2DAQ A;  3JB9 J;  4PLL A;  3WVD B;  1I4K 1;  1BKB A;  4L5G A;  3C12 A;  3RKX A;  1G3S A;  3CCM A;  5KE3 A;  3CCS T;  2L89 A;  3ER0 A;  4XU1 A;  4M7D C;  4F7U B;  3NTH A;  4BUG A;  2CS7 A;  3SWN A;  4C92 E;  4J6Y A;  4OB2 B;  4C92 F;  4OGC A;  4M7D A;  1WQ7 A;  1HK9 A;  3WVE B;  1BI2 A;  3EFR A;  3OYY A;  1SSF A;  4IUT A;  4J83 A;  3MEA A;  2XIC A;  2F5T X;  4MZT A;  2X35 A;  1VIE A;  4M78 C;  1YJW T;  1KD1 U;  5I2M A;  2GFU A;  3FB9 A;  5A0L A;  1ZHI A;  3OS5 A;  5GAM g;  3OYE A;  2K5F A;  3V8L A;  2LT4 A;  3M5A A;  1Q86 C;  4HKE A;  4NOY A;  3RMS A;  3L2W A;  2FHD A;  3G6E A;  4L59 A;  4D6W A;  4C92 G;  4JRQ A;  3JB9 I;  1YJ9 A;  2LQK A;  3PFS A;  4QW2 A;  4M7A D;  3VV0 A;  3CCE A;  5LJ3 d;  1QVF A;  4P5N A;  1XTD A;  3CPW S;  1PSE A;  4PL6 A;  2O4X B;  1QP2 A;  3J7A F;  5GAM h;  3JB9 H;  2P0Q A;  5LJ5 d;  5GAN f;  2K57 A;  3S3M A;  3WXM B;  4J7F A;  3L2U A;  5EG2 A;  4CRI A;  2O01 E;  3OW2 A;  1GXI E;  3J80 E;  5GAO q;  2ZPG B;  2EQU A;  3OYB A;  1VQ5 A;  2RI3 A;  1H64 1;  4X34 A;  2KY9 A;  1JBM A;  4A4F A;  3F70 A;  2HAX A;  3CCM T;  1YJN T;  5GAM e;  4C8Q D;  2QQR A;  4X9D A;  3O8V A;  3H8Z A;  3G7Z A;  4HCC A;  1DJ7 B;  3V8K A;  2CZ0 B;  3VU3 C;  4C92 C;  3QJ6 A;  2YRV A;  3MCA B;  1BI1 A;  3S3N A;  2RK2 A;  2KSS A;  1VQ9 A;  2C06 A;  1NPR A;  3MEV A;  1QW1 A;  4BDZ A;  3QZ9 B;  3S3O A;  3CCJ A;  4M7A E;  3CME T;  1U1S A;  1N6A A;  4M7A F;  1M4Z A;  1N27 A;  1KQ2 A;  3OYA A;  2EJF A;  3SD4 A;  3LGL A;  4RMO A;  2R5M A;  3PTA A;  4IUR A;  2V8I A;  4A54 A;  3CC2 A;  1OZ2 A;  3ME9 A;  4DOW A;  1G3W A;  3C94 A;  1BIB A;  2D9T A;  2VXF A;  4C5I A;  3L2Q A;  2BUD A;  1VQP T;  1M1K C;  1R8O B;  4LD6 A;  1LOJ A;  4M78 D;  4FIB A;  4JS4 A;  2LCC A;  2QQ9 A;  4EMK A;  2E6Z A;  4GY5 A;  5FLX E;  3KUF A;  3PMT A;  4BB7 A;  5GAN 2;  2XDD A;  4C8Q E;  5M9O A;  5GAM j;  1AHJ B;  4M77 C;  4C8Q F;  4IUQ A;  4M75 A;  3A8G B;  3VYG A;  2QQB A;  1QVG S;  2E1H A;  1K73 U;  4M7A G;  5CKH A;  3FLG A;  4PJO B;  2D0Q B;  1NE8 A;  5GMK h;  2P0P A;  5A2Q E;  3BY7 A;  2FVU A;  1VQ5 T;  5KH6 A;  3V7S A;  4FM4 B;  4ZN1 A;  2ZPB B;  4N4H A;  5L8R E;  4IUP A;  2HNI A;  1S72 T;  3TEE A;  4M7D E;  3M58 A;  3QXE B;  3FDR A;  4M78 B;  4F7U A;  3BDL A;  1M90 C;  4M7D F;  4PNO A;  1QVF S;  3QYH B;  1KC8 C;  2E64 A;  3GNG A;  1Y07 A;  4J7I A;  3OSS C;  5J3B A;  2K3X A;  4ZTF A;  3VJP A;  2BIV A;  3UPU A;  2L8D A;  2QQA A;  5GMK e;  3MP8 A;  2DXT A;  4PKC C;  2DPP B;  3OA6 A;  1KD1 C;  2V8J A;  4C8Q G;  2CYZ B;  1N8R C;  3RUX A;  5HKC A;  1ZQ1 A;  5GAO r;  2L3R A;  3OW2 S;  4IKF A;  2KAF A;  2MWP A;  2ZGW A;  3NTI A;  3JCM c;  2X4X A;  1RL2 A;  3FIF A;  5GAO n;  2PVD B;  2K5I A;  2RJD A;  4C92 D;  5CVI A;  3CCQ A;  3VUB A;  3CCL T;  1YHQ A;  5FU7 C;  3C4S A;  4KBM B;  2GF7 A;  3JCM d;  4XTZ A;  4M7D G;  2RHY A;  4O5V A;  3X28 B;  1VQ6 A;  2A7Y A;  2ZZD A;  5GAN g;  4J5Y A;  4R55 A;  1WJQ A;  3L2V A;  4JJN K;  1I5L A;  2OTL T;  3MP1 A;  4HT9 A;  4MML A;  2RO0 A;  2OTJ T;  4XQ3 A;  2DO3 A;  2DXC A;  2RI2 A;  1NPP A;  3ASK A;  4OP0 A;  5I21 A;  3MEW A;  2EWN A;  2O4X A;  2M1H A;  4C0D C;  4A4G A;  3M57 A;  4BY6 C;  1NZ9 A;  3DB3 A;  2XDP A;  3A8H B;  4JLG A;  4KUL A;  4C92 B;  2DTI A;  2KK4 A;  3H6Z A;  4M78 G;  5GAN h;  3OYD A;  4OMF B;  1O75 A;  3VKI A;  1X01 A;  5GMK j;  1VQ7 A;  4DQ2 A;  1KQS A;  5A0D A;  1LJO A;  3M4G A;  3SWN C;  3P8H A;  3I55 A;  1UB4 A;  3M9Q A;  1I8F A;  4C5H A;  4C0Z A;  3OMG A;  4M77 D;  3T9N A;  3PGG A;  1RI0 A;  1VQ4 T;  4OB0 B;  4E47 A;  4HCB A;  2EIF A;  3UT1 A;  3CMA A;  3HKS A;  5CKE A;  1VQK T;  2DIG A;  3ZFJ A;  3QUI A;  5GAN e;  4NL3 A;  3OS1 A;  2ZPI B;  4JDS A;  1M9S A;  5D6W A;  4C0F A;  3CCR A;  3HRT A;  3KBG A;  2JTF A;  3OMC A;  3CC4 T;  2DTO A;  2DXU A;  2L5Q A;  2RJC A;  4A53 A;  4JRI A;  2M16 A;  1X6O A;  4J8O A;  1VQL T;  2LX9 A;  3DKM A;  3OY9 A;  3L2R A;  4RCB A;  3CBM A;  4E7I A;  3CD6 A;  4LDW A;  2JUF A;  5C0M A;  3JCM b;  2JZ2 A;  3V7R A;  3VUZ A;  2EJG A;  3ZBD A;  3PIP A;  1VQ8 A;  4Z02 A;  4V2S A;  2JTM A;  4HA8 A;  2E65 A;  5FRN A;  3QYG B;  2RJE A;  4IUU A;  3QKJ A;  2E70 A;  4LDX A;  1K73 C;  4M75 F;  2K3Y A;  4JRK A;  4BD3 A;  1K9M U;  5I2S A;  3X26 B;  1OI1 A;  1FXX A;  5GMK m;  2RH2 A;  3L42 A;  5FU6 C;  1Q81 U;  1G5V A;  4M77 E;  4KUD K;  2LVM A;  4M77 F;  2MWO A;  3G71 A;  2XK0 A;  3OYN A;  1VUB A;  5GAN j;  2VV5 A;  3CCV T;  1TH7 A;  3FC3 A;  3CC7 A;  3R6O A;  4BDY A;  2ZPH B;  1KHC A;  3GPL A;  2ZCF B;  1KHI A;  2F5K A;  3OYK A;  4E7J A;  4R56 A;  3QBY A;  4M7A B;  5LJ3 e;  4FT2 A;  3SFM A;  5GMK i;  3J81 E;  5CKD A;  5FU7 B;  4UC4 A;  1NJI U;  1W2B A;  5GAN 4;  3X25 B;  4ELZ C;  1Y96 A;  2YHT A;  3NFC A;  5GAM d;  2JVV A;  1Q82 C;  3OYM A;  3VYH B;  5C6S A;  4XU2 A;  3HSB A;  2H3J A;  4M77 G;  3G4S A;  3RIR A;  3A8O B;  3LYI A;  3NTK A;  4EMG A;  4ZGJ B;  3C95 A;  5DLO A;  1YIJ A;  2QTX A;  5GMK l;  4M7D D;  3A8M B;  1KQS S;  2XU8 A;  1WJS A;  2CZ7 B;  3DLL A;  1B34 B;  4BY6 B;  3PIO A;  3X20 B;  1BI0 A;  3KXT A;  4C8Q B;  2EAY A;  1BYM A;  4ATO A;  4E7H A;  3BW1 A;  2VGM A;  4VUB A;  3G6E T;  2HD0 A;  4ZGD B;  4EMK C;  4C5E A;  3QG1 A;  3HRU A;  1YJ9 T;  1M8V A;  3CCE T;  5KCO A;  2JNG A;  4M75 C;  1UGP B;  5GAN 5;  4EDU A;  5LJ3 f;  3OS0 A;  4N4I A;  2RK1 A;  4XTV A;  2R58 A;  4M7D B;  1V29 B;  2QEX A;  2LTO A;  3OYH A;  2RB6 A;  5LJ5 f;  4QQG A;  5IT9 E;  1YCY A;  2Y4Y A;  3OBW A;  3CC7 T;  2XDB A;  2ZPE B;  4TVR A;  1LNX A;  3QDR B;  3GIB A;  2V8K A;  3OS2 A;  1JRI A;  5IN1 A;  4BE1 A;  4JUV A;  2MAM A;  2PU9 B;  3X24 B;  3MEU A;  3HPW A;  2GFA A;  5GAN 6;  1VQO A;  2FB7 A;  2E12 A;  1YI2 A;  3S6W A;  1K8A U;  4XU0 A;  2XKO C;  5KE2 A;  4N0A A;  1VQ9 T;  5J39 A;  3QPH A;  1VQM A;  2Y90 A;  2AHJ B;  3G4S T;  4ZTJ A;  5CKF A;  3OB9 A;  4C5G A;  3QO3 A;  3CCJ T;  1QP3 A;  4BI4 A;  3OYI A;  5HY6 A;  5LL6 S;  3UWN A;  2B8A A;  4PLI A;  2DIQ A;  2PVO B;  5FU6 B;  1YIT A;  2CGH A;  2MF2 A;  2CZ6 B;  3CC2 T;  2Y4X A;  2LC4 A;  3LGF A;  5D6X A;  3LX7 A;  5CO7 A;  4MDW A;  3OYG A;  1W2B S;  2QQS A;  3L1A A;  3SB2 A;  3JCM h;  3TRE A;  4O6J A;  5HK3 A;  3CCS A;  1G3T A;  2WAC A;  3HFO A;  2GQV A;  3CPF A;  4BI8 B;  3JCM P;  2DZ9 A;  3UDC A;  4RKU E;  1BI3 A;  4KT0 E;  3RKW A;  2WSE E;  2XHC A;  3JB9 D;  2DK3 A;  5FRM A;  2DKG A;  3M55 A;  2K4Y A;  2RI5 A;  2R5A A;  3CPW A;  3JSC A;  3LLR A;  5GAN 8;  3RMQ A;  3JCM e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...