3P8DA

Crystal structure of the second tudor domain of human phf20 (homodimer form)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
SEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Medulloblastoma antigen MU-MB-50.72
total genus 12
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8dA00
2DIGA 2M0OA 2K3YA 2BUDA 2PQWA 4BE0A 3E9FA 4CRIA 3LYIA 1KHCA 2MWOA 2X35A 2XDPA 2K3XA 3QJ6A 4OVAA 3OYHA 2JZ2A 2M16A 3LH0A 5KH6A 3OYMA 2X4WA 4BDYA 3P8DA 2RHUA 3OYCA 3OYAA 3OYLA 2EKOA 3FEOA 3L2WA 5FRNA 2HQEA 1WJRA 2IG0A 3OA6A 4C5HA 4Z02A 3S3OA 3C4SA 5CIUA 3DB4A 4A4HA 4C5IA 4HCZA 2EQMA 2YRVA 3PFSA 3OQ5A 2RJFA 2E6NA 2B8AA 2M1HA 4QQ6A 2XK0A 3ME9A 4PLLA 2RO0A 3L42A 5C0MA 1WJQA 4QQDA 2QQRA 4ZTFA 2NLUA 2RHYA 5KE3A 3OYKA 4X34A 4E7KA 3H8ZA 1H3ZA 1OZ2A 5KCOA 3OYFA 3QKJA 4PLIA 5M9OA 3MEAA 3NTKA 3P8HA 2O4XB 3MP6A 5FROA 3LGFA 2JTFA 4L59A 2LVMA 4B9WA 4UC4A 4E7HA 2LCCA 4IUPA 2EQJA 2WACA 2LRQA 2FHDA 3KUFA 4FL6A 4BDZA 4QVZA 5D6YA 3M9QA 3OB9A 3OYDA 3OYJA 3OMGA 4E7LA 3OYBA 2R57A 4BACA 1G5VA 2RJEA 3ASKA 4A4GA 2RI5A 4BE1A 5D6WA 3PNWC 2HQXA 3OS1A 2GFUA 2EQKA 3MEWA 2RI2A 1WJSA 2CKKA 4EDUA 3S3NA 3S3MA 3FDRA 3H6ZA 3LGLA 3LLRA 4IUTA 5IAYA 4GY5A 3OS0A 4ZTJA 2R5AA 4LD6A 3UWNA 3ZEHA 2BIVA 4Q5WA 2LTOA 2X4YA 4N4GA 3UT1A 3F70A 4E7IA 5C6SA 1OZ3A 4FU6A 3FLGA 2QQSA 5KCHA 3MP8A 5J26A 2D9TA 4BD3A 4E7JA 3OY9A 4IURA 3OYNA 2L89A 3E9GA 2F5KA 2EFIA 3L2RA 1XNIA 3O8VA 4II1A 3NTHA 3QBYA 2L8DA 2MWPA 3PMIA 5J39A 3MO8A 3DLMA 4C5GA 3OYGA 3QIIA 3DB3A 4A4EA 2BKDN 4N4IA 3META 2DAQA 1SSFA 3OYEA 3GOXA 4A4FA 3MEVA 3PMTA 2RHXA 2R58A 5IN1A 1WGSA 3SD4A 2DIQA 2EQUA 2GFAA 2LDMA 2RJDA 3MP1A 4IUVA 4IKFA 2VYTA 2RHZA 5KE2A 2P0KA 2R5MA 4IUQA 4IUUA 4QW2A 3OMCA 3BDLA 1MHNA 2E5QA 3EAEA 4QQGA 4RG2A 3S6WA 3LX7A 3L2QA 4NS5A 1OYXA 2G3RA 3MEUA 2RI3A 3NTIA 3CEYA 4PL6A 5D6XA 3OYIA 1RI0A 2RHIA 3FC3A 2RJCA 3Q1JA 3OS2A 2L3RA 2X4XA 4B9XA 3L2UA 4N4HA 3L2VA 1OI1A 5FRMA 2GF7A 2O4XA 4BE2A 1N27A 4C5EA
chains in the Genus database with same CATH superfamily
2HEQA 1VQKQ 1G3WA 3JCMg 3CXCP 3CCLA 4RTVA 1W4SA 5LJ3j 1M9SA 1K4US 1BI3A 2AT1B 3VUBA 3OYLA 4M75A 3M0SA 2DETA 2CS7A 2DXUA 2RJFA 2DEUA 3GBQA 4JZ4A 5GAMh 1LPLA 1J3TA 1I4K1 3JCMf 4RKUE 1TUCA 1NYGA 1NEBA 1PKSA 3A8OB 5HK3A 1BI1A 2RQWA 4FYVB 3ZL7C 2HD0A 2WACA 4C92E 1YITT 1JB0E 3EFOB 1MGQA 2VGNA 3JB9I 3OYJA 4Z88A 2RMOA 1YITA 1QCNA 3HL8A 4XTXA 2E5KA 4FSSA 1ZSZC 1KIKA 1FMWA 1VQ6Q 3S3NA 3A8GB 4KUDK 2JXBA 1PSFA 1M90U 4PJOB 4FU6A 4M78G 4JLGA 4PK4A 2P4TA 4LUEA 5J26A 5FW9A 5CKBA 5FU6C 4PJOG 4PJOA 2K5FA 5I2SA 2DERA 2WSEE 1OQKA 5DLQE 3JCMb 4ZGJB 1RAGB 2RN8A 3BW1A 1MMAA 3BE3A 5J3BA 3I9QA 5LJ5f 1H92A 3OYEA 1Y07A 4A4FA 1GBRA 2JMCA 3BY7A 5LL6S 3RESA 3BDLA 1MHNA 2CUBA 3TU4K 3CCSA 3LX7A 2PUOB 1B07A 1RI9A 3CEYA 2EYWA 3FC3A 4E6RA 4M75F 1VQNT 2CSQA 1I81A 1N9RA 2EYZA 1XTDA 2K5IA 5ECAA 3CMET 1NBEB 1M5Q1 2M0OA 2EYXA 1M8VA 4LDUA 2F2XA 3LYIA 4M75B 3TSZA 2JZ2A 4RTTA 2ABLA 1W2BS 3CC7T 3DKMA 2MAMA 3JAME 2EKOA 3GPLA 1C6VX 1KK7A 4C5HA 1VQ4A 3I56A 1SPKA 3WXMB 1OPKA 1TUDA 3QJYA 5FU6B 1YJNA 2SRCA 4ESRA 3VS6A 2EGEA 3EFRA 4C92F 5CR2A 2BTTA 3OYKA 2KMTA 1Q86R 4KH1B 1Z9ZA 1VYVA 3REAB 1VQ7A 5FROA 5FLXE 3CC2Q 1QP2A 4YTLA 4EMKC 2DJQA 4HCCA 2F69A 2G6FX 1KSWA 2KNBB 2RD1A 2GQVA 5GANh 1D3BA 1QWFA 2AZSA 1JJ2P 4PJOF 1GRIA 2BE9B 1RABB 2CP0A 1GBQA 1X43A 1M1GA 4M77F 4J6YA 4C0FA 1WNLA 3MEWA 1NYFA 1UJ0A 4PJJA 2J6OA 4ZTJA 1LOJA 3HRTA 5C6SA 2A36A 2B86A 1TU0B 4E7JA 2DA9A 4CC3A 3EG3A 1FYNA 1OV3A 2J05A 2O2OA 2YUPA 4II1A 4J9DA 5GJVB 2KEAA 3CMEA 4FIBA 1UDLA 1C1AA 1UG1A 4CC4B 2GNCA 1S72T 2E6ZA 4DBRA 2PVDB 1EX4A 3QSUA 2OAUA 2LDMA 4KH0B 1HK9A 2XMFA 1SKUB 4IUUA 3EAEA 4Z89A 4PL6A 3TVTA 1M2VB 1YITQ 3EH1A 2L3RA 4GBQA 4B9XA 1ARKA 2EVRA 2KSSA 2O4XA 3VS4A 1X2KA 2MOXA 3SWNC 2RM4A 5A0GA 2I0NA 5GMKm 1G83A 3I35A 5GAMf 3CCUT 2HSEB 2V8KA 1VQLA 2ED1A 2DZ9A 3EH2A 4XTZA 2CZ1B 4HVWA 4D8DA 3CCJA 2XK0A 3ME9A 1BIAA 4KRTA 5I11A 2NUZA 2LJ3A 2QI2A 1I5LA 2RHYA 3EGXB 2EQIA 1YJWA 2DVEA 1IGUA 1OZ2A 1YIJT 3MEAA 2RK2A 1VQKT 2JTFA 4LE9A 3CC2T 1V1CA 3VS3A 1HXDA 5LJ3f 7AT1B 1LCKA 4AFSC 4BACA 1D1AA 2IPOB 3MCAB 3JCMJ 3VJPA 4OMMA 1I5OB 1WJSA 3C95A 3JB9G 1VQ8T 4M78B 1KQ1A 1AT1B 2BIVA 2CREA 1U3OA 3CCVT 5GANg 2D9TA 1BCMA 2CDTA 5FU7C 2F5KA 4XK8E 1MV3A 4RCBA 4PFPA 4M7AG 4RTYA 1YI2Q 2FZKB 3DLMA 1Q81C 1KD1U 2KRSA 2OTLT 3GOXA 1K76A 1VQ8Q 3PMTA 2YSQA 2PTKA 3SD4A 3X28B 2LQKA 2AHJB 3CCRT 1Q7YC 4R56A 3C94A 3CBPA 5AYFA 1AWWA 3H0FA 5FU7B 2LC4A 3EG0A 1XOVA 3G4ST 2J7IA 2FZGB 1RAFB 3M59A 3VS5A 1YCSB 4BE0A 4C8QF 4CRIA 2YUQA 2K5LA 2X4WA 2BE7D 2JT4A 3O5ZA 4C92A 2OTJT 3OYCA 3WVDB 2V1RA 5IH2A 2DEQA 1Q86U 2J6FA 4FT2A 4DOVA 1ZUUA 4C5IA 4A4HA 3OW2A 1X2QA 1K0SA 1PC0A 3OQ5A 2RPNA 3I55T 2V26A 5HCKA 1UGSB 5I22A 4DA4A 3UATA 1D0YA 3JB9F 1N6AA 2CH4W 1G2BA 2YRDA 2LCCA 1BI0A 2LCLA 3TEEA 3OYBA 2L3SA 3H9NA 1T0JA 1OU9A 1VQOA 4M7AF 1VQNA 2GQIA 3CCJT 4F7UA 1X6BA 1TSFA 1JQQA 2D0QB 3UF4A 1U1TA 4E7IA 4J9EA 4M78A 2XKOC 1N5ZA 3MKDA 5KCHA 2RA2A 2HDAA 1RLPC 1VQPQ 3C12A 4C92D 5GAOm 3I55Q 4OMOA 3MO8A 5D7UA 4M7DA 1X27A 5EG2A 4EPCA 2KT8A 1MNEA 5KYUB 1VQ7Q 2RH2A 3CCLT 1WGSA 2CT4A 3L2ZA 4DEXA 1YIJQ 4RMOA 2RHZA 2R5MA 1VQ7T 3OMCA 2K4YA 3EFSA 1VQLT 2RHIA 2GCXA 3M54A 1YJNT 3JCMV 3L2VA 2K57A 3JB9J 2Y90A 1I07A 3CC4A 3E9FA 3QJ6A 2M02A 2BZXA 3EG9A 4A4KA 1YHQT 2AK5A 1PCXA 2QDLA 1ZSGA 1VQOQ 3OYAA 2KT1A 4N0AC 2NYSA 3VUZA 1PWTA 2A08A 4MMLA 2JJ9A 2VKNA 1VUBA 3SWNA 1RL2A 1H3HA 3T9NA 1AWXA 3MP6A 2PNIA 3NFCA 4JJBA 4M78F 1WA7A 2EAYA 3M56A 1WZOA 3M9QA 2DNUA 4KGXB 2RJEA 3RUXA 1D0ZA 3MJXA 2LNVA 2X51A 4AFZC 1FWZA 3PE0A 1IGQA 1QP3A 3CCEQ 4M78E 5IAYA 4ELYC 2OTLA 1AWJA 1IZ6A 4N4GA 2A37A 1VOMA 2P4RA 1WHGA 2QQSA 3JRZA 1WHKA 4IIOA 3CCRA 2NUPB 1T0HA 3G1JA 3E9GA 3GF5A 3URGA 2DXCA 4OP0A 2PUKB 2JS2A 3THKA 2YRCA 3HFOA 1M4ZA 4J9HA 3MPUB 1YCYA 5CK9A 3FJPA 3EGUA 2DX1A 4JPBW 2CP6A 3CCJQ 2RHXA 2R58A 5GAMg 1ZA2B 1K0XA 2V8IA 5GANd 2GTJA 1D1BA 5GAMj 2ECZA 3A5ZB 4QQGA 1GFDA 2K6DA 2KYMA 3NTIA 5KYWB 3RKXA 2FYKA 1RAEB 2DKGA 2EBPA 3M55A 1Y7XA 3FJ5A 1CKAA 5GAMe 1I1JA 3NHNA 2V8JA 5KYXB 2MYSA 3X25B 5LJ5g 1M1KC 4C92G 2X35A 4OVAA 1R77A 6AT1B 2KXCA 5KH6A 2HCKA 3TSWA 1K9AA 1BBZA 5FRNA 4KULA 2AIRB 3TCJA 2A28A 4X1VA 2YXYA 3SEMA 3GP8A 4PLLA 3L42A 2EPDA 1WJQA 2L0AA 1VQ5A 4OB2B 3RBBB 1PRMC 1Q82C 1H3ZA 2WSFE 2JVVA 1Y0MA 2OI3A 3QHSA 4PFZA 2ZPGB 4UC4A 4JS4A 5L23A 1ZSZB 4NL2A 2D8JA 2GBQA 3M4GA 1UHFA 3GNGA 3OYDA 1M1KU 2DXTA 5GAOp 2BZYA 2RQRA 2KBTA 2FVUA 1RAIB 4CC7A 3VS1A 4J8OA 2XG8D 3HHTB 1Y71A 2FRWA 3EGDA 5GJWB 3OSVA 1KFZA 1YIJA 1WPYA 3OY9A 3RR6A 4RUGA 1H8KA 5FWCA 3EFOA 4C8QB 1YJNQ 1QQJA 2FB7A 2QGFB 2E41A 4C0DC 4M75D 3JCMX 4N4IA 4M7AB 1WXTA 1BI2A 2DFUA 2DVJA 5GAN7 3JCMc 1QVFA 2E5QA 3VRZA 5GAN8 2EKHA 2KRNA 3QZ5B 4DQ2A 3J81E 1BYMA 1X75C 3Q1JA 5FWBA 1QKWA 3ER0A 3QUIA 1HYOA 4JUVA 4OB0B 4XTWA 2DIGA 1KG1A 3CPWP 2W0ZA 1ZBJA 3N5BB 4JRKA 3FRNA 1UUEA 4NOYA 4EMHA 3M58A 2XD0A 2DTOA 4BUGA 2HMAA 2HQEA 3C4SA 1ABQA 1Q81R 4QQ6A 2AZVA 1NG2A 4A54A 2DD5A 2JUFA 3RMSA 4X34A 2QYZA 1IHVA 2MCNA 4C8QC 4LDWA 5IT9E 2DMOA 1G3TA 2LX7A 3FIFA 5CQYA 2OX7A 4QVZA 1VQ6T 5KYYB 4FSXA 4LXCA 2CP3A 3CMAQ 1KQSS 1UE9A 4XU2A 3SB2A 1CKBA 4Y91A 3REBB 4F16A 4DBFA 1G3SA 3UWNA 1YJWQ 2M51A 1OZ3A 5GAMd 4F14A 2KK4A 3JCMQ 5KYUA 4IURA 3OYNA 2L89A 1ZHIA 2HKQB 2D0NA 3CCUA 1X69A 2K9GA 4F7UG 4M7DB 4AT1B 3G6EA 2MWPA 1WX6A 2E3HA 1SRLA 4E7SA 2RNAA 1GL5A 5GAN3 4RG8A 2QEXQ 3CCEA 1Q95G 2P0PA 3KBGA 5KYNA 5IN1A 2L3QA 2DTIA 2NUTB 2GFAA 1K8AC 1YJ9Q 5KE2A 4RG2A 2G3RA 1PHTA 4V2SA 2AKLA 4L5GA 3V7SA 3G4SA 4AFUC 1QVFP 3NPFA 2A7YA 4M7DF 2QDYB 3J80E 2COYA 1M3BA 2K3BA 1KHCA 5CAIA 2E12A 2NUPA 1UTIA 3OYHA 2SEMA 3CMAA 2ROLA 2HL3A 1R0CB 2EGAA 4F04B 1N9SA 1GFCA 3M53A 1KQSP 3HKSA 3FEOA 4KT0E 2IG0A 2DXBA 2L2PA 3M0PA 3S3OA 3CD6Q 1MMGA 1M30A 1C0MA 3M4YA 5GAOn 2RO0A 2WSCE 3VYHB 4QQDA 5GMKe 1YNZA 3INZA 2LP5A 2FZCB 2PZ1A 2HQHA 3A8LB 2JMAA 4L59A 3R6NA 1K73U 4E7HA 4IUPA 2EQJA 4KBMB 2LRQA 1AEYA 5GMKi 4JZ3A 1JJ2A 1T3LA 2JM9A 4XTUA 5D6WA 1Y96A 4FW2A 4C0GA 2CH4A 1KC8U 1TXQA 1O9SA 2LQ8A 3OBYA 2MF2A 3FDRA 3LLRA 2DE0X 1YBYA 2CP2A 2K2MA 2LTOA 2LJ0A 3RKYA 2JW4A 5I2MA 2ROTA 3MP8A 3U23A 1MV0B 1R8OB 2YWWA 3EG9B 4ZNXA 3EG2A 4J9CA 1M1FA 4PKCC 2KY9A 4AFQC 1TG0A 4LNPA 4J6XA 5GAN6 3E1SA 3META 1XQHA 3PT9A 2JS0A 2FG0A 2VASA 3QYHB 1YN8A 4HVUA 1W2BA 1JXOA 1M90R 3E19A 2EQUA 3P8BB 1WIEA 2RJDA 1KC8C 4X9DA 5IXBA 1TWBA 1WQ7A 4ORZA 5DLOA 4RTZA 3CCLQ 4Y92A 2JNGA 2QQAA 2C0TA 2EGCA 2QXFA 3JCMP 5FRMA 1A0NB 2RK1A 5HK0A 1VQOT 1E6HA 2GGRA 3JB9H 2XDPA 2K3XA 1M3AA 1SHFA 3CC4T 2Y4XA 2EYQA 4HKEA 2E3IA 3EG1A 4OMFB 4FCYA 3SDZA 2E6NA 2B8AA 4D6WA 4ZN1A 4GLKA 4HA8A 4HT8A 4ZTFA 1PD0A 4AG2C 2JOYA 1SF9A 1BIBA 3LGFA 3UDCA 5LJ3h 1NJIC 2MI6A 3V7RA 2ZCFB 4C0DB 1EZZB 4BDZA 4QVDA 1M2OA 3OS1A 1T3SA 2KAFA 2YT6A 3CCMQ 2NUTA 1DJ7B 2JN0A 2CZ0B 2R5AA 3VS7A 1PKTA 1AWOA 3JSCA 1WYXA 2LJ1A 3HP9A 3H41A 2GTOA 1X6OA 2ENMA 2D8HA 2CZ7B 1M8MA 1K8AU 8ATCB 2EFIA 1RAAB 3CCQT 2C0OA 2HBWA 1UGVA 1ZA1B 4O5VA 5J39A 1ABOA 4XU3A 2LX9A 3G71T 1QCOA 3OYGA 2RF0A 2XIDA 3QIIA 2DPPB 3CPFA 3M57A 2FPDA 1NEGA 4E7ZA 2EJ9A 2DIQA 5IHNA 1QKXA 3HRSA 2VB6A 4JRIA 3OYIA 1B7TA 1HSQA 3X26B 1VIFA 2RJCA 4J5YA 2CP5A 1FMKA 4BI8B 4N4HA 1S72Q 2X3XD 1ACMB 1GCPA 2PVGB 2YUOA 3AT1B 4C5EA 1K73R 1Y96B 2BUDA 4M77G 1VQMQ 2DL8A 4M75E 1Q7YU 4XTVA 1ZQ1A 2H3JA 1M2VA 2A3LA 1OX9A 2V1QA 5GANj 2DLPA 3RMQA 2DO3A 2E4HA 1KD1C 1MNDA 3DB4A 1BU1A 4A53A 3HPWA 2P84A 2DYBA 4PJOD 2QQRA 2XHCA 3ZFJA 4BI4A 3HSBA 3G6EQ 1VQ5T 1VQMT 5GANf 3UA7A 2MPXC 1NZ9A 2PVOB 4LN2A 5D6YA 3OB9A 2W10A 2COWA 3I55A 2FEIA 2GFUA 2DILA 5KYYA 3M0UA 4MZMA 4ZGEB 1U1SA 3OS0A 2F2VA 4AMCA 4PJOE 1FX7A 2MK5A 1N8RU 3VS0A 1NLOC 1MUZA 3CCST 3SHWA 4X9CA 2DYIA 4R0KA 3CCUQ 2FRYA 2CT3A 2LQWA 1SRMA 2DRMA 3BDUA 1EFNA 2J6KA 1GCQC 3WVEB 4JS5A 4C5GA 3M0TA 3CCVQ 2F5TX 2OTJQ 1EIFA 3RKWA 5KYWA 3CCMA 1JU5C 3PIOA 3QG1A 4FT4A 2EW3A 2Y4YA 2E65A 2L3PA 4ZGDB 2C0IA 1D0XA 1D1CA 2QA4Q 1ZSZA 2H3EB 4FYXB 3L2UA 3ULRB 1FMVA 3SFMA 1S72A 5HY6A 3X20B 4HCBA 2QAZA 4BB7A 4M7AD 1WFWA 4RTUA 5EC7A 3LH0A 4C8QD 1E7OA 1D09B 3CPWS 4FYYB 1F1BB 1W6XA 2D1XA 1WXUA 2DBKA 3OA6A 2D6FA 2COZA 1YI2A 2LNHB 3CCQQ 8AT1B 1U06A 2NLUA 4M7DC 1KQ2A 2FO0A 1VQ9T 1K8AR 3OYFA 1PNJA 1WI7A 2DL3A 3QO3A 3CC2A 3CMEQ 1TH7A 1R0BG 3NTKA 5A0DA 3EHQA 4HCKA 4M77D 4M78C 1KHIA 1YI2T 4EIKA 4A4GA 1QWEA 3PNWC 5LJ5h 4F7UF 3QWXX 3J7AF 2CKKA 5A0LA 3NMZC 4IUTA 4OGCA 4LD6A 2OJ2A 2LCSA 2X4YA 3G7ZA 4LDVA 3CC7A 3F70A 3CCMT 2ZAEA 2KDSA 4J9GA 2VVKA 4M4ZA 1KD1R 2E10A 3QWYA 3L2RA 1W2BP 4ANJA 2KROA 2Z0WA 2DJZA 4PNOA 2HAXA 5IXFA 1NPPA 2M0YA 1SG5A 1RACB 1VQ9Q 2OAWA 3RIRA 5LJ5d 1B34A 3H0HA 3CCVA 4D8KA 1WHJA 5IHIA 2ED0A 2H8HA 2P0KA 4IUQA 1VQPT 1HJDA 2ZPFB 2ZPBB 1H641 4MZTA 4PFOA 1YWOA 3M0QA 5D6XA 4R55A 4C92B 2ESWA 2J06A 4QVCA 4LDXA 1OI1A 1SSFA 4E7KA 2VGMA 1N8RC 2K3YA 2O88A 4M7DD 2MWOA 4FW1A 1VQ8A 1VQKA 5LJ5e 3VV0A 1LNXA 1V29B 3BFMA 2RQTA 5LJ3g 5AT1B 2ZPEB 3JB9D 4FM4B 1VQ6A 1OEBA 1AVZC 4J83A 4C8QE 2RQUA 5CIUA 4HCZA 2ATCB 3C0CA 3I56T 2DD4A 3A98A 3VRYA 4XAXB 4OMNA 5KE3A 1PSEA 3G71A 2XDBA 1NPRA 5M9OA 3RDVA 2LVMA 2DL4A 2PU9B 2XI9A 4HVVA 5DY9A 1VQ5Q 4IIMA 4JRQA 2HZYA 2O9VA 5GAN2 4E7LA 4MMKA 2R57A 2EJGA 1ZUYA 2HQXA 2YUNA 3LW5E 4C8QG 2EQKA 4PJOC 3I5SA 2ZPIB 3QPHA 3V8JA 3S3MA 3H6ZA 3X24B 9ATCB 1VQMA 1WDXA 4JDSA 2LT4A 4QT7A 1M1KR 3CMAT 5CCAA 3MHXA 3CCRQ 1I8FA 2E64A 1KJWA 3CPWA 2FPEA 3UPUA 3RERA 3PMIA 1SEMA 1BK2A 1CSKA 2LT1A 4E2FB 2VUBA 1AOJA 1YHQQ 2KRMA 4O6JA 1Q82R 4NL3A 4IKFA 3RNJA 4DOWA 2X4JA 4QW2A 4NS5A 3QDFA 2HL5C 1QMCA 2VXFA 3V8LA 3CCSQ 4RCCA 2FPFA 4ZN3A 1TOVA 3OS2A 4TVRA 2K7AA 3V7CA 5GMKj 4AG1C 1IHWA 1N27A 1VYUA 2VXEA 4HXJA 1RAHB 3KFVA 1Y57A 2LQNA 5CKHA 3P8DA 1NJIU 2KI7A 3LWIA 1AD5A 1ZLMA 5GAOr 1UHCA 5LJ5j 3PFSA 4J9IA 4E47A 2KR3A 4ELZC 3PTAA 3D7SB 5C0MA 3CCET 1SSHA 4MDXA 4F17A 4EMKB 5CKDA 2MIOA 3UA6A 2DF6A 4XQ3A 5KCOA 2DZCA 1X6GA 1G3YA 1IRXA 1Q7YR 2I2LA 4DEYA 5A2QE 1LJOA 2XU8A 2E70A 3KXTA 1KC8R 2ZPHB 1YP5A 4F7UB 1RADB 4M7DG 2RB6A 1G5VA 4VUBA 1AZEA 3ASKA 2QTXA 2RI5A 4BE1A 2JTEA 3R6OA 1PM3A 3E2UA 4PJNA 4CC2A 2YHTA 2QA4A 4JRPA 5GAN5 2F2WA 2KGTA 3A8MB 4M7AA 2CSIA 2RQVA 3G71Q 5GANe 1VQPA 1AHJB 1VA7A 2O31A 1OPLA 3H0IA 3QBYA 2EIFA 4M77B 2QK0A 5CKFA 3CCQA 3TREA 2CZ6B 1Q86C 2YLCA 1OOTA 1JO8A 2BKDN 2XICA 2E1HA 4OB1B 4C0ZA 3MP1A 2DL7A 2CYZB 1NM7A 1NJIR 3MEUA 1GXIE 2RI3A 3JCMW 1VQ4Q 1Z9QA 1UGQB 2EYYA 3CBMA 1I0CA 3VYGA 1PG5B 4BE2A 5DM7R 1YFNA 4C92C 2EWNA 2VC8A 3OS5A 2QG9B 3DLLA 4M77C 1UECA 4GLMA 3G4SQ 1TTHB 2CP7A 2M16A 4BDYA 3OW2S 4J9BA 1YJ9A 2RHUA 1NE8A 5GMKl 4M75G 4M77A 3OSSC 4M7AC 4QKUA 1HD3A 1BCOA 1KQSA 1M27C 1UEBA 2OTJA 5CKEA 2EQMA 4OB3B 2YLBA 2M1HA 3VS2A 1UGPB 1LVKA 3TQ7P 3H8ZA 3I56Q 2DM1A 3P8HA 2O4XB 4OF1A 3CBOA 1ZX6A 3ZBDA 5KYXA 4B9WA 4KGZB 1VQNQ 4Z8AA 5LJ3d 4PJLA 2CUDA 2K2VA 4A63B 3CD6A 1QVGP 1QLYA 1VIEA 2MMPA 1NLPC 3VKIA 4LD9K 3AHUA 4EDUA 2HSPA 4PJMA 3PGGA 4OMQA 3PIPA 1K73C 1RUWA 1JBMA 2KXDA 3JV3A 3M0RA 3IQLA 1XNIA 2KQWA 4J6WA 2LMJA 2C06A 2L8DA 4M77E 4LDYA 4WTOB 1JJ2S 1VQ9A 5L8RE 4MDWA 2DAQA 1O75A 1MMDA 3HTRA 3MEVA 2A0FB 2QEXA 2DRKA 1YJ9T 2AKKA 2QQBA 2ZZDA 4IUVA 4XU0A 2VYTA 1XJWB 3GLXA 4Z02A 1WHMA 1WHLA 3S6WA 3JCMh 3L2QA 3CXCS 1YWPA 2OTLQ 1RI0A 1G8XA 2YDLA 2X4XA 3CC7Q 3I5RA 1UB4A 3A1PA 3JCMe 1UGRB 1P92A 4KUIA 4JJDA 1V76A 1K9MC 2FL7A 3LWHA 3OYMA 1QVGS 3EGDB 3L1AA 1K1ZA 1IREB 4MZPA 1IXDA 2IIMA 4DBHA 1QVGA 1IO6A 4XU1A 2YRVA 1UJYA 4F7UE 1TS9A 4OMLA 3JCMd 3QKJA 4PLIA 3M5AA 1YHQA 3PVQA 3EGXA 4JJNK 1M90C 4N0AA 3KUFA 5GAOq 1OX8A 3FB9A 1U5SA 1K9MU 3OMGA 3HRUA 3OBWA 3OW2P 2K79A 3G6ET 1B3QA 1IB8A 1TUGB 1ZBXA 1N8RR 1QCFA 4J7FA 1UFFA 3LGLA 1YJWT 1PRLC 1WQWA 3A8HB 2ZGWA 4HT9A 3UT1A 5I21A 2QA4T 4WCIA 1JEGA 4J7IA 1W1FA 2F1LA 4B6MA 3NTHA 2DK3A 5CQXA 2VV5A 2CGHA 1OU8A 2QQ9A 1U8RA 4JLIA 1JRIA 2DTHA 4J9FA 3DB3A 2LZ6B 4K11A 5CO7A 2M9UA 4XTYA 1WLPB 2X3WD 3VU3C 4ATOA 2BZ8A 4CI0C 1WHHA 1W70A 3GNFB 1VYTA 1X01A 3CQTA 5LJ3e 4M75C 2HBPA 4LUDA 3PVLA 2PQWA 3CC4Q 4Y28E 3EHRA 2XDDA 1Q82U 1D3BB 4RTWA 4FYWB 2VWFA 4M7DE 3L2WA 1WJRA 1FXXA 4WF2A 1GCQA 4M78D 2EJFA 1VQ4T 3NGPA 1MMNA 2P0QA 1QVPA 2KE9A 1BB9A 1JXMA 1QVFS 3CXCA 1M3CA 3OYYA 3QXEB 1OULA 3V8KA 2O9SA 2FHDA 4FL6A 5GMKh 3GIBA 2L5QA 4JJCA 1S1NA 2IVWA 4EMKA 1ZUKA 2JM8A 2RI2A 1AZGB 1K9MR 4GY5A 2NWMA 1BKBA 3LH5A 4BY6C 5IHKA 3ZEHA 2DBMA 4Q5WA 2QASA 4OGEA 2QEXT 3FLGA 1PD1A 4OMPA 2O01E 2HKNA 4BD3A 1B34B 2QGGA 5GAOl 1E6GA 2KYBA 1RLQC 5GAN4 5CVIA 3O8VA 3QZ9B 1Q81U 3QDRB 2JTMA 4A4EA 2HNIA 4C8QA 4ME7A 4P5NA 2X9HA 4KGVB 3HFNA 4L6V5 1WXBA 1OYXA 4BY6B 2KVQG 4EMGA 4DBQA 2QTVA 3QYGB 5HKCA 2DL5A 1SHGA 3SWNB 3CD6T 4M7AE 1QW1A 2GF7A 4RTXA 1VQLQ 4BI3A
chains in the Genus database with same CATH topology
3CC4A 3JB9H 1G3WA 3E9FA 3JCMg 3CCLA 3QJ6A 2XDPA 1W4SA 2K3XA 5LJ3j 1M9SA 2VXEA 4A4KA 3CC4T 2Y4XA 1YHQT 2EYQA 1BI3A 5CKHA 3P8DA 4HKEA 1NJIU 3VUBA 3OYAA 3OYLA 3LWIA 4M75A 4N0AC 5GAOr 4OMFB 3SDZA 2CS7A 2DXUA 5LJ5j 3VUZA 3PFSA 2RJFA 2E6NA 2B8AA 4E47A 4D6WA 4ELZC 4ZN1A 4GLKA 4MMLA 5GAMh 3PTAA 4HA8A 5C0MA 3CCET 4MDXA 4HT8A 4ZTFA 4EMKB 1I4K1 1VUBA 3SWNA 5CKDA 1RL2A 4XQ3A 3T9NA 5KCOA 2DZCA 2JOYA 1BIBA 1G3YA 3JCMf 5GANj 2I2LA 3MP6A 3LGFA 3NFCA 4RKUE 3UDCA 5A2QE 5LJ3h 1NJIC 2MI6A 1LJOA 3V7RA 3A8OB 5HK3A 1BI1A 2ZCFB 1YITT 4C92E 2WACA 2HD0A 2XU8A 4M78F 1JB0E 2E70A 4C0DB 2EAYA 3M56A 3KXTA 2ZPHB 4BDZA 1MGQA 2VGNA 3M9QA 3JB9I 3OYJA 1YITA 4QVDA 4F7UB 4M7DG 2RB6A 1G5VA 2RJEA 3HL8A 4VUBA 3ASKA 2QTXA 2RI5A 3RUXA 4BE1A 4XTXA 3R6OA 3OS1A 2LNVA 2KAFA 1FWZA 1QP3A 3S3NA 4M78E 3A8GB 1DJ7B 2JN0A 2CZ0B 5IAYA 4KUDK 2R5AA 2YHTA 2QA4A 4ELYC 4JRPA 2OTLA 1PSFA 5GAN5 1IZ6A 4N4GA 1M90U 4PJOB 3JSCA 3A8MB 4FU6A 4M78G 3HP9A 4JLGA 4M7AA 2P4TA 2QQSA 5J26A 1X6OA 3JRZA 5CKBA 5FU6C 2CZ7B 4PJOG 5GANe 1AHJB 2K5FA 3E9GA 3CCRA 3GF5A 2EFIA 1VQPA 1K8AU 5I2SA 3URGA 2WSEE 5DLQE 2DXCA 3CCQT 3QBYA 2PUKB 2EIFA 4OP0A 3JCMb 4M77B 4O5VA 5J39A 3HFOA 1M4ZA 5CKFA 4ZGJB 3CCQA 3BW1A 3TREA 2CZ6B 4XU3A 3G71T 2LX9A 2YLCA 1Q86C 3OYGA 1YCYA 2XIDA 3QIIA 5CK9A 5J3BA 3FJPA 2BKDN 5LJ5f 2XICA 3OYEA 1Y07A 2DPPB 3CPFA 2E1HA 3M57A 4A4FA 2EJ9A 4OB1B 2RHXA 2R58A 2DIQA 3BY7A 5GAMg 4C0ZA 3MP1A 5LL6S 3RESA 2V8IA 5GANd 2CYZB 3HRSA 3BDLA 1MHNA 5GAMj 3A5ZB 4QQGA 3CCSA 3LX7A 2PUOB 3TU4K 4JRIA 3MEUA 3NTIA 2RI3A 3JCMW 3CEYA 1GXIE 3RKXA 3OYIA 3FC3A 2FYKA 3X26B 1VIFA 2DKGA 2RJCA 3M55A 4J5YA 1Y7XA 4M75F 1VQNT 1I81A 1N9RA 1XTDA 2K5IA 4BI8B 4N4HA 1UGQB 3CMET 5GAMe 3CBMA 3VYGA 4BE2A 2PVGB 5DM7R 1M5Q1 4C5EA 2M0OA 2V8JA 4C92C 2EWNA 3X25B 1Y96B 2BUDA 2VC8A 3OS5A 4M77G 1M8VA 4LDUA 5LJ5g 3DLLA 3LYIA 4C92G 4M75E 2X35A 1M1KC 4OVAA 4M75B 4M77C 1Q7YU 4XTVA 1ZQ1A 2H3JA 2JZ2A 2M16A 1W2BS 4PJOA 5KH6A 4BDYA 3OW2S 1YJ9A 3CC7T 2A3LA 2RHUA 1NE8A 3DKMA 2MAMA 5GMKl 4M75G 3RMQA 2EKOA 4M77A 3OSSC 3JAME 3GPLA 5FRNA 4M7AC 1KQSA 4KULA 1UEBA 2DO3A 3TCJA 4C5HA 1KD1C 2OTJA 1VQ4A 3DB4A 3I56A 5CKEA 2EQMA 4OB3B 3WXMB 4A53A 2YLBA 3GP8A 2M1HA 3HPWA 3QJYA 4PLLA 5FU6B 1UGPB 1YJNA 1VQOT 3L42A 3EFRA 5CR2A 1WJQA 4C92F 4PJOD 2QQRA 1VQ5A 2XHCA 3OYKA 2KMTA 4OB2B 3ZFJA 4BI4A 3HSBA 3H8ZA 1Q82C 1H3ZA 2WSFE 2JVVA 1VQ5T 3QHSA 1VQMT 3P8HA 2O4XB 4OF1A 3CBOA 5FROA 5FLXE 5GANf 1VQ7A 1QP2A 2ZPGB 4YTLA 3ZBDA 4UC4A 4B9WA 4EMKC 1NZ9A 5LJ3d 4JS4A 2PVOB 2F69A 4NL2A 4HCCA 3M4GA 3GNGA 2RD1A 5GANh 2GQVA 5D6YA 3OB9A 1D3BA 3OYDA 1M1KU 2DXTA 2K2VA 5GAOp 3CD6A 4PJOF 3I55A 2FVUA 4M77F 1M1GA 1VIEA 2MMPA 2GFUA 4J6YA 3VKIA 4LD9K 4C0FA 1WNLA 3MEWA 4J8OA 2XG8D 4MZMA 3HHTB 4EDUA 4ZGEB 3AHUA 1U1SA 1Y71A 3OS0A 4ZTJA 1LOJA 3OSVA 3PGGA 3PIPA 4PJOE 1YIJA 1FX7A 3HRTA 1K73C 5C6SA 1N8RU 1JBMA 1WPYA 3CCST 4E7JA 3OY9A 4X9CA 1XNIA 2KQWA 4J6WA 4II1A 3BDUA 2C06A 2L8DA 4M77E 3CMEA 4FIBA 4C8QB 3WVEB 4LDYA 2FB7A 4JS5A 1JJ2S 4C5GA 2E41A 1VQ9A 4C0DC 4M75D 3JCMX 4N4IA 5L8RE 1S72T 4MDWA 2DAQA 4M7AB 1O75A 1BI2A 2F5TX 2E6ZA 2PVDB 3MEVA 1EIFA 2OAUA 2QEXA 5GAN7 3RKWA 3QSUA 3JCMc 1YJ9T 2QQBA 2LDMA 2ZZDA 4IUVA 3CCMA 4XU0A 2VYTA 1QVFA 3PIOA 1HK9A 3GLXA 3QG1A 4IUUA 4Z02A 2E5QA 3EAEA 3S6WA 3L2QA 4FT4A 3JCMh 3CXCS 5GAN8 2Y4YA 2E65A 4PL6A 1RI0A 3QZ5B 4DQ2A 4ZGDB 3J81E 1BYMA 1X75C 3Q1JA 2L3RA 2X4XA 4B9XA 3L2UA 2KSSA 3SFMA 1UB4A 3ER0A 3QUIA 1S72A 2O4XA 5HY6A 4JUVA 4OB0B 4XTWA 3X20B 3JCMe 1UGRB 2DIGA 1P92A 4KUIA 4HCBA 1KG1A 4BB7A 4M7AD 3SWNC 3N5BB 2RM4A 4JRKA 3FRNA 5A0GA 1K9MC 5GMKm 2FL7A 3LH0A 4NOYA 4C8QD 3OYMA 3LWHA 5GAMf 1QVGS 3CPWS 4EMHA 3CCUT 3M58A 2XD0A 2DTOA 2V8KA 1VQLA 4BUGA 3L1AA 2HQEA 1IREB 4MZPA 3OA6A 3C4SA 2DZ9A 1QVGA 4XTZA 4XU1A 2YRVA 2D6FA 2CZ1B 1YI2A 4QQ6A 3CCJA 2XK0A 3ME9A 4F7UE 4A54A 1BIAA 2QI2A 2DD5A 2JUFA 1I5LA 2NLUA 2RHYA 4M7DC 3RMSA 4X34A 2DVEA 1YJWA 1KQ2A 1OZ2A 3JCMd 3OYFA 3QKJA 4PLIA 3M5AA 3QO3A 1VQ9T 1YIJT 3MEAA 2RK2A 1TH7A 4C8QC 1YHQA 3NTKA 5A0DA 3CC2A 4LDWA 5IT9E 1VQKT 2JTFA 3CC2T 1G3TA 4JJNK 1M90C 4N0AA 3FIFA 3KUFA 5CQYA 5GAOq 1HXDA 5LJ3f 4QVZA 3FB9A 4M77D 1VQ6T 1K9MU 3OMGA 3HRUA 4M78C 1KHIA 3OBWA 4FSXA 4BACA 1YI2T 4A4GA 3MCAB 3JCMJ 1KQSS 5LJ5h 3PNWC 3VJPA 3G6ET 1ZBXA 4XU2A 4F7UF 3SB2A 3J7AF 1WJSA 3C95A 2CKKA 5A0LA 4Y91A 3JB9G 4J7FA 1YJWT 3LGLA 1VQ8T 4M78B 1G3SA 1WQWA 3A8HB 4IUTA 1KQ1A 4OGCA 4LD6A 2ZGWA 3UWNA 2BIVA 4HT9A 2X4YA 3G7ZA 4LDVA 3UT1A 3F70A 5I21A 3CC7A 3CCMT 1OZ3A 5GAMd 3CCVT 2QA4T 2KDSA 5GANg 3JB9J 2KK4A 3JCMQ 2D9TA 4IURA 4J7IA 5FU7C 3OYNA 2L89A 2E10A 1ZHIA 2F5KA 4PJOC 4XK8E 3L2RA 4RCBA 3CCUA 4M7AG 3NTHA 4F7UG 4M7DB 2DK3A 5CQXA 3G6EA 2DJZA 2CGHA 2MWPA 2VV5A 4PNOA 2HAXA 1NPPA 2QQ9A 1U8RA 4JLIA 3DLMA 1JRIA 2DTHA 1Q81C 1KD1U 3DB3A 5GAN3 2OTLT 4RG8A 3GOXA 3CCEA 3RIRA 5LJ5d 2P0PA 1B34A 3KBGA 2M9UA 3PMTA 5CO7A 3CCVA 4XTYA 5IN1A 3VU3C 2DTIA 3SD4A 2GFAA 3X28B 2LQKA 1K8AC 4ATOA 5KE2A 2P0KA 4IUQA 2AHJB 4CI0C 3CCRT 1VQPT 2ZPFB 2ZPBB 1H641 4RG2A 4MZTA 1Q7YC 2G3RA 3GNFB 5D6XA 4R56A 4V2SA 3C94A 4L5GA 1X01A 3V7SA 4R55A 4C92B 3CBPA 3G4SA 5AYFA 5LJ3e 4M75C 4QVCA 2HBPA 1OI1A 4LDXA 5FU7B 2LC4A 2A7YA 1XOVA 3G4ST 1SSFA 4E7KA 2QDYB 4M7DF 2VGMA 3M59A 2K3YA 3J80E 1N8RC 2PQWA 4BE0A 4M7DD 4C8QF 4CRIA 1KHCA 2MWOA 1VQ8A 1VQKA 5CAIA 2E12A 3OYHA 4Y28E 5LJ5e 3CMAA 2K5LA 2XDDA 3VV0A 1LNXA 1V29B 1D3BB 3BFMA 1Q82U 2X4WA 1N9SA 4C92A 5LJ3g 2OTJT 3OYCA 3M53A 2ZPEB 3JB9D 3WVDB 4FM4B 3HKSA 3FEOA 4M7DE 3L2WA 4KT0E 2DEQA 1Q86U 1VQ6A 1WJRA 2IG0A 4FT2A 4DOVA 2DXBA 4J83A 3S3OA 4C8QE 1FXXA 5CIUA 4A4HA 4C5IA 4HCZA 4WF2A 3OW2A 3OQ5A 4M78D 3I55T 2EJFA 1VQ4T 3M4YA 2DD4A 2P0QA 2RO0A 5GAOn 4XAXB 2WSCE 1QVPA 3I56T 3VYHB 4QQDA 5KE3A 1UGSB 5GMKe 1PSEA 3G71A 3INZA 4DA4A 2XDBA 1NPRA 5M9OA 1N6AA 3CXCA 3OYYA 3QXEB 1QVFS 3JB9F 3V8KA 3A8LB 4L59A 2LVMA 2PU9B 2XI9A 1K73U 5DY9A 4E7HA 2LCCA 4IUPA 2EQJA 4KBMB 2LRQA 2FHDA 4JRQA 4FL6A 5GMKi 1BI0A 2LCLA 5GMKh 3TEEA 5GAN2 3GIBA 2L5QA 4E7LA 4MMKA 3OYBA 2R57A 1JJ2A 2EJGA 2IVWA 4EMKA 4XTUA 5D6WA 2HQXA 1Y96A 3LW5E 4C8QG 2EQKA 4C0GA 1VQOA 2ZPIB 1VQNA 3CCJT 1KC8U 4M7AF 1O9SA 2RI2A 3QPHA 4F7UA 3V8JA 2LQ8A 3OBYA 2MF2A 3S3MA 3FDRA 3H6ZA 3LLRA 3X24B 4GY5A 1BKBA 2D0QB 4BY6C 1U1TA 1YBYA 3ZEHA 1VQMA 4Q5WA 2LTOA 3RKYA 4OGEA 4E7IA 4JDSA 2QEXT 4M78A 2LT4A 3FLGA 5I2MA 2XKOC 5KCHA 2O01E 3MP8A 4BD3A 2RA2A 1B34B 3CMAT 5GAOl 1R8OB 5CCAA 3MHXA 5GAN4 5CVIA 1I8FA 3C12A 3O8VA 4C92D 2E64A 3CPWA 5GAOm 1M1FA 3UPUA 3RERA 3PMIA 3QZ9B 4PKCC 3MO8A 2KY9A 1Q81U 3QDRB 2JTMA 4M7DA 2LT1A 4J6XA 4A4EA 5GAN6 3E1SA 3META 5EG2A 1XQHA 4EPCA 2HNIA 3PT9A 4C8QA 1W2BA 3QYHB 4ME7A 2VUBA 4P5NA 3E19A 2RH2A 3CCLT 1WGSA 2EQUA 3P8BB 4O6JA 3L2ZA 2RJDA 4NL3A 4IKFA 1KC8C 4DOWA 4RMOA 2RHZA 2X4JA 4X9DA 2R5MA 3HFNA 4QW2A 4L6V5 1VQ7T 3OMCA 2K4YA 1WQ7A 4NS5A 3EFSA 1OYXA 4BY6B 2KVQG 2VXFA 4EMGA 3V8LA 1VQLT 3QYGB 5HKCA 2RHIA 5DLOA 4RCCA 2GCXA 4ZN3A 2JNGA 3OS2A 3M54A 3SWNB 1YJNT 3CD6T 2QQAA 4M7AE 3JCMV 3L2VA 2QXFA 1QW1A 3JCMP 5FRMA 4TVRA 2RK1A 3V7CA 2K57A 5GMKj 2GF7A 5HK0A 4BI3A 1N27A 2Y90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIG A;  2M0O A;  2K3Y A;  2BUD A;  2PQW A;  4BE0 A;  3E9F A;  4CRI A;  3LYI A;  1KHC A;  2MWO A;  2X35 A;  2XDP A;  2K3X A;  3QJ6 A;  4OVA A;  3OYH A;  2JZ2 A;  2M16 A;  3LH0 A;  5KH6 A;  3OYM A;  2X4W A;  4BDY A;  3P8D A;  2RHU A;  3OYC A;  3OYA A;  3OYL A;  2EKO A;  3FEO A;  3L2W A;  5FRN A;  2HQE A;  1WJR A;  2IG0 A;  3OA6 A;  4C5H A;  4Z02 A;  3S3O A;  3C4S A;  5CIU A;  3DB4 A;  4A4H A;  4C5I A;  4HCZ A;  2EQM A;  2YRV A;  3PFS A;  3OQ5 A;  2RJF A;  2E6N A;  2B8A A;  2M1H A;  4QQ6 A;  2XK0 A;  3ME9 A;  4PLL A;  2RO0 A;  3L42 A;  5C0M A;  1WJQ A;  4QQD A;  2QQR A;  4ZTF A;  2NLU A;  2RHY A;  5KE3 A;  3OYK A;  4X34 A;  4E7K A;  3H8Z A;  1H3Z A;  1OZ2 A;  5KCO A;  3OYF A;  3QKJ A;  4PLI A;  5M9O A;  3MEA A;  3NTK A;  3P8H A;  2O4X B;  3MP6 A;  5FRO A;  3LGF A;  2JTF A;  4L59 A;  2LVM A;  4B9W A;  4UC4 A;  4E7H A;  2LCC A;  4IUP A;  2EQJ A;  2WAC A;  2LRQ A;  2FHD A;  3KUF A;  4FL6 A;  4BDZ A;  4QVZ A;  5D6Y A;  3M9Q A;  3OB9 A;  3OYD A;  3OYJ A;  3OMG A;  4E7L A;  3OYB A;  2R57 A;  4BAC A;  1G5V A;  2RJE A;  3ASK A;  4A4G A;  2RI5 A;  4BE1 A;  5D6W A;  3PNW C;  2HQX A;  3OS1 A;  2GFU A;  2EQK A;  3MEW A;  2RI2 A;  1WJS A;  2CKK A;  4EDU A;  3S3N A;  3S3M A;  3FDR A;  3H6Z A;  3LGL A;  3LLR A;  4IUT A;  5IAY A;  4GY5 A;  3OS0 A;  4ZTJ A;  2R5A A;  4LD6 A;  3UWN A;  3ZEH A;  2BIV A;  4Q5W A;  2LTO A;  2X4Y A;  4N4G A;  3UT1 A;  3F70 A;  4E7I A;  5C6S A;  1OZ3 A;  4FU6 A;  3FLG A;  2QQS A;  5KCH A;  3MP8 A;  5J26 A;  2D9T A;  4BD3 A;  4E7J A;  3OY9 A;  4IUR A;  3OYN A;  2L89 A;  3E9G A;  2F5K A;  2EFI A;  3L2R A;  1XNI A;  3O8V A;  4II1 A;  3NTH A;  3QBY A;  2L8D A;  2MWP A;  3PMI A;  5J39 A;  3MO8 A;  3DLM A;  4C5G A;  3OYG A;  3QII A;  3DB3 A;  4A4E A;  2BKD N;  4N4I A;  3MET A;  2DAQ A;  1SSF A;  3OYE A;  3GOX A;  4A4F A;  3MEV A;  3PMT A;  2RHX A;  2R58 A;  5IN1 A;  1WGS A;  3SD4 A;  2DIQ A;  2EQU A;  2GFA A;  2LDM A;  2RJD A;  3MP1 A;  4IUV A;  4IKF A;  2VYT A;  2RHZ A;  5KE2 A;  2P0K A;  2R5M A;  4IUQ A;  4IUU A;  4QW2 A;  3OMC A;  3BDL A;  1MHN A;  2E5Q A;  3EAE A;  4QQG A;  4RG2 A;  3S6W A;  3LX7 A;  3L2Q A;  4NS5 A;  1OYX A;  2G3R A;  3MEU A;  2RI3 A;  3NTI A;  3CEY A;  4PL6 A;  5D6X A;  3OYI A;  1RI0 A;  2RHI A;  3FC3 A;  2RJC A;  3Q1J A;  3OS2 A;  2L3R A;  2X4X A;  4B9X A;  3L2U A;  4N4H A;  3L2V A;  1OI1 A;  5FRM A;  2GF7 A;  2O4X A;  4BE2 A;  1N27 A;  4C5E A; 
#chains in the Genus database with same CATH topology
 2HEQ A;  1VQK Q;  1G3W A;  3JCM g;  3CXC P;  3CCL A;  4RTV A;  1W4S A;  5LJ3 j;  1M9S A;  1K4U S;  1BI3 A;  2AT1 B;  3VUB A;  3OYL A;  4M75 A;  3M0S A;  2DET A;  2CS7 A;  2DXU A;  2RJF A;  2DEU A;  3GBQ A;  4JZ4 A;  5GAM h;  1LPL A;  1J3T A;  1I4K 1;  3JCM f;  4RKU E;  1TUC A;  1NYG A;  1NEB A;  1PKS A;  3A8O B;  5HK3 A;  1BI1 A;  2RQW A;  4FYV B;  3ZL7 C;  2HD0 A;  2WAC A;  4C92 E;  1YIT T;  1JB0 E;  3EFO B;  1MGQ A;  2VGN A;  3JB9 I;  3OYJ A;  4Z88 A;  2RMO A;  1YIT A;  1QCN A;  3HL8 A;  4XTX A;  2E5K A;  4FSS A;  1ZSZ C;  1KIK A;  1FMW A;  1VQ6 Q;  3S3N A;  3A8G B;  4KUD K;  2JXB A;  1PSF A;  1M90 U;  4PJO B;  4FU6 A;  4M78 G;  4JLG A;  4PK4 A;  2P4T A;  4LUE A;  5J26 A;  5FW9 A;  5CKB A;  5FU6 C;  4PJO G;  4PJO A;  2K5F A;  5I2S A;  2DER A;  2WSE E;  1OQK A;  5DLQ E;  3JCM b;  4ZGJ B;  1RAG B;  2RN8 A;  3BW1 A;  1MMA A;  3BE3 A;  5J3B A;  3I9Q A;  5LJ5 f;  1H92 A;  3OYE A;  1Y07 A;  4A4F A;  1GBR A;  2JMC A;  3BY7 A;  5LL6 S;  3RES A;  3BDL A;  1MHN A;  2CUB A;  3TU4 K;  3CCS A;  3LX7 A;  2PUO B;  1B07 A;  1RI9 A;  3CEY A;  2EYW A;  3FC3 A;  4E6R A;  4M75 F;  1VQN T;  2CSQ A;  1I81 A;  1N9R A;  2EYZ A;  1XTD A;  2K5I A;  5ECA A;  3CME T;  1NBE B;  1M5Q 1;  2M0O A;  2EYX A;  1M8V A;  4LDU A;  2F2X A;  3LYI A;  4M75 B;  3TSZ A;  2JZ2 A;  4RTT A;  2ABL A;  1W2B S;  3CC7 T;  3DKM A;  2MAM A;  3JAM E;  2EKO A;  3GPL A;  1C6V X;  1KK7 A;  4C5H A;  1VQ4 A;  3I56 A;  1SPK A;  3WXM B;  1OPK A;  1TUD A;  3QJY A;  5FU6 B;  1YJN A;  2SRC A;  4ESR A;  3VS6 A;  2EGE A;  3EFR A;  4C92 F;  5CR2 A;  2BTT A;  3OYK A;  2KMT A;  1Q86 R;  4KH1 B;  1Z9Z A;  1VYV A;  3REA B;  1VQ7 A;  5FRO A;  5FLX E;  3CC2 Q;  1QP2 A;  4YTL A;  4EMK C;  2DJQ A;  4HCC A;  2F69 A;  2G6F X;  1KSW A;  2KNB B;  2RD1 A;  2GQV A;  5GAN h;  1D3B A;  1QWF A;  2AZS A;  1JJ2 P;  4PJO F;  1GRI A;  2BE9 B;  1RAB B;  2CP0 A;  1GBQ A;  1X43 A;  1M1G A;  4M77 F;  4J6Y A;  4C0F A;  1WNL A;  3MEW A;  1NYF A;  1UJ0 A;  4PJJ A;  2J6O A;  4ZTJ A;  1LOJ A;  3HRT A;  5C6S A;  2A36 A;  2B86 A;  1TU0 B;  4E7J A;  2DA9 A;  4CC3 A;  3EG3 A;  1FYN A;  1OV3 A;  2J05 A;  2O2O A;  2YUP A;  4II1 A;  4J9D A;  5GJV B;  2KEA A;  3CME A;  4FIB A;  1UDL A;  1C1A A;  1UG1 A;  4CC4 B;  2GNC A;  1S72 T;  2E6Z A;  4DBR A;  2PVD B;  1EX4 A;  3QSU A;  2OAU A;  2LDM A;  4KH0 B;  1HK9 A;  2XMF A;  1SKU B;  4IUU A;  3EAE A;  4Z89 A;  4PL6 A;  3TVT A;  1M2V B;  1YIT Q;  3EH1 A;  2L3R A;  4GBQ A;  4B9X A;  1ARK A;  2EVR A;  2KSS A;  2O4X A;  3VS4 A;  1X2K A;  2MOX A;  3SWN C;  2RM4 A;  5A0G A;  2I0N A;  5GMK m;  1G83 A;  3I35 A;  5GAM f;  3CCU T;  2HSE B;  2V8K A;  1VQL A;  2ED1 A;  2DZ9 A;  3EH2 A;  4XTZ A;  2CZ1 B;  4HVW A;  4D8D A;  3CCJ A;  2XK0 A;  3ME9 A;  1BIA A;  4KRT A;  5I11 A;  2NUZ A;  2LJ3 A;  2QI2 A;  1I5L A;  2RHY A;  3EGX B;  2EQI A;  1YJW A;  2DVE A;  1IGU A;  1OZ2 A;  1YIJ T;  3MEA A;  2RK2 A;  1VQK T;  2JTF A;  4LE9 A;  3CC2 T;  1V1C A;  3VS3 A;  1HXD A;  5LJ3 f;  7AT1 B;  1LCK A;  4AFS C;  4BAC A;  1D1A A;  2IPO B;  3MCA B;  3JCM J;  3VJP A;  4OMM A;  1I5O B;  1WJS A;  3C95 A;  3JB9 G;  1VQ8 T;  4M78 B;  1KQ1 A;  1AT1 B;  2BIV A;  2CRE A;  1U3O A;  3CCV T;  5GAN g;  2D9T A;  1BCM A;  2CDT A;  5FU7 C;  2F5K A;  4XK8 E;  1MV3 A;  4RCB A;  4PFP A;  4M7A G;  4RTY A;  1YI2 Q;  2FZK B;  3DLM A;  1Q81 C;  1KD1 U;  2KRS A;  2OTL T;  3GOX A;  1K76 A;  1VQ8 Q;  3PMT A;  2YSQ A;  2PTK A;  3SD4 A;  3X28 B;  2LQK A;  2AHJ B;  3CCR T;  1Q7Y C;  4R56 A;  3C94 A;  3CBP A;  5AYF A;  1AWW A;  3H0F A;  5FU7 B;  2LC4 A;  3EG0 A;  1XOV A;  3G4S T;  2J7I A;  2FZG B;  1RAF B;  3M59 A;  3VS5 A;  1YCS B;  4BE0 A;  4C8Q F;  4CRI A;  2YUQ A;  2K5L A;  2X4W A;  2BE7 D;  2JT4 A;  3O5Z A;  4C92 A;  2OTJ T;  3OYC A;  3WVD B;  2V1R A;  5IH2 A;  2DEQ A;  1Q86 U;  2J6F A;  4FT2 A;  4DOV A;  1ZUU A;  4C5I A;  4A4H A;  3OW2 A;  1X2Q A;  1K0S A;  1PC0 A;  3OQ5 A;  2RPN A;  3I55 T;  2V26 A;  5HCK A;  1UGS B;  5I22 A;  4DA4 A;  3UAT A;  1D0Y A;  3JB9 F;  1N6A A;  2CH4 W;  1G2B A;  2YRD A;  2LCC A;  1BI0 A;  2LCL A;  3TEE A;  3OYB A;  2L3S A;  3H9N A;  1T0J A;  1OU9 A;  1VQO A;  4M7A F;  1VQN A;  2GQI A;  3CCJ T;  4F7U A;  1X6B A;  1TSF A;  1JQQ A;  2D0Q B;  3UF4 A;  1U1T A;  4E7I A;  4J9E A;  4M78 A;  2XKO C;  1N5Z A;  3MKD A;  5KCH A;  2RA2 A;  2HDA A;  1RLP C;  1VQP Q;  3C12 A;  4C92 D;  5GAO m;  3I55 Q;  4OMO A;  3MO8 A;  5D7U A;  4M7D A;  1X27 A;  5EG2 A;  4EPC A;  2KT8 A;  1MNE A;  5KYU B;  1VQ7 Q;  2RH2 A;  3CCL T;  1WGS A;  2CT4 A;  3L2Z A;  4DEX A;  1YIJ Q;  4RMO A;  2RHZ A;  2R5M A;  1VQ7 T;  3OMC A;  2K4Y A;  3EFS A;  1VQL T;  2RHI A;  2GCX A;  3M54 A;  1YJN T;  3JCM V;  3L2V A;  2K57 A;  3JB9 J;  2Y90 A;  1I07 A;  3CC4 A;  3E9F A;  3QJ6 A;  2M02 A;  2BZX A;  3EG9 A;  4A4K A;  1YHQ T;  2AK5 A;  1PCX A;  2QDL A;  1ZSG A;  1VQO Q;  3OYA A;  2KT1 A;  4N0A C;  2NYS A;  3VUZ A;  1PWT A;  2A08 A;  4MML A;  2JJ9 A;  2VKN A;  1VUB A;  3SWN A;  1RL2 A;  1H3H A;  3T9N A;  1AWX A;  3MP6 A;  2PNI A;  3NFC A;  4JJB A;  4M78 F;  1WA7 A;  2EAY A;  3M56 A;  1WZO A;  3M9Q A;  2DNU A;  4KGX B;  2RJE A;  3RUX A;  1D0Z A;  3MJX A;  2LNV A;  2X51 A;  4AFZ C;  1FWZ A;  3PE0 A;  1IGQ A;  1QP3 A;  3CCE Q;  4M78 E;  5IAY A;  4ELY C;  2OTL A;  1AWJ A;  1IZ6 A;  4N4G A;  2A37 A;  1VOM A;  2P4R A;  1WHG A;  2QQS A;  3JRZ A;  1WHK A;  4IIO A;  3CCR A;  2NUP B;  1T0H A;  3G1J A;  3E9G A;  3GF5 A;  3URG A;  2DXC A;  4OP0 A;  2PUK B;  2JS2 A;  3THK A;  2YRC A;  3HFO A;  1M4Z A;  4J9H A;  3MPU B;  1YCY A;  5CK9 A;  3FJP A;  3EGU A;  2DX1 A;  4JPB W;  2CP6 A;  3CCJ Q;  2RHX A;  2R58 A;  5GAM g;  1ZA2 B;  1K0X A;  2V8I A;  5GAN d;  2GTJ A;  1D1B A;  5GAM j;  2ECZ A;  3A5Z B;  4QQG A;  1GFD A;  2K6D A;  2KYM A;  3NTI A;  5KYW B;  3RKX A;  2FYK A;  1RAE B;  2DKG A;  2EBP A;  3M55 A;  1Y7X A;  3FJ5 A;  1CKA A;  5GAM e;  1I1J A;  3NHN A;  2V8J A;  5KYX B;  2MYS A;  3X25 B;  5LJ5 g;  1M1K C;  4C92 G;  2X35 A;  4OVA A;  1R77 A;  6AT1 B;  2KXC A;  5KH6 A;  2HCK A;  3TSW A;  1K9A A;  1BBZ A;  5FRN A;  4KUL A;  2AIR B;  3TCJ A;  2A28 A;  4X1V A;  2YXY A;  3SEM A;  3GP8 A;  4PLL A;  3L42 A;  2EPD A;  1WJQ A;  2L0A A;  1VQ5 A;  4OB2 B;  3RBB B;  1PRM C;  1Q82 C;  1H3Z A;  2WSF E;  2JVV A;  1Y0M A;  2OI3 A;  3QHS A;  4PFZ A;  2ZPG B;  4UC4 A;  4JS4 A;  5L23 A;  1ZSZ B;  4NL2 A;  2D8J A;  2GBQ A;  3M4G A;  1UHF A;  3GNG A;  3OYD A;  1M1K U;  2DXT A;  5GAO p;  2BZY A;  2RQR A;  2KBT A;  2FVU A;  1RAI B;  4CC7 A;  3VS1 A;  4J8O A;  2XG8 D;  3HHT B;  1Y71 A;  2FRW A;  3EGD A;  5GJW B;  3OSV A;  1KFZ A;  1YIJ A;  1WPY A;  3OY9 A;  3RR6 A;  4RUG A;  1H8K A;  5FWC A;  3EFO A;  4C8Q B;  1YJN Q;  1QQJ A;  2FB7 A;  2QGF B;  2E41 A;  4C0D C;  4M75 D;  3JCM X;  4N4I A;  4M7A B;  1WXT A;  1BI2 A;  2DFU A;  2DVJ A;  5GAN 7;  3JCM c;  1QVF A;  2E5Q A;  3VRZ A;  5GAN 8;  2EKH A;  2KRN A;  3QZ5 B;  4DQ2 A;  3J81 E;  1BYM A;  1X75 C;  3Q1J A;  5FWB A;  1QKW A;  3ER0 A;  3QUI A;  1HYO A;  4JUV A;  4OB0 B;  4XTW A;  2DIG A;  1KG1 A;  3CPW P;  2W0Z A;  1ZBJ A;  3N5B B;  4JRK A;  3FRN A;  1UUE A;  4NOY A;  4EMH A;  3M58 A;  2XD0 A;  2DTO A;  4BUG A;  2HMA A;  2HQE A;  3C4S A;  1ABQ A;  1Q81 R;  4QQ6 A;  2AZV A;  1NG2 A;  4A54 A;  2DD5 A;  2JUF A;  3RMS A;  4X34 A;  2QYZ A;  1IHV A;  2MCN A;  4C8Q C;  4LDW A;  5IT9 E;  2DMO A;  1G3T A;  2LX7 A;  3FIF A;  5CQY A;  2OX7 A;  4QVZ A;  1VQ6 T;  5KYY B;  4FSX A;  4LXC A;  2CP3 A;  3CMA Q;  1KQS S;  1UE9 A;  4XU2 A;  3SB2 A;  1CKB A;  4Y91 A;  3REB B;  4F16 A;  4DBF A;  1G3S A;  3UWN A;  1YJW Q;  2M51 A;  1OZ3 A;  5GAM d;  4F14 A;  2KK4 A;  3JCM Q;  5KYU A;  4IUR A;  3OYN A;  2L89 A;  1ZHI A;  2HKQ B;  2D0N A;  3CCU A;  1X69 A;  2K9G A;  4F7U G;  4M7D B;  4AT1 B;  3G6E A;  2MWP A;  1WX6 A;  2E3H A;  1SRL A;  4E7S A;  2RNA A;  1GL5 A;  5GAN 3;  4RG8 A;  2QEX Q;  3CCE A;  1Q95 G;  2P0P A;  3KBG A;  5KYN A;  5IN1 A;  2L3Q A;  2DTI A;  2NUT B;  2GFA A;  1K8A C;  1YJ9 Q;  5KE2 A;  4RG2 A;  2G3R A;  1PHT A;  4V2S A;  2AKL A;  4L5G A;  3V7S A;  3G4S A;  4AFU C;  1QVF P;  3NPF A;  2A7Y A;  4M7D F;  2QDY B;  3J80 E;  2COY A;  1M3B A;  2K3B A;  1KHC A;  5CAI A;  2E12 A;  2NUP A;  1UTI A;  3OYH A;  2SEM A;  3CMA A;  2ROL A;  2HL3 A;  1R0C B;  2EGA A;  4F04 B;  1N9S A;  1GFC A;  3M53 A;  1KQS P;  3HKS A;  3FEO A;  4KT0 E;  2IG0 A;  2DXB A;  2L2P A;  3M0P A;  3S3O A;  3CD6 Q;  1MMG A;  1M30 A;  1C0M A;  3M4Y A;  5GAO n;  2RO0 A;  2WSC E;  3VYH B;  4QQD A;  5GMK e;  1YNZ A;  3INZ A;  2LP5 A;  2FZC B;  2PZ1 A;  2HQH A;  3A8L B;  2JMA A;  4L59 A;  3R6N A;  1K73 U;  4E7H A;  4IUP A;  2EQJ A;  4KBM B;  2LRQ A;  1AEY A;  5GMK i;  4JZ3 A;  1JJ2 A;  1T3L A;  2JM9 A;  4XTU A;  5D6W A;  1Y96 A;  4FW2 A;  4C0G A;  2CH4 A;  1KC8 U;  1TXQ A;  1O9S A;  2LQ8 A;  3OBY A;  2MF2 A;  3FDR A;  3LLR A;  2DE0 X;  1YBY A;  2CP2 A;  2K2M A;  2LTO A;  2LJ0 A;  3RKY A;  2JW4 A;  5I2M A;  2ROT A;  3MP8 A;  3U23 A;  1MV0 B;  1R8O B;  2YWW A;  3EG9 B;  4ZNX A;  3EG2 A;  4J9C A;  1M1F A;  4PKC C;  2KY9 A;  4AFQ C;  1TG0 A;  4LNP A;  4J6X A;  5GAN 6;  3E1S A;  3MET A;  1XQH A;  3PT9 A;  2JS0 A;  2FG0 A;  2VAS A;  3QYH B;  1YN8 A;  4HVU A;  1W2B A;  1JXO A;  1M90 R;  3E19 A;  2EQU A;  3P8B B;  1WIE A;  2RJD A;  1KC8 C;  4X9D A;  5IXB A;  1TWB A;  1WQ7 A;  4ORZ A;  5DLO A;  4RTZ A;  3CCL Q;  4Y92 A;  2JNG A;  2QQA A;  2C0T A;  2EGC A;  2QXF A;  3JCM P;  5FRM A;  1A0N B;  2RK1 A;  5HK0 A;  1VQO T;  1E6H A;  2GGR A;  3JB9 H;  2XDP A;  2K3X A;  1M3A A;  1SHF A;  3CC4 T;  2Y4X A;  2EYQ A;  4HKE A;  2E3I A;  3EG1 A;  4OMF B;  4FCY A;  3SDZ A;  2E6N A;  2B8A A;  4D6W A;  4ZN1 A;  4GLK A;  4HA8 A;  4HT8 A;  4ZTF A;  1PD0 A;  4AG2 C;  2JOY A;  1SF9 A;  1BIB A;  3LGF A;  3UDC A;  5LJ3 h;  1NJI C;  2MI6 A;  3V7R A;  2ZCF B;  4C0D B;  1EZZ B;  4BDZ A;  4QVD A;  1M2O A;  3OS1 A;  1T3S A;  2KAF A;  2YT6 A;  3CCM Q;  2NUT A;  1DJ7 B;  2JN0 A;  2CZ0 B;  2R5A A;  3VS7 A;  1PKT A;  1AWO A;  3JSC A;  1WYX A;  2LJ1 A;  3HP9 A;  3H41 A;  2GTO A;  1X6O A;  2ENM A;  2D8H A;  2CZ7 B;  1M8M A;  1K8A U;  8ATC B;  2EFI A;  1RAA B;  3CCQ T;  2C0O A;  2HBW A;  1UGV A;  1ZA1 B;  4O5V A;  5J39 A;  1ABO A;  4XU3 A;  2LX9 A;  3G71 T;  1QCO A;  3OYG A;  2RF0 A;  2XID A;  3QII A;  2DPP B;  3CPF A;  3M57 A;  2FPD A;  1NEG A;  4E7Z A;  2EJ9 A;  2DIQ A;  5IHN A;  1QKX A;  3HRS A;  2VB6 A;  4JRI A;  3OYI A;  1B7T A;  1HSQ A;  3X26 B;  1VIF A;  2RJC A;  4J5Y A;  2CP5 A;  1FMK A;  4BI8 B;  4N4H A;  1S72 Q;  2X3X D;  1ACM B;  1GCP A;  2PVG B;  2YUO A;  3AT1 B;  4C5E A;  1K73 R;  1Y96 B;  2BUD A;  4M77 G;  1VQM Q;  2DL8 A;  4M75 E;  1Q7Y U;  4XTV A;  1ZQ1 A;  2H3J A;  1M2V A;  2A3L A;  1OX9 A;  2V1Q A;  5GAN j;  2DLP A;  3RMQ A;  2DO3 A;  2E4H A;  1KD1 C;  1MND A;  3DB4 A;  1BU1 A;  4A53 A;  3HPW A;  2P84 A;  2DYB A;  4PJO D;  2QQR A;  2XHC A;  3ZFJ A;  4BI4 A;  3HSB A;  3G6E Q;  1VQ5 T;  1VQM T;  5GAN f;  3UA7 A;  2MPX C;  1NZ9 A;  2PVO B;  4LN2 A;  5D6Y A;  3OB9 A;  2W10 A;  2COW A;  3I55 A;  2FEI A;  2GFU A;  2DIL A;  5KYY A;  3M0U A;  4MZM A;  4ZGE B;  1U1S A;  3OS0 A;  2F2V A;  4AMC A;  4PJO E;  1FX7 A;  2MK5 A;  1N8R U;  3VS0 A;  1NLO C;  1MUZ A;  3CCS T;  3SHW A;  4X9C A;  2DYI A;  4R0K A;  3CCU Q;  2FRY A;  2CT3 A;  2LQW A;  1SRM A;  2DRM A;  3BDU A;  1EFN A;  2J6K A;  1GCQ C;  3WVE B;  4JS5 A;  4C5G A;  3M0T A;  3CCV Q;  2F5T X;  2OTJ Q;  1EIF A;  3RKW A;  5KYW A;  3CCM A;  1JU5 C;  3PIO A;  3QG1 A;  4FT4 A;  2EW3 A;  2Y4Y A;  2E65 A;  2L3P A;  4ZGD B;  2C0I A;  1D0X A;  1D1C A;  2QA4 Q;  1ZSZ A;  2H3E B;  4FYX B;  3L2U A;  3ULR B;  1FMV A;  3SFM A;  1S72 A;  5HY6 A;  3X20 B;  4HCB A;  2QAZ A;  4BB7 A;  4M7A D;  1WFW A;  4RTU A;  5EC7 A;  3LH0 A;  4C8Q D;  1E7O A;  1D09 B;  3CPW S;  4FYY B;  1F1B B;  1W6X A;  2D1X A;  1WXU A;  2DBK A;  3OA6 A;  2D6F A;  2COZ A;  1YI2 A;  2LNH B;  3CCQ Q;  8AT1 B;  1U06 A;  2NLU A;  4M7D C;  1KQ2 A;  2FO0 A;  1VQ9 T;  1K8A R;  3OYF A;  1PNJ A;  1WI7 A;  2DL3 A;  3QO3 A;  3CC2 A;  3CME Q;  1TH7 A;  1R0B G;  3NTK A;  5A0D A;  3EHQ A;  4HCK A;  4M77 D;  4M78 C;  1KHI A;  1YI2 T;  4EIK A;  4A4G A;  1QWE A;  3PNW C;  5LJ5 h;  4F7U F;  3QWX X;  3J7A F;  2CKK A;  5A0L A;  3NMZ C;  4IUT A;  4OGC A;  4LD6 A;  2OJ2 A;  2LCS A;  2X4Y A;  3G7Z A;  4LDV A;  3CC7 A;  3F70 A;  3CCM T;  2ZAE A;  2KDS A;  4J9G A;  2VVK A;  4M4Z A;  1KD1 R;  2E10 A;  3QWY A;  3L2R A;  1W2B P;  4ANJ A;  2KRO A;  2Z0W A;  2DJZ A;  4PNO A;  2HAX A;  5IXF A;  1NPP A;  2M0Y A;  1SG5 A;  1RAC B;  1VQ9 Q;  2OAW A;  3RIR A;  5LJ5 d;  1B34 A;  3H0H A;  3CCV A;  4D8K A;  1WHJ A;  5IHI A;  2ED0 A;  2H8H A;  2P0K A;  4IUQ A;  1VQP T;  1HJD A;  2ZPF B;  2ZPB B;  1H64 1;  4MZT A;  4PFO A;  1YWO A;  3M0Q A;  5D6X A;  4R55 A;  4C92 B;  2ESW A;  2J06 A;  4QVC A;  4LDX A;  1OI1 A;  1SSF A;  4E7K A;  2VGM A;  1N8R C;  2K3Y A;  2O88 A;  4M7D D;  2MWO A;  4FW1 A;  1VQ8 A;  1VQK A;  5LJ5 e;  3VV0 A;  1LNX A;  1V29 B;  3BFM A;  2RQT A;  5LJ3 g;  5AT1 B;  2ZPE B;  3JB9 D;  4FM4 B;  1VQ6 A;  1OEB A;  1AVZ C;  4J83 A;  4C8Q E;  2RQU A;  5CIU A;  4HCZ A;  2ATC B;  3C0C A;  3I56 T;  2DD4 A;  3A98 A;  3VRY A;  4XAX B;  4OMN A;  5KE3 A;  1PSE A;  3G71 A;  2XDB A;  1NPR A;  5M9O A;  3RDV A;  2LVM A;  2DL4 A;  2PU9 B;  2XI9 A;  4HVV A;  5DY9 A;  1VQ5 Q;  4IIM A;  4JRQ A;  2HZY A;  2O9V A;  5GAN 2;  4E7L A;  4MMK A;  2R57 A;  2EJG A;  1ZUY A;  2HQX A;  2YUN A;  3LW5 E;  4C8Q G;  2EQK A;  4PJO C;  3I5S A;  2ZPI B;  3QPH A;  3V8J A;  3S3M A;  3H6Z A;  3X24 B;  9ATC B;  1VQM A;  1WDX A;  4JDS A;  2LT4 A;  4QT7 A;  1M1K R;  3CMA T;  5CCA A;  3MHX A;  3CCR Q;  1I8F A;  2E64 A;  1KJW A;  3CPW A;  2FPE A;  3UPU A;  3RER A;  3PMI A;  1SEM A;  1BK2 A;  1CSK A;  2LT1 A;  4E2F B;  2VUB A;  1AOJ A;  1YHQ Q;  2KRM A;  4O6J A;  1Q82 R;  4NL3 A;  4IKF A;  3RNJ A;  4DOW A;  2X4J A;  4QW2 A;  4NS5 A;  3QDF A;  2HL5 C;  1QMC A;  2VXF A;  3V8L A;  3CCS Q;  4RCC A;  2FPF A;  4ZN3 A;  1TOV A;  3OS2 A;  4TVR A;  2K7A A;  3V7C A;  5GMK j;  4AG1 C;  1IHW A;  1N27 A;  1VYU A;  2VXE A;  4HXJ A;  1RAH B;  3KFV A;  1Y57 A;  2LQN A;  5CKH A;  3P8D A;  1NJI U;  2KI7 A;  3LWI A;  1AD5 A;  1ZLM A;  5GAO r;  1UHC A;  5LJ5 j;  3PFS A;  4J9I A;  4E47 A;  2KR3 A;  4ELZ C;  3PTA A;  3D7S B;  5C0M A;  3CCE T;  1SSH A;  4MDX A;  4F17 A;  4EMK B;  5CKD A;  2MIO A;  3UA6 A;  2DF6 A;  4XQ3 A;  5KCO A;  2DZC A;  1X6G A;  1G3Y A;  1IRX A;  1Q7Y R;  2I2L A;  4DEY A;  5A2Q E;  1LJO A;  2XU8 A;  2E70 A;  3KXT A;  1KC8 R;  2ZPH B;  1YP5 A;  4F7U B;  1RAD B;  4M7D G;  2RB6 A;  1G5V A;  4VUB A;  1AZE A;  3ASK A;  2QTX A;  2RI5 A;  4BE1 A;  2JTE A;  3R6O A;  1PM3 A;  3E2U A;  4PJN A;  4CC2 A;  2YHT A;  2QA4 A;  4JRP A;  5GAN 5;  2F2W A;  2KGT A;  3A8M B;  4M7A A;  2CSI A;  2RQV A;  3G71 Q;  5GAN e;  1VQP A;  1AHJ B;  1VA7 A;  2O31 A;  1OPL A;  3H0I A;  3QBY A;  2EIF A;  4M77 B;  2QK0 A;  5CKF A;  3CCQ A;  3TRE A;  2CZ6 B;  1Q86 C;  2YLC A;  1OOT A;  1JO8 A;  2BKD N;  2XIC A;  2E1H A;  4OB1 B;  4C0Z A;  3MP1 A;  2DL7 A;  2CYZ B;  1NM7 A;  1NJI R;  3MEU A;  1GXI E;  2RI3 A;  3JCM W;  1VQ4 Q;  1Z9Q A;  1UGQ B;  2EYY A;  3CBM A;  1I0C A;  3VYG A;  1PG5 B;  4BE2 A;  5DM7 R;  1YFN A;  4C92 C;  2EWN A;  2VC8 A;  3OS5 A;  2QG9 B;  3DLL A;  4M77 C;  1UEC A;  4GLM A;  3G4S Q;  1TTH B;  2CP7 A;  2M16 A;  4BDY A;  3OW2 S;  4J9B A;  1YJ9 A;  2RHU A;  1NE8 A;  5GMK l;  4M75 G;  4M77 A;  3OSS C;  4M7A C;  4QKU A;  1HD3 A;  1BCO A;  1KQS A;  1M27 C;  1UEB A;  2OTJ A;  5CKE A;  2EQM A;  4OB3 B;  2YLB A;  2M1H A;  3VS2 A;  1UGP B;  1LVK A;  3TQ7 P;  3H8Z A;  3I56 Q;  2DM1 A;  3P8H A;  2O4X B;  4OF1 A;  3CBO A;  1ZX6 A;  3ZBD A;  5KYX A;  4B9W A;  4KGZ B;  1VQN Q;  4Z8A A;  5LJ3 d;  4PJL A;  2CUD A;  2K2V A;  4A63 B;  3CD6 A;  1QVG P;  1QLY A;  1VIE A;  2MMP A;  1NLP C;  3VKI A;  4LD9 K;  3AHU A;  4EDU A;  2HSP A;  4PJM A;  3PGG A;  4OMQ A;  3PIP A;  1K73 C;  1RUW A;  1JBM A;  2KXD A;  3JV3 A;  3M0R A;  3IQL A;  1XNI A;  2KQW A;  4J6W A;  2LMJ A;  2C06 A;  2L8D A;  4M77 E;  4LDY A;  4WTO B;  1JJ2 S;  1VQ9 A;  5L8R E;  4MDW A;  2DAQ A;  1O75 A;  1MMD A;  3HTR A;  3MEV A;  2A0F B;  2QEX A;  2DRK A;  1YJ9 T;  2AKK A;  2QQB A;  2ZZD A;  4IUV A;  4XU0 A;  2VYT A;  1XJW B;  3GLX A;  4Z02 A;  1WHM A;  1WHL A;  3S6W A;  3JCM h;  3L2Q A;  3CXC S;  1YWP A;  2OTL Q;  1RI0 A;  1G8X A;  2YDL A;  2X4X A;  3CC7 Q;  3I5R A;  1UB4 A;  3A1P A;  3JCM e;  1UGR B;  1P92 A;  4KUI A;  4JJD A;  1V76 A;  1K9M C;  2FL7 A;  3LWH A;  3OYM A;  1QVG S;  3EGD B;  3L1A A;  1K1Z A;  1IRE B;  4MZP A;  1IXD A;  2IIM A;  4DBH A;  1QVG A;  1IO6 A;  4XU1 A;  2YRV A;  1UJY A;  4F7U E;  1TS9 A;  4OML A;  3JCM d;  3QKJ A;  4PLI A;  3M5A A;  1YHQ A;  3PVQ A;  3EGX A;  4JJN K;  1M90 C;  4N0A A;  3KUF A;  5GAO q;  1OX8 A;  3FB9 A;  1U5S A;  1K9M U;  3OMG A;  3HRU A;  3OBW A;  3OW2 P;  2K79 A;  3G6E T;  1B3Q A;  1IB8 A;  1TUG B;  1ZBX A;  1N8R R;  1QCF A;  4J7F A;  1UFF A;  3LGL A;  1YJW T;  1PRL C;  1WQW A;  3A8H B;  2ZGW A;  4HT9 A;  3UT1 A;  5I21 A;  2QA4 T;  4WCI A;  1JEG A;  4J7I A;  1W1F A;  2F1L A;  4B6M A;  3NTH A;  2DK3 A;  5CQX A;  2VV5 A;  2CGH A;  1OU8 A;  2QQ9 A;  1U8R A;  4JLI A;  1JRI A;  2DTH A;  4J9F A;  3DB3 A;  2LZ6 B;  4K11 A;  5CO7 A;  2M9U A;  4XTY A;  1WLP B;  2X3W D;  3VU3 C;  4ATO A;  2BZ8 A;  4CI0 C;  1WHH A;  1W70 A;  3GNF B;  1VYT A;  1X01 A;  3CQT A;  5LJ3 e;  4M75 C;  2HBP A;  4LUD A;  3PVL A;  2PQW A;  3CC4 Q;  4Y28 E;  3EHR A;  2XDD A;  1Q82 U;  1D3B B;  4RTW A;  4FYW B;  2VWF A;  4M7D E;  3L2W A;  1WJR A;  1FXX A;  4WF2 A;  1GCQ A;  4M78 D;  2EJF A;  1VQ4 T;  3NGP A;  1MMN A;  2P0Q A;  1QVP A;  2KE9 A;  1BB9 A;  1JXM A;  1QVF S;  3CXC A;  1M3C A;  3OYY A;  3QXE B;  1OUL A;  3V8K A;  2O9S A;  2FHD A;  4FL6 A;  5GMK h;  3GIB A;  2L5Q A;  4JJC A;  1S1N A;  2IVW A;  4EMK A;  1ZUK A;  2JM8 A;  2RI2 A;  1AZG B;  1K9M R;  4GY5 A;  2NWM A;  1BKB A;  3LH5 A;  4BY6 C;  5IHK A;  3ZEH A;  2DBM A;  4Q5W A;  2QAS A;  4OGE A;  2QEX T;  3FLG A;  1PD1 A;  4OMP A;  2O01 E;  2HKN A;  4BD3 A;  1B34 B;  2QGG A;  5GAO l;  1E6G A;  2KYB A;  1RLQ C;  5GAN 4;  5CVI A;  3O8V A;  3QZ9 B;  1Q81 U;  3QDR B;  2JTM A;  4A4E A;  2HNI A;  4C8Q A;  4ME7 A;  4P5N A;  2X9H A;  4KGV B;  3HFN A;  4L6V 5;  1WXB A;  1OYX A;  4BY6 B;  2KVQ G;  4EMG A;  4DBQ A;  2QTV A;  3QYG B;  5HKC A;  2DL5 A;  1SHG A;  3SWN B;  3CD6 T;  4M7A E;  1QW1 A;  2GF7 A;  4RTX A;  1VQL Q;  4BI3 A; 
#chains in the Genus database with same CATH homology
 3CC4 A;  3JB9 H;  1G3W A;  3E9F A;  3JCM g;  3CCL A;  3QJ6 A;  2XDP A;  1W4S A;  2K3X A;  5LJ3 j;  1M9S A;  2VXE A;  4A4K A;  3CC4 T;  2Y4X A;  1YHQ T;  2EYQ A;  1BI3 A;  5CKH A;  3P8D A;  4HKE A;  1NJI U;  3VUB A;  3OYA A;  3OYL A;  3LWI A;  4M75 A;  4N0A C;  5GAO r;  4OMF B;  3SDZ A;  2CS7 A;  2DXU A;  5LJ5 j;  3VUZ A;  3PFS A;  2RJF A;  2E6N A;  2B8A A;  4E47 A;  4D6W A;  4ELZ C;  4ZN1 A;  4GLK A;  4MML A;  5GAM h;  3PTA A;  4HA8 A;  5C0M A;  3CCE T;  4MDX A;  4HT8 A;  4ZTF A;  4EMK B;  1I4K 1;  1VUB A;  3SWN A;  5CKD A;  1RL2 A;  4XQ3 A;  3T9N A;  5KCO A;  2DZC A;  2JOY A;  1BIB A;  1G3Y A;  3JCM f;  5GAN j;  2I2L A;  3MP6 A;  3LGF A;  3NFC A;  4RKU E;  3UDC A;  5A2Q E;  5LJ3 h;  1NJI C;  2MI6 A;  1LJO A;  3V7R A;  3A8O B;  5HK3 A;  1BI1 A;  2ZCF B;  1YIT T;  4C92 E;  2WAC A;  2HD0 A;  2XU8 A;  4M78 F;  1JB0 E;  2E70 A;  4C0D B;  2EAY A;  3M56 A;  3KXT A;  2ZPH B;  4BDZ A;  1MGQ A;  2VGN A;  3M9Q A;  3JB9 I;  3OYJ A;  1YIT A;  4QVD A;  4F7U B;  4M7D G;  2RB6 A;  1G5V A;  2RJE A;  3HL8 A;  4VUB A;  3ASK A;  2QTX A;  2RI5 A;  3RUX A;  4BE1 A;  4XTX A;  3R6O A;  3OS1 A;  2LNV A;  2KAF A;  1FWZ A;  1QP3 A;  3S3N A;  4M78 E;  3A8G B;  1DJ7 B;  2JN0 A;  2CZ0 B;  5IAY A;  4KUD K;  2R5A A;  2YHT A;  2QA4 A;  4ELY C;  4JRP A;  2OTL A;  1PSF A;  5GAN 5;  1IZ6 A;  4N4G A;  1M90 U;  4PJO B;  3JSC A;  3A8M B;  4FU6 A;  4M78 G;  3HP9 A;  4JLG A;  4M7A A;  2P4T A;  2QQS A;  5J26 A;  1X6O A;  3JRZ A;  5CKB A;  5FU6 C;  2CZ7 B;  4PJO G;  5GAN e;  1AHJ B;  2K5F A;  3E9G A;  3CCR A;  3GF5 A;  2EFI A;  1VQP A;  1K8A U;  5I2S A;  3URG A;  2WSE E;  5DLQ E;  2DXC A;  3CCQ T;  3QBY A;  2PUK B;  2EIF A;  4OP0 A;  3JCM b;  4M77 B;  4O5V A;  5J39 A;  3HFO A;  1M4Z A;  5CKF A;  4ZGJ B;  3CCQ A;  3BW1 A;  3TRE A;  2CZ6 B;  4XU3 A;  3G71 T;  2LX9 A;  2YLC A;  1Q86 C;  3OYG A;  1YCY A;  2XID A;  3QII A;  5CK9 A;  5J3B A;  3FJP A;  2BKD N;  5LJ5 f;  2XIC A;  3OYE A;  1Y07 A;  2DPP B;  3CPF A;  2E1H A;  3M57 A;  4A4F A;  2EJ9 A;  4OB1 B;  2RHX A;  2R58 A;  2DIQ A;  3BY7 A;  5GAM g;  4C0Z A;  3MP1 A;  5LL6 S;  3RES A;  2V8I A;  5GAN d;  2CYZ B;  3HRS A;  3BDL A;  1MHN A;  5GAM j;  3A5Z B;  4QQG A;  3CCS A;  3LX7 A;  2PUO B;  3TU4 K;  4JRI A;  3MEU A;  3NTI A;  2RI3 A;  3JCM W;  3CEY A;  1GXI E;  3RKX A;  3OYI A;  3FC3 A;  2FYK A;  3X26 B;  1VIF A;  2DKG A;  2RJC A;  3M55 A;  4J5Y A;  1Y7X A;  4M75 F;  1VQN T;  1I81 A;  1N9R A;  1XTD A;  2K5I A;  4BI8 B;  4N4H A;  1UGQ B;  3CME T;  5GAM e;  3CBM A;  3VYG A;  4BE2 A;  2PVG B;  5DM7 R;  1M5Q 1;  4C5E A;  2M0O A;  2V8J A;  4C92 C;  2EWN A;  3X25 B;  1Y96 B;  2BUD A;  2VC8 A;  3OS5 A;  4M77 G;  1M8V A;  4LDU A;  5LJ5 g;  3DLL A;  3LYI A;  4C92 G;  4M75 E;  2X35 A;  1M1K C;  4OVA A;  4M75 B;  4M77 C;  1Q7Y U;  4XTV A;  1ZQ1 A;  2H3J A;  2JZ2 A;  2M16 A;  1W2B S;  4PJO A;  5KH6 A;  4BDY A;  3OW2 S;  1YJ9 A;  3CC7 T;  2A3L A;  2RHU A;  1NE8 A;  3DKM A;  2MAM A;  5GMK l;  4M75 G;  3RMQ A;  2EKO A;  4M77 A;  3OSS C;  3JAM E;  3GPL A;  5FRN A;  4M7A C;  1KQS A;  4KUL A;  1UEB A;  2DO3 A;  3TCJ A;  4C5H A;  1KD1 C;  2OTJ A;  1VQ4 A;  3DB4 A;  3I56 A;  5CKE A;  2EQM A;  4OB3 B;  3WXM B;  4A53 A;  2YLB A;  3GP8 A;  2M1H A;  3HPW A;  3QJY A;  4PLL A;  5FU6 B;  1UGP B;  1YJN A;  1VQO T;  3L42 A;  3EFR A;  5CR2 A;  1WJQ A;  4C92 F;  4PJO D;  2QQR A;  1VQ5 A;  2XHC A;  3OYK A;  2KMT A;  4OB2 B;  3ZFJ A;  4BI4 A;  3HSB A;  3H8Z A;  1Q82 C;  1H3Z A;  2WSF E;  2JVV A;  1VQ5 T;  3QHS A;  1VQM T;  3P8H A;  2O4X B;  4OF1 A;  3CBO A;  5FRO A;  5FLX E;  5GAN f;  1VQ7 A;  1QP2 A;  2ZPG B;  4YTL A;  3ZBD A;  4UC4 A;  4B9W A;  4EMK C;  1NZ9 A;  5LJ3 d;  4JS4 A;  2PVO B;  2F69 A;  4NL2 A;  4HCC A;  3M4G A;  3GNG A;  2RD1 A;  5GAN h;  2GQV A;  5D6Y A;  3OB9 A;  1D3B A;  3OYD A;  1M1K U;  2DXT A;  2K2V A;  5GAO p;  3CD6 A;  4PJO F;  3I55 A;  2FVU A;  4M77 F;  1M1G A;  1VIE A;  2MMP A;  2GFU A;  4J6Y A;  3VKI A;  4LD9 K;  4C0F A;  1WNL A;  3MEW A;  4J8O A;  2XG8 D;  4MZM A;  3HHT B;  4EDU A;  4ZGE B;  3AHU A;  1U1S A;  1Y71 A;  3OS0 A;  4ZTJ A;  1LOJ A;  3OSV A;  3PGG A;  3PIP A;  4PJO E;  1YIJ A;  1FX7 A;  3HRT A;  1K73 C;  5C6S A;  1N8R U;  1JBM A;  1WPY A;  3CCS T;  4E7J A;  3OY9 A;  4X9C A;  1XNI A;  2KQW A;  4J6W A;  4II1 A;  3BDU A;  2C06 A;  2L8D A;  4M77 E;  3CME A;  4FIB A;  4C8Q B;  3WVE B;  4LDY A;  2FB7 A;  4JS5 A;  1JJ2 S;  4C5G A;  2E41 A;  1VQ9 A;  4C0D C;  4M75 D;  3JCM X;  4N4I A;  5L8R E;  1S72 T;  4MDW A;  2DAQ A;  4M7A B;  1O75 A;  1BI2 A;  2F5T X;  2E6Z A;  2PVD B;  3MEV A;  1EIF A;  2OAU A;  2QEX A;  5GAN 7;  3RKW A;  3QSU A;  3JCM c;  1YJ9 T;  2QQB A;  2LDM A;  2ZZD A;  4IUV A;  3CCM A;  4XU0 A;  2VYT A;  1QVF A;  3PIO A;  1HK9 A;  3GLX A;  3QG1 A;  4IUU A;  4Z02 A;  2E5Q A;  3EAE A;  3S6W A;  3L2Q A;  4FT4 A;  3JCM h;  3CXC S;  5GAN 8;  2Y4Y A;  2E65 A;  4PL6 A;  1RI0 A;  3QZ5 B;  4DQ2 A;  4ZGD B;  3J81 E;  1BYM A;  1X75 C;  3Q1J A;  2L3R A;  2X4X A;  4B9X A;  3L2U A;  2KSS A;  3SFM A;  1UB4 A;  3ER0 A;  3QUI A;  1S72 A;  2O4X A;  5HY6 A;  4JUV A;  4OB0 B;  4XTW A;  3X20 B;  3JCM e;  1UGR B;  2DIG A;  1P92 A;  4KUI A;  4HCB A;  1KG1 A;  4BB7 A;  4M7A D;  3SWN C;  3N5B B;  2RM4 A;  4JRK A;  3FRN A;  5A0G A;  1K9M C;  5GMK m;  2FL7 A;  3LH0 A;  4NOY A;  4C8Q D;  3OYM A;  3LWH A;  5GAM f;  1QVG S;  3CPW S;  4EMH A;  3CCU T;  3M58 A;  2XD0 A;  2DTO A;  2V8K A;  1VQL A;  4BUG A;  3L1A A;  2HQE A;  1IRE B;  4MZP A;  3OA6 A;  3C4S A;  2DZ9 A;  1QVG A;  4XTZ A;  4XU1 A;  2YRV A;  2D6F A;  2CZ1 B;  1YI2 A;  4QQ6 A;  3CCJ A;  2XK0 A;  3ME9 A;  4F7U E;  4A54 A;  1BIA A;  2QI2 A;  2DD5 A;  2JUF A;  1I5L A;  2NLU A;  2RHY A;  4M7D C;  3RMS A;  4X34 A;  2DVE A;  1YJW A;  1KQ2 A;  1OZ2 A;  3JCM d;  3OYF A;  3QKJ A;  4PLI A;  3M5A A;  3QO3 A;  1VQ9 T;  1YIJ T;  3MEA A;  2RK2 A;  1TH7 A;  4C8Q C;  1YHQ A;  3NTK A;  5A0D A;  3CC2 A;  4LDW A;  5IT9 E;  1VQK T;  2JTF A;  3CC2 T;  1G3T A;  4JJN K;  1M90 C;  4N0A A;  3FIF A;  3KUF A;  5CQY A;  5GAO q;  1HXD A;  5LJ3 f;  4QVZ A;  3FB9 A;  4M77 D;  1VQ6 T;  1K9M U;  3OMG A;  3HRU A;  4M78 C;  1KHI A;  3OBW A;  4FSX A;  4BAC A;  1YI2 T;  4A4G A;  3MCA B;  3JCM J;  1KQS S;  5LJ5 h;  3PNW C;  3VJP A;  3G6E T;  1ZBX A;  4XU2 A;  4F7U F;  3SB2 A;  3J7A F;  1WJS A;  3C95 A;  2CKK A;  5A0L A;  4Y91 A;  3JB9 G;  4J7F A;  1YJW T;  3LGL A;  1VQ8 T;  4M78 B;  1G3S A;  1WQW A;  3A8H B;  4IUT A;  1KQ1 A;  4OGC A;  4LD6 A;  2ZGW A;  3UWN A;  2BIV A;  4HT9 A;  2X4Y A;  3G7Z A;  4LDV A;  3UT1 A;  3F70 A;  5I21 A;  3CC7 A;  3CCM T;  1OZ3 A;  5GAM d;  3CCV T;  2QA4 T;  2KDS A;  5GAN g;  3JB9 J;  2KK4 A;  3JCM Q;  2D9T A;  4IUR A;  4J7I A;  5FU7 C;  3OYN A;  2L89 A;  2E10 A;  1ZHI A;  2F5K A;  4PJO C;  4XK8 E;  3L2R A;  4RCB A;  3CCU A;  4M7A G;  3NTH A;  4F7U G;  4M7D B;  2DK3 A;  5CQX A;  3G6E A;  2DJZ A;  2CGH A;  2MWP A;  2VV5 A;  4PNO A;  2HAX A;  1NPP A;  2QQ9 A;  1U8R A;  4JLI A;  3DLM A;  1JRI A;  2DTH A;  1Q81 C;  1KD1 U;  3DB3 A;  5GAN 3;  2OTL T;  4RG8 A;  3GOX A;  3CCE A;  3RIR A;  5LJ5 d;  2P0P A;  1B34 A;  3KBG A;  2M9U A;  3PMT A;  5CO7 A;  3CCV A;  4XTY A;  5IN1 A;  3VU3 C;  2DTI A;  3SD4 A;  2GFA A;  3X28 B;  2LQK A;  1K8A C;  4ATO A;  5KE2 A;  2P0K A;  4IUQ A;  2AHJ B;  4CI0 C;  3CCR T;  1VQP T;  2ZPF B;  2ZPB B;  1H64 1;  4RG2 A;  4MZT A;  1Q7Y C;  2G3R A;  3GNF B;  5D6X A;  4R56 A;  4V2S A;  3C94 A;  4L5G A;  1X01 A;  3V7S A;  4R55 A;  4C92 B;  3CBP A;  3G4S A;  5AYF A;  5LJ3 e;  4M75 C;  4QVC A;  2HBP A;  1OI1 A;  4LDX A;  5FU7 B;  2LC4 A;  2A7Y A;  1XOV A;  3G4S T;  1SSF A;  4E7K A;  2QDY B;  4M7D F;  2VGM A;  3M59 A;  2K3Y A;  3J80 E;  1N8R C;  2PQW A;  4BE0 A;  4M7D D;  4C8Q F;  4CRI A;  1KHC A;  2MWO A;  1VQ8 A;  1VQK A;  5CAI A;  2E12 A;  3OYH A;  4Y28 E;  5LJ5 e;  3CMA A;  2K5L A;  2XDD A;  3VV0 A;  1LNX A;  1V29 B;  1D3B B;  3BFM A;  1Q82 U;  2X4W A;  1N9S A;  4C92 A;  5LJ3 g;  2OTJ T;  3OYC A;  3M53 A;  2ZPE B;  3JB9 D;  3WVD B;  4FM4 B;  3HKS A;  3FEO A;  4M7D E;  3L2W A;  4KT0 E;  2DEQ A;  1Q86 U;  1VQ6 A;  1WJR A;  2IG0 A;  4FT2 A;  4DOV A;  2DXB A;  4J83 A;  3S3O A;  4C8Q E;  1FXX A;  5CIU A;  4A4H A;  4C5I A;  4HCZ A;  4WF2 A;  3OW2 A;  3OQ5 A;  4M78 D;  3I55 T;  2EJF A;  1VQ4 T;  3M4Y A;  2DD4 A;  2P0Q A;  2RO0 A;  5GAO n;  4XAX B;  2WSC E;  1QVP A;  3I56 T;  3VYH B;  4QQD A;  5KE3 A;  1UGS B;  5GMK e;  1PSE A;  3G71 A;  3INZ A;  4DA4 A;  2XDB A;  1NPR A;  5M9O A;  1N6A A;  3CXC A;  3OYY A;  3QXE B;  1QVF S;  3JB9 F;  3V8K A;  3A8L B;  4L59 A;  2LVM A;  2PU9 B;  2XI9 A;  1K73 U;  5DY9 A;  4E7H A;  2LCC A;  4IUP A;  2EQJ A;  4KBM B;  2LRQ A;  2FHD A;  4JRQ A;  4FL6 A;  5GMK i;  1BI0 A;  2LCL A;  5GMK h;  3TEE A;  5GAN 2;  3GIB A;  2L5Q A;  4E7L A;  4MMK A;  3OYB A;  2R57 A;  1JJ2 A;  2EJG A;  2IVW A;  4EMK A;  4XTU A;  5D6W A;  2HQX A;  1Y96 A;  3LW5 E;  4C8Q G;  2EQK A;  4C0G A;  1VQO A;  2ZPI B;  1VQN A;  3CCJ T;  1KC8 U;  4M7A F;  1O9S A;  2RI2 A;  3QPH A;  4F7U A;  3V8J A;  2LQ8 A;  3OBY A;  2MF2 A;  3S3M A;  3FDR A;  3H6Z A;  3LLR A;  3X24 B;  4GY5 A;  1BKB A;  2D0Q B;  4BY6 C;  1U1T A;  1YBY A;  3ZEH A;  1VQM A;  4Q5W A;  2LTO A;  3RKY A;  4OGE A;  4E7I A;  4JDS A;  2QEX T;  4M78 A;  2LT4 A;  3FLG A;  5I2M A;  2XKO C;  5KCH A;  2O01 E;  3MP8 A;  4BD3 A;  2RA2 A;  1B34 B;  3CMA T;  5GAO l;  1R8O B;  5CCA A;  3MHX A;  5GAN 4;  5CVI A;  1I8F A;  3C12 A;  3O8V A;  4C92 D;  2E64 A;  3CPW A;  5GAO m;  1M1F A;  3UPU A;  3RER A;  3PMI A;  3QZ9 B;  4PKC C;  3MO8 A;  2KY9 A;  1Q81 U;  3QDR B;  2JTM A;  4M7D A;  2LT1 A;  4J6X A;  4A4E A;  5GAN 6;  3E1S A;  3MET A;  5EG2 A;  1XQH A;  4EPC A;  2HNI A;  3PT9 A;  4C8Q A;  1W2B A;  3QYH B;  4ME7 A;  2VUB A;  4P5N A;  3E19 A;  2RH2 A;  3CCL T;  1WGS A;  2EQU A;  3P8B B;  4O6J A;  3L2Z A;  2RJD A;  4NL3 A;  4IKF A;  1KC8 C;  4DOW A;  4RMO A;  2RHZ A;  2X4J A;  4X9D A;  2R5M A;  3HFN A;  4QW2 A;  4L6V 5;  1VQ7 T;  3OMC A;  2K4Y A;  1WQ7 A;  4NS5 A;  3EFS A;  1OYX A;  4BY6 B;  2KVQ G;  2VXF A;  4EMG A;  3V8L A;  1VQL T;  3QYG B;  5HKC A;  2RHI A;  5DLO A;  4RCC A;  2GCX A;  4ZN3 A;  2JNG A;  3OS2 A;  3M54 A;  3SWN B;  1YJN T;  3CD6 T;  2QQA A;  4M7A E;  3JCM V;  3L2V A;  2QXF A;  1QW1 A;  3JCM P;  5FRM A;  4TVR A;  2RK1 A;  3V7C A;  2K57 A;  5GMK j;  2GF7 A;  5HK0 A;  4BI3 A;  1N27 A;  2Y90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...