4PJOB

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 83
sequence length 83
chains with identical sequence P, b, p
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoB00
4XTUA 3FB9A 5GAMh 1LJOA 1LNXA 2FYKA 2VC8A 4C8QB 4MMLA 2DTOA 3V7SA 3BFMA 3RKYA 4EMKA 1U1SA 2YLCA 4C92D 5GMKm 1I5LA 4M77B 4C8QC 4RCCA 4XTYA 4PJOF 3JB9F 2Y90A 4M7DG 4M77C 5GAOl 4M77F 4M78E 1D3BB 3BW1A 5GAN4 3JCMP 1B34B 4XTVA 2EJFA 3SB2A 4C8QD 4PJOD 1WNLA 1I81A 4M75B 4MMKA 5GMKh 4F7UE 5LJ5j 4M77D 5GANd 2DTHA 1LOJA 1M5Q1 4M75C 4RCBA 4XU0A 4N0AC 2RD1A 3JCMh 3RUXA 1I4K1 4XU1A 5GAMj 4M7DE 2EJGA 4M75D 3INZA 1B34A 1N9RA 4HA8A 2HNIA 4EMKC 4A53A 5I21A 5GAN8 4M7DB 4M78A 4N0AA 5LJ5e 4XU3A 3RIRA 4M78G 4M7DC 4A54A 3AHUA 3HFOA 4WF2A 4M7AG 2ZGWA 4J6WA 4JLIA 4F7UA 5GMKl 3JCMc 5GMKi 4F7UG 5GAMe 3QO3A 5GMKj 4M7DD 4J6XA 1M8VA 2DKGA 4C8QF 4DQ2A 3QHSA 3JCMf 4M7DA 2YLBA 4QVDA 2E1HA 5DY9A 5LJ3h 4M7AE 3JCMg 1X01A 4JRKA 2E65A 3FIFA 4Y91A 4M78B 4HT8A 3JB9H 4M7AB 4NL2A 4M75F 5GAN6 5GMKe 4M78C 4EMHA 2VXEA 4X9DA 4F7UB 4M7AC 3QSUA 2DJZA 4EMGA 1KQ2A 3JCMe 3EFSA 3VU3C 4F7UF 3JB9I 4M78D 4JRIA 2CGHA 3JCMb 5GAN5 2RA2A 4XTWA 3JCMJ 1TH7A 4M7DF 5LJ3f 4M7AA 1I8FA 5GANh 4J5YA 4C92G 3L1AA 1WQWA 2I2LA 5LJ3g 5LJ5d 2FB7A 2RB6A 3BDUA 2YHTA 5GAN7 4NL3A 5GAN2 3JCMW 4V2SA 1WQ7A 5GAOn 2E10A 3L2ZA 3PGGA 3RKXA 5GAMd 1Y96B 4PJOG 3V7CA 3JB9G 4HT9A 5LJ3e 2DZ9A 4C92E 2DEQA 1U1TA 3SWNB 3V7RA 3JCMX 3RKWA 2EAYA 3RESA 1HXDA 5GANf 4M78F 3SWNC 3QUIA 3V8JA 4C92B 4XTZA 4M7AF 2DXTA 4OP0A 2E64A 4C8QE 4PJOE 4C92C 5GANg 1BIAA 1HK9A 1Y96A 4QVCA 5GAOp 4M77E 2K57A 4M7AD 4PJOB 3V8LA 5GAOr 3FJPA 3SWNA 3JCMd 4JUVA 3EFRA 1JBMA 4PJOC 2VXFA 2RM4A 5LJ3j 1MGQA 3JB9J 2DVEA 4C92A 2EJ9A 4M75E 3HSBA 5GANe 5GAN3 3RERA 2EWNA 5LJ5f 5GAOm 3JB9D 1BIBA 3GIBA 4XU2A 4NOYA 2E41A 4J6YA 4C8QA 4PJOA 4XTXA 4C8QG 5LJ5g 4X9CA 4PNOA 5GAMf 1KQ1A 4M77A 5GAOq 3V8KA 1JRIA 2QTXA 3BY7A 3M4GA 4M77G 4EMKB 4XQ3A 1D3BA 5GAMg 3HFNA 2DTIA 3JCMV 5LJ5h 1WPYA 2DXUA 4M75A 1H641 5LJ3d 5GANj 1YCYA 2DZCA 4M75G 5CAIA 2JN0A 3JCMQ 4C92F 1N9SA
chains in the Genus database with same CATH superfamily
2EGCA 1U06A 4F04B 3CCQQ 3S3NA 1N8RC 1C6VX 3BFMA 3RKYA 2P0PA 2F69A 1ZBXA 4M7DG 5GAOl 4M77F 3PIOA 1QQJA 1VQ6A 2VASA 1K9MC 3MJXA 2HAXA 4L59A 5GAMj 2F1LA 1RAFB 2GFUA 2HQXA 2BE9B 5I21A 3X20B 3L2RA 2DJQA 1GBQA 1P92A 1LCKA 2PTKA 1WGSA 2OTJQ 2QA4A 4UC4A 2BKDN 3NHNA 2K9GA 2WACA 2K2VA 1VQOA 2X9HA 1IHWA 1KD1R 2YRDA 1R8OB 3LWHA 1M3CA 4NL2A 5CK9A 3OW2S 1YIJT 1VQ7Q 2XD0A 3O5ZA 3MEUA 1Q95G 3H8ZA 4XTWA 3CD6A 2KQWA 3VKIA 2DAQA 2HSPA 4PJJA 1VQ8A 2C06A 2DEQA 3SWNB 4J7FA 1ZSGA 1KC8C 2QG9B 4PJOE 2VKNA 1PNJA 3DB4A 3VS5A 1O75A 4BDZA 3UWNA 4HKEA 4LNPA 3SWNA 2VXFA 2RQRA 2MCNA 4B9XA 1WX6A 2LCLA 1VQPT 5J3BA 4FCYA 3PVLA 4C8QA 1EIFA 4ANJA 2K79A 1AZGB 4HCKA 4KUDK 1M3BA 4XQ3A 4D6WA 4D8DA 3G6EA 4A63B 1QVFA 1YCYA 4M75G 1PG5B 3CMAQ 1D1AA 2LMJA 1PSEA 2G6FX 3G71Q 1E6GA 3U23A 2LCSA 3M5AA 2MF2A 1BI0A 2HEQA 1MMDA 1VQ4A 1ZLMA 3FDRA 4X34A 1UB4A 2VUBA 1PM3A 1WHKA 3OS1A 2RD1A 1YCSB 4OGEA 3CCJA 2J6KA 1WHGA 3UT1A 4EMKC 4QT7A 1YI2A 4CC4B 4FT4A 3GNGA 4XU3A 5FU6B 2NUPB 4MZPA 3META 2VYTA 1D09B 3R6NA 4C5HA 2DVJA 3CCST 2H3JA 5DY9A 2QEXQ 1W6XA 1ABQA 2QDYB 1X2QA 2NUPA 3OQ5A 3CC4Q 3SHWA 5GMKe 1NE8A 1YJWQ 4ZN3A 4M7AC 4OGCA 5HK0A 1GL5A 3CCUQ 4E2FB 2DL7A 3QWXX 1K8AU 5KE3A 2R57A 1VQ9A 5D7UA 1JJ2A 3VS4A 4BB7A 4V2SA 3UPUA 3T9NA 2O4XB 3CMEQ 3FLGA 3ULRB 4DBHA 4E7LA 3PNWC 2EBPA 2EAYA 2KK4A 2C0TA 2FPDA 1WJRA 4FL6A 2O4XA 1HK9A 2KXDA 1JU5C 1AVZC 3A98A 2K57A 3JCMd 3EFRA 1Q7YU 2LCCA 3OBYA 2EJ9A 4BI4A 3RERA 5LJ5f 4J6YA 2CUBA 3J7AF 4J9EA 4JS4A 3HFNA 1VQKA 3CC7Q 1K73C 1M3AA 5CAIA 4QKUA 2RI3A 3WVEB 4MMLA 2YLCA 1M1KU 3OYCA 3CC2A 1NJIU 1I5OB 2B8AA 2EGEA 1D1CA 2KNBB 4C5EA 4F7UE 2DTHA 2V1QA 4PFZA 4HVWA 2K3BA 5KE2A 5CQXA 5A2QE 4KGVB 3H9NA 1UJ0A 2OI3A 3X25B 3OS0A 3OA6A 4ZNXA 4M7DC 3E19A 2V8KA 3EGDB 2LVMA 1PD0A 4MZMA 4RTUA 1NPPA 1H92A 1ZX6A 2CS7A 1YITA 3G7ZA 2X4WA 3CCQT 5FU7C 1TS9A 3N5BB 2GGRA 3RMSA 3PFSA 2P0QA 2QAZA 4FIBA 3JAME 4PK4A 2ZPHB 1GCQC 1OZ3A 2O9VA 3JB9I 1G3TA 1ZHIA 5CCAA 4C5GA 4DA4A 4YTLA 1KHCA 5LJ3f 4J5YA 2QI2A 2FO0A 2JT4A 1SRMA 4CC7A 3HL8A 2FZGB 1VIFA 2CT3A 2YT6A 3HRTA 1Q82U 3CPWS 1BK2A 5GAMd 4J9IA 1VQOT 3HKSA 3V7CA 3JB9G 3S6WA 5LJ3e 5CR2A 5GANf 4XTZA 2YUPA 4FYYB 1ABOA 4AT1B 1R0CB 2PVOB 4PJOB 3CPWP 1LPLA 5GANe 1Y7XA 5CQYA 3I55A 3GIBA 2EQKA 4LN2A 4PJOA 2XU8A 2QQAA 5GJWB 1BU1A 3IQLA 1UGQB 1YWPA 3KUFA 2QQBA 1TUGB 2KY9A 4L5GA 5KCHA 1IRXA 2KYMA 1N8RU 4ZGDB 4DBRA 3OW2A 1WIEA 1ZA1B 4LDYA 1K9MU 5KYXB 4M75C 3M0RA 3M0TA 1SF9A 2E4HA 4JS5A 2WSEE 3INZA 1QCOA 2DNUA 2JM8A 3OS2A 1S1NA 1M30A 4BDYA 2QTVA 4AFUC 2EPDA 4B6MA 2KMTA 1ZSZC 1OZ2A 2HBPA 4OMOA 3SFMA 3QYGB 5ECAA 3FIFA 3WXMB 4Y91A 2L3RA 2ZCFB 4MDWA 4M78B 2GQIA 2LC4A 1QWFA 1YIJA 1KSWA 3ZL7C 2CH4W 1YWOA 1KD1C 4M78D 3CCMQ 4AFSC 1NLPC 1MMAA 3Q1JA 1NBEB 2EYQA 3DKMA 4JJCA 2FB7A 4JZ4A 1MHNA 4E7SA 1UTIA 3VUZA 5GAN2 3JCMW 2RJCA 2LQ8A 3M0SA 4KH1B 4QVZA 3GBQA 1UFFA 1YJNQ 2D0QB 1KC8U 2QEXT 3OY9A 1CKAA 2GF7A 1GFDA 4OP0A 2JS0A 3NPFA 3D7SB 1G83A 4IURA 5CKEA 2RQTA 1U3OA 1H3HA 4FW1A 3UDCA 1YJWT 4J9GA 2DBKA 3SEMA 2CZ6B 2RH2A 3CCVQ 2OTLQ 1GRIA 1VQ9T 1MGQA 4M75E 5CKHA 3CCUT 3OYLA 2ZAEA 2RHUA 1VQPA 2O01E 2V1RA 4DEXA 2K4YA 1SRLA 3G1JA 4XU2A 4XTXA 4A4GA 1QP3A 1KQ1A 2HZYA 2V8JA 4OMPA 1WYXA 2FG0A 1QLYA 2MYSA 4EMKB 2KI7A 4OMQA 1MMGA 3H0IA 4KULA 1OPLA 2KR3A 2MPXC 3TEEA 3M0UA 4MMKA 1N9SA 1PRLC 2NUZA 1GFCA 4EMKA 4C92D 1Y57A 3CBOA 4M77B 1JO8A 4RCCA 4PJOF 4JJBA 3THKA 5HK3A 4DBFA 1D0XA 2LTOA 1WJQA 2EQIA 2EJFA 1TG0A 3M53A 5GMKh 3KBGA 4J9BA 1RUWA 3O8VA 4M77D 4LD9K 2HL3A 4N0AC 3CCLT 4E7ZA 1NYFA 2M0OA 2YSQA 2HSEB 1E6HA 1RL2A 3RIRA 2DD5A 4F7UA 3MHXA 1Q81C 4J6XA 3CCSA 3CC2T 2K2MA 1MNEA 3MP1A 2MWOA 4J9DA 4Z89A 3CXCS 1QP2A 2VXEA 2JS2A 3LH0A 3OYGA 4N4IA 1T3LA 3EGUA 2K7AA 1TH7A 1QKXA 1W2BS 4C92G 2JJ9A 3C0CA 5D6YA 5IXBA 4E7HA 4JJNK 1IO6A 5GAOn 1WZOA 2J7IA 4ELZC 1SPKA 2EFIA 3CBMA 3OYHA 4M78F 2C0OA 2JNGA 5FLXE 1W2BP 3LH5A 2D0NA 2LJ0A 1TSFA 1HJDA 4A4FA 2PVDB 4DEYA 3V8LA 5GAOr 1ZA2B 4JUVA 1Y0MA 3DB3A 2COWA 1X27A 3FC3A 1FMKA 2WSCE 3A8HB 3OYBA 4B9WA 2L3QA 1K76A 4KRTA 2R5MA 2KRMA 4BE2A 2EGAA 5GAMf 2DE0X 2H8HA 2HMAA 2RK2A 3EG0A 1K73U 4RTVA 2DZCA 2JN0A 2LRQA 2PVGB 4XTUA 2E12A 3GOXA 3JRZA 1WDXA 1BCMA 2JMCA 1W70A 3BDLA 5GAN4 4Z8AA 2XDDA 5C0MA 2RHZA 4A4EA 4XU1A 2PUOB 2E6NA 3MCAB 1UJYA 2M51A 4J83A 2CP6A 3CPWA 3AHUA 2DEUA 1BI2A 3CCQA 5LJ3h 3ZFJA 4LDUA 1LVKA 4N4HA 3HHTB 5I2MA 4HT8A 1RAGB 4EPCA 1T3SA 1YJ9Q 5LL6S 1YBYA 1TTHB 4LDXA 1PD1A 2F2WA 4F7UF 3CBPA 3QJ6A 2CP2A 2OJ2A 1FX7A 2PNIA 1T0JA 5GANh 3GNFB 2QQSA 2CYZB 2VV5A 1KG1A 2GNCA 2OTJA 3RKXA 4BY6C 3QYHB 2DPPB 2EW3A 1BI1A 2YUOA 1GBRA 5M9OA 4MDXA 2HQHA 1TXQA 4QVCA 5I22A 1VQMQ 3CCEQ 4JLGA 2OAUA 1VQ7A 3OBWA 1J3TA 1AHJB 2LQNA 3JB9J 4JRQA 1Q86C 2DIGA 3L42A 3OW2P 2M02A 2EVRA 2FZKB 3H6ZA 1JRIA 3M4GA 3VS0A 1D3BA 3CCRQ 1WPYA 2RJFA 3CD6Q 4M75A 9ATCB 3JCMQ 3H0FA 2LNVA 1LJOA 2ZPFB 4OB3B 4C8QB 1G5VA 1V76A 1C1AA 2EYWA 3MPUB 1S72T 2W10A 2Z0WA 4C8QD 1JQQA 3CCVT 4RCBA 2DYIA 1I0CA 1X6OA 2P4TA 2JUFA 2L2PA 3I9QA 1K8AR 1K0SA 3OSSC 1UGRB 2HNIA 3G4SQ 4AG1C 2H3EB 4J6WA 1SSFA 2JM9A 1TU0B 4BI8B 4ZN1A 3CMAA 2E1HA 2K5LA 3M56A 2XMFA 4RMOA 4J8OA 4J9CA 2F5TX 1M27C 2E3IA 2XICA 4GBQA 1NLOC 1KD1U 1M8MA 1OULA 3VYHB 2RA2A 1NEBA 1BYMA 1PC0A 1VQ4Q 2CKKA 1YHQQ 3CCJQ 1OEBA 1MV3A 4GY5A 1K9AA 1DJ7B 3PGGA 5EG2A 2RNAA 1YI2Q 3QZ9B 1OI1A 2A37A 1OYXA 3V7RA 5KH6A 3JCMX 2KAFA 3RESA 1NM7A 1HXDA 3VS2A 4DBQA 2X4JA 2QEXA 2KDSA 2E64A 1ARKA 4C92C 2COZA 1N27A 2W0ZA 1YJWA 4KT0E 1NYGA 5FRMA 1MUZA 3VS6A 1AZEA 1BCOA 2DVEA 3CCUA 5LJ5g 4X9CA 1OQKA 4KGZB 4FSSA 4XAXB 4E47A 2DTIA 2NUTA 3QPHA 4RKUE 1M90C 2MOXA 3FB9A 2KXCA 1LNXA 4OB0B 1G2BA 1YP5A 4N4GA 1OU8A 2ZPGB 3CXCA 5HY6A 2RHYA 1B34B 2AZSA 4XTVA 1RACB 2ZPEB 1D0ZA 3OMGA 3CCLA 1MMNA 1W2BA 1RAAB 2DF6A 1K1ZA 1B34A 2P84A 4A53A 3VJPA 4BD3A 2G3RA 2ED0A 5LJ5e 1Q82R 3HFOA 3R6OA 2XKOC 5C6SA 2AKKA 3CC7A 1Q81U 5GMKi 2V26A 5GMKj 1OPKA 4C8QF 2HD0A 1VQKQ 4FW2A 4TVRA 1KQSS 4M7AE 2DRKA 3AT1B 2JTEA 1WHHA 2HQEA 2K6DA 3PT9A 2ABLA 2AK5A 3VU3C 3A5ZB 2XDPA 2RHIA 4C5IA 4HCZA 4IUVA 2NLUA 1KQSP 5LJ3g 5GAN7 1ZQ1A 1WQ7A 3EHQA 3MP8A 1VA7A 1WXTA 4PL6A 2RQUA 2DZ9A 2F5KA 1U1TA 1QCFA 3RKWA 4IIOA 4JDSA 1N8RR 3QKJA 4HVUA 3NMZC 5IXFA 5GANg 2DERA 1VQNQ 1FWZA 2YXYA 4OMNA 1YJ9T 1EFNA 1JBMA 2DK3A 1QMCA 4AMCA 4CI0C 3HSBA 2GCXA 2OTJT 3HP9A 1WXUA 1O9SA 1UGSB 4R56A 1BBZA 1IHVA 1SSHA 3BY7A 2JXBA 2A08A 5DM7R 3KFVA 1M1GA 3LWIA 2DETA 3MEAA 1IREB 3X26B 4BACA 1AWJA 1KIKA 1M4ZA 1VQ7T 3M0QA 5GMKm 2D1XA 2SRCA 4RTYA 2VGNA 4PJOD 1I81A 2DXBA 1UHCA 2NWMA 1WA7A 3I56Q 1Z9ZA 4M7DE 1H8KA 1W1FA 1VYVA 1M2OA 2DL8A 2K3XA 2LNHB 3URGA 3I55Q 1VYTA 3J80E 3A8GB 2RO0A 2BE7D 5IN1A 1FMWA 1KC8R 3M4YA 2RPNA 4IUPA 2MI6A 2E6ZA 4PKCC 5IHKA 2HDAA 2K5IA 2Y4YA 2A0FB 2CGHA 4E7JA 3C4SA 4BE1A 3EH1A 2CP5A 2YRVA 4PLIA 1QVGS 3G4ST 3BDUA 3M59A 3CMAT 2E5QA 3E9GA 3JV3A 2HKQB 4FYWB 3L2ZA 3C12A 4EIKA 4PJOG 3G71T 1AT1B 1EZZB 2L3SA 2P4RA 1IB8A 3SWNC 2PU9B 2DXTA 1QVGP 3QBYA 1BIAA 5GAOp 2M1HA 1QVPA 5IH2A 1UE9A 4FYXB 3GPLA 1Q86U 1NPRA 4A4KA 1M2VB 1YIJQ 1RAEB 4JJDA 2R5AA 4NOYA 3MKDA 1YNZA 4FSXA 1YHQT 1VQLQ 2IVWA 2KBTA 2FRYA 3CQTA 1M2VA 3EH2A 3MO8A 3JCMV 3NTHA 4ATOA 2RMOA 1YJNA 3OYNA 3CC4T 2FYKA 1XTDA 1U1SA 4FU6A 3C95A 4XK8E 2CSIA 1S72A 3BW1A 3HRUA 3EHRA 3CCVA 2LQKA 2M16A 3ER0A 5AT1B 1M5Q1 2V8IA 1VYUA 2ROLA 4Q5WA 2RI2A 2IPOB 3CMET 1VQ5Q 2QXFA 4M78G 3REBB 2ED1A 2EYZA 2ZPIB 2DRMA 1I07A 2FZCB 1PRMC 3JCMf 2CREA 3PTAA 4JRKA 4RTTA 4Y92A 1FYNA 1UEBA 1ZUKA 2ZPBB 4M7AB 5GAN6 2CZ1B 4F7UB 3QSUA 1FXXA 1UUEA 4EMGA 1KQ2A 3JCMe 3EFSA 8ATCB 2KE9A 3M0PA 3QJYA 2AKLA 2CT4A 1TWBA 5GAN5 3OYAA 3JCMJ 2ECZA 1X75C 4M7AA 4J9FA 1OU9A 3CC7T 2I2LA 1RABB 1R77A 2E10A 2DBMA 2PZ1A 4MZTA 1AD5A 2YWWA 2FHDA 2DMOA 3ME9A 4IUQA 1R0BG 3CCSQ 3OYEA 4ZTJA 2GTJA 3OYMA 1BB9A 2RQVA 2O2OA 5KYNA 5GAOm 1BIBA 3CXCP 2DX1A 1ZUYA 3V8KA 2QTXA 4M77G 3FJ5A 5GAMg 1UDLA 5LJ5h 1M90U 2J05A 4Z88A 3J81E 3L2WA 4GLKA 1KQSA 3BE3A 1PSFA 3TSWA 2FVUA 3VS3A 1WNLA 4II1A 4XU0A 2I0NA 1HD3A 2YDLA 3P8DA 3RUXA 3S3MA 1I4K1 2EJGA 4FT2A 3VRZA 2FRWA 4JPBW 2MWPA 4M7DB 5GAN8 1SHGA 3LLRA 4ZGJB 4RTXA 5GAMe 4BUGA 5FU7B 4M7DA 5IT9E 1MV0B 2E65A 3E1SA 2JZ2A 4PFOA 3M55A 2LP5A 2BTTA 2CZ7B 4OB2B 1SEMA 3KXTA 5KCOA 1B7TA 1EX4A 2YRCA 3VS1A 1H3ZA 2J6OA 1RAHB 2EKHA 3I5RA 1GCQA 3QDFA 3UF4A 4PJNA 3L1AA 2LJ1A 1OV3A 2CSQA 4FYVB 2OAWA 1Y96B 2KT1A 2BZXA 4C0DC 3OMCA 1OOTA 3V8JA 3QUIA 4E7KA 4FM4B 3ASKA 4QQ6A 4M7AF 2DXCA 1RI0A 4KGXB 4CRIA 1Y96A 3OYYA 2F2XA 1YJ9A 4CC3A 1VQ6Q 4PJOC 5GAN3 3LGFA 3UATA 5HCKA 2XG8D 4PNOA 5A0GA 5A0LA 1GCPA 4O5VA 2LT4A 2HL5C 2JOYA 3QWYA 5CO7A 3H0HA 3VS7A 2QA4Q 5LJ3d 4J9HA 5J26A 2VC8A 1VQOQ 3ZEHA 1XOVA 2LDMA 1B07A 3LGLA 2ZZDA 4XTYA 3X28B 4X1VA 1VQMA 2E70A 3CCEA 4BI3A 1D0YA 3M57A 3CCMT 1D3BB 4M75B 3GLXA 2AT1B 5GANd 4RTZA 2QYZA 5CKDA 3RR6A 2LT1A 1AWOA 1G3WA 3OYIA 2CH4A 1QVGA 1M9SA 4RG8A 4M75D 1MNDA 2HBWA 3OSVA 1JXMA 1VQLT 4OMFB 5L8RE 1YJNT 2DD4A 4A54A 1PKTA 1ZSZB 2FPEA 3CCRA 1G3YA 1BKBA 4QQGA 1VQ8Q 3EAEA 1Z9QA 2RQWA 2JTFA 1OX8A 3S3OA 4DOWA 5L23A 2ATCB 4JZ3A 2OTLT 1ZSZA 3JB9H 2GFAA 5FW9A 5AYFA 4M78C 1K0XA 4EMHA 3EFOB 2QASA 2JMAA 2XK0A 1NEGA 4IKFA 1AWWA 2O88A 5KYUB 1WI7A 2ENMA 4HCBA 2X4YA 5EC7A 4M7DF 1I8FA 1WFWA 4HVVA 2XI9A 3EFOA 1TUCA 2DL3A 2DYBA 3MP6A 3SDZA 3G4SA 1VQ5T 3OYFA 4ME7A 1UGVA 5KYUA 2CP0A 3G6EQ 3G71A 4HT9A 2KGTA 5FWCA 1ZUUA 3P8BB 4CC2A 1Q7YR 4VUBA 1JEGA 2WSFE 2RI5A 3A1PA 1WHLA 4ESRA 3M58A 4WTOB 2XHCA 3PMIA 1WHMA 3QIIA 2KROA 3E9FA 1U5SA 3L2UA 1X6GA 1QCNA 2RK1A 4C8QG 1YHQA 4NS5A 2NYSA 2CZ0B 4LD6A 1Q81R 2L8DA 2BIVA 1M1KR 3CC4A 4ZTFA 5CVIA 1NJIR 2KYBA 4OMLA 2DL4A 2DL5A 1M1FA 1HSQA 8AT1B 4M77C 5IHNA 4M78E 3SB2A 2FPFA 2NUTB 4QQDA 1LOJA 5FWBA 4Z02A 3RNJA 3JCMh 1VQ9Q 2FEIA 3RDVA 3CMEA 4R0KA 4N0AA 2IG0A 2LX7A 4DOVA 2COYA 2A36A 2DFUA 2L0AA 2CDTA 4WCIA 2DKGA 1X2KA 2YLBA 7AT1B 2ROTA 1CSKA 2X3WD 1C0MA 2VGMA 4D8KA 2YUQA 4L6V5 4K11A 2EYXA 4M75F 5FROA 4JRPA 1G3SA 4RG2A 5KYWB 2ESWA 2AHJB 1XQHA 1FMVA 3TCJA 1U8RA 3EG9B 3TVTA 2CUDA 1IZ6A 4BE0A 2DM1A 3EG1A 5KYWA 3CCLQ 3JSCA 3VRYA 3EG9A 2A3LA 4RUGA 3TQ7P 2JVVA 4C92E 1PCXA 1QW1A 2P0KA 3CC2Q 2FL7A 4M77E 2O31A 3FJPA 5CIUA 3A8MB 2RM4A 2RJDA 5I2SA 2X51A 3OB9A 4OF1A 3TREA 2YUNA 2EWNA 3X24B 3JB9D 3F70A 2L5QA 5HKCA 1PKSA 3H41A 1CKBA 4F16A 3TU4K 2M9UA 4LUEA 2KEAA 3UA6A 2J06A 1VUBA 4LDVA 1YITQ 5FRNA 3OS5A 5GAMh 3NTIA 2DLPA 3V7SA 4KUIA 1K9MR 2MMPA 1JXOA 2R58A 3VUBA 1TUDA 1VQNA 2Y90A 2J6FA 4PLLA 3EGDA 1VQ6T 5LJ5j 4HXJA 2RF0A 2Y4XA 3DLLA 2VWFA 2MIOA 4HA8A 3EG2A 4PJMA 2VVKA 1ZBJA 2QA4T 3A8LB 1KK7A 3QO3A 4M4ZA 1UG1A 2IIMA 3NGPA 1VQMT 5DLQE 3CCET 4QVDA 4R55A 4C0DB 2L3PA 1AEYA 3L2VA 1RLPC 1YFNA 2QK0A 2BZ8A 3HPWA 2DJZA 1Q86R 3FRNA 3I56A 1X6BA 1RAIB 2X35A 5IAYA 2QQ9A 2C0IA 2LQWA 2RHXA 3QDRB 4KBMB 1UHFA 2RJEA 3CCRT 4OVAA 3CD6T 1WQWA 2RB6A 2YHTA 4LE9A 4BY6B 1Y71A 3SD4A 2DIQA 2CP7A 1VQ8T 2F2VA 2OX7A 1SHFA 4ELYC 4IUUA 2K5FA 6AT1B 4RTWA 1VIEA 1PHTA 2VB6A 1AOJA 2A28A 4GLMA 5LJ3j 1N5ZA 1KHIA 1A0NB 4F14A 4ZGEB 1SKUB 1V29B 3EGXB 5GAOq 2KSSA 3NTKA 1YN8A 1D1BA 3G6ET 2RN8A 3A8OB 5GANj 5KYXA 1RI9A 2GQVA 1Y07A 3EGXA 3LX7A 3RMQA 4E6RA 1RLQC 4C8QC 5IHIA 3JB9F 3CCMA 2EKOA 2QGFB 2DILA 5KYYB 3JCMP 2AZVA 1VQ4T 5GJVB 5J39A 5D6XA 3LW5E 4C0ZA 3CCJT 2M0YA 2JW4A 5KYYA 1G8XA 1YI2T 3M54A 1VQLA 4M78A 1KJWA 3EG3A 5GMKl 3FEOA 3JCMc 4E7IA 1QVFS 1M8VA 4LDWA 3QHSA 2PQWA 1IXDA 1IGQA 4ORZA 3JCMg 2OTLA 3PE0A 4O6JA 1JB0E 3MEWA 4X9DA 4C0FA 1WHJA 4JRIA 4KH0B 2LX9A 4LUDA 3JCMb 1S72Q 1QVFP 3L2QA 1VQPQ 1K8AC 2KRNA 4PJLA 5FU6C 1RADB 3RBBB 4NL3A 1VQ5A 4LXCA 4A4HA 1M90R 1VOMA 4IUTA 2BZYA 2XDBA 1SG5A 3QZ5B 3OYDA 2PUKB 2EYYA 4C0GA 2D6FA 4AG2C 3CPFA 4C92B 1AWXA 2LJ3A 4C8QE 1X69A 3CEYA 3PIPA 3REAB 3QXEB 3E2UA 4M7AD 1ACMB 1WXBA 2O9SA 4OMMA 1KFZA 4PFPA 1Q7YC 4AFZC 4C92A 1I1JA 1E7OA 1QWEA 5A0DA 4IIMA 1K73R 3TSZA 4M77A 1JJ2S 2JTMA 3LYIA 4QW2A 1B3QA 3UA7A 1VQKT 3GF5A 2KVQG 5CKBA 2X3XD 2DXUA 3PMTA 1H641 2XIDA 3OYKA 2B86A 3ZBDA 3I35A 1XNIA 2DTOA 1I5LA 1M1KC 4J7IA 3I5SA 2A7YA 4AFQC 1K4US 1BI3A 3HTRA 1JJ2P 1NJIC 1QKWA 3C94A 3P8HA 2KT8A 1XJWB 2LZ6B 4P5NA 2DO3A 2QQRA 1N9RA 2GTOA 2D8HA 1F1BB 4EDUA 1WJSA 1NG2A 4WF2A 4M7AG 1GXIE 2ZGWA 4JLIA 4F7UG 1YITT 1IGUA 4DQ2A 1VQNT 3M9QA 2QGGA 1X01A 1T0HA 2HCKA 2EQJA 5I11A 2EQUA 2D9TA 4HCCA 2EIFA 4Y28E 3VYGA 3PVQA 2HKNA 5D6WA 1OX9A 5LJ5d 2QDLA 4M7DD 2KRSA 1W4SA 2GBQA 4OB1B 1Q82C 5DLOA 2SEMA 2DA9A 3NFCA 3WVDB 3OYJA 1WLPB 3GP8A 1N6AA 2MK5A 5CKFA 1TOVA 2E5KA 3I56T 3QG1A 1X43A 2EQMA 1PWTA 4F17A 3VV0A 2BUDA 1UGPB 3DLMA 3MEVA 2K3YA 3I55T 2E41A 2AIRB 1HYOA 2E3HA 2D8JA 3HRSA 2L89A 2X4XA 1V1CA 1UECA 2MAMA 2CP3A 1NZ9A 4C92F
chains in the Genus database with same CATH topology
5CVIA 4BACA 3S3NA 1M4ZA 4EMKA 1N8RC 1VQ7T 3BFMA 3RKYA 2P0PA 4C92D 5GMKm 3CBOA 4M77B 4RCCA 4PJOF 5HK3A 1M1FA 2F69A 1ZBXA 4M7DG 4M77C 2LTOA 2VGNA 4M78E 4M77F 1WJQA 5GAOl 3PIOA 3SB2A 2EJFA 4PJOD 4QQDA 3M53A 1I81A 2DXBA 4MMKA 5GMKh 3KBGA 1VQ6A 3O8VA 4M77D 1K9MC 4LD9K 1LOJA 4Z02A 2HAXA 4N0AC 3JCMh 3CCLT 4L59A 4M7DE 5GAMj 2M0OA 2GFUA 2HQXA 5I21A 3X20B 3L2RA 3CMEA 2K3XA 4N0AA 1RL2A 1P92A 2IG0A 3RIRA 3URGA 4DOVA 1WGSA 2QA4A 4UC4A 2BKDN 2DD5A 4F7UA 3MHXA 1Q81C 3J80E 3A8GB 4J6XA 2RO0A 3CCSA 2DKGA 3CC2T 5IN1A 3MP1A 2WACA 2K2VA 2YLBA 3M4YA 1VQOA 4IUPA 2MWOA 2MI6A 1R8OB 2E6ZA 2VGMA 3LWHA 4L6V5 4PKCC 4NL2A 4M75F 1QP2A 5FROA 5CK9A 3CXCS 3OW2S 1YIJT 2VXEA 4JRPA 1G3SA 4RG2A 2XD0A 2AHJB 3LH0A 1XQHA 2K5IA 3OYGA 2Y4YA 4N4IA 3TCJA 3MEUA 2CGHA 4E7JA 1U8RA 3C4SA 3H8ZA 4XTWA 4BE1A 1TH7A 2YRVA 1IZ6A 4PLIA 1W2BS 1QVGS 4BE0A 3CD6A 4C92G 3G4ST 2KQWA 3BDUA 3JSCA 3M59A 3VKIA 5D6YA 4E7HA 2DAQA 4JJNK 2E5QA 3E9GA 3CMAT 5GAOn 3L2ZA 3C12A 2A3LA 4PJOG 3G71T 2JVVA 4ELZC 1VQ8A 2C06A 4C92E 2DEQA 3SWNB 4J7FA 2EFIA 3CBMA 3OYHA 4M78F 3SWNC 1KC8C 2JNGA 2PU9B 1QW1A 2DXTA 5FLXE 1VQ5T 2P0KA 4PJOE 3QBYA 1BIAA 2FL7A 3DB4A 5GAOp 4M77E 2M1HA 1O75A 1QVPA 2PVDB 3UWNA 4A4FA 3V8LA 4BDZA 3FJPA 4HKEA 3SWNA 4JUVA 5GAOr 3DB3A 3GPLA 5CIUA 2VXFA 2RM4A 3A8MB 2RJDA 5I2SA 3FC3A 1Q86U 2WSCE 1NPRA 3A8HB 4A4KA 3OB9A 4OF1A 3TREA 4B9XA 3OYBA 2LCLA 2EWNA 5J3BA 3X24B 4B9WA 3JB9D 1VQPT 2R5AA 2L5QA 3F70A 4NOYA 4C8QA 2R5MA 1EIFA 5HKCA 4FSXA 1YHQT 4BE2A 5GAMf 3TU4K 4KUDK 2IVWA 4XQ3A 2M9UA 4D6WA 2RK2A 3MO8A 3JCMV 3NTHA 3G6EA 1VUBA 1K73U 1QVFA 4ATOA 1YCYA 2DZCA 4M75G 2JN0A 2LRQA 4LDVA 1YJNA 3OYNA 3OS5A 3CC4T 5FRNA 2PVGB 4XTUA 5GAMh 2E12A 1PSEA 3GOXA 2FYKA 1XTDA 3NTIA 3JRZA 3V7SA 1U1SA 4KUIA 3M5AA 2MF2A 4FU6A 2MMPA 2R58A 3VUBA 1BI0A 3C95A 4XK8E 1VQNA 2Y90A 3BDLA 5GAN4 1S72A 3BW1A 3HRUA 2XDDA 5C0MA 1VQ4A 4PLLA 3CCVA 1VQ6T 2LQKA 2M16A 3ER0A 1UB4A 3FDRA 2VUBA 4X34A 5LJ5j 1M5Q1 2V8IA 2Y4XA 2RHZA 2RD1A 4A4EA 4OGEA 3OS1A 3DLLA 3CCJA 4XU1A 2PUOB 3UT1A 2E6NA 4Q5WA 3MCAB 2RI2A 4HA8A 4EMKC 3CMET 1YI2A 4J83A 4FT4A 2QXFA 3GNGA 4M78G 4XU3A 5FU6B 3CPWA 3AHUA 2QA4T 4MZPA 3A8LB 3META 2VYTA 2ZPIB 4C5HA 3QO3A 4M7DD 3CCST 2H3JA 1VQMT 5DLQE 3JCMf 1BI2A 3CCET 4QVDA 4R55A 5DY9A 3PTAA 5LJ3h 3ZFJA 3CCQA 2QDYB 4JRKA 4C0DB 4LDUA 3OQ5A 4N4HA 1UEBA 3HHTB 5I2MA 2ZPBB 3L2VA 4M7AB 4HT8A 5GAN6 1NE8A 3HPWA 4EPCA 5GMKe 4ZN3A 2CZ1B 5LL6S 4F7UB 4M7AC 1YBYA 3QSUA 1FXXA 2DJZA 4EMGA 4LDXA 1KQ2A 3JCMe 4OGCA 5HK0A 3EFSA 4F7UF 3FRNA 3CBPA 3QJ6A 3QJYA 5GAN5 1FX7A 3JCMJ 3OYAA 3I56A 2X35A 1X75C 5IAYA 4M7AA 2QQ9A 5GANh 1K8AU 2RHXA 5KE3A 2R57A 3QDRB 4KBMB 1VQ9A 2RJEA 3GNFB 4OVAA 3CCRT 3CC7T 3CD6T 1WQWA 2I2LA 2QQSA 1JJ2A 2CYZB 2RB6A 2YHTA 4BB7A 4V2SA 2VV5A 1KG1A 4BY6B 2OTJA 2E10A 1Y71A 3RKXA 3T9NA 2O4XB 3UPUA 3FLGA 4BY6C 4E7LA 3QYHB 4MZTA 3SD4A 2DIQA 1VQ8T 3PNWC 2FHDA 2DPPB 2EAYA 1BI1A 2KK4A 3ME9A 4ELYC 4IUUA 2K5FA 4IUQA 5M9OA 1WJRA 4FL6A 4MDXA 2O4XA 3OYEA 1HK9A 4QVCA 1VIEA 4JLGA 2K57A 2OAUA 4ZTJA 1VQ7A 3OYMA 3JCMd 3EFRA 3OBWA 2LCCA 1Q7YU 1AHJB 5LJ3j 3JB9J 3OBYA 4JRQA 2EJ9A 1Q86C 4BI4A 2DIGA 1KHIA 3RERA 3L42A 5LJ5f 5GAOm 1BIBA 4ZGEB 4J6YA 1V29B 3J7AF 5GAOq 3H6ZA 1JRIA 2KSSA 2QTXA 3M4GA 4M77G 3V8KA 3NTKA 4JS4A 1D3BA 5GAMg 3HFNA 1VQKA 3G6ET 5LJ5h 1WPYA 2RJFA 1M90U 4M75A 3A8OB 3J81E 3JCMQ 5GANj 5CAIA 3L2WA 1K73C 2GQVA 2LNVA 2RI3A 1Y07A 1LJOA 3LX7A 3WVEB 4GLKA 2ZPFB 4OB3B 4C8QB 3RMQA 4MMLA 1KQSA 2YLCA 1G5VA 1M1KU 1PSFA 4C8QC 3OYCA 3CC2A 2FVUA 3JB9F 3CCMA 1NJIU 1S72T 2EKOA 2B8AA 3JCMP 4C8QD 1VQ4T 1WNLA 4II1A 3CCVT 4C5EA 5J39A 4F7UE 5D6XA 2DTHA 3LW5E 4XU0A 4RCBA 1X6OA 4C0ZA 3CCJT 2P4TA 2JUFA 3P8DA 3RUXA 5KE2A 1I4K1 3S3MA 5CQXA 2EJGA 5A2QE 3OSSC 4FT2A 1UGRB 2MWPA 2HNIA 4M7DB 5GAN8 3X25B 3OS0A 1YI2T 3OA6A 3M54A 1VQLA 3LLRA 4M78A 3X26B 4M7DC 3E19A 2V8KA 4ZGJB 4J6WA 2LVMA 1SSFA 3FEOA 4MZMA 3JCMc 5GMKl 4E7IA 5GAMe 4BUGA 1NPPA 2CS7A 4BI8B 1QVFS 1M8VA 4LDWA 1YITA 5FU7B 3QHSA 4ZN1A 4M7DA 3CMAA 2PQWA 3G7ZA 2X4WA 2E1HA 2K5LA 3M56A 5FU7C 3CCQT 5IT9E 3N5BB 3JCMg 4RMOA 2E65A 4J8OA 3E1SA 2OTLA 2JZ2A 3RMSA 3PFSA 2P0QA 3M55A 4O6JA 4FIBA 1JB0E 2F5TX 3MEWA 2XICA 3JAME 4X9DA 2ZPHB 2CZ7B 4OB2B 1OZ3A 4C0FA 1KD1U 3KXTA 5KCOA 3JB9I 1G3TA 4JRIA 3VYHB 1ZHIA 2LX9A 5CCAA 2RA2A 3JCMb 3L2QA 1H3ZA 4C5GA 4DA4A 1BYMA 4YTLA 1KHCA 5LJ3f 2CKKA 4J5YA 1K8AC 2QI2A 5FU6C 3HL8A 3L1AA 1VIFA 4NL3A 1VQ5A 3HRTA 1Q82U 3CPWS 4GY5A 4A4HA 5GAMd 1DJ7B 3PGGA 5EG2A 1Y96B 4IUTA 3HKSA 3V7CA 1VQOT 3JB9G 2XDBA 3S6WA 3QZ9B 5LJ3e 1OI1A 3QZ5B 5CR2A 4C0DC 1OYXA 3V7RA 3OMCA 3OYDA 2PUKB 5KH6A 2KAFA 3RESA 3JCMX 4C0GA 1HXDA 5GANf 3V8JA 2X4JA 3QUIA 3CPFA 4C92B 4XTZA 2QEXA 4FM4B 3ASKA 4QQ6A 2KDSA 4E7KA 4M7AF 2DXCA 1RI0A 2E64A 4C8QE 4CRIA 4C92C 1Y96A 3CEYA 3OYYA 3PIPA 3QXEB 1N27A 4M7AD 1YJWA 2PVOB 4KT0E 1YJ9A 4PJOB 5FRMA 1Q7YC 4PJOC 2DVEA 4C92A 5GANe 3CCUA 5GAN3 1Y7XA 3LGFA 5CQYA 3I55A 3GIBA 2EQKA 5A0DA 4PJOA 2XU8A 2QQAA 5LJ5g 4X9CA 2XG8D 4PNOA 5A0GA 5A0LA 4M77A 1JJ2S 2JTMA 4O5VA 1UGQB 2LT4A 4XAXB 3KUFA 3LYIA 2QQBA 4QW2A 2JOYA 5CO7A 4E47A 1VQKT 2DTIA 3GF5A 2KVQG 5CKBA 3QPHA 2DXUA 3PMTA 1H641 4RKUE 5LJ3d 1M90C 2KY9A 2XIDA 3OYKA 5J26A 4L5GA 3ZBDA 5KCHA 1XNIA 3FB9A 1LNXA 1N8RU 4ZGDB 2VC8A 4OB0B 2DTOA 3ZEHA 1XOVA 2LDMA 3LGLA 2ZZDA 4N4GA 1I5LA 1M1KC 2ZPGB 4J7IA 4XTYA 3X28B 2A7YA 2E70A 3CXCA 5HY6A 4BI3A 3M57A 3CCEA 1VQMA 2RHYA 3CCMT 1BI3A 3OW2A 1D3BB 1NJIC 1B34B 3C94A 3P8HA 4XTVA 4M75B 3GLXA 4LDYA 2ZPEB 1K9MU 5GANd 3OMGA 4M75C 5CKDA 3CCLA 2LT1A 4P5NA 1G3WA 1W2BA 3OYIA 1QVGA 4JS5A 2WSEE 1M9SA 2DO3A 4M75D 3INZA 4RG8A 3OS2A 1B34A 1N9RA 2QQRA 4EDUA 4A53A 3OSVA 3VJPA 1VQLT 4BD3A 1WJSA 2G3RA 4OMFB 5L8RE 5LJ5e 1YJNT 2DD4A 4BDYA 4A54A 3HFOA 4WF2A 3R6OA 4M7AG 1GXIE 2XKOC 2ZGWA 4JLIA 5C6SA 1Q81U 3CC7A 3CCRA 2KMTA 4F7UG 1G3YA 5GMKi 5GMKj 1BKBA 4QQGA 1OZ2A 2HBPA 3EAEA 4C8QF 2HD0A 4DQ2A 1YITT 3CC4A 2JTFA 1VQNT 3S3OA 3M9QA 4TVRA 3SFMA 4DOWA 1KQSS 1X01A 3QYGB 4M7AE 3FIFA 2OTLT 3WXMB 4Y91A 2L3RA 2ZCFB 4MDWA 4M78B 2EQJA 2LC4A 2EQUA 3JB9H 2GFAA 5AYFA 4M78C 4EMHA 1YIJA 2D9TA 4HCCA 2HQEA 2EIFA 4Y28E 3PT9A 3VU3C 2XK0A 1KD1C 3A5ZB 4M78D 4IKFA 2XDPA 2RHIA 3VYGA 4HCBA 2X4YA 4C5IA 4M7DF 4HCZA 4IUVA 1I8FA 2XI9A 3Q1JA 2NLUA 5D6WA 3MP6A 2EYQA 3DKMA 3SDZA 5LJ3g 5LJ5d 1ZQ1A 5GAN7 2FB7A 3OYFA 1MHNA 4ME7A 3G4SA 3VUZA 1W4SA 5GAN2 2RJCA 3JCMW 1WQ7A 4OB1B 2LQ8A 1Q82C 5DLOA 3MP8A 4QVZA 3G71A 4HT9A 3NFCA 4PL6A 3WVDB 3OYJA 2DZ9A 2F5KA 1U1TA 2D0QB 3P8BB 3RKWA 4JDSA 1KC8U 3QKJA 2QEXT 3OY9A 3GP8A 2GF7A 4VUBA 4OP0A 1N6AA 2WSFE 4IURA 5CKEA 2RI5A 5CKFA 5GANg 1FWZA 3UDCA 1YJWT 3I56T 1YJ9T 3QG1A 3M58A 2CZ6B 2RH2A 1JBMA 2DK3A 2XHCA 3PMIA 3QIIA 1VQ9T 1MGQA 2EQMA 3E9FA 4CI0C 4M75E 5CKHA 3HSBA 3CCUT 3OYLA 3VV0A 2RHUA 3L2UA 2BUDA 1UGPB 2GCXA 1VQPA 2O01E 2K4YA 3DLMA 2K3YA 3MEVA 3I55T 3HP9A 4XU2A 2E41A 2OTJT 4XTXA 2RK1A 4A4GA 1O9SA 4C8QG 4NS5A 1UGSB 1QP3A 1YHQA 4R56A 2D6FA 1KQ1A 2V8JA 3HRSA 3BY7A 4EMKB 2L89A 2X4XA 2CZ0B 4LD6A 5DM7R 2MAMA 1M1GA 4KULA 1NZ9A 2L8DA 2BIVA 3LWIA 3TEEA 3MEAA 1IREB 4C92F 4ZTFA 1N9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTU A;  3FB9 A;  5GAM h;  1LJO A;  1LNX A;  2FYK A;  2VC8 A;  4C8Q B;  4MML A;  2DTO A;  3V7S A;  3BFM A;  3RKY A;  4EMK A;  1U1S A;  2YLC A;  4C92 D;  5GMK m;  1I5L A;  4M77 B;  4C8Q C;  4RCC A;  4XTY A;  4PJO F;  3JB9 F;  2Y90 A;  4M7D G;  4M77 C;  5GAO l;  4M77 F;  4M78 E;  1D3B B;  3BW1 A;  5GAN 4;  3JCM P;  1B34 B;  4XTV A;  2EJF A;  3SB2 A;  4C8Q D;  4PJO D;  1WNL A;  1I81 A;  4M75 B;  4MMK A;  5GMK h;  4F7U E;  5LJ5 j;  4M77 D;  5GAN d;  2DTH A;  1LOJ A;  1M5Q 1;  4M75 C;  4RCB A;  4XU0 A;  4N0A C;  2RD1 A;  3JCM h;  3RUX A;  1I4K 1;  4XU1 A;  5GAM j;  4M7D E;  2EJG A;  4M75 D;  3INZ A;  1B34 A;  1N9R A;  4HA8 A;  2HNI A;  4EMK C;  4A53 A;  5I21 A;  5GAN 8;  4M7D B;  4M78 A;  4N0A A;  5LJ5 e;  4XU3 A;  3RIR A;  4M78 G;  4M7D C;  4A54 A;  3AHU A;  3HFO A;  4WF2 A;  4M7A G;  2ZGW A;  4J6W A;  4JLI A;  4F7U A;  5GMK l;  3JCM c;  5GMK i;  4F7U G;  5GAM e;  3QO3 A;  5GMK j;  4M7D D;  4J6X A;  1M8V A;  2DKG A;  4C8Q F;  4DQ2 A;  3QHS A;  3JCM f;  4M7D A;  2YLB A;  4QVD A;  2E1H A;  5DY9 A;  5LJ3 h;  4M7A E;  3JCM g;  1X01 A;  4JRK A;  2E65 A;  3FIF A;  4Y91 A;  4M78 B;  4HT8 A;  3JB9 H;  4M7A B;  4NL2 A;  4M75 F;  5GAN 6;  5GMK e;  4M78 C;  4EMH A;  2VXE A;  4X9D A;  4F7U B;  4M7A C;  3QSU A;  2DJZ A;  4EMG A;  1KQ2 A;  3JCM e;  3EFS A;  3VU3 C;  4F7U F;  3JB9 I;  4M78 D;  4JRI A;  2CGH A;  3JCM b;  5GAN 5;  2RA2 A;  4XTW A;  3JCM J;  1TH7 A;  4M7D F;  5LJ3 f;  4M7A A;  1I8F A;  5GAN h;  4J5Y A;  4C92 G;  3L1A A;  1WQW A;  2I2L A;  5LJ3 g;  5LJ5 d;  2FB7 A;  2RB6 A;  3BDU A;  2YHT A;  5GAN 7;  4NL3 A;  5GAN 2;  3JCM W;  4V2S A;  1WQ7 A;  5GAO n;  2E10 A;  3L2Z A;  3PGG A;  3RKX A;  5GAM d;  1Y96 B;  4PJO G;  3V7C A;  3JB9 G;  4HT9 A;  5LJ3 e;  2DZ9 A;  4C92 E;  2DEQ A;  1U1T A;  3SWN B;  3V7R A;  3JCM X;  3RKW A;  2EAY A;  3RES A;  1HXD A;  5GAN f;  4M78 F;  3SWN C;  3QUI A;  3V8J A;  4C92 B;  4XTZ A;  4M7A F;  2DXT A;  4OP0 A;  2E64 A;  4C8Q E;  4PJO E;  4C92 C;  5GAN g;  1BIA A;  1HK9 A;  1Y96 A;  4QVC A;  5GAO p;  4M77 E;  2K57 A;  4M7A D;  4PJO B;  3V8L A;  5GAO r;  3FJP A;  3SWN A;  3JCM d;  4JUV A;  3EFR A;  1JBM A;  4PJO C;  2VXF A;  2RM4 A;  5LJ3 j;  1MGQ A;  3JB9 J;  2DVE A;  4C92 A;  2EJ9 A;  4M75 E;  3HSB A;  5GAN e;  5GAN 3;  3RER A;  2EWN A;  5LJ5 f;  5GAO m;  3JB9 D;  1BIB A;  3GIB A;  4XU2 A;  4NOY A;  2E41 A;  4J6Y A;  4C8Q A;  4PJO A;  4XTX A;  4C8Q G;  5LJ5 g;  4X9C A;  4PNO A;  5GAM f;  1KQ1 A;  4M77 A;  5GAO q;  3V8K A;  1JRI A;  2QTX A;  3BY7 A;  3M4G A;  4M77 G;  4EMK B;  4XQ3 A;  1D3B A;  5GAM g;  3HFN A;  2DTI A;  3JCM V;  5LJ5 h;  1WPY A;  2DXU A;  4M75 A;  1H64 1;  5LJ3 d;  5GAN j;  1YCY A;  2DZC A;  4M75 G;  5CAI A;  2JN0 A;  3JCM Q;  4C92 F;  1N9S A; 
#chains in the Genus database with same CATH topology
 2EGC A;  1U06 A;  4F04 B;  3CCQ Q;  3S3N A;  1N8R C;  1C6V X;  3BFM A;  3RKY A;  2P0P A;  2F69 A;  1ZBX A;  4M7D G;  5GAO l;  4M77 F;  3PIO A;  1QQJ A;  1VQ6 A;  2VAS A;  1K9M C;  3MJX A;  2HAX A;  4L59 A;  5GAM j;  2F1L A;  1RAF B;  2GFU A;  2HQX A;  2BE9 B;  5I21 A;  3X20 B;  3L2R A;  2DJQ A;  1GBQ A;  1P92 A;  1LCK A;  2PTK A;  1WGS A;  2OTJ Q;  2QA4 A;  4UC4 A;  2BKD N;  3NHN A;  2K9G A;  2WAC A;  2K2V A;  1VQO A;  2X9H A;  1IHW A;  1KD1 R;  2YRD A;  1R8O B;  3LWH A;  1M3C A;  4NL2 A;  5CK9 A;  3OW2 S;  1YIJ T;  1VQ7 Q;  2XD0 A;  3O5Z A;  3MEU A;  1Q95 G;  3H8Z A;  4XTW A;  3CD6 A;  2KQW A;  3VKI A;  2DAQ A;  2HSP A;  4PJJ A;  1VQ8 A;  2C06 A;  2DEQ A;  3SWN B;  4J7F A;  1ZSG A;  1KC8 C;  2QG9 B;  4PJO E;  2VKN A;  1PNJ A;  3DB4 A;  3VS5 A;  1O75 A;  4BDZ A;  3UWN A;  4HKE A;  4LNP A;  3SWN A;  2VXF A;  2RQR A;  2MCN A;  4B9X A;  1WX6 A;  2LCL A;  1VQP T;  5J3B A;  4FCY A;  3PVL A;  4C8Q A;  1EIF A;  4ANJ A;  2K79 A;  1AZG B;  4HCK A;  4KUD K;  1M3B A;  4XQ3 A;  4D6W A;  4D8D A;  3G6E A;  4A63 B;  1QVF A;  1YCY A;  4M75 G;  1PG5 B;  3CMA Q;  1D1A A;  2LMJ A;  1PSE A;  2G6F X;  3G71 Q;  1E6G A;  3U23 A;  2LCS A;  3M5A A;  2MF2 A;  1BI0 A;  2HEQ A;  1MMD A;  1VQ4 A;  1ZLM A;  3FDR A;  4X34 A;  1UB4 A;  2VUB A;  1PM3 A;  1WHK A;  3OS1 A;  2RD1 A;  1YCS B;  4OGE A;  3CCJ A;  2J6K A;  1WHG A;  3UT1 A;  4EMK C;  4QT7 A;  1YI2 A;  4CC4 B;  4FT4 A;  3GNG A;  4XU3 A;  5FU6 B;  2NUP B;  4MZP A;  3MET A;  2VYT A;  1D09 B;  3R6N A;  4C5H A;  2DVJ A;  3CCS T;  2H3J A;  5DY9 A;  2QEX Q;  1W6X A;  1ABQ A;  2QDY B;  1X2Q A;  2NUP A;  3OQ5 A;  3CC4 Q;  3SHW A;  5GMK e;  1NE8 A;  1YJW Q;  4ZN3 A;  4M7A C;  4OGC A;  5HK0 A;  1GL5 A;  3CCU Q;  4E2F B;  2DL7 A;  3QWX X;  1K8A U;  5KE3 A;  2R57 A;  1VQ9 A;  5D7U A;  1JJ2 A;  3VS4 A;  4BB7 A;  4V2S A;  3UPU A;  3T9N A;  2O4X B;  3CME Q;  3FLG A;  3ULR B;  4DBH A;  4E7L A;  3PNW C;  2EBP A;  2EAY A;  2KK4 A;  2C0T A;  2FPD A;  1WJR A;  4FL6 A;  2O4X A;  1HK9 A;  2KXD A;  1JU5 C;  1AVZ C;  3A98 A;  2K57 A;  3JCM d;  3EFR A;  1Q7Y U;  2LCC A;  3OBY A;  2EJ9 A;  4BI4 A;  3RER A;  5LJ5 f;  4J6Y A;  2CUB A;  3J7A F;  4J9E A;  4JS4 A;  3HFN A;  1VQK A;  3CC7 Q;  1K73 C;  1M3A A;  5CAI A;  4QKU A;  2RI3 A;  3WVE B;  4MML A;  2YLC A;  1M1K U;  3OYC A;  3CC2 A;  1NJI U;  1I5O B;  2B8A A;  2EGE A;  1D1C A;  2KNB B;  4C5E A;  4F7U E;  2DTH A;  2V1Q A;  4PFZ A;  4HVW A;  2K3B A;  5KE2 A;  5CQX A;  5A2Q E;  4KGV B;  3H9N A;  1UJ0 A;  2OI3 A;  3X25 B;  3OS0 A;  3OA6 A;  4ZNX A;  4M7D C;  3E19 A;  2V8K A;  3EGD B;  2LVM A;  1PD0 A;  4MZM A;  4RTU A;  1NPP A;  1H92 A;  1ZX6 A;  2CS7 A;  1YIT A;  3G7Z A;  2X4W A;  3CCQ T;  5FU7 C;  1TS9 A;  3N5B B;  2GGR A;  3RMS A;  3PFS A;  2P0Q A;  2QAZ A;  4FIB A;  3JAM E;  4PK4 A;  2ZPH B;  1GCQ C;  1OZ3 A;  2O9V A;  3JB9 I;  1G3T A;  1ZHI A;  5CCA A;  4C5G A;  4DA4 A;  4YTL A;  1KHC A;  5LJ3 f;  4J5Y A;  2QI2 A;  2FO0 A;  2JT4 A;  1SRM A;  4CC7 A;  3HL8 A;  2FZG B;  1VIF A;  2CT3 A;  2YT6 A;  3HRT A;  1Q82 U;  3CPW S;  1BK2 A;  5GAM d;  4J9I A;  1VQO T;  3HKS A;  3V7C A;  3JB9 G;  3S6W A;  5LJ3 e;  5CR2 A;  5GAN f;  4XTZ A;  2YUP A;  4FYY B;  1ABO A;  4AT1 B;  1R0C B;  2PVO B;  4PJO B;  3CPW P;  1LPL A;  5GAN e;  1Y7X A;  5CQY A;  3I55 A;  3GIB A;  2EQK A;  4LN2 A;  4PJO A;  2XU8 A;  2QQA A;  5GJW B;  1BU1 A;  3IQL A;  1UGQ B;  1YWP A;  3KUF A;  2QQB A;  1TUG B;  2KY9 A;  4L5G A;  5KCH A;  1IRX A;  2KYM A;  1N8R U;  4ZGD B;  4DBR A;  3OW2 A;  1WIE A;  1ZA1 B;  4LDY A;  1K9M U;  5KYX B;  4M75 C;  3M0R A;  3M0T A;  1SF9 A;  2E4H A;  4JS5 A;  2WSE E;  3INZ A;  1QCO A;  2DNU A;  2JM8 A;  3OS2 A;  1S1N A;  1M30 A;  4BDY A;  2QTV A;  4AFU C;  2EPD A;  4B6M A;  2KMT A;  1ZSZ C;  1OZ2 A;  2HBP A;  4OMO A;  3SFM A;  3QYG B;  5ECA A;  3FIF A;  3WXM B;  4Y91 A;  2L3R A;  2ZCF B;  4MDW A;  4M78 B;  2GQI A;  2LC4 A;  1QWF A;  1YIJ A;  1KSW A;  3ZL7 C;  2CH4 W;  1YWO A;  1KD1 C;  4M78 D;  3CCM Q;  4AFS C;  1NLP C;  1MMA A;  3Q1J A;  1NBE B;  2EYQ A;  3DKM A;  4JJC A;  2FB7 A;  4JZ4 A;  1MHN A;  4E7S A;  1UTI A;  3VUZ A;  5GAN 2;  3JCM W;  2RJC A;  2LQ8 A;  3M0S A;  4KH1 B;  4QVZ A;  3GBQ A;  1UFF A;  1YJN Q;  2D0Q B;  1KC8 U;  2QEX T;  3OY9 A;  1CKA A;  2GF7 A;  1GFD A;  4OP0 A;  2JS0 A;  3NPF A;  3D7S B;  1G83 A;  4IUR A;  5CKE A;  2RQT A;  1U3O A;  1H3H A;  4FW1 A;  3UDC A;  1YJW T;  4J9G A;  2DBK A;  3SEM A;  2CZ6 B;  2RH2 A;  3CCV Q;  2OTL Q;  1GRI A;  1VQ9 T;  1MGQ A;  4M75 E;  5CKH A;  3CCU T;  3OYL A;  2ZAE A;  2RHU A;  1VQP A;  2O01 E;  2V1R A;  4DEX A;  2K4Y A;  1SRL A;  3G1J A;  4XU2 A;  4XTX A;  4A4G A;  1QP3 A;  1KQ1 A;  2HZY A;  2V8J A;  4OMP A;  1WYX A;  2FG0 A;  1QLY A;  2MYS A;  4EMK B;  2KI7 A;  4OMQ A;  1MMG A;  3H0I A;  4KUL A;  1OPL A;  2KR3 A;  2MPX C;  3TEE A;  3M0U A;  4MMK A;  1N9S A;  1PRL C;  2NUZ A;  1GFC A;  4EMK A;  4C92 D;  1Y57 A;  3CBO A;  4M77 B;  1JO8 A;  4RCC A;  4PJO F;  4JJB A;  3THK A;  5HK3 A;  4DBF A;  1D0X A;  2LTO A;  1WJQ A;  2EQI A;  2EJF A;  1TG0 A;  3M53 A;  5GMK h;  3KBG A;  4J9B A;  1RUW A;  3O8V A;  4M77 D;  4LD9 K;  2HL3 A;  4N0A C;  3CCL T;  4E7Z A;  1NYF A;  2M0O A;  2YSQ A;  2HSE B;  1E6H A;  1RL2 A;  3RIR A;  2DD5 A;  4F7U A;  3MHX A;  1Q81 C;  4J6X A;  3CCS A;  3CC2 T;  2K2M A;  1MNE A;  3MP1 A;  2MWO A;  4J9D A;  4Z89 A;  3CXC S;  1QP2 A;  2VXE A;  2JS2 A;  3LH0 A;  3OYG A;  4N4I A;  1T3L A;  3EGU A;  2K7A A;  1TH7 A;  1QKX A;  1W2B S;  4C92 G;  2JJ9 A;  3C0C A;  5D6Y A;  5IXB A;  4E7H A;  4JJN K;  1IO6 A;  5GAO n;  1WZO A;  2J7I A;  4ELZ C;  1SPK A;  2EFI A;  3CBM A;  3OYH A;  4M78 F;  2C0O A;  2JNG A;  5FLX E;  1W2B P;  3LH5 A;  2D0N A;  2LJ0 A;  1TSF A;  1HJD A;  4A4F A;  2PVD B;  4DEY A;  3V8L A;  5GAO r;  1ZA2 B;  4JUV A;  1Y0M A;  3DB3 A;  2COW A;  1X27 A;  3FC3 A;  1FMK A;  2WSC E;  3A8H B;  3OYB A;  4B9W A;  2L3Q A;  1K76 A;  4KRT A;  2R5M A;  2KRM A;  4BE2 A;  2EGA A;  5GAM f;  2DE0 X;  2H8H A;  2HMA A;  2RK2 A;  3EG0 A;  1K73 U;  4RTV A;  2DZC A;  2JN0 A;  2LRQ A;  2PVG B;  4XTU A;  2E12 A;  3GOX A;  3JRZ A;  1WDX A;  1BCM A;  2JMC A;  1W70 A;  3BDL A;  5GAN 4;  4Z8A A;  2XDD A;  5C0M A;  2RHZ A;  4A4E A;  4XU1 A;  2PUO B;  2E6N A;  3MCA B;  1UJY A;  2M51 A;  4J83 A;  2CP6 A;  3CPW A;  3AHU A;  2DEU A;  1BI2 A;  3CCQ A;  5LJ3 h;  3ZFJ A;  4LDU A;  1LVK A;  4N4H A;  3HHT B;  5I2M A;  4HT8 A;  1RAG B;  4EPC A;  1T3S A;  1YJ9 Q;  5LL6 S;  1YBY A;  1TTH B;  4LDX A;  1PD1 A;  2F2W A;  4F7U F;  3CBP A;  3QJ6 A;  2CP2 A;  2OJ2 A;  1FX7 A;  2PNI A;  1T0J A;  5GAN h;  3GNF B;  2QQS A;  2CYZ B;  2VV5 A;  1KG1 A;  2GNC A;  2OTJ A;  3RKX A;  4BY6 C;  3QYH B;  2DPP B;  2EW3 A;  1BI1 A;  2YUO A;  1GBR A;  5M9O A;  4MDX A;  2HQH A;  1TXQ A;  4QVC A;  5I22 A;  1VQM Q;  3CCE Q;  4JLG A;  2OAU A;  1VQ7 A;  3OBW A;  1J3T A;  1AHJ B;  2LQN A;  3JB9 J;  4JRQ A;  1Q86 C;  2DIG A;  3L42 A;  3OW2 P;  2M02 A;  2EVR A;  2FZK B;  3H6Z A;  1JRI A;  3M4G A;  3VS0 A;  1D3B A;  3CCR Q;  1WPY A;  2RJF A;  3CD6 Q;  4M75 A;  9ATC B;  3JCM Q;  3H0F A;  2LNV A;  1LJO A;  2ZPF B;  4OB3 B;  4C8Q B;  1G5V A;  1V76 A;  1C1A A;  2EYW A;  3MPU B;  1S72 T;  2W10 A;  2Z0W A;  4C8Q D;  1JQQ A;  3CCV T;  4RCB A;  2DYI A;  1I0C A;  1X6O A;  2P4T A;  2JUF A;  2L2P A;  3I9Q A;  1K8A R;  1K0S A;  3OSS C;  1UGR B;  2HNI A;  3G4S Q;  4AG1 C;  2H3E B;  4J6W A;  1SSF A;  2JM9 A;  1TU0 B;  4BI8 B;  4ZN1 A;  3CMA A;  2E1H A;  2K5L A;  3M56 A;  2XMF A;  4RMO A;  4J8O A;  4J9C A;  2F5T X;  1M27 C;  2E3I A;  2XIC A;  4GBQ A;  1NLO C;  1KD1 U;  1M8M A;  1OUL A;  3VYH B;  2RA2 A;  1NEB A;  1BYM A;  1PC0 A;  1VQ4 Q;  2CKK A;  1YHQ Q;  3CCJ Q;  1OEB A;  1MV3 A;  4GY5 A;  1K9A A;  1DJ7 B;  3PGG A;  5EG2 A;  2RNA A;  1YI2 Q;  3QZ9 B;  1OI1 A;  2A37 A;  1OYX A;  3V7R A;  5KH6 A;  3JCM X;  2KAF A;  3RES A;  1NM7 A;  1HXD A;  3VS2 A;  4DBQ A;  2X4J A;  2QEX A;  2KDS A;  2E64 A;  1ARK A;  4C92 C;  2COZ A;  1N27 A;  2W0Z A;  1YJW A;  4KT0 E;  1NYG A;  5FRM A;  1MUZ A;  3VS6 A;  1AZE A;  1BCO A;  2DVE A;  3CCU A;  5LJ5 g;  4X9C A;  1OQK A;  4KGZ B;  4FSS A;  4XAX B;  4E47 A;  2DTI A;  2NUT A;  3QPH A;  4RKU E;  1M90 C;  2MOX A;  3FB9 A;  2KXC A;  1LNX A;  4OB0 B;  1G2B A;  1YP5 A;  4N4G A;  1OU8 A;  2ZPG B;  3CXC A;  5HY6 A;  2RHY A;  1B34 B;  2AZS A;  4XTV A;  1RAC B;  2ZPE B;  1D0Z A;  3OMG A;  3CCL A;  1MMN A;  1W2B A;  1RAA B;  2DF6 A;  1K1Z A;  1B34 A;  2P84 A;  4A53 A;  3VJP A;  4BD3 A;  2G3R A;  2ED0 A;  5LJ5 e;  1Q82 R;  3HFO A;  3R6O A;  2XKO C;  5C6S A;  2AKK A;  3CC7 A;  1Q81 U;  5GMK i;  2V26 A;  5GMK j;  1OPK A;  4C8Q F;  2HD0 A;  1VQK Q;  4FW2 A;  4TVR A;  1KQS S;  4M7A E;  2DRK A;  3AT1 B;  2JTE A;  1WHH A;  2HQE A;  2K6D A;  3PT9 A;  2ABL A;  2AK5 A;  3VU3 C;  3A5Z B;  2XDP A;  2RHI A;  4C5I A;  4HCZ A;  4IUV A;  2NLU A;  1KQS P;  5LJ3 g;  5GAN 7;  1ZQ1 A;  1WQ7 A;  3EHQ A;  3MP8 A;  1VA7 A;  1WXT A;  4PL6 A;  2RQU A;  2DZ9 A;  2F5K A;  1U1T A;  1QCF A;  3RKW A;  4IIO A;  4JDS A;  1N8R R;  3QKJ A;  4HVU A;  3NMZ C;  5IXF A;  5GAN g;  2DER A;  1VQN Q;  1FWZ A;  2YXY A;  4OMN A;  1YJ9 T;  1EFN A;  1JBM A;  2DK3 A;  1QMC A;  4AMC A;  4CI0 C;  3HSB A;  2GCX A;  2OTJ T;  3HP9 A;  1WXU A;  1O9S A;  1UGS B;  4R56 A;  1BBZ A;  1IHV A;  1SSH A;  3BY7 A;  2JXB A;  2A08 A;  5DM7 R;  3KFV A;  1M1G A;  3LWI A;  2DET A;  3MEA A;  1IRE B;  3X26 B;  4BAC A;  1AWJ A;  1KIK A;  1M4Z A;  1VQ7 T;  3M0Q A;  5GMK m;  2D1X A;  2SRC A;  4RTY A;  2VGN A;  4PJO D;  1I81 A;  2DXB A;  1UHC A;  2NWM A;  1WA7 A;  3I56 Q;  1Z9Z A;  4M7D E;  1H8K A;  1W1F A;  1VYV A;  1M2O A;  2DL8 A;  2K3X A;  2LNH B;  3URG A;  3I55 Q;  1VYT A;  3J80 E;  3A8G B;  2RO0 A;  2BE7 D;  5IN1 A;  1FMW A;  1KC8 R;  3M4Y A;  2RPN A;  4IUP A;  2MI6 A;  2E6Z A;  4PKC C;  5IHK A;  2HDA A;  2K5I A;  2Y4Y A;  2A0F B;  2CGH A;  4E7J A;  3C4S A;  4BE1 A;  3EH1 A;  2CP5 A;  2YRV A;  4PLI A;  1QVG S;  3G4S T;  3BDU A;  3M59 A;  3CMA T;  2E5Q A;  3E9G A;  3JV3 A;  2HKQ B;  4FYW B;  3L2Z A;  3C12 A;  4EIK A;  4PJO G;  3G71 T;  1AT1 B;  1EZZ B;  2L3S A;  2P4R A;  1IB8 A;  3SWN C;  2PU9 B;  2DXT A;  1QVG P;  3QBY A;  1BIA A;  5GAO p;  2M1H A;  1QVP A;  5IH2 A;  1UE9 A;  4FYX B;  3GPL A;  1Q86 U;  1NPR A;  4A4K A;  1M2V B;  1YIJ Q;  1RAE B;  4JJD A;  2R5A A;  4NOY A;  3MKD A;  1YNZ A;  4FSX A;  1YHQ T;  1VQL Q;  2IVW A;  2KBT A;  2FRY A;  3CQT A;  1M2V A;  3EH2 A;  3MO8 A;  3JCM V;  3NTH A;  4ATO A;  2RMO A;  1YJN A;  3OYN A;  3CC4 T;  2FYK A;  1XTD A;  1U1S A;  4FU6 A;  3C95 A;  4XK8 E;  2CSI A;  1S72 A;  3BW1 A;  3HRU A;  3EHR A;  3CCV A;  2LQK A;  2M16 A;  3ER0 A;  5AT1 B;  1M5Q 1;  2V8I A;  1VYU A;  2ROL A;  4Q5W A;  2RI2 A;  2IPO B;  3CME T;  1VQ5 Q;  2QXF A;  4M78 G;  3REB B;  2ED1 A;  2EYZ A;  2ZPI B;  2DRM A;  1I07 A;  2FZC B;  1PRM C;  3JCM f;  2CRE A;  3PTA A;  4JRK A;  4RTT A;  4Y92 A;  1FYN A;  1UEB A;  1ZUK A;  2ZPB B;  4M7A B;  5GAN 6;  2CZ1 B;  4F7U B;  3QSU A;  1FXX A;  1UUE A;  4EMG A;  1KQ2 A;  3JCM e;  3EFS A;  8ATC B;  2KE9 A;  3M0P A;  3QJY A;  2AKL A;  2CT4 A;  1TWB A;  5GAN 5;  3OYA A;  3JCM J;  2ECZ A;  1X75 C;  4M7A A;  4J9F A;  1OU9 A;  3CC7 T;  2I2L A;  1RAB B;  1R77 A;  2E10 A;  2DBM A;  2PZ1 A;  4MZT A;  1AD5 A;  2YWW A;  2FHD A;  2DMO A;  3ME9 A;  4IUQ A;  1R0B G;  3CCS Q;  3OYE A;  4ZTJ A;  2GTJ A;  3OYM A;  1BB9 A;  2RQV A;  2O2O A;  5KYN A;  5GAO m;  1BIB A;  3CXC P;  2DX1 A;  1ZUY A;  3V8K A;  2QTX A;  4M77 G;  3FJ5 A;  5GAM g;  1UDL A;  5LJ5 h;  1M90 U;  2J05 A;  4Z88 A;  3J81 E;  3L2W A;  4GLK A;  1KQS A;  3BE3 A;  1PSF A;  3TSW A;  2FVU A;  3VS3 A;  1WNL A;  4II1 A;  4XU0 A;  2I0N A;  1HD3 A;  2YDL A;  3P8D A;  3RUX A;  3S3M A;  1I4K 1;  2EJG A;  4FT2 A;  3VRZ A;  2FRW A;  4JPB W;  2MWP A;  4M7D B;  5GAN 8;  1SHG A;  3LLR A;  4ZGJ B;  4RTX A;  5GAM e;  4BUG A;  5FU7 B;  4M7D A;  5IT9 E;  1MV0 B;  2E65 A;  3E1S A;  2JZ2 A;  4PFO A;  3M55 A;  2LP5 A;  2BTT A;  2CZ7 B;  4OB2 B;  1SEM A;  3KXT A;  5KCO A;  1B7T A;  1EX4 A;  2YRC A;  3VS1 A;  1H3Z A;  2J6O A;  1RAH B;  2EKH A;  3I5R A;  1GCQ A;  3QDF A;  3UF4 A;  4PJN A;  3L1A A;  2LJ1 A;  1OV3 A;  2CSQ A;  4FYV B;  2OAW A;  1Y96 B;  2KT1 A;  2BZX A;  4C0D C;  3OMC A;  1OOT A;  3V8J A;  3QUI A;  4E7K A;  4FM4 B;  3ASK A;  4QQ6 A;  4M7A F;  2DXC A;  1RI0 A;  4KGX B;  4CRI A;  1Y96 A;  3OYY A;  2F2X A;  1YJ9 A;  4CC3 A;  1VQ6 Q;  4PJO C;  5GAN 3;  3LGF A;  3UAT A;  5HCK A;  2XG8 D;  4PNO A;  5A0G A;  5A0L A;  1GCP A;  4O5V A;  2LT4 A;  2HL5 C;  2JOY A;  3QWY A;  5CO7 A;  3H0H A;  3VS7 A;  2QA4 Q;  5LJ3 d;  4J9H A;  5J26 A;  2VC8 A;  1VQO Q;  3ZEH A;  1XOV A;  2LDM A;  1B07 A;  3LGL A;  2ZZD A;  4XTY A;  3X28 B;  4X1V A;  1VQM A;  2E70 A;  3CCE A;  4BI3 A;  1D0Y A;  3M57 A;  3CCM T;  1D3B B;  4M75 B;  3GLX A;  2AT1 B;  5GAN d;  4RTZ A;  2QYZ A;  5CKD A;  3RR6 A;  2LT1 A;  1AWO A;  1G3W A;  3OYI A;  2CH4 A;  1QVG A;  1M9S A;  4RG8 A;  4M75 D;  1MND A;  2HBW A;  3OSV A;  1JXM A;  1VQL T;  4OMF B;  5L8R E;  1YJN T;  2DD4 A;  4A54 A;  1PKT A;  1ZSZ B;  2FPE A;  3CCR A;  1G3Y A;  1BKB A;  4QQG A;  1VQ8 Q;  3EAE A;  1Z9Q A;  2RQW A;  2JTF A;  1OX8 A;  3S3O A;  4DOW A;  5L23 A;  2ATC B;  4JZ3 A;  2OTL T;  1ZSZ A;  3JB9 H;  2GFA A;  5FW9 A;  5AYF A;  4M78 C;  1K0X A;  4EMH A;  3EFO B;  2QAS A;  2JMA A;  2XK0 A;  1NEG A;  4IKF A;  1AWW A;  2O88 A;  5KYU B;  1WI7 A;  2ENM A;  4HCB A;  2X4Y A;  5EC7 A;  4M7D F;  1I8F A;  1WFW A;  4HVV A;  2XI9 A;  3EFO A;  1TUC A;  2DL3 A;  2DYB A;  3MP6 A;  3SDZ A;  3G4S A;  1VQ5 T;  3OYF A;  4ME7 A;  1UGV A;  5KYU A;  2CP0 A;  3G6E Q;  3G71 A;  4HT9 A;  2KGT A;  5FWC A;  1ZUU A;  3P8B B;  4CC2 A;  1Q7Y R;  4VUB A;  1JEG A;  2WSF E;  2RI5 A;  3A1P A;  1WHL A;  4ESR A;  3M58 A;  4WTO B;  2XHC A;  3PMI A;  1WHM A;  3QII A;  2KRO A;  3E9F A;  1U5S A;  3L2U A;  1X6G A;  1QCN A;  2RK1 A;  4C8Q G;  1YHQ A;  4NS5 A;  2NYS A;  2CZ0 B;  4LD6 A;  1Q81 R;  2L8D A;  2BIV A;  1M1K R;  3CC4 A;  4ZTF A;  5CVI A;  1NJI R;  2KYB A;  4OML A;  2DL4 A;  2DL5 A;  1M1F A;  1HSQ A;  8AT1 B;  4M77 C;  5IHN A;  4M78 E;  3SB2 A;  2FPF A;  2NUT B;  4QQD A;  1LOJ A;  5FWB A;  4Z02 A;  3RNJ A;  3JCM h;  1VQ9 Q;  2FEI A;  3RDV A;  3CME A;  4R0K A;  4N0A A;  2IG0 A;  2LX7 A;  4DOV A;  2COY A;  2A36 A;  2DFU A;  2L0A A;  2CDT A;  4WCI A;  2DKG A;  1X2K A;  2YLB A;  7AT1 B;  2ROT A;  1CSK A;  2X3W D;  1C0M A;  2VGM A;  4D8K A;  2YUQ A;  4L6V 5;  4K11 A;  2EYX A;  4M75 F;  5FRO A;  4JRP A;  1G3S A;  4RG2 A;  5KYW B;  2ESW A;  2AHJ B;  1XQH A;  1FMV A;  3TCJ A;  1U8R A;  3EG9 B;  3TVT A;  2CUD A;  1IZ6 A;  4BE0 A;  2DM1 A;  3EG1 A;  5KYW A;  3CCL Q;  3JSC A;  3VRY A;  3EG9 A;  2A3L A;  4RUG A;  3TQ7 P;  2JVV A;  4C92 E;  1PCX A;  1QW1 A;  2P0K A;  3CC2 Q;  2FL7 A;  4M77 E;  2O31 A;  3FJP A;  5CIU A;  3A8M B;  2RM4 A;  2RJD A;  5I2S A;  2X51 A;  3OB9 A;  4OF1 A;  3TRE A;  2YUN A;  2EWN A;  3X24 B;  3JB9 D;  3F70 A;  2L5Q A;  5HKC A;  1PKS A;  3H41 A;  1CKB A;  4F16 A;  3TU4 K;  2M9U A;  4LUE A;  2KEA A;  3UA6 A;  2J06 A;  1VUB A;  4LDV A;  1YIT Q;  5FRN A;  3OS5 A;  5GAM h;  3NTI A;  2DLP A;  3V7S A;  4KUI A;  1K9M R;  2MMP A;  1JXO A;  2R58 A;  3VUB A;  1TUD A;  1VQN A;  2Y90 A;  2J6F A;  4PLL A;  3EGD A;  1VQ6 T;  5LJ5 j;  4HXJ A;  2RF0 A;  2Y4X A;  3DLL A;  2VWF A;  2MIO A;  4HA8 A;  3EG2 A;  4PJM A;  2VVK A;  1ZBJ A;  2QA4 T;  3A8L B;  1KK7 A;  3QO3 A;  4M4Z A;  1UG1 A;  2IIM A;  3NGP A;  1VQM T;  5DLQ E;  3CCE T;  4QVD A;  4R55 A;  4C0D B;  2L3P A;  1AEY A;  3L2V A;  1RLP C;  1YFN A;  2QK0 A;  2BZ8 A;  3HPW A;  2DJZ A;  1Q86 R;  3FRN A;  3I56 A;  1X6B A;  1RAI B;  2X35 A;  5IAY A;  2QQ9 A;  2C0I A;  2LQW A;  2RHX A;  3QDR B;  4KBM B;  1UHF A;  2RJE A;  3CCR T;  4OVA A;  3CD6 T;  1WQW A;  2RB6 A;  2YHT A;  4LE9 A;  4BY6 B;  1Y71 A;  3SD4 A;  2DIQ A;  2CP7 A;  1VQ8 T;  2F2V A;  2OX7 A;  1SHF A;  4ELY C;  4IUU A;  2K5F A;  6AT1 B;  4RTW A;  1VIE A;  1PHT A;  2VB6 A;  1AOJ A;  2A28 A;  4GLM A;  5LJ3 j;  1N5Z A;  1KHI A;  1A0N B;  4F14 A;  4ZGE B;  1SKU B;  1V29 B;  3EGX B;  5GAO q;  2KSS A;  3NTK A;  1YN8 A;  1D1B A;  3G6E T;  2RN8 A;  3A8O B;  5GAN j;  5KYX A;  1RI9 A;  2GQV A;  1Y07 A;  3EGX A;  3LX7 A;  3RMQ A;  4E6R A;  1RLQ C;  4C8Q C;  5IHI A;  3JB9 F;  3CCM A;  2EKO A;  2QGF B;  2DIL A;  5KYY B;  3JCM P;  2AZV A;  1VQ4 T;  5GJV B;  5J39 A;  5D6X A;  3LW5 E;  4C0Z A;  3CCJ T;  2M0Y A;  2JW4 A;  5KYY A;  1G8X A;  1YI2 T;  3M54 A;  1VQL A;  4M78 A;  1KJW A;  3EG3 A;  5GMK l;  3FEO A;  3JCM c;  4E7I A;  1QVF S;  1M8V A;  4LDW A;  3QHS A;  2PQW A;  1IXD A;  1IGQ A;  4ORZ A;  3JCM g;  2OTL A;  3PE0 A;  4O6J A;  1JB0 E;  3MEW A;  4X9D A;  4C0F A;  1WHJ A;  4JRI A;  4KH0 B;  2LX9 A;  4LUD A;  3JCM b;  1S72 Q;  1QVF P;  3L2Q A;  1VQP Q;  1K8A C;  2KRN A;  4PJL A;  5FU6 C;  1RAD B;  3RBB B;  4NL3 A;  1VQ5 A;  4LXC A;  4A4H A;  1M90 R;  1VOM A;  4IUT A;  2BZY A;  2XDB A;  1SG5 A;  3QZ5 B;  3OYD A;  2PUK B;  2EYY A;  4C0G A;  2D6F A;  4AG2 C;  3CPF A;  4C92 B;  1AWX A;  2LJ3 A;  4C8Q E;  1X69 A;  3CEY A;  3PIP A;  3REA B;  3QXE B;  3E2U A;  4M7A D;  1ACM B;  1WXB A;  2O9S A;  4OMM A;  1KFZ A;  4PFP A;  1Q7Y C;  4AFZ C;  4C92 A;  1I1J A;  1E7O A;  1QWE A;  5A0D A;  4IIM A;  1K73 R;  3TSZ A;  4M77 A;  1JJ2 S;  2JTM A;  3LYI A;  4QW2 A;  1B3Q A;  3UA7 A;  1VQK T;  3GF5 A;  2KVQ G;  5CKB A;  2X3X D;  2DXU A;  3PMT A;  1H64 1;  2XID A;  3OYK A;  2B86 A;  3ZBD A;  3I35 A;  1XNI A;  2DTO A;  1I5L A;  1M1K C;  4J7I A;  3I5S A;  2A7Y A;  4AFQ C;  1K4U S;  1BI3 A;  3HTR A;  1JJ2 P;  1NJI C;  1QKW A;  3C94 A;  3P8H A;  2KT8 A;  1XJW B;  2LZ6 B;  4P5N A;  2DO3 A;  2QQR A;  1N9R A;  2GTO A;  2D8H A;  1F1B B;  4EDU A;  1WJS A;  1NG2 A;  4WF2 A;  4M7A G;  1GXI E;  2ZGW A;  4JLI A;  4F7U G;  1YIT T;  1IGU A;  4DQ2 A;  1VQN T;  3M9Q A;  2QGG A;  1X01 A;  1T0H A;  2HCK A;  2EQJ A;  5I11 A;  2EQU A;  2D9T A;  4HCC A;  2EIF A;  4Y28 E;  3VYG A;  3PVQ A;  2HKN A;  5D6W A;  1OX9 A;  5LJ5 d;  2QDL A;  4M7D D;  2KRS A;  1W4S A;  2GBQ A;  4OB1 B;  1Q82 C;  5DLO A;  2SEM A;  2DA9 A;  3NFC A;  3WVD B;  3OYJ A;  1WLP B;  3GP8 A;  1N6A A;  2MK5 A;  5CKF A;  1TOV A;  2E5K A;  3I56 T;  3QG1 A;  1X43 A;  2EQM A;  1PWT A;  4F17 A;  3VV0 A;  2BUD A;  1UGP B;  3DLM A;  3MEV A;  2K3Y A;  3I55 T;  2E41 A;  2AIR B;  1HYO A;  2E3H A;  2D8J A;  3HRS A;  2L89 A;  2X4X A;  1V1C A;  1UEC A;  2MAM A;  2CP3 A;  1NZ9 A;  4C92 F; 
#chains in the Genus database with same CATH homology
 5CVI A;  4BAC A;  3S3N A;  1M4Z A;  4EMK A;  1N8R C;  1VQ7 T;  3BFM A;  3RKY A;  2P0P A;  4C92 D;  5GMK m;  3CBO A;  4M77 B;  4RCC A;  4PJO F;  5HK3 A;  1M1F A;  2F69 A;  1ZBX A;  4M7D G;  4M77 C;  2LTO A;  2VGN A;  4M78 E;  4M77 F;  1WJQ A;  5GAO l;  3PIO A;  3SB2 A;  2EJF A;  4PJO D;  4QQD A;  3M53 A;  1I81 A;  2DXB A;  4MMK A;  5GMK h;  3KBG A;  1VQ6 A;  3O8V A;  4M77 D;  1K9M C;  4LD9 K;  1LOJ A;  4Z02 A;  2HAX A;  4N0A C;  3JCM h;  3CCL T;  4L59 A;  4M7D E;  5GAM j;  2M0O A;  2GFU A;  2HQX A;  5I21 A;  3X20 B;  3L2R A;  3CME A;  2K3X A;  4N0A A;  1RL2 A;  1P92 A;  2IG0 A;  3RIR A;  3URG A;  4DOV A;  1WGS A;  2QA4 A;  4UC4 A;  2BKD N;  2DD5 A;  4F7U A;  3MHX A;  1Q81 C;  3J80 E;  3A8G B;  4J6X A;  2RO0 A;  3CCS A;  2DKG A;  3CC2 T;  5IN1 A;  3MP1 A;  2WAC A;  2K2V A;  2YLB A;  3M4Y A;  1VQO A;  4IUP A;  2MWO A;  2MI6 A;  1R8O B;  2E6Z A;  2VGM A;  3LWH A;  4L6V 5;  4PKC C;  4NL2 A;  4M75 F;  1QP2 A;  5FRO A;  5CK9 A;  3CXC S;  3OW2 S;  1YIJ T;  2VXE A;  4JRP A;  1G3S A;  4RG2 A;  2XD0 A;  2AHJ B;  3LH0 A;  1XQH A;  2K5I A;  3OYG A;  2Y4Y A;  4N4I A;  3TCJ A;  3MEU A;  2CGH A;  4E7J A;  1U8R A;  3C4S A;  3H8Z A;  4XTW A;  4BE1 A;  1TH7 A;  2YRV A;  1IZ6 A;  4PLI A;  1W2B S;  1QVG S;  4BE0 A;  3CD6 A;  4C92 G;  3G4S T;  2KQW A;  3BDU A;  3JSC A;  3M59 A;  3VKI A;  5D6Y A;  4E7H A;  2DAQ A;  4JJN K;  2E5Q A;  3E9G A;  3CMA T;  5GAO n;  3L2Z A;  3C12 A;  2A3L A;  4PJO G;  3G71 T;  2JVV A;  4ELZ C;  1VQ8 A;  2C06 A;  4C92 E;  2DEQ A;  3SWN B;  4J7F A;  2EFI A;  3CBM A;  3OYH A;  4M78 F;  3SWN C;  1KC8 C;  2JNG A;  2PU9 B;  1QW1 A;  2DXT A;  5FLX E;  1VQ5 T;  2P0K A;  4PJO E;  3QBY A;  1BIA A;  2FL7 A;  3DB4 A;  5GAO p;  4M77 E;  2M1H A;  1O75 A;  1QVP A;  2PVD B;  3UWN A;  4A4F A;  3V8L A;  4BDZ A;  3FJP A;  4HKE A;  3SWN A;  4JUV A;  5GAO r;  3DB3 A;  3GPL A;  5CIU A;  2VXF A;  2RM4 A;  3A8M B;  2RJD A;  5I2S A;  3FC3 A;  1Q86 U;  2WSC E;  1NPR A;  3A8H B;  4A4K A;  3OB9 A;  4OF1 A;  3TRE A;  4B9X A;  3OYB A;  2LCL A;  2EWN A;  5J3B A;  3X24 B;  4B9W A;  3JB9 D;  1VQP T;  2R5A A;  2L5Q A;  3F70 A;  4NOY A;  4C8Q A;  2R5M A;  1EIF A;  5HKC A;  4FSX A;  1YHQ T;  4BE2 A;  5GAM f;  3TU4 K;  4KUD K;  2IVW A;  4XQ3 A;  2M9U A;  4D6W A;  2RK2 A;  3MO8 A;  3JCM V;  3NTH A;  3G6E A;  1VUB A;  1K73 U;  1QVF A;  4ATO A;  1YCY A;  2DZC A;  4M75 G;  2JN0 A;  2LRQ A;  4LDV A;  1YJN A;  3OYN A;  3OS5 A;  3CC4 T;  5FRN A;  2PVG B;  4XTU A;  5GAM h;  2E12 A;  1PSE A;  3GOX A;  2FYK A;  1XTD A;  3NTI A;  3JRZ A;  3V7S A;  1U1S A;  4KUI A;  3M5A A;  2MF2 A;  4FU6 A;  2MMP A;  2R58 A;  3VUB A;  1BI0 A;  3C95 A;  4XK8 E;  1VQN A;  2Y90 A;  3BDL A;  5GAN 4;  1S72 A;  3BW1 A;  3HRU A;  2XDD A;  5C0M A;  1VQ4 A;  4PLL A;  3CCV A;  1VQ6 T;  2LQK A;  2M16 A;  3ER0 A;  1UB4 A;  3FDR A;  2VUB A;  4X34 A;  5LJ5 j;  1M5Q 1;  2V8I A;  2Y4X A;  2RHZ A;  2RD1 A;  4A4E A;  4OGE A;  3OS1 A;  3DLL A;  3CCJ A;  4XU1 A;  2PUO B;  3UT1 A;  2E6N A;  4Q5W A;  3MCA B;  2RI2 A;  4HA8 A;  4EMK C;  3CME T;  1YI2 A;  4J83 A;  4FT4 A;  2QXF A;  3GNG A;  4M78 G;  4XU3 A;  5FU6 B;  3CPW A;  3AHU A;  2QA4 T;  4MZP A;  3A8L B;  3MET A;  2VYT A;  2ZPI B;  4C5H A;  3QO3 A;  4M7D D;  3CCS T;  2H3J A;  1VQM T;  5DLQ E;  3JCM f;  1BI2 A;  3CCE T;  4QVD A;  4R55 A;  5DY9 A;  3PTA A;  5LJ3 h;  3ZFJ A;  3CCQ A;  2QDY B;  4JRK A;  4C0D B;  4LDU A;  3OQ5 A;  4N4H A;  1UEB A;  3HHT B;  5I2M A;  2ZPB B;  3L2V A;  4M7A B;  4HT8 A;  5GAN 6;  1NE8 A;  3HPW A;  4EPC A;  5GMK e;  4ZN3 A;  2CZ1 B;  5LL6 S;  4F7U B;  4M7A C;  1YBY A;  3QSU A;  1FXX A;  2DJZ A;  4EMG A;  4LDX A;  1KQ2 A;  3JCM e;  4OGC A;  5HK0 A;  3EFS A;  4F7U F;  3FRN A;  3CBP A;  3QJ6 A;  3QJY A;  5GAN 5;  1FX7 A;  3JCM J;  3OYA A;  3I56 A;  2X35 A;  1X75 C;  5IAY A;  4M7A A;  2QQ9 A;  5GAN h;  1K8A U;  2RHX A;  5KE3 A;  2R57 A;  3QDR B;  4KBM B;  1VQ9 A;  2RJE A;  3GNF B;  4OVA A;  3CCR T;  3CC7 T;  3CD6 T;  1WQW A;  2I2L A;  2QQS A;  1JJ2 A;  2CYZ B;  2RB6 A;  2YHT A;  4BB7 A;  4V2S A;  2VV5 A;  1KG1 A;  4BY6 B;  2OTJ A;  2E10 A;  1Y71 A;  3RKX A;  3T9N A;  2O4X B;  3UPU A;  3FLG A;  4BY6 C;  4E7L A;  3QYH B;  4MZT A;  3SD4 A;  2DIQ A;  1VQ8 T;  3PNW C;  2FHD A;  2DPP B;  2EAY A;  1BI1 A;  2KK4 A;  3ME9 A;  4ELY C;  4IUU A;  2K5F A;  4IUQ A;  5M9O A;  1WJR A;  4FL6 A;  4MDX A;  2O4X A;  3OYE A;  1HK9 A;  4QVC A;  1VIE A;  4JLG A;  2K57 A;  2OAU A;  4ZTJ A;  1VQ7 A;  3OYM A;  3JCM d;  3EFR A;  3OBW A;  2LCC A;  1Q7Y U;  1AHJ B;  5LJ3 j;  3JB9 J;  3OBY A;  4JRQ A;  2EJ9 A;  1Q86 C;  4BI4 A;  2DIG A;  1KHI A;  3RER A;  3L42 A;  5LJ5 f;  5GAO m;  1BIB A;  4ZGE B;  4J6Y A;  1V29 B;  3J7A F;  5GAO q;  3H6Z A;  1JRI A;  2KSS A;  2QTX A;  3M4G A;  4M77 G;  3V8K A;  3NTK A;  4JS4 A;  1D3B A;  5GAM g;  3HFN A;  1VQK A;  3G6E T;  5LJ5 h;  1WPY A;  2RJF A;  1M90 U;  4M75 A;  3A8O B;  3J81 E;  3JCM Q;  5GAN j;  5CAI A;  3L2W A;  1K73 C;  2GQV A;  2LNV A;  2RI3 A;  1Y07 A;  1LJO A;  3LX7 A;  3WVE B;  4GLK A;  2ZPF B;  4OB3 B;  4C8Q B;  3RMQ A;  4MML A;  1KQS A;  2YLC A;  1G5V A;  1M1K U;  1PSF A;  4C8Q C;  3OYC A;  3CC2 A;  2FVU A;  3JB9 F;  3CCM A;  1NJI U;  1S72 T;  2EKO A;  2B8A A;  3JCM P;  4C8Q D;  1VQ4 T;  1WNL A;  4II1 A;  3CCV T;  4C5E A;  5J39 A;  4F7U E;  5D6X A;  2DTH A;  3LW5 E;  4XU0 A;  4RCB A;  1X6O A;  4C0Z A;  3CCJ T;  2P4T A;  2JUF A;  3P8D A;  3RUX A;  5KE2 A;  1I4K 1;  3S3M A;  5CQX A;  2EJG A;  5A2Q E;  3OSS C;  4FT2 A;  1UGR B;  2MWP A;  2HNI A;  4M7D B;  5GAN 8;  3X25 B;  3OS0 A;  1YI2 T;  3OA6 A;  3M54 A;  1VQL A;  3LLR A;  4M78 A;  3X26 B;  4M7D C;  3E19 A;  2V8K A;  4ZGJ B;  4J6W A;  2LVM A;  1SSF A;  3FEO A;  4MZM A;  3JCM c;  5GMK l;  4E7I A;  5GAM e;  4BUG A;  1NPP A;  2CS7 A;  4BI8 B;  1QVF S;  1M8V A;  4LDW A;  1YIT A;  5FU7 B;  3QHS A;  4ZN1 A;  4M7D A;  3CMA A;  2PQW A;  3G7Z A;  2X4W A;  2E1H A;  2K5L A;  3M56 A;  5FU7 C;  3CCQ T;  5IT9 E;  3N5B B;  3JCM g;  4RMO A;  2E65 A;  4J8O A;  3E1S A;  2OTL A;  2JZ2 A;  3RMS A;  3PFS A;  2P0Q A;  3M55 A;  4O6J A;  4FIB A;  1JB0 E;  2F5T X;  3MEW A;  2XIC A;  3JAM E;  4X9D A;  2ZPH B;  2CZ7 B;  4OB2 B;  1OZ3 A;  4C0F A;  1KD1 U;  3KXT A;  5KCO A;  3JB9 I;  1G3T A;  4JRI A;  3VYH B;  1ZHI A;  2LX9 A;  5CCA A;  2RA2 A;  3JCM b;  3L2Q A;  1H3Z A;  4C5G A;  4DA4 A;  1BYM A;  4YTL A;  1KHC A;  5LJ3 f;  2CKK A;  4J5Y A;  1K8A C;  2QI2 A;  5FU6 C;  3HL8 A;  3L1A A;  1VIF A;  4NL3 A;  1VQ5 A;  3HRT A;  1Q82 U;  3CPW S;  4GY5 A;  4A4H A;  5GAM d;  1DJ7 B;  3PGG A;  5EG2 A;  1Y96 B;  4IUT A;  3HKS A;  3V7C A;  1VQO T;  3JB9 G;  2XDB A;  3S6W A;  3QZ9 B;  5LJ3 e;  1OI1 A;  3QZ5 B;  5CR2 A;  4C0D C;  1OYX A;  3V7R A;  3OMC A;  3OYD A;  2PUK B;  5KH6 A;  2KAF A;  3RES A;  3JCM X;  4C0G A;  1HXD A;  5GAN f;  3V8J A;  2X4J A;  3QUI A;  3CPF A;  4C92 B;  4XTZ A;  2QEX A;  4FM4 B;  3ASK A;  4QQ6 A;  2KDS A;  4E7K A;  4M7A F;  2DXC A;  1RI0 A;  2E64 A;  4C8Q E;  4CRI A;  4C92 C;  1Y96 A;  3CEY A;  3OYY A;  3PIP A;  3QXE B;  1N27 A;  4M7A D;  1YJW A;  2PVO B;  4KT0 E;  1YJ9 A;  4PJO B;  5FRM A;  1Q7Y C;  4PJO C;  2DVE A;  4C92 A;  5GAN e;  3CCU A;  5GAN 3;  1Y7X A;  3LGF A;  5CQY A;  3I55 A;  3GIB A;  2EQK A;  5A0D A;  4PJO A;  2XU8 A;  2QQA A;  5LJ5 g;  4X9C A;  2XG8 D;  4PNO A;  5A0G A;  5A0L A;  4M77 A;  1JJ2 S;  2JTM A;  4O5V A;  1UGQ B;  2LT4 A;  4XAX B;  3KUF A;  3LYI A;  2QQB A;  4QW2 A;  2JOY A;  5CO7 A;  4E47 A;  1VQK T;  2DTI A;  3GF5 A;  2KVQ G;  5CKB A;  3QPH A;  2DXU A;  3PMT A;  1H64 1;  4RKU E;  5LJ3 d;  1M90 C;  2KY9 A;  2XID A;  3OYK A;  5J26 A;  4L5G A;  3ZBD A;  5KCH A;  1XNI A;  3FB9 A;  1LNX A;  1N8R U;  4ZGD B;  2VC8 A;  4OB0 B;  2DTO A;  3ZEH A;  1XOV A;  2LDM A;  3LGL A;  2ZZD A;  4N4G A;  1I5L A;  1M1K C;  2ZPG B;  4J7I A;  4XTY A;  3X28 B;  2A7Y A;  2E70 A;  3CXC A;  5HY6 A;  4BI3 A;  3M57 A;  3CCE A;  1VQM A;  2RHY A;  3CCM T;  1BI3 A;  3OW2 A;  1D3B B;  1NJI C;  1B34 B;  3C94 A;  3P8H A;  4XTV A;  4M75 B;  3GLX A;  4LDY A;  2ZPE B;  1K9M U;  5GAN d;  3OMG A;  4M75 C;  5CKD A;  3CCL A;  2LT1 A;  4P5N A;  1G3W A;  1W2B A;  3OYI A;  1QVG A;  4JS5 A;  2WSE E;  1M9S A;  2DO3 A;  4M75 D;  3INZ A;  4RG8 A;  3OS2 A;  1B34 A;  1N9R A;  2QQR A;  4EDU A;  4A53 A;  3OSV A;  3VJP A;  1VQL T;  4BD3 A;  1WJS A;  2G3R A;  4OMF B;  5L8R E;  5LJ5 e;  1YJN T;  2DD4 A;  4BDY A;  4A54 A;  3HFO A;  4WF2 A;  3R6O A;  4M7A G;  1GXI E;  2XKO C;  2ZGW A;  4JLI A;  5C6S A;  1Q81 U;  3CC7 A;  3CCR A;  2KMT A;  4F7U G;  1G3Y A;  5GMK i;  5GMK j;  1BKB A;  4QQG A;  1OZ2 A;  2HBP A;  3EAE A;  4C8Q F;  2HD0 A;  4DQ2 A;  1YIT T;  3CC4 A;  2JTF A;  1VQN T;  3S3O A;  3M9Q A;  4TVR A;  3SFM A;  4DOW A;  1KQS S;  1X01 A;  3QYG B;  4M7A E;  3FIF A;  2OTL T;  3WXM B;  4Y91 A;  2L3R A;  2ZCF B;  4MDW A;  4M78 B;  2EQJ A;  2LC4 A;  2EQU A;  3JB9 H;  2GFA A;  5AYF A;  4M78 C;  4EMH A;  1YIJ A;  2D9T A;  4HCC A;  2HQE A;  2EIF A;  4Y28 E;  3PT9 A;  3VU3 C;  2XK0 A;  1KD1 C;  3A5Z B;  4M78 D;  4IKF A;  2XDP A;  2RHI A;  3VYG A;  4HCB A;  2X4Y A;  4C5I A;  4M7D F;  4HCZ A;  4IUV A;  1I8F A;  2XI9 A;  3Q1J A;  2NLU A;  5D6W A;  3MP6 A;  2EYQ A;  3DKM A;  3SDZ A;  5LJ3 g;  5LJ5 d;  1ZQ1 A;  5GAN 7;  2FB7 A;  3OYF A;  1MHN A;  4ME7 A;  3G4S A;  3VUZ A;  1W4S A;  5GAN 2;  2RJC A;  3JCM W;  1WQ7 A;  4OB1 B;  2LQ8 A;  1Q82 C;  5DLO A;  3MP8 A;  4QVZ A;  3G71 A;  4HT9 A;  3NFC A;  4PL6 A;  3WVD B;  3OYJ A;  2DZ9 A;  2F5K A;  1U1T A;  2D0Q B;  3P8B B;  3RKW A;  4JDS A;  1KC8 U;  3QKJ A;  2QEX T;  3OY9 A;  3GP8 A;  2GF7 A;  4VUB A;  4OP0 A;  1N6A A;  2WSF E;  4IUR A;  5CKE A;  2RI5 A;  5CKF A;  5GAN g;  1FWZ A;  3UDC A;  1YJW T;  3I56 T;  1YJ9 T;  3QG1 A;  3M58 A;  2CZ6 B;  2RH2 A;  1JBM A;  2DK3 A;  2XHC A;  3PMI A;  3QII A;  1VQ9 T;  1MGQ A;  2EQM A;  3E9F A;  4CI0 C;  4M75 E;  5CKH A;  3HSB A;  3CCU T;  3OYL A;  3VV0 A;  2RHU A;  3L2U A;  2BUD A;  1UGP B;  2GCX A;  1VQP A;  2O01 E;  2K4Y A;  3DLM A;  2K3Y A;  3MEV A;  3I55 T;  3HP9 A;  4XU2 A;  2E41 A;  2OTJ T;  4XTX A;  2RK1 A;  4A4G A;  1O9S A;  4C8Q G;  4NS5 A;  1UGS B;  1QP3 A;  1YHQ A;  4R56 A;  2D6F A;  1KQ1 A;  2V8J A;  3HRS A;  3BY7 A;  4EMK B;  2L89 A;  2X4X A;  2CZ0 B;  4LD6 A;  5DM7 R;  2MAM A;  1M1G A;  4KUL A;  1NZ9 A;  2L8D A;  2BIV A;  3LWI A;  3TEE A;  3MEA A;  1IRE B;  4C92 F;  4ZTF A;  1N9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...