1UJYA

Solution structure of sh3 domain in rac/cdc42 guanine nucleotide exchange factor(gef) 6
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
GSSGSSGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of SH3 domain in Rac/Cdc42 guanine nucleotide exchange factor(GEF) 6
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 6
total genus 7
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ujyA00
2NUZA 4OMOA 2EPDA 1K76A 1MUZA 3NHNA 1E6GA 4LNPA 1M8MA 1X43A 5IHKA 3VS6A 2CDTA 2EQIA 1WFWA 2KRNA 5IH2A 3GBQA 2FPDA 1OEBA 1X6BA 2A37A 3M0PA 2PZ1A 3H41A 1X69A 1EFNA 1RLPC 1WI7A 2EYXA 5FWBA 2VKNA 3VS2A 4EIKA 4JJDA 4LUDA 1UJ0A 2CUDA 1M3BA 2KEAA 3TSWA 4D8DA 1WXTA 1YCSB 2RPNA 3EG1A 1T3SA 2FG0A 1VYUA 1TUCA 3ZL7C 2XMFA 1YWOA 1NLOC 2C0OA 2DBKA 2KXDA 2YT6A 2HBWA 1I0CA 1QWEA 1X2KA 4RUGA 1UECA 2DL5A 1U5SA 1H8KA 5GJWB 2FPEA 3EG0A 2DJQA 2P4RA 2BZXA 1I1JA 1WLPB 5HCKA 2L3QA 3EG3A 2KXCA 3REBB 4Z8AA 2OAWA 1KJWA 1UUEA 1ZBJA 4DEYA 2JMAA 3H0IA 1JXOA 4OMNA 4AG1C 1J3TA 3I5RA 4AFSC 1WDXA 1TUDA 1NEBA 4RTUA 2JS2A 4WCIA 2ESWA 4LE9A 1YP5A 2AKLA 2LX7A 4AG2C 2MOXA 1UE9A 2H8HA 2A36A 3VS7A 1NG2A 1SHGA 3KFVA 2ECZA 2LJ3A 2MIOA 2F2XA 1K0SA 2EYYA 2KNBB 1E6HA 2K3BA 3R6NA 2DE0X 2JS0A 2YDLA 4DEXA 1UHFA 2JM8A 2K7AA 1QLYA 2J7IA 3U23A 4RTYA 1QCFA 4J9BA 2ED1A 1CKAA 1ZUUA 1X6GA 3VS1A 2B86A 1WA7A 1LCKA 4GBQA 2RMOA 1RI9A 1HD3A 2F2WA 2YUOA 2YSQA 1T0HA 1T3LA 2DMOA 1JU5C 1U06A 2ABLA 5FWCA 1XOVA 4ESRA 2EVRA 4J9EA 3VS3A 2YUQA 4LN2A 3PE0A 3VRZA 2GBQA 1GL5A 2KBTA 2GGRA 5L23A 1UDLA 2AZVA 2KE9A 2KROA 4Z89A 2ED0A 5GJVB 2LNHB 1MV0B 1T0JA 2O2OA 1WXUA 1SPKA 2FRWA 4E6RA 4CC4B 4OMPA 1NM7A 2IIMA 1AOJA 2DYBA 2PNIA 1QKWA 1SEMA 1OV3A 2LMJA 1OPKA 1PKSA 1G83A 4F17A 2DBMA 3RBBB 2EBPA 2J6FA 2DLPA 4JZ4A 1OPLA 1HJDA 4F14A 1GFCA 2DA9A 2DF6A 4HVWA 4ORZA 4ZNXA 1M3AA 2LQWA 3VS4A 1AWXA 4HVVA 4R0KA 1PNJA 1SRLA 1YWPA 1Y57A 2DNUA 1FYNA 2D8JA 2E5KA 4HCKA 2HDAA 4AFUC 1B3QA 2CREA 1U3OA 2EYZA 2A08A 2QDLA 1JEGA 1B07A 1E7OA 2DM1A 5IHIA 1AD5A 2RF0A 1VYTA 2FPFA 2FRYA 2LCSA 2GTOA 2K2MA 1ZUYA 1K4US 1CKBA 2SRCA 2A28A 1WX6A 2DL8A 2M0YA 1OOTA 2FEIA 1PRLC 2DL3A 2CH4A 1UJYA 2ROLA 2L0AA 4RTVA 1VA7A 1IO6A 1KIKA 2JM9A 2K6DA 2AK5A 2LJ0A 2DILA 2AZSA 4JZ3A 4GLMA 3RNJA 1NYGA 2KRSA 1FMKA 1PKTA 1PWTA 2CT4A 1UG1A 2RQUA 3M0RA 3VS5A 4OMMA 4IIMA 1AWWA 1GBRA 1ZUKA 3EHRA 3THKA 1ARKA 2RQRA 1GCQC 2J6KA 1H92A 2LQNA 1RLQC 4RTWA 2K9GA 4QT7A 4RTZA 2NWMA 3ULRB 2GNCA 2KR3A 5I11A 2G6FX 2RQVA 2VVKA 3I35A 1N5ZA 1JO8A 5IHNA 2RQWA 2FO0A 3QWYA 2GTJA 2CSQA 1ABQA 2KT8A 1QWFA 2EGCA 4HXJA 3M0SA 1GFDA 2LJ1A 2GQIA 4LUEA 4D8KA 1UHCA 4X1VA 2CH4W 4J9FA 2D8HA 4A63B 3UA7A 3UA6A 1JQQA 2L2PA 2LZ6B 4AFZC 2C0TA 2JT4A 3I5SA 1UFFA 2DL7A 3IQLA 4F16A 2D1XA 4Y92A 1VYVA 1PHTA 2AKKA 3EGUA 3M0UA 2X3WD 4JJCA 1Y0MA 2DX1A 1M3CA 5FW9A 1GBQA 3TVTA 2O9SA 2W10A 5I22A 2CSIA 2CUBA 2EGEA 1UGVA 1W70A 1K0XA 3C0CA 1KSWA 2M51A 2BTTA 1H3HA 3H0HA 2JW4A 1HSQA 1X2QA 2V1QA 2SEMA 1ZSGA 3EG2A 1ABOA 1AVZC 1WXBA 5IXFA 5ECAA 2JTEA 3SEMA 3VS0A 4M4ZA 2O9VA 2RNAA 3I9QA 1W1FA 4KRTA 1ZLMA 2L3SA 1AWJA 1WYXA 1A0NB 3VRYA 1NEGA 1UTIA 4HVUA 2DL4A 1BBZA 2KT1A 1M27C 4J9IA 1M30A 1AWOA 3JV3A 2ENMA 3FJ5A 3M0QA 1BK2A 1SRMA 3REAB 3SHWA 1K9AA 2BZ8A 1JXMA 3TSZA 2J06A 2HCKA 4RTTA 2KYMA 2ROTA 3CQTA 1GCPA 1MV3A 1W6XA 1BU1A 2EGAA 2KGTA 1PRMC 2KRMA 2DRKA 2W0ZA 2YUNA 1X27A 4CC7A 4J9HA 2JMCA 3LH5A 4CC2A 4K11A 4FSSA 4J9CA 4OMQA 1TG0A 1GRIA 2C0IA 2EKHA 2CT3A 2EW3A 2YUPA 1G2BA 1S1NA 2MCNA 3UF4A 2KYBA 3A98A 4CC3A 2HSPA 2BZYA 2VWFA 4AFQC 1Z9ZA 5EC7A 1CSKA 4RTXA 2LP5A 3PVLA 1AZEA 2RQTA 1NYFA 1AZGB 3QWXX 4J9GA 1YNZA 2X3XD 3NMZC 1ZX6A 2I0NA 3NGPA 2DVJA 2O31A 3O5ZA 4IIOA 2JXBA 2V1RA 1K1ZA 3UATA 4J9DA 1AEYA 3NPFA 2J6OA 1QKXA 2DRMA 2O88A 2EYWA 5IXBA 1WIEA 1YN8A 2RN8A 1NLPC 3EHQA 2OJ2A 3PVQA 4JJBA 2L3PA 2PTKA 2K79A 1SHFA 2HEQA 1Z9QA 2OI3A 1V1CA 3M0TA 1GCQA 2D0NA 4JPBW 4Z88A 2F2VA 1RUWA 1BB9A 3H0FA 1KFZA 4OMLA 1I07A 2J05A 1SSHA
chains in the Genus database with same CATH superfamily
2NUZA 1OQKA 4N4HA 1K76A 1WZOA 1E6GA 1M8MA 1ZHIA 1M90C 2EQIA 4PJJA 4IUTA 4F7UG 1YJ9A 2Y90A 2LTOA 3GBQA 1OEBA 4C92A 2F69A 2A37A 1TOVA 2X35A 1VQ7A 1O75A 1TXQA 4KGVB 1VQ6Q 2YHTA 4PL6A 2MAMA 4FYXB 3TEEA 3OW2A 1G8XA 3M59A 1XJWB 5FWBA 4XTXA 3VS2A 4JJDA 4QQDA 1I81A 3L2UA 1VQOQ 2CP3A 1WXTA 1YCSB 1K73C 2RPNA 3CCJA 3CCJT 2QEXQ 2XMFA 3CMAT 3BDUA 1LNXA 4E7LA 1QVGS 2GF7A 4IUQA 1I0CA 1X2KA 4M78A 4RUGA 1Q95G 4EPCA 1U5SA 4M77F 1UGPB 3EG0A 2H3JA 2RHIA 3GPLA 4FIBA 3QBYA 2BZXA 3CEYA 2HMAA 3EG3A 2OAWA 2JTFA 3G4SQ 1JJ2A 3CPWP 1HXDA 2B8AA 4R56A 3OYCA 1JXOA 4N4GA 4AFSC 2KI7A 2DJZA 1WDXA 1KK7A 2DIGA 2F5KA 2HL3A 1EIFA 2ESWA 1Q7YC 2DD4A 3JB9F 2JJ9A 2LX7A 2X4YA 4AG2C 2H8HA 4PLIA 2A36A 3VS7A 4C5IA 1Q82R 4RCBA 2LJ3A 4M75G 3FIFA 4JRPA 3CPFA 4C0ZA 2YDLA 1ZSZB 1QP2A 3CCVA 4PJMA 1OX8A 2OTLQ 1KD1R 1ZQ1A 1VQKQ 1WHMA 3HFOA 5A2QE 1QCFA 1M1GA 3HL8A 2ED1A 1CKAA 2DK3A 2HL5C 1KD1U 2DEUA 3X20B 5D7UA 3RUXA 3VS1A 3CC7T 1WA7A 3QKJA 2YUOA 4F7UA 2DMOA 2ABLA 4M7DD 4XK8E 3CCST 3H9NA 3S3MA 4BI4A 2QQ9A 1I4K1 1GL5A 5D6WA 2AZVA 2KE9A 3CCEA 3RMQA 1T0JA 1BI3A 2O2OA 5GANh 5GAMj 4CC4B 4OMPA 2IIMA 1FX7A 3A8HB 1YITT 3QZ9B 1PKSA 5CK9A 4ZTFA 2Z0WA 3OYHA 2LCLA 3JCMQ 2EBPA 1RL2A 1R0CB 1OPLA 4FCYA 1IXDA 3JB9D 4HVWA 4QVCA 2CZ6B 3OA6A 2EWNA 1SRLA 4M75C 3CCRA 3CCJQ 2EIFA 2DTHA 2E5KA 4AFUC 5CKFA 3D7SB 2JNGA 3LYIA 1NZ9A 1VUBA 4OMFB 1E7OA 2A3LA 2L89A 2CP5A 5KE3A 1AD5A 3META 2QYZA 1VQ6A 2RF0A 2FPFA 3JSCA 2E65A 2XD0A 4BB7A 2RJDA 2A28A 1YHQA 1SG5A 1OULA 2FEIA 1PRLC 3J7AF 1UGSB 2ROLA 2QASA 3MKDA 2L0AA 3VYGA 2FL7A 4M7AD 1IO6A 3CC7Q 2CKKA 3X26B 1VQ9Q 2DEQA 2QTXA 2K6DA 3CC4A 1Q82C 1TWBA 1WHHA 2HKQB 5LJ3j 2K3XA 3JB9J 3RNJA 1NYGA 4WTOB 2CT4A 2D9TA 2XI9A 8ATCB 2LNVA 2PVOB 4L6V5 1AWWA 3QYGB 3VKIA 4J5YA 3L2QA 4A4FA 1LJOA 3THKA 3EGDA 2J6KA 4IUVA 2LQNA 1MNDA 4E47A 3TREA 4RTZA 2VGNA 2G6FX 4OB3B 2KY9A 4NS5A 1JO8A 5FRNA 2FZCB 3CCMQ 2L5QA 2FO0A 3QWYA 4D6WA 4J6WA 5A0DA 4PJLA 1GFDA 1R0BG 2LJ1A 3JRZA 5GANj 4LUEA 4D8KA 1BIBA 4E7SA 1UHCA 1KQ1A 2CH4W 2JZ2A 1YITQ 3CC4T 4J9FA 2RK1A 4A63B 3UA7A 3KXTA 3UA6A 2FHDA 1JQQA 5FU7C 2R5AA 3S3NA 2F1LA 1NE8A 3EGXA 2RHUA 2JT4A 1UFFA 4NL2A 1YHQT 4J6YA 3V8KA 1OU9A 1ZSZC 2DX1A 1N8RR 2LVMA 3GNGA 5FW9A 3JCMV 1IHWA 5IAYA 2DXBA 2CSIA 1VQ5Q 4LDYA 1UGVA 2YRDA 5GAN6 3FC3A 4BUGA 4BY6C 1H3HA 3H0HA 2HSEB 5KYYA 3EFOB 1HSQA 1X2QA 4FW1A 2SEMA 4JRIA 3SDZA 2QEXT 4C8QF 1RAAB 3L2WA 5IXFA 4N0AC 4OB1B 5ECAA 1V76A 4C92C 2MF2A 3SEMA 3VS0A 3CD6A 2DERA 1C1AA 1W1FA 1VQ9T 3OW2S 2PUOB 3EAEA 4M7AC 3JCMg 4E7ZA 4B6MA 2LDMA 4C5EA 2DL4A 4XTUA 4PJNA 1RABB 1BBZA 2KT1A 1M27C 1BCMA 2QQRA 3PMIA 3JV3A 3EFSA 1BI1A 1YITA 4A4KA 5GMKj 1BK2A 2X4XA 5GAN7 1JXMA 4M77G 2J06A 2P0QA 1YI2Q 3CQTA 1GCPA 1MV3A 1Y07A 2WSEE 1BU1A 2KRMA 1Y96A 3L2ZA 2K5IA 3CPWA 4CC7A 2CZ0B 2KDSA 5FU6C 4C8QE 4BE2A 3MEWA 4ANJA 3URGA 1VQNQ 4M7DC 4M75D 5GANg 1TG0A 2C0IA 4FYVB 3PT9A 2CP2A 2JVVA 2MCNA 3A98A 5DLQE 3KUFA 3SFMA 2RB6A 1CSKA 2X9HA 1WHLA 3MCAB 4J9GA 2MWOA 1YNZA 5C0MA 2OTJQ 1RAFB 1IRXA 1TSFA 2FB7A 1W2BS 2JXBA 1Q7YU 4QW2A 3MEVA 5GAMe 5D6YA 5CR2A 3JB9H 3M56A 5IXBA 2COWA 3JCMc 2FYKA 2RI5A 2L8DA 4RMOA 2OTLA 1VQNA 2KSSA 3PVQA 1KC8R 2K79A 2M02A 2HEQA 3CXCA 3UWNA 1NPPA 3LW5E 2F2VA 4MMLA 2VASA 1I07A 1WQWA 3NHNA 2RD1A 3MP8A 4LNPA 3OYFA 1MMAA 1LOJA 1B7TA 3VS6A 1VQ4T 2K2VA 2PVDB 2FPDA 2KMTA 4HCCA 1X6BA 2E10A 1YJWT 3J81E 4R55A 2WACA 1N8RU 4JDSA 3RERA 4EMKA 1WI7A 1R77A 2EYXA 2VKNA 1NJIU 4PFPA 4HA8A 4LUDA 4A4GA 2CUDA 3BFMA 2GFUA 1D1BA 1OZ2A 1N9RA 3INZA 1TUCA 3ZL7C 1G3YA 3LLRA 1NLOC 2C0OA 2KXDA 4XU3A 5KCOA 4NL3A 3OS2A 5GAN8 2DVEA 1VQ8A 4DBQA 4FL6A 1QWEA 2Y4XA 5GMKm 2DL5A 1KD1C 5GJWB 5KYXA 2DJQA 2P4RA 5FLXE 5HCKA 3CCQA 1YJ9T 3BDLA 1ACMB 1K8AR 3P8DA 2JMAA 3H0IA 5GAMf 4OMNA 4MZMA 3I5RA 3L2RA 3HSBA 3CCSQ 1NEBA 2P0KA 3HP9A 1N6AA 3CXCS 1WHGA 1NG2A 2NUPB 3E9FA 3GF5A 1DJ7B 2RH2A 4JS4A 2ECZA 2F2XA 2EYYA 1E6HA 3JCMb 3R6NA 2DE0X 2CP0A 4LDWA 4B9XA 1VOMA 5CQYA 4DEXA 1UHFA 1QVFS 2NLUA 2K7AA 3QUIA 1Q82U 2KVQG 2J7IA 3U23A 3AHUA 1PSFA 1X6GA 4M7AB 2NUTA 1EZZB 1M90R 2RMOA 3JCMf 1HD3A 1U1TA 2F2WA 2YSQA 1T3LA 3C4SA 4C92F 1TTHB 3SWNB 1KC8C 2EVRA 5AYFA 3C94A 5GAOl 1K73U 3VS3A 2YUQA 4PJOB 3GP8A 2V8JA 3PE0A 4HT8A 5L23A 1OZ3A 2HNIA 5GJVB 1KQSS 2LNHB 3CCQT 3G6EA 3OMCA 5GANd 2YLCA 5KYNA 4C8QG 5J39A 1Q86C 4FM4B 3JCMW 3MP1A 1Q81C 1PC0A 4M7AG 1YFNA 2XIDA 2PNIA 4M75A 3JB9G 1BYMA 1H641 5DY9A 2E41A 4HKEA 2GFAA 5GAN4 1HJDA 1WJQA 3MO8A 1GFCA 2DF6A 2DXTA 4ORZA 3G4ST 1Y96B 1XQHA 2LQWA 4KH1B 5J3BA 2RO0A 4R0KA 1Y57A 2D8JA 5LJ3e 2E3IA 5LJ3f 1Q7YR 2EYZA 2QDLA 3QG1A 1JEGA 2DM1A 2A7YA 1UB4A 5L8RE 3OSSC 5LJ5g 1QCNA 1VYTA 2MYSA 3CMAA 2GTOA 1K4US 5DM7R 2VV5A 2M0YA 1IZ6A 2CH4A 1UJYA 3DLMA 4J7IA 4C0GA 4RTVA 4KUDK 1M2VB 2K3YA 5CKEA 1KIKA 2AK5A 3X28B 3EGXB 2XHCA 2NYSA 1M1KC 2AZSA 4GLMA 2QQSA 4WF2A 4E7IA 1PKTA 1PWTA 3GOXA 4OF1A 1RAHB 3CCLQ 3HRUA 1QW1A 2LCCA 5CKHA 3BY7A 1ZUKA 3EHRA 1QVGA 4F7UF 2QGGA 1GCQC 1ARKA 3EG9A 2K9GA 3JCMe 4PKCC 4QT7A 3ULRB 2KR3A 2VVKA 3I35A 1N5ZA 5IHNA 3P8BB 2GTJA 2CSQA 6AT1B 4HXJA 2EGCA 4F04B 2RK2A 4BDYA 2GQIA 1W2BP 4BE0A 4C8QB 1KC8U 5I2SA 3M55A 5GAN3 4X1VA 5GAN5 5LJ3d 2D8HA 2RI2A 2L2PA 3LX7A 3QZ5B 4C0DC 4XTZA 4DOWA 2DL7A 4M78C 3CCQQ 5I2MA 3CC4Q 4Y92A 4ZTJA 3PIPA 1PHTA 3NTKA 3G6ET 2OX7A 3EGUA 4EDUA 5LJ5j 1YI2T 4UC4A 5CKDA 2V26A 2BE9B 3QHSA 3TVTA 2GQVA 3CPWS 2W10A 5I22A 2NUTB 1S72Q 1M1FA 5CIUA 3QPHA 5GANe 2QEXA 4A53A 1SSFA 1AVZC 1WXBA 3MHXA 2EFIA 1D1AA 2E5QA 4C92E 3CD6Q 3BE3A 4O5VA 1WYXA 1NEGA 4HVUA 5IT9E 4RKUE 3CCUA 1M30A 5GMKe 3VJPA 1AWOA 3HRTA 1YBYA 1SRMA 3SHWA 3RKXA 1WPYA 1K9AA 4J83A 1WJRA 2E3HA 1D3BB 2KYMA 3RR6A 3CMET 1W6XA 9ATCB 5GMKh 2LT1A 2KGTA 3I56T 1WHJA 2YUNA 3VUBA 2I2LA 3NTHA 5GMKl 2AIRB 4XTVA 2JMCA 3LH5A 3QIIA 3SWNA 4K11A 1ZA2B 3SB2A 2XDPA 2ATCB 4BE1A 2EW3A 2YUPA 4QVZA 1G2BA 2A0FB 2RJEA 4BY6B 2PVGB 1JB0E 2VWFA 4AFQC 4JS5A 1VQMA 2LP5A 2QK0A 3PVLA 2DAQA 2PU9B 1NJIR 1AZEA 2JN0A 5HK3A 2X3XD 1VQ8T 2I0NA 2CGHA 2E4HA 3FDRA 2D6FA 1HK9A 3EH1A 4PNOA 1QVFA 4MMKA 1TH7A 3UATA 3RIRA 1AEYA 2J6OA 2VC8A 3CMEA 2F5TX 1NPRA 2EYWA 2NUPA 2RM4A 2RN8A 1NLPC 4MDWA 5AT1B 3SD4A 2PTKA 3L2VA 4C5GA 4C8QC 5LJ5f 1EX4A 1XNIA 1Z9QA 4MZTA 3H6ZA 1FMWA 1GCQA 5D6XA 3A5ZB 3JCMd 2H3EB 1MHNA 1OI1A 2EQJA 1BB9A 1F1BB 3WXMB 2XDBA 2ZPEB 4X9DA 4OP0A 2EPDA 1M90U 3FLGA 1MUZA 2KRNA 1FXXA 4IKFA 4KUIA 4PLLA 3M0PA 4PJOC 2M0OA 1PM3A 4LXCA 1YJWQ 3P8HA 3L42A 5KYXB 1QVPA 1M3BA 2KEAA 3NFCA 1QP3A 1YI2A 1TUGB 5CO7A 4P5NA 1T3SA 2FG0A 4DBHA 1VYUA 4XAXB 4VUBA 2YT6A 4PFZA 2XKOC 2CYZB 2HBWA 4ZN1A 1MMDA 1C6VX 4LD9K 1UECA 1H8KA 2DKGA 2R5MA 5A0LA 3L1AA 4GY5A 3LH0A 2JOYA 1I1JA 4DQ2A 1WLPB 2L3QA 3ZBDA 3I55T 1OX9A 2KXCA 1G5VA 2LQ8A 3E19A 1ZBJA 4DEYA 4M77D 5LL6S 1J3TA 2MI6A 2DPPB 2DXUA 1TUDA 3I56Q 1JJ2P 4RTUA 1YJ9Q 4WCIA 3CMEQ 1K8AU 1UGRB 3ZFJA 2DXCA 2HQHA 3CCMA 3H8ZA 3CCMT 2HD0A 1PG5B 1VIEA 3OQ5A 3M57A 2KNBB 3OB9A 1W4SA 3VUZA 1WGSA 2JS0A 3QSUA 1WNLA 3QDRB 2Y4YA 3HPWA 2JM8A 2DYIA 3CCVT 2KQWA 1QLYA 2IVWA 4PJOD 5KYWB 3OYEA 1BCOA 1G3TA 5CCAA 2OTLT 1ZUUA 1D0ZA 3FJPA 2B86A 4XU0A 8AT1B 1LCKA 4GBQA 3V7CA 3LWIA 2KK4A 1I8FA 4M77A 1IB8A 3G7ZA 4JLGA 2QA4Q 1U06A 4M78F 1XOVA 5GAOq 2E70A 1YJNQ 4J9EA 3Q1JA 1YCYA 2O01E 4LN2A 2K5LA 3VRZA 1D09B 2KBTA 2GGRA 4LD6A 1UDLA 4Z89A 2KROA 2ZPHB 1NBEB 5GAMh 1YHQQ 1MV0B 2MMPA 3I56A 4PJOE 2E1HA 2EKOA 2M9UA 1NM7A 2HAXA 2DYBA 7AT1B 3G4SA 1SEMA 4FSXA 5KE2A 1OV3A 2LMJA 1OPKA 1KQSP 3OY9A 2DBMA 1N27A 2DLPA 2EJGA 2IPOB 3HFNA 4JZ4A 4EMHA 3CBPA 3PTAA 2P4TA 2DA9A 4OVAA 1VQ7Q 1QQJA 3VS4A 1M1KR 1AWXA 5GANf 1PNJA 4ELZC 1VQ8Q 1KQ2A 1YWPA 2FVUA 2DZ9A 3QDFA 1FYNA 3OMGA 3WVEB 4HCKA 2AT1B 2HDAA 3TQ7P 1ZBXA 1U3OA 1SKUB 1AT1B 3KBGA 1M4ZA 3EH2A 4C92G 4JRQA 1B07A 5IHIA 2QI2A 4V2SA 4J7FA 1Q81U 3VYHB 2LCSA 2C06A 5CKBA 1CKBA 2EJFA 5GAN2 5DLOA 1OOTA 4QVDA 3G1JA 4IUPA 3G71A 2WSFE 1W2BA 2DO3A 3S3OA 3OS0A 2QA4T 2LJ0A 2DILA 3RMSA 1JJ2S 2KRSA 3M58A 3GNFB 1X6OA 1UG1A 3M0RA 4O6JA 3VS5A 4IIMA 1GBRA 3G6EQ 2P0PA 5KYYB 1VQKA 2O4XA 1PD1A 4E7KA 4XTYA 3CCEQ 1RLQC 1RAEB 4RTWA 5GAMg 3CCVQ 5LJ5e 2GNCA 5I11A 2PUKB 1S72T 4HT9A 2X51A 1KHCA 1YIJT 4ZN3A 5CQXA 4XTWA 4F7UB 2HQEA 2KT8A 1PD0A 1QWFA 3M0SA 1MMNA 2EQKA 3OS5A 3TU4K 1WQ7A 3OYAA 5FRMA 2XU8A 2QXFA 1PCXA 4AFZC 5HK0A 2CZ1B 5GAOm 3UDCA 3OYJA 5C6SA 2L3RA 3IQLA 3A8MB 4BD3A 4F16A 1JBMA 1K8AC 4KBMB 1VYVA 3C12A 1OU8A 3M0UA 4JJCA 4XQ3A 1Y0MA 4C8QD 1M3CA 4FT4A 3G71Q 3UT1A 2V8KA 1GBQA 3SWNC 4BI3A 3MJXA 2VB6A 1VQLQ 2O9SA 2XK0A 2COZA 1QMCA 2CUBA 2EGEA 5GAOp 3JCMP 3CCSA 3C0CA 1KSWA 1YIJQ 2RHZA 3AT1B 4KULA 4PJOA 3DB3A 4DBFA 3CBOA 2DZCA 3EFOA 1VQKT 4M4ZA 3GLXA 2O9VA 2QGFB 2RNAA 2ZZDA 1ZLMA 4M7DF 2VYTA 1M5Q1 1A0NB 4HCBA 3VRYA 2VUBA 4Q5WA 3FRNA 4QQGA 4J9IA 1MGQA 5LJ5d 3FJ5A 2FZGB 2MK5A 3V8LA 4DOVA 4L5GA 4PK4A 1VQ5A 4RCCA 4C8QA 1G3SA 3TSZA 3OYNA 4RTTA 2ROTA 4ATOA 1R8OB 2O4XB 1D0XA 1PRMC 2W0ZA 1Y71A 2DTOA 4EMKB 1K9MU 3HRSA 2HQXA 4OB0B 3DB4A 4J9HA 2YRCA 3PNWC 4YTLA 2R58A 2IG0A 1ZSZA 4OMQA 1FWZA 1GRIA 3UPUA 4ELYC 4X34A 4JUVA 1S1NA 4L59A 4NOYA 3UF4A 4CC3A 3OS1A 2HSPA 2BZYA 1Z9ZA 4N4IA 3RKYA 4BACA 2JTMA 1YJNA 3QWXX 1X75C 2D0QB 2EQMA 1HYOA 2DVJA 3PMTA 3CC2Q 3O5ZA 4IIOA 4C92D 3S6WA 1M9SA 2E6NA 1K1ZA 3OYLA 1PSEA 3N5BB 2E64A 3A8GB 4FT2A 2DRMA 2EAYA 2O88A 2QQBA 1WIEA 2BKDN 2CP6A 3JB9I 3CCLA 2ZPGB 4JJBA 2FZKB 4FW2A 1V29B 4Y91A 2X4JA 3JCMh 3PIOA 2YWWA 1SHFA 2OI3A 3M0TA 4J6XA 4E2FB 2D0NA 4Z88A 4OB2B 3NTIA 1RUWA 3CXCP 4X9CA 3H0FA 1KFZA 5LJ3g 4OMLA 3CC7A 2JUFA 3M9QA 1LPLA 2J05A 1SSHA 2DIQA 4OMOA 1VQ9A 1SF9A 3A1PA 1VQPA 1RAGB 1X43A 5IHKA 2CDTA 1WFWA 5HKCA 2EJ9A 2HKNA 2QG9B 5IH2A 3LWHA 2PZ1A 3CCUQ 3H41A 3OSVA 4ME7A 3VV0A 3PFSA 1X69A 1EFNA 1RLPC 3V7RA 3GIBA 3ER0A 1D0YA 4EIKA 3ASKA 4MZPA 2QTVA 1LVKA 3T9NA 1UJ0A 1M8VA 3TSWA 4D8DA 4RG2A 3EG1A 4PFOA 3CCRQ 1U1SA 1YWOA 1TU0B 4PJOG 5CAIA 2YRVA 4KGXB 2DBKA 4QQ6A 3QJ6A 3JCMJ 1VIFA 2WSCE 2DTIA 4OGEA 3LGFA 2FPEA 2CS7A 2EYQA 1VQLA 3X25B 3ZEHA 4II1A 1FMVA 4J8OA 1UEBA 4M78G 2COYA 3CCLT 3REBB 4Z8AA 2X4WA 4M75E 4LDUA 1KJWA 1UUEA 1RI0A 3M4GA 4AG1C 3J80E 1K9MC 3I55A 3BW1A 2JS2A 4LE9A 1YP5A 2AKLA 3WVDB 1VQ7T 2MOXA 1UE9A 5KYWA 3QXEB 3HKSA 5GAOr 2BUDA 2LC4A 3OYBA 5J26A 1UGQB 1SHGA 3RESA 2MPXC 3KFVA 1K73R 3OYMA 2MIOA 1K0SA 4IUUA 1O9SA 4FYWB 2K3BA 2ZPIB 1BIAA 1Q86R 1VQ4Q 2EQUA 4M7DB 1IGQA 2ZAEA 4M78B 2M1HA 4CI0C 4RTYA 4A4HA 4J9BA 3CD6T 4ZGEB 4F7UE 5FROA 3ME9A 3HHTB 2R57A 3QO3A 3OYKA 2QDYB 1RI9A 1T0HA 5KYUB 1JU5C 3RKWA 5FWCA 4E7JA 4ESRA 5I21A 5HY6A 1RACB 1VQ5T 4A54A 2LQKA 1B34A 1WHKA 2GBQA 1RADB 3EG9B 1IHVA 3O8VA 4GLKA 4M7DG 2CP7A 2ED0A 2YLBA 4M77E 2G3RA 2DFUA 2P84A 4B9WA 1WXUA 1SPKA 1GXIE 2FRWA 1VQLT 4E6RA 3HTRA 3A8OB 1AOJA 3MP6A 4ZGDB 3M4YA 1QKWA 2QQAA 1BI0A 1KHIA 1QCOA 5FU6B 1G83A 4F17A 3C95A 3RBBB 1YJWA 2RA2A 2J6FA 4KGZB 5KCHA 4F14A 1I5OB 4Z02A 4ZNXA 1M3AA 3V8JA 4M77B 3CC2T 4HVVA 2QAZA 4TVRA 2BIVA 2OTJT 2DNUA 1ZA1B 1B3QA 2CREA 1K9MR 5KH6A 2XICA 2PQWA 4XU1A 2BE7D 3FB9A 3CCET 2A08A 5KYUA 2E6ZA 1VQNT 4HCZA 3DKMA 4C0FA 2RJFA 1VQPT 1H3ZA 1X01A 2FRYA 1B34B 1S72A 2K2MA 1ZUYA 2HBPA 2SRCA 3E1SA 1WX6A 2DL8A 3PGGA 2DL3A 2RI3A 4M77C 4EMKC 5LJ3h 1Q86U 2GCXA 3MEUA 1VA7A 3CBMA 2JM9A 2YXYA 4OGCA 3JCMX 1I5LA 2RJCA 2VGMA 4JZ3A 2V8IA 2QA4A 3DLLA 3RDVA 4A4EA 1FMKA 5GMKi 2VXFA 3M5AA 2RQUA 2OAUA 4M7DA 2HZYA 4OMMA 1YJNT 1M1KU 2RQRA 3TCJA 1H92A 4M7DE 1KQSA 2NWMA 1U8RA 1D1CA 2RQVA 2OTJA 4M7AE 3CC2A 2RQWA 4IURA 4KT0E 2DD5A 4AMCA 4Y28E 1ABQA 3V7SA 2LX9A 2CZ7B 4JLIA 3I55Q 2XDDA 5CVIA 5GAMd 2LZ6B 3QJYA 3OBWA 2VXEA 4PJOF 1JRIA 5LJ5h 2C0TA 1P92A 3I5SA 1G3WA 2KAFA 3E2UA 5A0GA 2K4YA 2D1XA 4FU6A 2ZPFB 1VQMT 1AHJB 1BKBA 1M2VA 4DBRA 2AKKA 3OBYA 2X3WD 4JRKA 1IGUA 2XG8D 4M7AF 4XU2A 1VQ6T 4LDXA 3M54A 3JAME 1W70A 1K0XA 1YIJA 3OW2P 2M51A 1OYXA 2BTTA 3LGLA 5M9OA 1M2OA 1TS9A 2JW4A 3OYYA 5GAOn 2V1QA 1ZSGA 2K5FA 3EG2A 1ABOA 2AHJB 3CCRT 2M16A 2JTEA 3A8LB 3I9QA 4KRTA 4AT1B 2L3SA 1AWJA 4C0DB 1MNEA 1D3BA 2RHYA 3CCUT 1UTIA 4M7AA 2ZCFB 3VU3C 3FEOA 3OYDA 1KG1A 2ENMA 3M0QA 1C0MA 1NJIC 3REAB 2RHXA 2LRQA 1Q81R 4N0AA 1VQPQ 3G71T 2BZ8A 1N9SA 1Y7XA 1N8RC 2HCKA 3EGDB 1VQOA 4QKUA 2E12A 2EGAA 4E7HA 3MEAA 2DRKA 4BI8B 1X27A 4MDXA 3X24B 1QVFP 2ZPBB 4CC2A 3F70A 4FYYB 4FSSA 4C92B 4ZGJB 4J9CA 2DETA 3R6OA 2EKHA 4JJNK 2CT3A 4BDZA 3EFRA 5FU7B 4M75F 3OYIA 2KYBA 5EC7A 2LT4A 3MPUB 3QYHB 4RTXA 2RQTA 4M78E 1NYFA 1VQ4A 1AZGB 4C5HA 3NMZC 5EG2A 4KH0B 1ZX6A 3NGPA 2O31A 1VQMQ 1XTDA 1MMGA 3OYGA 2MWPA 4M75B 2V1RA 1RAIB 1WJSA 4CRIA 4J9DA 3E9GA 3NPFA 1VQOT 1QKXA 4LDVA 1IREB 1YN8A 4EMGA 3EHQA 5IN1A 2OJ2A 3CMAQ 2L3PA 1V1CA 1BI2A 4JPBW 2K57A 4M78D 1QVGP 3M53A 2ZGWA 4RG8A 4DA4A
chains in the Genus database with same CATH topology
2NUZA 4OMOA 2EPDA 1K76A 1MUZA 3NHNA 1E6GA 4LNPA 1M8MA 1X43A 5IHKA 3VS6A 2CDTA 2EQIA 1WFWA 2KRNA 5IH2A 3GBQA 2FPDA 1OEBA 1X6BA 2A37A 3M0PA 2PZ1A 3H41A 1X69A 1EFNA 1RLPC 1WI7A 2EYXA 5FWBA 2VKNA 3VS2A 4EIKA 4JJDA 4LUDA 1UJ0A 2CUDA 1M3BA 2KEAA 3TSWA 4D8DA 1WXTA 1YCSB 2RPNA 3EG1A 1T3SA 2FG0A 1VYUA 1TUCA 3ZL7C 2XMFA 1YWOA 1NLOC 2C0OA 2DBKA 2KXDA 2YT6A 2HBWA 1I0CA 1QWEA 1X2KA 4RUGA 1UECA 2DL5A 1U5SA 1H8KA 5GJWB 2FPEA 3EG0A 2DJQA 2P4RA 2BZXA 1I1JA 1WLPB 5HCKA 2L3QA 3EG3A 2KXCA 3REBB 4Z8AA 2OAWA 1KJWA 1UUEA 1ZBJA 4DEYA 2JMAA 3H0IA 1JXOA 4OMNA 4AG1C 1J3TA 3I5RA 4AFSC 1WDXA 1TUDA 1NEBA 4RTUA 2JS2A 4WCIA 2ESWA 4LE9A 1YP5A 2AKLA 2LX7A 4AG2C 2MOXA 1UE9A 2H8HA 2A36A 3VS7A 1NG2A 1SHGA 3KFVA 2ECZA 2LJ3A 2MIOA 2F2XA 1K0SA 2EYYA 2KNBB 1E6HA 2K3BA 3R6NA 2DE0X 2JS0A 2YDLA 4DEXA 1UHFA 2JM8A 2K7AA 1QLYA 2J7IA 3U23A 4RTYA 1QCFA 4J9BA 2ED1A 1CKAA 1ZUUA 1X6GA 3VS1A 2B86A 1WA7A 1LCKA 4GBQA 2RMOA 1RI9A 1HD3A 2F2WA 2YUOA 2YSQA 1T0HA 1T3LA 2DMOA 1JU5C 1U06A 2ABLA 5FWCA 1XOVA 4ESRA 2EVRA 4J9EA 3VS3A 2YUQA 4LN2A 3PE0A 3VRZA 2GBQA 1GL5A 2KBTA 2GGRA 5L23A 1UDLA 2AZVA 2KE9A 2KROA 4Z89A 2ED0A 5GJVB 2LNHB 1MV0B 1T0JA 2O2OA 1WXUA 1SPKA 2FRWA 4E6RA 4CC4B 4OMPA 1NM7A 2IIMA 1AOJA 2DYBA 2PNIA 1QKWA 1SEMA 1OV3A 2LMJA 1OPKA 1PKSA 1G83A 4F17A 2DBMA 3RBBB 2EBPA 2J6FA 2DLPA 4JZ4A 1OPLA 1HJDA 4F14A 1GFCA 2DA9A 2DF6A 4HVWA 4ORZA 4ZNXA 1M3AA 2LQWA 3VS4A 1AWXA 4HVVA 4R0KA 1PNJA 1SRLA 1YWPA 1Y57A 2DNUA 1FYNA 2D8JA 2E5KA 4HCKA 2HDAA 4AFUC 1B3QA 2CREA 1U3OA 2EYZA 2A08A 2QDLA 1JEGA 1B07A 1E7OA 2DM1A 5IHIA 1AD5A 2RF0A 1VYTA 2FPFA 2FRYA 2LCSA 2GTOA 2K2MA 1ZUYA 1K4US 1CKBA 2SRCA 2A28A 1WX6A 2DL8A 2M0YA 1OOTA 2FEIA 1PRLC 2DL3A 2CH4A 1UJYA 2ROLA 2L0AA 4RTVA 1VA7A 1IO6A 1KIKA 2JM9A 2K6DA 2AK5A 2LJ0A 2DILA 2AZSA 4JZ3A 4GLMA 3RNJA 1NYGA 2KRSA 1FMKA 1PKTA 1PWTA 2CT4A 1UG1A 2RQUA 3M0RA 3VS5A 4OMMA 4IIMA 1AWWA 1GBRA 1ZUKA 3EHRA 3THKA 1ARKA 2RQRA 1GCQC 2J6KA 1H92A 2LQNA 1RLQC 4RTWA 2K9GA 4QT7A 4RTZA 2NWMA 3ULRB 2GNCA 2KR3A 5I11A 2G6FX 2RQVA 2VVKA 3I35A 1N5ZA 1JO8A 5IHNA 2RQWA 2FO0A 3QWYA 2GTJA 2CSQA 1ABQA 2KT8A 1QWFA 2EGCA 4HXJA 3M0SA 1GFDA 2LJ1A 2GQIA 4LUEA 4D8KA 1UHCA 4X1VA 2CH4W 4J9FA 2D8HA 4A63B 3UA7A 3UA6A 1JQQA 2L2PA 2LZ6B 4AFZC 2C0TA 2JT4A 3I5SA 1UFFA 2DL7A 3IQLA 4F16A 2D1XA 4Y92A 1VYVA 1PHTA 2AKKA 3EGUA 3M0UA 2X3WD 4JJCA 1Y0MA 2DX1A 1M3CA 5FW9A 1GBQA 3TVTA 2O9SA 2W10A 5I22A 2CSIA 2CUBA 2EGEA 1UGVA 1W70A 1K0XA 3C0CA 1KSWA 2M51A 2BTTA 1H3HA 3H0HA 2JW4A 1HSQA 1X2QA 2V1QA 2SEMA 1ZSGA 3EG2A 1ABOA 1AVZC 1WXBA 5IXFA 5ECAA 2JTEA 3SEMA 3VS0A 4M4ZA 2O9VA 2RNAA 3I9QA 1W1FA 4KRTA 1ZLMA 2L3SA 1AWJA 1WYXA 1A0NB 3VRYA 1NEGA 1UTIA 4HVUA 2DL4A 1BBZA 2KT1A 1M27C 4J9IA 1M30A 1AWOA 3JV3A 2ENMA 3FJ5A 3M0QA 1BK2A 1SRMA 3REAB 3SHWA 1K9AA 2BZ8A 1JXMA 3TSZA 2J06A 2HCKA 4RTTA 2KYMA 2ROTA 3CQTA 1GCPA 1MV3A 1W6XA 1BU1A 2EGAA 2KGTA 1PRMC 2KRMA 2DRKA 2W0ZA 2YUNA 1X27A 4CC7A 4J9HA 2JMCA 3LH5A 4CC2A 4K11A 4FSSA 4J9CA 4OMQA 1TG0A 1GRIA 2C0IA 2EKHA 2CT3A 2EW3A 2YUPA 1G2BA 1S1NA 2MCNA 3UF4A 2KYBA 3A98A 4CC3A 2HSPA 2BZYA 2VWFA 4AFQC 1Z9ZA 5EC7A 1CSKA 4RTXA 2LP5A 3PVLA 1AZEA 2RQTA 1NYFA 1AZGB 3QWXX 4J9GA 1YNZA 2X3XD 3NMZC 1ZX6A 2I0NA 3NGPA 2DVJA 2O31A 3O5ZA 4IIOA 2JXBA 2V1RA 1K1ZA 3UATA 4J9DA 1AEYA 3NPFA 2J6OA 1QKXA 2DRMA 2O88A 2EYWA 5IXBA 1WIEA 1YN8A 2RN8A 1NLPC 3EHQA 2OJ2A 3PVQA 4JJBA 2L3PA 2PTKA 2K79A 1SHFA 2HEQA 1Z9QA 2OI3A 1V1CA 3M0TA 1GCQA 2D0NA 4JPBW 4Z88A 2F2VA 1RUWA 1BB9A 3H0FA 1KFZA 4OMLA 1I07A 2J05A 1SSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUZ A;  4OMO A;  2EPD A;  1K76 A;  1MUZ A;  3NHN A;  1E6G A;  4LNP A;  1M8M A;  1X43 A;  5IHK A;  3VS6 A;  2CDT A;  2EQI A;  1WFW A;  2KRN A;  5IH2 A;  3GBQ A;  2FPD A;  1OEB A;  1X6B A;  2A37 A;  3M0P A;  2PZ1 A;  3H41 A;  1X69 A;  1EFN A;  1RLP C;  1WI7 A;  2EYX A;  5FWB A;  2VKN A;  3VS2 A;  4EIK A;  4JJD A;  4LUD A;  1UJ0 A;  2CUD A;  1M3B A;  2KEA A;  3TSW A;  4D8D A;  1WXT A;  1YCS B;  2RPN A;  3EG1 A;  1T3S A;  2FG0 A;  1VYU A;  1TUC A;  3ZL7 C;  2XMF A;  1YWO A;  1NLO C;  2C0O A;  2DBK A;  2KXD A;  2YT6 A;  2HBW A;  1I0C A;  1QWE A;  1X2K A;  4RUG A;  1UEC A;  2DL5 A;  1U5S A;  1H8K A;  5GJW B;  2FPE A;  3EG0 A;  2DJQ A;  2P4R A;  2BZX A;  1I1J A;  1WLP B;  5HCK A;  2L3Q A;  3EG3 A;  2KXC A;  3REB B;  4Z8A A;  2OAW A;  1KJW A;  1UUE A;  1ZBJ A;  4DEY A;  2JMA A;  3H0I A;  1JXO A;  4OMN A;  4AG1 C;  1J3T A;  3I5R A;  4AFS C;  1WDX A;  1TUD A;  1NEB A;  4RTU A;  2JS2 A;  4WCI A;  2ESW A;  4LE9 A;  1YP5 A;  2AKL A;  2LX7 A;  4AG2 C;  2MOX A;  1UE9 A;  2H8H A;  2A36 A;  3VS7 A;  1NG2 A;  1SHG A;  3KFV A;  2ECZ A;  2LJ3 A;  2MIO A;  2F2X A;  1K0S A;  2EYY A;  2KNB B;  1E6H A;  2K3B A;  3R6N A;  2DE0 X;  2JS0 A;  2YDL A;  4DEX A;  1UHF A;  2JM8 A;  2K7A A;  1QLY A;  2J7I A;  3U23 A;  4RTY A;  1QCF A;  4J9B A;  2ED1 A;  1CKA A;  1ZUU A;  1X6G A;  3VS1 A;  2B86 A;  1WA7 A;  1LCK A;  4GBQ A;  2RMO A;  1RI9 A;  1HD3 A;  2F2W A;  2YUO A;  2YSQ A;  1T0H A;  1T3L A;  2DMO A;  1JU5 C;  1U06 A;  2ABL A;  5FWC A;  1XOV A;  4ESR A;  2EVR A;  4J9E A;  3VS3 A;  2YUQ A;  4LN2 A;  3PE0 A;  3VRZ A;  2GBQ A;  1GL5 A;  2KBT A;  2GGR A;  5L23 A;  1UDL A;  2AZV A;  2KE9 A;  2KRO A;  4Z89 A;  2ED0 A;  5GJV B;  2LNH B;  1MV0 B;  1T0J A;  2O2O A;  1WXU A;  1SPK A;  2FRW A;  4E6R A;  4CC4 B;  4OMP A;  1NM7 A;  2IIM A;  1AOJ A;  2DYB A;  2PNI A;  1QKW A;  1SEM A;  1OV3 A;  2LMJ A;  1OPK A;  1PKS A;  1G83 A;  4F17 A;  2DBM A;  3RBB B;  2EBP A;  2J6F A;  2DLP A;  4JZ4 A;  1OPL A;  1HJD A;  4F14 A;  1GFC A;  2DA9 A;  2DF6 A;  4HVW A;  4ORZ A;  4ZNX A;  1M3A A;  2LQW A;  3VS4 A;  1AWX A;  4HVV A;  4R0K A;  1PNJ A;  1SRL A;  1YWP A;  1Y57 A;  2DNU A;  1FYN A;  2D8J A;  2E5K A;  4HCK A;  2HDA A;  4AFU C;  1B3Q A;  2CRE A;  1U3O A;  2EYZ A;  2A08 A;  2QDL A;  1JEG A;  1B07 A;  1E7O A;  2DM1 A;  5IHI A;  1AD5 A;  2RF0 A;  1VYT A;  2FPF A;  2FRY A;  2LCS A;  2GTO A;  2K2M A;  1ZUY A;  1K4U S;  1CKB A;  2SRC A;  2A28 A;  1WX6 A;  2DL8 A;  2M0Y A;  1OOT A;  2FEI A;  1PRL C;  2DL3 A;  2CH4 A;  1UJY A;  2ROL A;  2L0A A;  4RTV A;  1VA7 A;  1IO6 A;  1KIK A;  2JM9 A;  2K6D A;  2AK5 A;  2LJ0 A;  2DIL A;  2AZS A;  4JZ3 A;  4GLM A;  3RNJ A;  1NYG A;  2KRS A;  1FMK A;  1PKT A;  1PWT A;  2CT4 A;  1UG1 A;  2RQU A;  3M0R A;  3VS5 A;  4OMM A;  4IIM A;  1AWW A;  1GBR A;  1ZUK A;  3EHR A;  3THK A;  1ARK A;  2RQR A;  1GCQ C;  2J6K A;  1H92 A;  2LQN A;  1RLQ C;  4RTW A;  2K9G A;  4QT7 A;  4RTZ A;  2NWM A;  3ULR B;  2GNC A;  2KR3 A;  5I11 A;  2G6F X;  2RQV A;  2VVK A;  3I35 A;  1N5Z A;  1JO8 A;  5IHN A;  2RQW A;  2FO0 A;  3QWY A;  2GTJ A;  2CSQ A;  1ABQ A;  2KT8 A;  1QWF A;  2EGC A;  4HXJ A;  3M0S A;  1GFD A;  2LJ1 A;  2GQI A;  4LUE A;  4D8K A;  1UHC A;  4X1V A;  2CH4 W;  4J9F A;  2D8H A;  4A63 B;  3UA7 A;  3UA6 A;  1JQQ A;  2L2P A;  2LZ6 B;  4AFZ C;  2C0T A;  2JT4 A;  3I5S A;  1UFF A;  2DL7 A;  3IQL A;  4F16 A;  2D1X A;  4Y92 A;  1VYV A;  1PHT A;  2AKK A;  3EGU A;  3M0U A;  2X3W D;  4JJC A;  1Y0M A;  2DX1 A;  1M3C A;  5FW9 A;  1GBQ A;  3TVT A;  2O9S A;  2W10 A;  5I22 A;  2CSI A;  2CUB A;  2EGE A;  1UGV A;  1W70 A;  1K0X A;  3C0C A;  1KSW A;  2M51 A;  2BTT A;  1H3H A;  3H0H A;  2JW4 A;  1HSQ A;  1X2Q A;  2V1Q A;  2SEM A;  1ZSG A;  3EG2 A;  1ABO A;  1AVZ C;  1WXB A;  5IXF A;  5ECA A;  2JTE A;  3SEM A;  3VS0 A;  4M4Z A;  2O9V A;  2RNA A;  3I9Q A;  1W1F A;  4KRT A;  1ZLM A;  2L3S A;  1AWJ A;  1WYX A;  1A0N B;  3VRY A;  1NEG A;  1UTI A;  4HVU A;  2DL4 A;  1BBZ A;  2KT1 A;  1M27 C;  4J9I A;  1M30 A;  1AWO A;  3JV3 A;  2ENM A;  3FJ5 A;  3M0Q A;  1BK2 A;  1SRM A;  3REA B;  3SHW A;  1K9A A;  2BZ8 A;  1JXM A;  3TSZ A;  2J06 A;  2HCK A;  4RTT A;  2KYM A;  2ROT A;  3CQT A;  1GCP A;  1MV3 A;  1W6X A;  1BU1 A;  2EGA A;  2KGT A;  1PRM C;  2KRM A;  2DRK A;  2W0Z A;  2YUN A;  1X27 A;  4CC7 A;  4J9H A;  2JMC A;  3LH5 A;  4CC2 A;  4K11 A;  4FSS A;  4J9C A;  4OMQ A;  1TG0 A;  1GRI A;  2C0I A;  2EKH A;  2CT3 A;  2EW3 A;  2YUP A;  1G2B A;  1S1N A;  2MCN A;  3UF4 A;  2KYB A;  3A98 A;  4CC3 A;  2HSP A;  2BZY A;  2VWF A;  4AFQ C;  1Z9Z A;  5EC7 A;  1CSK A;  4RTX A;  2LP5 A;  3PVL A;  1AZE A;  2RQT A;  1NYF A;  1AZG B;  3QWX X;  4J9G A;  1YNZ A;  2X3X D;  3NMZ C;  1ZX6 A;  2I0N A;  3NGP A;  2DVJ A;  2O31 A;  3O5Z A;  4IIO A;  2JXB A;  2V1R A;  1K1Z A;  3UAT A;  4J9D A;  1AEY A;  3NPF A;  2J6O A;  1QKX A;  2DRM A;  2O88 A;  2EYW A;  5IXB A;  1WIE A;  1YN8 A;  2RN8 A;  1NLP C;  3EHQ A;  2OJ2 A;  3PVQ A;  4JJB A;  2L3P A;  2PTK A;  2K79 A;  1SHF A;  2HEQ A;  1Z9Q A;  2OI3 A;  1V1C A;  3M0T A;  1GCQ A;  2D0N A;  4JPB W;  4Z88 A;  2F2V A;  1RUW A;  1BB9 A;  3H0F A;  1KFZ A;  4OML A;  1I07 A;  2J05 A;  1SSH A; 
#chains in the Genus database with same CATH topology
 2NUZ A;  1OQK A;  4N4H A;  1K76 A;  1WZO A;  1E6G A;  1M8M A;  1ZHI A;  1M90 C;  2EQI A;  4PJJ A;  4IUT A;  4F7U G;  1YJ9 A;  2Y90 A;  2LTO A;  3GBQ A;  1OEB A;  4C92 A;  2F69 A;  2A37 A;  1TOV A;  2X35 A;  1VQ7 A;  1O75 A;  1TXQ A;  4KGV B;  1VQ6 Q;  2YHT A;  4PL6 A;  2MAM A;  4FYX B;  3TEE A;  3OW2 A;  1G8X A;  3M59 A;  1XJW B;  5FWB A;  4XTX A;  3VS2 A;  4JJD A;  4QQD A;  1I81 A;  3L2U A;  1VQO Q;  2CP3 A;  1WXT A;  1YCS B;  1K73 C;  2RPN A;  3CCJ A;  3CCJ T;  2QEX Q;  2XMF A;  3CMA T;  3BDU A;  1LNX A;  4E7L A;  1QVG S;  2GF7 A;  4IUQ A;  1I0C A;  1X2K A;  4M78 A;  4RUG A;  1Q95 G;  4EPC A;  1U5S A;  4M77 F;  1UGP B;  3EG0 A;  2H3J A;  2RHI A;  3GPL A;  4FIB A;  3QBY A;  2BZX A;  3CEY A;  2HMA A;  3EG3 A;  2OAW A;  2JTF A;  3G4S Q;  1JJ2 A;  3CPW P;  1HXD A;  2B8A A;  4R56 A;  3OYC A;  1JXO A;  4N4G A;  4AFS C;  2KI7 A;  2DJZ A;  1WDX A;  1KK7 A;  2DIG A;  2F5K A;  2HL3 A;  1EIF A;  2ESW A;  1Q7Y C;  2DD4 A;  3JB9 F;  2JJ9 A;  2LX7 A;  2X4Y A;  4AG2 C;  2H8H A;  4PLI A;  2A36 A;  3VS7 A;  4C5I A;  1Q82 R;  4RCB A;  2LJ3 A;  4M75 G;  3FIF A;  4JRP A;  3CPF A;  4C0Z A;  2YDL A;  1ZSZ B;  1QP2 A;  3CCV A;  4PJM A;  1OX8 A;  2OTL Q;  1KD1 R;  1ZQ1 A;  1VQK Q;  1WHM A;  3HFO A;  5A2Q E;  1QCF A;  1M1G A;  3HL8 A;  2ED1 A;  1CKA A;  2DK3 A;  2HL5 C;  1KD1 U;  2DEU A;  3X20 B;  5D7U A;  3RUX A;  3VS1 A;  3CC7 T;  1WA7 A;  3QKJ A;  2YUO A;  4F7U A;  2DMO A;  2ABL A;  4M7D D;  4XK8 E;  3CCS T;  3H9N A;  3S3M A;  4BI4 A;  2QQ9 A;  1I4K 1;  1GL5 A;  5D6W A;  2AZV A;  2KE9 A;  3CCE A;  3RMQ A;  1T0J A;  1BI3 A;  2O2O A;  5GAN h;  5GAM j;  4CC4 B;  4OMP A;  2IIM A;  1FX7 A;  3A8H B;  1YIT T;  3QZ9 B;  1PKS A;  5CK9 A;  4ZTF A;  2Z0W A;  3OYH A;  2LCL A;  3JCM Q;  2EBP A;  1RL2 A;  1R0C B;  1OPL A;  4FCY A;  1IXD A;  3JB9 D;  4HVW A;  4QVC A;  2CZ6 B;  3OA6 A;  2EWN A;  1SRL A;  4M75 C;  3CCR A;  3CCJ Q;  2EIF A;  2DTH A;  2E5K A;  4AFU C;  5CKF A;  3D7S B;  2JNG A;  3LYI A;  1NZ9 A;  1VUB A;  4OMF B;  1E7O A;  2A3L A;  2L89 A;  2CP5 A;  5KE3 A;  1AD5 A;  3MET A;  2QYZ A;  1VQ6 A;  2RF0 A;  2FPF A;  3JSC A;  2E65 A;  2XD0 A;  4BB7 A;  2RJD A;  2A28 A;  1YHQ A;  1SG5 A;  1OUL A;  2FEI A;  1PRL C;  3J7A F;  1UGS B;  2ROL A;  2QAS A;  3MKD A;  2L0A A;  3VYG A;  2FL7 A;  4M7A D;  1IO6 A;  3CC7 Q;  2CKK A;  3X26 B;  1VQ9 Q;  2DEQ A;  2QTX A;  2K6D A;  3CC4 A;  1Q82 C;  1TWB A;  1WHH A;  2HKQ B;  5LJ3 j;  2K3X A;  3JB9 J;  3RNJ A;  1NYG A;  4WTO B;  2CT4 A;  2D9T A;  2XI9 A;  8ATC B;  2LNV A;  2PVO B;  4L6V 5;  1AWW A;  3QYG B;  3VKI A;  4J5Y A;  3L2Q A;  4A4F A;  1LJO A;  3THK A;  3EGD A;  2J6K A;  4IUV A;  2LQN A;  1MND A;  4E47 A;  3TRE A;  4RTZ A;  2VGN A;  2G6F X;  4OB3 B;  2KY9 A;  4NS5 A;  1JO8 A;  5FRN A;  2FZC B;  3CCM Q;  2L5Q A;  2FO0 A;  3QWY A;  4D6W A;  4J6W A;  5A0D A;  4PJL A;  1GFD A;  1R0B G;  2LJ1 A;  3JRZ A;  5GAN j;  4LUE A;  4D8K A;  1BIB A;  4E7S A;  1UHC A;  1KQ1 A;  2CH4 W;  2JZ2 A;  1YIT Q;  3CC4 T;  4J9F A;  2RK1 A;  4A63 B;  3UA7 A;  3KXT A;  3UA6 A;  2FHD A;  1JQQ A;  5FU7 C;  2R5A A;  3S3N A;  2F1L A;  1NE8 A;  3EGX A;  2RHU A;  2JT4 A;  1UFF A;  4NL2 A;  1YHQ T;  4J6Y A;  3V8K A;  1OU9 A;  1ZSZ C;  2DX1 A;  1N8R R;  2LVM A;  3GNG A;  5FW9 A;  3JCM V;  1IHW A;  5IAY A;  2DXB A;  2CSI A;  1VQ5 Q;  4LDY A;  1UGV A;  2YRD A;  5GAN 6;  3FC3 A;  4BUG A;  4BY6 C;  1H3H A;  3H0H A;  2HSE B;  5KYY A;  3EFO B;  1HSQ A;  1X2Q A;  4FW1 A;  2SEM A;  4JRI A;  3SDZ A;  2QEX T;  4C8Q F;  1RAA B;  3L2W A;  5IXF A;  4N0A C;  4OB1 B;  5ECA A;  1V76 A;  4C92 C;  2MF2 A;  3SEM A;  3VS0 A;  3CD6 A;  2DER A;  1C1A A;  1W1F A;  1VQ9 T;  3OW2 S;  2PUO B;  3EAE A;  4M7A C;  3JCM g;  4E7Z A;  4B6M A;  2LDM A;  4C5E A;  2DL4 A;  4XTU A;  4PJN A;  1RAB B;  1BBZ A;  2KT1 A;  1M27 C;  1BCM A;  2QQR A;  3PMI A;  3JV3 A;  3EFS A;  1BI1 A;  1YIT A;  4A4K A;  5GMK j;  1BK2 A;  2X4X A;  5GAN 7;  1JXM A;  4M77 G;  2J06 A;  2P0Q A;  1YI2 Q;  3CQT A;  1GCP A;  1MV3 A;  1Y07 A;  2WSE E;  1BU1 A;  2KRM A;  1Y96 A;  3L2Z A;  2K5I A;  3CPW A;  4CC7 A;  2CZ0 B;  2KDS A;  5FU6 C;  4C8Q E;  4BE2 A;  3MEW A;  4ANJ A;  3URG A;  1VQN Q;  4M7D C;  4M75 D;  5GAN g;  1TG0 A;  2C0I A;  4FYV B;  3PT9 A;  2CP2 A;  2JVV A;  2MCN A;  3A98 A;  5DLQ E;  3KUF A;  3SFM A;  2RB6 A;  1CSK A;  2X9H A;  1WHL A;  3MCA B;  4J9G A;  2MWO A;  1YNZ A;  5C0M A;  2OTJ Q;  1RAF B;  1IRX A;  1TSF A;  2FB7 A;  1W2B S;  2JXB A;  1Q7Y U;  4QW2 A;  3MEV A;  5GAM e;  5D6Y A;  5CR2 A;  3JB9 H;  3M56 A;  5IXB A;  2COW A;  3JCM c;  2FYK A;  2RI5 A;  2L8D A;  4RMO A;  2OTL A;  1VQN A;  2KSS A;  3PVQ A;  1KC8 R;  2K79 A;  2M02 A;  2HEQ A;  3CXC A;  3UWN A;  1NPP A;  3LW5 E;  2F2V A;  4MML A;  2VAS A;  1I07 A;  1WQW A;  3NHN A;  2RD1 A;  3MP8 A;  4LNP A;  3OYF A;  1MMA A;  1LOJ A;  1B7T A;  3VS6 A;  1VQ4 T;  2K2V A;  2PVD B;  2FPD A;  2KMT A;  4HCC A;  1X6B A;  2E10 A;  1YJW T;  3J81 E;  4R55 A;  2WAC A;  1N8R U;  4JDS A;  3RER A;  4EMK A;  1WI7 A;  1R77 A;  2EYX A;  2VKN A;  1NJI U;  4PFP A;  4HA8 A;  4LUD A;  4A4G A;  2CUD A;  3BFM A;  2GFU A;  1D1B A;  1OZ2 A;  1N9R A;  3INZ A;  1TUC A;  3ZL7 C;  1G3Y A;  3LLR A;  1NLO C;  2C0O A;  2KXD A;  4XU3 A;  5KCO A;  4NL3 A;  3OS2 A;  5GAN 8;  2DVE A;  1VQ8 A;  4DBQ A;  4FL6 A;  1QWE A;  2Y4X A;  5GMK m;  2DL5 A;  1KD1 C;  5GJW B;  5KYX A;  2DJQ A;  2P4R A;  5FLX E;  5HCK A;  3CCQ A;  1YJ9 T;  3BDL A;  1ACM B;  1K8A R;  3P8D A;  2JMA A;  3H0I A;  5GAM f;  4OMN A;  4MZM A;  3I5R A;  3L2R A;  3HSB A;  3CCS Q;  1NEB A;  2P0K A;  3HP9 A;  1N6A A;  3CXC S;  1WHG A;  1NG2 A;  2NUP B;  3E9F A;  3GF5 A;  1DJ7 B;  2RH2 A;  4JS4 A;  2ECZ A;  2F2X A;  2EYY A;  1E6H A;  3JCM b;  3R6N A;  2DE0 X;  2CP0 A;  4LDW A;  4B9X A;  1VOM A;  5CQY A;  4DEX A;  1UHF A;  1QVF S;  2NLU A;  2K7A A;  3QUI A;  1Q82 U;  2KVQ G;  2J7I A;  3U23 A;  3AHU A;  1PSF A;  1X6G A;  4M7A B;  2NUT A;  1EZZ B;  1M90 R;  2RMO A;  3JCM f;  1HD3 A;  1U1T A;  2F2W A;  2YSQ A;  1T3L A;  3C4S A;  4C92 F;  1TTH B;  3SWN B;  1KC8 C;  2EVR A;  5AYF A;  3C94 A;  5GAO l;  1K73 U;  3VS3 A;  2YUQ A;  4PJO B;  3GP8 A;  2V8J A;  3PE0 A;  4HT8 A;  5L23 A;  1OZ3 A;  2HNI A;  5GJV B;  1KQS S;  2LNH B;  3CCQ T;  3G6E A;  3OMC A;  5GAN d;  2YLC A;  5KYN A;  4C8Q G;  5J39 A;  1Q86 C;  4FM4 B;  3JCM W;  3MP1 A;  1Q81 C;  1PC0 A;  4M7A G;  1YFN A;  2XID A;  2PNI A;  4M75 A;  3JB9 G;  1BYM A;  1H64 1;  5DY9 A;  2E41 A;  4HKE A;  2GFA A;  5GAN 4;  1HJD A;  1WJQ A;  3MO8 A;  1GFC A;  2DF6 A;  2DXT A;  4ORZ A;  3G4S T;  1Y96 B;  1XQH A;  2LQW A;  4KH1 B;  5J3B A;  2RO0 A;  4R0K A;  1Y57 A;  2D8J A;  5LJ3 e;  2E3I A;  5LJ3 f;  1Q7Y R;  2EYZ A;  2QDL A;  3QG1 A;  1JEG A;  2DM1 A;  2A7Y A;  1UB4 A;  5L8R E;  3OSS C;  5LJ5 g;  1QCN A;  1VYT A;  2MYS A;  3CMA A;  2GTO A;  1K4U S;  5DM7 R;  2VV5 A;  2M0Y A;  1IZ6 A;  2CH4 A;  1UJY A;  3DLM A;  4J7I A;  4C0G A;  4RTV A;  4KUD K;  1M2V B;  2K3Y A;  5CKE A;  1KIK A;  2AK5 A;  3X28 B;  3EGX B;  2XHC A;  2NYS A;  1M1K C;  2AZS A;  4GLM A;  2QQS A;  4WF2 A;  4E7I A;  1PKT A;  1PWT A;  3GOX A;  4OF1 A;  1RAH B;  3CCL Q;  3HRU A;  1QW1 A;  2LCC A;  5CKH A;  3BY7 A;  1ZUK A;  3EHR A;  1QVG A;  4F7U F;  2QGG A;  1GCQ C;  1ARK A;  3EG9 A;  2K9G A;  3JCM e;  4PKC C;  4QT7 A;  3ULR B;  2KR3 A;  2VVK A;  3I35 A;  1N5Z A;  5IHN A;  3P8B B;  2GTJ A;  2CSQ A;  6AT1 B;  4HXJ A;  2EGC A;  4F04 B;  2RK2 A;  4BDY A;  2GQI A;  1W2B P;  4BE0 A;  4C8Q B;  1KC8 U;  5I2S A;  3M55 A;  5GAN 3;  4X1V A;  5GAN 5;  5LJ3 d;  2D8H A;  2RI2 A;  2L2P A;  3LX7 A;  3QZ5 B;  4C0D C;  4XTZ A;  4DOW A;  2DL7 A;  4M78 C;  3CCQ Q;  5I2M A;  3CC4 Q;  4Y92 A;  4ZTJ A;  3PIP A;  1PHT A;  3NTK A;  3G6E T;  2OX7 A;  3EGU A;  4EDU A;  5LJ5 j;  1YI2 T;  4UC4 A;  5CKD A;  2V26 A;  2BE9 B;  3QHS A;  3TVT A;  2GQV A;  3CPW S;  2W10 A;  5I22 A;  2NUT B;  1S72 Q;  1M1F A;  5CIU A;  3QPH A;  5GAN e;  2QEX A;  4A53 A;  1SSF A;  1AVZ C;  1WXB A;  3MHX A;  2EFI A;  1D1A A;  2E5Q A;  4C92 E;  3CD6 Q;  3BE3 A;  4O5V A;  1WYX A;  1NEG A;  4HVU A;  5IT9 E;  4RKU E;  3CCU A;  1M30 A;  5GMK e;  3VJP A;  1AWO A;  3HRT A;  1YBY A;  1SRM A;  3SHW A;  3RKX A;  1WPY A;  1K9A A;  4J83 A;  1WJR A;  2E3H A;  1D3B B;  2KYM A;  3RR6 A;  3CME T;  1W6X A;  9ATC B;  5GMK h;  2LT1 A;  2KGT A;  3I56 T;  1WHJ A;  2YUN A;  3VUB A;  2I2L A;  3NTH A;  5GMK l;  2AIR B;  4XTV A;  2JMC A;  3LH5 A;  3QII A;  3SWN A;  4K11 A;  1ZA2 B;  3SB2 A;  2XDP A;  2ATC B;  4BE1 A;  2EW3 A;  2YUP A;  4QVZ A;  1G2B A;  2A0F B;  2RJE A;  4BY6 B;  2PVG B;  1JB0 E;  2VWF A;  4AFQ C;  4JS5 A;  1VQM A;  2LP5 A;  2QK0 A;  3PVL A;  2DAQ A;  2PU9 B;  1NJI R;  1AZE A;  2JN0 A;  5HK3 A;  2X3X D;  1VQ8 T;  2I0N A;  2CGH A;  2E4H A;  3FDR A;  2D6F A;  1HK9 A;  3EH1 A;  4PNO A;  1QVF A;  4MMK A;  1TH7 A;  3UAT A;  3RIR A;  1AEY A;  2J6O A;  2VC8 A;  3CME A;  2F5T X;  1NPR A;  2EYW A;  2NUP A;  2RM4 A;  2RN8 A;  1NLP C;  4MDW A;  5AT1 B;  3SD4 A;  2PTK A;  3L2V A;  4C5G A;  4C8Q C;  5LJ5 f;  1EX4 A;  1XNI A;  1Z9Q A;  4MZT A;  3H6Z A;  1FMW A;  1GCQ A;  5D6X A;  3A5Z B;  3JCM d;  2H3E B;  1MHN A;  1OI1 A;  2EQJ A;  1BB9 A;  1F1B B;  3WXM B;  2XDB A;  2ZPE B;  4X9D A;  4OP0 A;  2EPD A;  1M90 U;  3FLG A;  1MUZ A;  2KRN A;  1FXX A;  4IKF A;  4KUI A;  4PLL A;  3M0P A;  4PJO C;  2M0O A;  1PM3 A;  4LXC A;  1YJW Q;  3P8H A;  3L42 A;  5KYX B;  1QVP A;  1M3B A;  2KEA A;  3NFC A;  1QP3 A;  1YI2 A;  1TUG B;  5CO7 A;  4P5N A;  1T3S A;  2FG0 A;  4DBH A;  1VYU A;  4XAX B;  4VUB A;  2YT6 A;  4PFZ A;  2XKO C;  2CYZ B;  2HBW A;  4ZN1 A;  1MMD A;  1C6V X;  4LD9 K;  1UEC A;  1H8K A;  2DKG A;  2R5M A;  5A0L A;  3L1A A;  4GY5 A;  3LH0 A;  2JOY A;  1I1J A;  4DQ2 A;  1WLP B;  2L3Q A;  3ZBD A;  3I55 T;  1OX9 A;  2KXC A;  1G5V A;  2LQ8 A;  3E19 A;  1ZBJ A;  4DEY A;  4M77 D;  5LL6 S;  1J3T A;  2MI6 A;  2DPP B;  2DXU A;  1TUD A;  3I56 Q;  1JJ2 P;  4RTU A;  1YJ9 Q;  4WCI A;  3CME Q;  1K8A U;  1UGR B;  3ZFJ A;  2DXC A;  2HQH A;  3CCM A;  3H8Z A;  3CCM T;  2HD0 A;  1PG5 B;  1VIE A;  3OQ5 A;  3M57 A;  2KNB B;  3OB9 A;  1W4S A;  3VUZ A;  1WGS A;  2JS0 A;  3QSU A;  1WNL A;  3QDR B;  2Y4Y A;  3HPW A;  2JM8 A;  2DYI A;  3CCV T;  2KQW A;  1QLY A;  2IVW A;  4PJO D;  5KYW B;  3OYE A;  1BCO A;  1G3T A;  5CCA A;  2OTL T;  1ZUU A;  1D0Z A;  3FJP A;  2B86 A;  4XU0 A;  8AT1 B;  1LCK A;  4GBQ A;  3V7C A;  3LWI A;  2KK4 A;  1I8F A;  4M77 A;  1IB8 A;  3G7Z A;  4JLG A;  2QA4 Q;  1U06 A;  4M78 F;  1XOV A;  5GAO q;  2E70 A;  1YJN Q;  4J9E A;  3Q1J A;  1YCY A;  2O01 E;  4LN2 A;  2K5L A;  3VRZ A;  1D09 B;  2KBT A;  2GGR A;  4LD6 A;  1UDL A;  4Z89 A;  2KRO A;  2ZPH B;  1NBE B;  5GAM h;  1YHQ Q;  1MV0 B;  2MMP A;  3I56 A;  4PJO E;  2E1H A;  2EKO A;  2M9U A;  1NM7 A;  2HAX A;  2DYB A;  7AT1 B;  3G4S A;  1SEM A;  4FSX A;  5KE2 A;  1OV3 A;  2LMJ A;  1OPK A;  1KQS P;  3OY9 A;  2DBM A;  1N27 A;  2DLP A;  2EJG A;  2IPO B;  3HFN A;  4JZ4 A;  4EMH A;  3CBP A;  3PTA A;  2P4T A;  2DA9 A;  4OVA A;  1VQ7 Q;  1QQJ A;  3VS4 A;  1M1K R;  1AWX A;  5GAN f;  1PNJ A;  4ELZ C;  1VQ8 Q;  1KQ2 A;  1YWP A;  2FVU A;  2DZ9 A;  3QDF A;  1FYN A;  3OMG A;  3WVE B;  4HCK A;  2AT1 B;  2HDA A;  3TQ7 P;  1ZBX A;  1U3O A;  1SKU B;  1AT1 B;  3KBG A;  1M4Z A;  3EH2 A;  4C92 G;  4JRQ A;  1B07 A;  5IHI A;  2QI2 A;  4V2S A;  4J7F A;  1Q81 U;  3VYH B;  2LCS A;  2C06 A;  5CKB A;  1CKB A;  2EJF A;  5GAN 2;  5DLO A;  1OOT A;  4QVD A;  3G1J A;  4IUP A;  3G71 A;  2WSF E;  1W2B A;  2DO3 A;  3S3O A;  3OS0 A;  2QA4 T;  2LJ0 A;  2DIL A;  3RMS A;  1JJ2 S;  2KRS A;  3M58 A;  3GNF B;  1X6O A;  1UG1 A;  3M0R A;  4O6J A;  3VS5 A;  4IIM A;  1GBR A;  3G6E Q;  2P0P A;  5KYY B;  1VQK A;  2O4X A;  1PD1 A;  4E7K A;  4XTY A;  3CCE Q;  1RLQ C;  1RAE B;  4RTW A;  5GAM g;  3CCV Q;  5LJ5 e;  2GNC A;  5I11 A;  2PUK B;  1S72 T;  4HT9 A;  2X51 A;  1KHC A;  1YIJ T;  4ZN3 A;  5CQX A;  4XTW A;  4F7U B;  2HQE A;  2KT8 A;  1PD0 A;  1QWF A;  3M0S A;  1MMN A;  2EQK A;  3OS5 A;  3TU4 K;  1WQ7 A;  3OYA A;  5FRM A;  2XU8 A;  2QXF A;  1PCX A;  4AFZ C;  5HK0 A;  2CZ1 B;  5GAO m;  3UDC A;  3OYJ A;  5C6S A;  2L3R A;  3IQL A;  3A8M B;  4BD3 A;  4F16 A;  1JBM A;  1K8A C;  4KBM B;  1VYV A;  3C12 A;  1OU8 A;  3M0U A;  4JJC A;  4XQ3 A;  1Y0M A;  4C8Q D;  1M3C A;  4FT4 A;  3G71 Q;  3UT1 A;  2V8K A;  1GBQ A;  3SWN C;  4BI3 A;  3MJX A;  2VB6 A;  1VQL Q;  2O9S A;  2XK0 A;  2COZ A;  1QMC A;  2CUB A;  2EGE A;  5GAO p;  3JCM P;  3CCS A;  3C0C A;  1KSW A;  1YIJ Q;  2RHZ A;  3AT1 B;  4KUL A;  4PJO A;  3DB3 A;  4DBF A;  3CBO A;  2DZC A;  3EFO A;  1VQK T;  4M4Z A;  3GLX A;  2O9V A;  2QGF B;  2RNA A;  2ZZD A;  1ZLM A;  4M7D F;  2VYT A;  1M5Q 1;  1A0N B;  4HCB A;  3VRY A;  2VUB A;  4Q5W A;  3FRN A;  4QQG A;  4J9I A;  1MGQ A;  5LJ5 d;  3FJ5 A;  2FZG B;  2MK5 A;  3V8L A;  4DOV A;  4L5G A;  4PK4 A;  1VQ5 A;  4RCC A;  4C8Q A;  1G3S A;  3TSZ A;  3OYN A;  4RTT A;  2ROT A;  4ATO A;  1R8O B;  2O4X B;  1D0X A;  1PRM C;  2W0Z A;  1Y71 A;  2DTO A;  4EMK B;  1K9M U;  3HRS A;  2HQX A;  4OB0 B;  3DB4 A;  4J9H A;  2YRC A;  3PNW C;  4YTL A;  2R58 A;  2IG0 A;  1ZSZ A;  4OMQ A;  1FWZ A;  1GRI A;  3UPU A;  4ELY C;  4X34 A;  4JUV A;  1S1N A;  4L59 A;  4NOY A;  3UF4 A;  4CC3 A;  3OS1 A;  2HSP A;  2BZY A;  1Z9Z A;  4N4I A;  3RKY A;  4BAC A;  2JTM A;  1YJN A;  3QWX X;  1X75 C;  2D0Q B;  2EQM A;  1HYO A;  2DVJ A;  3PMT A;  3CC2 Q;  3O5Z A;  4IIO A;  4C92 D;  3S6W A;  1M9S A;  2E6N A;  1K1Z A;  3OYL A;  1PSE A;  3N5B B;  2E64 A;  3A8G B;  4FT2 A;  2DRM A;  2EAY A;  2O88 A;  2QQB A;  1WIE A;  2BKD N;  2CP6 A;  3JB9 I;  3CCL A;  2ZPG B;  4JJB A;  2FZK B;  4FW2 A;  1V29 B;  4Y91 A;  2X4J A;  3JCM h;  3PIO A;  2YWW A;  1SHF A;  2OI3 A;  3M0T A;  4J6X A;  4E2F B;  2D0N A;  4Z88 A;  4OB2 B;  3NTI A;  1RUW A;  3CXC P;  4X9C A;  3H0F A;  1KFZ A;  5LJ3 g;  4OML A;  3CC7 A;  2JUF A;  3M9Q A;  1LPL A;  2J05 A;  1SSH A;  2DIQ A;  4OMO A;  1VQ9 A;  1SF9 A;  3A1P A;  1VQP A;  1RAG B;  1X43 A;  5IHK A;  2CDT A;  1WFW A;  5HKC A;  2EJ9 A;  2HKN A;  2QG9 B;  5IH2 A;  3LWH A;  2PZ1 A;  3CCU Q;  3H41 A;  3OSV A;  4ME7 A;  3VV0 A;  3PFS A;  1X69 A;  1EFN A;  1RLP C;  3V7R A;  3GIB A;  3ER0 A;  1D0Y A;  4EIK A;  3ASK A;  4MZP A;  2QTV A;  1LVK A;  3T9N A;  1UJ0 A;  1M8V A;  3TSW A;  4D8D A;  4RG2 A;  3EG1 A;  4PFO A;  3CCR Q;  1U1S A;  1YWO A;  1TU0 B;  4PJO G;  5CAI A;  2YRV A;  4KGX B;  2DBK A;  4QQ6 A;  3QJ6 A;  3JCM J;  1VIF A;  2WSC E;  2DTI A;  4OGE A;  3LGF A;  2FPE A;  2CS7 A;  2EYQ A;  1VQL A;  3X25 B;  3ZEH A;  4II1 A;  1FMV A;  4J8O A;  1UEB A;  4M78 G;  2COY A;  3CCL T;  3REB B;  4Z8A A;  2X4W A;  4M75 E;  4LDU A;  1KJW A;  1UUE A;  1RI0 A;  3M4G A;  4AG1 C;  3J80 E;  1K9M C;  3I55 A;  3BW1 A;  2JS2 A;  4LE9 A;  1YP5 A;  2AKL A;  3WVD B;  1VQ7 T;  2MOX A;  1UE9 A;  5KYW A;  3QXE B;  3HKS A;  5GAO r;  2BUD A;  2LC4 A;  3OYB A;  5J26 A;  1UGQ B;  1SHG A;  3RES A;  2MPX C;  3KFV A;  1K73 R;  3OYM A;  2MIO A;  1K0S A;  4IUU A;  1O9S A;  4FYW B;  2K3B A;  2ZPI B;  1BIA A;  1Q86 R;  1VQ4 Q;  2EQU A;  4M7D B;  1IGQ A;  2ZAE A;  4M78 B;  2M1H A;  4CI0 C;  4RTY A;  4A4H A;  4J9B A;  3CD6 T;  4ZGE B;  4F7U E;  5FRO A;  3ME9 A;  3HHT B;  2R57 A;  3QO3 A;  3OYK A;  2QDY B;  1RI9 A;  1T0H A;  5KYU B;  1JU5 C;  3RKW A;  5FWC A;  4E7J A;  4ESR A;  5I21 A;  5HY6 A;  1RAC B;  1VQ5 T;  4A54 A;  2LQK A;  1B34 A;  1WHK A;  2GBQ A;  1RAD B;  3EG9 B;  1IHV A;  3O8V A;  4GLK A;  4M7D G;  2CP7 A;  2ED0 A;  2YLB A;  4M77 E;  2G3R A;  2DFU A;  2P84 A;  4B9W A;  1WXU A;  1SPK A;  1GXI E;  2FRW A;  1VQL T;  4E6R A;  3HTR A;  3A8O B;  1AOJ A;  3MP6 A;  4ZGD B;  3M4Y A;  1QKW A;  2QQA A;  1BI0 A;  1KHI A;  1QCO A;  5FU6 B;  1G83 A;  4F17 A;  3C95 A;  3RBB B;  1YJW A;  2RA2 A;  2J6F A;  4KGZ B;  5KCH A;  4F14 A;  1I5O B;  4Z02 A;  4ZNX A;  1M3A A;  3V8J A;  4M77 B;  3CC2 T;  4HVV A;  2QAZ A;  4TVR A;  2BIV A;  2OTJ T;  2DNU A;  1ZA1 B;  1B3Q A;  2CRE A;  1K9M R;  5KH6 A;  2XIC A;  2PQW A;  4XU1 A;  2BE7 D;  3FB9 A;  3CCE T;  2A08 A;  5KYU A;  2E6Z A;  1VQN T;  4HCZ A;  3DKM A;  4C0F A;  2RJF A;  1VQP T;  1H3Z A;  1X01 A;  2FRY A;  1B34 B;  1S72 A;  2K2M A;  1ZUY A;  2HBP A;  2SRC A;  3E1S A;  1WX6 A;  2DL8 A;  3PGG A;  2DL3 A;  2RI3 A;  4M77 C;  4EMK C;  5LJ3 h;  1Q86 U;  2GCX A;  3MEU A;  1VA7 A;  3CBM A;  2JM9 A;  2YXY A;  4OGC A;  3JCM X;  1I5L A;  2RJC A;  2VGM A;  4JZ3 A;  2V8I A;  2QA4 A;  3DLL A;  3RDV A;  4A4E A;  1FMK A;  5GMK i;  2VXF A;  3M5A A;  2RQU A;  2OAU A;  4M7D A;  2HZY A;  4OMM A;  1YJN T;  1M1K U;  2RQR A;  3TCJ A;  1H92 A;  4M7D E;  1KQS A;  2NWM A;  1U8R A;  1D1C A;  2RQV A;  2OTJ A;  4M7A E;  3CC2 A;  2RQW A;  4IUR A;  4KT0 E;  2DD5 A;  4AMC A;  4Y28 E;  1ABQ A;  3V7S A;  2LX9 A;  2CZ7 B;  4JLI A;  3I55 Q;  2XDD A;  5CVI A;  5GAM d;  2LZ6 B;  3QJY A;  3OBW A;  2VXE A;  4PJO F;  1JRI A;  5LJ5 h;  2C0T A;  1P92 A;  3I5S A;  1G3W A;  2KAF A;  3E2U A;  5A0G A;  2K4Y A;  2D1X A;  4FU6 A;  2ZPF B;  1VQM T;  1AHJ B;  1BKB A;  1M2V A;  4DBR A;  2AKK A;  3OBY A;  2X3W D;  4JRK A;  1IGU A;  2XG8 D;  4M7A F;  4XU2 A;  1VQ6 T;  4LDX A;  3M54 A;  3JAM E;  1W70 A;  1K0X A;  1YIJ A;  3OW2 P;  2M51 A;  1OYX A;  2BTT A;  3LGL A;  5M9O A;  1M2O A;  1TS9 A;  2JW4 A;  3OYY A;  5GAO n;  2V1Q A;  1ZSG A;  2K5F A;  3EG2 A;  1ABO A;  2AHJ B;  3CCR T;  2M16 A;  2JTE A;  3A8L B;  3I9Q A;  4KRT A;  4AT1 B;  2L3S A;  1AWJ A;  4C0D B;  1MNE A;  1D3B A;  2RHY A;  3CCU T;  1UTI A;  4M7A A;  2ZCF B;  3VU3 C;  3FEO A;  3OYD A;  1KG1 A;  2ENM A;  3M0Q A;  1C0M A;  1NJI C;  3REA B;  2RHX A;  2LRQ A;  1Q81 R;  4N0A A;  1VQP Q;  3G71 T;  2BZ8 A;  1N9S A;  1Y7X A;  1N8R C;  2HCK A;  3EGD B;  1VQO A;  4QKU A;  2E12 A;  2EGA A;  4E7H A;  3MEA A;  2DRK A;  4BI8 B;  1X27 A;  4MDX A;  3X24 B;  1QVF P;  2ZPB B;  4CC2 A;  3F70 A;  4FYY B;  4FSS A;  4C92 B;  4ZGJ B;  4J9C A;  2DET A;  3R6O A;  2EKH A;  4JJN K;  2CT3 A;  4BDZ A;  3EFR A;  5FU7 B;  4M75 F;  3OYI A;  2KYB A;  5EC7 A;  2LT4 A;  3MPU B;  3QYH B;  4RTX A;  2RQT A;  4M78 E;  1NYF A;  1VQ4 A;  1AZG B;  4C5H A;  3NMZ C;  5EG2 A;  4KH0 B;  1ZX6 A;  3NGP A;  2O31 A;  1VQM Q;  1XTD A;  1MMG A;  3OYG A;  2MWP A;  4M75 B;  2V1R A;  1RAI B;  1WJS A;  4CRI A;  4J9D A;  3E9G A;  3NPF A;  1VQO T;  1QKX A;  4LDV A;  1IRE B;  1YN8 A;  4EMG A;  3EHQ A;  5IN1 A;  2OJ2 A;  3CMA Q;  2L3P A;  1V1C A;  1BI2 A;  4JPB W;  2K57 A;  4M78 D;  1QVG P;  3M53 A;  2ZGW A;  4RG8 A;  4DA4 A; 
#chains in the Genus database with same CATH homology
 2NUZ A;  4OMO A;  2EPD A;  1K76 A;  1MUZ A;  3NHN A;  1E6G A;  4LNP A;  1M8M A;  1X43 A;  5IHK A;  3VS6 A;  2CDT A;  2EQI A;  1WFW A;  2KRN A;  5IH2 A;  3GBQ A;  2FPD A;  1OEB A;  1X6B A;  2A37 A;  3M0P A;  2PZ1 A;  3H41 A;  1X69 A;  1EFN A;  1RLP C;  1WI7 A;  2EYX A;  5FWB A;  2VKN A;  3VS2 A;  4EIK A;  4JJD A;  4LUD A;  1UJ0 A;  2CUD A;  1M3B A;  2KEA A;  3TSW A;  4D8D A;  1WXT A;  1YCS B;  2RPN A;  3EG1 A;  1T3S A;  2FG0 A;  1VYU A;  1TUC A;  3ZL7 C;  2XMF A;  1YWO A;  1NLO C;  2C0O A;  2DBK A;  2KXD A;  2YT6 A;  2HBW A;  1I0C A;  1QWE A;  1X2K A;  4RUG A;  1UEC A;  2DL5 A;  1U5S A;  1H8K A;  5GJW B;  2FPE A;  3EG0 A;  2DJQ A;  2P4R A;  2BZX A;  1I1J A;  1WLP B;  5HCK A;  2L3Q A;  3EG3 A;  2KXC A;  3REB B;  4Z8A A;  2OAW A;  1KJW A;  1UUE A;  1ZBJ A;  4DEY A;  2JMA A;  3H0I A;  1JXO A;  4OMN A;  4AG1 C;  1J3T A;  3I5R A;  4AFS C;  1WDX A;  1TUD A;  1NEB A;  4RTU A;  2JS2 A;  4WCI A;  2ESW A;  4LE9 A;  1YP5 A;  2AKL A;  2LX7 A;  4AG2 C;  2MOX A;  1UE9 A;  2H8H A;  2A36 A;  3VS7 A;  1NG2 A;  1SHG A;  3KFV A;  2ECZ A;  2LJ3 A;  2MIO A;  2F2X A;  1K0S A;  2EYY A;  2KNB B;  1E6H A;  2K3B A;  3R6N A;  2DE0 X;  2JS0 A;  2YDL A;  4DEX A;  1UHF A;  2JM8 A;  2K7A A;  1QLY A;  2J7I A;  3U23 A;  4RTY A;  1QCF A;  4J9B A;  2ED1 A;  1CKA A;  1ZUU A;  1X6G A;  3VS1 A;  2B86 A;  1WA7 A;  1LCK A;  4GBQ A;  2RMO A;  1RI9 A;  1HD3 A;  2F2W A;  2YUO A;  2YSQ A;  1T0H A;  1T3L A;  2DMO A;  1JU5 C;  1U06 A;  2ABL A;  5FWC A;  1XOV A;  4ESR A;  2EVR A;  4J9E A;  3VS3 A;  2YUQ A;  4LN2 A;  3PE0 A;  3VRZ A;  2GBQ A;  1GL5 A;  2KBT A;  2GGR A;  5L23 A;  1UDL A;  2AZV A;  2KE9 A;  2KRO A;  4Z89 A;  2ED0 A;  5GJV B;  2LNH B;  1MV0 B;  1T0J A;  2O2O A;  1WXU A;  1SPK A;  2FRW A;  4E6R A;  4CC4 B;  4OMP A;  1NM7 A;  2IIM A;  1AOJ A;  2DYB A;  2PNI A;  1QKW A;  1SEM A;  1OV3 A;  2LMJ A;  1OPK A;  1PKS A;  1G83 A;  4F17 A;  2DBM A;  3RBB B;  2EBP A;  2J6F A;  2DLP A;  4JZ4 A;  1OPL A;  1HJD A;  4F14 A;  1GFC A;  2DA9 A;  2DF6 A;  4HVW A;  4ORZ A;  4ZNX A;  1M3A A;  2LQW A;  3VS4 A;  1AWX A;  4HVV A;  4R0K A;  1PNJ A;  1SRL A;  1YWP A;  1Y57 A;  2DNU A;  1FYN A;  2D8J A;  2E5K A;  4HCK A;  2HDA A;  4AFU C;  1B3Q A;  2CRE A;  1U3O A;  2EYZ A;  2A08 A;  2QDL A;  1JEG A;  1B07 A;  1E7O A;  2DM1 A;  5IHI A;  1AD5 A;  2RF0 A;  1VYT A;  2FPF A;  2FRY A;  2LCS A;  2GTO A;  2K2M A;  1ZUY A;  1K4U S;  1CKB A;  2SRC A;  2A28 A;  1WX6 A;  2DL8 A;  2M0Y A;  1OOT A;  2FEI A;  1PRL C;  2DL3 A;  2CH4 A;  1UJY A;  2ROL A;  2L0A A;  4RTV A;  1VA7 A;  1IO6 A;  1KIK A;  2JM9 A;  2K6D A;  2AK5 A;  2LJ0 A;  2DIL A;  2AZS A;  4JZ3 A;  4GLM A;  3RNJ A;  1NYG A;  2KRS A;  1FMK A;  1PKT A;  1PWT A;  2CT4 A;  1UG1 A;  2RQU A;  3M0R A;  3VS5 A;  4OMM A;  4IIM A;  1AWW A;  1GBR A;  1ZUK A;  3EHR A;  3THK A;  1ARK A;  2RQR A;  1GCQ C;  2J6K A;  1H92 A;  2LQN A;  1RLQ C;  4RTW A;  2K9G A;  4QT7 A;  4RTZ A;  2NWM A;  3ULR B;  2GNC A;  2KR3 A;  5I11 A;  2G6F X;  2RQV A;  2VVK A;  3I35 A;  1N5Z A;  1JO8 A;  5IHN A;  2RQW A;  2FO0 A;  3QWY A;  2GTJ A;  2CSQ A;  1ABQ A;  2KT8 A;  1QWF A;  2EGC A;  4HXJ A;  3M0S A;  1GFD A;  2LJ1 A;  2GQI A;  4LUE A;  4D8K A;  1UHC A;  4X1V A;  2CH4 W;  4J9F A;  2D8H A;  4A63 B;  3UA7 A;  3UA6 A;  1JQQ A;  2L2P A;  2LZ6 B;  4AFZ C;  2C0T A;  2JT4 A;  3I5S A;  1UFF A;  2DL7 A;  3IQL A;  4F16 A;  2D1X A;  4Y92 A;  1VYV A;  1PHT A;  2AKK A;  3EGU A;  3M0U A;  2X3W D;  4JJC A;  1Y0M A;  2DX1 A;  1M3C A;  5FW9 A;  1GBQ A;  3TVT A;  2O9S A;  2W10 A;  5I22 A;  2CSI A;  2CUB A;  2EGE A;  1UGV A;  1W70 A;  1K0X A;  3C0C A;  1KSW A;  2M51 A;  2BTT A;  1H3H A;  3H0H A;  2JW4 A;  1HSQ A;  1X2Q A;  2V1Q A;  2SEM A;  1ZSG A;  3EG2 A;  1ABO A;  1AVZ C;  1WXB A;  5IXF A;  5ECA A;  2JTE A;  3SEM A;  3VS0 A;  4M4Z A;  2O9V A;  2RNA A;  3I9Q A;  1W1F A;  4KRT A;  1ZLM A;  2L3S A;  1AWJ A;  1WYX A;  1A0N B;  3VRY A;  1NEG A;  1UTI A;  4HVU A;  2DL4 A;  1BBZ A;  2KT1 A;  1M27 C;  4J9I A;  1M30 A;  1AWO A;  3JV3 A;  2ENM A;  3FJ5 A;  3M0Q A;  1BK2 A;  1SRM A;  3REA B;  3SHW A;  1K9A A;  2BZ8 A;  1JXM A;  3TSZ A;  2J06 A;  2HCK A;  4RTT A;  2KYM A;  2ROT A;  3CQT A;  1GCP A;  1MV3 A;  1W6X A;  1BU1 A;  2EGA A;  2KGT A;  1PRM C;  2KRM A;  2DRK A;  2W0Z A;  2YUN A;  1X27 A;  4CC7 A;  4J9H A;  2JMC A;  3LH5 A;  4CC2 A;  4K11 A;  4FSS A;  4J9C A;  4OMQ A;  1TG0 A;  1GRI A;  2C0I A;  2EKH A;  2CT3 A;  2EW3 A;  2YUP A;  1G2B A;  1S1N A;  2MCN A;  3UF4 A;  2KYB A;  3A98 A;  4CC3 A;  2HSP A;  2BZY A;  2VWF A;  4AFQ C;  1Z9Z A;  5EC7 A;  1CSK A;  4RTX A;  2LP5 A;  3PVL A;  1AZE A;  2RQT A;  1NYF A;  1AZG B;  3QWX X;  4J9G A;  1YNZ A;  2X3X D;  3NMZ C;  1ZX6 A;  2I0N A;  3NGP A;  2DVJ A;  2O31 A;  3O5Z A;  4IIO A;  2JXB A;  2V1R A;  1K1Z A;  3UAT A;  4J9D A;  1AEY A;  3NPF A;  2J6O A;  1QKX A;  2DRM A;  2O88 A;  2EYW A;  5IXB A;  1WIE A;  1YN8 A;  2RN8 A;  1NLP C;  3EHQ A;  2OJ2 A;  3PVQ A;  4JJB A;  2L3P A;  2PTK A;  2K79 A;  1SHF A;  2HEQ A;  1Z9Q A;  2OI3 A;  1V1C A;  3M0T A;  1GCQ A;  2D0N A;  4JPB W;  4Z88 A;  2F2V A;  1RUW A;  1BB9 A;  3H0F A;  1KFZ A;  4OML A;  1I07 A;  2J05 A;  1SSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...