1UJYA

Solution structure of sh3 domain in rac/cdc42 guanine nucleotide exchange factor(gef) 6
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
GSSGSSGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 6
publication title Solution structure of SH3 domain in Rac/Cdc42 guanine nucleotide exchange factor(GEF) 6
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ujyA00
1JU5C 2EBPA 1CSKA 2HCKA 1G2BA 1SEMA 4F17A 2AKLA 4OMLA 2JT4A 2CT3A 4DEYA 2EYWA 2K9GA 3I9QA 2BZXA 2D0NA 1M8MA 1SRLA 1NM7A 3PE0A 2F2XA 2A28A 2RF0A 2NWMA 1WFWA 4J9EA 5I22A 1K0SA 3TVTA 2DJQA 1UE9A 1GCPA 1NYGA 2RN8A 2SRCA 2IIMA 1K9AA 4D8DA 3QWYA 1UGVA 1WLPB 1RLPC 2KT8A 1T0HA 2FO0A 2X3WD 3UATA 3M0TA 2O88A 4AFQC 1WYXA 5L23A 4J9CA 1AWJA 2KEAA 1MV3A 2RQTA 3I35A 1UECA 3M0QA 2BZ8A 3FJ5A 2KRSA 2YUNA 4CC7A 1H92A 1SSHA 2O2OA 3CQTA 1QKWA 3M0PA 2J7IA 1KJWA 1BBZA 1QCFA 2JXBA 3R6NA 1YWOA 1BK2A 2FPDA 4GLMA 4AFUC 1AEYA 2GTOA 3RNJA 1YP5A 2KYMA 1M3CA 2F2WA 2EYXA 1ZUKA 2EKHA 4EIKA 1GCQA 1SPKA 2DRMA 2EW3A 2HDAA 1QWEA 1GBQA 2J6OA 3JV3A 2JW4A 3A98A 2RQRA 5GJWB 1AOJA 2ENMA 2MOXA 2GTJA 2ROLA 2DL4A 2JM8A 2MCNA 2J6FA 1CKAA 4ESRA 2H8HA 2GBQA 2EGCA 3QWXX 1OPLA 1FYNA 4AFZC 3M0SA 3NMZC 4RTYA 2DILA 2A08A 2YSQA 1GL5A 1K4US 2RQUA 4HCKA 1VYTA 2O9VA 2LCSA 2B86A 1AD5A 1KSWA 2DMOA 2ABLA 1EFNA 4JJDA 2J05A 1W1FA 2K2MA 4LE9A 2CSQA 2J06A 1UUEA 4RTXA 2ROTA 1X6BA 3O5ZA 2J6KA 3EG2A 2YUQA 3TSWA 2G6FX 3THKA 1WI7A 1T3LA 1YWPA 2RQWA 4RTUA 1Z9ZA 2FRWA 4KRTA 2DYBA 3H41A 1AZEA 1BB9A 2DF6A 2C0OA 2DA9A 1CKBA 2KROA 2CUBA 4R0KA 1B07A 2AZSA 2EGEA 2P4RA 2DBKA 2LMJA 2PTKA 3VS2A 1WXTA 3I5SA 1X2QA 1UJ0A 1Z9QA 2KRNA 4J9IA 2JM9A 1X2KA 1GBRA 1VYUA 3UF4A 2ED1A 3ZL7C 1QWFA 1LCKA 1UJYA 2HSPA 1QLYA 4LNPA 2KXDA 1NG2A 2EGAA 2D8HA 3UA6A 1Y57A 1PKSA 2I0NA 2YUPA 1U5SA 4GBQA 4ORZA 3REAB 1M3AA 2GNCA 2L0AA 2LZ6B 4E6RA 4JZ4A 1XOVA 2LJ0A 1OPKA 1T0JA 2W0ZA 4RUGA 4RTZA 2V1RA 1K1ZA 4HVVA 2X3XD 2F2VA 3PVQA 1ZLMA 1FMKA 2LJ1A 4JPBW 2LX7A 1GCQC 2E5KA 3PVLA 2OI3A 1NYFA 2AKKA 1WA7A 1JEGA 2D1XA 2ED0A 4Y92A 1UHFA 3EHRA 2RPNA 2O9SA 5IHIA 2GQIA 2CSIA 4ZNXA 1PWTA 5IHKA 3VS1A 2L2PA 1ABQA 2FRYA 1K76A 4HVWA 1AWOA 1UHCA 2M0YA 2FPFA 2JMCA 2K3BA 2GGRA 1T3SA 4J9HA 2JS2A 1VA7A 4X1VA 2DLPA 2YT6A 3IQLA 2ESWA 3H0FA 3KFVA 1GFCA 3LH5A 5IH2A 2SEMA 5EC7A 1PRMC 4RTWA 2LNHB 2DL5A 1ARKA 1YNZA 2L3PA 4LN2A 2O31A 1JXMA 1ZUUA 1NEGA 2V1QA 1MUZA 1X6GA 5FWCA 1E6HA 5IXBA 1UDLA 2JTEA 1ZSGA 1JQQA 2BZYA 4OMOA 2PNIA 4J9GA 3EHQA 4AG1C 1SHFA 3M0RA 1ZUYA 1GRIA 1AWWA 1KFZA 1UG1A 3EG3A 3RBBB 2AK5A 2CDTA 1ZX6A 1A0NB 2EQIA 1PNJA 4J9BA 1H3HA 3GBQA 2RQVA 1Y0MA 1M3BA 4HVUA 3EGUA 2CH4A 3SEMA 5HCKA 4WCIA 4OMQA 3NGPA 3UA7A 1JO8A 2L3SA 2C0TA 1KIKA 2K6DA 4OMNA 1NLPC 2EVRA 1MV0B 1HSQA 2CT4A 1OV3A 1WX6A 3NPFA 1VYVA 2AZVA 1WXBA 1SHGA 2KXCA 2M51A 2K7AA 3NHNA 2LQWA 1M30A 1ZBJA 4CC4B 1RI9A 1WDXA 4F16A 1X27A 4Z88A 2YDLA 1YCSB 4DEXA 3U23A 4Z8AA 2W10A 4K11A 2CREA 4AFSC 2KGTA 3EG0A 1WIEA 2LJ3A 2KR3A 1HJDA 3VRYA 5FW9A 3VS4A 1W70A 5I11A 3VRZA 2ECZA 2JMAA 2DE0X 1AVZC 1TUCA 4A63B 3M0UA 1I0CA 3VS6A 2DL8A 1PKTA 4AG2C 3ULRB 1IO6A 3TSZA 2D8JA 2OJ2A 1AWXA 1UTIA 2MIOA 2DL3A 2DRKA 2JS0A 2KBTA 2QDLA 2DL7A 2OAWA 1PRLC 2C0IA 3SHWA 4CC3A 2KRMA 2EYYA 4FSSA 2RNAA 2A36A 1JXOA 5ECAA 2CH4W 3VS7A 1WXUA 1W6XA 1RUWA 1H8KA 4QT7A 2LQNA 4J9FA 4JZ3A 4CC2A 1QKXA 4HXJA 4RTTA 1X69A 1I1JA 5IXFA 4JJBA 1GFDA 2KT1A 5FWBA 4IIOA 5GJVB 2LP5A 4JJCA 1HD3A 1I07A 2EYZA 2DNUA 2A37A 1OEBA 2KNBB 3C0CA 2CUDA 1G83A 2DM1A 1YN8A 3H0HA 4F14A 4LUDA 1NLOC 3H0IA 3EG1A 1N5ZA 3REBB 1B3QA 2FEIA 4LUEA 2HBWA 3VS3A 1X43A 1E6GA 4IIMA 2K79A 1RLQC 4OMMA 1OOTA 2DX1A 1K0XA 1ABOA 4J9DA 1PHTA 2L3QA 1NEBA 2KYBA 2FG0A 2VKNA 1UFFA 4OMPA 2RMOA 2YUOA 2VVKA 1J3TA 1TG0A 2DVJA 5IHNA 1SRMA 2BTTA 2HEQA 2VWFA 3VS5A 1M27C 1U06A 4D8KA 2NUZA 2KE9A 1U3OA 2FPEA 3I5RA 3VS0A 1E7OA 1S1NA 4M4ZA 2EPDA 4Z89A 2PZ1A 1V1CA 1BU1A 2DBMA 2XMFA 1TUDA 4RTVA 1AZGB
chains in the Genus database with same CATH superfamily
1UGQB 2EBPA 5LJ5e 4F17A 1G2BA 1SEMA 4OMLA 2CT3A 2EYWA 2K9GA 4J6XA 3I9QA 1KD1R 2F2XA 2NWMA 1WFWA 4J9EA 1FMWA 4EMKA 1K0SA 3JB9H 2QA4T 2YXYA 3RKXA 1VOMA 3ZBDA 1G3WA 1QW1A 4PNOA 1NYGA 3A8GB 4XTUA 3KBGA 5KYNA 4D8DA 4BI4A 4M78D 4M78C 1UGVA 1QVFS 3CXCA 1BYMA 1WHLA 2LQ8A 2ZPFB 3SWNA 4M78A 4J9CA 3A8LB 1I8FA 5CIUA 2RQTA 3QPHA 3LH0A 4M78F 4CC7A 1H92A 2O2OA 3CQTA 1MMAA 4PLLA 2EAYA 2J7IA 1M1KR 1WGSA 1YWOA 2NUTB 3UWNA 1W2BA 5LJ3h 2HZYA 2XIDA 4OGEA 4ZGJB 1LOJA 2KYMA 3KUFA 2R5MA 4XU1A 2LC4A 4MMKA 4E7SA 2QEXQ 1GCQA 1YFNA 2EW3A 2HDAA 1QWEA 4ZGEB 4O6JA 2JW4A 2I2LA 3CMAA 1OQKA 2X4JA 4DBHA 2MOXA 3CCVT 3S3NA 2DL4A 2JM8A 1K73U 2J6FA 1CKAA 3UDCA 2MI6A 4ELYC 1OPLA 4RTYA 1FX7A 1NPRA 1PD1A 2DETA 2LDMA 3L1AA 3JRZA 2E12A 1SKUB 3BDLA 3A5ZB 3HFNA 2GQVA 3GPLA 1KSWA 1VQ6Q 2QEXT 3CCRT 2DJZA 4JJDA 4HKEA 3CPFA 3CC4A 1QP3A 2K2MA 4A4FA 2J06A 1UUEA 1YJ9Q 2Y4YA 2ZCFB 2WSFE 2YHTA 3OA6A 2ROTA 1VQLQ 1WHJA 3PT9A 4BI8B 4IKFA 2A3LA 3TSWA 2G6FX 3X24B 1YITQ 3M4YA 1WI7A 1T3LA 2RQWA 5FROA 2FRWA 1QVFP 1Y96B 4RCBA 5HY6A 4X9DA 3V8JA 5CKDA 2DF6A 3S3OA 2C0OA 2DA9A 4TVRA 4QKUA 4UC4A 2KROA 1VQ8A 3OS2A 1B07A 2EGEA 3QDRB 3HRUA 2LMJA 1VQ6T 1OZ2A 5D7UA 3VS2A 2DTIA 3M56A 2KRNA 2M1HA 5KCHA 5GAN3 1YJ9T 2L5QA 3M58A 2VYTA 1VQ8T 2CP0A 3HTRA 3UF4A 3VJPA 2ED1A 3ZL7C 2FHDA 1YITT 3BDUA 3HRSA 2KXDA 2EGAA 4OB3B 2RJEA 2D8HA 4J6YA 1RAFB 4RMOA 3CMEQ 1Y57A 2I0NA 2YUPA 3JCMP 2XKOC 4KUDK 3REAB 2GNCA 2LZ6B 1OPKA 1T0JA 4M75E 2OTLQ 2HSEB 4CI0C 1MHNA 1ZBXA 4JLIA 2X3XD 4A4HA 3PVQA 4C0ZA 2E3HA 2XDPA 1Q7YU 3RESA 3MCAB 2E5KA 2A7YA 3PVLA 4F7UE 4EMKB 1WA7A 3EGXB 4M7DE 4LD6A 4MZTA 4A4KA 1UHFA 3VYHB 2ZPEB 5GAOm 3CMET 2O9SA 5IHIA 4LDWA 2GQIA 3OYHA 1KD1U 4HCCA 1QVGA 3VS1A 3RDVA 4PJNA 2HNIA 2DXUA 4HVWA 1AWOA 2OTLT 4J5YA 1U8RA 3N5BB 3OY9A 4GLKA 2X51A 4KT0E 2K3BA 3SWNB 2GGRA 4LD9K 1T3SA 4X1VA 1D0XA 1HYOA 2DERA 4N0AC 1N8RR 1GFCA 2JTMA 4XU0A 4RTWA 2DL5A 2DTOA 3RR6A 3QDFA 4OB2B 1MUZA 4QVZA 2X35A 3MEWA 1OI1A 2ZZDA 3QO3A 2MF2A 4OMOA 4PJOD 1M1KU 4PJOC 2RI3A 3EFOA 2KY9A 3FDRA 2EJ9A 2ZPBB 3JCMc 3KXTA 1ZUYA 4IUTA 1GRIA 2GCXA 5FLXE 1K9MC 2RHYA 1ZX6A 2CYZB 1M3BA 4HVUA 4PJOF 2CH4A 4II1A 4PLIA 4WCIA 2ZGWA 5GAN4 2OTJA 4M77D 4L59A 2K6DA 4M77C 1YJNQ 5GAMh 4OP0A 3OYDA 4ANJA 1PCXA 4R56A 1ZA1B 5KYUB 1SHGA 2M51A 4HT8A 2K7AA 3NHNA 4M78E 5EG2A 2LQWA 1M30A 4M77F 1KQSS 4ZN1A 4Z88A 4C5IA 1TH7A 3M59A 4OGCA 2JZ2A 1XJWB 5CKFA 4M7AC 4Z8AA 2DXBA 1BCOA 4AFSC 1IZ6A 4E7LA 3EG0A 1WIEA 1Y71A 1HJDA 3UPUA 4M7AA 5I2MA 1GXIE 1YI2A 4PJMA 4A4GA 3OS1A 3A8MB 4M7AF 5J26A 1I0CA 2MWPA 1PKTA 1VQPA 2OJ2A 2VGMA 1UTIA 1NBEB 2DRKA 3FEOA 1PG5B 1X6OA 2DL7A 5CK9A 2OAWA 2VUBA 4FL6A 2QI2A 4CC3A 2E10A 1VQOA 1N9SA 4FSSA 1HK9A 1XNIA 2RHZA 1JXOA 1K73C 3R6OA 2DEQA 2E5QA 4J9FA 4JZ3A 3HFOA 5KYXA 4HXJA 4RTTA 1I5OB 2HKQB 1WHHA 3LWIA 4FSXA 2BKDN 1NJIC 3OW2S 1Q82R 5LJ3j 2DD5A 2MPXC 2DNUA 2PVDB 3HKSA 3G71A 1ZQ1A 3CC2T 1JJ2P 3NFCA 3EFSA 4JJNK 2CUDA 3MP8A 1MMGA 4KUIA 2DM1A 4WTOB 4F14A 5I21A 3H0IA 1N5ZA 1KQSP 1O75A 5M9OA 3G71T 2HL5C 4IIMA 2RI5A 3CCMQ 3I55Q 1RLQC 4C0FA 5GMKm 2COZA 3GLXA 2D0QB 1K0XA 1VUBA 1NPPA 1YCYA 4J9DA 1Q86R 1ZSZB 1F1BB 3CD6Q 3J81E 3CEYA 3BFMA 2QQAA 5L8RE 4C8QG 5J39A 4PL6A 2BTTA 2DKGA 3VS5A 3OBYA 3MEUA 1WHMA 2KE9A 2RJFA 3VS0A 3OYJA 1E7OA 1VQ7Q 1S1NA 4M4ZA 2QTXA 4Z89A 4C0DB 2XK0A 2VXFA 2NLUA 5CQYA 1N8RU 2GFUA 1BU1A 4QVDA 4XTVA 3CCMT 3I55T 4OMFB 2L8DA 4E7KA 2AKLA 3O8VA 2JT4A 3CXCS 1OU9A 3EFOB 4PFOA 3I56A 2RJCA 1SRLA 3QHSA 2DVEA 4C8QA 5A2QE 2H3JA 1JJ2A 2FZCB 1X01A 1YHQQ 3CC7A 3CCLQ 1UE9A 1M90R 5LJ5h 1AT1B 1K9AA 2O01E 2P84A 3MKDA 1YIJQ 1Q95G 2ZPGB 1W2BS 1VQ7T 1WLPB 1IB8A 3OMGA 3D7SB 2KT8A 3OQ5A 4XTYA 3V7CA 3M0TA 1IHVA 3BE3A 2KQWA 2O88A 1QCNA 1IGUA 1NJIR 2DK3A 5L23A 2HAXA 3CCSA 1KD1C 7AT1B 2BZ8A 2D9TA 5KE3A 1LNXA 3CCQQ 3JCMW 4IUPA 3OS5A 3CCJQ 5IN1A 1QKWA 3M0PA 3M9QA 1KJWA 1QCFA 2YRVA 1VQKA 1VQNA 2KMTA 1VQ5A 2CP7A 5GAN2 3OSSC 2HL3A 2F2WA 1YIJT 1BI0A 2EKHA 3JCMh 2JNGA 3G6EA 1SPKA 2KI7A 3SDZA 2RQRA 3S3MA 1P92A 3RUXA 2GTJA 4E47A 2EJFA 2H8HA 2GBQA 2KSSA 4PJOE 3CCQT 1FYNA 3CCJT 1GL5A 2MYSA 4B9XA 4NL3A 3WVEB 1K4US 3CCEQ 3CXCP 2O9VA 3TQ7P 3OYNA 3S6WA 1VQ4Q 2QTVA 1EFNA 2VV5A 4M77E 2J05A 1VQ9A 1B34A 2F5KA 5GAN7 2LT4A 3M5AA 2A0FB 2NUPA 2HQHA 3O5ZA 1LVKA 2J6KA 2YUQA 4ZGDB 1W2BP 2E64A 2K5FA 3MEAA 4RTUA 2DYBA 4MZPA 2X4XA 3G1JA 1AZEA 1BB9A 1S72Q 4M7AE 3CCET 1Q82U 2QXFA 2QA4A 1UEBA 2IPOB 4R0KA 1ZHIA 3GIBA 3QKJA 1PC0A 4EMKC 2DEUA 1VQ4T 2PTKA 4NOYA 1UJ0A 3SB2A 1SSFA 2JM9A 3EGXA 4FIBA 4BI3A 3GOXA 3OSVA 1EZZB 1QWFA 3PTAA 5GAMj 4E7JA 1UJYA 1MGQA 1NG2A 3A8OB 3SWNC 1M2VA 4J6WA 3UA6A 1S72T 1Q86U 1PKSA 2HD0A 4GBQA 1BCMA 4JDSA 4E6RA 4JZ4A 1WZOA 2LJ0A 2W0ZA 4PJLA 4AMCA 4RTZA 1QVGS 3DB4A 3PMIA 3HRTA 1OU8A 2F2VA 1RAAB 4VUBA 3QZ9B 2E6NA 1FMKA 2LJ1A 3EGDB 4PK4A 3A8HB 5I2SA 3CCVA 1GCQC 2LVMA 2Y90A 4C8QB 1D3BA 2AKKA 4MDXA 1JEGA 1UGSB 2EQJA 4EDUA 2WACA 2ED0A 3EHRA 2CSIA 5IHKA 1ABQA 1Y7XA 1QMCA 1K76A 1G3TA 2M16A 1M90U 2R58A 3META 2JMCA 3TCJA 1VA7A 5CQXA 2DLPA 2QEXA 4DQ2A 3IQLA 5KE2A 3CCRA 3H0FA 1BIBA 2AHJB 5IH2A 2SEMA 4GY5A 5EC7A 2LNHB 3JB9J 1YNZA 2ATCB 1NJIU 4LN2A 5KYUA 1JXMA 3HL8A 2V1QA 3ZEHA 4LXCA 4HA8A 2JTEA 3E19A 3ME9A 2K3YA 2CP5A 2P0QA 1KFZA 1N8RC 1UG1A 2O4XA 5CKHA 2IG0A 1VQ6A 5C6SA 2PU9B 4J9BA 2LX9A 2FL7A 3A1PA 3EGUA 3GNGA 3SEMA 1YJ9A 1KHIA 3M53A 2DZCA 1Q81R 1VQLA 2EIFA 1QVGP 1KIKA 1NLPC 3QJ6A 1R77A 1YITA 2RO0A 1MV0B 1HSQA 3FB9A 3JSCA 2CT4A 3TREA 3RKWA 3EAEA 1WX6A 1JBMA 2AZVA 1K8AR 5A0DA 4IUVA 1BI2A 1VQLT 4HT9A 1B34B 1X27A 4XQ3A 1R0BG 2NUPB 4DEXA 2VGNA 4JRQA 2FVUA 2W10A 2JUFA 4K11A 2G3RA 4XAXB 3Q1JA 5FW9A 2QQ9A 5I11A 2CZ1B 2ECZA 5GMKj 3L42A 4A63B 1D09B 3FJPA 2FZGB 4XTXA 3ULRB 3TSZA 3CMEA 2DL3A 2JS0A 5LJ5j 5GANh 1SF9A 5LJ3e 1PRLC 3QG1A 3QXEB 2PVOB 3SHWA 2OTLA 2GFAA 2XICA 2A36A 4ME7A 3VS7A 1AHJB 1M2VB 1ZSZA 1RUWA 1H8KA 2LQNA 4DA4A 1YJWQ 1QKXA 2X9HA 3DLMA 1X69A 5GAOq 2LCCA 3QYGB 1GFDA 2EQMA 2EWNA 4E2FB 1NZ9A 5GJVB 4C0DC 2E4HA 1WPYA 4JUVA 4LDYA 3C0CA 1QVPA 3JCMQ 2QYZA 1KG1A 3RKYA 3H0HA 4J83A 3FIFA 4LUDA 5LJ3d 3QBYA 1D3BB 3EG1A 1C1AA 3OYEA 3REBB 1B3QA 3VS3A 2WSCE 2QK0A 2K79A 1YJWT 5LJ3f 3G4SQ 4OMMA 2FYKA 4BY6C 3EH1A 1PHTA 3CBPA 5J3BA 2D6FA 2KYBA 1LPLA 3VV0A 1Q82C 4OB1B 4OF1A 3DLLA 3CPWP 5C0MA 4PFZA 3OYLA 4ZTJA 3JCMV 1JJ2S 2NUZA 4IUQA 2FPEA 3I5RA 3QIIA 5LJ3g 1WQWA 2PZ1A 1V1CA 2R5AA 4DBRA 2DBMA 1TUDA 4RTVA 3G4ST 1Q86C 1CSKA 2HCKA 3V7RA 1YJNA 4DEYA 1KQ2A 4M7AD 3NTHA 1PSFA 2DIGA 4B6MA 3WXMB 1M8MA 2BE7D 1M4ZA 3PE0A 3WVDB 2RF0A 3AHUA 2O4XB 2V26A 1C6VX 4MZMA 1FXXA 1GCPA 3M57A 4FT4A 2SRCA 2PVGB 2RN8A 1YJNT 2MWOA 4N4GA 3C4SA 4QVCA 5HK3A 3ER0A 1T0HA 2X3WD 1MMDA 2DYIA 4HCBA 3CBOA 4F04B 1KHCA 4FW1A 1Q81U 1MMNA 1UGPB 1UECA 2V8IA 3M0QA 4DBFA 3FJ5A 2HQXA 1V76A 2CKKA 2KRSA 3C12A 4KH0B 3JCMJ 1IHWA 4ATOA 3QJYA 2X4WA 3CPWA 3MPUB 1M90C 2QASA 2JXBA 3R6NA 1K8AU 1BK2A 1BIAA 3LX7A 1VQMQ 1AEYA 3RNJA 3CC2A 1YP5A 1M3CA 3L2RA 1ZUKA 4EIKA 3VKIA 2DRMA 4C5GA 1GBQA 2J6OA 3JV3A 5GJWB 1AOJA 5KH6A 2XD0A 3C95A 1HXDA 4J8OA 4PFPA 3MP6A 2B8AA 3SFMA 2EGCA 4BACA 3QWXX 3NMZC 2DILA 3CBMA 2A08A 2YSQA 5FU6B 2LNVA 4BDZA 3NTKA 2DD4A 1VQMT 5GAOp 1D0YA 2LCSA 5GANf 2DO3A 2B86A 6AT1B 3PNWC 4KH1B 2RI2A 2RK2A 4D6WA 2CSQA 1I5LA 4Z02A 4FM4B 3OS0A 4RTXA 1X6BA 3E9GA 1OZ3A 3EG2A 3CCMA 3I55A 4A4EA 1YWPA 1Y07A 1Z9ZA 4KRTA 5GAMe 5CAIA 4XU3A 3HPWA 5KYWB 1RAIB 4JRPA 1M2OA 3CD6A 2KAFA 2MK5A 2CUBA 1WHGA 2XDDA 1TWBA 2AZSA 2OX7A 4C8QD 4C8QC 2P4RA 5GMKh 2XI9A 4JS5A 1UGRB 4FYYB 3EGDA 3I56Q 1WXTA 3CD6T 1M1GA 1X2QA 4J9IA 1VQ7A 2CGHA 2HBPA 4IURA 1GBRA 1YBYA 1VYUA 3UT1A 4C92G 2RJDA 4C8QF 2DAQA 4DOWA 3OYGA 5CKEA 4ELZC 5HKCA 1QLYA 5D6WA 4KULA 1KC8R 1U5SA 1N9RA 2CZ6B 5GAMd 3CCLA 1RAEB 4CRIA 1XOVA 3PFSA 3C94A 2QQSA 4RUGA 1YIJA 5GAMf 1K1ZA 1QCOA 4C92A 1YHQT 4M75G 4DOVA 3CCLT 4KGXB 1TUGB 2V8JA 2XDBA 4X9CA 4MDWA 4C92F 2RHXA 4JPBW 2LX7A 2CP6A 3X25B 4E7HA 3EG9A 4Y92A 3CCQA 2JN0A 4F7UG 3OYCA 3CCJA 2RPNA 4J7IA 2HKNA 3M4GA 5FU7B 4JS4A 1PWTA 5GANj 4M7DG 2L2PA 3L2QA 5GAMg 2XG8D 2FPFA 4M75A 4V2SA 2JS2A 3PGGA 4EPCA 2CP3A 1N27A 3LH5A 3F70A 3INZA 1ARKA 2YLCA 2L3PA 4FT2A 5DY9A 2O31A 5CKBA 2MMPA 8ATCB 2EKOA 4F7UA 1ZUUA 4KGZB 1G3SA 5D6YA 4M7DA 1UDLA 5CR2A 2DIQA 1H3ZA 1ZSGA 1JQQA 4M7DF 1QQJA 2PNIA 4J9GA 2K5IA 3EHQA 4AG1C 1G8XA 3CCUQ 3CCEA 2F1LA 1TOVA 1LJOA 3M0RA 4QQGA 3QSUA 3EG3A 3JB9G 4DBQA 3P8DA 2AK5A 1A0NB 1WQ7A 2M02A 2EQIA 4BUGA 1VQ4A 2K4YA 1H3HA 3GBQA 3RERA 1Y0MA 3OYIA 1R0CB 5HCKA 2VASA 3RIRA 4OMQA 3UA7A 1JO8A 4OMNA 5KYYB 1W4SA 1PSEA 4XTZA 1XTDA 3NPFA 1VYVA 1S72A 3CCUT 3H8ZA 4CC4B 1RI9A 3OB9A 1YCSB 2XHCA 3JB9F 4M78G 3U23A 3LGLA 4FCYA 2CREA 1Q81C 4XTWA 2P0PA 2KGTA 3HSBA 5HK0A 2LJ3A 4NL2A 3VS4A 1W70A 3GF5A 3VRZA 4FYVB 1AVZC 1TUCA 5GAN6 4LDXA 1K8AC 2CZ0B 3VS6A 4AG2C 3RMSA 3NTIA 2MIOA 3G7ZA 2Y4XA 3QZ5B 3CCVQ 2C0IA 2FB7A 2KRMA 2EYYA 5LL6S 1FMVA 4KGVB 3JCMe 3JCMX 3TU4K 3CMAQ 5LJ5d 1WXUA 4RCCA 2KDSA 1OULA 4L5GA 2EQKA 4E7ZA 3E9FA 4CC2A 5LJ5f 2KT1A 1TTHB 4C0GA 3QYHB 3CCRQ 4FYXB 2FZKB 4IIOA 1WJQA 1KC8U 3P8HA 1EIFA 1HD3A 1I07A 1NE8A 2EYZA 2KK4A 2M0OA 4C92B 2CS7A 2KNBB 3BW1A 4PKCC 2AIRB 2K57A 1G83A 3HHTB 5CO7A 1YN8A 1TSFA 2EFIA 5AYFA 1RACB 3CC4Q 4Y91A 3CMAT 5LJ5g 3EG9B 2FEIA 3PMTA 4XU2A 3JCMd 1OOTA 2DX1A 1ABOA 1VIEA 1NEBA 2FG0A 4C8QE 3JCMf 1MNEA 4OMPA 2RMOA 4M75B 2YRDA 1VQ8Q 2YUOA 2VVKA 2L89A 1J3TA 1TG0A 2DVJA 2VWFA 3TEEA 4QQDA 1M27C 4D8KA 1U3OA 3CC4T 4JRKA 2EPDA 4F7UB 1M5Q1 1UB4A 2XMFA 3L2VA 4M7DB 2WSEE 1AZGB 1JU5C 3JCMg 3E2UA 1TXQA 2RD1A 4C5HA 5AT1B 1N6AA 3OBWA 2BZXA 3OYMA 4IUUA 4C92E 2D0NA 5IAYA 1NM7A 2K2VA 2A28A 5I22A 3TVTA 1KQ1A 4N4HA 2DJQA 4EMGA 2Z0WA 1IGQA 2E6ZA 1WHKA 1KK7A 2IIMA 3CPWS 4NS5A 3X28B 2YRCA 3QWYA 2JTFA 1RLPC 5FU6C 2FO0A 3UATA 4B9WA 4AFQC 1WYXA 1AWJA 2KEAA 1MV3A 2X4YA 3FLGA 3I35A 2YUNA 3T9NA 1SSHA 1ZSZC 2BE9B 1BKBA 4L6V5 3DB3A 1BBZA 2JJ9A 4GLMA 2FPDA 4AFUC 2GTOA 3OYYA 4O5VA 1QVFA 1TS9A 3JAME 1H641 3H9NA 1RADB 2EYXA 2H3EB 3J80E 1M8VA 5DLQE 3GP8A 4EMHA 3LW5E 3ZFJA 3A98A 2ENMA 3OMCA 2ROLA 2VC8A 5KYWA 1I4K1 2MCNA 1YJWA 4ESRA 2K3XA 4LDUA 4AFZC 1JRIA 3M0SA 4M78B 3MHXA 4RG2A 3L2ZA 5GAOr 4KBMB 2L3RA 4PJOG 2DXCA 1D0ZA 2YLBA 2DZ9A 2RQUA 1PD0A 4HCKA 1VYTA 1EX4A 4N0AA 2RHUA 4C5EA 1TU0B 4BE1A 1AD5A 5GAN8 2DMOA 2ABLA 1W1FA 4LE9A 1M1FA 1JB0E 2LTOA 4X34A 4P5NA 2OTJQ 4M77G 4OB0B 5GMKi 4BB7A 5DLOA 3G4SA 3THKA 2EJGA 4J7FA 3JCMb 3LLRA 3E1SA 4PJOA 3GNFB 3H41A 1D1AA 3EH2A 1IXDA 1IREB 4ZTFA 4BDYA 1CKBA 3L2UA 2RK1A 3URGA 2RM4A 5GAOl 2DFUA 2DBKA 4FU6A 4M7AG 2OAUA 2EYQA 3I5SA 1Z9QA 4M77A 2ZPHB 1X2KA 5FU7C 2PQWA 2OTJT 3V8LA 1YI2Q 2HQEA 5FRMA 2QDYB 1LCKA 3M54A 1IRXA 2HSPA 1RL2A 1WJSA 4LNPA 1ZA2B 3OYKA 2QQBA 2R57A 1VQPQ 5CCAA 3SD4A 3V8KA 5KCOA 3JB9I 3OYFA 1BI1A 4ORZA 3L2WA 1O9SA 1M3AA 4RG8A 2IVWA 5GANe 2L0AA 1VQOQ 2LRQA 2F5TX 1RABB 2V1RA 4YTLA 2P0KA 4HVVA 2MAMA 2E41A 1YI2T 1ZLMA 2F69A 2LT1A 2OI3A 1NYFA 3CC2Q 1U1TA 1OX8A 1KC8C 2D1XA 1RAGB 4MMLA 1VQPT 3P8BB 4ZN3A 4RKUE 4E7IA 3MEVA 2JOYA 4BE2A 4ZNXA 3ASKA 3G71Q 4JRIA 1G5VA 1VQOT 2FRYA 1VQMA 3FRNA 4PJJA 1UHCA 2M0YA 4BE0A 2DTHA 4J9HA 3VUZA 2E65A 2YT6A 1K9MR 5GANd 1X75C 2ESWA 5D6XA 5KYYA 3KFVA 5GAN5 1PRMC 2COWA 2YWWA 1NEGA 3H6ZA 3LWHA 1X6GA 5FWCA 1E6HA 5IXBA 1B7TA 2BZYA 2E3IA 4JLGA 1ACMB 5GAOn 1SHFA 2COYA 3MO8A 1AWWA 3MJXA 1I81A 3RBBB 2RH2A 2CDTA 1U1SA 1WNLA 3HP9A 1PNJA 5GANg 2RQVA 2C06A 2XU8A 4WF2A 3PIPA 2EQUA 3NGPA 2L3SA 2C0TA 2AT1B 2EVRA 2DPPB 2PUKB 3OYBA 3VUBA 1WJRA 3BY7A 2K5LA 1OV3A 4AT1B 1WXBA 3CC7Q 3J7AF 2KXCA 1OYXA 2ZAEA 1ZBJA 2GF7A 9ATCB 1WDXA 1DJ7B 4F16A 2JVVA 1R8OB 5A0GA 2YDLA 4N4IA 2BIVA 2NUTA 3MP1A 2ZPIB 2KR3A 2P4TA 3VRYA 1YHQA 4PJOB 4Y28E 3OYAA 1K73R 3RMQA 2BUDA 2JMAA 2DE0X 4C92D 3CCSQ 4C92C 4QQ6A 2LCLA 4BY6B 3M0UA 4R55A 3I56T 2DL8A 1KQSA 1Q7YC 1IO6A 4A53A 1QP2A 3OW2P 2D8JA 2PUOB 1AWXA 3CC7T 5GMKl 1G3YA 1VQKQ 1VQNQ 1VQ5Q 2KBTA 1SG5A 2QDLA 3M55A 2RA2A 3LGFA 4BD3A 4M77B 1D1CA 2M9UA 2RNAA 1MNDA 3G6EQ 2CP2A 3EFRA 2QQRA 5IT9E 1BI3A 5FRNA 3PIOA 5ECAA 2CH4W 1XQHA 1OX9A 4M75D 1W6XA 3X20B 4M75C 2DXTA 2E70A 2QGFB 5DM7R 4QT7A 3CCST 4A54A 5IXFA 1I1JA 4JJBA 3VYGA 4M7AB 1RAHB 5FWBA 3FC3A 3V7SA 5A0LA 4M75F 1VQKT 2CZ7B 1VQNT 1VQ5T 4JJCA 2LP5A 2A37A 4M7DD 1Y96A 4LDVA 4M7DC 4FYWB 1OEBA 5CVIA 1PM3A 3G6ET 1FWZA 3X26B 1M1KC 3QUIA 1V29B 1VQ9Q 4F7UF 2VB6A 1NLOC 2QGGA 2KVQG 2V8KA 2HMAA 4LUEA 2HBWA 1X43A 1E6GA 3OW2A 2VXEA 2L3QA 1C0MA 4OVAA 4QW2A 1D1BA 1M9SA 2VKNA 5KYXB 1UFFA 2QA4Q 3CCUA 3AT1B 5IHNA 2RHIA 1SRMA 4Q5WA 2HEQA 2LQKA 3LYIA 3VU3C 5GMKe 1RI0A 1U06A 2E1HA 3JB9D 1VQ9T 4HCZA 8AT1B 2QG9B 1VIFA 2RB6A 4XK8E 1Q7YR 1K9MU 2NYSA 4FW2A 2QAZA 3DKMA
chains in the Genus database with same CATH topology
1JU5C 2EBPA 1CSKA 2HCKA 1G2BA 1SEMA 4F17A 2AKLA 4OMLA 2JT4A 2CT3A 4DEYA 2EYWA 2K9GA 3I9QA 2BZXA 2D0NA 1M8MA 1SRLA 1NM7A 3PE0A 2F2XA 2A28A 2RF0A 2NWMA 1WFWA 4J9EA 5I22A 1K0SA 3TVTA 2DJQA 1UE9A 1GCPA 1NYGA 2RN8A 2SRCA 2IIMA 1K9AA 4D8DA 3QWYA 1UGVA 1WLPB 1RLPC 2KT8A 1T0HA 2FO0A 2X3WD 3UATA 3M0TA 2O88A 4AFQC 1WYXA 5L23A 4J9CA 1AWJA 2KEAA 1MV3A 2RQTA 3I35A 1UECA 3M0QA 2BZ8A 3FJ5A 2KRSA 2YUNA 4CC7A 1H92A 1SSHA 2O2OA 3CQTA 1QKWA 3M0PA 2J7IA 1KJWA 1BBZA 1QCFA 2JXBA 3R6NA 1YWOA 1BK2A 2FPDA 4GLMA 4AFUC 1AEYA 2GTOA 3RNJA 1YP5A 2KYMA 1M3CA 2F2WA 2EYXA 1ZUKA 2EKHA 4EIKA 1GCQA 1SPKA 2DRMA 2EW3A 2HDAA 1QWEA 1GBQA 2J6OA 3JV3A 2JW4A 3A98A 2RQRA 5GJWB 1AOJA 2ENMA 2MOXA 2GTJA 2ROLA 2DL4A 2JM8A 2MCNA 2J6FA 1CKAA 4ESRA 2H8HA 2GBQA 2EGCA 3QWXX 1OPLA 1FYNA 4AFZC 3M0SA 3NMZC 4RTYA 2DILA 2A08A 2YSQA 1GL5A 1K4US 2RQUA 4HCKA 1VYTA 2O9VA 2LCSA 2B86A 1AD5A 1KSWA 2DMOA 2ABLA 1EFNA 4JJDA 2J05A 1W1FA 2K2MA 4LE9A 2CSQA 2J06A 1UUEA 4RTXA 2ROTA 1X6BA 3O5ZA 2J6KA 3EG2A 2YUQA 3TSWA 2G6FX 3THKA 1WI7A 1T3LA 1YWPA 2RQWA 4RTUA 1Z9ZA 2FRWA 4KRTA 2DYBA 3H41A 1AZEA 1BB9A 2DF6A 2C0OA 2DA9A 1CKBA 2KROA 2CUBA 4R0KA 1B07A 2AZSA 2EGEA 2P4RA 2DBKA 2LMJA 2PTKA 3VS2A 1WXTA 3I5SA 1X2QA 1UJ0A 1Z9QA 2KRNA 4J9IA 2JM9A 1X2KA 1GBRA 1VYUA 3UF4A 2ED1A 3ZL7C 1QWFA 1LCKA 1UJYA 2HSPA 1QLYA 4LNPA 2KXDA 1NG2A 2EGAA 2D8HA 3UA6A 1Y57A 1PKSA 2I0NA 2YUPA 1U5SA 4GBQA 4ORZA 3REAB 1M3AA 2GNCA 2L0AA 2LZ6B 4E6RA 4JZ4A 1XOVA 2LJ0A 1OPKA 1T0JA 2W0ZA 4RUGA 4RTZA 2V1RA 1K1ZA 4HVVA 2X3XD 2F2VA 3PVQA 1ZLMA 1FMKA 2LJ1A 4JPBW 2LX7A 1GCQC 2E5KA 3PVLA 2OI3A 1NYFA 2AKKA 1WA7A 1JEGA 2D1XA 2ED0A 4Y92A 1UHFA 3EHRA 2RPNA 2O9SA 5IHIA 2GQIA 2CSIA 4ZNXA 1PWTA 5IHKA 3VS1A 2L2PA 1ABQA 2FRYA 1K76A 4HVWA 1AWOA 1UHCA 2M0YA 2FPFA 2JMCA 2K3BA 2GGRA 1T3SA 4J9HA 2JS2A 1VA7A 4X1VA 2DLPA 2YT6A 3IQLA 2ESWA 3H0FA 3KFVA 1GFCA 3LH5A 5IH2A 2SEMA 5EC7A 1PRMC 4RTWA 2LNHB 2DL5A 1ARKA 1YNZA 2L3PA 4LN2A 2O31A 1JXMA 1ZUUA 1NEGA 2V1QA 1MUZA 1X6GA 5FWCA 1E6HA 5IXBA 1UDLA 2JTEA 1ZSGA 1JQQA 2BZYA 4OMOA 2PNIA 4J9GA 3EHQA 4AG1C 1SHFA 3M0RA 1ZUYA 1GRIA 1AWWA 1KFZA 1UG1A 3EG3A 3RBBB 2AK5A 2CDTA 1ZX6A 1A0NB 2EQIA 1PNJA 4J9BA 1H3HA 3GBQA 2RQVA 1Y0MA 1M3BA 4HVUA 3EGUA 2CH4A 3SEMA 5HCKA 4WCIA 4OMQA 3NGPA 3UA7A 1JO8A 2L3SA 2C0TA 1KIKA 2K6DA 4OMNA 1NLPC 2EVRA 1MV0B 1HSQA 2CT4A 1OV3A 1WX6A 3NPFA 1VYVA 2AZVA 1WXBA 1SHGA 2KXCA 2M51A 2K7AA 3NHNA 2LQWA 1M30A 1ZBJA 4CC4B 1RI9A 1WDXA 4F16A 1X27A 4Z88A 2YDLA 1YCSB 4DEXA 3U23A 4Z8AA 2W10A 4K11A 2CREA 4AFSC 2KGTA 3EG0A 1WIEA 2LJ3A 2KR3A 1HJDA 3VRYA 5FW9A 3VS4A 1W70A 5I11A 3VRZA 2ECZA 2JMAA 2DE0X 1AVZC 1TUCA 4A63B 3M0UA 1I0CA 3VS6A 2DL8A 1PKTA 4AG2C 3ULRB 1IO6A 3TSZA 2D8JA 2OJ2A 1AWXA 1UTIA 2MIOA 2DL3A 2DRKA 2JS0A 2KBTA 2QDLA 2DL7A 2OAWA 1PRLC 2C0IA 3SHWA 4CC3A 2KRMA 2EYYA 4FSSA 2RNAA 2A36A 1JXOA 5ECAA 2CH4W 3VS7A 1WXUA 1W6XA 1RUWA 1H8KA 4QT7A 2LQNA 4J9FA 4JZ3A 4CC2A 1QKXA 4HXJA 4RTTA 1X69A 1I1JA 5IXFA 4JJBA 1GFDA 2KT1A 5FWBA 4IIOA 5GJVB 2LP5A 4JJCA 1HD3A 1I07A 2EYZA 2DNUA 2A37A 1OEBA 2KNBB 3C0CA 2CUDA 1G83A 2DM1A 1YN8A 3H0HA 4F14A 4LUDA 1NLOC 3H0IA 3EG1A 1N5ZA 3REBB 1B3QA 2FEIA 4LUEA 2HBWA 3VS3A 1X43A 1E6GA 4IIMA 2K79A 1RLQC 4OMMA 1OOTA 2DX1A 1K0XA 1ABOA 4J9DA 1PHTA 2L3QA 1NEBA 2KYBA 2FG0A 2VKNA 1UFFA 4OMPA 2RMOA 2YUOA 2VVKA 1J3TA 1TG0A 2DVJA 5IHNA 1SRMA 2BTTA 2HEQA 2VWFA 3VS5A 1M27C 1U06A 4D8KA 2NUZA 2KE9A 1U3OA 2FPEA 3I5RA 3VS0A 1E7OA 1S1NA 4M4ZA 2EPDA 4Z89A 2PZ1A 1V1CA 1BU1A 2DBMA 2XMFA 1TUDA 4RTVA 1AZGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU5 C;  2EBP A;  1CSK A;  2HCK A;  1G2B A;  1SEM A;  4F17 A;  2AKL A;  4OML A;  2JT4 A;  2CT3 A;  4DEY A;  2EYW A;  2K9G A;  3I9Q A;  2BZX A;  2D0N A;  1M8M A;  1SRL A;  1NM7 A;  3PE0 A;  2F2X A;  2A28 A;  2RF0 A;  2NWM A;  1WFW A;  4J9E A;  5I22 A;  1K0S A;  3TVT A;  2DJQ A;  1UE9 A;  1GCP A;  1NYG A;  2RN8 A;  2SRC A;  2IIM A;  1K9A A;  4D8D A;  3QWY A;  1UGV A;  1WLP B;  1RLP C;  2KT8 A;  1T0H A;  2FO0 A;  2X3W D;  3UAT A;  3M0T A;  2O88 A;  4AFQ C;  1WYX A;  5L23 A;  4J9C A;  1AWJ A;  2KEA A;  1MV3 A;  2RQT A;  3I35 A;  1UEC A;  3M0Q A;  2BZ8 A;  3FJ5 A;  2KRS A;  2YUN A;  4CC7 A;  1H92 A;  1SSH A;  2O2O A;  3CQT A;  1QKW A;  3M0P A;  2J7I A;  1KJW A;  1BBZ A;  1QCF A;  2JXB A;  3R6N A;  1YWO A;  1BK2 A;  2FPD A;  4GLM A;  4AFU C;  1AEY A;  2GTO A;  3RNJ A;  1YP5 A;  2KYM A;  1M3C A;  2F2W A;  2EYX A;  1ZUK A;  2EKH A;  4EIK A;  1GCQ A;  1SPK A;  2DRM A;  2EW3 A;  2HDA A;  1QWE A;  1GBQ A;  2J6O A;  3JV3 A;  2JW4 A;  3A98 A;  2RQR A;  5GJW B;  1AOJ A;  2ENM A;  2MOX A;  2GTJ A;  2ROL A;  2DL4 A;  2JM8 A;  2MCN A;  2J6F A;  1CKA A;  4ESR A;  2H8H A;  2GBQ A;  2EGC A;  3QWX X;  1OPL A;  1FYN A;  4AFZ C;  3M0S A;  3NMZ C;  4RTY A;  2DIL A;  2A08 A;  2YSQ A;  1GL5 A;  1K4U S;  2RQU A;  4HCK A;  1VYT A;  2O9V A;  2LCS A;  2B86 A;  1AD5 A;  1KSW A;  2DMO A;  2ABL A;  1EFN A;  4JJD A;  2J05 A;  1W1F A;  2K2M A;  4LE9 A;  2CSQ A;  2J06 A;  1UUE A;  4RTX A;  2ROT A;  1X6B A;  3O5Z A;  2J6K A;  3EG2 A;  2YUQ A;  3TSW A;  2G6F X;  3THK A;  1WI7 A;  1T3L A;  1YWP A;  2RQW A;  4RTU A;  1Z9Z A;  2FRW A;  4KRT A;  2DYB A;  3H41 A;  1AZE A;  1BB9 A;  2DF6 A;  2C0O A;  2DA9 A;  1CKB A;  2KRO A;  2CUB A;  4R0K A;  1B07 A;  2AZS A;  2EGE A;  2P4R A;  2DBK A;  2LMJ A;  2PTK A;  3VS2 A;  1WXT A;  3I5S A;  1X2Q A;  1UJ0 A;  1Z9Q A;  2KRN A;  4J9I A;  2JM9 A;  1X2K A;  1GBR A;  1VYU A;  3UF4 A;  2ED1 A;  3ZL7 C;  1QWF A;  1LCK A;  1UJY A;  2HSP A;  1QLY A;  4LNP A;  2KXD A;  1NG2 A;  2EGA A;  2D8H A;  3UA6 A;  1Y57 A;  1PKS A;  2I0N A;  2YUP A;  1U5S A;  4GBQ A;  4ORZ A;  3REA B;  1M3A A;  2GNC A;  2L0A A;  2LZ6 B;  4E6R A;  4JZ4 A;  1XOV A;  2LJ0 A;  1OPK A;  1T0J A;  2W0Z A;  4RUG A;  4RTZ A;  2V1R A;  1K1Z A;  4HVV A;  2X3X D;  2F2V A;  3PVQ A;  1ZLM A;  1FMK A;  2LJ1 A;  4JPB W;  2LX7 A;  1GCQ C;  2E5K A;  3PVL A;  2OI3 A;  1NYF A;  2AKK A;  1WA7 A;  1JEG A;  2D1X A;  2ED0 A;  4Y92 A;  1UHF A;  3EHR A;  2RPN A;  2O9S A;  5IHI A;  2GQI A;  2CSI A;  4ZNX A;  1PWT A;  5IHK A;  3VS1 A;  2L2P A;  1ABQ A;  2FRY A;  1K76 A;  4HVW A;  1AWO A;  1UHC A;  2M0Y A;  2FPF A;  2JMC A;  2K3B A;  2GGR A;  1T3S A;  4J9H A;  2JS2 A;  1VA7 A;  4X1V A;  2DLP A;  2YT6 A;  3IQL A;  2ESW A;  3H0F A;  3KFV A;  1GFC A;  3LH5 A;  5IH2 A;  2SEM A;  5EC7 A;  1PRM C;  4RTW A;  2LNH B;  2DL5 A;  1ARK A;  1YNZ A;  2L3P A;  4LN2 A;  2O31 A;  1JXM A;  1ZUU A;  1NEG A;  2V1Q A;  1MUZ A;  1X6G A;  5FWC A;  1E6H A;  5IXB A;  1UDL A;  2JTE A;  1ZSG A;  1JQQ A;  2BZY A;  4OMO A;  2PNI A;  4J9G A;  3EHQ A;  4AG1 C;  1SHF A;  3M0R A;  1ZUY A;  1GRI A;  1AWW A;  1KFZ A;  1UG1 A;  3EG3 A;  3RBB B;  2AK5 A;  2CDT A;  1ZX6 A;  1A0N B;  2EQI A;  1PNJ A;  4J9B A;  1H3H A;  3GBQ A;  2RQV A;  1Y0M A;  1M3B A;  4HVU A;  3EGU A;  2CH4 A;  3SEM A;  5HCK A;  4WCI A;  4OMQ A;  3NGP A;  3UA7 A;  1JO8 A;  2L3S A;  2C0T A;  1KIK A;  2K6D A;  4OMN A;  1NLP C;  2EVR A;  1MV0 B;  1HSQ A;  2CT4 A;  1OV3 A;  1WX6 A;  3NPF A;  1VYV A;  2AZV A;  1WXB A;  1SHG A;  2KXC A;  2M51 A;  2K7A A;  3NHN A;  2LQW A;  1M30 A;  1ZBJ A;  4CC4 B;  1RI9 A;  1WDX A;  4F16 A;  1X27 A;  4Z88 A;  2YDL A;  1YCS B;  4DEX A;  3U23 A;  4Z8A A;  2W10 A;  4K11 A;  2CRE A;  4AFS C;  2KGT A;  3EG0 A;  1WIE A;  2LJ3 A;  2KR3 A;  1HJD A;  3VRY A;  5FW9 A;  3VS4 A;  1W70 A;  5I11 A;  3VRZ A;  2ECZ A;  2JMA A;  2DE0 X;  1AVZ C;  1TUC A;  4A63 B;  3M0U A;  1I0C A;  3VS6 A;  2DL8 A;  1PKT A;  4AG2 C;  3ULR B;  1IO6 A;  3TSZ A;  2D8J A;  2OJ2 A;  1AWX A;  1UTI A;  2MIO A;  2DL3 A;  2DRK A;  2JS0 A;  2KBT A;  2QDL A;  2DL7 A;  2OAW A;  1PRL C;  2C0I A;  3SHW A;  4CC3 A;  2KRM A;  2EYY A;  4FSS A;  2RNA A;  2A36 A;  1JXO A;  5ECA A;  2CH4 W;  3VS7 A;  1WXU A;  1W6X A;  1RUW A;  1H8K A;  4QT7 A;  2LQN A;  4J9F A;  4JZ3 A;  4CC2 A;  1QKX A;  4HXJ A;  4RTT A;  1X69 A;  1I1J A;  5IXF A;  4JJB A;  1GFD A;  2KT1 A;  5FWB A;  4IIO A;  5GJV B;  2LP5 A;  4JJC A;  1HD3 A;  1I07 A;  2EYZ A;  2DNU A;  2A37 A;  1OEB A;  2KNB B;  3C0C A;  2CUD A;  1G83 A;  2DM1 A;  1YN8 A;  3H0H A;  4F14 A;  4LUD A;  1NLO C;  3H0I A;  3EG1 A;  1N5Z A;  3REB B;  1B3Q A;  2FEI A;  4LUE A;  2HBW A;  3VS3 A;  1X43 A;  1E6G A;  4IIM A;  2K79 A;  1RLQ C;  4OMM A;  1OOT A;  2DX1 A;  1K0X A;  1ABO A;  4J9D A;  1PHT A;  2L3Q A;  1NEB A;  2KYB A;  2FG0 A;  2VKN A;  1UFF A;  4OMP A;  2RMO A;  2YUO A;  2VVK A;  1J3T A;  1TG0 A;  2DVJ A;  5IHN A;  1SRM A;  2BTT A;  2HEQ A;  2VWF A;  3VS5 A;  1M27 C;  1U06 A;  4D8K A;  2NUZ A;  2KE9 A;  1U3O A;  2FPE A;  3I5R A;  3VS0 A;  1E7O A;  1S1N A;  4M4Z A;  2EPD A;  4Z89 A;  2PZ1 A;  1V1C A;  1BU1 A;  2DBM A;  2XMF A;  1TUD A;  4RTV A;  1AZG B; 
#chains in the Genus database with same CATH topology
 1UGQ B;  2EBP A;  5LJ5 e;  4F17 A;  1G2B A;  1SEM A;  4OML A;  2CT3 A;  2EYW A;  2K9G A;  4J6X A;  3I9Q A;  1KD1 R;  2F2X A;  2NWM A;  1WFW A;  4J9E A;  1FMW A;  4EMK A;  1K0S A;  3JB9 H;  2QA4 T;  2YXY A;  3RKX A;  1VOM A;  3ZBD A;  1G3W A;  1QW1 A;  4PNO A;  1NYG A;  3A8G B;  4XTU A;  3KBG A;  5KYN A;  4D8D A;  4BI4 A;  4M78 D;  4M78 C;  1UGV A;  1QVF S;  3CXC A;  1BYM A;  1WHL A;  2LQ8 A;  2ZPF B;  3SWN A;  4M78 A;  4J9C A;  3A8L B;  1I8F A;  5CIU A;  2RQT A;  3QPH A;  3LH0 A;  4M78 F;  4CC7 A;  1H92 A;  2O2O A;  3CQT A;  1MMA A;  4PLL A;  2EAY A;  2J7I A;  1M1K R;  1WGS A;  1YWO A;  2NUT B;  3UWN A;  1W2B A;  5LJ3 h;  2HZY A;  2XID A;  4OGE A;  4ZGJ B;  1LOJ A;  2KYM A;  3KUF A;  2R5M A;  4XU1 A;  2LC4 A;  4MMK A;  4E7S A;  2QEX Q;  1GCQ A;  1YFN A;  2EW3 A;  2HDA A;  1QWE A;  4ZGE B;  4O6J A;  2JW4 A;  2I2L A;  3CMA A;  1OQK A;  2X4J A;  4DBH A;  2MOX A;  3CCV T;  3S3N A;  2DL4 A;  2JM8 A;  1K73 U;  2J6F A;  1CKA A;  3UDC A;  2MI6 A;  4ELY C;  1OPL A;  4RTY A;  1FX7 A;  1NPR A;  1PD1 A;  2DET A;  2LDM A;  3L1A A;  3JRZ A;  2E12 A;  1SKU B;  3BDL A;  3A5Z B;  3HFN A;  2GQV A;  3GPL A;  1KSW A;  1VQ6 Q;  2QEX T;  3CCR T;  2DJZ A;  4JJD A;  4HKE A;  3CPF A;  3CC4 A;  1QP3 A;  2K2M A;  4A4F A;  2J06 A;  1UUE A;  1YJ9 Q;  2Y4Y A;  2ZCF B;  2WSF E;  2YHT A;  3OA6 A;  2ROT A;  1VQL Q;  1WHJ A;  3PT9 A;  4BI8 B;  4IKF A;  2A3L A;  3TSW A;  2G6F X;  3X24 B;  1YIT Q;  3M4Y A;  1WI7 A;  1T3L A;  2RQW A;  5FRO A;  2FRW A;  1QVF P;  1Y96 B;  4RCB A;  5HY6 A;  4X9D A;  3V8J A;  5CKD A;  2DF6 A;  3S3O A;  2C0O A;  2DA9 A;  4TVR A;  4QKU A;  4UC4 A;  2KRO A;  1VQ8 A;  3OS2 A;  1B07 A;  2EGE A;  3QDR B;  3HRU A;  2LMJ A;  1VQ6 T;  1OZ2 A;  5D7U A;  3VS2 A;  2DTI A;  3M56 A;  2KRN A;  2M1H A;  5KCH A;  5GAN 3;  1YJ9 T;  2L5Q A;  3M58 A;  2VYT A;  1VQ8 T;  2CP0 A;  3HTR A;  3UF4 A;  3VJP A;  2ED1 A;  3ZL7 C;  2FHD A;  1YIT T;  3BDU A;  3HRS A;  2KXD A;  2EGA A;  4OB3 B;  2RJE A;  2D8H A;  4J6Y A;  1RAF B;  4RMO A;  3CME Q;  1Y57 A;  2I0N A;  2YUP A;  3JCM P;  2XKO C;  4KUD K;  3REA B;  2GNC A;  2LZ6 B;  1OPK A;  1T0J A;  4M75 E;  2OTL Q;  2HSE B;  4CI0 C;  1MHN A;  1ZBX A;  4JLI A;  2X3X D;  4A4H A;  3PVQ A;  4C0Z A;  2E3H A;  2XDP A;  1Q7Y U;  3RES A;  3MCA B;  2E5K A;  2A7Y A;  3PVL A;  4F7U E;  4EMK B;  1WA7 A;  3EGX B;  4M7D E;  4LD6 A;  4MZT A;  4A4K A;  1UHF A;  3VYH B;  2ZPE B;  5GAO m;  3CME T;  2O9S A;  5IHI A;  4LDW A;  2GQI A;  3OYH A;  1KD1 U;  4HCC A;  1QVG A;  3VS1 A;  3RDV A;  4PJN A;  2HNI A;  2DXU A;  4HVW A;  1AWO A;  2OTL T;  4J5Y A;  1U8R A;  3N5B B;  3OY9 A;  4GLK A;  2X51 A;  4KT0 E;  2K3B A;  3SWN B;  2GGR A;  4LD9 K;  1T3S A;  4X1V A;  1D0X A;  1HYO A;  2DER A;  4N0A C;  1N8R R;  1GFC A;  2JTM A;  4XU0 A;  4RTW A;  2DL5 A;  2DTO A;  3RR6 A;  3QDF A;  4OB2 B;  1MUZ A;  4QVZ A;  2X35 A;  3MEW A;  1OI1 A;  2ZZD A;  3QO3 A;  2MF2 A;  4OMO A;  4PJO D;  1M1K U;  4PJO C;  2RI3 A;  3EFO A;  2KY9 A;  3FDR A;  2EJ9 A;  2ZPB B;  3JCM c;  3KXT A;  1ZUY A;  4IUT A;  1GRI A;  2GCX A;  5FLX E;  1K9M C;  2RHY A;  1ZX6 A;  2CYZ B;  1M3B A;  4HVU A;  4PJO F;  2CH4 A;  4II1 A;  4PLI A;  4WCI A;  2ZGW A;  5GAN 4;  2OTJ A;  4M77 D;  4L59 A;  2K6D A;  4M77 C;  1YJN Q;  5GAM h;  4OP0 A;  3OYD A;  4ANJ A;  1PCX A;  4R56 A;  1ZA1 B;  5KYU B;  1SHG A;  2M51 A;  4HT8 A;  2K7A A;  3NHN A;  4M78 E;  5EG2 A;  2LQW A;  1M30 A;  4M77 F;  1KQS S;  4ZN1 A;  4Z88 A;  4C5I A;  1TH7 A;  3M59 A;  4OGC A;  2JZ2 A;  1XJW B;  5CKF A;  4M7A C;  4Z8A A;  2DXB A;  1BCO A;  4AFS C;  1IZ6 A;  4E7L A;  3EG0 A;  1WIE A;  1Y71 A;  1HJD A;  3UPU A;  4M7A A;  5I2M A;  1GXI E;  1YI2 A;  4PJM A;  4A4G A;  3OS1 A;  3A8M B;  4M7A F;  5J26 A;  1I0C A;  2MWP A;  1PKT A;  1VQP A;  2OJ2 A;  2VGM A;  1UTI A;  1NBE B;  2DRK A;  3FEO A;  1PG5 B;  1X6O A;  2DL7 A;  5CK9 A;  2OAW A;  2VUB A;  4FL6 A;  2QI2 A;  4CC3 A;  2E10 A;  1VQO A;  1N9S A;  4FSS A;  1HK9 A;  1XNI A;  2RHZ A;  1JXO A;  1K73 C;  3R6O A;  2DEQ A;  2E5Q A;  4J9F A;  4JZ3 A;  3HFO A;  5KYX A;  4HXJ A;  4RTT A;  1I5O B;  2HKQ B;  1WHH A;  3LWI A;  4FSX A;  2BKD N;  1NJI C;  3OW2 S;  1Q82 R;  5LJ3 j;  2DD5 A;  2MPX C;  2DNU A;  2PVD B;  3HKS A;  3G71 A;  1ZQ1 A;  3CC2 T;  1JJ2 P;  3NFC A;  3EFS A;  4JJN K;  2CUD A;  3MP8 A;  1MMG A;  4KUI A;  2DM1 A;  4WTO B;  4F14 A;  5I21 A;  3H0I A;  1N5Z A;  1KQS P;  1O75 A;  5M9O A;  3G71 T;  2HL5 C;  4IIM A;  2RI5 A;  3CCM Q;  3I55 Q;  1RLQ C;  4C0F A;  5GMK m;  2COZ A;  3GLX A;  2D0Q B;  1K0X A;  1VUB A;  1NPP A;  1YCY A;  4J9D A;  1Q86 R;  1ZSZ B;  1F1B B;  3CD6 Q;  3J81 E;  3CEY A;  3BFM A;  2QQA A;  5L8R E;  4C8Q G;  5J39 A;  4PL6 A;  2BTT A;  2DKG A;  3VS5 A;  3OBY A;  3MEU A;  1WHM A;  2KE9 A;  2RJF A;  3VS0 A;  3OYJ A;  1E7O A;  1VQ7 Q;  1S1N A;  4M4Z A;  2QTX A;  4Z89 A;  4C0D B;  2XK0 A;  2VXF A;  2NLU A;  5CQY A;  1N8R U;  2GFU A;  1BU1 A;  4QVD A;  4XTV A;  3CCM T;  3I55 T;  4OMF B;  2L8D A;  4E7K A;  2AKL A;  3O8V A;  2JT4 A;  3CXC S;  1OU9 A;  3EFO B;  4PFO A;  3I56 A;  2RJC A;  1SRL A;  3QHS A;  2DVE A;  4C8Q A;  5A2Q E;  2H3J A;  1JJ2 A;  2FZC B;  1X01 A;  1YHQ Q;  3CC7 A;  3CCL Q;  1UE9 A;  1M90 R;  5LJ5 h;  1AT1 B;  1K9A A;  2O01 E;  2P84 A;  3MKD A;  1YIJ Q;  1Q95 G;  2ZPG B;  1W2B S;  1VQ7 T;  1WLP B;  1IB8 A;  3OMG A;  3D7S B;  2KT8 A;  3OQ5 A;  4XTY A;  3V7C A;  3M0T A;  1IHV A;  3BE3 A;  2KQW A;  2O88 A;  1QCN A;  1IGU A;  1NJI R;  2DK3 A;  5L23 A;  2HAX A;  3CCS A;  1KD1 C;  7AT1 B;  2BZ8 A;  2D9T A;  5KE3 A;  1LNX A;  3CCQ Q;  3JCM W;  4IUP A;  3OS5 A;  3CCJ Q;  5IN1 A;  1QKW A;  3M0P A;  3M9Q A;  1KJW A;  1QCF A;  2YRV A;  1VQK A;  1VQN A;  2KMT A;  1VQ5 A;  2CP7 A;  5GAN 2;  3OSS C;  2HL3 A;  2F2W A;  1YIJ T;  1BI0 A;  2EKH A;  3JCM h;  2JNG A;  3G6E A;  1SPK A;  2KI7 A;  3SDZ A;  2RQR A;  3S3M A;  1P92 A;  3RUX A;  2GTJ A;  4E47 A;  2EJF A;  2H8H A;  2GBQ A;  2KSS A;  4PJO E;  3CCQ T;  1FYN A;  3CCJ T;  1GL5 A;  2MYS A;  4B9X A;  4NL3 A;  3WVE B;  1K4U S;  3CCE Q;  3CXC P;  2O9V A;  3TQ7 P;  3OYN A;  3S6W A;  1VQ4 Q;  2QTV A;  1EFN A;  2VV5 A;  4M77 E;  2J05 A;  1VQ9 A;  1B34 A;  2F5K A;  5GAN 7;  2LT4 A;  3M5A A;  2A0F B;  2NUP A;  2HQH A;  3O5Z A;  1LVK A;  2J6K A;  2YUQ A;  4ZGD B;  1W2B P;  2E64 A;  2K5F A;  3MEA A;  4RTU A;  2DYB A;  4MZP A;  2X4X A;  3G1J A;  1AZE A;  1BB9 A;  1S72 Q;  4M7A E;  3CCE T;  1Q82 U;  2QXF A;  2QA4 A;  1UEB A;  2IPO B;  4R0K A;  1ZHI A;  3GIB A;  3QKJ A;  1PC0 A;  4EMK C;  2DEU A;  1VQ4 T;  2PTK A;  4NOY A;  1UJ0 A;  3SB2 A;  1SSF A;  2JM9 A;  3EGX A;  4FIB A;  4BI3 A;  3GOX A;  3OSV A;  1EZZ B;  1QWF A;  3PTA A;  5GAM j;  4E7J A;  1UJY A;  1MGQ A;  1NG2 A;  3A8O B;  3SWN C;  1M2V A;  4J6W A;  3UA6 A;  1S72 T;  1Q86 U;  1PKS A;  2HD0 A;  4GBQ A;  1BCM A;  4JDS A;  4E6R A;  4JZ4 A;  1WZO A;  2LJ0 A;  2W0Z A;  4PJL A;  4AMC A;  4RTZ A;  1QVG S;  3DB4 A;  3PMI A;  3HRT A;  1OU8 A;  2F2V A;  1RAA B;  4VUB A;  3QZ9 B;  2E6N A;  1FMK A;  2LJ1 A;  3EGD B;  4PK4 A;  3A8H B;  5I2S A;  3CCV A;  1GCQ C;  2LVM A;  2Y90 A;  4C8Q B;  1D3B A;  2AKK A;  4MDX A;  1JEG A;  1UGS B;  2EQJ A;  4EDU A;  2WAC A;  2ED0 A;  3EHR A;  2CSI A;  5IHK A;  1ABQ A;  1Y7X A;  1QMC A;  1K76 A;  1G3T A;  2M16 A;  1M90 U;  2R58 A;  3MET A;  2JMC A;  3TCJ A;  1VA7 A;  5CQX A;  2DLP A;  2QEX A;  4DQ2 A;  3IQL A;  5KE2 A;  3CCR A;  3H0F A;  1BIB A;  2AHJ B;  5IH2 A;  2SEM A;  4GY5 A;  5EC7 A;  2LNH B;  3JB9 J;  1YNZ A;  2ATC B;  1NJI U;  4LN2 A;  5KYU A;  1JXM A;  3HL8 A;  2V1Q A;  3ZEH A;  4LXC A;  4HA8 A;  2JTE A;  3E19 A;  3ME9 A;  2K3Y A;  2CP5 A;  2P0Q A;  1KFZ A;  1N8R C;  1UG1 A;  2O4X A;  5CKH A;  2IG0 A;  1VQ6 A;  5C6S A;  2PU9 B;  4J9B A;  2LX9 A;  2FL7 A;  3A1P A;  3EGU A;  3GNG A;  3SEM A;  1YJ9 A;  1KHI A;  3M53 A;  2DZC A;  1Q81 R;  1VQL A;  2EIF A;  1QVG P;  1KIK A;  1NLP C;  3QJ6 A;  1R77 A;  1YIT A;  2RO0 A;  1MV0 B;  1HSQ A;  3FB9 A;  3JSC A;  2CT4 A;  3TRE A;  3RKW A;  3EAE A;  1WX6 A;  1JBM A;  2AZV A;  1K8A R;  5A0D A;  4IUV A;  1BI2 A;  1VQL T;  4HT9 A;  1B34 B;  1X27 A;  4XQ3 A;  1R0B G;  2NUP B;  4DEX A;  2VGN A;  4JRQ A;  2FVU A;  2W10 A;  2JUF A;  4K11 A;  2G3R A;  4XAX B;  3Q1J A;  5FW9 A;  2QQ9 A;  5I11 A;  2CZ1 B;  2ECZ A;  5GMK j;  3L42 A;  4A63 B;  1D09 B;  3FJP A;  2FZG B;  4XTX A;  3ULR B;  3TSZ A;  3CME A;  2DL3 A;  2JS0 A;  5LJ5 j;  5GAN h;  1SF9 A;  5LJ3 e;  1PRL C;  3QG1 A;  3QXE B;  2PVO B;  3SHW A;  2OTL A;  2GFA A;  2XIC A;  2A36 A;  4ME7 A;  3VS7 A;  1AHJ B;  1M2V B;  1ZSZ A;  1RUW A;  1H8K A;  2LQN A;  4DA4 A;  1YJW Q;  1QKX A;  2X9H A;  3DLM A;  1X69 A;  5GAO q;  2LCC A;  3QYG B;  1GFD A;  2EQM A;  2EWN A;  4E2F B;  1NZ9 A;  5GJV B;  4C0D C;  2E4H A;  1WPY A;  4JUV A;  4LDY A;  3C0C A;  1QVP A;  3JCM Q;  2QYZ A;  1KG1 A;  3RKY A;  3H0H A;  4J83 A;  3FIF A;  4LUD A;  5LJ3 d;  3QBY A;  1D3B B;  3EG1 A;  1C1A A;  3OYE A;  3REB B;  1B3Q A;  3VS3 A;  2WSC E;  2QK0 A;  2K79 A;  1YJW T;  5LJ3 f;  3G4S Q;  4OMM A;  2FYK A;  4BY6 C;  3EH1 A;  1PHT A;  3CBP A;  5J3B A;  2D6F A;  2KYB A;  1LPL A;  3VV0 A;  1Q82 C;  4OB1 B;  4OF1 A;  3DLL A;  3CPW P;  5C0M A;  4PFZ A;  3OYL A;  4ZTJ A;  3JCM V;  1JJ2 S;  2NUZ A;  4IUQ A;  2FPE A;  3I5R A;  3QII A;  5LJ3 g;  1WQW A;  2PZ1 A;  1V1C A;  2R5A A;  4DBR A;  2DBM A;  1TUD A;  4RTV A;  3G4S T;  1Q86 C;  1CSK A;  2HCK A;  3V7R A;  1YJN A;  4DEY A;  1KQ2 A;  4M7A D;  3NTH A;  1PSF A;  2DIG A;  4B6M A;  3WXM B;  1M8M A;  2BE7 D;  1M4Z A;  3PE0 A;  3WVD B;  2RF0 A;  3AHU A;  2O4X B;  2V26 A;  1C6V X;  4MZM A;  1FXX A;  1GCP A;  3M57 A;  4FT4 A;  2SRC A;  2PVG B;  2RN8 A;  1YJN T;  2MWO A;  4N4G A;  3C4S A;  4QVC A;  5HK3 A;  3ER0 A;  1T0H A;  2X3W D;  1MMD A;  2DYI A;  4HCB A;  3CBO A;  4F04 B;  1KHC A;  4FW1 A;  1Q81 U;  1MMN A;  1UGP B;  1UEC A;  2V8I A;  3M0Q A;  4DBF A;  3FJ5 A;  2HQX A;  1V76 A;  2CKK A;  2KRS A;  3C12 A;  4KH0 B;  3JCM J;  1IHW A;  4ATO A;  3QJY A;  2X4W A;  3CPW A;  3MPU B;  1M90 C;  2QAS A;  2JXB A;  3R6N A;  1K8A U;  1BK2 A;  1BIA A;  3LX7 A;  1VQM Q;  1AEY A;  3RNJ A;  3CC2 A;  1YP5 A;  1M3C A;  3L2R A;  1ZUK A;  4EIK A;  3VKI A;  2DRM A;  4C5G A;  1GBQ A;  2J6O A;  3JV3 A;  5GJW B;  1AOJ A;  5KH6 A;  2XD0 A;  3C95 A;  1HXD A;  4J8O A;  4PFP A;  3MP6 A;  2B8A A;  3SFM A;  2EGC A;  4BAC A;  3QWX X;  3NMZ C;  2DIL A;  3CBM A;  2A08 A;  2YSQ A;  5FU6 B;  2LNV A;  4BDZ A;  3NTK A;  2DD4 A;  1VQM T;  5GAO p;  1D0Y A;  2LCS A;  5GAN f;  2DO3 A;  2B86 A;  6AT1 B;  3PNW C;  4KH1 B;  2RI2 A;  2RK2 A;  4D6W A;  2CSQ A;  1I5L A;  4Z02 A;  4FM4 B;  3OS0 A;  4RTX A;  1X6B A;  3E9G A;  1OZ3 A;  3EG2 A;  3CCM A;  3I55 A;  4A4E A;  1YWP A;  1Y07 A;  1Z9Z A;  4KRT A;  5GAM e;  5CAI A;  4XU3 A;  3HPW A;  5KYW B;  1RAI B;  4JRP A;  1M2O A;  3CD6 A;  2KAF A;  2MK5 A;  2CUB A;  1WHG A;  2XDD A;  1TWB A;  2AZS A;  2OX7 A;  4C8Q D;  4C8Q C;  2P4R A;  5GMK h;  2XI9 A;  4JS5 A;  1UGR B;  4FYY B;  3EGD A;  3I56 Q;  1WXT A;  3CD6 T;  1M1G A;  1X2Q A;  4J9I A;  1VQ7 A;  2CGH A;  2HBP A;  4IUR A;  1GBR A;  1YBY A;  1VYU A;  3UT1 A;  4C92 G;  2RJD A;  4C8Q F;  2DAQ A;  4DOW A;  3OYG A;  5CKE A;  4ELZ C;  5HKC A;  1QLY A;  5D6W A;  4KUL A;  1KC8 R;  1U5S A;  1N9R A;  2CZ6 B;  5GAM d;  3CCL A;  1RAE B;  4CRI A;  1XOV A;  3PFS A;  3C94 A;  2QQS A;  4RUG A;  1YIJ A;  5GAM f;  1K1Z A;  1QCO A;  4C92 A;  1YHQ T;  4M75 G;  4DOV A;  3CCL T;  4KGX B;  1TUG B;  2V8J A;  2XDB A;  4X9C A;  4MDW A;  4C92 F;  2RHX A;  4JPB W;  2LX7 A;  2CP6 A;  3X25 B;  4E7H A;  3EG9 A;  4Y92 A;  3CCQ A;  2JN0 A;  4F7U G;  3OYC A;  3CCJ A;  2RPN A;  4J7I A;  2HKN A;  3M4G A;  5FU7 B;  4JS4 A;  1PWT A;  5GAN j;  4M7D G;  2L2P A;  3L2Q A;  5GAM g;  2XG8 D;  2FPF A;  4M75 A;  4V2S A;  2JS2 A;  3PGG A;  4EPC A;  2CP3 A;  1N27 A;  3LH5 A;  3F70 A;  3INZ A;  1ARK A;  2YLC A;  2L3P A;  4FT2 A;  5DY9 A;  2O31 A;  5CKB A;  2MMP A;  8ATC B;  2EKO A;  4F7U A;  1ZUU A;  4KGZ B;  1G3S A;  5D6Y A;  4M7D A;  1UDL A;  5CR2 A;  2DIQ A;  1H3Z A;  1ZSG A;  1JQQ A;  4M7D F;  1QQJ A;  2PNI A;  4J9G A;  2K5I A;  3EHQ A;  4AG1 C;  1G8X A;  3CCU Q;  3CCE A;  2F1L A;  1TOV A;  1LJO A;  3M0R A;  4QQG A;  3QSU A;  3EG3 A;  3JB9 G;  4DBQ A;  3P8D A;  2AK5 A;  1A0N B;  1WQ7 A;  2M02 A;  2EQI A;  4BUG A;  1VQ4 A;  2K4Y A;  1H3H A;  3GBQ A;  3RER A;  1Y0M A;  3OYI A;  1R0C B;  5HCK A;  2VAS A;  3RIR A;  4OMQ A;  3UA7 A;  1JO8 A;  4OMN A;  5KYY B;  1W4S A;  1PSE A;  4XTZ A;  1XTD A;  3NPF A;  1VYV A;  1S72 A;  3CCU T;  3H8Z A;  4CC4 B;  1RI9 A;  3OB9 A;  1YCS B;  2XHC A;  3JB9 F;  4M78 G;  3U23 A;  3LGL A;  4FCY A;  2CRE A;  1Q81 C;  4XTW A;  2P0P A;  2KGT A;  3HSB A;  5HK0 A;  2LJ3 A;  4NL2 A;  3VS4 A;  1W70 A;  3GF5 A;  3VRZ A;  4FYV B;  1AVZ C;  1TUC A;  5GAN 6;  4LDX A;  1K8A C;  2CZ0 B;  3VS6 A;  4AG2 C;  3RMS A;  3NTI A;  2MIO A;  3G7Z A;  2Y4X A;  3QZ5 B;  3CCV Q;  2C0I A;  2FB7 A;  2KRM A;  2EYY A;  5LL6 S;  1FMV A;  4KGV B;  3JCM e;  3JCM X;  3TU4 K;  3CMA Q;  5LJ5 d;  1WXU A;  4RCC A;  2KDS A;  1OUL A;  4L5G A;  2EQK A;  4E7Z A;  3E9F A;  4CC2 A;  5LJ5 f;  2KT1 A;  1TTH B;  4C0G A;  3QYH B;  3CCR Q;  4FYX B;  2FZK B;  4IIO A;  1WJQ A;  1KC8 U;  3P8H A;  1EIF A;  1HD3 A;  1I07 A;  1NE8 A;  2EYZ A;  2KK4 A;  2M0O A;  4C92 B;  2CS7 A;  2KNB B;  3BW1 A;  4PKC C;  2AIR B;  2K57 A;  1G83 A;  3HHT B;  5CO7 A;  1YN8 A;  1TSF A;  2EFI A;  5AYF A;  1RAC B;  3CC4 Q;  4Y91 A;  3CMA T;  5LJ5 g;  3EG9 B;  2FEI A;  3PMT A;  4XU2 A;  3JCM d;  1OOT A;  2DX1 A;  1ABO A;  1VIE A;  1NEB A;  2FG0 A;  4C8Q E;  3JCM f;  1MNE A;  4OMP A;  2RMO A;  4M75 B;  2YRD A;  1VQ8 Q;  2YUO A;  2VVK A;  2L89 A;  1J3T A;  1TG0 A;  2DVJ A;  2VWF A;  3TEE A;  4QQD A;  1M27 C;  4D8K A;  1U3O A;  3CC4 T;  4JRK A;  2EPD A;  4F7U B;  1M5Q 1;  1UB4 A;  2XMF A;  3L2V A;  4M7D B;  2WSE E;  1AZG B;  1JU5 C;  3JCM g;  3E2U A;  1TXQ A;  2RD1 A;  4C5H A;  5AT1 B;  1N6A A;  3OBW A;  2BZX A;  3OYM A;  4IUU A;  4C92 E;  2D0N A;  5IAY A;  1NM7 A;  2K2V A;  2A28 A;  5I22 A;  3TVT A;  1KQ1 A;  4N4H A;  2DJQ A;  4EMG A;  2Z0W A;  1IGQ A;  2E6Z A;  1WHK A;  1KK7 A;  2IIM A;  3CPW S;  4NS5 A;  3X28 B;  2YRC A;  3QWY A;  2JTF A;  1RLP C;  5FU6 C;  2FO0 A;  3UAT A;  4B9W A;  4AFQ C;  1WYX A;  1AWJ A;  2KEA A;  1MV3 A;  2X4Y A;  3FLG A;  3I35 A;  2YUN A;  3T9N A;  1SSH A;  1ZSZ C;  2BE9 B;  1BKB A;  4L6V 5;  3DB3 A;  1BBZ A;  2JJ9 A;  4GLM A;  2FPD A;  4AFU C;  2GTO A;  3OYY A;  4O5V A;  1QVF A;  1TS9 A;  3JAM E;  1H64 1;  3H9N A;  1RAD B;  2EYX A;  2H3E B;  3J80 E;  1M8V A;  5DLQ E;  3GP8 A;  4EMH A;  3LW5 E;  3ZFJ A;  3A98 A;  2ENM A;  3OMC A;  2ROL A;  2VC8 A;  5KYW A;  1I4K 1;  2MCN A;  1YJW A;  4ESR A;  2K3X A;  4LDU A;  4AFZ C;  1JRI A;  3M0S A;  4M78 B;  3MHX A;  4RG2 A;  3L2Z A;  5GAO r;  4KBM B;  2L3R A;  4PJO G;  2DXC A;  1D0Z A;  2YLB A;  2DZ9 A;  2RQU A;  1PD0 A;  4HCK A;  1VYT A;  1EX4 A;  4N0A A;  2RHU A;  4C5E A;  1TU0 B;  4BE1 A;  1AD5 A;  5GAN 8;  2DMO A;  2ABL A;  1W1F A;  4LE9 A;  1M1F A;  1JB0 E;  2LTO A;  4X34 A;  4P5N A;  2OTJ Q;  4M77 G;  4OB0 B;  5GMK i;  4BB7 A;  5DLO A;  3G4S A;  3THK A;  2EJG A;  4J7F A;  3JCM b;  3LLR A;  3E1S A;  4PJO A;  3GNF B;  3H41 A;  1D1A A;  3EH2 A;  1IXD A;  1IRE B;  4ZTF A;  4BDY A;  1CKB A;  3L2U A;  2RK1 A;  3URG A;  2RM4 A;  5GAO l;  2DFU A;  2DBK A;  4FU6 A;  4M7A G;  2OAU A;  2EYQ A;  3I5S A;  1Z9Q A;  4M77 A;  2ZPH B;  1X2K A;  5FU7 C;  2PQW A;  2OTJ T;  3V8L A;  1YI2 Q;  2HQE A;  5FRM A;  2QDY B;  1LCK A;  3M54 A;  1IRX A;  2HSP A;  1RL2 A;  1WJS A;  4LNP A;  1ZA2 B;  3OYK A;  2QQB A;  2R57 A;  1VQP Q;  5CCA A;  3SD4 A;  3V8K A;  5KCO A;  3JB9 I;  3OYF A;  1BI1 A;  4ORZ A;  3L2W A;  1O9S A;  1M3A A;  4RG8 A;  2IVW A;  5GAN e;  2L0A A;  1VQO Q;  2LRQ A;  2F5T X;  1RAB B;  2V1R A;  4YTL A;  2P0K A;  4HVV A;  2MAM A;  2E41 A;  1YI2 T;  1ZLM A;  2F69 A;  2LT1 A;  2OI3 A;  1NYF A;  3CC2 Q;  1U1T A;  1OX8 A;  1KC8 C;  2D1X A;  1RAG B;  4MML A;  1VQP T;  3P8B B;  4ZN3 A;  4RKU E;  4E7I A;  3MEV A;  2JOY A;  4BE2 A;  4ZNX A;  3ASK A;  3G71 Q;  4JRI A;  1G5V A;  1VQO T;  2FRY A;  1VQM A;  3FRN A;  4PJJ A;  1UHC A;  2M0Y A;  4BE0 A;  2DTH A;  4J9H A;  3VUZ A;  2E65 A;  2YT6 A;  1K9M R;  5GAN d;  1X75 C;  2ESW A;  5D6X A;  5KYY A;  3KFV A;  5GAN 5;  1PRM C;  2COW A;  2YWW A;  1NEG A;  3H6Z A;  3LWH A;  1X6G A;  5FWC A;  1E6H A;  5IXB A;  1B7T A;  2BZY A;  2E3I A;  4JLG A;  1ACM B;  5GAO n;  1SHF A;  2COY A;  3MO8 A;  1AWW A;  3MJX A;  1I81 A;  3RBB B;  2RH2 A;  2CDT A;  1U1S A;  1WNL A;  3HP9 A;  1PNJ A;  5GAN g;  2RQV A;  2C06 A;  2XU8 A;  4WF2 A;  3PIP A;  2EQU A;  3NGP A;  2L3S A;  2C0T A;  2AT1 B;  2EVR A;  2DPP B;  2PUK B;  3OYB A;  3VUB A;  1WJR A;  3BY7 A;  2K5L A;  1OV3 A;  4AT1 B;  1WXB A;  3CC7 Q;  3J7A F;  2KXC A;  1OYX A;  2ZAE A;  1ZBJ A;  2GF7 A;  9ATC B;  1WDX A;  1DJ7 B;  4F16 A;  2JVV A;  1R8O B;  5A0G A;  2YDL A;  4N4I A;  2BIV A;  2NUT A;  3MP1 A;  2ZPI B;  2KR3 A;  2P4T A;  3VRY A;  1YHQ A;  4PJO B;  4Y28 E;  3OYA A;  1K73 R;  3RMQ A;  2BUD A;  2JMA A;  2DE0 X;  4C92 D;  3CCS Q;  4C92 C;  4QQ6 A;  2LCL A;  4BY6 B;  3M0U A;  4R55 A;  3I56 T;  2DL8 A;  1KQS A;  1Q7Y C;  1IO6 A;  4A53 A;  1QP2 A;  3OW2 P;  2D8J A;  2PUO B;  1AWX A;  3CC7 T;  5GMK l;  1G3Y A;  1VQK Q;  1VQN Q;  1VQ5 Q;  2KBT A;  1SG5 A;  2QDL A;  3M55 A;  2RA2 A;  3LGF A;  4BD3 A;  4M77 B;  1D1C A;  2M9U A;  2RNA A;  1MND A;  3G6E Q;  2CP2 A;  3EFR A;  2QQR A;  5IT9 E;  1BI3 A;  5FRN A;  3PIO A;  5ECA A;  2CH4 W;  1XQH A;  1OX9 A;  4M75 D;  1W6X A;  3X20 B;  4M75 C;  2DXT A;  2E70 A;  2QGF B;  5DM7 R;  4QT7 A;  3CCS T;  4A54 A;  5IXF A;  1I1J A;  4JJB A;  3VYG A;  4M7A B;  1RAH B;  5FWB A;  3FC3 A;  3V7S A;  5A0L A;  4M75 F;  1VQK T;  2CZ7 B;  1VQN T;  1VQ5 T;  4JJC A;  2LP5 A;  2A37 A;  4M7D D;  1Y96 A;  4LDV A;  4M7D C;  4FYW B;  1OEB A;  5CVI A;  1PM3 A;  3G6E T;  1FWZ A;  3X26 B;  1M1K C;  3QUI A;  1V29 B;  1VQ9 Q;  4F7U F;  2VB6 A;  1NLO C;  2QGG A;  2KVQ G;  2V8K A;  2HMA A;  4LUE A;  2HBW A;  1X43 A;  1E6G A;  3OW2 A;  2VXE A;  2L3Q A;  1C0M A;  4OVA A;  4QW2 A;  1D1B A;  1M9S A;  2VKN A;  5KYX B;  1UFF A;  2QA4 Q;  3CCU A;  3AT1 B;  5IHN A;  2RHI A;  1SRM A;  4Q5W A;  2HEQ A;  2LQK A;  3LYI A;  3VU3 C;  5GMK e;  1RI0 A;  1U06 A;  2E1H A;  3JB9 D;  1VQ9 T;  4HCZ A;  8AT1 B;  2QG9 B;  1VIF A;  2RB6 A;  4XK8 E;  1Q7Y R;  1K9M U;  2NYS A;  4FW2 A;  2QAZ A;  3DKM A; 
#chains in the Genus database with same CATH homology
 1JU5 C;  2EBP A;  1CSK A;  2HCK A;  1G2B A;  1SEM A;  4F17 A;  2AKL A;  4OML A;  2JT4 A;  2CT3 A;  4DEY A;  2EYW A;  2K9G A;  3I9Q A;  2BZX A;  2D0N A;  1M8M A;  1SRL A;  1NM7 A;  3PE0 A;  2F2X A;  2A28 A;  2RF0 A;  2NWM A;  1WFW A;  4J9E A;  5I22 A;  1K0S A;  3TVT A;  2DJQ A;  1UE9 A;  1GCP A;  1NYG A;  2RN8 A;  2SRC A;  2IIM A;  1K9A A;  4D8D A;  3QWY A;  1UGV A;  1WLP B;  1RLP C;  2KT8 A;  1T0H A;  2FO0 A;  2X3W D;  3UAT A;  3M0T A;  2O88 A;  4AFQ C;  1WYX A;  5L23 A;  4J9C A;  1AWJ A;  2KEA A;  1MV3 A;  2RQT A;  3I35 A;  1UEC A;  3M0Q A;  2BZ8 A;  3FJ5 A;  2KRS A;  2YUN A;  4CC7 A;  1H92 A;  1SSH A;  2O2O A;  3CQT A;  1QKW A;  3M0P A;  2J7I A;  1KJW A;  1BBZ A;  1QCF A;  2JXB A;  3R6N A;  1YWO A;  1BK2 A;  2FPD A;  4GLM A;  4AFU C;  1AEY A;  2GTO A;  3RNJ A;  1YP5 A;  2KYM A;  1M3C A;  2F2W A;  2EYX A;  1ZUK A;  2EKH A;  4EIK A;  1GCQ A;  1SPK A;  2DRM A;  2EW3 A;  2HDA A;  1QWE A;  1GBQ A;  2J6O A;  3JV3 A;  2JW4 A;  3A98 A;  2RQR A;  5GJW B;  1AOJ A;  2ENM A;  2MOX A;  2GTJ A;  2ROL A;  2DL4 A;  2JM8 A;  2MCN A;  2J6F A;  1CKA A;  4ESR A;  2H8H A;  2GBQ A;  2EGC A;  3QWX X;  1OPL A;  1FYN A;  4AFZ C;  3M0S A;  3NMZ C;  4RTY A;  2DIL A;  2A08 A;  2YSQ A;  1GL5 A;  1K4U S;  2RQU A;  4HCK A;  1VYT A;  2O9V A;  2LCS A;  2B86 A;  1AD5 A;  1KSW A;  2DMO A;  2ABL A;  1EFN A;  4JJD A;  2J05 A;  1W1F A;  2K2M A;  4LE9 A;  2CSQ A;  2J06 A;  1UUE A;  4RTX A;  2ROT A;  1X6B A;  3O5Z A;  2J6K A;  3EG2 A;  2YUQ A;  3TSW A;  2G6F X;  3THK A;  1WI7 A;  1T3L A;  1YWP A;  2RQW A;  4RTU A;  1Z9Z A;  2FRW A;  4KRT A;  2DYB A;  3H41 A;  1AZE A;  1BB9 A;  2DF6 A;  2C0O A;  2DA9 A;  1CKB A;  2KRO A;  2CUB A;  4R0K A;  1B07 A;  2AZS A;  2EGE A;  2P4R A;  2DBK A;  2LMJ A;  2PTK A;  3VS2 A;  1WXT A;  3I5S A;  1X2Q A;  1UJ0 A;  1Z9Q A;  2KRN A;  4J9I A;  2JM9 A;  1X2K A;  1GBR A;  1VYU A;  3UF4 A;  2ED1 A;  3ZL7 C;  1QWF A;  1LCK A;  1UJY A;  2HSP A;  1QLY A;  4LNP A;  2KXD A;  1NG2 A;  2EGA A;  2D8H A;  3UA6 A;  1Y57 A;  1PKS A;  2I0N A;  2YUP A;  1U5S A;  4GBQ A;  4ORZ A;  3REA B;  1M3A A;  2GNC A;  2L0A A;  2LZ6 B;  4E6R A;  4JZ4 A;  1XOV A;  2LJ0 A;  1OPK A;  1T0J A;  2W0Z A;  4RUG A;  4RTZ A;  2V1R A;  1K1Z A;  4HVV A;  2X3X D;  2F2V A;  3PVQ A;  1ZLM A;  1FMK A;  2LJ1 A;  4JPB W;  2LX7 A;  1GCQ C;  2E5K A;  3PVL A;  2OI3 A;  1NYF A;  2AKK A;  1WA7 A;  1JEG A;  2D1X A;  2ED0 A;  4Y92 A;  1UHF A;  3EHR A;  2RPN A;  2O9S A;  5IHI A;  2GQI A;  2CSI A;  4ZNX A;  1PWT A;  5IHK A;  3VS1 A;  2L2P A;  1ABQ A;  2FRY A;  1K76 A;  4HVW A;  1AWO A;  1UHC A;  2M0Y A;  2FPF A;  2JMC A;  2K3B A;  2GGR A;  1T3S A;  4J9H A;  2JS2 A;  1VA7 A;  4X1V A;  2DLP A;  2YT6 A;  3IQL A;  2ESW A;  3H0F A;  3KFV A;  1GFC A;  3LH5 A;  5IH2 A;  2SEM A;  5EC7 A;  1PRM C;  4RTW A;  2LNH B;  2DL5 A;  1ARK A;  1YNZ A;  2L3P A;  4LN2 A;  2O31 A;  1JXM A;  1ZUU A;  1NEG A;  2V1Q A;  1MUZ A;  1X6G A;  5FWC A;  1E6H A;  5IXB A;  1UDL A;  2JTE A;  1ZSG A;  1JQQ A;  2BZY A;  4OMO A;  2PNI A;  4J9G A;  3EHQ A;  4AG1 C;  1SHF A;  3M0R A;  1ZUY A;  1GRI A;  1AWW A;  1KFZ A;  1UG1 A;  3EG3 A;  3RBB B;  2AK5 A;  2CDT A;  1ZX6 A;  1A0N B;  2EQI A;  1PNJ A;  4J9B A;  1H3H A;  3GBQ A;  2RQV A;  1Y0M A;  1M3B A;  4HVU A;  3EGU A;  2CH4 A;  3SEM A;  5HCK A;  4WCI A;  4OMQ A;  3NGP A;  3UA7 A;  1JO8 A;  2L3S A;  2C0T A;  1KIK A;  2K6D A;  4OMN A;  1NLP C;  2EVR A;  1MV0 B;  1HSQ A;  2CT4 A;  1OV3 A;  1WX6 A;  3NPF A;  1VYV A;  2AZV A;  1WXB A;  1SHG A;  2KXC A;  2M51 A;  2K7A A;  3NHN A;  2LQW A;  1M30 A;  1ZBJ A;  4CC4 B;  1RI9 A;  1WDX A;  4F16 A;  1X27 A;  4Z88 A;  2YDL A;  1YCS B;  4DEX A;  3U23 A;  4Z8A A;  2W10 A;  4K11 A;  2CRE A;  4AFS C;  2KGT A;  3EG0 A;  1WIE A;  2LJ3 A;  2KR3 A;  1HJD A;  3VRY A;  5FW9 A;  3VS4 A;  1W70 A;  5I11 A;  3VRZ A;  2ECZ A;  2JMA A;  2DE0 X;  1AVZ C;  1TUC A;  4A63 B;  3M0U A;  1I0C A;  3VS6 A;  2DL8 A;  1PKT A;  4AG2 C;  3ULR B;  1IO6 A;  3TSZ A;  2D8J A;  2OJ2 A;  1AWX A;  1UTI A;  2MIO A;  2DL3 A;  2DRK A;  2JS0 A;  2KBT A;  2QDL A;  2DL7 A;  2OAW A;  1PRL C;  2C0I A;  3SHW A;  4CC3 A;  2KRM A;  2EYY A;  4FSS A;  2RNA A;  2A36 A;  1JXO A;  5ECA A;  2CH4 W;  3VS7 A;  1WXU A;  1W6X A;  1RUW A;  1H8K A;  4QT7 A;  2LQN A;  4J9F A;  4JZ3 A;  4CC2 A;  1QKX A;  4HXJ A;  4RTT A;  1X69 A;  1I1J A;  5IXF A;  4JJB A;  1GFD A;  2KT1 A;  5FWB A;  4IIO A;  5GJV B;  2LP5 A;  4JJC A;  1HD3 A;  1I07 A;  2EYZ A;  2DNU A;  2A37 A;  1OEB A;  2KNB B;  3C0C A;  2CUD A;  1G83 A;  2DM1 A;  1YN8 A;  3H0H A;  4F14 A;  4LUD A;  1NLO C;  3H0I A;  3EG1 A;  1N5Z A;  3REB B;  1B3Q A;  2FEI A;  4LUE A;  2HBW A;  3VS3 A;  1X43 A;  1E6G A;  4IIM A;  2K79 A;  1RLQ C;  4OMM A;  1OOT A;  2DX1 A;  1K0X A;  1ABO A;  4J9D A;  1PHT A;  2L3Q A;  1NEB A;  2KYB A;  2FG0 A;  2VKN A;  1UFF A;  4OMP A;  2RMO A;  2YUO A;  2VVK A;  1J3T A;  1TG0 A;  2DVJ A;  5IHN A;  1SRM A;  2BTT A;  2HEQ A;  2VWF A;  3VS5 A;  1M27 C;  1U06 A;  4D8K A;  2NUZ A;  2KE9 A;  1U3O A;  2FPE A;  3I5R A;  3VS0 A;  1E7O A;  1S1N A;  4M4Z A;  2EPD A;  4Z89 A;  2PZ1 A;  1V1C A;  1BU1 A;  2DBM A;  2XMF A;  1TUD A;  4RTV A;  1AZG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...