1UJYA

Solution structure of sh3 domain in rac/cdc42 guanine nucleotide exchange factor(gef) 6
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
GSSGSSGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 6
publication title Solution structure of SH3 domain in Rac/Cdc42 guanine nucleotide exchange factor(GEF) 6
rcsb
source organism Homo sapiens
total genus 7
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ujyA00
1HD3A 2C0TA 3VS3A 1JQQA 3M0RA 5FWBA 2LQWA 2M0YA 2HBWA 4OMQA 2ROTA 2DL5A 4RTTA 2DBKA 1U5SA 1NYGA 2FPEA 2D8HA 1PNJA 1ZUKA 1PRLC 1HSQA 1N5ZA 3A98A 3O5ZA 3U23A 2GBQA 2DRKA 3EG0A 1I1JA 4QT7A 2LJ3A 2J6KA 4E6RA 1BK2A 1WIEA 2C0OA 1EFNA 2F2VA 3I35A 2X3WD 1JU5C 1Y57A 2KT8A 4JJBA 1X69A 4J9CA 1YNZA 4RTUA 2DM1A 2CDTA 2DJQA 1U06A 2L3QA 1B07A 2JM8A 2KE9A 1E6HA 1JEGA 3I5RA 3M0TA 1UUEA 2CH4W 2DLPA 1UHFA 2LQNA 2AZSA 1NLOC 2EQIA 1ABOA 2LP5A 2DYBA 1AZEA 2PNIA 1RLQC 4CC7A 1I0CA 1SHFA 1AZGB 2LMJA 1BU1A 4HXJA 3UA6A 2O9VA 4D8DA 1SEMA 1M30A 1H3HA 1H92A 2DL3A 3NHNA 2ED1A 2A37A 1AEYA 4M4ZA 1M3CA 2F2WA 2FG0A 4IIOA 2KXCA 2ED0A 3CQTA 4LUEA 2FPFA 1WX6A 4KRTA 4Z8AA 1K1ZA 2RNAA 1T0JA 2K9GA 1T3SA 1S1NA 2EYXA 4JZ4A 3RNJA 1ZLMA 3EG3A 1CKAA 2FO0A 2JS2A 3VS5A 4CC3A 2DVJA 4F16A 2CUBA 3PVQA 2AKLA 2EGCA 2YUQA 1BB9A 1WXBA 2BZXA 1AOJA 2GTJA 4J9DA 2MCNA 1KJWA 1X43A 3VS4A 1PWTA 4WCIA 2HCKA 2JW4A 1YWOA 2RPNA 2AZVA 2P4RA 1E7OA 4RTYA 5ECAA 4IIMA 1T0HA 3RBBB 1FYNA 2KYBA 1X27A 3EG2A 2DL7A 5I22A 2JS0A 2KBTA 2CH4A 1WFWA 4RTWA 3FJ5A 1UJYA 2DF6A 4GLMA 2H8HA 3UATA 1UFFA 1M3BA 2K3BA 4J9GA 4HVUA 1WA7A 3R6NA 1ARKA 3UA7A 2CUDA 1QWFA 1RUWA 1Z9QA 2ECZA 2DX1A 2GQIA 2SEMA 4LE9A 4Z89A 1AWOA 3M0SA 2BZ8A 1UGVA 2KNBB 2RF0A 5L23A 2BTTA 2GNCA 2RQRA 1WI7A 2HSPA 5GJVB 1GBRA 4LN2A 2PTKA 4OMNA 2D0NA 2QDLA 1GCQA 2K79A 1HJDA 1PHTA 2VVKA 3SEMA 1GL5A 2BZYA 2EYYA 2JXBA 1K76A 1MV0B 1K0XA 3H41A 3PVLA 3M0PA 1VYVA 3VRYA 4JJCA 1NYFA 1U3OA 3EGUA 1TG0A 2K6DA 2A28A 2RN8A 2ESWA 2DBMA 4D8KA 2ENMA 4FSSA 3M0UA 3KFVA 1NM7A 2EW3A 1AWWA 4Z88A 2CT3A 4OMMA 1GBQA 1OOTA 1W70A 3NGPA 1Y0MA 4HVVA 2KRNA 2EGAA 5HCKA 2EKHA 5IH2A 1PKTA 2O88A 1ZX6A 4J9BA 2HDAA 2HEQA 2X3XD 4F17A 2O9SA 4AFSC 2DILA 2FEIA 2KXDA 2V1RA 2RQUA 1JXOA 4J9IA 3I5SA 1YWPA 1YN8A 2J6FA 4X1VA 2ABLA 1UTIA 2J7IA 1W6XA 4RTVA 4CC4B 1X6BA 5IHKA 2EVRA 2DNUA 3IQLA 4A63B 3QWYA 2IIMA 3NMZC 3VRZA 2L0AA 1JXMA 3QWXX 1K9AA 5FW9A 2DL4A 2JTEA 3REAB 2VKNA 1CSKA 1BBZA 2NUZA 3VS0A 1OPLA 2MOXA 2M51A 1Z9ZA 1A0NB 4RUGA 2O2OA 1QKWA 2XMFA 1NLPC 2DL8A 2JT4A 1PKSA 2YSQA 5I11A 2B86A 1MV3A 4AFUC 2W0ZA 1XOVA 1AVZC 2A08A 3JV3A 2I0NA 4OMPA 2VWFA 4J9FA 1SPKA 2J05A 2LZ6B 1K4US 2DRMA 2L2PA 1I07A 2FPDA 1GRIA 1NG2A 3C0CA 2SRCA 4RTXA 2O31A 1KFZA 1QWEA 1SRLA 4RTZA 2KRMA 3SHWA 4K11A 4F14A 1CKBA 3VS6A 1NEBA 5IHNA 3PE0A 1SSHA 1YP5A 1MUZA 4DEYA 2JMAA 1K0SA 1M27C 4OMOA 1QKXA 2KYMA 1X2KA 1ABQA 4Y92A 1ZUUA 5IHIA 2YT6A 1GCQC 2CSQA 5EC7A 1X2QA 2G6FX 1JO8A 3NPFA 1AWJA 1T3LA 2DA9A 2V1QA 2KT1A 4LNPA 2K7AA 1UDLA 2AKKA 1WXUA 5IXBA 2EBPA 4HCKA 1E6GA 1VYTA 3H0HA 2KEAA 2EPDA 2J06A 4OMLA 2KR3A 4ESRA 2DE0X 1TUCA 2MIOA 1B3QA 1GFDA 1AWXA 4ORZA 4JPBW 1WXTA 2CT4A 2KRSA 3EHRA 1SRMA 3I9QA 2ROLA 1UG1A 3UF4A 4CC2A 2D8JA 2GGRA 3H0FA 2DMOA 1PRMC 2W10A 1FMKA 2J6OA 2YUPA 1H8KA 4LUDA 5IXFA 2A36A 1V1CA 2RQWA 1GCPA 1OPKA 2K2MA 1NEGA 4DEXA 4HVWA 1W1FA 1M8MA 1ZSGA 2RQTA 1X6GA 1VYUA 1RLPC 1J3TA 2RQVA 4R0KA 4AG2C 2LX7A 3REBB 2NWMA 1WLPB 2LJ0A 3LH5A 1OEBA 1TUDA 1ZUYA 1KSWA 2OAWA 1QCFA 1LCKA 4JJDA 2FRWA 1YCSB 2L3PA 3TSWA 3ULRB 4AFQC 1G2BA 2YDLA 3H0IA 2F2XA 4J9EA 2CREA 2L3SA 1M3AA 1OV3A 2D1XA 2OJ2A 3EG1A 1G83A 5GJWB 4AFZC 2EYZA 1GFCA 2AK5A 1IO6A 1WDXA 2PZ1A 2LCSA 1RI9A 4ZNXA 2KROA 1VA7A 3GBQA 1UJ0A 1UE9A 3TVTA 2C0IA 4GBQA 3M0QA 3VS2A 3VS1A 2RMOA 3EHQA 2E5KA 2CSIA 2LJ1A 1AD5A 2GTOA 1UHCA 3TSZA 1UECA 2EYWA 5FWCA 1WYXA 3VS7A 4EIKA 1SHGA 1ZBJA 1QLYA 2JMCA 3ZL7C 2EGEA 4AG1C 4JZ3A 2YUNA 2JM9A 2LNHB 3THKA 2KGTA 1KIKA 2OI3A 2YUOA 4J9HA 2FRYA
chains in the Genus database with same CATH superfamily
2CYZB 2C0TA 1VQ8A 3M0RA 4Y28E 2H3EB 2HBWA 4BUGA 1NJIR 1Q7YR 2DBKA 3J7AF 4LDYA 4NOYA 1OYXA 3OYBA 1ZA1B 2RD1A 4C92D 1XNIA 2FPEA 5GAOm 2HL3A 4QQ6A 1PNJA 2DZCA 1KD1U 3U23A 1B34B 2DRKA 1I8FA 3L2VA 1UEBA 4BE1A 4DBRA 4MZTA 1WIEA 4N4GA 1QVPA 3I35A 1JU5C 3SB2A 1Q86C 1WGSA 4EMHA 1BCOA 1KD1R 2F69A 1U06A 4JUVA 4R55A 2HKQB 1B07A 2KE9A 4EMKC 1NLOC 1M8VA 3P8BB 3QBYA 4OMFB 1SHFA 5GANd 2XDDA 1AZGB 4PJOB 3OYAA 3CCEQ 4XQ3A 4Y91A 1SEMA 2OTLQ 1VQ9Q 3CC2Q 1M30A 2QASA 3EG9A 2A37A 1HYOA 4M4ZA 4E7LA 2F2WA 2ED0A 4JRIA 2MK5A 4MZPA 1SF9A 4CRIA 1WNLA 3GP8A 3QXEB 1KQ1A 1S1NA 4LXCA 4C5HA 3HP9A 3HFNA 3A1PA 3EG3A 2FO0A 3VS5A 4F7UG 4CC3A 2JJ9A 3N5BB 2KAFA 4M75B 2EGCA 4OB1B 3QHSA 4HCBA 3OYGA 1WXBA 1YI2T 2DXBA 3CCSA 3CCMT 4WCIA 2EYQA 3PT9A 1PCXA 1M2VA 2BE7D 1TU0B 1YWOA 2JW4A 4QQDA 3OYLA 2ATCB 1ZQ1A 2AZVA 2PUOB 2X9HA 2MI6A 3A8HB 4AT1B 3E9GA 4MMLA 4PKCC 2DL7A 4A4GA 2PVGB 2DO3A 1PSEA 4PJOF 2LRQA 3CPWP 1VQ7Q 4M7AG 1UJYA 3JB9H 3EGXA 3WXMB 3META 3MP1A 3OS1A 1Y96A 2WSCE 4IUTA 5CO7A 3JCMf 3R6NA 2KMTA 3UA7A 4N0AA 4J7FA 1YI2A 4F7UE 3CPWA 1RUWA 2DX1A 4Z89A 2ZGWA 3M0SA 1UGVA 4PJLA 2QI2A 1K9MU 2K2VA 2K57A 5GAN8 1VQKQ 4QKUA 3DLMA 2H3JA 3LGFA 1W4SA 2BUDA 4F7UF 3MO8A 4WF2A 3M55A 1GCQA 3JCMe 1RI0A 1K9MR 3CMAQ 2O4XB 1VQMQ 2EYYA 2JXBA 2LNVA 1W2BS 4PLIA 4ELYC 1YJWQ 4ZGJB 4FU6A 3EGUA 4X9DA 4M7AE 4RCCA 1ZBXA 4D8KA 2RA2A 3G6ET 1JRIA 2MPXC 1IGUA 1X01A 4M75A 1G5VA 1NM7A 1OX9A 2XKOC 5GAMh 2ZPHB 4Z88A 1GBQA 4M7AF 4M75D 1Y0MA 4HVVA 3DB4A 1NZ9A 2E41A 2EKHA 5IH2A 1PKTA 2O88A 2GF7A 3RERA 4J9BA 2RI5A 5GAN7 2X3XD 5FRNA 2QQAA 3CPFA 2FEIA 4XU3A 4M78E 1Q82C 2V1RA 4J9IA 4M7AC 2E6ZA 2YRDA 3CC4A 2ABLA 3OYIA 4PJJA 1K73C 5IHKA 2ZCFB 4KULA 3VUBA 3TREA 1FXXA 2IIMA 2L0AA 3QWXX 4A53A 2JTEA 2PVOB 1IGQA 2YRCA 3DB3A 5J26A 5GMKh 1OPLA 2NYSA 4RUGA 2O2OA 5CKFA 1YJNQ 2AHJB 2XMFA 3TU4K 1G3TA 3A8OB 2YSQA 4M78C 2E3IA 3RMSA 3OYHA 1D0XA 3PFSA 3CBOA 2YRVA 2W0ZA 3C4SA 3RMQA 4FW2A 3JCMJ 3JV3A 3CCVQ 3CCLT 3L2QA 3GOXA 4OF1A 4OMPA 4OB2B 2O4XA 3JCMg 1X75C 1SPKA 1TWBA 3ME9A 2IVWA 4C0FA 3CCJQ 2O31A 1O75A 1KFZA 1QWEA 2MAMA 1BI2A 3T9NA 4X34A 3VS6A 5IHNA 5GANh 5LJ5d 2XK0A 5A0LA 1QVFA 3MEVA 1UGQB 1M27C 2KYMA 1U1SA 1ABQA 4Y92A 5IHIA 2CSQA 1AHJB 1D0YA 4XK8E 2DA9A 1YIJQ 4FYYB 1PD0A 2ZPBB 3LWIA 2VXEA 1N9SA 2AKKA 2NUPB 2VB6A 3OYNA 2EBPA 4HCKA 4E2FB 4E47A 1I5LA 2QTVA 1YFNA 2COZA 2KEAA 4OMLA 3CBPA 1M1KU 1H641 1WQ7A 2VXFA 2NUTA 2YLCA 5KYUB 1B3QA 1RABB 4ORZA 2FZCB 5EG2A 4M7DB 2KRSA 3MP6A 1G3YA 2ROLA 4BD3A 3M54A 2GGRA 1M1KR 4PJMA 2YUPA 4BACA 5AT1B 1JJ2A 2QQRA 3Q1JA 1GCPA 4XTWA 3GNFB 1OPKA 4XTUA 2K2MA 2P0QA 2RQTA 2PVDB 2JNGA 1J3TA 2RQVA 5GAMj 3CCUQ 1QVGP 3REBB 3RR6A 4Z02A 3OYCA 1OEBA 3AHUA 1UGPB 3RESA 1OX8A 1YCSB 2WSEE 3J80E 2Y4XA 3NTHA 3C94A 1G2BA 1QVGA 1QCNA 3FIFA 2L3SA 3MHXA 4OB0B 2IPOB 3JSCA 1G83A 2HNIA 5GJWB 1VQLT 1VQPQ 4AFZC 1RACB 1GFCA 2PZ1A 1IO6A 1WDXA 2LCSA 3OS5A 1NBEB 2KROA 4OVAA 2CZ1B 2C0IA 3QDRB 2DTIA 4IUUA 3OMCA 4IUQA 5HK0A 2RMOA 2CSIA 3SD4A 1AD5A 4HKEA 2V26A 5GMKl 1LNXA 1UHCA 4C5IA 2V8JA 3A8GB 3V8LA 5FWCA 4EIKA 3VS7A 1S72T 3VV0A 2XG8D 4EPCA 3HL8A 2KY9A 2EGEA 4JZ3A 2JM9A 1UGSB 2LNHB 5GMKj 2XICA 4BY6C 4ZTJA 1TSFA 1FX7A 2YUOA 4C8QE 2OAUA 1K73U 4QVZA 2DIQA 3EH2A 2X51A 1HD3A 1JQQA 2V8KA 4OMQA 5LJ3d 1VQLA 2M0OA 5KYUA 3G7ZA 2VGMA 3CD6Q 4M7DA 3BDUA 5I2SA 1N5ZA 3A98A 1K73R 2E4HA 2HMAA 4ELZC 2ZAEA 1I1JA 3HHTB 1EIFA 2QAZA 3OYEA 4M7DD 5DY9A 2EQKA 4E7HA 3CCRT 1S72A 1EFNA 2X3WD 1UGRB 2HZYA 4JJBA 3CXCS 2GFUA 2DM1A 1X6OA 2DJQA 3CC7A 1W2BP 2Y90A 2L3QA 3E9FA 4PFZA 2JM8A 2RJCA 2MMPA 1JEGA 5GANj 3I5RA 2DLPA 4A54A 4P5NA 2XD0A 2LQNA 3RKYA 3G4SQ 4KH0B 2LP5A 5J3BA 1W2BA 2RI3A 2LMJA 4HXJA 3UA6A 1VQ5A 1LVKA 4C92G 4D8DA 1Q95G 1ZSZC 2M1HA 2DL3A 3NHNA 2RH2A 1AEYA 3M58A 2VASA 3CCRA 2KXCA 4LUEA 2FPFA 2DAQA 4Z8AA 3FLGA 2EIFA 4OGEA 3UWNA 3QJ6A 2QA4Q 2MF2A 4EMKB 3BW1A 3GF5A 1ZHIA 2DVJA 1VQ6Q 1VOMA 3OSVA 3BY7A 2DD5A 3PVQA 2AKLA 4C5EA 5D6WA 3KXTA 2RB6A 2YUQA 2BZXA 1AOJA 2X4XA 2KK4A 4L59A 2VV5A 1DJ7B 1X43A 2A7YA 1PWTA 4JRPA 3QO3A 4NL2A 4LDVA 2DD4A 3ASKA 1K8AU 3OW2S 4C92E 2HL5C 4JLGA 1KHIA 4PJNA 5LJ5h 4JDSA 4PFPA 2P4RA 1E7OA 4RTYA 5ECAA 4IIMA 5CIUA 4M77G 3EG2A 3CCET 3JCMQ 5I22A 2OTLT 1VQ9T 3CC2T 3M9QA 1K8AR 1VQNA 1G8XA 2R5AA 5AYFA 2DF6A 2GFAA 1YHQA 3TCJA 3UATA 1M3BA 2F5TX 4J9GA 3VYGA 2RO0A 1MMNA 2LTOA 2CUDA 3QPHA 2K5FA 3MEAA 2L89A 1Z9QA 2GQIA 1PSFA 3JB9F 2V8IA 2RF0A 4C92C 2RQRA 1WI7A 1GBRA 2HQEA 2PTKA 5KYYB 4QQGA 4DQ2A 2D0NA 2QDLA 4LDWA 1HJDA 3CCEA 3SEMA 2RJFA 2OTLA 1VQ9A 3CC2A 2Z0WA 4M77E 1XJWB 4NS5A 5HY6A 4LDUA 1VYVA 3VRYA 4E7JA 2ZPFB 4ANJA 4JJNK 1ZA2B 2RN8A 2R57A 3PMTA 2DBMA 3V8KA 4EMKA 5A0GA 1VQ8Q 6AT1B 3M0UA 2DXTA 3KFVA 4M77F 1VQ7T 3H8ZA 3MJXA 3QJYA 4OB3B 1WHKA 2QXFA 3NGPA 2KRNA 3M59A 5FU7C 3WVDB 1ZX6A 4M77C 4DBQA 4PFOA 3VYHB 2HDAA 2HEQA 2E70A 4RG8A 1D1AA 2O9SA 2FZGB 5CQYA 1VQOQ 2DILA 4J7IA 1VQKT 3I5SA 1YN8A 1MNEA 4F7UB 2M16A 1UTIA 3JCMX 4RTVA 3S3OA 1X6BA 4C0ZA 1OU8A 3NTIA 3IQLA 3CMAT 3QWYA 3R6OA 5DLOA 1BIBA 1VQMT 2CP2A 1VQ7A 2P0KA 1JXMA 1RL2A 2PU9B 4BI4A 1YJWT 5FW9A 2OTJQ 3REAB 1CSKA 3RKXA 3VS0A 5LJ3h 2KVQG 1QKWA 2DL8A 2M02A 1B34A 2JT4A 2E6NA 1PKSA 4L6V5 4RCBA 3LGLA 5I11A 1BIAA 4RG2A 1MV3A 5KYYA 5GAMf 1WHJA 2A08A 1VQKA 4M7AB 1M2OA 2K3XA 1M1KC 4D6WA 2EKOA 1V29B 2VWFA 4B9XA 4C0DC 2LZ6B 2DFUA 2L2PA 3CMAA 5GMKi 1VQMA 1V76A 3CCMA 3C0CA 5LJ5j 2E65A 3AT1B 2CZ0B 5GAMe 3CCSQ 2COWA 1SKUB 4XTVA 4PJOA 1SRLA 3I56Q 3SHWA 4K11A 3PE0A 1SSHA 2DJZA 4PJOD 4M78G 4DEYA 1VIFA 3RUXA 1D1CA 2HAXA 3L1AA 2FYKA 3S3NA 3M57A 2R58A 4M75E 3L2RA 2FB7A 2EFIA 5GAOp 1JB0E 2YT6A 1GCQC 5IT9E 2KDSA 1YJNT 3NPFA 2RM4A 2FVUA 4BB7A 1XTDA 2K7AA 3PMIA 3CXCP 3X26B 5CKHA 1IB8A 4F7UA 3OYMA 3EFOB 3QYHB 4EDUA 3CCVT 2DE0X 5HK3A 4E7IA 2MIOA 5GMKe 3CXCA 1AWXA 3S3MA 4JPBW 1O9SA 2I2LA 3EHRA 2DZ9A 3OYJA 3QZ9B 4FYWB 3CCJT 3UF4A 3H6ZA 4CC2A 3OYKA 1MHNA 2J6OA 3LWHA 4LUDA 2A36A 2EQJA 1KQSS 4A4HA 4LD6A 4MZMA 4TVRA 4DEXA 1WPYA 5GANf 4M7AA 4A4FA 4QW2A 5CKEA 2HBPA 4AG2C 1FMVA 1RAEB 3G6EA 4M78F 1WLPB 2XDPA 3LH5A 3ZFJA 1KSWA 4M7AD 1QCFA 3HRSA 4JJDA 2FRWA 1YIJT 4J6XA 1C1AA 3TSWA 4AFQC 1QP2A 5GANe 4IURA 2CREA 4JRQA 1OV3A 3JAME 2XIDA 3CCJA 4A4KA 4KGVB 5GAMg 1VA7A 4FYVB 3HFOA 3ZBDA 3M0QA 1EX4A 3OW2P 1PD1A 1YITQ 5GAN2 2VYTA 3RIRA 3TSZA 3BE3A 4IUVA 1UECA 5KH6A 3FEOA 3X25B 3CC4Q 1ZBJA 5J39A 4C0GA 1B7TA 1Y71A 3MKDA 2YUNA 3OW2A 5D7UA 3SWNC 3THKA 4FCYA 2KGTA 1KIKA 5LJ3j 2OI3A 2D9TA 2E5QA 4J9HA 2FRYA 5HKCA 2EQMA 5CKDA 3EFOA 2DPPB 4L5GA 4IKFA 4XTYA 1D09B 5FWBA 3CCUT 1WHGA 2EJFA 2M0YA 5CQXA 2ROTA 4RTTA 2ZPGB 2AIRB 4HCZA 4O6JA 3SFMA 1ZUKA 2P0PA 1PRLC 3O5ZA 2CGHA 3V7SA 4QVCA 3EG0A 4QT7A 3CCLA 2LJ3A 1BK2A 1I4K1 1VQPT 2C0OA 2F2VA 3NFCA 1Y57A 3DLLA 5CK9A 4J9CA 1YNZA 4RTUA 2CDTA 4BY6B 1NPRA 3CMEQ 3M0TA 2RK2A 2CH4W 1U1TA 2BIVA 4N4HA 1ABOA 3QKJA 2DYBA 1K8AC 4ME7A 3X20B 1AZEA 2QGGA 3CCUA 3HKSA 2B8AA 3EGDB 2FL7A 4ZGDB 3GIBA 3PTAA 5GMKm 1RAAB 3H9NA 5FRMA 1H92A 8AT1B 2ED1A 5GANg 1M3CA 2LQKA 2FG0A 3OYYA 4IIOA 1HK9A 4V2SA 4RMOA 5FU6C 1WX6A 3CD6T 4KRTA 1Y7XA 4C8QG 3JB9J 3E1SA 4N4IA 1T0JA 5KYWB 2K9GA 1T3SA 4JZ4A 2VC8A 1ZLMA 7AT1B 1TOVA 4PNOA 4F16A 2CUBA 1D3BB 2RHUA 4KT0E 1NE8A 3MEUA 3QSUA 4JRKA 4J9DA 2MCNA 1QW1A 2DIGA 1KJWA 2KSSA 2FHDA 5GAN4 1ZSZB 2QQBA 3L2UA 2HCKA 3G4ST 2RPNA 1NPPA 1YJ9Q 3EFRA 5L8RE 1M4ZA 3VJPA 1C6VX 2MYSA 1T0HA 4KBMB 4HT8A 1FYNA 2GQVA 2JS0A 3P8DA 3CD6A 2CH4A 4M7DE 3FRNA 1WHLA 1WFWA 2K5LA 2NUPA 4B9WA 1IZ6A 4PL6A 4HA8A 1UFFA 2K3BA 1WA7A 4OGCA 4XTZA 2K4YA 1XQHA 3CCQQ 2ECZA 2SEMA 2BZ8A 2QA4T 3I55Q 5L23A 1BKBA 4C8QF 1AT1B 1BI0A 2BTTA 3EGDA 4MMKA 3E19A 2QK0A 3G4SA 1VQ6T 1PG5B 4FL6A 4FT2A 2HSPA 5GJVB 4FT4A 3G1JA 2X4WA 4OMNA 2EJ9A 3GNGA 2XHCA 2K79A 2VVKA 5GAN6 4BE0A 1GL5A 2QDYB 4C5GA 4C8QC 4WTOB 1K76A 1K0XA 3PVLA 3M0PA 5LJ5f 2MWPA 1UB4A 2CZ7B 3V7RA 5KYWA 1R77A 3C12A 2K6DA 1RAFB 2HKNA 4MDWA 2A28A 4A4EA 2ENMA 4XU2A 2QA4A 4C92B 1D3BA 5GAOr 4J83A 2DK3A 2CT3A 1VQ6A 5LJ5e 1W70A 1ZSZA 3QZ5B 1OI1A 4JLIA 1KQ2A 5KCHA 2QQ9A 4J8OA 3VKIA 5HCKA 2CP7A 2EJGA 2HD0A 4KGXB 5C0MA 1QCOA 4KH1B 1M90R 2PUKB 1KQSP 1JXOA 3CC7Q 2XU8A 2J6FA 1WJQA 3LX7A 2E12A 3PNWC 2J7IA 1N8RC 1M1GA 1W6XA 2K3YA 4CC4B 3EFSA 3VUZA 4AMCA 2DVEA 4A63B 1KQSA 3NMZC 2HQXA 1VQ5Q 2JOYA 2DL4A 2VKNA 1BBZA 4FM4B 2MOXA 1Q81C 1A0NB 1VQ8T 4ATOA 2F5KA 2LCLA 4FW1A 5FU7B 4M77B 3OS0A 1PC0A 3EG9B 2RJEA 4DA4A 2B86A 4DOWA 5D6YA 2K5IA 2LQ8A 2QG9B 3JCMd 3LH0A 2LCCA 5I2MA 1XOVA 1OQKA 3ZEHA 4C92F 3TQ7P 2E1HA 5CKBA 4J5YA 2EAYA 4IUPA 2LX9A 3OMGA 4J9FA 1SSFA 4KUDK 1M1FA 2DRMA 1I07A 2FPDA 1VQOT 1GRIA 3A8LB 3S6WA 2SRCA 1OULA 1QVFS 1WJSA 1TXQA 1HXDA 4RTZA 1KG1A 2KRMA 2YLBA 2X35A 1CKBA 3WVEB 1YP5A 1VQ4Q 4DBFA 5D6XA 1MUZA 1M2VB 1RAIB 3LYIA 2RI2A 3OYFA 2OTJT 2D0QB 1K0SA 5CAIA 1QKXA 4LD9K 2QEXQ 3G71Q 2A3LA 5LJ5g 5EC7A 1VQNQ 2G6FX 1JO8A 4DBHA 5LJ3f 5CVIA 1T3LA 4C0DB 1YHQQ 4LNPA 3A5ZB 2RK1A 2CP6A 3JB9D 1RAGB 1E6GA 1VQOA 1I5OB 2X4YA 3BDLA 3EGXB 3H0HA 4NL3A 2E10A 1C0MA 1Y96B 3JCMV 4ESRA 3HPWA 3OYDA 1TUCA 1GXIE 3OB9A 1KK7A 1GFDA 1JJ2S 1LJOA 5LJ3e 1WXTA 2CT4A 3L2ZA 3PIOA 1VUBA 5A0DA 1SRMA 1LPLA 4PJOG 1UG1A 3V7CA 3H0FA 2DMOA 1PRMC 2W10A 3CCST 2OTJA 1H8KA 2EQUA 5IXFA 4XU1A 1V1CA 4E7SA 2RQWA 3RDVA 4M77A 3CEYA 2YWWA 3I56T 1NEGA 1WJRA 3FC3A 2L5QA 1W1FA 3M4YA 2JTMA 1N9RA 1ZSGA 5GAN5 5GAOl 1X6GA 4M77D 5DM7R 1RLPC 4R0KA 3P8HA 2LX7A 2NWMA 2LJ0A 1QVGS 1TUDA 1ZUYA 2DTHA 2OAWA 1LCKA 2E3HA 2G3RA 4CI0C 3OY9A 3ULRB 2D6FA 4FSXA 3A8MB 2YDLA 4M75G 1IXDA 1M3AA 2OJ2A 3EG1A 5LL6S 2FZKB 3GBQA 1UJ0A 2AT1B 2LVMA 1R0BG 3M5AA 4PJOE 1F1BB 3MEWA 3VS2A 1P92A 3VS1A 3I56A 3EHQA 1YCYA 2E5KA 3L42A 2LJ1A 4XTXA 2VGNA 2F1LA 1WYXA 1SHGA 3LW5E 4AG1C 3GPLA 4F04B 1TUGB 1YJWA 1IRXA 1N8RU 3QIIA 4N0AC 1N6AA 1BCMA 3ER0A 3HSBA 5KYNA 2DERA 3VS3A 2LQWA 1U8RA 2DL5A 4M78B 3M53A 2HQHA 4PJOC 4HCCA 5DLQE 5GAOn 1U5SA 3PIPA 1NYGA 3DKMA 2D8HA 2YHTA 3QG1A 2JUFA 1N8RR 1HSQA 1MMAA 1Q81U 2GBQA 5LJ3g 2VUBA 1KHCA 3KBGA 4B6MA 2J6KA 4PK4A 4E6RA 1G3WA 3FDRA 3E2UA 4M75F 3PGGA 1IREB 2KT8A 2IG0A 1OZ2A 4J6WA 1SG5A 1X69A 5IN1A 1YI2Q 3SWNB 4X9CA 1WHHA 1YITT 1Q81R 2RHIA 3L2WA 3CCMQ 1E6HA 1UUEA 3LLRA 1UHFA 2AZSA 2X4JA 3CC4T 2JZ2A 2EQIA 2E64A 2KI7A 2PNIA 1BI3A 4M75C 1RLQC 4CC7A 1I0CA 5M9OA 2BKDN 4LDXA 1BU1A 3BFMA 2O9VA 2QTXA 1H3HA 2RHXA 3V8JA 1YJNA 5KE2A 1TH7A 2Y4YA 3UDCA 1D1BA 4RKUE 5GAN3 3CQTA 3JCMh 2OX7A 1PM3A 4E7ZA 3QYGB 4OP0A 1K1ZA 1FMWA 2RNAA 1YITA 3CCVA 2EYXA 4II1A 3RNJA 5I21A 4GLKA 3MP8A 1CKAA 2JS2A 1Q86U 2NUTB 1BB9A 1Y07A 2GTJA 4XAXB 2DEUA 2QGFB 3CMET 1YBYA 3RKWA 3VS4A 4ZN1A 1ACMB 1QQJA 4M78A 1BYMA 3OS2A 1BI1A 2WACA 3GLXA 1Q86R 4JS4A 3RBBB 3CBMA 3JCMc 4M78D 3JB9I 3KUFA 2KYBA 1X27A 5FU6B 1TS9A 2KBTA 2COYA 5IAYA 1TTHB 1RADB 3X28B 3G6EQ 4RTWA 3FJ5A 5KYXB 1MMDA 1YIJA 2ZZDA 4GLMA 1G3SA 2H8HA 2CZ6B 3SWNA 1M90C 4HVUA 8ATCB 1ARKA 4UC4A 1QWFA 1MNDA 1AWOA 4LE9A 4ZN3A 3CMEA 2KNBB 2JTFA 1QVFP 2XDBA 2GCXA 2LT1A 2GNCA 2CP3A 5CR2A 4KUIA 4LN2A 2XI9A 5C6SA 1PHTA 1KC8C 2BZYA 3HRTA 2JN0A 3HTRA 2DTOA 3FJPA 3NTKA 1MV0B 5CCAA 1YJ9T 3H41A 1OZ3A 2DYIA 4JJCA 1NYFA 1U3OA 1TG0A 2ESWA 3OSSC 1WQWA 3M4GA 3M56A 2WSFE 1QP3A 4FSSA 2LC4A 4KGZB 2EW3A 2NLUA 1AWWA 1JJ2P 4OMMA 3UPUA 1OOTA 2ZPEB 3CCLQ 1VQPA 4M7DG 2EGAA 3CCQT 2C06A 2L3RA 4FYXB 3I55T 3JCMb 4F17A 4C8QB 4AFSC 4FIBA 2KXDA 2BE9B 2RQUA 1NJIC 4BDZA 1Q7YC 1YWPA 1YJ9A 4X1VA 3D7SB 2A0FB 3EH1A 5KYXA 2P4TA 3HRUA 2EVRA 5FROA 2DNUA 3TEEA 3OA6A 3VRZA 4DOVA 2QQSA 1IHVA 1K9AA 2DEQA 2NUZA 1KD1C 3OBWA 2RJDA 4PLLA 2M51A 1Z9ZA 1D0ZA 4ZGEB 1NLPC 3CCQA 4BI8B 3I55A 2CP5A 4HT9A 4AFUC 4XU0A 5FLXE 1R0CB 1AVZC 2PQWA 5A2QE 3CPWS 3MPUB 1QMCA 1FWZA 2I0NA 2R5MA 4QVDA 2J05A 1H3ZA 1N27A 1K4US 4M7DF 3URGA 1Q82U 1MGQA 3JCMW 1NG2A 3CC7T 3C95A 1WZOA 4RTXA 2CS7A 2DKGA 3VU3C 4F14A 4VUBA 1NEBA 3INZA 4MDXA 3QUIA 4M7DC 1WHMA 3QDFA 1Q82R 4JS5A 3OQ5A 2DXUA 2CP0A 2JMAA 5GAOq 1VQ5T 2O01E 1RAHB 4OMOA 2HSEB 3J81E 4YTLA 2ZPIB 1X2KA 1ZUUA 3O8VA 1X2QA 4C8QA 1AWJA 4J6YA 2V1QA 2KT1A 4E7KA 1UDLA 1M9SA 1WXUA 5IXBA 1JBMA 4C8QD 1VYTA 1VQLQ 4O5VA 1OU9A 2EPDA 2J06A 4GY5A 4Q5WA 2DETA 1IHWA 2KR3A 3UT1A 1M90U 9ATCB 2LDMA 3JRZA 4R56A 2DXCA 2EWNA 1M5Q1 3I9QA 1S72Q 2D8JA 3JCMP 1FMKA 4BE2A 5KCOA 5KE3A 2P84A 3F70A 2M9UA 4HVWA 1VQ4T 1M8MA 1KC8U 4ZTFA 1VYUA 3JB9G 2L8DA 1R8OB 2QEXT 3G71T 1EZZB 2KQWA 1VQNT 3EAEA 3OBYA 2L3PA 1K9MC 1MMGA 5GAMd 1KC8R 1YHQT 3H0IA 2F2XA 4J9EA 1VIEA 2D1XA 2LT4A 3CCRQ 2EYZA 2AK5A 3FB9A 1RI9A 4EMGA 4ZNXA 1I81A 1UE9A 3TVTA 4GBQA 2QYZA 2GTOA 1VQ4A 2RHZA 2EYWA 3SDZA 1QLYA 2JMCA 3ZL7C 2JVVA 4BI3A 1NJIU 3X24B 2QEXA 3G71A 1Q7YU 2CKKA 3MCAB 2RHYA 1LOJA 2YXYA 4BDYA 2MWOA 4C92A
chains in the Genus database with same CATH topology
1HD3A 2C0TA 3VS3A 1JQQA 3M0RA 5FWBA 2LQWA 2M0YA 2HBWA 4OMQA 2ROTA 2DL5A 4RTTA 2DBKA 1U5SA 1NYGA 2FPEA 2D8HA 1PNJA 1ZUKA 1PRLC 1HSQA 1N5ZA 3A98A 3O5ZA 3U23A 2GBQA 2DRKA 3EG0A 1I1JA 4QT7A 2LJ3A 2J6KA 4E6RA 1BK2A 1WIEA 2C0OA 1EFNA 2F2VA 3I35A 2X3WD 1JU5C 1Y57A 2KT8A 4JJBA 1X69A 4J9CA 1YNZA 4RTUA 2DM1A 2CDTA 2DJQA 1U06A 2L3QA 1B07A 2JM8A 2KE9A 1E6HA 1JEGA 3I5RA 3M0TA 1UUEA 2CH4W 2DLPA 1UHFA 2LQNA 2AZSA 1NLOC 2EQIA 1ABOA 2LP5A 2DYBA 1AZEA 2PNIA 1RLQC 4CC7A 1I0CA 1SHFA 1AZGB 2LMJA 1BU1A 4HXJA 3UA6A 2O9VA 4D8DA 1SEMA 1M30A 1H3HA 1H92A 2DL3A 3NHNA 2ED1A 2A37A 1AEYA 4M4ZA 1M3CA 2F2WA 2FG0A 4IIOA 2KXCA 2ED0A 3CQTA 4LUEA 2FPFA 1WX6A 4KRTA 4Z8AA 1K1ZA 2RNAA 1T0JA 2K9GA 1T3SA 1S1NA 2EYXA 4JZ4A 3RNJA 1ZLMA 3EG3A 1CKAA 2FO0A 2JS2A 3VS5A 4CC3A 2DVJA 4F16A 2CUBA 3PVQA 2AKLA 2EGCA 2YUQA 1BB9A 1WXBA 2BZXA 1AOJA 2GTJA 4J9DA 2MCNA 1KJWA 1X43A 3VS4A 1PWTA 4WCIA 2HCKA 2JW4A 1YWOA 2RPNA 2AZVA 2P4RA 1E7OA 4RTYA 5ECAA 4IIMA 1T0HA 3RBBB 1FYNA 2KYBA 1X27A 3EG2A 2DL7A 5I22A 2JS0A 2KBTA 2CH4A 1WFWA 4RTWA 3FJ5A 1UJYA 2DF6A 4GLMA 2H8HA 3UATA 1UFFA 1M3BA 2K3BA 4J9GA 4HVUA 1WA7A 3R6NA 1ARKA 3UA7A 2CUDA 1QWFA 1RUWA 1Z9QA 2ECZA 2DX1A 2GQIA 2SEMA 4LE9A 4Z89A 1AWOA 3M0SA 2BZ8A 1UGVA 2KNBB 2RF0A 5L23A 2BTTA 2GNCA 2RQRA 1WI7A 2HSPA 5GJVB 1GBRA 4LN2A 2PTKA 4OMNA 2D0NA 2QDLA 1GCQA 2K79A 1HJDA 1PHTA 2VVKA 3SEMA 1GL5A 2BZYA 2EYYA 2JXBA 1K76A 1MV0B 1K0XA 3H41A 3PVLA 3M0PA 1VYVA 3VRYA 4JJCA 1NYFA 1U3OA 3EGUA 1TG0A 2K6DA 2A28A 2RN8A 2ESWA 2DBMA 4D8KA 2ENMA 4FSSA 3M0UA 3KFVA 1NM7A 2EW3A 1AWWA 4Z88A 2CT3A 4OMMA 1GBQA 1OOTA 1W70A 3NGPA 1Y0MA 4HVVA 2KRNA 2EGAA 5HCKA 2EKHA 5IH2A 1PKTA 2O88A 1ZX6A 4J9BA 2HDAA 2HEQA 2X3XD 4F17A 2O9SA 4AFSC 2DILA 2FEIA 2KXDA 2V1RA 2RQUA 1JXOA 4J9IA 3I5SA 1YWPA 1YN8A 2J6FA 4X1VA 2ABLA 1UTIA 2J7IA 1W6XA 4RTVA 4CC4B 1X6BA 5IHKA 2EVRA 2DNUA 3IQLA 4A63B 3QWYA 2IIMA 3NMZC 3VRZA 2L0AA 1JXMA 3QWXX 1K9AA 5FW9A 2DL4A 2JTEA 3REAB 2VKNA 1CSKA 1BBZA 2NUZA 3VS0A 1OPLA 2MOXA 2M51A 1Z9ZA 1A0NB 4RUGA 2O2OA 1QKWA 2XMFA 1NLPC 2DL8A 2JT4A 1PKSA 2YSQA 5I11A 2B86A 1MV3A 4AFUC 2W0ZA 1XOVA 1AVZC 2A08A 3JV3A 2I0NA 4OMPA 2VWFA 4J9FA 1SPKA 2J05A 2LZ6B 1K4US 2DRMA 2L2PA 1I07A 2FPDA 1GRIA 1NG2A 3C0CA 2SRCA 4RTXA 2O31A 1KFZA 1QWEA 1SRLA 4RTZA 2KRMA 3SHWA 4K11A 4F14A 1CKBA 3VS6A 1NEBA 5IHNA 3PE0A 1SSHA 1YP5A 1MUZA 4DEYA 2JMAA 1K0SA 1M27C 4OMOA 1QKXA 2KYMA 1X2KA 1ABQA 4Y92A 1ZUUA 5IHIA 2YT6A 1GCQC 2CSQA 5EC7A 1X2QA 2G6FX 1JO8A 3NPFA 1AWJA 1T3LA 2DA9A 2V1QA 2KT1A 4LNPA 2K7AA 1UDLA 2AKKA 1WXUA 5IXBA 2EBPA 4HCKA 1E6GA 1VYTA 3H0HA 2KEAA 2EPDA 2J06A 4OMLA 2KR3A 4ESRA 2DE0X 1TUCA 2MIOA 1B3QA 1GFDA 1AWXA 4ORZA 4JPBW 1WXTA 2CT4A 2KRSA 3EHRA 1SRMA 3I9QA 2ROLA 1UG1A 3UF4A 4CC2A 2D8JA 2GGRA 3H0FA 2DMOA 1PRMC 2W10A 1FMKA 2J6OA 2YUPA 1H8KA 4LUDA 5IXFA 2A36A 1V1CA 2RQWA 1GCPA 1OPKA 2K2MA 1NEGA 4DEXA 4HVWA 1W1FA 1M8MA 1ZSGA 2RQTA 1X6GA 1VYUA 1RLPC 1J3TA 2RQVA 4R0KA 4AG2C 2LX7A 3REBB 2NWMA 1WLPB 2LJ0A 3LH5A 1OEBA 1TUDA 1ZUYA 1KSWA 2OAWA 1QCFA 1LCKA 4JJDA 2FRWA 1YCSB 2L3PA 3TSWA 3ULRB 4AFQC 1G2BA 2YDLA 3H0IA 2F2XA 4J9EA 2CREA 2L3SA 1M3AA 1OV3A 2D1XA 2OJ2A 3EG1A 1G83A 5GJWB 4AFZC 2EYZA 1GFCA 2AK5A 1IO6A 1WDXA 2PZ1A 2LCSA 1RI9A 4ZNXA 2KROA 1VA7A 3GBQA 1UJ0A 1UE9A 3TVTA 2C0IA 4GBQA 3M0QA 3VS2A 3VS1A 2RMOA 3EHQA 2E5KA 2CSIA 2LJ1A 1AD5A 2GTOA 1UHCA 3TSZA 1UECA 2EYWA 5FWCA 1WYXA 3VS7A 4EIKA 1SHGA 1ZBJA 1QLYA 2JMCA 3ZL7C 2EGEA 4AG1C 4JZ3A 2YUNA 2JM9A 2LNHB 3THKA 2KGTA 1KIKA 2OI3A 2YUOA 4J9HA 2FRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD3 A;  2C0T A;  3VS3 A;  1JQQ A;  3M0R A;  5FWB A;  2LQW A;  2M0Y A;  2HBW A;  4OMQ A;  2ROT A;  2DL5 A;  4RTT A;  2DBK A;  1U5S A;  1NYG A;  2FPE A;  2D8H A;  1PNJ A;  1ZUK A;  1PRL C;  1HSQ A;  1N5Z A;  3A98 A;  3O5Z A;  3U23 A;  2GBQ A;  2DRK A;  3EG0 A;  1I1J A;  4QT7 A;  2LJ3 A;  2J6K A;  4E6R A;  1BK2 A;  1WIE A;  2C0O A;  1EFN A;  2F2V A;  3I35 A;  2X3W D;  1JU5 C;  1Y57 A;  2KT8 A;  4JJB A;  1X69 A;  4J9C A;  1YNZ A;  4RTU A;  2DM1 A;  2CDT A;  2DJQ A;  1U06 A;  2L3Q A;  1B07 A;  2JM8 A;  2KE9 A;  1E6H A;  1JEG A;  3I5R A;  3M0T A;  1UUE A;  2CH4 W;  2DLP A;  1UHF A;  2LQN A;  2AZS A;  1NLO C;  2EQI A;  1ABO A;  2LP5 A;  2DYB A;  1AZE A;  2PNI A;  1RLQ C;  4CC7 A;  1I0C A;  1SHF A;  1AZG B;  2LMJ A;  1BU1 A;  4HXJ A;  3UA6 A;  2O9V A;  4D8D A;  1SEM A;  1M30 A;  1H3H A;  1H92 A;  2DL3 A;  3NHN A;  2ED1 A;  2A37 A;  1AEY A;  4M4Z A;  1M3C A;  2F2W A;  2FG0 A;  4IIO A;  2KXC A;  2ED0 A;  3CQT A;  4LUE A;  2FPF A;  1WX6 A;  4KRT A;  4Z8A A;  1K1Z A;  2RNA A;  1T0J A;  2K9G A;  1T3S A;  1S1N A;  2EYX A;  4JZ4 A;  3RNJ A;  1ZLM A;  3EG3 A;  1CKA A;  2FO0 A;  2JS2 A;  3VS5 A;  4CC3 A;  2DVJ A;  4F16 A;  2CUB A;  3PVQ A;  2AKL A;  2EGC A;  2YUQ A;  1BB9 A;  1WXB A;  2BZX A;  1AOJ A;  2GTJ A;  4J9D A;  2MCN A;  1KJW A;  1X43 A;  3VS4 A;  1PWT A;  4WCI A;  2HCK A;  2JW4 A;  1YWO A;  2RPN A;  2AZV A;  2P4R A;  1E7O A;  4RTY A;  5ECA A;  4IIM A;  1T0H A;  3RBB B;  1FYN A;  2KYB A;  1X27 A;  3EG2 A;  2DL7 A;  5I22 A;  2JS0 A;  2KBT A;  2CH4 A;  1WFW A;  4RTW A;  3FJ5 A;  1UJY A;  2DF6 A;  4GLM A;  2H8H A;  3UAT A;  1UFF A;  1M3B A;  2K3B A;  4J9G A;  4HVU A;  1WA7 A;  3R6N A;  1ARK A;  3UA7 A;  2CUD A;  1QWF A;  1RUW A;  1Z9Q A;  2ECZ A;  2DX1 A;  2GQI A;  2SEM A;  4LE9 A;  4Z89 A;  1AWO A;  3M0S A;  2BZ8 A;  1UGV A;  2KNB B;  2RF0 A;  5L23 A;  2BTT A;  2GNC A;  2RQR A;  1WI7 A;  2HSP A;  5GJV B;  1GBR A;  4LN2 A;  2PTK A;  4OMN A;  2D0N A;  2QDL A;  1GCQ A;  2K79 A;  1HJD A;  1PHT A;  2VVK A;  3SEM A;  1GL5 A;  2BZY A;  2EYY A;  2JXB A;  1K76 A;  1MV0 B;  1K0X A;  3H41 A;  3PVL A;  3M0P A;  1VYV A;  3VRY A;  4JJC A;  1NYF A;  1U3O A;  3EGU A;  1TG0 A;  2K6D A;  2A28 A;  2RN8 A;  2ESW A;  2DBM A;  4D8K A;  2ENM A;  4FSS A;  3M0U A;  3KFV A;  1NM7 A;  2EW3 A;  1AWW A;  4Z88 A;  2CT3 A;  4OMM A;  1GBQ A;  1OOT A;  1W70 A;  3NGP A;  1Y0M A;  4HVV A;  2KRN A;  2EGA A;  5HCK A;  2EKH A;  5IH2 A;  1PKT A;  2O88 A;  1ZX6 A;  4J9B A;  2HDA A;  2HEQ A;  2X3X D;  4F17 A;  2O9S A;  4AFS C;  2DIL A;  2FEI A;  2KXD A;  2V1R A;  2RQU A;  1JXO A;  4J9I A;  3I5S A;  1YWP A;  1YN8 A;  2J6F A;  4X1V A;  2ABL A;  1UTI A;  2J7I A;  1W6X A;  4RTV A;  4CC4 B;  1X6B A;  5IHK A;  2EVR A;  2DNU A;  3IQL A;  4A63 B;  3QWY A;  2IIM A;  3NMZ C;  3VRZ A;  2L0A A;  1JXM A;  3QWX X;  1K9A A;  5FW9 A;  2DL4 A;  2JTE A;  3REA B;  2VKN A;  1CSK A;  1BBZ A;  2NUZ A;  3VS0 A;  1OPL A;  2MOX A;  2M51 A;  1Z9Z A;  1A0N B;  4RUG A;  2O2O A;  1QKW A;  2XMF A;  1NLP C;  2DL8 A;  2JT4 A;  1PKS A;  2YSQ A;  5I11 A;  2B86 A;  1MV3 A;  4AFU C;  2W0Z A;  1XOV A;  1AVZ C;  2A08 A;  3JV3 A;  2I0N A;  4OMP A;  2VWF A;  4J9F A;  1SPK A;  2J05 A;  2LZ6 B;  1K4U S;  2DRM A;  2L2P A;  1I07 A;  2FPD A;  1GRI A;  1NG2 A;  3C0C A;  2SRC A;  4RTX A;  2O31 A;  1KFZ A;  1QWE A;  1SRL A;  4RTZ A;  2KRM A;  3SHW A;  4K11 A;  4F14 A;  1CKB A;  3VS6 A;  1NEB A;  5IHN A;  3PE0 A;  1SSH A;  1YP5 A;  1MUZ A;  4DEY A;  2JMA A;  1K0S A;  1M27 C;  4OMO A;  1QKX A;  2KYM A;  1X2K A;  1ABQ A;  4Y92 A;  1ZUU A;  5IHI A;  2YT6 A;  1GCQ C;  2CSQ A;  5EC7 A;  1X2Q A;  2G6F X;  1JO8 A;  3NPF A;  1AWJ A;  1T3L A;  2DA9 A;  2V1Q A;  2KT1 A;  4LNP A;  2K7A A;  1UDL A;  2AKK A;  1WXU A;  5IXB A;  2EBP A;  4HCK A;  1E6G A;  1VYT A;  3H0H A;  2KEA A;  2EPD A;  2J06 A;  4OML A;  2KR3 A;  4ESR A;  2DE0 X;  1TUC A;  2MIO A;  1B3Q A;  1GFD A;  1AWX A;  4ORZ A;  4JPB W;  1WXT A;  2CT4 A;  2KRS A;  3EHR A;  1SRM A;  3I9Q A;  2ROL A;  1UG1 A;  3UF4 A;  4CC2 A;  2D8J A;  2GGR A;  3H0F A;  2DMO A;  1PRM C;  2W10 A;  1FMK A;  2J6O A;  2YUP A;  1H8K A;  4LUD A;  5IXF A;  2A36 A;  1V1C A;  2RQW A;  1GCP A;  1OPK A;  2K2M A;  1NEG A;  4DEX A;  4HVW A;  1W1F A;  1M8M A;  1ZSG A;  2RQT A;  1X6G A;  1VYU A;  1RLP C;  1J3T A;  2RQV A;  4R0K A;  4AG2 C;  2LX7 A;  3REB B;  2NWM A;  1WLP B;  2LJ0 A;  3LH5 A;  1OEB A;  1TUD A;  1ZUY A;  1KSW A;  2OAW A;  1QCF A;  1LCK A;  4JJD A;  2FRW A;  1YCS B;  2L3P A;  3TSW A;  3ULR B;  4AFQ C;  1G2B A;  2YDL A;  3H0I A;  2F2X A;  4J9E A;  2CRE A;  2L3S A;  1M3A A;  1OV3 A;  2D1X A;  2OJ2 A;  3EG1 A;  1G83 A;  5GJW B;  4AFZ C;  2EYZ A;  1GFC A;  2AK5 A;  1IO6 A;  1WDX A;  2PZ1 A;  2LCS A;  1RI9 A;  4ZNX A;  2KRO A;  1VA7 A;  3GBQ A;  1UJ0 A;  1UE9 A;  3TVT A;  2C0I A;  4GBQ A;  3M0Q A;  3VS2 A;  3VS1 A;  2RMO A;  3EHQ A;  2E5K A;  2CSI A;  2LJ1 A;  1AD5 A;  2GTO A;  1UHC A;  3TSZ A;  1UEC A;  2EYW A;  5FWC A;  1WYX A;  3VS7 A;  4EIK A;  1SHG A;  1ZBJ A;  1QLY A;  2JMC A;  3ZL7 C;  2EGE A;  4AG1 C;  4JZ3 A;  2YUN A;  2JM9 A;  2LNH B;  3THK A;  2KGT A;  1KIK A;  2OI3 A;  2YUO A;  4J9H A;  2FRY A; 
#chains in the Genus database with same CATH topology
 2CYZ B;  2C0T A;  1VQ8 A;  3M0R A;  4Y28 E;  2H3E B;  2HBW A;  4BUG A;  1NJI R;  1Q7Y R;  2DBK A;  3J7A F;  4LDY A;  4NOY A;  1OYX A;  3OYB A;  1ZA1 B;  2RD1 A;  4C92 D;  1XNI A;  2FPE A;  5GAO m;  2HL3 A;  4QQ6 A;  1PNJ A;  2DZC A;  1KD1 U;  3U23 A;  1B34 B;  2DRK A;  1I8F A;  3L2V A;  1UEB A;  4BE1 A;  4DBR A;  4MZT A;  1WIE A;  4N4G A;  1QVP A;  3I35 A;  1JU5 C;  3SB2 A;  1Q86 C;  1WGS A;  4EMH A;  1BCO A;  1KD1 R;  2F69 A;  1U06 A;  4JUV A;  4R55 A;  2HKQ B;  1B07 A;  2KE9 A;  4EMK C;  1NLO C;  1M8V A;  3P8B B;  3QBY A;  4OMF B;  1SHF A;  5GAN d;  2XDD A;  1AZG B;  4PJO B;  3OYA A;  3CCE Q;  4XQ3 A;  4Y91 A;  1SEM A;  2OTL Q;  1VQ9 Q;  3CC2 Q;  1M30 A;  2QAS A;  3EG9 A;  2A37 A;  1HYO A;  4M4Z A;  4E7L A;  2F2W A;  2ED0 A;  4JRI A;  2MK5 A;  4MZP A;  1SF9 A;  4CRI A;  1WNL A;  3GP8 A;  3QXE B;  1KQ1 A;  1S1N A;  4LXC A;  4C5H A;  3HP9 A;  3HFN A;  3A1P A;  3EG3 A;  2FO0 A;  3VS5 A;  4F7U G;  4CC3 A;  2JJ9 A;  3N5B B;  2KAF A;  4M75 B;  2EGC A;  4OB1 B;  3QHS A;  4HCB A;  3OYG A;  1WXB A;  1YI2 T;  2DXB A;  3CCS A;  3CCM T;  4WCI A;  2EYQ A;  3PT9 A;  1PCX A;  1M2V A;  2BE7 D;  1TU0 B;  1YWO A;  2JW4 A;  4QQD A;  3OYL A;  2ATC B;  1ZQ1 A;  2AZV A;  2PUO B;  2X9H A;  2MI6 A;  3A8H B;  4AT1 B;  3E9G A;  4MML A;  4PKC C;  2DL7 A;  4A4G A;  2PVG B;  2DO3 A;  1PSE A;  4PJO F;  2LRQ A;  3CPW P;  1VQ7 Q;  4M7A G;  1UJY A;  3JB9 H;  3EGX A;  3WXM B;  3MET A;  3MP1 A;  3OS1 A;  1Y96 A;  2WSC E;  4IUT A;  5CO7 A;  3JCM f;  3R6N A;  2KMT A;  3UA7 A;  4N0A A;  4J7F A;  1YI2 A;  4F7U E;  3CPW A;  1RUW A;  2DX1 A;  4Z89 A;  2ZGW A;  3M0S A;  1UGV A;  4PJL A;  2QI2 A;  1K9M U;  2K2V A;  2K57 A;  5GAN 8;  1VQK Q;  4QKU A;  3DLM A;  2H3J A;  3LGF A;  1W4S A;  2BUD A;  4F7U F;  3MO8 A;  4WF2 A;  3M55 A;  1GCQ A;  3JCM e;  1RI0 A;  1K9M R;  3CMA Q;  2O4X B;  1VQM Q;  2EYY A;  2JXB A;  2LNV A;  1W2B S;  4PLI A;  4ELY C;  1YJW Q;  4ZGJ B;  4FU6 A;  3EGU A;  4X9D A;  4M7A E;  4RCC A;  1ZBX A;  4D8K A;  2RA2 A;  3G6E T;  1JRI A;  2MPX C;  1IGU A;  1X01 A;  4M75 A;  1G5V A;  1NM7 A;  1OX9 A;  2XKO C;  5GAM h;  2ZPH B;  4Z88 A;  1GBQ A;  4M7A F;  4M75 D;  1Y0M A;  4HVV A;  3DB4 A;  1NZ9 A;  2E41 A;  2EKH A;  5IH2 A;  1PKT A;  2O88 A;  2GF7 A;  3RER A;  4J9B A;  2RI5 A;  5GAN 7;  2X3X D;  5FRN A;  2QQA A;  3CPF A;  2FEI A;  4XU3 A;  4M78 E;  1Q82 C;  2V1R A;  4J9I A;  4M7A C;  2E6Z A;  2YRD A;  3CC4 A;  2ABL A;  3OYI A;  4PJJ A;  1K73 C;  5IHK A;  2ZCF B;  4KUL A;  3VUB A;  3TRE A;  1FXX A;  2IIM A;  2L0A A;  3QWX X;  4A53 A;  2JTE A;  2PVO B;  1IGQ A;  2YRC A;  3DB3 A;  5J26 A;  5GMK h;  1OPL A;  2NYS A;  4RUG A;  2O2O A;  5CKF A;  1YJN Q;  2AHJ B;  2XMF A;  3TU4 K;  1G3T A;  3A8O B;  2YSQ A;  4M78 C;  2E3I A;  3RMS A;  3OYH A;  1D0X A;  3PFS A;  3CBO A;  2YRV A;  2W0Z A;  3C4S A;  3RMQ A;  4FW2 A;  3JCM J;  3JV3 A;  3CCV Q;  3CCL T;  3L2Q A;  3GOX A;  4OF1 A;  4OMP A;  4OB2 B;  2O4X A;  3JCM g;  1X75 C;  1SPK A;  1TWB A;  3ME9 A;  2IVW A;  4C0F A;  3CCJ Q;  2O31 A;  1O75 A;  1KFZ A;  1QWE A;  2MAM A;  1BI2 A;  3T9N A;  4X34 A;  3VS6 A;  5IHN A;  5GAN h;  5LJ5 d;  2XK0 A;  5A0L A;  1QVF A;  3MEV A;  1UGQ B;  1M27 C;  2KYM A;  1U1S A;  1ABQ A;  4Y92 A;  5IHI A;  2CSQ A;  1AHJ B;  1D0Y A;  4XK8 E;  2DA9 A;  1YIJ Q;  4FYY B;  1PD0 A;  2ZPB B;  3LWI A;  2VXE A;  1N9S A;  2AKK A;  2NUP B;  2VB6 A;  3OYN A;  2EBP A;  4HCK A;  4E2F B;  4E47 A;  1I5L A;  2QTV A;  1YFN A;  2COZ A;  2KEA A;  4OML A;  3CBP A;  1M1K U;  1H64 1;  1WQ7 A;  2VXF A;  2NUT A;  2YLC A;  5KYU B;  1B3Q A;  1RAB B;  4ORZ A;  2FZC B;  5EG2 A;  4M7D B;  2KRS A;  3MP6 A;  1G3Y A;  2ROL A;  4BD3 A;  3M54 A;  2GGR A;  1M1K R;  4PJM A;  2YUP A;  4BAC A;  5AT1 B;  1JJ2 A;  2QQR A;  3Q1J A;  1GCP A;  4XTW A;  3GNF B;  1OPK A;  4XTU A;  2K2M A;  2P0Q A;  2RQT A;  2PVD B;  2JNG A;  1J3T A;  2RQV A;  5GAM j;  3CCU Q;  1QVG P;  3REB B;  3RR6 A;  4Z02 A;  3OYC A;  1OEB A;  3AHU A;  1UGP B;  3RES A;  1OX8 A;  1YCS B;  2WSE E;  3J80 E;  2Y4X A;  3NTH A;  3C94 A;  1G2B A;  1QVG A;  1QCN A;  3FIF A;  2L3S A;  3MHX A;  4OB0 B;  2IPO B;  3JSC A;  1G83 A;  2HNI A;  5GJW B;  1VQL T;  1VQP Q;  4AFZ C;  1RAC B;  1GFC A;  2PZ1 A;  1IO6 A;  1WDX A;  2LCS A;  3OS5 A;  1NBE B;  2KRO A;  4OVA A;  2CZ1 B;  2C0I A;  3QDR B;  2DTI A;  4IUU A;  3OMC A;  4IUQ A;  5HK0 A;  2RMO A;  2CSI A;  3SD4 A;  1AD5 A;  4HKE A;  2V26 A;  5GMK l;  1LNX A;  1UHC A;  4C5I A;  2V8J A;  3A8G B;  3V8L A;  5FWC A;  4EIK A;  3VS7 A;  1S72 T;  3VV0 A;  2XG8 D;  4EPC A;  3HL8 A;  2KY9 A;  2EGE A;  4JZ3 A;  2JM9 A;  1UGS B;  2LNH B;  5GMK j;  2XIC A;  4BY6 C;  4ZTJ A;  1TSF A;  1FX7 A;  2YUO A;  4C8Q E;  2OAU A;  1K73 U;  4QVZ A;  2DIQ A;  3EH2 A;  2X51 A;  1HD3 A;  1JQQ A;  2V8K A;  4OMQ A;  5LJ3 d;  1VQL A;  2M0O A;  5KYU A;  3G7Z A;  2VGM A;  3CD6 Q;  4M7D A;  3BDU A;  5I2S A;  1N5Z A;  3A98 A;  1K73 R;  2E4H A;  2HMA A;  4ELZ C;  2ZAE A;  1I1J A;  3HHT B;  1EIF A;  2QAZ A;  3OYE A;  4M7D D;  5DY9 A;  2EQK A;  4E7H A;  3CCR T;  1S72 A;  1EFN A;  2X3W D;  1UGR B;  2HZY A;  4JJB A;  3CXC S;  2GFU A;  2DM1 A;  1X6O A;  2DJQ A;  3CC7 A;  1W2B P;  2Y90 A;  2L3Q A;  3E9F A;  4PFZ A;  2JM8 A;  2RJC A;  2MMP A;  1JEG A;  5GAN j;  3I5R A;  2DLP A;  4A54 A;  4P5N A;  2XD0 A;  2LQN A;  3RKY A;  3G4S Q;  4KH0 B;  2LP5 A;  5J3B A;  1W2B A;  2RI3 A;  2LMJ A;  4HXJ A;  3UA6 A;  1VQ5 A;  1LVK A;  4C92 G;  4D8D A;  1Q95 G;  1ZSZ C;  2M1H A;  2DL3 A;  3NHN A;  2RH2 A;  1AEY A;  3M58 A;  2VAS A;  3CCR A;  2KXC A;  4LUE A;  2FPF A;  2DAQ A;  4Z8A A;  3FLG A;  2EIF A;  4OGE A;  3UWN A;  3QJ6 A;  2QA4 Q;  2MF2 A;  4EMK B;  3BW1 A;  3GF5 A;  1ZHI A;  2DVJ A;  1VQ6 Q;  1VOM A;  3OSV A;  3BY7 A;  2DD5 A;  3PVQ A;  2AKL A;  4C5E A;  5D6W A;  3KXT A;  2RB6 A;  2YUQ A;  2BZX A;  1AOJ A;  2X4X A;  2KK4 A;  4L59 A;  2VV5 A;  1DJ7 B;  1X43 A;  2A7Y A;  1PWT A;  4JRP A;  3QO3 A;  4NL2 A;  4LDV A;  2DD4 A;  3ASK A;  1K8A U;  3OW2 S;  4C92 E;  2HL5 C;  4JLG A;  1KHI A;  4PJN A;  5LJ5 h;  4JDS A;  4PFP A;  2P4R A;  1E7O A;  4RTY A;  5ECA A;  4IIM A;  5CIU A;  4M77 G;  3EG2 A;  3CCE T;  3JCM Q;  5I22 A;  2OTL T;  1VQ9 T;  3CC2 T;  3M9Q A;  1K8A R;  1VQN A;  1G8X A;  2R5A A;  5AYF A;  2DF6 A;  2GFA A;  1YHQ A;  3TCJ A;  3UAT A;  1M3B A;  2F5T X;  4J9G A;  3VYG A;  2RO0 A;  1MMN A;  2LTO A;  2CUD A;  3QPH A;  2K5F A;  3MEA A;  2L89 A;  1Z9Q A;  2GQI A;  1PSF A;  3JB9 F;  2V8I A;  2RF0 A;  4C92 C;  2RQR A;  1WI7 A;  1GBR A;  2HQE A;  2PTK A;  5KYY B;  4QQG A;  4DQ2 A;  2D0N A;  2QDL A;  4LDW A;  1HJD A;  3CCE A;  3SEM A;  2RJF A;  2OTL A;  1VQ9 A;  3CC2 A;  2Z0W A;  4M77 E;  1XJW B;  4NS5 A;  5HY6 A;  4LDU A;  1VYV A;  3VRY A;  4E7J A;  2ZPF B;  4ANJ A;  4JJN K;  1ZA2 B;  2RN8 A;  2R57 A;  3PMT A;  2DBM A;  3V8K A;  4EMK A;  5A0G A;  1VQ8 Q;  6AT1 B;  3M0U A;  2DXT A;  3KFV A;  4M77 F;  1VQ7 T;  3H8Z A;  3MJX A;  3QJY A;  4OB3 B;  1WHK A;  2QXF A;  3NGP A;  2KRN A;  3M59 A;  5FU7 C;  3WVD B;  1ZX6 A;  4M77 C;  4DBQ A;  4PFO A;  3VYH B;  2HDA A;  2HEQ A;  2E70 A;  4RG8 A;  1D1A A;  2O9S A;  2FZG B;  5CQY A;  1VQO Q;  2DIL A;  4J7I A;  1VQK T;  3I5S A;  1YN8 A;  1MNE A;  4F7U B;  2M16 A;  1UTI A;  3JCM X;  4RTV A;  3S3O A;  1X6B A;  4C0Z A;  1OU8 A;  3NTI A;  3IQL A;  3CMA T;  3QWY A;  3R6O A;  5DLO A;  1BIB A;  1VQM T;  2CP2 A;  1VQ7 A;  2P0K A;  1JXM A;  1RL2 A;  2PU9 B;  4BI4 A;  1YJW T;  5FW9 A;  2OTJ Q;  3REA B;  1CSK A;  3RKX A;  3VS0 A;  5LJ3 h;  2KVQ G;  1QKW A;  2DL8 A;  2M02 A;  1B34 A;  2JT4 A;  2E6N A;  1PKS A;  4L6V 5;  4RCB A;  3LGL A;  5I11 A;  1BIA A;  4RG2 A;  1MV3 A;  5KYY A;  5GAM f;  1WHJ A;  2A08 A;  1VQK A;  4M7A B;  1M2O A;  2K3X A;  1M1K C;  4D6W A;  2EKO A;  1V29 B;  2VWF A;  4B9X A;  4C0D C;  2LZ6 B;  2DFU A;  2L2P A;  3CMA A;  5GMK i;  1VQM A;  1V76 A;  3CCM A;  3C0C A;  5LJ5 j;  2E65 A;  3AT1 B;  2CZ0 B;  5GAM e;  3CCS Q;  2COW A;  1SKU B;  4XTV A;  4PJO A;  1SRL A;  3I56 Q;  3SHW A;  4K11 A;  3PE0 A;  1SSH A;  2DJZ A;  4PJO D;  4M78 G;  4DEY A;  1VIF A;  3RUX A;  1D1C A;  2HAX A;  3L1A A;  2FYK A;  3S3N A;  3M57 A;  2R58 A;  4M75 E;  3L2R A;  2FB7 A;  2EFI A;  5GAO p;  1JB0 E;  2YT6 A;  1GCQ C;  5IT9 E;  2KDS A;  1YJN T;  3NPF A;  2RM4 A;  2FVU A;  4BB7 A;  1XTD A;  2K7A A;  3PMI A;  3CXC P;  3X26 B;  5CKH A;  1IB8 A;  4F7U A;  3OYM A;  3EFO B;  3QYH B;  4EDU A;  3CCV T;  2DE0 X;  5HK3 A;  4E7I A;  2MIO A;  5GMK e;  3CXC A;  1AWX A;  3S3M A;  4JPB W;  1O9S A;  2I2L A;  3EHR A;  2DZ9 A;  3OYJ A;  3QZ9 B;  4FYW B;  3CCJ T;  3UF4 A;  3H6Z A;  4CC2 A;  3OYK A;  1MHN A;  2J6O A;  3LWH A;  4LUD A;  2A36 A;  2EQJ A;  1KQS S;  4A4H A;  4LD6 A;  4MZM A;  4TVR A;  4DEX A;  1WPY A;  5GAN f;  4M7A A;  4A4F A;  4QW2 A;  5CKE A;  2HBP A;  4AG2 C;  1FMV A;  1RAE B;  3G6E A;  4M78 F;  1WLP B;  2XDP A;  3LH5 A;  3ZFJ A;  1KSW A;  4M7A D;  1QCF A;  3HRS A;  4JJD A;  2FRW A;  1YIJ T;  4J6X A;  1C1A A;  3TSW A;  4AFQ C;  1QP2 A;  5GAN e;  4IUR A;  2CRE A;  4JRQ A;  1OV3 A;  3JAM E;  2XID A;  3CCJ A;  4A4K A;  4KGV B;  5GAM g;  1VA7 A;  4FYV B;  3HFO A;  3ZBD A;  3M0Q A;  1EX4 A;  3OW2 P;  1PD1 A;  1YIT Q;  5GAN 2;  2VYT A;  3RIR A;  3TSZ A;  3BE3 A;  4IUV A;  1UEC A;  5KH6 A;  3FEO A;  3X25 B;  3CC4 Q;  1ZBJ A;  5J39 A;  4C0G A;  1B7T A;  1Y71 A;  3MKD A;  2YUN A;  3OW2 A;  5D7U A;  3SWN C;  3THK A;  4FCY A;  2KGT A;  1KIK A;  5LJ3 j;  2OI3 A;  2D9T A;  2E5Q A;  4J9H A;  2FRY A;  5HKC A;  2EQM A;  5CKD A;  3EFO A;  2DPP B;  4L5G A;  4IKF A;  4XTY A;  1D09 B;  5FWB A;  3CCU T;  1WHG A;  2EJF A;  2M0Y A;  5CQX A;  2ROT A;  4RTT A;  2ZPG B;  2AIR B;  4HCZ A;  4O6J A;  3SFM A;  1ZUK A;  2P0P A;  1PRL C;  3O5Z A;  2CGH A;  3V7S A;  4QVC A;  3EG0 A;  4QT7 A;  3CCL A;  2LJ3 A;  1BK2 A;  1I4K 1;  1VQP T;  2C0O A;  2F2V A;  3NFC A;  1Y57 A;  3DLL A;  5CK9 A;  4J9C A;  1YNZ A;  4RTU A;  2CDT A;  4BY6 B;  1NPR A;  3CME Q;  3M0T A;  2RK2 A;  2CH4 W;  1U1T A;  2BIV A;  4N4H A;  1ABO A;  3QKJ A;  2DYB A;  1K8A C;  4ME7 A;  3X20 B;  1AZE A;  2QGG A;  3CCU A;  3HKS A;  2B8A A;  3EGD B;  2FL7 A;  4ZGD B;  3GIB A;  3PTA A;  5GMK m;  1RAA B;  3H9N A;  5FRM A;  1H92 A;  8AT1 B;  2ED1 A;  5GAN g;  1M3C A;  2LQK A;  2FG0 A;  3OYY A;  4IIO A;  1HK9 A;  4V2S A;  4RMO A;  5FU6 C;  1WX6 A;  3CD6 T;  4KRT A;  1Y7X A;  4C8Q G;  3JB9 J;  3E1S A;  4N4I A;  1T0J A;  5KYW B;  2K9G A;  1T3S A;  4JZ4 A;  2VC8 A;  1ZLM A;  7AT1 B;  1TOV A;  4PNO A;  4F16 A;  2CUB A;  1D3B B;  2RHU A;  4KT0 E;  1NE8 A;  3MEU A;  3QSU A;  4JRK A;  4J9D A;  2MCN A;  1QW1 A;  2DIG A;  1KJW A;  2KSS A;  2FHD A;  5GAN 4;  1ZSZ B;  2QQB A;  3L2U A;  2HCK A;  3G4S T;  2RPN A;  1NPP A;  1YJ9 Q;  3EFR A;  5L8R E;  1M4Z A;  3VJP A;  1C6V X;  2MYS A;  1T0H A;  4KBM B;  4HT8 A;  1FYN A;  2GQV A;  2JS0 A;  3P8D A;  3CD6 A;  2CH4 A;  4M7D E;  3FRN A;  1WHL A;  1WFW A;  2K5L A;  2NUP A;  4B9W A;  1IZ6 A;  4PL6 A;  4HA8 A;  1UFF A;  2K3B A;  1WA7 A;  4OGC A;  4XTZ A;  2K4Y A;  1XQH A;  3CCQ Q;  2ECZ A;  2SEM A;  2BZ8 A;  2QA4 T;  3I55 Q;  5L23 A;  1BKB A;  4C8Q F;  1AT1 B;  1BI0 A;  2BTT A;  3EGD A;  4MMK A;  3E19 A;  2QK0 A;  3G4S A;  1VQ6 T;  1PG5 B;  4FL6 A;  4FT2 A;  2HSP A;  5GJV B;  4FT4 A;  3G1J A;  2X4W A;  4OMN A;  2EJ9 A;  3GNG A;  2XHC A;  2K79 A;  2VVK A;  5GAN 6;  4BE0 A;  1GL5 A;  2QDY B;  4C5G A;  4C8Q C;  4WTO B;  1K76 A;  1K0X A;  3PVL A;  3M0P A;  5LJ5 f;  2MWP A;  1UB4 A;  2CZ7 B;  3V7R A;  5KYW A;  1R77 A;  3C12 A;  2K6D A;  1RAF B;  2HKN A;  4MDW A;  2A28 A;  4A4E A;  2ENM A;  4XU2 A;  2QA4 A;  4C92 B;  1D3B A;  5GAO r;  4J83 A;  2DK3 A;  2CT3 A;  1VQ6 A;  5LJ5 e;  1W70 A;  1ZSZ A;  3QZ5 B;  1OI1 A;  4JLI A;  1KQ2 A;  5KCH A;  2QQ9 A;  4J8O A;  3VKI A;  5HCK A;  2CP7 A;  2EJG A;  2HD0 A;  4KGX B;  5C0M A;  1QCO A;  4KH1 B;  1M90 R;  2PUK B;  1KQS P;  1JXO A;  3CC7 Q;  2XU8 A;  2J6F A;  1WJQ A;  3LX7 A;  2E12 A;  3PNW C;  2J7I A;  1N8R C;  1M1G A;  1W6X A;  2K3Y A;  4CC4 B;  3EFS A;  3VUZ A;  4AMC A;  2DVE A;  4A63 B;  1KQS A;  3NMZ C;  2HQX A;  1VQ5 Q;  2JOY A;  2DL4 A;  2VKN A;  1BBZ A;  4FM4 B;  2MOX A;  1Q81 C;  1A0N B;  1VQ8 T;  4ATO A;  2F5K A;  2LCL A;  4FW1 A;  5FU7 B;  4M77 B;  3OS0 A;  1PC0 A;  3EG9 B;  2RJE A;  4DA4 A;  2B86 A;  4DOW A;  5D6Y A;  2K5I A;  2LQ8 A;  2QG9 B;  3JCM d;  3LH0 A;  2LCC A;  5I2M A;  1XOV A;  1OQK A;  3ZEH A;  4C92 F;  3TQ7 P;  2E1H A;  5CKB A;  4J5Y A;  2EAY A;  4IUP A;  2LX9 A;  3OMG A;  4J9F A;  1SSF A;  4KUD K;  1M1F A;  2DRM A;  1I07 A;  2FPD A;  1VQO T;  1GRI A;  3A8L B;  3S6W A;  2SRC A;  1OUL A;  1QVF S;  1WJS A;  1TXQ A;  1HXD A;  4RTZ A;  1KG1 A;  2KRM A;  2YLB A;  2X35 A;  1CKB A;  3WVE B;  1YP5 A;  1VQ4 Q;  4DBF A;  5D6X A;  1MUZ A;  1M2V B;  1RAI B;  3LYI A;  2RI2 A;  3OYF A;  2OTJ T;  2D0Q B;  1K0S A;  5CAI A;  1QKX A;  4LD9 K;  2QEX Q;  3G71 Q;  2A3L A;  5LJ5 g;  5EC7 A;  1VQN Q;  2G6F X;  1JO8 A;  4DBH A;  5LJ3 f;  5CVI A;  1T3L A;  4C0D B;  1YHQ Q;  4LNP A;  3A5Z B;  2RK1 A;  2CP6 A;  3JB9 D;  1RAG B;  1E6G A;  1VQO A;  1I5O B;  2X4Y A;  3BDL A;  3EGX B;  3H0H A;  4NL3 A;  2E10 A;  1C0M A;  1Y96 B;  3JCM V;  4ESR A;  3HPW A;  3OYD A;  1TUC A;  1GXI E;  3OB9 A;  1KK7 A;  1GFD A;  1JJ2 S;  1LJO A;  5LJ3 e;  1WXT A;  2CT4 A;  3L2Z A;  3PIO A;  1VUB A;  5A0D A;  1SRM A;  1LPL A;  4PJO G;  1UG1 A;  3V7C A;  3H0F A;  2DMO A;  1PRM C;  2W10 A;  3CCS T;  2OTJ A;  1H8K A;  2EQU A;  5IXF A;  4XU1 A;  1V1C A;  4E7S A;  2RQW A;  3RDV A;  4M77 A;  3CEY A;  2YWW A;  3I56 T;  1NEG A;  1WJR A;  3FC3 A;  2L5Q A;  1W1F A;  3M4Y A;  2JTM A;  1N9R A;  1ZSG A;  5GAN 5;  5GAO l;  1X6G A;  4M77 D;  5DM7 R;  1RLP C;  4R0K A;  3P8H A;  2LX7 A;  2NWM A;  2LJ0 A;  1QVG S;  1TUD A;  1ZUY A;  2DTH A;  2OAW A;  1LCK A;  2E3H A;  2G3R A;  4CI0 C;  3OY9 A;  3ULR B;  2D6F A;  4FSX A;  3A8M B;  2YDL A;  4M75 G;  1IXD A;  1M3A A;  2OJ2 A;  3EG1 A;  5LL6 S;  2FZK B;  3GBQ A;  1UJ0 A;  2AT1 B;  2LVM A;  1R0B G;  3M5A A;  4PJO E;  1F1B B;  3MEW A;  3VS2 A;  1P92 A;  3VS1 A;  3I56 A;  3EHQ A;  1YCY A;  2E5K A;  3L42 A;  2LJ1 A;  4XTX A;  2VGN A;  2F1L A;  1WYX A;  1SHG A;  3LW5 E;  4AG1 C;  3GPL A;  4F04 B;  1TUG B;  1YJW A;  1IRX A;  1N8R U;  3QII A;  4N0A C;  1N6A A;  1BCM A;  3ER0 A;  3HSB A;  5KYN A;  2DER A;  3VS3 A;  2LQW A;  1U8R A;  2DL5 A;  4M78 B;  3M53 A;  2HQH A;  4PJO C;  4HCC A;  5DLQ E;  5GAO n;  1U5S A;  3PIP A;  1NYG A;  3DKM A;  2D8H A;  2YHT A;  3QG1 A;  2JUF A;  1N8R R;  1HSQ A;  1MMA A;  1Q81 U;  2GBQ A;  5LJ3 g;  2VUB A;  1KHC A;  3KBG A;  4B6M A;  2J6K A;  4PK4 A;  4E6R A;  1G3W A;  3FDR A;  3E2U A;  4M75 F;  3PGG A;  1IRE B;  2KT8 A;  2IG0 A;  1OZ2 A;  4J6W A;  1SG5 A;  1X69 A;  5IN1 A;  1YI2 Q;  3SWN B;  4X9C A;  1WHH A;  1YIT T;  1Q81 R;  2RHI A;  3L2W A;  3CCM Q;  1E6H A;  1UUE A;  3LLR A;  1UHF A;  2AZS A;  2X4J A;  3CC4 T;  2JZ2 A;  2EQI A;  2E64 A;  2KI7 A;  2PNI A;  1BI3 A;  4M75 C;  1RLQ C;  4CC7 A;  1I0C A;  5M9O A;  2BKD N;  4LDX A;  1BU1 A;  3BFM A;  2O9V A;  2QTX A;  1H3H A;  2RHX A;  3V8J A;  1YJN A;  5KE2 A;  1TH7 A;  2Y4Y A;  3UDC A;  1D1B A;  4RKU E;  5GAN 3;  3CQT A;  3JCM h;  2OX7 A;  1PM3 A;  4E7Z A;  3QYG B;  4OP0 A;  1K1Z A;  1FMW A;  2RNA A;  1YIT A;  3CCV A;  2EYX A;  4II1 A;  3RNJ A;  5I21 A;  4GLK A;  3MP8 A;  1CKA A;  2JS2 A;  1Q86 U;  2NUT B;  1BB9 A;  1Y07 A;  2GTJ A;  4XAX B;  2DEU A;  2QGF B;  3CME T;  1YBY A;  3RKW A;  3VS4 A;  4ZN1 A;  1ACM B;  1QQJ A;  4M78 A;  1BYM A;  3OS2 A;  1BI1 A;  2WAC A;  3GLX A;  1Q86 R;  4JS4 A;  3RBB B;  3CBM A;  3JCM c;  4M78 D;  3JB9 I;  3KUF A;  2KYB A;  1X27 A;  5FU6 B;  1TS9 A;  2KBT A;  2COY A;  5IAY A;  1TTH B;  1RAD B;  3X28 B;  3G6E Q;  4RTW A;  3FJ5 A;  5KYX B;  1MMD A;  1YIJ A;  2ZZD A;  4GLM A;  1G3S A;  2H8H A;  2CZ6 B;  3SWN A;  1M90 C;  4HVU A;  8ATC B;  1ARK A;  4UC4 A;  1QWF A;  1MND A;  1AWO A;  4LE9 A;  4ZN3 A;  3CME A;  2KNB B;  2JTF A;  1QVF P;  2XDB A;  2GCX A;  2LT1 A;  2GNC A;  2CP3 A;  5CR2 A;  4KUI A;  4LN2 A;  2XI9 A;  5C6S A;  1PHT A;  1KC8 C;  2BZY A;  3HRT A;  2JN0 A;  3HTR A;  2DTO A;  3FJP A;  3NTK A;  1MV0 B;  5CCA A;  1YJ9 T;  3H41 A;  1OZ3 A;  2DYI A;  4JJC A;  1NYF A;  1U3O A;  1TG0 A;  2ESW A;  3OSS C;  1WQW A;  3M4G A;  3M56 A;  2WSF E;  1QP3 A;  4FSS A;  2LC4 A;  4KGZ B;  2EW3 A;  2NLU A;  1AWW A;  1JJ2 P;  4OMM A;  3UPU A;  1OOT A;  2ZPE B;  3CCL Q;  1VQP A;  4M7D G;  2EGA A;  3CCQ T;  2C06 A;  2L3R A;  4FYX B;  3I55 T;  3JCM b;  4F17 A;  4C8Q B;  4AFS C;  4FIB A;  2KXD A;  2BE9 B;  2RQU A;  1NJI C;  4BDZ A;  1Q7Y C;  1YWP A;  1YJ9 A;  4X1V A;  3D7S B;  2A0F B;  3EH1 A;  5KYX A;  2P4T A;  3HRU A;  2EVR A;  5FRO A;  2DNU A;  3TEE A;  3OA6 A;  3VRZ A;  4DOV A;  2QQS A;  1IHV A;  1K9A A;  2DEQ A;  2NUZ A;  1KD1 C;  3OBW A;  2RJD A;  4PLL A;  2M51 A;  1Z9Z A;  1D0Z A;  4ZGE B;  1NLP C;  3CCQ A;  4BI8 B;  3I55 A;  2CP5 A;  4HT9 A;  4AFU C;  4XU0 A;  5FLX E;  1R0C B;  1AVZ C;  2PQW A;  5A2Q E;  3CPW S;  3MPU B;  1QMC A;  1FWZ A;  2I0N A;  2R5M A;  4QVD A;  2J05 A;  1H3Z A;  1N27 A;  1K4U S;  4M7D F;  3URG A;  1Q82 U;  1MGQ A;  3JCM W;  1NG2 A;  3CC7 T;  3C95 A;  1WZO A;  4RTX A;  2CS7 A;  2DKG A;  3VU3 C;  4F14 A;  4VUB A;  1NEB A;  3INZ A;  4MDX A;  3QUI A;  4M7D C;  1WHM A;  3QDF A;  1Q82 R;  4JS5 A;  3OQ5 A;  2DXU A;  2CP0 A;  2JMA A;  5GAO q;  1VQ5 T;  2O01 E;  1RAH B;  4OMO A;  2HSE B;  3J81 E;  4YTL A;  2ZPI B;  1X2K A;  1ZUU A;  3O8V A;  1X2Q A;  4C8Q A;  1AWJ A;  4J6Y A;  2V1Q A;  2KT1 A;  4E7K A;  1UDL A;  1M9S A;  1WXU A;  5IXB A;  1JBM A;  4C8Q D;  1VYT A;  1VQL Q;  4O5V A;  1OU9 A;  2EPD A;  2J06 A;  4GY5 A;  4Q5W A;  2DET A;  1IHW A;  2KR3 A;  3UT1 A;  1M90 U;  9ATC B;  2LDM A;  3JRZ A;  4R56 A;  2DXC A;  2EWN A;  1M5Q 1;  3I9Q A;  1S72 Q;  2D8J A;  3JCM P;  1FMK A;  4BE2 A;  5KCO A;  5KE3 A;  2P84 A;  3F70 A;  2M9U A;  4HVW A;  1VQ4 T;  1M8M A;  1KC8 U;  4ZTF A;  1VYU A;  3JB9 G;  2L8D A;  1R8O B;  2QEX T;  3G71 T;  1EZZ B;  2KQW A;  1VQN T;  3EAE A;  3OBY A;  2L3P A;  1K9M C;  1MMG A;  5GAM d;  1KC8 R;  1YHQ T;  3H0I A;  2F2X A;  4J9E A;  1VIE A;  2D1X A;  2LT4 A;  3CCR Q;  2EYZ A;  2AK5 A;  3FB9 A;  1RI9 A;  4EMG A;  4ZNX A;  1I81 A;  1UE9 A;  3TVT A;  4GBQ A;  2QYZ A;  2GTO A;  1VQ4 A;  2RHZ A;  2EYW A;  3SDZ A;  1QLY A;  2JMC A;  3ZL7 C;  2JVV A;  4BI3 A;  1NJI U;  3X24 B;  2QEX A;  3G71 A;  1Q7Y U;  2CKK A;  3MCA B;  2RHY A;  1LOJ A;  2YXY A;  4BDY A;  2MWO A;  4C92 A; 
#chains in the Genus database with same CATH homology
 1HD3 A;  2C0T A;  3VS3 A;  1JQQ A;  3M0R A;  5FWB A;  2LQW A;  2M0Y A;  2HBW A;  4OMQ A;  2ROT A;  2DL5 A;  4RTT A;  2DBK A;  1U5S A;  1NYG A;  2FPE A;  2D8H A;  1PNJ A;  1ZUK A;  1PRL C;  1HSQ A;  1N5Z A;  3A98 A;  3O5Z A;  3U23 A;  2GBQ A;  2DRK A;  3EG0 A;  1I1J A;  4QT7 A;  2LJ3 A;  2J6K A;  4E6R A;  1BK2 A;  1WIE A;  2C0O A;  1EFN A;  2F2V A;  3I35 A;  2X3W D;  1JU5 C;  1Y57 A;  2KT8 A;  4JJB A;  1X69 A;  4J9C A;  1YNZ A;  4RTU A;  2DM1 A;  2CDT A;  2DJQ A;  1U06 A;  2L3Q A;  1B07 A;  2JM8 A;  2KE9 A;  1E6H A;  1JEG A;  3I5R A;  3M0T A;  1UUE A;  2CH4 W;  2DLP A;  1UHF A;  2LQN A;  2AZS A;  1NLO C;  2EQI A;  1ABO A;  2LP5 A;  2DYB A;  1AZE A;  2PNI A;  1RLQ C;  4CC7 A;  1I0C A;  1SHF A;  1AZG B;  2LMJ A;  1BU1 A;  4HXJ A;  3UA6 A;  2O9V A;  4D8D A;  1SEM A;  1M30 A;  1H3H A;  1H92 A;  2DL3 A;  3NHN A;  2ED1 A;  2A37 A;  1AEY A;  4M4Z A;  1M3C A;  2F2W A;  2FG0 A;  4IIO A;  2KXC A;  2ED0 A;  3CQT A;  4LUE A;  2FPF A;  1WX6 A;  4KRT A;  4Z8A A;  1K1Z A;  2RNA A;  1T0J A;  2K9G A;  1T3S A;  1S1N A;  2EYX A;  4JZ4 A;  3RNJ A;  1ZLM A;  3EG3 A;  1CKA A;  2FO0 A;  2JS2 A;  3VS5 A;  4CC3 A;  2DVJ A;  4F16 A;  2CUB A;  3PVQ A;  2AKL A;  2EGC A;  2YUQ A;  1BB9 A;  1WXB A;  2BZX A;  1AOJ A;  2GTJ A;  4J9D A;  2MCN A;  1KJW A;  1X43 A;  3VS4 A;  1PWT A;  4WCI A;  2HCK A;  2JW4 A;  1YWO A;  2RPN A;  2AZV A;  2P4R A;  1E7O A;  4RTY A;  5ECA A;  4IIM A;  1T0H A;  3RBB B;  1FYN A;  2KYB A;  1X27 A;  3EG2 A;  2DL7 A;  5I22 A;  2JS0 A;  2KBT A;  2CH4 A;  1WFW A;  4RTW A;  3FJ5 A;  1UJY A;  2DF6 A;  4GLM A;  2H8H A;  3UAT A;  1UFF A;  1M3B A;  2K3B A;  4J9G A;  4HVU A;  1WA7 A;  3R6N A;  1ARK A;  3UA7 A;  2CUD A;  1QWF A;  1RUW A;  1Z9Q A;  2ECZ A;  2DX1 A;  2GQI A;  2SEM A;  4LE9 A;  4Z89 A;  1AWO A;  3M0S A;  2BZ8 A;  1UGV A;  2KNB B;  2RF0 A;  5L23 A;  2BTT A;  2GNC A;  2RQR A;  1WI7 A;  2HSP A;  5GJV B;  1GBR A;  4LN2 A;  2PTK A;  4OMN A;  2D0N A;  2QDL A;  1GCQ A;  2K79 A;  1HJD A;  1PHT A;  2VVK A;  3SEM A;  1GL5 A;  2BZY A;  2EYY A;  2JXB A;  1K76 A;  1MV0 B;  1K0X A;  3H41 A;  3PVL A;  3M0P A;  1VYV A;  3VRY A;  4JJC A;  1NYF A;  1U3O A;  3EGU A;  1TG0 A;  2K6D A;  2A28 A;  2RN8 A;  2ESW A;  2DBM A;  4D8K A;  2ENM A;  4FSS A;  3M0U A;  3KFV A;  1NM7 A;  2EW3 A;  1AWW A;  4Z88 A;  2CT3 A;  4OMM A;  1GBQ A;  1OOT A;  1W70 A;  3NGP A;  1Y0M A;  4HVV A;  2KRN A;  2EGA A;  5HCK A;  2EKH A;  5IH2 A;  1PKT A;  2O88 A;  1ZX6 A;  4J9B A;  2HDA A;  2HEQ A;  2X3X D;  4F17 A;  2O9S A;  4AFS C;  2DIL A;  2FEI A;  2KXD A;  2V1R A;  2RQU A;  1JXO A;  4J9I A;  3I5S A;  1YWP A;  1YN8 A;  2J6F A;  4X1V A;  2ABL A;  1UTI A;  2J7I A;  1W6X A;  4RTV A;  4CC4 B;  1X6B A;  5IHK A;  2EVR A;  2DNU A;  3IQL A;  4A63 B;  3QWY A;  2IIM A;  3NMZ C;  3VRZ A;  2L0A A;  1JXM A;  3QWX X;  1K9A A;  5FW9 A;  2DL4 A;  2JTE A;  3REA B;  2VKN A;  1CSK A;  1BBZ A;  2NUZ A;  3VS0 A;  1OPL A;  2MOX A;  2M51 A;  1Z9Z A;  1A0N B;  4RUG A;  2O2O A;  1QKW A;  2XMF A;  1NLP C;  2DL8 A;  2JT4 A;  1PKS A;  2YSQ A;  5I11 A;  2B86 A;  1MV3 A;  4AFU C;  2W0Z A;  1XOV A;  1AVZ C;  2A08 A;  3JV3 A;  2I0N A;  4OMP A;  2VWF A;  4J9F A;  1SPK A;  2J05 A;  2LZ6 B;  1K4U S;  2DRM A;  2L2P A;  1I07 A;  2FPD A;  1GRI A;  1NG2 A;  3C0C A;  2SRC A;  4RTX A;  2O31 A;  1KFZ A;  1QWE A;  1SRL A;  4RTZ A;  2KRM A;  3SHW A;  4K11 A;  4F14 A;  1CKB A;  3VS6 A;  1NEB A;  5IHN A;  3PE0 A;  1SSH A;  1YP5 A;  1MUZ A;  4DEY A;  2JMA A;  1K0S A;  1M27 C;  4OMO A;  1QKX A;  2KYM A;  1X2K A;  1ABQ A;  4Y92 A;  1ZUU A;  5IHI A;  2YT6 A;  1GCQ C;  2CSQ A;  5EC7 A;  1X2Q A;  2G6F X;  1JO8 A;  3NPF A;  1AWJ A;  1T3L A;  2DA9 A;  2V1Q A;  2KT1 A;  4LNP A;  2K7A A;  1UDL A;  2AKK A;  1WXU A;  5IXB A;  2EBP A;  4HCK A;  1E6G A;  1VYT A;  3H0H A;  2KEA A;  2EPD A;  2J06 A;  4OML A;  2KR3 A;  4ESR A;  2DE0 X;  1TUC A;  2MIO A;  1B3Q A;  1GFD A;  1AWX A;  4ORZ A;  4JPB W;  1WXT A;  2CT4 A;  2KRS A;  3EHR A;  1SRM A;  3I9Q A;  2ROL A;  1UG1 A;  3UF4 A;  4CC2 A;  2D8J A;  2GGR A;  3H0F A;  2DMO A;  1PRM C;  2W10 A;  1FMK A;  2J6O A;  2YUP A;  1H8K A;  4LUD A;  5IXF A;  2A36 A;  1V1C A;  2RQW A;  1GCP A;  1OPK A;  2K2M A;  1NEG A;  4DEX A;  4HVW A;  1W1F A;  1M8M A;  1ZSG A;  2RQT A;  1X6G A;  1VYU A;  1RLP C;  1J3T A;  2RQV A;  4R0K A;  4AG2 C;  2LX7 A;  3REB B;  2NWM A;  1WLP B;  2LJ0 A;  3LH5 A;  1OEB A;  1TUD A;  1ZUY A;  1KSW A;  2OAW A;  1QCF A;  1LCK A;  4JJD A;  2FRW A;  1YCS B;  2L3P A;  3TSW A;  3ULR B;  4AFQ C;  1G2B A;  2YDL A;  3H0I A;  2F2X A;  4J9E A;  2CRE A;  2L3S A;  1M3A A;  1OV3 A;  2D1X A;  2OJ2 A;  3EG1 A;  1G83 A;  5GJW B;  4AFZ C;  2EYZ A;  1GFC A;  2AK5 A;  1IO6 A;  1WDX A;  2PZ1 A;  2LCS A;  1RI9 A;  4ZNX A;  2KRO A;  1VA7 A;  3GBQ A;  1UJ0 A;  1UE9 A;  3TVT A;  2C0I A;  4GBQ A;  3M0Q A;  3VS2 A;  3VS1 A;  2RMO A;  3EHQ A;  2E5K A;  2CSI A;  2LJ1 A;  1AD5 A;  2GTO A;  1UHC A;  3TSZ A;  1UEC A;  2EYW A;  5FWC A;  1WYX A;  3VS7 A;  4EIK A;  1SHG A;  1ZBJ A;  1QLY A;  2JMC A;  3ZL7 C;  2EGE A;  4AG1 C;  4JZ3 A;  2YUN A;  2JM9 A;  2LNH B;  3THK A;  2KGT A;  1KIK A;  2OI3 A;  2YUO A;  4J9H A;  2FRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...