2LMJA

Itk-sh3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
b'GPLGSPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ITK/TSK
molecule tags Transferase
source organism Homo sapiens
publication title The SH3 domains of the Tec family kinase Itk and the Src family kinase Lck compete for adjacent sites on T-cell specific adapter protein
rcsb
total genus 7
structure length 66
sequence length 66
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lmjA00
1UTIA 3H0FA 4HCKA 1AD5A 3TSZA 4Z89A 2HSPA 3VRYA 2E5KA 4EIKA 2AK5A 3H41A 4JJCA 4X1VA 2DVJA 2XMFA 2M51A 4J9FA 1UUEA 2L0AA 1AWWA 1QCFA 4J9IA 4LE9A 1M3CA 1K76A 3SEMA 2L2PA 2ROLA 3VS2A 1T3SA 2MIOA 1NEBA 4RTXA 2A28A 2PNIA 1PWTA 2K2MA 1JQQA 1TUCA 4RTTA 2YSQA 1AWOA 1FYNA 1SHFA 1ZLMA 2DBKA 1LCKA 1NLOC 2KT8A 2EPDA 2VVKA 2D1XA 4RTWA 3THKA 1I1JA 2FPDA 1UGVA 2EKHA 1YWOA 4ESRA 2F2VA 2CT3A 4QT7A 1X2QA 1QLYA 1VYVA 2KBTA 1ARKA 4IIMA 1JXMA 3TVTA 3EG1A 1GFDA 1B07A 1ZSGA 2IIMA 2LX7A 3IQLA 3EHQA 5HCKA 1MUZA 2EYYA 2KGTA 2LJ0A 3VS5A 1NEGA 2DYBA 2KR3A 3VS0A 1W70A 2OI3A 2LCSA 1GBQA 1OOTA 1ZUYA 1AWXA 4AG2C 5I11A 4J9HA 2O31A 2DRKA 4GBQA 1AWJA 1Z9QA 4IIOA 1RUWA 2D8JA 2EBPA 5I22A 1UG1A 1VA7A 2DE0X 2MOXA 5FW9A 3VS7A 1QKXA 4DEXA 3UA7A 1KJWA 2JS2A 2NWMA 2CH4A 4AFUC 2DMOA 2KXCA 3PVLA 2A36A 2K7AA 4M4ZA 4OMPA 1K1ZA 5L23A 1W1FA 4GLMA 2DILA 1PRMC 2CSQA 2CREA 1WX6A 2J06A 1ZX6A 2JXBA 3PVQA 2HEQA 2LZ6B 2DL5A 3I9QA 1SEMA 5GJWB 4E6RA 1OEBA 1MV3A 2DLPA 2FPFA 1TUDA 2JMCA 1GBRA 1UE9A 5FWCA 1M3AA 1SRMA 2DNUA 2ED0A 1E7OA 2EYWA 2FRWA 3KFVA 1T3LA 5IH2A 1K0SA 2DJQA 2EYZA 2NUZA 2GTOA 2RQUA 1RLQC 1W6XA 1H8KA 1UHFA 1UJ0A 3H0HA 4DEYA 1ABQA 2L3SA 2EGCA 2V1QA 4F14A 4HVVA 1CKAA 4JZ4A 1VYUA 1M27C 2L3QA 1KSWA 1IO6A 1BBZA 1UECA 2JTEA 2VKNA 4ZNXA 2D8HA 4JZ3A 2VWFA 2KT1A 1X43A 2YT6A 3REAB 3EG0A 1HD3A 4CC2A 4CC3A 3A98A 4D8DA 4J9BA 4LUEA 1WI7A 2CUBA 3EGUA 2KYMA 3EG3A 1GCQC 3TSWA 2O88A 2V1RA 2AZVA 2LNHB 1K4US 4WCIA 1CSKA 2AZSA 2DL8A 1UDLA 2EVRA 1E6HA 4HVWA 1T0HA 1T0JA 3NHNA 2HDAA 1V1CA 2YDLA 3M0QA 2B86A 1AZGB 1HJDA 2FG0A 1M8MA 1RLPC 2YUOA 1MV0B 2MCNA 4AFZC 4OMQA 2DA9A 3RNJA 1NYFA 2DL4A 4AFQC 3R6NA 1U06A 2LMJA 2OJ2A 1ABOA 1WA7A 1Y57A 1AVZC 2BZYA 3SHWA 2RN8A 5EC7A 2LJ3A 5IHKA 1QWEA 1JU5C 2C0TA 3U23A 2LQNA 2JM9A 2JMAA 3RBBB 1JO8A 3M0RA 4LNPA 2K79A 2KRMA 1KFZA 1H3HA 2J6FA 1WFWA 1X6GA 3O5ZA 3VS3A 3UA6A 3QWYA 2EQIA 2C0OA 1JXOA 1OV3A 2K6DA 2EGEA 1WLPB 1EFNA 4RUGA 4RTZA 1M3BA 2CDTA 4J9EA 1NLPC 1UFFA 2YUQA 1B3QA 1J3TA 2CSIA 4OMLA 2BZ8A 2EYXA 3I5RA 4LN2A 5IHIA 1E6GA 3NMZC 2LP5A 1X27A 1WXTA 1PNJA 2P4RA 2DBMA 2ABLA 4AG1C 1M30A 2K3BA 2L3PA 2KXDA 5IXBA 3ZL7C 2AKKA 3M0SA 2X3WD 4OMMA 2RPNA 4CC7A 2HBWA 3M0UA 1UJYA 2O2OA 2GNCA 3NGPA 2O9SA 4AFSC 2CH4W 4F17A 1NYGA 3ULRB 1K9AA 1X2KA 2KRSA 4Y92A 3PE0A 1SHGA 3EHRA 2KRNA 2HCKA 4D8KA 1VYTA 4HVUA 2KYBA 2GTJA 2ROTA 1WYXA 2I0NA 1WDXA 3I35A 5IXFA 1U3OA 5FWBA 1HSQA 2DX1A 2FPEA 2J6OA 2YUPA 3UATA 1ZUKA 2F2WA 2BZXA 2J05A 3LH5A 2RQVA 2O9VA 1X6BA 3REBB 3M0PA 3VRZA 2KROA 1AZEA 1YP5A 1SRLA 2AKLA 1AOJA 4OMOA 1PKTA 1WXUA 2J7IA 1YNZA 2KE9A 2JW4A 1A0NB 1G2BA 1RI9A 4RTUA 1I07A 2JM8A 2F2XA 3CQTA 1K0XA 2M0YA 4R0KA 1GL5A 2G6FX 2YUNA 1QKWA 1H92A 1GCQA 2GGRA 2RQWA 2H8HA 1X69A 2JT4A 3C0CA 1SPKA 4CC4B 2RNAA 2KEAA 4JJDA 1TG0A 2SEMA 2LJ1A 4OMNA 2C0IA 3M0TA 1Y0MA 4J9GA 4JPBW 4RTVA 4FSSA 2DL7A 1GFCA 2RMOA 2DM1A 1YCSB 2FRYA 2ENMA 2DF6A 2FEIA 3I5SA 1OPKA 4KRTA 3VS1A 2PTKA 1ZUUA 1AEYA 1BU1A 3JV3A 2ECZA 5GJVB 1BB9A 1SSHA 2ESWA 2J6KA 1WXBA 2KNBB 1CKBA 5IHNA 4A63B 3H0IA 4Z88A 2W0ZA 2CT4A 2A08A 1G83A 1GCPA 3EG2A 2GQIA 3QWXX 2W10A 2X3XD 1YN8A 3NPFA 2SRCA 1PKSA 2D0NA 1I0CA 2RF0A 5ECAA 1KIKA 2RQRA 1PHTA 4ORZA 2OAWA 1U5SA 2LQWA 1YWPA 4K11A 3VS4A 1N5ZA 2EW3A 1NM7A 1XOVA 2RQTA 2BTTA 1OPLA 4J9CA 1S1NA 1PRLC 2DRMA 3GBQA 4Z8AA 1ZBJA 1WIEA 2GBQA 2K9GA 2JS0A 2ED1A 4F16A 2EGAA 4LUDA 1UHCA 4JJBA 1FMKA 1Z9ZA 2DL3A 4HXJA 1BK2A 1NG2A 3FJ5A 4J9DA 3UF4A 2FO0A 1GRIA 2PZ1A 1JEGA 2QDLA 4RTYA 2A37A 3VS6A 1QWFA 2CUDA
chains in the Genus database with same CATH superfamily
1UTIA 4HCKA 4Z89A 1SG5A 4DOVA 3OB9A 2AK5A 2VB6A 3MP6A 4J9FA 2M51A 4F7UE 2COZA 1AWWA 4C8QC 1UB4A 4M7DE 4C0GA 3V7SA 2DEQA 4C8QG 4LE9A 1K76A 1VQ4A 3CMAT 4RCBA 1T3SA 4O6JA 4E7LA 4PJOB 3MPUB 4RTTA 2YSQA 4FCYA 1FYNA 4OB1B 4E7KA 1TH7A 1NLOC 2EQMA 4A53A 1YFNA 3I55A 3C4SA 3THKA 2O01E 2X4YA 1VQKA 3KXTA 4IUTA 3NTHA 1OQKA 2AIRB 2EKHA 2CZ0B 3CCJT 2ZZDA 1IHVA 4IIMA 3JRZA 3EG1A 1ZSGA 2CKKA 5LJ5h 5HCKA 3CMET 4M78B 1MUZA 2EYYA 5FROA 1YHQQ 2E64A 2KGTA 3VS5A 1KQ1A 3QIIA 2KR3A 3V8KA 3JCMc 2VXEA 2KDSA 2RJEA 4JRIA 1IZ6A 1OOTA 1QVFA 4E7IA 1BI2A 2Y4XA 4M78C 4GBQA 4IUPA 4PNOA 1Z9QA 3A8GB 4IIOA 3QUIA 4C8QE 5FW9A 3JAME 1IB8A 4DEXA 3UA7A 2DZCA 1KJWA 1N8RU 2NWMA 4XTUA 3MCAB 2CGHA 4OMPA 1K1ZA 3JCMQ 1W1FA 3I55Q 2DAQA 3JCMf 3ZEHA 1PRMC 1M1KR 4IUQA 2JVVA 5KYUA 4FYVB 2J06A 3CCLA 4J8OA 3CCST 5KCHA 2DLPA 2FPFA 3EFSA 3FDRA 2E3HA 3VJPA 1UE9A 3EFRA 2ED0A 4XU0A 3NTIA 4JRKA 1E7OA 2FRWA 5IH2A 1K0SA 4M78A 5LJ3j 2DJQA 2EYZA 1VQ7A 3JB9G 4Q5WA 1D1CA 1RLQC 3G4SA 1W6XA 3H0HA 3E9FA 2HSEB 1ABQA 2HKNA 2L3SA 2V1QA 4ELZC 4DBFA 3MO8A 1VYUA 4JZ4A 2EIFA 3HRSA 1IO6A 2Y4YA 1UECA 4FSXA 2D8HA 3OYBA 3CCLQ 3OW2A 3CCVA 2VWFA 5LJ5g 3V8LA 4C5IA 3GP8A 2IG0A 4LUEA 1YJ9T 2P0QA 1PCXA 2QQBA 3G7ZA 3CCUT 1I81A 4KGXB 5GANd 1PD0A 3P8HA 1UGPB 2EVRA 1OYXA 1T0JA 2M9UA 3NHNA 2X4WA 5I21A 2L5QA 1HJDA 2FG0A 4A4HA 1RLPC 1YIJQ 1M2OA 3HRUA 1FMVA 1VQ4T 3CCET 4AFZC 3LX7A 4OMQA 2DJZA 3RUXA 5CKHA 4QW2A 3EH1A 2DL4A 2LMJA 5GAOq 2DERA 1ABOA 1WA7A 4M77B 1BCOA 1NJIU 1YJ9A 1KG1A 3DB3A 2LJ3A 3OY9A 3JB9F 2C0TA 2LQNA 4M77D 4IKFA 2JM9A 5DLQE 2K79A 2KRMA 1ZSZA 1FMWA 1KC8C 2K5FA 1WFWA 2GFAA 3F70A 3VS3A 3OS2A 4M78E 2CP5A 4LD6A 2K4YA 2KI7A 3QWYA 2EQIA 2C0OA 1IHWA 1WLPB 1EFNA 3FRNA 4M75E 3HP9A 4J6YA 2CDTA 2QGGA 3OYKA 1O9SA 5KYWB 1NLPC 1UFFA 3R6OA 5LL6S 1B3QA 3OYYA 2NUTA 4ZGJB 5AYFA 4OMLA 1KQSP 1FXXA 2XG8D 5IHIA 3CCJQ 4M7DA 4AT1B 1YI2Q 1E6GA 2HZYA 4RCCA 1IRXA 3M4GA 4C8QF 2P4RA 2Y90A 5D7UA 1G3YA 2L3PA 1KD1R 4JJNK 4A4GA 3S3MA 4PFZA 3URGA 2QEXQ 1Q7YC 1K9MC 1FX7A 3V7RA 4KUDK 2DO3A 4FT4A 1U1TA 3G4ST 3CCVT 2E6ZA 3NGPA 3E1SA 3CPWS 1VQPA 2YRCA 3OA6A 3MEWA 3CD6T 1M4ZA 4JDSA 2KRSA 3PE0A 1FWZA 4OGEA 4IUUA 2A3LA 5GAN7 1KQ2A 1HXDA 2HCKA 4C92E 5LJ3e 2E41A 1VYTA 3P8BB 2WACA 1V76A 2KYBA 1B7TA 3OYFA 3CCMQ 2LQKA 3CCQQ 4J6XA 1HSQA 4TVRA 4BB7A 2DX1A 1M2VA 1BCMA 1D0ZA 3LLRA 2F2WA 1K73C 4FU6A 4BUGA 5GMKl 1QVGP 1JBMA 1N9SA 4LDUA 3I56A 1VQ9T 1AHJB 1RI0A 3GNFB 3I55T 4ZGDB 3SWNB 2BKDN 1X6BA 4J7IA 3REBB 3M0PA 2KROA 1YP5A 2VGNA 1RADB 3C94A 2VC8A 2LCCA 4WTOB 4XU2A 2OTLQ 2KE9A 3OSVA 2CP0A 1G2BA 1OI1A 1RI9A 5KYUB 5KYXB 4OGCA 3SDZA 4R0KA 1YI2T 1BI0A 1VQ5Q 1GCQA 5L8RE 2HQEA 1EX4A 4C5HA 4PJOG 1Q7YU 1TWBA 2I2LA 1SPKA 4NL3A 4C92G 1Q7YR 1WZOA 3QYHB 1KQSS 2KEAA 3WXMB 2SEMA 3I56Q 4OMNA 1WHKA 4RG2A 3TCJA 1XQHA 4RTVA 3CCMT 5GAOl 2DL7A 3CCJA 4PJJA 4PJLA 2ENMA 4KRTA 3VS1A 4BE1A 2COWA 1AEYA 4PJOD 2KK4A 1RABB 5KCOA 5GJVB 4C92D 1QVFP 3CD6Q 2EAYA 1CKBA 4M77C 3FB9A 1VQMT 4OB0B 4L5GA 3A8HB 5GAMg 3OYAA 2A08A 3HHTB 4XTYA 3JB9H 1GCPA 2GQIA 1M1FA 1YN8A 1RAAB 4LDYA 4QVCA 5J3BA 2CP6A 4M7AG 2LC4A 1VQNT 5DM7R 4HA8A 1K73R 1U5SA 4DQ2A 1X6OA 3VS4A 2XDPA 5HK3A 1S72A 2F5TX 1B34A 1K8AR 2RQTA 2MAMA 4J9CA 2RJDA 4Z8AA 1NBEB 1ZA2B 4LUDA 2HAXA 1D1BA 2CZ1B 3M4YA 1UHCA 2KY9A 1Z9ZA 2ZPEB 2DL3A 4JJBA 4HXJA 1BK2A 1NG2A 4J9DA 4J7FA 3CCEA 1VIEA 4JUVA 4PJMA 4C92B 2FO0A 3BDUA 1VUBA 4DBQA 2BIVA 2PVOB 2YWWA 3HSBA 4RTYA 2HL3A 2CUDA 1AD5A 1Y96A 4EMGA 4BE0A 1YJWT 5J26A 2E5KA 4EIKA 3E19A 4PK4A 3MKDA 4X1VA 2DVJA 2XMFA 3FC3A 3DB4A 1UUEA 1YJWA 3AT1B 4UC4A 5GANe 3CC7A 1EZZB 4ANJA 2L2PA 1VIFA 3CC4A 4ME7A 1TXQA 4RTXA 2A28A 3JB9I 1JQQA 3SB2A 2EJFA 4C8QB 2CZ7B 2DBKA 2QASA 4M7DG 3M59A 5GAN4 1I1JA 3SD4A 2EQUA 3J81E 2RB6A 1YWOA 4E2FB 1X2QA 2D9TA 1QLYA 4PKCC 3TVTA 1GFDA 1UGRB 1B07A 2JN0A 3IQLA 3EHQA 3OYGA 3TREA 1TSFA 2LJ0A 3CD6A 1NEGA 4FIBA 3VS0A 3OYIA 1W70A 2LCSA 1GBQA 5D6WA 1VQ6Q 1ZUYA 2DTOA 1AWXA 3QDRB 4AG2C 3JCMV 1OZ3A 1PG5B 2DKGA 1D09B 2X35A 1VQPQ 1LVKA 1VQ5T 2E65A 2GFUA 2EBPA 5DLOA 3QJ6A 2M16A 2CH4A 4AFUC 5IN1A 3QG1A 2DMOA 1M90U 3PMTA 1R0BG 4GLMA 4PFOA 2YRDA 5CKFA 1WX6A 2RA2A 3E2UA 1ZX6A 2QGFB 3CCSQ 1Q95G 2HEQA 3M55A 3JCMd 1VQ7Q 1SEMA 2DXTA 4E6RA 2XICA 1MV3A 1GBRA 3MEAA 1NZ9A 3CMEA 1NPRA 2E1HA 5FWCA 1SRMA 4BY6C 5KYNA 5GAOn 4J5YA 5A2QE 3KFVA 1T3LA 2G3RA 4MMKA 2NUZA 2GTOA 4ZGEB 1RAFB 1BIAA 3P8DA 1H8KA 1QCOA 4DEYA 2EGCA 4HVVA 3OS0A 2DD5A 3PGGA 5CCAA 2JTEA 4ZNXA 3PIOA 3QJYA 4LXCA 2PVDB 1HD3A 1N8RR 4CC2A 3VUBA 4CC3A 4A4EA 3A98A 3S3NA 4Z02A 3CMAQ 1WI7A 2CUBA 3UWNA 2EQJA 5GAMj 1GCQC 3TSWA 2AZVA 2LNHB 4F7UB 1K4US 1CSKA 1PSEA 1YIJA 3OYMA 1E6HA 4HVWA 3LWIA 4HT9A 1V1CA 2YDLA 3M0QA 1KHIA 2R58A 3C95A 5CKBA 3HPWA 2KAFA 2E12A 2DA9A 4XTZA 4EDUA 3CPFA 3PFSA 3CPWA 4AFQC 1U06A 3CCQA 1VQMQ 2ZGWA 1VQ6A 4KBMB 2CYZB 2XIDA 3QZ9B 1AVZC 3A1PA 1WJSA 5GMKe 5EC7A 3MEVA 5IHKA 1QWEA 3UT1A 4X9CA 1JO8A 3JCMh 3LGFA 4HCCA 4FM4B 3UA6A 2A0FB 2LVMA 3M58A 4C0ZA 4C92F 1OV3A 2BUDA 3G4SQ 1M3BA 1Q86U 3CCSA 4J9EA 2RI3A 2M1HA 5GMKh 3OBYA 4CRIA 1J3TA 2CSIA 3I5RA 4JLIA 4LN2A 2QK0A 1W2BA 1N6AA 1M90C 2LX9A 2RHUA 1NE8A 1N8RC 2ABLA 1C6VX 3M56A 4M75G 4AG1C 1VQOQ 3V8JA 3ZL7C 5GAMh 4DOWA 4FYYB 2DTIA 3M0SA 2X3WD 2K2VA 2RPNA 3KUFA 4CC7A 3JCMb 3EGDA 4XTXA 3JCMW 2DFUA 1VQLQ 2M02A 1W2BP 4AFSC 2VYTA 1SSFA 5GAN6 1QVGA 1VQ8T 1X2KA 4Y92A 1SHGA 1ZQ1A 2KRNA 2EFIA 1QW1A 4E7HA 3HFOA 3LWHA 2OTLT 1BI1A 4ZN3A 1K73U 1S72Q 1TUGB 2CP3A 2ZAEA 1YHQA 2QA4T 1M2VB 3O8VA 3RKYA 2MMPA 2QEXT 2RJCA 1U3OA 1LPLA 5FWBA 3ER0A 1RAIB 3SWNA 3ZBDA 4A54A 4D6WA 2IPOB 3G71T 4F7UG 2YUPA 2Z0WA 3QO3A 5C6SA 1WQ7A 4XTWA 2DETA 3D7SB 5A0LA 5LJ5f 3ME9A 2O9VA 2JJ9A 4J83A 2AKLA 3HFNA 3META 2RM4A 1WXUA 2LQ8A 1A0NB 5KE2A 4MZPA 4L6V5 3CQTA 2XHCA 1RAEB 1GL5A 2YUNA 2QQAA 1H92A 4M77A 1YITT 4R55A 2H8HA 1X69A 1P92A 1Y71A 4JRPA 1O75A 2QQSA 3G1JA 3C0CA 3E9GA 2BE7D 4CC4B 2RNAA 1JJ2S 1YITA 4WF2A 1XNIA 4E7JA 1PM3A 2DIGA 2LJ1A 3NTKA 1Y0MA 1M1KC 2CS7A 2FRYA 3OS5A 1Q81U 2DF6A 1OPKA 4XU3A 2LRQA 4M7DD 1D0XA 4E7ZA 1BU1A 3JV3A 3TQ7P 1BB9A 2ESWA 1WXBA 3RKWA 2OAUA 4M77E 2ZCFB 3CPWP 1WJRA 2JNGA 3LW5E 3EH2A 4GLKA 4Z88A 2A7YA 2W0ZA 2RHIA 1G83A 3QWXX 3RKXA 2HMAA 3OMGA 3NPFA 4FW2A 2ZPGB 4M7AA 3GF5A 3PIPA 1VQKQ 2RQRA 2JTMA 2OAWA 3JCMJ 1VQPT 2FYKA 4DBHA 1N5ZA 4LDWA 4C5GA 1OPLA 1S1NA 1M90R 1ZBJA 2K9GA 5KH6A 3OMCA 4C0DC 2EGAA 3PNWC 5KYYA 4RMOA 3HL8A 1WQWA 3CMEQ 1JRIA 1I4K1 3OBWA 3M54A 2V8JA 2A37A 2XU8A 2YLCA 4JRQA 1YBYA 3TSZA 4C0DB 2HSPA 3H41A 5GAN3 4OF1A 2FVUA 1TS9A 1M1KU 3QPHA 1QCFA 3WVDB 1Y07A 5C0MA 3SEMA 1D3BA 2ROLA 2MIOA 1NEBA 3DLMA 4AMCA 3S3OA 4MDXA 3FJPA 5CVIA 2F1LA 1UGSB 4PLIA 1WHGA 4EMKC 3QDFA 1TUCA 2LNVA 1B34B 2EJGA 1SHFA 1ZLMA 4BI3A 2KT8A 2EPDA 3EGXA 4Y91A 2VVKA 3EFOB 3CCMA 1VQNQ 3G71Q 3S6WA 4ESRA 2HD0A 4QT7A 4OB3B 1VYVA 4M77F 3G6EQ 1JXMA 1D3BB 4C8QA 2DYBA 4M7AF 1ZSZB 1PSFA 2OI3A 5FLXE 5FRMA 4ELYC 2R57A 4II1A 4A4KA 3VU3C 1VQ8Q 5I11A 4KH0B 2O31A 2WSEE 2DRKA 3PTAA 2NUPA 2KVQG 3RESA 1RAHB 2D8JA 3A5ZB 5I22A 1UG1A 1LNXA 1VA7A 2MOXA 3VS7A 1QKXA 3CC7Q 1WHLA 2JS2A 2MWOA 1M9SA 3BDLA 3CC2Q 3H8ZA 2KSSA 2KXCA 2A36A 2K7AA 4M4ZA 1VQ9A 1TTHB 5CK9A 3RDVA 2DILA 4HT8A 2GQVA 4DBRA 3FIFA 1WNLA 2EWNA 4O5VA 3EFOA 2DIQA 3L2ZA 2DL5A 2NUPB 1PD1A 1Q86C 3M5AA 1TUDA 2DZ9A 2JMCA 3CCVQ 3CC4T 5HY6A 3L2WA 3CXCP 1KC8R 4KH1B 2EYWA 2E70A 1QQJA 1W2BS 2RQUA 2RI2A 3OYCA 1BI3A 3CC4Q 3OW2S 4RKUE 2YRVA 1JJ2P 4KGZB 6AT1B 2E3IA 4F04B 1MMAA 1BBZA 2VKNA 3MP8A 5J39A 4JZ3A 1VQLT 2X51A 5GAN2 2KT1A 1X43A 2VUBA 2WSCE 2YT6A 3EG0A 4FYXB 4D8DA 3M57A 4J9BA 3INZA 3VUZA 2F69A 3EGDB 5FU6B 2FZKB 4R56A 4CI0C 3BFMA 3EG3A 2IVWA 3MJXA 3EG9A 1K9MR 1VQOT 1S72T 1KC8U 1W4SA 1VQMA 2DL8A 1T0HA 2NUTB 3RMQA 3HTRA 2PVGB 2GF7A 4BD3A 2B86A 1AZGB 2ZPHB 2DYIA 2V26A 2YUOA 1XTDA 2MCNA 4M75A 2RO0A 1R8OB 3A8OB 3RNJA 1NPPA 2OX7A 2MWPA 8ATCB 2OJ2A 3OYJA 3G6ET 2D6FA 3EG9B 3TEEA 2XK0A 1MGQA 1Y57A 3CCRA 1JB0E 4JLGA 1Q86R 3U23A 3J7AF 2JMAA 3RBBB 3M0RA 1VQNA 1OX9A 4OP0A 4BE2A 1X6GA 4HKEA 3RERA 1JXOA 4M75D 3FEOA 2K6DA 2EGEA 2FHDA 2WSFE 4RTZA 4RUGA 1D1AA 2ZPIB 3JCMX 3RIRA 2CP2A 2JTFA 3JCMg 2YUQA 4QVZA 3ZFJA 2BZ8A 2EYXA 1VQ4Q 1OX8A 1Y96B 2LP5A 1X27A 3X26B 3KBGA 1PNJA 1RL2A 5GAOm 4N4HA 5IXBA 1ZSZC 1Q81R 5GAN5 2B8AA 2EJ9A 3BW1A 2QTVA 1H641 5GMKm 2YHTA 1D0YA 4M7AD 3M0UA 3GLXA 2DXCA 4RG8A 3HRTA 2GNCA 4FYWB 2PU9B 1JJ2A 1G3TA 1RAGB 2O9SA 3Q1JA 4E7SA 4ZTJA 2CH4W 1V29B 1NYGA 3ULRB 2K3YA 4M77G 5LJ5j 2OTJA 2QXFA 5CQXA 8AT1B 2EQKA 4D8KA 2X4JA 3OYLA 5CKEA 2GTJA 2ROTA 3LYIA 4B9WA 4EMKA 3ASKA 2DVEA 2I0NA 3I35A 3VKIA 1BYMA 3CCLT 5CQYA 2FPEA 2E4HA 2RHZA 2XKOC 1EIFA 4KGVB 2J05A 2LDMA 4LD9K 2RQVA 5GAOp 1PC0A 3NFCA 2VGMA 1K8AC 1AZEA 5A0GA 4OMOA 4PLLA 1PKTA 2J7IA 1NJIR 1YNZA 2DXBA 3GPLA 2VXFA 1I07A 2JM8A 5GAN8 2QEXA 2M0YA 2G6FX 3OSSC 4N0AA 3SWNC 1VQ5A 1KD1C 3RMSA 1YJWQ 2RQWA 1BIBA 1VQKT 1Q81C 5GANh 4LDVA 1QP3A 2LCLA 4M7AC 3CXCA 1G3WA 3MP1A 4XAXB 2JZ2A 3M0TA 4B6MA 1M5Q1 1XJWB 3A8LB 3OS1A 4C8QD 4FSSA 1GFCA 4X9DA 2RMOA 4NL2A 2DM1A 1YCSB 4QQGA 4BY6B 2KMTA 2E10A 1ZUUA 5FU7B 2XDBA 1SSHA 2NYSA 2KNBB 3DLLA 5IHNA 4XU1A 1YHQT 3CCUQ 4A63B 2FZCB 4QKUA 1YJNT 3H0IA 2LTOA 1IREB 5LJ5e 2DTHA 2CT4A 1YJ9Q 1LOJA 2XI9A 2SRCA 1PKSA 1I0CA 5ECAA 5CO7A 4ORZA 2DK3A 2F5KA 4PJOA 5D6XA 3CCRT 1NM7A 3A8MB 3CBPA 1MMDA 3GBQA 2KQWA 2JS0A 1MMGA 1NJIC 1GXIE 1H3ZA 4M78D 1QCNA 2HNIA 2PUOB 1WHJA 4PFPA 2PZ1A 3J80E 2P4TA 3VS6A 3H6ZA 1SF9A 3H0FA 2QTXA 1R0CB 4GY5A 3VRYA 4BACA 4BDZA 3QSUA 2M0OA 2QI2A 4JJCA 4PJOC 2RK2A 3PMIA 4EMKB 2K5LA 2VASA 2L0AA 2EYQA 2QA4Q 3SFMA 4M75F 3X25B 4J9IA 1WHMA 1M3CA 3GNGA 3JSCA 3VS2A 4F7UF 5GAMe 5LJ5d 3BY7A 1G3SA 4C5EA 1HK9A 2EKOA 2PNIA 1PWTA 2K2MA 2HQHA 1AWOA 4XQ3A 1LCKA 4QQDA 5CKDA 2D1XA 4RTWA 5GANf 2FPDA 2JOYA 4OVAA 1G5VA 2V8IA 1UGVA 5LJ3d 2F2VA 2CT3A 4QVDA 3CEYA 3VV0A 4NOYA 3QHSA 2KBTA 3T9NA 4JS4A 4PJOE 1ARKA 2RJFA 2IIMA 2LX7A 2OTJT 1ACMB 4B9XA 1MHNA 3V7CA 1OZ2A 4E47A 3VYHB 3CC2T 1K8AU 1DJ7B 1X01A 3X24B 3L42A 3L2UA 4BI8B 1OU9A 2MYSA 5GAMf 4PL6A 1R77A 1MNEA 2QQ9A 4J9HA 5CAIA 5KE3A 1AWJA 2HBPA 1RUWA 2R5MA 2DE0X 3M53A 4BI4A 2C06A 2K5IA 3MEUA 2FL7A 4MMLA 1M1GA 4FT2A 5GANg 4OMFB 3CMAA 3PVLA 3L2RA 1VQOA 5L23A 5KYXA 5CIUA 2MI6A 1YJNQ 2CSQA 3OYEA 3CXCS 2CREA 1K9MU 4HCBA 3HKSA 2L89A 4FW1A 2OTLA 2JXBA 3PVQA 4F7UA 2LZ6B 4M7AE 4ZTFA 3QBYA 3I9QA 5GJWB 1OEBA 2QDYB 1HYOA 1M3AA 1ZA1B 4LDXA 3EAEA 2DNUA 4EMHA 1YI2A 2RH2A 1Q82C 5FU7C 4N4IA 1OU8A 5CR2A 3L1AA 1UHFA 1UJ0A 3QYGB 2DXUA 4F14A 4XK8E 2K57A 1VQ7T 1CKAA 5HK0A 2XD0A 1M27C 2L3QA 3BE3A 3PT9A 1VOMA 1VQ9Q 5LJ3h 1KSWA 2QG9B 5FU6C 1KHCA 4M75C 3CC2A 2E6NA 4J6WA 1N27A 1I5LA 3N5BB 5I2SA 1LJOA 4X34A 1QVPA 3REAB 5IT9E 5EG2A 1QVFS 3JB9D 1C0MA 1WPYA 4DA4A 5KYWA 2OTJQ 3EGUA 2KYMA 4N0AC 1X75C 2RHXA 2O88A 2COYA 2V1RA 2DEUA 5D6YA 4WCIA 2AZSA 1UDLA 1RACB 1UGQB 2HDAA 2QQRA 1WGSA 1M8MA 5M9OA 1MV0B 3OW2P 2FZGB 2L8DA 2AHJB 5GAOr 1G8XA 2CP7A 1NYFA 3R6NA 4A4FA 1Y7XA 3JB9J 4M78G 3DKMA 4PJNA 1ZHIA 1IGQA 3MHXA 2V8KA 2BZYA 3SHWA 2RN8A 3LGLA 3UDCA 1JU5C 5HKCA 2AT1B 4M7AB 1KFZA 4LNPA 2HQXA 1H3HA 5LJ3f 1Q82U 2RHYA 1U1SA 2J6FA 4FL6A 3O5ZA 1MMNA 1SKUB 5GMKi 1VQ6T 3CC7T 1IXDA 4M7DF 2D0QB 2DPPB 1KD1U 1N9RA 7AT1B 4ZN1A 1YJNA 1AT1B 5A0DA 2H3JA 3GOXA 2ZPFB 2P0PA 2RD1A 2MK5A 4ATOA 3NMZC 3CCRQ 3RR6A 4C92A 1WXTA 1YITQ 2DBMA 2FB7A 1M30A 2K3BA 2O4XA 2KXDA 3CBOA 3CBMA 2ATCB 2HKQB 5LJ3g 2AKKA 4OMMA 4Y28E 2HBWA 3FLGA 1QVGS 3X28B 4N4GA 3CCEQ 4C0FA 1UJYA 2O2OA 3JCMe 3TU4K 5GAMd 3EGXB 3OQ5A 4M78F 5DY9A 4OB2B 2MPXC 2QAZA 4V2SA 4F17A 2LT4A 2BE9B 1K9AA 1VQ8A 4EPCA 4HCZA 2XDDA 3EHRA 2CZ6B 3JCMP 4IUVA 4C92C 4HVUA 1WYXA 3QZ5B 2L3RA 2E5QA 1U8RA 2P0KA 4VUBA 1WDXA 2JUFA 1KK7A 5IXFA 2MF2A 1Q82R 4QQ6A 4XTVA 2J6OA 3G71A 3UATA 2DD4A 1ZUKA 2BZXA 2LT1A 3LH5A 2RK1A 1IGUA 3CCUA 3VYGA 3LH0A 2GCXA 2QA4A 4L59A 3VRZA 1SRLA 3GIBA 1AOJA 3I56T 2JW4A 4M75B 1UEBA 2VV5A 1VQLA 4RTUA 4IURA 1MNDA 3UPUA 2F2XA 2QYZA 5GMKj 1K0XA 4JS5A 1QKWA 3WVEB 1TU0B 1WHHA 3OYNA 2X9HA 2GGRA 9ATCB 4KT0E 1ZBXA 2JT4A 2K3XA 4JJDA 1TG0A 1OULA 2C0IA 2R5AA 1YCYA 4J9GA 4JPBW 5I2MA 5KYYB 4MDWA 2O4XB 4NS5A 4MZMA 2H3EB 2FEIA 3I5SA 2PTKA 3QKJA 2NLUA 2ECZA 1M8VA 2J6KA 2ZPBB 3QXEB 4P5NA 3CCQT 1TOVA 3AHUA 1QP2A 4KUIA 3EG2A 2W10A 2X3XD 2YLBA 3OYHA 1I8FA 3M9QA 2D0NA 2RF0A 3X20B 5AT1B 1KIKA 5GANj 1PHTA 5IAYA 2LQWA 1YWPA 4K11A 3C12A 1QMCA 2EW3A 3OYDA 1XOVA 1C1AA 2BTTA 1I5OB 2PUKB 2P84A 2PQWA 4M7DC 1PRLC 2DRMA 1WIEA 2GBQA 2ED1A 4F16A 1BKBA 4BDYA 2RI5A 1FMKA 4PJOF 1WJQA 3FJ5A 2X4XA 1F1BB 3UF4A 4KULA 2HL5C 3L2VA 5FRNA 3H9NA 1GRIA 4YTLA 1KQSA 1JEGA 2QDLA 3L2QA 2YXYA 1QWFA 3G6EA 4MZTA 4M7DB 1YIJT
chains in the Genus database with same CATH topology
1UTIA 3H0FA 4HCKA 1AD5A 3TSZA 4Z89A 2HSPA 3VRYA 2E5KA 4EIKA 2AK5A 3H41A 4JJCA 4X1VA 2DVJA 2XMFA 2M51A 4J9FA 1UUEA 2L0AA 1AWWA 1QCFA 4J9IA 4LE9A 1M3CA 1K76A 3SEMA 2L2PA 2ROLA 3VS2A 1T3SA 2MIOA 1NEBA 4RTXA 2A28A 2PNIA 1PWTA 2K2MA 1JQQA 1TUCA 4RTTA 2YSQA 1AWOA 1FYNA 1SHFA 1ZLMA 2DBKA 1LCKA 1NLOC 2KT8A 2EPDA 2VVKA 2D1XA 4RTWA 3THKA 1I1JA 2FPDA 1UGVA 2EKHA 1YWOA 4ESRA 2F2VA 2CT3A 4QT7A 1X2QA 1QLYA 1VYVA 2KBTA 1ARKA 4IIMA 1JXMA 3TVTA 3EG1A 1GFDA 1B07A 1ZSGA 2IIMA 2LX7A 3IQLA 3EHQA 5HCKA 1MUZA 2EYYA 2KGTA 2LJ0A 3VS5A 1NEGA 2DYBA 2KR3A 3VS0A 1W70A 2OI3A 2LCSA 1GBQA 1OOTA 1ZUYA 1AWXA 4AG2C 5I11A 4J9HA 2O31A 2DRKA 4GBQA 1AWJA 1Z9QA 4IIOA 1RUWA 2D8JA 2EBPA 5I22A 1UG1A 1VA7A 2DE0X 2MOXA 5FW9A 3VS7A 1QKXA 4DEXA 3UA7A 1KJWA 2JS2A 2NWMA 2CH4A 4AFUC 2DMOA 2KXCA 3PVLA 2A36A 2K7AA 4M4ZA 4OMPA 1K1ZA 5L23A 1W1FA 4GLMA 2DILA 1PRMC 2CSQA 2CREA 1WX6A 2J06A 1ZX6A 2JXBA 3PVQA 2HEQA 2LZ6B 2DL5A 3I9QA 1SEMA 5GJWB 4E6RA 1OEBA 1MV3A 2DLPA 2FPFA 1TUDA 2JMCA 1GBRA 1UE9A 5FWCA 1M3AA 1SRMA 2DNUA 2ED0A 1E7OA 2EYWA 2FRWA 3KFVA 1T3LA 5IH2A 1K0SA 2DJQA 2EYZA 2NUZA 2GTOA 2RQUA 1RLQC 1W6XA 1H8KA 1UHFA 1UJ0A 3H0HA 4DEYA 1ABQA 2L3SA 2EGCA 2V1QA 4F14A 4HVVA 1CKAA 4JZ4A 1VYUA 1M27C 2L3QA 1KSWA 1IO6A 1BBZA 1UECA 2JTEA 2VKNA 4ZNXA 2D8HA 4JZ3A 2VWFA 2KT1A 1X43A 2YT6A 3REAB 3EG0A 1HD3A 4CC2A 4CC3A 3A98A 4D8DA 4J9BA 4LUEA 1WI7A 2CUBA 3EGUA 2KYMA 3EG3A 1GCQC 3TSWA 2O88A 2V1RA 2AZVA 2LNHB 1K4US 4WCIA 1CSKA 2AZSA 2DL8A 1UDLA 2EVRA 1E6HA 4HVWA 1T0HA 1T0JA 3NHNA 2HDAA 1V1CA 2YDLA 3M0QA 2B86A 1AZGB 1HJDA 2FG0A 1M8MA 1RLPC 2YUOA 1MV0B 2MCNA 4AFZC 4OMQA 2DA9A 3RNJA 1NYFA 2DL4A 4AFQC 3R6NA 1U06A 2LMJA 2OJ2A 1ABOA 1WA7A 1Y57A 1AVZC 2BZYA 3SHWA 2RN8A 5EC7A 2LJ3A 5IHKA 1QWEA 1JU5C 2C0TA 3U23A 2LQNA 2JM9A 2JMAA 3RBBB 1JO8A 3M0RA 4LNPA 2K79A 2KRMA 1KFZA 1H3HA 2J6FA 1WFWA 1X6GA 3O5ZA 3VS3A 3UA6A 3QWYA 2EQIA 2C0OA 1JXOA 1OV3A 2K6DA 2EGEA 1WLPB 1EFNA 4RUGA 4RTZA 1M3BA 2CDTA 4J9EA 1NLPC 1UFFA 2YUQA 1B3QA 1J3TA 2CSIA 4OMLA 2BZ8A 2EYXA 3I5RA 4LN2A 5IHIA 1E6GA 3NMZC 2LP5A 1X27A 1WXTA 1PNJA 2P4RA 2DBMA 2ABLA 4AG1C 1M30A 2K3BA 2L3PA 2KXDA 5IXBA 3ZL7C 2AKKA 3M0SA 2X3WD 4OMMA 2RPNA 4CC7A 2HBWA 3M0UA 1UJYA 2O2OA 2GNCA 3NGPA 2O9SA 4AFSC 2CH4W 4F17A 1NYGA 3ULRB 1K9AA 1X2KA 2KRSA 4Y92A 3PE0A 1SHGA 3EHRA 2KRNA 2HCKA 4D8KA 1VYTA 4HVUA 2KYBA 2GTJA 2ROTA 1WYXA 2I0NA 1WDXA 3I35A 5IXFA 1U3OA 5FWBA 1HSQA 2DX1A 2FPEA 2J6OA 2YUPA 3UATA 1ZUKA 2F2WA 2BZXA 2J05A 3LH5A 2RQVA 2O9VA 1X6BA 3REBB 3M0PA 3VRZA 2KROA 1AZEA 1YP5A 1SRLA 2AKLA 1AOJA 4OMOA 1PKTA 1WXUA 2J7IA 1YNZA 2KE9A 2JW4A 1A0NB 1G2BA 1RI9A 4RTUA 1I07A 2JM8A 2F2XA 3CQTA 1K0XA 2M0YA 4R0KA 1GL5A 2G6FX 2YUNA 1QKWA 1H92A 1GCQA 2GGRA 2RQWA 2H8HA 1X69A 2JT4A 3C0CA 1SPKA 4CC4B 2RNAA 2KEAA 4JJDA 1TG0A 2SEMA 2LJ1A 4OMNA 2C0IA 3M0TA 1Y0MA 4J9GA 4JPBW 4RTVA 4FSSA 2DL7A 1GFCA 2RMOA 2DM1A 1YCSB 2FRYA 2ENMA 2DF6A 2FEIA 3I5SA 1OPKA 4KRTA 3VS1A 2PTKA 1ZUUA 1AEYA 1BU1A 3JV3A 2ECZA 5GJVB 1BB9A 1SSHA 2ESWA 2J6KA 1WXBA 2KNBB 1CKBA 5IHNA 4A63B 3H0IA 4Z88A 2W0ZA 2CT4A 2A08A 1G83A 1GCPA 3EG2A 2GQIA 3QWXX 2W10A 2X3XD 1YN8A 3NPFA 2SRCA 1PKSA 2D0NA 1I0CA 2RF0A 5ECAA 1KIKA 2RQRA 1PHTA 4ORZA 2OAWA 1U5SA 2LQWA 1YWPA 4K11A 3VS4A 1N5ZA 2EW3A 1NM7A 1XOVA 2RQTA 2BTTA 1OPLA 4J9CA 1S1NA 1PRLC 2DRMA 3GBQA 4Z8AA 1ZBJA 1WIEA 2GBQA 2K9GA 2JS0A 2ED1A 4F16A 2EGAA 4LUDA 1UHCA 4JJBA 1FMKA 1Z9ZA 2DL3A 4HXJA 1BK2A 1NG2A 3FJ5A 4J9DA 3UF4A 2FO0A 1GRIA 2PZ1A 1JEGA 2QDLA 4RTYA 2A37A 3VS6A 1QWFA 2CUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTI A;  3H0F A;  4HCK A;  1AD5 A;  3TSZ A;  4Z89 A;  2HSP A;  3VRY A;  2E5K A;  4EIK A;  2AK5 A;  3H41 A;  4JJC A;  4X1V A;  2DVJ A;  2XMF A;  2M51 A;  4J9F A;  1UUE A;  2L0A A;  1AWW A;  1QCF A;  4J9I A;  4LE9 A;  1M3C A;  1K76 A;  3SEM A;  2L2P A;  2ROL A;  3VS2 A;  1T3S A;  2MIO A;  1NEB A;  4RTX A;  2A28 A;  2PNI A;  1PWT A;  2K2M A;  1JQQ A;  1TUC A;  4RTT A;  2YSQ A;  1AWO A;  1FYN A;  1SHF A;  1ZLM A;  2DBK A;  1LCK A;  1NLO C;  2KT8 A;  2EPD A;  2VVK A;  2D1X A;  4RTW A;  3THK A;  1I1J A;  2FPD A;  1UGV A;  2EKH A;  1YWO A;  4ESR A;  2F2V A;  2CT3 A;  4QT7 A;  1X2Q A;  1QLY A;  1VYV A;  2KBT A;  1ARK A;  4IIM A;  1JXM A;  3TVT A;  3EG1 A;  1GFD A;  1B07 A;  1ZSG A;  2IIM A;  2LX7 A;  3IQL A;  3EHQ A;  5HCK A;  1MUZ A;  2EYY A;  2KGT A;  2LJ0 A;  3VS5 A;  1NEG A;  2DYB A;  2KR3 A;  3VS0 A;  1W70 A;  2OI3 A;  2LCS A;  1GBQ A;  1OOT A;  1ZUY A;  1AWX A;  4AG2 C;  5I11 A;  4J9H A;  2O31 A;  2DRK A;  4GBQ A;  1AWJ A;  1Z9Q A;  4IIO A;  1RUW A;  2D8J A;  2EBP A;  5I22 A;  1UG1 A;  1VA7 A;  2DE0 X;  2MOX A;  5FW9 A;  3VS7 A;  1QKX A;  4DEX A;  3UA7 A;  1KJW A;  2JS2 A;  2NWM A;  2CH4 A;  4AFU C;  2DMO A;  2KXC A;  3PVL A;  2A36 A;  2K7A A;  4M4Z A;  4OMP A;  1K1Z A;  5L23 A;  1W1F A;  4GLM A;  2DIL A;  1PRM C;  2CSQ A;  2CRE A;  1WX6 A;  2J06 A;  1ZX6 A;  2JXB A;  3PVQ A;  2HEQ A;  2LZ6 B;  2DL5 A;  3I9Q A;  1SEM A;  5GJW B;  4E6R A;  1OEB A;  1MV3 A;  2DLP A;  2FPF A;  1TUD A;  2JMC A;  1GBR A;  1UE9 A;  5FWC A;  1M3A A;  1SRM A;  2DNU A;  2ED0 A;  1E7O A;  2EYW A;  2FRW A;  3KFV A;  1T3L A;  5IH2 A;  1K0S A;  2DJQ A;  2EYZ A;  2NUZ A;  2GTO A;  2RQU A;  1RLQ C;  1W6X A;  1H8K A;  1UHF A;  1UJ0 A;  3H0H A;  4DEY A;  1ABQ A;  2L3S A;  2EGC A;  2V1Q A;  4F14 A;  4HVV A;  1CKA A;  4JZ4 A;  1VYU A;  1M27 C;  2L3Q A;  1KSW A;  1IO6 A;  1BBZ A;  1UEC A;  2JTE A;  2VKN A;  4ZNX A;  2D8H A;  4JZ3 A;  2VWF A;  2KT1 A;  1X43 A;  2YT6 A;  3REA B;  3EG0 A;  1HD3 A;  4CC2 A;  4CC3 A;  3A98 A;  4D8D A;  4J9B A;  4LUE A;  1WI7 A;  2CUB A;  3EGU A;  2KYM A;  3EG3 A;  1GCQ C;  3TSW A;  2O88 A;  2V1R A;  2AZV A;  2LNH B;  1K4U S;  4WCI A;  1CSK A;  2AZS A;  2DL8 A;  1UDL A;  2EVR A;  1E6H A;  4HVW A;  1T0H A;  1T0J A;  3NHN A;  2HDA A;  1V1C A;  2YDL A;  3M0Q A;  2B86 A;  1AZG B;  1HJD A;  2FG0 A;  1M8M A;  1RLP C;  2YUO A;  1MV0 B;  2MCN A;  4AFZ C;  4OMQ A;  2DA9 A;  3RNJ A;  1NYF A;  2DL4 A;  4AFQ C;  3R6N A;  1U06 A;  2LMJ A;  2OJ2 A;  1ABO A;  1WA7 A;  1Y57 A;  1AVZ C;  2BZY A;  3SHW A;  2RN8 A;  5EC7 A;  2LJ3 A;  5IHK A;  1QWE A;  1JU5 C;  2C0T A;  3U23 A;  2LQN A;  2JM9 A;  2JMA A;  3RBB B;  1JO8 A;  3M0R A;  4LNP A;  2K79 A;  2KRM A;  1KFZ A;  1H3H A;  2J6F A;  1WFW A;  1X6G A;  3O5Z A;  3VS3 A;  3UA6 A;  3QWY A;  2EQI A;  2C0O A;  1JXO A;  1OV3 A;  2K6D A;  2EGE A;  1WLP B;  1EFN A;  4RUG A;  4RTZ A;  1M3B A;  2CDT A;  4J9E A;  1NLP C;  1UFF A;  2YUQ A;  1B3Q A;  1J3T A;  2CSI A;  4OML A;  2BZ8 A;  2EYX A;  3I5R A;  4LN2 A;  5IHI A;  1E6G A;  3NMZ C;  2LP5 A;  1X27 A;  1WXT A;  1PNJ A;  2P4R A;  2DBM A;  2ABL A;  4AG1 C;  1M30 A;  2K3B A;  2L3P A;  2KXD A;  5IXB A;  3ZL7 C;  2AKK A;  3M0S A;  2X3W D;  4OMM A;  2RPN A;  4CC7 A;  2HBW A;  3M0U A;  1UJY A;  2O2O A;  2GNC A;  3NGP A;  2O9S A;  4AFS C;  2CH4 W;  4F17 A;  1NYG A;  3ULR B;  1K9A A;  1X2K A;  2KRS A;  4Y92 A;  3PE0 A;  1SHG A;  3EHR A;  2KRN A;  2HCK A;  4D8K A;  1VYT A;  4HVU A;  2KYB A;  2GTJ A;  2ROT A;  1WYX A;  2I0N A;  1WDX A;  3I35 A;  5IXF A;  1U3O A;  5FWB A;  1HSQ A;  2DX1 A;  2FPE A;  2J6O A;  2YUP A;  3UAT A;  1ZUK A;  2F2W A;  2BZX A;  2J05 A;  3LH5 A;  2RQV A;  2O9V A;  1X6B A;  3REB B;  3M0P A;  3VRZ A;  2KRO A;  1AZE A;  1YP5 A;  1SRL A;  2AKL A;  1AOJ A;  4OMO A;  1PKT A;  1WXU A;  2J7I A;  1YNZ A;  2KE9 A;  2JW4 A;  1A0N B;  1G2B A;  1RI9 A;  4RTU A;  1I07 A;  2JM8 A;  2F2X A;  3CQT A;  1K0X A;  2M0Y A;  4R0K A;  1GL5 A;  2G6F X;  2YUN A;  1QKW A;  1H92 A;  1GCQ A;  2GGR A;  2RQW A;  2H8H A;  1X69 A;  2JT4 A;  3C0C A;  1SPK A;  4CC4 B;  2RNA A;  2KEA A;  4JJD A;  1TG0 A;  2SEM A;  2LJ1 A;  4OMN A;  2C0I A;  3M0T A;  1Y0M A;  4J9G A;  4JPB W;  4RTV A;  4FSS A;  2DL7 A;  1GFC A;  2RMO A;  2DM1 A;  1YCS B;  2FRY A;  2ENM A;  2DF6 A;  2FEI A;  3I5S A;  1OPK A;  4KRT A;  3VS1 A;  2PTK A;  1ZUU A;  1AEY A;  1BU1 A;  3JV3 A;  2ECZ A;  5GJV B;  1BB9 A;  1SSH A;  2ESW A;  2J6K A;  1WXB A;  2KNB B;  1CKB A;  5IHN A;  4A63 B;  3H0I A;  4Z88 A;  2W0Z A;  2CT4 A;  2A08 A;  1G83 A;  1GCP A;  3EG2 A;  2GQI A;  3QWX X;  2W10 A;  2X3X D;  1YN8 A;  3NPF A;  2SRC A;  1PKS A;  2D0N A;  1I0C A;  2RF0 A;  5ECA A;  1KIK A;  2RQR A;  1PHT A;  4ORZ A;  2OAW A;  1U5S A;  2LQW A;  1YWP A;  4K11 A;  3VS4 A;  1N5Z A;  2EW3 A;  1NM7 A;  1XOV A;  2RQT A;  2BTT A;  1OPL A;  4J9C A;  1S1N A;  1PRL C;  2DRM A;  3GBQ A;  4Z8A A;  1ZBJ A;  1WIE A;  2GBQ A;  2K9G A;  2JS0 A;  2ED1 A;  4F16 A;  2EGA A;  4LUD A;  1UHC A;  4JJB A;  1FMK A;  1Z9Z A;  2DL3 A;  4HXJ A;  1BK2 A;  1NG2 A;  3FJ5 A;  4J9D A;  3UF4 A;  2FO0 A;  1GRI A;  2PZ1 A;  1JEG A;  2QDL A;  4RTY A;  2A37 A;  3VS6 A;  1QWF A;  2CUD A; 
#chains in the Genus database with same CATH topology
 1UTI A;  4HCK A;  4Z89 A;  1SG5 A;  4DOV A;  3OB9 A;  2AK5 A;  2VB6 A;  3MP6 A;  4J9F A;  2M51 A;  4F7U E;  2COZ A;  1AWW A;  4C8Q C;  1UB4 A;  4M7D E;  4C0G A;  3V7S A;  2DEQ A;  4C8Q G;  4LE9 A;  1K76 A;  1VQ4 A;  3CMA T;  4RCB A;  1T3S A;  4O6J A;  4E7L A;  4PJO B;  3MPU B;  4RTT A;  2YSQ A;  4FCY A;  1FYN A;  4OB1 B;  4E7K A;  1TH7 A;  1NLO C;  2EQM A;  4A53 A;  1YFN A;  3I55 A;  3C4S A;  3THK A;  2O01 E;  2X4Y A;  1VQK A;  3KXT A;  4IUT A;  3NTH A;  1OQK A;  2AIR B;  2EKH A;  2CZ0 B;  3CCJ T;  2ZZD A;  1IHV A;  4IIM A;  3JRZ A;  3EG1 A;  1ZSG A;  2CKK A;  5LJ5 h;  5HCK A;  3CME T;  4M78 B;  1MUZ A;  2EYY A;  5FRO A;  1YHQ Q;  2E64 A;  2KGT A;  3VS5 A;  1KQ1 A;  3QII A;  2KR3 A;  3V8K A;  3JCM c;  2VXE A;  2KDS A;  2RJE A;  4JRI A;  1IZ6 A;  1OOT A;  1QVF A;  4E7I A;  1BI2 A;  2Y4X A;  4M78 C;  4GBQ A;  4IUP A;  4PNO A;  1Z9Q A;  3A8G B;  4IIO A;  3QUI A;  4C8Q E;  5FW9 A;  3JAM E;  1IB8 A;  4DEX A;  3UA7 A;  2DZC A;  1KJW A;  1N8R U;  2NWM A;  4XTU A;  3MCA B;  2CGH A;  4OMP A;  1K1Z A;  3JCM Q;  1W1F A;  3I55 Q;  2DAQ A;  3JCM f;  3ZEH A;  1PRM C;  1M1K R;  4IUQ A;  2JVV A;  5KYU A;  4FYV B;  2J06 A;  3CCL A;  4J8O A;  3CCS T;  5KCH A;  2DLP A;  2FPF A;  3EFS A;  3FDR A;  2E3H A;  3VJP A;  1UE9 A;  3EFR A;  2ED0 A;  4XU0 A;  3NTI A;  4JRK A;  1E7O A;  2FRW A;  5IH2 A;  1K0S A;  4M78 A;  5LJ3 j;  2DJQ A;  2EYZ A;  1VQ7 A;  3JB9 G;  4Q5W A;  1D1C A;  1RLQ C;  3G4S A;  1W6X A;  3H0H A;  3E9F A;  2HSE B;  1ABQ A;  2HKN A;  2L3S A;  2V1Q A;  4ELZ C;  4DBF A;  3MO8 A;  1VYU A;  4JZ4 A;  2EIF A;  3HRS A;  1IO6 A;  2Y4Y A;  1UEC A;  4FSX A;  2D8H A;  3OYB A;  3CCL Q;  3OW2 A;  3CCV A;  2VWF A;  5LJ5 g;  3V8L A;  4C5I A;  3GP8 A;  2IG0 A;  4LUE A;  1YJ9 T;  2P0Q A;  1PCX A;  2QQB A;  3G7Z A;  3CCU T;  1I81 A;  4KGX B;  5GAN d;  1PD0 A;  3P8H A;  1UGP B;  2EVR A;  1OYX A;  1T0J A;  2M9U A;  3NHN A;  2X4W A;  5I21 A;  2L5Q A;  1HJD A;  2FG0 A;  4A4H A;  1RLP C;  1YIJ Q;  1M2O A;  3HRU A;  1FMV A;  1VQ4 T;  3CCE T;  4AFZ C;  3LX7 A;  4OMQ A;  2DJZ A;  3RUX A;  5CKH A;  4QW2 A;  3EH1 A;  2DL4 A;  2LMJ A;  5GAO q;  2DER A;  1ABO A;  1WA7 A;  4M77 B;  1BCO A;  1NJI U;  1YJ9 A;  1KG1 A;  3DB3 A;  2LJ3 A;  3OY9 A;  3JB9 F;  2C0T A;  2LQN A;  4M77 D;  4IKF A;  2JM9 A;  5DLQ E;  2K79 A;  2KRM A;  1ZSZ A;  1FMW A;  1KC8 C;  2K5F A;  1WFW A;  2GFA A;  3F70 A;  3VS3 A;  3OS2 A;  4M78 E;  2CP5 A;  4LD6 A;  2K4Y A;  2KI7 A;  3QWY A;  2EQI A;  2C0O A;  1IHW A;  1WLP B;  1EFN A;  3FRN A;  4M75 E;  3HP9 A;  4J6Y A;  2CDT A;  2QGG A;  3OYK A;  1O9S A;  5KYW B;  1NLP C;  1UFF A;  3R6O A;  5LL6 S;  1B3Q A;  3OYY A;  2NUT A;  4ZGJ B;  5AYF A;  4OML A;  1KQS P;  1FXX A;  2XG8 D;  5IHI A;  3CCJ Q;  4M7D A;  4AT1 B;  1YI2 Q;  1E6G A;  2HZY A;  4RCC A;  1IRX A;  3M4G A;  4C8Q F;  2P4R A;  2Y90 A;  5D7U A;  1G3Y A;  2L3P A;  1KD1 R;  4JJN K;  4A4G A;  3S3M A;  4PFZ A;  3URG A;  2QEX Q;  1Q7Y C;  1K9M C;  1FX7 A;  3V7R A;  4KUD K;  2DO3 A;  4FT4 A;  1U1T A;  3G4S T;  3CCV T;  2E6Z A;  3NGP A;  3E1S A;  3CPW S;  1VQP A;  2YRC A;  3OA6 A;  3MEW A;  3CD6 T;  1M4Z A;  4JDS A;  2KRS A;  3PE0 A;  1FWZ A;  4OGE A;  4IUU A;  2A3L A;  5GAN 7;  1KQ2 A;  1HXD A;  2HCK A;  4C92 E;  5LJ3 e;  2E41 A;  1VYT A;  3P8B B;  2WAC A;  1V76 A;  2KYB A;  1B7T A;  3OYF A;  3CCM Q;  2LQK A;  3CCQ Q;  4J6X A;  1HSQ A;  4TVR A;  4BB7 A;  2DX1 A;  1M2V A;  1BCM A;  1D0Z A;  3LLR A;  2F2W A;  1K73 C;  4FU6 A;  4BUG A;  5GMK l;  1QVG P;  1JBM A;  1N9S A;  4LDU A;  3I56 A;  1VQ9 T;  1AHJ B;  1RI0 A;  3GNF B;  3I55 T;  4ZGD B;  3SWN B;  2BKD N;  1X6B A;  4J7I A;  3REB B;  3M0P A;  2KRO A;  1YP5 A;  2VGN A;  1RAD B;  3C94 A;  2VC8 A;  2LCC A;  4WTO B;  4XU2 A;  2OTL Q;  2KE9 A;  3OSV A;  2CP0 A;  1G2B A;  1OI1 A;  1RI9 A;  5KYU B;  5KYX B;  4OGC A;  3SDZ A;  4R0K A;  1YI2 T;  1BI0 A;  1VQ5 Q;  1GCQ A;  5L8R E;  2HQE A;  1EX4 A;  4C5H A;  4PJO G;  1Q7Y U;  1TWB A;  2I2L A;  1SPK A;  4NL3 A;  4C92 G;  1Q7Y R;  1WZO A;  3QYH B;  1KQS S;  2KEA A;  3WXM B;  2SEM A;  3I56 Q;  4OMN A;  1WHK A;  4RG2 A;  3TCJ A;  1XQH A;  4RTV A;  3CCM T;  5GAO l;  2DL7 A;  3CCJ A;  4PJJ A;  4PJL A;  2ENM A;  4KRT A;  3VS1 A;  4BE1 A;  2COW A;  1AEY A;  4PJO D;  2KK4 A;  1RAB B;  5KCO A;  5GJV B;  4C92 D;  1QVF P;  3CD6 Q;  2EAY A;  1CKB A;  4M77 C;  3FB9 A;  1VQM T;  4OB0 B;  4L5G A;  3A8H B;  5GAM g;  3OYA A;  2A08 A;  3HHT B;  4XTY A;  3JB9 H;  1GCP A;  2GQI A;  1M1F A;  1YN8 A;  1RAA B;  4LDY A;  4QVC A;  5J3B A;  2CP6 A;  4M7A G;  2LC4 A;  1VQN T;  5DM7 R;  4HA8 A;  1K73 R;  1U5S A;  4DQ2 A;  1X6O A;  3VS4 A;  2XDP A;  5HK3 A;  1S72 A;  2F5T X;  1B34 A;  1K8A R;  2RQT A;  2MAM A;  4J9C A;  2RJD A;  4Z8A A;  1NBE B;  1ZA2 B;  4LUD A;  2HAX A;  1D1B A;  2CZ1 B;  3M4Y A;  1UHC A;  2KY9 A;  1Z9Z A;  2ZPE B;  2DL3 A;  4JJB A;  4HXJ A;  1BK2 A;  1NG2 A;  4J9D A;  4J7F A;  3CCE A;  1VIE A;  4JUV A;  4PJM A;  4C92 B;  2FO0 A;  3BDU A;  1VUB A;  4DBQ A;  2BIV A;  2PVO B;  2YWW A;  3HSB A;  4RTY A;  2HL3 A;  2CUD A;  1AD5 A;  1Y96 A;  4EMG A;  4BE0 A;  1YJW T;  5J26 A;  2E5K A;  4EIK A;  3E19 A;  4PK4 A;  3MKD A;  4X1V A;  2DVJ A;  2XMF A;  3FC3 A;  3DB4 A;  1UUE A;  1YJW A;  3AT1 B;  4UC4 A;  5GAN e;  3CC7 A;  1EZZ B;  4ANJ A;  2L2P A;  1VIF A;  3CC4 A;  4ME7 A;  1TXQ A;  4RTX A;  2A28 A;  3JB9 I;  1JQQ A;  3SB2 A;  2EJF A;  4C8Q B;  2CZ7 B;  2DBK A;  2QAS A;  4M7D G;  3M59 A;  5GAN 4;  1I1J A;  3SD4 A;  2EQU A;  3J81 E;  2RB6 A;  1YWO A;  4E2F B;  1X2Q A;  2D9T A;  1QLY A;  4PKC C;  3TVT A;  1GFD A;  1UGR B;  1B07 A;  2JN0 A;  3IQL A;  3EHQ A;  3OYG A;  3TRE A;  1TSF A;  2LJ0 A;  3CD6 A;  1NEG A;  4FIB A;  3VS0 A;  3OYI A;  1W70 A;  2LCS A;  1GBQ A;  5D6W A;  1VQ6 Q;  1ZUY A;  2DTO A;  1AWX A;  3QDR B;  4AG2 C;  3JCM V;  1OZ3 A;  1PG5 B;  2DKG A;  1D09 B;  2X35 A;  1VQP Q;  1LVK A;  1VQ5 T;  2E65 A;  2GFU A;  2EBP A;  5DLO A;  3QJ6 A;  2M16 A;  2CH4 A;  4AFU C;  5IN1 A;  3QG1 A;  2DMO A;  1M90 U;  3PMT A;  1R0B G;  4GLM A;  4PFO A;  2YRD A;  5CKF A;  1WX6 A;  2RA2 A;  3E2U A;  1ZX6 A;  2QGF B;  3CCS Q;  1Q95 G;  2HEQ A;  3M55 A;  3JCM d;  1VQ7 Q;  1SEM A;  2DXT A;  4E6R A;  2XIC A;  1MV3 A;  1GBR A;  3MEA A;  1NZ9 A;  3CME A;  1NPR A;  2E1H A;  5FWC A;  1SRM A;  4BY6 C;  5KYN A;  5GAO n;  4J5Y A;  5A2Q E;  3KFV A;  1T3L A;  2G3R A;  4MMK A;  2NUZ A;  2GTO A;  4ZGE B;  1RAF B;  1BIA A;  3P8D A;  1H8K A;  1QCO A;  4DEY A;  2EGC A;  4HVV A;  3OS0 A;  2DD5 A;  3PGG A;  5CCA A;  2JTE A;  4ZNX A;  3PIO A;  3QJY A;  4LXC A;  2PVD B;  1HD3 A;  1N8R R;  4CC2 A;  3VUB A;  4CC3 A;  4A4E A;  3A98 A;  3S3N A;  4Z02 A;  3CMA Q;  1WI7 A;  2CUB A;  3UWN A;  2EQJ A;  5GAM j;  1GCQ C;  3TSW A;  2AZV A;  2LNH B;  4F7U B;  1K4U S;  1CSK A;  1PSE A;  1YIJ A;  3OYM A;  1E6H A;  4HVW A;  3LWI A;  4HT9 A;  1V1C A;  2YDL A;  3M0Q A;  1KHI A;  2R58 A;  3C95 A;  5CKB A;  3HPW A;  2KAF A;  2E12 A;  2DA9 A;  4XTZ A;  4EDU A;  3CPF A;  3PFS A;  3CPW A;  4AFQ C;  1U06 A;  3CCQ A;  1VQM Q;  2ZGW A;  1VQ6 A;  4KBM B;  2CYZ B;  2XID A;  3QZ9 B;  1AVZ C;  3A1P A;  1WJS A;  5GMK e;  5EC7 A;  3MEV A;  5IHK A;  1QWE A;  3UT1 A;  4X9C A;  1JO8 A;  3JCM h;  3LGF A;  4HCC A;  4FM4 B;  3UA6 A;  2A0F B;  2LVM A;  3M58 A;  4C0Z A;  4C92 F;  1OV3 A;  2BUD A;  3G4S Q;  1M3B A;  1Q86 U;  3CCS A;  4J9E A;  2RI3 A;  2M1H A;  5GMK h;  3OBY A;  4CRI A;  1J3T A;  2CSI A;  3I5R A;  4JLI A;  4LN2 A;  2QK0 A;  1W2B A;  1N6A A;  1M90 C;  2LX9 A;  2RHU A;  1NE8 A;  1N8R C;  2ABL A;  1C6V X;  3M56 A;  4M75 G;  4AG1 C;  1VQO Q;  3V8J A;  3ZL7 C;  5GAM h;  4DOW A;  4FYY B;  2DTI A;  3M0S A;  2X3W D;  2K2V A;  2RPN A;  3KUF A;  4CC7 A;  3JCM b;  3EGD A;  4XTX A;  3JCM W;  2DFU A;  1VQL Q;  2M02 A;  1W2B P;  4AFS C;  2VYT A;  1SSF A;  5GAN 6;  1QVG A;  1VQ8 T;  1X2K A;  4Y92 A;  1SHG A;  1ZQ1 A;  2KRN A;  2EFI A;  1QW1 A;  4E7H A;  3HFO A;  3LWH A;  2OTL T;  1BI1 A;  4ZN3 A;  1K73 U;  1S72 Q;  1TUG B;  2CP3 A;  2ZAE A;  1YHQ A;  2QA4 T;  1M2V B;  3O8V A;  3RKY A;  2MMP A;  2QEX T;  2RJC A;  1U3O A;  1LPL A;  5FWB A;  3ER0 A;  1RAI B;  3SWN A;  3ZBD A;  4A54 A;  4D6W A;  2IPO B;  3G71 T;  4F7U G;  2YUP A;  2Z0W A;  3QO3 A;  5C6S A;  1WQ7 A;  4XTW A;  2DET A;  3D7S B;  5A0L A;  5LJ5 f;  3ME9 A;  2O9V A;  2JJ9 A;  4J83 A;  2AKL A;  3HFN A;  3MET A;  2RM4 A;  1WXU A;  2LQ8 A;  1A0N B;  5KE2 A;  4MZP A;  4L6V 5;  3CQT A;  2XHC A;  1RAE B;  1GL5 A;  2YUN A;  2QQA A;  1H92 A;  4M77 A;  1YIT T;  4R55 A;  2H8H A;  1X69 A;  1P92 A;  1Y71 A;  4JRP A;  1O75 A;  2QQS A;  3G1J A;  3C0C A;  3E9G A;  2BE7 D;  4CC4 B;  2RNA A;  1JJ2 S;  1YIT A;  4WF2 A;  1XNI A;  4E7J A;  1PM3 A;  2DIG A;  2LJ1 A;  3NTK A;  1Y0M A;  1M1K C;  2CS7 A;  2FRY A;  3OS5 A;  1Q81 U;  2DF6 A;  1OPK A;  4XU3 A;  2LRQ A;  4M7D D;  1D0X A;  4E7Z A;  1BU1 A;  3JV3 A;  3TQ7 P;  1BB9 A;  2ESW A;  1WXB A;  3RKW A;  2OAU A;  4M77 E;  2ZCF B;  3CPW P;  1WJR A;  2JNG A;  3LW5 E;  3EH2 A;  4GLK A;  4Z88 A;  2A7Y A;  2W0Z A;  2RHI A;  1G83 A;  3QWX X;  3RKX A;  2HMA A;  3OMG A;  3NPF A;  4FW2 A;  2ZPG B;  4M7A A;  3GF5 A;  3PIP A;  1VQK Q;  2RQR A;  2JTM A;  2OAW A;  3JCM J;  1VQP T;  2FYK A;  4DBH A;  1N5Z A;  4LDW A;  4C5G A;  1OPL A;  1S1N A;  1M90 R;  1ZBJ A;  2K9G A;  5KH6 A;  3OMC A;  4C0D C;  2EGA A;  3PNW C;  5KYY A;  4RMO A;  3HL8 A;  1WQW A;  3CME Q;  1JRI A;  1I4K 1;  3OBW A;  3M54 A;  2V8J A;  2A37 A;  2XU8 A;  2YLC A;  4JRQ A;  1YBY A;  3TSZ A;  4C0D B;  2HSP A;  3H41 A;  5GAN 3;  4OF1 A;  2FVU A;  1TS9 A;  1M1K U;  3QPH A;  1QCF A;  3WVD B;  1Y07 A;  5C0M A;  3SEM A;  1D3B A;  2ROL A;  2MIO A;  1NEB A;  3DLM A;  4AMC A;  3S3O A;  4MDX A;  3FJP A;  5CVI A;  2F1L A;  1UGS B;  4PLI A;  1WHG A;  4EMK C;  3QDF A;  1TUC A;  2LNV A;  1B34 B;  2EJG A;  1SHF A;  1ZLM A;  4BI3 A;  2KT8 A;  2EPD A;  3EGX A;  4Y91 A;  2VVK A;  3EFO B;  3CCM A;  1VQN Q;  3G71 Q;  3S6W A;  4ESR A;  2HD0 A;  4QT7 A;  4OB3 B;  1VYV A;  4M77 F;  3G6E Q;  1JXM A;  1D3B B;  4C8Q A;  2DYB A;  4M7A F;  1ZSZ B;  1PSF A;  2OI3 A;  5FLX E;  5FRM A;  4ELY C;  2R57 A;  4II1 A;  4A4K A;  3VU3 C;  1VQ8 Q;  5I11 A;  4KH0 B;  2O31 A;  2WSE E;  2DRK A;  3PTA A;  2NUP A;  2KVQ G;  3RES A;  1RAH B;  2D8J A;  3A5Z B;  5I22 A;  1UG1 A;  1LNX A;  1VA7 A;  2MOX A;  3VS7 A;  1QKX A;  3CC7 Q;  1WHL A;  2JS2 A;  2MWO A;  1M9S A;  3BDL A;  3CC2 Q;  3H8Z A;  2KSS A;  2KXC A;  2A36 A;  2K7A A;  4M4Z A;  1VQ9 A;  1TTH B;  5CK9 A;  3RDV A;  2DIL A;  4HT8 A;  2GQV A;  4DBR A;  3FIF A;  1WNL A;  2EWN A;  4O5V A;  3EFO A;  2DIQ A;  3L2Z A;  2DL5 A;  2NUP B;  1PD1 A;  1Q86 C;  3M5A A;  1TUD A;  2DZ9 A;  2JMC A;  3CCV Q;  3CC4 T;  5HY6 A;  3L2W A;  3CXC P;  1KC8 R;  4KH1 B;  2EYW A;  2E70 A;  1QQJ A;  1W2B S;  2RQU A;  2RI2 A;  3OYC A;  1BI3 A;  3CC4 Q;  3OW2 S;  4RKU E;  2YRV A;  1JJ2 P;  4KGZ B;  6AT1 B;  2E3I A;  4F04 B;  1MMA A;  1BBZ A;  2VKN A;  3MP8 A;  5J39 A;  4JZ3 A;  1VQL T;  2X51 A;  5GAN 2;  2KT1 A;  1X43 A;  2VUB A;  2WSC E;  2YT6 A;  3EG0 A;  4FYX B;  4D8D A;  3M57 A;  4J9B A;  3INZ A;  3VUZ A;  2F69 A;  3EGD B;  5FU6 B;  2FZK B;  4R56 A;  4CI0 C;  3BFM A;  3EG3 A;  2IVW A;  3MJX A;  3EG9 A;  1K9M R;  1VQO T;  1S72 T;  1KC8 U;  1W4S A;  1VQM A;  2DL8 A;  1T0H A;  2NUT B;  3RMQ A;  3HTR A;  2PVG B;  2GF7 A;  4BD3 A;  2B86 A;  1AZG B;  2ZPH B;  2DYI A;  2V26 A;  2YUO A;  1XTD A;  2MCN A;  4M75 A;  2RO0 A;  1R8O B;  3A8O B;  3RNJ A;  1NPP A;  2OX7 A;  2MWP A;  8ATC B;  2OJ2 A;  3OYJ A;  3G6E T;  2D6F A;  3EG9 B;  3TEE A;  2XK0 A;  1MGQ A;  1Y57 A;  3CCR A;  1JB0 E;  4JLG A;  1Q86 R;  3U23 A;  3J7A F;  2JMA A;  3RBB B;  3M0R A;  1VQN A;  1OX9 A;  4OP0 A;  4BE2 A;  1X6G A;  4HKE A;  3RER A;  1JXO A;  4M75 D;  3FEO A;  2K6D A;  2EGE A;  2FHD A;  2WSF E;  4RTZ A;  4RUG A;  1D1A A;  2ZPI B;  3JCM X;  3RIR A;  2CP2 A;  2JTF A;  3JCM g;  2YUQ A;  4QVZ A;  3ZFJ A;  2BZ8 A;  2EYX A;  1VQ4 Q;  1OX8 A;  1Y96 B;  2LP5 A;  1X27 A;  3X26 B;  3KBG A;  1PNJ A;  1RL2 A;  5GAO m;  4N4H A;  5IXB A;  1ZSZ C;  1Q81 R;  5GAN 5;  2B8A A;  2EJ9 A;  3BW1 A;  2QTV A;  1H64 1;  5GMK m;  2YHT A;  1D0Y A;  4M7A D;  3M0U A;  3GLX A;  2DXC A;  4RG8 A;  3HRT A;  2GNC A;  4FYW B;  2PU9 B;  1JJ2 A;  1G3T A;  1RAG B;  2O9S A;  3Q1J A;  4E7S A;  4ZTJ A;  2CH4 W;  1V29 B;  1NYG A;  3ULR B;  2K3Y A;  4M77 G;  5LJ5 j;  2OTJ A;  2QXF A;  5CQX A;  8AT1 B;  2EQK A;  4D8K A;  2X4J A;  3OYL A;  5CKE A;  2GTJ A;  2ROT A;  3LYI A;  4B9W A;  4EMK A;  3ASK A;  2DVE A;  2I0N A;  3I35 A;  3VKI A;  1BYM A;  3CCL T;  5CQY A;  2FPE A;  2E4H A;  2RHZ A;  2XKO C;  1EIF A;  4KGV B;  2J05 A;  2LDM A;  4LD9 K;  2RQV A;  5GAO p;  1PC0 A;  3NFC A;  2VGM A;  1K8A C;  1AZE A;  5A0G A;  4OMO A;  4PLL A;  1PKT A;  2J7I A;  1NJI R;  1YNZ A;  2DXB A;  3GPL A;  2VXF A;  1I07 A;  2JM8 A;  5GAN 8;  2QEX A;  2M0Y A;  2G6F X;  3OSS C;  4N0A A;  3SWN C;  1VQ5 A;  1KD1 C;  3RMS A;  1YJW Q;  2RQW A;  1BIB A;  1VQK T;  1Q81 C;  5GAN h;  4LDV A;  1QP3 A;  2LCL A;  4M7A C;  3CXC A;  1G3W A;  3MP1 A;  4XAX B;  2JZ2 A;  3M0T A;  4B6M A;  1M5Q 1;  1XJW B;  3A8L B;  3OS1 A;  4C8Q D;  4FSS A;  1GFC A;  4X9D A;  2RMO A;  4NL2 A;  2DM1 A;  1YCS B;  4QQG A;  4BY6 B;  2KMT A;  2E10 A;  1ZUU A;  5FU7 B;  2XDB A;  1SSH A;  2NYS A;  2KNB B;  3DLL A;  5IHN A;  4XU1 A;  1YHQ T;  3CCU Q;  4A63 B;  2FZC B;  4QKU A;  1YJN T;  3H0I A;  2LTO A;  1IRE B;  5LJ5 e;  2DTH A;  2CT4 A;  1YJ9 Q;  1LOJ A;  2XI9 A;  2SRC A;  1PKS A;  1I0C A;  5ECA A;  5CO7 A;  4ORZ A;  2DK3 A;  2F5K A;  4PJO A;  5D6X A;  3CCR T;  1NM7 A;  3A8M B;  3CBP A;  1MMD A;  3GBQ A;  2KQW A;  2JS0 A;  1MMG A;  1NJI C;  1GXI E;  1H3Z A;  4M78 D;  1QCN A;  2HNI A;  2PUO B;  1WHJ A;  4PFP A;  2PZ1 A;  3J80 E;  2P4T A;  3VS6 A;  3H6Z A;  1SF9 A;  3H0F A;  2QTX A;  1R0C B;  4GY5 A;  3VRY A;  4BAC A;  4BDZ A;  3QSU A;  2M0O A;  2QI2 A;  4JJC A;  4PJO C;  2RK2 A;  3PMI A;  4EMK B;  2K5L A;  2VAS A;  2L0A A;  2EYQ A;  2QA4 Q;  3SFM A;  4M75 F;  3X25 B;  4J9I A;  1WHM A;  1M3C A;  3GNG A;  3JSC A;  3VS2 A;  4F7U F;  5GAM e;  5LJ5 d;  3BY7 A;  1G3S A;  4C5E A;  1HK9 A;  2EKO A;  2PNI A;  1PWT A;  2K2M A;  2HQH A;  1AWO A;  4XQ3 A;  1LCK A;  4QQD A;  5CKD A;  2D1X A;  4RTW A;  5GAN f;  2FPD A;  2JOY A;  4OVA A;  1G5V A;  2V8I A;  1UGV A;  5LJ3 d;  2F2V A;  2CT3 A;  4QVD A;  3CEY A;  3VV0 A;  4NOY A;  3QHS A;  2KBT A;  3T9N A;  4JS4 A;  4PJO E;  1ARK A;  2RJF A;  2IIM A;  2LX7 A;  2OTJ T;  1ACM B;  4B9X A;  1MHN A;  3V7C A;  1OZ2 A;  4E47 A;  3VYH B;  3CC2 T;  1K8A U;  1DJ7 B;  1X01 A;  3X24 B;  3L42 A;  3L2U A;  4BI8 B;  1OU9 A;  2MYS A;  5GAM f;  4PL6 A;  1R77 A;  1MNE A;  2QQ9 A;  4J9H A;  5CAI A;  5KE3 A;  1AWJ A;  2HBP A;  1RUW A;  2R5M A;  2DE0 X;  3M53 A;  4BI4 A;  2C06 A;  2K5I A;  3MEU A;  2FL7 A;  4MML A;  1M1G A;  4FT2 A;  5GAN g;  4OMF B;  3CMA A;  3PVL A;  3L2R A;  1VQO A;  5L23 A;  5KYX A;  5CIU A;  2MI6 A;  1YJN Q;  2CSQ A;  3OYE A;  3CXC S;  2CRE A;  1K9M U;  4HCB A;  3HKS A;  2L89 A;  4FW1 A;  2OTL A;  2JXB A;  3PVQ A;  4F7U A;  2LZ6 B;  4M7A E;  4ZTF A;  3QBY A;  3I9Q A;  5GJW B;  1OEB A;  2QDY B;  1HYO A;  1M3A A;  1ZA1 B;  4LDX A;  3EAE A;  2DNU A;  4EMH A;  1YI2 A;  2RH2 A;  1Q82 C;  5FU7 C;  4N4I A;  1OU8 A;  5CR2 A;  3L1A A;  1UHF A;  1UJ0 A;  3QYG B;  2DXU A;  4F14 A;  4XK8 E;  2K57 A;  1VQ7 T;  1CKA A;  5HK0 A;  2XD0 A;  1M27 C;  2L3Q A;  3BE3 A;  3PT9 A;  1VOM A;  1VQ9 Q;  5LJ3 h;  1KSW A;  2QG9 B;  5FU6 C;  1KHC A;  4M75 C;  3CC2 A;  2E6N A;  4J6W A;  1N27 A;  1I5L A;  3N5B B;  5I2S A;  1LJO A;  4X34 A;  1QVP A;  3REA B;  5IT9 E;  5EG2 A;  1QVF S;  3JB9 D;  1C0M A;  1WPY A;  4DA4 A;  5KYW A;  2OTJ Q;  3EGU A;  2KYM A;  4N0A C;  1X75 C;  2RHX A;  2O88 A;  2COY A;  2V1R A;  2DEU A;  5D6Y A;  4WCI A;  2AZS A;  1UDL A;  1RAC B;  1UGQ B;  2HDA A;  2QQR A;  1WGS A;  1M8M A;  5M9O A;  1MV0 B;  3OW2 P;  2FZG B;  2L8D A;  2AHJ B;  5GAO r;  1G8X A;  2CP7 A;  1NYF A;  3R6N A;  4A4F A;  1Y7X A;  3JB9 J;  4M78 G;  3DKM A;  4PJN A;  1ZHI A;  1IGQ A;  3MHX A;  2V8K A;  2BZY A;  3SHW A;  2RN8 A;  3LGL A;  3UDC A;  1JU5 C;  5HKC A;  2AT1 B;  4M7A B;  1KFZ A;  4LNP A;  2HQX A;  1H3H A;  5LJ3 f;  1Q82 U;  2RHY A;  1U1S A;  2J6F A;  4FL6 A;  3O5Z A;  1MMN A;  1SKU B;  5GMK i;  1VQ6 T;  3CC7 T;  1IXD A;  4M7D F;  2D0Q B;  2DPP B;  1KD1 U;  1N9R A;  7AT1 B;  4ZN1 A;  1YJN A;  1AT1 B;  5A0D A;  2H3J A;  3GOX A;  2ZPF B;  2P0P A;  2RD1 A;  2MK5 A;  4ATO A;  3NMZ C;  3CCR Q;  3RR6 A;  4C92 A;  1WXT A;  1YIT Q;  2DBM A;  2FB7 A;  1M30 A;  2K3B A;  2O4X A;  2KXD A;  3CBO A;  3CBM A;  2ATC B;  2HKQ B;  5LJ3 g;  2AKK A;  4OMM A;  4Y28 E;  2HBW A;  3FLG A;  1QVG S;  3X28 B;  4N4G A;  3CCE Q;  4C0F A;  1UJY A;  2O2O A;  3JCM e;  3TU4 K;  5GAM d;  3EGX B;  3OQ5 A;  4M78 F;  5DY9 A;  4OB2 B;  2MPX C;  2QAZ A;  4V2S A;  4F17 A;  2LT4 A;  2BE9 B;  1K9A A;  1VQ8 A;  4EPC A;  4HCZ A;  2XDD A;  3EHR A;  2CZ6 B;  3JCM P;  4IUV A;  4C92 C;  4HVU A;  1WYX A;  3QZ5 B;  2L3R A;  2E5Q A;  1U8R A;  2P0K A;  4VUB A;  1WDX A;  2JUF A;  1KK7 A;  5IXF A;  2MF2 A;  1Q82 R;  4QQ6 A;  4XTV A;  2J6O A;  3G71 A;  3UAT A;  2DD4 A;  1ZUK A;  2BZX A;  2LT1 A;  3LH5 A;  2RK1 A;  1IGU A;  3CCU A;  3VYG A;  3LH0 A;  2GCX A;  2QA4 A;  4L59 A;  3VRZ A;  1SRL A;  3GIB A;  1AOJ A;  3I56 T;  2JW4 A;  4M75 B;  1UEB A;  2VV5 A;  1VQL A;  4RTU A;  4IUR A;  1MND A;  3UPU A;  2F2X A;  2QYZ A;  5GMK j;  1K0X A;  4JS5 A;  1QKW A;  3WVE B;  1TU0 B;  1WHH A;  3OYN A;  2X9H A;  2GGR A;  9ATC B;  4KT0 E;  1ZBX A;  2JT4 A;  2K3X A;  4JJD A;  1TG0 A;  1OUL A;  2C0I A;  2R5A A;  1YCY A;  4J9G A;  4JPB W;  5I2M A;  5KYY B;  4MDW A;  2O4X B;  4NS5 A;  4MZM A;  2H3E B;  2FEI A;  3I5S A;  2PTK A;  3QKJ A;  2NLU A;  2ECZ A;  1M8V A;  2J6K A;  2ZPB B;  3QXE B;  4P5N A;  3CCQ T;  1TOV A;  3AHU A;  1QP2 A;  4KUI A;  3EG2 A;  2W10 A;  2X3X D;  2YLB A;  3OYH A;  1I8F A;  3M9Q A;  2D0N A;  2RF0 A;  3X20 B;  5AT1 B;  1KIK A;  5GAN j;  1PHT A;  5IAY A;  2LQW A;  1YWP A;  4K11 A;  3C12 A;  1QMC A;  2EW3 A;  3OYD A;  1XOV A;  1C1A A;  2BTT A;  1I5O B;  2PUK B;  2P84 A;  2PQW A;  4M7D C;  1PRL C;  2DRM A;  1WIE A;  2GBQ A;  2ED1 A;  4F16 A;  1BKB A;  4BDY A;  2RI5 A;  1FMK A;  4PJO F;  1WJQ A;  3FJ5 A;  2X4X A;  1F1B B;  3UF4 A;  4KUL A;  2HL5 C;  3L2V A;  5FRN A;  3H9N A;  1GRI A;  4YTL A;  1KQS A;  1JEG A;  2QDL A;  3L2Q A;  2YXY A;  1QWF A;  3G6E A;  4MZT A;  4M7D B;  1YIJ T; 
#chains in the Genus database with same CATH homology
 1UTI A;  3H0F A;  4HCK A;  1AD5 A;  3TSZ A;  4Z89 A;  2HSP A;  3VRY A;  2E5K A;  4EIK A;  2AK5 A;  3H41 A;  4JJC A;  4X1V A;  2DVJ A;  2XMF A;  2M51 A;  4J9F A;  1UUE A;  2L0A A;  1AWW A;  1QCF A;  4J9I A;  4LE9 A;  1M3C A;  1K76 A;  3SEM A;  2L2P A;  2ROL A;  3VS2 A;  1T3S A;  2MIO A;  1NEB A;  4RTX A;  2A28 A;  2PNI A;  1PWT A;  2K2M A;  1JQQ A;  1TUC A;  4RTT A;  2YSQ A;  1AWO A;  1FYN A;  1SHF A;  1ZLM A;  2DBK A;  1LCK A;  1NLO C;  2KT8 A;  2EPD A;  2VVK A;  2D1X A;  4RTW A;  3THK A;  1I1J A;  2FPD A;  1UGV A;  2EKH A;  1YWO A;  4ESR A;  2F2V A;  2CT3 A;  4QT7 A;  1X2Q A;  1QLY A;  1VYV A;  2KBT A;  1ARK A;  4IIM A;  1JXM A;  3TVT A;  3EG1 A;  1GFD A;  1B07 A;  1ZSG A;  2IIM A;  2LX7 A;  3IQL A;  3EHQ A;  5HCK A;  1MUZ A;  2EYY A;  2KGT A;  2LJ0 A;  3VS5 A;  1NEG A;  2DYB A;  2KR3 A;  3VS0 A;  1W70 A;  2OI3 A;  2LCS A;  1GBQ A;  1OOT A;  1ZUY A;  1AWX A;  4AG2 C;  5I11 A;  4J9H A;  2O31 A;  2DRK A;  4GBQ A;  1AWJ A;  1Z9Q A;  4IIO A;  1RUW A;  2D8J A;  2EBP A;  5I22 A;  1UG1 A;  1VA7 A;  2DE0 X;  2MOX A;  5FW9 A;  3VS7 A;  1QKX A;  4DEX A;  3UA7 A;  1KJW A;  2JS2 A;  2NWM A;  2CH4 A;  4AFU C;  2DMO A;  2KXC A;  3PVL A;  2A36 A;  2K7A A;  4M4Z A;  4OMP A;  1K1Z A;  5L23 A;  1W1F A;  4GLM A;  2DIL A;  1PRM C;  2CSQ A;  2CRE A;  1WX6 A;  2J06 A;  1ZX6 A;  2JXB A;  3PVQ A;  2HEQ A;  2LZ6 B;  2DL5 A;  3I9Q A;  1SEM A;  5GJW B;  4E6R A;  1OEB A;  1MV3 A;  2DLP A;  2FPF A;  1TUD A;  2JMC A;  1GBR A;  1UE9 A;  5FWC A;  1M3A A;  1SRM A;  2DNU A;  2ED0 A;  1E7O A;  2EYW A;  2FRW A;  3KFV A;  1T3L A;  5IH2 A;  1K0S A;  2DJQ A;  2EYZ A;  2NUZ A;  2GTO A;  2RQU A;  1RLQ C;  1W6X A;  1H8K A;  1UHF A;  1UJ0 A;  3H0H A;  4DEY A;  1ABQ A;  2L3S A;  2EGC A;  2V1Q A;  4F14 A;  4HVV A;  1CKA A;  4JZ4 A;  1VYU A;  1M27 C;  2L3Q A;  1KSW A;  1IO6 A;  1BBZ A;  1UEC A;  2JTE A;  2VKN A;  4ZNX A;  2D8H A;  4JZ3 A;  2VWF A;  2KT1 A;  1X43 A;  2YT6 A;  3REA B;  3EG0 A;  1HD3 A;  4CC2 A;  4CC3 A;  3A98 A;  4D8D A;  4J9B A;  4LUE A;  1WI7 A;  2CUB A;  3EGU A;  2KYM A;  3EG3 A;  1GCQ C;  3TSW A;  2O88 A;  2V1R A;  2AZV A;  2LNH B;  1K4U S;  4WCI A;  1CSK A;  2AZS A;  2DL8 A;  1UDL A;  2EVR A;  1E6H A;  4HVW A;  1T0H A;  1T0J A;  3NHN A;  2HDA A;  1V1C A;  2YDL A;  3M0Q A;  2B86 A;  1AZG B;  1HJD A;  2FG0 A;  1M8M A;  1RLP C;  2YUO A;  1MV0 B;  2MCN A;  4AFZ C;  4OMQ A;  2DA9 A;  3RNJ A;  1NYF A;  2DL4 A;  4AFQ C;  3R6N A;  1U06 A;  2LMJ A;  2OJ2 A;  1ABO A;  1WA7 A;  1Y57 A;  1AVZ C;  2BZY A;  3SHW A;  2RN8 A;  5EC7 A;  2LJ3 A;  5IHK A;  1QWE A;  1JU5 C;  2C0T A;  3U23 A;  2LQN A;  2JM9 A;  2JMA A;  3RBB B;  1JO8 A;  3M0R A;  4LNP A;  2K79 A;  2KRM A;  1KFZ A;  1H3H A;  2J6F A;  1WFW A;  1X6G A;  3O5Z A;  3VS3 A;  3UA6 A;  3QWY A;  2EQI A;  2C0O A;  1JXO A;  1OV3 A;  2K6D A;  2EGE A;  1WLP B;  1EFN A;  4RUG A;  4RTZ A;  1M3B A;  2CDT A;  4J9E A;  1NLP C;  1UFF A;  2YUQ A;  1B3Q A;  1J3T A;  2CSI A;  4OML A;  2BZ8 A;  2EYX A;  3I5R A;  4LN2 A;  5IHI A;  1E6G A;  3NMZ C;  2LP5 A;  1X27 A;  1WXT A;  1PNJ A;  2P4R A;  2DBM A;  2ABL A;  4AG1 C;  1M30 A;  2K3B A;  2L3P A;  2KXD A;  5IXB A;  3ZL7 C;  2AKK A;  3M0S A;  2X3W D;  4OMM A;  2RPN A;  4CC7 A;  2HBW A;  3M0U A;  1UJY A;  2O2O A;  2GNC A;  3NGP A;  2O9S A;  4AFS C;  2CH4 W;  4F17 A;  1NYG A;  3ULR B;  1K9A A;  1X2K A;  2KRS A;  4Y92 A;  3PE0 A;  1SHG A;  3EHR A;  2KRN A;  2HCK A;  4D8K A;  1VYT A;  4HVU A;  2KYB A;  2GTJ A;  2ROT A;  1WYX A;  2I0N A;  1WDX A;  3I35 A;  5IXF A;  1U3O A;  5FWB A;  1HSQ A;  2DX1 A;  2FPE A;  2J6O A;  2YUP A;  3UAT A;  1ZUK A;  2F2W A;  2BZX A;  2J05 A;  3LH5 A;  2RQV A;  2O9V A;  1X6B A;  3REB B;  3M0P A;  3VRZ A;  2KRO A;  1AZE A;  1YP5 A;  1SRL A;  2AKL A;  1AOJ A;  4OMO A;  1PKT A;  1WXU A;  2J7I A;  1YNZ A;  2KE9 A;  2JW4 A;  1A0N B;  1G2B A;  1RI9 A;  4RTU A;  1I07 A;  2JM8 A;  2F2X A;  3CQT A;  1K0X A;  2M0Y A;  4R0K A;  1GL5 A;  2G6F X;  2YUN A;  1QKW A;  1H92 A;  1GCQ A;  2GGR A;  2RQW A;  2H8H A;  1X69 A;  2JT4 A;  3C0C A;  1SPK A;  4CC4 B;  2RNA A;  2KEA A;  4JJD A;  1TG0 A;  2SEM A;  2LJ1 A;  4OMN A;  2C0I A;  3M0T A;  1Y0M A;  4J9G A;  4JPB W;  4RTV A;  4FSS A;  2DL7 A;  1GFC A;  2RMO A;  2DM1 A;  1YCS B;  2FRY A;  2ENM A;  2DF6 A;  2FEI A;  3I5S A;  1OPK A;  4KRT A;  3VS1 A;  2PTK A;  1ZUU A;  1AEY A;  1BU1 A;  3JV3 A;  2ECZ A;  5GJV B;  1BB9 A;  1SSH A;  2ESW A;  2J6K A;  1WXB A;  2KNB B;  1CKB A;  5IHN A;  4A63 B;  3H0I A;  4Z88 A;  2W0Z A;  2CT4 A;  2A08 A;  1G83 A;  1GCP A;  3EG2 A;  2GQI A;  3QWX X;  2W10 A;  2X3X D;  1YN8 A;  3NPF A;  2SRC A;  1PKS A;  2D0N A;  1I0C A;  2RF0 A;  5ECA A;  1KIK A;  2RQR A;  1PHT A;  4ORZ A;  2OAW A;  1U5S A;  2LQW A;  1YWP A;  4K11 A;  3VS4 A;  1N5Z A;  2EW3 A;  1NM7 A;  1XOV A;  2RQT A;  2BTT A;  1OPL A;  4J9C A;  1S1N A;  1PRL C;  2DRM A;  3GBQ A;  4Z8A A;  1ZBJ A;  1WIE A;  2GBQ A;  2K9G A;  2JS0 A;  2ED1 A;  4F16 A;  2EGA A;  4LUD A;  1UHC A;  4JJB A;  1FMK A;  1Z9Z A;  2DL3 A;  4HXJ A;  1BK2 A;  1NG2 A;  3FJ5 A;  4J9D A;  3UF4 A;  2FO0 A;  1GRI A;  2PZ1 A;  1JEG A;  2QDL A;  4RTY A;  2A37 A;  3VS6 A;  1QWF A;  2CUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...