2LMJA

Itk-sh3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
GPLGSPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title The SH3 domains of the Tec family kinase Itk and the Src family kinase Lck compete for adjacent sites on T-cell specific adapter protein
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 66
sequence length 66
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lmjA00
1I07A 2C0TA 1KJWA 2FRYA 2AZSA 2YT6A 3RNJA 1M3BA 4HVWA 2KR3A 4Z88A 3VS0A 2V1QA 3M0TA 3EG1A 1FYNA 1GBRA 2D8HA 1FMKA 2RQUA 1ZSGA 1WXUA 2F2VA 2YSQA 1QCFA 3UA6A 1WDXA 4GLMA 1ARKA 2YUQA 3VS5A 1ABOA 2H8HA 1RI9A 2CT3A 4ORZA 2HBWA 1HD3A 2LQWA 1G83A 1K4US 3I35A 5IHIA 3EHQA 2JW4A 4J9FA 1PKTA 2RQTA 2SRCA 2F2WA 1K0SA 2DL8A 3O5ZA 1PRMC 2X3WD 1K9AA 2FPDA 2DYBA 2MIOA 2MCNA 1JO8A 2DL3A 1LCKA 3VRZA 2O31A 4E6RA 1WIEA 1UGVA 1WXBA 4HCKA 2G6FX 5L23A 1AWOA 1PKSA 1X6GA 2DL5A 4LNPA 1H8KA 4RTVA 1QWFA 2RPNA 1AD5A 2ROTA 2FEIA 1SSHA 1UHFA 4J9IA 1KSWA 2DLPA 4K11A 4J9CA 2J6KA 2L3SA 3NHNA 3M0QA 4HVUA 3VS1A 3I5SA 2J6OA 1SRMA 2RMOA 1H3HA 2HSPA 4AFQC 2DBKA 2ABLA 4F17A 1VYUA 4J9DA 1YWOA 4JPBW 4HVVA 1SRLA 1PRLC 2K79A 4AFUC 2I0NA 1M8MA 2EGAA 2AKKA 2GNCA 2KXDA 5GJVB 3SEMA 4OMPA 5GJWB 3TVTA 1AWXA 2JS0A 4R0KA 1V1CA 1CSKA 2CSQA 1ZX6A 2ED0A 2KRNA 2OI3A 2GTOA 4DEXA 1X2QA 4D8DA 1AZGB 4OMNA 4J9EA 2KGTA 1QKWA 4D8KA 1HSQA 1NM7A 1E7OA 1SHGA 1WI7A 2O88A 3CQTA 1YCSB 3GBQA 4RTZA 2RNAA 3A98A 1K76A 1WX6A 1X27A 1E6HA 2JS2A 2A37A 2DBMA 2GTJA 1M30A 2NWMA 2YUNA 3PVQA 3ULRB 1UG1A 1OPLA 1BU1A 1TUCA 2DL7A 2FPEA 2KRSA 5EC7A 2V1RA 2EGEA 2KYBA 4AG2C 4M4ZA 2M51A 3VS3A 4F16A 2JMCA 5IXFA 1UDLA 3REBB 2GQIA 2XMFA 1WLPB 2QDLA 1J3TA 5IXBA 2RQWA 1MUZA 1OEBA 2W10A 1OOTA 2DNUA 2DILA 2J6FA 1UHCA 1IO6A 4LE9A 4WCIA 2DE0X 2EPDA 2C0OA 2L2PA 1GL5A 4AFSC 1JXOA 2EKHA 1T0HA 4OMMA 2EYWA 1WYXA 4RTYA 3PE0A 2ED1A 1YN8A 3QWYA 1GFDA 1T3LA 1B3QA 2RF0A 1T0JA 3LH5A 1GCPA 2JMAA 2JM8A 1UTIA 2EYZA 1QWEA 4IIMA 2O9VA 1GCQA 4FSSA 1PNJA 1KIKA 3TSZA 1X2KA 2ESWA 1I0CA 2DA9A 2LZ6B 5FWCA 3M0UA 4J9HA 3TSWA 2OAWA 4JJCA 2GBQA 1HJDA 1ZBJA 4RUGA 1Z9QA 3VS6A 1RUWA 2PZ1A 4RTUA 3REAB 1W6XA 2E5KA 2IIMA 2O2OA 3H0HA 4JJBA 4RTTA 1K1ZA 2K3BA 2LCSA 4IIOA 1AOJA 1ABQA 2NUZA 1W1FA 4LN2A 2D1XA 2CUBA 5ECAA 1G2BA 5I22A 3RBBB 1SHFA 2EGCA 3EG0A 1MV0B 1NEGA 2KNBB 2K7AA 4OMOA 2JTEA 1UECA 1AZEA 1X69A 1OV3A 2KEAA 4HXJA 3ZL7C 1M3CA 2SEMA 1KFZA 1BB9A 3VS7A 2P4RA 2CT4A 2GGRA 2YUOA 1YNZA 2VWFA 2OJ2A 1YP5A 4GBQA 2LQNA 3NPFA 2CH4W 1UFFA 5IHNA 2A08A 1RLPC 1OPKA 3NGPA 4LUEA 3QWXX 2DL4A 2DX1A 2DRKA 2J7IA 2AZVA 3EG2A 2DMOA 4KRTA 4RTWA 2ECZA 2HCKA 1PWTA 2A28A 3NMZC 1NG2A 2RQRA 1A0NB 1GCQC 2K9GA 1GFCA 3VRYA 4Z89A 2C0IA 1WXTA 3UA7A 3I5RA 1Z9ZA 3U23A 1NLOC 1AWJA 2HEQA 2D8JA 2X3XD 1NYFA 2AK5A 1T3SA 2PTKA 1S1NA 2L3PA 1GRIA 4CC3A 1JXMA 4JJDA 1YWPA 1RLQC 4CC2A 2DJQA 3VS2A 1X6BA 2EW3A 4OMQA 1VYTA 1U3OA 1M27C 2L0AA 4QT7A 1N5ZA 2K2MA 3VS4A 3M0RA 2BZ8A 3EHRA 2ROLA 2FRWA 1K0XA 1TG0A 1H92A 4RTXA 2DM1A 2CDTA 2JT4A 1SEMA 3UATA 2LJ3A 1Y57A 1ZLMA 2LJ1A 1AWWA 2RN8A 2RQVA 1CKBA 1QLYA 2FPFA 2MOXA 2LJ0A 2W0ZA 3H0FA 2KT1A 1SPKA 3JV3A 1WFWA 2KE9A 1U06A 2EBPA 1WA7A 2KRMA 1I1JA 4J9GA 4JZ4A 3EG3A 5I11A 2EQIA 2PNIA 1TUDA 2CH4A 2JM9A 4F14A 1JQQA 1AEYA 3C0CA 3KFVA 3THKA 1B07A 1XOVA 1CKAA 2HDAA 1U5SA 2BZXA 3SHWA 2M0YA 1NLPC 3M0SA 2DVJA 3H0IA 3PVLA 4CC4B 1ZUUA 3IQLA 2JXBA 1EFNA 4LUDA 1MV3A 2DF6A 1GBQA 5FWBA 2YUPA 2KXCA 2LP5A 2CSIA 3UF4A 4AFZC 1X43A 2CREA 2F2XA 4OMLA 2K6DA 1UE9A 4AG1C 2YDLA 4JZ3A 3R6NA 1W70A 1VYVA 4ZNXA 1BK2A 4Y92A 5FW9A 1PHTA 5IH2A 1Y0MA 5HCKA 2O9SA 2LNHB 4A63B 3H41A 1AVZC 2CUDA 2L3QA 4J9BA 1M3AA 2B86A 1UJYA 1JEGA 1VA7A 2KYMA 4ESRA 2A36A 2AKLA 2BTTA 2VKNA 2ENMA 2LMJA 3EGUA 2D0NA 4Z8AA 1NEBA 1BBZA 1ZUKA 2J05A 1UUEA 3FJ5A 3I9QA 2VVKA 3M0PA 1NYGA 2KT8A 4DEYA 2FO0A 2LX7A 2EYXA 2EYYA 4X1VA 5IHKA 2BZYA 2DRMA 1E6GA 2KBTA 1QKXA 4EIKA 4CC7A 1UJ0A 2FG0A 2EVRA 1JU5C 1ZUYA 2J06A 2KROA
chains in the Genus database with same CATH superfamily
3DB3A 4V2SA 2H3JA 4M75B 1S72A 1Q82R 1VQPQ 3M59A 1M3BA 4Z88A 3G6EA 2V1QA 1FYNA 2XICA 2D8HA 4RG2A 4XTUA 1G3SA 2RQUA 3UDCA 1WGSA 3MP8A 1WXUA 1Y96A 1QQJA 1TH7A 3EFRA 1KQ1A 4GLMA 3GPLA 5FU6C 1WJSA 2YUQA 3CC7A 3VS5A 1RAHB 3Q1JA 1HD3A 2BUDA 5LJ5j 2LQWA 3CXCS 3HSBA 1ZQ1A 3I35A 4JLIA 4C92C 3EHQA 4MMKA 1BIAA 2JW4A 2P0PA 3X20B 5GAN5 4M7AF 1OU9A 3OMCA 4A4KA 4PNOA 2X3WD 2FPDA 2DYBA 4ELYC 2MCNA 1JO8A 1M1KU 2X4WA 5CR2A 5L23A 1PKSA 3EGXA 3BDUA 3I56A 4M77G 2K4YA 4BD3A 2RPNA 3X28B 3A8OB 2OTJA 2DLPA 3QO3A 4K11A 4J9CA 4KGXB 3L2QA 3M0QA 3LX7A 3VS1A 4ZTFA 1Q81C 2ABLA 4F17A 1Q86C 1M1FA 2E3IA 3CCJQ 1G3YA 1SRLA 1VQ5A 2I0NA 1SKUB 3G71T 4M7AB 2XDPA 1VQNA 2RH2A 2GNCA 5GJVB 2RB6A 4OGCA 2DD5A 2ED0A 1ZX6A 2DZCA 4ME7A 4R56A 2DFUA 1ZSZB 3QJYA 2NUPB 4DEXA 4D6WA 1S72T 4XTWA 2XU8A 3MKDA 2M16A 1QKWA 3G6ET 4B9XA 4M7DG 5FLXE 3I55A 1WI7A 2ZPHB 1NBEB 3J80E 5GMKj 2FVUA 4KH1B 3V7CA 2FL7A 2R57A 3HFNA 1OZ3A 4M78G 2JS2A 2DBMA 3CC7T 1M30A 5CCAA 3SB2A 2NUTA 2X4YA 3SWNC 4M77E 1JJ2S 3V7RA 1WHMA 3PMIA 5EC7A 2KDSA 4AG2C 1IHWA 4EPCA 3BY7A 2COYA 4XQ3A 3REBB 1B34A 3JB9D 3CD6A 2QDLA 2RHZA 4OB0B 2RQWA 3EH1A 4L6V5 3I56T 3CCVA 2DNUA 2HQEA 3QJ6A 1X01A 2OTJT 1UHCA 5KYUB 2EPDA 2A3LA 3NFCA 2DERA 2EKHA 2FB7A 2P0QA 4F7UA 4RTYA 3PE0A 4ZGJB 1M90U 4OB2B 1B3QA 3CCRQ 2HMAA 4M7DE 1ACMB 4PJOF 1GCPA 7AT1B 1VQNT 4FT2A 2EYZA 4QW2A 1QWEA 4J8OA 4LDXA 2CS7A 3C94A 3HP9A 3CC4A 1YFNA 4M78E 1YJWQ 5I21A 4FSSA 4DQ2A 4A4HA 3WXMB 3QDFA 2M02A 2LZ6B 5KE3A 4YTLA 1IRXA 4J9HA 3FRNA 4IURA 3I55T 1ZA1B 3L2UA 2RJCA 4F7UG 1N8RR 2GBQA 2PZ1A 4PJLA 4E47A 1W2BS 3REAB 2GFUA 3OS0A 2O2OA 4RTTA 2QA4A 1VQOQ 3AHUA 2PUOB 2DD4A 1WHHA 2DKGA 3L2VA 2B8AA 2HNIA 4ATOA 4PJOB 2CUBA 1G2BA 1DJ7B 1VQ4Q 3OBYA 1IGUA 4E7LA 1AZEA 1IXDA 4KUIA 2EFIA 1X69A 5GAMh 3ZL7C 4RCCA 2HKQB 4FM4B 2P4RA 1WJRA 5GAOm 1V29B 3JCMP 1HXDA 1K9MU 2WACA 2QAZA 3FJPA 3CCVT 2OJ2A 2DXTA 3HRSA 1YP5A 2K5IA 4M75A 1YHQQ 1FXXA 2DEQA 4GY5A 2DK3A 1RLPC 4M77C 2HAXA 3QWXX 2R58A 5GAN8 1VQ9A 1IB8A 2J7IA 1QVFS 5KYWA 4KT0E 5KYXB 4ZGDB 5I2MA 1YITQ 2RA2A 4RTWA 1VQ7A 3CC4T 3NMZC 3HPWA 2DETA 4OGEA 1MGQA 1GCQC 3VRYA 1I5OB 2QG9B 4DBFA 3I5RA 4OF1A 4M75G 1KD1U 1NYFA 2AK5A 1T3SA 1KHIA 3X26B 1S1NA 1R0CB 3MP1A 4E7IA 2QA4T 1YWPA 1RLQC 2XI9A 1X6BA 2EJGA 1N8RC 5CK9A 4DA4A 2BIVA 1TOVA 5L8RE 2YWWA 3UWNA 4M77F 4BY6C 4M78C 2E70A 1YI2Q 1PC0A 1N5ZA 3MEAA 2ROLA 2FRWA 1K0XA 1VIFA 3CMAA 3JB9J 1H92A 2CDTA 2CP5A 3GP8A 1SEMA 5A0LA 4M7AA 4PJNA 2COZA 1XNIA 2HD0A 4C92D 2DO3A 4ANJA 5GAMf 3JCMd 3EGDB 2ZAEA 1VIEA 5GAN7 4BB7A 1WA7A 2DZ9A 1RAAB 2Y90A 3RMSA 3CPWP 5LJ3f 2M9UA 4NL3A 5DY9A 1TUDA 1EIFA 4A54A 3META 4M7DF 1JQQA 1AEYA 2OTLQ 4M7AG 3THKA 1VQ7T 1VUBA 2K57A 2P0KA 3A1PA 4CC4B 1KQ2A 3IQLA 4M78F 4LUDA 1MV3A 2DF6A 3M4GA 1GBQA 1P92A 2YUPA 2DXBA 3E2UA 2E12A 4RCBA 2QQ9A 4O6JA 2DIQA 2K6DA 3KUFA 4AG1C 5KYYA 1Q82U 2PVGB 1Q7YU 1YHQA 5GAOn 5FW9A 4LD9K 5HCKA 5FRNA 2FZCB 1IHVA 5GAMe 4HT9A 2CUDA 3CCLQ 2GQVA 4QKUA 3CCQA 4MDXA 1UGQB 4VUBA 4QQGA 5LJ5d 1JBMA 2BE7D 2KYMA 3LH0A 2BKDN 4R55A 3CMAT 4FCYA 5LJ3e 2FZKB 3CCEQ 3FEOA 1M4ZA 3HTRA 2L3RA 1ZUKA 4C5GA 2LQ8A 1NYGA 3H6ZA 5DM7R 3M54A 2FO0A 3A8HB 1KC8U 4B6MA 1JJ2A 3TEEA 4IUPA 5KE2A 4CC7A 1ZUYA 2K3YA 2YRVA 1VQOT 2XKOC 1I07A 2C0TA 3RKXA 2AZSA 3RNJA 4PK4A 4HVWA 3RR6A 5J26A 1GBRA 1RAGB 2RJEA 1FMKA 2EQMA 1KQSS 4Y91A 4PJOA 1ZSGA 3ZEHA 4Q5WA 1RAFB 3BDLA 5GAOr 3QKJA 1G3WA 1ARKA 3EG9A 1LPLA 4XK8E 1R0BG 2H8HA 2EJ9A 1TXQA 1K4US 4XTYA 4J9FA 3OYGA 3CCMA 1VQ6A 1PSEA 1YHQT 1PRMC 4M75C 5GANf 1K9AA 1M2OA 2EJFA 2MIOA 2DL3A 4J83A 3RDVA 2O31A 4E6RA 1WIEA 1UGVA 3RKYA 4LNPA 3JCMc 4L5GA 1H8KA 4MZMA 1M90C 4PJOG 3JCMb 2ROTA 2FEIA 4J9IA 2MI6A 2EKOA 1Y71A 2L3SA 2RHIA 5FRMA 4HVUA 1W2BA 3I5SA 3M5AA 4IUVA 2QASA 2HSPA 2PQWA 3HFOA 1VYUA 1H641 5HK3A 2RJDA 3M4YA 2QGFB 4FW1A 4HVVA 4QVCA 4JRQA 5AT1B 2V8JA 4GLKA 1YJ9Q 1AWXA 1V1CA 4LDUA 1IGQA 2LQKA 1XTDA 1X2QA 3LLRA 3OS5A 1QW1A 1D3BA 2KGTA 1Q81R 1YI2T 1Q86R 3OYKA 2O88A 4XTZA 5GANe 5CKHA 4RTZA 3HRTA 2M1HA 3L2ZA 3A98A 4A4GA 1K76A 1V76A 4M7AC 4LDYA 2GFAA 1QVFA 5GMKi 2YUNA 3ULRB 1UG1A 3QIIA 1YBYA 1MMGA 5IT9E 2KRSA 5J3BA 1ZSZC 2V1RA 2EGEA 3CCMT 1VQ6T 2M51A 2GCXA 4IUQA 1M5Q1 2JMCA 1O9SA 3OYCA 3X25B 5IN1A 1K73R 3H8ZA 1PD0A 1VQMQ 1MUZA 1OEBA 1RACB 2QDYB 5GMKm 2L89A 4E7JA 1BKBA 1IZ6A 1GL5A 4M77A 1T0HA 1VQKA 4IUUA 4OMMA 4PKCC 3P8HA 1U1SA 3M55A 3JCMV 2WSCE 3P8BB 4JLGA 1NPPA 2RF0A 2VB6A 3L1AA 3WVEB 2CYZB 1UTIA 2O01E 3V8KA 4X9CA 2O9VA 3LGFA 3A8GB 1GCQA 5GAMj 4DBQA 3HHTB 1X2KA 2DA9A 3QG1A 1I81A 3CC2A 3OA6A 5FWCA 4XU1A 1BYMA 3TSWA 1G8XA 5LJ3j 2P84A 4MZPA 1SF9A 2A0FB 4JJCA 3WVDB 1Z9QA 2ZPFB 4E7KA 1RUWA 4RTUA 4M7DA 4OMFB 3CCET 3H0HA 2RJFA 4DOWA 2E10A 1C0MA 1YJNQ 2LCSA 4IIOA 1WNLA 1FMWA 1ABQA 2NUZA 1W1FA 4BE2A 1NE8A 4M78A 5C6SA 3RBBB 2HKNA 3ME9A 4XU2A 3V8LA 4PLLA 1NEGA 3LGLA 2K7AA 4OMOA 1OU8A 1UECA 2KQWA 4FL6A 1VQLQ 3LW5E 2M0OA 1OV3A 1TTHB 4FT4A 1QVGS 1BB9A 4RG8A 3VS7A 1X6OA 2DXUA 1FMVA 3QZ5B 1M2VB 2LT4A 3G7ZA 2EWNA 4HCCA 4ELZC 2XDDA 4HCZA 3NPFA 2CH4W 1UFFA 3CCSQ 1K73C 4IKFA 4L59A 4PJOC 1VQKT 5CKDA 1KHCA 1OPKA 2DL4A 2DRKA 4DOVA 2AZVA 2JZ2A 4J6WA 4BI4A 2DTIA 3CMEQ 5CKFA 2ECZA 1PWTA 2A28A 4F04B 1NG2A 3E1SA 4WTOB 3EH2A 1Q7YC 4Z89A 1U1TA 2C0IA 1WXTA 1YIJQ 2X4XA 2KSSA 1Z9ZA 3EFOA 2E6ZA 3CC2T 1VQPA 5AYFA 5A2QE 2PTKA 2G3RA 1GRIA 3HRUA 1JXMA 4CC3A 3MP6A 1OQKA 3OYAA 4JJDA 3CCUQ 3EFSA 4C92B 4CC2A 1M8VA 3S3MA 1K8AU 2MK5A 1WZOA 2EW3A 3JCMh 3QUIA 3URGA 4JDSA 1U3OA 2CP7A 4QT7A 2K2MA 2F5TX 3VS4A 3CEYA 1KQSA 2XG8D 4RTXA 2JT4A 2LJ3A 1WJQA 1ZLMA 3M57A 2RN8A 3E19A 2O4XB 2FPFA 4C0DB 2LJ0A 2RD1A 4DBRA 5GANj 4M75D 2HL3A 2GF7A 3MEWA 1WFWA 1I5LA 2EBPA 2LT1A 2E5QA 5KCHA 1NJIU 3OQ5A 4PL6A 4BE0A 3A8LB 3CXCP 4C8QF 4EMHA 2H3EB 2PNIA 1F1BB 4FYVB 2XD0A 4OP0A 2CH4A 2V8IA 3CCJA 4KGZB 1B7TA 2V8KA 3KFVA 3JCMX 3JB9H 1U5SA 2M0YA 1NLPC 1ZUUA 5GAN4 2JXBA 3KXTA 1BI2A 2KXCA 2LP5A 1VQPT 4P5NA 4LDWA 1Y07A 5LJ5h 4AFZC 3F70A 2F2XA 2CP2A 3JCMQ 5EG2A 4KUDK 2P4TA 3OYBA 3SWNB 2QGGA 4C8QB 4NL2A 2O9SA 1PSFA 1AVZC 1ZBXA 4J9BA 1M3AA 8ATCB 3MO8A 5KCOA 3OSSC 1VA7A 2AKLA 5HKCA 2DEUA 3OW2P 1TUGB 4M7AD 2D0NA 4Z8AA 4MZTA 2RO0A 1BBZA 2VXEA 1UUEA 3FJ5A 4ZTJA 2VVKA 2ZGWA 1G3TA 5HY6A 4J5YA 2KVQG 3OYEA 2EYXA 3PNWC 2DRMA 1QKXA 3R6OA 2D6FA 4MMLA 8AT1B 2ZPIB 4M7DC 5GAOl 1JU5C 1MHNA 2J06A 1JJ2P 1YJNT 2OX7A 2ZPBB 1KK7A 2FRYA 3G4SQ 3CCJT 3CCRA 2VGNA 3OYHA 2MAMA 1MMAA 3M0TA 4IUTA 2LNVA 2DYIA 3NTHA 1QMCA 3FLGA 5GMKh 2F2VA 2YSQA 2YLBA 1QCFA 3UA6A 1YJWA 1WDXA 1LJOA 2E64A 4FIBA 3OBWA 1BI1A 2CT3A 3E9GA 3OYFA 1G83A 1ZSZA 4JRKA 3X24B 5C0MA 5IHIA 3OS1A 3MJXA 2NUPA 5FROA 4XU3A 1M2VA 1N9RA 4BI8B 4FYXB 1K0SA 2DL8A 3O5ZA 3CCST 1Q81U 3T9NA 1LCKA 3VRZA 5GAN3 2ZZDA 1VQOA 1WXBA 1AWOA 1X6GA 3JCMg 1MMDA 4QQ6A 2VXFA 2QEXQ 2RK1A 1QWFA 1ZA2B 1AD5A 4WF2A 1VQ4A 4EMKB 1KSWA 3JRZA 2XDBA 2DTOA 3ER0A 1D1AA 2J6OA 2RMOA 1H3HA 2AHJB 1RAIB 4AFQC 2LTOA 3LYIA 3RIRA 4J9DA 1M1KC 4UC4A 2QTVA 1BCOA 1M1GA 4EDUA 4OB3B 1YWOA 1Y96B 1W2BP 4AFUC 1I4K1 5CAIA 2EGAA 2HZYA 3CBMA 2AKKA 2MPXC 3FB9A 4CI0C 1M90R 2KXDA 1AHJB 3SEMA 4OMPA 5GJWB 2JS0A 3CCUT 3DLMA 2OI3A 1QVGA 5KYUA 2JNGA 2I2LA 2GTOA 4N4GA 1XJWB 3CCRT 3D7SB 1OI1A 2VYTA 4J9EA 4D8KA 1NM7A 4PJOD 1YITA 2F5KA 3CQTA 3QXEB 1YCSB 3GBQA 5GAMd 1YJWT 1WX6A 1X27A 1E6HA 2EQKA 5D6WA 3PVQA 2RHUA 2DIGA 5LJ5g 2MWOA 1BU1A 2O4XA 2FPEA 5LJ3d 2KYBA 1VQ8Q 3GNGA 3VS3A 1QVFP 4F16A 2QTXA 5IXFA 1C6VX 3E9FA 2GQIA 4C92G 1FWZA 1GXIE 1WLPB 1UGPB 2E41A 1J3TA 2RI3A 5IXBA 2W10A 3TCJA 2D9TA 2DILA 2J6FA 3PIOA 3G71Q 1VQ4T 1YI2A 2F1LA 2DE0X 4A4EA 2C0OA 3VYGA 2L2PA 1D0XA 1JXOA 3CBPA 3VYHB 2AT1B 1WYXA 1GFDA 1T0JA 3VJPA 3G6EQ 2JMAA 4OB1B 2JM8A 1PD1A 4IIMA 3SD4A 1KIKA 2HQXA 3V7SA 3TSZA 2ESWA 1I0CA 1MNEA 2LDMA 5J39A 3UPUA 1K8AC 3M0UA 1OX8A 3RKWA 2CKKA 2OAWA 3HL8A 1YITT 2OTLA 3OMGA 1WHJA 3MHXA 1HJDA 5KYXA 4RUGA 1PG5B 1W6XA 2E5KA 3RUXA 3JB9F 2EIFA 3OY9A 4C92E 1K1ZA 4JS5A 1KD1R 2AIRB 1AOJA 1MMNA 4LN2A 2D1XA 5ECAA 3I56Q 5I22A 1UGRB 4II1A 1SHFA 2EGCA 1MV0B 2OTJQ 2DXCA 2JTEA 3GNFB 3JAME 3M9QA 4CRIA 1WQWA 4HXJA 1M3CA 2EQUA 4C8QG 1RADB 1NZ9A 2CT4A 1UEBA 3QPHA 4FU6A 1OZ2A 3G4ST 2RHXA 3CCLA 2VWFA 3CPFA 2X4JA 4FYWB 1VQ5Q 1BCMA 3M53A 2VASA 4PFPA 3BE3A 4N4IA 4M77D 2LQNA 1VQNQ 4LXCA 2JVVA 3VV0A 3PIPA 4C5EA 3CCEA 3NGPA 1XQHA 4LUEA 2DX1A 5CQXA 4C0ZA 1BI0A 1OYXA 3EG2A 1K9MC 5GANd 2QQAA 3I55Q 2DMOA 1PCXA 1VQ8A 2HCKA 1PM3A 3EGDA 1C1AA 2R5MA 1QVPA 2RHYA 2RM4A 1GFCA 3UA7A 1N8RU 9ATCB 2CP0A 2VGMA 1AWJA 3JB9I 2D8JA 2PU9B 3PT9A 2MMPA 3SFMA 5DLQE 4LDVA 2OTLT 4M7DD 3C12A 4BE1A 4QQDA 2E65A 4BDZA 3LWHA 4C8QE 2L8DA 4EMKA 2KK4A 2HSEB 3S3NA 3CD6Q 4HT8A 3NTKA 4XAXB 2DJQA 4M78D 2E6NA 3VS2A 3SDZA 5GAN6 1VYTA 4Z02A 1Q7YR 3CCVQ 2LCCA 1M27C 5DLOA 3VU3C 3AT1B 3M0RA 1KD1C 3ASKA 5KYWB 1Y7XA 1UB4A 4LD6A 1N6AA 1SG5A 2JUFA 1JB0E 1AWWA 1WPYA 4O5VA 2RQVA 1CKBA 1QLYA 2MOXA 1KQSP 2YXYA 2LC4A 3CCLT 2A7YA 3ZBDA 1HK9A 2KT1A 1EX4A 3C95A 4X34A 3N5BB 2KE9A 1U06A 3CC4Q 1I1JA 2WSEE 4ZGEB 3G1JA 4J9GA 1KC8R 5D6YA 5GMKl 2JM9A 3OYDA 1VQ8T 4C0DC 1XOVA 2HL5C 2HDAA 2X51A 2PVOB 5FU7B 2BZXA 3L42A 3MEVA 3PVLA 1YJ9A 3H0IA 2QA4Q 5FWBA 1FX7A 3OYMA 4BDYA 2CZ1B 2R5AA 2CSIA 3UF4A 1X43A 2CREA 4OMLA 4X9DA 4A53A 4C0FA 3H9NA 1UE9A 2CP3A 2YDLA 2CZ6B 1BK2A 4Y92A 1PHTA 2JOYA 2YRDA 2Z0WA 4C92F 2QI2A 3OW2S 3H41A 4N0AC 2L3QA 2ZCFB 1NPRA 1RABB 2B86A 1UJYA 5CIUA 5CQYA 2A36A 5D7UA 3FC3A 2ENMA 2LMJA 3OB9A 4XU0A 5A0DA 3S3OA 2QYZA 1TS9A 1Q82C 5I2SA 3GLXA 1VQ9Q 2VC8A 1LNXA 5HK0A 2KT8A 2DAQA 4DEYA 1VQMA 2LX7A 2DVEA 4PFOA 2EYYA 3V8JA 4X1VA 4C8QC 1R77A 5IHKA 5FU6B 3RMQA 5IAYA 1VQ7Q 2JTFA 2JTMA 1X75C 2IPOB 2EVRA 2QXFA 4FSXA 2KROA 4JUVA 4E7SA 1KJWA 3RERA 2CGHA 3VUBA 2YT6A 4HKEA 3QSUA 5KYYB 1KG1A 3BW1A 3JSCA 2KR3A 3VS0A 3EG1A 4BUGA 2EQJA 2NYSA 1KC8C 3O8VA 3NTIA 3LWIA 1YJ9T 3PFSA 2WSFE 5CO7A 3RESA 6AT1B 1QCNA 4XTVA 3QYHB 2IG0A 3OYLA 1ABOA 1RI9A 4ORZA 1M9SA 4QVDA 3CPWS 2HBWA 1VQ5T 4BACA 2COWA 2E4HA 1D0YA 5KYNA 1PKTA 2RQTA 2SRCA 2F2WA 3CMAQ 4RKUE 3DB4A 3QHSA 1H3ZA 2OAUA 1YJNA 4HCKA 4Y28E 2G6FX 4QVZA 2PVDB 3PGGA 2DL5A 3MEUA 3OS2A 4RTVA 2MWPA 2IVWA 1RAEB 1TWBA 1SSHA 1UHFA 3PMTA 2RI2A 4C5HA 2J6KA 3NHNA 4PFZA 1VQLA 1TSFA 3A8MB 1SRMA 1D1BA 2DBKA 2MF2A 2LRQA 2NLUA 3M58A 1VQMT 4JPBW 1WHKA 1PRLC 2K79A 3OYNA 1M8MA 3INZA 3EG9B 2LCLA 4J6YA 3CCSA 4C5IA 3TVTA 4R0KA 1CSKA 2CSQA 2KRNA 3JB9G 3CD6T 4EMKC 4D8DA 1AZGB 4OMNA 1YCYA 1HSQA 1E7OA 1SHGA 1M1KR 5LJ3h 3CMEA 1QVGP 3JCMf 5CKEA 3QYGB 1D0ZA 2RNAA 3JCMW 1BIBA 1YIJA 2A37A 2GTJA 3P8DA 2NWMA 3CCQQ 3EAEA 5D6XA 3A5ZB 3BFMA 5KH6A 1OPLA 1TUCA 4HCBA 2DL7A 4F7UE 2K5FA 4M4ZA 1UDLA 3CCUA 1SSFA 2XMFA 2E3HA 1D1CA 3DKMA 1OOTA 2K2VA 2KAFA 3TQ7P 4PJJA 1IO6A 4LE9A 4WCIA 3L2WA 2D0QB 4AFSC 1VQLT 1D3BB 1WHLA 5M9OA 2EYWA 1O75A 2ED1A 1YN8A 3QWYA 1LOJA 1T3LA 4B9WA 3LH5A 2K5LA 3QZ9B 1QP3A 3JCMe 2Y4XA 1TU0B 2RI5A 5LL6S 3DLLA 5LJ5f 1I8FA 3OSVA 2KY9A 3HKSA 1Q86U 1PNJA 1Q95G 1OULA 3FDRA 4DBHA 2CP6A 1IREB 4PJMA 3CXCA 3CMET 3CCMQ 1VQ6Q 1ZBJA 3VS6A 4JJBA 2DJZA 2IIMA 2VUBA 3GOXA 1RL2A 2K3BA 1YIJT 3UT1A 1VQ9T 3C4SA 2E1HA 4M75E 1N27A 1D09B 3QDRB 4M77B 3EG0A 2QQRA 3OYYA 2ZPGB 1K73U 2QQSA 2KNBB 2EYQA 1K8AR 2YLCA 2KEAA 2YHTA 1BI3A 1R8OB 2SEMA 1KFZA 4JRIA 3MPUB 2GGRA 3TREA 2YUOA 1YNZA 2RK2A 5GANh 4C92A 4NS5A 4A4FA 2KI7A 1N9SA 2ATCB 4GBQA 1QP2A 5LJ5e 4JS4A 5IHNA 3EGXB 4AMCA 2PUKB 2A08A 2XIDA 2KMTA 2DPPB 3OW2A 2YRCA 1EZZB 4M7DB 2QK0A 1NJIR 4KRTA 2MYSA 4J7IA 5GAMg 2CZ0B 2RQRA 1A0NB 3MCAB 4BY6B 4M78B 2K9GA 4E7ZA 4C8QD 3U23A 1NLOC 2HEQA 3GF5A 3G4SA 1JRIA 2X3XD 5LJ3g 2X9HA 4M7AE 4J7FA 5A0GA 5CKBA 2L3PA 3PTAA 1K9MR 4KH0B 4XTXA 3GIBA 4TVRA 2XK0A 4FYYB 5CVIA 1WHGA 2Y4YA 4N0AA 4OMQA 4BI3A 1S72Q 2L0AA 1MNDA 2HBPA 2BZ8A 3EHRA 4F7UF 4ZN3A 3TU4K 1TG0A 2NUTB 5GAN2 2DM1A 1VQKQ 3UATA 2HQHA 1Y57A 2LJ1A 3J81E 3CC7Q 3H0FA 2W0ZA 5GMKe 3J7AF 1UGSB 3VUZA 3SWNA 1AT1B 1G5VA 1ZHIA 2QEXA 2V26A 3CPWA 4KULA 4NOYA 4C8QA 4JRPA 1SPKA 3JV3A 3FIFA 2CZ7B 1B34B 2KRMA 3EFOB 4ZN1A 2QQBA 4AT1B 3JCMJ 4JZ4A 3EG3A 4PLIA 5I11A 1RI0A 2EQIA 2VV5A 1W4SA 3CCQT 2C06A 3CC2Q 3KBGA 4F14A 2JJ9A 2F69A 4F7UB 3C0CA 1B07A 4E7HA 1CKAA 4KGVB 3SHWA 3M0SA 2DVJA 2LVMA 2FZGB 1NJIC 2BE9B 1EFNA 1HYOA 1OX9A 4C0GA 4E2FB 2FHDA 2X35A 3OYIA 2XHCA 1U8RA 4JJNK 4JZ3A 4N4HA 3R6NA 2DTHA 1W70A 1VYVA 4ZNXA 2JN0A 5IH2A 1Y0MA 2ZPEB 2FYKA 2LNHB 4A63B 2L5QA 1VOMA 4M75F 5FU7C 3VKIA 4J6XA 4FW2A 1JEGA 4MDWA 4ESRA 2BTTA 2VKNA 3S6WA 4RMOA 3QBYA 2EAYA 2LX9A 5GAOp 3EGUA 1WQ7A 5GAOq 1LVKA 1NEBA 2J05A 3I9QA 3M0PA 4EMGA 4OVAA 2K3XA 2QEXT 4PJOE 3M56A 3CBOA 5GANg 4HA8A 1QCOA 3ZFJA 3G71A 2BZYA 1E6GA 2KBTA 4EIKA 1UJ0A 2FG0A 4KBMB 3L2RA 3OYJA
chains in the Genus database with same CATH topology
1I07A 2C0TA 1KJWA 2FRYA 2AZSA 2YT6A 3RNJA 1M3BA 4HVWA 2KR3A 4Z88A 3VS0A 2V1QA 3M0TA 3EG1A 1FYNA 1GBRA 2D8HA 1FMKA 2RQUA 1ZSGA 1WXUA 2F2VA 2YSQA 1QCFA 3UA6A 1WDXA 4GLMA 1ARKA 2YUQA 3VS5A 1ABOA 2H8HA 1RI9A 2CT3A 4ORZA 2HBWA 1HD3A 2LQWA 1G83A 1K4US 3I35A 5IHIA 3EHQA 2JW4A 4J9FA 1PKTA 2RQTA 2SRCA 2F2WA 1K0SA 2DL8A 3O5ZA 1PRMC 2X3WD 1K9AA 2FPDA 2DYBA 2MIOA 2MCNA 1JO8A 2DL3A 1LCKA 3VRZA 2O31A 4E6RA 1WIEA 1UGVA 1WXBA 4HCKA 2G6FX 5L23A 1AWOA 1PKSA 1X6GA 2DL5A 4LNPA 1H8KA 4RTVA 1QWFA 2RPNA 1AD5A 2ROTA 2FEIA 1SSHA 1UHFA 4J9IA 1KSWA 2DLPA 4K11A 4J9CA 2J6KA 2L3SA 3NHNA 3M0QA 4HVUA 3VS1A 3I5SA 2J6OA 1SRMA 2RMOA 1H3HA 2HSPA 4AFQC 2DBKA 2ABLA 4F17A 1VYUA 4J9DA 1YWOA 4JPBW 4HVVA 1SRLA 1PRLC 2K79A 4AFUC 2I0NA 1M8MA 2EGAA 2AKKA 2GNCA 2KXDA 5GJVB 3SEMA 4OMPA 5GJWB 3TVTA 1AWXA 2JS0A 4R0KA 1V1CA 1CSKA 2CSQA 1ZX6A 2ED0A 2KRNA 2OI3A 2GTOA 4DEXA 1X2QA 4D8DA 1AZGB 4OMNA 4J9EA 2KGTA 1QKWA 4D8KA 1HSQA 1NM7A 1E7OA 1SHGA 1WI7A 2O88A 3CQTA 1YCSB 3GBQA 4RTZA 2RNAA 3A98A 1K76A 1WX6A 1X27A 1E6HA 2JS2A 2A37A 2DBMA 2GTJA 1M30A 2NWMA 2YUNA 3PVQA 3ULRB 1UG1A 1OPLA 1BU1A 1TUCA 2DL7A 2FPEA 2KRSA 5EC7A 2V1RA 2EGEA 2KYBA 4AG2C 4M4ZA 2M51A 3VS3A 4F16A 2JMCA 5IXFA 1UDLA 3REBB 2GQIA 2XMFA 1WLPB 2QDLA 1J3TA 5IXBA 2RQWA 1MUZA 1OEBA 2W10A 1OOTA 2DNUA 2DILA 2J6FA 1UHCA 1IO6A 4LE9A 4WCIA 2DE0X 2EPDA 2C0OA 2L2PA 1GL5A 4AFSC 1JXOA 2EKHA 1T0HA 4OMMA 2EYWA 1WYXA 4RTYA 3PE0A 2ED1A 1YN8A 3QWYA 1GFDA 1T3LA 1B3QA 2RF0A 1T0JA 3LH5A 1GCPA 2JMAA 2JM8A 1UTIA 2EYZA 1QWEA 4IIMA 2O9VA 1GCQA 4FSSA 1PNJA 1KIKA 3TSZA 1X2KA 2ESWA 1I0CA 2DA9A 2LZ6B 5FWCA 3M0UA 4J9HA 3TSWA 2OAWA 4JJCA 2GBQA 1HJDA 1ZBJA 4RUGA 1Z9QA 3VS6A 1RUWA 2PZ1A 4RTUA 3REAB 1W6XA 2E5KA 2IIMA 2O2OA 3H0HA 4JJBA 4RTTA 1K1ZA 2K3BA 2LCSA 4IIOA 1AOJA 1ABQA 2NUZA 1W1FA 4LN2A 2D1XA 2CUBA 5ECAA 1G2BA 5I22A 3RBBB 1SHFA 2EGCA 3EG0A 1MV0B 1NEGA 2KNBB 2K7AA 4OMOA 2JTEA 1UECA 1AZEA 1X69A 1OV3A 2KEAA 4HXJA 3ZL7C 1M3CA 2SEMA 1KFZA 1BB9A 3VS7A 2P4RA 2CT4A 2GGRA 2YUOA 1YNZA 2VWFA 2OJ2A 1YP5A 4GBQA 2LQNA 3NPFA 2CH4W 1UFFA 5IHNA 2A08A 1RLPC 1OPKA 3NGPA 4LUEA 3QWXX 2DL4A 2DX1A 2DRKA 2J7IA 2AZVA 3EG2A 2DMOA 4KRTA 4RTWA 2ECZA 2HCKA 1PWTA 2A28A 3NMZC 1NG2A 2RQRA 1A0NB 1GCQC 2K9GA 1GFCA 3VRYA 4Z89A 2C0IA 1WXTA 3UA7A 3I5RA 1Z9ZA 3U23A 1NLOC 1AWJA 2HEQA 2D8JA 2X3XD 1NYFA 2AK5A 1T3SA 2PTKA 1S1NA 2L3PA 1GRIA 4CC3A 1JXMA 4JJDA 1YWPA 1RLQC 4CC2A 2DJQA 3VS2A 1X6BA 2EW3A 4OMQA 1VYTA 1U3OA 1M27C 2L0AA 4QT7A 1N5ZA 2K2MA 3VS4A 3M0RA 2BZ8A 3EHRA 2ROLA 2FRWA 1K0XA 1TG0A 1H92A 4RTXA 2DM1A 2CDTA 2JT4A 1SEMA 3UATA 2LJ3A 1Y57A 1ZLMA 2LJ1A 1AWWA 2RN8A 2RQVA 1CKBA 1QLYA 2FPFA 2MOXA 2LJ0A 2W0ZA 3H0FA 2KT1A 1SPKA 3JV3A 1WFWA 2KE9A 1U06A 2EBPA 1WA7A 2KRMA 1I1JA 4J9GA 4JZ4A 3EG3A 5I11A 2EQIA 2PNIA 1TUDA 2CH4A 2JM9A 4F14A 1JQQA 1AEYA 3C0CA 3KFVA 3THKA 1B07A 1XOVA 1CKAA 2HDAA 1U5SA 2BZXA 3SHWA 2M0YA 1NLPC 3M0SA 2DVJA 3H0IA 3PVLA 4CC4B 1ZUUA 3IQLA 2JXBA 1EFNA 4LUDA 1MV3A 2DF6A 1GBQA 5FWBA 2YUPA 2KXCA 2LP5A 2CSIA 3UF4A 4AFZC 1X43A 2CREA 2F2XA 4OMLA 2K6DA 1UE9A 4AG1C 2YDLA 4JZ3A 3R6NA 1W70A 1VYVA 4ZNXA 1BK2A 4Y92A 5FW9A 1PHTA 5IH2A 1Y0MA 5HCKA 2O9SA 2LNHB 4A63B 3H41A 1AVZC 2CUDA 2L3QA 4J9BA 1M3AA 2B86A 1UJYA 1JEGA 1VA7A 2KYMA 4ESRA 2A36A 2AKLA 2BTTA 2VKNA 2ENMA 2LMJA 3EGUA 2D0NA 4Z8AA 1NEBA 1BBZA 1ZUKA 2J05A 1UUEA 3FJ5A 3I9QA 2VVKA 3M0PA 1NYGA 2KT8A 4DEYA 2FO0A 2LX7A 2EYXA 2EYYA 4X1VA 5IHKA 2BZYA 2DRMA 1E6GA 2KBTA 1QKXA 4EIKA 4CC7A 1UJ0A 2FG0A 2EVRA 1JU5C 1ZUYA 2J06A 2KROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I07 A;  2C0T A;  1KJW A;  2FRY A;  2AZS A;  2YT6 A;  3RNJ A;  1M3B A;  4HVW A;  2KR3 A;  4Z88 A;  3VS0 A;  2V1Q A;  3M0T A;  3EG1 A;  1FYN A;  1GBR A;  2D8H A;  1FMK A;  2RQU A;  1ZSG A;  1WXU A;  2F2V A;  2YSQ A;  1QCF A;  3UA6 A;  1WDX A;  4GLM A;  1ARK A;  2YUQ A;  3VS5 A;  1ABO A;  2H8H A;  1RI9 A;  2CT3 A;  4ORZ A;  2HBW A;  1HD3 A;  2LQW A;  1G83 A;  1K4U S;  3I35 A;  5IHI A;  3EHQ A;  2JW4 A;  4J9F A;  1PKT A;  2RQT A;  2SRC A;  2F2W A;  1K0S A;  2DL8 A;  3O5Z A;  1PRM C;  2X3W D;  1K9A A;  2FPD A;  2DYB A;  2MIO A;  2MCN A;  1JO8 A;  2DL3 A;  1LCK A;  3VRZ A;  2O31 A;  4E6R A;  1WIE A;  1UGV A;  1WXB A;  4HCK A;  2G6F X;  5L23 A;  1AWO A;  1PKS A;  1X6G A;  2DL5 A;  4LNP A;  1H8K A;  4RTV A;  1QWF A;  2RPN A;  1AD5 A;  2ROT A;  2FEI A;  1SSH A;  1UHF A;  4J9I A;  1KSW A;  2DLP A;  4K11 A;  4J9C A;  2J6K A;  2L3S A;  3NHN A;  3M0Q A;  4HVU A;  3VS1 A;  3I5S A;  2J6O A;  1SRM A;  2RMO A;  1H3H A;  2HSP A;  4AFQ C;  2DBK A;  2ABL A;  4F17 A;  1VYU A;  4J9D A;  1YWO A;  4JPB W;  4HVV A;  1SRL A;  1PRL C;  2K79 A;  4AFU C;  2I0N A;  1M8M A;  2EGA A;  2AKK A;  2GNC A;  2KXD A;  5GJV B;  3SEM A;  4OMP A;  5GJW B;  3TVT A;  1AWX A;  2JS0 A;  4R0K A;  1V1C A;  1CSK A;  2CSQ A;  1ZX6 A;  2ED0 A;  2KRN A;  2OI3 A;  2GTO A;  4DEX A;  1X2Q A;  4D8D A;  1AZG B;  4OMN A;  4J9E A;  2KGT A;  1QKW A;  4D8K A;  1HSQ A;  1NM7 A;  1E7O A;  1SHG A;  1WI7 A;  2O88 A;  3CQT A;  1YCS B;  3GBQ A;  4RTZ A;  2RNA A;  3A98 A;  1K76 A;  1WX6 A;  1X27 A;  1E6H A;  2JS2 A;  2A37 A;  2DBM A;  2GTJ A;  1M30 A;  2NWM A;  2YUN A;  3PVQ A;  3ULR B;  1UG1 A;  1OPL A;  1BU1 A;  1TUC A;  2DL7 A;  2FPE A;  2KRS A;  5EC7 A;  2V1R A;  2EGE A;  2KYB A;  4AG2 C;  4M4Z A;  2M51 A;  3VS3 A;  4F16 A;  2JMC A;  5IXF A;  1UDL A;  3REB B;  2GQI A;  2XMF A;  1WLP B;  2QDL A;  1J3T A;  5IXB A;  2RQW A;  1MUZ A;  1OEB A;  2W10 A;  1OOT A;  2DNU A;  2DIL A;  2J6F A;  1UHC A;  1IO6 A;  4LE9 A;  4WCI A;  2DE0 X;  2EPD A;  2C0O A;  2L2P A;  1GL5 A;  4AFS C;  1JXO A;  2EKH A;  1T0H A;  4OMM A;  2EYW A;  1WYX A;  4RTY A;  3PE0 A;  2ED1 A;  1YN8 A;  3QWY A;  1GFD A;  1T3L A;  1B3Q A;  2RF0 A;  1T0J A;  3LH5 A;  1GCP A;  2JMA A;  2JM8 A;  1UTI A;  2EYZ A;  1QWE A;  4IIM A;  2O9V A;  1GCQ A;  4FSS A;  1PNJ A;  1KIK A;  3TSZ A;  1X2K A;  2ESW A;  1I0C A;  2DA9 A;  2LZ6 B;  5FWC A;  3M0U A;  4J9H A;  3TSW A;  2OAW A;  4JJC A;  2GBQ A;  1HJD A;  1ZBJ A;  4RUG A;  1Z9Q A;  3VS6 A;  1RUW A;  2PZ1 A;  4RTU A;  3REA B;  1W6X A;  2E5K A;  2IIM A;  2O2O A;  3H0H A;  4JJB A;  4RTT A;  1K1Z A;  2K3B A;  2LCS A;  4IIO A;  1AOJ A;  1ABQ A;  2NUZ A;  1W1F A;  4LN2 A;  2D1X A;  2CUB A;  5ECA A;  1G2B A;  5I22 A;  3RBB B;  1SHF A;  2EGC A;  3EG0 A;  1MV0 B;  1NEG A;  2KNB B;  2K7A A;  4OMO A;  2JTE A;  1UEC A;  1AZE A;  1X69 A;  1OV3 A;  2KEA A;  4HXJ A;  3ZL7 C;  1M3C A;  2SEM A;  1KFZ A;  1BB9 A;  3VS7 A;  2P4R A;  2CT4 A;  2GGR A;  2YUO A;  1YNZ A;  2VWF A;  2OJ2 A;  1YP5 A;  4GBQ A;  2LQN A;  3NPF A;  2CH4 W;  1UFF A;  5IHN A;  2A08 A;  1RLP C;  1OPK A;  3NGP A;  4LUE A;  3QWX X;  2DL4 A;  2DX1 A;  2DRK A;  2J7I A;  2AZV A;  3EG2 A;  2DMO A;  4KRT A;  4RTW A;  2ECZ A;  2HCK A;  1PWT A;  2A28 A;  3NMZ C;  1NG2 A;  2RQR A;  1A0N B;  1GCQ C;  2K9G A;  1GFC A;  3VRY A;  4Z89 A;  2C0I A;  1WXT A;  3UA7 A;  3I5R A;  1Z9Z A;  3U23 A;  1NLO C;  1AWJ A;  2HEQ A;  2D8J A;  2X3X D;  1NYF A;  2AK5 A;  1T3S A;  2PTK A;  1S1N A;  2L3P A;  1GRI A;  4CC3 A;  1JXM A;  4JJD A;  1YWP A;  1RLQ C;  4CC2 A;  2DJQ A;  3VS2 A;  1X6B A;  2EW3 A;  4OMQ A;  1VYT A;  1U3O A;  1M27 C;  2L0A A;  4QT7 A;  1N5Z A;  2K2M A;  3VS4 A;  3M0R A;  2BZ8 A;  3EHR A;  2ROL A;  2FRW A;  1K0X A;  1TG0 A;  1H92 A;  4RTX A;  2DM1 A;  2CDT A;  2JT4 A;  1SEM A;  3UAT A;  2LJ3 A;  1Y57 A;  1ZLM A;  2LJ1 A;  1AWW A;  2RN8 A;  2RQV A;  1CKB A;  1QLY A;  2FPF A;  2MOX A;  2LJ0 A;  2W0Z A;  3H0F A;  2KT1 A;  1SPK A;  3JV3 A;  1WFW A;  2KE9 A;  1U06 A;  2EBP A;  1WA7 A;  2KRM A;  1I1J A;  4J9G A;  4JZ4 A;  3EG3 A;  5I11 A;  2EQI A;  2PNI A;  1TUD A;  2CH4 A;  2JM9 A;  4F14 A;  1JQQ A;  1AEY A;  3C0C A;  3KFV A;  3THK A;  1B07 A;  1XOV A;  1CKA A;  2HDA A;  1U5S A;  2BZX A;  3SHW A;  2M0Y A;  1NLP C;  3M0S A;  2DVJ A;  3H0I A;  3PVL A;  4CC4 B;  1ZUU A;  3IQL A;  2JXB A;  1EFN A;  4LUD A;  1MV3 A;  2DF6 A;  1GBQ A;  5FWB A;  2YUP A;  2KXC A;  2LP5 A;  2CSI A;  3UF4 A;  4AFZ C;  1X43 A;  2CRE A;  2F2X A;  4OML A;  2K6D A;  1UE9 A;  4AG1 C;  2YDL A;  4JZ3 A;  3R6N A;  1W70 A;  1VYV A;  4ZNX A;  1BK2 A;  4Y92 A;  5FW9 A;  1PHT A;  5IH2 A;  1Y0M A;  5HCK A;  2O9S A;  2LNH B;  4A63 B;  3H41 A;  1AVZ C;  2CUD A;  2L3Q A;  4J9B A;  1M3A A;  2B86 A;  1UJY A;  1JEG A;  1VA7 A;  2KYM A;  4ESR A;  2A36 A;  2AKL A;  2BTT A;  2VKN A;  2ENM A;  2LMJ A;  3EGU A;  2D0N A;  4Z8A A;  1NEB A;  1BBZ A;  1ZUK A;  2J05 A;  1UUE A;  3FJ5 A;  3I9Q A;  2VVK A;  3M0P A;  1NYG A;  2KT8 A;  4DEY A;  2FO0 A;  2LX7 A;  2EYX A;  2EYY A;  4X1V A;  5IHK A;  2BZY A;  2DRM A;  1E6G A;  2KBT A;  1QKX A;  4EIK A;  4CC7 A;  1UJ0 A;  2FG0 A;  2EVR A;  1JU5 C;  1ZUY A;  2J06 A;  2KRO A; 
#chains in the Genus database with same CATH topology
 3DB3 A;  4V2S A;  2H3J A;  4M75 B;  1S72 A;  1Q82 R;  1VQP Q;  3M59 A;  1M3B A;  4Z88 A;  3G6E A;  2V1Q A;  1FYN A;  2XIC A;  2D8H A;  4RG2 A;  4XTU A;  1G3S A;  2RQU A;  3UDC A;  1WGS A;  3MP8 A;  1WXU A;  1Y96 A;  1QQJ A;  1TH7 A;  3EFR A;  1KQ1 A;  4GLM A;  3GPL A;  5FU6 C;  1WJS A;  2YUQ A;  3CC7 A;  3VS5 A;  1RAH B;  3Q1J A;  1HD3 A;  2BUD A;  5LJ5 j;  2LQW A;  3CXC S;  3HSB A;  1ZQ1 A;  3I35 A;  4JLI A;  4C92 C;  3EHQ A;  4MMK A;  1BIA A;  2JW4 A;  2P0P A;  3X20 B;  5GAN 5;  4M7A F;  1OU9 A;  3OMC A;  4A4K A;  4PNO A;  2X3W D;  2FPD A;  2DYB A;  4ELY C;  2MCN A;  1JO8 A;  1M1K U;  2X4W A;  5CR2 A;  5L23 A;  1PKS A;  3EGX A;  3BDU A;  3I56 A;  4M77 G;  2K4Y A;  4BD3 A;  2RPN A;  3X28 B;  3A8O B;  2OTJ A;  2DLP A;  3QO3 A;  4K11 A;  4J9C A;  4KGX B;  3L2Q A;  3M0Q A;  3LX7 A;  3VS1 A;  4ZTF A;  1Q81 C;  2ABL A;  4F17 A;  1Q86 C;  1M1F A;  2E3I A;  3CCJ Q;  1G3Y A;  1SRL A;  1VQ5 A;  2I0N A;  1SKU B;  3G71 T;  4M7A B;  2XDP A;  1VQN A;  2RH2 A;  2GNC A;  5GJV B;  2RB6 A;  4OGC A;  2DD5 A;  2ED0 A;  1ZX6 A;  2DZC A;  4ME7 A;  4R56 A;  2DFU A;  1ZSZ B;  3QJY A;  2NUP B;  4DEX A;  4D6W A;  1S72 T;  4XTW A;  2XU8 A;  3MKD A;  2M16 A;  1QKW A;  3G6E T;  4B9X A;  4M7D G;  5FLX E;  3I55 A;  1WI7 A;  2ZPH B;  1NBE B;  3J80 E;  5GMK j;  2FVU A;  4KH1 B;  3V7C A;  2FL7 A;  2R57 A;  3HFN A;  1OZ3 A;  4M78 G;  2JS2 A;  2DBM A;  3CC7 T;  1M30 A;  5CCA A;  3SB2 A;  2NUT A;  2X4Y A;  3SWN C;  4M77 E;  1JJ2 S;  3V7R A;  1WHM A;  3PMI A;  5EC7 A;  2KDS A;  4AG2 C;  1IHW A;  4EPC A;  3BY7 A;  2COY A;  4XQ3 A;  3REB B;  1B34 A;  3JB9 D;  3CD6 A;  2QDL A;  2RHZ A;  4OB0 B;  2RQW A;  3EH1 A;  4L6V 5;  3I56 T;  3CCV A;  2DNU A;  2HQE A;  3QJ6 A;  1X01 A;  2OTJ T;  1UHC A;  5KYU B;  2EPD A;  2A3L A;  3NFC A;  2DER A;  2EKH A;  2FB7 A;  2P0Q A;  4F7U A;  4RTY A;  3PE0 A;  4ZGJ B;  1M90 U;  4OB2 B;  1B3Q A;  3CCR Q;  2HMA A;  4M7D E;  1ACM B;  4PJO F;  1GCP A;  7AT1 B;  1VQN T;  4FT2 A;  2EYZ A;  4QW2 A;  1QWE A;  4J8O A;  4LDX A;  2CS7 A;  3C94 A;  3HP9 A;  3CC4 A;  1YFN A;  4M78 E;  1YJW Q;  5I21 A;  4FSS A;  4DQ2 A;  4A4H A;  3WXM B;  3QDF A;  2M02 A;  2LZ6 B;  5KE3 A;  4YTL A;  1IRX A;  4J9H A;  3FRN A;  4IUR A;  3I55 T;  1ZA1 B;  3L2U A;  2RJC A;  4F7U G;  1N8R R;  2GBQ A;  2PZ1 A;  4PJL A;  4E47 A;  1W2B S;  3REA B;  2GFU A;  3OS0 A;  2O2O A;  4RTT A;  2QA4 A;  1VQO Q;  3AHU A;  2PUO B;  2DD4 A;  1WHH A;  2DKG A;  3L2V A;  2B8A A;  2HNI A;  4ATO A;  4PJO B;  2CUB A;  1G2B A;  1DJ7 B;  1VQ4 Q;  3OBY A;  1IGU A;  4E7L A;  1AZE A;  1IXD A;  4KUI A;  2EFI A;  1X69 A;  5GAM h;  3ZL7 C;  4RCC A;  2HKQ B;  4FM4 B;  2P4R A;  1WJR A;  5GAO m;  1V29 B;  3JCM P;  1HXD A;  1K9M U;  2WAC A;  2QAZ A;  3FJP A;  3CCV T;  2OJ2 A;  2DXT A;  3HRS A;  1YP5 A;  2K5I A;  4M75 A;  1YHQ Q;  1FXX A;  2DEQ A;  4GY5 A;  2DK3 A;  1RLP C;  4M77 C;  2HAX A;  3QWX X;  2R58 A;  5GAN 8;  1VQ9 A;  1IB8 A;  2J7I A;  1QVF S;  5KYW A;  4KT0 E;  5KYX B;  4ZGD B;  5I2M A;  1YIT Q;  2RA2 A;  4RTW A;  1VQ7 A;  3CC4 T;  3NMZ C;  3HPW A;  2DET A;  4OGE A;  1MGQ A;  1GCQ C;  3VRY A;  1I5O B;  2QG9 B;  4DBF A;  3I5R A;  4OF1 A;  4M75 G;  1KD1 U;  1NYF A;  2AK5 A;  1T3S A;  1KHI A;  3X26 B;  1S1N A;  1R0C B;  3MP1 A;  4E7I A;  2QA4 T;  1YWP A;  1RLQ C;  2XI9 A;  1X6B A;  2EJG A;  1N8R C;  5CK9 A;  4DA4 A;  2BIV A;  1TOV A;  5L8R E;  2YWW A;  3UWN A;  4M77 F;  4BY6 C;  4M78 C;  2E70 A;  1YI2 Q;  1PC0 A;  1N5Z A;  3MEA A;  2ROL A;  2FRW A;  1K0X A;  1VIF A;  3CMA A;  3JB9 J;  1H92 A;  2CDT A;  2CP5 A;  3GP8 A;  1SEM A;  5A0L A;  4M7A A;  4PJN A;  2COZ A;  1XNI A;  2HD0 A;  4C92 D;  2DO3 A;  4ANJ A;  5GAM f;  3JCM d;  3EGD B;  2ZAE A;  1VIE A;  5GAN 7;  4BB7 A;  1WA7 A;  2DZ9 A;  1RAA B;  2Y90 A;  3RMS A;  3CPW P;  5LJ3 f;  2M9U A;  4NL3 A;  5DY9 A;  1TUD A;  1EIF A;  4A54 A;  3MET A;  4M7D F;  1JQQ A;  1AEY A;  2OTL Q;  4M7A G;  3THK A;  1VQ7 T;  1VUB A;  2K57 A;  2P0K A;  3A1P A;  4CC4 B;  1KQ2 A;  3IQL A;  4M78 F;  4LUD A;  1MV3 A;  2DF6 A;  3M4G A;  1GBQ A;  1P92 A;  2YUP A;  2DXB A;  3E2U A;  2E12 A;  4RCB A;  2QQ9 A;  4O6J A;  2DIQ A;  2K6D A;  3KUF A;  4AG1 C;  5KYY A;  1Q82 U;  2PVG B;  1Q7Y U;  1YHQ A;  5GAO n;  5FW9 A;  4LD9 K;  5HCK A;  5FRN A;  2FZC B;  1IHV A;  5GAM e;  4HT9 A;  2CUD A;  3CCL Q;  2GQV A;  4QKU A;  3CCQ A;  4MDX A;  1UGQ B;  4VUB A;  4QQG A;  5LJ5 d;  1JBM A;  2BE7 D;  2KYM A;  3LH0 A;  2BKD N;  4R55 A;  3CMA T;  4FCY A;  5LJ3 e;  2FZK B;  3CCE Q;  3FEO A;  1M4Z A;  3HTR A;  2L3R A;  1ZUK A;  4C5G A;  2LQ8 A;  1NYG A;  3H6Z A;  5DM7 R;  3M54 A;  2FO0 A;  3A8H B;  1KC8 U;  4B6M A;  1JJ2 A;  3TEE A;  4IUP A;  5KE2 A;  4CC7 A;  1ZUY A;  2K3Y A;  2YRV A;  1VQO T;  2XKO C;  1I07 A;  2C0T A;  3RKX A;  2AZS A;  3RNJ A;  4PK4 A;  4HVW A;  3RR6 A;  5J26 A;  1GBR A;  1RAG B;  2RJE A;  1FMK A;  2EQM A;  1KQS S;  4Y91 A;  4PJO A;  1ZSG A;  3ZEH A;  4Q5W A;  1RAF B;  3BDL A;  5GAO r;  3QKJ A;  1G3W A;  1ARK A;  3EG9 A;  1LPL A;  4XK8 E;  1R0B G;  2H8H A;  2EJ9 A;  1TXQ A;  1K4U S;  4XTY A;  4J9F A;  3OYG A;  3CCM A;  1VQ6 A;  1PSE A;  1YHQ T;  1PRM C;  4M75 C;  5GAN f;  1K9A A;  1M2O A;  2EJF A;  2MIO A;  2DL3 A;  4J83 A;  3RDV A;  2O31 A;  4E6R A;  1WIE A;  1UGV A;  3RKY A;  4LNP A;  3JCM c;  4L5G A;  1H8K A;  4MZM A;  1M90 C;  4PJO G;  3JCM b;  2ROT A;  2FEI A;  4J9I A;  2MI6 A;  2EKO A;  1Y71 A;  2L3S A;  2RHI A;  5FRM A;  4HVU A;  1W2B A;  3I5S A;  3M5A A;  4IUV A;  2QAS A;  2HSP A;  2PQW A;  3HFO A;  1VYU A;  1H64 1;  5HK3 A;  2RJD A;  3M4Y A;  2QGF B;  4FW1 A;  4HVV A;  4QVC A;  4JRQ A;  5AT1 B;  2V8J A;  4GLK A;  1YJ9 Q;  1AWX A;  1V1C A;  4LDU A;  1IGQ A;  2LQK A;  1XTD A;  1X2Q A;  3LLR A;  3OS5 A;  1QW1 A;  1D3B A;  2KGT A;  1Q81 R;  1YI2 T;  1Q86 R;  3OYK A;  2O88 A;  4XTZ A;  5GAN e;  5CKH A;  4RTZ A;  3HRT A;  2M1H A;  3L2Z A;  3A98 A;  4A4G A;  1K76 A;  1V76 A;  4M7A C;  4LDY A;  2GFA A;  1QVF A;  5GMK i;  2YUN A;  3ULR B;  1UG1 A;  3QII A;  1YBY A;  1MMG A;  5IT9 E;  2KRS A;  5J3B A;  1ZSZ C;  2V1R A;  2EGE A;  3CCM T;  1VQ6 T;  2M51 A;  2GCX A;  4IUQ A;  1M5Q 1;  2JMC A;  1O9S A;  3OYC A;  3X25 B;  5IN1 A;  1K73 R;  3H8Z A;  1PD0 A;  1VQM Q;  1MUZ A;  1OEB A;  1RAC B;  2QDY B;  5GMK m;  2L89 A;  4E7J A;  1BKB A;  1IZ6 A;  1GL5 A;  4M77 A;  1T0H A;  1VQK A;  4IUU A;  4OMM A;  4PKC C;  3P8H A;  1U1S A;  3M55 A;  3JCM V;  2WSC E;  3P8B B;  4JLG A;  1NPP A;  2RF0 A;  2VB6 A;  3L1A A;  3WVE B;  2CYZ B;  1UTI A;  2O01 E;  3V8K A;  4X9C A;  2O9V A;  3LGF A;  3A8G B;  1GCQ A;  5GAM j;  4DBQ A;  3HHT B;  1X2K A;  2DA9 A;  3QG1 A;  1I81 A;  3CC2 A;  3OA6 A;  5FWC A;  4XU1 A;  1BYM A;  3TSW A;  1G8X A;  5LJ3 j;  2P84 A;  4MZP A;  1SF9 A;  2A0F B;  4JJC A;  3WVD B;  1Z9Q A;  2ZPF B;  4E7K A;  1RUW A;  4RTU A;  4M7D A;  4OMF B;  3CCE T;  3H0H A;  2RJF A;  4DOW A;  2E10 A;  1C0M A;  1YJN Q;  2LCS A;  4IIO A;  1WNL A;  1FMW A;  1ABQ A;  2NUZ A;  1W1F A;  4BE2 A;  1NE8 A;  4M78 A;  5C6S A;  3RBB B;  2HKN A;  3ME9 A;  4XU2 A;  3V8L A;  4PLL A;  1NEG A;  3LGL A;  2K7A A;  4OMO A;  1OU8 A;  1UEC A;  2KQW A;  4FL6 A;  1VQL Q;  3LW5 E;  2M0O A;  1OV3 A;  1TTH B;  4FT4 A;  1QVG S;  1BB9 A;  4RG8 A;  3VS7 A;  1X6O A;  2DXU A;  1FMV A;  3QZ5 B;  1M2V B;  2LT4 A;  3G7Z A;  2EWN A;  4HCC A;  4ELZ C;  2XDD A;  4HCZ A;  3NPF A;  2CH4 W;  1UFF A;  3CCS Q;  1K73 C;  4IKF A;  4L59 A;  4PJO C;  1VQK T;  5CKD A;  1KHC A;  1OPK A;  2DL4 A;  2DRK A;  4DOV A;  2AZV A;  2JZ2 A;  4J6W A;  4BI4 A;  2DTI A;  3CME Q;  5CKF A;  2ECZ A;  1PWT A;  2A28 A;  4F04 B;  1NG2 A;  3E1S A;  4WTO B;  3EH2 A;  1Q7Y C;  4Z89 A;  1U1T A;  2C0I A;  1WXT A;  1YIJ Q;  2X4X A;  2KSS A;  1Z9Z A;  3EFO A;  2E6Z A;  3CC2 T;  1VQP A;  5AYF A;  5A2Q E;  2PTK A;  2G3R A;  1GRI A;  3HRU A;  1JXM A;  4CC3 A;  3MP6 A;  1OQK A;  3OYA A;  4JJD A;  3CCU Q;  3EFS A;  4C92 B;  4CC2 A;  1M8V A;  3S3M A;  1K8A U;  2MK5 A;  1WZO A;  2EW3 A;  3JCM h;  3QUI A;  3URG A;  4JDS A;  1U3O A;  2CP7 A;  4QT7 A;  2K2M A;  2F5T X;  3VS4 A;  3CEY A;  1KQS A;  2XG8 D;  4RTX A;  2JT4 A;  2LJ3 A;  1WJQ A;  1ZLM A;  3M57 A;  2RN8 A;  3E19 A;  2O4X B;  2FPF A;  4C0D B;  2LJ0 A;  2RD1 A;  4DBR A;  5GAN j;  4M75 D;  2HL3 A;  2GF7 A;  3MEW A;  1WFW A;  1I5L A;  2EBP A;  2LT1 A;  2E5Q A;  5KCH A;  1NJI U;  3OQ5 A;  4PL6 A;  4BE0 A;  3A8L B;  3CXC P;  4C8Q F;  4EMH A;  2H3E B;  2PNI A;  1F1B B;  4FYV B;  2XD0 A;  4OP0 A;  2CH4 A;  2V8I A;  3CCJ A;  4KGZ B;  1B7T A;  2V8K A;  3KFV A;  3JCM X;  3JB9 H;  1U5S A;  2M0Y A;  1NLP C;  1ZUU A;  5GAN 4;  2JXB A;  3KXT A;  1BI2 A;  2KXC A;  2LP5 A;  1VQP T;  4P5N A;  4LDW A;  1Y07 A;  5LJ5 h;  4AFZ C;  3F70 A;  2F2X A;  2CP2 A;  3JCM Q;  5EG2 A;  4KUD K;  2P4T A;  3OYB A;  3SWN B;  2QGG A;  4C8Q B;  4NL2 A;  2O9S A;  1PSF A;  1AVZ C;  1ZBX A;  4J9B A;  1M3A A;  8ATC B;  3MO8 A;  5KCO A;  3OSS C;  1VA7 A;  2AKL A;  5HKC A;  2DEU A;  3OW2 P;  1TUG B;  4M7A D;  2D0N A;  4Z8A A;  4MZT A;  2RO0 A;  1BBZ A;  2VXE A;  1UUE A;  3FJ5 A;  4ZTJ A;  2VVK A;  2ZGW A;  1G3T A;  5HY6 A;  4J5Y A;  2KVQ G;  3OYE A;  2EYX A;  3PNW C;  2DRM A;  1QKX A;  3R6O A;  2D6F A;  4MML A;  8AT1 B;  2ZPI B;  4M7D C;  5GAO l;  1JU5 C;  1MHN A;  2J06 A;  1JJ2 P;  1YJN T;  2OX7 A;  2ZPB B;  1KK7 A;  2FRY A;  3G4S Q;  3CCJ T;  3CCR A;  2VGN A;  3OYH A;  2MAM A;  1MMA A;  3M0T A;  4IUT A;  2LNV A;  2DYI A;  3NTH A;  1QMC A;  3FLG A;  5GMK h;  2F2V A;  2YSQ A;  2YLB A;  1QCF A;  3UA6 A;  1YJW A;  1WDX A;  1LJO A;  2E64 A;  4FIB A;  3OBW A;  1BI1 A;  2CT3 A;  3E9G A;  3OYF A;  1G83 A;  1ZSZ A;  4JRK A;  3X24 B;  5C0M A;  5IHI A;  3OS1 A;  3MJX A;  2NUP A;  5FRO A;  4XU3 A;  1M2V A;  1N9R A;  4BI8 B;  4FYX B;  1K0S A;  2DL8 A;  3O5Z A;  3CCS T;  1Q81 U;  3T9N A;  1LCK A;  3VRZ A;  5GAN 3;  2ZZD A;  1VQO A;  1WXB A;  1AWO A;  1X6G A;  3JCM g;  1MMD A;  4QQ6 A;  2VXF A;  2QEX Q;  2RK1 A;  1QWF A;  1ZA2 B;  1AD5 A;  4WF2 A;  1VQ4 A;  4EMK B;  1KSW A;  3JRZ A;  2XDB A;  2DTO A;  3ER0 A;  1D1A A;  2J6O A;  2RMO A;  1H3H A;  2AHJ B;  1RAI B;  4AFQ C;  2LTO A;  3LYI A;  3RIR A;  4J9D A;  1M1K C;  4UC4 A;  2QTV A;  1BCO A;  1M1G A;  4EDU A;  4OB3 B;  1YWO A;  1Y96 B;  1W2B P;  4AFU C;  1I4K 1;  5CAI A;  2EGA A;  2HZY A;  3CBM A;  2AKK A;  2MPX C;  3FB9 A;  4CI0 C;  1M90 R;  2KXD A;  1AHJ B;  3SEM A;  4OMP A;  5GJW B;  2JS0 A;  3CCU T;  3DLM A;  2OI3 A;  1QVG A;  5KYU A;  2JNG A;  2I2L A;  2GTO A;  4N4G A;  1XJW B;  3CCR T;  3D7S B;  1OI1 A;  2VYT A;  4J9E A;  4D8K A;  1NM7 A;  4PJO D;  1YIT A;  2F5K A;  3CQT A;  3QXE B;  1YCS B;  3GBQ A;  5GAM d;  1YJW T;  1WX6 A;  1X27 A;  1E6H A;  2EQK A;  5D6W A;  3PVQ A;  2RHU A;  2DIG A;  5LJ5 g;  2MWO A;  1BU1 A;  2O4X A;  2FPE A;  5LJ3 d;  2KYB A;  1VQ8 Q;  3GNG A;  3VS3 A;  1QVF P;  4F16 A;  2QTX A;  5IXF A;  1C6V X;  3E9F A;  2GQI A;  4C92 G;  1FWZ A;  1GXI E;  1WLP B;  1UGP B;  2E41 A;  1J3T A;  2RI3 A;  5IXB A;  2W10 A;  3TCJ A;  2D9T A;  2DIL A;  2J6F A;  3PIO A;  3G71 Q;  1VQ4 T;  1YI2 A;  2F1L A;  2DE0 X;  4A4E A;  2C0O A;  3VYG A;  2L2P A;  1D0X A;  1JXO A;  3CBP A;  3VYH B;  2AT1 B;  1WYX A;  1GFD A;  1T0J A;  3VJP A;  3G6E Q;  2JMA A;  4OB1 B;  2JM8 A;  1PD1 A;  4IIM A;  3SD4 A;  1KIK A;  2HQX A;  3V7S A;  3TSZ A;  2ESW A;  1I0C A;  1MNE A;  2LDM A;  5J39 A;  3UPU A;  1K8A C;  3M0U A;  1OX8 A;  3RKW A;  2CKK A;  2OAW A;  3HL8 A;  1YIT T;  2OTL A;  3OMG A;  1WHJ A;  3MHX A;  1HJD A;  5KYX A;  4RUG A;  1PG5 B;  1W6X A;  2E5K A;  3RUX A;  3JB9 F;  2EIF A;  3OY9 A;  4C92 E;  1K1Z A;  4JS5 A;  1KD1 R;  2AIR B;  1AOJ A;  1MMN A;  4LN2 A;  2D1X A;  5ECA A;  3I56 Q;  5I22 A;  1UGR B;  4II1 A;  1SHF A;  2EGC A;  1MV0 B;  2OTJ Q;  2DXC A;  2JTE A;  3GNF B;  3JAM E;  3M9Q A;  4CRI A;  1WQW A;  4HXJ A;  1M3C A;  2EQU A;  4C8Q G;  1RAD B;  1NZ9 A;  2CT4 A;  1UEB A;  3QPH A;  4FU6 A;  1OZ2 A;  3G4S T;  2RHX A;  3CCL A;  2VWF A;  3CPF A;  2X4J A;  4FYW B;  1VQ5 Q;  1BCM A;  3M53 A;  2VAS A;  4PFP A;  3BE3 A;  4N4I A;  4M77 D;  2LQN A;  1VQN Q;  4LXC A;  2JVV A;  3VV0 A;  3PIP A;  4C5E A;  3CCE A;  3NGP A;  1XQH A;  4LUE A;  2DX1 A;  5CQX A;  4C0Z A;  1BI0 A;  1OYX A;  3EG2 A;  1K9M C;  5GAN d;  2QQA A;  3I55 Q;  2DMO A;  1PCX A;  1VQ8 A;  2HCK A;  1PM3 A;  3EGD A;  1C1A A;  2R5M A;  1QVP A;  2RHY A;  2RM4 A;  1GFC A;  3UA7 A;  1N8R U;  9ATC B;  2CP0 A;  2VGM A;  1AWJ A;  3JB9 I;  2D8J A;  2PU9 B;  3PT9 A;  2MMP A;  3SFM A;  5DLQ E;  4LDV A;  2OTL T;  4M7D D;  3C12 A;  4BE1 A;  4QQD A;  2E65 A;  4BDZ A;  3LWH A;  4C8Q E;  2L8D A;  4EMK A;  2KK4 A;  2HSE B;  3S3N A;  3CD6 Q;  4HT8 A;  3NTK A;  4XAX B;  2DJQ A;  4M78 D;  2E6N A;  3VS2 A;  3SDZ A;  5GAN 6;  1VYT A;  4Z02 A;  1Q7Y R;  3CCV Q;  2LCC A;  1M27 C;  5DLO A;  3VU3 C;  3AT1 B;  3M0R A;  1KD1 C;  3ASK A;  5KYW B;  1Y7X A;  1UB4 A;  4LD6 A;  1N6A A;  1SG5 A;  2JUF A;  1JB0 E;  1AWW A;  1WPY A;  4O5V A;  2RQV A;  1CKB A;  1QLY A;  2MOX A;  1KQS P;  2YXY A;  2LC4 A;  3CCL T;  2A7Y A;  3ZBD A;  1HK9 A;  2KT1 A;  1EX4 A;  3C95 A;  4X34 A;  3N5B B;  2KE9 A;  1U06 A;  3CC4 Q;  1I1J A;  2WSE E;  4ZGE B;  3G1J A;  4J9G A;  1KC8 R;  5D6Y A;  5GMK l;  2JM9 A;  3OYD A;  1VQ8 T;  4C0D C;  1XOV A;  2HL5 C;  2HDA A;  2X51 A;  2PVO B;  5FU7 B;  2BZX A;  3L42 A;  3MEV A;  3PVL A;  1YJ9 A;  3H0I A;  2QA4 Q;  5FWB A;  1FX7 A;  3OYM A;  4BDY A;  2CZ1 B;  2R5A A;  2CSI A;  3UF4 A;  1X43 A;  2CRE A;  4OML A;  4X9D A;  4A53 A;  4C0F A;  3H9N A;  1UE9 A;  2CP3 A;  2YDL A;  2CZ6 B;  1BK2 A;  4Y92 A;  1PHT A;  2JOY A;  2YRD A;  2Z0W A;  4C92 F;  2QI2 A;  3OW2 S;  3H41 A;  4N0A C;  2L3Q A;  2ZCF B;  1NPR A;  1RAB B;  2B86 A;  1UJY A;  5CIU A;  5CQY A;  2A36 A;  5D7U A;  3FC3 A;  2ENM A;  2LMJ A;  3OB9 A;  4XU0 A;  5A0D A;  3S3O A;  2QYZ A;  1TS9 A;  1Q82 C;  5I2S A;  3GLX A;  1VQ9 Q;  2VC8 A;  1LNX A;  5HK0 A;  2KT8 A;  2DAQ A;  4DEY A;  1VQM A;  2LX7 A;  2DVE A;  4PFO A;  2EYY A;  3V8J A;  4X1V A;  4C8Q C;  1R77 A;  5IHK A;  5FU6 B;  3RMQ A;  5IAY A;  1VQ7 Q;  2JTF A;  2JTM A;  1X75 C;  2IPO B;  2EVR A;  2QXF A;  4FSX A;  2KRO A;  4JUV A;  4E7S A;  1KJW A;  3RER A;  2CGH A;  3VUB A;  2YT6 A;  4HKE A;  3QSU A;  5KYY B;  1KG1 A;  3BW1 A;  3JSC A;  2KR3 A;  3VS0 A;  3EG1 A;  4BUG A;  2EQJ A;  2NYS A;  1KC8 C;  3O8V A;  3NTI A;  3LWI A;  1YJ9 T;  3PFS A;  2WSF E;  5CO7 A;  3RES A;  6AT1 B;  1QCN A;  4XTV A;  3QYH B;  2IG0 A;  3OYL A;  1ABO A;  1RI9 A;  4ORZ A;  1M9S A;  4QVD A;  3CPW S;  2HBW A;  1VQ5 T;  4BAC A;  2COW A;  2E4H A;  1D0Y A;  5KYN A;  1PKT A;  2RQT A;  2SRC A;  2F2W A;  3CMA Q;  4RKU E;  3DB4 A;  3QHS A;  1H3Z A;  2OAU A;  1YJN A;  4HCK A;  4Y28 E;  2G6F X;  4QVZ A;  2PVD B;  3PGG A;  2DL5 A;  3MEU A;  3OS2 A;  4RTV A;  2MWP A;  2IVW A;  1RAE B;  1TWB A;  1SSH A;  1UHF A;  3PMT A;  2RI2 A;  4C5H A;  2J6K A;  3NHN A;  4PFZ A;  1VQL A;  1TSF A;  3A8M B;  1SRM A;  1D1B A;  2DBK A;  2MF2 A;  2LRQ A;  2NLU A;  3M58 A;  1VQM T;  4JPB W;  1WHK A;  1PRL C;  2K79 A;  3OYN A;  1M8M A;  3INZ A;  3EG9 B;  2LCL A;  4J6Y A;  3CCS A;  4C5I A;  3TVT A;  4R0K A;  1CSK A;  2CSQ A;  2KRN A;  3JB9 G;  3CD6 T;  4EMK C;  4D8D A;  1AZG B;  4OMN A;  1YCY A;  1HSQ A;  1E7O A;  1SHG A;  1M1K R;  5LJ3 h;  3CME A;  1QVG P;  3JCM f;  5CKE A;  3QYG B;  1D0Z A;  2RNA A;  3JCM W;  1BIB A;  1YIJ A;  2A37 A;  2GTJ A;  3P8D A;  2NWM A;  3CCQ Q;  3EAE A;  5D6X A;  3A5Z B;  3BFM A;  5KH6 A;  1OPL A;  1TUC A;  4HCB A;  2DL7 A;  4F7U E;  2K5F A;  4M4Z A;  1UDL A;  3CCU A;  1SSF A;  2XMF A;  2E3H A;  1D1C A;  3DKM A;  1OOT A;  2K2V A;  2KAF A;  3TQ7 P;  4PJJ A;  1IO6 A;  4LE9 A;  4WCI A;  3L2W A;  2D0Q B;  4AFS C;  1VQL T;  1D3B B;  1WHL A;  5M9O A;  2EYW A;  1O75 A;  2ED1 A;  1YN8 A;  3QWY A;  1LOJ A;  1T3L A;  4B9W A;  3LH5 A;  2K5L A;  3QZ9 B;  1QP3 A;  3JCM e;  2Y4X A;  1TU0 B;  2RI5 A;  5LL6 S;  3DLL A;  5LJ5 f;  1I8F A;  3OSV A;  2KY9 A;  3HKS A;  1Q86 U;  1PNJ A;  1Q95 G;  1OUL A;  3FDR A;  4DBH A;  2CP6 A;  1IRE B;  4PJM A;  3CXC A;  3CME T;  3CCM Q;  1VQ6 Q;  1ZBJ A;  3VS6 A;  4JJB A;  2DJZ A;  2IIM A;  2VUB A;  3GOX A;  1RL2 A;  2K3B A;  1YIJ T;  3UT1 A;  1VQ9 T;  3C4S A;  2E1H A;  4M75 E;  1N27 A;  1D09 B;  3QDR B;  4M77 B;  3EG0 A;  2QQR A;  3OYY A;  2ZPG B;  1K73 U;  2QQS A;  2KNB B;  2EYQ A;  1K8A R;  2YLC A;  2KEA A;  2YHT A;  1BI3 A;  1R8O B;  2SEM A;  1KFZ A;  4JRI A;  3MPU B;  2GGR A;  3TRE A;  2YUO A;  1YNZ A;  2RK2 A;  5GAN h;  4C92 A;  4NS5 A;  4A4F A;  2KI7 A;  1N9S A;  2ATC B;  4GBQ A;  1QP2 A;  5LJ5 e;  4JS4 A;  5IHN A;  3EGX B;  4AMC A;  2PUK B;  2A08 A;  2XID A;  2KMT A;  2DPP B;  3OW2 A;  2YRC A;  1EZZ B;  4M7D B;  2QK0 A;  1NJI R;  4KRT A;  2MYS A;  4J7I A;  5GAM g;  2CZ0 B;  2RQR A;  1A0N B;  3MCA B;  4BY6 B;  4M78 B;  2K9G A;  4E7Z A;  4C8Q D;  3U23 A;  1NLO C;  2HEQ A;  3GF5 A;  3G4S A;  1JRI A;  2X3X D;  5LJ3 g;  2X9H A;  4M7A E;  4J7F A;  5A0G A;  5CKB A;  2L3P A;  3PTA A;  1K9M R;  4KH0 B;  4XTX A;  3GIB A;  4TVR A;  2XK0 A;  4FYY B;  5CVI A;  1WHG A;  2Y4Y A;  4N0A A;  4OMQ A;  4BI3 A;  1S72 Q;  2L0A A;  1MND A;  2HBP A;  2BZ8 A;  3EHR A;  4F7U F;  4ZN3 A;  3TU4 K;  1TG0 A;  2NUT B;  5GAN 2;  2DM1 A;  1VQK Q;  3UAT A;  2HQH A;  1Y57 A;  2LJ1 A;  3J81 E;  3CC7 Q;  3H0F A;  2W0Z A;  5GMK e;  3J7A F;  1UGS B;  3VUZ A;  3SWN A;  1AT1 B;  1G5V A;  1ZHI A;  2QEX A;  2V26 A;  3CPW A;  4KUL A;  4NOY A;  4C8Q A;  4JRP A;  1SPK A;  3JV3 A;  3FIF A;  2CZ7 B;  1B34 B;  2KRM A;  3EFO B;  4ZN1 A;  2QQB A;  4AT1 B;  3JCM J;  4JZ4 A;  3EG3 A;  4PLI A;  5I11 A;  1RI0 A;  2EQI A;  2VV5 A;  1W4S A;  3CCQ T;  2C06 A;  3CC2 Q;  3KBG A;  4F14 A;  2JJ9 A;  2F69 A;  4F7U B;  3C0C A;  1B07 A;  4E7H A;  1CKA A;  4KGV B;  3SHW A;  3M0S A;  2DVJ A;  2LVM A;  2FZG B;  1NJI C;  2BE9 B;  1EFN A;  1HYO A;  1OX9 A;  4C0G A;  4E2F B;  2FHD A;  2X35 A;  3OYI A;  2XHC A;  1U8R A;  4JJN K;  4JZ3 A;  4N4H A;  3R6N A;  2DTH A;  1W70 A;  1VYV A;  4ZNX A;  2JN0 A;  5IH2 A;  1Y0M A;  2ZPE B;  2FYK A;  2LNH B;  4A63 B;  2L5Q A;  1VOM A;  4M75 F;  5FU7 C;  3VKI A;  4J6X A;  4FW2 A;  1JEG A;  4MDW A;  4ESR A;  2BTT A;  2VKN A;  3S6W A;  4RMO A;  3QBY A;  2EAY A;  2LX9 A;  5GAO p;  3EGU A;  1WQ7 A;  5GAO q;  1LVK A;  1NEB A;  2J05 A;  3I9Q A;  3M0P A;  4EMG A;  4OVA A;  2K3X A;  2QEX T;  4PJO E;  3M56 A;  3CBO A;  5GAN g;  4HA8 A;  1QCO A;  3ZFJ A;  3G71 A;  2BZY A;  1E6G A;  2KBT A;  4EIK A;  1UJ0 A;  2FG0 A;  4KBM B;  3L2R A;  3OYJ A; 
#chains in the Genus database with same CATH homology
 1I07 A;  2C0T A;  1KJW A;  2FRY A;  2AZS A;  2YT6 A;  3RNJ A;  1M3B A;  4HVW A;  2KR3 A;  4Z88 A;  3VS0 A;  2V1Q A;  3M0T A;  3EG1 A;  1FYN A;  1GBR A;  2D8H A;  1FMK A;  2RQU A;  1ZSG A;  1WXU A;  2F2V A;  2YSQ A;  1QCF A;  3UA6 A;  1WDX A;  4GLM A;  1ARK A;  2YUQ A;  3VS5 A;  1ABO A;  2H8H A;  1RI9 A;  2CT3 A;  4ORZ A;  2HBW A;  1HD3 A;  2LQW A;  1G83 A;  1K4U S;  3I35 A;  5IHI A;  3EHQ A;  2JW4 A;  4J9F A;  1PKT A;  2RQT A;  2SRC A;  2F2W A;  1K0S A;  2DL8 A;  3O5Z A;  1PRM C;  2X3W D;  1K9A A;  2FPD A;  2DYB A;  2MIO A;  2MCN A;  1JO8 A;  2DL3 A;  1LCK A;  3VRZ A;  2O31 A;  4E6R A;  1WIE A;  1UGV A;  1WXB A;  4HCK A;  2G6F X;  5L23 A;  1AWO A;  1PKS A;  1X6G A;  2DL5 A;  4LNP A;  1H8K A;  4RTV A;  1QWF A;  2RPN A;  1AD5 A;  2ROT A;  2FEI A;  1SSH A;  1UHF A;  4J9I A;  1KSW A;  2DLP A;  4K11 A;  4J9C A;  2J6K A;  2L3S A;  3NHN A;  3M0Q A;  4HVU A;  3VS1 A;  3I5S A;  2J6O A;  1SRM A;  2RMO A;  1H3H A;  2HSP A;  4AFQ C;  2DBK A;  2ABL A;  4F17 A;  1VYU A;  4J9D A;  1YWO A;  4JPB W;  4HVV A;  1SRL A;  1PRL C;  2K79 A;  4AFU C;  2I0N A;  1M8M A;  2EGA A;  2AKK A;  2GNC A;  2KXD A;  5GJV B;  3SEM A;  4OMP A;  5GJW B;  3TVT A;  1AWX A;  2JS0 A;  4R0K A;  1V1C A;  1CSK A;  2CSQ A;  1ZX6 A;  2ED0 A;  2KRN A;  2OI3 A;  2GTO A;  4DEX A;  1X2Q A;  4D8D A;  1AZG B;  4OMN A;  4J9E A;  2KGT A;  1QKW A;  4D8K A;  1HSQ A;  1NM7 A;  1E7O A;  1SHG A;  1WI7 A;  2O88 A;  3CQT A;  1YCS B;  3GBQ A;  4RTZ A;  2RNA A;  3A98 A;  1K76 A;  1WX6 A;  1X27 A;  1E6H A;  2JS2 A;  2A37 A;  2DBM A;  2GTJ A;  1M30 A;  2NWM A;  2YUN A;  3PVQ A;  3ULR B;  1UG1 A;  1OPL A;  1BU1 A;  1TUC A;  2DL7 A;  2FPE A;  2KRS A;  5EC7 A;  2V1R A;  2EGE A;  2KYB A;  4AG2 C;  4M4Z A;  2M51 A;  3VS3 A;  4F16 A;  2JMC A;  5IXF A;  1UDL A;  3REB B;  2GQI A;  2XMF A;  1WLP B;  2QDL A;  1J3T A;  5IXB A;  2RQW A;  1MUZ A;  1OEB A;  2W10 A;  1OOT A;  2DNU A;  2DIL A;  2J6F A;  1UHC A;  1IO6 A;  4LE9 A;  4WCI A;  2DE0 X;  2EPD A;  2C0O A;  2L2P A;  1GL5 A;  4AFS C;  1JXO A;  2EKH A;  1T0H A;  4OMM A;  2EYW A;  1WYX A;  4RTY A;  3PE0 A;  2ED1 A;  1YN8 A;  3QWY A;  1GFD A;  1T3L A;  1B3Q A;  2RF0 A;  1T0J A;  3LH5 A;  1GCP A;  2JMA A;  2JM8 A;  1UTI A;  2EYZ A;  1QWE A;  4IIM A;  2O9V A;  1GCQ A;  4FSS A;  1PNJ A;  1KIK A;  3TSZ A;  1X2K A;  2ESW A;  1I0C A;  2DA9 A;  2LZ6 B;  5FWC A;  3M0U A;  4J9H A;  3TSW A;  2OAW A;  4JJC A;  2GBQ A;  1HJD A;  1ZBJ A;  4RUG A;  1Z9Q A;  3VS6 A;  1RUW A;  2PZ1 A;  4RTU A;  3REA B;  1W6X A;  2E5K A;  2IIM A;  2O2O A;  3H0H A;  4JJB A;  4RTT A;  1K1Z A;  2K3B A;  2LCS A;  4IIO A;  1AOJ A;  1ABQ A;  2NUZ A;  1W1F A;  4LN2 A;  2D1X A;  2CUB A;  5ECA A;  1G2B A;  5I22 A;  3RBB B;  1SHF A;  2EGC A;  3EG0 A;  1MV0 B;  1NEG A;  2KNB B;  2K7A A;  4OMO A;  2JTE A;  1UEC A;  1AZE A;  1X69 A;  1OV3 A;  2KEA A;  4HXJ A;  3ZL7 C;  1M3C A;  2SEM A;  1KFZ A;  1BB9 A;  3VS7 A;  2P4R A;  2CT4 A;  2GGR A;  2YUO A;  1YNZ A;  2VWF A;  2OJ2 A;  1YP5 A;  4GBQ A;  2LQN A;  3NPF A;  2CH4 W;  1UFF A;  5IHN A;  2A08 A;  1RLP C;  1OPK A;  3NGP A;  4LUE A;  3QWX X;  2DL4 A;  2DX1 A;  2DRK A;  2J7I A;  2AZV A;  3EG2 A;  2DMO A;  4KRT A;  4RTW A;  2ECZ A;  2HCK A;  1PWT A;  2A28 A;  3NMZ C;  1NG2 A;  2RQR A;  1A0N B;  1GCQ C;  2K9G A;  1GFC A;  3VRY A;  4Z89 A;  2C0I A;  1WXT A;  3UA7 A;  3I5R A;  1Z9Z A;  3U23 A;  1NLO C;  1AWJ A;  2HEQ A;  2D8J A;  2X3X D;  1NYF A;  2AK5 A;  1T3S A;  2PTK A;  1S1N A;  2L3P A;  1GRI A;  4CC3 A;  1JXM A;  4JJD A;  1YWP A;  1RLQ C;  4CC2 A;  2DJQ A;  3VS2 A;  1X6B A;  2EW3 A;  4OMQ A;  1VYT A;  1U3O A;  1M27 C;  2L0A A;  4QT7 A;  1N5Z A;  2K2M A;  3VS4 A;  3M0R A;  2BZ8 A;  3EHR A;  2ROL A;  2FRW A;  1K0X A;  1TG0 A;  1H92 A;  4RTX A;  2DM1 A;  2CDT A;  2JT4 A;  1SEM A;  3UAT A;  2LJ3 A;  1Y57 A;  1ZLM A;  2LJ1 A;  1AWW A;  2RN8 A;  2RQV A;  1CKB A;  1QLY A;  2FPF A;  2MOX A;  2LJ0 A;  2W0Z A;  3H0F A;  2KT1 A;  1SPK A;  3JV3 A;  1WFW A;  2KE9 A;  1U06 A;  2EBP A;  1WA7 A;  2KRM A;  1I1J A;  4J9G A;  4JZ4 A;  3EG3 A;  5I11 A;  2EQI A;  2PNI A;  1TUD A;  2CH4 A;  2JM9 A;  4F14 A;  1JQQ A;  1AEY A;  3C0C A;  3KFV A;  3THK A;  1B07 A;  1XOV A;  1CKA A;  2HDA A;  1U5S A;  2BZX A;  3SHW A;  2M0Y A;  1NLP C;  3M0S A;  2DVJ A;  3H0I A;  3PVL A;  4CC4 B;  1ZUU A;  3IQL A;  2JXB A;  1EFN A;  4LUD A;  1MV3 A;  2DF6 A;  1GBQ A;  5FWB A;  2YUP A;  2KXC A;  2LP5 A;  2CSI A;  3UF4 A;  4AFZ C;  1X43 A;  2CRE A;  2F2X A;  4OML A;  2K6D A;  1UE9 A;  4AG1 C;  2YDL A;  4JZ3 A;  3R6N A;  1W70 A;  1VYV A;  4ZNX A;  1BK2 A;  4Y92 A;  5FW9 A;  1PHT A;  5IH2 A;  1Y0M A;  5HCK A;  2O9S A;  2LNH B;  4A63 B;  3H41 A;  1AVZ C;  2CUD A;  2L3Q A;  4J9B A;  1M3A A;  2B86 A;  1UJY A;  1JEG A;  1VA7 A;  2KYM A;  4ESR A;  2A36 A;  2AKL A;  2BTT A;  2VKN A;  2ENM A;  2LMJ A;  3EGU A;  2D0N A;  4Z8A A;  1NEB A;  1BBZ A;  1ZUK A;  2J05 A;  1UUE A;  3FJ5 A;  3I9Q A;  2VVK A;  3M0P A;  1NYG A;  2KT8 A;  4DEY A;  2FO0 A;  2LX7 A;  2EYX A;  2EYY A;  4X1V A;  5IHK A;  2BZY A;  2DRM A;  1E6G A;  2KBT A;  1QKX A;  4EIK A;  4CC7 A;  1UJ0 A;  2FG0 A;  2EVR A;  1JU5 C;  1ZUY A;  2J06 A;  2KRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...