2LMJA

Itk-sh3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
GPLGSPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title The SH3 domains of the Tec family kinase Itk and the Src family kinase Lck compete for adjacent sites on T-cell specific adapter protein
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 66
sequence length 66
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lmjA00
4D8KA 2OJ2A 3VS5A 1UUEA 3H0FA 2MIOA 3NPFA 2CUDA 1E7OA 4RUGA 1NEGA 1AEYA 2M51A 1KFZA 2CT4A 1LCKA 2F2XA 1PNJA 4AFZC 2RQVA 2SRCA 4IIMA 1BB9A 5FWCA 2ED1A 1WDXA 1GRIA 2AZSA 3M0UA 2X3XD 1Z9ZA 3NHNA 1B07A 4LN2A 2KXCA 2KNBB 1M8MA 2D0NA 4J9IA 1E6HA 2DNUA 1SEMA 4D8DA 2CSIA 4HVWA 4HVUA 4OMMA 3EGUA 4RTYA 3QWXX 2AZVA 2D1XA 5I11A 4RTWA 2EVRA 3PVQA 2RF0A 1UECA 1WIEA 2LCSA 4GLMA 4JZ3A 1SHGA 2CDTA 2K6DA 2DL3A 2IIMA 2GTJA 1K76A 5IHKA 1MUZA 2ENMA 4CC7A 4J9GA 1PWTA 2GGRA 3NGPA 3TVTA 1UHFA 2FEIA 2GBQA 1SRLA 2EBPA 1T0HA 1WI7A 2VKNA 2L2PA 3QWYA 3TSWA 2K3BA 1J3TA 4JJBA 2RN8A 2DVJA 3VRZA 2JXBA 2DILA 1EFNA 1ZX6A 2KXDA 4HVVA 2V1RA 1K1ZA 1QKWA 2K7AA 2EYYA 3KFVA 1OV3A 2CH4A 3FJ5A 3RBBB 1UJYA 3PVLA 2L0AA 1UG1A 1Y57A 3I9QA 1JEGA 2LQNA 2HDAA 4Z8AA 5L23A 4OMOA 3UA7A 1UFFA 1U5SA 2C0IA 1M3BA 2LP5A 5FW9A 4HCKA 2W10A 1OPKA 2RNAA 2ABLA 3UF4A 1WLPB 1W1FA 3SHWA 3VS3A 2CUBA 1YNZA 4CC3A 4DEXA 1X69A 1JO8A 4RTVA 1UDLA 2J05A 2DM1A 5IHIA 1AVZC 2KROA 3VS4A 2RPNA 4M4ZA 3M0TA 2EYWA 2EQIA 2NUZA 4FSSA 2FPDA 1K0SA 4GBQA 2DL7A 1QWEA 1GFCA 1ZBJA 2DBKA 1HJDA 2DRMA 1E6GA 1QKXA 3EHRA 3VS0A 2V1QA 4AFSC 2W0ZA 4LNPA 4AFQC 2EYXA 3VS6A 2ED0A 4X1VA 2DYBA 2KBTA 3C0CA 4HXJA 1T3LA 2CSQA 2LJ3A 1G83A 3I5SA 2YSQA 4IIOA 4F16A 1MV3A 2A37A 2DA9A 2JTEA 1JQQA 1NLOC 1CSKA 1H8KA 1M3AA 1U06A 3I35A 2A08A 1ZSGA 2A36A 4CC2A 2H8HA 2RMOA 2KGTA 2F2VA 4ZNXA 3M0SA 1X2KA 3GBQA 1AWWA 1RUWA 4F17A 1WXTA 4LE9A 1PRMC 5IXBA 3VS7A 1ARKA 1VYTA 2BZYA 1AZEA 4RTZA 1ZLMA 2HSPA 2PNIA 2LMJA 2YUNA 2DL4A 1ZUUA 1PKTA 1GCQC 1YP5A 1ABQA 2DMOA 2KT1A 1ABOA 1V1CA 2F2WA 2K2MA 2LZ6B 4LUDA 1SSHA 2JS2A 1PKSA 2JMAA 3UATA 1N5ZA 2GNCA 1AZGB 3THKA 1OEBA 2LQWA 2RQUA 2XMFA 1GL5A 1QLYA 2HCKA 2L3QA 3ZL7C 2KT8A 1I1JA 2JM9A 4WCIA 5GJVB 1GCQA 2FO0A 2ECZA 2J7IA 4OMQA 3H0HA 1AOJA 1U3OA 1FYNA 2KR3A 2DE0X 3EG3A 2RQTA 2OI3A 3PE0A 4AG1C 4J9EA 2BZXA 4J9FA 1T0JA 4Z89A 2B86A 2J06A 2ROLA 4RTTA 1WX6A 1IO6A 1VYVA 3H0IA 1KSWA 2EGAA 2JW4A 1TUCA 2FG0A 5GJWB 3IQLA 2AK5A 2C0OA 2KE9A 3SEMA 3M0RA 1B3QA 1G2BA 1ZUYA 2YUOA 2A28A 1WXBA 2YT6A 2EGCA 2KYMA 1JXMA 2JS0A 3M0QA 1K0XA 2YUQA 4ESRA 1JXOA 3M0PA 2O88A 2D8HA 2BZ8A 5EC7A 1A0NB 2D8JA 1SRMA 3I5RA 1BK2A 1GFDA 3LH5A 1ZUKA 1X27A 3RNJA 4OMNA 4K11A 2O9VA 2ESWA 1KJWA 2O2OA 5IHNA 1X2QA 2RQRA 3EHQA 1WA7A 1QCFA 1TG0A 2KRNA 1M27C 1I07A 1UHCA 1YCSB 3R6NA 1MV0B 1AWXA 2EPDA 1S1NA 2ROTA 2HEQA 5ECAA 1QWFA 1YWPA 4A63B 4J9DA 4R0KA 3VS2A 2EW3A 2EGEA 2VVKA 4KRTA 1UGVA 3EG2A 1NYGA 3UA6A 4EIKA 1I0CA 1FMKA 2GQIA 1AD5A 1WYXA 4AG2C 2VWFA 1WFWA 1NYFA 1H92A 1KIKA 2DJQA 4F14A 3A98A 2MCNA 2EKHA 2SEMA 4LUEA 1RLPC 2DLPA 2LJ0A 4OMPA 2PTKA 4QT7A 2J6KA 4Y92A 5IH2A 2MOXA 3REAB 3REBB 1M30A 1SPKA 2DL5A 1HD3A 4JZ4A 2J6OA 2KRMA 2L3PA 4E6RA 4RTUA 2DRKA 4J9HA 1RI9A 1GCPA 4JJDA 2DBMA 4J9BA 1X6BA 4J9CA 3EG0A 2EYZA 2JMCA 4CC4B 1RLQC 2AKKA 3EG1A 1WXUA 3JV3A 3U23A 3NMZC 2LX7A 1X43A 1YWOA 2FPEA 1OPLA 1BBZA 1BU1A 2CREA 2LNHB 1TUDA 2KEAA 2CT3A 2FPFA 2J6FA 1Y0MA 1AWJA 2AKLA 5FWBA 1W70A 1PRLC 1UJ0A 2KRSA 1NLPC 2E5KA 2L3SA 3CQTA 1K4US 1HSQA 2PZ1A 2RQWA 2DX1A 1SHFA 1GBQA 2NWMA 1JU5C 2BTTA 2K79A 3TSZA 1H3HA 1X6GA 2GTOA 4JPBW 1CKBA 2O31A 2C0TA 4ORZA 2DL8A 2CH4W 3H41A 4JJCA 1AWOA 2P4RA 1M3CA 3VRYA 4DEYA 2M0YA 2YUPA 1CKAA 4OMLA 5IXFA 1NEBA 2G6FX 2K9GA 5HCKA 2O9SA 2HBWA 2I0NA 1VYUA 1PHTA 2QDLA 2LJ1A 4Z88A 1OOTA 2YDLA 1XOVA 2OAWA 1UE9A 1VA7A 4AFUC 3VS1A 2JM8A 2FRYA 2X3WD 1K9AA 2DF6A 1NM7A 1T3SA 1W6XA 2KYBA 1NG2A 1UTIA 1YN8A 1Z9QA 2FRWA 5I22A 3ULRB 3O5ZA 1GBRA 4RTXA 2JT4A
chains in the Genus database with same CATH superfamily
3GPLA 5FROA 2K4YA 2QI2A 4M7DC 2GFAA 3E2UA 2DXCA 2VC8A 2P0PA 4RUGA 4C92F 3CCQQ 2CT4A 1ZQ1A 3QYGB 2RH2A 1LCKA 4XTXA 3RMQA 4BE2A 2RQVA 2EKOA 1VIFA 3OQ5A 1C6VX 5LJ3h 3WVEB 1U1TA 2AZSA 2PUKB 1VQOA 1HK9A 1SG5A 3M0UA 3OBYA 2DETA 4ZTFA 2DAQA 4JLIA 2KNBB 1PSFA 5CQXA 3A8HB 5LJ3f 4F7UG 5LJ3g 4OP0A 4FT2A 1KQ2A 1Q86R 1VQ9A 2CSIA 3EGDB 4OMMA 3E9FA 2FZGB 2D1XA 3HFNA 2V8JA 4RTWA 2RF0A 4MMKA 4XU0A 2K6DA 2IIMA 4CC7A 2P4TA 1PWTA 1EZZB 3TQ7P 1UHFA 3TVTA 2EBPA 1U1SA 2VKNA 4E7IA 2L2PA 3SDZA 3QWYA 2K3BA 1M90R 1J3TA 1VQ6Q 2OTLQ 2RN8A 2DVJA 4M77E 1ZX6A 2KVQG 5FU7C 2NYSA 3CCQA 4JS5A 4FCYA 1QKWA 2D0QB 1OV3A 2WACA 3QG1A 2ZPEB 3RBBB 1UJYA 2RA2A 1RAAB 1UG1A 1RL2A 1Y57A 3I9QA 3C95A 3OYMA 1KQSS 4Z8AA 2L3RA 4RMOA 4A4EA 4C92A 1U5SA 5CAIA 2W10A 3GF5A 2GQVA 2R58A 1WLPB 1KQSA 3PMTA 2CZ0B 2K3YA 2RHXA 3A5ZB 4F7UF 1BCMA 5LJ5f 3VS4A 5LJ5g 2EYWA 3NTIA 1MMNA 4C5HA 4FSSA 5D6YA 2DL7A 4PJJA 4HCCA 2FL7A 3JAME 1GFCA 1YITA 2DBKA 2KDSA 4XTVA 3J80E 3GP8A 1E6GA 2W0ZA 4LNPA 1RABB 1YJNQ 2KBTA 3OS1A 1VQNT 5GAOm 2LQKA 4HXJA 2E64A 2ZPFB 3I5SA 1O9SA 5GAOq 4IIOA 2FYKA 3H6ZA 3CD6Q 1QCOA 1CSKA 5FRMA 4C0ZA 1H8KA 1M3AA 4PLLA 3I35A 3CCUA 1K73R 2NUPA 2A08A 8ATCB 1ZSGA 1G8XA 1IHWA 4JLGA 4DBRA 2RI5A 2XU8A 2O01E 4II1A 4PJOB 3M5AA 4KT0E 4HA8A 3OA6A 1RUWA 4F17A 1PRMC 2BE9B 5IXBA 3VS7A 5D6XA 1ARKA 2CZ6B 2DPPB 4RKUE 2DL4A 4MDWA 2EJ9A 1VQLQ 1D1BA 2FZKB 3EAEA 4LXCA 3CMEQ 1OX9A 2JVVA 5FU7B 3E9GA 1YJWA 2OTJT 1V1CA 4J83A 4HCZA 2JJ9A 4M75B 1N6AA 2GNCA 2IG0A 1G5VA 1OEBA 2DKGA 4M7DD 2HCKA 1KHCA 2DFUA 5KYUA 2JM9A 4WCIA 5GJVB 2RM4A 1D09B 2ECZA 1VQ7T 5A2QE 3I56T 1B34A 3QJ6A 3CCST 1FYNA 2DE0X 2FHDA 3PE0A 4EMKB 4Y28E 3CXCP 1C1AA 1X6OA 3SB2A 2J06A 4RTTA 1VYVA 3CCEA 3A8OB 1TUCA 2NUTB 1B7TA 3MCAB 2MYSA 2C0OA 2KE9A 2RHZA 3HFOA 3CBPA 2JZ2A 2LRQA 2YT6A 3CXCS 4C5EA 3JCMc 1K0XA 4ESRA 3JCMd 4A4FA 4BI4A 2P0QA 2QYZA 1MNEA 2KI7A 2D8HA 5GMKe 1H3ZA 4PJOD 3X25B 3CMEA 1UEBA 1X27A 2O9VA 2XDPA 3M56A 3JCMW 2O2OA 1W2BS 1M2VA 1QW1A 1TU0B 1TG0A 5GAN2 1MV0B 1AWXA 1LOJA 4XQ3A 4M75D 1I5LA 1WHJA 5ECAA 5GAOl 4J9DA 2E5QA 1K8AR 2EW3A 2EGEA 4A53A 5GANf 5GANg 2VVKA 1NYGA 3UA6A 4EIKA 2HAXA 3ASKA 2GQIA 3HKSA 1D0XA 2VASA 3CPWA 1WFWA 1NYFA 1H92A 4N0AC 4GLKA 4M78E 5A0LA 2CGHA 2SEMA 1Q82R 4IUTA 4QT7A 2J6KA 4Y92A 5IH2A 4BDYA 3MP8A 3REBB 4MDXA 1HD3A 3G6ET 2L3PA 4E6RA 1QP2A 2KK4A 2DBMA 4J9BA 3CC2Q 1P92A 1QQJA 2EQKA 2H3EB 4PJOG 3F70A 2G3RA 2Y4XA 3FEOA 2FPEA 4JJNK 2LNHB 1BU1A 4ZN1A 4ME7A 2KEAA 1Q7YC 1IRXA 1IZ6A 1VQ8Q 1EIFA 5FWBA 1W70A 5M9OA 4LDWA 1M9SA 3CQTA 1HSQA 4M75G 1MMGA 2DX1A 3CMAA 2NWMA 4FU6A 2DTIA 1N8RC 4Z02A 2K79A 3TSZA 1H3HA 1X6GA 2JUFA 4JPBW 3EGDA 2C0TA 2QTXA 3CCVA 1OX8A 4DEYA 2M0YA 1BI3A 4OMLA 2RJFA 4E2FB 2O9SA 3UPUA 5CCAA 2YDLA 2OAWA 3CC2A 1RACB 3GNFB 2X3WD 1BI2A 1T3SA 1R77A 1N9RA 1NG2A 1V76A 1Z9QA 4PJOF 3LH0A 2FRWA 4KGXB 3OYIA 5AT1B 5I22A 1YIJT 1I4K1 1G3TA 4RTXA 2EIFA 2EQJA 3RKYA 2OJ2A 3DKMA 2BUDA 1UUEA 7AT1B 2DXUA 2MIOA 2CUDA 1E7OA 1Q81C 1AEYA 2CYZB 1K9MC 1N8RU 2F2XA 4F04B 3AHUA 4AFZC 4MZPA 1PM3A 4XU3A 3I55A 1HYOA 4M75F 1BB9A 1QVGS 2X3XD 2EJGA 2LX9A 4C5IA 3D7SB 4C8QG 2F1LA 3JCMQ 3RIRA 3CCMA 4CI0C 2KXCA 1M8MA 1RAGB 5IAYA 4D8DA 1IGUA 1SEMA 2COWA 3FRNA 4XU1A 4HVUA 4RTYA 3OYEA 4LDXA 1D0YA 4DOVA 2F69A 5I11A 3OMCA 3CCRQ 2K5LA 3PVQA 5GAMf 1WIEA 2LCSA 3M57A 4GLMA 1M1GA 2MWPA 5GAMg 4JZ3A 2DL3A 2GTJA 2QGGA 3ME9A 4OB3B 4J9GA 1VQ4T 5LJ3j 2GGRA 2HNIA 2CP6A 4AT1B 1LJOA 3S3OA 3TSWA 1YJ9A 1Q81U 4JJBA 4FYVB 3OYAA 1K9MU 3BY7A 3VRZA 3BW1A 3QDRB 1IREB 4HVVA 5LJ3d 1K1ZA 4PJOA 3OBWA 3VKIA 1QCNA 5CKHA 3FJ5A 1VQOQ 3PVLA 2L0AA 2PQWA 3V7RA 1JEGA 2LQNA 2HDAA 1KD1C 2AT1B 4OMOA 3CC7Q 5D7UA 1TWBA 1YHQA 5KCOA 5L8RE 3QO3A 1M2OA 3OB9A 1KG1A 2PU9B 3RKWA 3UF4A 1W1FA 3SHWA 1YNZA 4M75A 1JO8A 4RTVA 2J05A 3G71A 2QEXQ 1VQPQ 3M0TA 3L2RA 4M7DE 3OYHA 2FPDA 1S72Q 1BIAA 1NJIC 1QWEA 1SSFA 1ZBJA 2VGMA 2BE7D 2DRMA 2EQUA 3VS0A 2V1QA 3INZA 5LL6S 1W4SA 4A4KA 4AFQC 2EYXA 3VS6A 4OB0B 4EMKA 4IUPA 5KH6A 5LJ5j 2LJ3A 2X4XA 2YHTA 2NUTA 2YSQA 1MV3A 2QQBA 1JQQA 1KD1U 3M59A 2A7YA 3RESA 2JNGA 2QA4T 4ZTJA 2A36A 1R8OB 4CC2A 2H8HA 2RMOA 4E7SA 3CC7A 1D3BB 3CCLA 2RHIA 5I2MA 1LNXA 2CP7A 3JB9J 2PNIA 3OYYA 5CO7A 2LMJA 2YUNA 4OB1B 2EFIA 2QEXA 1ZUUA 1PKTA 1NJIU 3NTHA 1GCQC 1VQPA 1ABQA 2KT1A 1ABOA 1YITQ 3MHXA 1S72A 2K2MA 4LUDA 2ZCFB 2MMPA 2E4HA 1SSHA 1D1CA 2VXFA 4PJOC 4RCBA 5IN1A 2OTLT 3ZL7C 4OF1A 1I1JA 5CK9A 1JRIA 2COYA 2M9UA 1G3YA 2FO0A 4Q5WA 2J7IA 3H0HA 1AOJA 1PC0A 1WJQA 2LVMA 2BIVA 2KR3A 3EG3A 4M75C 3JB9G 3LW5E 1WHMA 3OSSC 1T0JA 3CCUQ 2ROLA 3P8DA 1YFNA 3H0IA 3CC4A 5LJ5h 2K3XA 2DXBA 4DA4A 2X51A 1G2BA 2YUOA 1N27A 2A28A 2DEUA 2KYMA 1UGQB 3M0QA 4EMKC 2HL3A 3X24B 4PJNA 3M0PA 5CKEA 2O88A 2KMTA 2XHCA 3OYKA 1TXQA 2BZ8A 2DO3A 4XTUA 1YJWQ 3I5RA 1BK2A 2DXTA 4JS4A 5KE2A 2QA4A 2XDDA 1WPYA 3JCMe 2ESWA 3G4ST 3GOXA 1YJNT 2E70A 2RQRA 4KBMB 3VJPA 1QCFA 2D6FA 1QVFP 4PL6A 2KRNA 1XNIA 1I07A 2PVGB 4QKUA 1UHCA 4BY6C 1QP3A 4X34A 3EG9B 4JDSA 2EPDA 4FW1A 3CD6T 1KC8C 1EX4A 2HEQA 2ROTA 2X4JA 3PNWC 4J8OA 1YWPA 1X01A 2ZPBB 2VB6A 3JB9I 2RHUA 2VUBA 1QVFS 3SWNC 3CCEQ 3UDCA 4KRTA 1Y96B 2DERA 2RK1A 1I0CA 4FW2A 1FMKA 1WYXA 4AG2C 3KUFA 3FLGA 5AYFA 2RB6A 4C8QC 3RMSA 4XAXB 3EFOA 4OGCA 2MCNA 2EKHA 1RI0A 1VQLT 1RLPC 1MMAA 4M7AG 4C0GA 4OMPA 5GANj 3WXMB 4JRPA 4PFPA 2DD4A 3FC3A 4C92E 2RHYA 3OS2A 1M30A 1SPKA 4JZ4A 1NBEB 4N0AA 2KRMA 2VGNA 2QG9B 4PJMA 2DRKA 2E12A 4J9HA 1RI9A 4J7IA 4JJDA 2LDMA 1X6BA 4F7UA 2DZ9A 2JMCA 1V29B 5FU6B 4CC4B 3HPWA 1KC8U 2AKKA 3EG1A 3NMZC 4HT8A 4C0FA 2LQ8A 3MJXA 3QUIA 4R56A 1X43A 1YWOA 1OPLA 2CREA 3OS0A 2OTJQ 4ZGDB 2F5KA 1PRLC 2P84A 1JJ2P 2HQEA 1F1BB 5GAOp 2DYIA 2E5KA 4FL6A 2VYTA 2RQWA 1YCYA 3HRSA 3AT1B 1SHFA 5CIUA 1HXDA 1VQNA 1JU5C 3ZEHA 5FLXE 2BTTA 5GAN6 8AT1B 1JJ2S 4BY6B 1VQKT 2GTOA 4FIBA 2BKDN 3QSUA 1CKBA 2O31A 4MZMA 3TCJA 4ORZA 2ATCB 4JJCA 2P4RA 1M3CA 3VRYA 2YUPA 3CXCA 4QQ6A 5GAN7 2XIDA 5GAN5 4M7AF 2QDYB 3DLLA 2QDLA 4ZGJB 3SWNB 1XOVA 1IGQA 1VA7A 3X28B 2CZ1B 4ELZC 3JB9H 4EDUA 4VUBA 5GANh 2PVDB 2K5FA 1K9AA 2LT1A 3G1JA 5GMKi 1QVPA 2KYBA 4KUDK 4C8QB 3HP9A 1W2BA 1KK7A 5HK0A 3LYIA 4KGZB 2ZPHB 2L5QA 1FMWA 2OTJA 3CPWP 4E7KA 3TREA 1GBRA 2GF7A 4D8KA 2FZCB 3C12A 4F7UE 1NZ9A 1TH7A 3H0FA 4EMHA 3CMAQ 2DK3A 3NPFA 1NEGA 2IVWA 3H8ZA 2LCLA 5GAOr 2MWOA 3PFSA 4C5GA 4PFZA 3OS5A 1VQ7A 5GAN8 2AHJB 5FWCA 3BDLA 3I56A 1WDXA 1NE8A 3OYDA 1WHHA 4N4HA 3CCSA 3CCVQ 1Z9ZA 1JBMA 3NHNA 1IHVA 4EPCA 1B07A 4LN2A 1WHLA 2A3LA 4KUIA 5KYYB 3NTKA 4ZN3A 2DNUA 3DLMA 5GAN4 1SKUB 3EH2A 3EGUA 3QWXX 2AZVA 2RJDA 3H9NA 1WZOA 4ANJA 2DD5A 1UECA 1WHGA 2QASA 3ZFJA 1LPLA 1IB8A 1BIBA 2K5IA 4UC4A 1K76A 2ENMA 3O8VA 1VQ8T 1R0CB 2PVOB 4NL3A 2GBQA 3JCMf 5I21A 3VU3C 1YI2T 2RO0A 3G6EQ 1SRLA 1T0HA 2K2VA 3PGGA 3CCJT 1Y7XA 5CKDA 1WQ7A 4C8QD 3VUZA 5GAMj 2X9HA 2Y4YA 3I55Q 1D3BA 4O5VA 5J3BA 5KYNA 2K7AA 3V8LA 3MEVA 2CP5A 2CH4A 4KH0B 1WQWA 2YLCA 2X4YA 2DTHA 4JRQA 1BI1A 3CBMA 3OMGA 5L23A 3CCMQ 1VQMT 2VXEA 4DBHA 3VYGA 3UA7A 1UFFA 5LJ3e 3LLRA 3EGXB 4J6XA 1M3BA 2LP5A 5FW9A 2OX7A 4HCKA 2WSEE 1OPKA 2XKOC 4CC3A 2K57A 1X69A 3HHTB 4QQDA 1UDLA 2DM1A 5IHIA 1AVZC 2KROA 2RPNA 4M4ZA 3P8HA 3WVDB 2O4XB 2EQIA 3L2VA 1K0SA 1DJ7B 1PD0A 1M1KC 1WJSA 2EJFA 1HJDA 3QZ9B 3OW2P 1M4ZA 1YJ9Q 2ED0A 4X1VA 3G6EA 3C0CA 3DB3A 1X75C 1T3LA 2MAMA 3JCMX 5HKCA 2A0FB 1G83A 4N4GA 3QDFA 1VQ5T 3OW2S 4PFOA 4X9DA 2VV5A 4F16A 2A37A 4KULA 3META 1NLOC 3MP1A 2HBPA 1OYXA 3QXEB 4E7HA 1YHQQ 1YIJQ 2F5TX 1IXDA 1MHNA 3X26B 2KGTA 3QJYA 4M78B 2F2VA 4ZNXA 4M7AC 4PKCC 1Q86C 3GBQA 5GAMh 1AWWA 3PMIA 4A54A 2CZ7B 4RCCA 3G71Q 1QVGA 5GMKh 3CCRT 2LC4A 1M8VA 5LJ5e 1AZEA 3GNGA 4RTZA 2HSPA 2DZCA 2DTOA 2E6ZA 2EQMA 2DMOA 1YP5A 1M1KU 4O6JA 3EG9A 2DIQA 3VUBA 2LNVA 2LZ6B 3BFMA 3EH1A 1PKSA 5KYXB 3UATA 1VQMA 1LVKA 1I5OB 2RQUA 3MEUA 3G7ZA 1QLYA 1GL5A 3OSVA 1M90C 2DIGA 2L3QA 3L2UA 2KT8A 2DJZA 3VYHB 3MEAA 1Y96A 4FYWB 3L2WA 2Y90A 1BKBA 1GCQA 2HKQB 5CQYA 1U3OA 1VQOT 2L89A 2V8KA 3P8BB 2ZPIB 3NFCA 3JCMP 3DB4A 4IUVA 4J9EA 2BZXA 1Q7YR 1RADB 2B86A 1JB0E 1WX6A 1IO6A 2EGAA 3X20B 1BCOA 1YIJA 1Q86U 3CCLQ 5GJWB 2XDBA 3IQLA 1VQ9T 1MMDA 4LD9K 4OMFB 3SEMA 2XG8D 4FT4A 4P5NA 1B3QA 1ZUYA 5CVIA 4C8QF 1WXBA 2ZAEA 2EGCA 2YRDA 3J7AF 4QQGA 2JTFA 2YUQA 3J81E 2QQAA 1JXOA 1N8RR 2KY9A 1VOMA 4PLIA 3V7SA 2E3IA 1A0NB 1SRMA 1M5Q1 1OZ3A 2E65A 1GFDA 3JRZA 4IURA 4PK4A 4A4HA 4K11A 1PG5B 3S3MA 1M90U 1KJWA 5IHNA 1X2QA 4BE0A 3JB9D 3EHQA 1WA7A 3QHSA 5C6SA 4J5YA 3RERA 2YWWA 4WF2A 3CCQT 1MGQA 1YCSB 1TOVA 4FSXA 4M7AB 5CKBA 3LWHA 1I81A 1S1NA 3PIOA 3JCMb 2M0OA 4R0KA 2X35A 3QKJA 4BUGA 1K73C 3CC4Q 1UGVA 1VQ4A 5LJ5d 4ELYC 3QZ5B 2R5AA 4NS5A 2L8DA 2VWFA 5A0DA 2NLUA 1Q81R 1K9MR 3PT9A 3A98A 4PJOE 3T9NA 1TS9A 1XTDA 1ZSZC 2LJ0A 3SWNA 5GAOn 6AT1B 1YITT 2KQWA 3REAB 2QA4Q 1AT1B 3MEWA 1OU9A 3UT1A 5FRNA 4C8QA 5D6WA 2E3HA 4RTUA 1ZBXA 2X4WA 3E19A 4M75E 1Q95G 1GCPA 3M54A 1VQ6T 3V8JA 3EG0A 4XTWA 4M78G 4A4GA 5DLOA 2E1HA 3GIBA 3JV3A 2B8AA 2EYQA 3RR6A 1QMCA 3LX7A 3M58A 1BBZA 1TUDA 3CCUT 1K73U 5GANe 3CPFA 1RAFB 3RUXA 1SF9A 3OYBA 3CBOA 1AWJA 1TUGB 2AKLA 2QQSA 2COZA 4WTOB 3RDVA 5GMKm 5EG2A 2KRSA 1NLPC 5FU6C 4M7AD 2L3SA 1KQSP 1K4US 3R6OA 4DBQA 4HCBA 1KHIA 2XI9A 1GBQA 5KYYA 4DQ2A 1YJWT 3M9QA 2E6NA 2QXFA 4M77C 2DL8A 2CH4W 3H41A 4MZTA 1KD1R 2M1HA 5C0MA 4B6MA 1CKAA 4HT9A 1WGSA 2M16A 5HCKA 2HBWA 1VYUA 1BYMA 1PHTA 1Y07A 4LDVA 2WSFE 4FYYB 3VS1A 4M7DB 2FRYA 1PSEA 2QK0A 3URGA 4J7FA 2DF6A 1W6XA 4M78F 2WSCE 1ACMB 1K8AC 1NJIR 1YN8A 4C8QE 3CCET 9ATCB 1PCXA 3ULRB 1ZSZB 4DOWA 2CKKA 1ZHIA 3VS5A 3G4SQ 2V26A 4TVRA 1O75A 3JB9F 4X9CA 3HTRA 1VQ6A 2OTLA 2M51A 2ZZDA 1KFZA 5CKFA 1QVFA 1VQNQ 3E1SA 3EGXA 2XICA 1PNJA 4IUQA 4R55A 2SRCA 4IIMA 2ED1A 1H641 1Q82C 2IPOB 1GRIA 3FJPA 3L2ZA 1BI0A 3QIIA 3CMET 4PJLA 5DLQE 5HY6A 2O4XA 2D0NA 1UGPB 4J9IA 1E6HA 2HQHA 4QVZA 5KYWB 3M4YA 3EFSA 1G3SA 4HVWA 4NOYA 5GANd 4NL2A 4IKFA 2EVRA 4OVAA 3PIPA 4LDUA 2QQRA 3OY9A 1K8AU 2LTOA 4JRIA 4KGVB 1SHGA 2CDTA 3LGFA 5IHKA 1MUZA 1ZA2B 3LGLA 3NGPA 2FEIA 1WI7A 3OYFA 4M77B 2RD1A 4L59A 4Y91A 1PD1A 3G4SA 1YJNA 4C92C 4BACA 2JXBA 2DILA 5GMKl 1EFNA 2R57A 1XQHA 2KXDA 3S3NA 3S6WA 2V1RA 4DBFA 1OQKA 4M78A 1VQ7Q 2HQXA 3I56Q 1VIEA 1Q82U 2EYYA 3KFVA 3CD6A 2P0KA 4JUVA 3CCSQ 3OYLA 1N9SA 4BE1A 4FM4B 5J26A 4CRIA 4C0DC 2MPXC 2C0IA 1G3WA 3M55A 2RNAA 2ABLA 4J6WA 1JJ2A 3VS3A 2CUBA 5KYXA 2RI3A 4MMLA 4DEXA 3C4SA 4J6YA 1W2BP 2M02A 2AIRB 5GAMe 5A0GA 2XK0A 1VQKQ 2NUZA 2GFUA 1VQLA 3L1AA 4GBQA 2CP3A 2HZYA 1RAIB 3MO8A 4GY5A 3QYHB 1QKXA 3EHRA 4AFSC 2QAZA 3CMAT 2DYBA 3FB9A 2QGFB 1D0ZA 2CSQA 1WJRA 3FIFA 4E7ZA 2HSEB 1KC8R 2H3JA 2JTEA 2DA9A 3EFRA 3MPUB 3CPWS 2GCXA 4M7DG 3CCVT 4M77D 1U06A 4BI3A 2EAYA 3HL8A 3BDUA 4PNOA 3CEYA 1ZA1B 4KH1B 3RKXA 3M4GA 3M0SA 3OYGA 1X2KA 3L42A 1WXTA 2E41A 4LE9A 3CC2T 4XU2A 5KE3A 1VYTA 2BZYA 1RAHB 3TU4K 1ZLMA 3JCMJ 3ZBDA 1FX7A 3LWIA 4V2SA 3JCMh 4C92B 4LDYA 4ATOA 3KBGA 1VQKA 4M78C 2F2WA 3A8LB 4M7AA 2JS2A 4LD6A 2JMAA 1N5ZA 2C06A 1AZGB 3THKA 1C0MA 2LQWA 2CS7A 2XMFA 5DM7R 4L5GA 3JCMg 1GXIE 4XTYA 4D6WA 3A8MB 1D1AA 4HKEA 4C0DB 1OZ2A 3MKDA 3I55T 3HRTA 4OMQA 4B9WA 1OU8A 5GMKj 2LT4A 2ZPGB 2RQTA 2OI3A 4AG1C 3CCMT 5CR2A 1KQ1A 4J9FA 1AHJB 4Z89A 3OYCA 1YI2Q 3MP6A 1KSWA 4N4IA 3V7CA 2XD0A 2JW4A 4M7DF 2FG0A 5GAMd 2V8IA 2CP2A 3CCJQ 2AK5A 5GAN3 3M0RA 5IT9E 1OULA 4BB7A 1I8FA 4M77G 2LCCA 1JXMA 2JS0A 1UB4A 1FMVA 2NUPB 3A8GB 2QTVA 4AMCA 3BE3A 2PUOB 5EC7A 2D8JA 2JTMA 1NPPA 1VQMQ 3LH5A 1ZUKA 3RNJA 1WNLA 4OMNA 3EFOB 1YBYA 4B9XA 1YJ9T 2YRVA 1UGRB 4BDZA 1M27C 4C92D 2E10A 4E7LA 4XK8E 3R6NA 1OI1A 1M1FA 2I2LA 3HSBA 2YLBA 3JCMV 1Q7YU 1QWFA 4A63B 4M7AE 1MNDA 3VS2A 1RAEB 4F7UB 3KXTA 1YHQT 5KYUB 3OYJA 3EG2A 1UGSB 4QVCA 2DEQA 2ZGWA 1VQ8A 4IUUA 3M53A 3Q1JA 1AD5A 3OW2A 2RJCA 1YI2A 2JOYA 1QVGP 3L2QA 1B34B 4L6V5 3SD4A 1TSFA 3G71T 3CCJA 2RI2A 1U8RA 4RG2A 1KIKA 1NPRA 2DJQA 4F14A 1VUBA 1VQ5Q 4LUEA 1R0BG 2DLPA 3FDRA 2JN0A 2FB7A 2PTKA 4JRKA 2OAUA 4M77F 4M7DA 2KAFA 2MOXA 2Z0WA 3HRUA 3GLXA 4OGEA 4BI8B 2DL5A 2J6OA 2HKNA 1WHKA 3VV0A 4J9CA 2EYZA 1ZSZA 1RLQC 3SFMA 2CP0A 1WXUA 3U23A 3V8KA 2LX7A 5DY9A 3UWNA 2D9TA 1M2VB 2CT3A 2FPFA 4RG8A 2R5MA 2J6FA 1VQ4Q 1Y0MA 4C92G 1FWZA 2KSSA 3CC7T 3CCLT 1UJ0A 4E7JA 2RJEA 3JSCA 2PZ1A 3C94A 2DVEA 4XTZA 4BD3A 4EMGA 2MF2A 5HK3A 2EWNA 2RK2A 3TEEA 2QEXT 5KYWA 2MI6A 1VQPT 1VQ5A 1TTHB 4QW2A 1FXXA 1S72T 3A1PA 2YRCA 4M78D 1AWOA 4ZGEB 2YXYA 2HD0A 3QPHA 5IXFA 3QBYA 3N5BB 1NEBA 2G6FX 2K9GA 1VQ9Q 2HL5C 2I0NA 4YTLA 2HMAA 2LJ1A 4Z88A 4QVDA 1OOTA 1UE9A 4AFUC 2JM8A 4FYXB 4E47A 3OYNA 5I2SA 3CCRA 4M77A 3ER0A 1NM7A 1XJWB 2FVUA 5J39A 1UTIA 1Y71A 1M1KR 3CC4T 2QQ9A 3O5ZA 3PTAA 2MK5A 2JT4A 4OB2B 5KCHA
chains in the Genus database with same CATH topology
4D8KA 2OJ2A 3VS5A 1UUEA 3H0FA 2MIOA 3NPFA 2CUDA 1E7OA 4RUGA 1NEGA 1AEYA 2M51A 1KFZA 2CT4A 1LCKA 2F2XA 1PNJA 4AFZC 2RQVA 2SRCA 4IIMA 1BB9A 5FWCA 2ED1A 1WDXA 1GRIA 2AZSA 3M0UA 2X3XD 1Z9ZA 3NHNA 1B07A 4LN2A 2KXCA 2KNBB 1M8MA 2D0NA 4J9IA 1E6HA 2DNUA 1SEMA 4D8DA 2CSIA 4HVWA 4HVUA 4OMMA 3EGUA 4RTYA 3QWXX 2AZVA 2D1XA 5I11A 4RTWA 2EVRA 3PVQA 2RF0A 1UECA 1WIEA 2LCSA 4GLMA 4JZ3A 1SHGA 2CDTA 2K6DA 2DL3A 2IIMA 2GTJA 1K76A 5IHKA 1MUZA 2ENMA 4CC7A 4J9GA 1PWTA 2GGRA 3NGPA 3TVTA 1UHFA 2FEIA 2GBQA 1SRLA 2EBPA 1T0HA 1WI7A 2VKNA 2L2PA 3QWYA 3TSWA 2K3BA 1J3TA 4JJBA 2RN8A 2DVJA 3VRZA 2JXBA 2DILA 1EFNA 1ZX6A 2KXDA 4HVVA 2V1RA 1K1ZA 1QKWA 2K7AA 2EYYA 3KFVA 1OV3A 2CH4A 3FJ5A 3RBBB 1UJYA 3PVLA 2L0AA 1UG1A 1Y57A 3I9QA 1JEGA 2LQNA 2HDAA 4Z8AA 5L23A 4OMOA 3UA7A 1UFFA 1U5SA 2C0IA 1M3BA 2LP5A 5FW9A 4HCKA 2W10A 1OPKA 2RNAA 2ABLA 3UF4A 1WLPB 1W1FA 3SHWA 3VS3A 2CUBA 1YNZA 4CC3A 4DEXA 1X69A 1JO8A 4RTVA 1UDLA 2J05A 2DM1A 5IHIA 1AVZC 2KROA 3VS4A 2RPNA 4M4ZA 3M0TA 2EYWA 2EQIA 2NUZA 4FSSA 2FPDA 1K0SA 4GBQA 2DL7A 1QWEA 1GFCA 1ZBJA 2DBKA 1HJDA 2DRMA 1E6GA 1QKXA 3EHRA 3VS0A 2V1QA 4AFSC 2W0ZA 4LNPA 4AFQC 2EYXA 3VS6A 2ED0A 4X1VA 2DYBA 2KBTA 3C0CA 4HXJA 1T3LA 2CSQA 2LJ3A 1G83A 3I5SA 2YSQA 4IIOA 4F16A 1MV3A 2A37A 2DA9A 2JTEA 1JQQA 1NLOC 1CSKA 1H8KA 1M3AA 1U06A 3I35A 2A08A 1ZSGA 2A36A 4CC2A 2H8HA 2RMOA 2KGTA 2F2VA 4ZNXA 3M0SA 1X2KA 3GBQA 1AWWA 1RUWA 4F17A 1WXTA 4LE9A 1PRMC 5IXBA 3VS7A 1ARKA 1VYTA 2BZYA 1AZEA 4RTZA 1ZLMA 2HSPA 2PNIA 2LMJA 2YUNA 2DL4A 1ZUUA 1PKTA 1GCQC 1YP5A 1ABQA 2DMOA 2KT1A 1ABOA 1V1CA 2F2WA 2K2MA 2LZ6B 4LUDA 1SSHA 2JS2A 1PKSA 2JMAA 3UATA 1N5ZA 2GNCA 1AZGB 3THKA 1OEBA 2LQWA 2RQUA 2XMFA 1GL5A 1QLYA 2HCKA 2L3QA 3ZL7C 2KT8A 1I1JA 2JM9A 4WCIA 5GJVB 1GCQA 2FO0A 2ECZA 2J7IA 4OMQA 3H0HA 1AOJA 1U3OA 1FYNA 2KR3A 2DE0X 3EG3A 2RQTA 2OI3A 3PE0A 4AG1C 4J9EA 2BZXA 4J9FA 1T0JA 4Z89A 2B86A 2J06A 2ROLA 4RTTA 1WX6A 1IO6A 1VYVA 3H0IA 1KSWA 2EGAA 2JW4A 1TUCA 2FG0A 5GJWB 3IQLA 2AK5A 2C0OA 2KE9A 3SEMA 3M0RA 1B3QA 1G2BA 1ZUYA 2YUOA 2A28A 1WXBA 2YT6A 2EGCA 2KYMA 1JXMA 2JS0A 3M0QA 1K0XA 2YUQA 4ESRA 1JXOA 3M0PA 2O88A 2D8HA 2BZ8A 5EC7A 1A0NB 2D8JA 1SRMA 3I5RA 1BK2A 1GFDA 3LH5A 1ZUKA 1X27A 3RNJA 4OMNA 4K11A 2O9VA 2ESWA 1KJWA 2O2OA 5IHNA 1X2QA 2RQRA 3EHQA 1WA7A 1QCFA 1TG0A 2KRNA 1M27C 1I07A 1UHCA 1YCSB 3R6NA 1MV0B 1AWXA 2EPDA 1S1NA 2ROTA 2HEQA 5ECAA 1QWFA 1YWPA 4A63B 4J9DA 4R0KA 3VS2A 2EW3A 2EGEA 2VVKA 4KRTA 1UGVA 3EG2A 1NYGA 3UA6A 4EIKA 1I0CA 1FMKA 2GQIA 1AD5A 1WYXA 4AG2C 2VWFA 1WFWA 1NYFA 1H92A 1KIKA 2DJQA 4F14A 3A98A 2MCNA 2EKHA 2SEMA 4LUEA 1RLPC 2DLPA 2LJ0A 4OMPA 2PTKA 4QT7A 2J6KA 4Y92A 5IH2A 2MOXA 3REAB 3REBB 1M30A 1SPKA 2DL5A 1HD3A 4JZ4A 2J6OA 2KRMA 2L3PA 4E6RA 4RTUA 2DRKA 4J9HA 1RI9A 1GCPA 4JJDA 2DBMA 4J9BA 1X6BA 4J9CA 3EG0A 2EYZA 2JMCA 4CC4B 1RLQC 2AKKA 3EG1A 1WXUA 3JV3A 3U23A 3NMZC 2LX7A 1X43A 1YWOA 2FPEA 1OPLA 1BBZA 1BU1A 2CREA 2LNHB 1TUDA 2KEAA 2CT3A 2FPFA 2J6FA 1Y0MA 1AWJA 2AKLA 5FWBA 1W70A 1PRLC 1UJ0A 2KRSA 1NLPC 2E5KA 2L3SA 3CQTA 1K4US 1HSQA 2PZ1A 2RQWA 2DX1A 1SHFA 1GBQA 2NWMA 1JU5C 2BTTA 2K79A 3TSZA 1H3HA 1X6GA 2GTOA 4JPBW 1CKBA 2O31A 2C0TA 4ORZA 2DL8A 2CH4W 3H41A 4JJCA 1AWOA 2P4RA 1M3CA 3VRYA 4DEYA 2M0YA 2YUPA 1CKAA 4OMLA 5IXFA 1NEBA 2G6FX 2K9GA 5HCKA 2O9SA 2HBWA 2I0NA 1VYUA 1PHTA 2QDLA 2LJ1A 4Z88A 1OOTA 2YDLA 1XOVA 2OAWA 1UE9A 1VA7A 4AFUC 3VS1A 2JM8A 2FRYA 2X3WD 1K9AA 2DF6A 1NM7A 1T3SA 1W6XA 2KYBA 1NG2A 1UTIA 1YN8A 1Z9QA 2FRWA 5I22A 3ULRB 3O5ZA 1GBRA 4RTXA 2JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8K A;  2OJ2 A;  3VS5 A;  1UUE A;  3H0F A;  2MIO A;  3NPF A;  2CUD A;  1E7O A;  4RUG A;  1NEG A;  1AEY A;  2M51 A;  1KFZ A;  2CT4 A;  1LCK A;  2F2X A;  1PNJ A;  4AFZ C;  2RQV A;  2SRC A;  4IIM A;  1BB9 A;  5FWC A;  2ED1 A;  1WDX A;  1GRI A;  2AZS A;  3M0U A;  2X3X D;  1Z9Z A;  3NHN A;  1B07 A;  4LN2 A;  2KXC A;  2KNB B;  1M8M A;  2D0N A;  4J9I A;  1E6H A;  2DNU A;  1SEM A;  4D8D A;  2CSI A;  4HVW A;  4HVU A;  4OMM A;  3EGU A;  4RTY A;  3QWX X;  2AZV A;  2D1X A;  5I11 A;  4RTW A;  2EVR A;  3PVQ A;  2RF0 A;  1UEC A;  1WIE A;  2LCS A;  4GLM A;  4JZ3 A;  1SHG A;  2CDT A;  2K6D A;  2DL3 A;  2IIM A;  2GTJ A;  1K76 A;  5IHK A;  1MUZ A;  2ENM A;  4CC7 A;  4J9G A;  1PWT A;  2GGR A;  3NGP A;  3TVT A;  1UHF A;  2FEI A;  2GBQ A;  1SRL A;  2EBP A;  1T0H A;  1WI7 A;  2VKN A;  2L2P A;  3QWY A;  3TSW A;  2K3B A;  1J3T A;  4JJB A;  2RN8 A;  2DVJ A;  3VRZ A;  2JXB A;  2DIL A;  1EFN A;  1ZX6 A;  2KXD A;  4HVV A;  2V1R A;  1K1Z A;  1QKW A;  2K7A A;  2EYY A;  3KFV A;  1OV3 A;  2CH4 A;  3FJ5 A;  3RBB B;  1UJY A;  3PVL A;  2L0A A;  1UG1 A;  1Y57 A;  3I9Q A;  1JEG A;  2LQN A;  2HDA A;  4Z8A A;  5L23 A;  4OMO A;  3UA7 A;  1UFF A;  1U5S A;  2C0I A;  1M3B A;  2LP5 A;  5FW9 A;  4HCK A;  2W10 A;  1OPK A;  2RNA A;  2ABL A;  3UF4 A;  1WLP B;  1W1F A;  3SHW A;  3VS3 A;  2CUB A;  1YNZ A;  4CC3 A;  4DEX A;  1X69 A;  1JO8 A;  4RTV A;  1UDL A;  2J05 A;  2DM1 A;  5IHI A;  1AVZ C;  2KRO A;  3VS4 A;  2RPN A;  4M4Z A;  3M0T A;  2EYW A;  2EQI A;  2NUZ A;  4FSS A;  2FPD A;  1K0S A;  4GBQ A;  2DL7 A;  1QWE A;  1GFC A;  1ZBJ A;  2DBK A;  1HJD A;  2DRM A;  1E6G A;  1QKX A;  3EHR A;  3VS0 A;  2V1Q A;  4AFS C;  2W0Z A;  4LNP A;  4AFQ C;  2EYX A;  3VS6 A;  2ED0 A;  4X1V A;  2DYB A;  2KBT A;  3C0C A;  4HXJ A;  1T3L A;  2CSQ A;  2LJ3 A;  1G83 A;  3I5S A;  2YSQ A;  4IIO A;  4F16 A;  1MV3 A;  2A37 A;  2DA9 A;  2JTE A;  1JQQ A;  1NLO C;  1CSK A;  1H8K A;  1M3A A;  1U06 A;  3I35 A;  2A08 A;  1ZSG A;  2A36 A;  4CC2 A;  2H8H A;  2RMO A;  2KGT A;  2F2V A;  4ZNX A;  3M0S A;  1X2K A;  3GBQ A;  1AWW A;  1RUW A;  4F17 A;  1WXT A;  4LE9 A;  1PRM C;  5IXB A;  3VS7 A;  1ARK A;  1VYT A;  2BZY A;  1AZE A;  4RTZ A;  1ZLM A;  2HSP A;  2PNI A;  2LMJ A;  2YUN A;  2DL4 A;  1ZUU A;  1PKT A;  1GCQ C;  1YP5 A;  1ABQ A;  2DMO A;  2KT1 A;  1ABO A;  1V1C A;  2F2W A;  2K2M A;  2LZ6 B;  4LUD A;  1SSH A;  2JS2 A;  1PKS A;  2JMA A;  3UAT A;  1N5Z A;  2GNC A;  1AZG B;  3THK A;  1OEB A;  2LQW A;  2RQU A;  2XMF A;  1GL5 A;  1QLY A;  2HCK A;  2L3Q A;  3ZL7 C;  2KT8 A;  1I1J A;  2JM9 A;  4WCI A;  5GJV B;  1GCQ A;  2FO0 A;  2ECZ A;  2J7I A;  4OMQ A;  3H0H A;  1AOJ A;  1U3O A;  1FYN A;  2KR3 A;  2DE0 X;  3EG3 A;  2RQT A;  2OI3 A;  3PE0 A;  4AG1 C;  4J9E A;  2BZX A;  4J9F A;  1T0J A;  4Z89 A;  2B86 A;  2J06 A;  2ROL A;  4RTT A;  1WX6 A;  1IO6 A;  1VYV A;  3H0I A;  1KSW A;  2EGA A;  2JW4 A;  1TUC A;  2FG0 A;  5GJW B;  3IQL A;  2AK5 A;  2C0O A;  2KE9 A;  3SEM A;  3M0R A;  1B3Q A;  1G2B A;  1ZUY A;  2YUO A;  2A28 A;  1WXB A;  2YT6 A;  2EGC A;  2KYM A;  1JXM A;  2JS0 A;  3M0Q A;  1K0X A;  2YUQ A;  4ESR A;  1JXO A;  3M0P A;  2O88 A;  2D8H A;  2BZ8 A;  5EC7 A;  1A0N B;  2D8J A;  1SRM A;  3I5R A;  1BK2 A;  1GFD A;  3LH5 A;  1ZUK A;  1X27 A;  3RNJ A;  4OMN A;  4K11 A;  2O9V A;  2ESW A;  1KJW A;  2O2O A;  5IHN A;  1X2Q A;  2RQR A;  3EHQ A;  1WA7 A;  1QCF A;  1TG0 A;  2KRN A;  1M27 C;  1I07 A;  1UHC A;  1YCS B;  3R6N A;  1MV0 B;  1AWX A;  2EPD A;  1S1N A;  2ROT A;  2HEQ A;  5ECA A;  1QWF A;  1YWP A;  4A63 B;  4J9D A;  4R0K A;  3VS2 A;  2EW3 A;  2EGE A;  2VVK A;  4KRT A;  1UGV A;  3EG2 A;  1NYG A;  3UA6 A;  4EIK A;  1I0C A;  1FMK A;  2GQI A;  1AD5 A;  1WYX A;  4AG2 C;  2VWF A;  1WFW A;  1NYF A;  1H92 A;  1KIK A;  2DJQ A;  4F14 A;  3A98 A;  2MCN A;  2EKH A;  2SEM A;  4LUE A;  1RLP C;  2DLP A;  2LJ0 A;  4OMP A;  2PTK A;  4QT7 A;  2J6K A;  4Y92 A;  5IH2 A;  2MOX A;  3REA B;  3REB B;  1M30 A;  1SPK A;  2DL5 A;  1HD3 A;  4JZ4 A;  2J6O A;  2KRM A;  2L3P A;  4E6R A;  4RTU A;  2DRK A;  4J9H A;  1RI9 A;  1GCP A;  4JJD A;  2DBM A;  4J9B A;  1X6B A;  4J9C A;  3EG0 A;  2EYZ A;  2JMC A;  4CC4 B;  1RLQ C;  2AKK A;  3EG1 A;  1WXU A;  3JV3 A;  3U23 A;  3NMZ C;  2LX7 A;  1X43 A;  1YWO A;  2FPE A;  1OPL A;  1BBZ A;  1BU1 A;  2CRE A;  2LNH B;  1TUD A;  2KEA A;  2CT3 A;  2FPF A;  2J6F A;  1Y0M A;  1AWJ A;  2AKL A;  5FWB A;  1W70 A;  1PRL C;  1UJ0 A;  2KRS A;  1NLP C;  2E5K A;  2L3S A;  3CQT A;  1K4U S;  1HSQ A;  2PZ1 A;  2RQW A;  2DX1 A;  1SHF A;  1GBQ A;  2NWM A;  1JU5 C;  2BTT A;  2K79 A;  3TSZ A;  1H3H A;  1X6G A;  2GTO A;  4JPB W;  1CKB A;  2O31 A;  2C0T A;  4ORZ A;  2DL8 A;  2CH4 W;  3H41 A;  4JJC A;  1AWO A;  2P4R A;  1M3C A;  3VRY A;  4DEY A;  2M0Y A;  2YUP A;  1CKA A;  4OML A;  5IXF A;  1NEB A;  2G6F X;  2K9G A;  5HCK A;  2O9S A;  2HBW A;  2I0N A;  1VYU A;  1PHT A;  2QDL A;  2LJ1 A;  4Z88 A;  1OOT A;  2YDL A;  1XOV A;  2OAW A;  1UE9 A;  1VA7 A;  4AFU C;  3VS1 A;  2JM8 A;  2FRY A;  2X3W D;  1K9A A;  2DF6 A;  1NM7 A;  1T3S A;  1W6X A;  2KYB A;  1NG2 A;  1UTI A;  1YN8 A;  1Z9Q A;  2FRW A;  5I22 A;  3ULR B;  3O5Z A;  1GBR A;  4RTX A;  2JT4 A; 
#chains in the Genus database with same CATH topology
 3GPL A;  5FRO A;  2K4Y A;  2QI2 A;  4M7D C;  2GFA A;  3E2U A;  2DXC A;  2VC8 A;  2P0P A;  4RUG A;  4C92 F;  3CCQ Q;  2CT4 A;  1ZQ1 A;  3QYG B;  2RH2 A;  1LCK A;  4XTX A;  3RMQ A;  4BE2 A;  2RQV A;  2EKO A;  1VIF A;  3OQ5 A;  1C6V X;  5LJ3 h;  3WVE B;  1U1T A;  2AZS A;  2PUK B;  1VQO A;  1HK9 A;  1SG5 A;  3M0U A;  3OBY A;  2DET A;  4ZTF A;  2DAQ A;  4JLI A;  2KNB B;  1PSF A;  5CQX A;  3A8H B;  5LJ3 f;  4F7U G;  5LJ3 g;  4OP0 A;  4FT2 A;  1KQ2 A;  1Q86 R;  1VQ9 A;  2CSI A;  3EGD B;  4OMM A;  3E9F A;  2FZG B;  2D1X A;  3HFN A;  2V8J A;  4RTW A;  2RF0 A;  4MMK A;  4XU0 A;  2K6D A;  2IIM A;  4CC7 A;  2P4T A;  1PWT A;  1EZZ B;  3TQ7 P;  1UHF A;  3TVT A;  2EBP A;  1U1S A;  2VKN A;  4E7I A;  2L2P A;  3SDZ A;  3QWY A;  2K3B A;  1M90 R;  1J3T A;  1VQ6 Q;  2OTL Q;  2RN8 A;  2DVJ A;  4M77 E;  1ZX6 A;  2KVQ G;  5FU7 C;  2NYS A;  3CCQ A;  4JS5 A;  4FCY A;  1QKW A;  2D0Q B;  1OV3 A;  2WAC A;  3QG1 A;  2ZPE B;  3RBB B;  1UJY A;  2RA2 A;  1RAA B;  1UG1 A;  1RL2 A;  1Y57 A;  3I9Q A;  3C95 A;  3OYM A;  1KQS S;  4Z8A A;  2L3R A;  4RMO A;  4A4E A;  4C92 A;  1U5S A;  5CAI A;  2W10 A;  3GF5 A;  2GQV A;  2R58 A;  1WLP B;  1KQS A;  3PMT A;  2CZ0 B;  2K3Y A;  2RHX A;  3A5Z B;  4F7U F;  1BCM A;  5LJ5 f;  3VS4 A;  5LJ5 g;  2EYW A;  3NTI A;  1MMN A;  4C5H A;  4FSS A;  5D6Y A;  2DL7 A;  4PJJ A;  4HCC A;  2FL7 A;  3JAM E;  1GFC A;  1YIT A;  2DBK A;  2KDS A;  4XTV A;  3J80 E;  3GP8 A;  1E6G A;  2W0Z A;  4LNP A;  1RAB B;  1YJN Q;  2KBT A;  3OS1 A;  1VQN T;  5GAO m;  2LQK A;  4HXJ A;  2E64 A;  2ZPF B;  3I5S A;  1O9S A;  5GAO q;  4IIO A;  2FYK A;  3H6Z A;  3CD6 Q;  1QCO A;  1CSK A;  5FRM A;  4C0Z A;  1H8K A;  1M3A A;  4PLL A;  3I35 A;  3CCU A;  1K73 R;  2NUP A;  2A08 A;  8ATC B;  1ZSG A;  1G8X A;  1IHW A;  4JLG A;  4DBR A;  2RI5 A;  2XU8 A;  2O01 E;  4II1 A;  4PJO B;  3M5A A;  4KT0 E;  4HA8 A;  3OA6 A;  1RUW A;  4F17 A;  1PRM C;  2BE9 B;  5IXB A;  3VS7 A;  5D6X A;  1ARK A;  2CZ6 B;  2DPP B;  4RKU E;  2DL4 A;  4MDW A;  2EJ9 A;  1VQL Q;  1D1B A;  2FZK B;  3EAE A;  4LXC A;  3CME Q;  1OX9 A;  2JVV A;  5FU7 B;  3E9G A;  1YJW A;  2OTJ T;  1V1C A;  4J83 A;  4HCZ A;  2JJ9 A;  4M75 B;  1N6A A;  2GNC A;  2IG0 A;  1G5V A;  1OEB A;  2DKG A;  4M7D D;  2HCK A;  1KHC A;  2DFU A;  5KYU A;  2JM9 A;  4WCI A;  5GJV B;  2RM4 A;  1D09 B;  2ECZ A;  1VQ7 T;  5A2Q E;  3I56 T;  1B34 A;  3QJ6 A;  3CCS T;  1FYN A;  2DE0 X;  2FHD A;  3PE0 A;  4EMK B;  4Y28 E;  3CXC P;  1C1A A;  1X6O A;  3SB2 A;  2J06 A;  4RTT A;  1VYV A;  3CCE A;  3A8O B;  1TUC A;  2NUT B;  1B7T A;  3MCA B;  2MYS A;  2C0O A;  2KE9 A;  2RHZ A;  3HFO A;  3CBP A;  2JZ2 A;  2LRQ A;  2YT6 A;  3CXC S;  4C5E A;  3JCM c;  1K0X A;  4ESR A;  3JCM d;  4A4F A;  4BI4 A;  2P0Q A;  2QYZ A;  1MNE A;  2KI7 A;  2D8H A;  5GMK e;  1H3Z A;  4PJO D;  3X25 B;  3CME A;  1UEB A;  1X27 A;  2O9V A;  2XDP A;  3M56 A;  3JCM W;  2O2O A;  1W2B S;  1M2V A;  1QW1 A;  1TU0 B;  1TG0 A;  5GAN 2;  1MV0 B;  1AWX A;  1LOJ A;  4XQ3 A;  4M75 D;  1I5L A;  1WHJ A;  5ECA A;  5GAO l;  4J9D A;  2E5Q A;  1K8A R;  2EW3 A;  2EGE A;  4A53 A;  5GAN f;  5GAN g;  2VVK A;  1NYG A;  3UA6 A;  4EIK A;  2HAX A;  3ASK A;  2GQI A;  3HKS A;  1D0X A;  2VAS A;  3CPW A;  1WFW A;  1NYF A;  1H92 A;  4N0A C;  4GLK A;  4M78 E;  5A0L A;  2CGH A;  2SEM A;  1Q82 R;  4IUT A;  4QT7 A;  2J6K A;  4Y92 A;  5IH2 A;  4BDY A;  3MP8 A;  3REB B;  4MDX A;  1HD3 A;  3G6E T;  2L3P A;  4E6R A;  1QP2 A;  2KK4 A;  2DBM A;  4J9B A;  3CC2 Q;  1P92 A;  1QQJ A;  2EQK A;  2H3E B;  4PJO G;  3F70 A;  2G3R A;  2Y4X A;  3FEO A;  2FPE A;  4JJN K;  2LNH B;  1BU1 A;  4ZN1 A;  4ME7 A;  2KEA A;  1Q7Y C;  1IRX A;  1IZ6 A;  1VQ8 Q;  1EIF A;  5FWB A;  1W70 A;  5M9O A;  4LDW A;  1M9S A;  3CQT A;  1HSQ A;  4M75 G;  1MMG A;  2DX1 A;  3CMA A;  2NWM A;  4FU6 A;  2DTI A;  1N8R C;  4Z02 A;  2K79 A;  3TSZ A;  1H3H A;  1X6G A;  2JUF A;  4JPB W;  3EGD A;  2C0T A;  2QTX A;  3CCV A;  1OX8 A;  4DEY A;  2M0Y A;  1BI3 A;  4OML A;  2RJF A;  4E2F B;  2O9S A;  3UPU A;  5CCA A;  2YDL A;  2OAW A;  3CC2 A;  1RAC B;  3GNF B;  2X3W D;  1BI2 A;  1T3S A;  1R77 A;  1N9R A;  1NG2 A;  1V76 A;  1Z9Q A;  4PJO F;  3LH0 A;  2FRW A;  4KGX B;  3OYI A;  5AT1 B;  5I22 A;  1YIJ T;  1I4K 1;  1G3T A;  4RTX A;  2EIF A;  2EQJ A;  3RKY A;  2OJ2 A;  3DKM A;  2BUD A;  1UUE A;  7AT1 B;  2DXU A;  2MIO A;  2CUD A;  1E7O A;  1Q81 C;  1AEY A;  2CYZ B;  1K9M C;  1N8R U;  2F2X A;  4F04 B;  3AHU A;  4AFZ C;  4MZP A;  1PM3 A;  4XU3 A;  3I55 A;  1HYO A;  4M75 F;  1BB9 A;  1QVG S;  2X3X D;  2EJG A;  2LX9 A;  4C5I A;  3D7S B;  4C8Q G;  2F1L A;  3JCM Q;  3RIR A;  3CCM A;  4CI0 C;  2KXC A;  1M8M A;  1RAG B;  5IAY A;  4D8D A;  1IGU A;  1SEM A;  2COW A;  3FRN A;  4XU1 A;  4HVU A;  4RTY A;  3OYE A;  4LDX A;  1D0Y A;  4DOV A;  2F69 A;  5I11 A;  3OMC A;  3CCR Q;  2K5L A;  3PVQ A;  5GAM f;  1WIE A;  2LCS A;  3M57 A;  4GLM A;  1M1G A;  2MWP A;  5GAM g;  4JZ3 A;  2DL3 A;  2GTJ A;  2QGG A;  3ME9 A;  4OB3 B;  4J9G A;  1VQ4 T;  5LJ3 j;  2GGR A;  2HNI A;  2CP6 A;  4AT1 B;  1LJO A;  3S3O A;  3TSW A;  1YJ9 A;  1Q81 U;  4JJB A;  4FYV B;  3OYA A;  1K9M U;  3BY7 A;  3VRZ A;  3BW1 A;  3QDR B;  1IRE B;  4HVV A;  5LJ3 d;  1K1Z A;  4PJO A;  3OBW A;  3VKI A;  1QCN A;  5CKH A;  3FJ5 A;  1VQO Q;  3PVL A;  2L0A A;  2PQW A;  3V7R A;  1JEG A;  2LQN A;  2HDA A;  1KD1 C;  2AT1 B;  4OMO A;  3CC7 Q;  5D7U A;  1TWB A;  1YHQ A;  5KCO A;  5L8R E;  3QO3 A;  1M2O A;  3OB9 A;  1KG1 A;  2PU9 B;  3RKW A;  3UF4 A;  1W1F A;  3SHW A;  1YNZ A;  4M75 A;  1JO8 A;  4RTV A;  2J05 A;  3G71 A;  2QEX Q;  1VQP Q;  3M0T A;  3L2R A;  4M7D E;  3OYH A;  2FPD A;  1S72 Q;  1BIA A;  1NJI C;  1QWE A;  1SSF A;  1ZBJ A;  2VGM A;  2BE7 D;  2DRM A;  2EQU A;  3VS0 A;  2V1Q A;  3INZ A;  5LL6 S;  1W4S A;  4A4K A;  4AFQ C;  2EYX A;  3VS6 A;  4OB0 B;  4EMK A;  4IUP A;  5KH6 A;  5LJ5 j;  2LJ3 A;  2X4X A;  2YHT A;  2NUT A;  2YSQ A;  1MV3 A;  2QQB A;  1JQQ A;  1KD1 U;  3M59 A;  2A7Y A;  3RES A;  2JNG A;  2QA4 T;  4ZTJ A;  2A36 A;  1R8O B;  4CC2 A;  2H8H A;  2RMO A;  4E7S A;  3CC7 A;  1D3B B;  3CCL A;  2RHI A;  5I2M A;  1LNX A;  2CP7 A;  3JB9 J;  2PNI A;  3OYY A;  5CO7 A;  2LMJ A;  2YUN A;  4OB1 B;  2EFI A;  2QEX A;  1ZUU A;  1PKT A;  1NJI U;  3NTH A;  1GCQ C;  1VQP A;  1ABQ A;  2KT1 A;  1ABO A;  1YIT Q;  3MHX A;  1S72 A;  2K2M A;  4LUD A;  2ZCF B;  2MMP A;  2E4H A;  1SSH A;  1D1C A;  2VXF A;  4PJO C;  4RCB A;  5IN1 A;  2OTL T;  3ZL7 C;  4OF1 A;  1I1J A;  5CK9 A;  1JRI A;  2COY A;  2M9U A;  1G3Y A;  2FO0 A;  4Q5W A;  2J7I A;  3H0H A;  1AOJ A;  1PC0 A;  1WJQ A;  2LVM A;  2BIV A;  2KR3 A;  3EG3 A;  4M75 C;  3JB9 G;  3LW5 E;  1WHM A;  3OSS C;  1T0J A;  3CCU Q;  2ROL A;  3P8D A;  1YFN A;  3H0I A;  3CC4 A;  5LJ5 h;  2K3X A;  2DXB A;  4DA4 A;  2X51 A;  1G2B A;  2YUO A;  1N27 A;  2A28 A;  2DEU A;  2KYM A;  1UGQ B;  3M0Q A;  4EMK C;  2HL3 A;  3X24 B;  4PJN A;  3M0P A;  5CKE A;  2O88 A;  2KMT A;  2XHC A;  3OYK A;  1TXQ A;  2BZ8 A;  2DO3 A;  4XTU A;  1YJW Q;  3I5R A;  1BK2 A;  2DXT A;  4JS4 A;  5KE2 A;  2QA4 A;  2XDD A;  1WPY A;  3JCM e;  2ESW A;  3G4S T;  3GOX A;  1YJN T;  2E70 A;  2RQR A;  4KBM B;  3VJP A;  1QCF A;  2D6F A;  1QVF P;  4PL6 A;  2KRN A;  1XNI A;  1I07 A;  2PVG B;  4QKU A;  1UHC A;  4BY6 C;  1QP3 A;  4X34 A;  3EG9 B;  4JDS A;  2EPD A;  4FW1 A;  3CD6 T;  1KC8 C;  1EX4 A;  2HEQ A;  2ROT A;  2X4J A;  3PNW C;  4J8O A;  1YWP A;  1X01 A;  2ZPB B;  2VB6 A;  3JB9 I;  2RHU A;  2VUB A;  1QVF S;  3SWN C;  3CCE Q;  3UDC A;  4KRT A;  1Y96 B;  2DER A;  2RK1 A;  1I0C A;  4FW2 A;  1FMK A;  1WYX A;  4AG2 C;  3KUF A;  3FLG A;  5AYF A;  2RB6 A;  4C8Q C;  3RMS A;  4XAX B;  3EFO A;  4OGC A;  2MCN A;  2EKH A;  1RI0 A;  1VQL T;  1RLP C;  1MMA A;  4M7A G;  4C0G A;  4OMP A;  5GAN j;  3WXM B;  4JRP A;  4PFP A;  2DD4 A;  3FC3 A;  4C92 E;  2RHY A;  3OS2 A;  1M30 A;  1SPK A;  4JZ4 A;  1NBE B;  4N0A A;  2KRM A;  2VGN A;  2QG9 B;  4PJM A;  2DRK A;  2E12 A;  4J9H A;  1RI9 A;  4J7I A;  4JJD A;  2LDM A;  1X6B A;  4F7U A;  2DZ9 A;  2JMC A;  1V29 B;  5FU6 B;  4CC4 B;  3HPW A;  1KC8 U;  2AKK A;  3EG1 A;  3NMZ C;  4HT8 A;  4C0F A;  2LQ8 A;  3MJX A;  3QUI A;  4R56 A;  1X43 A;  1YWO A;  1OPL A;  2CRE A;  3OS0 A;  2OTJ Q;  4ZGD B;  2F5K A;  1PRL C;  2P84 A;  1JJ2 P;  2HQE A;  1F1B B;  5GAO p;  2DYI A;  2E5K A;  4FL6 A;  2VYT A;  2RQW A;  1YCY A;  3HRS A;  3AT1 B;  1SHF A;  5CIU A;  1HXD A;  1VQN A;  1JU5 C;  3ZEH A;  5FLX E;  2BTT A;  5GAN 6;  8AT1 B;  1JJ2 S;  4BY6 B;  1VQK T;  2GTO A;  4FIB A;  2BKD N;  3QSU A;  1CKB A;  2O31 A;  4MZM A;  3TCJ A;  4ORZ A;  2ATC B;  4JJC A;  2P4R A;  1M3C A;  3VRY A;  2YUP A;  3CXC A;  4QQ6 A;  5GAN 7;  2XID A;  5GAN 5;  4M7A F;  2QDY B;  3DLL A;  2QDL A;  4ZGJ B;  3SWN B;  1XOV A;  1IGQ A;  1VA7 A;  3X28 B;  2CZ1 B;  4ELZ C;  3JB9 H;  4EDU A;  4VUB A;  5GAN h;  2PVD B;  2K5F A;  1K9A A;  2LT1 A;  3G1J A;  5GMK i;  1QVP A;  2KYB A;  4KUD K;  4C8Q B;  3HP9 A;  1W2B A;  1KK7 A;  5HK0 A;  3LYI A;  4KGZ B;  2ZPH B;  2L5Q A;  1FMW A;  2OTJ A;  3CPW P;  4E7K A;  3TRE A;  1GBR A;  2GF7 A;  4D8K A;  2FZC B;  3C12 A;  4F7U E;  1NZ9 A;  1TH7 A;  3H0F A;  4EMH A;  3CMA Q;  2DK3 A;  3NPF A;  1NEG A;  2IVW A;  3H8Z A;  2LCL A;  5GAO r;  2MWO A;  3PFS A;  4C5G A;  4PFZ A;  3OS5 A;  1VQ7 A;  5GAN 8;  2AHJ B;  5FWC A;  3BDL A;  3I56 A;  1WDX A;  1NE8 A;  3OYD A;  1WHH A;  4N4H A;  3CCS A;  3CCV Q;  1Z9Z A;  1JBM A;  3NHN A;  1IHV A;  4EPC A;  1B07 A;  4LN2 A;  1WHL A;  2A3L A;  4KUI A;  5KYY B;  3NTK A;  4ZN3 A;  2DNU A;  3DLM A;  5GAN 4;  1SKU B;  3EH2 A;  3EGU A;  3QWX X;  2AZV A;  2RJD A;  3H9N A;  1WZO A;  4ANJ A;  2DD5 A;  1UEC A;  1WHG A;  2QAS A;  3ZFJ A;  1LPL A;  1IB8 A;  1BIB A;  2K5I A;  4UC4 A;  1K76 A;  2ENM A;  3O8V A;  1VQ8 T;  1R0C B;  2PVO B;  4NL3 A;  2GBQ A;  3JCM f;  5I21 A;  3VU3 C;  1YI2 T;  2RO0 A;  3G6E Q;  1SRL A;  1T0H A;  2K2V A;  3PGG A;  3CCJ T;  1Y7X A;  5CKD A;  1WQ7 A;  4C8Q D;  3VUZ A;  5GAM j;  2X9H A;  2Y4Y A;  3I55 Q;  1D3B A;  4O5V A;  5J3B A;  5KYN A;  2K7A A;  3V8L A;  3MEV A;  2CP5 A;  2CH4 A;  4KH0 B;  1WQW A;  2YLC A;  2X4Y A;  2DTH A;  4JRQ A;  1BI1 A;  3CBM A;  3OMG A;  5L23 A;  3CCM Q;  1VQM T;  2VXE A;  4DBH A;  3VYG A;  3UA7 A;  1UFF A;  5LJ3 e;  3LLR A;  3EGX B;  4J6X A;  1M3B A;  2LP5 A;  5FW9 A;  2OX7 A;  4HCK A;  2WSE E;  1OPK A;  2XKO C;  4CC3 A;  2K57 A;  1X69 A;  3HHT B;  4QQD A;  1UDL A;  2DM1 A;  5IHI A;  1AVZ C;  2KRO A;  2RPN A;  4M4Z A;  3P8H A;  3WVD B;  2O4X B;  2EQI A;  3L2V A;  1K0S A;  1DJ7 B;  1PD0 A;  1M1K C;  1WJS A;  2EJF A;  1HJD A;  3QZ9 B;  3OW2 P;  1M4Z A;  1YJ9 Q;  2ED0 A;  4X1V A;  3G6E A;  3C0C A;  3DB3 A;  1X75 C;  1T3L A;  2MAM A;  3JCM X;  5HKC A;  2A0F B;  1G83 A;  4N4G A;  3QDF A;  1VQ5 T;  3OW2 S;  4PFO A;  4X9D A;  2VV5 A;  4F16 A;  2A37 A;  4KUL A;  3MET A;  1NLO C;  3MP1 A;  2HBP A;  1OYX A;  3QXE B;  4E7H A;  1YHQ Q;  1YIJ Q;  2F5T X;  1IXD A;  1MHN A;  3X26 B;  2KGT A;  3QJY A;  4M78 B;  2F2V A;  4ZNX A;  4M7A C;  4PKC C;  1Q86 C;  3GBQ A;  5GAM h;  1AWW A;  3PMI A;  4A54 A;  2CZ7 B;  4RCC A;  3G71 Q;  1QVG A;  5GMK h;  3CCR T;  2LC4 A;  1M8V A;  5LJ5 e;  1AZE A;  3GNG A;  4RTZ A;  2HSP A;  2DZC A;  2DTO A;  2E6Z A;  2EQM A;  2DMO A;  1YP5 A;  1M1K U;  4O6J A;  3EG9 A;  2DIQ A;  3VUB A;  2LNV A;  2LZ6 B;  3BFM A;  3EH1 A;  1PKS A;  5KYX B;  3UAT A;  1VQM A;  1LVK A;  1I5O B;  2RQU A;  3MEU A;  3G7Z A;  1QLY A;  1GL5 A;  3OSV A;  1M90 C;  2DIG A;  2L3Q A;  3L2U A;  2KT8 A;  2DJZ A;  3VYH B;  3MEA A;  1Y96 A;  4FYW B;  3L2W A;  2Y90 A;  1BKB A;  1GCQ A;  2HKQ B;  5CQY A;  1U3O A;  1VQO T;  2L89 A;  2V8K A;  3P8B B;  2ZPI B;  3NFC A;  3JCM P;  3DB4 A;  4IUV A;  4J9E A;  2BZX A;  1Q7Y R;  1RAD B;  2B86 A;  1JB0 E;  1WX6 A;  1IO6 A;  2EGA A;  3X20 B;  1BCO A;  1YIJ A;  1Q86 U;  3CCL Q;  5GJW B;  2XDB A;  3IQL A;  1VQ9 T;  1MMD A;  4LD9 K;  4OMF B;  3SEM A;  2XG8 D;  4FT4 A;  4P5N A;  1B3Q A;  1ZUY A;  5CVI A;  4C8Q F;  1WXB A;  2ZAE A;  2EGC A;  2YRD A;  3J7A F;  4QQG A;  2JTF A;  2YUQ A;  3J81 E;  2QQA A;  1JXO A;  1N8R R;  2KY9 A;  1VOM A;  4PLI A;  3V7S A;  2E3I A;  1A0N B;  1SRM A;  1M5Q 1;  1OZ3 A;  2E65 A;  1GFD A;  3JRZ A;  4IUR A;  4PK4 A;  4A4H A;  4K11 A;  1PG5 B;  3S3M A;  1M90 U;  1KJW A;  5IHN A;  1X2Q A;  4BE0 A;  3JB9 D;  3EHQ A;  1WA7 A;  3QHS A;  5C6S A;  4J5Y A;  3RER A;  2YWW A;  4WF2 A;  3CCQ T;  1MGQ A;  1YCS B;  1TOV A;  4FSX A;  4M7A B;  5CKB A;  3LWH A;  1I81 A;  1S1N A;  3PIO A;  3JCM b;  2M0O A;  4R0K A;  2X35 A;  3QKJ A;  4BUG A;  1K73 C;  3CC4 Q;  1UGV A;  1VQ4 A;  5LJ5 d;  4ELY C;  3QZ5 B;  2R5A A;  4NS5 A;  2L8D A;  2VWF A;  5A0D A;  2NLU A;  1Q81 R;  1K9M R;  3PT9 A;  3A98 A;  4PJO E;  3T9N A;  1TS9 A;  1XTD A;  1ZSZ C;  2LJ0 A;  3SWN A;  5GAO n;  6AT1 B;  1YIT T;  2KQW A;  3REA B;  2QA4 Q;  1AT1 B;  3MEW A;  1OU9 A;  3UT1 A;  5FRN A;  4C8Q A;  5D6W A;  2E3H A;  4RTU A;  1ZBX A;  2X4W A;  3E19 A;  4M75 E;  1Q95 G;  1GCP A;  3M54 A;  1VQ6 T;  3V8J A;  3EG0 A;  4XTW A;  4M78 G;  4A4G A;  5DLO A;  2E1H A;  3GIB A;  3JV3 A;  2B8A A;  2EYQ A;  3RR6 A;  1QMC A;  3LX7 A;  3M58 A;  1BBZ A;  1TUD A;  3CCU T;  1K73 U;  5GAN e;  3CPF A;  1RAF B;  3RUX A;  1SF9 A;  3OYB A;  3CBO A;  1AWJ A;  1TUG B;  2AKL A;  2QQS A;  2COZ A;  4WTO B;  3RDV A;  5GMK m;  5EG2 A;  2KRS A;  1NLP C;  5FU6 C;  4M7A D;  2L3S A;  1KQS P;  1K4U S;  3R6O A;  4DBQ A;  4HCB A;  1KHI A;  2XI9 A;  1GBQ A;  5KYY A;  4DQ2 A;  1YJW T;  3M9Q A;  2E6N A;  2QXF A;  4M77 C;  2DL8 A;  2CH4 W;  3H41 A;  4MZT A;  1KD1 R;  2M1H A;  5C0M A;  4B6M A;  1CKA A;  4HT9 A;  1WGS A;  2M16 A;  5HCK A;  2HBW A;  1VYU A;  1BYM A;  1PHT A;  1Y07 A;  4LDV A;  2WSF E;  4FYY B;  3VS1 A;  4M7D B;  2FRY A;  1PSE A;  2QK0 A;  3URG A;  4J7F A;  2DF6 A;  1W6X A;  4M78 F;  2WSC E;  1ACM B;  1K8A C;  1NJI R;  1YN8 A;  4C8Q E;  3CCE T;  9ATC B;  1PCX A;  3ULR B;  1ZSZ B;  4DOW A;  2CKK A;  1ZHI A;  3VS5 A;  3G4S Q;  2V26 A;  4TVR A;  1O75 A;  3JB9 F;  4X9C A;  3HTR A;  1VQ6 A;  2OTL A;  2M51 A;  2ZZD A;  1KFZ A;  5CKF A;  1QVF A;  1VQN Q;  3E1S A;  3EGX A;  2XIC A;  1PNJ A;  4IUQ A;  4R55 A;  2SRC A;  4IIM A;  2ED1 A;  1H64 1;  1Q82 C;  2IPO B;  1GRI A;  3FJP A;  3L2Z A;  1BI0 A;  3QII A;  3CME T;  4PJL A;  5DLQ E;  5HY6 A;  2O4X A;  2D0N A;  1UGP B;  4J9I A;  1E6H A;  2HQH A;  4QVZ A;  5KYW B;  3M4Y A;  3EFS A;  1G3S A;  4HVW A;  4NOY A;  5GAN d;  4NL2 A;  4IKF A;  2EVR A;  4OVA A;  3PIP A;  4LDU A;  2QQR A;  3OY9 A;  1K8A U;  2LTO A;  4JRI A;  4KGV B;  1SHG A;  2CDT A;  3LGF A;  5IHK A;  1MUZ A;  1ZA2 B;  3LGL A;  3NGP A;  2FEI A;  1WI7 A;  3OYF A;  4M77 B;  2RD1 A;  4L59 A;  4Y91 A;  1PD1 A;  3G4S A;  1YJN A;  4C92 C;  4BAC A;  2JXB A;  2DIL A;  5GMK l;  1EFN A;  2R57 A;  1XQH A;  2KXD A;  3S3N A;  3S6W A;  2V1R A;  4DBF A;  1OQK A;  4M78 A;  1VQ7 Q;  2HQX A;  3I56 Q;  1VIE A;  1Q82 U;  2EYY A;  3KFV A;  3CD6 A;  2P0K A;  4JUV A;  3CCS Q;  3OYL A;  1N9S A;  4BE1 A;  4FM4 B;  5J26 A;  4CRI A;  4C0D C;  2MPX C;  2C0I A;  1G3W A;  3M55 A;  2RNA A;  2ABL A;  4J6W A;  1JJ2 A;  3VS3 A;  2CUB A;  5KYX A;  2RI3 A;  4MML A;  4DEX A;  3C4S A;  4J6Y A;  1W2B P;  2M02 A;  2AIR B;  5GAM e;  5A0G A;  2XK0 A;  1VQK Q;  2NUZ A;  2GFU A;  1VQL A;  3L1A A;  4GBQ A;  2CP3 A;  2HZY A;  1RAI B;  3MO8 A;  4GY5 A;  3QYH B;  1QKX A;  3EHR A;  4AFS C;  2QAZ A;  3CMA T;  2DYB A;  3FB9 A;  2QGF B;  1D0Z A;  2CSQ A;  1WJR A;  3FIF A;  4E7Z A;  2HSE B;  1KC8 R;  2H3J A;  2JTE A;  2DA9 A;  3EFR A;  3MPU B;  3CPW S;  2GCX A;  4M7D G;  3CCV T;  4M77 D;  1U06 A;  4BI3 A;  2EAY A;  3HL8 A;  3BDU A;  4PNO A;  3CEY A;  1ZA1 B;  4KH1 B;  3RKX A;  3M4G A;  3M0S A;  3OYG A;  1X2K A;  3L42 A;  1WXT A;  2E41 A;  4LE9 A;  3CC2 T;  4XU2 A;  5KE3 A;  1VYT A;  2BZY A;  1RAH B;  3TU4 K;  1ZLM A;  3JCM J;  3ZBD A;  1FX7 A;  3LWI A;  4V2S A;  3JCM h;  4C92 B;  4LDY A;  4ATO A;  3KBG A;  1VQK A;  4M78 C;  2F2W A;  3A8L B;  4M7A A;  2JS2 A;  4LD6 A;  2JMA A;  1N5Z A;  2C06 A;  1AZG B;  3THK A;  1C0M A;  2LQW A;  2CS7 A;  2XMF A;  5DM7 R;  4L5G A;  3JCM g;  1GXI E;  4XTY A;  4D6W A;  3A8M B;  1D1A A;  4HKE A;  4C0D B;  1OZ2 A;  3MKD A;  3I55 T;  3HRT A;  4OMQ A;  4B9W A;  1OU8 A;  5GMK j;  2LT4 A;  2ZPG B;  2RQT A;  2OI3 A;  4AG1 C;  3CCM T;  5CR2 A;  1KQ1 A;  4J9F A;  1AHJ B;  4Z89 A;  3OYC A;  1YI2 Q;  3MP6 A;  1KSW A;  4N4I A;  3V7C A;  2XD0 A;  2JW4 A;  4M7D F;  2FG0 A;  5GAM d;  2V8I A;  2CP2 A;  3CCJ Q;  2AK5 A;  5GAN 3;  3M0R A;  5IT9 E;  1OUL A;  4BB7 A;  1I8F A;  4M77 G;  2LCC A;  1JXM A;  2JS0 A;  1UB4 A;  1FMV A;  2NUP B;  3A8G B;  2QTV A;  4AMC A;  3BE3 A;  2PUO B;  5EC7 A;  2D8J A;  2JTM A;  1NPP A;  1VQM Q;  3LH5 A;  1ZUK A;  3RNJ A;  1WNL A;  4OMN A;  3EFO B;  1YBY A;  4B9X A;  1YJ9 T;  2YRV A;  1UGR B;  4BDZ A;  1M27 C;  4C92 D;  2E10 A;  4E7L A;  4XK8 E;  3R6N A;  1OI1 A;  1M1F A;  2I2L A;  3HSB A;  2YLB A;  3JCM V;  1Q7Y U;  1QWF A;  4A63 B;  4M7A E;  1MND A;  3VS2 A;  1RAE B;  4F7U B;  3KXT A;  1YHQ T;  5KYU B;  3OYJ A;  3EG2 A;  1UGS B;  4QVC A;  2DEQ A;  2ZGW A;  1VQ8 A;  4IUU A;  3M53 A;  3Q1J A;  1AD5 A;  3OW2 A;  2RJC A;  1YI2 A;  2JOY A;  1QVG P;  3L2Q A;  1B34 B;  4L6V 5;  3SD4 A;  1TSF A;  3G71 T;  3CCJ A;  2RI2 A;  1U8R A;  4RG2 A;  1KIK A;  1NPR A;  2DJQ A;  4F14 A;  1VUB A;  1VQ5 Q;  4LUE A;  1R0B G;  2DLP A;  3FDR A;  2JN0 A;  2FB7 A;  2PTK A;  4JRK A;  2OAU A;  4M77 F;  4M7D A;  2KAF A;  2MOX A;  2Z0W A;  3HRU A;  3GLX A;  4OGE A;  4BI8 B;  2DL5 A;  2J6O A;  2HKN A;  1WHK A;  3VV0 A;  4J9C A;  2EYZ A;  1ZSZ A;  1RLQ C;  3SFM A;  2CP0 A;  1WXU A;  3U23 A;  3V8K A;  2LX7 A;  5DY9 A;  3UWN A;  2D9T A;  1M2V B;  2CT3 A;  2FPF A;  4RG8 A;  2R5M A;  2J6F A;  1VQ4 Q;  1Y0M A;  4C92 G;  1FWZ A;  2KSS A;  3CC7 T;  3CCL T;  1UJ0 A;  4E7J A;  2RJE A;  3JSC A;  2PZ1 A;  3C94 A;  2DVE A;  4XTZ A;  4BD3 A;  4EMG A;  2MF2 A;  5HK3 A;  2EWN A;  2RK2 A;  3TEE A;  2QEX T;  5KYW A;  2MI6 A;  1VQP T;  1VQ5 A;  1TTH B;  4QW2 A;  1FXX A;  1S72 T;  3A1P A;  2YRC A;  4M78 D;  1AWO A;  4ZGE B;  2YXY A;  2HD0 A;  3QPH A;  5IXF A;  3QBY A;  3N5B B;  1NEB A;  2G6F X;  2K9G A;  1VQ9 Q;  2HL5 C;  2I0N A;  4YTL A;  2HMA A;  2LJ1 A;  4Z88 A;  4QVD A;  1OOT A;  1UE9 A;  4AFU C;  2JM8 A;  4FYX B;  4E47 A;  3OYN A;  5I2S A;  3CCR A;  4M77 A;  3ER0 A;  1NM7 A;  1XJW B;  2FVU A;  5J39 A;  1UTI A;  1Y71 A;  1M1K R;  3CC4 T;  2QQ9 A;  3O5Z A;  3PTA A;  2MK5 A;  2JT4 A;  4OB2 B;  5KCH A; 
#chains in the Genus database with same CATH homology
 4D8K A;  2OJ2 A;  3VS5 A;  1UUE A;  3H0F A;  2MIO A;  3NPF A;  2CUD A;  1E7O A;  4RUG A;  1NEG A;  1AEY A;  2M51 A;  1KFZ A;  2CT4 A;  1LCK A;  2F2X A;  1PNJ A;  4AFZ C;  2RQV A;  2SRC A;  4IIM A;  1BB9 A;  5FWC A;  2ED1 A;  1WDX A;  1GRI A;  2AZS A;  3M0U A;  2X3X D;  1Z9Z A;  3NHN A;  1B07 A;  4LN2 A;  2KXC A;  2KNB B;  1M8M A;  2D0N A;  4J9I A;  1E6H A;  2DNU A;  1SEM A;  4D8D A;  2CSI A;  4HVW A;  4HVU A;  4OMM A;  3EGU A;  4RTY A;  3QWX X;  2AZV A;  2D1X A;  5I11 A;  4RTW A;  2EVR A;  3PVQ A;  2RF0 A;  1UEC A;  1WIE A;  2LCS A;  4GLM A;  4JZ3 A;  1SHG A;  2CDT A;  2K6D A;  2DL3 A;  2IIM A;  2GTJ A;  1K76 A;  5IHK A;  1MUZ A;  2ENM A;  4CC7 A;  4J9G A;  1PWT A;  2GGR A;  3NGP A;  3TVT A;  1UHF A;  2FEI A;  2GBQ A;  1SRL A;  2EBP A;  1T0H A;  1WI7 A;  2VKN A;  2L2P A;  3QWY A;  3TSW A;  2K3B A;  1J3T A;  4JJB A;  2RN8 A;  2DVJ A;  3VRZ A;  2JXB A;  2DIL A;  1EFN A;  1ZX6 A;  2KXD A;  4HVV A;  2V1R A;  1K1Z A;  1QKW A;  2K7A A;  2EYY A;  3KFV A;  1OV3 A;  2CH4 A;  3FJ5 A;  3RBB B;  1UJY A;  3PVL A;  2L0A A;  1UG1 A;  1Y57 A;  3I9Q A;  1JEG A;  2LQN A;  2HDA A;  4Z8A A;  5L23 A;  4OMO A;  3UA7 A;  1UFF A;  1U5S A;  2C0I A;  1M3B A;  2LP5 A;  5FW9 A;  4HCK A;  2W10 A;  1OPK A;  2RNA A;  2ABL A;  3UF4 A;  1WLP B;  1W1F A;  3SHW A;  3VS3 A;  2CUB A;  1YNZ A;  4CC3 A;  4DEX A;  1X69 A;  1JO8 A;  4RTV A;  1UDL A;  2J05 A;  2DM1 A;  5IHI A;  1AVZ C;  2KRO A;  3VS4 A;  2RPN A;  4M4Z A;  3M0T A;  2EYW A;  2EQI A;  2NUZ A;  4FSS A;  2FPD A;  1K0S A;  4GBQ A;  2DL7 A;  1QWE A;  1GFC A;  1ZBJ A;  2DBK A;  1HJD A;  2DRM A;  1E6G A;  1QKX A;  3EHR A;  3VS0 A;  2V1Q A;  4AFS C;  2W0Z A;  4LNP A;  4AFQ C;  2EYX A;  3VS6 A;  2ED0 A;  4X1V A;  2DYB A;  2KBT A;  3C0C A;  4HXJ A;  1T3L A;  2CSQ A;  2LJ3 A;  1G83 A;  3I5S A;  2YSQ A;  4IIO A;  4F16 A;  1MV3 A;  2A37 A;  2DA9 A;  2JTE A;  1JQQ A;  1NLO C;  1CSK A;  1H8K A;  1M3A A;  1U06 A;  3I35 A;  2A08 A;  1ZSG A;  2A36 A;  4CC2 A;  2H8H A;  2RMO A;  2KGT A;  2F2V A;  4ZNX A;  3M0S A;  1X2K A;  3GBQ A;  1AWW A;  1RUW A;  4F17 A;  1WXT A;  4LE9 A;  1PRM C;  5IXB A;  3VS7 A;  1ARK A;  1VYT A;  2BZY A;  1AZE A;  4RTZ A;  1ZLM A;  2HSP A;  2PNI A;  2LMJ A;  2YUN A;  2DL4 A;  1ZUU A;  1PKT A;  1GCQ C;  1YP5 A;  1ABQ A;  2DMO A;  2KT1 A;  1ABO A;  1V1C A;  2F2W A;  2K2M A;  2LZ6 B;  4LUD A;  1SSH A;  2JS2 A;  1PKS A;  2JMA A;  3UAT A;  1N5Z A;  2GNC A;  1AZG B;  3THK A;  1OEB A;  2LQW A;  2RQU A;  2XMF A;  1GL5 A;  1QLY A;  2HCK A;  2L3Q A;  3ZL7 C;  2KT8 A;  1I1J A;  2JM9 A;  4WCI A;  5GJV B;  1GCQ A;  2FO0 A;  2ECZ A;  2J7I A;  4OMQ A;  3H0H A;  1AOJ A;  1U3O A;  1FYN A;  2KR3 A;  2DE0 X;  3EG3 A;  2RQT A;  2OI3 A;  3PE0 A;  4AG1 C;  4J9E A;  2BZX A;  4J9F A;  1T0J A;  4Z89 A;  2B86 A;  2J06 A;  2ROL A;  4RTT A;  1WX6 A;  1IO6 A;  1VYV A;  3H0I A;  1KSW A;  2EGA A;  2JW4 A;  1TUC A;  2FG0 A;  5GJW B;  3IQL A;  2AK5 A;  2C0O A;  2KE9 A;  3SEM A;  3M0R A;  1B3Q A;  1G2B A;  1ZUY A;  2YUO A;  2A28 A;  1WXB A;  2YT6 A;  2EGC A;  2KYM A;  1JXM A;  2JS0 A;  3M0Q A;  1K0X A;  2YUQ A;  4ESR A;  1JXO A;  3M0P A;  2O88 A;  2D8H A;  2BZ8 A;  5EC7 A;  1A0N B;  2D8J A;  1SRM A;  3I5R A;  1BK2 A;  1GFD A;  3LH5 A;  1ZUK A;  1X27 A;  3RNJ A;  4OMN A;  4K11 A;  2O9V A;  2ESW A;  1KJW A;  2O2O A;  5IHN A;  1X2Q A;  2RQR A;  3EHQ A;  1WA7 A;  1QCF A;  1TG0 A;  2KRN A;  1M27 C;  1I07 A;  1UHC A;  1YCS B;  3R6N A;  1MV0 B;  1AWX A;  2EPD A;  1S1N A;  2ROT A;  2HEQ A;  5ECA A;  1QWF A;  1YWP A;  4A63 B;  4J9D A;  4R0K A;  3VS2 A;  2EW3 A;  2EGE A;  2VVK A;  4KRT A;  1UGV A;  3EG2 A;  1NYG A;  3UA6 A;  4EIK A;  1I0C A;  1FMK A;  2GQI A;  1AD5 A;  1WYX A;  4AG2 C;  2VWF A;  1WFW A;  1NYF A;  1H92 A;  1KIK A;  2DJQ A;  4F14 A;  3A98 A;  2MCN A;  2EKH A;  2SEM A;  4LUE A;  1RLP C;  2DLP A;  2LJ0 A;  4OMP A;  2PTK A;  4QT7 A;  2J6K A;  4Y92 A;  5IH2 A;  2MOX A;  3REA B;  3REB B;  1M30 A;  1SPK A;  2DL5 A;  1HD3 A;  4JZ4 A;  2J6O A;  2KRM A;  2L3P A;  4E6R A;  4RTU A;  2DRK A;  4J9H A;  1RI9 A;  1GCP A;  4JJD A;  2DBM A;  4J9B A;  1X6B A;  4J9C A;  3EG0 A;  2EYZ A;  2JMC A;  4CC4 B;  1RLQ C;  2AKK A;  3EG1 A;  1WXU A;  3JV3 A;  3U23 A;  3NMZ C;  2LX7 A;  1X43 A;  1YWO A;  2FPE A;  1OPL A;  1BBZ A;  1BU1 A;  2CRE A;  2LNH B;  1TUD A;  2KEA A;  2CT3 A;  2FPF A;  2J6F A;  1Y0M A;  1AWJ A;  2AKL A;  5FWB A;  1W70 A;  1PRL C;  1UJ0 A;  2KRS A;  1NLP C;  2E5K A;  2L3S A;  3CQT A;  1K4U S;  1HSQ A;  2PZ1 A;  2RQW A;  2DX1 A;  1SHF A;  1GBQ A;  2NWM A;  1JU5 C;  2BTT A;  2K79 A;  3TSZ A;  1H3H A;  1X6G A;  2GTO A;  4JPB W;  1CKB A;  2O31 A;  2C0T A;  4ORZ A;  2DL8 A;  2CH4 W;  3H41 A;  4JJC A;  1AWO A;  2P4R A;  1M3C A;  3VRY A;  4DEY A;  2M0Y A;  2YUP A;  1CKA A;  4OML A;  5IXF A;  1NEB A;  2G6F X;  2K9G A;  5HCK A;  2O9S A;  2HBW A;  2I0N A;  1VYU A;  1PHT A;  2QDL A;  2LJ1 A;  4Z88 A;  1OOT A;  2YDL A;  1XOV A;  2OAW A;  1UE9 A;  1VA7 A;  4AFU C;  3VS1 A;  2JM8 A;  2FRY A;  2X3W D;  1K9A A;  2DF6 A;  1NM7 A;  1T3S A;  1W6X A;  2KYB A;  1NG2 A;  1UTI A;  1YN8 A;  1Z9Q A;  2FRW A;  5I22 A;  3ULR B;  3O5Z A;  1GBR A;  4RTX A;  2JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...