1Q81R

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q81R00
1YI2Q 1VQOQ 1VQPQ 1VQ6Q 3I55Q 1YJWQ 2QEXQ 3CCJQ 1N8RR 1YJ9Q 1VQ8Q 1K8AR 3CMAQ 1K9MR 2OTJQ 3OW2P 3CCMQ 3G4SQ 3I56Q 1Q86R 3CCQQ 1Q82R 1KQSP 1VQ5Q 1VQNQ 2QA4Q 1YJNQ 3CPWP 1VQLQ 1VQMQ 1KD1R 1VQ9Q 1NJIR 3CCVQ 1VQ7Q 1K73R 1S72Q 3CC4Q 3CC2Q 3G71Q 3CCRQ 3CD6Q 1Q7YR 1YIJQ 1W2BP 1Q81R 3CCLQ 1VQKQ 3CMEQ 3CCSQ 1JJ2P 3CCEQ 1KC8R 1QVFP 3CXCP 3CCUQ 1YHQQ 2OTLQ 3G6EQ 1M1KR 1VQ4Q 1YITQ 1M90R 1QVGP 3CC7Q
chains in the Genus database with same CATH superfamily
3SB2A 1AWJA 2FPEA 3CCRA 2EGEA 4GBQA 1KQ1A 5GMKi 4RMOA 4M77F 3QZ9B 4M75A 2NUPB 1Y96B 5IHKA 4EIKA 3JB9H 3FB9A 1YJWA 2PVOB 2KQWA 5DM7R 2V8KA 1JQQA 2LJ1A 3G6ET 3HSBA 2DMOA 3ME9A 2EW3A 3UF4A 2R57A 1TS9A 1JRIA 3VUZA 3CCJQ 1G8XA 1N8RR 3NTKA 4J7FA 2RI5A 1M90U 3PIOA 4L6V5 2DXBA 2BTTA 2CT4A 1VQLQ 5KYUA 1NLOC 3JB9D 3UPUA 3KBGA 3G71Q 4BDYA 1PM3A 2KYMA 4Z89A 1WLPB 2D0NA 1JO8A 1VYTA 1VQNA 4MDWA 1K73U 2YUNA 4KUDK 2HSEB 2XHCA 4FW1A 5GAOl 4E7SA 2K6DA 4BDZA 2I0NA 5A0GA 2QA4T 4M75F 2JM8A 3QHSA 4Q5WA 1FX7A 1YI2A 4Y92A 1VQOA 3I55A 1WHGA 3UA6A 2GTOA 4JJNK 1M27C 1G3TA 2OTLQ 2K2VA 5D6WA 2DL3A 4BI8B 5CIUA 5I21A 1A0NB 4PJJA 8ATCB 4O5VA 4QT7A 1ZLMA 1N8RU 4Y28E 4XTXA 4M4ZA 4J9DA 2JTMA 3JCMP 5FW9A 1Y96A 4E7IA 1PKSA 4B9WA 1KC8R 3V8LA 1DJ7B 3L2ZA 2QQAA 4QVZA 1KFZA 3CC4A 1QVFA 4C8QC 3LX7A 4HKEA 4PK4A 4XU2A 2KR3A 3CPWS 1VUBA 3EHQA 2KK4A 2Y4YA 4JRQA 3CBOA 1X6BA 2YLBA 2E6NA 1TUCA 2Z0WA 4J9GA 3A8HB 4Z88A 5J26A 2EYQA 3OYAA 2R58A 3LH0A 2PVDB 1W4SA 1VQ5A 1BIAA 1VIEA 4E7JA 3EH2A 1W1FA 1ZX6A 2DZ9A 1YWPA 4F7UE 4PLLA 5GAOq 1SPKA 4FSSA 1YITA 1WFWA 1WJRA 1GCPA 2HQEA 1Q7YR 4A4KA 4FYVB 1T0HA 1UDLA 2P4TA 4E47A 3I56A 2GFUA 4CI0C 2KT8A 3VYHB 4M7DB 2DXUA 2F69A 2E5QA 3OYIA 1UB4A 1KC8U 3FEOA 2EBPA 5CQXA 2EJ9A 3OYKA 5FWBA 3LWIA 4WTOB 1M1FA 4HCZA 5EG2A 3VS4A 5GANg 2QQRA 3G4SA 1D1BA 3CPFA 3UDCA 1SEMA 1H641 1RLQC 1UUEA 2YWWA 1R77A 1TSFA 1G2BA 3UATA 3OW2S 2ABLA 5GMKl 1YHQA 3OYNA 1OZ2A 2AHJB 1M8MA 2LCSA 2JUFA 1VQKT 3CMET 1NG2A 2F2WA 2HBWA 5LJ5g 1QP3A 2J6KA 5C6SA 4MZPA 4FT4A 3DB4A 1Q7YU 3I5SA 2DE0X 3A8OB 4DBRA 1YBYA 2ZPHB 2A08A 4FYYB 2LP5A 2KT1A 2QDYB 3LLRA 3CCUA 2K3BA 1VQNQ 3G7ZA 2JS0A 4LN2A 2DD4A 2FRWA 1W2BS 1BI2A 1CSKA 1IGUA 4BI4A 4HT9A 4DBQA 3QPHA 4XU0A 3OYMA 2LX7A 3QUIA 8AT1B 2VVKA 1YI2Q 2Y90A 4CC2A 3EFRA 4M7DA 1BKBA 3RNJA 1KK7A 1X43A 1BK2A 4YTLA 4FCYA 1SSFA 1XTDA 3PT9A 2FPDA 2E12A 3J80E 1N9SA 4XQ3A 1X6GA 1VOMA 2X51A 1QP2A 2VWFA 2COWA 4E7ZA 2DJZA 2YDLA 4PFPA 4RTYA 3VS5A 5L23A 3CC7T 3QKJA 3JCMc 1MNEA 2EJFA 4C8QE 1N9RA 1QVGA 1MUZA 3JCMg 2L5QA 1FYNA 3P8DA 5GANh 2CDTA 5ECAA 1BI1A 2G3RA 3DLLA 2V8JA 3CC4Q 1YIJT 2EPDA 5LJ5d 1UHFA 4ZGJB 2RD1A 1VQ4T 1OZ3A 2RHXA 2JT4A 1VQ9A 2X3XD 4C5HA 4JRIA 1YJ9Q 3CCLA 4M7DF 5CR2A 2EFIA 1D09B 4NL2A 3CCQT 4ZN3A 1U06A 3WVEB 1HK9A 4X9CA 2E3HA 1OU9A 3CPWP 2RJDA 4JRPA 7AT1B 4QQ6A 5KE3A 3QDFA 3HRTA 3FC3A 2KYBA 2BZ8A 2KXCA 3CCVA 3VS7A 5KH6A 3L2RA 3HRSA 2QTVA 3RESA 1ZA2B 2HL5C 2SRCA 3M53A 4JJCA 4L59A 1Q86R 2M51A 2EKOA 2DD5A 2HMAA 5GAOn 1NJIR 5D6XA 4OGEA 4P5NA 2L3PA 2HCKA 2FL7A 2MYSA 1IHVA 4RTTA 2DF6A 3MO8A 3TSZA 4FM4B 2RQTA 4C92B 1HSQA 2JS2A 3HRUA 2E6ZA 5IHIA 1WGSA 3EH1A 5GJVB 3SWNB 9ATCB 3JCMd 2CS7A 1BI3A 5GAN6 1KG1A 1UEBA 3X24B 4C92G 4DEYA 3X20B 4R56A 4A4FA 3ZL7C 1WHLA 5DLQE 3E9GA 2VUBA 4M7AG 2PUKB 1UGPB 4GY5A 1QVFP 3QJYA 5FROA 4UC4A 1FXXA 1WXBA 2ROTA 3X26B 2KY9A 3OMGA 2PVGB 1D3BB 2QGFB 3DB3A 1MV3A 3JCMX 4C8QG 3A98A 2KEAA 3A5ZB 1YJNT 1ABOA 2A36A 2PTKA 5I11A 1QQJA 4HXJA 1KQ2A 1Q82C 1ZUUA 2K2MA 1NJIC 1JJ2A 2XMFA 1AEYA 1AWOA 1VQ6Q 3VRZA 2Y4XA 3JRZA 1ZSGA 5HKCA 1RAAB 1K8AR 2CSQA 2F5KA 4E2FB 1LPLA 3X25B 4A54A 2W0ZA 4KH0B 3QDRB 3CCJA 4MZMA 1UJYA 1YWOA 2IIMA 3T9NA 1VQLA 1VQPT 1R8OB 1KD1C 3A8GB 2QEXT 3OBWA 4M7AD 3G71A 4RKUE 2RA2A 1M2OA 4D6WA 4R0KA 3GLXA 4C92A 2FB7A 4ELYC 1X75C 2CZ6B 1BB9A 4A4HA 4M77G 1S72T 2GFAA 5FU7B 1K76A 1OX9A 2WSFE 2OI3A 2YHTA 4C8QD 4M78B 2IVWA 3S3MA 1IGQA 3KXTA 4C0DB 3H41A 1IRXA 3LGLA 4PJOF 4K11A 4M7DC 3MJXA 4EMKB 1KQSS 3R6OA 2VC8A 2GBQA 3GNGA 3KFVA 1YP5A 1LOJA 4HCKA 2MI6A 1SF9A 1Y71A 1D3BA 3CCRT 3BDUA 2PNIA 1K8AU 1TU0B 1B34B 2J7IA 3E9FA 1QVPA 2L3RA 5GJWB 4DA4A 1M1KR 4BE1A 4XK8E 3TCJA 2WSEE 4RG2A 3TSWA 2RK2A 1MMGA 1RAHB 2CUDA 4KGXB 4ZTJA 2XK0A 5IHNA 2FEIA 3QYGB 5FLXE 3CCMQ 2OTJQ 2RMOA 2BKDN 2YLCA 3QBYA 3OYLA 3GF5A 4M75G 1G3WA 1PNJA 1HD3A 1QKWA 1RAGB 1ZSZB 5CAIA 2LZ6B 3PVLA 1WHKA 4M77A 2RJCA 3EG1A 3QXEB 2DZCA 2BZYA 2K5FA 3VS2A 2QQBA 2ED0A 5FWCA 2LDMA 3CXCS 1T3LA 1WIEA 3SD4A 2O4XB 4LD9K 1R0BG 5J39A 1M90R 2DFUA 1VQOT 4M78A 3I55T 1QVGP 1M8VA 3NHNA 4HVVA 2FG0A 2XG8D 4PKCC 4J9CA 4AMCA 4EMKA 2DKGA 2DYBA 1MMNA 1WI7A 3CCST 4KBMB 1IZ6A 1S1NA 3QJ6A 3RKWA 2DILA 1D0XA 4M75D 1B34A 3CQTA 1D1AA 2KE9A 4JS5A 2CZ0B 3JB9J 1K9MR 2HNIA 3M0UA 1V29B 5GAOm 1IB8A 4AFUC 2C06A 5DLOA 2LQ8A 1MHNA 3CD6Q 4DQ2A 1GRIA 3O5ZA 1JU5C 3F70A 2MOXA 1WQWA 2E5KA 4XTWA 3HFNA 2CGHA 2LQNA 2MK5A 1Z9QA 4M78F 3FJPA 5LJ3d 3RUXA 3QYHB 3A1PA 1ZSZA 4IUPA 2AK5A 3M57A 3H9NA 2ZAEA 2DK3A 1VQ5T 3I35A 5FRNA 2OJ2A 1M90C 2F2VA 1YCYA 2V8IA 1KHIA 2A7YA 2P84A 4IKFA 4KRTA 4FU6A 1RAFB 2LVMA 4HVUA 2K7AA 2RQWA 1YITT 4ZN1A 2RN8A 1K73C 2O4XA 1LVKA 3CEYA 4FSXA 1ZA1B 1UG1A 4JJBA 1XOVA 3I56T 4J7IA 2NWMA 5GAMd 1VQMT 2ROLA 1MGQA 2I2LA 1K9MU 3C12A 5GAN5 5DY9A 2G6FX 3HHTB 3PMTA 4Z8AA 4EMGA 3OYHA 2V1QA 2ZPIB 3S3NA 4ZTFA 4QKUA 3GNFB 3OYFA 2RF0A 2XD0A 3SEMA 2DL8A 4HT8A 2L0AA 4C92C 2RM4A 2H3EB 3G4ST 4O6JA 1OX8A 2CT3A 1KQSP 4M7AC 2P0KA 2MMPA 4CC7A 3CC2Q 1N8RC 1UE9A 2NUPA 3LW5E 3SFMA 1JJ2P 1YHQT 1ZUYA 3TVTA 4OMLA 2L8DA 3MP6A 3BE3A 3FJ5A 1VYVA 2XKOC 3I5RA 2OX7A 2CH4A 1ARKA 2L3SA 1ABQA 2MIOA 3CMAQ 1WHHA 2DVEA 3BW1A 3H0FA 2JTEA 3QG1A 3PFSA 3M4YA 1YJNQ 2GQIA 2LC4A 2VB6A 3D7SB 1PRLC 4LDVA 1YJ9A 2RJEA 2LTOA 5KYXB 1YN8A 2FZKB 4ZNXA 1SG5A 3CCUT 3C4SA 3JB9F 2JMCA 1O9SA 2P0QA 1T0JA 3OYJA 3VKIA 1VIFA 4CC3A 1TOVA 4JUVA 1Y57A 3M0SA 1XQHA 1WHMA 1RACB 2EWNA 5GMKm 4LD6A 3RKYA 3EGDB 1CKBA 3HKSA 3J7AF 1IREB 3CCEQ 2JNGA 2VKNA 2RI2A 2ED1A 3NTHA 3CXCP 2L89A 3E19A 3RKXA 3NMZC 1AD5A 2BUDA 4F14A 2RQVA 2D9TA 2GGRA 4M77C 2JVVA 1KC8C 4M7DG 4IIOA 3RIRA 3QIIA 4OMPA 3H0HA 3U23A 4RTVA 1VQ7Q 3JSCA 3VS3A 5GAOp 3MKDA 2E3IA 4ANJA 1QVFS 5GAN7 2JM9A 4JJDA 3QZ5B 1X6OA 4ATOA 2M02A 3L2UA 2K5IA 1EZZB 4J6WA 3V8KA 4BUGA 1VQ8Q 4C0DC 3M0TA 1CKAA 4C0ZA 2HSPA 2GNCA 4EMKC 4MZTA 2RPNA 2CSIA 3CCLT 2NLUA 4AFZC 2RO0A 4BY6C 3BDLA 1HXDA 1HJDA 5KYXA 3INZA 2QG9B 1RUWA 1GCQA 4XU3A 1C6VX 1Q7YC 1E7OA 3JB9I 4B6MA 1SHFA 2HQXA 4J83A 4FYXB 4M75C 1MMDA 3CCVT 2M0YA 1VQ6A 2AKKA 4C5IA 4BI3A 3WXMB 3RMSA 3JCMV 3V7RA 2X35A 4M7DD 1D1CA 2JZ2A 3EGDA 2M16A 2B86A 1D0YA 2RQUA 4KULA 2CP6A 1BIBA 2A28A 2KROA 4C92E 4CC4B 4M7AE 2MPXC 4N4HA 3THKA 3REBB 2FPFA 4RTWA 1NPPA 4F7UB 5EC7A 5GANd 1E6GA 3NGPA 5CKBA 1LNXA 1NE8A 3EAEA 4LDXA 5GMKe 5M9OA 1RI9A 4OB2B 4C0FA 2L3QA 1I1JA 1M2VB 4FL6A 3A8MB 4RCBA 3IQLA 1FMKA 5IAYA 1LCKA 2F5TX 1MV0B 4EPCA 2JMAA 3GPLA 4JZ4A 3BY7A 4QQDA 1QCNA 1K4US 1YNZA 2QASA 1SRMA 5LJ3e 4IUVA 3PE0A 4A53A 2EGCA 2K3YA 2FRYA 4J9IA 1MMAA 3M54A 5KYNA 2OTJA 1GBRA 3CCMA 4PJOB 1C0MA 3G6EQ 2O9SA 2E70A 2EAYA 2DTHA 3CCJT 4PJLA 1OV3A 1VQKA 3CMEA 2JXBA 4M77E 4X1VA 1M9SA 3TQ7P 4PLIA 1RADB 1I5OB 1VQLT 4IUUA 3VYGA 5J3BA 1N5ZA 2LMJA 2M1HA 1SSHA 1OOTA 3EG9B 3G71T 5GAMe 3TU4K 2GCXA 3O8VA 1PD0A 3HP9A 4E6RA 1QVGS 1OI1A 3JAME 2AZSA 4F7UA 3L2QA 1OPKA 4OMNA 2W10A 4JPBW 3JCMJ 3LWHA 4KT0E 2DL7A 1Y07A 1MNDA 2QA4Q 1PSFA 1QW1A 5HK3A 3V8JA 1M2VA 5HCKA 2OTLT 5GMKj 2LCCA 3RR6A 1RLPC 1H92A 1X27A 1K9AA 6AT1B 4R55A 4IUQA 3EG2A 4LXCA 4XTVA 3PMIA 4XTZA 4M75E 3CBMA 2R5AA 3WVDB 3CC7A 1AVZC 2ZZDA 4DBFA 2B8AA 4WF2A 5IH2A 1Q86C 1OULA 4F7UF 5LJ3j 5I22A 2FHDA 3CD6A 3JV3A 4PJOA 2QI2A 2K9GA 2HD0A 2EKHA 3NFCA 5CKHA 2HBPA 4Z02A 2CKKA 1K0SA 4KGZB 4LUDA 3EG9A 1D0ZA 4C92D 1V1CA 1GFDA 2FZGB 4IURA 1WPYA 2HKQB 2DO3A 2K5LA 4OB1B 3DKMA 1M3AA 4FYWB 5GAMj 3M58A 1H3ZA 2RK1A 2HKNA 3FLGA 3SWNA 2VGNA 3EGUA 4FIBA 1Q81R 4ELZC 1KD1U 2DEQA 3MP8A 4DOVA 2BE9B 3C94A 1W70A 5CQYA 4OP0A 3ZBDA 2M9UA 3M4GA 4BE2A 5HY6A 4M78G 5D7UA 4C0GA 2QQSA 3R6NA 4BB7A 4E7KA 2YRCA 2VGMA 4RCCA 1JJ2S 1K8AC 4LDWA 1WA7A 2VV5A 3HL8A 2MWPA 2C0IA 1ACMB 1VA7A 1JBMA 3CC2A 2P0PA 1YJWT 4RTXA 1PC0A 4OB0B 2KNBB 2ZGWA 1QCFA 1M5Q1 2CUBA 1WJQA 3L1AA 4N4IA 2RNAA 2YT6A 1VQKQ 4GLMA 2F1LA 3CMEQ 3S3OA 3CMAA 4J6YA 5GAOr 3MP1A 2E65A 4M77D 2KXDA 1U3OA 1YJNA 3EG0A 1Q81U 4XU1A 4JRKA 1WXUA 2YUQA 1VQNT 2PU9B 2GF7A 4ORZA 2EYYA 4N0AA 2CP2A 4M78D 2EJGA 2BIVA 2FO0A 2HZYA 1X2KA 1WNLA 2DX1A 2DIGA 3KUFA 3UT1A 4AFSC 2WACA 1FWZA 2CREA 1YI2T 3VS6A 5GANe 4C8QF 1ZBJA 4GLKA 3CCEA 4NS5A 2BZXA 1V76A 4L5GA 2O88A 3PVQA 2DRKA 1M1KC 2A37A 3VS0A 1VQPA 4J9FA 2O9VA 2QEXA 4OMOA 4OVAA 4LUEA 4E7HA 1PRMC 1NEBA 2DYIA 2HL3A 4LNPA 2LQKA 1I0CA 2DBKA 4PFOA 2X3WD 5LJ5e 1AWXA 1S72A 1VQ7A 3CC7Q 3JB9G 1P92A 4NL3A 1Q95G 3VS1A 4KUIA 2AIRB 3CC4T 4JLGA 2AZVA 2J6OA 3E2UA 1RAIB 1VQ8A 1YIJQ 2L2PA 5FU6B 2JOYA 4PL6A 5L8RE 5KE2A 2DJQA 3M5AA 4EDUA 1VQ4Q 1AWWA 2DA9A 4XTYA 2OAUA 1YJ9T 2KMTA 5CKDA 5A0LA 4BD3A 2CP0A 2QQ9A 1PD1A 5A0DA 3PIPA 3JCMQ 3CCQQ 5GMKh 5FRMA 3C95A 3AT1B 3GOXA 2NUTB 2D6FA 2ZCFB 2AT1B 3E1SA 3P8BB 5AT1B 1KIKA 3OYGA 1QCOA 4IUTA 3PTAA 1IHWA 3MEVA 3CBPA 4PJOC 2E10A 1BBZA 4LDUA 4M7DE 2EYZA 1SHGA 1AOJA 4AFQC 2KRNA 3JCMe 2COYA 3CPWA 2QTXA 3RDVA 5LJ3h 1R0CB 3S6WA 1K9MC 5GANj 3OS2A 2D8JA 4IIMA 3M56A 1JXMA 1RL2A 4WCIA 5CCAA 2RHUA 4QVDA 2E4HA 3FRNA 3SWNC 3UA7A 2J6FA 2EIFA 2EYXA 4ZGDB 5LJ5j 2CH4W 1WQ7A 1NYFA 3M0QA 5GAMh 2RJFA 2XDDA 1JEGA 2PZ1A 2IPOB 2E64A 3FIFA 1QKXA 2DL5A 3CCSA 1F1BB 1WJSA 1BU1A 3M9QA 3X28B 5HK0A 4VUBA 2P4RA 1OEBA 5CKEA 1UTIA 2J06A 1G5VA 1M1GA 4OMQA 1B7TA 2JW4A 1T3SA 1YFNA 3RBBB 2V26A 1TXQA 5IN1A 2DXCA 2EQKA 1WYXA 1UGSB 2NUTA 1RI0A 2LT1A 1VQ6T 4J9HA 5A2QE 4HCCA 2DLPA 1NYGA 3NTIA 2WSCE 4OMMA 2K79A 5AYFA 1U1TA 3OSSC 3G6EA 1Y0MA 3OW2A 3UWNA 1IXDA 2EVRA 3OYYA 2YUPA 1VYUA 1SKUB 2KSSA 2DIQA 1TUDA 2BE7D 2NUZA 1VQPQ 1AHJB 3TEEA 2QEXQ 4B9XA 4ZGEB 4MDXA 2RH2A 1I07A 4XAXB 2RI3A 4N0AC 1PWTA 1S72Q 1ZHIA 1Y7XA 1BCMA 1U5SA 2CZ7B 1FMWA 4HVWA 4FW2A 1BI0A 5FU7C 1W2BA 4MMLA 4OF1A 1VQMA 2YSQA 2QA4A 3AHUA 3A8LB 2CYZB 4M78C 1OPLA 3ZEHA 2HDAA 3LH5A 2KAFA 3EHRA 1VQ9T 2XDBA 1G3SA 2EQMA 1UECA 4AG2C 2HEQA 3CCRQ 3I9QA 1ZUKA 2X4WA 4OB3B 4OMFB 2DETA 1EX4A 3OYEA 4J8OA 5LJ3f 4DEXA 1YJWQ 2JJ9A 3VU3C 4PJOE 2OTJT 3CCMT 3EGXB 2LNVA 4RTUA 2RHYA 4A63B 1QWEA 3H0IA 3OB9A 2CZ1B 3MEAA 3NPFA 2ESWA 2H3JA 1B07A 4HCBA 2H8HA 4LE9A 4RG8A 4J5YA 1PG5B 1TH7A 1ZSZC 2JTFA 2FYKA 1FMVA 1PSEA 1U1SA 1WXTA 2IG0A 3VUBA 5GAMf 1NEGA 3PGGA 1G3YA 1UGRB 2D8HA 2HQHA 4J9BA 5GAN4 3M0PA 2X9HA 2SEMA 1E6HA 3OYCA 1VQOQ 3I55Q 4PNOA 4F7UG 2GQVA 1OYXA 3MPUB 2ZPGB 5CK9A 2F2XA 2ECZA 2QDLA 2RB6A 4N4GA 2DAQA 3MEWA 5KYYB 4Y91A 3CCSQ 3JCMb 3V7CA 3META 2MAMA 4ME7A 3REAB 1W6XA 1AZGB 2C0TA 4D8KA 3ASKA 2ZPBB 2CP5A 1UJ0A 3LGFA 1K1ZA 1C1AA 2ZPFB 3CD6T 3EGXA 3OA6A 1YCSB 2XU8A 3QO3A 1H8KA 3OS5A 4RUGA 3Q1JA 1I8FA 2MWOA 4QQGA 1M4ZA 1PCXA 2O31A 4C5EA 4F16A 5FU6C 3EG3A 1NZ9A 2FZCB 1Z9ZA 2CP7A 2X4XA 1RAEB 5LJ5h 2KI7A 4PJOG 1VQ5Q 3VJPA 3EFSA 1UHCA 2RQRA 2D1XA 2J05A 3OYDA 4BACA 5GAN2 3OS0A 1YITQ 4JLIA 4M78E 1GFCA 5IXBA 2KDSA 1TUGB 1JXOA 4RTZA 3I56Q 1SRLA 4MMKA 1Q82R 4LDYA 1KHCA 3OYBA 2YUOA 1VQMQ 4A4EA 1OQKA 1GBQA 2CP3A 4F17A 1QWFA 2E41A 5CKFA 2OAWA 2EQIA 1X69A 2KRSA 2O01E 2DTOA 3VRYA 1AZEA 1N6AA 2EQJA 1WDXA 4OGCA 5KYYA 4HA8A 2FVUA 3L42A 4V2SA 4F04B 2LJ0A 1ZBXA 4M7AB 4JZ3A 3G4SQ 1AT1B 1I4K1 4PJNA 1KD1R 3CC2T 2LCLA 3EFOB 4PJOD 1QLYA 2VXFA 2HAXA 2KVQG 5CO7A 4C8QB 3JCMh 1YHQQ 2RHIA 2MCNA 4CRIA 5IT9E 3OY9A 1PHTA 1YIJA 1GXIE 3CMAT 3H6ZA 4TVRA 4J9EA 3OW2P 4E7LA 1VQ4A 2EYWA 5LL6S 2JN0A 3JCMW 2VYTA 1QMCA 4EMHA 1KQSA 2PQWA 1Q86U 1I81A 5C0MA 1Q82U 2YXYA 2DNUA 1NJIU 3SDZA 3SHWA 3CCQA 2COZA 3HTRA 3CCUQ 2QK0A 1EFNA 4PFZA 2LJ3A 1NPRA 2YRVA 5I2SA 3GIBA 2VXEA 2DERA 2AKLA 3PNWC 1ZQ1A 3OQ5A 1TG0A 4KGVB 2YRDA 1UGQB 1GCQC 1WHJA 3V7SA 2XI9A 2DPPB 3TREA 4D8DA 3L2VA 2DRMA 1NM7A 2K3XA 2RHZA 5IXFA 1BCOA 1XNIA 1W2BP 3CCET 5I2MA 1M3CA 5GANf 1HYOA 1RABB 4M77B 3MHXA 3RERA 3OMCA 4DBHA 1NBEB 3N5BB 2DBMA 5KYWB 1WX6A 3MEUA 1NLPC 5CVIA 3P8HA 4JDSA 1VQ7T 4M7AA 4ESRA 1N27A 1UFFA 2D0QB 1X2QA 3L2WA 2KGTA 1B3QA 5LJ5f 2DVJA 4BE0A 2LQWA 2M0OA 4X9DA 1WZOA 2K4YA 3EFOA 3RMQA 2E1HA 3CXCA 1VQ8T 4C8QA 4QVCA 1TWBA 1O75A 3M59A 2OTLA 3ZFJA 2C0OA 4KH1B 2LNHB 2A3LA 2ATCB 1VQ9Q 4BY6B 1X01A 2R5MA 3FDRA 2LT4A 3CCLQ 1OU8A 2ZPEB 4J6XA 2DM1A 2DXTA 4M75B 2QAZA 1Q81C 4C92F 2QGGA 5D6YA 3C0CA 2X4JA 4PJMA 3ER0A 3GP8A 2O2OA 4M7AF 1M30A 3CCVQ 3M55A 5KCHA 3OBYA 1JB0E 3GBQA 3QSUA 4AT1B 1H3HA 2V1RA 2EQUA 1K0XA 1KSWA 4C5GA 2XICA 4DOWA 5LJ3g 2X4YA 1GL5A 2QXFA 4II1A 2GTJA 2NYSA 3G1JA 5KYUB 1M3BA 3H8ZA 3VV0A 4XTUA 3JCMf 1EIFA 3BFMA 5KYWA 3MCAB 2KBTA 3OS1A 3QWXX 2PUOB 2DEUA 2MF2A 3HPWA 1XJWB 4AG1C 4QW2A 2ENMA 3OSVA 3LYIA 1J3TA 4X34A 3J81E 2EGAA 4NOYA 3URGA 1KJWA 2K57A 4FT2A 2XIDA 5GAN8 2XDPA 2LRQA 1M1KU 2QYZA 1IO6A 3DLMA 5GAMg 2LX9A 1BYMA 3QWYA 3HFOA 1UGVA 1TTHB 1K73R 2DTIA 4A4GA 1I5LA 1U8RA 3M0RA 5GAN3 1G83A 3ULRB 2KRMA 2VASA 5KCOA 1LJOA 1PKTA 2A0FB 2DL4A 4JS4A
chains in the Genus database with same CATH topology
1YI2Q 1VQOQ 1VQPQ 1VQ6Q 3I55Q 1YJWQ 2QEXQ 3CCJQ 1N8RR 1YJ9Q 1VQ8Q 1K8AR 3CMAQ 1K9MR 2OTJQ 3OW2P 3CCMQ 3G4SQ 3I56Q 1Q86R 3CCQQ 1Q82R 1KQSP 1VQ5Q 1VQNQ 2QA4Q 1YJNQ 3CPWP 1VQLQ 1VQMQ 1KD1R 1VQ9Q 1NJIR 3CCVQ 1VQ7Q 1K73R 1S72Q 3CC4Q 3CC2Q 3G71Q 3CCRQ 3CD6Q 1Q7YR 1YIJQ 1W2BP 1Q81R 3CCLQ 1VQKQ 3CMEQ 3CCSQ 1JJ2P 3CCEQ 1KC8R 1QVFP 3CXCP 3CCUQ 1YHQQ 2OTLQ 3G6EQ 1M1KR 1VQ4Q 1YITQ 1M90R 1QVGP 3CC7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Q;  1VQO Q;  1VQP Q;  1VQ6 Q;  3I55 Q;  1YJW Q;  2QEX Q;  3CCJ Q;  1N8R R;  1YJ9 Q;  1VQ8 Q;  1K8A R;  3CMA Q;  1K9M R;  2OTJ Q;  3OW2 P;  3CCM Q;  3G4S Q;  3I56 Q;  1Q86 R;  3CCQ Q;  1Q82 R;  1KQS P;  1VQ5 Q;  1VQN Q;  2QA4 Q;  1YJN Q;  3CPW P;  1VQL Q;  1VQM Q;  1KD1 R;  1VQ9 Q;  1NJI R;  3CCV Q;  1VQ7 Q;  1K73 R;  1S72 Q;  3CC4 Q;  3CC2 Q;  3G71 Q;  3CCR Q;  3CD6 Q;  1Q7Y R;  1YIJ Q;  1W2B P;  1Q81 R;  3CCL Q;  1VQK Q;  3CME Q;  3CCS Q;  1JJ2 P;  3CCE Q;  1KC8 R;  1QVF P;  3CXC P;  3CCU Q;  1YHQ Q;  2OTL Q;  3G6E Q;  1M1K R;  1VQ4 Q;  1YIT Q;  1M90 R;  1QVG P;  3CC7 Q; 
#chains in the Genus database with same CATH topology
 3SB2 A;  1AWJ A;  2FPE A;  3CCR A;  2EGE A;  4GBQ A;  1KQ1 A;  5GMK i;  4RMO A;  4M77 F;  3QZ9 B;  4M75 A;  2NUP B;  1Y96 B;  5IHK A;  4EIK A;  3JB9 H;  3FB9 A;  1YJW A;  2PVO B;  2KQW A;  5DM7 R;  2V8K A;  1JQQ A;  2LJ1 A;  3G6E T;  3HSB A;  2DMO A;  3ME9 A;  2EW3 A;  3UF4 A;  2R57 A;  1TS9 A;  1JRI A;  3VUZ A;  3CCJ Q;  1G8X A;  1N8R R;  3NTK A;  4J7F A;  2RI5 A;  1M90 U;  3PIO A;  4L6V 5;  2DXB A;  2BTT A;  2CT4 A;  1VQL Q;  5KYU A;  1NLO C;  3JB9 D;  3UPU A;  3KBG A;  3G71 Q;  4BDY A;  1PM3 A;  2KYM A;  4Z89 A;  1WLP B;  2D0N A;  1JO8 A;  1VYT A;  1VQN A;  4MDW A;  1K73 U;  2YUN A;  4KUD K;  2HSE B;  2XHC A;  4FW1 A;  5GAO l;  4E7S A;  2K6D A;  4BDZ A;  2I0N A;  5A0G A;  2QA4 T;  4M75 F;  2JM8 A;  3QHS A;  4Q5W A;  1FX7 A;  1YI2 A;  4Y92 A;  1VQO A;  3I55 A;  1WHG A;  3UA6 A;  2GTO A;  4JJN K;  1M27 C;  1G3T A;  2OTL Q;  2K2V A;  5D6W A;  2DL3 A;  4BI8 B;  5CIU A;  5I21 A;  1A0N B;  4PJJ A;  8ATC B;  4O5V A;  4QT7 A;  1ZLM A;  1N8R U;  4Y28 E;  4XTX A;  4M4Z A;  4J9D A;  2JTM A;  3JCM P;  5FW9 A;  1Y96 A;  4E7I A;  1PKS A;  4B9W A;  1KC8 R;  3V8L A;  1DJ7 B;  3L2Z A;  2QQA A;  4QVZ A;  1KFZ A;  3CC4 A;  1QVF A;  4C8Q C;  3LX7 A;  4HKE A;  4PK4 A;  4XU2 A;  2KR3 A;  3CPW S;  1VUB A;  3EHQ A;  2KK4 A;  2Y4Y A;  4JRQ A;  3CBO A;  1X6B A;  2YLB A;  2E6N A;  1TUC A;  2Z0W A;  4J9G A;  3A8H B;  4Z88 A;  5J26 A;  2EYQ A;  3OYA A;  2R58 A;  3LH0 A;  2PVD B;  1W4S A;  1VQ5 A;  1BIA A;  1VIE A;  4E7J A;  3EH2 A;  1W1F A;  1ZX6 A;  2DZ9 A;  1YWP A;  4F7U E;  4PLL A;  5GAO q;  1SPK A;  4FSS A;  1YIT A;  1WFW A;  1WJR A;  1GCP A;  2HQE A;  1Q7Y R;  4A4K A;  4FYV B;  1T0H A;  1UDL A;  2P4T A;  4E47 A;  3I56 A;  2GFU A;  4CI0 C;  2KT8 A;  3VYH B;  4M7D B;  2DXU A;  2F69 A;  2E5Q A;  3OYI A;  1UB4 A;  1KC8 U;  3FEO A;  2EBP A;  5CQX A;  2EJ9 A;  3OYK A;  5FWB A;  3LWI A;  4WTO B;  1M1F A;  4HCZ A;  5EG2 A;  3VS4 A;  5GAN g;  2QQR A;  3G4S A;  1D1B A;  3CPF A;  3UDC A;  1SEM A;  1H64 1;  1RLQ C;  1UUE A;  2YWW A;  1R77 A;  1TSF A;  1G2B A;  3UAT A;  3OW2 S;  2ABL A;  5GMK l;  1YHQ A;  3OYN A;  1OZ2 A;  2AHJ B;  1M8M A;  2LCS A;  2JUF A;  1VQK T;  3CME T;  1NG2 A;  2F2W A;  2HBW A;  5LJ5 g;  1QP3 A;  2J6K A;  5C6S A;  4MZP A;  4FT4 A;  3DB4 A;  1Q7Y U;  3I5S A;  2DE0 X;  3A8O B;  4DBR A;  1YBY A;  2ZPH B;  2A08 A;  4FYY B;  2LP5 A;  2KT1 A;  2QDY B;  3LLR A;  3CCU A;  2K3B A;  1VQN Q;  3G7Z A;  2JS0 A;  4LN2 A;  2DD4 A;  2FRW A;  1W2B S;  1BI2 A;  1CSK A;  1IGU A;  4BI4 A;  4HT9 A;  4DBQ A;  3QPH A;  4XU0 A;  3OYM A;  2LX7 A;  3QUI A;  8AT1 B;  2VVK A;  1YI2 Q;  2Y90 A;  4CC2 A;  3EFR A;  4M7D A;  1BKB A;  3RNJ A;  1KK7 A;  1X43 A;  1BK2 A;  4YTL A;  4FCY A;  1SSF A;  1XTD A;  3PT9 A;  2FPD A;  2E12 A;  3J80 E;  1N9S A;  4XQ3 A;  1X6G A;  1VOM A;  2X51 A;  1QP2 A;  2VWF A;  2COW A;  4E7Z A;  2DJZ A;  2YDL A;  4PFP A;  4RTY A;  3VS5 A;  5L23 A;  3CC7 T;  3QKJ A;  3JCM c;  1MNE A;  2EJF A;  4C8Q E;  1N9R A;  1QVG A;  1MUZ A;  3JCM g;  2L5Q A;  1FYN A;  3P8D A;  5GAN h;  2CDT A;  5ECA A;  1BI1 A;  2G3R A;  3DLL A;  2V8J A;  3CC4 Q;  1YIJ T;  2EPD A;  5LJ5 d;  1UHF A;  4ZGJ B;  2RD1 A;  1VQ4 T;  1OZ3 A;  2RHX A;  2JT4 A;  1VQ9 A;  2X3X D;  4C5H A;  4JRI A;  1YJ9 Q;  3CCL A;  4M7D F;  5CR2 A;  2EFI A;  1D09 B;  4NL2 A;  3CCQ T;  4ZN3 A;  1U06 A;  3WVE B;  1HK9 A;  4X9C A;  2E3H A;  1OU9 A;  3CPW P;  2RJD A;  4JRP A;  7AT1 B;  4QQ6 A;  5KE3 A;  3QDF A;  3HRT A;  3FC3 A;  2KYB A;  2BZ8 A;  2KXC A;  3CCV A;  3VS7 A;  5KH6 A;  3L2R A;  3HRS A;  2QTV A;  3RES A;  1ZA2 B;  2HL5 C;  2SRC A;  3M53 A;  4JJC A;  4L59 A;  1Q86 R;  2M51 A;  2EKO A;  2DD5 A;  2HMA A;  5GAO n;  1NJI R;  5D6X A;  4OGE A;  4P5N A;  2L3P A;  2HCK A;  2FL7 A;  2MYS A;  1IHV A;  4RTT A;  2DF6 A;  3MO8 A;  3TSZ A;  4FM4 B;  2RQT A;  4C92 B;  1HSQ A;  2JS2 A;  3HRU A;  2E6Z A;  5IHI A;  1WGS A;  3EH1 A;  5GJV B;  3SWN B;  9ATC B;  3JCM d;  2CS7 A;  1BI3 A;  5GAN 6;  1KG1 A;  1UEB A;  3X24 B;  4C92 G;  4DEY A;  3X20 B;  4R56 A;  4A4F A;  3ZL7 C;  1WHL A;  5DLQ E;  3E9G A;  2VUB A;  4M7A G;  2PUK B;  1UGP B;  4GY5 A;  1QVF P;  3QJY A;  5FRO A;  4UC4 A;  1FXX A;  1WXB A;  2ROT A;  3X26 B;  2KY9 A;  3OMG A;  2PVG B;  1D3B B;  2QGF B;  3DB3 A;  1MV3 A;  3JCM X;  4C8Q G;  3A98 A;  2KEA A;  3A5Z B;  1YJN T;  1ABO A;  2A36 A;  2PTK A;  5I11 A;  1QQJ A;  4HXJ A;  1KQ2 A;  1Q82 C;  1ZUU A;  2K2M A;  1NJI C;  1JJ2 A;  2XMF A;  1AEY A;  1AWO A;  1VQ6 Q;  3VRZ A;  2Y4X A;  3JRZ A;  1ZSG A;  5HKC A;  1RAA B;  1K8A R;  2CSQ A;  2F5K A;  4E2F B;  1LPL A;  3X25 B;  4A54 A;  2W0Z A;  4KH0 B;  3QDR B;  3CCJ A;  4MZM A;  1UJY A;  1YWO A;  2IIM A;  3T9N A;  1VQL A;  1VQP T;  1R8O B;  1KD1 C;  3A8G B;  2QEX T;  3OBW A;  4M7A D;  3G71 A;  4RKU E;  2RA2 A;  1M2O A;  4D6W A;  4R0K A;  3GLX A;  4C92 A;  2FB7 A;  4ELY C;  1X75 C;  2CZ6 B;  1BB9 A;  4A4H A;  4M77 G;  1S72 T;  2GFA A;  5FU7 B;  1K76 A;  1OX9 A;  2WSF E;  2OI3 A;  2YHT A;  4C8Q D;  4M78 B;  2IVW A;  3S3M A;  1IGQ A;  3KXT A;  4C0D B;  3H41 A;  1IRX A;  3LGL A;  4PJO F;  4K11 A;  4M7D C;  3MJX A;  4EMK B;  1KQS S;  3R6O A;  2VC8 A;  2GBQ A;  3GNG A;  3KFV A;  1YP5 A;  1LOJ A;  4HCK A;  2MI6 A;  1SF9 A;  1Y71 A;  1D3B A;  3CCR T;  3BDU A;  2PNI A;  1K8A U;  1TU0 B;  1B34 B;  2J7I A;  3E9F A;  1QVP A;  2L3R A;  5GJW B;  4DA4 A;  1M1K R;  4BE1 A;  4XK8 E;  3TCJ A;  2WSE E;  4RG2 A;  3TSW A;  2RK2 A;  1MMG A;  1RAH B;  2CUD A;  4KGX B;  4ZTJ A;  2XK0 A;  5IHN A;  2FEI A;  3QYG B;  5FLX E;  3CCM Q;  2OTJ Q;  2RMO A;  2BKD N;  2YLC A;  3QBY A;  3OYL A;  3GF5 A;  4M75 G;  1G3W A;  1PNJ A;  1HD3 A;  1QKW A;  1RAG B;  1ZSZ B;  5CAI A;  2LZ6 B;  3PVL A;  1WHK A;  4M77 A;  2RJC A;  3EG1 A;  3QXE B;  2DZC A;  2BZY A;  2K5F A;  3VS2 A;  2QQB A;  2ED0 A;  5FWC A;  2LDM A;  3CXC S;  1T3L A;  1WIE A;  3SD4 A;  2O4X B;  4LD9 K;  1R0B G;  5J39 A;  1M90 R;  2DFU A;  1VQO T;  4M78 A;  3I55 T;  1QVG P;  1M8V A;  3NHN A;  4HVV A;  2FG0 A;  2XG8 D;  4PKC C;  4J9C A;  4AMC A;  4EMK A;  2DKG A;  2DYB A;  1MMN A;  1WI7 A;  3CCS T;  4KBM B;  1IZ6 A;  1S1N A;  3QJ6 A;  3RKW A;  2DIL A;  1D0X A;  4M75 D;  1B34 A;  3CQT A;  1D1A A;  2KE9 A;  4JS5 A;  2CZ0 B;  3JB9 J;  1K9M R;  2HNI A;  3M0U A;  1V29 B;  5GAO m;  1IB8 A;  4AFU C;  2C06 A;  5DLO A;  2LQ8 A;  1MHN A;  3CD6 Q;  4DQ2 A;  1GRI A;  3O5Z A;  1JU5 C;  3F70 A;  2MOX A;  1WQW A;  2E5K A;  4XTW A;  3HFN A;  2CGH A;  2LQN A;  2MK5 A;  1Z9Q A;  4M78 F;  3FJP A;  5LJ3 d;  3RUX A;  3QYH B;  3A1P A;  1ZSZ A;  4IUP A;  2AK5 A;  3M57 A;  3H9N A;  2ZAE A;  2DK3 A;  1VQ5 T;  3I35 A;  5FRN A;  2OJ2 A;  1M90 C;  2F2V A;  1YCY A;  2V8I A;  1KHI A;  2A7Y A;  2P84 A;  4IKF A;  4KRT A;  4FU6 A;  1RAF B;  2LVM A;  4HVU A;  2K7A A;  2RQW A;  1YIT T;  4ZN1 A;  2RN8 A;  1K73 C;  2O4X A;  1LVK A;  3CEY A;  4FSX A;  1ZA1 B;  1UG1 A;  4JJB A;  1XOV A;  3I56 T;  4J7I A;  2NWM A;  5GAM d;  1VQM T;  2ROL A;  1MGQ A;  2I2L A;  1K9M U;  3C12 A;  5GAN 5;  5DY9 A;  2G6F X;  3HHT B;  3PMT A;  4Z8A A;  4EMG A;  3OYH A;  2V1Q A;  2ZPI B;  3S3N A;  4ZTF A;  4QKU A;  3GNF B;  3OYF A;  2RF0 A;  2XD0 A;  3SEM A;  2DL8 A;  4HT8 A;  2L0A A;  4C92 C;  2RM4 A;  2H3E B;  3G4S T;  4O6J A;  1OX8 A;  2CT3 A;  1KQS P;  4M7A C;  2P0K A;  2MMP A;  4CC7 A;  3CC2 Q;  1N8R C;  1UE9 A;  2NUP A;  3LW5 E;  3SFM A;  1JJ2 P;  1YHQ T;  1ZUY A;  3TVT A;  4OML A;  2L8D A;  3MP6 A;  3BE3 A;  3FJ5 A;  1VYV A;  2XKO C;  3I5R A;  2OX7 A;  2CH4 A;  1ARK A;  2L3S A;  1ABQ A;  2MIO A;  3CMA Q;  1WHH A;  2DVE A;  3BW1 A;  3H0F A;  2JTE A;  3QG1 A;  3PFS A;  3M4Y A;  1YJN Q;  2GQI A;  2LC4 A;  2VB6 A;  3D7S B;  1PRL C;  4LDV A;  1YJ9 A;  2RJE A;  2LTO A;  5KYX B;  1YN8 A;  2FZK B;  4ZNX A;  1SG5 A;  3CCU T;  3C4S A;  3JB9 F;  2JMC A;  1O9S A;  2P0Q A;  1T0J A;  3OYJ A;  3VKI A;  1VIF A;  4CC3 A;  1TOV A;  4JUV A;  1Y57 A;  3M0S A;  1XQH A;  1WHM A;  1RAC B;  2EWN A;  5GMK m;  4LD6 A;  3RKY A;  3EGD B;  1CKB A;  3HKS A;  3J7A F;  1IRE B;  3CCE Q;  2JNG A;  2VKN A;  2RI2 A;  2ED1 A;  3NTH A;  3CXC P;  2L89 A;  3E19 A;  3RKX A;  3NMZ C;  1AD5 A;  2BUD A;  4F14 A;  2RQV A;  2D9T A;  2GGR A;  4M77 C;  2JVV A;  1KC8 C;  4M7D G;  4IIO A;  3RIR A;  3QII A;  4OMP A;  3H0H A;  3U23 A;  4RTV A;  1VQ7 Q;  3JSC A;  3VS3 A;  5GAO p;  3MKD A;  2E3I A;  4ANJ A;  1QVF S;  5GAN 7;  2JM9 A;  4JJD A;  3QZ5 B;  1X6O A;  4ATO A;  2M02 A;  3L2U A;  2K5I A;  1EZZ B;  4J6W A;  3V8K A;  4BUG A;  1VQ8 Q;  4C0D C;  3M0T A;  1CKA A;  4C0Z A;  2HSP A;  2GNC A;  4EMK C;  4MZT A;  2RPN A;  2CSI A;  3CCL T;  2NLU A;  4AFZ C;  2RO0 A;  4BY6 C;  3BDL A;  1HXD A;  1HJD A;  5KYX A;  3INZ A;  2QG9 B;  1RUW A;  1GCQ A;  4XU3 A;  1C6V X;  1Q7Y C;  1E7O A;  3JB9 I;  4B6M A;  1SHF A;  2HQX A;  4J83 A;  4FYX B;  4M75 C;  1MMD A;  3CCV T;  2M0Y A;  1VQ6 A;  2AKK A;  4C5I A;  4BI3 A;  3WXM B;  3RMS A;  3JCM V;  3V7R A;  2X35 A;  4M7D D;  1D1C A;  2JZ2 A;  3EGD A;  2M16 A;  2B86 A;  1D0Y A;  2RQU A;  4KUL A;  2CP6 A;  1BIB A;  2A28 A;  2KRO A;  4C92 E;  4CC4 B;  4M7A E;  2MPX C;  4N4H A;  3THK A;  3REB B;  2FPF A;  4RTW A;  1NPP A;  4F7U B;  5EC7 A;  5GAN d;  1E6G A;  3NGP A;  5CKB A;  1LNX A;  1NE8 A;  3EAE A;  4LDX A;  5GMK e;  5M9O A;  1RI9 A;  4OB2 B;  4C0F A;  2L3Q A;  1I1J A;  1M2V B;  4FL6 A;  3A8M B;  4RCB A;  3IQL A;  1FMK A;  5IAY A;  1LCK A;  2F5T X;  1MV0 B;  4EPC A;  2JMA A;  3GPL A;  4JZ4 A;  3BY7 A;  4QQD A;  1QCN A;  1K4U S;  1YNZ A;  2QAS A;  1SRM A;  5LJ3 e;  4IUV A;  3PE0 A;  4A53 A;  2EGC A;  2K3Y A;  2FRY A;  4J9I A;  1MMA A;  3M54 A;  5KYN A;  2OTJ A;  1GBR A;  3CCM A;  4PJO B;  1C0M A;  3G6E Q;  2O9S A;  2E70 A;  2EAY A;  2DTH A;  3CCJ T;  4PJL A;  1OV3 A;  1VQK A;  3CME A;  2JXB A;  4M77 E;  4X1V A;  1M9S A;  3TQ7 P;  4PLI A;  1RAD B;  1I5O B;  1VQL T;  4IUU A;  3VYG A;  5J3B A;  1N5Z A;  2LMJ A;  2M1H A;  1SSH A;  1OOT A;  3EG9 B;  3G71 T;  5GAM e;  3TU4 K;  2GCX A;  3O8V A;  1PD0 A;  3HP9 A;  4E6R A;  1QVG S;  1OI1 A;  3JAM E;  2AZS A;  4F7U A;  3L2Q A;  1OPK A;  4OMN A;  2W10 A;  4JPB W;  3JCM J;  3LWH A;  4KT0 E;  2DL7 A;  1Y07 A;  1MND A;  2QA4 Q;  1PSF A;  1QW1 A;  5HK3 A;  3V8J A;  1M2V A;  5HCK A;  2OTL T;  5GMK j;  2LCC A;  3RR6 A;  1RLP C;  1H92 A;  1X27 A;  1K9A A;  6AT1 B;  4R55 A;  4IUQ A;  3EG2 A;  4LXC A;  4XTV A;  3PMI A;  4XTZ A;  4M75 E;  3CBM A;  2R5A A;  3WVD B;  3CC7 A;  1AVZ C;  2ZZD A;  4DBF A;  2B8A A;  4WF2 A;  5IH2 A;  1Q86 C;  1OUL A;  4F7U F;  5LJ3 j;  5I22 A;  2FHD A;  3CD6 A;  3JV3 A;  4PJO A;  2QI2 A;  2K9G A;  2HD0 A;  2EKH A;  3NFC A;  5CKH A;  2HBP A;  4Z02 A;  2CKK A;  1K0S A;  4KGZ B;  4LUD A;  3EG9 A;  1D0Z A;  4C92 D;  1V1C A;  1GFD A;  2FZG B;  4IUR A;  1WPY A;  2HKQ B;  2DO3 A;  2K5L A;  4OB1 B;  3DKM A;  1M3A A;  4FYW B;  5GAM j;  3M58 A;  1H3Z A;  2RK1 A;  2HKN A;  3FLG A;  3SWN A;  2VGN A;  3EGU A;  4FIB A;  1Q81 R;  4ELZ C;  1KD1 U;  2DEQ A;  3MP8 A;  4DOV A;  2BE9 B;  3C94 A;  1W70 A;  5CQY A;  4OP0 A;  3ZBD A;  2M9U A;  3M4G A;  4BE2 A;  5HY6 A;  4M78 G;  5D7U A;  4C0G A;  2QQS A;  3R6N A;  4BB7 A;  4E7K A;  2YRC A;  2VGM A;  4RCC A;  1JJ2 S;  1K8A C;  4LDW A;  1WA7 A;  2VV5 A;  3HL8 A;  2MWP A;  2C0I A;  1ACM B;  1VA7 A;  1JBM A;  3CC2 A;  2P0P A;  1YJW T;  4RTX A;  1PC0 A;  4OB0 B;  2KNB B;  2ZGW A;  1QCF A;  1M5Q 1;  2CUB A;  1WJQ A;  3L1A A;  4N4I A;  2RNA A;  2YT6 A;  1VQK Q;  4GLM A;  2F1L A;  3CME Q;  3S3O A;  3CMA A;  4J6Y A;  5GAO r;  3MP1 A;  2E65 A;  4M77 D;  2KXD A;  1U3O A;  1YJN A;  3EG0 A;  1Q81 U;  4XU1 A;  4JRK A;  1WXU A;  2YUQ A;  1VQN T;  2PU9 B;  2GF7 A;  4ORZ A;  2EYY A;  4N0A A;  2CP2 A;  4M78 D;  2EJG A;  2BIV A;  2FO0 A;  2HZY A;  1X2K A;  1WNL A;  2DX1 A;  2DIG A;  3KUF A;  3UT1 A;  4AFS C;  2WAC A;  1FWZ A;  2CRE A;  1YI2 T;  3VS6 A;  5GAN e;  4C8Q F;  1ZBJ A;  4GLK A;  3CCE A;  4NS5 A;  2BZX A;  1V76 A;  4L5G A;  2O88 A;  3PVQ A;  2DRK A;  1M1K C;  2A37 A;  3VS0 A;  1VQP A;  4J9F A;  2O9V A;  2QEX A;  4OMO A;  4OVA A;  4LUE A;  4E7H A;  1PRM C;  1NEB A;  2DYI A;  2HL3 A;  4LNP A;  2LQK A;  1I0C A;  2DBK A;  4PFO A;  2X3W D;  5LJ5 e;  1AWX A;  1S72 A;  1VQ7 A;  3CC7 Q;  3JB9 G;  1P92 A;  4NL3 A;  1Q95 G;  3VS1 A;  4KUI A;  2AIR B;  3CC4 T;  4JLG A;  2AZV A;  2J6O A;  3E2U A;  1RAI B;  1VQ8 A;  1YIJ Q;  2L2P A;  5FU6 B;  2JOY A;  4PL6 A;  5L8R E;  5KE2 A;  2DJQ A;  3M5A A;  4EDU A;  1VQ4 Q;  1AWW A;  2DA9 A;  4XTY A;  2OAU A;  1YJ9 T;  2KMT A;  5CKD A;  5A0L A;  4BD3 A;  2CP0 A;  2QQ9 A;  1PD1 A;  5A0D A;  3PIP A;  3JCM Q;  3CCQ Q;  5GMK h;  5FRM A;  3C95 A;  3AT1 B;  3GOX A;  2NUT B;  2D6F A;  2ZCF B;  2AT1 B;  3E1S A;  3P8B B;  5AT1 B;  1KIK A;  3OYG A;  1QCO A;  4IUT A;  3PTA A;  1IHW A;  3MEV A;  3CBP A;  4PJO C;  2E10 A;  1BBZ A;  4LDU A;  4M7D E;  2EYZ A;  1SHG A;  1AOJ A;  4AFQ C;  2KRN A;  3JCM e;  2COY A;  3CPW A;  2QTX A;  3RDV A;  5LJ3 h;  1R0C B;  3S6W A;  1K9M C;  5GAN j;  3OS2 A;  2D8J A;  4IIM A;  3M56 A;  1JXM A;  1RL2 A;  4WCI A;  5CCA A;  2RHU A;  4QVD A;  2E4H A;  3FRN A;  3SWN C;  3UA7 A;  2J6F A;  2EIF A;  2EYX A;  4ZGD B;  5LJ5 j;  2CH4 W;  1WQ7 A;  1NYF A;  3M0Q A;  5GAM h;  2RJF A;  2XDD A;  1JEG A;  2PZ1 A;  2IPO B;  2E64 A;  3FIF A;  1QKX A;  2DL5 A;  3CCS A;  1F1B B;  1WJS A;  1BU1 A;  3M9Q A;  3X28 B;  5HK0 A;  4VUB A;  2P4R A;  1OEB A;  5CKE A;  1UTI A;  2J06 A;  1G5V A;  1M1G A;  4OMQ A;  1B7T A;  2JW4 A;  1T3S A;  1YFN A;  3RBB B;  2V26 A;  1TXQ A;  5IN1 A;  2DXC A;  2EQK A;  1WYX A;  1UGS B;  2NUT A;  1RI0 A;  2LT1 A;  1VQ6 T;  4J9H A;  5A2Q E;  4HCC A;  2DLP A;  1NYG A;  3NTI A;  2WSC E;  4OMM A;  2K79 A;  5AYF A;  1U1T A;  3OSS C;  3G6E A;  1Y0M A;  3OW2 A;  3UWN A;  1IXD A;  2EVR A;  3OYY A;  2YUP A;  1VYU A;  1SKU B;  2KSS A;  2DIQ A;  1TUD A;  2BE7 D;  2NUZ A;  1VQP Q;  1AHJ B;  3TEE A;  2QEX Q;  4B9X A;  4ZGE B;  4MDX A;  2RH2 A;  1I07 A;  4XAX B;  2RI3 A;  4N0A C;  1PWT A;  1S72 Q;  1ZHI A;  1Y7X A;  1BCM A;  1U5S A;  2CZ7 B;  1FMW A;  4HVW A;  4FW2 A;  1BI0 A;  5FU7 C;  1W2B A;  4MML A;  4OF1 A;  1VQM A;  2YSQ A;  2QA4 A;  3AHU A;  3A8L B;  2CYZ B;  4M78 C;  1OPL A;  3ZEH A;  2HDA A;  3LH5 A;  2KAF A;  3EHR A;  1VQ9 T;  2XDB A;  1G3S A;  2EQM A;  1UEC A;  4AG2 C;  2HEQ A;  3CCR Q;  3I9Q A;  1ZUK A;  2X4W A;  4OB3 B;  4OMF B;  2DET A;  1EX4 A;  3OYE A;  4J8O A;  5LJ3 f;  4DEX A;  1YJW Q;  2JJ9 A;  3VU3 C;  4PJO E;  2OTJ T;  3CCM T;  3EGX B;  2LNV A;  4RTU A;  2RHY A;  4A63 B;  1QWE A;  3H0I A;  3OB9 A;  2CZ1 B;  3MEA A;  3NPF A;  2ESW A;  2H3J A;  1B07 A;  4HCB A;  2H8H A;  4LE9 A;  4RG8 A;  4J5Y A;  1PG5 B;  1TH7 A;  1ZSZ C;  2JTF A;  2FYK A;  1FMV A;  1PSE A;  1U1S A;  1WXT A;  2IG0 A;  3VUB A;  5GAM f;  1NEG A;  3PGG A;  1G3Y A;  1UGR B;  2D8H A;  2HQH A;  4J9B A;  5GAN 4;  3M0P A;  2X9H A;  2SEM A;  1E6H A;  3OYC A;  1VQO Q;  3I55 Q;  4PNO A;  4F7U G;  2GQV A;  1OYX A;  3MPU B;  2ZPG B;  5CK9 A;  2F2X A;  2ECZ A;  2QDL A;  2RB6 A;  4N4G A;  2DAQ A;  3MEW A;  5KYY B;  4Y91 A;  3CCS Q;  3JCM b;  3V7C A;  3MET A;  2MAM A;  4ME7 A;  3REA B;  1W6X A;  1AZG B;  2C0T A;  4D8K A;  3ASK A;  2ZPB B;  2CP5 A;  1UJ0 A;  3LGF A;  1K1Z A;  1C1A A;  2ZPF B;  3CD6 T;  3EGX A;  3OA6 A;  1YCS B;  2XU8 A;  3QO3 A;  1H8K A;  3OS5 A;  4RUG A;  3Q1J A;  1I8F A;  2MWO A;  4QQG A;  1M4Z A;  1PCX A;  2O31 A;  4C5E A;  4F16 A;  5FU6 C;  3EG3 A;  1NZ9 A;  2FZC B;  1Z9Z A;  2CP7 A;  2X4X A;  1RAE B;  5LJ5 h;  2KI7 A;  4PJO G;  1VQ5 Q;  3VJP A;  3EFS A;  1UHC A;  2RQR A;  2D1X A;  2J05 A;  3OYD A;  4BAC A;  5GAN 2;  3OS0 A;  1YIT Q;  4JLI A;  4M78 E;  1GFC A;  5IXB A;  2KDS A;  1TUG B;  1JXO A;  4RTZ A;  3I56 Q;  1SRL A;  4MMK A;  1Q82 R;  4LDY A;  1KHC A;  3OYB A;  2YUO A;  1VQM Q;  4A4E A;  1OQK A;  1GBQ A;  2CP3 A;  4F17 A;  1QWF A;  2E41 A;  5CKF A;  2OAW A;  2EQI A;  1X69 A;  2KRS A;  2O01 E;  2DTO A;  3VRY A;  1AZE A;  1N6A A;  2EQJ A;  1WDX A;  4OGC A;  5KYY A;  4HA8 A;  2FVU A;  3L42 A;  4V2S A;  4F04 B;  2LJ0 A;  1ZBX A;  4M7A B;  4JZ3 A;  3G4S Q;  1AT1 B;  1I4K 1;  4PJN A;  1KD1 R;  3CC2 T;  2LCL A;  3EFO B;  4PJO D;  1QLY A;  2VXF A;  2HAX A;  2KVQ G;  5CO7 A;  4C8Q B;  3JCM h;  1YHQ Q;  2RHI A;  2MCN A;  4CRI A;  5IT9 E;  3OY9 A;  1PHT A;  1YIJ A;  1GXI E;  3CMA T;  3H6Z A;  4TVR A;  4J9E A;  3OW2 P;  4E7L A;  1VQ4 A;  2EYW A;  5LL6 S;  2JN0 A;  3JCM W;  2VYT A;  1QMC A;  4EMH A;  1KQS A;  2PQW A;  1Q86 U;  1I81 A;  5C0M A;  1Q82 U;  2YXY A;  2DNU A;  1NJI U;  3SDZ A;  3SHW A;  3CCQ A;  2COZ A;  3HTR A;  3CCU Q;  2QK0 A;  1EFN A;  4PFZ A;  2LJ3 A;  1NPR A;  2YRV A;  5I2S A;  3GIB A;  2VXE A;  2DER A;  2AKL A;  3PNW C;  1ZQ1 A;  3OQ5 A;  1TG0 A;  4KGV B;  2YRD A;  1UGQ B;  1GCQ C;  1WHJ A;  3V7S A;  2XI9 A;  2DPP B;  3TRE A;  4D8D A;  3L2V A;  2DRM A;  1NM7 A;  2K3X A;  2RHZ A;  5IXF A;  1BCO A;  1XNI A;  1W2B P;  3CCE T;  5I2M A;  1M3C A;  5GAN f;  1HYO A;  1RAB B;  4M77 B;  3MHX A;  3RER A;  3OMC A;  4DBH A;  1NBE B;  3N5B B;  2DBM A;  5KYW B;  1WX6 A;  3MEU A;  1NLP C;  5CVI A;  3P8H A;  4JDS A;  1VQ7 T;  4M7A A;  4ESR A;  1N27 A;  1UFF A;  2D0Q B;  1X2Q A;  3L2W A;  2KGT A;  1B3Q A;  5LJ5 f;  2DVJ A;  4BE0 A;  2LQW A;  2M0O A;  4X9D A;  1WZO A;  2K4Y A;  3EFO A;  3RMQ A;  2E1H A;  3CXC A;  1VQ8 T;  4C8Q A;  4QVC A;  1TWB A;  1O75 A;  3M59 A;  2OTL A;  3ZFJ A;  2C0O A;  4KH1 B;  2LNH B;  2A3L A;  2ATC B;  1VQ9 Q;  4BY6 B;  1X01 A;  2R5M A;  3FDR A;  2LT4 A;  3CCL Q;  1OU8 A;  2ZPE B;  4J6X A;  2DM1 A;  2DXT A;  4M75 B;  2QAZ A;  1Q81 C;  4C92 F;  2QGG A;  5D6Y A;  3C0C A;  2X4J A;  4PJM A;  3ER0 A;  3GP8 A;  2O2O A;  4M7A F;  1M30 A;  3CCV Q;  3M55 A;  5KCH A;  3OBY A;  1JB0 E;  3GBQ A;  3QSU A;  4AT1 B;  1H3H A;  2V1R A;  2EQU A;  1K0X A;  1KSW A;  4C5G A;  2XIC A;  4DOW A;  5LJ3 g;  2X4Y A;  1GL5 A;  2QXF A;  4II1 A;  2GTJ A;  2NYS A;  3G1J A;  5KYU B;  1M3B A;  3H8Z A;  3VV0 A;  4XTU A;  3JCM f;  1EIF A;  3BFM A;  5KYW A;  3MCA B;  2KBT A;  3OS1 A;  3QWX X;  2PUO B;  2DEU A;  2MF2 A;  3HPW A;  1XJW B;  4AG1 C;  4QW2 A;  2ENM A;  3OSV A;  3LYI A;  1J3T A;  4X34 A;  3J81 E;  2EGA A;  4NOY A;  3URG A;  1KJW A;  2K57 A;  4FT2 A;  2XID A;  5GAN 8;  2XDP A;  2LRQ A;  1M1K U;  2QYZ A;  1IO6 A;  3DLM A;  5GAM g;  2LX9 A;  1BYM A;  3QWY A;  3HFO A;  1UGV A;  1TTH B;  1K73 R;  2DTI A;  4A4G A;  1I5L A;  1U8R A;  3M0R A;  5GAN 3;  1G83 A;  3ULR B;  2KRM A;  2VAS A;  5KCO A;  1LJO A;  1PKT A;  2A0F B;  2DL4 A;  4JS4 A; 
#chains in the Genus database with same CATH homology
 1YI2 Q;  1VQO Q;  1VQP Q;  1VQ6 Q;  3I55 Q;  1YJW Q;  2QEX Q;  3CCJ Q;  1N8R R;  1YJ9 Q;  1VQ8 Q;  1K8A R;  3CMA Q;  1K9M R;  2OTJ Q;  3OW2 P;  3CCM Q;  3G4S Q;  3I56 Q;  1Q86 R;  3CCQ Q;  1Q82 R;  1KQS P;  1VQ5 Q;  1VQN Q;  2QA4 Q;  1YJN Q;  3CPW P;  1VQL Q;  1VQM Q;  1KD1 R;  1VQ9 Q;  1NJI R;  3CCV Q;  1VQ7 Q;  1K73 R;  1S72 Q;  3CC4 Q;  3CC2 Q;  3G71 Q;  3CCR Q;  3CD6 Q;  1Q7Y R;  1YIJ Q;  1W2B P;  1Q81 R;  3CCL Q;  1VQK Q;  3CME Q;  3CCS Q;  1JJ2 P;  3CCE Q;  1KC8 R;  1QVF P;  3CXC P;  3CCU Q;  1YHQ Q;  2OTL Q;  3G6E Q;  1M1K R;  1VQ4 Q;  1YIT Q;  1M90 R;  1QVG P;  3CC7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...