1Q81R

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q81R00
3CC4Q 3CXCP 1YJNQ 3CCUQ 1VQLQ 1QVFP 1VQ4Q 1N8RR 3G71Q 3CCMQ 3CCSQ 2QA4Q 1VQNQ 3I55Q 2QEXQ 1VQKQ 1M90R 3CCRQ 1VQMQ 1YJ9Q 3CCQQ 1S72Q 1VQ5Q 1QVGP 1K73R 3CC2Q 1VQ9Q 1Q81R 3OW2P 3CCEQ 1VQPQ 1VQ7Q 1K8AR 3CPWP 1Q86R 1K9MR 3CD6Q 3G4SQ 3CMEQ 1Q82R 1KC8R 1VQOQ 1NJIR 1M1KR 1YIJQ 1Q7YR 1VQ6Q 1YITQ 1W2BP 1JJ2P 1YJWQ 2OTJQ 3G6EQ 1KD1R 1KQSP 1VQ8Q 3CCVQ 1YI2Q 1YHQQ 3I56Q 3CMAQ 3CCLQ 3CC7Q 2OTLQ 3CCJQ
chains in the Genus database with same CATH superfamily
2MMPA 4EMGA 2XG8D 3L2RA 3OYYA 1AZGB 1RACB 5IHIA 3M0RA 2HDAA 1X75C 2P0PA 2V1QA 2DL4A 4X1VA 1D1BA 4RCCA 2FPFA 2CS7A 1Q81C 4E47A 4JS4A 5J26A 3ZBDA 3KFVA 1WJQA 3OYEA 1CSKA 5J3BA 1IRXA 3EFOB 3ME9A 2RB6A 3M0UA 3I9QA 2P4RA 3CC7Q 3EGUA 3REBB 3VJPA 4E7HA 2RPNA 4M78F 1H3ZA 3OYJA 2XK0A 4FU6A 2BZXA 1D0YA 3CCVT 1OEBA 1NJIR 5EC7A 1RAIB 5GANh 5FROA 4D8KA 4BE1A 1JJ2A 3JB9F 2A36A 2KGTA 3C4SA 2HMAA 2LJ3A 4KGXB 1ABOA 4HVUA 3HRSA 2ZCFB 1NM7A 4C8QG 3AHUA 4F7UG 3VU3C 1KD1C 2X4JA 3TCJA 2K2VA 3L42A 3TVTA 2O01E 1YJWT 4C8QC 3UWNA 1MV0B 1UG1A 1GBQA 4A4KA 1M4ZA 1M90U 2X3WD 1Z9ZA 3MJXA 4EPCA 3G71T 1WYXA 1PM3A 3CMAA 3LH0A 3CCJA 1I0CA 4M7AE 4X9DA 2X4WA 5M9OA 1VQLA 1X01A 5CVIA 2NUPB 3PMIA 1YN8A 3ER0A 2DKGA 4FW1A 4EMHA 3O5ZA 2LVMA 4KGVB 4DEYA 1VQ7Q 3CPWS 1ZSGA 1QCOA 3MPUB 1OU8A 1KQ2A 1UECA 4KULA 4HT8A 1ZUKA 2FRWA 3X24B 3IQLA 1HXDA 2LNHB 3CMAQ 4QVCA 1Q7YC 3CCJQ 3CXCA 4EMKA 3U23A 2KDSA 3UF4A 4LUEA 3VS6A 4Y91A 1YIJT 1MNEA 2WACA 4Y28E 1OU9A 2E41A 3WVDB 3MEWA 1WHHA 1WXBA 2QGGA 2DTOA 3H0FA 1ZLMA 1CKAA 1SRLA 3CCVA 1IXDA 1VQPT 1KC8U 4J5YA 1MMAA 4M75B 3L2VA 1WX6A 1ZBJA 4ELZC 4M78E 2K3YA 4C0DC 1WZOA 3QSUA 4J9IA 3LGLA 2BUDA 4C0ZA 2LCLA 3VS0A 1K9AA 3EG1A 3M59A 1YJWA 5IHNA 4MDXA 5KYNA 3CCVQ 3QHSA 2LQ8A 3G71A 5KYUA 4BE0A 3OY9A 1S1NA 2BZ8A 5LJ3e 2V26A 4PJJA 3CCLT 1YJNT 5HKCA 4B9WA 1J3TA 1TTHB 3QJYA 2C0OA 2CUDA 3INZA 4KRTA 1YJWQ 3JCMe 4KH0B 1BBZA 2DIGA 3R6NA 4M7DD 4OMQA 3G71Q 3GNFB 1XTDA 3M4YA 5LJ5e 2JMCA 3G6ET 1G3YA 3OQ5A 4J9FA 2HKQB 1D3BA 3BFMA 1H3HA 1TXQA 1MHNA 1YIJA 3A8GB 3JCMb 4JJNK 4C5HA 1NLPC 4N0AC 2LT4A 2D8JA 2DNUA 4DQ2A 2VUBA 2VWFA 2MWPA 3BDLA 2CZ6B 1KHCA 2ED0A 4HVVA 1VQPA 3KXTA 2X3XD 2G6FX 3QPHA 3NMZC 1W2BP 3F70A 3GIBA 2F69A 2V8IA 1KQSP 5HY6A 1WA7A 1WHLA 2QTXA 2Y90A 1C0MA 3A8HB 4C92A 4ZTFA 1WHGA 2J6KA 1I07A 5CAIA 4J6YA 3OW2S 1EFNA 4IUTA 3TQ7P 3NTIA 5AT1B 4FYXB 3OYLA 2MIOA 1Y57A 4O5VA 3EG9A 2YRVA 4HA8A 2KSSA 1K8AU 1YJNA 2GQVA 2RI3A 3PT9A 3URGA 1LVKA 2HD0A 1BI1A 2LC4A 4ZGJB 4PK4A 2O88A 1RABB 2MAMA 3V8LA 4C8QF 2EKHA 4F7UF 1PD1A 1OX8A 2QASA 1YCSB 2RJDA 1UGPB 2ESWA 2FG0A 2A28A 2E12A 2VKNA 4MZMA 3M56A 3I5RA 2CT4A 3HFOA 3JAME 3G6EA 2KRMA 3OB9A 2YDLA 3ZEHA 1GXIE 2DZCA 2DVJA 3OBWA 3CCLQ 1X27A 1YJNQ 4JJDA 4F17A 1QMCA 2A08A 1SHFA 3REAB 1KG1A 4B6MA 3AT1B 2RM4A 4ANJA 5GAOp 5CKDA 1BCOA 1BK2A 1VA7A 3GPLA 2KR3A 5I22A 4OMPA 2CP2A 5D6WA 1U5SA 3G6EQ 1NEGA 3OYBA 4DBRA 1B34A 1TUCA 2JTEA 2QA4A 2CH4W 1M2VA 2GGRA 2EYYA 4M77B 2DXTA 2EBPA 5KE3A 2RI5A 4OB3B 1GBRA 4LDXA 5FRMA 5FRNA 2R5MA 4XU1A 4Y92A 1JRIA 1K9MC 1I81A 3OYMA 3PIOA 2DTIA 3EHRA 4M7AA 3V7RA 5FLXE 1K73C 1NLOC 2GNCA 1TSFA 2XICA 2ZPGB 3OS5A 3QZ5B 1WHMA 3CPWP 1RAFB 2KRSA 2LRQA 2BIVA 2K5LA 3P8DA 3RKWA 2QQBA 2VXFA 5KYWB 2FZGB 3GBQA 1IZ6A 2XDDA 2ROTA 3DB3A 3DKMA 2JM8A 1ZUYA 3EFOA 1G3TA 4PLIA 4C8QE 2HQEA 4M7DG 2A37A 5GJVB 3P8BB 4WF2A 4MDWA 4M7DC 1NPPA 4AT1B 2K3BA 4J6WA 1VQKT 1GCQC 1JJ2S 2RQRA 2A0FB 5LJ3d 2RHZA 1RAHB 2JXBA 3A98A 4UC4A 2GQIA 5IXFA 1XQHA 3LLRA 1XOVA 2DYBA 5GAN2 1M8MA 3S3OA 1AWWA 3PGGA 3JCMd 1PC0A 1KIKA 5LJ5g 5FU6C 1UGVA 3GF5A 1H641 1WFWA 1UJYA 2MF2A 4FL6A 2PTKA 4AFQC 5LJ5d 3HRUA 2V8KA 1UGQB 2CZ7B 4GLKA 2K4YA 2YUPA 2QEXA 3QUIA 2E6ZA 2NUPA 2AK5A 2HAXA 2DAQA 3GNGA 3WVEB 2P4TA 3SWNB 3NHNA 1WLPB 1AWJA 3L2WA 1N5ZA 4ORZA 2ROLA 4HT9A 5LJ3f 1KSWA 1NE8A 4JUVA 2IVWA 2ZPEB 3OYIA 5LJ5j 3CXCS 2EYWA 4OMFB 2AKLA 2DK3A 5GJWB 3JCMf 4IIOA 2YUQA 4XK8E 1YHQT 1E6GA 2FPDA 2JNGA 1Q81R 3T9NA 2LZ6B 2AKKA 4N4GA 2LX9A 3FDRA 3CCQT 1TWBA 5CCAA 2DZ9A 1E6HA 2JUFA 2VGMA 1D09B 5IAYA 5CQXA 3OS2A 2MOXA 2XI9A 4J9HA 1VQKA 4IKFA 4AFUC 4M75A 2RHXA 3G1JA 4MZPA 2QGFB 2WSEE 4E2FB 2K5IA 2P84A 1PCXA 4J83A 4NS5A 4Z02A 5KH6A 1K4US 1M2OA 2RMOA 2KY9A 1KFZA 2K6DA 4QKUA 1KD1R 1PRLC 4C5EA 4BI3A 1NPRA 2FRYA 3CMET 2L89A 1B7TA 1MMNA 4GLMA 5LJ5h 3MEVA 4AG1C 1VQKQ 3QDFA 2C0TA 2GCXA 4CC3A 3TSZA 4OP0A 4DBFA 4E7LA 2LDMA 2DA9A 5A0DA 3OW2P 2KNBB 3OSSC 1MNDA 2CREA 2KEAA 2H3JA 2CKKA 1OZ3A 3EFSA 2DEUA 1I5LA 4WTOB 2KK4A 1WNLA 1VOMA 2FZKB 2FYKA 1G3SA 4KUDK 2L5QA 4PJLA 1O75A 3KBGA 1R0BG 1K0SA 1Q7YR 1YHQA 1WHJA 1Q86U 5IH2A 1T0JA 5CIUA 3PE0A 4D6WA 1NBEB 5IT9E 5LL6S 4LNPA 3OYCA 4JRQA 3EG0A 1LOJA 2ABLA 3I5SA 3EG3A 4RG8A 1HK9A 3GOXA 1MUZA 2JN0A 2H3EB 5CKHA 4RTZA 4A4EA 1UUEA 3E9FA 2EVRA 3CC2T 3VRZA 1KJWA 2AHJB 2HZYA 3MEUA 1YHQQ 3V7CA 2CP5A 2QDYB 1JEGA 5CKBA 3CCQQ 1AEYA 5KYXB 1OOTA 2BE9B 2HEQA 3CMEA 3FB9A 4M7DF 2RHUA 3MCAB 2CH4A 5A2QE 2YUOA 4C92D 2HSEB 1UB4A 1YP5A 4PLLA 4LD9K 3UA6A 3V8JA 2DD5A 3JV3A 2CZ1B 4YTLA 1C6VX 1D0ZA 4L6V5 2O4XB 1UE9A 3OSVA 1QVFA 2M0OA 4M78B 3M0SA 2YT6A 1UDLA 2LCCA 2DO3A 2F2VA 2DVEA 2LQNA 2RA2A 3VUZA 1K76A 4X9CA 2EYQA 1VQ7A 2DF6A 4QW2A 1M90C 4A4FA 1OYXA 2FVUA 8AT1B 3VS1A 5GAN3 3CMEQ 2KRNA 4A54A 3M53A 5IN1A 3E19A 3VS5A 3X26B 2K9GA 2CP3A 1G2BA 2YRDA 3HRTA 1M1KU 5KYYB 2DIQA 4FM4B 1IGUA 1IO6A 4XTWA 5GMKe 3LH5A 4PJOG 3DLMA 4HKEA 1N8RU 2RQTA 1U8RA 3MO8A 2MI6A 1JJ2P 4PJOA 3OYHA 4BDZA 4E7ZA 3S6WA 4EMKC 3C12A 4M77G 5KCOA 3JCMJ 1RADB 3OYKA 3CC2A 1IHWA 2L3QA 4J9GA 2R5AA 1QVGA 1WQWA 1I5OB 2QAZA 4M77A 2OTLT 2E10A 1OPKA 4K11A 2EJFA 3NFCA 4XU2A 4QQGA 2EQIA 4A63B 5J39A 2Y4XA 2DL5A 1WIEA 1VQMT 2K7AA 1ZA1B 1KC8C 1TH7A 2HBPA 2DL8A 1ZSZB 3MP1A 3EG2A 1SKUB 1DJ7B 4A4GA 3CC2Q 4CC2A 2SRCA 2EIFA 1YI2T 2NUZA 1XNIA 3PTAA 2E6NA 4M7AD 2A7YA 1AWXA 2L2PA 2M16A 1UJ0A 2JJ9A 1X69A 4BE2A 1VQ8Q 5KYWA 4J9BA 2FHDA 3MEAA 2DETA 3CXCP 1WHKA 4JJCA 3RMSA 4FSSA 3FC3A 2LP5A 2OAWA 4PL6A 2JZ2A 2ZZDA 2ZPIB 1P92A 4ESRA 1PKTA 5GMKm 5EG2A 1WJSA 4JRPA 3M54A 4JRIA 5CKFA 1LCKA 5FW9A 1NJIU 1ZHIA 2LJ0A 2AZSA 4ZN3A 2P0QA 1QCNA 4J9CA 1YWPA 2KE9A 1YITT 2D8HA 2IG0A 2QK0A 3OYAA 4FIBA 2FO0A 3JCMV 3M0TA 2E3HA 2WSFE 2OTLA 2EGEA 2XMFA 2RO0A 5GAOm 1VQMA 1BB9A 1G8XA 2QDLA 2AIRB 2X9HA 1K9MR 4BY6C 3SWNA 3FJ5A 2H8HA 3PNWC 2Z0WA 3RKXA 1YI2A 4V2SA 4C92G 3X25B 2OTLQ 3J80E 2PVOB 4E6RA 3SDZA 3EGXB 2ZPBB 4C5IA 4C92C 2QQ9A 1RLQC 5GAMe 3NPFA 2BTTA 3A8MB 2A3LA 3H0IA 1VQMQ 1H92A 4DBHA 1RAAB 2JTFA 1PNJA 3QJ6A 1VYUA 3CEYA 1K8AC 3C0CA 3JCMQ 3CBPA 4E7JA 2COWA 1YI2Q 2ED1A 3CCLA 4XAXB 1HJDA 3G4ST 1NZ9A 4AG2C 2NWMA 1G5VA 4IUVA 2ZPHB 1UGRB 2AT1B 4R55A 2DRMA 4XU3A 4PKCC 2FEIA 1QQJA 4XTYA 4M75D 2Y4YA 3M4GA 1OI1A 2DJZA 2JTMA 2VYTA 4XTVA 2EJGA 1NYFA 2EQMA 2RHIA 1RUWA 1WXTA 3NTKA 2KT1A 2F5TX 1UHFA 5I11A 4C8QB 1Y96B 5FU7C 2HCKA 2KAFA 2RF0A 2ZAEA 1X6OA 4F7UB 5GAN4 1AVZC 3BE3A 3JB9J 2HKNA 1UFFA 2EAYA 2CSIA 2J6FA 3HP9A 1Q82R 3S3NA 3CCMT 1AWOA 3VYGA 5GANe 1WGSA 2HBWA 1QP2A 1QKXA 1YITQ 4BACA 3GLXA 2NYSA 4LDVA 1RAEB 4FCYA 1MMDA 2COYA 4ELYC 2LNVA 1BKBA 1LPLA 4ME7A 3VS3A 4M7AG 1JB0E 3EH2A 4M7AC 2KBTA 1MMGA 3M9QA 3J7AF 2LT1A 1QVPA 2RK1A 2R58A 3HSBA 4A53A 2L8DA 1HSQA 3E9GA 1NEBA 1LNXA 3VS4A 2F1LA 2K57A 1VUBA 4IUQA 1T0HA 4D8DA 1O9SA 3G4SA 2CT3A 3MKDA 5I2MA 2B8AA 1Y7XA 1VQOQ 1VQNT 1ZA2B 3UATA 1UEBA 1PG5B 1WQ7A 1PWTA 5CKEA 1TOVA 5A0LA 1B07A 4OB1B 3H0HA 3QWYA 3VYHB 1HD3A 2QQRA 2DD4A 4Z88A 4C0DB 3JB9I 1BU1A 1QW1A 4F7UE 3BY7A 2CP0A 3FRNA 2DJQA 4CC4B 3G4SQ 5LJ3g 1Y0MA 2NUTB 1WPYA 2PQWA 2DXBA 3CD6T 4M78G 2VXEA 3RUXA 3CCMA 1QVFS 1I4K1 3JCMg 2CYZB 1N27A 4M4ZA 3RMQA 2K3XA 2O4XA 2OTJT 3JB9H 4M78A 1Q95G 4OB2B 4KH1B 4QT7A 2KMTA 5KE2A 1N9SA 2K79A 1GRIA 5CQYA 2XIDA 3OMGA 3EFRA 2IIMA 1KK7A 1SHGA 3CCMQ 3TEEA 5LJ3j 3L2ZA 2D1XA 5KYYA 4DBQA 1SSHA 2XKOC 1VIFA 3EGDB 3CC4T 2FZCB 3QWXX 1ZQ1A 3DB4A 3M5AA 3JCMX 1X2KA 1QWFA 4HCKA 1VQ5T 4JDSA 2X4XA 1Q82U 2VV5A 5GAN5 2JW4A 4EDUA 3M55A 4C92F 5DM7R 2OI3A 3C95A 1VQNA 1T3SA 2C0IA 1VQ4Q 1U06A 4FT2A 3CPFA 2QI2A 4PJOD 3MHXA 1QVGS 1BIAA 2HNIA 4BY6B 2DL7A 4AFZC 1Y07A 4JJBA 4TVRA 3HTRA 5IXBA 5GAMd 2RI2A 3EAEA 4RTXA 4M77D 4M75G 5C6SA 9ATCB 2L3RA 2HQHA 2YUNA 4M75C 1ZSZA 2CP7A 1VQNQ 2DPPB 1M3BA 4P5NA 3X28B 1RI0A 5LJ3h 2E1HA 4FYWB 3CD6A 2XDPA 2I2LA 4XTZA 2HSPA 2CP6A 3OS0A 3QO3A 2OTJA 2COZA 3LW5E 3JCMh 1VYVA 1SG5A 2M02A 2YWWA 5D7UA 5FWBA 5GAMj 2ZPFB 2CSQA 2OJ2A 1M9SA 3JCMc 2E70A 4A4HA 1W6XA 3UA7A 1CKBA 1SF9A 2C06A 3RERA 3CD6Q 5GAMf 2EWNA 4FT4A 1M1FA 5CR2A 4FSXA 1JXOA 2OTJQ 5A0GA 3CC4A 1I8FA 3DLLA 5AYFA 1VQ5A 2J05A 2JM9A 5GANd 2DMOA 2PVDB 4LXCA 4EIKA 1MGQA 2EQKA 4RTUA 3NTHA 2YLBA 3WXMB 2EQUA 4CC7A 2F2WA 3RDVA 1SSFA 1W2BS 1S72T 1Q86C 4LE9A 3PVQA 1KQSS 5D6XA 3M57A 4ATOA 4AMCA 1YWOA 4M7AF 4MMLA 3CC4Q 4J7FA 3CCUQ 2R57A 3META 2O31A 2MK5A 3CCQA 1VQ5Q 4LDYA 1W1FA 1WI7A 1NYGA 4QVZA 4DEXA 5GANj 2CZ0B 2SEMA 3VS2A 1KC8R 1M3AA 1IB8A 1YJ9T 3LWHA 4RMOA 3FLGA 2GTJA 3O8VA 5FWCA 4BD3A 4PJNA 4GBQA 4BI8B 5GANf 4JS5A 2MPXC 2L0AA 4XTUA 3EGXA 1YNZA 5GAN6 4PFOA 2OAUA 4QQDA 3RKYA 3KUFA 1VQ8T 2M9UA 4J9EA 3OS1A 1X43A 4DOWA 3GP8A 3CCST 1U1TA 3E2UA 3CCRT 2LQKA 1Q81U 1VQ9T 4FYVB 4OMLA 4JLIA 4L5GA 1X2QA 3G7ZA 2QXFA 3HL8A 1RL2A 2VGNA 4CI0C 2KXDA 3X20B 1B3QA 2LQWA 4R56A 4OMOA 4M7DB 2L3PA 3L1AA 3SD4A 1FWZA 2DLPA 4BB7A 3UDCA 1AD5A 4OVAA 1M1KC 1PHTA 4LDUA 1WJRA 3HKSA 1I1JA 2DBKA 2LCSA 2K5FA 2GTOA 1S72A 2XD0A 5HK0A 1W70A 1KD1U 4C8QA 1Y96A 4J6XA 5FU6B 4F7UA 1N8RC 3ULRB 2DYIA 1Y71A 1TUDA 3FIFA 3H41A 2EGCA 4PJOC 2B86A 2D0NA 2LTOA 4OMMA 4ZTJA 1ZUUA 1QVFP 1EZZB 1YJ9A 3QG1A 2D9TA 1S72Q 5HCKA 3PFSA 1QCFA 3MP6A 4M77C 4J7IA 1BI3A 1PSEA 2QG9B 4PNOA 1JU5C 3LYIA 2J06A 3A8LB 1VQ8A 2FB7A 1D1CA 4Z89A 1G3WA 5HK3A 1K1ZA 4M75F 3CCSA 1Q7YU 1VQLQ 3CCRA 2W10A 1BI0A 1VQ9A 1YJ9Q 5GAOn 3RBBB 1K8AR 1TU0B 2KYBA 2DX1A 4JRKA 1ACMB 2MWOA 1U1SA 2AZVA 4M7DE 2RQVA 2RN8A 2I0NA 4IUPA 4JZ4A 2KROA 2RQUA 5KCHA 4LDWA 4L59A 4J9DA 4F16A 2HQXA 1ABQA 2ATCB 2RK2A 1M5Q1 5GMKi 3CCSQ 1VQ6T 1GL5A 1WDXA 4RTTA 3CCRQ 3VUBA 4F04B 1QVGP 4ZN1A 1VQ9Q 4HCBA 4KT0E 1AHJB 4MZTA 2RH2A 2XHCA 4GY5A 3ZL7C 5CK9A 3SB2A 5L8RE 1LJOA 1FYNA 4RKUE 2NUTA 1NJIC 2YSQA 2DXUA 4IURA 3LWIA 2CGHA 2P0KA 2D6FA 2M1HA 4FW2A 2DXCA 3OYFA 3J81E 3PIPA 2IPOB 2DILA 3SFMA 2CDTA 3OBYA 1FMWA 3D7SB 3H8ZA 2GBQA 4MMKA 1BI2A 1IGQA 1W2BA 1QP3A 4M78D 1YCYA 4JPBW 1KQSA 1PRMC 4FYYB 1ZBXA 3H9NA 1HYOA 2G3RA 1OQKA 4E7SA 1QKWA 5IHKA 3PVLA 4DOVA 3JSCA 3JB9D 1EX4A 3SWNC 3EGDA 3CBOA 2E3IA 1R77A 3E1SA 3CCET 2DBMA 4N0AA 1K73R 4RG2A 4OMNA 2RJEA 4M75E 1PKSA 2KT8A 1VQOT 4BDYA 2EKOA 3M0QA 4N4IA 2CUBA 2KQWA 4JLGA 2QA4T 1VQ6A 4IIMA 1YIJQ 4BI4A 5I21A 4X34A 1OV3A 2MCNA 2JT4A 3ZFJA 1OULA 2LMJA 4OGCA 2VB6A 3A1PA 3M0PA 1UTIA 3I56T 1VQPQ 1D1AA 4F14A 1V1CA 1K0XA 3I55T 3JCMP 3JRZA 1VQ6Q 1UGSB 1FMKA 1BYMA 2F2XA 1OPLA 2JOYA 5ECAA 1W4SA 3VRYA 2OX7A 1YITA 1N9RA 4CRIA 2PUOB 1RLPC 1TUGB 3Q1JA 2EFIA 1X6BA 2ZGWA 4N4HA 4PFPA 4IUUA 4PJOF 1F1BB 2DFUA 3S3MA 3OYNA 2EW3A 4O6JA 1H8KA 1D0XA 3UPUA 4NL2A 3SEMA 5DLOA 4OGEA 3CCEA 1FX7A 3R6OA 4II1A 4M77F 3V8KA 3VV0A 4PJMA 2DL3A 2RNAA 4KUIA 3OYDA 3CPWA 2V1RA 1AOJA 1R8OB 2PU9B 2E65A 3I35A 1BCMA 2QQSA 1VQOA 2QQAA 2BZYA 4PJOB 1VQ4T 5C0MA 4ZGEB 4HCCA 2V8JA 1GCPA 4B9XA 2WSCE 4EMKB 4BUGA 2EJ9A 4NL3A 1RAGB 4AFSC 2DRKA 2PVGB 4RUGA 4Z8AA 5GMKj 2KI7A 1QLYA 5DLQE 3A8OB 3A5ZB 3CCEQ 2LJ1A 2F5KA 1ZX6A 1IREB 2W0ZA 3TSWA 3TREA 3EH1A 2QEXT 4WCIA 4C0GA 4E7IA 3I56A 1K9MU 1PSFA 3LX7A 2EYZA 3FJPA 3I55A 1FXXA 1E7OA 4ZNXA 2QA4Q 4C5GA 2QYZA 1K73U 5GMKl 3ASKA 3OMCA 1OX9A 5DY9A 3HPWA 2X51A 5KYXA 4E7KA 3OA6A 2XDBA 1NG2A 2E5QA 3MP8A 4C0FA 4QVDA 3I56Q 5KYUB 1KHIA 2PZ1A 3LGFA 2RJFA 3I55Q 1V29B 1FMVA 4M78C 3RR6A 3QXEB 5CO7A 4KBMB 3L2UA 5GAOr 4XQ3A 2O9SA 5GMKh 4XU0A 2PNIA 2EGAA 2EPDA 3HHTB 3BW1A 3FEOA 2X4YA 3JB9G 3QBYA 4M7DA 3H6ZA 1M3CA 1AZEA 4PJOE 2BE7D 1RI9A 4LN2A 5GAOl 1GCQA 1YBYA 2JS2A 2YXYA 2RD1A 2E4HA 4HCZA 4HVWA 1M8VA 1VQ4A 3V7SA 1SEMA 5L23A 1WXUA 2L3SA 4LD6A 1D3BB 4M77E 3RNJA 1Q86R 2XU8A 3QKJA 4LUDA 4JZ3A 3C94A 3CCUT 1OZ2A 1M30A 2VVKA 1Q82C 4C8QD 3CQTA 1GFCA 1XJWB 4NOYA 3QYHB 3QZ9B 2VASA 2DM1A 1TG0A 2FPEA 1GFDA 1TS9A 1SRMA 4R0KA 3QDRB 5GAMg 2DTHA 1T3LA 2DEQA 1VIEA 4HXJA 2O2OA 2GF7A 1A0NB 4RTYA 2KXCA 1KQ1A 3RIRA 2KVQG 1N6AA 4C92B 4RTVA 4QQ6A 1ZSZC 2HL5C 2VC8A 1YFNA 2QEXQ 2JVVA 4RCBA 3OW2A 3RESA 3PMTA 3QIIA 3CC7T 3SHWA 3UT1A 3HFNA 3N5BB 3EG9B 5LJ5f 2PUKB 1U3OA 1JBMA 2YRCA 3P8HA 3OYGA 1BIBA 2HL3A 1M27C 2EYXA 5GAOq 1IHVA 1SPKA 2ECZA 4RTWA 3VKIA 7AT1B 2BKDN 3NGPA 4VUBA 1M90R 2E5KA 2M0YA 1UHCA 2NLUA 2EQJA 2QTVA 3L2QA 4OB0B 1EIFA 1G83A 3EHQA 3M58A 4DA4A 2YLCA 2RQWA 3TU4K 2FL7A 1M1KR 3BDUA 4ZGDB 1Z9QA 1V76A 1ARKA 5GANg 3VS7A 6AT1B 2RHYA 3CCUA 2O9VA 1N8RR 1AT1B 1JXMA 5FU7B 3JCMW 8ATCB 2X35A 2J7IA 4OF1A 2RJCA 1JO8A 1C1AA 2KYMA 1JQQA 1M1GA 2M51A 5I2SA 2JS0A 2J6OA 1B34B 5GAN7 1QWEA 1VQ7T 2E64A 2GFAA 1VYTA 1X6GA 2JMAA 2MYSA 5D6YA 1M2VB 4C92E 5GAMh 2K2MA 3QYGB 1MV3A 3THKA 4PFZA 4Q5WA 2ENMA 3CMAT 1R0CB 3CBMA 3CCJT 2D0QB 1VQLT 2GFUA 1PD0A 5GAN8 3CC7A 4J8OA 4KGZB 4M7AB 4XTXA 2LX7A 2DERA 2DE0X 2YHTA
chains in the Genus database with same CATH topology
3CC4Q 3CXCP 1YJNQ 3CCUQ 1VQLQ 1QVFP 1VQ4Q 1N8RR 3G71Q 3CCMQ 3CCSQ 2QA4Q 1VQNQ 3I55Q 2QEXQ 1VQKQ 1M90R 3CCRQ 1VQMQ 1YJ9Q 3CCQQ 1S72Q 1VQ5Q 1QVGP 1K73R 3CC2Q 1VQ9Q 1Q81R 3OW2P 3CCEQ 1VQPQ 1VQ7Q 1K8AR 3CPWP 1Q86R 1K9MR 3CD6Q 3G4SQ 3CMEQ 1Q82R 1KC8R 1VQOQ 1NJIR 1M1KR 1YIJQ 1Q7YR 1VQ6Q 1YITQ 1W2BP 1JJ2P 1YJWQ 2OTJQ 3G6EQ 1KD1R 1KQSP 1VQ8Q 3CCVQ 1YI2Q 1YHQQ 3I56Q 3CMAQ 3CCLQ 3CC7Q 2OTLQ 3CCJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Q;  3CXC P;  1YJN Q;  3CCU Q;  1VQL Q;  1QVF P;  1VQ4 Q;  1N8R R;  3G71 Q;  3CCM Q;  3CCS Q;  2QA4 Q;  1VQN Q;  3I55 Q;  2QEX Q;  1VQK Q;  1M90 R;  3CCR Q;  1VQM Q;  1YJ9 Q;  3CCQ Q;  1S72 Q;  1VQ5 Q;  1QVG P;  1K73 R;  3CC2 Q;  1VQ9 Q;  1Q81 R;  3OW2 P;  3CCE Q;  1VQP Q;  1VQ7 Q;  1K8A R;  3CPW P;  1Q86 R;  1K9M R;  3CD6 Q;  3G4S Q;  3CME Q;  1Q82 R;  1KC8 R;  1VQO Q;  1NJI R;  1M1K R;  1YIJ Q;  1Q7Y R;  1VQ6 Q;  1YIT Q;  1W2B P;  1JJ2 P;  1YJW Q;  2OTJ Q;  3G6E Q;  1KD1 R;  1KQS P;  1VQ8 Q;  3CCV Q;  1YI2 Q;  1YHQ Q;  3I56 Q;  3CMA Q;  3CCL Q;  3CC7 Q;  2OTL Q;  3CCJ Q; 
#chains in the Genus database with same CATH topology
 2MMP A;  4EMG A;  2XG8 D;  3L2R A;  3OYY A;  1AZG B;  1RAC B;  5IHI A;  3M0R A;  2HDA A;  1X75 C;  2P0P A;  2V1Q A;  2DL4 A;  4X1V A;  1D1B A;  4RCC A;  2FPF A;  2CS7 A;  1Q81 C;  4E47 A;  4JS4 A;  5J26 A;  3ZBD A;  3KFV A;  1WJQ A;  3OYE A;  1CSK A;  5J3B A;  1IRX A;  3EFO B;  3ME9 A;  2RB6 A;  3M0U A;  3I9Q A;  2P4R A;  3CC7 Q;  3EGU A;  3REB B;  3VJP A;  4E7H A;  2RPN A;  4M78 F;  1H3Z A;  3OYJ A;  2XK0 A;  4FU6 A;  2BZX A;  1D0Y A;  3CCV T;  1OEB A;  1NJI R;  5EC7 A;  1RAI B;  5GAN h;  5FRO A;  4D8K A;  4BE1 A;  1JJ2 A;  3JB9 F;  2A36 A;  2KGT A;  3C4S A;  2HMA A;  2LJ3 A;  4KGX B;  1ABO A;  4HVU A;  3HRS A;  2ZCF B;  1NM7 A;  4C8Q G;  3AHU A;  4F7U G;  3VU3 C;  1KD1 C;  2X4J A;  3TCJ A;  2K2V A;  3L42 A;  3TVT A;  2O01 E;  1YJW T;  4C8Q C;  3UWN A;  1MV0 B;  1UG1 A;  1GBQ A;  4A4K A;  1M4Z A;  1M90 U;  2X3W D;  1Z9Z A;  3MJX A;  4EPC A;  3G71 T;  1WYX A;  1PM3 A;  3CMA A;  3LH0 A;  3CCJ A;  1I0C A;  4M7A E;  4X9D A;  2X4W A;  5M9O A;  1VQL A;  1X01 A;  5CVI A;  2NUP B;  3PMI A;  1YN8 A;  3ER0 A;  2DKG A;  4FW1 A;  4EMH A;  3O5Z A;  2LVM A;  4KGV B;  4DEY A;  1VQ7 Q;  3CPW S;  1ZSG A;  1QCO A;  3MPU B;  1OU8 A;  1KQ2 A;  1UEC A;  4KUL A;  4HT8 A;  1ZUK A;  2FRW A;  3X24 B;  3IQL A;  1HXD A;  2LNH B;  3CMA Q;  4QVC A;  1Q7Y C;  3CCJ Q;  3CXC A;  4EMK A;  3U23 A;  2KDS A;  3UF4 A;  4LUE A;  3VS6 A;  4Y91 A;  1YIJ T;  1MNE A;  2WAC A;  4Y28 E;  1OU9 A;  2E41 A;  3WVD B;  3MEW A;  1WHH A;  1WXB A;  2QGG A;  2DTO A;  3H0F A;  1ZLM A;  1CKA A;  1SRL A;  3CCV A;  1IXD A;  1VQP T;  1KC8 U;  4J5Y A;  1MMA A;  4M75 B;  3L2V A;  1WX6 A;  1ZBJ A;  4ELZ C;  4M78 E;  2K3Y A;  4C0D C;  1WZO A;  3QSU A;  4J9I A;  3LGL A;  2BUD A;  4C0Z A;  2LCL A;  3VS0 A;  1K9A A;  3EG1 A;  3M59 A;  1YJW A;  5IHN A;  4MDX A;  5KYN A;  3CCV Q;  3QHS A;  2LQ8 A;  3G71 A;  5KYU A;  4BE0 A;  3OY9 A;  1S1N A;  2BZ8 A;  5LJ3 e;  2V26 A;  4PJJ A;  3CCL T;  1YJN T;  5HKC A;  4B9W A;  1J3T A;  1TTH B;  3QJY A;  2C0O A;  2CUD A;  3INZ A;  4KRT A;  1YJW Q;  3JCM e;  4KH0 B;  1BBZ A;  2DIG A;  3R6N A;  4M7D D;  4OMQ A;  3G71 Q;  3GNF B;  1XTD A;  3M4Y A;  5LJ5 e;  2JMC A;  3G6E T;  1G3Y A;  3OQ5 A;  4J9F A;  2HKQ B;  1D3B A;  3BFM A;  1H3H A;  1TXQ A;  1MHN A;  1YIJ A;  3A8G B;  3JCM b;  4JJN K;  4C5H A;  1NLP C;  4N0A C;  2LT4 A;  2D8J A;  2DNU A;  4DQ2 A;  2VUB A;  2VWF A;  2MWP A;  3BDL A;  2CZ6 B;  1KHC A;  2ED0 A;  4HVV A;  1VQP A;  3KXT A;  2X3X D;  2G6F X;  3QPH A;  3NMZ C;  1W2B P;  3F70 A;  3GIB A;  2F69 A;  2V8I A;  1KQS P;  5HY6 A;  1WA7 A;  1WHL A;  2QTX A;  2Y90 A;  1C0M A;  3A8H B;  4C92 A;  4ZTF A;  1WHG A;  2J6K A;  1I07 A;  5CAI A;  4J6Y A;  3OW2 S;  1EFN A;  4IUT A;  3TQ7 P;  3NTI A;  5AT1 B;  4FYX B;  3OYL A;  2MIO A;  1Y57 A;  4O5V A;  3EG9 A;  2YRV A;  4HA8 A;  2KSS A;  1K8A U;  1YJN A;  2GQV A;  2RI3 A;  3PT9 A;  3URG A;  1LVK A;  2HD0 A;  1BI1 A;  2LC4 A;  4ZGJ B;  4PK4 A;  2O88 A;  1RAB B;  2MAM A;  3V8L A;  4C8Q F;  2EKH A;  4F7U F;  1PD1 A;  1OX8 A;  2QAS A;  1YCS B;  2RJD A;  1UGP B;  2ESW A;  2FG0 A;  2A28 A;  2E12 A;  2VKN A;  4MZM A;  3M56 A;  3I5R A;  2CT4 A;  3HFO A;  3JAM E;  3G6E A;  2KRM A;  3OB9 A;  2YDL A;  3ZEH A;  1GXI E;  2DZC A;  2DVJ A;  3OBW A;  3CCL Q;  1X27 A;  1YJN Q;  4JJD A;  4F17 A;  1QMC A;  2A08 A;  1SHF A;  3REA B;  1KG1 A;  4B6M A;  3AT1 B;  2RM4 A;  4ANJ A;  5GAO p;  5CKD A;  1BCO A;  1BK2 A;  1VA7 A;  3GPL A;  2KR3 A;  5I22 A;  4OMP A;  2CP2 A;  5D6W A;  1U5S A;  3G6E Q;  1NEG A;  3OYB A;  4DBR A;  1B34 A;  1TUC A;  2JTE A;  2QA4 A;  2CH4 W;  1M2V A;  2GGR A;  2EYY A;  4M77 B;  2DXT A;  2EBP A;  5KE3 A;  2RI5 A;  4OB3 B;  1GBR A;  4LDX A;  5FRM A;  5FRN A;  2R5M A;  4XU1 A;  4Y92 A;  1JRI A;  1K9M C;  1I81 A;  3OYM A;  3PIO A;  2DTI A;  3EHR A;  4M7A A;  3V7R A;  5FLX E;  1K73 C;  1NLO C;  2GNC A;  1TSF A;  2XIC A;  2ZPG B;  3OS5 A;  3QZ5 B;  1WHM A;  3CPW P;  1RAF B;  2KRS A;  2LRQ A;  2BIV A;  2K5L A;  3P8D A;  3RKW A;  2QQB A;  2VXF A;  5KYW B;  2FZG B;  3GBQ A;  1IZ6 A;  2XDD A;  2ROT A;  3DB3 A;  3DKM A;  2JM8 A;  1ZUY A;  3EFO A;  1G3T A;  4PLI A;  4C8Q E;  2HQE A;  4M7D G;  2A37 A;  5GJV B;  3P8B B;  4WF2 A;  4MDW A;  4M7D C;  1NPP A;  4AT1 B;  2K3B A;  4J6W A;  1VQK T;  1GCQ C;  1JJ2 S;  2RQR A;  2A0F B;  5LJ3 d;  2RHZ A;  1RAH B;  2JXB A;  3A98 A;  4UC4 A;  2GQI A;  5IXF A;  1XQH A;  3LLR A;  1XOV A;  2DYB A;  5GAN 2;  1M8M A;  3S3O A;  1AWW A;  3PGG A;  3JCM d;  1PC0 A;  1KIK A;  5LJ5 g;  5FU6 C;  1UGV A;  3GF5 A;  1H64 1;  1WFW A;  1UJY A;  2MF2 A;  4FL6 A;  2PTK A;  4AFQ C;  5LJ5 d;  3HRU A;  2V8K A;  1UGQ B;  2CZ7 B;  4GLK A;  2K4Y A;  2YUP A;  2QEX A;  3QUI A;  2E6Z A;  2NUP A;  2AK5 A;  2HAX A;  2DAQ A;  3GNG A;  3WVE B;  2P4T A;  3SWN B;  3NHN A;  1WLP B;  1AWJ A;  3L2W A;  1N5Z A;  4ORZ A;  2ROL A;  4HT9 A;  5LJ3 f;  1KSW A;  1NE8 A;  4JUV A;  2IVW A;  2ZPE B;  3OYI A;  5LJ5 j;  3CXC S;  2EYW A;  4OMF B;  2AKL A;  2DK3 A;  5GJW B;  3JCM f;  4IIO A;  2YUQ A;  4XK8 E;  1YHQ T;  1E6G A;  2FPD A;  2JNG A;  1Q81 R;  3T9N A;  2LZ6 B;  2AKK A;  4N4G A;  2LX9 A;  3FDR A;  3CCQ T;  1TWB A;  5CCA A;  2DZ9 A;  1E6H A;  2JUF A;  2VGM A;  1D09 B;  5IAY A;  5CQX A;  3OS2 A;  2MOX A;  2XI9 A;  4J9H A;  1VQK A;  4IKF A;  4AFU C;  4M75 A;  2RHX A;  3G1J A;  4MZP A;  2QGF B;  2WSE E;  4E2F B;  2K5I A;  2P84 A;  1PCX A;  4J83 A;  4NS5 A;  4Z02 A;  5KH6 A;  1K4U S;  1M2O A;  2RMO A;  2KY9 A;  1KFZ A;  2K6D A;  4QKU A;  1KD1 R;  1PRL C;  4C5E A;  4BI3 A;  1NPR A;  2FRY A;  3CME T;  2L89 A;  1B7T A;  1MMN A;  4GLM A;  5LJ5 h;  3MEV A;  4AG1 C;  1VQK Q;  3QDF A;  2C0T A;  2GCX A;  4CC3 A;  3TSZ A;  4OP0 A;  4DBF A;  4E7L A;  2LDM A;  2DA9 A;  5A0D A;  3OW2 P;  2KNB B;  3OSS C;  1MND A;  2CRE A;  2KEA A;  2H3J A;  2CKK A;  1OZ3 A;  3EFS A;  2DEU A;  1I5L A;  4WTO B;  2KK4 A;  1WNL A;  1VOM A;  2FZK B;  2FYK A;  1G3S A;  4KUD K;  2L5Q A;  4PJL A;  1O75 A;  3KBG A;  1R0B G;  1K0S A;  1Q7Y R;  1YHQ A;  1WHJ A;  1Q86 U;  5IH2 A;  1T0J A;  5CIU A;  3PE0 A;  4D6W A;  1NBE B;  5IT9 E;  5LL6 S;  4LNP A;  3OYC A;  4JRQ A;  3EG0 A;  1LOJ A;  2ABL A;  3I5S A;  3EG3 A;  4RG8 A;  1HK9 A;  3GOX A;  1MUZ A;  2JN0 A;  2H3E B;  5CKH A;  4RTZ A;  4A4E A;  1UUE A;  3E9F A;  2EVR A;  3CC2 T;  3VRZ A;  1KJW A;  2AHJ B;  2HZY A;  3MEU A;  1YHQ Q;  3V7C A;  2CP5 A;  2QDY B;  1JEG A;  5CKB A;  3CCQ Q;  1AEY A;  5KYX B;  1OOT A;  2BE9 B;  2HEQ A;  3CME A;  3FB9 A;  4M7D F;  2RHU A;  3MCA B;  2CH4 A;  5A2Q E;  2YUO A;  4C92 D;  2HSE B;  1UB4 A;  1YP5 A;  4PLL A;  4LD9 K;  3UA6 A;  3V8J A;  2DD5 A;  3JV3 A;  2CZ1 B;  4YTL A;  1C6V X;  1D0Z A;  4L6V 5;  2O4X B;  1UE9 A;  3OSV A;  1QVF A;  2M0O A;  4M78 B;  3M0S A;  2YT6 A;  1UDL A;  2LCC A;  2DO3 A;  2F2V A;  2DVE A;  2LQN A;  2RA2 A;  3VUZ A;  1K76 A;  4X9C A;  2EYQ A;  1VQ7 A;  2DF6 A;  4QW2 A;  1M90 C;  4A4F A;  1OYX A;  2FVU A;  8AT1 B;  3VS1 A;  5GAN 3;  3CME Q;  2KRN A;  4A54 A;  3M53 A;  5IN1 A;  3E19 A;  3VS5 A;  3X26 B;  2K9G A;  2CP3 A;  1G2B A;  2YRD A;  3HRT A;  1M1K U;  5KYY B;  2DIQ A;  4FM4 B;  1IGU A;  1IO6 A;  4XTW A;  5GMK e;  3LH5 A;  4PJO G;  3DLM A;  4HKE A;  1N8R U;  2RQT A;  1U8R A;  3MO8 A;  2MI6 A;  1JJ2 P;  4PJO A;  3OYH A;  4BDZ A;  4E7Z A;  3S6W A;  4EMK C;  3C12 A;  4M77 G;  5KCO A;  3JCM J;  1RAD B;  3OYK A;  3CC2 A;  1IHW A;  2L3Q A;  4J9G A;  2R5A A;  1QVG A;  1WQW A;  1I5O B;  2QAZ A;  4M77 A;  2OTL T;  2E10 A;  1OPK A;  4K11 A;  2EJF A;  3NFC A;  4XU2 A;  4QQG A;  2EQI A;  4A63 B;  5J39 A;  2Y4X A;  2DL5 A;  1WIE A;  1VQM T;  2K7A A;  1ZA1 B;  1KC8 C;  1TH7 A;  2HBP A;  2DL8 A;  1ZSZ B;  3MP1 A;  3EG2 A;  1SKU B;  1DJ7 B;  4A4G A;  3CC2 Q;  4CC2 A;  2SRC A;  2EIF A;  1YI2 T;  2NUZ A;  1XNI A;  3PTA A;  2E6N A;  4M7A D;  2A7Y A;  1AWX A;  2L2P A;  2M16 A;  1UJ0 A;  2JJ9 A;  1X69 A;  4BE2 A;  1VQ8 Q;  5KYW A;  4J9B A;  2FHD A;  3MEA A;  2DET A;  3CXC P;  1WHK A;  4JJC A;  3RMS A;  4FSS A;  3FC3 A;  2LP5 A;  2OAW A;  4PL6 A;  2JZ2 A;  2ZZD A;  2ZPI B;  1P92 A;  4ESR A;  1PKT A;  5GMK m;  5EG2 A;  1WJS A;  4JRP A;  3M54 A;  4JRI A;  5CKF A;  1LCK A;  5FW9 A;  1NJI U;  1ZHI A;  2LJ0 A;  2AZS A;  4ZN3 A;  2P0Q A;  1QCN A;  4J9C A;  1YWP A;  2KE9 A;  1YIT T;  2D8H A;  2IG0 A;  2QK0 A;  3OYA A;  4FIB A;  2FO0 A;  3JCM V;  3M0T A;  2E3H A;  2WSF E;  2OTL A;  2EGE A;  2XMF A;  2RO0 A;  5GAO m;  1VQM A;  1BB9 A;  1G8X A;  2QDL A;  2AIR B;  2X9H A;  1K9M R;  4BY6 C;  3SWN A;  3FJ5 A;  2H8H A;  3PNW C;  2Z0W A;  3RKX A;  1YI2 A;  4V2S A;  4C92 G;  3X25 B;  2OTL Q;  3J80 E;  2PVO B;  4E6R A;  3SDZ A;  3EGX B;  2ZPB B;  4C5I A;  4C92 C;  2QQ9 A;  1RLQ C;  5GAM e;  3NPF A;  2BTT A;  3A8M B;  2A3L A;  3H0I A;  1VQM Q;  1H92 A;  4DBH A;  1RAA B;  2JTF A;  1PNJ A;  3QJ6 A;  1VYU A;  3CEY A;  1K8A C;  3C0C A;  3JCM Q;  3CBP A;  4E7J A;  2COW A;  1YI2 Q;  2ED1 A;  3CCL A;  4XAX B;  1HJD A;  3G4S T;  1NZ9 A;  4AG2 C;  2NWM A;  1G5V A;  4IUV A;  2ZPH B;  1UGR B;  2AT1 B;  4R55 A;  2DRM A;  4XU3 A;  4PKC C;  2FEI A;  1QQJ A;  4XTY A;  4M75 D;  2Y4Y A;  3M4G A;  1OI1 A;  2DJZ A;  2JTM A;  2VYT A;  4XTV A;  2EJG A;  1NYF A;  2EQM A;  2RHI A;  1RUW A;  1WXT A;  3NTK A;  2KT1 A;  2F5T X;  1UHF A;  5I11 A;  4C8Q B;  1Y96 B;  5FU7 C;  2HCK A;  2KAF A;  2RF0 A;  2ZAE A;  1X6O A;  4F7U B;  5GAN 4;  1AVZ C;  3BE3 A;  3JB9 J;  2HKN A;  1UFF A;  2EAY A;  2CSI A;  2J6F A;  3HP9 A;  1Q82 R;  3S3N A;  3CCM T;  1AWO A;  3VYG A;  5GAN e;  1WGS A;  2HBW A;  1QP2 A;  1QKX A;  1YIT Q;  4BAC A;  3GLX A;  2NYS A;  4LDV A;  1RAE B;  4FCY A;  1MMD A;  2COY A;  4ELY C;  2LNV A;  1BKB A;  1LPL A;  4ME7 A;  3VS3 A;  4M7A G;  1JB0 E;  3EH2 A;  4M7A C;  2KBT A;  1MMG A;  3M9Q A;  3J7A F;  2LT1 A;  1QVP A;  2RK1 A;  2R58 A;  3HSB A;  4A53 A;  2L8D A;  1HSQ A;  3E9G A;  1NEB A;  1LNX A;  3VS4 A;  2F1L A;  2K57 A;  1VUB A;  4IUQ A;  1T0H A;  4D8D A;  1O9S A;  3G4S A;  2CT3 A;  3MKD A;  5I2M A;  2B8A A;  1Y7X A;  1VQO Q;  1VQN T;  1ZA2 B;  3UAT A;  1UEB A;  1PG5 B;  1WQ7 A;  1PWT A;  5CKE A;  1TOV A;  5A0L A;  1B07 A;  4OB1 B;  3H0H A;  3QWY A;  3VYH B;  1HD3 A;  2QQR A;  2DD4 A;  4Z88 A;  4C0D B;  3JB9 I;  1BU1 A;  1QW1 A;  4F7U E;  3BY7 A;  2CP0 A;  3FRN A;  2DJQ A;  4CC4 B;  3G4S Q;  5LJ3 g;  1Y0M A;  2NUT B;  1WPY A;  2PQW A;  2DXB A;  3CD6 T;  4M78 G;  2VXE A;  3RUX A;  3CCM A;  1QVF S;  1I4K 1;  3JCM g;  2CYZ B;  1N27 A;  4M4Z A;  3RMQ A;  2K3X A;  2O4X A;  2OTJ T;  3JB9 H;  4M78 A;  1Q95 G;  4OB2 B;  4KH1 B;  4QT7 A;  2KMT A;  5KE2 A;  1N9S A;  2K79 A;  1GRI A;  5CQY A;  2XID A;  3OMG A;  3EFR A;  2IIM A;  1KK7 A;  1SHG A;  3CCM Q;  3TEE A;  5LJ3 j;  3L2Z A;  2D1X A;  5KYY A;  4DBQ A;  1SSH A;  2XKO C;  1VIF A;  3EGD B;  3CC4 T;  2FZC B;  3QWX X;  1ZQ1 A;  3DB4 A;  3M5A A;  3JCM X;  1X2K A;  1QWF A;  4HCK A;  1VQ5 T;  4JDS A;  2X4X A;  1Q82 U;  2VV5 A;  5GAN 5;  2JW4 A;  4EDU A;  3M55 A;  4C92 F;  5DM7 R;  2OI3 A;  3C95 A;  1VQN A;  1T3S A;  2C0I A;  1VQ4 Q;  1U06 A;  4FT2 A;  3CPF A;  2QI2 A;  4PJO D;  3MHX A;  1QVG S;  1BIA A;  2HNI A;  4BY6 B;  2DL7 A;  4AFZ C;  1Y07 A;  4JJB A;  4TVR A;  3HTR A;  5IXB A;  5GAM d;  2RI2 A;  3EAE A;  4RTX A;  4M77 D;  4M75 G;  5C6S A;  9ATC B;  2L3R A;  2HQH A;  2YUN A;  4M75 C;  1ZSZ A;  2CP7 A;  1VQN Q;  2DPP B;  1M3B A;  4P5N A;  3X28 B;  1RI0 A;  5LJ3 h;  2E1H A;  4FYW B;  3CD6 A;  2XDP A;  2I2L A;  4XTZ A;  2HSP A;  2CP6 A;  3OS0 A;  3QO3 A;  2OTJ A;  2COZ A;  3LW5 E;  3JCM h;  1VYV A;  1SG5 A;  2M02 A;  2YWW A;  5D7U A;  5FWB A;  5GAM j;  2ZPF B;  2CSQ A;  2OJ2 A;  1M9S A;  3JCM c;  2E70 A;  4A4H A;  1W6X A;  3UA7 A;  1CKB A;  1SF9 A;  2C06 A;  3RER A;  3CD6 Q;  5GAM f;  2EWN A;  4FT4 A;  1M1F A;  5CR2 A;  4FSX A;  1JXO A;  2OTJ Q;  5A0G A;  3CC4 A;  1I8F A;  3DLL A;  5AYF A;  1VQ5 A;  2J05 A;  2JM9 A;  5GAN d;  2DMO A;  2PVD B;  4LXC A;  4EIK A;  1MGQ A;  2EQK A;  4RTU A;  3NTH A;  2YLB A;  3WXM B;  2EQU A;  4CC7 A;  2F2W A;  3RDV A;  1SSF A;  1W2B S;  1S72 T;  1Q86 C;  4LE9 A;  3PVQ A;  1KQS S;  5D6X A;  3M57 A;  4ATO A;  4AMC A;  1YWO A;  4M7A F;  4MML A;  3CC4 Q;  4J7F A;  3CCU Q;  2R57 A;  3MET A;  2O31 A;  2MK5 A;  3CCQ A;  1VQ5 Q;  4LDY A;  1W1F A;  1WI7 A;  1NYG A;  4QVZ A;  4DEX A;  5GAN j;  2CZ0 B;  2SEM A;  3VS2 A;  1KC8 R;  1M3A A;  1IB8 A;  1YJ9 T;  3LWH A;  4RMO A;  3FLG A;  2GTJ A;  3O8V A;  5FWC A;  4BD3 A;  4PJN A;  4GBQ A;  4BI8 B;  5GAN f;  4JS5 A;  2MPX C;  2L0A A;  4XTU A;  3EGX A;  1YNZ A;  5GAN 6;  4PFO A;  2OAU A;  4QQD A;  3RKY A;  3KUF A;  1VQ8 T;  2M9U A;  4J9E A;  3OS1 A;  1X43 A;  4DOW A;  3GP8 A;  3CCS T;  1U1T A;  3E2U A;  3CCR T;  2LQK A;  1Q81 U;  1VQ9 T;  4FYV B;  4OML A;  4JLI A;  4L5G A;  1X2Q A;  3G7Z A;  2QXF A;  3HL8 A;  1RL2 A;  2VGN A;  4CI0 C;  2KXD A;  3X20 B;  1B3Q A;  2LQW A;  4R56 A;  4OMO A;  4M7D B;  2L3P A;  3L1A A;  3SD4 A;  1FWZ A;  2DLP A;  4BB7 A;  3UDC A;  1AD5 A;  4OVA A;  1M1K C;  1PHT A;  4LDU A;  1WJR A;  3HKS A;  1I1J A;  2DBK A;  2LCS A;  2K5F A;  2GTO A;  1S72 A;  2XD0 A;  5HK0 A;  1W70 A;  1KD1 U;  4C8Q A;  1Y96 A;  4J6X A;  5FU6 B;  4F7U A;  1N8R C;  3ULR B;  2DYI A;  1Y71 A;  1TUD A;  3FIF A;  3H41 A;  2EGC A;  4PJO C;  2B86 A;  2D0N A;  2LTO A;  4OMM A;  4ZTJ A;  1ZUU A;  1QVF P;  1EZZ B;  1YJ9 A;  3QG1 A;  2D9T A;  1S72 Q;  5HCK A;  3PFS A;  1QCF A;  3MP6 A;  4M77 C;  4J7I A;  1BI3 A;  1PSE A;  2QG9 B;  4PNO A;  1JU5 C;  3LYI A;  2J06 A;  3A8L B;  1VQ8 A;  2FB7 A;  1D1C A;  4Z89 A;  1G3W A;  5HK3 A;  1K1Z A;  4M75 F;  3CCS A;  1Q7Y U;  1VQL Q;  3CCR A;  2W10 A;  1BI0 A;  1VQ9 A;  1YJ9 Q;  5GAO n;  3RBB B;  1K8A R;  1TU0 B;  2KYB A;  2DX1 A;  4JRK A;  1ACM B;  2MWO A;  1U1S A;  2AZV A;  4M7D E;  2RQV A;  2RN8 A;  2I0N A;  4IUP A;  4JZ4 A;  2KRO A;  2RQU A;  5KCH A;  4LDW A;  4L59 A;  4J9D A;  4F16 A;  2HQX A;  1ABQ A;  2ATC B;  2RK2 A;  1M5Q 1;  5GMK i;  3CCS Q;  1VQ6 T;  1GL5 A;  1WDX A;  4RTT A;  3CCR Q;  3VUB A;  4F04 B;  1QVG P;  4ZN1 A;  1VQ9 Q;  4HCB A;  4KT0 E;  1AHJ B;  4MZT A;  2RH2 A;  2XHC A;  4GY5 A;  3ZL7 C;  5CK9 A;  3SB2 A;  5L8R E;  1LJO A;  1FYN A;  4RKU E;  2NUT A;  1NJI C;  2YSQ A;  2DXU A;  4IUR A;  3LWI A;  2CGH A;  2P0K A;  2D6F A;  2M1H A;  4FW2 A;  2DXC A;  3OYF A;  3J81 E;  3PIP A;  2IPO B;  2DIL A;  3SFM A;  2CDT A;  3OBY A;  1FMW A;  3D7S B;  3H8Z A;  2GBQ A;  4MMK A;  1BI2 A;  1IGQ A;  1W2B A;  1QP3 A;  4M78 D;  1YCY A;  4JPB W;  1KQS A;  1PRM C;  4FYY B;  1ZBX A;  3H9N A;  1HYO A;  2G3R A;  1OQK A;  4E7S A;  1QKW A;  5IHK A;  3PVL A;  4DOV A;  3JSC A;  3JB9 D;  1EX4 A;  3SWN C;  3EGD A;  3CBO A;  2E3I A;  1R77 A;  3E1S A;  3CCE T;  2DBM A;  4N0A A;  1K73 R;  4RG2 A;  4OMN A;  2RJE A;  4M75 E;  1PKS A;  2KT8 A;  1VQO T;  4BDY A;  2EKO A;  3M0Q A;  4N4I A;  2CUB A;  2KQW A;  4JLG A;  2QA4 T;  1VQ6 A;  4IIM A;  1YIJ Q;  4BI4 A;  5I21 A;  4X34 A;  1OV3 A;  2MCN A;  2JT4 A;  3ZFJ A;  1OUL A;  2LMJ A;  4OGC A;  2VB6 A;  3A1P A;  3M0P A;  1UTI A;  3I56 T;  1VQP Q;  1D1A A;  4F14 A;  1V1C A;  1K0X A;  3I55 T;  3JCM P;  3JRZ A;  1VQ6 Q;  1UGS B;  1FMK A;  1BYM A;  2F2X A;  1OPL A;  2JOY A;  5ECA A;  1W4S A;  3VRY A;  2OX7 A;  1YIT A;  1N9R A;  4CRI A;  2PUO B;  1RLP C;  1TUG B;  3Q1J A;  2EFI A;  1X6B A;  2ZGW A;  4N4H A;  4PFP A;  4IUU A;  4PJO F;  1F1B B;  2DFU A;  3S3M A;  3OYN A;  2EW3 A;  4O6J A;  1H8K A;  1D0X A;  3UPU A;  4NL2 A;  3SEM A;  5DLO A;  4OGE A;  3CCE A;  1FX7 A;  3R6O A;  4II1 A;  4M77 F;  3V8K A;  3VV0 A;  4PJM A;  2DL3 A;  2RNA A;  4KUI A;  3OYD A;  3CPW A;  2V1R A;  1AOJ A;  1R8O B;  2PU9 B;  2E65 A;  3I35 A;  1BCM A;  2QQS A;  1VQO A;  2QQA A;  2BZY A;  4PJO B;  1VQ4 T;  5C0M A;  4ZGE B;  4HCC A;  2V8J A;  1GCP A;  4B9X A;  2WSC E;  4EMK B;  4BUG A;  2EJ9 A;  4NL3 A;  1RAG B;  4AFS C;  2DRK A;  2PVG B;  4RUG A;  4Z8A A;  5GMK j;  2KI7 A;  1QLY A;  5DLQ E;  3A8O B;  3A5Z B;  3CCE Q;  2LJ1 A;  2F5K A;  1ZX6 A;  1IRE B;  2W0Z A;  3TSW A;  3TRE A;  3EH1 A;  2QEX T;  4WCI A;  4C0G A;  4E7I A;  3I56 A;  1K9M U;  1PSF A;  3LX7 A;  2EYZ A;  3FJP A;  3I55 A;  1FXX A;  1E7O A;  4ZNX A;  2QA4 Q;  4C5G A;  2QYZ A;  1K73 U;  5GMK l;  3ASK A;  3OMC A;  1OX9 A;  5DY9 A;  3HPW A;  2X51 A;  5KYX A;  4E7K A;  3OA6 A;  2XDB A;  1NG2 A;  2E5Q A;  3MP8 A;  4C0F A;  4QVD A;  3I56 Q;  5KYU B;  1KHI A;  2PZ1 A;  3LGF A;  2RJF A;  3I55 Q;  1V29 B;  1FMV A;  4M78 C;  3RR6 A;  3QXE B;  5CO7 A;  4KBM B;  3L2U A;  5GAO r;  4XQ3 A;  2O9S A;  5GMK h;  4XU0 A;  2PNI A;  2EGA A;  2EPD A;  3HHT B;  3BW1 A;  3FEO A;  2X4Y A;  3JB9 G;  3QBY A;  4M7D A;  3H6Z A;  1M3C A;  1AZE A;  4PJO E;  2BE7 D;  1RI9 A;  4LN2 A;  5GAO l;  1GCQ A;  1YBY A;  2JS2 A;  2YXY A;  2RD1 A;  2E4H A;  4HCZ A;  4HVW A;  1M8V A;  1VQ4 A;  3V7S A;  1SEM A;  5L23 A;  1WXU A;  2L3S A;  4LD6 A;  1D3B B;  4M77 E;  3RNJ A;  1Q86 R;  2XU8 A;  3QKJ A;  4LUD A;  4JZ3 A;  3C94 A;  3CCU T;  1OZ2 A;  1M30 A;  2VVK A;  1Q82 C;  4C8Q D;  3CQT A;  1GFC A;  1XJW B;  4NOY A;  3QYH B;  3QZ9 B;  2VAS A;  2DM1 A;  1TG0 A;  2FPE A;  1GFD A;  1TS9 A;  1SRM A;  4R0K A;  3QDR B;  5GAM g;  2DTH A;  1T3L A;  2DEQ A;  1VIE A;  4HXJ A;  2O2O A;  2GF7 A;  1A0N B;  4RTY A;  2KXC A;  1KQ1 A;  3RIR A;  2KVQ G;  1N6A A;  4C92 B;  4RTV A;  4QQ6 A;  1ZSZ C;  2HL5 C;  2VC8 A;  1YFN A;  2QEX Q;  2JVV A;  4RCB A;  3OW2 A;  3RES A;  3PMT A;  3QII A;  3CC7 T;  3SHW A;  3UT1 A;  3HFN A;  3N5B B;  3EG9 B;  5LJ5 f;  2PUK B;  1U3O A;  1JBM A;  2YRC A;  3P8H A;  3OYG A;  1BIB A;  2HL3 A;  1M27 C;  2EYX A;  5GAO q;  1IHV A;  1SPK A;  2ECZ A;  4RTW A;  3VKI A;  7AT1 B;  2BKD N;  3NGP A;  4VUB A;  1M90 R;  2E5K A;  2M0Y A;  1UHC A;  2NLU A;  2EQJ A;  2QTV A;  3L2Q A;  4OB0 B;  1EIF A;  1G83 A;  3EHQ A;  3M58 A;  4DA4 A;  2YLC A;  2RQW A;  3TU4 K;  2FL7 A;  1M1K R;  3BDU A;  4ZGD B;  1Z9Q A;  1V76 A;  1ARK A;  5GAN g;  3VS7 A;  6AT1 B;  2RHY A;  3CCU A;  2O9V A;  1N8R R;  1AT1 B;  1JXM A;  5FU7 B;  3JCM W;  8ATC B;  2X35 A;  2J7I A;  4OF1 A;  2RJC A;  1JO8 A;  1C1A A;  2KYM A;  1JQQ A;  1M1G A;  2M51 A;  5I2S A;  2JS0 A;  2J6O A;  1B34 B;  5GAN 7;  1QWE A;  1VQ7 T;  2E64 A;  2GFA A;  1VYT A;  1X6G A;  2JMA A;  2MYS A;  5D6Y A;  1M2V B;  4C92 E;  5GAM h;  2K2M A;  3QYG B;  1MV3 A;  3THK A;  4PFZ A;  4Q5W A;  2ENM A;  3CMA T;  1R0C B;  3CBM A;  3CCJ T;  2D0Q B;  1VQL T;  2GFU A;  1PD0 A;  5GAN 8;  3CC7 A;  4J8O A;  4KGZ B;  4M7A B;  4XTX A;  2LX7 A;  2DER A;  2DE0 X;  2YHT A; 
#chains in the Genus database with same CATH homology
 3CC4 Q;  3CXC P;  1YJN Q;  3CCU Q;  1VQL Q;  1QVF P;  1VQ4 Q;  1N8R R;  3G71 Q;  3CCM Q;  3CCS Q;  2QA4 Q;  1VQN Q;  3I55 Q;  2QEX Q;  1VQK Q;  1M90 R;  3CCR Q;  1VQM Q;  1YJ9 Q;  3CCQ Q;  1S72 Q;  1VQ5 Q;  1QVG P;  1K73 R;  3CC2 Q;  1VQ9 Q;  1Q81 R;  3OW2 P;  3CCE Q;  1VQP Q;  1VQ7 Q;  1K8A R;  3CPW P;  1Q86 R;  1K9M R;  3CD6 Q;  3G4S Q;  3CME Q;  1Q82 R;  1KC8 R;  1VQO Q;  1NJI R;  1M1K R;  1YIJ Q;  1Q7Y R;  1VQ6 Q;  1YIT Q;  1W2B P;  1JJ2 P;  1YJW Q;  2OTJ Q;  3G6E Q;  1KD1 R;  1KQS P;  1VQ8 Q;  3CCV Q;  1YI2 Q;  1YHQ Q;  3I56 Q;  3CMA Q;  3CCL Q;  3CC7 Q;  2OTL Q;  3CCJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...