1Q81R

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q81R00
2QEXQ 1VQ9Q 1VQPQ 1YJ9Q 1K9MR 3CD6Q 3CCMQ 1KC8R 1QVGP 1NJIR 3CCRQ 3I55Q 3CCQQ 3CPWP 1Q81R 1VQ7Q 1VQ8Q 1QVFP 3CC7Q 1M1KR 2OTLQ 3G71Q 1YHQQ 1VQNQ 1Q82R 3CCJQ 1Q7YR 1JJ2P 3CCVQ 3I56Q 1YITQ 1VQ4Q 1VQMQ 1YJWQ 2OTJQ 3OW2P 1W2BP 3CCLQ 3CMEQ 1KD1R 1YI2Q 3CXCP 1VQLQ 1K73R 3G4SQ 1N8RR 3G6EQ 1M90R 1KQSP 3CCUQ 1VQ5Q 1VQOQ 1YIJQ 2QA4Q 1K8AR 1S72Q 1YJNQ 3CMAQ 3CC2Q 1VQ6Q 3CCSQ 1VQKQ 3CC4Q 1Q86R 3CCEQ
chains in the Genus database with same CATH superfamily
3PNWC 4QQDA 5HCKA 5IHKA 4OB2B 4FW1A 1CSKA 2PUKB 2DL8A 2GQIA 3OS2A 3RKXA 3G1JA 2NUTB 3NTKA 3SFMA 1D3BB 3M4YA 2YRDA 4EMGA 2A08A 2PUOB 3JB9G 4GLKA 3C12A 1GXIE 1Z9ZA 2CREA 1QCOA 4XU3A 2FRYA 4NL2A 3CCRA 3VYGA 1Q7YR 3SD4A 3JCMV 3KFVA 2HCKA 3QDRB 4PJOD 4BB7A 3O5ZA 1M3AA 5GAMh 4X34A 2CZ0B 1VQ5A 2KXCA 2RHUA 2O31A 2VXFA 1E6HA 4FT4A 2HL5C 4M77G 3URGA 4PJOB 2E41A 1FXXA 4EDUA 4RTXA 2V26A 3CCQQ 2M0YA 1Z9QA 5A0LA 1K9AA 2EKHA 3G7ZA 1PWTA 1AWWA 4FW2A 1NLOC 1SG5A 2RMOA 1OYXA 1YI2A 2HBWA 2EVRA 4GLMA 5DM7R 4KRTA 3I55T 1SHGA 3EFOA 3JCMQ 2E4HA 4AMCA 2E70A 2JTMA 4M77E 4UC4A 4FU6A 4OB1B 4Y91A 4D6WA 3EFOB 3H8ZA 4GBQA 2FO0A 5GAN7 5LJ3j 4MDWA 1X01A 2FZKB 5CR2A 5FU6C 1U8RA 5HK0A 3OSVA 5KYUA 1MMNA 2COZA 3RMSA 2NUZA 1BCMA 3M0TA 2LX9A 4WTOB 4AG2C 2R58A 4J7FA 3EGUA 3RKYA 2Y90A 3QIIA 1NJIR 3JB9J 4AFQC 2YUNA 1BU1A 1TSFA 1QVGA 4KUDK 1X69A 3QBYA 3PIOA 4DBRA 3JV3A 2JTFA 2ESWA 1GRIA 1ZUYA 1D0YA 2EGEA 4RCBA 4C5EA 3KUFA 1U5SA 3CCEA 1JQQA 2RJEA 2ZAEA 2O4XB 3EGXA 5KE3A 1JXMA 5J39A 1M3BA 1IXDA 5GMKh 3CCRQ 3EGDA 4C0GA 3FDRA 5LJ5g 3EGXB 4EMKC 1UFFA 3VS0A 4J9GA 1K73R 2X4XA 4A63B 1O75A 1VQ5Q 3ZBDA 5KYXA 4KT0E 5IXFA 2VASA 2G6FX 4IUUA 3VUZA 3OS0A 1VQ7A 5GAOm 4MMKA 1G3WA 4LUEA 4IUVA 1YI2Q 1AT1B 2CH4A 2DL3A 2V8JA 2HEQA 4BE1A 3NHNA 1VIEA 4J9IA 1FMKA 2KT1A 5I2SA 2EYQA 4A4GA 3RERA 1JRIA 1O9SA 3HTRA 3SEMA 4J6XA 3THKA 4FCYA 1A0NB 1V29B 3RMQA 3QJ6A 1SPKA 3V7SA 1YNZA 1VQPT 2OI3A 1B3QA 1XOVA 2XDDA 3INZA 3OW2S 4EMKA 1I0CA 4CC7A 2DIGA 1H641 2KBTA 3CC4A 2JM8A 5FWBA 3RBBB 4J9HA 2PVOB 2KMTA 2KROA 1WQWA 1VQ8A 2P4RA 2XIDA 1EIFA 2CZ7B 5LJ5h 1IHVA 1UUEA 3QO3A 3QDFA 2L3RA 4J9BA 2QQRA 1YIJA 3OMCA 5IT9E 2R57A 2DAQA 3J81E 4NOYA 5GANh 3CCEQ 3H0FA 2RI5A 2ENMA 3OYDA 3GBQA 3VU3C 4M75D 3QYHB 4JRKA 4ZTFA 1OU8A 3NPFA 2D0NA 5LJ3g 1NE8A 2R5AA 1NZ9A 4X9DA 2FG0A 2EKOA 2KXDA 2LRQA 3PGGA 2BZXA 2LJ1A 1GCQC 4M75B 2G3RA 1XNIA 4X1VA 1R0BG 2FVUA 3G4ST 1BI2A 1UJYA 2RD1A 1WHMA 1K9MC 1VQ7Q 2OX7A 1Y96B 1YFNA 2CP7A 2YHTA 4BI4A 3FC3A 2F2WA 2QAZA 4QVCA 4C0ZA 1QVFA 2Y4YA 1MV0B 3J7AF 2E64A 1M2VA 4XU2A 2AIRB 3QUIA 1ZSZB 2X4WA 4E7HA 4C0FA 4O6JA 2K5LA 4QT7A 4TVRA 2O9VA 1HD3A 2HKQB 1JU5C 3OYNA 1TTHB 3BE3A 1X2QA 2KSSA 2LT1A 2K3YA 4C92F 1S1NA 3RR6A 3L2RA 1PD1A 2SRCA 2OAUA 1PRLC 1PHTA 1M4ZA 3CC4Q 3OYEA 2O9SA 2X51A 2NUPB 4KH0B 1VA7A 5ECAA 1NJIU 2QG9B 4J9EA 1IHWA 1VQ8Q 2RQUA 1SRLA 2JJ9A 1D1AA 1OPKA 3I56A 1VQLT 1ZA1B 2JTEA 1JO8A 3H0HA 2RPNA 3AHUA 3QKJA 4LDYA 2KYBA 3P8BB 5LJ3h 1ZSGA 5CKBA 2M16A 3CC7T 4RTWA 1YIJQ 4IKFA 2J6OA 1AZEA 2BE7D 2VVKA 3BDUA 4PJOG 4LE9A 4HCKA 2HSEB 1RLQC 3JCMX 3V7CA 5EG2A 1UDLA 3CPWA 2GTJA 5GJWB 1K73U 1BI1A 3MO8A 4JJDA 5KCHA 4OP0A 3JCMf 4IUQA 2KAFA 3F70A 4RTVA 4PJOE 3X28B 3CCSA 4MZTA 3JCMb 1OZ3A 2BE9B 2GTOA 2AKLA 1HXDA 1UE9A 2XU8A 4ZGDB 2A28A 3CC2T 2EPDA 4C5IA 4JDSA 3CCVA 4HVVA 3H9NA 2CKKA 1KFZA 3CXCP 4IURA 2ECZA 4JZ3A 3EG1A 3UWNA 2QK0A 3SB2A 4J6WA 4A4FA 2KE9A 2K9GA 5GMKl 1M9SA 1WYXA 3CCUT 4CC2A 3MEWA 4AG1C 4ESRA 1YCYA 3R6OA 4DBHA 2XDPA 4JLIA 2DD5A 2ED1A 4BI3A 4AFZC 1VOMA 2YXYA 2BIVA 2K57A 1VYUA 5J3BA 2YLCA 2OTJT 3WVDB 2J6KA 1WHJA 2FPFA 1KG1A 1H8KA 4WCIA 4D8KA 2HNIA 2K79A 2RJFA 5KYNA 1JJ2P 2DZ9A 2KRNA 3I56Q 2ZPFB 2ZCFB 5GAOp 4O5VA 4DQ2A 1BIAA 4ELZC 1K1ZA 4ORZA 2WSEE 4OMFB 1BIBA 5LL6S 1JB0E 1V1CA 4RG2A 3TU4K 3MJXA 4M75F 2D0QB 1Q81C 2VYTA 1Q82R 1EX4A 1VQ6T 1JXOA 4Y28E 3EAEA 3VYHB 3QZ5B 2YDLA 4M78F 1N8RR 2DRKA 3PVQA 1M8MA 2RJCA 3CCSQ 1QLYA 1E7OA 5GAOr 4E7ZA 1OPLA 2JT4A 3C0CA 4OMLA 3J80E 3QG1A 1FYNA 1W70A 3ZFJA 3CCVQ 4J6YA 3CCLA 3L1AA 5KYWB 2DL5A 4QKUA 1C1AA 3VS7A 4B6MA 1YJNA 1WFWA 4F16A 4M7AD 1F1BB 1Q86R 2EFIA 1T0HA 3JCMe 1KC8R 2RJDA 1QWFA 1AWJA 4M7AB 4BE2A 3TREA 2QQ9A 4FL6A 2OAWA 2RHYA 3FLGA 3CCQT 2P0KA 3VRYA 4RTYA 5CO7A 1MHNA 1MMAA 3HHTB 5IAYA 2DA9A 3I5SA 4DEXA 3GLXA 2NWMA 1YBYA 4BE0A 4XQ3A 3UATA 4E7SA 2R5MA 1WHHA 2COYA 3A8MB 2DO3A 1BCOA 5I2MA 3I35A 4QW2A 1D09B 2XHCA 3TVTA 1MGQA 4M75G 1WHKA 5GAN4 2K2MA 3SDZA 3BDLA 4EMHA 2FB7A 1AHJB 1VQ9A 1Y0MA 2DTHA 2JN0A 3REBB 5C6SA 1FMVA 4E7LA 2NUTA 4D8DA 1Q7YC 1D3BA 4DA4A 5HK3A 4AFSC 1KD1C 3QSUA 4M75E 1VUBA 1UEBA 2X35A 2RA2A 3NMZC 2M0OA 3BFMA 4CI0C 2PVDB 2IVWA 3O8VA 4XTYA 2FPDA 1NYFA 2XMFA 3C4SA 1RAHB 2E12A 1KQ2A 1N5ZA 4C92C 3CCLQ 3GOXA 4KBMB 4R0KA 3L2WA 3CCRT 4PJOA 5I21A 1W2BA 1YJNQ 1UGQB 1WXBA 5AT1B 2VGMA 2W10A 2C06A 1VQ5T 2RI3A 3PMTA 2CP5A 1G8XA 5IHNA 2A37A 2RH2A 2VXEA 3H0IA 1PCXA 4HA8A 1NLPC 5FRMA 3M0PA 4K11A 2XI9A 5FLXE 4IUTA 1C0MA 3M0QA 3M0UA 2QTVA 3MP1A 5KYYB 1YI2T 1BYMA 1OI1A 3CD6A 1NJIC 1UGVA 5FROA 3DKMA 4XAXB 2M02A 1G83A 1GBQA 3CMEA 4F14A 4HCCA 2D8HA 2MI6A 2ABLA 2DK3A 3VS6A 2A3LA 5IN1A 4C92D 3DLLA 2P0PA 2DVEA 2NYSA 1H92A 1AZGB 4C92A 4E7JA 2JUFA 5DY9A 1VIFA 2LCSA 1VQ9Q 2FZGB 2K3XA 2L3QA 2BKDN 3PFSA 2DXCA 1Q82U 2CT3A 4LDVA 4C92B 3RUXA 2HBPA 4R56A 2RN8A 2FL7A 3N5BB 1I07A 3BY7A 1N8RU 2P4TA 1UB4A 2O4XA 2YRCA 3CMAA 2A0FB 1AEYA 1TG0A 3OS5A 1QKXA 4IUPA 1G5VA 3UF4A 1J3TA 2LT4A 4VUBA 2HSPA 2QYZA 1MNDA 1RABB 2ROLA 3JCMP 1X27A 3CCET 2BZYA 4KULA 2LNHB 3EG0A 4RTZA 1IGUA 1OOTA 2QA4A 3WVEB 1YP5A 4M7AF 5GANg 3GF5A 4N0AC 3OYIA 1Q86U 1EZZB 2LQKA 4HT9A 5CKFA 1PG5B 1PRMC 1KC8U 2FPEA 2HD0A 5FU7C 1LPLA 3SHWA 3KXTA 2DXTA 2NLUA 1X6OA 2HQXA 4PK4A 2AK5A 2F1LA 4NL3A 1YITA 2ZPEB 3MEUA 1C6VX 2DFUA 3HSBA 4BDZA 1QMCA 1VQ7T 1M90C 1BKBA 3L2UA 1NM7A 2EQKA 1I4K1 2ZPBB 3PVLA 1PSFA 4MZMA 1Y71A 1QKWA 4II1A 4LUDA 4M75C 3X26B 1D0XA 3CD6Q 2D9TA 1MUZA 3OYAA 4M78C 3CMEQ 2Z0WA 4ZN1A 4BI8B 3FJ5A 1WXUA 1ZSZC 5GAMd 3FRNA 5AYFA 5GMKi 2MIOA 3META 1X6GA 2XICA 1NBEB 2EW3A 2H3JA 2GGRA 4XTXA 1RAEB 1SKUB 1PSEA 2ED0A 2F69A 4N0AA 4YTLA 3CC4T 1QP2A 2M9UA 2LVMA 2C0OA 3M4GA 5GAOl 1VQ8T 2SEMA 3RESA 3CXCA 1M1GA 2L89A 3JSCA 3CMAQ 4Z88A 5FU7B 1XJWB 1RAIB 1UGRB 2HZYA 1T0JA 1YIJT 2I2LA 4ATOA 1YCSB 2E6NA 3EH1A 1QQJA 1GL5A 3VS3A 3SWNB 5GAN8 1QVFS 4M75A 1AOJA 2H8HA 4OB3B 1PKTA 1UHFA 3M54A 3JB9H 4M78D 2QA4Q 1WHGA 1M5Q1 3OBYA 5FRNA 2DTOA 2DD4A 1Y96A 3L2ZA 3JB9I 2QEXA 2J6FA 3CCMA 4DEYA 2BUDA 4M7AE 4F7UB 5KCOA 4M78B 2JZ2A 1ZSZA 3QXEB 1NEBA 1YITQ 1VQMA 1JJ2A 2EQJA 1B07A 3OA6A 1UHCA 2FEIA 4L59A 4L6V5 4RCCA 3VKIA 4QQGA 4IIMA 2M1HA 5I22A 3RIRA 1YJ9A 2RQRA 1VQKA 3JCMc 4M7DC 1LOJA 2CP0A 1BB9A 2DERA 1M1KC 3A8OB 1RACB 4OMOA 3HPWA 1CKAA 4JS4A 3C95A 5CQXA 1N9SA 2NUPA 1PNJA 1D1BA 1HSQA 1K8AC 4B9XA 2HL3A 4L5GA 3HKSA 4E2FB 3M0RA 1W1FA 3I5RA 2KNBB 2RF0A 2DXBA 2CSQA 1K9MR 3P8DA 3JCMg 1YWPA 2EWNA 1LCKA 1KJWA 1SSHA 1GCQA 3V8JA 2BZ8A 1TWBA 2KGTA 3CPWS 3JCMW 2RK1A 5CAIA 2ROTA 4KGXB 2K5FA 1TUDA 4PJJA 2KRSA 3I56T 2JW4A 1BBZA 1G3TA 4M77B 1QVPA 1N27A 4N4GA 1VQNA 2FYKA 1RUWA 2JNGA 2LCLA 5L23A 2VWFA 4M7DD 2RO0A 1M3CA 1X2KA 4QVZA 3NFCA 3VUBA 2GFUA 1VYVA 4PJNA 5CKEA 3MEVA 3PE0A 2QEXQ 2VKNA 4M7DB 2PTKA 4RKUE 2LCCA 4A54A 1NPRA 3X20B 3CCMQ 4AFUC 1WX6A 3ZEHA 5GAMj 4LDUA 2LX7A 4MZPA 2QASA 3CCST 2RHIA 1VQMQ 1UGPB 2AZSA 3M53A 3OYHA 1VQOA 5GAOn 5LJ5d 1WZOA 2WACA 2GNCA 3CCVT 1T3LA 4XK8E 1Y57A 1M2OA 1YJ9Q 1VQKQ 2AZVA 3QPHA 3LLRA 2EYWA 1IZ6A 1ZHIA 4C92G 3GNGA 3JCMh 4JJNK 4FT2A 3HP9A 5J26A 2AKKA 3REAB 2HQHA 2KRMA 3OW2P 3LGLA 2J7IA 2LQNA 1ZLMA 3S6WA 1AD5A 4P5NA 5GAN3 3CEYA 2MPXC 3DB4A 4C92E 1TUCA 3FEOA 4WF2A 2LC4A 2L8DA 3QJYA 4IIOA 5GAN6 1Q82C 2EQIA 2JMAA 1HK9A 2DYIA 1RI0A 1YJWA 3RDVA 1N8RC 4M7AC 1N9RA 3UT1A 2PU9B 2QQAA 1ABQA 3A1PA 1K0SA 2B86A 3TSWA 3DB3A 2D6FA 1SRMA 1OEBA 1BI3A 3MP8A 2L3SA 3HRTA 4E7KA 2MMPA 1VQNQ 1OQKA 3FB9A 3S3MA 1BI0A 1MMGA 1WJQA 1I1JA 2RHZA 1ZUUA 1VQ4A 4JRIA 3OB9A 4F7UF 2VC8A 2DE0X 8ATCB 3G6EA 2M51A 2K6DA 4EIKA 4HKEA 1Q86C 4FM4B 1KHIA 5IH2A 2EGCA 2CSIA 2JXBA 1HJDA 3HL8A 1ACMB 2OTLA 1RAGB 5KYWA 1X75C 1SF9A 4HCZA 2YUOA 2JVVA 3LW5E 4MMLA 2ZZDA 4JZ4A 2RQWA 5CQYA 1QCNA 4HXJA 3EG2A 1VQOQ 3E9GA 3VS5A 2CP6A 1VYTA 1IO6A 3CCLT 4OGCA 3PMIA 4C0DC 5D6XA 4M7AA 9ATCB 2PZ1A 1Q81R 4E7IA 1YJNT 2J05A 3CCJA 4ZGEB 2MAMA 1BK2A 5C0MA 2D8JA 1XQHA 4AT1B 3ASKA 1HYOA 4OMNA 2DEUA 1LNXA 1S72A 5IXBA 2CP3A 1WLPB 2ZPHB 2O88A 2LQWA 1UECA 2KK4A 3EFRA 4Z02A 1U06A 1KQSS 1WJRA 4FYXB 5CIUA 1K9MU 1MNEA 2PVGB 4ELYC 4FSXA 4PKCC 3M0SA 3G71A 1D1CA 1M8VA 5FW9A 3OYBA 4M77F 2CH4W 4XTVA 1YJWQ 4FSSA 4KH1B 4BY6B 2CP2A 2L5QA 3X25B 2QDLA 1IB8A 2BTTA 1NPPA 2DTIA 3E1SA 3ER0A 4OMPA 1K4US 4F7UG 3NGPA 4M78G 3RNJA 4J9CA 1WXTA 2RNAA 3CBMA 1Y7XA 5GAN2 1YHQA 1TOVA 1RI9A 4RTTA 2A7YA 2DRMA 2IIMA 3UPUA 4M7DF 1VQ4Q 1CKBA 4EPCA 1VQ9T 1WJSA 4C8QD 2O2OA 3G6EQ 3V7RA 3OS1A 3OBWA 3QWYA 4J9DA 3OQ5A 3I9QA 2F2XA 2LQ8A 3VRZA 1W2BS 4C0DB 5GAMf 1YN8A 3L2QA 4N4IA 4F7UE 4M78E 1W6XA 2QQSA 4C8QB 2GCXA 2OTLQ 3LH0A 5L8RE 2Y4XA 4X9CA 2EJGA 4LN2A 3TQ7P 3HFNA 5M9OA 3E2UA 2X4YA 2DMOA 4PFZA 1RAFB 4DOVA 2FHDA 4JUVA 1OU9A 2MOXA 3OYKA 3CCJQ 2DXUA 1R0CB 1KD1R 2YWWA 2YSQA 5KYYA 3LYIA 1S72Q 2ATCB 2V1QA 4PJLA 2F5TX 4JPBW 4Q5WA 4E6RA 2YRVA 2E3IA 3NTIA 4FYWB 2DJZA 3M59A 2YLBA 3I55A 3S3NA 2IPOB 3G71Q 3E19A 2E5KA 2DL4A 4PJMA 1SSFA 4ZN3A 1QVGS 1PM3A 2JM9A 3CD6T 2KDSA 2L2PA 5CVIA 4LD9K 3EH2A 1V76A 4PL6A 4M7DG 3CMET 4QVDA 3MCAB 4JRPA 1TS9A 4J5YA 2CUDA 1YHQQ 3TCJA 1U3OA 1UJ0A 2GFAA 2ZPIB 2JOYA 3QHSA 3UA6A 1B7TA 1JBMA 3LX7A 3V8LA 3S3OA 2EYXA 4A4KA 1K73C 3A5ZB 4Z89A 2DETA 5CK9A 4M7DE 4C5GA 1M27C 3OYYA 1ZUKA 2RQVA 3MEAA 2LMJA 1LVKA 5KYUB 2DZCA 1ABOA 1UTIA 3CMAT 4RUGA 3VS1A 4XTUA 2XD0A 4MDXA 3KBGA 2DYBA 3JRZA 4J8OA 4OMQA 3Q1JA 1IRXA 4A4EA 3HFOA 1RL2A 4A53A 1WNLA 3A98A 4HVUA 1FWZA 1QWEA 1Q81U 1R8OB 2QA4T 4ZTJA 4NS5A 5GAMe 1W4SA 3MP6A 5D7UA 2X4JA 2XG8D 2DL7A 3EGDB 2XDBA 2E5QA 2MWPA 3SWNC 2EQMA 4J83A 3GPLA 1KQSP 2EYZA 5CCAA 2DVJA 2YUPA 1WI7A 1YITT 1R77A 2GBQA 2HKNA 2KEAA 4ME7A 5KYXB 3TEEA 3DLMA 1U1TA 1I5OB 2DX1A 3I55Q 1U1SA 1Y07A 4OMMA 2AT1B 5FU6B 3QWXX 1PD0A 3OY9A 3EFSA 2EYYA 1H3ZA 2QGFB 4J7IA 5LJ5f 2D1XA 2E10A 4XU1A 3CXCS 4OF1A 2DF6A 3CBOA 2EJFA 3LGFA 5D6YA 5CKHA 1QP3A 2CS7A 3VS2A 1ZBJA 1WDXA 1VQPA 1Q95G 4XU0A 2MYSA 5GANf 2X3XD 3A8GB 4BUGA 1W2BP 4C8QF 1DJ7B 1M90R 2KR3A 1M1FA 3M5AA 4KUIA 4F17A 2IG0A 2F5KA 3X24B 2FRWA 5HKCA 4N4HA 2RI2A 3SWNA 2B8AA 4EMKB 4Z8AA 4OVAA 2QGGA 2A36A 4M7AG 1KSWA 2CZ6B 2K2VA 1PC0A 1JJ2S 2XKOC 3OW2A 1WA7A 2LZ6B 3LWIA 2I0NA 3LWHA 2O01E 5GMKe 4RTUA 4F7UA 2KVQG 4B9WA 5DLOA 3GP8A 5DLQE 4M78A 4DOWA 2CUBA 3EHRA 3D7SB 1Q7YU 4M77C 2E1HA 4DBFA 4PJOF 2F2VA 5A0DA 2QEXT 2DJQA 3RKWA 1KD1U 1G2BA 3TSZA 3E9FA 3OYCA 3G4SA 4FIBA 3CCMT 2JS2A 1H3HA 1P92A 1KHCA 2CT4A 2EJ9A 1RAAB 3CPFA 1TUGB 1VQMT 2CDTA 1GBRA 2X3WD 1UG1A 1QVGP 1ZA2B 3JB9D 2EBPA 3P8HA 2ZPGB 8AT1B 1K76A 4BDYA 1I8FA 3M58A 1YJ9T 2P0QA 3L42A 3ME9A 5A2QE 1VQKT 1RLPC 3LH5A 1M2VB 5LJ3f 2LJ0A 2JMCA 4CRIA 2GF7A 1VQPQ 5GAN5 2KYMA 4KGZB 4C8QG 4PFPA 2MCNA 4OB0B 2DM1A 3R6NA 1OV3A 4GY5A 3M55A 3MHXA 4M77D 1X43A 1X6BA 1UGSB 3H6ZA 2HQEA 4M77A 3IQLA 3UA7A 4QQ6A 2LP5A 1MV3A 5CKDA 3M57A 2HMAA 1VQLA 4ZGJB 3OYMA 3HRSA 4C8QE 2MWOA 2K5IA 2RK2A 2DEQA 3H41A 4ANJA 5LJ5e 1I5LA 3CC7A 2L0AA 1M1KR 3QZ9B 4HVWA 3PT9A 4XTWA 2E6ZA 2K4YA 4LDXA 2CYZB 4J9FA 4PNOA 5GMKm 1M30A 3VV0A 5GANe 1VQNT 3MKDA 4M7DA 3OSSC 4PLIA 1K8AR 5A0GA 3VJPA 2VUBA 4JJBA 1ZQ1A 4FYVB 2LDMA 1SHFA 2VB6A 1WGSA 3JCMJ 2HDAA 2HAXA 5D6WA 1ZX6A 4OGEA 2DBMA 2LNVA 3G4SQ 3GNFB 1KK7A 5KH6A 2RB6A 1JEGA 2CGHA 2WSFE 2RHXA 3CC2A 2EGAA 3PIPA 1E6GA 4HT8A 3A8HB 4CC3A 1IGQA 2QDYB 2DNUA 4JS5A 2DIQA 1VQOT 1WQ7A 1LJOA 3HRUA 1T3SA 5IHIA 5GANd 2EAYA 2YT6A 3MPUB 1ARKA 1WHLA 1AWOA 3OYFA 3CCUA 6AT1B 2V8IA 4JJCA 3UDCA 2YUQA 2X9HA 3NTHA 4LNPA 4C5HA 2CZ1B 2EQUA 1D0ZA 1GCPA 4BACA 3GIBA 4JLGA 1FX7A 4F04B 1GFCA 2KY9A 2OTJA 3OYJA 4R55A 3EHQA 4LXCA 4ZNXA 4A4HA 1M90U 1RADB 3BW1A 3VS4A 4XTZA 2ZGWA 4Y92A 1YJWT 1VQLQ 2KI7A 4DBQA 2C0IA 4V2SA 2OJ2A 1NG2A 1TXQA 1QVFP 4KGVB 3CC7Q 5LJ3e 4PFOA 2L3PA 1YWOA 3QYGB 2DILA 2LJ3A 2QTXA 1OX8A 4M4ZA 3FJPA 2VV5A 2K3BA 1GFDA 1VQ6A 4BY6C 2GQVA 5GMKj 1VQ4T 1G3SA 2V8KA 3JAME 3OMGA 3PTAA 3G6ET 3V8KA 2C0TA 1KC8C 4RG8A 3AT1B 3CQTA 1G3YA 1ZBXA 4FYYB 2KQWA 2MF2A 3M56A 3C94A 1AWXA 2VGNA 1TU0B 1I81A 3EG9A 3EG3A 2OTLT 3A8LB 2J06A 3ZL7C 3CC2Q 1NYGA 5LJ3d 3EG9B 1MMDA 2QXFA 2DKGA 2XK0A 3WXMB 2PNIA 3JB9F 2DPPB 3M9QA 2E3HA 4C8QC 2V1RA 2LTOA 1QW1A 1PKSA 3U23A 3T9NA 2MK5A 3CCUQ 3CBPA 3ULRB 2K7AA 3FIFA 3CCJT 4JRQA 1B34A 5HY6A 1KQ1A 2H3EB 1TH7A 1AVZC 2AHJB 3CCQA 1B34B 3CPWP 2DLPA 1S72T 3OYGA 5GAMg 2QI2A 1IREB 2P84A 1WPYA 4LDWA 5EC7A 2OTJQ 2E65A 3OYLA 3G71T 1FMWA 1KIKA 2KT8A 1K0XA 2RM4A 4HCBA 1OULA 5I11A 1N6AA 1WIEA 2QQBA 3L2VA 1M1KU 1EFNA 2JS0A 5LJ5j 4PJOC 1OX9A 5KE2A 2COWA 7AT1B 1OZ2A 4RMOA 5FWCA 1QCFA 2W0ZA 4E47A 4BD3A 3JCMd 2EIFA 4LD6A 5GJVB 5GANj 1YHQT 1K8AU 2DBKA 2PQWA 5GAOq 4CC4B 4PLLA 1VQ6Q 4C8QA 1NEGA 1SEMA 2RQTA 2WSCE 1KQSA 2FZCB 1XTDA
chains in the Genus database with same CATH topology
2QEXQ 1VQ9Q 1VQPQ 1YJ9Q 1K9MR 3CD6Q 3CCMQ 1KC8R 1QVGP 1NJIR 3CCRQ 3I55Q 3CCQQ 3CPWP 1Q81R 1VQ7Q 1VQ8Q 1QVFP 3CC7Q 1M1KR 2OTLQ 3G71Q 1YHQQ 1VQNQ 1Q82R 3CCJQ 1Q7YR 1JJ2P 3CCVQ 3I56Q 1YITQ 1VQ4Q 1VQMQ 1YJWQ 2OTJQ 3OW2P 1W2BP 3CCLQ 3CMEQ 1KD1R 1YI2Q 3CXCP 1VQLQ 1K73R 3G4SQ 1N8RR 3G6EQ 1M90R 1KQSP 3CCUQ 1VQ5Q 1VQOQ 1YIJQ 2QA4Q 1K8AR 1S72Q 1YJNQ 3CMAQ 3CC2Q 1VQ6Q 3CCSQ 1VQKQ 3CC4Q 1Q86R 3CCEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Q;  1VQ9 Q;  1VQP Q;  1YJ9 Q;  1K9M R;  3CD6 Q;  3CCM Q;  1KC8 R;  1QVG P;  1NJI R;  3CCR Q;  3I55 Q;  3CCQ Q;  3CPW P;  1Q81 R;  1VQ7 Q;  1VQ8 Q;  1QVF P;  3CC7 Q;  1M1K R;  2OTL Q;  3G71 Q;  1YHQ Q;  1VQN Q;  1Q82 R;  3CCJ Q;  1Q7Y R;  1JJ2 P;  3CCV Q;  3I56 Q;  1YIT Q;  1VQ4 Q;  1VQM Q;  1YJW Q;  2OTJ Q;  3OW2 P;  1W2B P;  3CCL Q;  3CME Q;  1KD1 R;  1YI2 Q;  3CXC P;  1VQL Q;  1K73 R;  3G4S Q;  1N8R R;  3G6E Q;  1M90 R;  1KQS P;  3CCU Q;  1VQ5 Q;  1VQO Q;  1YIJ Q;  2QA4 Q;  1K8A R;  1S72 Q;  1YJN Q;  3CMA Q;  3CC2 Q;  1VQ6 Q;  3CCS Q;  1VQK Q;  3CC4 Q;  1Q86 R;  3CCE Q; 
#chains in the Genus database with same CATH topology
 3PNW C;  4QQD A;  5HCK A;  5IHK A;  4OB2 B;  4FW1 A;  1CSK A;  2PUK B;  2DL8 A;  2GQI A;  3OS2 A;  3RKX A;  3G1J A;  2NUT B;  3NTK A;  3SFM A;  1D3B B;  3M4Y A;  2YRD A;  4EMG A;  2A08 A;  2PUO B;  3JB9 G;  4GLK A;  3C12 A;  1GXI E;  1Z9Z A;  2CRE A;  1QCO A;  4XU3 A;  2FRY A;  4NL2 A;  3CCR A;  3VYG A;  1Q7Y R;  3SD4 A;  3JCM V;  3KFV A;  2HCK A;  3QDR B;  4PJO D;  4BB7 A;  3O5Z A;  1M3A A;  5GAM h;  4X34 A;  2CZ0 B;  1VQ5 A;  2KXC A;  2RHU A;  2O31 A;  2VXF A;  1E6H A;  4FT4 A;  2HL5 C;  4M77 G;  3URG A;  4PJO B;  2E41 A;  1FXX A;  4EDU A;  4RTX A;  2V26 A;  3CCQ Q;  2M0Y A;  1Z9Q A;  5A0L A;  1K9A A;  2EKH A;  3G7Z A;  1PWT A;  1AWW A;  4FW2 A;  1NLO C;  1SG5 A;  2RMO A;  1OYX A;  1YI2 A;  2HBW A;  2EVR A;  4GLM A;  5DM7 R;  4KRT A;  3I55 T;  1SHG A;  3EFO A;  3JCM Q;  2E4H A;  4AMC A;  2E70 A;  2JTM A;  4M77 E;  4UC4 A;  4FU6 A;  4OB1 B;  4Y91 A;  4D6W A;  3EFO B;  3H8Z A;  4GBQ A;  2FO0 A;  5GAN 7;  5LJ3 j;  4MDW A;  1X01 A;  2FZK B;  5CR2 A;  5FU6 C;  1U8R A;  5HK0 A;  3OSV A;  5KYU A;  1MMN A;  2COZ A;  3RMS A;  2NUZ A;  1BCM A;  3M0T A;  2LX9 A;  4WTO B;  4AG2 C;  2R58 A;  4J7F A;  3EGU A;  3RKY A;  2Y90 A;  3QII A;  1NJI R;  3JB9 J;  4AFQ C;  2YUN A;  1BU1 A;  1TSF A;  1QVG A;  4KUD K;  1X69 A;  3QBY A;  3PIO A;  4DBR A;  3JV3 A;  2JTF A;  2ESW A;  1GRI A;  1ZUY A;  1D0Y A;  2EGE A;  4RCB A;  4C5E A;  3KUF A;  1U5S A;  3CCE A;  1JQQ A;  2RJE A;  2ZAE A;  2O4X B;  3EGX A;  5KE3 A;  1JXM A;  5J39 A;  1M3B A;  1IXD A;  5GMK h;  3CCR Q;  3EGD A;  4C0G A;  3FDR A;  5LJ5 g;  3EGX B;  4EMK C;  1UFF A;  3VS0 A;  4J9G A;  1K73 R;  2X4X A;  4A63 B;  1O75 A;  1VQ5 Q;  3ZBD A;  5KYX A;  4KT0 E;  5IXF A;  2VAS A;  2G6F X;  4IUU A;  3VUZ A;  3OS0 A;  1VQ7 A;  5GAO m;  4MMK A;  1G3W A;  4LUE A;  4IUV A;  1YI2 Q;  1AT1 B;  2CH4 A;  2DL3 A;  2V8J A;  2HEQ A;  4BE1 A;  3NHN A;  1VIE A;  4J9I A;  1FMK A;  2KT1 A;  5I2S A;  2EYQ A;  4A4G A;  3RER A;  1JRI A;  1O9S A;  3HTR A;  3SEM A;  4J6X A;  3THK A;  4FCY A;  1A0N B;  1V29 B;  3RMQ A;  3QJ6 A;  1SPK A;  3V7S A;  1YNZ A;  1VQP T;  2OI3 A;  1B3Q A;  1XOV A;  2XDD A;  3INZ A;  3OW2 S;  4EMK A;  1I0C A;  4CC7 A;  2DIG A;  1H64 1;  2KBT A;  3CC4 A;  2JM8 A;  5FWB A;  3RBB B;  4J9H A;  2PVO B;  2KMT A;  2KRO A;  1WQW A;  1VQ8 A;  2P4R A;  2XID A;  1EIF A;  2CZ7 B;  5LJ5 h;  1IHV A;  1UUE A;  3QO3 A;  3QDF A;  2L3R A;  4J9B A;  2QQR A;  1YIJ A;  3OMC A;  5IT9 E;  2R57 A;  2DAQ A;  3J81 E;  4NOY A;  5GAN h;  3CCE Q;  3H0F A;  2RI5 A;  2ENM A;  3OYD A;  3GBQ A;  3VU3 C;  4M75 D;  3QYH B;  4JRK A;  4ZTF A;  1OU8 A;  3NPF A;  2D0N A;  5LJ3 g;  1NE8 A;  2R5A A;  1NZ9 A;  4X9D A;  2FG0 A;  2EKO A;  2KXD A;  2LRQ A;  3PGG A;  2BZX A;  2LJ1 A;  1GCQ C;  4M75 B;  2G3R A;  1XNI A;  4X1V A;  1R0B G;  2FVU A;  3G4S T;  1BI2 A;  1UJY A;  2RD1 A;  1WHM A;  1K9M C;  1VQ7 Q;  2OX7 A;  1Y96 B;  1YFN A;  2CP7 A;  2YHT A;  4BI4 A;  3FC3 A;  2F2W A;  2QAZ A;  4QVC A;  4C0Z A;  1QVF A;  2Y4Y A;  1MV0 B;  3J7A F;  2E64 A;  1M2V A;  4XU2 A;  2AIR B;  3QUI A;  1ZSZ B;  2X4W A;  4E7H A;  4C0F A;  4O6J A;  2K5L A;  4QT7 A;  4TVR A;  2O9V A;  1HD3 A;  2HKQ B;  1JU5 C;  3OYN A;  1TTH B;  3BE3 A;  1X2Q A;  2KSS A;  2LT1 A;  2K3Y A;  4C92 F;  1S1N A;  3RR6 A;  3L2R A;  1PD1 A;  2SRC A;  2OAU A;  1PRL C;  1PHT A;  1M4Z A;  3CC4 Q;  3OYE A;  2O9S A;  2X51 A;  2NUP B;  4KH0 B;  1VA7 A;  5ECA A;  1NJI U;  2QG9 B;  4J9E A;  1IHW A;  1VQ8 Q;  2RQU A;  1SRL A;  2JJ9 A;  1D1A A;  1OPK A;  3I56 A;  1VQL T;  1ZA1 B;  2JTE A;  1JO8 A;  3H0H A;  2RPN A;  3AHU A;  3QKJ A;  4LDY A;  2KYB A;  3P8B B;  5LJ3 h;  1ZSG A;  5CKB A;  2M16 A;  3CC7 T;  4RTW A;  1YIJ Q;  4IKF A;  2J6O A;  1AZE A;  2BE7 D;  2VVK A;  3BDU A;  4PJO G;  4LE9 A;  4HCK A;  2HSE B;  1RLQ C;  3JCM X;  3V7C A;  5EG2 A;  1UDL A;  3CPW A;  2GTJ A;  5GJW B;  1K73 U;  1BI1 A;  3MO8 A;  4JJD A;  5KCH A;  4OP0 A;  3JCM f;  4IUQ A;  2KAF A;  3F70 A;  4RTV A;  4PJO E;  3X28 B;  3CCS A;  4MZT A;  3JCM b;  1OZ3 A;  2BE9 B;  2GTO A;  2AKL A;  1HXD A;  1UE9 A;  2XU8 A;  4ZGD B;  2A28 A;  3CC2 T;  2EPD A;  4C5I A;  4JDS A;  3CCV A;  4HVV A;  3H9N A;  2CKK A;  1KFZ A;  3CXC P;  4IUR A;  2ECZ A;  4JZ3 A;  3EG1 A;  3UWN A;  2QK0 A;  3SB2 A;  4J6W A;  4A4F A;  2KE9 A;  2K9G A;  5GMK l;  1M9S A;  1WYX A;  3CCU T;  4CC2 A;  3MEW A;  4AG1 C;  4ESR A;  1YCY A;  3R6O A;  4DBH A;  2XDP A;  4JLI A;  2DD5 A;  2ED1 A;  4BI3 A;  4AFZ C;  1VOM A;  2YXY A;  2BIV A;  2K57 A;  1VYU A;  5J3B A;  2YLC A;  2OTJ T;  3WVD B;  2J6K A;  1WHJ A;  2FPF A;  1KG1 A;  1H8K A;  4WCI A;  4D8K A;  2HNI A;  2K79 A;  2RJF A;  5KYN A;  1JJ2 P;  2DZ9 A;  2KRN A;  3I56 Q;  2ZPF B;  2ZCF B;  5GAO p;  4O5V A;  4DQ2 A;  1BIA A;  4ELZ C;  1K1Z A;  4ORZ A;  2WSE E;  4OMF B;  1BIB A;  5LL6 S;  1JB0 E;  1V1C A;  4RG2 A;  3TU4 K;  3MJX A;  4M75 F;  2D0Q B;  1Q81 C;  2VYT A;  1Q82 R;  1EX4 A;  1VQ6 T;  1JXO A;  4Y28 E;  3EAE A;  3VYH B;  3QZ5 B;  2YDL A;  4M78 F;  1N8R R;  2DRK A;  3PVQ A;  1M8M A;  2RJC A;  3CCS Q;  1QLY A;  1E7O A;  5GAO r;  4E7Z A;  1OPL A;  2JT4 A;  3C0C A;  4OML A;  3J80 E;  3QG1 A;  1FYN A;  1W70 A;  3ZFJ A;  3CCV Q;  4J6Y A;  3CCL A;  3L1A A;  5KYW B;  2DL5 A;  4QKU A;  1C1A A;  3VS7 A;  4B6M A;  1YJN A;  1WFW A;  4F16 A;  4M7A D;  1F1B B;  1Q86 R;  2EFI A;  1T0H A;  3JCM e;  1KC8 R;  2RJD A;  1QWF A;  1AWJ A;  4M7A B;  4BE2 A;  3TRE A;  2QQ9 A;  4FL6 A;  2OAW A;  2RHY A;  3FLG A;  3CCQ T;  2P0K A;  3VRY A;  4RTY A;  5CO7 A;  1MHN A;  1MMA A;  3HHT B;  5IAY A;  2DA9 A;  3I5S A;  4DEX A;  3GLX A;  2NWM A;  1YBY A;  4BE0 A;  4XQ3 A;  3UAT A;  4E7S A;  2R5M A;  1WHH A;  2COY A;  3A8M B;  2DO3 A;  1BCO A;  5I2M A;  3I35 A;  4QW2 A;  1D09 B;  2XHC A;  3TVT A;  1MGQ A;  4M75 G;  1WHK A;  5GAN 4;  2K2M A;  3SDZ A;  3BDL A;  4EMH A;  2FB7 A;  1AHJ B;  1VQ9 A;  1Y0M A;  2DTH A;  2JN0 A;  3REB B;  5C6S A;  1FMV A;  4E7L A;  2NUT A;  4D8D A;  1Q7Y C;  1D3B A;  4DA4 A;  5HK3 A;  4AFS C;  1KD1 C;  3QSU A;  4M75 E;  1VUB A;  1UEB A;  2X35 A;  2RA2 A;  3NMZ C;  2M0O A;  3BFM A;  4CI0 C;  2PVD B;  2IVW A;  3O8V A;  4XTY A;  2FPD A;  1NYF A;  2XMF A;  3C4S A;  1RAH B;  2E12 A;  1KQ2 A;  1N5Z A;  4C92 C;  3CCL Q;  3GOX A;  4KBM B;  4R0K A;  3L2W A;  3CCR T;  4PJO A;  5I21 A;  1W2B A;  1YJN Q;  1UGQ B;  1WXB A;  5AT1 B;  2VGM A;  2W10 A;  2C06 A;  1VQ5 T;  2RI3 A;  3PMT A;  2CP5 A;  1G8X A;  5IHN A;  2A37 A;  2RH2 A;  2VXE A;  3H0I A;  1PCX A;  4HA8 A;  1NLP C;  5FRM A;  3M0P A;  4K11 A;  2XI9 A;  5FLX E;  4IUT A;  1C0M A;  3M0Q A;  3M0U A;  2QTV A;  3MP1 A;  5KYY B;  1YI2 T;  1BYM A;  1OI1 A;  3CD6 A;  1NJI C;  1UGV A;  5FRO A;  3DKM A;  4XAX B;  2M02 A;  1G83 A;  1GBQ A;  3CME A;  4F14 A;  4HCC A;  2D8H A;  2MI6 A;  2ABL A;  2DK3 A;  3VS6 A;  2A3L A;  5IN1 A;  4C92 D;  3DLL A;  2P0P A;  2DVE A;  2NYS A;  1H92 A;  1AZG B;  4C92 A;  4E7J A;  2JUF A;  5DY9 A;  1VIF A;  2LCS A;  1VQ9 Q;  2FZG B;  2K3X A;  2L3Q A;  2BKD N;  3PFS A;  2DXC A;  1Q82 U;  2CT3 A;  4LDV A;  4C92 B;  3RUX A;  2HBP A;  4R56 A;  2RN8 A;  2FL7 A;  3N5B B;  1I07 A;  3BY7 A;  1N8R U;  2P4T A;  1UB4 A;  2O4X A;  2YRC A;  3CMA A;  2A0F B;  1AEY A;  1TG0 A;  3OS5 A;  1QKX A;  4IUP A;  1G5V A;  3UF4 A;  1J3T A;  2LT4 A;  4VUB A;  2HSP A;  2QYZ A;  1MND A;  1RAB B;  2ROL A;  3JCM P;  1X27 A;  3CCE T;  2BZY A;  4KUL A;  2LNH B;  3EG0 A;  4RTZ A;  1IGU A;  1OOT A;  2QA4 A;  3WVE B;  1YP5 A;  4M7A F;  5GAN g;  3GF5 A;  4N0A C;  3OYI A;  1Q86 U;  1EZZ B;  2LQK A;  4HT9 A;  5CKF A;  1PG5 B;  1PRM C;  1KC8 U;  2FPE A;  2HD0 A;  5FU7 C;  1LPL A;  3SHW A;  3KXT A;  2DXT A;  2NLU A;  1X6O A;  2HQX A;  4PK4 A;  2AK5 A;  2F1L A;  4NL3 A;  1YIT A;  2ZPE B;  3MEU A;  1C6V X;  2DFU A;  3HSB A;  4BDZ A;  1QMC A;  1VQ7 T;  1M90 C;  1BKB A;  3L2U A;  1NM7 A;  2EQK A;  1I4K 1;  2ZPB B;  3PVL A;  1PSF A;  4MZM A;  1Y71 A;  1QKW A;  4II1 A;  4LUD A;  4M75 C;  3X26 B;  1D0X A;  3CD6 Q;  2D9T A;  1MUZ A;  3OYA A;  4M78 C;  3CME Q;  2Z0W A;  4ZN1 A;  4BI8 B;  3FJ5 A;  1WXU A;  1ZSZ C;  5GAM d;  3FRN A;  5AYF A;  5GMK i;  2MIO A;  3MET A;  1X6G A;  2XIC A;  1NBE B;  2EW3 A;  2H3J A;  2GGR A;  4XTX A;  1RAE B;  1SKU B;  1PSE A;  2ED0 A;  2F69 A;  4N0A A;  4YTL A;  3CC4 T;  1QP2 A;  2M9U A;  2LVM A;  2C0O A;  3M4G A;  5GAO l;  1VQ8 T;  2SEM A;  3RES A;  3CXC A;  1M1G A;  2L89 A;  3JSC A;  3CMA Q;  4Z88 A;  5FU7 B;  1XJW B;  1RAI B;  1UGR B;  2HZY A;  1T0J A;  1YIJ T;  2I2L A;  4ATO A;  1YCS B;  2E6N A;  3EH1 A;  1QQJ A;  1GL5 A;  3VS3 A;  3SWN B;  5GAN 8;  1QVF S;  4M75 A;  1AOJ A;  2H8H A;  4OB3 B;  1PKT A;  1UHF A;  3M54 A;  3JB9 H;  4M78 D;  2QA4 Q;  1WHG A;  1M5Q 1;  3OBY A;  5FRN A;  2DTO A;  2DD4 A;  1Y96 A;  3L2Z A;  3JB9 I;  2QEX A;  2J6F A;  3CCM A;  4DEY A;  2BUD A;  4M7A E;  4F7U B;  5KCO A;  4M78 B;  2JZ2 A;  1ZSZ A;  3QXE B;  1NEB A;  1YIT Q;  1VQM A;  1JJ2 A;  2EQJ A;  1B07 A;  3OA6 A;  1UHC A;  2FEI A;  4L59 A;  4L6V 5;  4RCC A;  3VKI A;  4QQG A;  4IIM A;  2M1H A;  5I22 A;  3RIR A;  1YJ9 A;  2RQR A;  1VQK A;  3JCM c;  4M7D C;  1LOJ A;  2CP0 A;  1BB9 A;  2DER A;  1M1K C;  3A8O B;  1RAC B;  4OMO A;  3HPW A;  1CKA A;  4JS4 A;  3C95 A;  5CQX A;  1N9S A;  2NUP A;  1PNJ A;  1D1B A;  1HSQ A;  1K8A C;  4B9X A;  2HL3 A;  4L5G A;  3HKS A;  4E2F B;  3M0R A;  1W1F A;  3I5R A;  2KNB B;  2RF0 A;  2DXB A;  2CSQ A;  1K9M R;  3P8D A;  3JCM g;  1YWP A;  2EWN A;  1LCK A;  1KJW A;  1SSH A;  1GCQ A;  3V8J A;  2BZ8 A;  1TWB A;  2KGT A;  3CPW S;  3JCM W;  2RK1 A;  5CAI A;  2ROT A;  4KGX B;  2K5F A;  1TUD A;  4PJJ A;  2KRS A;  3I56 T;  2JW4 A;  1BBZ A;  1G3T A;  4M77 B;  1QVP A;  1N27 A;  4N4G A;  1VQN A;  2FYK A;  1RUW A;  2JNG A;  2LCL A;  5L23 A;  2VWF A;  4M7D D;  2RO0 A;  1M3C A;  1X2K A;  4QVZ A;  3NFC A;  3VUB A;  2GFU A;  1VYV A;  4PJN A;  5CKE A;  3MEV A;  3PE0 A;  2QEX Q;  2VKN A;  4M7D B;  2PTK A;  4RKU E;  2LCC A;  4A54 A;  1NPR A;  3X20 B;  3CCM Q;  4AFU C;  1WX6 A;  3ZEH A;  5GAM j;  4LDU A;  2LX7 A;  4MZP A;  2QAS A;  3CCS T;  2RHI A;  1VQM Q;  1UGP B;  2AZS A;  3M53 A;  3OYH A;  1VQO A;  5GAO n;  5LJ5 d;  1WZO A;  2WAC A;  2GNC A;  3CCV T;  1T3L A;  4XK8 E;  1Y57 A;  1M2O A;  1YJ9 Q;  1VQK Q;  2AZV A;  3QPH A;  3LLR A;  2EYW A;  1IZ6 A;  1ZHI A;  4C92 G;  3GNG A;  3JCM h;  4JJN K;  4FT2 A;  3HP9 A;  5J26 A;  2AKK A;  3REA B;  2HQH A;  2KRM A;  3OW2 P;  3LGL A;  2J7I A;  2LQN A;  1ZLM A;  3S6W A;  1AD5 A;  4P5N A;  5GAN 3;  3CEY A;  2MPX C;  3DB4 A;  4C92 E;  1TUC A;  3FEO A;  4WF2 A;  2LC4 A;  2L8D A;  3QJY A;  4IIO A;  5GAN 6;  1Q82 C;  2EQI A;  2JMA A;  1HK9 A;  2DYI A;  1RI0 A;  1YJW A;  3RDV A;  1N8R C;  4M7A C;  1N9R A;  3UT1 A;  2PU9 B;  2QQA A;  1ABQ A;  3A1P A;  1K0S A;  2B86 A;  3TSW A;  3DB3 A;  2D6F A;  1SRM A;  1OEB A;  1BI3 A;  3MP8 A;  2L3S A;  3HRT A;  4E7K A;  2MMP A;  1VQN Q;  1OQK A;  3FB9 A;  3S3M A;  1BI0 A;  1MMG A;  1WJQ A;  1I1J A;  2RHZ A;  1ZUU A;  1VQ4 A;  4JRI A;  3OB9 A;  4F7U F;  2VC8 A;  2DE0 X;  8ATC B;  3G6E A;  2M51 A;  2K6D A;  4EIK A;  4HKE A;  1Q86 C;  4FM4 B;  1KHI A;  5IH2 A;  2EGC A;  2CSI A;  2JXB A;  1HJD A;  3HL8 A;  1ACM B;  2OTL A;  1RAG B;  5KYW A;  1X75 C;  1SF9 A;  4HCZ A;  2YUO A;  2JVV A;  3LW5 E;  4MML A;  2ZZD A;  4JZ4 A;  2RQW A;  5CQY A;  1QCN A;  4HXJ A;  3EG2 A;  1VQO Q;  3E9G A;  3VS5 A;  2CP6 A;  1VYT A;  1IO6 A;  3CCL T;  4OGC A;  3PMI A;  4C0D C;  5D6X A;  4M7A A;  9ATC B;  2PZ1 A;  1Q81 R;  4E7I A;  1YJN T;  2J05 A;  3CCJ A;  4ZGE B;  2MAM A;  1BK2 A;  5C0M A;  2D8J A;  1XQH A;  4AT1 B;  3ASK A;  1HYO A;  4OMN A;  2DEU A;  1LNX A;  1S72 A;  5IXB A;  2CP3 A;  1WLP B;  2ZPH B;  2O88 A;  2LQW A;  1UEC A;  2KK4 A;  3EFR A;  4Z02 A;  1U06 A;  1KQS S;  1WJR A;  4FYX B;  5CIU A;  1K9M U;  1MNE A;  2PVG B;  4ELY C;  4FSX A;  4PKC C;  3M0S A;  3G71 A;  1D1C A;  1M8V A;  5FW9 A;  3OYB A;  4M77 F;  2CH4 W;  4XTV A;  1YJW Q;  4FSS A;  4KH1 B;  4BY6 B;  2CP2 A;  2L5Q A;  3X25 B;  2QDL A;  1IB8 A;  2BTT A;  1NPP A;  2DTI A;  3E1S A;  3ER0 A;  4OMP A;  1K4U S;  4F7U G;  3NGP A;  4M78 G;  3RNJ A;  4J9C A;  1WXT A;  2RNA A;  3CBM A;  1Y7X A;  5GAN 2;  1YHQ A;  1TOV A;  1RI9 A;  4RTT A;  2A7Y A;  2DRM A;  2IIM A;  3UPU A;  4M7D F;  1VQ4 Q;  1CKB A;  4EPC A;  1VQ9 T;  1WJS A;  4C8Q D;  2O2O A;  3G6E Q;  3V7R A;  3OS1 A;  3OBW A;  3QWY A;  4J9D A;  3OQ5 A;  3I9Q A;  2F2X A;  2LQ8 A;  3VRZ A;  1W2B S;  4C0D B;  5GAM f;  1YN8 A;  3L2Q A;  4N4I A;  4F7U E;  4M78 E;  1W6X A;  2QQS A;  4C8Q B;  2GCX A;  2OTL Q;  3LH0 A;  5L8R E;  2Y4X A;  4X9C A;  2EJG A;  4LN2 A;  3TQ7 P;  3HFN A;  5M9O A;  3E2U A;  2X4Y A;  2DMO A;  4PFZ A;  1RAF B;  4DOV A;  2FHD A;  4JUV A;  1OU9 A;  2MOX A;  3OYK A;  3CCJ Q;  2DXU A;  1R0C B;  1KD1 R;  2YWW A;  2YSQ A;  5KYY A;  3LYI A;  1S72 Q;  2ATC B;  2V1Q A;  4PJL A;  2F5T X;  4JPB W;  4Q5W A;  4E6R A;  2YRV A;  2E3I A;  3NTI A;  4FYW B;  2DJZ A;  3M59 A;  2YLB A;  3I55 A;  3S3N A;  2IPO B;  3G71 Q;  3E19 A;  2E5K A;  2DL4 A;  4PJM A;  1SSF A;  4ZN3 A;  1QVG S;  1PM3 A;  2JM9 A;  3CD6 T;  2KDS A;  2L2P A;  5CVI A;  4LD9 K;  3EH2 A;  1V76 A;  4PL6 A;  4M7D G;  3CME T;  4QVD A;  3MCA B;  4JRP A;  1TS9 A;  4J5Y A;  2CUD A;  1YHQ Q;  3TCJ A;  1U3O A;  1UJ0 A;  2GFA A;  2ZPI B;  2JOY A;  3QHS A;  3UA6 A;  1B7T A;  1JBM A;  3LX7 A;  3V8L A;  3S3O A;  2EYX A;  4A4K A;  1K73 C;  3A5Z B;  4Z89 A;  2DET A;  5CK9 A;  4M7D E;  4C5G A;  1M27 C;  3OYY A;  1ZUK A;  2RQV A;  3MEA A;  2LMJ A;  1LVK A;  5KYU B;  2DZC A;  1ABO A;  1UTI A;  3CMA T;  4RUG A;  3VS1 A;  4XTU A;  2XD0 A;  4MDX A;  3KBG A;  2DYB A;  3JRZ A;  4J8O A;  4OMQ A;  3Q1J A;  1IRX A;  4A4E A;  3HFO A;  1RL2 A;  4A53 A;  1WNL A;  3A98 A;  4HVU A;  1FWZ A;  1QWE A;  1Q81 U;  1R8O B;  2QA4 T;  4ZTJ A;  4NS5 A;  5GAM e;  1W4S A;  3MP6 A;  5D7U A;  2X4J A;  2XG8 D;  2DL7 A;  3EGD B;  2XDB A;  2E5Q A;  2MWP A;  3SWN C;  2EQM A;  4J83 A;  3GPL A;  1KQS P;  2EYZ A;  5CCA A;  2DVJ A;  2YUP A;  1WI7 A;  1YIT T;  1R77 A;  2GBQ A;  2HKN A;  2KEA A;  4ME7 A;  5KYX B;  3TEE A;  3DLM A;  1U1T A;  1I5O B;  2DX1 A;  3I55 Q;  1U1S A;  1Y07 A;  4OMM A;  2AT1 B;  5FU6 B;  3QWX X;  1PD0 A;  3OY9 A;  3EFS A;  2EYY A;  1H3Z A;  2QGF B;  4J7I A;  5LJ5 f;  2D1X A;  2E10 A;  4XU1 A;  3CXC S;  4OF1 A;  2DF6 A;  3CBO A;  2EJF A;  3LGF A;  5D6Y A;  5CKH A;  1QP3 A;  2CS7 A;  3VS2 A;  1ZBJ A;  1WDX A;  1VQP A;  1Q95 G;  4XU0 A;  2MYS A;  5GAN f;  2X3X D;  3A8G B;  4BUG A;  1W2B P;  4C8Q F;  1DJ7 B;  1M90 R;  2KR3 A;  1M1F A;  3M5A A;  4KUI A;  4F17 A;  2IG0 A;  2F5K A;  3X24 B;  2FRW A;  5HKC A;  4N4H A;  2RI2 A;  3SWN A;  2B8A A;  4EMK B;  4Z8A A;  4OVA A;  2QGG A;  2A36 A;  4M7A G;  1KSW A;  2CZ6 B;  2K2V A;  1PC0 A;  1JJ2 S;  2XKO C;  3OW2 A;  1WA7 A;  2LZ6 B;  3LWI A;  2I0N A;  3LWH A;  2O01 E;  5GMK e;  4RTU A;  4F7U A;  2KVQ G;  4B9W A;  5DLO A;  3GP8 A;  5DLQ E;  4M78 A;  4DOW A;  2CUB A;  3EHR A;  3D7S B;  1Q7Y U;  4M77 C;  2E1H A;  4DBF A;  4PJO F;  2F2V A;  5A0D A;  2QEX T;  2DJQ A;  3RKW A;  1KD1 U;  1G2B A;  3TSZ A;  3E9F A;  3OYC A;  3G4S A;  4FIB A;  3CCM T;  2JS2 A;  1H3H A;  1P92 A;  1KHC A;  2CT4 A;  2EJ9 A;  1RAA B;  3CPF A;  1TUG B;  1VQM T;  2CDT A;  1GBR A;  2X3W D;  1UG1 A;  1QVG P;  1ZA2 B;  3JB9 D;  2EBP A;  3P8H A;  2ZPG B;  8AT1 B;  1K76 A;  4BDY A;  1I8F A;  3M58 A;  1YJ9 T;  2P0Q A;  3L42 A;  3ME9 A;  5A2Q E;  1VQK T;  1RLP C;  3LH5 A;  1M2V B;  5LJ3 f;  2LJ0 A;  2JMC A;  4CRI A;  2GF7 A;  1VQP Q;  5GAN 5;  2KYM A;  4KGZ B;  4C8Q G;  4PFP A;  2MCN A;  4OB0 B;  2DM1 A;  3R6N A;  1OV3 A;  4GY5 A;  3M55 A;  3MHX A;  4M77 D;  1X43 A;  1X6B A;  1UGS B;  3H6Z A;  2HQE A;  4M77 A;  3IQL A;  3UA7 A;  4QQ6 A;  2LP5 A;  1MV3 A;  5CKD A;  3M57 A;  2HMA A;  1VQL A;  4ZGJ B;  3OYM A;  3HRS A;  4C8Q E;  2MWO A;  2K5I A;  2RK2 A;  2DEQ A;  3H41 A;  4ANJ A;  5LJ5 e;  1I5L A;  3CC7 A;  2L0A A;  1M1K R;  3QZ9 B;  4HVW A;  3PT9 A;  4XTW A;  2E6Z A;  2K4Y A;  4LDX A;  2CYZ B;  4J9F A;  4PNO A;  5GMK m;  1M30 A;  3VV0 A;  5GAN e;  1VQN T;  3MKD A;  4M7D A;  3OSS C;  4PLI A;  1K8A R;  5A0G A;  3VJP A;  2VUB A;  4JJB A;  1ZQ1 A;  4FYV B;  2LDM A;  1SHF A;  2VB6 A;  1WGS A;  3JCM J;  2HDA A;  2HAX A;  5D6W A;  1ZX6 A;  4OGE A;  2DBM A;  2LNV A;  3G4S Q;  3GNF B;  1KK7 A;  5KH6 A;  2RB6 A;  1JEG A;  2CGH A;  2WSF E;  2RHX A;  3CC2 A;  2EGA A;  3PIP A;  1E6G A;  4HT8 A;  3A8H B;  4CC3 A;  1IGQ A;  2QDY B;  2DNU A;  4JS5 A;  2DIQ A;  1VQO T;  1WQ7 A;  1LJO A;  3HRU A;  1T3S A;  5IHI A;  5GAN d;  2EAY A;  2YT6 A;  3MPU B;  1ARK A;  1WHL A;  1AWO A;  3OYF A;  3CCU A;  6AT1 B;  2V8I A;  4JJC A;  3UDC A;  2YUQ A;  2X9H A;  3NTH A;  4LNP A;  4C5H A;  2CZ1 B;  2EQU A;  1D0Z A;  1GCP A;  4BAC A;  3GIB A;  4JLG A;  1FX7 A;  4F04 B;  1GFC A;  2KY9 A;  2OTJ A;  3OYJ A;  4R55 A;  3EHQ A;  4LXC A;  4ZNX A;  4A4H A;  1M90 U;  1RAD B;  3BW1 A;  3VS4 A;  4XTZ A;  2ZGW A;  4Y92 A;  1YJW T;  1VQL Q;  2KI7 A;  4DBQ A;  2C0I A;  4V2S A;  2OJ2 A;  1NG2 A;  1TXQ A;  1QVF P;  4KGV B;  3CC7 Q;  5LJ3 e;  4PFO A;  2L3P A;  1YWO A;  3QYG B;  2DIL A;  2LJ3 A;  2QTX A;  1OX8 A;  4M4Z A;  3FJP A;  2VV5 A;  2K3B A;  1GFD A;  1VQ6 A;  4BY6 C;  2GQV A;  5GMK j;  1VQ4 T;  1G3S A;  2V8K A;  3JAM E;  3OMG A;  3PTA A;  3G6E T;  3V8K A;  2C0T A;  1KC8 C;  4RG8 A;  3AT1 B;  3CQT A;  1G3Y A;  1ZBX A;  4FYY B;  2KQW A;  2MF2 A;  3M56 A;  3C94 A;  1AWX A;  2VGN A;  1TU0 B;  1I81 A;  3EG9 A;  3EG3 A;  2OTL T;  3A8L B;  2J06 A;  3ZL7 C;  3CC2 Q;  1NYG A;  5LJ3 d;  3EG9 B;  1MMD A;  2QXF A;  2DKG A;  2XK0 A;  3WXM B;  2PNI A;  3JB9 F;  2DPP B;  3M9Q A;  2E3H A;  4C8Q C;  2V1R A;  2LTO A;  1QW1 A;  1PKS A;  3U23 A;  3T9N A;  2MK5 A;  3CCU Q;  3CBP A;  3ULR B;  2K7A A;  3FIF A;  3CCJ T;  4JRQ A;  1B34 A;  5HY6 A;  1KQ1 A;  2H3E B;  1TH7 A;  1AVZ C;  2AHJ B;  3CCQ A;  1B34 B;  3CPW P;  2DLP A;  1S72 T;  3OYG A;  5GAM g;  2QI2 A;  1IRE B;  2P84 A;  1WPY A;  4LDW A;  5EC7 A;  2OTJ Q;  2E65 A;  3OYL A;  3G71 T;  1FMW A;  1KIK A;  2KT8 A;  1K0X A;  2RM4 A;  4HCB A;  1OUL A;  5I11 A;  1N6A A;  1WIE A;  2QQB A;  3L2V A;  1M1K U;  1EFN A;  2JS0 A;  5LJ5 j;  4PJO C;  1OX9 A;  5KE2 A;  2COW A;  7AT1 B;  1OZ2 A;  4RMO A;  5FWC A;  1QCF A;  2W0Z A;  4E47 A;  4BD3 A;  3JCM d;  2EIF A;  4LD6 A;  5GJV B;  5GAN j;  1YHQ T;  1K8A U;  2DBK A;  2PQW A;  5GAO q;  4CC4 B;  4PLL A;  1VQ6 Q;  4C8Q A;  1NEG A;  1SEM A;  2RQT A;  2WSC E;  1KQS A;  2FZC B;  1XTD A; 
#chains in the Genus database with same CATH homology
 2QEX Q;  1VQ9 Q;  1VQP Q;  1YJ9 Q;  1K9M R;  3CD6 Q;  3CCM Q;  1KC8 R;  1QVG P;  1NJI R;  3CCR Q;  3I55 Q;  3CCQ Q;  3CPW P;  1Q81 R;  1VQ7 Q;  1VQ8 Q;  1QVF P;  3CC7 Q;  1M1K R;  2OTL Q;  3G71 Q;  1YHQ Q;  1VQN Q;  1Q82 R;  3CCJ Q;  1Q7Y R;  1JJ2 P;  3CCV Q;  3I56 Q;  1YIT Q;  1VQ4 Q;  1VQM Q;  1YJW Q;  2OTJ Q;  3OW2 P;  1W2B P;  3CCL Q;  3CME Q;  1KD1 R;  1YI2 Q;  3CXC P;  1VQL Q;  1K73 R;  3G4S Q;  1N8R R;  3G6E Q;  1M90 R;  1KQS P;  3CCU Q;  1VQ5 Q;  1VQO Q;  1YIJ Q;  2QA4 Q;  1K8A R;  1S72 Q;  1YJN Q;  3CMA Q;  3CC2 Q;  1VQ6 Q;  3CCS Q;  1VQK Q;  3CC4 Q;  1Q86 R;  3CCE Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...