3BW1A

Crystal structure of homomeric yeast lsm3 exhibiting novel octameric ring organisation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
86
Chain Sequence
HHMETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSAVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm3
publication title Crystal structure of Lsm3 octamer from Saccharomyces cerevisiae: implications for Lsm ring organisation and recruitment
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 15
structure length 86
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3bw1A00
4M75F 4OP0A 3JCMc 2DVEA 4EMKB 3BDUA 5LJ3g 5LJ5f 4J6YA 5LJ5j 3EFSA 4HT9A 2DTOA 4RCBA 4PJOF 5CAIA 4NL3A 4JUVA 4JRIA 5LJ3d 5LJ3e 5GAN5 4M7DB 4XTZA 4JLIA 4M77F 2FYKA 5I21A 2E41A 2RD1A 3HFNA 1LNXA 4F7UG 3FIFA 4C8QA 1LOJA 4M7AF 2DTIA 5GMKh 4M7DA 3M4GA 3INZA 4M75A 2DXTA 3SWNC 5GAMh 4M78C 5GANf 5GANj 3V8LA 2EJ9A 1Y96A 2Y90A 5LJ5h 4PJOA 4C92D 1WQ7A 4HA8A 4C8QE 3GIBA 3PGGA 3V7RA 4XU2A 4M7DE 5GAOr 4MMKA 4M75E 4M77A 2DEQA 4C92G 2E1HA 3JCMf 4PJOE 4WF2A 4M78D 2FB7A 1D3BB 4A54A 3RKXA 1I4K1 3JB9D 4JRKA 2DTHA 4M77E 1TH7A 3VU3C 4M7AA 4V2SA 4N0AA 4M78G 3JB9I 4C92C 5GMKl 4EMKA 3RERA 5GANh 4QVDA 1MGQA 5GMKe 2VXFA 5LJ3f 4A53A 5LJ3j 3JB9G 1M8VA 5GAN2 3EFRA 3RIRA 5GAMe 3JCMV 4HT8A 4M7AE 3SB2A 4F7UF 4NL2A 5LJ5e 1JRIA 4PJOD 1WNLA 1WQWA 2EJFA 3V7SA 3SWNB 5GAN8 4M78B 4MMLA 2E64A 3JCMW 4QVCA 2EAYA 3L2ZA 2VC8A 1B34B 4M77D 2HNIA 3JCMh 5GAN7 5GAOn 2RM4A 4F7UB 5GAOl 4C8QC 2DJZA 2I2LA 1M5Q1 1U1TA 1WPYA 2YLBA 3FB9A 1KQ1A 3BFMA 2RB6A 4M75C 2JN0A 4M7AD 4M7DF 5DY9A 4C92F 1U1SA 4PJOC 4J6WA 5LJ3h 3JCMX 4XTUA 3HFOA 4EMHA 3QSUA 1N9RA 4F7UA 3JCMb 5GAN4 4XTVA 2CGHA 1HXDA 5GAMg 2YHTA 4M77C 4C8QD 1KQ2A 4X9CA 3JB9H 4C92B 2DZCA 5LJ5g 4M78F 4M7DD 3QHSA 4M75D 1HK9A 1BIAA 5GAMd 2EWNA 4Y91A 2RA2A 4F7UE 4C8QG 4RCCA 3JB9F 2DZ9A 5LJ5d 3JCMP 1D3BA 4XQ3A 2EJGA 3JCMe 3JB9J 4M7AC 1X01A 3FJPA 2QTXA 3V8KA 4M75G 4PNOA 5GMKj 5GMKm 4N0AC 4XTYA 5GAMj 4X9DA 4EMKC 1BIBA 4C92A 4EMGA 4PJOG 4J5YA 1H641 1YCYA 4C8QB 4M7DC 4M77G 3RKYA 5GANg 2K57A 4M75B 1N9SA 1I8FA 4XU0A 3SWNA 4C92E 4M78A 3JCMJ 4XU3A 5GAOm 1Y96B 3QUIA 3RUXA 1B34A 4PJOB 1JBMA 4XTWA 3JCMQ 5GANe 5GANd 4DQ2A 3RESA 3HSBA 3BW1A 3RKWA 3BY7A 4M7AG 3L1AA 5GAOq 4M77B 3AHUA 2ZGWA 4M78E 2DKGA 2VXEA 2E10A 2E65A 3JCMg 1LJOA 1I81A 5GAN6 4XU1A 3V7CA 3QO3A 4XTXA 3V8JA 1I5LA 2YLCA 3JCMd 2DXUA 4J6XA 4C8QF 4M7AB 5GAN3 4M7DG 4NOYA 5GAOp 5GMKi 5GAMf
chains in the Genus database with same CATH superfamily
1KD1U 4CRIA 2J05A 1BI3A 2AZSA 5LJ5j 3EFSA 3M59A 3JRZA 1PRLC 3EHQA 4FYWB 4YTLA 2FYKA 3VS0A 2X4XA 3UA6A 2LQ8A 4HCBA 3C0CA 1ZUUA 3OYEA 1WHGA 2BUDA 2DTIA 1UB4A 2PVGB 5D6XA 2HDAA 1JEGA 1BCOA 1UDLA 2B8AA 1D0ZA 3M0QA 4C0GA 3PIPA 3CCQQ 1XOVA 4M7AA 4JDSA 3BE3A 4M78G 4C92C 2X35A 5LJ3f 1VIEA 4LXCA 4QQ6A 4LDVA 4RTXA 4M78B 4M77D 3GPLA 1WJRA 2F2WA 3OS1A 4JRQA 1QKXA 1WHHA 3BFMA 5KE3A 2JJ9A 3I5SA 4DBRA 1VQ7T 3JB9H 2CP0A 2V1RA 4Y91A 3M56A 4B6MA 3TSWA 1X6GA 5IXBA 1NG2A 1T3LA 5L23A 3ZFJA 2D8HA 1YWOA 1K8AU 4OMLA 3CCLQ 2EVRA 3TU4K 2E70A 4M77G 2EQUA 3X25B 1QLYA 2MYSA 4XU0A 5KYWB 2HL3A 1Q86C 1VQKQ 3OB9A 1G8XA 3MCAB 4M77B 3HHTB 3CMEA 3VYHB 3CCEQ 2JS0A 4XTXA 1VQ5Q 2KR3A 1UHFA 1PKTA 2DXUA 1FMVA 3J81E 2DRMA 4HCCA 4M75F 3BDUA 2JMCA 1M1KC 8ATCB 3HRTA 1ZSZA 4QKUA 4C5HA 3QBYA 4MZMA 4D6WA 3H41A 3VV0A 3J80E 2KXDA 1KC8R 3CCVT 3S3NA 3OSVA 5A0LA 2CH4W 5GMKh 4M7DA 2BZYA 1VQNT 1I07A 1KJWA 3VS1A 1Y96A 2LX9A 2DNUA 4BD3A 3S3MA 1KQSS 4XU2A 1D0XA 4OB3B 5KCHA 1Z9QA 3LGLA 1U5SA 2LT1A 2ZPHB 2EGAA 4C5GA 4N0AA 1H8KA 1YIJT 3M58A 1MGQA 4CC7A 3IQLA 1Y57A 3G6EQ 4EPCA 2O9VA 3CQTA 4MMLA 1OYXA 4KT0E 4AG1C 2ZZDA 5GAN7 3AT1B 4Y28E 2I2LA 2D0QB 2E4HA 1IRXA 5HKCA 1Y71A 1IB8A 4BI8B 2KBTA 4XTUA 3QG1A 3CXCS 4Q5WA 3MO8A 2EW3A 1X75C 2NUTB 4X34A 4M75D 1S1NA 4C8QG 3MP6A 2P4TA 1IO6A 4J9DA 2YRVA 4WTOB 2D0NA 1PRMC 4J5YA 2FZCB 2K7AA 4C8QB 1E6GA 1VQ9Q 3CCST 4PJLA 1ZA2B 2J6KA 2HSPA 2K6DA 1ZUYA 2FEIA 1VYUA 3DLLA 5CO7A 3G71Q 2A7YA 3UWNA 1NBEB 2RNAA 4RG8A 2LX7A 3AHUA 1AZEA 1JU5C 2JM8A 4GBQA 4J8OA 1LJOA 2JUFA 3CC2A 1D1CA 1RUWA 2GQVA 3OA6A 4FYVB 2YUNA 3QJ6A 3SEMA 2F1LA 2ZPFB 3PTAA 3A5ZB 3CMET 2DBKA 1X2KA 2O31A 3QWXX 2JTMA 3CD6Q 2QQRA 3UDCA 1EX4A 4F7UG 1LPLA 4M7AF 3SWNC 2EIFA 2J6OA 1JQQA 1X6BA 2JXBA 3E9FA 2OX7A 5HY6A 1TUDA 1YWPA 1KC8U 1I1JA 1HSQA 2SRCA 4E7SA 2KSSA 2AKKA 4DA4A 4RG2A 3C95A 3RERA 1B3QA 1X2QA 3UA7A 3NTKA 4C0ZA 3NMZC 1M2VA 5LJ5e 1OU9A 2VC8A 3R6NA 1VQ8Q 1AWXA 1EFNA 1PM3A 1TWBA 3SD4A 1OZ3A 4LNPA 4EMHA 1TXQA 5FW9A 1F1BB 3M5AA 4R55A 3I55A 1M30A 2DZCA 1HK9A 4VUBA 2DX1A 4BY6C 3JB9F 4Y92A 3EGDB 1V76A 3UF4A 3I56T 1CKBA 3G4SA 1Q7YU 1YCYA 2QA4T 4E2FB 3CCRA 4X1VA 1X69A 2RJEA 4M78A 3OS2A 3NFCA 2ZCFB 4IUQA 1JB0E 3WVDB 2PVDB 2YXYA 1NYGA 3BY7A 2DK3A 2DFUA 5EG2A 1YI2Q 5GAN6 2E65A 1I81A 1K9MR 1SPKA 2JS2A 4GY5A 4JJNK 4C5EA 2DEUA 3JAME 4M7DF 2CP7A 5KH6A 5IHNA 5FLXE 2JMAA 2QDYB 1VQOA 3VKIA 3S6WA 5I21A 1KSWA 1WLPB 3O8VA 3TVTA 1MMNA 1WXUA 3VS7A 5KYWA 2EJ9A 2E6ZA 1HJDA 5DLOA 3V7RA 4QT7A 2RHIA 4M77A 4C92G 2D9TA 2C0IA 3OYHA 4LDUA 1JXOA 1FXXA 4BI4A 3JB9D 4P5NA 2LCSA 4LD6A 4QVDA 2COYA 2VXFA 5A2QE 3JCMV 1JRIA 3WVEB 5GAN8 2E64A 5GAOn 2HNIA 1M90C 1ZBJA 2NUPB 5FU6C 3ULRB 5EC7A 4DOWA 5C0MA 4IUUA 3OYNA 2PNIA 1U1SA 4JJBA 2AKLA 5IH2A 2CGHA 3I35A 3CC4A 1BI2A 1LCKA 4M7DD 3THKA 2CZ6B 5LJ5d 1K0XA 2CREA 1BI1A 3ZEHA 4TVRA 2MK5A 1TU0B 3ER0A 3BDLA 2P0QA 4JJDA 1NPRA 1ZX6A 3QYGB 2M9UA 1GFDA 1QVGA 1E7OA 2CSQA 4AFSC 3RUXA 2CZ0B 1VQMQ 2KMTA 4OMNA 3PT9A 1N8RC 2QQ9A 1H3ZA 2QG9B 3VS4A 3PVQA 2IIMA 3CCRT 1H3HA 4M7DG 1MHNA 3QDFA 1WHKA 4OP0A 3PMTA 2NUTA 4HT9A 3QWYA 5J3BA 1U8RA 4M7DB 4OMPA 1K9MU 3KXTA 2LP5A 3PNWC 1KD1R 2QAZA 4C8QA 2LZ6B 1QKWA 2QTVA 1RAHB 1K1ZA 2FPFA 3V8LA 3OYIA 2Y90A 3GNGA 2K5LA 3HRUA 2V8KA 4M75E 1UEBA 4J9GA 2KYBA 3F70A 2FB7A 2D8JA 4J9IA 2DO3A 4D8DA 2H3JA 4KULA 1ZUKA 2A37A 2KAFA 1IHWA 2COZA 5GAMe 2MF2A 2ED1A 4HT8A 1UHCA 2KE9A 4RUGA 1UUEA 2EJFA 5M9OA 3LLRA 4A4FA 5IN1A 1AWOA 1VQ6T 3OYKA 3LH0A 2H3EB 4JJCA 1FMWA 1U1TA 2RK1A 3L2QA 2SEMA 4M75C 2DD5A 3NPFA 1MMGA 2OAWA 1YJ9A 2XI9A 1M1GA 1I5OB 1Y0MA 1AD5A 1VQ7Q 1C0MA 1VA7A 4F7UA 2B86A 2RHUA 4M78F 4JS4A 1T3SA 3J7AF 2LCCA 2O01E 2EJGA 4PKCC 3JCMe 5GMKj 3EGUA 2I0NA 3FEOA 1QVFA 3Q1JA 4OB1B 1UJ0A 3P8HA 2LVMA 4O6JA 1OX9A 3CC4T 3CCJT 2KT1A 3RNJA 1G2BA 3QUIA 2M16A 2RJFA 3CPFA 1YJWQ 3GBQA 3CCUQ 1I5LA 3A98A 1KG1A 5DLQE 2OTLQ 3MHXA 2FRWA 1OPLA 2F2VA 1SEMA 3JCMc 1TUCA 1PWTA 4Z89A 1ZLMA 4QQDA 3EGDA 3QDRB 4M77F 4ESRA 1ARKA 4FU6A 3FDRA 4BUGA 2MWPA 2KEAA 4C0DC 1QVGS 2RK2A 2HBWA 2GNCA 3LGFA 1KQSA 2EQMA 1RABB 5FU7B 4F16A 1UECA 1YHQQ 2YT6A 3CCVA 2LDMA 2VASA 3TQ7P 4LE9A 2HQEA 3CC7A 1VQ4Q 2E1HA 3OBWA 1VQNA 1M9SA 4WF2A 1RLQC 4M78D 3A8HB 1M2VB 5HCKA 2KT8A 4AMCA 4EIKA 4V2SA 4BB7A 5GMKl 2JOYA 1Q81C 2BKDN 3EFRA 3G1JA 2DERA 1UGPB 4M7AE 1Z9ZA 4PJOD 1YN8A 3V7SA 2KI7A 1GFCA 4FW1A 4D8KA 2EAYA 5CVIA 3UT1A 3L2ZA 1YIJA 3SFMA 1G3YA 1VQPA 3CXCA 4PJMA 4QQGA 5I22A 5HK3A 2X4JA 1UGQB 2COWA 4J6WA 3CEYA 5GAN4 2RI5A 2XICA 3META 5LJ5g 4FIBA 1R8OB 1K73C 5GAMd 4RTVA 3X26B 3JB9J 4M7AC 1X01A 2MCNA 5GMKm 4XTYA 1YJ9T 4C92A 1UG1A 4PJOG 1UJYA 2K79A 1UGRB 2M0OA 1U3OA 1BB9A 2HSEB 3CCMQ 1XNIA 1N9SA 1I8FA 2CP5A 2KGTA 2BIVA 4PJOB 3HSBA 1KQSP 2NUPA 2QDLA 1AWJA 3CCQA 4KUDK 1PKSA 3CCSA 1D09B 4II1A 4XU1A 4OMOA 2DLPA 1BK2A 3JCMd 4C8QF 3OS5A 3KUFA 4EMKB 4HXJA 1Y07A 4FSXA 4ORZA 2DTOA 2ZPBB 1QVFS 3ZL7C 2AIRB 1W4SA 2FVUA 2X4YA 1OV3A 5IHKA 2L3QA 5IT9E 1DJ7B 1AEYA 1MUZA 2AZVA 1AOJA 3M0PA 5GANj 4A4EA 4JPBW 4IUTA 1TSFA 2C0OA 1RLPC 2K3BA 4M7DE 5DM7R 3CXCP 3M0TA 2XIDA 1YITA 2VWFA 2HBPA 2DTHA 5J26A 1TH7A 3LWIA 2YDLA 5J39A 1NJIR 3E1SA 3H8ZA 3CCLA 4GLKA 3RMQA 5GAN2 1ZSZC 3RBBB 4PFOA 2AHJB 3FJ5A 4F7UF 3OMGA 3CC7T 3EG9A 2E6NA 2J6FA 1I0CA 2JW4A 4ZGEB 2EYWA 2CDTA 3TREA 2FRYA 1KIKA 2VV5A 4OB2B 3OW2A 2ED0A 4OMMA 3HFOA 1KK7A 2ROLA 3MEVA 4C8QD 5CKFA 4X9CA 1SHFA 2AK5A 1GCPA 1BIAA 5IHIA 2EWNA 1IZ6A 4RKUE 1QCNA 2DXCA 1TG0A 1VQPT 4PNOA 3EG3A 2HKNA 4N0AC 2J7IA 3RMSA 3I5RA 4C0FA 1VUBA 4PL6A 3A1PA 4AT1B 2LNVA 3I56A 3BW1A 4Z88A 2KRNA 2QA4A 4CC2A 1Q7YR 2OAUA 3ME9A 2QQSA 2WSFE 3TCJA 2QASA 3V7CA 2ABLA 2DETA 1R0CB 3OYFA 4NOYA 4XK8E 1BU1A 5GMKi 2L2PA 2DVEA 2MI6A 3REBB 4RCBA 4ELYC 2ECZA 3CCQT 3CC2Q 2XKOC 3HTRA 1BBZA 2E3IA 2QXFA 2FL7A 4AFUC 1RAIB 3M0RA 2J06A 5IAYA 1PHTA 2R5AA 5LJ5h 1WQ7A 1OU8A 4L6V5 1QP3A 2OTJQ 2YSQA 2LNHB 4ZTFA 4L59A 1IREB 3TEEA 3VU3C 3H6ZA 5KCOA 3RR6A 5KYYA 2ZPGB 5LJ3j 1M8VA 2JNGA 4BACA 3QIIA 2HQHA 3M0UA 3OYYA 2RQUA 3C4SA 3G71A 2F2XA 1AZGB 2KVQG 1M1FA 1YITT 4F7UB 4ZGDB 1Q82R 2RQRA 2GF7A 1NJIU 1M5Q1 3CCLT 1WJQA 1N6AA 4C92F 4DBHA 1D1BA 2ENMA 1G3TA 1VQKT 4XTVA 5GAMg 4PJJA 1Q95G 2RPNA 1N8RU 3NGPA 1VQ5T 1K8AC 2EBPA 3CMAQ 3I55Q 1M3CA 5KYXB 3WXMB 4E7KA 1V1CA 1JJ2A 5CKDA 1ABOA 3M55A 1KFZA 1JBMA 3JSCA 2VGMA 2YRDA 2NUZA 2M02A 3OW2S 3L2VA 2DL3A 3G4SQ 4M78E 3JCMg 4JZ3A 3RDVA 3TSZA 3EGXA 5FRMA 2YLCA 5KE2A 3EH1A 3L2RA 2BE7D 2HL5C 4J6YA 1PD1A 2ATCB 2EQJA 4NL3A 1N27A 1OQKA 4JRIA 4E7ZA 1NLOC 4XTZA 2XDBA 2CT4A 1VQ8A 4OB0B 2DL8A 3GP8A 2MIOA 3A8LB 2RF0A 3X24B 1GBQA 3FIFA 3MEAA 4ZN1A 4KUIA 4OGCA 1VQOQ 3INZA 2CSIA 4M78C 2DAQA 1PG5B 2V8IA 4BDYA 2F5KA 4WCIA 3G6ET 4C92D 1IGUA 4PJOA 3QJYA 4A4HA 4FW2A 2X4WA 4ZGJB 3CPWA 2L3PA 2KXCA 4M77E 3VS2A 1EIFA 1WJSA 3HL8A 2K2MA 4EMKA 4MDWA 4PLIA 4A53A 1NYFA 3RIRA 2LC4A 3OMCA 4NL2A 4KGZB 3QYHB 4IUPA 2KK4A 5CQYA 3MPUB 2ZAEA 3QKJA 3E19A 3FC3A 1YNZA 4JZ4A 2LMJA 1VQ6A 2QQBA 3U23A 2QEXQ 3VS6A 4M77C 4C92B 3G71T 2A36A 1FYNA 1Q82U 3UATA 2XD0A 4F14A 1G83A 2DZ9A 3P8DA 5I11A 1PCXA 1Q86R 1X43A 2BZXA 1D1AA 1MV3A 1M8MA 2HD0A 4ME7A 2HAXA 1FMKA 2ROTA 1HYOA 2HCKA 4NS5A 4XTWA 3ASKA 3EG1A 3L1AA 1X27A 1M1KR 1SG5A 2A28A 3CCJA 2FPDA 2DYBA 2CS7A 2Z0WA 5GAN3 4HCZA 2LQKA 3OS0A 4A4GA 5LJ5f 4R56A 1OOTA 3P8BB 3HPWA 4PFZA 2PTKA 1W1FA 1FWZA 2LCLA 4N4HA 2WSEE 1JJ2S 2Y4YA 1Q81U 4LDWA 5GAMh 4C8QE 5I2SA 2RHZA 3EG0A 1KC8C 4MMKA 1VQ8T 1MMAA 2RQTA 1BCMA 2K2VA 1K76A 5CK9A 3M9QA 3OYAA 3EG9B 1RAGB 2IPOB 1NEBA 2QYZA 3NTIA 2E12A 1C1AA 1WIEA 2PUKB 3I9QA 1JO8A 1ZSGA 2FG0A 2FO0A 3JCMW 1B34B 3JCMh 1GXIE 1M3AA 4C8QC 1N5ZA 3FB9A 1WHJA 1VQLA 4LN2A 1W2BA 2ZPEB 1OULA 3JCMX 3QSUA 4ATOA 1OI1A 4AG2C 2RO0A 3CPWS 2JTFA 2QK0A 1YP5A 2CYZB 4F7UE 2QQAA 4L5GA 4RCCA 4XQ3A 1ABQA 2JZ2A 1YJ9Q 1PNJA 3O5ZA 3T9NA 1BIBA 3CBPA 1WHLA 1QVGP 2GGRA 2MPXC 2O4XB 1HD3A 2NYSA 4J9FA 3H0HA 4FCYA 3JCMQ 2DF6A 5GANd 1RI9A 1Q86U 4LUDA 2K5IA 3GOXA 2ZGWA 4CC3A 4FT2A 1QCFA 1GBRA 4BE0A 1RL2A 2MOXA 4K11A 3OYJA 4DEXA 1WYXA 5HK0A 4PJOF 3UPUA 1GCQC 2X3WD 1M1KU 4JLIA 2EKOA 1G3WA 1WZOA 1YJNA 1MNEA 1YBYA 5KYXA 1T0JA 3M4GA 3A8OB 2OI3A 3M53A 4FT4A 2RHYA 2XU8A 4OMQA 4HA8A 2FZGB 2JTEA 1PSFA 1T0HA 1TTHB 5KYYB 3NTHA 2XMFA 2LJ3A 1QQJA 1I4K1 4J7IA 4KRTA 4ZNXA 3CCVQ 2CP3A 3CC7Q 1VQNQ 2PZ1A 1WNLA 1WX6A 3SWNB 4E6RA 1GRIA 5GAOl 1YJWA 2EGCA 2E3HA 2V8JA 3CCUA 1IHVA 1PSEA 1KQ1A 4DBFA 9ATCB 2KRMA 2OTLA 1N9RA 1RI0A 3JCMb 1YIJQ 3EH2A 1VQMT 2YHTA 2P0PA 1TUGB 1EZZB 1VQPQ 1XTDA 2DBMA 3JCMP 1G3SA 2O2OA 1QVFP 3L42A 2HEQA 1VQLT 2XHCA 1D0YA 4IIOA 3FLGA 5CKEA 2DL4A 2O9SA 2YRCA 4J7FA 3OYCA 1FX7A 2GTOA 3M0SA 1BI0A 2DA9A 4C92E 1S72A 3EGXB 4OMFB 5GAOm 1YHQA 1AVZC 3CBMA 2MMPA 1UGVA 5FROA 3OYDA 1VQ4A 1W2BS 2DXBA 3DB4A 2DKGA 2P84A 1XQHA 4BY6B 1MV0B 2EQKA 3OSSC 3PFSA 5GAMf 3LWHA 5L8RE 2HQXA 3KBGA 5CKBA 3C12A 2NWMA 1RAEB 3CCSQ 1K9MC 5LJ3d 2PQWA 3VYGA 1H92A 2G3RA 2EKHA 4BE1A 1ZA1B 2CUDA 4BDZA 1LNXA 4IIMA 2BTTA 5AT1B 3GIBA 4JLGA 4N4IA 2HKQB 3MJXA 2LJ1A 1YJNT 1UGSB 3JCMf 4E7IA 4OGEA 3CMEQ 1J3TA 2VVKA 4A54A 2GFAA 3FRNA 4JRKA 5D7UA 4LUEA 2H8HA 4MDXA 1AHJB 3R6OA 2DE0X 4RTWA 1M90R 1SKUB 3CCMA 3KFVA 4RTUA 1SHGA 4ZTJA 3L2UA 1YITQ 3VRYA 3MKDA 5KYUA 3LH5A 4IURA 5C6SA 4DOVA 4FYYB 2WACA 2EYZA 1TOVA 2IG0A 1YJWT 2FZKB 3QHSA 4C5IA 2RA2A 2KROA 2K4YA 3VJPA 3CCUT 4KGXB 1SRMA 3OYGA 3C94A 1VQKA 3M4YA 2PU9B 7AT1B 1RAFB 2CT3A 2OTLT 1C6VX 1ZHIA 2EYQA 5FU6B 1N8RR 3CCEA 2A08A 3MEUA 4M7DC 5GANg 1VQ5A 2VYTA 1R0BG 1B34A 4J9EA 4ELZC 2L89A 4ZN3A 4J9HA 1UTIA 4OVAA 2RJCA 1TS9A 2RI3A 2WSCE 2PVOB 2V1QA 2YUPA 3QO3A 4AFQC 3QPHA 3MP8A 3H9NA 2R57A 1S72T 1WXBA 3I56Q 4B9XA 1YHQT 4MZTA 2OJ2A 2QA4Q 1SRLA 4QVZA 1WFWA 5CAIA 1VQ4T 5GAN5 2CZ7B 1BYMA 2W10A 3E2UA 2E41A 4IKFA 2L3RA 1LVKA 2O4XA 4M4ZA 1IGQA 1M4ZA 3HRSA 1NE8A 1KD1C 2QGGA 5GAOr 2XDPA 2DRKA 3G6EA 3QZ9B 1D3BB 1MMDA 2P4RA 1VIFA 3EFOB 5GMKe 2EGEA 2RI2A 1IXDA 1A0NB 2CH4A 4RTTA 4J9BA 4RMOA 4RTYA 2EYYA 1R77A 1WI7A 2RMOA 4KH0B 2DJZA 2EYXA 1BKBA 3OW2P 2YLBA 1M90U 4BI3A 4E47A 1G5VA 4PJNA 2G6FX 4IUVA 3SHWA 3CCMT 1RAAB 2P0KA 4UC4A 3LX7A 3PE0A 1KQ2A 1QP2A 1VQ9A 3A8MB 1UE9A 5CKHA 3CBOA 5ECAA 2MWOA 3V8KA 4JS5A 4M75G 2F69A 5GAMj 2GTJA 3MEWA 2PUOB 1WHMA 2NLUA 2BE9B 2LRQA 3RKYA 4M75B 2L0AA 1SSFA 4B9WA 2O88A 2M0YA 3SWNA 2YUOA 3X28B 3NHNA 4DQ2A 3OYMA 3H0FA 2OTJA 1SSHA 2RH2A 2VXEA 2K5FA 2M51A 5FU7C 3M57A 3CCET 2JM9A 4A63B 5D6WA 1NEGA 1KHIA 3EAEA 3CD6A 5LJ3g 4HKEA 3VS5A 5I2MA 1B07A 4EDUA 2M1HA 2DIGA 3OQ5A 1OEBA 2DL7A 2LT4A 3PIOA 4LD9K 1U06A 1WDXA 2F5TX 1LOJA 3LYIA 3CCRQ 5IXFA 8AT1B 2W0ZA 1Q81R 2KDSA 4Z02A 4PJOE 3JV3A 1NM7A 5CIUA 4N4GA 2CP6A 3OYLA 5CCAA 5A0DA 3CMAA 2GBQA 2HMAA 5GANh 1O9SA 5KYNA 4C0DB 3SB2A 1YCSB 5FWCA 4FYXB 1WQWA 2LQNA 4F17A 4QVCA 1QMCA 1UFFA 3DLMA 3D7SB 2RM4A 3HKSA 1WPYA 4Z8AA 4J9CA 4XAXB 1K73R 2DPPB 4M7AD 5DY9A 1ACMB 3EHRA 4PJOC 2DJQA 1B7TA 1HXDA 2CZ1B 2DYIA 6AT1B 1PD0A 1M2OA 3FJPA 4E7HA 1RACB 2QGFB 1YFNA 5CQXA 3E9GA 1VQ6Q 4X9DA 4EMKC 2ESWA 4FL6A 1YI2A 2A3LA 1H641 1JJ2P 4FSSA 1O75A 3GLXA 3REAB 2K57A 1VQ9T 3CC2T 2EFIA 5GANe 3RESA 3RKWA 4M7AG 5GAOq 1E6HA 2RN8A 2V26A 2E10A 1QWEA 2DIQA 3ZBDA 3PVLA 4E7LA 3QZ5B 4M7AB 1KHCA 3S3OA 2K3XA 1WXTA 4OF1A 2DVJA 5AYFA 4RTZA 3CC4Q 1PC0A 4JRPA 3CCJQ 2OTJT 4KH1B 4FM4B 2FHDA 2RD1A 3HFNA 2VGNA 1W6XA 4KBMB 3CD6T 4PFPA 3VUBA 3DB3A 1X6OA 2EQIA 4LDXA 1OX8A 3L2WA 2QEXA 3PGGA 2D6FA 2AT1B 2DEQA 3CPWP 2RHXA 1XJWB 1SF9A 2QI2A 4HCKA 5KYUB 2KY9A 4MZPA 3JB9G 4HVUA 1ZQ1A 4PLLA 1GL5A 1AT1B 4E7JA 5GJVB 2KRSA 3JB9I 1NJIC 4HVVA 1NLPC 3CMAT 1QCOA 2JVVA 3I55T 2HZYA 2RB6A 2JN0A 2KYMA 3HP9A 1W70A 5LJ3h 2XG8D 3PMIA 2CKKA 2C0TA 3GNFB 1VYTA 3SDZA 5GJWB 3VRZA 3G4ST 1ZSZB 1VQLQ 1D3BA 1OPKA 1K73U 2K9GA 1WGSA 3EFOA 1VQMA 4HVWA 1OZ2A 1NPPA 2E5QA 3OBYA 5FRNA 4BE2A 3JCMJ 1Y96B 2R58A 1K4US 2CUBA 2L3SA 2IVWA 2DILA 5FWBA 1YI2T 1VQOT 2YWWA 3M54A 2LTOA 2RQVA 4J6XA 1QW1A 2GQIA 5GAOp 2VUBA 1Q7YC 3EG2A 4CC4B 4LDYA 4JUVA 4GLMA 5LJ3e 4CI0C 2D1XA 2XDDA 2KQWA 4PK4A 3H0IA 3OYBA 1M27C 2VKNA 1K0SA 1AWWA 4J83A 4M75A 2DXTA 5GANf 2DM1A 2JT4A 3MP1A 2X3XD 1M3BA 2RQWA 1YJNQ 2BZ8A 3QXEB 1CSKA 2LQWA 3DKMA 3N5BB 1WA7A 3RKXA 2YUQA 4O5VA 1JXMA 2QEXT 4DEYA 4DBQA 5CR2A 1GCQA 3GF5A 2KNBB 2RJDA 1VQ7A 1VYVA 2VB6A 2CP2A 2FPEA 2A0FB 2E5KA 4AFZC 3A8GB 1W2BP 3X20B 2C06A 2Y4XA 2EPDA 4F04B 3URGA 2DL5A 1MNDA 1K8AR 2XK0A 2DD4A 1Q82C 1QVPA 2X9HA 2L8DA 1P92A 2LJ0A 3OY9A 2ZPIB 2L5QA 2MAMA 2DMOA 1QWFA 4R0KA 1NZ9A 1RADB 2QTXA 3LW5E 3G7ZA 4ANJA 4EMGA 5D6YA 1V29B 5A0GA 2GFUA 2R5MA 1Y7XA 1VOMA 5LL6S 2GCXA 4A4KA 1ZBXA 4XU3A 1K9AA 1CKAA 3VS3A 4KGVB 3V8JA 3VUZA 1S72Q 4QW2A 2X51A 2K3YA
chains in the Genus database with same CATH topology
4B9XA 1YHQT 4MZTA 4OP0A 3PMTA 3L2RA 4CRIA 1KD1U 1BI3A 5LJ5j 4J6YA 4HT9A 3EFSA 3M59A 4QVZA 5CAIA 2EQJA 4NL3A 1VQ4T 1N27A 3JRZA 4JRIA 5J3BA 5GAN5 1U8RA 4XTZA 2CZ7B 2XDBA 4M7DB 4YTLA 1BYMA 2FYKA 1K9MU 3KXTA 1VQ8A 4OB0B 2X4XA 2E41A 3PNWC 3GP8A 4IKFA 2LQ8A 3A8LB 4HCBA 2L3RA 3X24B 3FIFA 3MEAA 4C8QA 4ZN1A 3OYEA 2O4XA 2DTIA 2BUDA 4KUIA 4OGCA 3INZA 4M78C 2DAQA 1UB4A 2V8IA 1M4ZA 3V8LA 2PVGB 2Y90A 3HRSA 3OYIA 2F5KA 1NE8A 3GNGA 4C92D 3G6ET 4PJOA 3QJYA 5D6XA 1KD1C 2K5LA 4A4HA 2B8AA 5GAOr 3HRUA 2V8KA 4M75E 4C0GA 3PIPA 2XDPA 1UEBA 2X4WA 3F70A 2FB7A 4ZGJB 3CPWA 3G6EA 3QZ9B 2DO3A 1D3BB 2H3JA 1XOVA 4M77E 4KULA 4M7AA 4JDSA 1EIFA 1VIFA 4M78G 1WJSA 4C92C 3HL8A 4EMKA 2KAFA 4MDWA 2X35A 2RI2A 4PLIA 5LJ3f 4A53A 5GMKe 1VIEA 2LC4A 4QQ6A 2MF2A 3RIRA 4LDVA 5GAMe 4HT8A 3OMCA 4NL2A 4RMOA 3QYHB 2EJFA 4IUPA 5M9OA 2KK4A 4M78B 3LLRA 5CQYA 4M77D 5IN1A 4A4FA 1WJRA 3GPLA 1VQ6T 3OYKA 3LH0A 3OS1A 2DJZA 1BKBA 3QKJA 4JRQA 1U1TA 2RK1A 2YLBA 3E19A 3L2QA 1M90U 3BFMA 4M75C 2DD5A 4BI3A 3FC3A 5KE3A 1MHNA 4E47A 1YJ9A 2XI9A 1G5VA 4IUVA 1M1GA 3CCMT 1VQ6A 2QQBA 2P0KA 4UC4A 4F7UA 3LX7A 1VQ7T 4M77C 1KQ2A 3JB9H 2RHUA 1QP2A 4C92B 3G71T 4M78F 1VQ9A 3A8MB 1Q82U 4JS4A 5CKHA 4Y91A 2XD0A 3M56A 2DZ9A 3P8DA 3J7AF 2LCCA 2O01E 2EJGA 3CBOA 4PKCC 3JCMe 2MWOA 3V8KA 5GMKj 4JS5A 4M75G 3FEOA 2F69A 5GAMj 1QVFA 3Q1JA 4OB1B 3ZFJA 3MEWA 2PUOB 2HD0A 1K8AU 2NLUA 3P8HA 4ME7A 2LVMA 4O6JA 3TU4K 2E70A 2LRQA 2HAXA 4M77G 3RKYA 3CC4T 2EQUA 3X25B 3CCJT 4M75B 4B9WA 1SSFA 4XU0A 3SWNA 3X28B 1Q86C 3QUIA 4NS5A 2M16A 2RJFA 3CPFA 4XTWA 4DQ2A 3ASKA 3OYMA 2OTJA 3OB9A 3L1AA 3MCAB 4M77B 3HHTB 3CMEA 2RH2A 3CCJA 2VXEA 3VYHB 2K5FA 5FU7C 4XTXA 3M57A 1I5LA 3CCET 2CS7A 5D6WA 2DXUA 5DLQE 1KG1A 5GAN3 4HCZA 2LQKA 1KHIA 3MHXA 3J81E 3EAEA 4HCCA 3CD6A 4M75F 3JCMc 5LJ3g 3BDUA 3OS0A 1M1KC 4HKEA 4A4GA 5LJ5f 3HRTA 4R56A 3P8BB 3HPWA 4QQDA 5I2MA 1FWZA 2LCLA 4C5HA 3QDRB 3QBYA 4M77F 4N4HA 4FU6A 2M1HA 2DIGA 2WSEE 3OQ5A 3FDRA 4MZMA 4D6WA 4EDUA 4BUGA 3VV0A 2LT4A 2MWPA 3J80E 4C0DC 1QVGS 1JJ2S 3PIOA 3CCVT 2Y4YA 3S3NA 4LD9K 2RK2A 2F5TX 1LOJA 3OSVA 5A0LA 1Q81U 4LDWA 3LGFA 5GMKh 2EQMA 3LYIA 1KQSA 4M7DA 1VQNT 5GAMh 1Y96A 2LX9A 5FU7B 4BD3A 3S3MA 4C8QE 5I2SA 1KQSS 2RHZA 3CCVA 4XU2A 2LDMA 1KC8C 4MMKA 1VQ8T 4OB3B 2HQEA 3CC7A 2E1HA 3LGLA 3OBWA 5KCHA 4BDYA 1VQNA 2KDSA 4Z02A 4PJOE 1M9SA 4WF2A 4M78D 3A8HB 2K2VA 5CIUA 2LT1A 2ZPHB 4N4GA 5CK9A 3OYLA 3M9QA 5CCAA 5A0DA 3OYAA 4C5GA 3CMAA 4V2SA 4N0AA 4BB7A 5GMKl 3NTIA 2JOYA 3M58A 1O9SA 1MGQA 5GANh 1YIJT 1Q81C 2E12A 4C0DB 2PUKB 2BKDN 3EFRA 1UGPB 3SB2A 4M7AE 4PJOD 1WQWA 3V7SA 4EPCA 4MMLA 3JCMW 1OYXA 4KT0E 2EAYA 5CVIA 3UT1A 3L2ZA 1B34B 3JCMh 3DLMA 2ZZDA 3SFMA 5GAN7 1YIJA 2RM4A 1GXIE 4Y28E 3HKSA 4C8QC 2I2LA 2D0QB 1G3YA 1WPYA 3FB9A 1VQPA 4XAXB 5HKCA 3CXCA 2DPPB 1Y71A 1VQLA 4BI8B 5DY9A 4QQGA 4M7AD 5HK3A 2X4JA 2ZPEB 1W2BA 1UGQB 4PJOC 4J6WA 3CEYA 3JCMX 4XTUA 3QSUA 4ATOA 5GAN4 1OI1A 3QG1A 3CXCS 2RI5A 4Q5WA 2RO0A 1HXDA 2XICA 3MO8A 3CPWS 1X75C 2CZ1B 2JTFA 3META 5LJ5g 4FIBA 1R8OB 4X34A 1K73C 4M75D 5GAMd 2CYZB 4F7UE 2QQAA 4L5GA 4RCCA 4C8QG 3MP6A 2P4TA 4XQ3A 3X26B 2JZ2A 3JB9J 4M7AC 1X01A 3FJPA 4E7HA 2YRVA 5CQXA 5GMKm 3E9GA 4XTYA 3T9NA 4X9DA 4EMKC 1BIBA 3CBPA 4C92A 1YJ9T 4FL6A 4PJOG 4J5YA 1YI2A 2A3LA 1H641 2M0OA 1UGRB 4C8QB 4QVCA 1O75A 2O4XB 3GLXA 2K57A 1XNIA 1N9SA 1I8FA 3CCST 1VQ9T 2BIVA 3CC2T 2EFIA 4PJOB 3DLLA 3JCMQ 5GANd 5GANe 3HSBA 3RESA 5CO7A 3RKWA 1Q86U 4M7AG 2A7YA 2K5IA 3UWNA 3GOXA 5GAOq 4RG8A 3CCQA 3AHUA 2ZGWA 4KUDK 2E10A 4J8OA 3CCSA 1LJOA 4II1A 2JUFA 2DIQA 4FT2A 4XU1A 3CC2A 3ZBDA 3JCMd 4BE0A 1RL2A 4E7LA 3QZ5B 4C8QF 3OS5A 2GQVA 4M7AB 3OA6A 3KUFA 1KHCA 3S3OA 3OYJA 4EMKB 2K3XA 3QJ6A 1Y07A 4FSXA 4OF1A 5AYFA 2DTOA 2ZPFB 4PJOF 5HK0A 3UPUA 3PTAA 4JRPA 2OTJT 2ZPBB 1QVFS 1M1KU 3A5ZB 3CMET 4JLIA 1W4SA 1G3WA 2EKOA 2FVUA 2JTMA 4FM4B 2FHDA 2X4YA 1YJNA 2RD1A 3HFNA 2VGNA 2QQRA 3UDCA 4F7UG 4KBMB 1YBYA 5IT9E 1DJ7B 3CD6T 4M7AF 3VUBA 3DB3A 1X6OA 3M4GA 5GANj 3SWNC 2EIFA 4LDXA 4A4EA 3L2WA 3A8OB 3M53A 4FT4A 2RHYA 2XU8A 4IUTA 2QEXA 4HA8A 1PSFA 3E9FA 3PGGA 2D6FA 5HY6A 4M7DE 5DM7R 2DEQA 2RHXA 3NTHA 1KC8U 2XIDA 1YITA 2KSSA 1I4K1 4J7IA 2HBPA 2DTHA 5J26A 1TH7A 4RG2A 3C95A 3LWIA 4DA4A 5J39A 2QI2A 3E1SA 3H8ZA 3CCLA 3RERA 2KY9A 4MZPA 3JB9G 3NTKA 4GLKA 3RMQA 4C0ZA 5GAN2 2AHJB 4F7UF 5LJ5e 1ZQ1A 3OMGA 3CC7T 1WNLA 4PLLA 2E6NA 3SWNB 4E7JA 3JB9I 2VC8A 5GAOl 1YJWA 1NJIC 3CMAT 2V8JA 2JVVA 3I55T 4ZGEB 3CCUA 1PSEA 3TREA 3SD4A 1KQ1A 2RB6A 1OZ3A 2VV5A 2JN0A 4OB2B 3OW2A 3HP9A 2OTLA 5LJ3h 3HFOA 4EMHA 2XG8D 1N9RA 1RI0A 2CKKA 3PMIA 3MEVA 3JCMb 3M5AA 3GNFB 1VQMT 2YHTA 3SDZA 5CKFA 4C8QD 4X9CA 4R55A 3I55A 2DZCA 2P0PA 1HK9A 1BIAA 4VUBA 3G4ST 2EWNA 4BY6C 1IZ6A 1XTDA 3JB9F 4RKUE 3JCMP 1D3BA 1G3SA 2DXCA 1K73U 1VQPT 3L42A 1WGSA 4PNOA 1VQLT 1VQMA 4N0AC 5A0GA 3RMSA 2XHCA 3FLGA 5CKEA 3I56T 1OZ2A 3G4SA 1NPPA 2E5QA 1Q7YU 1YCYA 4J7FA 3OYCA 3CCRA 1FX7A 3OBYA 4C0FA 2QA4T 5FRNA 1BI0A 1VUBA 4PL6A 4C92E 4BE2A 1S72A 2RJEA 4M78A 3OS2A 3JCMJ 4OMFB 5GAOm 1YHQA 1Y96B 3NFCA 2ZCFB 4IUQA 1JB0E 2LNVA 2PVDB 3CBMA 2MMPA 2R58A 3WVDB 3I56A 4M7DC 3BW1A 3BY7A 5FROA 3OYDA 2IVWA 2QA4A 1VQ4A 2DK3A 2OAUA 3ME9A 2DXBA 5EG2A 1W2BS 3DB4A 2DKGA 2QQSA 2E65A 5GAN6 1I81A 2WSFE 3TCJA 1YI2T 1XQHA 3V7CA 1VQOT 4BY6B 3M54A 4GY5A 2LTOA 4JJNK 4J6XA 1QW1A 4C5EA 3OYFA 2EQKA 4NOYA 3OSSC 3PFSA 4XK8E 5GAOp 5GMKi 5GAMf 5KH6A 2VUBA 3JAME 3LWHA 1Q7YC 4M7DF 2DVEA 2MI6A 5L8RE 2HQXA 5FLXE 3KBGA 2QDYB 5CKBA 4RCBA 3C12A 4ELYC 4LDYA 1VQOA 4JUVA 1K9MC 3VKIA 5LJ3d 3CCQT 2PQWA 5LJ3e 4CI0C 2XKOC 3VYGA 2G3RA 4BE1A 2XDDA 3S6WA 5I21A 2KQWA 2QXFA 4BDZA 2FL7A 1LNXA 3O8VA 3OYBA 4J83A 4M75A 2DXTA 5IAYA 5GANf 2R5AA 2EJ9A 3MP1A 2E6ZA 5LJ5h 1WQ7A 3GIBA 4JLGA 4N4IA 5DLOA 4L6V5 3V7RA 2RHIA 3QXEB 1QP3A 4M77A 1YJNT 1UGSB 4C92G 2D9TA 3OYHA 3JCMf 4E7IA 4OGEA 4ZTFA 3DKMA 4LDUA 4L59A 3JB9D 3N5BB 4A54A 3RKXA 2GFAA 1FXXA 3FRNA 4JRKA 4BI4A 4O5VA 1IREB 3TEEA 3VU3C 3H6ZA 4P5NA 4MDXA 1AHJB 3R6OA 5KCOA 4LD6A 4QVDA 2ZPGB 2QEXT 2VXFA 5LJ3j 1M8VA 2JNGA 5CR2A 5A2QE 4BACA 3CCMA 3JCMV 3QIIA 1JRIA 3OYYA 3WVEB 3GF5A 4ZTJA 2RJDA 3L2UA 1VQ7A 5GAN8 2E64A 3C4SA 3G71A 5GAOn 2HNIA 2KVQG 1YITT 1M1FA 1M90C 4F7UB 4ZGDB 4IURA 5FU6C 2GF7A 5C6SA 1M5Q1 1NJIU 3A8GB 3CCLT 1WJQA 1N6AA 3X20B 4DOWA 5C0MA 4IUUA 4C92F 2C06A 2Y4XA 3OYNA 1U1SA 3URGA 4DOVA 1G3TA 1VQKT 2WACA 2CGHA 2XK0A 2DD4A 4XTVA 1QVPA 5GAMg 1Q82C 2IG0A 3CC4A 2L8DA 1YJWT 1BI2A 1P92A 3OY9A 4M7DD 3QHSA 2ZPIB 4C5IA 2CZ6B 2RA2A 3VJPA 2K4YA 2L5QA 1N8RU 5LJ5d 2MAMA 3CCUT 3OYGA 1NZ9A 3C94A 2QTXA 1VQ5T 1BI1A 3M4YA 1VQKA 2PU9B 3ZEHA 1K8AC 4TVRA 3LW5E 2OTLT 3G7ZA 4EMGA 3ER0A 5D6YA 1V29B 1ZHIA 3BDLA 2GFUA 2P0QA 2R5MA 1Y7XA 1NPRA 5LL6S 2EYQA 3QYGB 5FU6B 2GCXA 3WXMB 3CCEA 3MEUA 4A4KA 2M9UA 4E7KA 1JJ2A 5GANg 5CKDA 1QVGA 1ZBXA 2VYTA 1VQ5A 3M55A 4XU3A 3RUXA 2CZ0B 1B34A 1JBMA 4ELZC 2L89A 3JSCA 2KMTA 2VGMA 4ZN3A 4OVAA 2RJCA 3OW2S 3L2VA 3PT9A 2RI3A 1N8RC 2WSCE 2QQ9A 4M78E 1H3ZA 3JCMg 2PVOB 3QO3A 3V8JA 5FRMA 3CCRT 3VUZA 2YLCA 4QW2A 3QPHA 4M7DG 3MP8A 5KE2A 2R57A 1S72T 2K3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 F;  4OP0 A;  3JCM c;  2DVE A;  4EMK B;  3BDU A;  5LJ3 g;  5LJ5 f;  4J6Y A;  5LJ5 j;  3EFS A;  4HT9 A;  2DTO A;  4RCB A;  4PJO F;  5CAI A;  4NL3 A;  4JUV A;  4JRI A;  5LJ3 d;  5LJ3 e;  5GAN 5;  4M7D B;  4XTZ A;  4JLI A;  4M77 F;  2FYK A;  5I21 A;  2E41 A;  2RD1 A;  3HFN A;  1LNX A;  4F7U G;  3FIF A;  4C8Q A;  1LOJ A;  4M7A F;  2DTI A;  5GMK h;  4M7D A;  3M4G A;  3INZ A;  4M75 A;  2DXT A;  3SWN C;  5GAM h;  4M78 C;  5GAN f;  5GAN j;  3V8L A;  2EJ9 A;  1Y96 A;  2Y90 A;  5LJ5 h;  4PJO A;  4C92 D;  1WQ7 A;  4HA8 A;  4C8Q E;  3GIB A;  3PGG A;  3V7R A;  4XU2 A;  4M7D E;  5GAO r;  4MMK A;  4M75 E;  4M77 A;  2DEQ A;  4C92 G;  2E1H A;  3JCM f;  4PJO E;  4WF2 A;  4M78 D;  2FB7 A;  1D3B B;  4A54 A;  3RKX A;  1I4K 1;  3JB9 D;  4JRK A;  2DTH A;  4M77 E;  1TH7 A;  3VU3 C;  4M7A A;  4V2S A;  4N0A A;  4M78 G;  3JB9 I;  4C92 C;  5GMK l;  4EMK A;  3RER A;  5GAN h;  4QVD A;  1MGQ A;  5GMK e;  2VXF A;  5LJ3 f;  4A53 A;  5LJ3 j;  3JB9 G;  1M8V A;  5GAN 2;  3EFR A;  3RIR A;  5GAM e;  3JCM V;  4HT8 A;  4M7A E;  3SB2 A;  4F7U F;  4NL2 A;  5LJ5 e;  1JRI A;  4PJO D;  1WNL A;  1WQW A;  2EJF A;  3V7S A;  3SWN B;  5GAN 8;  4M78 B;  4MML A;  2E64 A;  3JCM W;  4QVC A;  2EAY A;  3L2Z A;  2VC8 A;  1B34 B;  4M77 D;  2HNI A;  3JCM h;  5GAN 7;  5GAO n;  2RM4 A;  4F7U B;  5GAO l;  4C8Q C;  2DJZ A;  2I2L A;  1M5Q 1;  1U1T A;  1WPY A;  2YLB A;  3FB9 A;  1KQ1 A;  3BFM A;  2RB6 A;  4M75 C;  2JN0 A;  4M7A D;  4M7D F;  5DY9 A;  4C92 F;  1U1S A;  4PJO C;  4J6W A;  5LJ3 h;  3JCM X;  4XTU A;  3HFO A;  4EMH A;  3QSU A;  1N9R A;  4F7U A;  3JCM b;  5GAN 4;  4XTV A;  2CGH A;  1HXD A;  5GAM g;  2YHT A;  4M77 C;  4C8Q D;  1KQ2 A;  4X9C A;  3JB9 H;  4C92 B;  2DZC A;  5LJ5 g;  4M78 F;  4M7D D;  3QHS A;  4M75 D;  1HK9 A;  1BIA A;  5GAM d;  2EWN A;  4Y91 A;  2RA2 A;  4F7U E;  4C8Q G;  4RCC A;  3JB9 F;  2DZ9 A;  5LJ5 d;  3JCM P;  1D3B A;  4XQ3 A;  2EJG A;  3JCM e;  3JB9 J;  4M7A C;  1X01 A;  3FJP A;  2QTX A;  3V8K A;  4M75 G;  4PNO A;  5GMK j;  5GMK m;  4N0A C;  4XTY A;  5GAM j;  4X9D A;  4EMK C;  1BIB A;  4C92 A;  4EMG A;  4PJO G;  4J5Y A;  1H64 1;  1YCY A;  4C8Q B;  4M7D C;  4M77 G;  3RKY A;  5GAN g;  2K57 A;  4M75 B;  1N9S A;  1I8F A;  4XU0 A;  3SWN A;  4C92 E;  4M78 A;  3JCM J;  4XU3 A;  5GAO m;  1Y96 B;  3QUI A;  3RUX A;  1B34 A;  4PJO B;  1JBM A;  4XTW A;  3JCM Q;  5GAN e;  5GAN d;  4DQ2 A;  3RES A;  3HSB A;  3BW1 A;  3RKW A;  3BY7 A;  4M7A G;  3L1A A;  5GAO q;  4M77 B;  3AHU A;  2ZGW A;  4M78 E;  2DKG A;  2VXE A;  2E10 A;  2E65 A;  3JCM g;  1LJO A;  1I81 A;  5GAN 6;  4XU1 A;  3V7C A;  3QO3 A;  4XTX A;  3V8J A;  1I5L A;  2YLC A;  3JCM d;  2DXU A;  4J6X A;  4C8Q F;  4M7A B;  5GAN 3;  4M7D G;  4NOY A;  5GAO p;  5GMK i;  5GAM f; 
#chains in the Genus database with same CATH topology
 1KD1 U;  4CRI A;  2J05 A;  1BI3 A;  2AZS A;  5LJ5 j;  3EFS A;  3M59 A;  3JRZ A;  1PRL C;  3EHQ A;  4FYW B;  4YTL A;  2FYK A;  3VS0 A;  2X4X A;  3UA6 A;  2LQ8 A;  4HCB A;  3C0C A;  1ZUU A;  3OYE A;  1WHG A;  2BUD A;  2DTI A;  1UB4 A;  2PVG B;  5D6X A;  2HDA A;  1JEG A;  1BCO A;  1UDL A;  2B8A A;  1D0Z A;  3M0Q A;  4C0G A;  3PIP A;  3CCQ Q;  1XOV A;  4M7A A;  4JDS A;  3BE3 A;  4M78 G;  4C92 C;  2X35 A;  5LJ3 f;  1VIE A;  4LXC A;  4QQ6 A;  4LDV A;  4RTX A;  4M78 B;  4M77 D;  3GPL A;  1WJR A;  2F2W A;  3OS1 A;  4JRQ A;  1QKX A;  1WHH A;  3BFM A;  5KE3 A;  2JJ9 A;  3I5S A;  4DBR A;  1VQ7 T;  3JB9 H;  2CP0 A;  2V1R A;  4Y91 A;  3M56 A;  4B6M A;  3TSW A;  1X6G A;  5IXB A;  1NG2 A;  1T3L A;  5L23 A;  3ZFJ A;  2D8H A;  1YWO A;  1K8A U;  4OML A;  3CCL Q;  2EVR A;  3TU4 K;  2E70 A;  4M77 G;  2EQU A;  3X25 B;  1QLY A;  2MYS A;  4XU0 A;  5KYW B;  2HL3 A;  1Q86 C;  1VQK Q;  3OB9 A;  1G8X A;  3MCA B;  4M77 B;  3HHT B;  3CME A;  3VYH B;  3CCE Q;  2JS0 A;  4XTX A;  1VQ5 Q;  2KR3 A;  1UHF A;  1PKT A;  2DXU A;  1FMV A;  3J81 E;  2DRM A;  4HCC A;  4M75 F;  3BDU A;  2JMC A;  1M1K C;  8ATC B;  3HRT A;  1ZSZ A;  4QKU A;  4C5H A;  3QBY A;  4MZM A;  4D6W A;  3H41 A;  3VV0 A;  3J80 E;  2KXD A;  1KC8 R;  3CCV T;  3S3N A;  3OSV A;  5A0L A;  2CH4 W;  5GMK h;  4M7D A;  2BZY A;  1VQN T;  1I07 A;  1KJW A;  3VS1 A;  1Y96 A;  2LX9 A;  2DNU A;  4BD3 A;  3S3M A;  1KQS S;  4XU2 A;  1D0X A;  4OB3 B;  5KCH A;  1Z9Q A;  3LGL A;  1U5S A;  2LT1 A;  2ZPH B;  2EGA A;  4C5G A;  4N0A A;  1H8K A;  1YIJ T;  3M58 A;  1MGQ A;  4CC7 A;  3IQL A;  1Y57 A;  3G6E Q;  4EPC A;  2O9V A;  3CQT A;  4MML A;  1OYX A;  4KT0 E;  4AG1 C;  2ZZD A;  5GAN 7;  3AT1 B;  4Y28 E;  2I2L A;  2D0Q B;  2E4H A;  1IRX A;  5HKC A;  1Y71 A;  1IB8 A;  4BI8 B;  2KBT A;  4XTU A;  3QG1 A;  3CXC S;  4Q5W A;  3MO8 A;  2EW3 A;  1X75 C;  2NUT B;  4X34 A;  4M75 D;  1S1N A;  4C8Q G;  3MP6 A;  2P4T A;  1IO6 A;  4J9D A;  2YRV A;  4WTO B;  2D0N A;  1PRM C;  4J5Y A;  2FZC B;  2K7A A;  4C8Q B;  1E6G A;  1VQ9 Q;  3CCS T;  4PJL A;  1ZA2 B;  2J6K A;  2HSP A;  2K6D A;  1ZUY A;  2FEI A;  1VYU A;  3DLL A;  5CO7 A;  3G71 Q;  2A7Y A;  3UWN A;  1NBE B;  2RNA A;  4RG8 A;  2LX7 A;  3AHU A;  1AZE A;  1JU5 C;  2JM8 A;  4GBQ A;  4J8O A;  1LJO A;  2JUF A;  3CC2 A;  1D1C A;  1RUW A;  2GQV A;  3OA6 A;  4FYV B;  2YUN A;  3QJ6 A;  3SEM A;  2F1L A;  2ZPF B;  3PTA A;  3A5Z B;  3CME T;  2DBK A;  1X2K A;  2O31 A;  3QWX X;  2JTM A;  3CD6 Q;  2QQR A;  3UDC A;  1EX4 A;  4F7U G;  1LPL A;  4M7A F;  3SWN C;  2EIF A;  2J6O A;  1JQQ A;  1X6B A;  2JXB A;  3E9F A;  2OX7 A;  5HY6 A;  1TUD A;  1YWP A;  1KC8 U;  1I1J A;  1HSQ A;  2SRC A;  4E7S A;  2KSS A;  2AKK A;  4DA4 A;  4RG2 A;  3C95 A;  3RER A;  1B3Q A;  1X2Q A;  3UA7 A;  3NTK A;  4C0Z A;  3NMZ C;  1M2V A;  5LJ5 e;  1OU9 A;  2VC8 A;  3R6N A;  1VQ8 Q;  1AWX A;  1EFN A;  1PM3 A;  1TWB A;  3SD4 A;  1OZ3 A;  4LNP A;  4EMH A;  1TXQ A;  5FW9 A;  1F1B B;  3M5A A;  4R55 A;  3I55 A;  1M30 A;  2DZC A;  1HK9 A;  4VUB A;  2DX1 A;  4BY6 C;  3JB9 F;  4Y92 A;  3EGD B;  1V76 A;  3UF4 A;  3I56 T;  1CKB A;  3G4S A;  1Q7Y U;  1YCY A;  2QA4 T;  4E2F B;  3CCR A;  4X1V A;  1X69 A;  2RJE A;  4M78 A;  3OS2 A;  3NFC A;  2ZCF B;  4IUQ A;  1JB0 E;  3WVD B;  2PVD B;  2YXY A;  1NYG A;  3BY7 A;  2DK3 A;  2DFU A;  5EG2 A;  1YI2 Q;  5GAN 6;  2E65 A;  1I81 A;  1K9M R;  1SPK A;  2JS2 A;  4GY5 A;  4JJN K;  4C5E A;  2DEU A;  3JAM E;  4M7D F;  2CP7 A;  5KH6 A;  5IHN A;  5FLX E;  2JMA A;  2QDY B;  1VQO A;  3VKI A;  3S6W A;  5I21 A;  1KSW A;  1WLP B;  3O8V A;  3TVT A;  1MMN A;  1WXU A;  3VS7 A;  5KYW A;  2EJ9 A;  2E6Z A;  1HJD A;  5DLO A;  3V7R A;  4QT7 A;  2RHI A;  4M77 A;  4C92 G;  2D9T A;  2C0I A;  3OYH A;  4LDU A;  1JXO A;  1FXX A;  4BI4 A;  3JB9 D;  4P5N A;  2LCS A;  4LD6 A;  4QVD A;  2COY A;  2VXF A;  5A2Q E;  3JCM V;  1JRI A;  3WVE B;  5GAN 8;  2E64 A;  5GAO n;  2HNI A;  1M90 C;  1ZBJ A;  2NUP B;  5FU6 C;  3ULR B;  5EC7 A;  4DOW A;  5C0M A;  4IUU A;  3OYN A;  2PNI A;  1U1S A;  4JJB A;  2AKL A;  5IH2 A;  2CGH A;  3I35 A;  3CC4 A;  1BI2 A;  1LCK A;  4M7D D;  3THK A;  2CZ6 B;  5LJ5 d;  1K0X A;  2CRE A;  1BI1 A;  3ZEH A;  4TVR A;  2MK5 A;  1TU0 B;  3ER0 A;  3BDL A;  2P0Q A;  4JJD A;  1NPR A;  1ZX6 A;  3QYG B;  2M9U A;  1GFD A;  1QVG A;  1E7O A;  2CSQ A;  4AFS C;  3RUX A;  2CZ0 B;  1VQM Q;  2KMT A;  4OMN A;  3PT9 A;  1N8R C;  2QQ9 A;  1H3Z A;  2QG9 B;  3VS4 A;  3PVQ A;  2IIM A;  3CCR T;  1H3H A;  4M7D G;  1MHN A;  3QDF A;  1WHK A;  4OP0 A;  3PMT A;  2NUT A;  4HT9 A;  3QWY A;  5J3B A;  1U8R A;  4M7D B;  4OMP A;  1K9M U;  3KXT A;  2LP5 A;  3PNW C;  1KD1 R;  2QAZ A;  4C8Q A;  2LZ6 B;  1QKW A;  2QTV A;  1RAH B;  1K1Z A;  2FPF A;  3V8L A;  3OYI A;  2Y90 A;  3GNG A;  2K5L A;  3HRU A;  2V8K A;  4M75 E;  1UEB A;  4J9G A;  2KYB A;  3F70 A;  2FB7 A;  2D8J A;  4J9I A;  2DO3 A;  4D8D A;  2H3J A;  4KUL A;  1ZUK A;  2A37 A;  2KAF A;  1IHW A;  2COZ A;  5GAM e;  2MF2 A;  2ED1 A;  4HT8 A;  1UHC A;  2KE9 A;  4RUG A;  1UUE A;  2EJF A;  5M9O A;  3LLR A;  4A4F A;  5IN1 A;  1AWO A;  1VQ6 T;  3OYK A;  3LH0 A;  2H3E B;  4JJC A;  1FMW A;  1U1T A;  2RK1 A;  3L2Q A;  2SEM A;  4M75 C;  2DD5 A;  3NPF A;  1MMG A;  2OAW A;  1YJ9 A;  2XI9 A;  1M1G A;  1I5O B;  1Y0M A;  1AD5 A;  1VQ7 Q;  1C0M A;  1VA7 A;  4F7U A;  2B86 A;  2RHU A;  4M78 F;  4JS4 A;  1T3S A;  3J7A F;  2LCC A;  2O01 E;  2EJG A;  4PKC C;  3JCM e;  5GMK j;  3EGU A;  2I0N A;  3FEO A;  1QVF A;  3Q1J A;  4OB1 B;  1UJ0 A;  3P8H A;  2LVM A;  4O6J A;  1OX9 A;  3CC4 T;  3CCJ T;  2KT1 A;  3RNJ A;  1G2B A;  3QUI A;  2M16 A;  2RJF A;  3CPF A;  1YJW Q;  3GBQ A;  3CCU Q;  1I5L A;  3A98 A;  1KG1 A;  5DLQ E;  2OTL Q;  3MHX A;  2FRW A;  1OPL A;  2F2V A;  1SEM A;  3JCM c;  1TUC A;  1PWT A;  4Z89 A;  1ZLM A;  4QQD A;  3EGD A;  3QDR B;  4M77 F;  4ESR A;  1ARK A;  4FU6 A;  3FDR A;  4BUG A;  2MWP A;  2KEA A;  4C0D C;  1QVG S;  2RK2 A;  2HBW A;  2GNC A;  3LGF A;  1KQS A;  2EQM A;  1RAB B;  5FU7 B;  4F16 A;  1UEC A;  1YHQ Q;  2YT6 A;  3CCV A;  2LDM A;  2VAS A;  3TQ7 P;  4LE9 A;  2HQE A;  3CC7 A;  1VQ4 Q;  2E1H A;  3OBW A;  1VQN A;  1M9S A;  4WF2 A;  1RLQ C;  4M78 D;  3A8H B;  1M2V B;  5HCK A;  2KT8 A;  4AMC A;  4EIK A;  4V2S A;  4BB7 A;  5GMK l;  2JOY A;  1Q81 C;  2BKD N;  3EFR A;  3G1J A;  2DER A;  1UGP B;  4M7A E;  1Z9Z A;  4PJO D;  1YN8 A;  3V7S A;  2KI7 A;  1GFC A;  4FW1 A;  4D8K A;  2EAY A;  5CVI A;  3UT1 A;  3L2Z A;  1YIJ A;  3SFM A;  1G3Y A;  1VQP A;  3CXC A;  4PJM A;  4QQG A;  5I22 A;  5HK3 A;  2X4J A;  1UGQ B;  2COW A;  4J6W A;  3CEY A;  5GAN 4;  2RI5 A;  2XIC A;  3MET A;  5LJ5 g;  4FIB A;  1R8O B;  1K73 C;  5GAM d;  4RTV A;  3X26 B;  3JB9 J;  4M7A C;  1X01 A;  2MCN A;  5GMK m;  4XTY A;  1YJ9 T;  4C92 A;  1UG1 A;  4PJO G;  1UJY A;  2K79 A;  1UGR B;  2M0O A;  1U3O A;  1BB9 A;  2HSE B;  3CCM Q;  1XNI A;  1N9S A;  1I8F A;  2CP5 A;  2KGT A;  2BIV A;  4PJO B;  3HSB A;  1KQS P;  2NUP A;  2QDL A;  1AWJ A;  3CCQ A;  4KUD K;  1PKS A;  3CCS A;  1D09 B;  4II1 A;  4XU1 A;  4OMO A;  2DLP A;  1BK2 A;  3JCM d;  4C8Q F;  3OS5 A;  3KUF A;  4EMK B;  4HXJ A;  1Y07 A;  4FSX A;  4ORZ A;  2DTO A;  2ZPB B;  1QVF S;  3ZL7 C;  2AIR B;  1W4S A;  2FVU A;  2X4Y A;  1OV3 A;  5IHK A;  2L3Q A;  5IT9 E;  1DJ7 B;  1AEY A;  1MUZ A;  2AZV A;  1AOJ A;  3M0P A;  5GAN j;  4A4E A;  4JPB W;  4IUT A;  1TSF A;  2C0O A;  1RLP C;  2K3B A;  4M7D E;  5DM7 R;  3CXC P;  3M0T A;  2XID A;  1YIT A;  2VWF A;  2HBP A;  2DTH A;  5J26 A;  1TH7 A;  3LWI A;  2YDL A;  5J39 A;  1NJI R;  3E1S A;  3H8Z A;  3CCL A;  4GLK A;  3RMQ A;  5GAN 2;  1ZSZ C;  3RBB B;  4PFO A;  2AHJ B;  3FJ5 A;  4F7U F;  3OMG A;  3CC7 T;  3EG9 A;  2E6N A;  2J6F A;  1I0C A;  2JW4 A;  4ZGE B;  2EYW A;  2CDT A;  3TRE A;  2FRY A;  1KIK A;  2VV5 A;  4OB2 B;  3OW2 A;  2ED0 A;  4OMM A;  3HFO A;  1KK7 A;  2ROL A;  3MEV A;  4C8Q D;  5CKF A;  4X9C A;  1SHF A;  2AK5 A;  1GCP A;  1BIA A;  5IHI A;  2EWN A;  1IZ6 A;  4RKU E;  1QCN A;  2DXC A;  1TG0 A;  1VQP T;  4PNO A;  3EG3 A;  2HKN A;  4N0A C;  2J7I A;  3RMS A;  3I5R A;  4C0F A;  1VUB A;  4PL6 A;  3A1P A;  4AT1 B;  2LNV A;  3I56 A;  3BW1 A;  4Z88 A;  2KRN A;  2QA4 A;  4CC2 A;  1Q7Y R;  2OAU A;  3ME9 A;  2QQS A;  2WSF E;  3TCJ A;  2QAS A;  3V7C A;  2ABL A;  2DET A;  1R0C B;  3OYF A;  4NOY A;  4XK8 E;  1BU1 A;  5GMK i;  2L2P A;  2DVE A;  2MI6 A;  3REB B;  4RCB A;  4ELY C;  2ECZ A;  3CCQ T;  3CC2 Q;  2XKO C;  3HTR A;  1BBZ A;  2E3I A;  2QXF A;  2FL7 A;  4AFU C;  1RAI B;  3M0R A;  2J06 A;  5IAY A;  1PHT A;  2R5A A;  5LJ5 h;  1WQ7 A;  1OU8 A;  4L6V 5;  1QP3 A;  2OTJ Q;  2YSQ A;  2LNH B;  4ZTF A;  4L59 A;  1IRE B;  3TEE A;  3VU3 C;  3H6Z A;  5KCO A;  3RR6 A;  5KYY A;  2ZPG B;  5LJ3 j;  1M8V A;  2JNG A;  4BAC A;  3QII A;  2HQH A;  3M0U A;  3OYY A;  2RQU A;  3C4S A;  3G71 A;  2F2X A;  1AZG B;  2KVQ G;  1M1F A;  1YIT T;  4F7U B;  4ZGD B;  1Q82 R;  2RQR A;  2GF7 A;  1NJI U;  1M5Q 1;  3CCL T;  1WJQ A;  1N6A A;  4C92 F;  4DBH A;  1D1B A;  2ENM A;  1G3T A;  1VQK T;  4XTV A;  5GAM g;  4PJJ A;  1Q95 G;  2RPN A;  1N8R U;  3NGP A;  1VQ5 T;  1K8A C;  2EBP A;  3CMA Q;  3I55 Q;  1M3C A;  5KYX B;  3WXM B;  4E7K A;  1V1C A;  1JJ2 A;  5CKD A;  1ABO A;  3M55 A;  1KFZ A;  1JBM A;  3JSC A;  2VGM A;  2YRD A;  2NUZ A;  2M02 A;  3OW2 S;  3L2V A;  2DL3 A;  3G4S Q;  4M78 E;  3JCM g;  4JZ3 A;  3RDV A;  3TSZ A;  3EGX A;  5FRM A;  2YLC A;  5KE2 A;  3EH1 A;  3L2R A;  2BE7 D;  2HL5 C;  4J6Y A;  1PD1 A;  2ATC B;  2EQJ A;  4NL3 A;  1N27 A;  1OQK A;  4JRI A;  4E7Z A;  1NLO C;  4XTZ A;  2XDB A;  2CT4 A;  1VQ8 A;  4OB0 B;  2DL8 A;  3GP8 A;  2MIO A;  3A8L B;  2RF0 A;  3X24 B;  1GBQ A;  3FIF A;  3MEA A;  4ZN1 A;  4KUI A;  4OGC A;  1VQO Q;  3INZ A;  2CSI A;  4M78 C;  2DAQ A;  1PG5 B;  2V8I A;  4BDY A;  2F5K A;  4WCI A;  3G6E T;  4C92 D;  1IGU A;  4PJO A;  3QJY A;  4A4H A;  4FW2 A;  2X4W A;  4ZGJ B;  3CPW A;  2L3P A;  2KXC A;  4M77 E;  3VS2 A;  1EIF A;  1WJS A;  3HL8 A;  2K2M A;  4EMK A;  4MDW A;  4PLI A;  4A53 A;  1NYF A;  3RIR A;  2LC4 A;  3OMC A;  4NL2 A;  4KGZ B;  3QYH B;  4IUP A;  2KK4 A;  5CQY A;  3MPU B;  2ZAE A;  3QKJ A;  3E19 A;  3FC3 A;  1YNZ A;  4JZ4 A;  2LMJ A;  1VQ6 A;  2QQB A;  3U23 A;  2QEX Q;  3VS6 A;  4M77 C;  4C92 B;  3G71 T;  2A36 A;  1FYN A;  1Q82 U;  3UAT A;  2XD0 A;  4F14 A;  1G83 A;  2DZ9 A;  3P8D A;  5I11 A;  1PCX A;  1Q86 R;  1X43 A;  2BZX A;  1D1A A;  1MV3 A;  1M8M A;  2HD0 A;  4ME7 A;  2HAX A;  1FMK A;  2ROT A;  1HYO A;  2HCK A;  4NS5 A;  4XTW A;  3ASK A;  3EG1 A;  3L1A A;  1X27 A;  1M1K R;  1SG5 A;  2A28 A;  3CCJ A;  2FPD A;  2DYB A;  2CS7 A;  2Z0W A;  5GAN 3;  4HCZ A;  2LQK A;  3OS0 A;  4A4G A;  5LJ5 f;  4R56 A;  1OOT A;  3P8B B;  3HPW A;  4PFZ A;  2PTK A;  1W1F A;  1FWZ A;  2LCL A;  4N4H A;  2WSE E;  1JJ2 S;  2Y4Y A;  1Q81 U;  4LDW A;  5GAM h;  4C8Q E;  5I2S A;  2RHZ A;  3EG0 A;  1KC8 C;  4MMK A;  1VQ8 T;  1MMA A;  2RQT A;  1BCM A;  2K2V A;  1K76 A;  5CK9 A;  3M9Q A;  3OYA A;  3EG9 B;  1RAG B;  2IPO B;  1NEB A;  2QYZ A;  3NTI A;  2E12 A;  1C1A A;  1WIE A;  2PUK B;  3I9Q A;  1JO8 A;  1ZSG A;  2FG0 A;  2FO0 A;  3JCM W;  1B34 B;  3JCM h;  1GXI E;  1M3A A;  4C8Q C;  1N5Z A;  3FB9 A;  1WHJ A;  1VQL A;  4LN2 A;  1W2B A;  2ZPE B;  1OUL A;  3JCM X;  3QSU A;  4ATO A;  1OI1 A;  4AG2 C;  2RO0 A;  3CPW S;  2JTF A;  2QK0 A;  1YP5 A;  2CYZ B;  4F7U E;  2QQA A;  4L5G A;  4RCC A;  4XQ3 A;  1ABQ A;  2JZ2 A;  1YJ9 Q;  1PNJ A;  3O5Z A;  3T9N A;  1BIB A;  3CBP A;  1WHL A;  1QVG P;  2GGR A;  2MPX C;  2O4X B;  1HD3 A;  2NYS A;  4J9F A;  3H0H A;  4FCY A;  3JCM Q;  2DF6 A;  5GAN d;  1RI9 A;  1Q86 U;  4LUD A;  2K5I A;  3GOX A;  2ZGW A;  4CC3 A;  4FT2 A;  1QCF A;  1GBR A;  4BE0 A;  1RL2 A;  2MOX A;  4K11 A;  3OYJ A;  4DEX A;  1WYX A;  5HK0 A;  4PJO F;  3UPU A;  1GCQ C;  2X3W D;  1M1K U;  4JLI A;  2EKO A;  1G3W A;  1WZO A;  1YJN A;  1MNE A;  1YBY A;  5KYX A;  1T0J A;  3M4G A;  3A8O B;  2OI3 A;  3M53 A;  4FT4 A;  2RHY A;  2XU8 A;  4OMQ A;  4HA8 A;  2FZG B;  2JTE A;  1PSF A;  1T0H A;  1TTH B;  5KYY B;  3NTH A;  2XMF A;  2LJ3 A;  1QQJ A;  1I4K 1;  4J7I A;  4KRT A;  4ZNX A;  3CCV Q;  2CP3 A;  3CC7 Q;  1VQN Q;  2PZ1 A;  1WNL A;  1WX6 A;  3SWN B;  4E6R A;  1GRI A;  5GAO l;  1YJW A;  2EGC A;  2E3H A;  2V8J A;  3CCU A;  1IHV A;  1PSE A;  1KQ1 A;  4DBF A;  9ATC B;  2KRM A;  2OTL A;  1N9R A;  1RI0 A;  3JCM b;  1YIJ Q;  3EH2 A;  1VQM T;  2YHT A;  2P0P A;  1TUG B;  1EZZ B;  1VQP Q;  1XTD A;  2DBM A;  3JCM P;  1G3S A;  2O2O A;  1QVF P;  3L42 A;  2HEQ A;  1VQL T;  2XHC A;  1D0Y A;  4IIO A;  3FLG A;  5CKE A;  2DL4 A;  2O9S A;  2YRC A;  4J7F A;  3OYC A;  1FX7 A;  2GTO A;  3M0S A;  1BI0 A;  2DA9 A;  4C92 E;  1S72 A;  3EGX B;  4OMF B;  5GAO m;  1YHQ A;  1AVZ C;  3CBM A;  2MMP A;  1UGV A;  5FRO A;  3OYD A;  1VQ4 A;  1W2B S;  2DXB A;  3DB4 A;  2DKG A;  2P84 A;  1XQH A;  4BY6 B;  1MV0 B;  2EQK A;  3OSS C;  3PFS A;  5GAM f;  3LWH A;  5L8R E;  2HQX A;  3KBG A;  5CKB A;  3C12 A;  2NWM A;  1RAE B;  3CCS Q;  1K9M C;  5LJ3 d;  2PQW A;  3VYG A;  1H92 A;  2G3R A;  2EKH A;  4BE1 A;  1ZA1 B;  2CUD A;  4BDZ A;  1LNX A;  4IIM A;  2BTT A;  5AT1 B;  3GIB A;  4JLG A;  4N4I A;  2HKQ B;  3MJX A;  2LJ1 A;  1YJN T;  1UGS B;  3JCM f;  4E7I A;  4OGE A;  3CME Q;  1J3T A;  2VVK A;  4A54 A;  2GFA A;  3FRN A;  4JRK A;  5D7U A;  4LUE A;  2H8H A;  4MDX A;  1AHJ B;  3R6O A;  2DE0 X;  4RTW A;  1M90 R;  1SKU B;  3CCM A;  3KFV A;  4RTU A;  1SHG A;  4ZTJ A;  3L2U A;  1YIT Q;  3VRY A;  3MKD A;  5KYU A;  3LH5 A;  4IUR A;  5C6S A;  4DOV A;  4FYY B;  2WAC A;  2EYZ A;  1TOV A;  2IG0 A;  1YJW T;  2FZK B;  3QHS A;  4C5I A;  2RA2 A;  2KRO A;  2K4Y A;  3VJP A;  3CCU T;  4KGX B;  1SRM A;  3OYG A;  3C94 A;  1VQK A;  3M4Y A;  2PU9 B;  7AT1 B;  1RAF B;  2CT3 A;  2OTL T;  1C6V X;  1ZHI A;  2EYQ A;  5FU6 B;  1N8R R;  3CCE A;  2A08 A;  3MEU A;  4M7D C;  5GAN g;  1VQ5 A;  2VYT A;  1R0B G;  1B34 A;  4J9E A;  4ELZ C;  2L89 A;  4ZN3 A;  4J9H A;  1UTI A;  4OVA A;  2RJC A;  1TS9 A;  2RI3 A;  2WSC E;  2PVO B;  2V1Q A;  2YUP A;  3QO3 A;  4AFQ C;  3QPH A;  3MP8 A;  3H9N A;  2R57 A;  1S72 T;  1WXB A;  3I56 Q;  4B9X A;  1YHQ T;  4MZT A;  2OJ2 A;  2QA4 Q;  1SRL A;  4QVZ A;  1WFW A;  5CAI A;  1VQ4 T;  5GAN 5;  2CZ7 B;  1BYM A;  2W10 A;  3E2U A;  2E41 A;  4IKF A;  2L3R A;  1LVK A;  2O4X A;  4M4Z A;  1IGQ A;  1M4Z A;  3HRS A;  1NE8 A;  1KD1 C;  2QGG A;  5GAO r;  2XDP A;  2DRK A;  3G6E A;  3QZ9 B;  1D3B B;  1MMD A;  2P4R A;  1VIF A;  3EFO B;  5GMK e;  2EGE A;  2RI2 A;  1IXD A;  1A0N B;  2CH4 A;  4RTT A;  4J9B A;  4RMO A;  4RTY A;  2EYY A;  1R77 A;  1WI7 A;  2RMO A;  4KH0 B;  2DJZ A;  2EYX A;  1BKB A;  3OW2 P;  2YLB A;  1M90 U;  4BI3 A;  4E47 A;  1G5V A;  4PJN A;  2G6F X;  4IUV A;  3SHW A;  3CCM T;  1RAA B;  2P0K A;  4UC4 A;  3LX7 A;  3PE0 A;  1KQ2 A;  1QP2 A;  1VQ9 A;  3A8M B;  1UE9 A;  5CKH A;  3CBO A;  5ECA A;  2MWO A;  3V8K A;  4JS5 A;  4M75 G;  2F69 A;  5GAM j;  2GTJ A;  3MEW A;  2PUO B;  1WHM A;  2NLU A;  2BE9 B;  2LRQ A;  3RKY A;  4M75 B;  2L0A A;  1SSF A;  4B9W A;  2O88 A;  2M0Y A;  3SWN A;  2YUO A;  3X28 B;  3NHN A;  4DQ2 A;  3OYM A;  3H0F A;  2OTJ A;  1SSH A;  2RH2 A;  2VXE A;  2K5F A;  2M51 A;  5FU7 C;  3M57 A;  3CCE T;  2JM9 A;  4A63 B;  5D6W A;  1NEG A;  1KHI A;  3EAE A;  3CD6 A;  5LJ3 g;  4HKE A;  3VS5 A;  5I2M A;  1B07 A;  4EDU A;  2M1H A;  2DIG A;  3OQ5 A;  1OEB A;  2DL7 A;  2LT4 A;  3PIO A;  4LD9 K;  1U06 A;  1WDX A;  2F5T X;  1LOJ A;  3LYI A;  3CCR Q;  5IXF A;  8AT1 B;  2W0Z A;  1Q81 R;  2KDS A;  4Z02 A;  4PJO E;  3JV3 A;  1NM7 A;  5CIU A;  4N4G A;  2CP6 A;  3OYL A;  5CCA A;  5A0D A;  3CMA A;  2GBQ A;  2HMA A;  5GAN h;  1O9S A;  5KYN A;  4C0D B;  3SB2 A;  1YCS B;  5FWC A;  4FYX B;  1WQW A;  2LQN A;  4F17 A;  4QVC A;  1QMC A;  1UFF A;  3DLM A;  3D7S B;  2RM4 A;  3HKS A;  1WPY A;  4Z8A A;  4J9C A;  4XAX B;  1K73 R;  2DPP B;  4M7A D;  5DY9 A;  1ACM B;  3EHR A;  4PJO C;  2DJQ A;  1B7T A;  1HXD A;  2CZ1 B;  2DYI A;  6AT1 B;  1PD0 A;  1M2O A;  3FJP A;  4E7H A;  1RAC B;  2QGF B;  1YFN A;  5CQX A;  3E9G A;  1VQ6 Q;  4X9D A;  4EMK C;  2ESW A;  4FL6 A;  1YI2 A;  2A3L A;  1H64 1;  1JJ2 P;  4FSS A;  1O75 A;  3GLX A;  3REA B;  2K57 A;  1VQ9 T;  3CC2 T;  2EFI A;  5GAN e;  3RES A;  3RKW A;  4M7A G;  5GAO q;  1E6H A;  2RN8 A;  2V26 A;  2E10 A;  1QWE A;  2DIQ A;  3ZBD A;  3PVL A;  4E7L A;  3QZ5 B;  4M7A B;  1KHC A;  3S3O A;  2K3X A;  1WXT A;  4OF1 A;  2DVJ A;  5AYF A;  4RTZ A;  3CC4 Q;  1PC0 A;  4JRP A;  3CCJ Q;  2OTJ T;  4KH1 B;  4FM4 B;  2FHD A;  2RD1 A;  3HFN A;  2VGN A;  1W6X A;  4KBM B;  3CD6 T;  4PFP A;  3VUB A;  3DB3 A;  1X6O A;  2EQI A;  4LDX A;  1OX8 A;  3L2W A;  2QEX A;  3PGG A;  2D6F A;  2AT1 B;  2DEQ A;  3CPW P;  2RHX A;  1XJW B;  1SF9 A;  2QI2 A;  4HCK A;  5KYU B;  2KY9 A;  4MZP A;  3JB9 G;  4HVU A;  1ZQ1 A;  4PLL A;  1GL5 A;  1AT1 B;  4E7J A;  5GJV B;  2KRS A;  3JB9 I;  1NJI C;  4HVV A;  1NLP C;  3CMA T;  1QCO A;  2JVV A;  3I55 T;  2HZY A;  2RB6 A;  2JN0 A;  2KYM A;  3HP9 A;  1W70 A;  5LJ3 h;  2XG8 D;  3PMI A;  2CKK A;  2C0T A;  3GNF B;  1VYT A;  3SDZ A;  5GJW B;  3VRZ A;  3G4S T;  1ZSZ B;  1VQL Q;  1D3B A;  1OPK A;  1K73 U;  2K9G A;  1WGS A;  3EFO A;  1VQM A;  4HVW A;  1OZ2 A;  1NPP A;  2E5Q A;  3OBY A;  5FRN A;  4BE2 A;  3JCM J;  1Y96 B;  2R58 A;  1K4U S;  2CUB A;  2L3S A;  2IVW A;  2DIL A;  5FWB A;  1YI2 T;  1VQO T;  2YWW A;  3M54 A;  2LTO A;  2RQV A;  4J6X A;  1QW1 A;  2GQI A;  5GAO p;  2VUB A;  1Q7Y C;  3EG2 A;  4CC4 B;  4LDY A;  4JUV A;  4GLM A;  5LJ3 e;  4CI0 C;  2D1X A;  2XDD A;  2KQW A;  4PK4 A;  3H0I A;  3OYB A;  1M27 C;  2VKN A;  1K0S A;  1AWW A;  4J83 A;  4M75 A;  2DXT A;  5GAN f;  2DM1 A;  2JT4 A;  3MP1 A;  2X3X D;  1M3B A;  2RQW A;  1YJN Q;  2BZ8 A;  3QXE B;  1CSK A;  2LQW A;  3DKM A;  3N5B B;  1WA7 A;  3RKX A;  2YUQ A;  4O5V A;  1JXM A;  2QEX T;  4DEY A;  4DBQ A;  5CR2 A;  1GCQ A;  3GF5 A;  2KNB B;  2RJD A;  1VQ7 A;  1VYV A;  2VB6 A;  2CP2 A;  2FPE A;  2A0F B;  2E5K A;  4AFZ C;  3A8G B;  1W2B P;  3X20 B;  2C06 A;  2Y4X A;  2EPD A;  4F04 B;  3URG A;  2DL5 A;  1MND A;  1K8A R;  2XK0 A;  2DD4 A;  1Q82 C;  1QVP A;  2X9H A;  2L8D A;  1P92 A;  2LJ0 A;  3OY9 A;  2ZPI B;  2L5Q A;  2MAM A;  2DMO A;  1QWF A;  4R0K A;  1NZ9 A;  1RAD B;  2QTX A;  3LW5 E;  3G7Z A;  4ANJ A;  4EMG A;  5D6Y A;  1V29 B;  5A0G A;  2GFU A;  2R5M A;  1Y7X A;  1VOM A;  5LL6 S;  2GCX A;  4A4K A;  1ZBX A;  4XU3 A;  1K9A A;  1CKA A;  3VS3 A;  4KGV B;  3V8J A;  3VUZ A;  1S72 Q;  4QW2 A;  2X51 A;  2K3Y A; 
#chains in the Genus database with same CATH homology
 4B9X A;  1YHQ T;  4MZT A;  4OP0 A;  3PMT A;  3L2R A;  4CRI A;  1KD1 U;  1BI3 A;  5LJ5 j;  4J6Y A;  4HT9 A;  3EFS A;  3M59 A;  4QVZ A;  5CAI A;  2EQJ A;  4NL3 A;  1VQ4 T;  1N27 A;  3JRZ A;  4JRI A;  5J3B A;  5GAN 5;  1U8R A;  4XTZ A;  2CZ7 B;  2XDB A;  4M7D B;  4YTL A;  1BYM A;  2FYK A;  1K9M U;  3KXT A;  1VQ8 A;  4OB0 B;  2X4X A;  2E41 A;  3PNW C;  3GP8 A;  4IKF A;  2LQ8 A;  3A8L B;  4HCB A;  2L3R A;  3X24 B;  3FIF A;  3MEA A;  4C8Q A;  4ZN1 A;  3OYE A;  2O4X A;  2DTI A;  2BUD A;  4KUI A;  4OGC A;  3INZ A;  4M78 C;  2DAQ A;  1UB4 A;  2V8I A;  1M4Z A;  3V8L A;  2PVG B;  2Y90 A;  3HRS A;  3OYI A;  2F5K A;  1NE8 A;  3GNG A;  4C92 D;  3G6E T;  4PJO A;  3QJY A;  5D6X A;  1KD1 C;  2K5L A;  4A4H A;  2B8A A;  5GAO r;  3HRU A;  2V8K A;  4M75 E;  4C0G A;  3PIP A;  2XDP A;  1UEB A;  2X4W A;  3F70 A;  2FB7 A;  4ZGJ B;  3CPW A;  3G6E A;  3QZ9 B;  2DO3 A;  1D3B B;  2H3J A;  1XOV A;  4M77 E;  4KUL A;  4M7A A;  4JDS A;  1EIF A;  1VIF A;  4M78 G;  1WJS A;  4C92 C;  3HL8 A;  4EMK A;  2KAF A;  4MDW A;  2X35 A;  2RI2 A;  4PLI A;  5LJ3 f;  4A53 A;  5GMK e;  1VIE A;  2LC4 A;  4QQ6 A;  2MF2 A;  3RIR A;  4LDV A;  5GAM e;  4HT8 A;  3OMC A;  4NL2 A;  4RMO A;  3QYH B;  2EJF A;  4IUP A;  5M9O A;  2KK4 A;  4M78 B;  3LLR A;  5CQY A;  4M77 D;  5IN1 A;  4A4F A;  1WJR A;  3GPL A;  1VQ6 T;  3OYK A;  3LH0 A;  3OS1 A;  2DJZ A;  1BKB A;  3QKJ A;  4JRQ A;  1U1T A;  2RK1 A;  2YLB A;  3E19 A;  3L2Q A;  1M90 U;  3BFM A;  4M75 C;  2DD5 A;  4BI3 A;  3FC3 A;  5KE3 A;  1MHN A;  4E47 A;  1YJ9 A;  2XI9 A;  1G5V A;  4IUV A;  1M1G A;  3CCM T;  1VQ6 A;  2QQB A;  2P0K A;  4UC4 A;  4F7U A;  3LX7 A;  1VQ7 T;  4M77 C;  1KQ2 A;  3JB9 H;  2RHU A;  1QP2 A;  4C92 B;  3G71 T;  4M78 F;  1VQ9 A;  3A8M B;  1Q82 U;  4JS4 A;  5CKH A;  4Y91 A;  2XD0 A;  3M56 A;  2DZ9 A;  3P8D A;  3J7A F;  2LCC A;  2O01 E;  2EJG A;  3CBO A;  4PKC C;  3JCM e;  2MWO A;  3V8K A;  5GMK j;  4JS5 A;  4M75 G;  3FEO A;  2F69 A;  5GAM j;  1QVF A;  3Q1J A;  4OB1 B;  3ZFJ A;  3MEW A;  2PUO B;  2HD0 A;  1K8A U;  2NLU A;  3P8H A;  4ME7 A;  2LVM A;  4O6J A;  3TU4 K;  2E70 A;  2LRQ A;  2HAX A;  4M77 G;  3RKY A;  3CC4 T;  2EQU A;  3X25 B;  3CCJ T;  4M75 B;  4B9W A;  1SSF A;  4XU0 A;  3SWN A;  3X28 B;  1Q86 C;  3QUI A;  4NS5 A;  2M16 A;  2RJF A;  3CPF A;  4XTW A;  4DQ2 A;  3ASK A;  3OYM A;  2OTJ A;  3OB9 A;  3L1A A;  3MCA B;  4M77 B;  3HHT B;  3CME A;  2RH2 A;  3CCJ A;  2VXE A;  3VYH B;  2K5F A;  5FU7 C;  4XTX A;  3M57 A;  1I5L A;  3CCE T;  2CS7 A;  5D6W A;  2DXU A;  5DLQ E;  1KG1 A;  5GAN 3;  4HCZ A;  2LQK A;  1KHI A;  3MHX A;  3J81 E;  3EAE A;  4HCC A;  3CD6 A;  4M75 F;  3JCM c;  5LJ3 g;  3BDU A;  3OS0 A;  1M1K C;  4HKE A;  4A4G A;  5LJ5 f;  3HRT A;  4R56 A;  3P8B B;  3HPW A;  4QQD A;  5I2M A;  1FWZ A;  2LCL A;  4C5H A;  3QDR B;  3QBY A;  4M77 F;  4N4H A;  4FU6 A;  2M1H A;  2DIG A;  2WSE E;  3OQ5 A;  3FDR A;  4MZM A;  4D6W A;  4EDU A;  4BUG A;  3VV0 A;  2LT4 A;  2MWP A;  3J80 E;  4C0D C;  1QVG S;  1JJ2 S;  3PIO A;  3CCV T;  2Y4Y A;  3S3N A;  4LD9 K;  2RK2 A;  2F5T X;  1LOJ A;  3OSV A;  5A0L A;  1Q81 U;  4LDW A;  3LGF A;  5GMK h;  2EQM A;  3LYI A;  1KQS A;  4M7D A;  1VQN T;  5GAM h;  1Y96 A;  2LX9 A;  5FU7 B;  4BD3 A;  3S3M A;  4C8Q E;  5I2S A;  1KQS S;  2RHZ A;  3CCV A;  4XU2 A;  2LDM A;  1KC8 C;  4MMK A;  1VQ8 T;  4OB3 B;  2HQE A;  3CC7 A;  2E1H A;  3LGL A;  3OBW A;  5KCH A;  4BDY A;  1VQN A;  2KDS A;  4Z02 A;  4PJO E;  1M9S A;  4WF2 A;  4M78 D;  3A8H B;  2K2V A;  5CIU A;  2LT1 A;  2ZPH B;  4N4G A;  5CK9 A;  3OYL A;  3M9Q A;  5CCA A;  5A0D A;  3OYA A;  4C5G A;  3CMA A;  4V2S A;  4N0A A;  4BB7 A;  5GMK l;  3NTI A;  2JOY A;  3M58 A;  1O9S A;  1MGQ A;  5GAN h;  1YIJ T;  1Q81 C;  2E12 A;  4C0D B;  2PUK B;  2BKD N;  3EFR A;  1UGP B;  3SB2 A;  4M7A E;  4PJO D;  1WQW A;  3V7S A;  4EPC A;  4MML A;  3JCM W;  1OYX A;  4KT0 E;  2EAY A;  5CVI A;  3UT1 A;  3L2Z A;  1B34 B;  3JCM h;  3DLM A;  2ZZD A;  3SFM A;  5GAN 7;  1YIJ A;  2RM4 A;  1GXI E;  4Y28 E;  3HKS A;  4C8Q C;  2I2L A;  2D0Q B;  1G3Y A;  1WPY A;  3FB9 A;  1VQP A;  4XAX B;  5HKC A;  3CXC A;  2DPP B;  1Y71 A;  1VQL A;  4BI8 B;  5DY9 A;  4QQG A;  4M7A D;  5HK3 A;  2X4J A;  2ZPE B;  1W2B A;  1UGQ B;  4PJO C;  4J6W A;  3CEY A;  3JCM X;  4XTU A;  3QSU A;  4ATO A;  5GAN 4;  1OI1 A;  3QG1 A;  3CXC S;  2RI5 A;  4Q5W A;  2RO0 A;  1HXD A;  2XIC A;  3MO8 A;  3CPW S;  1X75 C;  2CZ1 B;  2JTF A;  3MET A;  5LJ5 g;  4FIB A;  1R8O B;  4X34 A;  1K73 C;  4M75 D;  5GAM d;  2CYZ B;  4F7U E;  2QQA A;  4L5G A;  4RCC A;  4C8Q G;  3MP6 A;  2P4T A;  4XQ3 A;  3X26 B;  2JZ2 A;  3JB9 J;  4M7A C;  1X01 A;  3FJP A;  4E7H A;  2YRV A;  5CQX A;  5GMK m;  3E9G A;  4XTY A;  3T9N A;  4X9D A;  4EMK C;  1BIB A;  3CBP A;  4C92 A;  1YJ9 T;  4FL6 A;  4PJO G;  4J5Y A;  1YI2 A;  2A3L A;  1H64 1;  2M0O A;  1UGR B;  4C8Q B;  4QVC A;  1O75 A;  2O4X B;  3GLX A;  2K57 A;  1XNI A;  1N9S A;  1I8F A;  3CCS T;  1VQ9 T;  2BIV A;  3CC2 T;  2EFI A;  4PJO B;  3DLL A;  3JCM Q;  5GAN d;  5GAN e;  3HSB A;  3RES A;  5CO7 A;  3RKW A;  1Q86 U;  4M7A G;  2A7Y A;  2K5I A;  3UWN A;  3GOX A;  5GAO q;  4RG8 A;  3CCQ A;  3AHU A;  2ZGW A;  4KUD K;  2E10 A;  4J8O A;  3CCS A;  1LJO A;  4II1 A;  2JUF A;  2DIQ A;  4FT2 A;  4XU1 A;  3CC2 A;  3ZBD A;  3JCM d;  4BE0 A;  1RL2 A;  4E7L A;  3QZ5 B;  4C8Q F;  3OS5 A;  2GQV A;  4M7A B;  3OA6 A;  3KUF A;  1KHC A;  3S3O A;  3OYJ A;  4EMK B;  2K3X A;  3QJ6 A;  1Y07 A;  4FSX A;  4OF1 A;  5AYF A;  2DTO A;  2ZPF B;  4PJO F;  5HK0 A;  3UPU A;  3PTA A;  4JRP A;  2OTJ T;  2ZPB B;  1QVF S;  1M1K U;  3A5Z B;  3CME T;  4JLI A;  1W4S A;  1G3W A;  2EKO A;  2FVU A;  2JTM A;  4FM4 B;  2FHD A;  2X4Y A;  1YJN A;  2RD1 A;  3HFN A;  2VGN A;  2QQR A;  3UDC A;  4F7U G;  4KBM B;  1YBY A;  5IT9 E;  1DJ7 B;  3CD6 T;  4M7A F;  3VUB A;  3DB3 A;  1X6O A;  3M4G A;  5GAN j;  3SWN C;  2EIF A;  4LDX A;  4A4E A;  3L2W A;  3A8O B;  3M53 A;  4FT4 A;  2RHY A;  2XU8 A;  4IUT A;  2QEX A;  4HA8 A;  1PSF A;  3E9F A;  3PGG A;  2D6F A;  5HY6 A;  4M7D E;  5DM7 R;  2DEQ A;  2RHX A;  3NTH A;  1KC8 U;  2XID A;  1YIT A;  2KSS A;  1I4K 1;  4J7I A;  2HBP A;  2DTH A;  5J26 A;  1TH7 A;  4RG2 A;  3C95 A;  3LWI A;  4DA4 A;  5J39 A;  2QI2 A;  3E1S A;  3H8Z A;  3CCL A;  3RER A;  2KY9 A;  4MZP A;  3JB9 G;  3NTK A;  4GLK A;  3RMQ A;  4C0Z A;  5GAN 2;  2AHJ B;  4F7U F;  5LJ5 e;  1ZQ1 A;  3OMG A;  3CC7 T;  1WNL A;  4PLL A;  2E6N A;  3SWN B;  4E7J A;  3JB9 I;  2VC8 A;  5GAO l;  1YJW A;  1NJI C;  3CMA T;  2V8J A;  2JVV A;  3I55 T;  4ZGE B;  3CCU A;  1PSE A;  3TRE A;  3SD4 A;  1KQ1 A;  2RB6 A;  1OZ3 A;  2VV5 A;  2JN0 A;  4OB2 B;  3OW2 A;  3HP9 A;  2OTL A;  5LJ3 h;  3HFO A;  4EMH A;  2XG8 D;  1N9R A;  1RI0 A;  2CKK A;  3PMI A;  3MEV A;  3JCM b;  3M5A A;  3GNF B;  1VQM T;  2YHT A;  3SDZ A;  5CKF A;  4C8Q D;  4X9C A;  4R55 A;  3I55 A;  2DZC A;  2P0P A;  1HK9 A;  1BIA A;  4VUB A;  3G4S T;  2EWN A;  4BY6 C;  1IZ6 A;  1XTD A;  3JB9 F;  4RKU E;  3JCM P;  1D3B A;  1G3S A;  2DXC A;  1K73 U;  1VQP T;  3L42 A;  1WGS A;  4PNO A;  1VQL T;  1VQM A;  4N0A C;  5A0G A;  3RMS A;  2XHC A;  3FLG A;  5CKE A;  3I56 T;  1OZ2 A;  3G4S A;  1NPP A;  2E5Q A;  1Q7Y U;  1YCY A;  4J7F A;  3OYC A;  3CCR A;  1FX7 A;  3OBY A;  4C0F A;  2QA4 T;  5FRN A;  1BI0 A;  1VUB A;  4PL6 A;  4C92 E;  4BE2 A;  1S72 A;  2RJE A;  4M78 A;  3OS2 A;  3JCM J;  4OMF B;  5GAO m;  1YHQ A;  1Y96 B;  3NFC A;  2ZCF B;  4IUQ A;  1JB0 E;  2LNV A;  2PVD B;  3CBM A;  2MMP A;  2R58 A;  3WVD B;  3I56 A;  4M7D C;  3BW1 A;  3BY7 A;  5FRO A;  3OYD A;  2IVW A;  2QA4 A;  1VQ4 A;  2DK3 A;  2OAU A;  3ME9 A;  2DXB A;  5EG2 A;  1W2B S;  3DB4 A;  2DKG A;  2QQS A;  2E65 A;  5GAN 6;  1I81 A;  2WSF E;  3TCJ A;  1YI2 T;  1XQH A;  3V7C A;  1VQO T;  4BY6 B;  3M54 A;  4GY5 A;  2LTO A;  4JJN K;  4J6X A;  1QW1 A;  4C5E A;  3OYF A;  2EQK A;  4NOY A;  3OSS C;  3PFS A;  4XK8 E;  5GAO p;  5GMK i;  5GAM f;  5KH6 A;  2VUB A;  3JAM E;  3LWH A;  1Q7Y C;  4M7D F;  2DVE A;  2MI6 A;  5L8R E;  2HQX A;  5FLX E;  3KBG A;  2QDY B;  5CKB A;  4RCB A;  3C12 A;  4ELY C;  4LDY A;  1VQO A;  4JUV A;  1K9M C;  3VKI A;  5LJ3 d;  3CCQ T;  2PQW A;  5LJ3 e;  4CI0 C;  2XKO C;  3VYG A;  2G3R A;  4BE1 A;  2XDD A;  3S6W A;  5I21 A;  2KQW A;  2QXF A;  4BDZ A;  2FL7 A;  1LNX A;  3O8V A;  3OYB A;  4J83 A;  4M75 A;  2DXT A;  5IAY A;  5GAN f;  2R5A A;  2EJ9 A;  3MP1 A;  2E6Z A;  5LJ5 h;  1WQ7 A;  3GIB A;  4JLG A;  4N4I A;  5DLO A;  4L6V 5;  3V7R A;  2RHI A;  3QXE B;  1QP3 A;  4M77 A;  1YJN T;  1UGS B;  4C92 G;  2D9T A;  3OYH A;  3JCM f;  4E7I A;  4OGE A;  4ZTF A;  3DKM A;  4LDU A;  4L59 A;  3JB9 D;  3N5B B;  4A54 A;  3RKX A;  2GFA A;  1FXX A;  3FRN A;  4JRK A;  4BI4 A;  4O5V A;  1IRE B;  3TEE A;  3VU3 C;  3H6Z A;  4P5N A;  4MDX A;  1AHJ B;  3R6O A;  5KCO A;  4LD6 A;  4QVD A;  2ZPG B;  2QEX T;  2VXF A;  5LJ3 j;  1M8V A;  2JNG A;  5CR2 A;  5A2Q E;  4BAC A;  3CCM A;  3JCM V;  3QII A;  1JRI A;  3OYY A;  3WVE B;  3GF5 A;  4ZTJ A;  2RJD A;  3L2U A;  1VQ7 A;  5GAN 8;  2E64 A;  3C4S A;  3G71 A;  5GAO n;  2HNI A;  2KVQ G;  1YIT T;  1M1F A;  1M90 C;  4F7U B;  4ZGD B;  4IUR A;  5FU6 C;  2GF7 A;  5C6S A;  1M5Q 1;  1NJI U;  3A8G B;  3CCL T;  1WJQ A;  1N6A A;  3X20 B;  4DOW A;  5C0M A;  4IUU A;  4C92 F;  2C06 A;  2Y4X A;  3OYN A;  1U1S A;  3URG A;  4DOV A;  1G3T A;  1VQK T;  2WAC A;  2CGH A;  2XK0 A;  2DD4 A;  4XTV A;  1QVP A;  5GAM g;  1Q82 C;  2IG0 A;  3CC4 A;  2L8D A;  1YJW T;  1BI2 A;  1P92 A;  3OY9 A;  4M7D D;  3QHS A;  2ZPI B;  4C5I A;  2CZ6 B;  2RA2 A;  3VJP A;  2K4Y A;  2L5Q A;  1N8R U;  5LJ5 d;  2MAM A;  3CCU T;  3OYG A;  1NZ9 A;  3C94 A;  2QTX A;  1VQ5 T;  1BI1 A;  3M4Y A;  1VQK A;  2PU9 B;  3ZEH A;  1K8A C;  4TVR A;  3LW5 E;  2OTL T;  3G7Z A;  4EMG A;  3ER0 A;  5D6Y A;  1V29 B;  1ZHI A;  3BDL A;  2GFU A;  2P0Q A;  2R5M A;  1Y7X A;  1NPR A;  5LL6 S;  2EYQ A;  3QYG B;  5FU6 B;  2GCX A;  3WXM B;  3CCE A;  3MEU A;  4A4K A;  2M9U A;  4E7K A;  1JJ2 A;  5GAN g;  5CKD A;  1QVG A;  1ZBX A;  2VYT A;  1VQ5 A;  3M55 A;  4XU3 A;  3RUX A;  2CZ0 B;  1B34 A;  1JBM A;  4ELZ C;  2L89 A;  3JSC A;  2KMT A;  2VGM A;  4ZN3 A;  4OVA A;  2RJC A;  3OW2 S;  3L2V A;  3PT9 A;  2RI3 A;  1N8R C;  2WSC E;  2QQ9 A;  4M78 E;  1H3Z A;  3JCM g;  2PVO B;  3QO3 A;  3V8J A;  5FRM A;  3CCR T;  3VUZ A;  2YLC A;  4QW2 A;  3QPH A;  4M7D G;  3MP8 A;  5KE2 A;  2R57 A;  1S72 T;  2K3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...