3BW1A

Crystal structure of homomeric yeast lsm3 exhibiting novel octameric ring organisation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
86
Chain Sequence
HHMETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSAVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm3
publication title Crystal structure of Lsm3 octamer from Saccharomyces cerevisiae: implications for Lsm ring organisation and recruitment
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 86
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3bw1A00
4XU0A 3FJPA 4C8QD 5LJ5h 3JB9D 4EMKC 5GMKm 4PJOE 2E65A 4C92F 5GAN2 4M78G 4M78E 3V8LA 4C8QC 4PJOD 3JCMd 5GAN7 5GAMd 4F7UB 1H641 1B34A 3BFMA 3HSBA 5GAOq 1WQWA 2RB6A 5LJ3f 3V7CA 1JRIA 5GMKh 2YHTA 4DQ2A 4V2SA 3JCMc 1M8VA 5GAMj 4EMHA 5LJ5f 4QVCA 4A54A 3JB9H 3JB9J 3JB9I 4A53A 2DKGA 3M4GA 1U1SA 3SWNA 1KQ2A 4PJOA 2VXFA 1TH7A 4M75D 2HNIA 2EJFA 4JRKA 4EMKB 4M78A 4M7DE 1BIAA 4OP0A 2RA2A 4N0AA 2DZ9A 4HA8A 3JCMb 2RD1A 1HK9A 5GANf 3VU3C 5LJ3g 4M7DD 3HFNA 5GMKl 3FIFA 5LJ3h 4M77D 4MMLA 5GAMe 3JCMe 3SWNB 2K57A 4PJOB 2Y90A 4XTZA 3JCMW 4C8QF 2DTOA 1KQ1A 2DXTA 2VXEA 4M75A 5GAOn 4JRIA 4M7AG 4M7AE 3RKYA 3INZA 2JN0A 4QVDA 4PNOA 1YCYA 4M7DA 2YLCA 4M78D 5LJ5j 4M77A 1U1TA 3JCMf 4X9DA 3SWNC 5GANg 4MMKA 4PJOC 5GANh 4M75B 5GAOp 2EWNA 4M78C 5GAN8 3JCMX 4F7UF 4N0AC 5GMKi 3QHSA 3BY7A 5GMKj 4M7AA 1B34B 4M7DB 3AHUA 3RERA 1D3BA 4M77B 4XTXA 4C92G 4C92E 5GAOr 4EMGA 4HT9A 3L1AA 1N9SA 4M75C 3JCMQ 2E41A 3JCMg 5GAMg 3JCMV 2E10A 2YLBA 1MGQA 1Y96A 2CGHA 2FB7A 3JCMh 2RM4A 3EFSA 2DEQA 4XQ3A 1X01A 4M7AB 3RIRA 5LJ3d 4M7DC 1D3BB 4M77C 4M78B 3JB9F 5LJ5d 3FB9A 4F7UG 4XTWA 4WF2A 3L2ZA 5GAN6 5LJ3j 4J5YA 4XU1A 4M7AD 4PJOF 3RESA 4C92A 4J6XA 1Y96B 3BDUA 2I2LA 5GAN3 1LJOA 5GAMf 4M78F 4M7AC 2DVEA 2EAYA 3PGGA 4JLIA 4RCBA 5GAOl 2E1HA 4XTVA 3V8KA 3EFRA 3GIBA 3V7SA 3RUXA 4C8QG 1M5Q1 4C8QE 3JB9G 1N9RA 2E64A 5LJ3e 5GAOm 4M75F 3JCMJ 2DJZA 2EJGA 5GANj 4HT8A 1HXDA 5LJ5e 3QUIA 1LNXA 2QTXA 4NOYA 5DY9A 2DZCA 4PJOG 4C92D 4M7DF 5GAMh 4RCCA 2DTIA 4M77F 3BW1A 4C92C 2EJ9A 1WPYA 5I21A 4EMKA 1WNLA 4XTYA 5GMKe 4Y91A 4F7UE 1I5LA 3RKXA 1I4K1 2DTHA 5GANe 4C8QA 2FYKA 3V7RA 5CAIA 2DXUA 3HFOA 1LOJA 2VC8A 4JUVA 1I81A 3RKWA 4XU2A 4M7AF 4M75G 4M75E 4NL3A 4XTUA 3V8JA 3QO3A 5GANd 3SB2A 5GAN5 4X9CA 4M7DG 4J6YA 4M77G 4M77E 1I8FA 4C8QB 1BIBA 3JCMP 4C92B 4NL2A 4F7UA 1JBMA 1WQ7A 2ZGWA 5GAN4 5LJ5g 3QSUA 4J6WA 4XU3A
chains in the Genus database with same CATH superfamily
3VS5A 4EPCA 3L2VA 3M53A 2DJQA 5J39A 1D09B 1M1FA 3R6NA 1M1GA 2YHTA 3JCMc 3VRYA 2XDBA 2A3LA 4RKUE 5KCHA 4JJNK 1RAHB 4DBFA 4LUDA 3EAEA 1OPLA 1HK9A 4E47A 2E12A 1V76A 4MZTA 1MV3A 5GAMe 1K9MC 2DETA 1IZ6A 4XTZA 4O6JA 3JCMW 4M75A 1VQNA 5AT1B 4KGZB 3OYIA 2RJCA 3CCRA 6AT1B 1PHTA 3OS5A 3FEOA 1K73R 3A1PA 4OMLA 5GAN8 1ABOA 3BY7A 4AFSC 3MO8A 2QDLA 1WLPB 4Z89A 2CZ1B 5D6YA 1N8RR 1FYNA 1PKTA 2CGHA 1YNZA 2K7AA 2K4YA 1NPRA 3RIRA 2HBPA 1YJNQ 1GCPA 4F7UG 1AT1B 1VQ6A 3PFSA 2O2OA 1UGPB 2YUQA 5A0GA 3FRNA 2X4WA 5GAOl 4E2FB 3L42A 3NTKA 1PSFA 3PE0A 1M5Q1 4KUIA 2FZGB 5LJ3e 3S3MA 2EJGA 3RBBB 2X4JA 3LX7A 4JLGA 4RTWA 1WA7A 2GF7A 1S72A 2JXBA 2DD4A 2NWMA 4HCCA 3JCMJ 2RI5A 3BDLA 1UTIA 2M16A 3PMTA 1LOJA 1I81A 4KGXB 2P0QA 4MZMA 5CVIA 5KE2A 5EC7A 4X9CA 3CCLA 1PM3A 3MCAB 1KC8U 4F7UA 2V1QA 2AT1B 2OI3A 4XU3A 5LJ5h 5DM7R 8AT1B 2J6OA 4A4HA 4PJOE 2JS2A 1AZEA 2ATCB 5GMKh 1IHVA 2XG8D 1YN8A 3MJXA 4L5GA 4GLMA 9ATCB 2ZPHB 1WXUA 3OYLA 4PJLA 2JOYA 2RJEA 1W2BP 2VXFA 1M90R 1TWBA 3CCSA 2JVVA 4FL6A 1W2BS 1VUBA 3OS1A 3OYHA 1YBYA 2RQTA 3M0QA 3M55A 2K57A 1NYFA 2VXEA 4M7AG 4QVDA 1ABQA 1MMAA 3G1JA 1YWPA 4E7IA 4OB1B 4E7JA 4DOVA 2V8KA 4M78C 4J8OA 4FYWB 2HSEB 4N0AC 2KRMA 2A28A 1ZLMA 3X20B 1B34B 1JXOA 2LTOA 3AHUA 1MNDA 3EGDA 2JTMA 3L2RA 2KMTA 2OJ2A 2O9VA 2E10A 5FU6B 3OSVA 2A36A 1TTHB 4KBMB 2DO3A 4JPBW 3QYGB 2QDYB 2MAMA 2FG0A 2LCSA 3A8MB 2WACA 2E64A 2H3JA 3CMAA 3MP1A 4RG2A 2KE9A 3MEWA 3QUIA 4C0DB 1Q7YU 2KXDA 3A8OB 1Q86U 3QWYA 4C92C 1M9SA 4KULA 5FWCA 2ABLA 4OB2B 2X9HA 2IPOB 4F04B 3CCMA 4JZ3A 2X3XD 2V8IA 2EYYA 3GP8A 4LDWA 2QASA 3MHXA 2DL7A 3EGXA 1B07A 4FU6A 4XU0A 1H3ZA 3JB9D 4EMKC 2AKKA 4JJDA 2COWA 2CSQA 4FT4A 2VV5A 5GAN7 1QW1A 1QCFA 1RABB 1B34A 4E7KA 2GQVA 3OS0A 2AZVA 3CCEA 3LWIA 1AZGB 1K9AA 3UA6A 2KXCA 1X69A 2DPPB 1YFNA 5KYYB 3SFMA 3OW2A 2AIRB 3HFNA 1K1ZA 4M77D 4BY6C 1MNEA 1Q95G 1H3HA 3INZA 4PFPA 5C6SA 4OB0B 2EQUA 3RMSA 4KH0B 2RQRA 3CXCP 2ZPGB 1MUZA 3CXCS 4M77B 2FZCB 3G4SA 3L1AA 4M75C 4CC7A 4OGEA 2XDDA 1MGQA 3VS2A 1SKUB 2A08A 2VB6A 1UDLA 1NM7A 2DLPA 2JM8A 3FB9A 3BE3A 2IG0A 1YIJT 2JUFA 2M9UA 2VYTA 1VYTA 3L2UA 2FL7A 2DIQA 3QWXX 2GGRA 2LT4A 5CQYA 2LX7A 4J9GA 2PU9B 2XD0A 4LE9A 3CCQQ 1YP5A 1QWFA 5GANj 4ME7A 2DJZA 2DXBA 1FMWA 1QP2A 2DZCA 2QK0A 2X35A 1TUCA 3BW1A 1VQ8A 1RI9A 1FWZA 1RLPC 2E6ZA 5KYYA 5CAIA 3OSSC 1QCNA 3KFVA 4M7AF 4M75E 2HL3A 2HZYA 1MHNA 1BKBA 2RF0A 1BBZA 3RDVA 1VQ9A 1G5VA 2QEXA 1BIBA 2VWFA 2K2MA 1VQOA 4DA4A 3H8ZA 2PVDB 1VQ7T 5D6WA 4C8QD 2FVUA 4QQGA 3VS7A 2L5QA 3DLMA 4PJOD 3HRSA 5GAOq 1KC8C 2CT4A 2ECZA 5LJ5f 1VQMT 4PL6A 1RADB 5CR2A 1G83A 1TS9A 5IHIA 5KYWA 4BUGA 1YIJQ 5J3BA 4F16A 1KSWA 1SSHA 3ZFJA 3JCMe 4IIMA 4PJOB 3CC2T 1KHIA 1YIJA 3TSWA 1Q82C 3RKYA 3QXEB 4E7SA 2RQVA 4R55A 2MI6A 3E19A 4CC3A 5CCAA 2HMAA 2ZPEB 1EIFA 5KYUB 3H9NA 2LQ8A 3T9NA 2LP5A 2O9SA 3PTAA 2QA4Q 1Z9QA 5IHKA 5I22A 1SSFA 2GTOA 3EG9A 4ATOA 1RI0A 1WJRA 4HXJA 2ROTA 1F1BB 4D6WA 1VQ7Q 3KXTA 1K9MR 5KYNA 3WVDB 3C95A 2DNUA 3V8KA 1NPPA 4HT8A 3GLXA 3AT1B 1VQMQ 3OMCA 4F14A 4BB7A 1ZBXA 3P8BB 1X75C 1WIEA 4C8QA 2NUTB 2M02A 4JRPA 1YJ9A 1Q7YC 3CC2Q 2GFUA 2RI2A 1Q86C 3VKIA 3M0PA 4M7DG 1I8FA 1WDXA 2DBKA 2QTVA 4A4FA 1BI2A 1U5SA 4FW2A 5KYUA 4M78G 1RAAB 4QT7A 5L23A 1Y57A 2GFAA 3HSBA 1WQWA 5ECAA 4DQ2A 1ZSZA 2AZSA 2DD5A 1QP3A 2ZZDA 1CKBA 1QKXA 2X4XA 2HSPA 2D8HA 3I56T 2VASA 4M7AE 1JQQA 2JN0A 2J7IA 4J9IA 4M7DA 3PVQA 3QZ5B 2RI3A 4C5HA 3JCMX 1QVGP 2F5KA 1Y7XA 3EGUA 3CPWA 1QVGS 2QGGA 2BUDA 2J06A 3PMIA 3RERA 4C92G 1QVFP 2FPEA 2LNVA 4QQ6A 2EYWA 1QVFS 1OYXA 2K6DA 2EQKA 4LN2A 3M5AA 2C06A 2CH4A 4C0DC 3I5SA 3CD6T 2I2LA 3LLRA 1VYVA 2H3EB 1UG1A 1KIKA 4C0FA 4A4KA 2LDMA 2RMOA 2ZAEA 3DB3A 4C5IA 1T3LA 3V7SA 2HEQA 2YUOA 1N9RA 2F5TX 1C6VX 1LNXA 1A0NB 4Y92A 4Y91A 5FRMA 3I56Q 2KROA 2RK1A 3C12A 4XTUA 1WHMA 3I56A 1JJ2A 5DLQE 5GAN5 4C0GA 1XOVA 2R5MA 1TXQA 2EGAA 2MPXC 3ULRB 3CC7A 5GAN4 3CC4T 2VUBA 1WJSA 3FJPA 3UT1A 4N4HA 3PVLA 1HJDA 1MMDA 2SEMA 5GAMd 2LCLA 1YJWA 4BACA 2L3PA 2HAXA 3G71A 1RAGB 1RL2A 5L8RE 5CKHA 2FO0A 3EH2A 1W6XA 1NG2A 3CD6Q 5GMKl 4LXCA 1OULA 3H41A 2D8JA 4J9BA 2RHZA 2G3RA 2YUPA 4JRIA 4KT0E 1MV0B 3M0TA 4PNOA 2DYBA 2RO0A 2HKNA 4JDSA 3TREA 1D0XA 2C0OA 1YHQT 2HBWA 4RG8A 5CKDA 1JO8A 3JCMV 5GAMg 2P84A 1OQKA 1VQPT 1M3AA 5LJ3d 2P4RA 3OYJA 1K73U 4N4IA 2RQWA 3BDUA 5GAN3 4M78F 3CC4Q 1U3OA 2CT3A 2DVEA 4O5VA 2F2XA 2KYMA 1QVPA 1YITT 4RCBA 1KQSP 2DL4A 3GIBA 2JTFA 1KQSS 2F69A 5DY9A 4FT2A 2B8AA 1C0MA 3GBQA 1WNLA 4DBRA 2QQSA 1X6BA 2CP0A 2VC8A 1ACMB 4PFOA 1YJNA 2JMCA 2LRQA 5GANd 2KVQG 3SB2A 3PIOA 4FSSA 1G3YA 3TEEA 3X26B 2FPFA 3QSUA 1YHQQ 2RHUA 4C92F 2K3BA 4C8QC 2E6NA 4BE2A 4DOWA 3HTRA 2EPDA 2KYBA 2BE9B 1OZ2A 4EMHA 3JB9H 1VQPQ 4D8DA 2ZCFB 4PJMA 4E7ZA 1NJIR 2DILA 2W0ZA 2HNIA 2EJFA 4Z02A 3GOXA 1M2OA 4OMOA 1IXDA 3JCMb 1KG1A 5GANf 1UECA 5IAYA 3FJ5A 4ZGDB 3SWNB 2OTLT 2CZ7B 1YITQ 1NZ9A 2CZ0B 1ZSZC 3MP6A 4J83A 2LNHB 4J7FA 3NPFA 5GANg 2J6FA 2X3WD 1GFCA 1G3WA 3EG0A 1RAEB 2QI2A 5HCKA 1Q82U 5A0LA 4HCKA 3CQTA 5CK9A 1KC8R 1N9SA 5IH2A 2J05A 4OMFB 1OX9A 2VKNA 3OMGA 2V26A 1D1CA 5I11A 1AWWA 4M7AB 4M7DC 3JAME 1M2VB 1D3BB 4OGCA 1VQKT 3VUBA 1D1AA 1OEBA 4JJCA 2DIGA 1KD1C 3VRZA 1UGRB 4AG1C 3LH0A 2EYZA 3WXMB 2VVKA 4M75F 4BE1A 2O01E 3X28B 3M4YA 3UPUA 2DRKA 2J6KA 1QLYA 5M9OA 1NEGA 2D0QB 3UWNA 3NHNA 4JUVA 1N6AA 4E7HA 2OTLQ 3V8JA 2LQKA 1W4SA 1TUDA 3CBMA 2RH2A 4J6YA 2Y4XA 2OTLA 2A7YA 2EGCA 2FRYA 5AYFA 4AMCA 4M78E 5IXFA 2LT1A 5GAMj 4A54A 2GCXA 2LJ0A 3JB9J 3OYNA 5CQXA 1TH7A 1O9SA 1VQKQ 2DZ9A 1JEGA 1SPKA 4MMLA 2DAQA 1HSQA 1D0YA 3UA7A 4N4GA 5HY6A 1YWOA 3QJ6A 3CCQT 1I1JA 4PLLA 1O75A 1M3CA 3OYGA 4MMKA 5LL6S 5GAOp 3CCJT 3NMZC 1IGUA 4F7UF 4LNPA 1K4US 1WHKA 4MDXA 4C92E 4OF1A 1ZA1B 1M30A 2L89A 1R8OB 1Y0MA 1LVKA 3ZEHA 1UJ0A 2FB7A 1Q81R 2DK3A 4BI4A 5FU7C 5LJ3j 1PRLC 1Y96B 3OYBA 1VA7A 2EIFA 4PJJA 1UE9A 2NUPB 5FWBA 4JLIA 3M0SA 5I2SA 2YWWA 3CCVT 1JXMA 5KH6A 2DERA 3NGPA 3JB9G 1K73C 1GBRA 1WZOA 2DFUA 2DF6A 2JT4A 3THKA 4BDZA 4LD6A 4RCCA 5CIUA 2DTIA 4JZ4A 3OYKA 4PJNA 4BDYA 3CCUT 1K8AU 3NTHA 1N8RC 3TU4K 2L0AA 2DXUA 2LMJA 1VQ4T 3L2QA 3OYYA 4FSXA 3OY9A 2LVMA 1T0JA 4M77G 3JCMP 1UHCA 1J3TA 3I35A 3J7AF 2EQJA 3I9QA 4TVRA 2JZ2A 3CCQA 3LYIA 4CRIA 3CCJQ 4X34A 5GAN2 4ZNXA 1AEYA 3JCMd 3M0UA 1PD0A 1UJYA 1KJWA 1WFWA 4XK8E 1ZA2B 2QA4T 3M4GA 3QZ9B 3UATA 1UB4A 4WTOB 3O5ZA 1GXIE 2RHIA 3REAB 2OX7A 3LW5E 2D1XA 2M1HA 2Y90A 2JM9A 3ZBDA 4EIKA 2CH4W 3CCVQ 1FXXA 1HYOA 3X24B 3QG1A 1M1KR 3OW2P 1N27A 1WHHA 1U1TA 4M77A 3JCMf 1NE8A 1M4ZA 3OW2S 2K79A 2RHYA 3MEVA 3OYMA 5FLXE 2BTTA 3CCUQ 2V1RA 1B3QA 1PNJA 1R77A 1PSEA 3JCMg 1VQ4Q 3EHRA 2DX1A 2MK5A 1E6GA 2COYA 4FYYB 1BCMA 4Z8AA 2E5QA 2WSFE 2PNIA 2MOXA 2VGNA 3CBOA 3EG1A 3QDFA 4OMMA 4RTTA 3C94A 2KK4A 3CBPA 4C8QG 4J9DA 2C0TA 4OVAA 3QBYA 3H0FA 5LJ5e 1WJQA 3QKJA 3ZL7C 4PJOG 3MKDA 1W70A 1X2QA 1PRMC 2KR3A 2ZPIB 1UEBA 5GMKe 4F7UE 1YCSB 5CKFA 2PVOB 4JS4A 2QA4A 5FROA 1SF9A 2L8DA 4NL3A 3QO3A 2M51A 4YTLA 1NBEB 3CEYA 3N5BB 1VQLT 1VQ7A 1HD3A 3OYCA 3A8GB 4L6V5 2RHXA 4K11A 2MYSA 2E65A 4ESRA 3SEMA 1WHJA 2I0NA 3H0IA 1VQMA 3OBWA 2RJDA 2CP2A 4RUGA 1MMGA 3VS0A 2GBQA 3QJYA 1U1SA 4PJOA 2E5KA 5IHNA 4JRKA 3CC2A 4IUTA 2D6FA 3Q1JA 4AT1B 1AHJB 3URGA 3UF4A 3PNWC 3S3OA 2L3RA 4ELZC 2X4YA 1SRLA 1WXTA 5GANh 3FLGA 3SD4A 2LCCA 1G8XA 2CUBA 3CMET 1IHWA 3KBGA 4EMGA 3QPHA 5KYXB 2KDSA 3OA6A 2Z0WA 1TUGB 2JNGA 1X01A 4XQ3A 3VV0A 4AFQC 3LGLA 1BU1A 3FDRA 4WF2A 2AHJB 2CKKA 3LGFA 2E3HA 1VQLQ 3E9GA 4J7IA 5FU6C 4EDUA 3META 1QQJA 1MMNA 3HHTB 4XTVA 2NUZA 2QXFA 3EFRA 2PUOB 3S3NA 2K3XA 3P8DA 2QGFB 4NOYA 2NUTA 1KD1U 3FC3A 2D9TA 2C0IA 3S6WA 4B9WA 3G6ET 3V7RA 1KFZA 4XU2A 1M27C 2O88A 2KY9A 3DKMA 1E6HA 2KGTA 3VUZA 1K8AC 3EFOB 2ZGWA 1EX4A 2F1LA 1X27A 3VYGA 4AG2C 4HVUA 2FRWA 2BZ8A 3CMEQ 4A63B 5J26A 1JRIA 2HQXA 2RN8A 1B7TA 1WYXA 2G6FX 3A8LB 1KQ2A 3O8VA 2YRCA 4M75D 2MIOA 1BIAA 2EQMA 3VU3C 4ZN1A 2E4HA 3KUFA 4C8QF 3MPUB 2EYXA 1VQNT 4UC4A 5LJ5j 2QG9B 3CCRT 3H6ZA 2FPDA 2KT1A 2ZPBB 4M75B 5GJVB 5GMKj 4VUBA 4XTXA 5A0DA 1WI7A 3OB9A 2YXYA 3RR6A 3G6EQ 4BI3A 1XTDA 3OYDA 1I0CA 2RM4A 4M77C 1ZUKA 3CPWP 2K5LA 3CD6A 3I55T 2QYZA 3CPWS 2YSQA 1LCKA 4XU1A 2DE0X 1VQ6T 4J6XA 4AFUC 5GAMf 2FHDA 1XQHA 2JMAA 2COZA 4MZPA 5FRNA 4ZTJA 2KRNA 1JB0E 1G3TA 2QTXA 4M7DF 3SDZA 1XJWB 2EJ9A 3H0HA 4KGVB 5GJWB 4XTYA 2H8HA 3I5RA 3HKSA 2CUDA 1S72T 3HFOA 2QQ9A 4J9HA 1RLQC 2FEIA 2M0OA 1V29B 1PWTA 2L3SA 4IKFA 1X2KA 4M77E 1VQNQ 1N8RU 2R58A 3CC4A 3CCLT 1WHGA 2JTEA 2KBTA 4ORZA 4JS5A 4J6WA 3CCRQ 3VJPA 1W2BA 1QWEA 3PT9A 4IURA 1JJ2P 4F7UB 4IUQA 1JJ2S 5LJ3f 3P8HA 4HKEA 2B86A 4LDXA 2RPNA 2DKGA 2KEAA 1Z9ZA 2XDPA 1IGQA 4BI8B 3QDRB 4QKUA 2D0NA 1QMCA 4OP0A 2EFIA 2LC4A 3I55Q 2RD1A 3CCST 5LJ3g 1FMKA 4ELYC 1VQ6Q 1WHLA 3X25B 2QAZA 1CKAA 3I55A 2DXTA 1KQ1A 3ER0A 5DLOA 4CI0C 1EZZB 2AK5A 1KHCA 1NEBA 2A0FB 2IVWA 1YHQA 4X9DA 3MEUA 4PJOC 2CDTA 2LZ6B 1NJIU 2OAUA 1GRIA 3VS4A 1IO6A 2VGMA 4FYVB 1VQPA 4QVZA 4HT9A 1S72Q 4B9XA 3JCMh 1C1AA 4OB3B 1OU9A 1X6OA 2KNBB 2P0KA 2E70A 3EGDB 4HVVA 4XTWA 1OOTA 5IXBA 1R0CB 2GNCA 4M7AD 3RESA 3CCLQ 2QQAA 1TSFA 4RTVA 1YITA 1M90U 2DBMA 1M8MA 8ATCB 3OS2A 4FCYA 1K0XA 4C8QE 4RTYA 2HKQB 4HVWA 1HXDA 3C0CA 1OI1A 3CMAT 3NTIA 2RK2A 7AT1B 1S1NA 2XMFA 4CC4B 2W10A 4KRTA 4IUPA 2F2VA 4J9FA 3RKXA 5GANe 3CCSQ 4II1A 1WX6A 1GBQA 4R56A 2NYSA 2PQWA 2DM1A 2RQUA 4PKCC 1SG5A 4WCIA 1QKWA 4PK4A 3CCMT 2DYIA 1ZQ1A 2R5AA 3VS3A 1Q82R 2DVJA 4FW1A 2V8JA 2BE7D 2OAWA 1RACB 2KSSA 3NFCA 1JBMA 5IT9E 4LDYA 4KUDK 1WGSA 4MDWA 2E3IA 4Z88A 4JJBA 3EGXB 3QIIA 2LQWA 4QW2A 5KCOA 3C4SA 3V7CA 4LUEA 3F70A 2PTKA 2JS0A 1G2BA 2RJFA 3CCET 3M54A 3SWNA 4X1VA 1SEMA 2IIMA 2MWOA 3RNJA 4M7DE 5KE3A 1TG0A 5HKCA 1JU5C 2O31A 3CXCA 1SHGA 2JW4A 2EBPA 2GTJA 1OZ3A 1PD1A 1X6GA 1BYMA 1Y71A 4OMNA 1ARKA 4C5GA 3CMAQ 4DBQA 4R0KA 2CP5A 4M7AA 3CPFA 1M2VA 1D3BA 1KK7A 5GAOr 3JCMQ 3G4ST 2ED0A 1RAFB 2XICA 1VQKA 2YDLA 1Q7YR 3CCMQ 4PFZA 1Q86R 2K9GA 1UGQB 4LDUA 2EGEA 3J81E 1RAIB 3VS1A 4DEYA 1PKSA 3GF5A 1N5ZA 2HQEA 1NLPC 3RUXA 4AFZC 2HDAA 2RNAA 5HK0A 4IUVA 1BB9A 2XHCA 4ZGEB 2LX9A 2DEUA 1Q81U 3TQ7P 4DBHA 1BK2A 1PC0A 2CP7A 3JSCA 4FIBA 3CCEQ 2Y4YA 1RUWA 2K3YA 5I21A 3GNGA 3REBB 1V1CA 3TCJA 1VQ8T 2O4XB 1I4K1 4JRQA 2BKDN 2FYKA 1AWOA 1PCXA 2BIVA 4A4EA 4BE0A 2XI9A 2EKOA 2EKHA 4KH1B 1VQ9T 3IQLA 2QEXT 3VYHB 1OX8A 1TU0B 1WQ7A 1VQOT 5GMKm 3M59A 2LJ3A 2CYZB 2YT6A 2A37A 3J80E 1H641 3BFMA 3L2WA 4M4ZA 2RB6A 1NYGA 3G4SQ 3ASKA 4QVCA 1X43A 1FX7A 2RA2A 3M58A 2DL3A 5KYWB 2MF2A 4FYXB 3E1SA 1YCYA 1K8AR 1EFNA 4ZGJB 3CCJA 5C0MA 2HCKA 2EWNA 5FW9A 1ZX6A 5GMKi 2NLUA 2ZPFB 1D0ZA 1VQ8Q 2O4XA 1GCQA 4ZN3A 1Y96A 2LQNA 1NJIC 3U23A 2DXCA 2FZKB 3EFSA 2WSEE 2NUPA 1M1KU 5LJ5d 1I07A 2CREA 3L2ZA 2CSIA 2ESWA 1VQ9Q 2QEXQ 1AWXA 1T3SA 1WXBA 1H8KA 4RTZA 4J9CA 1VQOQ 1UGSB 1AD5A 3CCVA 3PGGA 3EG9B 4IIOA 1D1BA 1K0SA 3UDCA 5GAOm 1E7OA 4HCBA 2P4TA 3D7SB 3LH5A 4QQDA 1T0HA 4OMQA 5GAMh 3CCUA 2LJ1A 1M90C 1P92A 1UGVA 2GQIA 1OU8A 1YI2T 3A5ZB 4FM4B 1VQ4A 1UHFA 4F17A 1U8RA 3OQ5A 3R6OA 1GL5A 2DRMA 1VIFA 1YJ9T 2BZYA 4PLIA 1GFDA 2SRCA 3HPWA 3QYHB 1CSKA 1AWJA 4OMPA 5I2MA 4C8QB 1OPKA 1U06A 3MEAA 5LJ5g 3HP9A 3RMQA 5D6XA 5CKEA 4HCZA 3HRUA 2F2WA 3V8LA 1BCOA 3M0RA 2YRVA 1IREB 1M8VA 1BI0A 4LDVA 1ZUUA 4L59A 1K9MU 3A98A 3SHWA 1TOVA 1ZSZB 4HA8A 1XNIA 1H92A 2YRDA 2CS7A 4M7DD 5EG2A 4RMOA 3LWHA 1AOJA 2P0PA 3FIFA 5LJ3h 3ME9A 1QVGA 1SHFA 2EW3A 5CO7A 2DTOA 2KT8A 4ANJA 4LD9K 1Y07A 2JJ9A 3GNFB 1QVFA 4M78D 2K5IA 3SWNC 2K5FA 3JV3A 5IN1A 2XKOC 3A8HB 4C5EA 4M7DB 1AVZC 3OYFA 1YI2Q 2EVRA 4IUUA 1VQ5T 2YLBA 2AKLA 1YI2A 1YJ9Q 4RTUA 4M78B 3JB9F 3M9QA 2EYQA 5GAN6 2OTJT 3PIPA 1OV3A 2XK0A 4M7AC 2EAYA 1M3BA 3DLLA 5A2QE 2CZ6B 1PG5B 1NLOC 4C0ZA 2KRSA 4RTXA 4J9EA 1FMVA 4C92D 2ENMA 1UFFA 2CP3A 4M77F 4CC2A 1K76A 1WPYA 3E2UA 3JRZA 1I5LA 2DTHA 2HL5C 4GLKA 3MP8A 3TVTA 2KAFA 1Q81C 2PUKB 2K2VA 2DA9A 2PVGB 1VQLA 3EHQA 4C92B 2DL5A 2MMPA 3CC7T 3EH1A 1ZBJA 2XIDA 1ZHIA 1YJWT 4V2SA 1LPLA 1IRXA 1VQ5Q 4DEXA 4A4GA 3JB9I 2HD0A 4A53A 3G71T 4EMKB 1VYUA 1VQ5A 4M78A 2DMOA 4N0AA 4ZTFA 5D7UA 2HQHA 2OTJQ 2L2PA 4P5NA 3HRTA 1G3SA 1VOMA 2XU8A 2PZ1A 1KD1R 2OTJA 5GAOn 2WSCE 3TSZA 2KQWA 2YLCA 2YUNA 1UUEA 4GBQA 1ZUYA 5KYXA 4NS5A 3CMEA 4BY6B 3QHSA 1SRMA 5HK3A 3VS6A 4Q5WA 1DJ7B 3WVEB 2M0YA 2BZXA 5FU7B 3OYEA 3DB4A 2E41A 3E9FA 3HL8A 2DEQA 2L3QA 1KQSA 3EG2A 2ROLA 3EG3A 4Y28E 1QCOA 4J5YA 4PJOF 2KI7A 4C92A 1LJOA 3G7ZA 3M57A 4XAXB 3CC7Q 4BD3A 2E1HA 1GCQC 1M1KC 2MWPA 1YJWQ 2MCNA 3OBYA 1BI1A 1BI3A 1ZSGA 2DL8A 2R57A 2ED1A 2EQIA 3G71Q 4EMKA 2CP6A 3G6EA 4GY5A 2QQBA 4E7LA 1W1FA 3M56A 3GPLA 3EFOA 5CKBA 3RKWA 4M75G 4E6RA 2QQRA 4B6MA 1I5OB 4D8KA 1IB8A 1R0BG 1YJNT 2X51A 4NL2A 1VIEA 3OYAA
chains in the Genus database with same CATH topology
4CRIA 4X34A 5GAN2 4M78G 3JCMd 3QIIA 4EPCA 3L2VA 4QW2A 2GFAA 3M53A 5KCOA 3C4SA 1WQWA 1M1FA 3V7CA 5J39A 3HSBA 1M1GA 2YHTA 4DQ2A 3JCMc 3F70A 2XDBA 2A3LA 2DD5A 1QP3A 4RKUE 4XK8E 2RJFA 3CCET 3M54A 5KCHA 4JJNK 2ZZDA 2QA4T 3M4GA 3SWNA 3QZ9B 3EAEA 2X4XA 1UB4A 2MWOA 4M7DE 5KE3A 1HK9A 4E47A 2E12A 3I56T 1GXIE 2RHIA 5HKCA 3LW5E 4MZTA 5GAMe 3CXCA 1K9MC 2M1HA 1IZ6A 2Y90A 4XTZA 4O6JA 3ZBDA 3JCMW 4M75A 4M7AE 1VQNA 1OZ3A 2JN0A 1FXXA 3OYIA 1BYMA 2RJCA 1Y71A 3QG1A 3X24B 3CCRA 4M7DA 3QZ5B 1N27A 2RI3A 1U1TA 4M77A 3JCMf 1NE8A 4C5HA 3OS5A 3FEOA 4C5GA 1M4ZA 3OW2S 2RHYA 5GAN8 3MEVA 3JCMX 3OYMA 2F5KA 1Y7XA 5FLXE 2OTJA 3BY7A 3CPWA 1QVGS 4M7AA 3MO8A 2BUDA 3CPFA 3PMIA 3RERA 1D3BA 4C92G 1PSEA 2CZ1B 5GAOr 5D6YA 3JCMQ 3G4ST 2LNVA 3JCMg 4QQ6A 2XICA 2CGHA 1QVFS 1OYXA 2EQKA 2K4YA 1NPRA 3RIRA 1VQKA 2HBPA 3M5AA 2C06A 4F7UG 1VQ6A 3PFSA 4C0DC 3CD6T 2I2LA 1UGQB 1UGPB 2E5QA 4LDUA 3LLRA 2WSFE 5A0GA 3FRNA 4C0FA 2X4WA 4A4KA 3J81E 2VGNA 2LDMA 3CBOA 5GAOl 3C94A 3DB3A 3GF5A 4C5IA 2HQEA 2KK4A 3L42A 1PSFA 3CBPA 3NTKA 3RUXA 1M5Q1 4IUVA 4KUIA 1N9RA 4C8QG 2XHCA 4ZGEB 5HK0A 5LJ3e 2LX9A 2EJGA 4OVAA 3S3MA 3QBYA 2F5TX 1WJQA 5LJ5e 1Q81U 3QKJA 1LNXA 4PJOG 2X4JA 3LX7A 3JSCA 4FIBA 2Y4YA 4JLGA 2K3YA 2GF7A 2ZPIB 5I21A 1UEBA 3GNGA 1S72A 2DD4A 5GMKe 3TCJA 5CKFA 4Y91A 4F7UE 1VQ8T 2O4XB 3JCMJ 2RI5A 1I4K1 2BKDN 3BDLA 2FYKA 4JRQA 2PVOB 4JS4A 2QA4A 2M16A 3PMTA 1LOJA 1I81A 2RK1A 5FROA 3C12A 2BIVA 2P0QA 2L8DA 4A4EA 4MZMA 4NL3A 4XTUA 3QO3A 4YTLA 5CVIA 5KE2A 2XI9A 4BE0A 1JJ2A 3I56A 3CEYA 5DLQE 3N5BB 2EKOA 4X9CA 5GAN5 3CCLA 4C0GA 1XOVA 3MCAB 2R5MA 1VQ9T 1KC8U 2QEXT 3VYHB 1VQLT 1VQ7A 4F7UA 3OYCA 1WQ7A 3CC7A 3A8GB 4L6V5 5GAN4 3CC4T 2VUBA 2RHXA 4XU3A 1WJSA 3FJPA 5LJ5h 1VQOT 5DM7R 3UT1A 5GMKm 4PJOE 4N4HA 4A4HA 3M59A 2E65A 2CYZB 5GAMd 2LCLA 3J80E 1H641 1YJWA 4BACA 3BFMA 3L2WA 2RB6A 5GMKh 1VQMA 2XG8D 3OBWA 2HAXA 2RJDA 4L5GA 3ASKA 2ZPHB 4QVCA 3G71A 3OYLA 3QJYA 1U1SA 4PJOA 1RL2A 2JOYA 2RJEA 1FX7A 2VXFA 5L8RE 3CCSA 4JRKA 2JVVA 4FL6A 1W2BS 5CKHA 2RA2A 1VUBA 3M58A 3OS1A 5GMKl 3CC2A 4IUTA 3OYHA 1YBYA 2D6FA 3Q1JA 3M55A 2K57A 2RHZA 2G3RA 2VXEA 1AHJB 4JRIA 4KT0E 2MF2A 4M7AG 4QVDA 5FRMA 3URGA 4PNOA 3E1SA 3PNWC 1YCYA 2RO0A 3S3OA 2L3RA 4ZGJB 4JDSA 4ELZC 2X4YA 3TREA 5C0MA 3CCJA 4E7IA 5GANh 4OB1B 4E7JA 4DOVA 2V8KA 3FLGA 2EWNA 4J8OA 4M78C 3SD4A 1YHQT 4N0AC 5GMKi 2LCCA 2NLUA 3X20B 1B34B 2ZPFB 3CMET 4RG8A 2LTOA 3AHUA 3OYAA 3KBGA 4EMGA 2O4XA 3QPHA 5CKDA 2JTMA 3L2RA 2KDSA 2KMTA 3JCMV 4ZN3A 5FU6B 2E10A 5GAMg 1Y96A 1VQPT 1NJIC 2DXCA 3OSVA 3OA6A 3EFSA 3VV0A 2JNGA 2WSEE 1X01A 4XQ3A 5LJ3d 3LGLA 1M1KU 5LJ5d 4WF2A 3FDRA 2AHJB 3L2ZA 3OYJA 1K73U 2CKKA 3LGFA 4N4IA 3E9GA 4J7IA 4KBMB 5FU6C 4EDUA 3BDUA 5GAN3 3V7SA 2DO3A 4M78F 3META 2DVEA 1UGSB 3QYGB 4O5VA 2QDYB 3CCVA 3PGGA 1QVPA 1YITT 4RCBA 3HHTB 2MAMA 4XTVA 2QXFA 3EFRA 3GIBA 2PUOB 2JTFA 1KQSS 3S3NA 3A8MB 2WACA 3UDCA 2K3XA 2E64A 2H3JA 3P8DA 5GAOm 3CMAA 3MP1A 4RG2A 4HCBA 2P4TA 2F69A 3MEWA 3QUIA 4C0DB 4QQDA 4NOYA 5DY9A 1Q7YU 4FT2A 2B8AA 3FC3A 1KD1U 5GAMh 3A8OB 3CCUA 1Q86U 2D9TA 1M90C 1P92A 4C92C 1YI2T 1M9SA 1WNLA 3S6WA 4B9WA 4KULA 3A5ZB 2QQSA 4FM4B 3V7RA 3G6ET 1VQ4A 1U8RA 3OQ5A 2VC8A 3R6OA 4OB2B 4XU2A 1YJNA 2KY9A 3CCMA 1VIFA 1YJ9T 2LRQA 2V8IA 4PLIA 3DKMA 3HPWA 2KVQG 4LDWA 3SB2A 3QYHB 5GANd 3PIOA 3GP8A 5I2MA 4C8QB 3MHXA 1G3YA 3VUZA 1K8AC 3TEEA 4FU6A 2ZGWA 3X26B 3MEAA 5LJ5g 3QSUA 4XU0A 3HP9A 3RMQA 1H3ZA 5D6XA 3JB9D 4EMKC 5CKEA 2RHUA 4HCZA 3VYGA 4C92F 4FT4A 3HRUA 3V8LA 2VV5A 4C8QC 2E6NA 5GAN7 4BE2A 1QW1A 4DOWA 1B34A 4E7KA 2GQVA 3OS0A 5J26A 2YRVA 1IREB 1JRIA 1BI0A 4LDVA 2HQXA 3LWHA 3CCEA 4L59A 1K9MU 1M8VA 1OZ2A 4EMHA 3LWIA 3JB9H 2ZCFB 3A8LB 1KQ2A 3O8VA 4M75D 2HNIA 2DPPB 2EJFA 4Z02A 3GOXA 1BIAA 2EQMA 4HA8A 3JCMb 3SFMA 1XNIA 5GANf 3OW2A 3VU3C 2CS7A 4M7DD 1KG1A 3HFNA 5EG2A 4ZN1A 2P0PA 5IAYA 3FIFA 5LJ3h 4M77D 4ZGDB 4RMOA 4BY6C 3ME9A 3SWNB 2OTLT 1QVGA 2CZ7B 3KUFA 5CO7A 2DTOA 4C8QF 1NZ9A 2CZ0B 4LD9K 3INZA 3MP6A 1Y07A 5C6SA 4J83A 4OB0B 1VQNT 4UC4A 3GNFB 2EQUA 4J7FA 4M78D 3RMSA 5LJ5j 1QVFA 2K5IA 3SWNC 5GANg 2K5FA 3CCRT 3H6ZA 2ZPBB 4M75B 2ZPGB 5IN1A 1G3WA 2XKOC 3CXCS 3A8HB 2QI2A 4C5EA 1Q82U 5GMKj 4M7DB 3OYFA 4VUBA 4M77B 5A0LA 4XTXA 3G4SA 5CK9A 5A0DA 3OB9A 3L1AA 4IUUA 1N9SA 4M75C 4OMFB 4BI3A 1VQ5T 3OMGA 1XTDA 4OGEA 2YLBA 2XDDA 1MGQA 3OYDA 1YI2A 2RM4A 4M7AB 4M7DC 3JAME 1D3BB 4M77C 4M78B 3JB9F 2K5LA 3FB9A 3M9QA 3CD6A 4OGCA 2EYQA 1VQKT 3I55T 5GAN6 2IG0A 2OTJT 3CPWS 3PIPA 2JUFA 1YIJT 4XU1A 2M9UA 2VYTA 2XK0A 4J6XA 3VUBA 2FL7A 3L2UA 1VQ6T 2DIQA 5GAMf 2LT4A 5CQYA 4M7AC 2DIGA 1KD1C 1UGRB 2EAYA 2PU9B 3DLLA 2XD0A 2FHDA 2CZ6B 5A2QE 3LH0A 1XQHA 3WXMB 4MZPA 4C0ZA 5GANj 5FRNA 4M75F 4ME7A 2DJZA 4ZTJA 4BE1A 2O01E 2DXBA 1JB0E 1G3TA 1QP2A 2QTXA 4C92D 2DZCA 3X28B 2X35A 4M7DF 3M4YA 3SDZA 3UPUA 4M77F 3BW1A 1VQ8A 2EJ9A 1WPYA 4XTYA 1FWZA 5M9OA 3JRZA 3HKSA 1I5LA 2E6ZA 2DTHA 1S72T 2D0QB 5CAIA 3UWNA 3HFOA 4GLKA 3OSSC 4JUVA 2QQ9A 1N6AA 3MP8A 4M7AF 4M75E 2KAFA 1Q81C 2PUKB 1MHNA 2M0OA 1V29B 2K2VA 1BKBA 2LQKA 3V8JA 4E7HA 2PVGB 1VQ9A 1W4SA 1VQLA 2QEXA 3CBMA 1G5VA 4IKFA 2RH2A 4J6YA 4M77E 1BIBA 4C92B 1N8RU 2R58A 2Y4XA 3CCLT 3CC4A 2OTLA 1VQOA 4DA4A 2A7YA 3H8ZA 4JS5A 2PVDB 4J6WA 2MMPA 5D6WA 5AYFA 4C8QD 1VQ7T 2FVUA 3CC7T 4QQGA 3VJPA 1W2BA 2XIDA 2L5QA 3PT9A 4IURA 3DLMA 1ZHIA 4M78E 4PJOD 4F7UB 4IUQA 3HRSA 1JJ2S 5GAOq 5LJ3f 3P8HA 1YJWT 2LT1A 1KC8C 4V2SA 4HKEA 4LDXA 5GAMj 5LJ5f 1VQMT 4A54A 2GCXA 4PL6A 4A4GA 3JB9I 3JB9J 2HD0A 3OYNA 4A53A 2DKGA 5CR2A 2XDPA 5CQXA 3G71T 1TH7A 1O9SA 3QDRB 4BI8B 4EMKB 1VQ5A 4M78A 4OP0A 4BUGA 2EFIA 2LC4A 2DZ9A 4N0AA 4ZTFA 2RD1A 3CCST 5J3BA 5LJ3g 4ELYC 3ZFJA 4MMLA 3JCMe 4P5NA 2DAQA 3X25B 3HRTA 4PJOB 3CC2T 1G3SA 2XU8A 4N4GA 3I55A 1KHIA 2DXTA 1KQ1A 5HY6A 3QJ6A 5GAOn 3CCQT 2WSCE 3ER0A 5DLOA 3RKYA 1YIJA 3QXEB 1Q82C 4CI0C 4PLLA 4R55A 1KHCA 2MI6A 1O75A 2KQWA 3OYGA 2YLCA 2IVWA 3E19A 3CCQA 5CCAA 4X9DA 1YHQA 3MEUA 4MMKA 4PJOC 5LL6S 1NJIU 2ZPEB 1EIFA 5GAOp 3CCJT 4NS5A 2OAUA 3CMEA 4F7UF 4BY6B 3QHSA 5HK3A 4MDXA 2LQ8A 2VGMA 4Q5WA 1DJ7B 3T9NA 3WVEB 4C92E 4OF1A 1VQPA 2L89A 1R8OB 4QVZA 4HT9A 5FU7B 3ZEHA 3DB4A 2E41A 4B9XA 3OYEA 3JCMh 2FB7A 4OB3B 3E9FA 3HL8A 3PTAA 2DEQA 1KQSA 1X6OA 2DK3A 1SSFA 2P0KA 2E70A 4BI4A 4XTWA 4ATOA 1RI0A 1WJRA 4Y28E 5FU7C 5LJ3j 4J5YA 4M7AD 4PJOF 3RESA 4C92A 1Y96B 2QQAA 3OYBA 2EIFA 4D6WA 1LJOA 1YITA 3G7ZA 3KXTA 3M57A 4XAXB 4BD3A 4JLIA 1M90U 5I2SA 3WVDB 2E1HA 3C95A 3V8KA 3CCVT 4HCCA 3OS2A 5KH6A 1M1KC 2MWPA 1NPPA 4C8QE 3JB9G 4HT8A 1K73C 3GLXA 1HXDA 1OI1A 3CMAT 3OBYA 3NTIA 1BI1A 1BI3A 3OMCA 2R57A 2RK2A 4BDZA 4LD6A 4RCCA 5CIUA 2DTIA 3OYKA 4BB7A 4BDYA 1ZBXA 3CCUT 3P8BB 4IUPA 4EMKA 3G6EA 1K8AU 3NTHA 1N8RC 3TU4K 3RKXA 1X75C 4GY5A 5GANe 4C8QA 4II1A 2QQBA 2DXUA 3M56A 4E7LA 3GPLA 4JRPA 1YJ9A 3RKWA 5CKBA 4R56A 4M75G 1VQ4T 3L2QA 2QQRA 3OYYA 2PQWA 1Q7YC 4PKCC 2GFUA 4FSXA 3OY9A 2LVMA 2RI2A 1YJNT 3VKIA 1Q86C 3CCMT 4M7DG 1ZQ1A 2R5AA 4M77G 1I8FA 2V8JA 3JCMP 4NL2A 1BI2A 2KSSA 3NFCA 1JBMA 4A4FA 5IT9E 4LDYA 3J7AF 2EQJA 4KUDK 4TVRA 1VIEA 1WGSA 2JZ2A 4MDWA 3LYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU0 A;  3FJP A;  4C8Q D;  5LJ5 h;  3JB9 D;  4EMK C;  5GMK m;  4PJO E;  2E65 A;  4C92 F;  5GAN 2;  4M78 G;  4M78 E;  3V8L A;  4C8Q C;  4PJO D;  3JCM d;  5GAN 7;  5GAM d;  4F7U B;  1H64 1;  1B34 A;  3BFM A;  3HSB A;  5GAO q;  1WQW A;  2RB6 A;  5LJ3 f;  3V7C A;  1JRI A;  5GMK h;  2YHT A;  4DQ2 A;  4V2S A;  3JCM c;  1M8V A;  5GAM j;  4EMH A;  5LJ5 f;  4QVC A;  4A54 A;  3JB9 H;  3JB9 J;  3JB9 I;  4A53 A;  2DKG A;  3M4G A;  1U1S A;  3SWN A;  1KQ2 A;  4PJO A;  2VXF A;  1TH7 A;  4M75 D;  2HNI A;  2EJF A;  4JRK A;  4EMK B;  4M78 A;  4M7D E;  1BIA A;  4OP0 A;  2RA2 A;  4N0A A;  2DZ9 A;  4HA8 A;  3JCM b;  2RD1 A;  1HK9 A;  5GAN f;  3VU3 C;  5LJ3 g;  4M7D D;  3HFN A;  5GMK l;  3FIF A;  5LJ3 h;  4M77 D;  4MML A;  5GAM e;  3JCM e;  3SWN B;  2K57 A;  4PJO B;  2Y90 A;  4XTZ A;  3JCM W;  4C8Q F;  2DTO A;  1KQ1 A;  2DXT A;  2VXE A;  4M75 A;  5GAO n;  4JRI A;  4M7A G;  4M7A E;  3RKY A;  3INZ A;  2JN0 A;  4QVD A;  4PNO A;  1YCY A;  4M7D A;  2YLC A;  4M78 D;  5LJ5 j;  4M77 A;  1U1T A;  3JCM f;  4X9D A;  3SWN C;  5GAN g;  4MMK A;  4PJO C;  5GAN h;  4M75 B;  5GAO p;  2EWN A;  4M78 C;  5GAN 8;  3JCM X;  4F7U F;  4N0A C;  5GMK i;  3QHS A;  3BY7 A;  5GMK j;  4M7A A;  1B34 B;  4M7D B;  3AHU A;  3RER A;  1D3B A;  4M77 B;  4XTX A;  4C92 G;  4C92 E;  5GAO r;  4EMG A;  4HT9 A;  3L1A A;  1N9S A;  4M75 C;  3JCM Q;  2E41 A;  3JCM g;  5GAM g;  3JCM V;  2E10 A;  2YLB A;  1MGQ A;  1Y96 A;  2CGH A;  2FB7 A;  3JCM h;  2RM4 A;  3EFS A;  2DEQ A;  4XQ3 A;  1X01 A;  4M7A B;  3RIR A;  5LJ3 d;  4M7D C;  1D3B B;  4M77 C;  4M78 B;  3JB9 F;  5LJ5 d;  3FB9 A;  4F7U G;  4XTW A;  4WF2 A;  3L2Z A;  5GAN 6;  5LJ3 j;  4J5Y A;  4XU1 A;  4M7A D;  4PJO F;  3RES A;  4C92 A;  4J6X A;  1Y96 B;  3BDU A;  2I2L A;  5GAN 3;  1LJO A;  5GAM f;  4M78 F;  4M7A C;  2DVE A;  2EAY A;  3PGG A;  4JLI A;  4RCB A;  5GAO l;  2E1H A;  4XTV A;  3V8K A;  3EFR A;  3GIB A;  3V7S A;  3RUX A;  4C8Q G;  1M5Q 1;  4C8Q E;  3JB9 G;  1N9R A;  2E64 A;  5LJ3 e;  5GAO m;  4M75 F;  3JCM J;  2DJZ A;  2EJG A;  5GAN j;  4HT8 A;  1HXD A;  5LJ5 e;  3QUI A;  1LNX A;  2QTX A;  4NOY A;  5DY9 A;  2DZC A;  4PJO G;  4C92 D;  4M7D F;  5GAM h;  4RCC A;  2DTI A;  4M77 F;  3BW1 A;  4C92 C;  2EJ9 A;  1WPY A;  5I21 A;  4EMK A;  1WNL A;  4XTY A;  5GMK e;  4Y91 A;  4F7U E;  1I5L A;  3RKX A;  1I4K 1;  2DTH A;  5GAN e;  4C8Q A;  2FYK A;  3V7R A;  5CAI A;  2DXU A;  3HFO A;  1LOJ A;  2VC8 A;  4JUV A;  1I81 A;  3RKW A;  4XU2 A;  4M7A F;  4M75 G;  4M75 E;  4NL3 A;  4XTU A;  3V8J A;  3QO3 A;  5GAN d;  3SB2 A;  5GAN 5;  4X9C A;  4M7D G;  4J6Y A;  4M77 G;  4M77 E;  1I8F A;  4C8Q B;  1BIB A;  3JCM P;  4C92 B;  4NL2 A;  4F7U A;  1JBM A;  1WQ7 A;  2ZGW A;  5GAN 4;  5LJ5 g;  3QSU A;  4J6W A;  4XU3 A; 
#chains in the Genus database with same CATH topology
 3VS5 A;  4EPC A;  3L2V A;  3M53 A;  2DJQ A;  5J39 A;  1D09 B;  1M1F A;  3R6N A;  1M1G A;  2YHT A;  3JCM c;  3VRY A;  2XDB A;  2A3L A;  4RKU E;  5KCH A;  4JJN K;  1RAH B;  4DBF A;  4LUD A;  3EAE A;  1OPL A;  1HK9 A;  4E47 A;  2E12 A;  1V76 A;  4MZT A;  1MV3 A;  5GAM e;  1K9M C;  2DET A;  1IZ6 A;  4XTZ A;  4O6J A;  3JCM W;  4M75 A;  1VQN A;  5AT1 B;  4KGZ B;  3OYI A;  2RJC A;  3CCR A;  6AT1 B;  1PHT A;  3OS5 A;  3FEO A;  1K73 R;  3A1P A;  4OML A;  5GAN 8;  1ABO A;  3BY7 A;  4AFS C;  3MO8 A;  2QDL A;  1WLP B;  4Z89 A;  2CZ1 B;  5D6Y A;  1N8R R;  1FYN A;  1PKT A;  2CGH A;  1YNZ A;  2K7A A;  2K4Y A;  1NPR A;  3RIR A;  2HBP A;  1YJN Q;  1GCP A;  4F7U G;  1AT1 B;  1VQ6 A;  3PFS A;  2O2O A;  1UGP B;  2YUQ A;  5A0G A;  3FRN A;  2X4W A;  5GAO l;  4E2F B;  3L42 A;  3NTK A;  1PSF A;  3PE0 A;  1M5Q 1;  4KUI A;  2FZG B;  5LJ3 e;  3S3M A;  2EJG A;  3RBB B;  2X4J A;  3LX7 A;  4JLG A;  4RTW A;  1WA7 A;  2GF7 A;  1S72 A;  2JXB A;  2DD4 A;  2NWM A;  4HCC A;  3JCM J;  2RI5 A;  3BDL A;  1UTI A;  2M16 A;  3PMT A;  1LOJ A;  1I81 A;  4KGX B;  2P0Q A;  4MZM A;  5CVI A;  5KE2 A;  5EC7 A;  4X9C A;  3CCL A;  1PM3 A;  3MCA B;  1KC8 U;  4F7U A;  2V1Q A;  2AT1 B;  2OI3 A;  4XU3 A;  5LJ5 h;  5DM7 R;  8AT1 B;  2J6O A;  4A4H A;  4PJO E;  2JS2 A;  1AZE A;  2ATC B;  5GMK h;  1IHV A;  2XG8 D;  1YN8 A;  3MJX A;  4L5G A;  4GLM A;  9ATC B;  2ZPH B;  1WXU A;  3OYL A;  4PJL A;  2JOY A;  2RJE A;  1W2B P;  2VXF A;  1M90 R;  1TWB A;  3CCS A;  2JVV A;  4FL6 A;  1W2B S;  1VUB A;  3OS1 A;  3OYH A;  1YBY A;  2RQT A;  3M0Q A;  3M55 A;  2K57 A;  1NYF A;  2VXE A;  4M7A G;  4QVD A;  1ABQ A;  1MMA A;  3G1J A;  1YWP A;  4E7I A;  4OB1 B;  4E7J A;  4DOV A;  2V8K A;  4M78 C;  4J8O A;  4FYW B;  2HSE B;  4N0A C;  2KRM A;  2A28 A;  1ZLM A;  3X20 B;  1B34 B;  1JXO A;  2LTO A;  3AHU A;  1MND A;  3EGD A;  2JTM A;  3L2R A;  2KMT A;  2OJ2 A;  2O9V A;  2E10 A;  5FU6 B;  3OSV A;  2A36 A;  1TTH B;  4KBM B;  2DO3 A;  4JPB W;  3QYG B;  2QDY B;  2MAM A;  2FG0 A;  2LCS A;  3A8M B;  2WAC A;  2E64 A;  2H3J A;  3CMA A;  3MP1 A;  4RG2 A;  2KE9 A;  3MEW A;  3QUI A;  4C0D B;  1Q7Y U;  2KXD A;  3A8O B;  1Q86 U;  3QWY A;  4C92 C;  1M9S A;  4KUL A;  5FWC A;  2ABL A;  4OB2 B;  2X9H A;  2IPO B;  4F04 B;  3CCM A;  4JZ3 A;  2X3X D;  2V8I A;  2EYY A;  3GP8 A;  4LDW A;  2QAS A;  3MHX A;  2DL7 A;  3EGX A;  1B07 A;  4FU6 A;  4XU0 A;  1H3Z A;  3JB9 D;  4EMK C;  2AKK A;  4JJD A;  2COW A;  2CSQ A;  4FT4 A;  2VV5 A;  5GAN 7;  1QW1 A;  1QCF A;  1RAB B;  1B34 A;  4E7K A;  2GQV A;  3OS0 A;  2AZV A;  3CCE A;  3LWI A;  1AZG B;  1K9A A;  3UA6 A;  2KXC A;  1X69 A;  2DPP B;  1YFN A;  5KYY B;  3SFM A;  3OW2 A;  2AIR B;  3HFN A;  1K1Z A;  4M77 D;  4BY6 C;  1MNE A;  1Q95 G;  1H3H A;  3INZ A;  4PFP A;  5C6S A;  4OB0 B;  2EQU A;  3RMS A;  4KH0 B;  2RQR A;  3CXC P;  2ZPG B;  1MUZ A;  3CXC S;  4M77 B;  2FZC B;  3G4S A;  3L1A A;  4M75 C;  4CC7 A;  4OGE A;  2XDD A;  1MGQ A;  3VS2 A;  1SKU B;  2A08 A;  2VB6 A;  1UDL A;  1NM7 A;  2DLP A;  2JM8 A;  3FB9 A;  3BE3 A;  2IG0 A;  1YIJ T;  2JUF A;  2M9U A;  2VYT A;  1VYT A;  3L2U A;  2FL7 A;  2DIQ A;  3QWX X;  2GGR A;  2LT4 A;  5CQY A;  2LX7 A;  4J9G A;  2PU9 B;  2XD0 A;  4LE9 A;  3CCQ Q;  1YP5 A;  1QWF A;  5GAN j;  4ME7 A;  2DJZ A;  2DXB A;  1FMW A;  1QP2 A;  2DZC A;  2QK0 A;  2X35 A;  1TUC A;  3BW1 A;  1VQ8 A;  1RI9 A;  1FWZ A;  1RLP C;  2E6Z A;  5KYY A;  5CAI A;  3OSS C;  1QCN A;  3KFV A;  4M7A F;  4M75 E;  2HL3 A;  2HZY A;  1MHN A;  1BKB A;  2RF0 A;  1BBZ A;  3RDV A;  1VQ9 A;  1G5V A;  2QEX A;  1BIB A;  2VWF A;  2K2M A;  1VQO A;  4DA4 A;  3H8Z A;  2PVD B;  1VQ7 T;  5D6W A;  4C8Q D;  2FVU A;  4QQG A;  3VS7 A;  2L5Q A;  3DLM A;  4PJO D;  3HRS A;  5GAO q;  1KC8 C;  2CT4 A;  2ECZ A;  5LJ5 f;  1VQM T;  4PL6 A;  1RAD B;  5CR2 A;  1G83 A;  1TS9 A;  5IHI A;  5KYW A;  4BUG A;  1YIJ Q;  5J3B A;  4F16 A;  1KSW A;  1SSH A;  3ZFJ A;  3JCM e;  4IIM A;  4PJO B;  3CC2 T;  1KHI A;  1YIJ A;  3TSW A;  1Q82 C;  3RKY A;  3QXE B;  4E7S A;  2RQV A;  4R55 A;  2MI6 A;  3E19 A;  4CC3 A;  5CCA A;  2HMA A;  2ZPE B;  1EIF A;  5KYU B;  3H9N A;  2LQ8 A;  3T9N A;  2LP5 A;  2O9S A;  3PTA A;  2QA4 Q;  1Z9Q A;  5IHK A;  5I22 A;  1SSF A;  2GTO A;  3EG9 A;  4ATO A;  1RI0 A;  1WJR A;  4HXJ A;  2ROT A;  1F1B B;  4D6W A;  1VQ7 Q;  3KXT A;  1K9M R;  5KYN A;  3WVD B;  3C95 A;  2DNU A;  3V8K A;  1NPP A;  4HT8 A;  3GLX A;  3AT1 B;  1VQM Q;  3OMC A;  4F14 A;  4BB7 A;  1ZBX A;  3P8B B;  1X75 C;  1WIE A;  4C8Q A;  2NUT B;  2M02 A;  4JRP A;  1YJ9 A;  1Q7Y C;  3CC2 Q;  2GFU A;  2RI2 A;  1Q86 C;  3VKI A;  3M0P A;  4M7D G;  1I8F A;  1WDX A;  2DBK A;  2QTV A;  4A4F A;  1BI2 A;  1U5S A;  4FW2 A;  5KYU A;  4M78 G;  1RAA B;  4QT7 A;  5L23 A;  1Y57 A;  2GFA A;  3HSB A;  1WQW A;  5ECA A;  4DQ2 A;  1ZSZ A;  2AZS A;  2DD5 A;  1QP3 A;  2ZZD A;  1CKB A;  1QKX A;  2X4X A;  2HSP A;  2D8H A;  3I56 T;  2VAS A;  4M7A E;  1JQQ A;  2JN0 A;  2J7I A;  4J9I A;  4M7D A;  3PVQ A;  3QZ5 B;  2RI3 A;  4C5H A;  3JCM X;  1QVG P;  2F5K A;  1Y7X A;  3EGU A;  3CPW A;  1QVG S;  2QGG A;  2BUD A;  2J06 A;  3PMI A;  3RER A;  4C92 G;  1QVF P;  2FPE A;  2LNV A;  4QQ6 A;  2EYW A;  1QVF S;  1OYX A;  2K6D A;  2EQK A;  4LN2 A;  3M5A A;  2C06 A;  2CH4 A;  4C0D C;  3I5S A;  3CD6 T;  2I2L A;  3LLR A;  1VYV A;  2H3E B;  1UG1 A;  1KIK A;  4C0F A;  4A4K A;  2LDM A;  2RMO A;  2ZAE A;  3DB3 A;  4C5I A;  1T3L A;  3V7S A;  2HEQ A;  2YUO A;  1N9R A;  2F5T X;  1C6V X;  1LNX A;  1A0N B;  4Y92 A;  4Y91 A;  5FRM A;  3I56 Q;  2KRO A;  2RK1 A;  3C12 A;  4XTU A;  1WHM A;  3I56 A;  1JJ2 A;  5DLQ E;  5GAN 5;  4C0G A;  1XOV A;  2R5M A;  1TXQ A;  2EGA A;  2MPX C;  3ULR B;  3CC7 A;  5GAN 4;  3CC4 T;  2VUB A;  1WJS A;  3FJP A;  3UT1 A;  4N4H A;  3PVL A;  1HJD A;  1MMD A;  2SEM A;  5GAM d;  2LCL A;  1YJW A;  4BAC A;  2L3P A;  2HAX A;  3G71 A;  1RAG B;  1RL2 A;  5L8R E;  5CKH A;  2FO0 A;  3EH2 A;  1W6X A;  1NG2 A;  3CD6 Q;  5GMK l;  4LXC A;  1OUL A;  3H41 A;  2D8J A;  4J9B A;  2RHZ A;  2G3R A;  2YUP A;  4JRI A;  4KT0 E;  1MV0 B;  3M0T A;  4PNO A;  2DYB A;  2RO0 A;  2HKN A;  4JDS A;  3TRE A;  1D0X A;  2C0O A;  1YHQ T;  2HBW A;  4RG8 A;  5CKD A;  1JO8 A;  3JCM V;  5GAM g;  2P84 A;  1OQK A;  1VQP T;  1M3A A;  5LJ3 d;  2P4R A;  3OYJ A;  1K73 U;  4N4I A;  2RQW A;  3BDU A;  5GAN 3;  4M78 F;  3CC4 Q;  1U3O A;  2CT3 A;  2DVE A;  4O5V A;  2F2X A;  2KYM A;  1QVP A;  1YIT T;  4RCB A;  1KQS P;  2DL4 A;  3GIB A;  2JTF A;  1KQS S;  2F69 A;  5DY9 A;  4FT2 A;  2B8A A;  1C0M A;  3GBQ A;  1WNL A;  4DBR A;  2QQS A;  1X6B A;  2CP0 A;  2VC8 A;  1ACM B;  4PFO A;  1YJN A;  2JMC A;  2LRQ A;  5GAN d;  2KVQ G;  3SB2 A;  3PIO A;  4FSS A;  1G3Y A;  3TEE A;  3X26 B;  2FPF A;  3QSU A;  1YHQ Q;  2RHU A;  4C92 F;  2K3B A;  4C8Q C;  2E6N A;  4BE2 A;  4DOW A;  3HTR A;  2EPD A;  2KYB A;  2BE9 B;  1OZ2 A;  4EMH A;  3JB9 H;  1VQP Q;  4D8D A;  2ZCF B;  4PJM A;  4E7Z A;  1NJI R;  2DIL A;  2W0Z A;  2HNI A;  2EJF A;  4Z02 A;  3GOX A;  1M2O A;  4OMO A;  1IXD A;  3JCM b;  1KG1 A;  5GAN f;  1UEC A;  5IAY A;  3FJ5 A;  4ZGD B;  3SWN B;  2OTL T;  2CZ7 B;  1YIT Q;  1NZ9 A;  2CZ0 B;  1ZSZ C;  3MP6 A;  4J83 A;  2LNH B;  4J7F A;  3NPF A;  5GAN g;  2J6F A;  2X3W D;  1GFC A;  1G3W A;  3EG0 A;  1RAE B;  2QI2 A;  5HCK A;  1Q82 U;  5A0L A;  4HCK A;  3CQT A;  5CK9 A;  1KC8 R;  1N9S A;  5IH2 A;  2J05 A;  4OMF B;  1OX9 A;  2VKN A;  3OMG A;  2V26 A;  1D1C A;  5I11 A;  1AWW A;  4M7A B;  4M7D C;  3JAM E;  1M2V B;  1D3B B;  4OGC A;  1VQK T;  3VUB A;  1D1A A;  1OEB A;  4JJC A;  2DIG A;  1KD1 C;  3VRZ A;  1UGR B;  4AG1 C;  3LH0 A;  2EYZ A;  3WXM B;  2VVK A;  4M75 F;  4BE1 A;  2O01 E;  3X28 B;  3M4Y A;  3UPU A;  2DRK A;  2J6K A;  1QLY A;  5M9O A;  1NEG A;  2D0Q B;  3UWN A;  3NHN A;  4JUV A;  1N6A A;  4E7H A;  2OTL Q;  3V8J A;  2LQK A;  1W4S A;  1TUD A;  3CBM A;  2RH2 A;  4J6Y A;  2Y4X A;  2OTL A;  2A7Y A;  2EGC A;  2FRY A;  5AYF A;  4AMC A;  4M78 E;  5IXF A;  2LT1 A;  5GAM j;  4A54 A;  2GCX A;  2LJ0 A;  3JB9 J;  3OYN A;  5CQX A;  1TH7 A;  1O9S A;  1VQK Q;  2DZ9 A;  1JEG A;  1SPK A;  4MML A;  2DAQ A;  1HSQ A;  1D0Y A;  3UA7 A;  4N4G A;  5HY6 A;  1YWO A;  3QJ6 A;  3CCQ T;  1I1J A;  4PLL A;  1O75 A;  1M3C A;  3OYG A;  4MMK A;  5LL6 S;  5GAO p;  3CCJ T;  3NMZ C;  1IGU A;  4F7U F;  4LNP A;  1K4U S;  1WHK A;  4MDX A;  4C92 E;  4OF1 A;  1ZA1 B;  1M30 A;  2L89 A;  1R8O B;  1Y0M A;  1LVK A;  3ZEH A;  1UJ0 A;  2FB7 A;  1Q81 R;  2DK3 A;  4BI4 A;  5FU7 C;  5LJ3 j;  1PRL C;  1Y96 B;  3OYB A;  1VA7 A;  2EIF A;  4PJJ A;  1UE9 A;  2NUP B;  5FWB A;  4JLI A;  3M0S A;  5I2S A;  2YWW A;  3CCV T;  1JXM A;  5KH6 A;  2DER A;  3NGP A;  3JB9 G;  1K73 C;  1GBR A;  1WZO A;  2DFU A;  2DF6 A;  2JT4 A;  3THK A;  4BDZ A;  4LD6 A;  4RCC A;  5CIU A;  2DTI A;  4JZ4 A;  3OYK A;  4PJN A;  4BDY A;  3CCU T;  1K8A U;  3NTH A;  1N8R C;  3TU4 K;  2L0A A;  2DXU A;  2LMJ A;  1VQ4 T;  3L2Q A;  3OYY A;  4FSX A;  3OY9 A;  2LVM A;  1T0J A;  4M77 G;  3JCM P;  1UHC A;  1J3T A;  3I35 A;  3J7A F;  2EQJ A;  3I9Q A;  4TVR A;  2JZ2 A;  3CCQ A;  3LYI A;  4CRI A;  3CCJ Q;  4X34 A;  5GAN 2;  4ZNX A;  1AEY A;  3JCM d;  3M0U A;  1PD0 A;  1UJY A;  1KJW A;  1WFW A;  4XK8 E;  1ZA2 B;  2QA4 T;  3M4G A;  3QZ9 B;  3UAT A;  1UB4 A;  4WTO B;  3O5Z A;  1GXI E;  2RHI A;  3REA B;  2OX7 A;  3LW5 E;  2D1X A;  2M1H A;  2Y90 A;  2JM9 A;  3ZBD A;  4EIK A;  2CH4 W;  3CCV Q;  1FXX A;  1HYO A;  3X24 B;  3QG1 A;  1M1K R;  3OW2 P;  1N27 A;  1WHH A;  1U1T A;  4M77 A;  3JCM f;  1NE8 A;  1M4Z A;  3OW2 S;  2K79 A;  2RHY A;  3MEV A;  3OYM A;  5FLX E;  2BTT A;  3CCU Q;  2V1R A;  1B3Q A;  1PNJ A;  1R77 A;  1PSE A;  3JCM g;  1VQ4 Q;  3EHR A;  2DX1 A;  2MK5 A;  1E6G A;  2COY A;  4FYY B;  1BCM A;  4Z8A A;  2E5Q A;  2WSF E;  2PNI A;  2MOX A;  2VGN A;  3CBO A;  3EG1 A;  3QDF A;  4OMM A;  4RTT A;  3C94 A;  2KK4 A;  3CBP A;  4C8Q G;  4J9D A;  2C0T A;  4OVA A;  3QBY A;  3H0F A;  5LJ5 e;  1WJQ A;  3QKJ A;  3ZL7 C;  4PJO G;  3MKD A;  1W70 A;  1X2Q A;  1PRM C;  2KR3 A;  2ZPI B;  1UEB A;  5GMK e;  4F7U E;  1YCS B;  5CKF A;  2PVO B;  4JS4 A;  2QA4 A;  5FRO A;  1SF9 A;  2L8D A;  4NL3 A;  3QO3 A;  2M51 A;  4YTL A;  1NBE B;  3CEY A;  3N5B B;  1VQL T;  1VQ7 A;  1HD3 A;  3OYC A;  3A8G B;  4L6V 5;  2RHX A;  4K11 A;  2MYS A;  2E65 A;  4ESR A;  3SEM A;  1WHJ A;  2I0N A;  3H0I A;  1VQM A;  3OBW A;  2RJD A;  2CP2 A;  4RUG A;  1MMG A;  3VS0 A;  2GBQ A;  3QJY A;  1U1S A;  4PJO A;  2E5K A;  5IHN A;  4JRK A;  3CC2 A;  4IUT A;  2D6F A;  3Q1J A;  4AT1 B;  1AHJ B;  3URG A;  3UF4 A;  3PNW C;  3S3O A;  2L3R A;  4ELZ C;  2X4Y A;  1SRL A;  1WXT A;  5GAN h;  3FLG A;  3SD4 A;  2LCC A;  1G8X A;  2CUB A;  3CME T;  1IHW A;  3KBG A;  4EMG A;  3QPH A;  5KYX B;  2KDS A;  3OA6 A;  2Z0W A;  1TUG B;  2JNG A;  1X01 A;  4XQ3 A;  3VV0 A;  4AFQ C;  3LGL A;  1BU1 A;  3FDR A;  4WF2 A;  2AHJ B;  2CKK A;  3LGF A;  2E3H A;  1VQL Q;  3E9G A;  4J7I A;  5FU6 C;  4EDU A;  3MET A;  1QQJ A;  1MMN A;  3HHT B;  4XTV A;  2NUZ A;  2QXF A;  3EFR A;  2PUO B;  3S3N A;  2K3X A;  3P8D A;  2QGF B;  4NOY A;  2NUT A;  1KD1 U;  3FC3 A;  2D9T A;  2C0I A;  3S6W A;  4B9W A;  3G6E T;  3V7R A;  1KFZ A;  4XU2 A;  1M27 C;  2O88 A;  2KY9 A;  3DKM A;  1E6H A;  2KGT A;  3VUZ A;  1K8A C;  3EFO B;  2ZGW A;  1EX4 A;  2F1L A;  1X27 A;  3VYG A;  4AG2 C;  4HVU A;  2FRW A;  2BZ8 A;  3CME Q;  4A63 B;  5J26 A;  1JRI A;  2HQX A;  2RN8 A;  1B7T A;  1WYX A;  2G6F X;  3A8L B;  1KQ2 A;  3O8V A;  2YRC A;  4M75 D;  2MIO A;  1BIA A;  2EQM A;  3VU3 C;  4ZN1 A;  2E4H A;  3KUF A;  4C8Q F;  3MPU B;  2EYX A;  1VQN T;  4UC4 A;  5LJ5 j;  2QG9 B;  3CCR T;  3H6Z A;  2FPD A;  2KT1 A;  2ZPB B;  4M75 B;  5GJV B;  5GMK j;  4VUB A;  4XTX A;  5A0D A;  1WI7 A;  3OB9 A;  2YXY A;  3RR6 A;  3G6E Q;  4BI3 A;  1XTD A;  3OYD A;  1I0C A;  2RM4 A;  4M77 C;  1ZUK A;  3CPW P;  2K5L A;  3CD6 A;  3I55 T;  2QYZ A;  3CPW S;  2YSQ A;  1LCK A;  4XU1 A;  2DE0 X;  1VQ6 T;  4J6X A;  4AFU C;  5GAM f;  2FHD A;  1XQH A;  2JMA A;  2COZ A;  4MZP A;  5FRN A;  4ZTJ A;  2KRN A;  1JB0 E;  1G3T A;  2QTX A;  4M7D F;  3SDZ A;  1XJW B;  2EJ9 A;  3H0H A;  4KGV B;  5GJW B;  4XTY A;  2H8H A;  3I5R A;  3HKS A;  2CUD A;  1S72 T;  3HFO A;  2QQ9 A;  4J9H A;  1RLQ C;  2FEI A;  2M0O A;  1V29 B;  1PWT A;  2L3S A;  4IKF A;  1X2K A;  4M77 E;  1VQN Q;  1N8R U;  2R58 A;  3CC4 A;  3CCL T;  1WHG A;  2JTE A;  2KBT A;  4ORZ A;  4JS5 A;  4J6W A;  3CCR Q;  3VJP A;  1W2B A;  1QWE A;  3PT9 A;  4IUR A;  1JJ2 P;  4F7U B;  4IUQ A;  1JJ2 S;  5LJ3 f;  3P8H A;  4HKE A;  2B86 A;  4LDX A;  2RPN A;  2DKG A;  2KEA A;  1Z9Z A;  2XDP A;  1IGQ A;  4BI8 B;  3QDR B;  4QKU A;  2D0N A;  1QMC A;  4OP0 A;  2EFI A;  2LC4 A;  3I55 Q;  2RD1 A;  3CCS T;  5LJ3 g;  1FMK A;  4ELY C;  1VQ6 Q;  1WHL A;  3X25 B;  2QAZ A;  1CKA A;  3I55 A;  2DXT A;  1KQ1 A;  3ER0 A;  5DLO A;  4CI0 C;  1EZZ B;  2AK5 A;  1KHC A;  1NEB A;  2A0F B;  2IVW A;  1YHQ A;  4X9D A;  3MEU A;  4PJO C;  2CDT A;  2LZ6 B;  1NJI U;  2OAU A;  1GRI A;  3VS4 A;  1IO6 A;  2VGM A;  4FYV B;  1VQP A;  4QVZ A;  4HT9 A;  1S72 Q;  4B9X A;  3JCM h;  1C1A A;  4OB3 B;  1OU9 A;  1X6O A;  2KNB B;  2P0K A;  2E70 A;  3EGD B;  4HVV A;  4XTW A;  1OOT A;  5IXB A;  1R0C B;  2GNC A;  4M7A D;  3RES A;  3CCL Q;  2QQA A;  1TSF A;  4RTV A;  1YIT A;  1M90 U;  2DBM A;  1M8M A;  8ATC B;  3OS2 A;  4FCY A;  1K0X A;  4C8Q E;  4RTY A;  2HKQ B;  4HVW A;  1HXD A;  3C0C A;  1OI1 A;  3CMA T;  3NTI A;  2RK2 A;  7AT1 B;  1S1N A;  2XMF A;  4CC4 B;  2W10 A;  4KRT A;  4IUP A;  2F2V A;  4J9F A;  3RKX A;  5GAN e;  3CCS Q;  4II1 A;  1WX6 A;  1GBQ A;  4R56 A;  2NYS A;  2PQW A;  2DM1 A;  2RQU A;  4PKC C;  1SG5 A;  4WCI A;  1QKW A;  4PK4 A;  3CCM T;  2DYI A;  1ZQ1 A;  2R5A A;  3VS3 A;  1Q82 R;  2DVJ A;  4FW1 A;  2V8J A;  2BE7 D;  2OAW A;  1RAC B;  2KSS A;  3NFC A;  1JBM A;  5IT9 E;  4LDY A;  4KUD K;  1WGS A;  4MDW A;  2E3I A;  4Z88 A;  4JJB A;  3EGX B;  3QII A;  2LQW A;  4QW2 A;  5KCO A;  3C4S A;  3V7C A;  4LUE A;  3F70 A;  2PTK A;  2JS0 A;  1G2B A;  2RJF A;  3CCE T;  3M54 A;  3SWN A;  4X1V A;  1SEM A;  2IIM A;  2MWO A;  3RNJ A;  4M7D E;  5KE3 A;  1TG0 A;  5HKC A;  1JU5 C;  2O31 A;  3CXC A;  1SHG A;  2JW4 A;  2EBP A;  2GTJ A;  1OZ3 A;  1PD1 A;  1X6G A;  1BYM A;  1Y71 A;  4OMN A;  1ARK A;  4C5G A;  3CMA Q;  4DBQ A;  4R0K A;  2CP5 A;  4M7A A;  3CPF A;  1M2V A;  1D3B A;  1KK7 A;  5GAO r;  3JCM Q;  3G4S T;  2ED0 A;  1RAF B;  2XIC A;  1VQK A;  2YDL A;  1Q7Y R;  3CCM Q;  4PFZ A;  1Q86 R;  2K9G A;  1UGQ B;  4LDU A;  2EGE A;  3J81 E;  1RAI B;  3VS1 A;  4DEY A;  1PKS A;  3GF5 A;  1N5Z A;  2HQE A;  1NLP C;  3RUX A;  4AFZ C;  2HDA A;  2RNA A;  5HK0 A;  4IUV A;  1BB9 A;  2XHC A;  4ZGE B;  2LX9 A;  2DEU A;  1Q81 U;  3TQ7 P;  4DBH A;  1BK2 A;  1PC0 A;  2CP7 A;  3JSC A;  4FIB A;  3CCE Q;  2Y4Y A;  1RUW A;  2K3Y A;  5I21 A;  3GNG A;  3REB B;  1V1C A;  3TCJ A;  1VQ8 T;  2O4X B;  1I4K 1;  4JRQ A;  2BKD N;  2FYK A;  1AWO A;  1PCX A;  2BIV A;  4A4E A;  4BE0 A;  2XI9 A;  2EKO A;  2EKH A;  4KH1 B;  1VQ9 T;  3IQL A;  2QEX T;  3VYH B;  1OX8 A;  1TU0 B;  1WQ7 A;  1VQO T;  5GMK m;  3M59 A;  2LJ3 A;  2CYZ B;  2YT6 A;  2A37 A;  3J80 E;  1H64 1;  3BFM A;  3L2W A;  4M4Z A;  2RB6 A;  1NYG A;  3G4S Q;  3ASK A;  4QVC A;  1X43 A;  1FX7 A;  2RA2 A;  3M58 A;  2DL3 A;  5KYW B;  2MF2 A;  4FYX B;  3E1S A;  1YCY A;  1K8A R;  1EFN A;  4ZGJ B;  3CCJ A;  5C0M A;  2HCK A;  2EWN A;  5FW9 A;  1ZX6 A;  5GMK i;  2NLU A;  2ZPF B;  1D0Z A;  1VQ8 Q;  2O4X A;  1GCQ A;  4ZN3 A;  1Y96 A;  2LQN A;  1NJI C;  3U23 A;  2DXC A;  2FZK B;  3EFS A;  2WSE E;  2NUP A;  1M1K U;  5LJ5 d;  1I07 A;  2CRE A;  3L2Z A;  2CSI A;  2ESW A;  1VQ9 Q;  2QEX Q;  1AWX A;  1T3S A;  1WXB A;  1H8K A;  4RTZ A;  4J9C A;  1VQO Q;  1UGS B;  1AD5 A;  3CCV A;  3PGG A;  3EG9 B;  4IIO A;  1D1B A;  1K0S A;  3UDC A;  5GAO m;  1E7O A;  4HCB A;  2P4T A;  3D7S B;  3LH5 A;  4QQD A;  1T0H A;  4OMQ A;  5GAM h;  3CCU A;  2LJ1 A;  1M90 C;  1P92 A;  1UGV A;  2GQI A;  1OU8 A;  1YI2 T;  3A5Z B;  4FM4 B;  1VQ4 A;  1UHF A;  4F17 A;  1U8R A;  3OQ5 A;  3R6O A;  1GL5 A;  2DRM A;  1VIF A;  1YJ9 T;  2BZY A;  4PLI A;  1GFD A;  2SRC A;  3HPW A;  3QYH B;  1CSK A;  1AWJ A;  4OMP A;  5I2M A;  4C8Q B;  1OPK A;  1U06 A;  3MEA A;  5LJ5 g;  3HP9 A;  3RMQ A;  5D6X A;  5CKE A;  4HCZ A;  3HRU A;  2F2W A;  3V8L A;  1BCO A;  3M0R A;  2YRV A;  1IRE B;  1M8V A;  1BI0 A;  4LDV A;  1ZUU A;  4L59 A;  1K9M U;  3A98 A;  3SHW A;  1TOV A;  1ZSZ B;  4HA8 A;  1XNI A;  1H92 A;  2YRD A;  2CS7 A;  4M7D D;  5EG2 A;  4RMO A;  3LWH A;  1AOJ A;  2P0P A;  3FIF A;  5LJ3 h;  3ME9 A;  1QVG A;  1SHF A;  2EW3 A;  5CO7 A;  2DTO A;  2KT8 A;  4ANJ A;  4LD9 K;  1Y07 A;  2JJ9 A;  3GNF B;  1QVF A;  4M78 D;  2K5I A;  3SWN C;  2K5F A;  3JV3 A;  5IN1 A;  2XKO C;  3A8H B;  4C5E A;  4M7D B;  1AVZ C;  3OYF A;  1YI2 Q;  2EVR A;  4IUU A;  1VQ5 T;  2YLB A;  2AKL A;  1YI2 A;  1YJ9 Q;  4RTU A;  4M78 B;  3JB9 F;  3M9Q A;  2EYQ A;  5GAN 6;  2OTJ T;  3PIP A;  1OV3 A;  2XK0 A;  4M7A C;  2EAY A;  1M3B A;  3DLL A;  5A2Q E;  2CZ6 B;  1PG5 B;  1NLO C;  4C0Z A;  2KRS A;  4RTX A;  4J9E A;  1FMV A;  4C92 D;  2ENM A;  1UFF A;  2CP3 A;  4M77 F;  4CC2 A;  1K76 A;  1WPY A;  3E2U A;  3JRZ A;  1I5L A;  2DTH A;  2HL5 C;  4GLK A;  3MP8 A;  3TVT A;  2KAF A;  1Q81 C;  2PUK B;  2K2V A;  2DA9 A;  2PVG B;  1VQL A;  3EHQ A;  4C92 B;  2DL5 A;  2MMP A;  3CC7 T;  3EH1 A;  1ZBJ A;  2XID A;  1ZHI A;  1YJW T;  4V2S A;  1LPL A;  1IRX A;  1VQ5 Q;  4DEX A;  4A4G A;  3JB9 I;  2HD0 A;  4A53 A;  3G71 T;  4EMK B;  1VYU A;  1VQ5 A;  4M78 A;  2DMO A;  4N0A A;  4ZTF A;  5D7U A;  2HQH A;  2OTJ Q;  2L2P A;  4P5N A;  3HRT A;  1G3S A;  1VOM A;  2XU8 A;  2PZ1 A;  1KD1 R;  2OTJ A;  5GAO n;  2WSC E;  3TSZ A;  2KQW A;  2YLC A;  2YUN A;  1UUE A;  4GBQ A;  1ZUY A;  5KYX A;  4NS5 A;  3CME A;  4BY6 B;  3QHS A;  1SRM A;  5HK3 A;  3VS6 A;  4Q5W A;  1DJ7 B;  3WVE B;  2M0Y A;  2BZX A;  5FU7 B;  3OYE A;  3DB4 A;  2E41 A;  3E9F A;  3HL8 A;  2DEQ A;  2L3Q A;  1KQS A;  3EG2 A;  2ROL A;  3EG3 A;  4Y28 E;  1QCO A;  4J5Y A;  4PJO F;  2KI7 A;  4C92 A;  1LJO A;  3G7Z A;  3M57 A;  4XAX B;  3CC7 Q;  4BD3 A;  2E1H A;  1GCQ C;  1M1K C;  2MWP A;  1YJW Q;  2MCN A;  3OBY A;  1BI1 A;  1BI3 A;  1ZSG A;  2DL8 A;  2R57 A;  2ED1 A;  2EQI A;  3G71 Q;  4EMK A;  2CP6 A;  3G6E A;  4GY5 A;  2QQB A;  4E7L A;  1W1F A;  3M56 A;  3GPL A;  3EFO A;  5CKB A;  3RKW A;  4M75 G;  4E6R A;  2QQR A;  4B6M A;  1I5O B;  4D8K A;  1IB8 A;  1R0B G;  1YJN T;  2X51 A;  4NL2 A;  1VIE A;  3OYA A; 
#chains in the Genus database with same CATH homology
 4CRI A;  4X34 A;  5GAN 2;  4M78 G;  3JCM d;  3QII A;  4EPC A;  3L2V A;  4QW2 A;  2GFA A;  3M53 A;  5KCO A;  3C4S A;  1WQW A;  1M1F A;  3V7C A;  5J39 A;  3HSB A;  1M1G A;  2YHT A;  4DQ2 A;  3JCM c;  3F70 A;  2XDB A;  2A3L A;  2DD5 A;  1QP3 A;  4RKU E;  4XK8 E;  2RJF A;  3CCE T;  3M54 A;  5KCH A;  4JJN K;  2ZZD A;  2QA4 T;  3M4G A;  3SWN A;  3QZ9 B;  3EAE A;  2X4X A;  1UB4 A;  2MWO A;  4M7D E;  5KE3 A;  1HK9 A;  4E47 A;  2E12 A;  3I56 T;  1GXI E;  2RHI A;  5HKC A;  3LW5 E;  4MZT A;  5GAM e;  3CXC A;  1K9M C;  2M1H A;  1IZ6 A;  2Y90 A;  4XTZ A;  4O6J A;  3ZBD A;  3JCM W;  4M75 A;  4M7A E;  1VQN A;  1OZ3 A;  2JN0 A;  1FXX A;  3OYI A;  1BYM A;  2RJC A;  1Y71 A;  3QG1 A;  3X24 B;  3CCR A;  4M7D A;  3QZ5 B;  1N27 A;  2RI3 A;  1U1T A;  4M77 A;  3JCM f;  1NE8 A;  4C5H A;  3OS5 A;  3FEO A;  4C5G A;  1M4Z A;  3OW2 S;  2RHY A;  5GAN 8;  3MEV A;  3JCM X;  3OYM A;  2F5K A;  1Y7X A;  5FLX E;  2OTJ A;  3BY7 A;  3CPW A;  1QVG S;  4M7A A;  3MO8 A;  2BUD A;  3CPF A;  3PMI A;  3RER A;  1D3B A;  4C92 G;  1PSE A;  2CZ1 B;  5GAO r;  5D6Y A;  3JCM Q;  3G4S T;  2LNV A;  3JCM g;  4QQ6 A;  2XIC A;  2CGH A;  1QVF S;  1OYX A;  2EQK A;  2K4Y A;  1NPR A;  3RIR A;  1VQK A;  2HBP A;  3M5A A;  2C06 A;  4F7U G;  1VQ6 A;  3PFS A;  4C0D C;  3CD6 T;  2I2L A;  1UGQ B;  1UGP B;  2E5Q A;  4LDU A;  3LLR A;  2WSF E;  5A0G A;  3FRN A;  4C0F A;  2X4W A;  4A4K A;  3J81 E;  2VGN A;  2LDM A;  3CBO A;  5GAO l;  3C94 A;  3DB3 A;  3GF5 A;  4C5I A;  2HQE A;  2KK4 A;  3L42 A;  1PSF A;  3CBP A;  3NTK A;  3RUX A;  1M5Q 1;  4IUV A;  4KUI A;  1N9R A;  4C8Q G;  2XHC A;  4ZGE B;  5HK0 A;  5LJ3 e;  2LX9 A;  2EJG A;  4OVA A;  3S3M A;  3QBY A;  2F5T X;  1WJQ A;  5LJ5 e;  1Q81 U;  3QKJ A;  1LNX A;  4PJO G;  2X4J A;  3LX7 A;  3JSC A;  4FIB A;  2Y4Y A;  4JLG A;  2K3Y A;  2GF7 A;  2ZPI B;  5I21 A;  1UEB A;  3GNG A;  1S72 A;  2DD4 A;  5GMK e;  3TCJ A;  5CKF A;  4Y91 A;  4F7U E;  1VQ8 T;  2O4X B;  3JCM J;  2RI5 A;  1I4K 1;  2BKD N;  3BDL A;  2FYK A;  4JRQ A;  2PVO B;  4JS4 A;  2QA4 A;  2M16 A;  3PMT A;  1LOJ A;  1I81 A;  2RK1 A;  5FRO A;  3C12 A;  2BIV A;  2P0Q A;  2L8D A;  4A4E A;  4MZM A;  4NL3 A;  4XTU A;  3QO3 A;  4YTL A;  5CVI A;  5KE2 A;  2XI9 A;  4BE0 A;  1JJ2 A;  3I56 A;  3CEY A;  5DLQ E;  3N5B B;  2EKO A;  4X9C A;  5GAN 5;  3CCL A;  4C0G A;  1XOV A;  3MCA B;  2R5M A;  1VQ9 T;  1KC8 U;  2QEX T;  3VYH B;  1VQL T;  1VQ7 A;  4F7U A;  3OYC A;  1WQ7 A;  3CC7 A;  3A8G B;  4L6V 5;  5GAN 4;  3CC4 T;  2VUB A;  2RHX A;  4XU3 A;  1WJS A;  3FJP A;  5LJ5 h;  1VQO T;  5DM7 R;  3UT1 A;  5GMK m;  4PJO E;  4N4H A;  4A4H A;  3M59 A;  2E65 A;  2CYZ B;  5GAM d;  2LCL A;  3J80 E;  1H64 1;  1YJW A;  4BAC A;  3BFM A;  3L2W A;  2RB6 A;  5GMK h;  1VQM A;  2XG8 D;  3OBW A;  2HAX A;  2RJD A;  4L5G A;  3ASK A;  2ZPH B;  4QVC A;  3G71 A;  3OYL A;  3QJY A;  1U1S A;  4PJO A;  1RL2 A;  2JOY A;  2RJE A;  1FX7 A;  2VXF A;  5L8R E;  3CCS A;  4JRK A;  2JVV A;  4FL6 A;  1W2B S;  5CKH A;  2RA2 A;  1VUB A;  3M58 A;  3OS1 A;  5GMK l;  3CC2 A;  4IUT A;  3OYH A;  1YBY A;  2D6F A;  3Q1J A;  3M55 A;  2K57 A;  2RHZ A;  2G3R A;  2VXE A;  1AHJ B;  4JRI A;  4KT0 E;  2MF2 A;  4M7A G;  4QVD A;  5FRM A;  3URG A;  4PNO A;  3E1S A;  3PNW C;  1YCY A;  2RO0 A;  3S3O A;  2L3R A;  4ZGJ B;  4JDS A;  4ELZ C;  2X4Y A;  3TRE A;  5C0M A;  3CCJ A;  4E7I A;  5GAN h;  4OB1 B;  4E7J A;  4DOV A;  2V8K A;  3FLG A;  2EWN A;  4J8O A;  4M78 C;  3SD4 A;  1YHQ T;  4N0A C;  5GMK i;  2LCC A;  2NLU A;  3X20 B;  1B34 B;  2ZPF B;  3CME T;  4RG8 A;  2LTO A;  3AHU A;  3OYA A;  3KBG A;  4EMG A;  2O4X A;  3QPH A;  5CKD A;  2JTM A;  3L2R A;  2KDS A;  2KMT A;  3JCM V;  4ZN3 A;  5FU6 B;  2E10 A;  5GAM g;  1Y96 A;  1VQP T;  1NJI C;  2DXC A;  3OSV A;  3OA6 A;  3EFS A;  3VV0 A;  2JNG A;  2WSE E;  1X01 A;  4XQ3 A;  5LJ3 d;  3LGL A;  1M1K U;  5LJ5 d;  4WF2 A;  3FDR A;  2AHJ B;  3L2Z A;  3OYJ A;  1K73 U;  2CKK A;  3LGF A;  4N4I A;  3E9G A;  4J7I A;  4KBM B;  5FU6 C;  4EDU A;  3BDU A;  5GAN 3;  3V7S A;  2DO3 A;  4M78 F;  3MET A;  2DVE A;  1UGS B;  3QYG B;  4O5V A;  2QDY B;  3CCV A;  3PGG A;  1QVP A;  1YIT T;  4RCB A;  3HHT B;  2MAM A;  4XTV A;  2QXF A;  3EFR A;  3GIB A;  2PUO B;  2JTF A;  1KQS S;  3S3N A;  3A8M B;  2WAC A;  3UDC A;  2K3X A;  2E64 A;  2H3J A;  3P8D A;  5GAO m;  3CMA A;  3MP1 A;  4RG2 A;  4HCB A;  2P4T A;  2F69 A;  3MEW A;  3QUI A;  4C0D B;  4QQD A;  4NOY A;  5DY9 A;  1Q7Y U;  4FT2 A;  2B8A A;  3FC3 A;  1KD1 U;  5GAM h;  3A8O B;  3CCU A;  1Q86 U;  2D9T A;  1M90 C;  1P92 A;  4C92 C;  1YI2 T;  1M9S A;  1WNL A;  3S6W A;  4B9W A;  4KUL A;  3A5Z B;  2QQS A;  4FM4 B;  3V7R A;  3G6E T;  1VQ4 A;  1U8R A;  3OQ5 A;  2VC8 A;  3R6O A;  4OB2 B;  4XU2 A;  1YJN A;  2KY9 A;  3CCM A;  1VIF A;  1YJ9 T;  2LRQ A;  2V8I A;  4PLI A;  3DKM A;  3HPW A;  2KVQ G;  4LDW A;  3SB2 A;  3QYH B;  5GAN d;  3PIO A;  3GP8 A;  5I2M A;  4C8Q B;  3MHX A;  1G3Y A;  3VUZ A;  1K8A C;  3TEE A;  4FU6 A;  2ZGW A;  3X26 B;  3MEA A;  5LJ5 g;  3QSU A;  4XU0 A;  3HP9 A;  3RMQ A;  1H3Z A;  5D6X A;  3JB9 D;  4EMK C;  5CKE A;  2RHU A;  4HCZ A;  3VYG A;  4C92 F;  4FT4 A;  3HRU A;  3V8L A;  2VV5 A;  4C8Q C;  2E6N A;  5GAN 7;  4BE2 A;  1QW1 A;  4DOW A;  1B34 A;  4E7K A;  2GQV A;  3OS0 A;  5J26 A;  2YRV A;  1IRE B;  1JRI A;  1BI0 A;  4LDV A;  2HQX A;  3LWH A;  3CCE A;  4L59 A;  1K9M U;  1M8V A;  1OZ2 A;  4EMH A;  3LWI A;  3JB9 H;  2ZCF B;  3A8L B;  1KQ2 A;  3O8V A;  4M75 D;  2HNI A;  2DPP B;  2EJF A;  4Z02 A;  3GOX A;  1BIA A;  2EQM A;  4HA8 A;  3JCM b;  3SFM A;  1XNI A;  5GAN f;  3OW2 A;  3VU3 C;  2CS7 A;  4M7D D;  1KG1 A;  3HFN A;  5EG2 A;  4ZN1 A;  2P0P A;  5IAY A;  3FIF A;  5LJ3 h;  4M77 D;  4ZGD B;  4RMO A;  4BY6 C;  3ME9 A;  3SWN B;  2OTL T;  1QVG A;  2CZ7 B;  3KUF A;  5CO7 A;  2DTO A;  4C8Q F;  1NZ9 A;  2CZ0 B;  4LD9 K;  3INZ A;  3MP6 A;  1Y07 A;  5C6S A;  4J83 A;  4OB0 B;  1VQN T;  4UC4 A;  3GNF B;  2EQU A;  4J7F A;  4M78 D;  3RMS A;  5LJ5 j;  1QVF A;  2K5I A;  3SWN C;  5GAN g;  2K5F A;  3CCR T;  3H6Z A;  2ZPB B;  4M75 B;  2ZPG B;  5IN1 A;  1G3W A;  2XKO C;  3CXC S;  3A8H B;  2QI2 A;  4C5E A;  1Q82 U;  5GMK j;  4M7D B;  3OYF A;  4VUB A;  4M77 B;  5A0L A;  4XTX A;  3G4S A;  5CK9 A;  5A0D A;  3OB9 A;  3L1A A;  4IUU A;  1N9S A;  4M75 C;  4OMF B;  4BI3 A;  1VQ5 T;  3OMG A;  1XTD A;  4OGE A;  2YLB A;  2XDD A;  1MGQ A;  3OYD A;  1YI2 A;  2RM4 A;  4M7A B;  4M7D C;  3JAM E;  1D3B B;  4M77 C;  4M78 B;  3JB9 F;  2K5L A;  3FB9 A;  3M9Q A;  3CD6 A;  4OGC A;  2EYQ A;  1VQK T;  3I55 T;  5GAN 6;  2IG0 A;  2OTJ T;  3CPW S;  3PIP A;  2JUF A;  1YIJ T;  4XU1 A;  2M9U A;  2VYT A;  2XK0 A;  4J6X A;  3VUB A;  2FL7 A;  3L2U A;  1VQ6 T;  2DIQ A;  5GAM f;  2LT4 A;  5CQY A;  4M7A C;  2DIG A;  1KD1 C;  1UGR B;  2EAY A;  2PU9 B;  3DLL A;  2XD0 A;  2FHD A;  2CZ6 B;  5A2Q E;  3LH0 A;  1XQH A;  3WXM B;  4MZP A;  4C0Z A;  5GAN j;  5FRN A;  4M75 F;  4ME7 A;  2DJZ A;  4ZTJ A;  4BE1 A;  2O01 E;  2DXB A;  1JB0 E;  1G3T A;  1QP2 A;  2QTX A;  4C92 D;  2DZC A;  3X28 B;  2X35 A;  4M7D F;  3M4Y A;  3SDZ A;  3UPU A;  4M77 F;  3BW1 A;  1VQ8 A;  2EJ9 A;  1WPY A;  4XTY A;  1FWZ A;  5M9O A;  3JRZ A;  3HKS A;  1I5L A;  2E6Z A;  2DTH A;  1S72 T;  2D0Q B;  5CAI A;  3UWN A;  3HFO A;  4GLK A;  3OSS C;  4JUV A;  2QQ9 A;  1N6A A;  3MP8 A;  4M7A F;  4M75 E;  2KAF A;  1Q81 C;  2PUK B;  1MHN A;  2M0O A;  1V29 B;  2K2V A;  1BKB A;  2LQK A;  3V8J A;  4E7H A;  2PVG B;  1VQ9 A;  1W4S A;  1VQL A;  2QEX A;  3CBM A;  1G5V A;  4IKF A;  2RH2 A;  4J6Y A;  4M77 E;  1BIB A;  4C92 B;  1N8R U;  2R58 A;  2Y4X A;  3CCL T;  3CC4 A;  2OTL A;  1VQO A;  4DA4 A;  2A7Y A;  3H8Z A;  4JS5 A;  2PVD B;  4J6W A;  2MMP A;  5D6W A;  5AYF A;  4C8Q D;  1VQ7 T;  2FVU A;  3CC7 T;  4QQG A;  3VJP A;  1W2B A;  2XID A;  2L5Q A;  3PT9 A;  4IUR A;  3DLM A;  1ZHI A;  4M78 E;  4PJO D;  4F7U B;  4IUQ A;  3HRS A;  1JJ2 S;  5GAO q;  5LJ3 f;  3P8H A;  1YJW T;  2LT1 A;  1KC8 C;  4V2S A;  4HKE A;  4LDX A;  5GAM j;  5LJ5 f;  1VQM T;  4A54 A;  2GCX A;  4PL6 A;  4A4G A;  3JB9 I;  3JB9 J;  2HD0 A;  3OYN A;  4A53 A;  2DKG A;  5CR2 A;  2XDP A;  5CQX A;  3G71 T;  1TH7 A;  1O9S A;  3QDR B;  4BI8 B;  4EMK B;  1VQ5 A;  4M78 A;  4OP0 A;  4BUG A;  2EFI A;  2LC4 A;  2DZ9 A;  4N0A A;  4ZTF A;  2RD1 A;  3CCS T;  5J3B A;  5LJ3 g;  4ELY C;  3ZFJ A;  4MML A;  3JCM e;  4P5N A;  2DAQ A;  3X25 B;  3HRT A;  4PJO B;  3CC2 T;  1G3S A;  2XU8 A;  4N4G A;  3I55 A;  1KHI A;  2DXT A;  1KQ1 A;  5HY6 A;  3QJ6 A;  5GAO n;  3CCQ T;  2WSC E;  3ER0 A;  5DLO A;  3RKY A;  1YIJ A;  3QXE B;  1Q82 C;  4CI0 C;  4PLL A;  4R55 A;  1KHC A;  2MI6 A;  1O75 A;  2KQW A;  3OYG A;  2YLC A;  2IVW A;  3E19 A;  3CCQ A;  5CCA A;  4X9D A;  1YHQ A;  3MEU A;  4MMK A;  4PJO C;  5LL6 S;  1NJI U;  2ZPE B;  1EIF A;  5GAO p;  3CCJ T;  4NS5 A;  2OAU A;  3CME A;  4F7U F;  4BY6 B;  3QHS A;  5HK3 A;  4MDX A;  2LQ8 A;  2VGM A;  4Q5W A;  1DJ7 B;  3T9N A;  3WVE B;  4C92 E;  4OF1 A;  1VQP A;  2L89 A;  1R8O B;  4QVZ A;  4HT9 A;  5FU7 B;  3ZEH A;  3DB4 A;  2E41 A;  4B9X A;  3OYE A;  3JCM h;  2FB7 A;  4OB3 B;  3E9F A;  3HL8 A;  3PTA A;  2DEQ A;  1KQS A;  1X6O A;  2DK3 A;  1SSF A;  2P0K A;  2E70 A;  4BI4 A;  4XTW A;  4ATO A;  1RI0 A;  1WJR A;  4Y28 E;  5FU7 C;  5LJ3 j;  4J5Y A;  4M7A D;  4PJO F;  3RES A;  4C92 A;  1Y96 B;  2QQA A;  3OYB A;  2EIF A;  4D6W A;  1LJO A;  1YIT A;  3G7Z A;  3KXT A;  3M57 A;  4XAX B;  4BD3 A;  4JLI A;  1M90 U;  5I2S A;  3WVD B;  2E1H A;  3C95 A;  3V8K A;  3CCV T;  4HCC A;  3OS2 A;  5KH6 A;  1M1K C;  2MWP A;  1NPP A;  4C8Q E;  3JB9 G;  4HT8 A;  1K73 C;  3GLX A;  1HXD A;  1OI1 A;  3CMA T;  3OBY A;  3NTI A;  1BI1 A;  1BI3 A;  3OMC A;  2R57 A;  2RK2 A;  4BDZ A;  4LD6 A;  4RCC A;  5CIU A;  2DTI A;  3OYK A;  4BB7 A;  4BDY A;  1ZBX A;  3CCU T;  3P8B B;  4IUP A;  4EMK A;  3G6E A;  1K8A U;  3NTH A;  1N8R C;  3TU4 K;  3RKX A;  1X75 C;  4GY5 A;  5GAN e;  4C8Q A;  4II1 A;  2QQB A;  2DXU A;  3M56 A;  4E7L A;  3GPL A;  4JRP A;  1YJ9 A;  3RKW A;  5CKB A;  4R56 A;  4M75 G;  1VQ4 T;  3L2Q A;  2QQR A;  3OYY A;  2PQW A;  1Q7Y C;  4PKC C;  2GFU A;  4FSX A;  3OY9 A;  2LVM A;  2RI2 A;  1YJN T;  3VKI A;  1Q86 C;  3CCM T;  4M7D G;  1ZQ1 A;  2R5A A;  4M77 G;  1I8F A;  2V8J A;  3JCM P;  4NL2 A;  1BI2 A;  2KSS A;  3NFC A;  1JBM A;  4A4F A;  5IT9 E;  4LDY A;  3J7A F;  2EQJ A;  4KUD K;  4TVR A;  1VIE A;  1WGS A;  2JZ2 A;  4MDW A;  3LYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...