3BW1A

Crystal structure of homomeric yeast lsm3 exhibiting novel octameric ring organisation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
86
Chain Sequence
HHMETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSAVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Lsm3 octamer from Saccharomyces cerevisiae: implications for Lsm ring organisation and recruitment
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm3
total genus 15
structure length 86
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3bw1A00
4XU1A 4DQ2A 4C92F 2E41A 4M7DC 2YLCA 3QUIA 4F7UE 5LJ5j 5GAOq 4X9CA 2DTHA 4M77B 2EJFA 4N0AA 4J6WA 4M77E 1BIAA 2YLBA 4XTVA 4XTYA 5LJ5h 1N9RA 3SWNA 3JCMh 3AHUA 4M7DG 4M78C 1N9SA 4EMKB 4M7AD 1Y96A 5GAN6 4PJOD 2DEQA 5GAMg 4M78B 4EMKC 4C8QF 3V7SA 3SB2A 5GAMe 5LJ5f 2RA2A 3QSUA 5GANd 4M7DD 4PJOA 5LJ3e 3JCMe 3FIFA 4M77A 3BY7A 4QVCA 4EMHA 2I2LA 2EAYA 1KQ1A 2VC8A 3M4GA 1WQ7A 1JBMA 4C8QB 4Y91A 5GAMh 1YCYA 1H641 4XTWA 5GAOn 3PGGA 5GANh 3L2ZA 5LJ3h 4HT9A 5CAIA 3JCMW 2DZCA 4J6YA 4C92E 4F7UB 3V8LA 5GMKl 3GIBA 4PJOB 3JCMc 2FYKA 3VU3C 3JCMb 5GANg 4M7AA 3JB9J 5GMKm 4XU0A 4HT8A 5GANe 1I8FA 5GAOm 5GAMd 4JRKA 3JCMf 1D3BB 4HA8A 4M75A 1B34A 4RCCA 5GAN5 4M7AG 3RKWA 2CGHA 3BFMA 3QO3A 4NL2A 4XQ3A 2ZGWA 4F7UA 2HNIA 3HFOA 3JB9I 4C92B 2DTIA 5LJ3f 4M78A 4M7DB 1I81A 4PNOA 2DTOA 3JB9H 4C92C 5GAN8 2EJGA 1LOJA 5GAMf 5GAOp 2VXEA 4M77F 4QVDA 2JN0A 1I4K1 4OP0A 3JB9F 5LJ5g 4M7DF 1M8VA 2DZ9A 3QHSA 4WF2A 1HXDA 3RESA 5LJ5d 3JCMQ 3FJPA 5GMKh 4V2SA 2RD1A 5DY9A 3RKXA 4PJOF 3RUXA 4M75G 3HFNA 3FB9A 3V8JA 1HK9A 1U1SA 4J5YA 5LJ3j 4M77C 1JRIA 1M5Q1 5GAOr 1I5LA 3V8KA 4M75D 4M7DE 4C92A 4F7UG 2RM4A 5GMKe 4M77G 4PJOG 5GAN2 5GANj 1WQWA 2DJZA 4JRIA 5GAMj 1D3BA 3EFRA 5GANf 1B34B 4X9DA 3INZA 2DVEA 4M78D 5GAOl 3RIRA 1WPYA 4M7AC 3JB9D 3V7RA 4PJOC 3JCMJ 4A54A 2EWNA 4XTXA 2RB6A 5LJ3d 4M77D 1BIBA 2FB7A 4M78G 2E64A 1X01A 1LJOA 4M75E 4XTUA 2K57A 3SWNB 3JCMV 4EMKA 5GMKi 4JLIA 1TH7A 4M7DA 1WNLA 3BW1A 4MMKA 5GAN7 5I21A 4PJOE 4NOYA 4C8QC 4C92G 5GAN3 3BDUA 5LJ3g 1MGQA 4M78E 4XTZA 3RERA 3V7CA 4NL3A 2VXFA 4C92D 4M78F 2DKGA 4N0AC 1U1TA 4A53A 4C8QG 4EMGA 4MMLA 2DXUA 2QTXA 3L1AA 3JCMd 1Y96B 5GAN4 2E10A 4C8QE 4F7UF 3JCMX 2YHTA 1KQ2A 3EFSA 4XU3A 4M75F 2DXTA 2EJ9A 3JB9G 4C8QD 2Y90A 4RCBA 4M7AE 2E65A 3SWNC 3HSBA 1LNXA 5LJ5e 4M75B 4M7AF 4XU2A 5GMKj 4J6XA 3RKYA 3JCMg 4M7AB 4C8QA 2E1HA 3JCMP 4JUVA 4M75C
chains in the Genus database with same CATH superfamily
3OS2A 2F5KA 1HD3A 1QVFP 2OTLQ 2EGAA 2FPDA 2KSSA 3QDFA 3ZBDA 5GAN6 3HRSA 1NBEB 1SEMA 1UE9A 4OB3B 2K3XA 1Q82C 2D8HA 4FU6A 1YHQT 2I2LA 2B86A 4E47A 3EGDA 2VB6A 1AEYA 1DJ7B 3L2ZA 2QTVA 1KC8R 2MK5A 5CAIA 4C92E 2LNHB 3OMCA 4LUDA 1C6VX 3CCSQ 4BACA 2R5AA 2FYKA 4PLLA 1KSWA 5GAOm 2P0PA 1M4ZA 2QEXA 1D1CA 4K11A 2ZGWA 2DFUA 2DTIA 1O75A 1M1KR 3OYBA 4JZ3A 1LOJA 1WFWA 3DB3A 1R0BG 3J81E 4JJNK 2ATCB 4A4HA 3SDZA 2XK0A 2VVKA 5DLQE 3V8JA 3PIPA 1OI1A 5ECAA 4AT1B 2QA4T 3EFOA 2X4JA 2L0AA 2FPFA 2MIOA 1JXMA 4KBMB 2XICA 1QVPA 4LN2A 1K73U 4RUGA 2YSQA 4PJOC 4PFPA 2FB7A 2IIMA 4RTUA 2K57A 3G71T 4EMKA 3L2QA 1K9MC 4IUUA 4KUDK 4KH1B 3CPWP 3P8DA 2JS0A 2RPNA 4N0AC 3UF4A 3OYIA 4Z8AA 2QTXA 2E10A 4BE1A 3CC7T 4GBQA 1NJIU 2KT1A 1VQ7T 1MV0B 2LC4A 2FPEA 4RTTA 3HSBA 1SHGA 2CP0A 5A0DA 4J6XA 2WSCE 4OB0B 3L42A 1H8KA 2R5MA 1FMWA 1VQ4Q 1BCOA 2AZSA 3SWNA 1TSFA 2CYZB 1YNZA 1VQ5Q 2LCCA 3SB2A 4KT0E 1MMNA 3G4ST 2IPOB 2RI5A 4JJBA 4LD6A 3TQ7P 4F7UB 1WJQA 4HCKA 3CCVQ 1PCXA 1OPKA 1T0JA 2FHDA 1OPLA 2K4YA 3RKWA 3UWNA 1TUCA 4C92B 3PMIA 5FRNA 1YITT 3H8ZA 1SHFA 2EKOA 1D0YA 2LQKA 2FL7A 3TCJA 2CUDA 5A0GA 1VQ5T 3HP9A 2DD4A 3CCST 3MKDA 4LD9K 2KXDA 2O88A 3FEOA 3GP8A 2LZ6B 1X43A 4M7DE 4J83A 5FLXE 4KULA 3L2UA 1Q7YC 3GLXA 1B34B 3INZA 4M7AC 3E2UA 1M30A 3SFMA 3ER0A 2NYSA 2D9TA 2L3PA 1VQ9T 2VV5A 5CQYA 5I21A 3UA6A 3D7SB 1KD1R 2CUBA 1QCOA 2DPPB 3MHXA 4JLGA 3NHNA 1OX9A 3MEAA 1VQKT 1QVGS 5A0LA 2LMJA 1KHCA 3N5BB 2DEUA 2E65A 3S3NA 4M7AE 2HL5C 4M75B 1VQ8Q 1UTIA 3AT1B 4KGZB 3JCMP 3CXCA 2YLCA 1B07A 1UFFA 2CS7A 2ZAEA 2HCKA 4E6RA 3MEWA 2EVRA 2LQ8A 1H3ZA 5KYXB 2ROLA 2HBWA 4PJNA 2K7AA 3PFSA 2EAYA 2DETA 1WHKA 4L59A 2KK4A 4E7LA 3V8LA 1NEGA 1KIKA 4DBRA 3JCMb 1VQPQ 1X2QA 3G6EA 1HSQA 1B34A 3OSSC 4XQ3A 2A36A 1VOMA 1BI3A 2FVUA 3MEVA 3UDCA 1NLOC 2M9UA 1Y0MA 3EG9A 4KRTA 2DM1A 2PVDB 1YJWQ 1E6GA 3M0UA 1TWBA 4Z02A 1NYFA 2HBPA 2X35A 3RESA 1Y07A 2KROA 4DOWA 3FJPA 3NTKA 3OYAA 3CCUQ 1NPPA 2BZ8A 4M75G 1IO6A 2ABLA 2BKDN 1WI7A 4JRPA 1QP3A 3V8KA 1M1GA 1N8RR 3LX7A 1Q86C 2L8DA 1G83A 1D1AA 4N4IA 5IT9E 5LJ3d 5GMKi 3NMZC 2LQNA 2KYMA 3X28B 1WNLA 1VQNT 2H8HA 1WHHA 2QAZA 3M58A 3ULRB 2M02A 4XTZA 4VUBA 3H6ZA 2ZZDA 3SEMA 5GAN4 3EH1A 3E9FA 3JCMX 2ZPBB 1NJIC 2HZYA 2OAUA 1C1AA 3VYGA 5KYWA 4RCBA 5IH2A 3TU4K 4QT7A 4RTXA 2COWA 3ME9A 2DMOA 1K0SA 4QKUA 2FEIA 4LDVA 2PNIA 3DLMA 1RAFB 3KFVA 2KRMA 5LJ5h 2CT4A 3VS7A 5HK0A 4PK4A 4BY6C 1K73C 2FO0A 2QQSA 1PSFA 1OV3A 5GAMe 3CCLA 3RR6A 1R77A 3JCMe 1WJRA 3BY7A 1WZOA 4EDUA 3QPHA 1KQ1A 4CI0C 3OYMA 1M3CA 4C8QB 3H0IA 2O4XA 2BUDA 2HD0A 3VV0A 1UEBA 1FYNA 3OW2P 3OSVA 2W0ZA 3FJ5A 4E7KA 1X6BA 2CT3A 2WSEE 2DAQA 2DD5A 6AT1B 2EJGA 3EGXA 2JN0A 3KXTA 1RLPC 4WF2A 3EHQA 3OYLA 3S3MA 1X6GA 4OVAA 2AIRB 2DBKA 3RMSA 3RUXA 3OYJA 2O9VA 2SEMA 4ZTFA 1U1SA 2NUPA 4DBFA 1Q82U 1VQ6Q 3DB4A 2R57A 1XOVA 1ZSGA 2DJZA 2EGEA 2RQRA 2BTTA 3JB9D 4A54A 4C5GA 2OTJA 2O31A 2YUOA 3OS0A 2DL3A 2YRVA 2YUPA 2EQUA 1ZLMA 3LYIA 3VS1A 4O6JA 1Q86U 3RERA 5CVIA 5IHKA 1U1TA 5DM7R 4FM4B 3CBPA 3URGA 2EKHA 2QK0A 4JPBW 2LNVA 3VYHB 2E3IA 1VQOA 2EJ9A 2O4XB 3OYHA 1WXUA 1VQ4A 2HQEA 5D6XA 4OGEA 4A4EA 4D8KA 4C0FA 2QXFA 2LX7A 3OYGA 2R58A 1Y96A 4FL6A 1VQLQ 1ABQA 4FW1A 2LP5A 3FC3A 2ZCFB 4M77A 2M1HA 2XHCA 3RBBB 3PGGA 2AKKA 2P0QA 3VU3C 2O9SA 3CCRT 3CCVT 4JRQA 3JB9J 2C06A 1I8FA 5J3BA 2AZVA 3OYCA 3CCMA 4F04B 4BI4A 5M9OA 3M9QA 3JB9I 2L89A 1YP5A 2V1RA 1V1CA 2L3RA 4LDXA 1VQ9Q 2CZ7B 3EHRA 3REAB 1VQ6T 1D0ZA 1BKBA 1X75C 1PNJA 3C12A 4GLMA 5GMKh 1R0CB 2QA4A 3RKXA 2F2XA 1QKXA 4PJJA 1T3SA 3OW2S 3QXEB 1RAEB 1BBZA 1QCFA 5GAOl 2DVEA 5CKHA 2GQIA 1WPYA 3CMET 4RG2A 2RB6A 1QVFS 5GAN3 1TH7A 5CQXA 4C0ZA 3EG2A 3R6OA 1TOVA 2RQTA 2MF2A 1C0MA 7AT1B 4EMGA 3I55T 1RI0A 1JJ2A 2A7YA 2V8JA 1B3QA 1OZ2A 2YHTA 1WHLA 2CP2A 4DEXA 2CSIA 5GJWB 1PC0A 2KXCA 3A8MB 2AHJB 4JZ4A 2RI2A 2K2VA 4M7DC 3QUIA 1LPLA 4F7UE 1QVFA 2FRYA 1AWWA 1HJDA 1N9RA 3PE0A 4M7DG 4AFQC 5C6SA 1K8AC 5CKBA 1XQHA 4AFUC 5LJ5f 3O8VA 4IUTA 3FIFA 3C95A 1M3AA 4M4ZA 3CMAQ 1YIJT 1IXDA 1Y71A 1W2BA 1JBMA 2PU9B 1UGQB 2X9HA 3M55A 1YJ9A 1VQKQ 2E6ZA 5HY6A 2RH2A 2JS2A 2F2WA 1BB9A 1BI2A 2CH4W 2RN8A 3CBMA 2JUFA 5KYUB 1N8RU 3CCJQ 1IGQA 1SSHA 4IUPA 5CCAA 1FXXA 3EG1A 2HSPA 1YJNQ 5KE2A 1AZEA 3ZL7C 2ZPFB 5LJ3f 3CCJT 2RNAA 1PKTA 2VUBA 4HCCA 2DZ9A 2HKNA 2HL3A 3C4SA 1YI2Q 3G1JA 2RD1A 3CD6A 4PLIA 2PVOB 2DXBA 1YIJQ 3CC7A 2EQJA 3HFNA 1HK9A 1PG5B 4AFSC 2QA4Q 2VGNA 1OULA 1VQ7A 4C92A 3VS2A 5D7UA 4M78D 1SSFA 1YFNA 1KHIA 3UT1A 4HVUA 1G3WA 4Y28E 4ZNXA 4DEYA 2XDPA 4NL3A 2VXFA 2I0NA 4M78F 1Y96B 1G3TA 4KGXB 4A4FA 1Q82R 5EG2A 1OYXA 2EBPA 3EAEA 2IVWA 4CC3A 3PVLA 4XU2A 1BI1A 4X1VA 3HPWA 1R8OB 3DLLA 3WVDB 4JS5A 4M75C 1MV3A 2LDMA 1CSKA 1ZBXA 5IHNA 3G71Q 2ED0A 2RJEA 3G7ZA 1SRLA 4B9WA 1QCNA 3OYNA 1H3HA 2GQVA 4BUGA 4KGVB 2ZPHB 3MP8A 4M7DD 2RHYA 4EMHA 2RJDA 2HQHA 3META 3NTHA 3GOXA 4CC2A 1Q7YR 3CCLQ 3JAME 1H641 1AOJA 4L6V5 4R0KA 4PJOB 2RHZA 1GL5A 1ZA1B 3M54A 5GANe 1AWJA 4NL2A 4DOVA 3CCJA 3CCQA 4C5IA 1UGPB 2K5FA 1LCKA 1I81A 1UG1A 1NLPC 4LE9A 5HKCA 1KC8C 2YUQA 4M77F 4EIKA 1Z9ZA 3G4SA 3MEUA 1UHCA 3VS5A 4L5GA 3L2WA 2RO0A 2K5LA 3SD4A 1VQ6A 4ELZC 2OTJT 4MZTA 1OU9A 3OYKA 2J6OA 2HDAA 2JTEA 1NEBA 3EG0A 4N4GA 4F7UG 1RABB 1VYTA 3I35A 1YI2T 3X25B 3CCUA 1WIEA 2L2PA 1OX8A 4FYVB 3JCMd 4M78G 1X01A 4J7IA 2CDTA 5EC7A 1KD1C 2LJ3A 1M2VB 1NM7A 1X27A 2X51A 4C92G 1Q81C 3M57A 3L2VA 4HT8A 2DKGA 1QW1A 4ZN3A 3CCQQ 4FT4A 3EFSA 3JB9G 4XK8E 2RF0A 4F17A 2HQXA 4F16A 3ZEHA 2E4HA 1XNIA 3VS6A 2DYBA 1M8MA 4GY5A 4E7IA 1VQNQ 1JXOA 5LJ5j 3OY9A 3BE3A 2MCNA 3UATA 2DYIA 2M0OA 3JCMh 2KVQG 1T0HA 3EGDB 1JO8A 3I5SA 1UGVA 4WCIA 2KYBA 4EMKC 1IHWA 3M0TA 4OMFB 3CCVA 1Q7YU 1S1NA 4P5NA 1O9SA 1RL2A 2JVVA 3OYDA 2D0QB 2M51A 1IREB 3LLRA 1RACB 3VKIA 2A28A 3JRZA 3PNWC 3CCRQ 4M7AA 3MCAB 2GNCA 3EFOB 4J9CA 5GMKm 2BZXA 1D0XA 4JRKA 3OB9A 5FWBA 5IAYA 4E2FB 5HK3A 5FW9A 4E7JA 2GCXA 1UGSB 2ZPGB 1A0NB 4FYXB 3NPFA 8AT1B 1VQLT 1OEBA 2PUKB 4M7DF 1KG1A 1G8XA 2RQVA 1VQ9A 2E70A 2YDLA 1TU0B 1WA7A 3QYGB 2EPDA 1JRIA 1M5Q1 2XIDA 1I5LA 2WSFE 2RM4A 1UDLA 2FG0A 4M77G 5GAN2 1QKWA 4WTOB 4QQDA 3LGFA 4BB7A 4XTXA 4DBHA 5IN1A 1K9MR 3SWNB 2DLPA 1YJWT 4M7DA 2K9GA 4JLIA 4HVVA 3C0CA 2NUPB 2XKOC 4F7UF 2L3QA 4BY6B 3LH5A 2RI3A 3CMEQ 2DBMA 2K5IA 1BK2A 3A98A 1FWZA 5GMKj 2MYSA 3RKYA 4M7AB 2P4TA 4JUVA 4BI3A 1ZUKA 4C92F 4PL6A 2LT4A 1NE8A 4X9CA 4R55A 1VQNA 3I5RA 3F70A 2DEQA 1JB0E 4MDWA 2MI6A 3M0SA 2CP3A 2JTMA 5GANd 3S3OA 4B6MA 2LCLA 2O01E 2P84A 5CR2A 3M0PA 1ZBJA 4Y91A 3PIOA 3TSWA 2G3RA 1EIFA 2GTOA 3OS1A 1YBYA 1I5OB 1MHNA 3CXCS 3H0HA 4RTWA 2Z0WA 5I11A 1S72T 1IHVA 2X3XD 5GAMd 4OMOA 3JCMf 1M90R 4IURA 1NZ9A 3BFMA 1XTDA 1ZUYA 4TVRA 3CC4T 1S72Q 4M7DB 1U3OA 3VS3A 3M5AA 1CKBA 2VXEA 5LJ5g 1HXDA 3QJYA 2RHIA 3JCMQ 3QG1A 4IIMA 2AK5A 2J6FA 2C0OA 3CMAT 2W10A 4M77C 3H0FA 1Z9QA 3CEYA 1RAAB 4M75D 4J9GA 3P8BB 2QEXQ 2G6FX 1MMGA 2GFUA 3H41A 4BDZA 5GAMj 1D3BA 5FROA 4ANJA 1T3LA 4X9DA 1BU1A 4Z89A 5LL6S 2OJ2A 1TS9A 5AT1B 1V29B 2X4WA 4LXCA 1KJWA 2LQWA 2DL5A 3HRTA 5KYXA 5DLOA 4MMLA 2DXUA 3CQTA 1D1BA 2EYQA 1AD5A 3GF5A 3Q1JA 1KQ2A 1QWFA 1D09B 3EGUA 2DXTA 3VUBA 4C8QD 2FZCB 3DKMA 1FMVA 3CCLT 1JEGA 2XU8A 3HKSA 5LJ5e 5KCOA 3RMQA 4IKFA 1Y57A 2VYTA 2DRMA 2J7IA 2PQWA 4XU1A 1YHQA 3CCEQ 5KH6A 2JMAA 2LVMA 4XTVA 3THKA 4XTYA 3EGXB 4PJOD 2CP6A 1PD0A 3EG9B 2RA2A 2CH4A 2KEAA 2E12A 2JXBA 3OMGA 1JJ2S 4QVCA 4OMPA 3M56A 1SRMA 4J9DA 4BE0A 1IZ6A 2HEQA 2DE0X 4UC4A 5GAOn 2K6DA 1JQQA 4J9FA 4RCCA 2DX1A 3X24B 2X4YA 1WLPB 1VQMQ 2JOYA 1K9AA 1M90C 4M78A 1I07A 2RQWA 1W2BP 4OB1B 1PSEA 2DA9A 3G6ET 2COZA 3QIIA 3J7AF 2VWFA 4N4HA 3I9QA 5DY9A 1M1KU 1N5ZA 2V8KA 3G4SQ 2OTJQ 4PJMA 4KH0B 2KRNA 5GJVB 2HSEB 1RAIB 2J6KA 1OZ3A 2EQIA 2VASA 4PJOG 2CP7A 4II1A 3RIRA 4ELYC 2DL7A 3J80E 2E3HA 1M3BA 3LH0A 4M77D 4JS4A 1VQMT 2JM8A 4PJOE 2YUNA 3QWXX 4OMNA 3CC2A 2CZ1B 1NG2A 1S72A 5I22A 4A53A 4C8QG 2HAXA 2BE9B 1UECA 1E6HA 5CKFA 4DA4A 2KMTA 4OF1A 1M9SA 3CC4A 1M90U 1VQPT 2XDBA 5KYNA 2J06A 1ZUUA 2VGMA 5KCHA 1JU5C 2E1HA 4HT9A 1IRXA 4LUEA 4NS5A 2QASA 1RAHB 2EJFA 4HKEA 2YLBA 1YHQQ 3AHUA 2QQBA 4EMKB 4LNPA 1NPRA 3MPUB 3FDRA 4IUVA 3LGLA 4M78B 3PTAA 4PFZA 2H3JA 5D6YA 1MMDA 2HMAA 3ZFJA 1N27A 1SKUB 4XAXB 4JJDA 1M1KC 2EIFA 4AG2C 3TVTA 1ZQ1A 3CD6T 2DZCA 4AFZC 4FW2A 3M0QA 1VQOT 3JCMc 2AT1B 1GBRA 2GTJA 5A2QE 5C0MA 1VQ5A 4B9XA 1ZSZC 2BIVA 2V26A 1NYGA 2CGHA 1WYXA 4F7UA 4RMOA 3NTIA 2QQRA 4EPCA 1TUGB 5GAOp 1UB4A 1WXBA 1WGSA 1ZSZA 3QHSA 1VUBA 2GGRA 1MUZA 4QQGA 2DERA 1YJ9T 2EQKA 1X69A 4PJOF 2QEXT 4IIOA 1M2OA 1VIEA 4RTYA 3HTRA 1NJIR 1Q81R 1KQSS 1RI9A 4E7HA 2X4XA 3E1SA 1RAGB 1U8RA 2OTLT 5FU6B 2OX7A 2QDLA 3JCMV 2F2VA 3CC2T 2P4RA 4NOYA 4C8QC 5LJ3g 4D6WA 2ESWA 3T9NA 3CMAA 5I2MA 4XU3A 1AHJB 1UUEA 3CCQT 3ASKA 3SWNC 1M27C 1VQOQ 4R56A 4M7AF 1WJSA 1YWOA 3VRZA 1PD1A 2RJFA 1W1FA 2E41A 4C0DC 3MO8A 4M77B 2EW3A 2CZ0B 1BIAA 3OS5A 4A4KA 1AWXA 4FCYA 2GF7A 4M78C 4FSSA 1RUWA 1KC8U 4C8QF 1XJWB 2EFIA 3OYFA 2MOXA 4YTLA 3GNFB 1YCSB 1QWEA 3CCUT 1LVKA 4C5EA 5LJ3h 2KAFA 2QQ9A 1Q95G 4J6YA 5GMKl 2FZKB 2NUTB 3LWIA 1KD1U 2IG0A 2JMCA 4FIBA 2DO3A 3VS4A 1YITQ 3R6NA 5KYYA 4HA8A 1WX6A 1N6AA 1YI2A 3P8HA 2JTFA 4LDWA 3HFOA 2EYYA 2LCSA 5IXFA 2LTOA 2DIQA 4C0GA 4PJLA 1VYVA 1I4K1 2HKQB 2NWMA 3TREA 1UJYA 2CKKA 1GFCA 2QDYB 1QVGA 1RLQC 3X26B 4C5HA 5GANj 3WXMB 1YJWA 3CCSA 1W70A 4Y92A 5AYFA 3V7RA 3JCMJ 1PHTA 1VQ4T 1X6OA 3MJXA 4M75E 1LJOA 4ATOA 4XTUA 2EYXA 1K9MU 4JDSA 3BDUA 1AT1B 2L5QA 4X34A 2KT8A 1WXTA 4C92D 3QBYA 4FSXA 1JJ2P 1GBQA 2DJQA 5D6WA 1SG5A 3MP6A 1ABOA 4Z88A 2RJCA 2CP5A 3KBGA 1KQSP 4OGCA 1LNXA 3PVQA 3U23A 1FX7A 4A4GA 3M0RA 1QP2A 2MWOA 2XDDA 2XI9A 3MP1A 5GAOq 1M8VA 9ATCB 4FYYB 1YJ9Q 1GRIA 2Y4XA 1VQKA 2BE7D 2KY9A 5GAMg 4GLKA 2DRKA 2PUOB 4OB2B 3QSUA 2A08A 1AVZC 1U5SA 3M4GA 4C0DB 1G2BA 2JJ9A 4XTWA 5GANh 4KUIA 2A3LA 3A8GB 5J39A 1KQSA 5I2SA 1ZSZB 2DVJA 4OMQA 1VQ8A 2E6NA 2Y4YA 3A8HB 3TSZA 4DBQA 1BCMA 1YIJA 4M75A 3HHTB 3QO3A 2DF6A 3I56Q 3FLGA 3FRNA 1GXIE 5GAN8 2K3YA 1GCQC 4CRIA 4OP0A 3JB9F 2KDSA 1OU8A 2KGTA 2E5KA 5FRMA 3IQLA 2K2MA 4RKUE 2KNBB 1W6XA 3PMTA 3WVEB 4ESRA 3X20B 4FYWB 2DXCA 4J9HA 1PRLC 3H9NA 3LW5E 4JRIA 1VQ7Q 3EFRA 1IB8A 3UPUA 5HCKA 2JW4A 3E19A 4F14A 1YITA 3I55Q 1VQPA 1KK7A 3BW1A 4MZPA 1QLYA 1WHGA 4M78E 3G71A 2OI3A 3M4YA 4FT2A 1VA7A 2OAWA 3OYYA 1UJ0A 3L1AA 4HCZA 2LJ0A 3HL8A 1AZGB 3EH2A 2DL8A 1YN8A 4ME7A 2P0KA 2ZPEB 3GPLA 3BDLA 1Q86R 2OTLA 3HRUA 3C94A 2K3BA 1PM3A 2QQAA 4AMCA 2DTHA 4N0AA 3TEEA 2K79A 2E5QA 3QKJA 2DNUA 1N9SA 4MDXA 5IHIA 5CO7A 3JSCA 5L8RE 1F1BB 1K1ZA 2EQMA 4PJOA 1GCPA 3CXCP 1FMKA 1QVGP 3VUZA 4ZN1A 2QG9B 1VQ8T 5CIUA 1K76A 1MMAA 1I0CA 2A0FB 5KYWB 1VQLA 2DK3A 2RMOA 4E7ZA 3EG3A 2YT6A 1EZZB 2QGFB 2ROTA 4M7AG 2QYZA 1PRMC 2C0IA 2HNIA 4A63B 2AKLA 2C0TA 5CKDA 4JJCA 1X2KA 4PNOA 3JB9H 1K0XA 1BYMA 3JV3A 4RG8A 2EYWA 3M59A 1HYOA 2O2OA 3PT9A 5LJ5d 2BZYA 4V2SA 1OOTA 2DILA 2RHUA 5L23A 3FB9A 2RK1A 1SF9A 5LJ3j 8ATCB 3CCEA 1VYUA 5GAOr 1M2VA 4QW2A 3L2RA 3KUFA 1BIBA 2FZGB 3G6EQ 3CMEA 3QZ9B 2PTKA 2KR3A 4ZGJB 3QDRB 2JZ2A 4MMKA 5GAN7 2XMFA 2CREA 1VIFA 5IXBA 1MNEA 2XD0A 2KI7A 1ARKA 1K8AR 2COYA 3OA6A 4J8OA 2F69A 4RTVA 3M53A 1Y7XA 2RK2A 4M77E 2DIGA 2F1LA 4RTZA 3OBYA 4ORZA 3V7SA 1W2BS 2M16A 2A37A 1UHFA 2MAMA 1RADB 2LX9A 2VC8A 1TXQA 1TUDA 1B7TA 2GFAA 3VS0A 3QWYA 2JT4A 1G3YA 4LDUA 4QQ6A 2LT1A 1AWOA 3CBOA 1J3TA 3GIBA 4ZGDB 1ACMB 3OW2A 1YJNA 2LRQA 3REBB 4BE2A 2F5TX 5GAN5 1GCQA 1OQKA 4Q5WA 1QMCA 2JM9A 2NUTA 2XG8D 1V76A 2MWPA 1N8RC 2YRDA 4PKCC 4C92C 3I55A 4CC4B 4AG1C 2PVGB 5KYUA 5KYYB 2D6FA 4QVDA 4CC7A 3CD6Q 5CKEA 1WHMA 1K4US 2YXYA 1GFDA 2EYZA 1ZX6A 2KQWA 3CCET 2YRCA 4HXJA 3RDVA 4MZMA 3A1PA 4HVWA 5GMKe 2D1XA 5GANf 1H92A 1QQJA 2V1QA 1P92A 3CCMQ 2QI2A 2EWNA 3OBWA 1WDXA 2DL4A 4D8DA 2MPXC 2LJ1A 2NLUA 3VJPA 5FU6C 1ZHIA 2YWWA 2B8AA 4HCBA 3GNGA 4IUQA 3V7CA 1KFZA 2D8JA 5FU7C 4C8QE 4BD3A 1EFNA 1U06A 2ENMA 4J7FA 4M75F 2Y90A 1TTHB 3QZ5B 3LWHA 3JCMg 4J9EA 2ED1A 4C8QA 5CK9A 4DQ2A 3CCRA 3GBQA 2J05A 1PWTA 2L3SA 3A8OB 4J6WA 1VQMA 3CCMT 1BI0A 1MNDA 4M7AD 2GBQA 2NUZA 4LDYA 4BDYA 1G5VA 2RHXA 4O5VA 5LJ3e 4PFOA 1W4SA 1PKSA 3QYHB 4J9IA 1WQ7A 5GAMh 1YCYA 1WHJA 2QGGA 1TG0A 3JCMW 2H3EB 3S6WA 1YWPA 1ZA2B 2D0NA 3O5ZA 5GANg 1K73R 1I1JA 4XU0A 2M0YA 1D3BB 4QVZA 5J26A 3NFCA 2KBTA 1SPKA 2PZ1A 3OYEA 2WACA 3VRYA 5KE3A 2DTOA 3CC2Q 2KE9A 2RQUA 5GAMf 3CPFA 4OMLA 1K8AU 5FWCA 4OMMA 3QJ6A 5FU7B 2V8IA 4J9BA 2VKNA 3UA7A 2CZ6B 4J5YA 3I56A 3A8LB 3E9GA 3CPWS 2ZPIB 1UGRB 1WQWA 2ECZA 1Q81U 3OQ5A 3RNJA 2JNGA 2X3WD 3CC7Q 3CC4Q 2E64A 4ZTJA 1IGUA 2CSQA 1M1FA 1MGQA 3SHWA 3I56T 1YJNT 2FRWA 2SRCA 1CKAA 4BI8B 1E7OA 3CPWA 3NGPA 1EX4A 2EGCA 1G3SA 2MMPA 4E7SA 3A5ZB 2KRSA 4ZGEB
chains in the Genus database with same CATH topology
4BI3A 2XI9A 4C92F 3MP1A 4PL6A 3OS2A 2LT4A 5GAOq 1NE8A 2F5KA 4X9CA 2QXFA 1M8VA 3OYGA 4R55A 2R58A 2Y4XA 1VQNA 1VQKA 2KSSA 3ZBDA 1Y96A 5GAN6 2KY9A 3F70A 3HRSA 2DEQA 4FL6A 4GLKA 5GAMg 1JB0E 4MDWA 2MI6A 2JTMA 4OB3B 2PUOB 4OB2B 3FC3A 5GANd 3QSUA 2K3XA 2ZCFB 3S3OA 1Q82C 4FU6A 4M77A 1YHQT 2LCLA 2I2LA 2M1HA 2O01E 5CR2A 2XHCA 4E47A 3M4GA 4C0DB 4Y91A 3PIOA 2G3RA 4XTWA 1EIFA 3PGGA 5GANh 1DJ7B 4KUIA 3L2ZA 2A3LA 3OS1A 1YBYA 5CAIA 4C92E 3A8GB 2P0QA 3OMCA 5J39A 1KQSA 5I2SA 4BACA 2R5AA 2FYKA 3VU3C 3CCRT 1MHNA 2E6NA 3CCVT 4JRQA 1VQ8A 2Y4YA 3A8HB 3CXCS 3JB9J 4PLLA 2C06A 1I8FA 5J3BA 5GAOm 2P0PA 1S72T 5GAMd 3OYCA 1M4ZA 3JCMf 3CCMA 4M75A 2QEXA 1YIJA 3HHTB 4IURA 1NZ9A 3BFMA 3QO3A 4BI4A 1XTDA 5M9OA 2ZGWA 3M9QA 3JB9I 2L89A 4TVRA 3FLGA 3CC4T 2DTIA 3FRNA 1O75A 1GXIE 3OYBA 4M7DB 2L3RA 4LDXA 5GAN8 1LOJA 3DB3A 3M5AA 2K3YA 2CZ7B 3J81E 4JJNK 2VXEA 1VQ6T 4A4HA 4CRIA 1BKBA 4OP0A 3JB9F 5LJ5g 3SDZA 2KDSA 1HXDA 1X75C 5FRMA 3QJYA 2RHIA 2XK0A 3C12A 3JCMQ 5GMKh 2QA4A 3QG1A 4RKUE 3RKXA 5DLQE 3CMAT 3V8JA 3PIPA 3PMTA 4M77C 1OI1A 3WVEB 3X20B 2QA4T 3CEYA 4M75D 2X4JA 3OW2S 3CCJA 3P8BB 3QXEB 2DXCA 4KBMB 2XICA 2GFUA 1QVPA 3LW5E 4JRIA 1D3BA 3EFRA 5FROA 5GAMj 4X9DA 4BDZA 5GAOl 2DVEA 5CKHA 3UPUA 1K73U 1WPYA 5LL6S 3CMET 4RG2A 4PJOC 1V29B 2X4WA 2RB6A 1QVFS 5GAN3 2FB7A 3E19A 1YITA 2K57A 3G71T 4EMKA 3L2QA 1K9MC 1VQPA 1TH7A 4IUUA 3BW1A 4KUDK 4MZPA 5CQXA 3HRTA 4C0ZA 3R6OA 3P8DA 4M78E 2MF2A 3G71A 3M4YA 4N0AC 4EMGA 4FT2A 5DLOA 3OYYA 2DXUA 1RI0A 2QTXA 3L1AA 4MMLA 3OYIA 2A7YA 2E10A 2EYQA 3GF5A 3Q1JA 4BE1A 3CC7T 2V8JA 1OZ2A 2YHTA 4HCZA 1KQ2A 3VUBA 2DXTA 3HL8A 1NJIU 4C8QD 3DKMA 1VQ7T 3CCLT 3A8MB 2AHJB 2LC4A 3HSBA 2XU8A 3HKSA 4ME7A 5LJ5e 2P0KA 2ZPEB 3RMQA 3BDLA 5A0DA 5KCOA 2RI2A 2K2VA 3HRUA 4J6XA 3GPLA 2OTLA 4IKFA 2VYTA 3C94A 2PQWA 2QQAA 4XU1A 1YHQA 2WSCE 4M7DC 3QUIA 5KH6A 4OB0B 3L42A 4F7UE 1QVFA 2DTHA 4N0AA 4XTVA 2LVMA 3TEEA 4XTYA 2R5MA 2E5QA 1N9RA 3QKJA 3SWNA 4M7DG 1N9SA 2CYZB 5C6SA 4MDXA 4PJOD 1K8AC 5CKBA 5CO7A 3JSCA 1XQHA 5L8RE 2LCCA 3SB2A 5LJ5f 3O8VA 2RA2A 2EQMA 4KT0E 2E12A 4PJOA 4IUTA 3FIFA 3C95A 3OMGA 1JJ2S 4QVCA 3G4ST 3M56A 1YIJT 1Y71A 1W2BA 1JBMA 2PU9B 2RI5A 4BE0A 1IZ6A 4UC4A 3VUZA 1UGQB 4LD6A 4ZN1A 5GAOn 3M55A 1YJ9A 4F7UB 1VQ8T 5CIUA 2E6ZA 1WJQA 5HY6A 2RH2A 1VQLA 2DK3A 2FHDA 1BI2A 2K4YA 3CBMA 2JUFA 1N8RU 4M7AG 4IUPA 4RCCA 5CCAA 3RKWA 3UWNA 1FXXA 2X4YA 3X24B 5KE2A 2JOYA 2HNIA 1M90C 4C92B 3PMIA 2ZPFB 5LJ3f 3CCJT 5CKDA 4M78A 5FRNA 1YITT 4PNOA 3JB9H 3H8ZA 1BYMA 2EKOA 2LQKA 4OB1B 1PSEA 2VUBA 2FL7A 4RG8A 3TCJA 5A0GA 1VQ5T 3M59A 3G6ET 3HP9A 2DD4A 3CCST 3QIIA 4HCCA 3PT9A 2DZ9A 3J7AF 4N4HA 5LJ5d 3C4SA 4V2SA 4LD9K 2RD1A 3CD6A 4PLIA 5DY9A 2PVOB 2DXBA 1M1KU 3CC7A 2V8KA 2RHUA 2EQJA 3HFNA 3FB9A 1HK9A 2RK1A 3FEOA 5LJ3j 3CCEA 3GP8A 2VGNA 5GAOr 1VQ7A 4M7DE 4J83A 4C92A 4QW2A 3L2RA 1OZ3A 5FLXE 4PJOG 3CCQA 4KULA 4II1A 3L2UA 1Q7YC 3GLXA 1B34B 3INZA 4M78D 4M7AC 3RIRA 4ELYC 1SSFA 3SFMA 3J80E 3KUFA 3LH0A 4M77D 1BIBA 3ER0A 1KHIA 3CMEA 2D9TA 3QZ9B 3UT1A 4JS4A 1G3WA 4Y28E 1VQMT 1VQ9T 4ZGJB 3QDRB 2JZ2A 4MMKA 2VV5A 5CQYA 5I21A 5GAN7 4PJOE 3CC2A 2XDPA 1VIFA 2CZ1B 2DPPB 2XD0A 4NL3A 2VXFA 1S72A 4M78F 4A53A 4C8QG 2HAXA 3MHXA 4JLGA 1Y96B 1G3TA 5CKFA 4DA4A 2KMTA 3MEAA 4OF1A 4A4FA 1VQKT 1QVGS 5A0LA 1M9SA 3CC4A 1M90U 5EG2A 1OYXA 3OA6A 4J8OA 1VQPT 2F69A 2XDBA 1KHCA 3EAEA 3N5BB 4M7AE 2E65A 3S3NA 2IVWA 4M75B 2VGMA 4XU2A 3M53A 5KCHA 1BI1A 3DLLA 3HPWA 1R8OB 4JS5A 2E1HA 3WVDB 3JCMP 4HT9A 4M75C 2LDMA 1Y7XA 1ZBXA 4NS5A 2YLCA 3CXCA 2RJEA 3G7ZA 2RK2A 2CS7A 2EJFA 4B9WA 4HKEA 4M77E 2YLBA 3OYNA 2DIGA 3AHUA 2QQBA 4EMKB 1NPRA 2GQVA 3FDRA 3OBYA 4IUVA 4BUGA 3LGLA 3MEWA 2LQ8A 1H3ZA 4M78B 3PTAA 3V7SA 2ZPHB 3MP8A 1W2BS 2H3JA 4M7DD 2M16A 2MAMA 2RHYA 5D6YA 4EMHA 3PFSA 2RJDA 3ZFJA 2EAYA 3META 2LX9A 3NTHA 2VC8A 3GOXA 1N27A 2GFAA 4XAXB 1M1KC 4LDUA 1G3YA 3JAME 2EIFA 4QQ6A 1H641 2LT1A 4L59A 4L6V5 2KK4A 3CBOA 4E7LA 1ZQ1A 3CD6T 2DZCA 3GIBA 3V8LA 1VQOT 4PJOB 3JCMc 3JCMb 2XDDA 2RHZA 4ZGDB 5A2QE 5C0MA 1VQ5A 3G6EA 3M54A 4B9XA 5GANe 3OW2A 1YJNA 2BIVA 2LRQA 3I55T 4BE2A 2F5TX 1B34A 5GAN5 3OSSC 2CGHA 4NL2A 4XQ3A 4Q5WA 4DOVA 4F7UA 4C5IA 1BI3A 1UGPB 2FVUA 2K5FA 3MEVA 3UDCA 2M9UA 3NTIA 2XG8D 4RMOA 2QQRA 4EPCA 2MWPA 1N8RC 1I81A 4PKCC 4C92C 3I55A 2PVGB 1KC8C 5HKCA 2PVDB 5GAOp 1UB4A 4M77F 3G4SA 2D6FA 4QVDA 3MEUA 1WGSA 4Z02A 5CKEA 3QHSA 1VUBA 4L5GA 2HBPA 2X35A 3RESA 1Y07A 4DOWA 4QQGA 3L2WA 2RO0A 3FJPA 3NTKA 2K5LA 3OYAA 1YJ9T 1NPPA 2EQKA 3SD4A 1VQ6A 4PJOF 4ELZC 2QEXT 2OTJT 2KQWA 4M75G 1VIEA 4MZTA 3CCET 3OYKA 2BKDN 1KQSS 4JRPA 1QP3A 4MZMA 3V8KA 4N4GA 1M1GA 4F7UG 5GMKe 3LX7A 4E7HA 1Q86C 2L8DA 2X4XA 3E1SA 5GANf 1YI2T 3X25B 1P92A 3CCUA 2QI2A 1U8RA 2OTLT 2EWNA 3OBWA 4N4IA 5FU6B 5LJ3d 3JCMd 4M78G 5IT9E 3JCMV 1X01A 5GMKi 4J7IA 2NLUA 1VQNT 3X28B 1WNLA 1KD1C 3CC2T 3VJPA 5FU6C 1ZHIA 2B8AA 3M58A 4NOYA 4C92G 4C8QC 4HCBA 5LJ3g 3GNGA 4XTZA 4VUBA 1Q81C 4IUQA 3V7CA 3M57A 4D6WA 3H6ZA 3T9NA 3L2VA 4HT8A 2DKGA 1QW1A 2ZZDA 4ZN3A 3CMAA 5FU7C 5I2MA 4FT4A 5GAN4 4C8QE 3E9FA 4BD3A 3JCMX 2ZPBB 1NJIC 2OAUA 3VYGA 3EFSA 1AHJB 4J7FA 4M75F 4XU3A 3JB9G 1VQ4T 2Y90A 4XK8E 4RCBA 3ASKA 3CCQT 3TU4K 3SWNC 4R56A 2HQXA 3ME9A 3QZ5B 4M7AF 1WJSA 3ZEHA 3LWHA 1XNIA 3JCMg 4C8QA 5CK9A 4GY5A 4LDVA 2RJFA 4E7IA 4DQ2A 3DLMA 3CCRA 4C0DC 2E41A 5LJ5j 3MO8A 3OY9A 4M77B 3A8OB 4J6WA 2CZ0B 1BIAA 3OS5A 5LJ5h 1VQMA 4A4KA 2M0OA 2KVQG 2GF7A 3JCMh 1BI0A 4M78C 5HK0A 4BY6C 3CCMT 4M7AD 1K73C 2QQSA 4EMKC 4LDYA 1PSFA 4C8QF 4BDYA 1KC8U 3CCLA 5GAMe 2EFIA 4OMFB 3CCVA 1G5VA 3OYFA 3JB9D 2RHXA 4O5VA 5LJ3e 4YTLA 1WJRA 3JCMe 1Q7YU 3BY7A 4P5NA 1W4SA 1O9SA 3GNFB 1RL2A 3QPHA 4EDUA 1KQ1A 2JVVA 3QYHB 4CI0C 1WQ7A 3OYMA 4C8QB 5GAMh 3OYDA 3CCUT 1YCYA 2D0QB 1IREB 4C5EA 5LJ3h 3LLRA 2O4XA 2BUDA 2KAFA 2QQ9A 3JCMW 2HD0A 4J6YA 5GMKl 3S6WA 3VKIA 3VV0A 3LWIA 3JRZA 1KD1U 1UEBA 3PNWC 5GANg 2IG0A 3MCAB 4FIBA 4M7AA 2DO3A 5GMKm 3OSVA 4XU0A 4JRKA 1D3BB 4HA8A 4QVZA 5J26A 3NFCA 1N6AA 4E7KA 3OB9A 5IAYA 1YI2A 1JJ2A 3P8HA 2JTFA 5HK3A 4LDWA 3HFOA 2WSEE 2DAQA 3OYEA 2WACA 4E7JA 2GCXA 2DD5A 5KE3A 1UGSB 2DTOA 2ZPGB 2EJGA 2LTOA 2DIQA 4C0GA 5GAMf 3CPFA 2JN0A 1I4K1 1K8AU 3KXTA 1VQLT 3QJ6A 2PUKB 4M7DF 5FU7B 3TREA 1KG1A 4WF2A 2V8IA 3OYLA 3S3MA 2CKKA 4OVAA 2QDYB 3RMSA 1VQ9A 3RUXA 3OYJA 2E70A 1QVGA 2CZ6B 4ZTFA 1U1SA 3QYGB 4J5YA 3I56A 1JRIA 3A8LB 1M5Q1 2XIDA 1I5LA 3X26B 4C5HA 1Q82U 2WSFE 3E9GA 3CPWS 2RM4A 2ZPIB 1UGRB 2R57A 3DB4A 4M77G 1XOVA 3WXMB 5GAN2 5GANj 1WQWA 2DJZA 1Q81U 3OQ5A 1YJWA 3CCSA 2JNGA 4QQDA 3LGFA 5AYFA 3V7RA 4BB7A 4A54A 3JCMJ 1X6OA 4XTXA 5IN1A 4C5GA 2OTJA 2E64A 1LJOA 4M75E 4XTUA 3SWNB 4ZTJA 1YJWT 4ATOA 3OS0A 4M7DA 4JLIA 2YRVA 1K9MU 4JDSA 2EQUA 3BDUA 1M1FA 1MGQA 3LYIA 2L5QA 4X34A 3I56T 4O6JA 1Q86U 3RERA 5CVIA 4C92D 1YJNT 3QBYA 1U1TA 5DM7R 4FM4B 2XKOC 4FSXA 3CBPA 3URGA 5D6WA 4F7UF 4BY6B 3MP6A 2RI3A 2LNVA 2RJCA 3VYHB 4BI8B 1VQOA 2EJ9A 3KBGA 3CPWA 2O4XB 4OGCA 1LNXA 3OYHA 2K5IA 1G3SA 1FX7A 4A4GA 5GMKj 1FWZA 2HQEA 2MMPA 4OGEA 5D6XA 4A4EA 1VQ4A 1QP2A 3RKYA 4M7AB 2MWOA 3A5ZB 2P4TA 4JUVA 4ZGEB 4C0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU1 A;  4DQ2 A;  4C92 F;  2E41 A;  4M7D C;  2YLC A;  3QUI A;  4F7U E;  5LJ5 j;  5GAO q;  4X9C A;  2DTH A;  4M77 B;  2EJF A;  4N0A A;  4J6W A;  4M77 E;  1BIA A;  2YLB A;  4XTV A;  4XTY A;  5LJ5 h;  1N9R A;  3SWN A;  3JCM h;  3AHU A;  4M7D G;  4M78 C;  1N9S A;  4EMK B;  4M7A D;  1Y96 A;  5GAN 6;  4PJO D;  2DEQ A;  5GAM g;  4M78 B;  4EMK C;  4C8Q F;  3V7S A;  3SB2 A;  5GAM e;  5LJ5 f;  2RA2 A;  3QSU A;  5GAN d;  4M7D D;  4PJO A;  5LJ3 e;  3JCM e;  3FIF A;  4M77 A;  3BY7 A;  4QVC A;  4EMH A;  2I2L A;  2EAY A;  1KQ1 A;  2VC8 A;  3M4G A;  1WQ7 A;  1JBM A;  4C8Q B;  4Y91 A;  5GAM h;  1YCY A;  1H64 1;  4XTW A;  5GAO n;  3PGG A;  5GAN h;  3L2Z A;  5LJ3 h;  4HT9 A;  5CAI A;  3JCM W;  2DZC A;  4J6Y A;  4C92 E;  4F7U B;  3V8L A;  5GMK l;  3GIB A;  4PJO B;  3JCM c;  2FYK A;  3VU3 C;  3JCM b;  5GAN g;  4M7A A;  3JB9 J;  5GMK m;  4XU0 A;  4HT8 A;  5GAN e;  1I8F A;  5GAO m;  5GAM d;  4JRK A;  3JCM f;  1D3B B;  4HA8 A;  4M75 A;  1B34 A;  4RCC A;  5GAN 5;  4M7A G;  3RKW A;  2CGH A;  3BFM A;  3QO3 A;  4NL2 A;  4XQ3 A;  2ZGW A;  4F7U A;  2HNI A;  3HFO A;  3JB9 I;  4C92 B;  2DTI A;  5LJ3 f;  4M78 A;  4M7D B;  1I81 A;  4PNO A;  2DTO A;  3JB9 H;  4C92 C;  5GAN 8;  2EJG A;  1LOJ A;  5GAM f;  5GAO p;  2VXE A;  4M77 F;  4QVD A;  2JN0 A;  1I4K 1;  4OP0 A;  3JB9 F;  5LJ5 g;  4M7D F;  1M8V A;  2DZ9 A;  3QHS A;  4WF2 A;  1HXD A;  3RES A;  5LJ5 d;  3JCM Q;  3FJP A;  5GMK h;  4V2S A;  2RD1 A;  5DY9 A;  3RKX A;  4PJO F;  3RUX A;  4M75 G;  3HFN A;  3FB9 A;  3V8J A;  1HK9 A;  1U1S A;  4J5Y A;  5LJ3 j;  4M77 C;  1JRI A;  1M5Q 1;  5GAO r;  1I5L A;  3V8K A;  4M75 D;  4M7D E;  4C92 A;  4F7U G;  2RM4 A;  5GMK e;  4M77 G;  4PJO G;  5GAN 2;  5GAN j;  1WQW A;  2DJZ A;  4JRI A;  5GAM j;  1D3B A;  3EFR A;  5GAN f;  1B34 B;  4X9D A;  3INZ A;  2DVE A;  4M78 D;  5GAO l;  3RIR A;  1WPY A;  4M7A C;  3JB9 D;  3V7R A;  4PJO C;  3JCM J;  4A54 A;  2EWN A;  4XTX A;  2RB6 A;  5LJ3 d;  4M77 D;  1BIB A;  2FB7 A;  4M78 G;  2E64 A;  1X01 A;  1LJO A;  4M75 E;  4XTU A;  2K57 A;  3SWN B;  3JCM V;  4EMK A;  5GMK i;  4JLI A;  1TH7 A;  4M7D A;  1WNL A;  3BW1 A;  4MMK A;  5GAN 7;  5I21 A;  4PJO E;  4NOY A;  4C8Q C;  4C92 G;  5GAN 3;  3BDU A;  5LJ3 g;  1MGQ A;  4M78 E;  4XTZ A;  3RER A;  3V7C A;  4NL3 A;  2VXF A;  4C92 D;  4M78 F;  2DKG A;  4N0A C;  1U1T A;  4A53 A;  4C8Q G;  4EMG A;  4MML A;  2DXU A;  2QTX A;  3L1A A;  3JCM d;  1Y96 B;  5GAN 4;  2E10 A;  4C8Q E;  4F7U F;  3JCM X;  2YHT A;  1KQ2 A;  3EFS A;  4XU3 A;  4M75 F;  2DXT A;  2EJ9 A;  3JB9 G;  4C8Q D;  2Y90 A;  4RCB A;  4M7A E;  2E65 A;  3SWN C;  3HSB A;  1LNX A;  5LJ5 e;  4M75 B;  4M7A F;  4XU2 A;  5GMK j;  4J6X A;  3RKY A;  3JCM g;  4M7A B;  4C8Q A;  2E1H A;  3JCM P;  4JUV A;  4M75 C; 
#chains in the Genus database with same CATH topology
 3OS2 A;  2F5K A;  1HD3 A;  1QVF P;  2OTL Q;  2EGA A;  2FPD A;  2KSS A;  3QDF A;  3ZBD A;  5GAN 6;  3HRS A;  1NBE B;  1SEM A;  1UE9 A;  4OB3 B;  2K3X A;  1Q82 C;  2D8H A;  4FU6 A;  1YHQ T;  2I2L A;  2B86 A;  4E47 A;  3EGD A;  2VB6 A;  1AEY A;  1DJ7 B;  3L2Z A;  2QTV A;  1KC8 R;  2MK5 A;  5CAI A;  4C92 E;  2LNH B;  3OMC A;  4LUD A;  1C6V X;  3CCS Q;  4BAC A;  2R5A A;  2FYK A;  4PLL A;  1KSW A;  5GAO m;  2P0P A;  1M4Z A;  2QEX A;  1D1C A;  4K11 A;  2ZGW A;  2DFU A;  2DTI A;  1O75 A;  1M1K R;  3OYB A;  4JZ3 A;  1LOJ A;  1WFW A;  3DB3 A;  1R0B G;  3J81 E;  4JJN K;  2ATC B;  4A4H A;  3SDZ A;  2XK0 A;  2VVK A;  5DLQ E;  3V8J A;  3PIP A;  1OI1 A;  5ECA A;  4AT1 B;  2QA4 T;  3EFO A;  2X4J A;  2L0A A;  2FPF A;  2MIO A;  1JXM A;  4KBM B;  2XIC A;  1QVP A;  4LN2 A;  1K73 U;  4RUG A;  2YSQ A;  4PJO C;  4PFP A;  2FB7 A;  2IIM A;  4RTU A;  2K57 A;  3G71 T;  4EMK A;  3L2Q A;  1K9M C;  4IUU A;  4KUD K;  4KH1 B;  3CPW P;  3P8D A;  2JS0 A;  2RPN A;  4N0A C;  3UF4 A;  3OYI A;  4Z8A A;  2QTX A;  2E10 A;  4BE1 A;  3CC7 T;  4GBQ A;  1NJI U;  2KT1 A;  1VQ7 T;  1MV0 B;  2LC4 A;  2FPE A;  4RTT A;  3HSB A;  1SHG A;  2CP0 A;  5A0D A;  4J6X A;  2WSC E;  4OB0 B;  3L42 A;  1H8K A;  2R5M A;  1FMW A;  1VQ4 Q;  1BCO A;  2AZS A;  3SWN A;  1TSF A;  2CYZ B;  1YNZ A;  1VQ5 Q;  2LCC A;  3SB2 A;  4KT0 E;  1MMN A;  3G4S T;  2IPO B;  2RI5 A;  4JJB A;  4LD6 A;  3TQ7 P;  4F7U B;  1WJQ A;  4HCK A;  3CCV Q;  1PCX A;  1OPK A;  1T0J A;  2FHD A;  1OPL A;  2K4Y A;  3RKW A;  3UWN A;  1TUC A;  4C92 B;  3PMI A;  5FRN A;  1YIT T;  3H8Z A;  1SHF A;  2EKO A;  1D0Y A;  2LQK A;  2FL7 A;  3TCJ A;  2CUD A;  5A0G A;  1VQ5 T;  3HP9 A;  2DD4 A;  3CCS T;  3MKD A;  4LD9 K;  2KXD A;  2O88 A;  3FEO A;  3GP8 A;  2LZ6 B;  1X43 A;  4M7D E;  4J83 A;  5FLX E;  4KUL A;  3L2U A;  1Q7Y C;  3GLX A;  1B34 B;  3INZ A;  4M7A C;  3E2U A;  1M30 A;  3SFM A;  3ER0 A;  2NYS A;  2D9T A;  2L3P A;  1VQ9 T;  2VV5 A;  5CQY A;  5I21 A;  3UA6 A;  3D7S B;  1KD1 R;  2CUB A;  1QCO A;  2DPP B;  3MHX A;  4JLG A;  3NHN A;  1OX9 A;  3MEA A;  1VQK T;  1QVG S;  5A0L A;  2LMJ A;  1KHC A;  3N5B B;  2DEU A;  2E65 A;  3S3N A;  4M7A E;  2HL5 C;  4M75 B;  1VQ8 Q;  1UTI A;  3AT1 B;  4KGZ B;  3JCM P;  3CXC A;  2YLC A;  1B07 A;  1UFF A;  2CS7 A;  2ZAE A;  2HCK A;  4E6R A;  3MEW A;  2EVR A;  2LQ8 A;  1H3Z A;  5KYX B;  2ROL A;  2HBW A;  4PJN A;  2K7A A;  3PFS A;  2EAY A;  2DET A;  1WHK A;  4L59 A;  2KK4 A;  4E7L A;  3V8L A;  1NEG A;  1KIK A;  4DBR A;  3JCM b;  1VQP Q;  1X2Q A;  3G6E A;  1HSQ A;  1B34 A;  3OSS C;  4XQ3 A;  2A36 A;  1VOM A;  1BI3 A;  2FVU A;  3MEV A;  3UDC A;  1NLO C;  2M9U A;  1Y0M A;  3EG9 A;  4KRT A;  2DM1 A;  2PVD B;  1YJW Q;  1E6G A;  3M0U A;  1TWB A;  4Z02 A;  1NYF A;  2HBP A;  2X35 A;  3RES A;  1Y07 A;  2KRO A;  4DOW A;  3FJP A;  3NTK A;  3OYA A;  3CCU Q;  1NPP A;  2BZ8 A;  4M75 G;  1IO6 A;  2ABL A;  2BKD N;  1WI7 A;  4JRP A;  1QP3 A;  3V8K A;  1M1G A;  1N8R R;  3LX7 A;  1Q86 C;  2L8D A;  1G83 A;  1D1A A;  4N4I A;  5IT9 E;  5LJ3 d;  5GMK i;  3NMZ C;  2LQN A;  2KYM A;  3X28 B;  1WNL A;  1VQN T;  2H8H A;  1WHH A;  2QAZ A;  3M58 A;  3ULR B;  2M02 A;  4XTZ A;  4VUB A;  3H6Z A;  2ZZD A;  3SEM A;  5GAN 4;  3EH1 A;  3E9F A;  3JCM X;  2ZPB B;  1NJI C;  2HZY A;  2OAU A;  1C1A A;  3VYG A;  5KYW A;  4RCB A;  5IH2 A;  3TU4 K;  4QT7 A;  4RTX A;  2COW A;  3ME9 A;  2DMO A;  1K0S A;  4QKU A;  2FEI A;  4LDV A;  2PNI A;  3DLM A;  1RAF B;  3KFV A;  2KRM A;  5LJ5 h;  2CT4 A;  3VS7 A;  5HK0 A;  4PK4 A;  4BY6 C;  1K73 C;  2FO0 A;  2QQS A;  1PSF A;  1OV3 A;  5GAM e;  3CCL A;  3RR6 A;  1R77 A;  3JCM e;  1WJR A;  3BY7 A;  1WZO A;  4EDU A;  3QPH A;  1KQ1 A;  4CI0 C;  3OYM A;  1M3C A;  4C8Q B;  3H0I A;  2O4X A;  2BUD A;  2HD0 A;  3VV0 A;  1UEB A;  1FYN A;  3OW2 P;  3OSV A;  2W0Z A;  3FJ5 A;  4E7K A;  1X6B A;  2CT3 A;  2WSE E;  2DAQ A;  2DD5 A;  6AT1 B;  2EJG A;  3EGX A;  2JN0 A;  3KXT A;  1RLP C;  4WF2 A;  3EHQ A;  3OYL A;  3S3M A;  1X6G A;  4OVA A;  2AIR B;  2DBK A;  3RMS A;  3RUX A;  3OYJ A;  2O9V A;  2SEM A;  4ZTF A;  1U1S A;  2NUP A;  4DBF A;  1Q82 U;  1VQ6 Q;  3DB4 A;  2R57 A;  1XOV A;  1ZSG A;  2DJZ A;  2EGE A;  2RQR A;  2BTT A;  3JB9 D;  4A54 A;  4C5G A;  2OTJ A;  2O31 A;  2YUO A;  3OS0 A;  2DL3 A;  2YRV A;  2YUP A;  2EQU A;  1ZLM A;  3LYI A;  3VS1 A;  4O6J A;  1Q86 U;  3RER A;  5CVI A;  5IHK A;  1U1T A;  5DM7 R;  4FM4 B;  3CBP A;  3URG A;  2EKH A;  2QK0 A;  4JPB W;  2LNV A;  3VYH B;  2E3I A;  1VQO A;  2EJ9 A;  2O4X B;  3OYH A;  1WXU A;  1VQ4 A;  2HQE A;  5D6X A;  4OGE A;  4A4E A;  4D8K A;  4C0F A;  2QXF A;  2LX7 A;  3OYG A;  2R58 A;  1Y96 A;  4FL6 A;  1VQL Q;  1ABQ A;  4FW1 A;  2LP5 A;  3FC3 A;  2ZCF B;  4M77 A;  2M1H A;  2XHC A;  3RBB B;  3PGG A;  2AKK A;  2P0Q A;  3VU3 C;  2O9S A;  3CCR T;  3CCV T;  4JRQ A;  3JB9 J;  2C06 A;  1I8F A;  5J3B A;  2AZV A;  3OYC A;  3CCM A;  4F04 B;  4BI4 A;  5M9O A;  3M9Q A;  3JB9 I;  2L89 A;  1YP5 A;  2V1R A;  1V1C A;  2L3R A;  4LDX A;  1VQ9 Q;  2CZ7 B;  3EHR A;  3REA B;  1VQ6 T;  1D0Z A;  1BKB A;  1X75 C;  1PNJ A;  3C12 A;  4GLM A;  5GMK h;  1R0C B;  2QA4 A;  3RKX A;  2F2X A;  1QKX A;  4PJJ A;  1T3S A;  3OW2 S;  3QXE B;  1RAE B;  1BBZ A;  1QCF A;  5GAO l;  2DVE A;  5CKH A;  2GQI A;  1WPY A;  3CME T;  4RG2 A;  2RB6 A;  1QVF S;  5GAN 3;  1TH7 A;  5CQX A;  4C0Z A;  3EG2 A;  3R6O A;  1TOV A;  2RQT A;  2MF2 A;  1C0M A;  7AT1 B;  4EMG A;  3I55 T;  1RI0 A;  1JJ2 A;  2A7Y A;  2V8J A;  1B3Q A;  1OZ2 A;  2YHT A;  1WHL A;  2CP2 A;  4DEX A;  2CSI A;  5GJW B;  1PC0 A;  2KXC A;  3A8M B;  2AHJ B;  4JZ4 A;  2RI2 A;  2K2V A;  4M7D C;  3QUI A;  1LPL A;  4F7U E;  1QVF A;  2FRY A;  1AWW A;  1HJD A;  1N9R A;  3PE0 A;  4M7D G;  4AFQ C;  5C6S A;  1K8A C;  5CKB A;  1XQH A;  4AFU C;  5LJ5 f;  3O8V A;  4IUT A;  3FIF A;  3C95 A;  1M3A A;  4M4Z A;  3CMA Q;  1YIJ T;  1IXD A;  1Y71 A;  1W2B A;  1JBM A;  2PU9 B;  1UGQ B;  2X9H A;  3M55 A;  1YJ9 A;  1VQK Q;  2E6Z A;  5HY6 A;  2RH2 A;  2JS2 A;  2F2W A;  1BB9 A;  1BI2 A;  2CH4 W;  2RN8 A;  3CBM A;  2JUF A;  5KYU B;  1N8R U;  3CCJ Q;  1IGQ A;  1SSH A;  4IUP A;  5CCA A;  1FXX A;  3EG1 A;  2HSP A;  1YJN Q;  5KE2 A;  1AZE A;  3ZL7 C;  2ZPF B;  5LJ3 f;  3CCJ T;  2RNA A;  1PKT A;  2VUB A;  4HCC A;  2DZ9 A;  2HKN A;  2HL3 A;  3C4S A;  1YI2 Q;  3G1J A;  2RD1 A;  3CD6 A;  4PLI A;  2PVO B;  2DXB A;  1YIJ Q;  3CC7 A;  2EQJ A;  3HFN A;  1HK9 A;  1PG5 B;  4AFS C;  2QA4 Q;  2VGN A;  1OUL A;  1VQ7 A;  4C92 A;  3VS2 A;  5D7U A;  4M78 D;  1SSF A;  1YFN A;  1KHI A;  3UT1 A;  4HVU A;  1G3W A;  4Y28 E;  4ZNX A;  4DEY A;  2XDP A;  4NL3 A;  2VXF A;  2I0N A;  4M78 F;  1Y96 B;  1G3T A;  4KGX B;  4A4F A;  1Q82 R;  5EG2 A;  1OYX A;  2EBP A;  3EAE A;  2IVW A;  4CC3 A;  3PVL A;  4XU2 A;  1BI1 A;  4X1V A;  3HPW A;  1R8O B;  3DLL A;  3WVD B;  4JS5 A;  4M75 C;  1MV3 A;  2LDM A;  1CSK A;  1ZBX A;  5IHN A;  3G71 Q;  2ED0 A;  2RJE A;  3G7Z A;  1SRL A;  4B9W A;  1QCN A;  3OYN A;  1H3H A;  2GQV A;  4BUG A;  4KGV B;  2ZPH B;  3MP8 A;  4M7D D;  2RHY A;  4EMH A;  2RJD A;  2HQH A;  3MET A;  3NTH A;  3GOX A;  4CC2 A;  1Q7Y R;  3CCL Q;  3JAM E;  1H64 1;  1AOJ A;  4L6V 5;  4R0K A;  4PJO B;  2RHZ A;  1GL5 A;  1ZA1 B;  3M54 A;  5GAN e;  1AWJ A;  4NL2 A;  4DOV A;  3CCJ A;  3CCQ A;  4C5I A;  1UGP B;  2K5F A;  1LCK A;  1I81 A;  1UG1 A;  1NLP C;  4LE9 A;  5HKC A;  1KC8 C;  2YUQ A;  4M77 F;  4EIK A;  1Z9Z A;  3G4S A;  3MEU A;  1UHC A;  3VS5 A;  4L5G A;  3L2W A;  2RO0 A;  2K5L A;  3SD4 A;  1VQ6 A;  4ELZ C;  2OTJ T;  4MZT A;  1OU9 A;  3OYK A;  2J6O A;  2HDA A;  2JTE A;  1NEB A;  3EG0 A;  4N4G A;  4F7U G;  1RAB B;  1VYT A;  3I35 A;  1YI2 T;  3X25 B;  3CCU A;  1WIE A;  2L2P A;  1OX8 A;  4FYV B;  3JCM d;  4M78 G;  1X01 A;  4J7I A;  2CDT A;  5EC7 A;  1KD1 C;  2LJ3 A;  1M2V B;  1NM7 A;  1X27 A;  2X51 A;  4C92 G;  1Q81 C;  3M57 A;  3L2V A;  4HT8 A;  2DKG A;  1QW1 A;  4ZN3 A;  3CCQ Q;  4FT4 A;  3EFS A;  3JB9 G;  4XK8 E;  2RF0 A;  4F17 A;  2HQX A;  4F16 A;  3ZEH A;  2E4H A;  1XNI A;  3VS6 A;  2DYB A;  1M8M A;  4GY5 A;  4E7I A;  1VQN Q;  1JXO A;  5LJ5 j;  3OY9 A;  3BE3 A;  2MCN A;  3UAT A;  2DYI A;  2M0O A;  3JCM h;  2KVQ G;  1T0H A;  3EGD B;  1JO8 A;  3I5S A;  1UGV A;  4WCI A;  2KYB A;  4EMK C;  1IHW A;  3M0T A;  4OMF B;  3CCV A;  1Q7Y U;  1S1N A;  4P5N A;  1O9S A;  1RL2 A;  2JVV A;  3OYD A;  2D0Q B;  2M51 A;  1IRE B;  3LLR A;  1RAC B;  3VKI A;  2A28 A;  3JRZ A;  3PNW C;  3CCR Q;  4M7A A;  3MCA B;  2GNC A;  3EFO B;  4J9C A;  5GMK m;  2BZX A;  1D0X A;  4JRK A;  3OB9 A;  5FWB A;  5IAY A;  4E2F B;  5HK3 A;  5FW9 A;  4E7J A;  2GCX A;  1UGS B;  2ZPG B;  1A0N B;  4FYX B;  3NPF A;  8AT1 B;  1VQL T;  1OEB A;  2PUK B;  4M7D F;  1KG1 A;  1G8X A;  2RQV A;  1VQ9 A;  2E70 A;  2YDL A;  1TU0 B;  1WA7 A;  3QYG B;  2EPD A;  1JRI A;  1M5Q 1;  2XID A;  1I5L A;  2WSF E;  2RM4 A;  1UDL A;  2FG0 A;  4M77 G;  5GAN 2;  1QKW A;  4WTO B;  4QQD A;  3LGF A;  4BB7 A;  4XTX A;  4DBH A;  5IN1 A;  1K9M R;  3SWN B;  2DLP A;  1YJW T;  4M7D A;  2K9G A;  4JLI A;  4HVV A;  3C0C A;  2NUP B;  2XKO C;  4F7U F;  2L3Q A;  4BY6 B;  3LH5 A;  2RI3 A;  3CME Q;  2DBM A;  2K5I A;  1BK2 A;  3A98 A;  1FWZ A;  5GMK j;  2MYS A;  3RKY A;  4M7A B;  2P4T A;  4JUV A;  4BI3 A;  1ZUK A;  4C92 F;  4PL6 A;  2LT4 A;  1NE8 A;  4X9C A;  4R55 A;  1VQN A;  3I5R A;  3F70 A;  2DEQ A;  1JB0 E;  4MDW A;  2MI6 A;  3M0S A;  2CP3 A;  2JTM A;  5GAN d;  3S3O A;  4B6M A;  2LCL A;  2O01 E;  2P84 A;  5CR2 A;  3M0P A;  1ZBJ A;  4Y91 A;  3PIO A;  3TSW A;  2G3R A;  1EIF A;  2GTO A;  3OS1 A;  1YBY A;  1I5O B;  1MHN A;  3CXC S;  3H0H A;  4RTW A;  2Z0W A;  5I11 A;  1S72 T;  1IHV A;  2X3X D;  5GAM d;  4OMO A;  3JCM f;  1M90 R;  4IUR A;  1NZ9 A;  3BFM A;  1XTD A;  1ZUY A;  4TVR A;  3CC4 T;  1S72 Q;  4M7D B;  1U3O A;  3VS3 A;  3M5A A;  1CKB A;  2VXE A;  5LJ5 g;  1HXD A;  3QJY A;  2RHI A;  3JCM Q;  3QG1 A;  4IIM A;  2AK5 A;  2J6F A;  2C0O A;  3CMA T;  2W10 A;  4M77 C;  3H0F A;  1Z9Q A;  3CEY A;  1RAA B;  4M75 D;  4J9G A;  3P8B B;  2QEX Q;  2G6F X;  1MMG A;  2GFU A;  3H41 A;  4BDZ A;  5GAM j;  1D3B A;  5FRO A;  4ANJ A;  1T3L A;  4X9D A;  1BU1 A;  4Z89 A;  5LL6 S;  2OJ2 A;  1TS9 A;  5AT1 B;  1V29 B;  2X4W A;  4LXC A;  1KJW A;  2LQW A;  2DL5 A;  3HRT A;  5KYX A;  5DLO A;  4MML A;  2DXU A;  3CQT A;  1D1B A;  2EYQ A;  1AD5 A;  3GF5 A;  3Q1J A;  1KQ2 A;  1QWF A;  1D09 B;  3EGU A;  2DXT A;  3VUB A;  4C8Q D;  2FZC B;  3DKM A;  1FMV A;  3CCL T;  1JEG A;  2XU8 A;  3HKS A;  5LJ5 e;  5KCO A;  3RMQ A;  4IKF A;  1Y57 A;  2VYT A;  2DRM A;  2J7I A;  2PQW A;  4XU1 A;  1YHQ A;  3CCE Q;  5KH6 A;  2JMA A;  2LVM A;  4XTV A;  3THK A;  4XTY A;  3EGX B;  4PJO D;  2CP6 A;  1PD0 A;  3EG9 B;  2RA2 A;  2CH4 A;  2KEA A;  2E12 A;  2JXB A;  3OMG A;  1JJ2 S;  4QVC A;  4OMP A;  3M56 A;  1SRM A;  4J9D A;  4BE0 A;  1IZ6 A;  2HEQ A;  2DE0 X;  4UC4 A;  5GAO n;  2K6D A;  1JQQ A;  4J9F A;  4RCC A;  2DX1 A;  3X24 B;  2X4Y A;  1WLP B;  1VQM Q;  2JOY A;  1K9A A;  1M90 C;  4M78 A;  1I07 A;  2RQW A;  1W2B P;  4OB1 B;  1PSE A;  2DA9 A;  3G6E T;  2COZ A;  3QII A;  3J7A F;  2VWF A;  4N4H A;  3I9Q A;  5DY9 A;  1M1K U;  1N5Z A;  2V8K A;  3G4S Q;  2OTJ Q;  4PJM A;  4KH0 B;  2KRN A;  5GJV B;  2HSE B;  1RAI B;  2J6K A;  1OZ3 A;  2EQI A;  2VAS A;  4PJO G;  2CP7 A;  4II1 A;  3RIR A;  4ELY C;  2DL7 A;  3J80 E;  2E3H A;  1M3B A;  3LH0 A;  4M77 D;  4JS4 A;  1VQM T;  2JM8 A;  4PJO E;  2YUN A;  3QWX X;  4OMN A;  3CC2 A;  2CZ1 B;  1NG2 A;  1S72 A;  5I22 A;  4A53 A;  4C8Q G;  2HAX A;  2BE9 B;  1UEC A;  1E6H A;  5CKF A;  4DA4 A;  2KMT A;  4OF1 A;  1M9S A;  3CC4 A;  1M90 U;  1VQP T;  2XDB A;  5KYN A;  2J06 A;  1ZUU A;  2VGM A;  5KCH A;  1JU5 C;  2E1H A;  4HT9 A;  1IRX A;  4LUE A;  4NS5 A;  2QAS A;  1RAH B;  2EJF A;  4HKE A;  2YLB A;  1YHQ Q;  3AHU A;  2QQB A;  4EMK B;  4LNP A;  1NPR A;  3MPU B;  3FDR A;  4IUV A;  3LGL A;  4M78 B;  3PTA A;  4PFZ A;  2H3J A;  5D6Y A;  1MMD A;  2HMA A;  3ZFJ A;  1N27 A;  1SKU B;  4XAX B;  4JJD A;  1M1K C;  2EIF A;  4AG2 C;  3TVT A;  1ZQ1 A;  3CD6 T;  2DZC A;  4AFZ C;  4FW2 A;  3M0Q A;  1VQO T;  3JCM c;  2AT1 B;  1GBR A;  2GTJ A;  5A2Q E;  5C0M A;  1VQ5 A;  4B9X A;  1ZSZ C;  2BIV A;  2V26 A;  1NYG A;  2CGH A;  1WYX A;  4F7U A;  4RMO A;  3NTI A;  2QQR A;  4EPC A;  1TUG B;  5GAO p;  1UB4 A;  1WXB A;  1WGS A;  1ZSZ A;  3QHS A;  1VUB A;  2GGR A;  1MUZ A;  4QQG A;  2DER A;  1YJ9 T;  2EQK A;  1X69 A;  4PJO F;  2QEX T;  4IIO A;  1M2O A;  1VIE A;  4RTY A;  3HTR A;  1NJI R;  1Q81 R;  1KQS S;  1RI9 A;  4E7H A;  2X4X A;  3E1S A;  1RAG B;  1U8R A;  2OTL T;  5FU6 B;  2OX7 A;  2QDL A;  3JCM V;  2F2V A;  3CC2 T;  2P4R A;  4NOY A;  4C8Q C;  5LJ3 g;  4D6W A;  2ESW A;  3T9N A;  3CMA A;  5I2M A;  4XU3 A;  1AHJ B;  1UUE A;  3CCQ T;  3ASK A;  3SWN C;  1M27 C;  1VQO Q;  4R56 A;  4M7A F;  1WJS A;  1YWO A;  3VRZ A;  1PD1 A;  2RJF A;  1W1F A;  2E41 A;  4C0D C;  3MO8 A;  4M77 B;  2EW3 A;  2CZ0 B;  1BIA A;  3OS5 A;  4A4K A;  1AWX A;  4FCY A;  2GF7 A;  4M78 C;  4FSS A;  1RUW A;  1KC8 U;  4C8Q F;  1XJW B;  2EFI A;  3OYF A;  2MOX A;  4YTL A;  3GNF B;  1YCS B;  1QWE A;  3CCU T;  1LVK A;  4C5E A;  5LJ3 h;  2KAF A;  2QQ9 A;  1Q95 G;  4J6Y A;  5GMK l;  2FZK B;  2NUT B;  3LWI A;  1KD1 U;  2IG0 A;  2JMC A;  4FIB A;  2DO3 A;  3VS4 A;  1YIT Q;  3R6N A;  5KYY A;  4HA8 A;  1WX6 A;  1N6A A;  1YI2 A;  3P8H A;  2JTF A;  4LDW A;  3HFO A;  2EYY A;  2LCS A;  5IXF A;  2LTO A;  2DIQ A;  4C0G A;  4PJL A;  1VYV A;  1I4K 1;  2HKQ B;  2NWM A;  3TRE A;  1UJY A;  2CKK A;  1GFC A;  2QDY B;  1QVG A;  1RLQ C;  3X26 B;  4C5H A;  5GAN j;  3WXM B;  1YJW A;  3CCS A;  1W70 A;  4Y92 A;  5AYF A;  3V7R A;  3JCM J;  1PHT A;  1VQ4 T;  1X6O A;  3MJX A;  4M75 E;  1LJO A;  4ATO A;  4XTU A;  2EYX A;  1K9M U;  4JDS A;  3BDU A;  1AT1 B;  2L5Q A;  4X34 A;  2KT8 A;  1WXT A;  4C92 D;  3QBY A;  4FSX A;  1JJ2 P;  1GBQ A;  2DJQ A;  5D6W A;  1SG5 A;  3MP6 A;  1ABO A;  4Z88 A;  2RJC A;  2CP5 A;  3KBG A;  1KQS P;  4OGC A;  1LNX A;  3PVQ A;  3U23 A;  1FX7 A;  4A4G A;  3M0R A;  1QP2 A;  2MWO A;  2XDD A;  2XI9 A;  3MP1 A;  5GAO q;  1M8V A;  9ATC B;  4FYY B;  1YJ9 Q;  1GRI A;  2Y4X A;  1VQK A;  2BE7 D;  2KY9 A;  5GAM g;  4GLK A;  2DRK A;  2PUO B;  4OB2 B;  3QSU A;  2A08 A;  1AVZ C;  1U5S A;  3M4G A;  4C0D B;  1G2B A;  2JJ9 A;  4XTW A;  5GAN h;  4KUI A;  2A3L A;  3A8G B;  5J39 A;  1KQS A;  5I2S A;  1ZSZ B;  2DVJ A;  4OMQ A;  1VQ8 A;  2E6N A;  2Y4Y A;  3A8H B;  3TSZ A;  4DBQ A;  1BCM A;  1YIJ A;  4M75 A;  3HHT B;  3QO3 A;  2DF6 A;  3I56 Q;  3FLG A;  3FRN A;  1GXI E;  5GAN 8;  2K3Y A;  1GCQ C;  4CRI A;  4OP0 A;  3JB9 F;  2KDS A;  1OU8 A;  2KGT A;  2E5K A;  5FRM A;  3IQL A;  2K2M A;  4RKU E;  2KNB B;  1W6X A;  3PMT A;  3WVE B;  4ESR A;  3X20 B;  4FYW B;  2DXC A;  4J9H A;  1PRL C;  3H9N A;  3LW5 E;  4JRI A;  1VQ7 Q;  3EFR A;  1IB8 A;  3UPU A;  5HCK A;  2JW4 A;  3E19 A;  4F14 A;  1YIT A;  3I55 Q;  1VQP A;  1KK7 A;  3BW1 A;  4MZP A;  1QLY A;  1WHG A;  4M78 E;  3G71 A;  2OI3 A;  3M4Y A;  4FT2 A;  1VA7 A;  2OAW A;  3OYY A;  1UJ0 A;  3L1A A;  4HCZ A;  2LJ0 A;  3HL8 A;  1AZG B;  3EH2 A;  2DL8 A;  1YN8 A;  4ME7 A;  2P0K A;  2ZPE B;  3GPL A;  3BDL A;  1Q86 R;  2OTL A;  3HRU A;  3C94 A;  2K3B A;  1PM3 A;  2QQA A;  4AMC A;  2DTH A;  4N0A A;  3TEE A;  2K79 A;  2E5Q A;  3QKJ A;  2DNU A;  1N9S A;  4MDX A;  5IHI A;  5CO7 A;  3JSC A;  5L8R E;  1F1B B;  1K1Z A;  2EQM A;  4PJO A;  1GCP A;  3CXC P;  1FMK A;  1QVG P;  3VUZ A;  4ZN1 A;  2QG9 B;  1VQ8 T;  5CIU A;  1K76 A;  1MMA A;  1I0C A;  2A0F B;  5KYW B;  1VQL A;  2DK3 A;  2RMO A;  4E7Z A;  3EG3 A;  2YT6 A;  1EZZ B;  2QGF B;  2ROT A;  4M7A G;  2QYZ A;  1PRM C;  2C0I A;  2HNI A;  4A63 B;  2AKL A;  2C0T A;  5CKD A;  4JJC A;  1X2K A;  4PNO A;  3JB9 H;  1K0X A;  1BYM A;  3JV3 A;  4RG8 A;  2EYW A;  3M59 A;  1HYO A;  2O2O A;  3PT9 A;  5LJ5 d;  2BZY A;  4V2S A;  1OOT A;  2DIL A;  2RHU A;  5L23 A;  3FB9 A;  2RK1 A;  1SF9 A;  5LJ3 j;  8ATC B;  3CCE A;  1VYU A;  5GAO r;  1M2V A;  4QW2 A;  3L2R A;  3KUF A;  1BIB A;  2FZG B;  3G6E Q;  3CME A;  3QZ9 B;  2PTK A;  2KR3 A;  4ZGJ B;  3QDR B;  2JZ2 A;  4MMK A;  5GAN 7;  2XMF A;  2CRE A;  1VIF A;  5IXB A;  1MNE A;  2XD0 A;  2KI7 A;  1ARK A;  1K8A R;  2COY A;  3OA6 A;  4J8O A;  2F69 A;  4RTV A;  3M53 A;  1Y7X A;  2RK2 A;  4M77 E;  2DIG A;  2F1L A;  4RTZ A;  3OBY A;  4ORZ A;  3V7S A;  1W2B S;  2M16 A;  2A37 A;  1UHF A;  2MAM A;  1RAD B;  2LX9 A;  2VC8 A;  1TXQ A;  1TUD A;  1B7T A;  2GFA A;  3VS0 A;  3QWY A;  2JT4 A;  1G3Y A;  4LDU A;  4QQ6 A;  2LT1 A;  1AWO A;  3CBO A;  1J3T A;  3GIB A;  4ZGD B;  1ACM B;  3OW2 A;  1YJN A;  2LRQ A;  3REB B;  4BE2 A;  2F5T X;  5GAN 5;  1GCQ A;  1OQK A;  4Q5W A;  1QMC A;  2JM9 A;  2NUT A;  2XG8 D;  1V76 A;  2MWP A;  1N8R C;  2YRD A;  4PKC C;  4C92 C;  3I55 A;  4CC4 B;  4AG1 C;  2PVG B;  5KYU A;  5KYY B;  2D6F A;  4QVD A;  4CC7 A;  3CD6 Q;  5CKE A;  1WHM A;  1K4U S;  2YXY A;  1GFD A;  2EYZ A;  1ZX6 A;  2KQW A;  3CCE T;  2YRC A;  4HXJ A;  3RDV A;  4MZM A;  3A1P A;  4HVW A;  5GMK e;  2D1X A;  5GAN f;  1H92 A;  1QQJ A;  2V1Q A;  1P92 A;  3CCM Q;  2QI2 A;  2EWN A;  3OBW A;  1WDX A;  2DL4 A;  4D8D A;  2MPX C;  2LJ1 A;  2NLU A;  3VJP A;  5FU6 C;  1ZHI A;  2YWW A;  2B8A A;  4HCB A;  3GNG A;  4IUQ A;  3V7C A;  1KFZ A;  2D8J A;  5FU7 C;  4C8Q E;  4BD3 A;  1EFN A;  1U06 A;  2ENM A;  4J7F A;  4M75 F;  2Y90 A;  1TTH B;  3QZ5 B;  3LWH A;  3JCM g;  4J9E A;  2ED1 A;  4C8Q A;  5CK9 A;  4DQ2 A;  3CCR A;  3GBQ A;  2J05 A;  1PWT A;  2L3S A;  3A8O B;  4J6W A;  1VQM A;  3CCM T;  1BI0 A;  1MND A;  4M7A D;  2GBQ A;  2NUZ A;  4LDY A;  4BDY A;  1G5V A;  2RHX A;  4O5V A;  5LJ3 e;  4PFO A;  1W4S A;  1PKS A;  3QYH B;  4J9I A;  1WQ7 A;  5GAM h;  1YCY A;  1WHJ A;  2QGG A;  1TG0 A;  3JCM W;  2H3E B;  3S6W A;  1YWP A;  1ZA2 B;  2D0N A;  3O5Z A;  5GAN g;  1K73 R;  1I1J A;  4XU0 A;  2M0Y A;  1D3B B;  4QVZ A;  5J26 A;  3NFC A;  2KBT A;  1SPK A;  2PZ1 A;  3OYE A;  2WAC A;  3VRY A;  5KE3 A;  2DTO A;  3CC2 Q;  2KE9 A;  2RQU A;  5GAM f;  3CPF A;  4OML A;  1K8A U;  5FWC A;  4OMM A;  3QJ6 A;  5FU7 B;  2V8I A;  4J9B A;  2VKN A;  3UA7 A;  2CZ6 B;  4J5Y A;  3I56 A;  3A8L B;  3E9G A;  3CPW S;  2ZPI B;  1UGR B;  1WQW A;  2ECZ A;  1Q81 U;  3OQ5 A;  3RNJ A;  2JNG A;  2X3W D;  3CC7 Q;  3CC4 Q;  2E64 A;  4ZTJ A;  1IGU A;  2CSQ A;  1M1F A;  1MGQ A;  3SHW A;  3I56 T;  1YJN T;  2FRW A;  2SRC A;  1CKA A;  4BI8 B;  1E7O A;  3CPW A;  3NGP A;  1EX4 A;  2EGC A;  1G3S A;  2MMP A;  4E7S A;  3A5Z B;  2KRS A;  4ZGE B; 
#chains in the Genus database with same CATH homology
 4BI3 A;  2XI9 A;  4C92 F;  3MP1 A;  4PL6 A;  3OS2 A;  2LT4 A;  5GAO q;  1NE8 A;  2F5K A;  4X9C A;  2QXF A;  1M8V A;  3OYG A;  4R55 A;  2R58 A;  2Y4X A;  1VQN A;  1VQK A;  2KSS A;  3ZBD A;  1Y96 A;  5GAN 6;  2KY9 A;  3F70 A;  3HRS A;  2DEQ A;  4FL6 A;  4GLK A;  5GAM g;  1JB0 E;  4MDW A;  2MI6 A;  2JTM A;  4OB3 B;  2PUO B;  4OB2 B;  3FC3 A;  5GAN d;  3QSU A;  2K3X A;  2ZCF B;  3S3O A;  1Q82 C;  4FU6 A;  4M77 A;  1YHQ T;  2LCL A;  2I2L A;  2M1H A;  2O01 E;  5CR2 A;  2XHC A;  4E47 A;  3M4G A;  4C0D B;  4Y91 A;  3PIO A;  2G3R A;  4XTW A;  1EIF A;  3PGG A;  5GAN h;  1DJ7 B;  4KUI A;  3L2Z A;  2A3L A;  3OS1 A;  1YBY A;  5CAI A;  4C92 E;  3A8G B;  2P0Q A;  3OMC A;  5J39 A;  1KQS A;  5I2S A;  4BAC A;  2R5A A;  2FYK A;  3VU3 C;  3CCR T;  1MHN A;  2E6N A;  3CCV T;  4JRQ A;  1VQ8 A;  2Y4Y A;  3A8H B;  3CXC S;  3JB9 J;  4PLL A;  2C06 A;  1I8F A;  5J3B A;  5GAO m;  2P0P A;  1S72 T;  5GAM d;  3OYC A;  1M4Z A;  3JCM f;  3CCM A;  4M75 A;  2QEX A;  1YIJ A;  3HHT B;  4IUR A;  1NZ9 A;  3BFM A;  3QO3 A;  4BI4 A;  1XTD A;  5M9O A;  2ZGW A;  3M9Q A;  3JB9 I;  2L89 A;  4TVR A;  3FLG A;  3CC4 T;  2DTI A;  3FRN A;  1O75 A;  1GXI E;  3OYB A;  4M7D B;  2L3R A;  4LDX A;  5GAN 8;  1LOJ A;  3DB3 A;  3M5A A;  2K3Y A;  2CZ7 B;  3J81 E;  4JJN K;  2VXE A;  1VQ6 T;  4A4H A;  4CRI A;  1BKB A;  4OP0 A;  3JB9 F;  5LJ5 g;  3SDZ A;  2KDS A;  1HXD A;  1X75 C;  5FRM A;  3QJY A;  2RHI A;  2XK0 A;  3C12 A;  3JCM Q;  5GMK h;  2QA4 A;  3QG1 A;  4RKU E;  3RKX A;  5DLQ E;  3CMA T;  3V8J A;  3PIP A;  3PMT A;  4M77 C;  1OI1 A;  3WVE B;  3X20 B;  2QA4 T;  3CEY A;  4M75 D;  2X4J A;  3OW2 S;  3CCJ A;  3P8B B;  3QXE B;  2DXC A;  4KBM B;  2XIC A;  2GFU A;  1QVP A;  3LW5 E;  4JRI A;  1D3B A;  3EFR A;  5FRO A;  5GAM j;  4X9D A;  4BDZ A;  5GAO l;  2DVE A;  5CKH A;  3UPU A;  1K73 U;  1WPY A;  5LL6 S;  3CME T;  4RG2 A;  4PJO C;  1V29 B;  2X4W A;  2RB6 A;  1QVF S;  5GAN 3;  2FB7 A;  3E19 A;  1YIT A;  2K57 A;  3G71 T;  4EMK A;  3L2Q A;  1K9M C;  1VQP A;  1TH7 A;  4IUU A;  3BW1 A;  4KUD K;  4MZP A;  5CQX A;  3HRT A;  4C0Z A;  3R6O A;  3P8D A;  4M78 E;  2MF2 A;  3G71 A;  3M4Y A;  4N0A C;  4EMG A;  4FT2 A;  5DLO A;  3OYY A;  2DXU A;  1RI0 A;  2QTX A;  3L1A A;  4MML A;  3OYI A;  2A7Y A;  2E10 A;  2EYQ A;  3GF5 A;  3Q1J A;  4BE1 A;  3CC7 T;  2V8J A;  1OZ2 A;  2YHT A;  4HCZ A;  1KQ2 A;  3VUB A;  2DXT A;  3HL8 A;  1NJI U;  4C8Q D;  3DKM A;  1VQ7 T;  3CCL T;  3A8M B;  2AHJ B;  2LC4 A;  3HSB A;  2XU8 A;  3HKS A;  4ME7 A;  5LJ5 e;  2P0K A;  2ZPE B;  3RMQ A;  3BDL A;  5A0D A;  5KCO A;  2RI2 A;  2K2V A;  3HRU A;  4J6X A;  3GPL A;  2OTL A;  4IKF A;  2VYT A;  3C94 A;  2PQW A;  2QQA A;  4XU1 A;  1YHQ A;  2WSC E;  4M7D C;  3QUI A;  5KH6 A;  4OB0 B;  3L42 A;  4F7U E;  1QVF A;  2DTH A;  4N0A A;  4XTV A;  2LVM A;  3TEE A;  4XTY A;  2R5M A;  2E5Q A;  1N9R A;  3QKJ A;  3SWN A;  4M7D G;  1N9S A;  2CYZ B;  5C6S A;  4MDX A;  4PJO D;  1K8A C;  5CKB A;  5CO7 A;  3JSC A;  1XQH A;  5L8R E;  2LCC A;  3SB2 A;  5LJ5 f;  3O8V A;  2RA2 A;  2EQM A;  4KT0 E;  2E12 A;  4PJO A;  4IUT A;  3FIF A;  3C95 A;  3OMG A;  1JJ2 S;  4QVC A;  3G4S T;  3M56 A;  1YIJ T;  1Y71 A;  1W2B A;  1JBM A;  2PU9 B;  2RI5 A;  4BE0 A;  1IZ6 A;  4UC4 A;  3VUZ A;  1UGQ B;  4LD6 A;  4ZN1 A;  5GAO n;  3M55 A;  1YJ9 A;  4F7U B;  1VQ8 T;  5CIU A;  2E6Z A;  1WJQ A;  5HY6 A;  2RH2 A;  1VQL A;  2DK3 A;  2FHD A;  1BI2 A;  2K4Y A;  3CBM A;  2JUF A;  1N8R U;  4M7A G;  4IUP A;  4RCC A;  5CCA A;  3RKW A;  3UWN A;  1FXX A;  2X4Y A;  3X24 B;  5KE2 A;  2JOY A;  2HNI A;  1M90 C;  4C92 B;  3PMI A;  2ZPF B;  5LJ3 f;  3CCJ T;  5CKD A;  4M78 A;  5FRN A;  1YIT T;  4PNO A;  3JB9 H;  3H8Z A;  1BYM A;  2EKO A;  2LQK A;  4OB1 B;  1PSE A;  2VUB A;  2FL7 A;  4RG8 A;  3TCJ A;  5A0G A;  1VQ5 T;  3M59 A;  3G6E T;  3HP9 A;  2DD4 A;  3CCS T;  3QII A;  4HCC A;  3PT9 A;  2DZ9 A;  3J7A F;  4N4H A;  5LJ5 d;  3C4S A;  4V2S A;  4LD9 K;  2RD1 A;  3CD6 A;  4PLI A;  5DY9 A;  2PVO B;  2DXB A;  1M1K U;  3CC7 A;  2V8K A;  2RHU A;  2EQJ A;  3HFN A;  3FB9 A;  1HK9 A;  2RK1 A;  3FEO A;  5LJ3 j;  3CCE A;  3GP8 A;  2VGN A;  5GAO r;  1VQ7 A;  4M7D E;  4J83 A;  4C92 A;  4QW2 A;  3L2R A;  1OZ3 A;  5FLX E;  4PJO G;  3CCQ A;  4KUL A;  4II1 A;  3L2U A;  1Q7Y C;  3GLX A;  1B34 B;  3INZ A;  4M78 D;  4M7A C;  3RIR A;  4ELY C;  1SSF A;  3SFM A;  3J80 E;  3KUF A;  3LH0 A;  4M77 D;  1BIB A;  3ER0 A;  1KHI A;  3CME A;  2D9T A;  3QZ9 B;  3UT1 A;  4JS4 A;  1G3W A;  4Y28 E;  1VQM T;  1VQ9 T;  4ZGJ B;  3QDR B;  2JZ2 A;  4MMK A;  2VV5 A;  5CQY A;  5I21 A;  5GAN 7;  4PJO E;  3CC2 A;  2XDP A;  1VIF A;  2CZ1 B;  2DPP B;  2XD0 A;  4NL3 A;  2VXF A;  1S72 A;  4M78 F;  4A53 A;  4C8Q G;  2HAX A;  3MHX A;  4JLG A;  1Y96 B;  1G3T A;  5CKF A;  4DA4 A;  2KMT A;  3MEA A;  4OF1 A;  4A4F A;  1VQK T;  1QVG S;  5A0L A;  1M9S A;  3CC4 A;  1M90 U;  5EG2 A;  1OYX A;  3OA6 A;  4J8O A;  1VQP T;  2F69 A;  2XDB A;  1KHC A;  3EAE A;  3N5B B;  4M7A E;  2E65 A;  3S3N A;  2IVW A;  4M75 B;  2VGM A;  4XU2 A;  3M53 A;  5KCH A;  1BI1 A;  3DLL A;  3HPW A;  1R8O B;  4JS5 A;  2E1H A;  3WVD B;  3JCM P;  4HT9 A;  4M75 C;  2LDM A;  1Y7X A;  1ZBX A;  4NS5 A;  2YLC A;  3CXC A;  2RJE A;  3G7Z A;  2RK2 A;  2CS7 A;  2EJF A;  4B9W A;  4HKE A;  4M77 E;  2YLB A;  3OYN A;  2DIG A;  3AHU A;  2QQB A;  4EMK B;  1NPR A;  2GQV A;  3FDR A;  3OBY A;  4IUV A;  4BUG A;  3LGL A;  3MEW A;  2LQ8 A;  1H3Z A;  4M78 B;  3PTA A;  3V7S A;  2ZPH B;  3MP8 A;  1W2B S;  2H3J A;  4M7D D;  2M16 A;  2MAM A;  2RHY A;  5D6Y A;  4EMH A;  3PFS A;  2RJD A;  3ZFJ A;  2EAY A;  3MET A;  2LX9 A;  3NTH A;  2VC8 A;  3GOX A;  1N27 A;  2GFA A;  4XAX B;  1M1K C;  4LDU A;  1G3Y A;  3JAM E;  2EIF A;  4QQ6 A;  1H64 1;  2LT1 A;  4L59 A;  4L6V 5;  2KK4 A;  3CBO A;  4E7L A;  1ZQ1 A;  3CD6 T;  2DZC A;  3GIB A;  3V8L A;  1VQO T;  4PJO B;  3JCM c;  3JCM b;  2XDD A;  2RHZ A;  4ZGD B;  5A2Q E;  5C0M A;  1VQ5 A;  3G6E A;  3M54 A;  4B9X A;  5GAN e;  3OW2 A;  1YJN A;  2BIV A;  2LRQ A;  3I55 T;  4BE2 A;  2F5T X;  1B34 A;  5GAN 5;  3OSS C;  2CGH A;  4NL2 A;  4XQ3 A;  4Q5W A;  4DOV A;  4F7U A;  4C5I A;  1BI3 A;  1UGP B;  2FVU A;  2K5F A;  3MEV A;  3UDC A;  2M9U A;  3NTI A;  2XG8 D;  4RMO A;  2QQR A;  4EPC A;  2MWP A;  1N8R C;  1I81 A;  4PKC C;  4C92 C;  3I55 A;  2PVG B;  1KC8 C;  5HKC A;  2PVD B;  5GAO p;  1UB4 A;  4M77 F;  3G4S A;  2D6F A;  4QVD A;  3MEU A;  1WGS A;  4Z02 A;  5CKE A;  3QHS A;  1VUB A;  4L5G A;  2HBP A;  2X35 A;  3RES A;  1Y07 A;  4DOW A;  4QQG A;  3L2W A;  2RO0 A;  3FJP A;  3NTK A;  2K5L A;  3OYA A;  1YJ9 T;  1NPP A;  2EQK A;  3SD4 A;  1VQ6 A;  4PJO F;  4ELZ C;  2QEX T;  2OTJ T;  2KQW A;  4M75 G;  1VIE A;  4MZT A;  3CCE T;  3OYK A;  2BKD N;  1KQS S;  4JRP A;  1QP3 A;  4MZM A;  3V8K A;  4N4G A;  1M1G A;  4F7U G;  5GMK e;  3LX7 A;  4E7H A;  1Q86 C;  2L8D A;  2X4X A;  3E1S A;  5GAN f;  1YI2 T;  3X25 B;  1P92 A;  3CCU A;  2QI2 A;  1U8R A;  2OTL T;  2EWN A;  3OBW A;  4N4I A;  5FU6 B;  5LJ3 d;  3JCM d;  4M78 G;  5IT9 E;  3JCM V;  1X01 A;  5GMK i;  4J7I A;  2NLU A;  1VQN T;  3X28 B;  1WNL A;  1KD1 C;  3CC2 T;  3VJP A;  5FU6 C;  1ZHI A;  2B8A A;  3M58 A;  4NOY A;  4C92 G;  4C8Q C;  4HCB A;  5LJ3 g;  3GNG A;  4XTZ A;  4VUB A;  1Q81 C;  4IUQ A;  3V7C A;  3M57 A;  4D6W A;  3H6Z A;  3T9N A;  3L2V A;  4HT8 A;  2DKG A;  1QW1 A;  2ZZD A;  4ZN3 A;  3CMA A;  5FU7 C;  5I2M A;  4FT4 A;  5GAN 4;  4C8Q E;  3E9F A;  4BD3 A;  3JCM X;  2ZPB B;  1NJI C;  2OAU A;  3VYG A;  3EFS A;  1AHJ B;  4J7F A;  4M75 F;  4XU3 A;  3JB9 G;  1VQ4 T;  2Y90 A;  4XK8 E;  4RCB A;  3ASK A;  3CCQ T;  3TU4 K;  3SWN C;  4R56 A;  2HQX A;  3ME9 A;  3QZ5 B;  4M7A F;  1WJS A;  3ZEH A;  3LWH A;  1XNI A;  3JCM g;  4C8Q A;  5CK9 A;  4GY5 A;  4LDV A;  2RJF A;  4E7I A;  4DQ2 A;  3DLM A;  3CCR A;  4C0D C;  2E41 A;  5LJ5 j;  3MO8 A;  3OY9 A;  4M77 B;  3A8O B;  4J6W A;  2CZ0 B;  1BIA A;  3OS5 A;  5LJ5 h;  1VQM A;  4A4K A;  2M0O A;  2KVQ G;  2GF7 A;  3JCM h;  1BI0 A;  4M78 C;  5HK0 A;  4BY6 C;  3CCM T;  4M7A D;  1K73 C;  2QQS A;  4EMK C;  4LDY A;  1PSF A;  4C8Q F;  4BDY A;  1KC8 U;  3CCL A;  5GAM e;  2EFI A;  4OMF B;  3CCV A;  1G5V A;  3OYF A;  3JB9 D;  2RHX A;  4O5V A;  5LJ3 e;  4YTL A;  1WJR A;  3JCM e;  1Q7Y U;  3BY7 A;  4P5N A;  1W4S A;  1O9S A;  3GNF B;  1RL2 A;  3QPH A;  4EDU A;  1KQ1 A;  2JVV A;  3QYH B;  4CI0 C;  1WQ7 A;  3OYM A;  4C8Q B;  5GAM h;  3OYD A;  3CCU T;  1YCY A;  2D0Q B;  1IRE B;  4C5E A;  5LJ3 h;  3LLR A;  2O4X A;  2BUD A;  2KAF A;  2QQ9 A;  3JCM W;  2HD0 A;  4J6Y A;  5GMK l;  3S6W A;  3VKI A;  3VV0 A;  3LWI A;  3JRZ A;  1KD1 U;  1UEB A;  3PNW C;  5GAN g;  2IG0 A;  3MCA B;  4FIB A;  4M7A A;  2DO3 A;  5GMK m;  3OSV A;  4XU0 A;  4JRK A;  1D3B B;  4HA8 A;  4QVZ A;  5J26 A;  3NFC A;  1N6A A;  4E7K A;  3OB9 A;  5IAY A;  1YI2 A;  1JJ2 A;  3P8H A;  2JTF A;  5HK3 A;  4LDW A;  3HFO A;  2WSE E;  2DAQ A;  3OYE A;  2WAC A;  4E7J A;  2GCX A;  2DD5 A;  5KE3 A;  1UGS B;  2DTO A;  2ZPG B;  2EJG A;  2LTO A;  2DIQ A;  4C0G A;  5GAM f;  3CPF A;  2JN0 A;  1I4K 1;  1K8A U;  3KXT A;  1VQL T;  3QJ6 A;  2PUK B;  4M7D F;  5FU7 B;  3TRE A;  1KG1 A;  4WF2 A;  2V8I A;  3OYL A;  3S3M A;  2CKK A;  4OVA A;  2QDY B;  3RMS A;  1VQ9 A;  3RUX A;  3OYJ A;  2E70 A;  1QVG A;  2CZ6 B;  4ZTF A;  1U1S A;  3QYG B;  4J5Y A;  3I56 A;  1JRI A;  3A8L B;  1M5Q 1;  2XID A;  1I5L A;  3X26 B;  4C5H A;  1Q82 U;  2WSF E;  3E9G A;  3CPW S;  2RM4 A;  2ZPI B;  1UGR B;  2R57 A;  3DB4 A;  4M77 G;  1XOV A;  3WXM B;  5GAN 2;  5GAN j;  1WQW A;  2DJZ A;  1Q81 U;  3OQ5 A;  1YJW A;  3CCS A;  2JNG A;  4QQD A;  3LGF A;  5AYF A;  3V7R A;  4BB7 A;  4A54 A;  3JCM J;  1X6O A;  4XTX A;  5IN1 A;  4C5G A;  2OTJ A;  2E64 A;  1LJO A;  4M75 E;  4XTU A;  3SWN B;  4ZTJ A;  1YJW T;  4ATO A;  3OS0 A;  4M7D A;  4JLI A;  2YRV A;  1K9M U;  4JDS A;  2EQU A;  3BDU A;  1M1F A;  1MGQ A;  3LYI A;  2L5Q A;  4X34 A;  3I56 T;  4O6J A;  1Q86 U;  3RER A;  5CVI A;  4C92 D;  1YJN T;  3QBY A;  1U1T A;  5DM7 R;  4FM4 B;  2XKO C;  4FSX A;  3CBP A;  3URG A;  5D6W A;  4F7U F;  4BY6 B;  3MP6 A;  2RI3 A;  2LNV A;  2RJC A;  3VYH B;  4BI8 B;  1VQO A;  2EJ9 A;  3KBG A;  3CPW A;  2O4X B;  4OGC A;  1LNX A;  3OYH A;  2K5I A;  1G3S A;  1FX7 A;  4A4G A;  5GMK j;  1FWZ A;  2HQE A;  2MMP A;  4OGE A;  5D6X A;  4A4E A;  1VQ4 A;  1QP2 A;  3RKY A;  4M7A B;  2MWO A;  3A5Z B;  2P4T A;  4JUV A;  4ZGE B;  4C0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...