2KK4A

Solution nmr structure of protein af2094 from archaeoglobus fulgidus. northeast structural genomics consotium (nesg) target gt2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'QGHMDLICMYVFKGEESFGESIDVYGDYLIVKVGTEFLAVPKKSIKSVEDGRIVIGEFDEEEARELGRKWLEEKSKPVTLEELKSYGFGEEGEGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_2094
publication title Solution NMR structure of proterin AF2094 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.580 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kk4A00
2KK4A
chains in the Genus database with same CATH superfamily
4J8OA 4RTYA 1RI0A 3P8BB 2HDAA 2O2OA 1UGPB 3OYDA 3QZ5B 5LJ3j 1K4US 3OYMA 4OMFB 2F5KA 2FYKA 3H0FA 4E7JA 1AD5A 2V8KA 5CKDA 1PKSA 4JJNK 1KK7A 2D9TA 2L3QA 4RKUE 2HL5C 1OU8A 2LX7A 3J80E 1YP5A 4X1VA 1ZBJA 1PRMC 4PL6A 2JVVA 3AT1B 1S1NA 2FPDA 3JCMe 3CMAA 2COZA 2LCLA 3BE3A 5LJ5d 2CDTA 2E41A 3LGFA 3T9NA 4BD3A 4M7AE 2OAWA 2VB6A 1D3BB 2C0TA 1VQKA 1JQQA 1K9MU 1RAAB 1MGQA 4QKUA 2RJCA 2EJGA 5AT1B 2X3XD 2RHYA 4CRIA 3QZ9B 3OYJA 1VQ5T 3CCRA 3JCMW 1GRIA 4D8DA 1OQKA 2HQHA 2VKNA 3LH0A 5IXBA 1VQ8A 4JJCA 4BY6B 1QCNA 1M2VB 2YWWA 3QWXX 3CCEA 4C0ZA 3M4GA 1EFNA 1M9SA 1M8VA 1Q82C 1I0CA 3SHWA 5GAOn 4JRKA 1D1CA 2B86A 2JMCA 3M55A 4FYVB 4QT7A 4HA8A 2QASA 2KVQG 5GJWB 5I2SA 1UE9A 2I0NA 3G4ST 2KY9A 3J81E 4N4GA 1NPPA 2F1LA 4LUDA 2E5KA 5J26A 3JCMg 2JW4A 2VVKA 1VQMA 3CC2A 1SEMA 3ZL7C 4BACA 2KT1A 1M90U 4DOVA 1MMGA 1N8RR 1JBMA 2R5MA 4B9XA 1PM3A 4E6RA 1G83A 3OBYA 3MP1A 4F14A 3QO3A 3OYBA 1RLPC 2DD4A 1Q81U 3M9QA 4FCYA 1Q86U 4F04B 2DBMA 3G4SQ 3CPWS 1X01A 1BU1A 1AWOA 1BCOA 3M0SA 3Q1JA 2MI6A 2AIRB 2VC8A 1M27C 5FROA 3JCMQ 4NL3A 1QVGA 1TUCA 2CP0A 3C95A 4J9EA 2I2LA 4FYYB 4Y28E 2SEMA 4CC7A 3C94A 1YITT 3QJYA 1RACB 3EGDB 5GAN2 2QEXQ 1M3AA 2KSSA 3OSVA 2NLUA 1YJWQ 3JB9I 3VS3A 1VQ4A 1K76A 1WNLA 4XU1A 3I56T 2LJ1A 1AWJA 2DTHA 1RABB 2DRMA 4BE1A 4HVVA 2DM1A 3VS4A 1VQLT 3RESA 3EG9A 3PVLA 2VUBA 1LCKA 2DL5A 2CZ1B 3I9QA 1X27A 3OMGA 1K0XA 2D6FA 1B34A 1JJ2A 3OQ5A 3CEYA 1M1KU 1M1FA 3PIPA 3CXCA 3SB2A 4RCBA 3TEEA 3HL8A 2K79A 3OA6A 1KQ1A 1VOMA 2CS7A 2HSEB 3OS5A 3DLLA 3JCMX 3I56Q 4ATOA 3CC7T 1BYMA 2HZYA 1K8AR 1VQLQ 1PC0A 5KYNA 1N9RA 5IAYA 1YWPA 4IUPA 4RG2A 2LP5A 1SPKA 4WCIA 4Z02A 4PJOF 3CCLQ 1W6XA 2EIFA 3GBQA 1NLPC 2W10A 3WVEB 3QIIA 3OBWA 5EG2A 2LNHB 1IGUA 2OTLA 1B7TA 4PJOA 4PLLA 1YN8A 3QHSA 1OPLA 2GGRA 2JOYA 1WJRA 4CC4B 1GCPA 3CC7Q 1SHFA 1WHKA 2RQTA 1NYGA 4KRTA 3SWNA 2E6ZA 2M0YA 2RMOA 2IG0A 1SF9A 1VQNA 1AOJA 1N27A 4PJOC 1GCQA 2HQXA 1E7OA 3VS0A 4M7AG 3HRUA 1BIBA 1YIJQ 2C0IA 2KQWA 2E70A 1AHJB 1NYFA 1OX8A 1UGSB 1VYVA 3H8ZA 1K0SA 1ZSZB 5DM7R 2CP3A 4OMPA 2BTTA 3SWNC 3FDRA 6AT1B 1WHHA 2VV5A 3VRYA 5GAN8 4FL6A 1HYOA 4OB3B 1GCQC 2SRCA 1MV3A 3VV0A 2DVJA 3G71T 1MNDA 3CCQT 2RF0A 4CI0C 2OTJT 1QKXA 1RAEB 2DE0X 2X3WD 3L2QA 4L59A 4FT2A 3TCJA 1ZSZA 2EQUA 1WPYA 2CUBA 4M7DG 2JTFA 2L3SA 2QTXA 5M9OA 3HHTB 2ABLA 3JCMV 4JJDA 4M75B 2DERA 1DJ7B 4PJLA 1B3QA 1RI9A 2K2VA 2LMJA 5CQYA 4AFUC 4HT9A 2KROA 1WXUA 1QVGS 1ZSZC 2D0NA 3CCUA 4RMOA 2D8HA 1FXXA 1G3SA 2DEUA 1VQ7A 4HCZA 2LNVA 3CBMA 3CCQQ 1BI1A 3G6EA 2OTJQ 3LLRA 4KUDK 3EG1A 2V26A 2A08A 4OB1B 3KXTA 3SEMA 1Y7XA 2QGGA 2YSQA 4FIBA 1K9MR 1HD3A 2MCNA 2LRQA 3L2ZA 3CCST 2X35A 1UHCA 3V7RA 5KYUB 1YNZA 3CMEQ 4M75C 1R0CB 5FU6C 2Y90A 4JZ4A 3I5SA 1QP3A 3OYGA 3HSBA 2RHUA 4B9WA 2IPOB 2QYZA 2KRSA 2ESWA 4F7UE 3VS2A 1UGQB 2J05A 1VQ9T 3CXCS 2VGMA 4Z88A 1VQOA 1PSEA 2CZ6B 3V7SA 2AZSA 2A7YA 2GNCA 3I35A 4ZN1A 4L6V5 1GBRA 2B8AA 2KNBB 1Y57A 1I81A 2PZ1A 3EGXA 4GLKA 2EYYA 2NUZA 4HCBA 4AG1C 2BZ8A 2DAQA 2CGHA 2RQWA 1S72Q 4DEYA 1HSQA 1WFWA 1ACMB 4QVDA 1C1AA 2KYMA 2LQKA 1YJ9T 1W1FA 2HCKA 2RK1A 2M51A 3TVTA 5GAN7 4F17A 2EYQA 2ENMA 2YLBA 2YRCA 3LX7A 1VQ9Q 5CKBA 2COWA 2ZPBB 5KYWB 2AT1B 4KGVB 3C4SA 2RJFA 2CT4A 2EGAA 4MMKA 1WXBA 2JTMA 1N8RC 1N9SA 3X25B 4A63B 2OI3A 1Q81R 1ZBXA 3ZEHA 1FYNA 2RQUA 1X6GA 4PJOD 1Q86R 2RNAA 2QGFB 2EJFA 3MEUA 1UTIA 2YRDA 3X26B 5KYWA 2CP5A 2ZZDA 2DL7A 1X69A 1TWBA 2LVMA 2L8DA 1OV3A 2YUNA 5L23A 3FRNA 2XG8D 4Q5WA 5FRMA 3PE0A 1S72A 1WX6A 2Y4YA 2K3YA 4KBMB 4DBFA 3RIRA 2GTJA 4QQDA 2JS2A 3GF5A 4RCCA 3EFRA 3E9GA 2FPEA 2EWNA 3OYIA 2RI2A 5CKFA 3L42A 2CZ0B 3OB9A 3U23A 3OYHA 3PNWC 1R77A 2JTEA 3CMAT 3JSCA 2DIGA 4O6JA 2ZPIB 2FEIA 2ROLA 4XTZA 3X20B 1ABQA 3NTKA 1M3BA 1VQKT 2KXDA 1M1KR 3QXEB 2FZCB 2R57A 3ER0A 1W2BP 1WHGA 1ZQ1A 1Z9ZA 2ROTA 3EFOA 1NG2A 3CCRT 1YFNA 4M77G 5D6WA 4RTTA 3EG2A 4M75D 2DEQA 1VQ8T 3EH2A 3CCJA 2C0OA 5J3BA 3EG3A 2YHTA 2KI7A 3M57A 1K73U 2LQNA 3CCET 2EKOA 1K8AC 4XU3A 1VQKQ 1M3CA 4ZNXA 1VYUA 2HKNA 1PSFA 1E6HA 1XNIA 2YUQA 4C0DC 4B6MA 3CCRQ 4D8KA 2HMAA 1Q95G 4EMHA 4FYXB 4NS5A 2DBKA 5CR2A 3OYNA 2JJ9A 2NUPB 4GBQA 1VQ8Q 1VQMT 3CC2T 4LNPA 3OS0A 2HSPA 2KRNA 1QQJA 1VQPA 1VIEA 2KR3A 1WHJA 3VKIA 3CCEQ 1WGSA 1X6OA 2E10A 1RAIB 1LPLA 2JN0A 4MMLA 3CCMA 3OW2A 3A8GB 2EQJA 1V76A 2PUKB 3QYHB 3P8HA 4C5IA 2D0QB 2ATCB 4X9DA 3EAEA 1QKWA 2O4XB 4F7UG 1VQMQ 4MZMA 5I21A 3CC2Q 2F2XA 3NTHA 5GAOm 4J7IA 3JB9J 1H3ZA 3DKMA 3AHUA 4XTVA 2W0ZA 2CUDA 2DMOA 3HRSA 4DBQA 4FW2A 3NGPA 2K5IA 4J6YA 2O4XA 4C5GA 2RD1A 4RTUA 1D1BA 2ED1A 4PJOE 2J7IA 4FSXA 1SHGA 1QP2A 2E3HA 1XQHA 4ZGDB 5KYXB 1D3BA 3OYEA 2DO3A 2YUOA 2QK0A 1CKAA 2DNUA 4N0AA 3HTRA 5GAMh 3FLGA 1JXMA 5GANh 2AKLA 4DQ2A 2E4HA 4E7IA 3PFSA 5FU7B 4FM4B 3OMCA 4A4FA 4OGCA 3HPWA 2OAUA 4PLIA 5GAMf 2QTVA 3M54A 5GANf 4LDWA 3VS7A 5KYXA 1U8RA 4HVUA 4N0AC 1UG1A 1YHQQ 2EW3A 5DY9A 3VYHB 1M2VA 2A36A 2DK3A 2EKHA 8AT1B 3LYIA 4ZN3A 1VQ4Q 2QI2A 4C0GA 3L2WA 1AWWA 1UB4A 1UEBA 2QQRA 4PJNA 5IXFA 4C92B 4PNOA 5C0MA 3L2UA 1VIFA 1W70A 4BY6C 2ZCFB 2E1HA 4Y92A 2EQMA 2MIOA 4D6WA 4A53A 1IGQA 4C92F 5LL6S 1IRXA 2RI5A 3I55A 3J7AF 5GAMe 2QEXT 2RO0A 5GANe 1U5SA 5GMKi 3VS1A 4JS4A 4QW2A 3JCMc 4C92A 3P8DA 3DB4A 4JRIA 2DILA 1GBQA 1YJWT 3UA6A 1U1SA 1AVZC 4AFZC 2CSQA 2IVWA 4X9CA 5GAOl 4M75E 5J39A 3ULRB 1VQNT 4IUUA 2EYWA 2GBQA 4C92C 3NFCA 2V8IA 4LUEA 3BY7A 4K11A 3SFMA 1T3SA 2DETA 3URGA 3JB9F 2O9SA 4QVZA 2VXFA 3CC4A 2OX7A 2PVGB 4M78B 3QKJA 2MOXA 2OTLQ 1Q81C 2QQ9A 3RMQA 2R58A 1YHQA 1Q86C 4OF1A 4LD9K 2BE9B 1OZ2A 2WSFE 4DA4A 3A1PA 4E7SA 2YXYA 2J6KA 2PU9B 4EMKB 5I2MA 3OW2S 3O5ZA 2EGEA 2XDBA 1RAFB 2JT4A 1BI2A 1VQNQ 3EGDA 3M0TA 4M78A 1QWEA 3MKDA 2H3EB 1UJYA 1HJDA 4WF2A 3RKYA 1VQ5A 4TVRA 3M5AA 4BUGA 5LJ5h 1O75A 1YWOA 3CCLT 3VYGA 4C5EA 1OX9A 2ZPEB 3L2RA 4IKFA 4AT1B 4EMKA 3CCVQ 5GAMg 1AZGB 1RAGB 5GANg 1XTDA 2CT3A 4ANJA 4M78C 1PG5B 1ZA2B 5LJ5f 1VQ7T 3EHQA 3KFVA 2R5AA 5ECAA 1HXDA 2E5QA 4E2FB 3G6ET 4FSSA 1E6GA 4JDSA 2DXTA 4Z8AA 4DEXA 2BZYA 4BDZA 1IXDA 4EMKC 1GFCA 1SRLA 1FMWA 1NEGA 2HBWA 5IHKA 4EIKA 4F16A 3D7SB 1PCXA 3MP6A 1YIJT 2QQSA 2KAFA 3DB3A 2FVUA 3JCMb 3A5ZB 3MPUB 1Z9QA 3HKSA 3SDZA 3CCUQ 2RA2A 2DXBA 2F2WA 1KQSP 1VQ7Q 2EFIA 2JZ2A 1TG0A 2D8JA 3M0QA 3G6EQ 5LJ5e 1YJNA 4XK8E 2XDDA 3MEWA 1K73R 2V1RA 4IIOA 2FL7A 3VUBA 4PFZA 4PK4A 1D0YA 2FG0A 4M7DB 1SSHA 1WI7A 2EVRA 1EZZB 1YCSB 2KXCA 2FRYA 1QVPA 4II1A 2M02A 3HRTA 4LE9A 2VGNA 2AKKA 2C06A 4O5VA 3CCVA 3RBBB 4A4HA 2HQEA 2JS0A 4NOYA 4PJOG 5D6XA 5IHIA 2L0AA 1MV0B 1QVFP 1AWXA 5CKEA 5CK9A 1NEBA 4XU2A 2HBPA 3JCMP 1WJSA 1VQOQ 1YITA 2DL8A 4C8QB 3QUIA 4MZTA 1UDLA 3TSZA 1LVKA 2PQWA 1Q7YU 3UA7A 2PTKA 3E2UA 5FWBA 1H3HA 2HAXA 3INZA 2QA4A 4EDUA 8ATCB 1V1CA 1U06A 4FW1A 4AG2C 4C92D 1C6VX 2RQVA 3ZBDA 3CMET 2RB6A 4C8QA 1FX7A 5CQXA 4FYWB 4M75F 4XTWA 1AEYA 5A0GA 1IO6A 4UC4A 5LJ5g 4HCKA 1M5Q1 4AMCA 1KFZA 4E7KA 2EGCA 2HD0A 4M75A 2XDPA 1RL2A 1J3TA 1WDXA 5HCKA 3RUXA 2LT1A 4C8QC 2KRMA 5CCAA 4Y91A 5A0LA 1OOTA 2WSCE 3H0IA 5GMKe 1S72T 3VS6A 2FPFA 2NUTB 1IHWA 1FMKA 4J7FA 3OS2A 3JB9D 2A3LA 3ZFJA 3QBYA 2E64A 5AYFA 4LDVA 2DFUA 1KHCA 4KGXB 1JJ2S 1UHFA 2NWMA 2WACA 1Y71A 4M78D 1P92A 4A54A 2DPPB 2DZ9A 2EQKA 1U3OA 1X2QA 5KYUA 4IUVA 4M4ZA 3LGLA 5GJVB 2X4JA 3MCAB 1MMDA 3NMZC 2NYSA 3JRZA 1SRMA 4IURA 4RG8A 3VS5A 3RNJA 3JAME 3A8OB 2GFUA 3GLXA 3JCMd 4LXCA 3C0CA 4DBHA 4IIMA 4XTUA 1M90R 2WSEE 3FIFA 4MZPA 2LJ3A 2QG9B 2P84A 3M53A 5GAN5 2DTIA 3X24B 1KC8U 2MMPA 4ESRA 3OS1A 2X4XA 4E7HA 4HCCA 1PWTA 1ZUUA 5KYYB 3G7ZA 5C6SA 1UFFA 2AZVA 3M0PA 4L5GA 3G71A 1QLYA 1SKUB 4XQ3A 3UT1A 2BUDA 3QPHA 3M0UA 1VYTA 1JXOA 3CCJQ 1NZ9A 4ME7A 2DRKA 3G1JA 1UGVA 2PVDB 1VQPT 5KE3A 5HKCA 4OMNA 1NJIU 2RM4A 1PRLC 2XD0A 3MEAA 1W2BA 1BIAA 2DD5A 3M0RA 3E1SA 3CCMT 1WXTA 1WA7A 1MMAA 4OB0B 4PFPA 4DOWA 2FHDA 4M77B 2QDLA 3OYCA 2A0FB 2HEQA 1KSWA 2ZGWA 2GF7A 1VQPQ 1ZSGA 3MHXA 3A98A 3V8KA 1XJWB 5HK3A 2JMAA 3PMTA 3HFNA 1PKTA 2K7AA 4JRQA 5LJ3h 1D0ZA 2KBTA 1ZUKA 3L1AA 2ZPHB 4ORZA 3VU3C 5A2QE 3CCMQ 4OMOA 1Y07A 2PUOB 3WXMB 3M59A 1OEBA 2EBPA 4C8QD 1NBEB 3NHNA 4QVCA 5LJ3f 1MHNA 2Y4XA 4J83A 4C92E 5GAN4 2VASA 1KD1U 4DBRA 2K57A 3OYYA 3QSUA 2CH4A 5KCHA 5DLOA 2MF2A 2JUFA 1NM7A 1G3WA 4LN2A 2FZKB 2DIQA 4J6XA 1NLOC 2G6FX 9ATCB 5GMKm 4LDXA 2KEAA 2LX9A 1C0MA 1B07A 1X43A 1N5ZA 2V1QA 1I07A 3JCMf 3GNFB 2MWPA 2RHIA 4JPBW 5LJ3e 3PT9A 4F7UB 1PD0A 3RDVA 2AK5A 1WYXA 1GXIE 4VUBA 5KCOA 2L5QA 5CKHA 3DLMA 1K73C 1ZA1B 4M78E 5HY6A 4JLIA 2MPXC 3MP8A 1UECA 2IIMA 3N5BB 2O31A 4QQ6A 4BDYA 3LH5A 1NE8A 4OVAA 2A37A 3O8VA 3I55T 2PVOB 2NUPA 2RK2A 5IHNA 2DX1A 1F1BB 3JV3A 2CP6A 3CD6Q 2K9GA 2EPDA 1KIKA 1VQ6A 2LCSA 1A0NB 4GY5A 3REAB 1Q7YR 4JLGA 4BB7A 1OULA 1QMCA 5IT9E 3CPWP 5CVIA 5GAN6 4R55A 5GAN3 5HK0A 1I5OB 3CQTA 3QG1A 1MMNA 1ZHIA 2V8JA 3A8MB 4FU6A 2QXFA 1YI2A 3CC4T 3I55Q 3L2VA 4V2SA 3LWHA 1YHQT 2L3PA 5LJ3g 1LOJA 3JB9H 4RTVA 1W2BS 1FMVA 1VQ4T 1Q82U 4ZTJA 4YTLA 2DL3A 3V7CA 1BI3A 2RHZA 3UWNA 1G5VA 2FB7A 1UJ0A 2M0OA 4J9IA 3R6NA 3H0HA 3FJPA 2GCXA 5IN1A 3QJ6A 4A4GA 3OW2P 1K9MC 2XHCA 3UPUA 4XTXA 4QQGA 2DLPA 2J06A 3CC4Q 5GMKl 2CKKA 1TS9A 4J9CA 3VUZA 3NTIA 2LTOA 1GFDA 2LT4A 1VA7A 4JJBA 3CD6A 5IH2A 4M7DE 3JCMJ 1IREB 2CP7A 3OY9A 1MNEA 5FRNA 3E9FA 3EFSA 2MYSA 3FEOA 2K4YA 2QAZA 4M77D 2CREA 1VQ5Q 2HL3A 1JU5C 2RJEA 4J5YA 1VUBA 5FU7C 5FW9A 3H9NA 3IQLA 2OTLT 5DLQE 3R6OA 2KK4A 3UF4A 3SD4A 4C8QE 4KGZB 4P5NA 1KG1A 3TQ7P 1WZOA 1YJNT 3BDLA 4ZGEB 4LDYA 3F70A 3UATA 4IUQA 5CIUA 4RTWA 3QDFA 2CYZB 1ZLMA 2DF6A 4OMMA 2RPNA 1KC8R 2O9VA 2K3BA 1U1TA 1M90C 1T0JA 2EAYA 2YT6A 1RADB 4J9HA 1I4K1 3TSWA 2CSIA 5GAMj 2ED0A 1TOVA 5GAOq 5GANj 4OP0A 3A8HB 3CCVT 1KHIA 3RKXA 1M8MA 1UUEA 2M1HA 1BI0A 4C92G 2HKQB 3QYGB 4M78F 2H8HA 1YJNQ 2J6OA 1M30A 1W4SA 4N4IA 1KQ2A 2GQVA 4HXJA 2YDLA 3M4YA 1AT1B 1NJIR 3EG9B 1ZX6A 4NL2A 2H3JA 3X28B 4J9GA 1KJWA 4A4EA 3M56A 3S6WA 1B34B 1IB8A 5L8RE 1PHTA 4OMLA 3HFOA 4MDXA 2QA4T 1KQSA 5KH6A 2DXCA 1TU0B 2HNIA 2KT8A 2BE7D 1OU9A 1K9AA 1QCOA 3CCUT 4KUIA 1X6BA 4R0KA 1BK2A 1OYXA 3JB9G 1YCYA 3OYFA 3QWYA 2DL4A 2PNIA 2F5TX 4EPCA 1BCMA 2KMTA 1V29B 1PNJA 1YITQ 4AFQC 1TUDA 1QVGP 3THKA 4BE2A 3ME9A 7AT1B 1MUZA 3PMIA 2EQIA 4M7AB 1SSFA 2YRVA 4M78G 1H8KA 3REBB 2ZAEA 1NPRA 1R8OB 1BB9A 2QA4Q 2AHJB 3G4SA 4JZ3A 1M1KC 4M7AF 1GL5A 1X75C 2A28A 3META 3VJPA 1QVFA 1JRIA 2P0PA 1QWFA 3A8LB 4PJOB 5A0DA 2QQAA 4GLMA 4BI3A 2RH2A 1KD1R 2G3RA 4ZGJB 3CPFA 1X2KA 3UDCA 4M7AA 4OB2B 1Y0MA 3SWNB 4BI4A 1OI1A 2LJ0A 1VQOT 1UGRB 3FC3A 2BKDN 2F69A 2QEXA 3H6ZA 3EGUA 2E12A 1JJ2P 2KYBA 4M7AC 1BBZA 2FRWA 4JS5A 2MK5A 3QDRB 3CBPA 4XU0A 3CXCP 1YJWA 4M7DF 2K2MA 5D7UA 3OSSC 1T3LA 2DYIA 1I5LA 2XI9A 1JEGA 3PGGA 5LJ5j 3KUFA 4M7DA 5CAIA 2QQBA 2ZPGB 5GMKh 1TUGB 3RMSA 5GAOp 2X51A 3WVDB 1RLQC 2EYZA 4KH1B 1WHMA 3S3MA 1PD1A 3MJXA 4M77E 4M7DC 4C8QF 2XICA 1RUWA 2X4WA 3ASKA 1JB0E 3M58A 3I56A 1ABOA 5KE2A 1WJQA 1WQWA 1VQLA 1I8FA 2XU8A 1M4ZA 1FWZA 2P0KA 2COYA 2ZPFB 3CCLA 3TU4K 1D0XA 1G3TA 1TTHB 2VYTA 3KBGA 5FU6B 3V8JA 2RI3A 2FZGB 2P4TA 3E19A 1Q7YC 3H41A 3MO8A 1TH7A 4PJJA 1T0HA 3GOXA 3V8LA 2O88A 3EG0A 3G71Q 1XOVA 3FJ5A 2QDYB 3PIOA 3PVQA 3CC7A 4EMGA 5LJ3d 1M2OA 2M9UA 1OZ3A 2Z0WA 3CBOA 4J9DA 1JO8A 2CH4W 1Q82R 5I22A 1G2BA 4C8QG 3NPFA 4HVWA 4OGEA 2M16A 4A4KA 2DXUA 1KQSS 2YLCA 4PFOA 1H641 3GNGA 1YIJA 1ARKA 3BW1A 4RTXA 4LD6A 5GAOr 3EH1A 4M75G 2NUTA 2LC4A 4Z89A 3EHRA 5GMKj 3EGXB 4RTZA 1BKBA 1N6AA 1I1JA 4E7ZA 4PJMA 3PTAA 4CC2A 2BIVA 2RHXA 3S3NA 2VXEA 1LJOA 2LQ8A 1OPKA 2E65A 1D09B 4BI8B 1HK9A 2JXBA 2P4RA 4HT8A 1WQ7A 4MDWA 1QCFA 2GQIA 1WIEA 3LWIA 4JRPA 3CCJT 2DA9A 1N8RU 1M1GA 4J9BA 3CCSQ 1G8XA 4E7LA 4X34A 5CO7A 2X9HA 1QVFS 2DJZA 4J9FA 2CZ7B 2YUPA 3CCQA 2OTJA 3FB9A 2RQRA 2FO0A 1QW1A 4XTYA 2E6NA 2LQWA 3RKWA 4M7AD 3LW5E 2DKGA 2OJ2A 1YBYA 2DZCA 2MWOA 5FLXE 3BFMA 5KYYA 2K6DA 2KGTA 2D1XA 4BE0A 2KDSA 2JM8A 1KC8C 4R56A 3CMEA 2F2VA 2X4YA 1YJ9Q 3GIBA 4HKEA 4J6WA 3OYAA 2GFAA 4M7DD 4LDUA 2LCCA 4PKCC 1D1AA 4FT4A 4JUVA 1EX4A 4KH0B 1TSFA 3RR6A 3S3OA 4ZTFA 1VQ6T 4N4HA 1CSKA 4RUGA 1G3YA 2DTOA 2E3IA 4M77F 2LZ6B 3CCSA 2XK0A 2BZXA 4IUTA 2K3XA 1NJIC 1H92A 4CC3A 2CP2A 2XMFA 1EIFA 4M77A 2JM9A 5GAMd 4E47A 5GANd 1YI2T 1AZEA 2VWFA 2L3RA 4XAXB 2EJ9A 3MEVA 3EFOB 5FWCA 1TXQA 1VQ9A 3BDUA 2LDMA 1Y96B 2P0QA 1ZUYA 1K8AU 1SG5A 1VQ6Q 2K5FA 4M77C 4C5HA 3I5RA 4ELYC 2EYXA 2JNGA 4C0DB 1IZ6A 2KE9A 3RERA 1IHVA 3GPLA 1LNXA 2XIDA 1K1ZA 4KT0E 1Y96A 1YJ9A 2GTOA 2RJDA 4ELZC 1YI2Q 4C0FA 5EC7A 3CMAQ 2MAMA 3TREA 4AFSC 4KULA 2L89A 2DJQA 2O01E 3OYLA 3CD6T 3C12A 4WTOB 1KD1C 3CPWA 3OYKA 1O9SA 1RAHB 2ECZA 3VRZA 2XKOC 1CKBA 3HP9A 3JCMh 4OMQA 4F7UF 2DYBA 1WLPB 3GP8A 1R0BG 2J6FA 2RN8A 1WHLA 2K5LA 5D6YA 2L2PA 4F7UA 2DVEA 5I11A
chains in the Genus database with same CATH topology
1U1TA 4J8OA 4NOYA 1RI0A 1M90C 4PJOG 4MMKA 5D6XA 2JTMA 2EAYA 3P8BB 1N8RC 1N9SA 3X25B 1UGPB 3OYDA 3QZ5B 5LJ3j 1ZBXA 3ZEHA 3OYMA 4OMFB 5CKEA 1I4K1 2F5KA 5CK9A 4PJOD 4XU2A 2HBPA 3JCMP 1WJSA 2EJFA 2FYKA 5GAMj 1YITA 4C8QB 5GAOq 4E7JA 5GANj 3QUIA 2V8KA 3MEUA 4MZTA 4OP0A 3A8HB 3CCVT 1KHIA 2PQWA 1Q7YU 3X26B 3RKXA 5CKDA 2M1HA 1BI0A 4JJNK 4C92G 2D9TA 3QYGB 2ZZDA 2HAXA 4M78F 4RKUE 3INZA 2QA4A 4EDUA 3J80E 1W4SA 4N4IA 4C92D 1KQ2A 2LVMA 2GQVA 2L8DA 3ZBDA 3M4YA 3CMET 2RB6A 4PL6A 2JVVA 4C8QA 1FX7A 5CQXA 3FRNA 2XG8D 4M75F 4XTWA 4NL2A 3JCMe 3CMAA 5A0GA 4Q5WA 2H3JA 3X28B 4UC4A 5FRMA 1S72A 5LJ5g 2LCLA 4A4EA 3M56A 2Y4YA 3S6WA 1B34B 2K3YA 5LJ5d 5L8RE 4KBMB 2E41A 1M5Q1 3LGFA 3T9NA 3RIRA 3HFOA 4BD3A 4E7KA 4MDXA 4M7AE 4QQDA 2QA4T 1KQSA 2HD0A 3GF5A 2DXCA 4M75A 5KH6A 1D3BB 3EFRA 3E9GA 4RCCA 2XDPA 2EWNA 1VQKA 3OYIA 2HNIA 2RI2A 1RL2A 3L42A 5CKFA 2CZ0B 1K9MU 3RUXA 2LT1A 3OB9A 4C8QC 1MGQA 3OYHA 3PNWC 2RJCA 5CCAA 4Y91A 3CCUT 2EJGA 4KUIA 3CMAT 3JSCA 2DIGA 2RHYA 2WSCE 4O6JA 3QZ9B 4CRIA 5A0LA 5GMKe 3OYJA 1S72T 1OYXA 3JB9G 2ZPIB 1VQ5T 1YCYA 3OYFA 3CCRA 3JCMW 4EPCA 2F5TX 2KMTA 1V29B 4XTZA 4J7FA 3X20B 3OS2A 3LH0A 3JB9D 3NTKA 4BE2A 3ME9A 1VQKT 2A3LA 3ZFJA 3QBYA 2E64A 3PMIA 1VQ8A 4M7AB 3QXEB 5AYFA 1SSFA 4BY6B 2YRVA 4M78G 4LDVA 1KHCA 1JJ2S 2R57A 3ER0A 1NPRA 1R8OB 2WACA 3CCEA 1Y71A 1ZQ1A 3M4GA 4M78D 2AHJB 4C0ZA 3G4SA 1P92A 1M9SA 1M8VA 3CCRT 1Q82C 1M1KC 4M7AF 4A54A 1X75C 5GAOn 2DPPB 2DZ9A 3META 4JRKA 2EQKA 3VJPA 1QVFA 1JRIA 4M77G 2P0PA 4IUVA 3A8LB 5D6WA 4PJOB 5A0DA 2QQAA 4BI3A 3LGLA 2RH2A 4M75D 2G3RA 4ZGJB 2DEQA 3CPFA 1VQ8T 2X4JA 3M55A 3MCAB 3CCJA 3UDCA 5J3BA 4M7AA 4HA8A 2YHTA 3JRZA 3M57A 4IURA 4RG8A 4OB2B 2KVQG 1K73U 3CCET 5I2SA 2EKOA 1K8AC 3SWNB 2KY9A 4BI4A 3J81E 3G4ST 1OI1A 4N4GA 1NPPA 1VQOT 1UGRB 3JAME 4XU3A 3FC3A 3A8OB 2GFUA 3GLXA 5J26A 2BKDN 3JCMg 2F69A 1VQMA 2QEXA 3JCMd 1PSFA 3CC2A 3H6ZA 2E12A 1XNIA 4BACA 1M90U 4M7AC 4JS5A 4XTUA 4DOVA 2WSEE 3QDRB 3CBPA 3FIFA 4MZPA 1JBMA 4XU0A 2R5MA 4C0DC 1YJWA 4M7DF 4B9XA 3M53A 4EMHA 3OBYA 2DTIA 5GAN5 3MP1A 3X24B 4NS5A 2MMPA 1KC8U 3OSSC 3OS1A 2X4XA 3QO3A 3OYBA 5CR2A 3OYNA 4E7HA 1I5LA 2XI9A 4HCCA 3PGGA 1VQMT 5LJ5j 2DD4A 1Q81U 3M9QA 3KUFA 3CC2T 4M7DA 3OS0A 3G7ZA 5C6SA 5CAIA 2QQBA 1VIEA 2ZPGB 4L5GA 5GMKh 3VKIA 3G71A 1VQPA 1Q86U 3RMSA 5GAOp 1WGSA 3CPWS 1X6OA 4XQ3A 3UT1A 3WVDB 2BUDA 2E10A 3QPHA 1X01A 3Q1JA 2MI6A 2JN0A 2VC8A 5FROA 3S3MA 4MMLA 3JCMQ 3CCMA 3OW2A 3A8GB 4NL3A 1QVGA 4M77E 2EQJA 4M7DC 3C95A 1NZ9A 4C8QF 2PUKB 2XICA 4ME7A 2I2LA 2PVDB 1VQPT 4Y28E 3QYHB 5KE3A 2X4WA 3C94A 5HKCA 3ASKA 3P8HA 4C5IA 2D0QB 1JB0E 3M58A 3I56A 1NJIU 2RM4A 4X9DA 5KE2A 3EAEA 3QJYA 1YITT 2XD0A 1WJQA 3MEAA 2O4XB 1WQWA 1W2BA 5GAN2 1VQLA 1I8FA 2XU8A 1M4ZA 4F7UG 1BIAA 2DD5A 4MZMA 5I21A 3E1SA 3NTHA 5GAOm 3JB9J 1FWZA 2KSSA 3OSVA 4J7IA 3CCMT 2P0KA 1H3ZA 3DKMA 4OB0B 3AHUA 2NLUA 2ZPFB 4XTVA 3CCLA 3TU4K 3JB9I 1G3TA 2VYTA 2FHDA 3KBGA 5FU6B 4DOWA 3HRSA 4M77B 3V8JA 1VQ4A 2RI3A 1WNLA 4XU1A 3I56T 3OYCA 2P4TA 3E19A 1Q7YC 2DTHA 2K5IA 3MO8A 4BE1A 4J6YA 1TH7A 1VQLT 2O4XA 3RESA 4C5GA 2ZGWA 2RD1A 2VUBA 3GOXA 2GF7A 3V8LA 3MHXA 2CZ1B 1XOVA 4PJOE 2QDYB 3OMGA 3V8KA 3PIOA 5HK3A 2D6FA 1B34A 4FSXA 3PMTA 3CC7A 1JJ2A 4EMGA 5LJ3d 3HFNA 1QP2A 2M9UA 3OQ5A 1XQHA 3CEYA 5LJ3h 4JRQA 4ZGDB 1OZ3A 1M1KU 1M1FA 3CBOA 1D3BA 3PIPA 3L1AA 3CXCA 2ZPHB 3SB2A 2DO3A 3OYEA 4RCBA 4C8QG 3VU3C 5A2QE 1Y07A 4OGEA 4N0AA 3TEEA 5GAMh 3HL8A 2PUOB 3FLGA 3WXMB 2M16A 4A4KA 3M59A 5GANh 4C8QD 1KQ1A 3OA6A 2DXUA 4DQ2A 1KQSS 2YLCA 1H641 3GNGA 2CS7A 1YIJA 3BW1A 3OS5A 4QVCA 5LJ3f 4E7IA 3DLLA 3PFSA 1MHNA 2Y4XA 4J83A 4C92E 3JCMX 4LD6A 5GAOr 4ATOA 4M75G 4FM4B 5FU7B 3OMCA 4A4FA 3CC7T 5GAN4 2LC4A 4OGCA 3HPWA 2OAUA 1BYMA 4PLIA 1KD1U 5GAMf 3M54A 5GMKj 5GANf 1BKBA 4LDWA 1N9RA 1N6AA 1U8RA 5IAYA 2K57A 4N0AC 4IUPA 3OYYA 4RG2A 3PTAA 2BIVA 5DY9A 3VYHB 3QSUA 2RHXA 5KCHA 5DLOA 4Z02A 2MF2A 2DK3A 2JUFA 4PJOF 3LYIA 2EIFA 1G3WA 3S3NA 3WVEB 2VXEA 4ZN3A 3QIIA 3OBWA 1LJOA 2LQ8A 2E65A 2DIQA 2QI2A 4C0GA 3L2WA 4J6XA 5EG2A 4BI8B 1HK9A 1UB4A 1UEBA 2OTLA 2QQRA 5GMKm 4HT8A 1WQ7A 4MDWA 4C92B 4LDXA 4PJOA 4PLLA 2LX9A 4PNOA 3LWIA 4JRPA 5C0MA 3L2UA 3CCJT 1VIFA 1N8RU 4BY6C 1M1GA 3QHSA 3JCMf 2ZCFB 2E1HA 4E7LA 2EQMA 2JOYA 3GNFB 1WJRA 4X34A 5CO7A 1QVFS 4D6WA 2MWPA 4A53A 2RHIA 5LJ3e 4C92F 5LL6S 3PT9A 2RI5A 3SWNA 4F7UB 2E6ZA 3I55A 3J7AF 2IG0A 1VQNA 1GXIE 5GAMe 2QEXT 2DJZA 1N27A 2RO0A 2L5QA 4VUBA 5CKHA 5GANe 5KCOA 5GMKi 4JS4A 4QW2A 2HQXA 4PJOC 3DLMA 4M7AG 3JCMc 4C92A 1K73C 3P8DA 2CZ7B 3DB4A 3CCQA 3HRUA 2OTJA 4M78E 3FB9A 4JRIA 5HY6A 1BIBA 2KQWA 2E70A 4JLIA 1QW1A 4XTYA 1YJWT 1AHJB 2E6NA 1U1SA 3RKWA 3MP8A 4M7AD 3LW5E 1UGSB 3H8ZA 3N5BB 5DM7R 4QQ6A 3SWNC 2DKGA 3FDRA 4BDYA 1YBYA 2IVWA 2VV5A 3HSBA 1NE8A 4X9CA 4OVAA 5GAN8 2DZCA 2MWOA 3O8VA 4M75E 5GAOl 5FLXE 5J39A 3I55T 2PVOB 4FL6A 1VQNT 4OB3B 3BFMA 4IUUA 4C92C 2RK2A 3NFCA 2V8IA 3VV0A 3G71T 3CCQT 3BY7A 4CI0C 2OTJT 4BE0A 3SFMA 2KDSA 3URGA 1KC8C 4R56A 3CMEA 1VQ6A 3JB9F 4QVZA 2VXFA 2X4YA 3CC4A 2PVGB 4M78B 4L59A 3QKJA 4FT2A 3L2QA 3GIBA 3TCJA 2EQUA 1Q81C 4HKEA 1WPYA 2QQ9A 4GY5A 3RMQA 2R58A 4JLGA 4BB7A 4J6WA 1YHQA 3OYAA 1Q86C 4OF1A 4M7DG 4LD9K 2JTFA 2QTXA 1OZ2A 2GFAA 5IT9E 5M9OA 2WSFE 4DA4A 3HHTB 5CVIA 3JCMV 5GAN6 4M75B 5GAN3 4R55A 5HK0A 4LDUA 4M7DD 1DJ7B 2LCCA 2PU9B 4FT4A 4PKCC 4EMKB 5I2MA 3QG1A 4JUVA 2K2VA 5CQYA 1ZHIA 3OW2S 4HT9A 2V8JA 3A8MB 3S3OA 4ZTFA 1VQ6T 2XDBA 4FU6A 2QXFA 1QVGS 1YI2A 4N4HA 3CC4T 1G3YA 1BI2A 2DTOA 3CCUA 4RMOA 4M78A 3L2VA 4V2SA 1FXXA 3LWHA 1G3SA 4M77F 1VQ7A 4HCZA 4WF2A 2LNVA 3RKYA 1YHQT 3CBMA 3CCSA 1VQ5A 1BI1A 4TVRA 2XK0A 3G6EA 3M5AA 1LOJA 5LJ3g 3JB9H 3LLRA 4IUTA 4BUGA 5LJ5h 2K3XA 1O75A 3CCLT 1W2BS 3VYGA 1NJIC 4C5EA 2ZPEB 3L2RA 1VQ4T 4OB1B 1Q82U 3KXTA 4IKFA 1EIFA 4EMKA 4M77A 4ZTJA 5GAMg 1Y7XA 4YTLA 5GANg 1XTDA 5GAMd 3V7CA 1BI3A 4E47A 5GANd 4FIBA 1YI2T 4M78C 2RHZA 3UWNA 2L3RA 4XAXB 1G5VA 2FB7A 2EJ9A 3MEVA 2LRQA 3L2ZA 2M0OA 5LJ5f 1VQ7T 2R5AA 3FJPA 1VQ9A 1HXDA 3CCST 2E5QA 2GCXA 3BDUA 2LDMA 5IN1A 3G6ET 1Y96B 3QJ6A 2P0QA 2X35A 4JDSA 2DXTA 3V7RA 4A4GA 1K8AU 1K9MC 2K5FA 2XHCA 4M75C 4BDZA 5FU6C 3UPUA 2Y90A 4M77C 4QQGA 1QP3A 4XTXA 4C5HA 2RHUA 4EMKC 5GMKl 4B9WA 3OYGA 2CKKA 4ELYC 3VUZA 3NTIA 2JNGA 4C0DB 4F7UE 2LTOA 1IZ6A 3RERA 1UGQB 2LT4A 3MP6A 3CD6A 3GPLA 1LNXA 1YIJT 2QQSA 4M7DE 2KAFA 3DB3A 2FVUA 3JCMb 1VQ9T 3CXCS 2VGMA 1VQOA 2XIDA 3JCMJ 1PSEA 1IREB 2CZ6B 3V7SA 4KT0E 1Y96A 3OY9A 3A5ZB 1YJ9A 5FRNA 3E9FA 2A7YA 2RJDA 4ELZC 4ZN1A 3HKSA 3EFSA 4L6V5 3SDZA 2B8AA 3FEOA 2RA2A 4C0FA 1I81A 2DXBA 4GLKA 2K4YA 4HCBA 4M77D 2MAMA 2DAQA 2CGHA 2EFIA 2JZ2A 3TREA 4KULA 2L89A 5LJ5e 1YJNA 4XK8E 2XDDA 2O01E 3MEWA 4QVDA 3OYLA 3CD6T 2FL7A 3C12A 3VUBA 1KD1C 3CPWA 2RJEA 2LQKA 3OYKA 1O9SA 4J5YA 1VUBA 5FU7C 1YJ9T 2XKOC 4M7DB 3HP9A 5DLQE 2OTLT 3R6OA 2KK4A 2RK1A 3JCMh 3SD4A 4C8QE 5GAN7 1QVPA 4P5NA 4II1A 4F7UF 2EYQA 3HRTA 1KG1A 2YLBA 3GP8A 3LX7A 5CKBA 1YJNT 2ZPBB 2VGNA 3BDLA 4LDYA 4ZGEB 3F70A 4IUQA 2C06A 4O5VA 5CIUA 3CCVA 4A4HA 2CYZB 2K5LA 2HQEA 5D6YA 4F7UA 2DVEA 4KUDK 3C4SA 2RJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK4 A; 
#chains in the Genus database with same CATH topology
 4J8O A;  4RTY A;  1RI0 A;  3P8B B;  2HDA A;  2O2O A;  1UGP B;  3OYD A;  3QZ5 B;  5LJ3 j;  1K4U S;  3OYM A;  4OMF B;  2F5K A;  2FYK A;  3H0F A;  4E7J A;  1AD5 A;  2V8K A;  5CKD A;  1PKS A;  4JJN K;  1KK7 A;  2D9T A;  2L3Q A;  4RKU E;  2HL5 C;  1OU8 A;  2LX7 A;  3J80 E;  1YP5 A;  4X1V A;  1ZBJ A;  1PRM C;  4PL6 A;  2JVV A;  3AT1 B;  1S1N A;  2FPD A;  3JCM e;  3CMA A;  2COZ A;  2LCL A;  3BE3 A;  5LJ5 d;  2CDT A;  2E41 A;  3LGF A;  3T9N A;  4BD3 A;  4M7A E;  2OAW A;  2VB6 A;  1D3B B;  2C0T A;  1VQK A;  1JQQ A;  1K9M U;  1RAA B;  1MGQ A;  4QKU A;  2RJC A;  2EJG A;  5AT1 B;  2X3X D;  2RHY A;  4CRI A;  3QZ9 B;  3OYJ A;  1VQ5 T;  3CCR A;  3JCM W;  1GRI A;  4D8D A;  1OQK A;  2HQH A;  2VKN A;  3LH0 A;  5IXB A;  1VQ8 A;  4JJC A;  4BY6 B;  1QCN A;  1M2V B;  2YWW A;  3QWX X;  3CCE A;  4C0Z A;  3M4G A;  1EFN A;  1M9S A;  1M8V A;  1Q82 C;  1I0C A;  3SHW A;  5GAO n;  4JRK A;  1D1C A;  2B86 A;  2JMC A;  3M55 A;  4FYV B;  4QT7 A;  4HA8 A;  2QAS A;  2KVQ G;  5GJW B;  5I2S A;  1UE9 A;  2I0N A;  3G4S T;  2KY9 A;  3J81 E;  4N4G A;  1NPP A;  2F1L A;  4LUD A;  2E5K A;  5J26 A;  3JCM g;  2JW4 A;  2VVK A;  1VQM A;  3CC2 A;  1SEM A;  3ZL7 C;  4BAC A;  2KT1 A;  1M90 U;  4DOV A;  1MMG A;  1N8R R;  1JBM A;  2R5M A;  4B9X A;  1PM3 A;  4E6R A;  1G83 A;  3OBY A;  3MP1 A;  4F14 A;  3QO3 A;  3OYB A;  1RLP C;  2DD4 A;  1Q81 U;  3M9Q A;  4FCY A;  1Q86 U;  4F04 B;  2DBM A;  3G4S Q;  3CPW S;  1X01 A;  1BU1 A;  1AWO A;  1BCO A;  3M0S A;  3Q1J A;  2MI6 A;  2AIR B;  2VC8 A;  1M27 C;  5FRO A;  3JCM Q;  4NL3 A;  1QVG A;  1TUC A;  2CP0 A;  3C95 A;  4J9E A;  2I2L A;  4FYY B;  4Y28 E;  2SEM A;  4CC7 A;  3C94 A;  1YIT T;  3QJY A;  1RAC B;  3EGD B;  5GAN 2;  2QEX Q;  1M3A A;  2KSS A;  3OSV A;  2NLU A;  1YJW Q;  3JB9 I;  3VS3 A;  1VQ4 A;  1K76 A;  1WNL A;  4XU1 A;  3I56 T;  2LJ1 A;  1AWJ A;  2DTH A;  1RAB B;  2DRM A;  4BE1 A;  4HVV A;  2DM1 A;  3VS4 A;  1VQL T;  3RES A;  3EG9 A;  3PVL A;  2VUB A;  1LCK A;  2DL5 A;  2CZ1 B;  3I9Q A;  1X27 A;  3OMG A;  1K0X A;  2D6F A;  1B34 A;  1JJ2 A;  3OQ5 A;  3CEY A;  1M1K U;  1M1F A;  3PIP A;  3CXC A;  3SB2 A;  4RCB A;  3TEE A;  3HL8 A;  2K79 A;  3OA6 A;  1KQ1 A;  1VOM A;  2CS7 A;  2HSE B;  3OS5 A;  3DLL A;  3JCM X;  3I56 Q;  4ATO A;  3CC7 T;  1BYM A;  2HZY A;  1K8A R;  1VQL Q;  1PC0 A;  5KYN A;  1N9R A;  5IAY A;  1YWP A;  4IUP A;  4RG2 A;  2LP5 A;  1SPK A;  4WCI A;  4Z02 A;  4PJO F;  3CCL Q;  1W6X A;  2EIF A;  3GBQ A;  1NLP C;  2W10 A;  3WVE B;  3QII A;  3OBW A;  5EG2 A;  2LNH B;  1IGU A;  2OTL A;  1B7T A;  4PJO A;  4PLL A;  1YN8 A;  3QHS A;  1OPL A;  2GGR A;  2JOY A;  1WJR A;  4CC4 B;  1GCP A;  3CC7 Q;  1SHF A;  1WHK A;  2RQT A;  1NYG A;  4KRT A;  3SWN A;  2E6Z A;  2M0Y A;  2RMO A;  2IG0 A;  1SF9 A;  1VQN A;  1AOJ A;  1N27 A;  4PJO C;  1GCQ A;  2HQX A;  1E7O A;  3VS0 A;  4M7A G;  3HRU A;  1BIB A;  1YIJ Q;  2C0I A;  2KQW A;  2E70 A;  1AHJ B;  1NYF A;  1OX8 A;  1UGS B;  1VYV A;  3H8Z A;  1K0S A;  1ZSZ B;  5DM7 R;  2CP3 A;  4OMP A;  2BTT A;  3SWN C;  3FDR A;  6AT1 B;  1WHH A;  2VV5 A;  3VRY A;  5GAN 8;  4FL6 A;  1HYO A;  4OB3 B;  1GCQ C;  2SRC A;  1MV3 A;  3VV0 A;  2DVJ A;  3G71 T;  1MND A;  3CCQ T;  2RF0 A;  4CI0 C;  2OTJ T;  1QKX A;  1RAE B;  2DE0 X;  2X3W D;  3L2Q A;  4L59 A;  4FT2 A;  3TCJ A;  1ZSZ A;  2EQU A;  1WPY A;  2CUB A;  4M7D G;  2JTF A;  2L3S A;  2QTX A;  5M9O A;  3HHT B;  2ABL A;  3JCM V;  4JJD A;  4M75 B;  2DER A;  1DJ7 B;  4PJL A;  1B3Q A;  1RI9 A;  2K2V A;  2LMJ A;  5CQY A;  4AFU C;  4HT9 A;  2KRO A;  1WXU A;  1QVG S;  1ZSZ C;  2D0N A;  3CCU A;  4RMO A;  2D8H A;  1FXX A;  1G3S A;  2DEU A;  1VQ7 A;  4HCZ A;  2LNV A;  3CBM A;  3CCQ Q;  1BI1 A;  3G6E A;  2OTJ Q;  3LLR A;  4KUD K;  3EG1 A;  2V26 A;  2A08 A;  4OB1 B;  3KXT A;  3SEM A;  1Y7X A;  2QGG A;  2YSQ A;  4FIB A;  1K9M R;  1HD3 A;  2MCN A;  2LRQ A;  3L2Z A;  3CCS T;  2X35 A;  1UHC A;  3V7R A;  5KYU B;  1YNZ A;  3CME Q;  4M75 C;  1R0C B;  5FU6 C;  2Y90 A;  4JZ4 A;  3I5S A;  1QP3 A;  3OYG A;  3HSB A;  2RHU A;  4B9W A;  2IPO B;  2QYZ A;  2KRS A;  2ESW A;  4F7U E;  3VS2 A;  1UGQ B;  2J05 A;  1VQ9 T;  3CXC S;  2VGM A;  4Z88 A;  1VQO A;  1PSE A;  2CZ6 B;  3V7S A;  2AZS A;  2A7Y A;  2GNC A;  3I35 A;  4ZN1 A;  4L6V 5;  1GBR A;  2B8A A;  2KNB B;  1Y57 A;  1I81 A;  2PZ1 A;  3EGX A;  4GLK A;  2EYY A;  2NUZ A;  4HCB A;  4AG1 C;  2BZ8 A;  2DAQ A;  2CGH A;  2RQW A;  1S72 Q;  4DEY A;  1HSQ A;  1WFW A;  1ACM B;  4QVD A;  1C1A A;  2KYM A;  2LQK A;  1YJ9 T;  1W1F A;  2HCK A;  2RK1 A;  2M51 A;  3TVT A;  5GAN 7;  4F17 A;  2EYQ A;  2ENM A;  2YLB A;  2YRC A;  3LX7 A;  1VQ9 Q;  5CKB A;  2COW A;  2ZPB B;  5KYW B;  2AT1 B;  4KGV B;  3C4S A;  2RJF A;  2CT4 A;  2EGA A;  4MMK A;  1WXB A;  2JTM A;  1N8R C;  1N9S A;  3X25 B;  4A63 B;  2OI3 A;  1Q81 R;  1ZBX A;  3ZEH A;  1FYN A;  2RQU A;  1X6G A;  4PJO D;  1Q86 R;  2RNA A;  2QGF B;  2EJF A;  3MEU A;  1UTI A;  2YRD A;  3X26 B;  5KYW A;  2CP5 A;  2ZZD A;  2DL7 A;  1X69 A;  1TWB A;  2LVM A;  2L8D A;  1OV3 A;  2YUN A;  5L23 A;  3FRN A;  2XG8 D;  4Q5W A;  5FRM A;  3PE0 A;  1S72 A;  1WX6 A;  2Y4Y A;  2K3Y A;  4KBM B;  4DBF A;  3RIR A;  2GTJ A;  4QQD A;  2JS2 A;  3GF5 A;  4RCC A;  3EFR A;  3E9G A;  2FPE A;  2EWN A;  3OYI A;  2RI2 A;  5CKF A;  3L42 A;  2CZ0 B;  3OB9 A;  3U23 A;  3OYH A;  3PNW C;  1R77 A;  2JTE A;  3CMA T;  3JSC A;  2DIG A;  4O6J A;  2ZPI B;  2FEI A;  2ROL A;  4XTZ A;  3X20 B;  1ABQ A;  3NTK A;  1M3B A;  1VQK T;  2KXD A;  1M1K R;  3QXE B;  2FZC B;  2R57 A;  3ER0 A;  1W2B P;  1WHG A;  1ZQ1 A;  1Z9Z A;  2ROT A;  3EFO A;  1NG2 A;  3CCR T;  1YFN A;  4M77 G;  5D6W A;  4RTT A;  3EG2 A;  4M75 D;  2DEQ A;  1VQ8 T;  3EH2 A;  3CCJ A;  2C0O A;  5J3B A;  3EG3 A;  2YHT A;  2KI7 A;  3M57 A;  1K73 U;  2LQN A;  3CCE T;  2EKO A;  1K8A C;  4XU3 A;  1VQK Q;  1M3C A;  4ZNX A;  1VYU A;  2HKN A;  1PSF A;  1E6H A;  1XNI A;  2YUQ A;  4C0D C;  4B6M A;  3CCR Q;  4D8K A;  2HMA A;  1Q95 G;  4EMH A;  4FYX B;  4NS5 A;  2DBK A;  5CR2 A;  3OYN A;  2JJ9 A;  2NUP B;  4GBQ A;  1VQ8 Q;  1VQM T;  3CC2 T;  4LNP A;  3OS0 A;  2HSP A;  2KRN A;  1QQJ A;  1VQP A;  1VIE A;  2KR3 A;  1WHJ A;  3VKI A;  3CCE Q;  1WGS A;  1X6O A;  2E10 A;  1RAI B;  1LPL A;  2JN0 A;  4MML A;  3CCM A;  3OW2 A;  3A8G B;  2EQJ A;  1V76 A;  2PUK B;  3QYH B;  3P8H A;  4C5I A;  2D0Q B;  2ATC B;  4X9D A;  3EAE A;  1QKW A;  2O4X B;  4F7U G;  1VQM Q;  4MZM A;  5I21 A;  3CC2 Q;  2F2X A;  3NTH A;  5GAO m;  4J7I A;  3JB9 J;  1H3Z A;  3DKM A;  3AHU A;  4XTV A;  2W0Z A;  2CUD A;  2DMO A;  3HRS A;  4DBQ A;  4FW2 A;  3NGP A;  2K5I A;  4J6Y A;  2O4X A;  4C5G A;  2RD1 A;  4RTU A;  1D1B A;  2ED1 A;  4PJO E;  2J7I A;  4FSX A;  1SHG A;  1QP2 A;  2E3H A;  1XQH A;  4ZGD B;  5KYX B;  1D3B A;  3OYE A;  2DO3 A;  2YUO A;  2QK0 A;  1CKA A;  2DNU A;  4N0A A;  3HTR A;  5GAM h;  3FLG A;  1JXM A;  5GAN h;  2AKL A;  4DQ2 A;  2E4H A;  4E7I A;  3PFS A;  5FU7 B;  4FM4 B;  3OMC A;  4A4F A;  4OGC A;  3HPW A;  2OAU A;  4PLI A;  5GAM f;  2QTV A;  3M54 A;  5GAN f;  4LDW A;  3VS7 A;  5KYX A;  1U8R A;  4HVU A;  4N0A C;  1UG1 A;  1YHQ Q;  2EW3 A;  5DY9 A;  3VYH B;  1M2V A;  2A36 A;  2DK3 A;  2EKH A;  8AT1 B;  3LYI A;  4ZN3 A;  1VQ4 Q;  2QI2 A;  4C0G A;  3L2W A;  1AWW A;  1UB4 A;  1UEB A;  2QQR A;  4PJN A;  5IXF A;  4C92 B;  4PNO A;  5C0M A;  3L2U A;  1VIF A;  1W70 A;  4BY6 C;  2ZCF B;  2E1H A;  4Y92 A;  2EQM A;  2MIO A;  4D6W A;  4A53 A;  1IGQ A;  4C92 F;  5LL6 S;  1IRX A;  2RI5 A;  3I55 A;  3J7A F;  5GAM e;  2QEX T;  2RO0 A;  5GAN e;  1U5S A;  5GMK i;  3VS1 A;  4JS4 A;  4QW2 A;  3JCM c;  4C92 A;  3P8D A;  3DB4 A;  4JRI A;  2DIL A;  1GBQ A;  1YJW T;  3UA6 A;  1U1S A;  1AVZ C;  4AFZ C;  2CSQ A;  2IVW A;  4X9C A;  5GAO l;  4M75 E;  5J39 A;  3ULR B;  1VQN T;  4IUU A;  2EYW A;  2GBQ A;  4C92 C;  3NFC A;  2V8I A;  4LUE A;  3BY7 A;  4K11 A;  3SFM A;  1T3S A;  2DET A;  3URG A;  3JB9 F;  2O9S A;  4QVZ A;  2VXF A;  3CC4 A;  2OX7 A;  2PVG B;  4M78 B;  3QKJ A;  2MOX A;  2OTL Q;  1Q81 C;  2QQ9 A;  3RMQ A;  2R58 A;  1YHQ A;  1Q86 C;  4OF1 A;  4LD9 K;  2BE9 B;  1OZ2 A;  2WSF E;  4DA4 A;  3A1P A;  4E7S A;  2YXY A;  2J6K A;  2PU9 B;  4EMK B;  5I2M A;  3OW2 S;  3O5Z A;  2EGE A;  2XDB A;  1RAF B;  2JT4 A;  1BI2 A;  1VQN Q;  3EGD A;  3M0T A;  4M78 A;  1QWE A;  3MKD A;  2H3E B;  1UJY A;  1HJD A;  4WF2 A;  3RKY A;  1VQ5 A;  4TVR A;  3M5A A;  4BUG A;  5LJ5 h;  1O75 A;  1YWO A;  3CCL T;  3VYG A;  4C5E A;  1OX9 A;  2ZPE B;  3L2R A;  4IKF A;  4AT1 B;  4EMK A;  3CCV Q;  5GAM g;  1AZG B;  1RAG B;  5GAN g;  1XTD A;  2CT3 A;  4ANJ A;  4M78 C;  1PG5 B;  1ZA2 B;  5LJ5 f;  1VQ7 T;  3EHQ A;  3KFV A;  2R5A A;  5ECA A;  1HXD A;  2E5Q A;  4E2F B;  3G6E T;  4FSS A;  1E6G A;  4JDS A;  2DXT A;  4Z8A A;  4DEX A;  2BZY A;  4BDZ A;  1IXD A;  4EMK C;  1GFC A;  1SRL A;  1FMW A;  1NEG A;  2HBW A;  5IHK A;  4EIK A;  4F16 A;  3D7S B;  1PCX A;  3MP6 A;  1YIJ T;  2QQS A;  2KAF A;  3DB3 A;  2FVU A;  3JCM b;  3A5Z B;  3MPU B;  1Z9Q A;  3HKS A;  3SDZ A;  3CCU Q;  2RA2 A;  2DXB A;  2F2W A;  1KQS P;  1VQ7 Q;  2EFI A;  2JZ2 A;  1TG0 A;  2D8J A;  3M0Q A;  3G6E Q;  5LJ5 e;  1YJN A;  4XK8 E;  2XDD A;  3MEW A;  1K73 R;  2V1R A;  4IIO A;  2FL7 A;  3VUB A;  4PFZ A;  4PK4 A;  1D0Y A;  2FG0 A;  4M7D B;  1SSH A;  1WI7 A;  2EVR A;  1EZZ B;  1YCS B;  2KXC A;  2FRY A;  1QVP A;  4II1 A;  2M02 A;  3HRT A;  4LE9 A;  2VGN A;  2AKK A;  2C06 A;  4O5V A;  3CCV A;  3RBB B;  4A4H A;  2HQE A;  2JS0 A;  4NOY A;  4PJO G;  5D6X A;  5IHI A;  2L0A A;  1MV0 B;  1QVF P;  1AWX A;  5CKE A;  5CK9 A;  1NEB A;  4XU2 A;  2HBP A;  3JCM P;  1WJS A;  1VQO Q;  1YIT A;  2DL8 A;  4C8Q B;  3QUI A;  4MZT A;  1UDL A;  3TSZ A;  1LVK A;  2PQW A;  1Q7Y U;  3UA7 A;  2PTK A;  3E2U A;  5FWB A;  1H3H A;  2HAX A;  3INZ A;  2QA4 A;  4EDU A;  8ATC B;  1V1C A;  1U06 A;  4FW1 A;  4AG2 C;  4C92 D;  1C6V X;  2RQV A;  3ZBD A;  3CME T;  2RB6 A;  4C8Q A;  1FX7 A;  5CQX A;  4FYW B;  4M75 F;  4XTW A;  1AEY A;  5A0G A;  1IO6 A;  4UC4 A;  5LJ5 g;  4HCK A;  1M5Q 1;  4AMC A;  1KFZ A;  4E7K A;  2EGC A;  2HD0 A;  4M75 A;  2XDP A;  1RL2 A;  1J3T A;  1WDX A;  5HCK A;  3RUX A;  2LT1 A;  4C8Q C;  2KRM A;  5CCA A;  4Y91 A;  5A0L A;  1OOT A;  2WSC E;  3H0I A;  5GMK e;  1S72 T;  3VS6 A;  2FPF A;  2NUT B;  1IHW A;  1FMK A;  4J7F A;  3OS2 A;  3JB9 D;  2A3L A;  3ZFJ A;  3QBY A;  2E64 A;  5AYF A;  4LDV A;  2DFU A;  1KHC A;  4KGX B;  1JJ2 S;  1UHF A;  2NWM A;  2WAC A;  1Y71 A;  4M78 D;  1P92 A;  4A54 A;  2DPP B;  2DZ9 A;  2EQK A;  1U3O A;  1X2Q A;  5KYU A;  4IUV A;  4M4Z A;  3LGL A;  5GJV B;  2X4J A;  3MCA B;  1MMD A;  3NMZ C;  2NYS A;  3JRZ A;  1SRM A;  4IUR A;  4RG8 A;  3VS5 A;  3RNJ A;  3JAM E;  3A8O B;  2GFU A;  3GLX A;  3JCM d;  4LXC A;  3C0C A;  4DBH A;  4IIM A;  4XTU A;  1M90 R;  2WSE E;  3FIF A;  4MZP A;  2LJ3 A;  2QG9 B;  2P84 A;  3M53 A;  5GAN 5;  2DTI A;  3X24 B;  1KC8 U;  2MMP A;  4ESR A;  3OS1 A;  2X4X A;  4E7H A;  4HCC A;  1PWT A;  1ZUU A;  5KYY B;  3G7Z A;  5C6S A;  1UFF A;  2AZV A;  3M0P A;  4L5G A;  3G71 A;  1QLY A;  1SKU B;  4XQ3 A;  3UT1 A;  2BUD A;  3QPH A;  3M0U A;  1VYT A;  1JXO A;  3CCJ Q;  1NZ9 A;  4ME7 A;  2DRK A;  3G1J A;  1UGV A;  2PVD B;  1VQP T;  5KE3 A;  5HKC A;  4OMN A;  1NJI U;  2RM4 A;  1PRL C;  2XD0 A;  3MEA A;  1W2B A;  1BIA A;  2DD5 A;  3M0R A;  3E1S A;  3CCM T;  1WXT A;  1WA7 A;  1MMA A;  4OB0 B;  4PFP A;  4DOW A;  2FHD A;  4M77 B;  2QDL A;  3OYC A;  2A0F B;  2HEQ A;  1KSW A;  2ZGW A;  2GF7 A;  1VQP Q;  1ZSG A;  3MHX A;  3A98 A;  3V8K A;  1XJW B;  5HK3 A;  2JMA A;  3PMT A;  3HFN A;  1PKT A;  2K7A A;  4JRQ A;  5LJ3 h;  1D0Z A;  2KBT A;  1ZUK A;  3L1A A;  2ZPH B;  4ORZ A;  3VU3 C;  5A2Q E;  3CCM Q;  4OMO A;  1Y07 A;  2PUO B;  3WXM B;  3M59 A;  1OEB A;  2EBP A;  4C8Q D;  1NBE B;  3NHN A;  4QVC A;  5LJ3 f;  1MHN A;  2Y4X A;  4J83 A;  4C92 E;  5GAN 4;  2VAS A;  1KD1 U;  4DBR A;  2K57 A;  3OYY A;  3QSU A;  2CH4 A;  5KCH A;  5DLO A;  2MF2 A;  2JUF A;  1NM7 A;  1G3W A;  4LN2 A;  2FZK B;  2DIQ A;  4J6X A;  1NLO C;  2G6F X;  9ATC B;  5GMK m;  4LDX A;  2KEA A;  2LX9 A;  1C0M A;  1B07 A;  1X43 A;  1N5Z A;  2V1Q A;  1I07 A;  3JCM f;  3GNF B;  2MWP A;  2RHI A;  4JPB W;  5LJ3 e;  3PT9 A;  4F7U B;  1PD0 A;  3RDV A;  2AK5 A;  1WYX A;  1GXI E;  4VUB A;  5KCO A;  2L5Q A;  5CKH A;  3DLM A;  1K73 C;  1ZA1 B;  4M78 E;  5HY6 A;  4JLI A;  2MPX C;  3MP8 A;  1UEC A;  2IIM A;  3N5B B;  2O31 A;  4QQ6 A;  4BDY A;  3LH5 A;  1NE8 A;  4OVA A;  2A37 A;  3O8V A;  3I55 T;  2PVO B;  2NUP A;  2RK2 A;  5IHN A;  2DX1 A;  1F1B B;  3JV3 A;  2CP6 A;  3CD6 Q;  2K9G A;  2EPD A;  1KIK A;  1VQ6 A;  2LCS A;  1A0N B;  4GY5 A;  3REA B;  1Q7Y R;  4JLG A;  4BB7 A;  1OUL A;  1QMC A;  5IT9 E;  3CPW P;  5CVI A;  5GAN 6;  4R55 A;  5GAN 3;  5HK0 A;  1I5O B;  3CQT A;  3QG1 A;  1MMN A;  1ZHI A;  2V8J A;  3A8M B;  4FU6 A;  2QXF A;  1YI2 A;  3CC4 T;  3I55 Q;  3L2V A;  4V2S A;  3LWH A;  1YHQ T;  2L3P A;  5LJ3 g;  1LOJ A;  3JB9 H;  4RTV A;  1W2B S;  1FMV A;  1VQ4 T;  1Q82 U;  4ZTJ A;  4YTL A;  2DL3 A;  3V7C A;  1BI3 A;  2RHZ A;  3UWN A;  1G5V A;  2FB7 A;  1UJ0 A;  2M0O A;  4J9I A;  3R6N A;  3H0H A;  3FJP A;  2GCX A;  5IN1 A;  3QJ6 A;  4A4G A;  3OW2 P;  1K9M C;  2XHC A;  3UPU A;  4XTX A;  4QQG A;  2DLP A;  2J06 A;  3CC4 Q;  5GMK l;  2CKK A;  1TS9 A;  4J9C A;  3VUZ A;  3NTI A;  2LTO A;  1GFD A;  2LT4 A;  1VA7 A;  4JJB A;  3CD6 A;  5IH2 A;  4M7D E;  3JCM J;  1IRE B;  2CP7 A;  3OY9 A;  1MNE A;  5FRN A;  3E9F A;  3EFS A;  2MYS A;  3FEO A;  2K4Y A;  2QAZ A;  4M77 D;  2CRE A;  1VQ5 Q;  2HL3 A;  1JU5 C;  2RJE A;  4J5Y A;  1VUB A;  5FU7 C;  5FW9 A;  3H9N A;  3IQL A;  2OTL T;  5DLQ E;  3R6O A;  2KK4 A;  3UF4 A;  3SD4 A;  4C8Q E;  4KGZ B;  4P5N A;  1KG1 A;  3TQ7 P;  1WZO A;  1YJN T;  3BDL A;  4ZGE B;  4LDY A;  3F70 A;  3UAT A;  4IUQ A;  5CIU A;  4RTW A;  3QDF A;  2CYZ B;  1ZLM A;  2DF6 A;  4OMM A;  2RPN A;  1KC8 R;  2O9V A;  2K3B A;  1U1T A;  1M90 C;  1T0J A;  2EAY A;  2YT6 A;  1RAD B;  4J9H A;  1I4K 1;  3TSW A;  2CSI A;  5GAM j;  2ED0 A;  1TOV A;  5GAO q;  5GAN j;  4OP0 A;  3A8H B;  3CCV T;  1KHI A;  3RKX A;  1M8M A;  1UUE A;  2M1H A;  1BI0 A;  4C92 G;  2HKQ B;  3QYG B;  4M78 F;  2H8H A;  1YJN Q;  2J6O A;  1M30 A;  1W4S A;  4N4I A;  1KQ2 A;  2GQV A;  4HXJ A;  2YDL A;  3M4Y A;  1AT1 B;  1NJI R;  3EG9 B;  1ZX6 A;  4NL2 A;  2H3J A;  3X28 B;  4J9G A;  1KJW A;  4A4E A;  3M56 A;  3S6W A;  1B34 B;  1IB8 A;  5L8R E;  1PHT A;  4OML A;  3HFO A;  4MDX A;  2QA4 T;  1KQS A;  5KH6 A;  2DXC A;  1TU0 B;  2HNI A;  2KT8 A;  2BE7 D;  1OU9 A;  1K9A A;  1QCO A;  3CCU T;  4KUI A;  1X6B A;  4R0K A;  1BK2 A;  1OYX A;  3JB9 G;  1YCY A;  3OYF A;  3QWY A;  2DL4 A;  2PNI A;  2F5T X;  4EPC A;  1BCM A;  2KMT A;  1V29 B;  1PNJ A;  1YIT Q;  4AFQ C;  1TUD A;  1QVG P;  3THK A;  4BE2 A;  3ME9 A;  7AT1 B;  1MUZ A;  3PMI A;  2EQI A;  4M7A B;  1SSF A;  2YRV A;  4M78 G;  1H8K A;  3REB B;  2ZAE A;  1NPR A;  1R8O B;  1BB9 A;  2QA4 Q;  2AHJ B;  3G4S A;  4JZ3 A;  1M1K C;  4M7A F;  1GL5 A;  1X75 C;  2A28 A;  3MET A;  3VJP A;  1QVF A;  1JRI A;  2P0P A;  1QWF A;  3A8L B;  4PJO B;  5A0D A;  2QQA A;  4GLM A;  4BI3 A;  2RH2 A;  1KD1 R;  2G3R A;  4ZGJ B;  3CPF A;  1X2K A;  3UDC A;  4M7A A;  4OB2 B;  1Y0M A;  3SWN B;  4BI4 A;  1OI1 A;  2LJ0 A;  1VQO T;  1UGR B;  3FC3 A;  2BKD N;  2F69 A;  2QEX A;  3H6Z A;  3EGU A;  2E12 A;  1JJ2 P;  2KYB A;  4M7A C;  1BBZ A;  2FRW A;  4JS5 A;  2MK5 A;  3QDR B;  3CBP A;  4XU0 A;  3CXC P;  1YJW A;  4M7D F;  2K2M A;  5D7U A;  3OSS C;  1T3L A;  2DYI A;  1I5L A;  2XI9 A;  1JEG A;  3PGG A;  5LJ5 j;  3KUF A;  4M7D A;  5CAI A;  2QQB A;  2ZPG B;  5GMK h;  1TUG B;  3RMS A;  5GAO p;  2X51 A;  3WVD B;  1RLQ C;  2EYZ A;  4KH1 B;  1WHM A;  3S3M A;  1PD1 A;  3MJX A;  4M77 E;  4M7D C;  4C8Q F;  2XIC A;  1RUW A;  2X4W A;  3ASK A;  1JB0 E;  3M58 A;  3I56 A;  1ABO A;  5KE2 A;  1WJQ A;  1WQW A;  1VQL A;  1I8F A;  2XU8 A;  1M4Z A;  1FWZ A;  2P0K A;  2COY A;  2ZPF B;  3CCL A;  3TU4 K;  1D0X A;  1G3T A;  1TTH B;  2VYT A;  3KBG A;  5FU6 B;  3V8J A;  2RI3 A;  2FZG B;  2P4T A;  3E19 A;  1Q7Y C;  3H41 A;  3MO8 A;  1TH7 A;  4PJJ A;  1T0H A;  3GOX A;  3V8L A;  2O88 A;  3EG0 A;  3G71 Q;  1XOV A;  3FJ5 A;  2QDY B;  3PIO A;  3PVQ A;  3CC7 A;  4EMG A;  5LJ3 d;  1M2O A;  2M9U A;  1OZ3 A;  2Z0W A;  3CBO A;  4J9D A;  1JO8 A;  2CH4 W;  1Q82 R;  5I22 A;  1G2B A;  4C8Q G;  3NPF A;  4HVW A;  4OGE A;  2M16 A;  4A4K A;  2DXU A;  1KQS S;  2YLC A;  4PFO A;  1H64 1;  3GNG A;  1YIJ A;  1ARK A;  3BW1 A;  4RTX A;  4LD6 A;  5GAO r;  3EH1 A;  4M75 G;  2NUT A;  2LC4 A;  4Z89 A;  3EHR A;  5GMK j;  3EGX B;  4RTZ A;  1BKB A;  1N6A A;  1I1J A;  4E7Z A;  4PJM A;  3PTA A;  4CC2 A;  2BIV A;  2RHX A;  3S3N A;  2VXE A;  1LJO A;  2LQ8 A;  1OPK A;  2E65 A;  1D09 B;  4BI8 B;  1HK9 A;  2JXB A;  2P4R A;  4HT8 A;  1WQ7 A;  4MDW A;  1QCF A;  2GQI A;  1WIE A;  3LWI A;  4JRP A;  3CCJ T;  2DA9 A;  1N8R U;  1M1G A;  4J9B A;  3CCS Q;  1G8X A;  4E7L A;  4X34 A;  5CO7 A;  2X9H A;  1QVF S;  2DJZ A;  4J9F A;  2CZ7 B;  2YUP A;  3CCQ A;  2OTJ A;  3FB9 A;  2RQR A;  2FO0 A;  1QW1 A;  4XTY A;  2E6N A;  2LQW A;  3RKW A;  4M7A D;  3LW5 E;  2DKG A;  2OJ2 A;  1YBY A;  2DZC A;  2MWO A;  5FLX E;  3BFM A;  5KYY A;  2K6D A;  2KGT A;  2D1X A;  4BE0 A;  2KDS A;  2JM8 A;  1KC8 C;  4R56 A;  3CME A;  2F2V A;  2X4Y A;  1YJ9 Q;  3GIB A;  4HKE A;  4J6W A;  3OYA A;  2GFA A;  4M7D D;  4LDU A;  2LCC A;  4PKC C;  1D1A A;  4FT4 A;  4JUV A;  1EX4 A;  4KH0 B;  1TSF A;  3RR6 A;  3S3O A;  4ZTF A;  1VQ6 T;  4N4H A;  1CSK A;  4RUG A;  1G3Y A;  2DTO A;  2E3I A;  4M77 F;  2LZ6 B;  3CCS A;  2XK0 A;  2BZX A;  4IUT A;  2K3X A;  1NJI C;  1H92 A;  4CC3 A;  2CP2 A;  2XMF A;  1EIF A;  4M77 A;  2JM9 A;  5GAM d;  4E47 A;  5GAN d;  1YI2 T;  1AZE A;  2VWF A;  2L3R A;  4XAX B;  2EJ9 A;  3MEV A;  3EFO B;  5FWC A;  1TXQ A;  1VQ9 A;  3BDU A;  2LDM A;  1Y96 B;  2P0Q A;  1ZUY A;  1K8A U;  1SG5 A;  1VQ6 Q;  2K5F A;  4M77 C;  4C5H A;  3I5R A;  4ELY C;  2EYX A;  2JNG A;  4C0D B;  1IZ6 A;  2KE9 A;  3RER A;  1IHV A;  3GPL A;  1LNX A;  2XID A;  1K1Z A;  4KT0 E;  1Y96 A;  1YJ9 A;  2GTO A;  2RJD A;  4ELZ C;  1YI2 Q;  4C0F A;  5EC7 A;  3CMA Q;  2MAM A;  3TRE A;  4AFS C;  4KUL A;  2L89 A;  2DJQ A;  2O01 E;  3OYL A;  3CD6 T;  3C12 A;  4WTO B;  1KD1 C;  3CPW A;  3OYK A;  1O9S A;  1RAH B;  2ECZ A;  3VRZ A;  2XKO C;  1CKB A;  3HP9 A;  3JCM h;  4OMQ A;  4F7U F;  2DYB A;  1WLP B;  3GP8 A;  1R0B G;  2J6F A;  2RN8 A;  1WHL A;  2K5L A;  5D6Y A;  2L2P A;  4F7U A;  2DVE A;  5I11 A; 
#chains in the Genus database with same CATH homology
 1U1T A;  4J8O A;  4NOY A;  1RI0 A;  1M90 C;  4PJO G;  4MMK A;  5D6X A;  2JTM A;  2EAY A;  3P8B B;  1N8R C;  1N9S A;  3X25 B;  1UGP B;  3OYD A;  3QZ5 B;  5LJ3 j;  1ZBX A;  3ZEH A;  3OYM A;  4OMF B;  5CKE A;  1I4K 1;  2F5K A;  5CK9 A;  4PJO D;  4XU2 A;  2HBP A;  3JCM P;  1WJS A;  2EJF A;  2FYK A;  5GAM j;  1YIT A;  4C8Q B;  5GAO q;  4E7J A;  5GAN j;  3QUI A;  2V8K A;  3MEU A;  4MZT A;  4OP0 A;  3A8H B;  3CCV T;  1KHI A;  2PQW A;  1Q7Y U;  3X26 B;  3RKX A;  5CKD A;  2M1H A;  1BI0 A;  4JJN K;  4C92 G;  2D9T A;  3QYG B;  2ZZD A;  2HAX A;  4M78 F;  4RKU E;  3INZ A;  2QA4 A;  4EDU A;  3J80 E;  1W4S A;  4N4I A;  4C92 D;  1KQ2 A;  2LVM A;  2GQV A;  2L8D A;  3ZBD A;  3M4Y A;  3CME T;  2RB6 A;  4PL6 A;  2JVV A;  4C8Q A;  1FX7 A;  5CQX A;  3FRN A;  2XG8 D;  4M75 F;  4XTW A;  4NL2 A;  3JCM e;  3CMA A;  5A0G A;  4Q5W A;  2H3J A;  3X28 B;  4UC4 A;  5FRM A;  1S72 A;  5LJ5 g;  2LCL A;  4A4E A;  3M56 A;  2Y4Y A;  3S6W A;  1B34 B;  2K3Y A;  5LJ5 d;  5L8R E;  4KBM B;  2E41 A;  1M5Q 1;  3LGF A;  3T9N A;  3RIR A;  3HFO A;  4BD3 A;  4E7K A;  4MDX A;  4M7A E;  4QQD A;  2QA4 T;  1KQS A;  2HD0 A;  3GF5 A;  2DXC A;  4M75 A;  5KH6 A;  1D3B B;  3EFR A;  3E9G A;  4RCC A;  2XDP A;  2EWN A;  1VQK A;  3OYI A;  2HNI A;  2RI2 A;  1RL2 A;  3L42 A;  5CKF A;  2CZ0 B;  1K9M U;  3RUX A;  2LT1 A;  3OB9 A;  4C8Q C;  1MGQ A;  3OYH A;  3PNW C;  2RJC A;  5CCA A;  4Y91 A;  3CCU T;  2EJG A;  4KUI A;  3CMA T;  3JSC A;  2DIG A;  2RHY A;  2WSC E;  4O6J A;  3QZ9 B;  4CRI A;  5A0L A;  5GMK e;  3OYJ A;  1S72 T;  1OYX A;  3JB9 G;  2ZPI B;  1VQ5 T;  1YCY A;  3OYF A;  3CCR A;  3JCM W;  4EPC A;  2F5T X;  2KMT A;  1V29 B;  4XTZ A;  4J7F A;  3X20 B;  3OS2 A;  3LH0 A;  3JB9 D;  3NTK A;  4BE2 A;  3ME9 A;  1VQK T;  2A3L A;  3ZFJ A;  3QBY A;  2E64 A;  3PMI A;  1VQ8 A;  4M7A B;  3QXE B;  5AYF A;  1SSF A;  4BY6 B;  2YRV A;  4M78 G;  4LDV A;  1KHC A;  1JJ2 S;  2R57 A;  3ER0 A;  1NPR A;  1R8O B;  2WAC A;  3CCE A;  1Y71 A;  1ZQ1 A;  3M4G A;  4M78 D;  2AHJ B;  4C0Z A;  3G4S A;  1P92 A;  1M9S A;  1M8V A;  3CCR T;  1Q82 C;  1M1K C;  4M7A F;  4A54 A;  1X75 C;  5GAO n;  2DPP B;  2DZ9 A;  3MET A;  4JRK A;  2EQK A;  3VJP A;  1QVF A;  1JRI A;  4M77 G;  2P0P A;  4IUV A;  3A8L B;  5D6W A;  4PJO B;  5A0D A;  2QQA A;  4BI3 A;  3LGL A;  2RH2 A;  4M75 D;  2G3R A;  4ZGJ B;  2DEQ A;  3CPF A;  1VQ8 T;  2X4J A;  3M55 A;  3MCA B;  3CCJ A;  3UDC A;  5J3B A;  4M7A A;  4HA8 A;  2YHT A;  3JRZ A;  3M57 A;  4IUR A;  4RG8 A;  4OB2 B;  2KVQ G;  1K73 U;  3CCE T;  5I2S A;  2EKO A;  1K8A C;  3SWN B;  2KY9 A;  4BI4 A;  3J81 E;  3G4S T;  1OI1 A;  4N4G A;  1NPP A;  1VQO T;  1UGR B;  3JAM E;  4XU3 A;  3FC3 A;  3A8O B;  2GFU A;  3GLX A;  5J26 A;  2BKD N;  3JCM g;  2F69 A;  1VQM A;  2QEX A;  3JCM d;  1PSF A;  3CC2 A;  3H6Z A;  2E12 A;  1XNI A;  4BAC A;  1M90 U;  4M7A C;  4JS5 A;  4XTU A;  4DOV A;  2WSE E;  3QDR B;  3CBP A;  3FIF A;  4MZP A;  1JBM A;  4XU0 A;  2R5M A;  4C0D C;  1YJW A;  4M7D F;  4B9X A;  3M53 A;  4EMH A;  3OBY A;  2DTI A;  5GAN 5;  3MP1 A;  3X24 B;  4NS5 A;  2MMP A;  1KC8 U;  3OSS C;  3OS1 A;  2X4X A;  3QO3 A;  3OYB A;  5CR2 A;  3OYN A;  4E7H A;  1I5L A;  2XI9 A;  4HCC A;  3PGG A;  1VQM T;  5LJ5 j;  2DD4 A;  1Q81 U;  3M9Q A;  3KUF A;  3CC2 T;  4M7D A;  3OS0 A;  3G7Z A;  5C6S A;  5CAI A;  2QQB A;  1VIE A;  2ZPG B;  4L5G A;  5GMK h;  3VKI A;  3G71 A;  1VQP A;  1Q86 U;  3RMS A;  5GAO p;  1WGS A;  3CPW S;  1X6O A;  4XQ3 A;  3UT1 A;  3WVD B;  2BUD A;  2E10 A;  3QPH A;  1X01 A;  3Q1J A;  2MI6 A;  2JN0 A;  2VC8 A;  5FRO A;  3S3M A;  4MML A;  3JCM Q;  3CCM A;  3OW2 A;  3A8G B;  4NL3 A;  1QVG A;  4M77 E;  2EQJ A;  4M7D C;  3C95 A;  1NZ9 A;  4C8Q F;  2PUK B;  2XIC A;  4ME7 A;  2I2L A;  2PVD B;  1VQP T;  4Y28 E;  3QYH B;  5KE3 A;  2X4W A;  3C94 A;  5HKC A;  3ASK A;  3P8H A;  4C5I A;  2D0Q B;  1JB0 E;  3M58 A;  3I56 A;  1NJI U;  2RM4 A;  4X9D A;  5KE2 A;  3EAE A;  3QJY A;  1YIT T;  2XD0 A;  1WJQ A;  3MEA A;  2O4X B;  1WQW A;  1W2B A;  5GAN 2;  1VQL A;  1I8F A;  2XU8 A;  1M4Z A;  4F7U G;  1BIA A;  2DD5 A;  4MZM A;  5I21 A;  3E1S A;  3NTH A;  5GAO m;  3JB9 J;  1FWZ A;  2KSS A;  3OSV A;  4J7I A;  3CCM T;  2P0K A;  1H3Z A;  3DKM A;  4OB0 B;  3AHU A;  2NLU A;  2ZPF B;  4XTV A;  3CCL A;  3TU4 K;  3JB9 I;  1G3T A;  2VYT A;  2FHD A;  3KBG A;  5FU6 B;  4DOW A;  3HRS A;  4M77 B;  3V8J A;  1VQ4 A;  2RI3 A;  1WNL A;  4XU1 A;  3I56 T;  3OYC A;  2P4T A;  3E19 A;  1Q7Y C;  2DTH A;  2K5I A;  3MO8 A;  4BE1 A;  4J6Y A;  1TH7 A;  1VQL T;  2O4X A;  3RES A;  4C5G A;  2ZGW A;  2RD1 A;  2VUB A;  3GOX A;  2GF7 A;  3V8L A;  3MHX A;  2CZ1 B;  1XOV A;  4PJO E;  2QDY B;  3OMG A;  3V8K A;  3PIO A;  5HK3 A;  2D6F A;  1B34 A;  4FSX A;  3PMT A;  3CC7 A;  1JJ2 A;  4EMG A;  5LJ3 d;  3HFN A;  1QP2 A;  2M9U A;  3OQ5 A;  1XQH A;  3CEY A;  5LJ3 h;  4JRQ A;  4ZGD B;  1OZ3 A;  1M1K U;  1M1F A;  3CBO A;  1D3B A;  3PIP A;  3L1A A;  3CXC A;  2ZPH B;  3SB2 A;  2DO3 A;  3OYE A;  4RCB A;  4C8Q G;  3VU3 C;  5A2Q E;  1Y07 A;  4OGE A;  4N0A A;  3TEE A;  5GAM h;  3HL8 A;  2PUO B;  3FLG A;  3WXM B;  2M16 A;  4A4K A;  3M59 A;  5GAN h;  4C8Q D;  1KQ1 A;  3OA6 A;  2DXU A;  4DQ2 A;  1KQS S;  2YLC A;  1H64 1;  3GNG A;  2CS7 A;  1YIJ A;  3BW1 A;  3OS5 A;  4QVC A;  5LJ3 f;  4E7I A;  3DLL A;  3PFS A;  1MHN A;  2Y4X A;  4J83 A;  4C92 E;  3JCM X;  4LD6 A;  5GAO r;  4ATO A;  4M75 G;  4FM4 B;  5FU7 B;  3OMC A;  4A4F A;  3CC7 T;  5GAN 4;  2LC4 A;  4OGC A;  3HPW A;  2OAU A;  1BYM A;  4PLI A;  1KD1 U;  5GAM f;  3M54 A;  5GMK j;  5GAN f;  1BKB A;  4LDW A;  1N9R A;  1N6A A;  1U8R A;  5IAY A;  2K57 A;  4N0A C;  4IUP A;  3OYY A;  4RG2 A;  3PTA A;  2BIV A;  5DY9 A;  3VYH B;  3QSU A;  2RHX A;  5KCH A;  5DLO A;  4Z02 A;  2MF2 A;  2DK3 A;  2JUF A;  4PJO F;  3LYI A;  2EIF A;  1G3W A;  3S3N A;  3WVE B;  2VXE A;  4ZN3 A;  3QII A;  3OBW A;  1LJO A;  2LQ8 A;  2E65 A;  2DIQ A;  2QI2 A;  4C0G A;  3L2W A;  4J6X A;  5EG2 A;  4BI8 B;  1HK9 A;  1UB4 A;  1UEB A;  2OTL A;  2QQR A;  5GMK m;  4HT8 A;  1WQ7 A;  4MDW A;  4C92 B;  4LDX A;  4PJO A;  4PLL A;  2LX9 A;  4PNO A;  3LWI A;  4JRP A;  5C0M A;  3L2U A;  3CCJ T;  1VIF A;  1N8R U;  4BY6 C;  1M1G A;  3QHS A;  3JCM f;  2ZCF B;  2E1H A;  4E7L A;  2EQM A;  2JOY A;  3GNF B;  1WJR A;  4X34 A;  5CO7 A;  1QVF S;  4D6W A;  2MWP A;  4A53 A;  2RHI A;  5LJ3 e;  4C92 F;  5LL6 S;  3PT9 A;  2RI5 A;  3SWN A;  4F7U B;  2E6Z A;  3I55 A;  3J7A F;  2IG0 A;  1VQN A;  1GXI E;  5GAM e;  2QEX T;  2DJZ A;  1N27 A;  2RO0 A;  2L5Q A;  4VUB A;  5CKH A;  5GAN e;  5KCO A;  5GMK i;  4JS4 A;  4QW2 A;  2HQX A;  4PJO C;  3DLM A;  4M7A G;  3JCM c;  4C92 A;  1K73 C;  3P8D A;  2CZ7 B;  3DB4 A;  3CCQ A;  3HRU A;  2OTJ A;  4M78 E;  3FB9 A;  4JRI A;  5HY6 A;  1BIB A;  2KQW A;  2E70 A;  4JLI A;  1QW1 A;  4XTY A;  1YJW T;  1AHJ B;  2E6N A;  1U1S A;  3RKW A;  3MP8 A;  4M7A D;  3LW5 E;  1UGS B;  3H8Z A;  3N5B B;  5DM7 R;  4QQ6 A;  3SWN C;  2DKG A;  3FDR A;  4BDY A;  1YBY A;  2IVW A;  2VV5 A;  3HSB A;  1NE8 A;  4X9C A;  4OVA A;  5GAN 8;  2DZC A;  2MWO A;  3O8V A;  4M75 E;  5GAO l;  5FLX E;  5J39 A;  3I55 T;  2PVO B;  4FL6 A;  1VQN T;  4OB3 B;  3BFM A;  4IUU A;  4C92 C;  2RK2 A;  3NFC A;  2V8I A;  3VV0 A;  3G71 T;  3CCQ T;  3BY7 A;  4CI0 C;  2OTJ T;  4BE0 A;  3SFM A;  2KDS A;  3URG A;  1KC8 C;  4R56 A;  3CME A;  1VQ6 A;  3JB9 F;  4QVZ A;  2VXF A;  2X4Y A;  3CC4 A;  2PVG B;  4M78 B;  4L59 A;  3QKJ A;  4FT2 A;  3L2Q A;  3GIB A;  3TCJ A;  2EQU A;  1Q81 C;  4HKE A;  1WPY A;  2QQ9 A;  4GY5 A;  3RMQ A;  2R58 A;  4JLG A;  4BB7 A;  4J6W A;  1YHQ A;  3OYA A;  1Q86 C;  4OF1 A;  4M7D G;  4LD9 K;  2JTF A;  2QTX A;  1OZ2 A;  2GFA A;  5IT9 E;  5M9O A;  2WSF E;  4DA4 A;  3HHT B;  5CVI A;  3JCM V;  5GAN 6;  4M75 B;  5GAN 3;  4R55 A;  5HK0 A;  4LDU A;  4M7D D;  1DJ7 B;  2LCC A;  2PU9 B;  4FT4 A;  4PKC C;  4EMK B;  5I2M A;  3QG1 A;  4JUV A;  2K2V A;  5CQY A;  1ZHI A;  3OW2 S;  4HT9 A;  2V8J A;  3A8M B;  3S3O A;  4ZTF A;  1VQ6 T;  2XDB A;  4FU6 A;  2QXF A;  1QVG S;  1YI2 A;  4N4H A;  3CC4 T;  1G3Y A;  1BI2 A;  2DTO A;  3CCU A;  4RMO A;  4M78 A;  3L2V A;  4V2S A;  1FXX A;  3LWH A;  1G3S A;  4M77 F;  1VQ7 A;  4HCZ A;  4WF2 A;  2LNV A;  3RKY A;  1YHQ T;  3CBM A;  3CCS A;  1VQ5 A;  1BI1 A;  4TVR A;  2XK0 A;  3G6E A;  3M5A A;  1LOJ A;  5LJ3 g;  3JB9 H;  3LLR A;  4IUT A;  4BUG A;  5LJ5 h;  2K3X A;  1O75 A;  3CCL T;  1W2B S;  3VYG A;  1NJI C;  4C5E A;  2ZPE B;  3L2R A;  1VQ4 T;  4OB1 B;  1Q82 U;  3KXT A;  4IKF A;  1EIF A;  4EMK A;  4M77 A;  4ZTJ A;  5GAM g;  1Y7X A;  4YTL A;  5GAN g;  1XTD A;  5GAM d;  3V7C A;  1BI3 A;  4E47 A;  5GAN d;  4FIB A;  1YI2 T;  4M78 C;  2RHZ A;  3UWN A;  2L3R A;  4XAX B;  1G5V A;  2FB7 A;  2EJ9 A;  3MEV A;  2LRQ A;  3L2Z A;  2M0O A;  5LJ5 f;  1VQ7 T;  2R5A A;  3FJP A;  1VQ9 A;  1HXD A;  3CCS T;  2E5Q A;  2GCX A;  3BDU A;  2LDM A;  5IN1 A;  3G6E T;  1Y96 B;  3QJ6 A;  2P0Q A;  2X35 A;  4JDS A;  2DXT A;  3V7R A;  4A4G A;  1K8A U;  1K9M C;  2K5F A;  2XHC A;  4M75 C;  4BDZ A;  5FU6 C;  3UPU A;  2Y90 A;  4M77 C;  4QQG A;  1QP3 A;  4XTX A;  4C5H A;  2RHU A;  4EMK C;  5GMK l;  4B9W A;  3OYG A;  2CKK A;  4ELY C;  3VUZ A;  3NTI A;  2JNG A;  4C0D B;  4F7U E;  2LTO A;  1IZ6 A;  3RER A;  1UGQ B;  2LT4 A;  3MP6 A;  3CD6 A;  3GPL A;  1LNX A;  1YIJ T;  2QQS A;  4M7D E;  2KAF A;  3DB3 A;  2FVU A;  3JCM b;  1VQ9 T;  3CXC S;  2VGM A;  1VQO A;  2XID A;  3JCM J;  1PSE A;  1IRE B;  2CZ6 B;  3V7S A;  4KT0 E;  1Y96 A;  3OY9 A;  3A5Z B;  1YJ9 A;  5FRN A;  3E9F A;  2A7Y A;  2RJD A;  4ELZ C;  4ZN1 A;  3HKS A;  3EFS A;  4L6V 5;  3SDZ A;  2B8A A;  3FEO A;  2RA2 A;  4C0F A;  1I81 A;  2DXB A;  4GLK A;  2K4Y A;  4HCB A;  4M77 D;  2MAM A;  2DAQ A;  2CGH A;  2EFI A;  2JZ2 A;  3TRE A;  4KUL A;  2L89 A;  5LJ5 e;  1YJN A;  4XK8 E;  2XDD A;  2O01 E;  3MEW A;  4QVD A;  3OYL A;  3CD6 T;  2FL7 A;  3C12 A;  3VUB A;  1KD1 C;  3CPW A;  2RJE A;  2LQK A;  3OYK A;  1O9S A;  4J5Y A;  1VUB A;  5FU7 C;  1YJ9 T;  2XKO C;  4M7D B;  3HP9 A;  5DLQ E;  2OTL T;  3R6O A;  2KK4 A;  2RK1 A;  3JCM h;  3SD4 A;  4C8Q E;  5GAN 7;  1QVP A;  4P5N A;  4II1 A;  4F7U F;  2EYQ A;  3HRT A;  1KG1 A;  2YLB A;  3GP8 A;  3LX7 A;  5CKB A;  1YJN T;  2ZPB B;  2VGN A;  3BDL A;  4LDY A;  4ZGE B;  3F70 A;  4IUQ A;  2C06 A;  4O5V A;  5CIU A;  3CCV A;  4A4H A;  2CYZ B;  2K5L A;  2HQE A;  5D6Y A;  4F7U A;  2DVE A;  4KUD K;  3C4S A;  2RJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...