2KK4A

Solution nmr structure of protein af2094 from archaeoglobus fulgidus. northeast structural genomics consotium (nesg) target gt2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'QGHMDLICMYVFKGEESFGESIDVYGDYLIVKVGTEFLAVPKKSIKSVEDGRIVIGEFDEEEARELGRKWLEEKSKPVTLEELKSYGFGEEGEGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_2094
publication title Solution NMR structure of proterin AF2094 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.580 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kk4A00
2KK4A
chains in the Genus database with same CATH superfamily
4RTXA 4Y28E 1UTIA 5ECAA 4F17A 2EPDA 1MMNA 3NMZC 1Q95G 1UECA 1D0XA 3ULRB 5I2SA 3EAEA 1KC8C 1VQ7A 3JCMg 3H8ZA 4MZTA 4PFPA 4UC4A 4QQGA 2ABLA 2DERA 1ZLMA 3VV0A 3CC4A 4M77E 4M77A 3H9NA 3SHWA 2J6KA 4A54A 3RIRA 2QGFB 1Y96A 3VYHB 4PJMA 4F7UG 2RN8A 4M77B 5CKHA 3FLGA 3M9QA 4J9CA 4DA4A 2D9TA 2EGEA 2JUFA 3WXMB 5KYUA 2ROLA 4M7DE 4M7DA 1IRXA 1Y96B 2CS7A 2M51A 2RHIA 1G3YA 4FYYB 4C0ZA 2O31A 1NG2A 1PHTA 3I55Q 1M1KC 3LW5E 4AFUC 1YWOA 3HPWA 5KYUB 3QYHB 4M7DB 1VQLA 3HRTA 2P0PA 5DM7R 3VS0A 4ORZA 3BDUA 1QCFA 4WCIA 4KH0B 5KYYA 1N6AA 5J26A 2RI2A 2KT8A 5LJ3e 1YP5A 1ZUYA 2D1XA 1M90U 5KYYB 4JRQA 4K11A 1ACMB 3M0SA 3FEOA 2LJ0A 3G4SA 3OSVA 3T9NA 2Y90A 3CMAQ 2EGAA 2KI7A 2MWPA 3HFNA 4ZNXA 1N5ZA 2E12A 1OV3A 3TU4K 2DRKA 3HRUA 1I1JA 1T0JA 3I5SA 2RF0A 2M16A 1OZ3A 1K1ZA 4HT8A 1K4US 3UT1A 3PVLA 4D6WA 3L2QA 2E5KA 1M8VA 3M5AA 1RAFB 5DLQE 2XI9A 5C0MA 2ZZDA 3CCRT 2FHDA 1ZA1B 2JS0A 1VOMA 4RG2A 1MGQA 3QWYA 2X51A 3CD6Q 4XAXB 4GBQA 1M3CA 4L6V5 4LDUA 1WQWA 2DYBA 4M4ZA 1R8OB 4M78E 1SHGA 2FB7A 4M78A 2O4XA 2NWMA 1SRLA 1VQ4Q 2FPDA 1RABB 2LNVA 3G71A 2OTLA 4FL6A 1VYTA 1CKBA 4M78B 3CEYA 5GAN8 2O4XB 2L2PA 3THKA 4F7UF 5GMKh 3JCMP 2CGHA 2KK4A 2DPPB 4M7AE 4M7AA 3V7SA 1KQSP 1WX6A 2DD5A 2EKHA 1MMAA 2QXFA 4M7AB 3JCMb 1UGPB 2CUDA 5DLOA 5DY9A 2IPOB 2RHZA 4J7IA 4C5GA 1VQ6A 2WSFE 3PT9A 5IHNA 2DJQA 3EGUA 1BK2A 3CCVQ 1GCPA 3FDRA 1Q82C 1YIJA 4BD3A 3LH5A 1VQNT 4C92G 1ZSZC 4XK8E 3CPWP 3PTAA 1K73U 1NZ9A 3META 3CCST 1GCQA 3MEAA 2L3PA 2LP5A 1KQSA 1BIBA 3A1PA 3I56A 2VXFA 1YJ9Q 1UJ0A 2ZCFB 1UE9A 2P4RA 3UA7A 1UGRB 3JCMQ 3FB9A 1YCYA 2XK0A 1VIEA 2AHJB 2JNGA 3PVQA 1O9SA 2CSIA 5KE2A 3QXEB 4PK4A 3RERA 4ELYC 2PUKB 2QA4Q 4LDVA 2EYZA 1VQ9A 3MP8A 1NYFA 2OJ2A 4IUVA 5LJ3f 3HTRA 4C8QD 4MDWA 3JCMh 1H641 3C4SA 3CCUT 1C6VX 2X3XD 2MOXA 1VQ5A 3M57A 1UEBA 4XTZA 2YLCA 2QEXQ 4AFZC 3IQLA 3SEMA 5GAN3 1M3BA 5LJ5j 3H41A 3INZA 5KCOA 3VUZA 5LJ5d 3JB9J 5GAMe 2QQSA 4C0DB 1YJNT 4IKFA 3LH0A 3C0CA 2XICA 2K9GA 3UA6A 1RACB 1H8KA 2RPNA 2EGCA 1E7OA 1AWXA 1TXQA 1C0MA 1S72Q 2O9SA 2NLUA 2FZKB 4LNPA 5IT9E 1Q86R 1UHFA 1MHNA 3CPFA 3LGLA 4OB1B 1Q7YR 2QGGA 5GAN2 3OS2A 3QYGB 1PC0A 2GNCA 1EZZB 5A2QE 2XDDA 1P92A 3EH1A 4BE2A 1PKTA 4ELZC 4OGEA 1OYXA 1QVGP 2KYBA 3QWXX 3E2UA 2P4TA 1FXXA 4AFQC 4BE1A 3X20B 4QW2A 3CCMT 4KGXB 1WI7A 4HKEA 1M1KU 1VQPA 4RTUA 4RCCA 2PVGB 1WJSA 1YITA 2DIQA 4LUEA 3P8HA 4J5YA 2DE0X 1YI2A 1G3WA 2VC8A 2CP7A 3CC7A 2A08A 3NGPA 2IIMA 3FJPA 4C92F 2KMTA 4GLKA 4KT0E 4JRIA 4BE0A 2DF6A 1RAEB 2KVQG 4N0AA 4BACA 3SWNC 2JJ9A 2XU8A 3E9GA 5GAMj 1MV3A 2X4XA 3A5ZB 4OMQA 5CCAA 2EYYA 2VVKA 1WZOA 3A8GB 4WF2A 5GAMd 3CCQT 3V8KA 2BZYA 3L2RA 1JJ2P 3TVTA 1VQOA 1NYGA 2FL7A 4M77D 2FG0A 4XTWA 1VQMA 1M90C 2ZPGB 1JRIA 2COYA 4FT4A 2KYMA 2EVRA 5LJ5g 1TUGB 2GGRA 3EH2A 4LDWA 1DJ7B 2CZ1B 1AVZC 4A4EA 2F2WA 1V1CA 2K79A 4E7KA 4M7DD 2DL8A 2O88A 5FW9A 2YLBA 1X2KA 3JCMe 4D8DA 2DEUA 1ABQA 2D6FA 4ATOA 2V1QA 2DILA 4LD9K 2KT1A 4PJJA 3HP9A 4OB0B 3BW1A 1ZUUA 1TOVA 3EG0A 4J7FA 4OMLA 2DKGA 2QASA 2W0ZA 1QMCA 2BUDA 2R5AA 2FRYA 3OYHA 2KQWA 1QVFP 2OTLT 3X25B 1K0XA 1U1TA 2HBWA 3FIFA 3MCAB 2YDLA 2LRQA 3HKSA 5GAOn 5GMKl 2A7YA 3CC2T 2RK2A 3C12A 1T3LA 4IUTA 4OGCA 2AK5A 4VUBA 1OX9A 4L59A 1YHQT 4JJDA 1UDLA 2QAZA 1WFWA 1QLYA 3VS3A 1WHMA 1PCXA 1VQ8A 4V2SA 4IUUA 1RLPC 1SRMA 2RK1A 3SDZA 1QVFA 2COWA 5GAMg 1KD1R 5AT1B 3RKWA 4JZ3A 4PNOA 1JXMA 1H3HA 2LQNA 1K8AU 1CKAA 1YIJT 1K0SA 1I4K1 4PJLA 4X9DA 2CYZB 3CCRQ 1BI0A 3JB9D 4F14A 1WLPB 2E65A 1NM7A 2CZ6B 3L1AA 1ZHIA 2R58A 9ATCB 4M75G 2NUTA 3OYIA 2L89A 2YUNA 3REAB 4KULA 1AD5A 1OU8A 4M78D 3V7CA 2DETA 2JTEA 2COZA 2J7IA 3RKYA 4EMKC 2X3WD 2NUTB 2KR3A 4GLMA 3C94A 1EX4A 4Y91A 2C0OA 3CCLT 4OF1A 1K73C 3H0IA 1NPRA 2X4JA 1QWFA 2GBQA 4J9BA 3OYJA 2P84A 4M7AD 2ZAEA 3M0TA 1OEBA 2CT3A 5CO7A 3LYIA 2HL5C 2L8DA 2EYQA 3H6ZA 4HCKA 3L2VA 1T3SA 5GAN6 1K9MR 4J83A 4J9GA 1TUDA 4X34A 3A8LB 2OTJT 4PJOE 4PJOA 3LWHA 2O2OA 4XU0A 3RMQA 2JMAA 1N8RR 1QW1A 1WJQA 2KDSA 4RTZA 4C5HA 3GOXA 3ZFJA 2RQTA 2F5KA 4PJOB 1AOJA 2K5FA 4ME7A 3DKMA 3JV3A 1OI1A 3M56A 2DM1A 2HBPA 1VQNQ 2A0FB 2J05A 2E3HA 1RAIB 4OVAA 3CCSQ 2RJDA 5GAOl 2VV5A 2EIFA 3PE0A 3KXTA 3JCMf 2DX1A 1UHCA 3P8BB 3E1SA 2CP2A 1QWEA 5FLXE 2MK5A 3CXCP 4HVUA 2HZYA 3RMSA 4KGZB 3VS5A 4JLIA 2MYSA 4XTUA 2RB6A 1GFCA 3OS5A 2GF7A 4JJNK 5CK9A 5I21A 2C0TA 1WA7A 1X75C 1M30A 3I55A 1D0YA 3L2ZA 3PFSA 4J9EA 4FYWB 1YJWT 1W2BP 3UF4A 1MV0B 3CCUQ 2FO0A 3OYDA 1MMGA 1BCOA 2CZ0B 3M59A 1LNXA 4BDZA 4PFZA 3E19A 3TEEA 2E3IA 2DLPA 1QKWA 3HHTB 1R77A 1Q81C 4M75F 5LJ5h 2QYZA 4JDSA 1X6OA 2PZ1A 1IREB 2OAWA 1YFNA 3EHRA 4RTYA 2HKQB 1YJNQ 1TTHB 2EQJA 4JRKA 5EG2A 2EJFA 5J39A 1B07A 2CDTA 4R55A 1LOJA 3PGGA 4EMHA 4A4HA 1Y07A 4LD6A 1W2BA 4BUGA 3OS0A 3CMAA 4HXJA 2L0AA 3EGDA 5L23A 2LTOA 1OU9A 2YRVA 2YSQA 3S3MA 3EGDB 2K57A 1RLQC 3CMET 3UWNA 5HY6A 1OPLA 1SF9A 2EQIA 5CVIA 2DL5A 2KGTA 4TVRA 4FU6A 3M58A 5D6WA 3CCMQ 2DO3A 4N4IA 3PIOA 2FZGB 3ZEHA 4BB7A 5KYNA 2R5MA 3QIIA 3OYCA 1NJIR 1I5LA 5IN1A 4M75C 3CCJT 3CD6A 1B7TA 1VIFA 4A4GA 1W2BS 4HA8A 2GFUA 3HRSA 1W4SA 1PSFA 2RA2A 1KFZA 3JCMV 1M8MA 3PMIA 1KK7A 5C6SA 2LMJA 1WGSA 4LUDA 5CKDA 5GAMh 3OMGA 3CCQQ 1V29B 1KC8R 3M4YA 3I9QA 1VQKT 3X26B 1EFNA 2K3YA 2F2XA 4DOVA 2JTFA 2NUPA 4PKCC 2K4YA 2GTJA 2RMOA 2EW3A 1N9RA 4E7ZA 2DXTA 4LE9A 4AG2C 1ZSGA 1Y71A 3FC3A 3Q1JA 2RI3A 4Z89A 1FX7A 2QQAA 3G1JA 2FYKA 2NUPB 3JB9H 4IIMA 4NS5A 2BZXA 2BKDN 2QI2A 4IURA 1OQKA 2DEQA 3O8VA 5I2MA 3OBYA 3VU3C 2V8IA 2K5IA 3M54A 4PJNA 1PD1A 2CP0A 2FEIA 2PTKA 3TQ7P 4HCZA 4HT9A 2YWWA 1I07A 1M1FA 3CCVA 4AFSC 1M1KR 4DBFA 2XMFA 2K3XA 5LJ5e 4BDYA 3CQTA 3JB9I 2XG8D 1K8AC 2IVWA 2W10A 2FPEA 4QVZA 1FYNA 2QQBA 2OTLQ 2YHTA 3RNJA 2BE7D 4J9FA 4C0GA 1YJ9A 5GAOq 2VUBA 3CC2Q 1K76A 1WHJA 2ZPEB 3OYKA 1X43A 2A36A 5GAN5 2ZPFB 2K5LA 2FRWA 4ZN3A 3R6OA 3CCET 2K2MA 4II1A 3QJYA 1LCKA 1YHQQ 3OYNA 1NPPA 1D1CA 2QA4A 1ZSZA 3VS7A 2YXYA 4E7HA 3OW2P 1QP2A 1YBYA 3RBBB 3G6ET 2DL3A 2JVVA 5LL6S 3ME9A 2JTMA 3VKIA 1Y7XA 1IGUA 4KUIA 1ZSZB 3MEVA 3GPLA 4N4HA 4F7UE 4F7UA 2YT6A 1HYOA 4J6YA 4X1VA 2FVUA 1UJYA 4E7SA 3PMTA 2F69A 1OX8A 4F7UB 4BI8B 1YIJQ 2IG0A 3CPWA 3NTIA 3NPFA 2AKKA 1IO6A 1IHVA 4C0FA 2JW4A 1KQSS 4J8OA 2DAQA 3GNFB 3QZ9B 1VQ7T 3OYGA 1XTDA 5GAN7 2RJCA 4E7LA 5GANj 2E4HA 1S72A 4QVCA 4C0DC 3VYGA 1SPKA 3VRZA 5GANd 3CCLQ 2XHCA 3V7RA 1SG5A 2LNHB 2QTXA 3CC4T 2JN0A 4C8QG 1M4ZA 4J9DA 1VYVA 1GFDA 1KHCA 2MCNA 4MMKA 2BIVA 1X69A 1M1GA 3UATA 1IXDA 1ARKA 3CPWS 3OY9A 4PJOD 2OTJQ 1XNIA 4KH1B 1UFFA 2RHXA 1VQLT 1RUWA 5FWCA 3V8LA 2CP5A 1Q81U 5GMKi 4R0KA 3QSUA 2HQEA 1D0ZA 3J81E 2LZ6B 3ASKA 1OULA 2E1HA 3AHUA 3I5RA 3ZBDA 3EFRA 1NEGA 2ZGWA 2JOYA 2DTIA 1IHWA 4JLGA 1FWZA 1V76A 3JAME 1Q82R 2JZ2A 1PSEA 2DZCA 3JCMJ 3MO8A 3G4ST 3OS1A 1QVGA 2RO0A 5CQXA 1QCOA 1UB4A 2RHUA 2HDAA 1AZGB 2QDYB 4N0AC 4ZGJB 2LCLA 1FMWA 1Z9QA 1X01A 2HKNA 3SWNA 4IUPA 2KRNA 2A37A 5FU6C 5LJ5f 3M0UA 2KSSA 3A8OB 4ZGDB 1ABOA 3TSZA 4OMPA 4R56A 1RAHB 4XU1A 1ZBJA 3SWNB 2H8HA 1QP3A 3S3NA 1YJWQ 4CC7A 5GANg 3F70A 5HCKA 3ZL7C 1JU5C 5FROA 4HCCA 1FMKA 3QKJA 2JM9A 4CC3A 3BFMA 4RG8A 3M53A 2VASA 3SFMA 8AT1B 1N9SA 4B9WA 1OOTA 1B34A 2AT1B 2OX7A 4O6JA 1QVGS 1U3OA 2M1HA 5HK0A 1JBMA 1JJ2A 4M77G 1BI3A 3HFOA 4BI4A 2L3QA 1B34B 3QUIA 4P5NA 2LCCA 2RJFA 4D8KA 3JCMX 5GAN4 1ZUKA 4X9CA 3J7AF 5A0DA 3G71T 4C92E 4C92A 3OYMA 4C8QF 4DBRA 3FRNA 1PM3A 2LJ3A 4ANJA 4M7DG 2LT4A 4C5EA 4C92B 2C0IA 2XKOC 1F1BB 4FM4B 1WPYA 2BTTA 2KRSA 3CMEQ 3M55A 2E10A 1WHLA 2J06A 2KAFA 3RDVA 1KG1A 4Y92A 2QG9B 3MEUA 1D1AA 2ENMA 3GBQA 3NTHA 1AEYA 4FIBA 2J6OA 2MAMA 5GAMf 2EFIA 4XTYA 1JJ2S 1UGQB 4XTXA 1I81A 1M27C 3CCJQ 1JO8A 1Q7YU 1VQ6T 2MWOA 4ZN1A 2DJZA 3M0RA 4LDXA 2Y4YA 1D1BA 1NLOC 3UPUA 4JRPA 3LLRA 2VGMA 2PVOB 4C8QC 3I56T 1G3TA 2LC4A 4FYVB 4AT1B 4JJCA 1Y0MA 5FU7B 4FW2A 2XDPA 1W70A 1VQKQ 1NBEB 3G7ZA 1U8RA 5GAOm 2Y4XA 1M2VA 2KY9A 4BY6B 5D6YA 4XU3A 4KRTA 4EMKA 1M90R 4Z88A 1M2VB 2HQXA 1VQ9T 1QVFS 1WXUA 4A63B 2RQWA 2CP6A 2HSEB 5D7UA 1O75A 1QVPA 1GXIE 1CSKA 2MF2A 4DBHA 3JB9G 4EMKB 1HJDA 1VQ5T 3MJXA 1MNEA 1UUEA 1D3BA 1HXDA 2CUBA 1OZ2A 3KUFA 3WVDB 2E5QA 3VS4A 2GCXA 4M78G 1RI9A 1GL5A 1M5Q1 3QJ6A 1D3BB 5L8RE 4J6WA 4M77F 1VQNA 1QQJA 5CKFA 2HEQA 3OYFA 3M4GA 3EG9A 3CCSA 3MP6A 4E7JA 2DL7A 1MNDA 1C1AA 5I11A 3QPHA 3EG9B 3LWIA 2KXCA 4YTLA 2GTOA 2EWNA 4NOYA 5GAOr 4MMLA 4CC2A 4M7DF 5KH6A 2HNIA 4M7AG 2RH2A 5J3BA 4JS5A 3CCEQ 1PRLC 4J9HA 3GLXA 2ED1A 5IHKA 2O9VA 3OBWA 1MMDA 2X9HA 2LVMA 3G6EQ 1RI0A 4RTVA 3CCUA 5KCHA 1OPKA 4CRIA 1WHKA 3GP8A 2OI3A 2WSEE 1VQPT 3OMCA 2O01E 5FRMA 3GIBA 1KSWA 1LJOA 1PWTA 3URGA 1YITT 4ZGEB 2GFAA 2HAXA 1YI2T 4M77C 3CC7T 1X2QA 2LX7A 1YJNA 3SB2A 3QDRB 1IZ6A 2ED0A 4E7IA 1G5VA 4Z02A 4CI0C 1BI2A 2MPXC 1JQQA 3CXCA 2CH4W 1VQ7Q 1WIEA 4M7DC 1GBRA 2CP3A 3RKXA 1KD1U 2DNUA 5GANh 2RNAA 1VQOT 3CC4Q 1VQMT 1Z9ZA 1TS9A 3OB9A 2M0YA 2DBKA 1PKSA 3QZ5B 2EYWA 4F16A 3WVEB 4O5VA 3JCMc 4PLLA 1K73R 1X6BA 3CCMA 3QDFA 2RQRA 3JB9F 2EQMA 2B8AA 2K7AA 1SHFA 2B86A 2J6FA 3M0QA 2ROTA 2ZPHB 4ZTJA 2KXDA 1BU1A 2Z0WA 4M78F 2C06A 3MHXA 1ZX6A 8ATCB 1VQLQ 3CXCS 1KQ1A 1T0HA 2VB6A 4LN2A 4JUVA 1BIAA 2HMAA 2VXEA 3NHNA 1BKBA 4HVWA 2LCSA 2LJ1A 1YN8A 4LXCA 1U06A 3MEWA 2CREA 2DXBA 3PNWC 3EHQA 2H3JA 1AHJB 2EQUA 2A28A 4M7AF 3CCQA 1K9MU 5GJWB 1KJWA 4M75E 4M75A 5IXBA 1BI1A 3AT1B 5KYXA 3G4SQ 4IUQA 1VQ4A 1GBQA 4Q5WA 2QDLA 3TCJA 1N8RU 4DOWA 2FZCB 4M75B 1BCMA 1WDXA 5KYXB 5GJVB 3DLMA 1VQ8T 5CAIA 2PVDB 2V1RA 5KE3A 1NLPC 3PIPA 3OYAA 1HD3A 1LPLA 2DIGA 1UG1A 1U1SA 1AT1B 5M9OA 1H92A 4M78C 3MP1A 1TG0A 4JS4A 2WACA 3LGFA 4KGVB 3A8HB 5CKEA 2EQKA 2QQ9A 1M9SA 1KIKA 2DBMA 1X6GA 2VYTA 1XQHA 5LJ3j 1E6HA 4QT7A 1W6XA 4FSXA 2M0OA 3JSCA 2DVJA 5GAOp 5LJ3d 3L2UA 4MDXA 1VA7A 2PUOB 1Q86C 1YCSB 2KBTA 4IIOA 3CC2A 4C5IA 4M7AC 2CKKA 3DB3A 3EG3A 1JXOA 1Q7YC 1Q81R 3TSWA 2L3SA 1WYXA 5CQYA 2YUQA 5GANe 4ZTFA 1ZBXA 2RQVA 4C92D 2HL3A 1M3AA 3G71Q 1YHQA 1RAGB 2E41A 3VUBA 2G3RA 1I5OB 2M02A 2HQHA 4FCYA 1AWOA 1G83A 1MUZA 5CR2A 5AYFA 2EYXA 3SD4A 2D8JA 4E47A 1GRIA 2I0NA 4JPBW 4ESRA 4NL2A 4QKUA 3C95A 4MZMA 4DEXA 1VYUA 4E2FB 2HCKA 4FYXB 1XJWB 1I0CA 3JRZA 3OA6A 1GCQC 2XDBA 4PLIA 2G6FX 2EKOA 4A53A 3EG2A 1R0CB 2QEXA 4NL3A 2M9UA 1VQ6Q 2JMCA 4OMOA 4E6RA 3REBB 2RQUA 3BDLA 1JB0E 2NUZA 4FSSA 2D0QB 1JEGA 5FWBA 3CBOA 3EFOA 4QQDA 2ECZA 4QVDA 3CCLA 2JT4A 1TSFA 2L5QA 2RM4A 3I56Q 2H3EB 1BBZA 3EFOB 3OW2A 1X27A 1BYMA 4F04B 3RESA 1NJIU 1H3ZA 1W1FA 3EGXA 1R0BG 1WHHA 2RHYA 2A3LA 3E9FA 5LJ3g 2JS2A 3QBYA 3ER0A 3J80E 3EGXB 5I22A 2JM8A 3CBPA 4KUDK 2DXUA 1VQ9Q 2RD1A 1HK9A 2KEAA 3I55T 2DVEA 2E6ZA 4EDUA 2OTJA 2BZ8A 2DK3A 2CZ7B 1N27A 1VQ5Q 3VJPA 4OB2B 1KC8U 2XD0A 3X28B 1NEBA 4PL6A 4OB3B 2D0NA 2NYSA 4JJBA 1TUCA 2SEMA 3OYBA 2YRDA 1ZQ1A 3CBMA 5CIUA 3OW2S 2LDMA 2HD0A 4A4FA 1WNLA 2EAYA 4PFOA 3EG1A 4J9IA 4RTTA 1YWPA 4N4GA 2V8KA 2L3RA 5GMKe 4FW1A 3DB4A 1WHGA 3O5ZA 1IGQA 1WQ7A 1K8AR 3GF5A 2KROA 3CMAT 4HVVA 1SEMA 4CC4B 5KYWA 2VGNA 2QK0A 1KQ2A 1KD1C 2I2LA 1PD0A 1BB9A 2CT4A 2KRMA 4Z8AA 5KYWB 4PJOG 2E64A 4EIKA 4DBQA 2X4WA 1KHIA 3LX7A 1YJWA 1D09B 5GMKm 4OMMA 3R6NA 7AT1B 3A98A 2LQWA 1IB8A 1YNZA 2PQWA 1ZA2B 4RMOA 1VQPQ 2EJ9A 5IAYA 5GANf 1HSQA 1YITQ 2DTHA 2DZ9A 2HSPA 1RAAB 3QO3A 3BE3A 2GQVA 1YI2Q 2K2VA 3CD6T 3CC7Q 4RKUE 1RL2A 2LT1A 5IH2A 3HL8A 3VS2A 4QQ6A 5FU6B 3L2WA 1QKXA 3UDCA 1PNJA 4RTWA 1SKUB 1VQ4T 3JCMW 2AKLA 5GMKj 1AWWA 4XQ3A 4EPCA 3KFVA 1VQOQ 3TREA 1VQMQ 4XU2A 3VRYA 1K9MC 3CMEA 2YRCA 3V8JA 2EJGA 2VWFA 4RCBA 1N8RC 2PNIA 2CSQA 4C92C 1VUBA 2DRMA 3KBGA 4BI3A 4L5GA 2FPFA 2DD4A 2X4YA 1G2BA 2E6NA 1RADB 2X35A 2KNBB 1TU0B 1I8FA 2AZSA 3OSSC 3CCJA 1B3QA 3X24B 1WXTA 4AMCA 2CH4A 5IHIA 3CCVT 2K3BA 3N5BB 3I35A 4B6MA 4J6XA 4XTVA 5FRNA 3CCRA 2MI6A 3RR6A 3OYYA 3MKDA 5D6XA 1Q86U 1AZEA 2ZPIB 2DYIA 1PG5B 2E70A 3QHSA 2F5TX 2MIOA 1YJ9T 1M2OA 2ESWA 4M75D 1VQKA 2AIRB 4RUGA 2LQKA 3GNGA 2P0QA 2P0KA 3RUXA 2VKNA 4MZPA 2ATCB 1S1NA 1XOVA 3MPUB 4B9XA 4PJOF 2LQ8A 2K6DA 3A8MB 4FT2A 2DFUA 1PRMC 2QA4T 2WSCE 3U23A 2F2VA 5FU7C 5EC7A 2RJEA 4KBMB 1VQ8Q 5A0GA 4C8QE 4C8QA 3M0PA 3JCMd 2BE9B 1TWBA 4BY6C 1Q82U 3NTKA 2OAUA 4OMNA 2QEXT 4A4KA 1G8XA 2QQRA 2AZVA 2YUOA 1TH7A 2JXBA 4C8QB 3S3OA 4EMGA 5A0LA 1UGSB 2DL4A 1FMVA 2PU9B 3S6WA 2DMOA 2R57A 4DEYA 3D7SB 2DXCA 2ZPBB 2MMPA 2XIDA 2GQIA 1U5SA 3QG1A 5LJ3h 3EFSA 3P8DA 3VS6A 3BY7A 1WXBA 2F1LA 1WJRA 3NFCA 3H0FA 1E6GA 4LDYA 5CKBA 4OP0A 1S72T 6AT1B 1AWJA 3VS1A 3CCEA 2D8HA 4WTOB 2DTOA 2V26A 1J3TA 4PJOC 2RI5A 2YUPA 2LX9A 1G3SA 3FJ5A 3OYLA 2KE9A 3HSBA 1K9AA 5HKCA 3G6EA 2EBPA 1QCNA 1UGVA 4GY5A 1EIFA 3DLLA 1NJIC 1A0NB 3H0HA 4OMFB 4DQ2A 2SRCA 1SSHA 3OYEA 3OQ5A 1SSFA 4HCBA 4AG1C 3L42A 2QTVA 1LVKA 1NE8A 1Y57A 2DA9A 5IXFA 4JZ4A 2V8JA 5HK3A
chains in the Genus database with same CATH topology
3CC4T 4Y28E 2JN0A 3FIFA 3MCAB 5KE3A 2LRQA 3HKSA 5GAOn 5GMKl 3PIPA 2DIGA 3OYAA 4C8QG 2A7YA 3CC2T 1U1SA 1M4ZA 2RK2A 3C12A 5M9OA 4IUTA 1KHCA 4OGCA 4M78C 3MP1A 4MMKA 2BIVA 4JS4A 2WACA 1M1GA 4VUBA 3LGFA 3A8HB 5I2SA 5CKEA 3EAEA 4L59A 1KC8C 2QQ9A 2EQKA 3JCMg 1M9SA 1VQ7A 3CPWS 1YHQT 3H8ZA 2VYTA 4MZTA 3SB2A 1XQHA 4UC4A 4QQGA 5LJ3j 3OY9A 4FSXA 2M0OA 4PJOD 3JSCA 1XNIA 1VQ8A 5GAOp 2RHXA 4IUUA 5LJ3d 3VV0A 3CC4A 4V2SA 4M77E 3L2UA 4M77A 1VQ8T 2RK1A 4MDXA 1VQLT 1Q86C 2PUOB 3V8LA 3CC2A 4M7AC 4C5IA 2CKKA 4A54A 3SDZA 3DB3A 1QVFA 1Q7YC 3RIRA 1Q81U 5GAMg 5GMKi 1Y96A 3VYHB 4F7UG 3QSUA 2HQEA 3J81E 5CQYA 4M77B 5CKHA 3ASKA 3FLGA 3M9QA 3RKWA 4PNOA 2E1HA 5GANe 3AHUA 3ZBDA 4ZTFA 1ZBXA 4DA4A 4C92D 2D9TA 3EFRA 1K8AU 2JUFA 3WXMB 1YHQA 2ZGWA 1YIJT 2JOYA 2DTIA 4M7DE 4M7DA 1I4K1 1Y96B 2E41A 4JLGA 4X9DA 1FWZA 2CS7A 2CYZB 2G3RA 3VUBA 2RHIA 1G3YA 3JAME 1BI0A 4C0ZA 3JB9D 1M1KC 2E65A 2JZ2A 3LW5E 5CR2A 2CZ6B 3HPWA 5AYFA 3L1AA 3QYHB 3SD4A 1PSEA 1ZHIA 2DZCA 2R58A 4E47A 4M7DB 1VQLA 3HRTA 4M75G 3OYIA 4NL2A 3JCMJ 2L89A 3MO8A 2P0PA 5DM7R 3OS1A 3G4ST 3C95A 1QVGA 4MZMA 2RO0A 3BDUA 4KULA 4M78D 3V7CA 5CQXA 3RKYA 2RHUA 1UB4A 4EMKC 2QDYB 4N0AC 4ZGJB 3JRZA 3OA6A 2LCLA 1X01A 3SWNA 2XDBA 1N6AA 5J26A 4IUPA 3C94A 5FU6C 4Y91A 5LJ5f 3CCLT 4ZGDB 2KSSA 3A8OB 2RI2A 5LJ3e 4PLIA 4OF1A 1K73C 2EKOA 4A53A 4R56A 1M90U 4XU1A 1NPRA 2X4JA 3SWNB 4JRQA 1QP3A 2QEXA 4NL3A 2M9UA 3S3NA 5GANg 3F70A 3FEOA 3OYJA 5FROA 4M7AD 3G4SA 4HCCA 3QKJA 5CO7A 3OSVA 3LYIA 3BFMA 3BDLA 3M53A 4RG8A 1JB0E 2Y90A 3T9NA 2D0QB 3SFMA 3CBOA 2L8DA 2EYQA 1N9SA 2MWPA 3H6ZA 4QQDA 3HFNA 4B9WA 3L2VA 5GAN6 4QVDA 4J83A 2E12A 4X34A 3CCLA 3TU4K 1B34A 3A8LB 3HRUA 2OTJT 4PJOE 2L5QA 4PJOA 3LWHA 2RM4A 4O6JA 3OW2A 4XU0A 2M16A 1QVGS 2M1HA 1OZ3A 5HK0A 1JBMA 1BYMA 1JJ2A 3RMQA 4M77G 3RESA 1NJIU 1H3ZA 1BI3A 3HFOA 4HT8A 4BI4A 1QW1A 1WJQA 2KDSA 1B34B 3QUIA 4C5HA 3GOXA 4P5NA 3ZFJA 2LCCA 2RJFA 3UT1A 2RHYA 2F5KA 3JCMX 5GAN4 2K5FA 4PJOB 2A3LA 3E9FA 1YJNA 5LJ3g 3QBYA 4ME7A 4X9CA 3DKMA 4D6WA 3ER0A 3L2QA 1OI1A 3M56A 3J7AF 3M5AA 1M8VA 5A0DA 3G71T 5DLQE 4C92E 2XI9A 4C92A 3J80E 5C0MA 3OYMA 2ZZDA 4C8QF 3FRNA 2HBPA 4KUDK 3CBPA 4OVAA 2DXUA 3CCRT 2RD1A 4M7DG 1HK9A 2FHDA 2LT4A 2RJDA 5GAOl 2VV5A 2EIFA 4C5EA 3KXTA 3I55T 2DVEA 2E6ZA 3JCMf 4EDUA 4RG2A 2OTJA 1MGQA 4C92B 2DK3A 2XKOC 4XAXB 4FM4B 1WPYA 2CZ7B 1N27A 3P8BB 4L6V5 3E1SA 4LDUA 3VJPA 5FLXE 1WQWA 3M55A 4OB2B 1KC8U 2XD0A 1R8OB 2E10A 3X28B 4M78E 2KAFA 2FB7A 4M78A 4OB3B 4PL6A 3RMSA 1KG1A 2O4XA 3MEUA 4JLIA 4XTUA 3NTHA 2RB6A 2LNVA 3OYBA 3G71A 4FIBA 3OS5A 2GF7A 2OTLA 4JJNK 3CBMA 1ZQ1A 2MAMA 4FL6A 5CIUA 5CK9A 3OW2S 5GAMf 2LDMA 2EFIA 2HD0A 4M78B 4XTYA 4A4FA 5I21A 3CEYA 1WNLA 5GAN8 2O4XB 2EAYA 1JJ2S 1X75C 4F7UF 4N4GA 3I55A 2V8KA 1UGQB 4XTXA 5GMKh 3L2ZA 1I81A 2L3RA 3PFSA 5GMKe 3JCMP 1YJWT 2CGHA 2KK4A 3DB4A 1Q7YU 2DPPB 1VQ6T 3OYDA 2MWOA 4ZN1A 2CZ0B 1WQ7A 2DJZA 3M59A 4M7AE 4M7AA 3GF5A 1LNXA 3V7SA 4BDZA 4LDXA 3CMAT 3E19A 3TEEA 2Y4YA 2DD5A 2VGNA 3HHTB 2QXFA 3DLMA 1KQ2A 3UPUA 1Q81C 4M7AB 3JCMb 1UGPB 4M75F 1KD1C 2I2LA 5LJ5h 4JRPA 3LLRA 5DLOA 4JDSA 1X6OA 2VGMA 2PVOB 4C8QC 1IREB 3I56T 1G3TA 2LC4A 5DY9A 4PJOG 2E64A 5FU7B 2RHZA 2XDPA 2X4WA 1KHIA 3G7ZA 1U8RA 3LX7A 1YJWA 4J7IA 2EQJA 5GMKm 4JRKA 5EG2A 4C5GA 2WSFE 5GAOm 1VQ6A 2Y4XA 2EJFA 3PT9A 5J39A 4R55A 1LOJA 2KY9A 3PGGA 1Q82C 3FDRA 4EMHA 4A4HA 1Y07A 4LD6A 4BY6B 1YIJA 4BD3A 1W2BA 4BUGA 2PQWA 3OS0A 3CMAA 4RMOA 2EJ9A 5D6YA 4XU3A 4EMKA 2LTOA 5IAYA 5GANf 4C92G 4XK8E 1VQNT 3PTAA 1K73U 1QVFS 2HQXA 1NZ9A 2YRVA 3META 3CCST 2DTHA 2DZ9A 1VQ9T 3MEAA 3QO3A 1KQSA 1BIBA 3S3MA 1O75A 1QVPA 2GQVA 1GXIE 2K2VA 2MF2A 3I56A 3JB9G 3CD6T 2VXFA 4EMKB 4RKUE 1RL2A 2LT1A 2ZCFB 1VQ5T 2K57A 3HL8A 3CMET 1D3BA 1HXDA 4QQ6A 1UGRB 3JCMQ 1OZ2A 3KUFA 5FU6B 3UWNA 3FB9A 3UDCA 3WVDB 3L2WA 2E5QA 1YCYA 5HY6A 5CVIA 2XK0A 4TVRA 2GCXA 4M78G 1VIEA 4FU6A 3M58A 5D6WA 2AHJB 2JNGA 2DO3A 1VQ4T 1O9SA 1M5Q1 3QJ6A 4N4IA 1D3BB 5L8RE 4J6WA 3PIOA 5KE2A 3QXEB 3ZEHA 4BB7A 3JCMW 3RERA 4M77F 2PUKB 2R5MA 4ELYC 1VQNA 3QIIA 5GMKj 4LDVA 5CKFA 1VQ9A 3MP8A 3OYCA 3M4GA 4IUVA 4XQ3A 3OYFA 3MP6A 3CCSA 1I5LA 5LJ3f 4EPCA 4E7JA 5IN1A 4M75C 4MDWA 3TREA 4C8QD 3JCMh 3CCJT 1H641 3C4SA 4XU2A 3CCUT 3CD6A 1VIFA 1VQ5A 1K9MC 4A4GA 3M57A 1UEBA 3QPHA 4XTZA 3LWIA 3CMEA 4HA8A 4NOYA 2EWNA 2EJGA 4YTLA 3V8JA 4MMLA 5GAOr 4M7DF 2YLCA 5KH6A 2GFUA 2HNIA 4M7AG 2RH2A 3HRSA 4RCBA 5GAN3 1W4SA 5J3BA 4JS5A 1PSFA 2RA2A 5LJ5j 3JCMV 1N8RC 3PMIA 3GLXA 5C6SA 4C92C 3INZA 1VUBA 1WGSA 5KCOA 3KBGA 4BI3A 3VUZA 5LJ5d 4L5GA 5CKDA 2DD4A 2X4YA 5GAMh 3JB9J 5GAMe 3OBWA 3OMGA 2QQSA 4C0DB 2E6NA 2X35A 2LVMA 1V29B 1RI0A 3M4YA 1YJNT 4IKFA 1VQKT 3X26B 3LH0A 1I8FA 3OSSC 2XICA 3CCJA 3CCUA 3X24B 5KCHA 2K3YA 4CRIA 4DOVA 3CCVT 2JTFA 4PKCC 3N5BB 2K4YA 1N9RA 3GP8A 2DXTA 2WSEE 4J6XA 4XTVA 3OMCA 2O01E 1VQPT 5FRNA 5FRMA 3GIBA 1Y71A 2NLUA 3FC3A 2MI6A 1LJOA 3Q1JA 2RI3A 3CCRA 1FX7A 2QQAA 3OYYA 5D6XA 5IT9E 3URGA 1YITT 2FYKA 1Q86U 4ZGEB 2GFAA 1MHNA 3CPFA 3LGLA 4OB1B 2ZPIB 2HAXA 3JB9H 5GAN2 3OS2A 2E70A 1YI2T 3QHSA 4M77C 4NS5A 2BKDN 2F5TX 3QYGB 3CC7T 1YJ9T 5A2QE 2QI2A 1P92A 2XDDA 4IURA 4BE2A 2DEQA 3O8VA 5I2MA 3QDRB 3OBYA 4M75D 1IZ6A 2V8IA 1OYXA 2K5IA 3M54A 4OGEA 3VU3C 4ELZC 1VQKA 2P4TA 4E7IA 1G5VA 2LQKA 4HCZA 3GNGA 2P0QA 4HT9A 4Z02A 1FXXA 2P0KA 3RUXA 4CI0C 1M1FA 1BI2A 4BE1A 3X20B 4MZPA 3CCVA 4QW2A 3CCMT 1XOVA 3CXCA 1W2BS 4B9XA 4HKEA 4PJOF 2LQ8A 1M1KU 1VQPA 2K3XA 3A8MB 4FT2A 3RKXA 5LJ5e 4BDYA 1KD1U 4M7DC 2QA4T 2WSCE 4RCCA 3JB9I 2XG8D 2PVGB 5GANh 1K8AC 1WJSA 5FU7C 2DIQA 2RJEA 3P8HA 2IVWA 1YITA 4J5YA 4QVZA 2QQBA 4KBMB 1VQOT 2YHTA 5A0GA 1YI2A 1G3WA 2VC8A 1VQMT 4C8QE 3CC7A 4C8QA 3OB9A 4C0GA 3JCMd 1YJ9A 5GAOq 2VUBA 3QZ5B 3FJPA 4BY6C 2KMTA 4C92F 3NTKA 4GLKA 2OAUA 2ZPEB 3OYKA 1Q82U 4KT0E 3WVEB 4JRIA 4O5VA 4A4KA 5GAN5 2QEXT 2QQRA 2ZPFB 4BE0A 2K5LA 3JCMc 1TH7A 4PLLA 2KVQG 4N0AA 4C8QB 3S3OA 4ZN3A 4BACA 3CCMA 3R6OA 3SWNC 3CCET 4II1A 3JB9F 4EMGA 5A0LA 3QJYA 2XU8A 1UGSB 3E9GA 2PU9B 2EQMA 2B8AA 3S6WA 5GAMj 3OYNA 1NPPA 2QA4A 2X4XA 3A5ZB 2ZPHB 2R57A 5CCAA 4ZTJA 4E7HA 2DXCA 3A8GB 2ZPBB 4WF2A 1QP2A 5GAMd 3CCQT 1YBYA 2MMPA 2XIDA 3V8KA 3L2RA 3G6ET 3QG1A 1VQOA 4M78F 2FL7A 5LJ3h 2C06A 3MHXA 4M77D 2JVVA 3EFSA 4XTWA 3P8DA 1VQMA 5LL6S 3ME9A 2JTMA 1M90C 3BY7A 1Y7XA 2ZPGB 1JRIA 3VKIA 3CXCS 4KUIA 1KQ1A 3MEVA 1WJRA 4FT4A 3NFCA 5LJ5g 3GPLA 4JUVA 4N4HA 4F7UE 1BIAA 4F7UA 2VXEA 4LDYA 4LDWA 1BKBA 1DJ7B 2CZ1B 4J6YA 4OP0A 5CKBA 1S72T 4A4EA 2FVUA 3CCEA 4E7KA 2DTOA 3PMTA 4M7DD 2F69A 3MEWA 4F7UB 4BI8B 2DXBA 2IG0A 2YLBA 3PNWC 4PJOC 2H3JA 3JCMe 3CPWA 2RI5A 3NTIA 2LX9A 1G3SA 1AHJB 2EQUA 3OYLA 3CCQA 4M7AF 2D6FA 3HSBA 5HKCA 4ATOA 3G6EA 1K9MU 4LD9K 4M75E 4M75A 1BI1A 4GY5A 3HP9A 4OB0B 3BW1A 4C0FA 1EIFA 3DLLA 1NJIC 4IUQA 1VQ4A 4Q5WA 1KQSS 4J8OA 2DAQA 3GNFB 3QZ9B 4J7FA 3TCJA 1VQ7T 3OYGA 1N8RU 1XTDA 4OMFB 5GAN7 2RJCA 4DOWA 4E7LA 4M75B 5GANj 4DQ2A 1S72A 2DKGA 3OQ5A 4QVCA 3OYEA 1SSFA 4C0DC 4HCBA 3VYGA 3L42A 2BUDA 5GANd 2R5AA 1NE8A 3OYHA 2XHCA 2KQWA 3V7RA 2OTLT 3X25B 2V8JA 1U1TA 5HK3A 5CAIA 2PVDB 2QTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK4 A; 
#chains in the Genus database with same CATH topology
 4RTX A;  4Y28 E;  1UTI A;  5ECA A;  4F17 A;  2EPD A;  1MMN A;  3NMZ C;  1Q95 G;  1UEC A;  1D0X A;  3ULR B;  5I2S A;  3EAE A;  1KC8 C;  1VQ7 A;  3JCM g;  3H8Z A;  4MZT A;  4PFP A;  4UC4 A;  4QQG A;  2ABL A;  2DER A;  1ZLM A;  3VV0 A;  3CC4 A;  4M77 E;  4M77 A;  3H9N A;  3SHW A;  2J6K A;  4A54 A;  3RIR A;  2QGF B;  1Y96 A;  3VYH B;  4PJM A;  4F7U G;  2RN8 A;  4M77 B;  5CKH A;  3FLG A;  3M9Q A;  4J9C A;  4DA4 A;  2D9T A;  2EGE A;  2JUF A;  3WXM B;  5KYU A;  2ROL A;  4M7D E;  4M7D A;  1IRX A;  1Y96 B;  2CS7 A;  2M51 A;  2RHI A;  1G3Y A;  4FYY B;  4C0Z A;  2O31 A;  1NG2 A;  1PHT A;  3I55 Q;  1M1K C;  3LW5 E;  4AFU C;  1YWO A;  3HPW A;  5KYU B;  3QYH B;  4M7D B;  1VQL A;  3HRT A;  2P0P A;  5DM7 R;  3VS0 A;  4ORZ A;  3BDU A;  1QCF A;  4WCI A;  4KH0 B;  5KYY A;  1N6A A;  5J26 A;  2RI2 A;  2KT8 A;  5LJ3 e;  1YP5 A;  1ZUY A;  2D1X A;  1M90 U;  5KYY B;  4JRQ A;  4K11 A;  1ACM B;  3M0S A;  3FEO A;  2LJ0 A;  3G4S A;  3OSV A;  3T9N A;  2Y90 A;  3CMA Q;  2EGA A;  2KI7 A;  2MWP A;  3HFN A;  4ZNX A;  1N5Z A;  2E12 A;  1OV3 A;  3TU4 K;  2DRK A;  3HRU A;  1I1J A;  1T0J A;  3I5S A;  2RF0 A;  2M16 A;  1OZ3 A;  1K1Z A;  4HT8 A;  1K4U S;  3UT1 A;  3PVL A;  4D6W A;  3L2Q A;  2E5K A;  1M8V A;  3M5A A;  1RAF B;  5DLQ E;  2XI9 A;  5C0M A;  2ZZD A;  3CCR T;  2FHD A;  1ZA1 B;  2JS0 A;  1VOM A;  4RG2 A;  1MGQ A;  3QWY A;  2X51 A;  3CD6 Q;  4XAX B;  4GBQ A;  1M3C A;  4L6V 5;  4LDU A;  1WQW A;  2DYB A;  4M4Z A;  1R8O B;  4M78 E;  1SHG A;  2FB7 A;  4M78 A;  2O4X A;  2NWM A;  1SRL A;  1VQ4 Q;  2FPD A;  1RAB B;  2LNV A;  3G71 A;  2OTL A;  4FL6 A;  1VYT A;  1CKB A;  4M78 B;  3CEY A;  5GAN 8;  2O4X B;  2L2P A;  3THK A;  4F7U F;  5GMK h;  3JCM P;  2CGH A;  2KK4 A;  2DPP B;  4M7A E;  4M7A A;  3V7S A;  1KQS P;  1WX6 A;  2DD5 A;  2EKH A;  1MMA A;  2QXF A;  4M7A B;  3JCM b;  1UGP B;  2CUD A;  5DLO A;  5DY9 A;  2IPO B;  2RHZ A;  4J7I A;  4C5G A;  1VQ6 A;  2WSF E;  3PT9 A;  5IHN A;  2DJQ A;  3EGU A;  1BK2 A;  3CCV Q;  1GCP A;  3FDR A;  1Q82 C;  1YIJ A;  4BD3 A;  3LH5 A;  1VQN T;  4C92 G;  1ZSZ C;  4XK8 E;  3CPW P;  3PTA A;  1K73 U;  1NZ9 A;  3MET A;  3CCS T;  1GCQ A;  3MEA A;  2L3P A;  2LP5 A;  1KQS A;  1BIB A;  3A1P A;  3I56 A;  2VXF A;  1YJ9 Q;  1UJ0 A;  2ZCF B;  1UE9 A;  2P4R A;  3UA7 A;  1UGR B;  3JCM Q;  3FB9 A;  1YCY A;  2XK0 A;  1VIE A;  2AHJ B;  2JNG A;  3PVQ A;  1O9S A;  2CSI A;  5KE2 A;  3QXE B;  4PK4 A;  3RER A;  4ELY C;  2PUK B;  2QA4 Q;  4LDV A;  2EYZ A;  1VQ9 A;  3MP8 A;  1NYF A;  2OJ2 A;  4IUV A;  5LJ3 f;  3HTR A;  4C8Q D;  4MDW A;  3JCM h;  1H64 1;  3C4S A;  3CCU T;  1C6V X;  2X3X D;  2MOX A;  1VQ5 A;  3M57 A;  1UEB A;  4XTZ A;  2YLC A;  2QEX Q;  4AFZ C;  3IQL A;  3SEM A;  5GAN 3;  1M3B A;  5LJ5 j;  3H41 A;  3INZ A;  5KCO A;  3VUZ A;  5LJ5 d;  3JB9 J;  5GAM e;  2QQS A;  4C0D B;  1YJN T;  4IKF A;  3LH0 A;  3C0C A;  2XIC A;  2K9G A;  3UA6 A;  1RAC B;  1H8K A;  2RPN A;  2EGC A;  1E7O A;  1AWX A;  1TXQ A;  1C0M A;  1S72 Q;  2O9S A;  2NLU A;  2FZK B;  4LNP A;  5IT9 E;  1Q86 R;  1UHF A;  1MHN A;  3CPF A;  3LGL A;  4OB1 B;  1Q7Y R;  2QGG A;  5GAN 2;  3OS2 A;  3QYG B;  1PC0 A;  2GNC A;  1EZZ B;  5A2Q E;  2XDD A;  1P92 A;  3EH1 A;  4BE2 A;  1PKT A;  4ELZ C;  4OGE A;  1OYX A;  1QVG P;  2KYB A;  3QWX X;  3E2U A;  2P4T A;  1FXX A;  4AFQ C;  4BE1 A;  3X20 B;  4QW2 A;  3CCM T;  4KGX B;  1WI7 A;  4HKE A;  1M1K U;  1VQP A;  4RTU A;  4RCC A;  2PVG B;  1WJS A;  1YIT A;  2DIQ A;  4LUE A;  3P8H A;  4J5Y A;  2DE0 X;  1YI2 A;  1G3W A;  2VC8 A;  2CP7 A;  3CC7 A;  2A08 A;  3NGP A;  2IIM A;  3FJP A;  4C92 F;  2KMT A;  4GLK A;  4KT0 E;  4JRI A;  4BE0 A;  2DF6 A;  1RAE B;  2KVQ G;  4N0A A;  4BAC A;  3SWN C;  2JJ9 A;  2XU8 A;  3E9G A;  5GAM j;  1MV3 A;  2X4X A;  3A5Z B;  4OMQ A;  5CCA A;  2EYY A;  2VVK A;  1WZO A;  3A8G B;  4WF2 A;  5GAM d;  3CCQ T;  3V8K A;  2BZY A;  3L2R A;  1JJ2 P;  3TVT A;  1VQO A;  1NYG A;  2FL7 A;  4M77 D;  2FG0 A;  4XTW A;  1VQM A;  1M90 C;  2ZPG B;  1JRI A;  2COY A;  4FT4 A;  2KYM A;  2EVR A;  5LJ5 g;  1TUG B;  2GGR A;  3EH2 A;  4LDW A;  1DJ7 B;  2CZ1 B;  1AVZ C;  4A4E A;  2F2W A;  1V1C A;  2K79 A;  4E7K A;  4M7D D;  2DL8 A;  2O88 A;  5FW9 A;  2YLB A;  1X2K A;  3JCM e;  4D8D A;  2DEU A;  1ABQ A;  2D6F A;  4ATO A;  2V1Q A;  2DIL A;  4LD9 K;  2KT1 A;  4PJJ A;  3HP9 A;  4OB0 B;  3BW1 A;  1ZUU A;  1TOV A;  3EG0 A;  4J7F A;  4OML A;  2DKG A;  2QAS A;  2W0Z A;  1QMC A;  2BUD A;  2R5A A;  2FRY A;  3OYH A;  2KQW A;  1QVF P;  2OTL T;  3X25 B;  1K0X A;  1U1T A;  2HBW A;  3FIF A;  3MCA B;  2YDL A;  2LRQ A;  3HKS A;  5GAO n;  5GMK l;  2A7Y A;  3CC2 T;  2RK2 A;  3C12 A;  1T3L A;  4IUT A;  4OGC A;  2AK5 A;  4VUB A;  1OX9 A;  4L59 A;  1YHQ T;  4JJD A;  1UDL A;  2QAZ A;  1WFW A;  1QLY A;  3VS3 A;  1WHM A;  1PCX A;  1VQ8 A;  4V2S A;  4IUU A;  1RLP C;  1SRM A;  2RK1 A;  3SDZ A;  1QVF A;  2COW A;  5GAM g;  1KD1 R;  5AT1 B;  3RKW A;  4JZ3 A;  4PNO A;  1JXM A;  1H3H A;  2LQN A;  1K8A U;  1CKA A;  1YIJ T;  1K0S A;  1I4K 1;  4PJL A;  4X9D A;  2CYZ B;  3CCR Q;  1BI0 A;  3JB9 D;  4F14 A;  1WLP B;  2E65 A;  1NM7 A;  2CZ6 B;  3L1A A;  1ZHI A;  2R58 A;  9ATC B;  4M75 G;  2NUT A;  3OYI A;  2L89 A;  2YUN A;  3REA B;  4KUL A;  1AD5 A;  1OU8 A;  4M78 D;  3V7C A;  2DET A;  2JTE A;  2COZ A;  2J7I A;  3RKY A;  4EMK C;  2X3W D;  2NUT B;  2KR3 A;  4GLM A;  3C94 A;  1EX4 A;  4Y91 A;  2C0O A;  3CCL T;  4OF1 A;  1K73 C;  3H0I A;  1NPR A;  2X4J A;  1QWF A;  2GBQ A;  4J9B A;  3OYJ A;  2P84 A;  4M7A D;  2ZAE A;  3M0T A;  1OEB A;  2CT3 A;  5CO7 A;  3LYI A;  2HL5 C;  2L8D A;  2EYQ A;  3H6Z A;  4HCK A;  3L2V A;  1T3S A;  5GAN 6;  1K9M R;  4J83 A;  4J9G A;  1TUD A;  4X34 A;  3A8L B;  2OTJ T;  4PJO E;  4PJO A;  3LWH A;  2O2O A;  4XU0 A;  3RMQ A;  2JMA A;  1N8R R;  1QW1 A;  1WJQ A;  2KDS A;  4RTZ A;  4C5H A;  3GOX A;  3ZFJ A;  2RQT A;  2F5K A;  4PJO B;  1AOJ A;  2K5F A;  4ME7 A;  3DKM A;  3JV3 A;  1OI1 A;  3M56 A;  2DM1 A;  2HBP A;  1VQN Q;  2A0F B;  2J05 A;  2E3H A;  1RAI B;  4OVA A;  3CCS Q;  2RJD A;  5GAO l;  2VV5 A;  2EIF A;  3PE0 A;  3KXT A;  3JCM f;  2DX1 A;  1UHC A;  3P8B B;  3E1S A;  2CP2 A;  1QWE A;  5FLX E;  2MK5 A;  3CXC P;  4HVU A;  2HZY A;  3RMS A;  4KGZ B;  3VS5 A;  4JLI A;  2MYS A;  4XTU A;  2RB6 A;  1GFC A;  3OS5 A;  2GF7 A;  4JJN K;  5CK9 A;  5I21 A;  2C0T A;  1WA7 A;  1X75 C;  1M30 A;  3I55 A;  1D0Y A;  3L2Z A;  3PFS A;  4J9E A;  4FYW B;  1YJW T;  1W2B P;  3UF4 A;  1MV0 B;  3CCU Q;  2FO0 A;  3OYD A;  1MMG A;  1BCO A;  2CZ0 B;  3M59 A;  1LNX A;  4BDZ A;  4PFZ A;  3E19 A;  3TEE A;  2E3I A;  2DLP A;  1QKW A;  3HHT B;  1R77 A;  1Q81 C;  4M75 F;  5LJ5 h;  2QYZ A;  4JDS A;  1X6O A;  2PZ1 A;  1IRE B;  2OAW A;  1YFN A;  3EHR A;  4RTY A;  2HKQ B;  1YJN Q;  1TTH B;  2EQJ A;  4JRK A;  5EG2 A;  2EJF A;  5J39 A;  1B07 A;  2CDT A;  4R55 A;  1LOJ A;  3PGG A;  4EMH A;  4A4H A;  1Y07 A;  4LD6 A;  1W2B A;  4BUG A;  3OS0 A;  3CMA A;  4HXJ A;  2L0A A;  3EGD A;  5L23 A;  2LTO A;  1OU9 A;  2YRV A;  2YSQ A;  3S3M A;  3EGD B;  2K57 A;  1RLQ C;  3CME T;  3UWN A;  5HY6 A;  1OPL A;  1SF9 A;  2EQI A;  5CVI A;  2DL5 A;  2KGT A;  4TVR A;  4FU6 A;  3M58 A;  5D6W A;  3CCM Q;  2DO3 A;  4N4I A;  3PIO A;  2FZG B;  3ZEH A;  4BB7 A;  5KYN A;  2R5M A;  3QII A;  3OYC A;  1NJI R;  1I5L A;  5IN1 A;  4M75 C;  3CCJ T;  3CD6 A;  1B7T A;  1VIF A;  4A4G A;  1W2B S;  4HA8 A;  2GFU A;  3HRS A;  1W4S A;  1PSF A;  2RA2 A;  1KFZ A;  3JCM V;  1M8M A;  3PMI A;  1KK7 A;  5C6S A;  2LMJ A;  1WGS A;  4LUD A;  5CKD A;  5GAM h;  3OMG A;  3CCQ Q;  1V29 B;  1KC8 R;  3M4Y A;  3I9Q A;  1VQK T;  3X26 B;  1EFN A;  2K3Y A;  2F2X A;  4DOV A;  2JTF A;  2NUP A;  4PKC C;  2K4Y A;  2GTJ A;  2RMO A;  2EW3 A;  1N9R A;  4E7Z A;  2DXT A;  4LE9 A;  4AG2 C;  1ZSG A;  1Y71 A;  3FC3 A;  3Q1J A;  2RI3 A;  4Z89 A;  1FX7 A;  2QQA A;  3G1J A;  2FYK A;  2NUP B;  3JB9 H;  4IIM A;  4NS5 A;  2BZX A;  2BKD N;  2QI2 A;  4IUR A;  1OQK A;  2DEQ A;  3O8V A;  5I2M A;  3OBY A;  3VU3 C;  2V8I A;  2K5I A;  3M54 A;  4PJN A;  1PD1 A;  2CP0 A;  2FEI A;  2PTK A;  3TQ7 P;  4HCZ A;  4HT9 A;  2YWW A;  1I07 A;  1M1F A;  3CCV A;  4AFS C;  1M1K R;  4DBF A;  2XMF A;  2K3X A;  5LJ5 e;  4BDY A;  3CQT A;  3JB9 I;  2XG8 D;  1K8A C;  2IVW A;  2W10 A;  2FPE A;  4QVZ A;  1FYN A;  2QQB A;  2OTL Q;  2YHT A;  3RNJ A;  2BE7 D;  4J9F A;  4C0G A;  1YJ9 A;  5GAO q;  2VUB A;  3CC2 Q;  1K76 A;  1WHJ A;  2ZPE B;  3OYK A;  1X43 A;  2A36 A;  5GAN 5;  2ZPF B;  2K5L A;  2FRW A;  4ZN3 A;  3R6O A;  3CCE T;  2K2M A;  4II1 A;  3QJY A;  1LCK A;  1YHQ Q;  3OYN A;  1NPP A;  1D1C A;  2QA4 A;  1ZSZ A;  3VS7 A;  2YXY A;  4E7H A;  3OW2 P;  1QP2 A;  1YBY A;  3RBB B;  3G6E T;  2DL3 A;  2JVV A;  5LL6 S;  3ME9 A;  2JTM A;  3VKI A;  1Y7X A;  1IGU A;  4KUI A;  1ZSZ B;  3MEV A;  3GPL A;  4N4H A;  4F7U E;  4F7U A;  2YT6 A;  1HYO A;  4J6Y A;  4X1V A;  2FVU A;  1UJY A;  4E7S A;  3PMT A;  2F69 A;  1OX8 A;  4F7U B;  4BI8 B;  1YIJ Q;  2IG0 A;  3CPW A;  3NTI A;  3NPF A;  2AKK A;  1IO6 A;  1IHV A;  4C0F A;  2JW4 A;  1KQS S;  4J8O A;  2DAQ A;  3GNF B;  3QZ9 B;  1VQ7 T;  3OYG A;  1XTD A;  5GAN 7;  2RJC A;  4E7L A;  5GAN j;  2E4H A;  1S72 A;  4QVC A;  4C0D C;  3VYG A;  1SPK A;  3VRZ A;  5GAN d;  3CCL Q;  2XHC A;  3V7R A;  1SG5 A;  2LNH B;  2QTX A;  3CC4 T;  2JN0 A;  4C8Q G;  1M4Z A;  4J9D A;  1VYV A;  1GFD A;  1KHC A;  2MCN A;  4MMK A;  2BIV A;  1X69 A;  1M1G A;  3UAT A;  1IXD A;  1ARK A;  3CPW S;  3OY9 A;  4PJO D;  2OTJ Q;  1XNI A;  4KH1 B;  1UFF A;  2RHX A;  1VQL T;  1RUW A;  5FWC A;  3V8L A;  2CP5 A;  1Q81 U;  5GMK i;  4R0K A;  3QSU A;  2HQE A;  1D0Z A;  3J81 E;  2LZ6 B;  3ASK A;  1OUL A;  2E1H A;  3AHU A;  3I5R A;  3ZBD A;  3EFR A;  1NEG A;  2ZGW A;  2JOY A;  2DTI A;  1IHW A;  4JLG A;  1FWZ A;  1V76 A;  3JAM E;  1Q82 R;  2JZ2 A;  1PSE A;  2DZC A;  3JCM J;  3MO8 A;  3G4S T;  3OS1 A;  1QVG A;  2RO0 A;  5CQX A;  1QCO A;  1UB4 A;  2RHU A;  2HDA A;  1AZG B;  2QDY B;  4N0A C;  4ZGJ B;  2LCL A;  1FMW A;  1Z9Q A;  1X01 A;  2HKN A;  3SWN A;  4IUP A;  2KRN A;  2A37 A;  5FU6 C;  5LJ5 f;  3M0U A;  2KSS A;  3A8O B;  4ZGD B;  1ABO A;  3TSZ A;  4OMP A;  4R56 A;  1RAH B;  4XU1 A;  1ZBJ A;  3SWN B;  2H8H A;  1QP3 A;  3S3N A;  1YJW Q;  4CC7 A;  5GAN g;  3F70 A;  5HCK A;  3ZL7 C;  1JU5 C;  5FRO A;  4HCC A;  1FMK A;  3QKJ A;  2JM9 A;  4CC3 A;  3BFM A;  4RG8 A;  3M53 A;  2VAS A;  3SFM A;  8AT1 B;  1N9S A;  4B9W A;  1OOT A;  1B34 A;  2AT1 B;  2OX7 A;  4O6J A;  1QVG S;  1U3O A;  2M1H A;  5HK0 A;  1JBM A;  1JJ2 A;  4M77 G;  1BI3 A;  3HFO A;  4BI4 A;  2L3Q A;  1B34 B;  3QUI A;  4P5N A;  2LCC A;  2RJF A;  4D8K A;  3JCM X;  5GAN 4;  1ZUK A;  4X9C A;  3J7A F;  5A0D A;  3G71 T;  4C92 E;  4C92 A;  3OYM A;  4C8Q F;  4DBR A;  3FRN A;  1PM3 A;  2LJ3 A;  4ANJ A;  4M7D G;  2LT4 A;  4C5E A;  4C92 B;  2C0I A;  2XKO C;  1F1B B;  4FM4 B;  1WPY A;  2BTT A;  2KRS A;  3CME Q;  3M55 A;  2E10 A;  1WHL A;  2J06 A;  2KAF A;  3RDV A;  1KG1 A;  4Y92 A;  2QG9 B;  3MEU A;  1D1A A;  2ENM A;  3GBQ A;  3NTH A;  1AEY A;  4FIB A;  2J6O A;  2MAM A;  5GAM f;  2EFI A;  4XTY A;  1JJ2 S;  1UGQ B;  4XTX A;  1I81 A;  1M27 C;  3CCJ Q;  1JO8 A;  1Q7Y U;  1VQ6 T;  2MWO A;  4ZN1 A;  2DJZ A;  3M0R A;  4LDX A;  2Y4Y A;  1D1B A;  1NLO C;  3UPU A;  4JRP A;  3LLR A;  2VGM A;  2PVO B;  4C8Q C;  3I56 T;  1G3T A;  2LC4 A;  4FYV B;  4AT1 B;  4JJC A;  1Y0M A;  5FU7 B;  4FW2 A;  2XDP A;  1W70 A;  1VQK Q;  1NBE B;  3G7Z A;  1U8R A;  5GAO m;  2Y4X A;  1M2V A;  2KY9 A;  4BY6 B;  5D6Y A;  4XU3 A;  4KRT A;  4EMK A;  1M90 R;  4Z88 A;  1M2V B;  2HQX A;  1VQ9 T;  1QVF S;  1WXU A;  4A63 B;  2RQW A;  2CP6 A;  2HSE B;  5D7U A;  1O75 A;  1QVP A;  1GXI E;  1CSK A;  2MF2 A;  4DBH A;  3JB9 G;  4EMK B;  1HJD A;  1VQ5 T;  3MJX A;  1MNE A;  1UUE A;  1D3B A;  1HXD A;  2CUB A;  1OZ2 A;  3KUF A;  3WVD B;  2E5Q A;  3VS4 A;  2GCX A;  4M78 G;  1RI9 A;  1GL5 A;  1M5Q 1;  3QJ6 A;  1D3B B;  5L8R E;  4J6W A;  4M77 F;  1VQN A;  1QQJ A;  5CKF A;  2HEQ A;  3OYF A;  3M4G A;  3EG9 A;  3CCS A;  3MP6 A;  4E7J A;  2DL7 A;  1MND A;  1C1A A;  5I11 A;  3QPH A;  3EG9 B;  3LWI A;  2KXC A;  4YTL A;  2GTO A;  2EWN A;  4NOY A;  5GAO r;  4MML A;  4CC2 A;  4M7D F;  5KH6 A;  2HNI A;  4M7A G;  2RH2 A;  5J3B A;  4JS5 A;  3CCE Q;  1PRL C;  4J9H A;  3GLX A;  2ED1 A;  5IHK A;  2O9V A;  3OBW A;  1MMD A;  2X9H A;  2LVM A;  3G6E Q;  1RI0 A;  4RTV A;  3CCU A;  5KCH A;  1OPK A;  4CRI A;  1WHK A;  3GP8 A;  2OI3 A;  2WSE E;  1VQP T;  3OMC A;  2O01 E;  5FRM A;  3GIB A;  1KSW A;  1LJO A;  1PWT A;  3URG A;  1YIT T;  4ZGE B;  2GFA A;  2HAX A;  1YI2 T;  4M77 C;  3CC7 T;  1X2Q A;  2LX7 A;  1YJN A;  3SB2 A;  3QDR B;  1IZ6 A;  2ED0 A;  4E7I A;  1G5V A;  4Z02 A;  4CI0 C;  1BI2 A;  2MPX C;  1JQQ A;  3CXC A;  2CH4 W;  1VQ7 Q;  1WIE A;  4M7D C;  1GBR A;  2CP3 A;  3RKX A;  1KD1 U;  2DNU A;  5GAN h;  2RNA A;  1VQO T;  3CC4 Q;  1VQM T;  1Z9Z A;  1TS9 A;  3OB9 A;  2M0Y A;  2DBK A;  1PKS A;  3QZ5 B;  2EYW A;  4F16 A;  3WVE B;  4O5V A;  3JCM c;  4PLL A;  1K73 R;  1X6B A;  3CCM A;  3QDF A;  2RQR A;  3JB9 F;  2EQM A;  2B8A A;  2K7A A;  1SHF A;  2B86 A;  2J6F A;  3M0Q A;  2ROT A;  2ZPH B;  4ZTJ A;  2KXD A;  1BU1 A;  2Z0W A;  4M78 F;  2C06 A;  3MHX A;  1ZX6 A;  8ATC B;  1VQL Q;  3CXC S;  1KQ1 A;  1T0H A;  2VB6 A;  4LN2 A;  4JUV A;  1BIA A;  2HMA A;  2VXE A;  3NHN A;  1BKB A;  4HVW A;  2LCS A;  2LJ1 A;  1YN8 A;  4LXC A;  1U06 A;  3MEW A;  2CRE A;  2DXB A;  3PNW C;  3EHQ A;  2H3J A;  1AHJ B;  2EQU A;  2A28 A;  4M7A F;  3CCQ A;  1K9M U;  5GJW B;  1KJW A;  4M75 E;  4M75 A;  5IXB A;  1BI1 A;  3AT1 B;  5KYX A;  3G4S Q;  4IUQ A;  1VQ4 A;  1GBQ A;  4Q5W A;  2QDL A;  3TCJ A;  1N8R U;  4DOW A;  2FZC B;  4M75 B;  1BCM A;  1WDX A;  5KYX B;  5GJV B;  3DLM A;  1VQ8 T;  5CAI A;  2PVD B;  2V1R A;  5KE3 A;  1NLP C;  3PIP A;  3OYA A;  1HD3 A;  1LPL A;  2DIG A;  1UG1 A;  1U1S A;  1AT1 B;  5M9O A;  1H92 A;  4M78 C;  3MP1 A;  1TG0 A;  4JS4 A;  2WAC A;  3LGF A;  4KGV B;  3A8H B;  5CKE A;  2EQK A;  2QQ9 A;  1M9S A;  1KIK A;  2DBM A;  1X6G A;  2VYT A;  1XQH A;  5LJ3 j;  1E6H A;  4QT7 A;  1W6X A;  4FSX A;  2M0O A;  3JSC A;  2DVJ A;  5GAO p;  5LJ3 d;  3L2U A;  4MDX A;  1VA7 A;  2PUO B;  1Q86 C;  1YCS B;  2KBT A;  4IIO A;  3CC2 A;  4C5I A;  4M7A C;  2CKK A;  3DB3 A;  3EG3 A;  1JXO A;  1Q7Y C;  1Q81 R;  3TSW A;  2L3S A;  1WYX A;  5CQY A;  2YUQ A;  5GAN e;  4ZTF A;  1ZBX A;  2RQV A;  4C92 D;  2HL3 A;  1M3A A;  3G71 Q;  1YHQ A;  1RAG B;  2E41 A;  3VUB A;  2G3R A;  1I5O B;  2M02 A;  2HQH A;  4FCY A;  1AWO A;  1G83 A;  1MUZ A;  5CR2 A;  5AYF A;  2EYX A;  3SD4 A;  2D8J A;  4E47 A;  1GRI A;  2I0N A;  4JPB W;  4ESR A;  4NL2 A;  4QKU A;  3C95 A;  4MZM A;  4DEX A;  1VYU A;  4E2F B;  2HCK A;  4FYX B;  1XJW B;  1I0C A;  3JRZ A;  3OA6 A;  1GCQ C;  2XDB A;  4PLI A;  2G6F X;  2EKO A;  4A53 A;  3EG2 A;  1R0C B;  2QEX A;  4NL3 A;  2M9U A;  1VQ6 Q;  2JMC A;  4OMO A;  4E6R A;  3REB B;  2RQU A;  3BDL A;  1JB0 E;  2NUZ A;  4FSS A;  2D0Q B;  1JEG A;  5FWB A;  3CBO A;  3EFO A;  4QQD A;  2ECZ A;  4QVD A;  3CCL A;  2JT4 A;  1TSF A;  2L5Q A;  2RM4 A;  3I56 Q;  2H3E B;  1BBZ A;  3EFO B;  3OW2 A;  1X27 A;  1BYM A;  4F04 B;  3RES A;  1NJI U;  1H3Z A;  1W1F A;  3EGX A;  1R0B G;  1WHH A;  2RHY A;  2A3L A;  3E9F A;  5LJ3 g;  2JS2 A;  3QBY A;  3ER0 A;  3J80 E;  3EGX B;  5I22 A;  2JM8 A;  3CBP A;  4KUD K;  2DXU A;  1VQ9 Q;  2RD1 A;  1HK9 A;  2KEA A;  3I55 T;  2DVE A;  2E6Z A;  4EDU A;  2OTJ A;  2BZ8 A;  2DK3 A;  2CZ7 B;  1N27 A;  1VQ5 Q;  3VJP A;  4OB2 B;  1KC8 U;  2XD0 A;  3X28 B;  1NEB A;  4PL6 A;  4OB3 B;  2D0N A;  2NYS A;  4JJB A;  1TUC A;  2SEM A;  3OYB A;  2YRD A;  1ZQ1 A;  3CBM A;  5CIU A;  3OW2 S;  2LDM A;  2HD0 A;  4A4F A;  1WNL A;  2EAY A;  4PFO A;  3EG1 A;  4J9I A;  4RTT A;  1YWP A;  4N4G A;  2V8K A;  2L3R A;  5GMK e;  4FW1 A;  3DB4 A;  1WHG A;  3O5Z A;  1IGQ A;  1WQ7 A;  1K8A R;  3GF5 A;  2KRO A;  3CMA T;  4HVV A;  1SEM A;  4CC4 B;  5KYW A;  2VGN A;  2QK0 A;  1KQ2 A;  1KD1 C;  2I2L A;  1PD0 A;  1BB9 A;  2CT4 A;  2KRM A;  4Z8A A;  5KYW B;  4PJO G;  2E64 A;  4EIK A;  4DBQ A;  2X4W A;  1KHI A;  3LX7 A;  1YJW A;  1D09 B;  5GMK m;  4OMM A;  3R6N A;  7AT1 B;  3A98 A;  2LQW A;  1IB8 A;  1YNZ A;  2PQW A;  1ZA2 B;  4RMO A;  1VQP Q;  2EJ9 A;  5IAY A;  5GAN f;  1HSQ A;  1YIT Q;  2DTH A;  2DZ9 A;  2HSP A;  1RAA B;  3QO3 A;  3BE3 A;  2GQV A;  1YI2 Q;  2K2V A;  3CD6 T;  3CC7 Q;  4RKU E;  1RL2 A;  2LT1 A;  5IH2 A;  3HL8 A;  3VS2 A;  4QQ6 A;  5FU6 B;  3L2W A;  1QKX A;  3UDC A;  1PNJ A;  4RTW A;  1SKU B;  1VQ4 T;  3JCM W;  2AKL A;  5GMK j;  1AWW A;  4XQ3 A;  4EPC A;  3KFV A;  1VQO Q;  3TRE A;  1VQM Q;  4XU2 A;  3VRY A;  1K9M C;  3CME A;  2YRC A;  3V8J A;  2EJG A;  2VWF A;  4RCB A;  1N8R C;  2PNI A;  2CSQ A;  4C92 C;  1VUB A;  2DRM A;  3KBG A;  4BI3 A;  4L5G A;  2FPF A;  2DD4 A;  2X4Y A;  1G2B A;  2E6N A;  1RAD B;  2X35 A;  2KNB B;  1TU0 B;  1I8F A;  2AZS A;  3OSS C;  3CCJ A;  1B3Q A;  3X24 B;  1WXT A;  4AMC A;  2CH4 A;  5IHI A;  3CCV T;  2K3B A;  3N5B B;  3I35 A;  4B6M A;  4J6X A;  4XTV A;  5FRN A;  3CCR A;  2MI6 A;  3RR6 A;  3OYY A;  3MKD A;  5D6X A;  1Q86 U;  1AZE A;  2ZPI B;  2DYI A;  1PG5 B;  2E70 A;  3QHS A;  2F5T X;  2MIO A;  1YJ9 T;  1M2O A;  2ESW A;  4M75 D;  1VQK A;  2AIR B;  4RUG A;  2LQK A;  3GNG A;  2P0Q A;  2P0K A;  3RUX A;  2VKN A;  4MZP A;  2ATC B;  1S1N A;  1XOV A;  3MPU B;  4B9X A;  4PJO F;  2LQ8 A;  2K6D A;  3A8M B;  4FT2 A;  2DFU A;  1PRM C;  2QA4 T;  2WSC E;  3U23 A;  2F2V A;  5FU7 C;  5EC7 A;  2RJE A;  4KBM B;  1VQ8 Q;  5A0G A;  4C8Q E;  4C8Q A;  3M0P A;  3JCM d;  2BE9 B;  1TWB A;  4BY6 C;  1Q82 U;  3NTK A;  2OAU A;  4OMN A;  2QEX T;  4A4K A;  1G8X A;  2QQR A;  2AZV A;  2YUO A;  1TH7 A;  2JXB A;  4C8Q B;  3S3O A;  4EMG A;  5A0L A;  1UGS B;  2DL4 A;  1FMV A;  2PU9 B;  3S6W A;  2DMO A;  2R57 A;  4DEY A;  3D7S B;  2DXC A;  2ZPB B;  2MMP A;  2XID A;  2GQI A;  1U5S A;  3QG1 A;  5LJ3 h;  3EFS A;  3P8D A;  3VS6 A;  3BY7 A;  1WXB A;  2F1L A;  1WJR A;  3NFC A;  3H0F A;  1E6G A;  4LDY A;  5CKB A;  4OP0 A;  1S72 T;  6AT1 B;  1AWJ A;  3VS1 A;  3CCE A;  2D8H A;  4WTO B;  2DTO A;  2V26 A;  1J3T A;  4PJO C;  2RI5 A;  2YUP A;  2LX9 A;  1G3S A;  3FJ5 A;  3OYL A;  2KE9 A;  3HSB A;  1K9A A;  5HKC A;  3G6E A;  2EBP A;  1QCN A;  1UGV A;  4GY5 A;  1EIF A;  3DLL A;  1NJI C;  1A0N B;  3H0H A;  4OMF B;  4DQ2 A;  2SRC A;  1SSH A;  3OYE A;  3OQ5 A;  1SSF A;  4HCB A;  4AG1 C;  3L42 A;  2QTV A;  1LVK A;  1NE8 A;  1Y57 A;  2DA9 A;  5IXF A;  4JZ4 A;  2V8J A;  5HK3 A; 
#chains in the Genus database with same CATH homology
 3CC4 T;  4Y28 E;  2JN0 A;  3FIF A;  3MCA B;  5KE3 A;  2LRQ A;  3HKS A;  5GAO n;  5GMK l;  3PIP A;  2DIG A;  3OYA A;  4C8Q G;  2A7Y A;  3CC2 T;  1U1S A;  1M4Z A;  2RK2 A;  3C12 A;  5M9O A;  4IUT A;  1KHC A;  4OGC A;  4M78 C;  3MP1 A;  4MMK A;  2BIV A;  4JS4 A;  2WAC A;  1M1G A;  4VUB A;  3LGF A;  3A8H B;  5I2S A;  5CKE A;  3EAE A;  4L59 A;  1KC8 C;  2QQ9 A;  2EQK A;  3JCM g;  1M9S A;  1VQ7 A;  3CPW S;  1YHQ T;  3H8Z A;  2VYT A;  4MZT A;  3SB2 A;  1XQH A;  4UC4 A;  4QQG A;  5LJ3 j;  3OY9 A;  4FSX A;  2M0O A;  4PJO D;  3JSC A;  1XNI A;  1VQ8 A;  5GAO p;  2RHX A;  4IUU A;  5LJ3 d;  3VV0 A;  3CC4 A;  4V2S A;  4M77 E;  3L2U A;  4M77 A;  1VQ8 T;  2RK1 A;  4MDX A;  1VQL T;  1Q86 C;  2PUO B;  3V8L A;  3CC2 A;  4M7A C;  4C5I A;  2CKK A;  4A54 A;  3SDZ A;  3DB3 A;  1QVF A;  1Q7Y C;  3RIR A;  1Q81 U;  5GAM g;  5GMK i;  1Y96 A;  3VYH B;  4F7U G;  3QSU A;  2HQE A;  3J81 E;  5CQY A;  4M77 B;  5CKH A;  3ASK A;  3FLG A;  3M9Q A;  3RKW A;  4PNO A;  2E1H A;  5GAN e;  3AHU A;  3ZBD A;  4ZTF A;  1ZBX A;  4DA4 A;  4C92 D;  2D9T A;  3EFR A;  1K8A U;  2JUF A;  3WXM B;  1YHQ A;  2ZGW A;  1YIJ T;  2JOY A;  2DTI A;  4M7D E;  4M7D A;  1I4K 1;  1Y96 B;  2E41 A;  4JLG A;  4X9D A;  1FWZ A;  2CS7 A;  2CYZ B;  2G3R A;  3VUB A;  2RHI A;  1G3Y A;  3JAM E;  1BI0 A;  4C0Z A;  3JB9 D;  1M1K C;  2E65 A;  2JZ2 A;  3LW5 E;  5CR2 A;  2CZ6 B;  3HPW A;  5AYF A;  3L1A A;  3QYH B;  3SD4 A;  1PSE A;  1ZHI A;  2DZC A;  2R58 A;  4E47 A;  4M7D B;  1VQL A;  3HRT A;  4M75 G;  3OYI A;  4NL2 A;  3JCM J;  2L89 A;  3MO8 A;  2P0P A;  5DM7 R;  3OS1 A;  3G4S T;  3C95 A;  1QVG A;  4MZM A;  2RO0 A;  3BDU A;  4KUL A;  4M78 D;  3V7C A;  5CQX A;  3RKY A;  2RHU A;  1UB4 A;  4EMK C;  2QDY B;  4N0A C;  4ZGJ B;  3JRZ A;  3OA6 A;  2LCL A;  1X01 A;  3SWN A;  2XDB A;  1N6A A;  5J26 A;  4IUP A;  3C94 A;  5FU6 C;  4Y91 A;  5LJ5 f;  3CCL T;  4ZGD B;  2KSS A;  3A8O B;  2RI2 A;  5LJ3 e;  4PLI A;  4OF1 A;  1K73 C;  2EKO A;  4A53 A;  4R56 A;  1M90 U;  4XU1 A;  1NPR A;  2X4J A;  3SWN B;  4JRQ A;  1QP3 A;  2QEX A;  4NL3 A;  2M9U A;  3S3N A;  5GAN g;  3F70 A;  3FEO A;  3OYJ A;  5FRO A;  4M7A D;  3G4S A;  4HCC A;  3QKJ A;  5CO7 A;  3OSV A;  3LYI A;  3BFM A;  3BDL A;  3M53 A;  4RG8 A;  1JB0 E;  2Y90 A;  3T9N A;  2D0Q B;  3SFM A;  3CBO A;  2L8D A;  2EYQ A;  1N9S A;  2MWP A;  3H6Z A;  4QQD A;  3HFN A;  4B9W A;  3L2V A;  5GAN 6;  4QVD A;  4J83 A;  2E12 A;  4X34 A;  3CCL A;  3TU4 K;  1B34 A;  3A8L B;  3HRU A;  2OTJ T;  4PJO E;  2L5Q A;  4PJO A;  3LWH A;  2RM4 A;  4O6J A;  3OW2 A;  4XU0 A;  2M16 A;  1QVG S;  2M1H A;  1OZ3 A;  5HK0 A;  1JBM A;  1BYM A;  1JJ2 A;  3RMQ A;  4M77 G;  3RES A;  1NJI U;  1H3Z A;  1BI3 A;  3HFO A;  4HT8 A;  4BI4 A;  1QW1 A;  1WJQ A;  2KDS A;  1B34 B;  3QUI A;  4C5H A;  3GOX A;  4P5N A;  3ZFJ A;  2LCC A;  2RJF A;  3UT1 A;  2RHY A;  2F5K A;  3JCM X;  5GAN 4;  2K5F A;  4PJO B;  2A3L A;  3E9F A;  1YJN A;  5LJ3 g;  3QBY A;  4ME7 A;  4X9C A;  3DKM A;  4D6W A;  3ER0 A;  3L2Q A;  1OI1 A;  3M56 A;  3J7A F;  3M5A A;  1M8V A;  5A0D A;  3G71 T;  5DLQ E;  4C92 E;  2XI9 A;  4C92 A;  3J80 E;  5C0M A;  3OYM A;  2ZZD A;  4C8Q F;  3FRN A;  2HBP A;  4KUD K;  3CBP A;  4OVA A;  2DXU A;  3CCR T;  2RD1 A;  4M7D G;  1HK9 A;  2FHD A;  2LT4 A;  2RJD A;  5GAO l;  2VV5 A;  2EIF A;  4C5E A;  3KXT A;  3I55 T;  2DVE A;  2E6Z A;  3JCM f;  4EDU A;  4RG2 A;  2OTJ A;  1MGQ A;  4C92 B;  2DK3 A;  2XKO C;  4XAX B;  4FM4 B;  1WPY A;  2CZ7 B;  1N27 A;  3P8B B;  4L6V 5;  3E1S A;  4LDU A;  3VJP A;  5FLX E;  1WQW A;  3M55 A;  4OB2 B;  1KC8 U;  2XD0 A;  1R8O B;  2E10 A;  3X28 B;  4M78 E;  2KAF A;  2FB7 A;  4M78 A;  4OB3 B;  4PL6 A;  3RMS A;  1KG1 A;  2O4X A;  3MEU A;  4JLI A;  4XTU A;  3NTH A;  2RB6 A;  2LNV A;  3OYB A;  3G71 A;  4FIB A;  3OS5 A;  2GF7 A;  2OTL A;  4JJN K;  3CBM A;  1ZQ1 A;  2MAM A;  4FL6 A;  5CIU A;  5CK9 A;  3OW2 S;  5GAM f;  2LDM A;  2EFI A;  2HD0 A;  4M78 B;  4XTY A;  4A4F A;  5I21 A;  3CEY A;  1WNL A;  5GAN 8;  2O4X B;  2EAY A;  1JJ2 S;  1X75 C;  4F7U F;  4N4G A;  3I55 A;  2V8K A;  1UGQ B;  4XTX A;  5GMK h;  3L2Z A;  1I81 A;  2L3R A;  3PFS A;  5GMK e;  3JCM P;  1YJW T;  2CGH A;  2KK4 A;  3DB4 A;  1Q7Y U;  2DPP B;  1VQ6 T;  3OYD A;  2MWO A;  4ZN1 A;  2CZ0 B;  1WQ7 A;  2DJZ A;  3M59 A;  4M7A E;  4M7A A;  3GF5 A;  1LNX A;  3V7S A;  4BDZ A;  4LDX A;  3CMA T;  3E19 A;  3TEE A;  2Y4Y A;  2DD5 A;  2VGN A;  3HHT B;  2QXF A;  3DLM A;  1KQ2 A;  3UPU A;  1Q81 C;  4M7A B;  3JCM b;  1UGP B;  4M75 F;  1KD1 C;  2I2L A;  5LJ5 h;  4JRP A;  3LLR A;  5DLO A;  4JDS A;  1X6O A;  2VGM A;  2PVO B;  4C8Q C;  1IRE B;  3I56 T;  1G3T A;  2LC4 A;  5DY9 A;  4PJO G;  2E64 A;  5FU7 B;  2RHZ A;  2XDP A;  2X4W A;  1KHI A;  3G7Z A;  1U8R A;  3LX7 A;  1YJW A;  4J7I A;  2EQJ A;  5GMK m;  4JRK A;  5EG2 A;  4C5G A;  2WSF E;  5GAO m;  1VQ6 A;  2Y4X A;  2EJF A;  3PT9 A;  5J39 A;  4R55 A;  1LOJ A;  2KY9 A;  3PGG A;  1Q82 C;  3FDR A;  4EMH A;  4A4H A;  1Y07 A;  4LD6 A;  4BY6 B;  1YIJ A;  4BD3 A;  1W2B A;  4BUG A;  2PQW A;  3OS0 A;  3CMA A;  4RMO A;  2EJ9 A;  5D6Y A;  4XU3 A;  4EMK A;  2LTO A;  5IAY A;  5GAN f;  4C92 G;  4XK8 E;  1VQN T;  3PTA A;  1K73 U;  1QVF S;  2HQX A;  1NZ9 A;  2YRV A;  3MET A;  3CCS T;  2DTH A;  2DZ9 A;  1VQ9 T;  3MEA A;  3QO3 A;  1KQS A;  1BIB A;  3S3M A;  1O75 A;  1QVP A;  2GQV A;  1GXI E;  2K2V A;  2MF2 A;  3I56 A;  3JB9 G;  3CD6 T;  2VXF A;  4EMK B;  4RKU E;  1RL2 A;  2LT1 A;  2ZCF B;  1VQ5 T;  2K57 A;  3HL8 A;  3CME T;  1D3B A;  1HXD A;  4QQ6 A;  1UGR B;  3JCM Q;  1OZ2 A;  3KUF A;  5FU6 B;  3UWN A;  3FB9 A;  3UDC A;  3WVD B;  3L2W A;  2E5Q A;  1YCY A;  5HY6 A;  5CVI A;  2XK0 A;  4TVR A;  2GCX A;  4M78 G;  1VIE A;  4FU6 A;  3M58 A;  5D6W A;  2AHJ B;  2JNG A;  2DO3 A;  1VQ4 T;  1O9S A;  1M5Q 1;  3QJ6 A;  4N4I A;  1D3B B;  5L8R E;  4J6W A;  3PIO A;  5KE2 A;  3QXE B;  3ZEH A;  4BB7 A;  3JCM W;  3RER A;  4M77 F;  2PUK B;  2R5M A;  4ELY C;  1VQN A;  3QII A;  5GMK j;  4LDV A;  5CKF A;  1VQ9 A;  3MP8 A;  3OYC A;  3M4G A;  4IUV A;  4XQ3 A;  3OYF A;  3MP6 A;  3CCS A;  1I5L A;  5LJ3 f;  4EPC A;  4E7J A;  5IN1 A;  4M75 C;  4MDW A;  3TRE A;  4C8Q D;  3JCM h;  3CCJ T;  1H64 1;  3C4S A;  4XU2 A;  3CCU T;  3CD6 A;  1VIF A;  1VQ5 A;  1K9M C;  4A4G A;  3M57 A;  1UEB A;  3QPH A;  4XTZ A;  3LWI A;  3CME A;  4HA8 A;  4NOY A;  2EWN A;  2EJG A;  4YTL A;  3V8J A;  4MML A;  5GAO r;  4M7D F;  2YLC A;  5KH6 A;  2GFU A;  2HNI A;  4M7A G;  2RH2 A;  3HRS A;  4RCB A;  5GAN 3;  1W4S A;  5J3B A;  4JS5 A;  1PSF A;  2RA2 A;  5LJ5 j;  3JCM V;  1N8R C;  3PMI A;  3GLX A;  5C6S A;  4C92 C;  3INZ A;  1VUB A;  1WGS A;  5KCO A;  3KBG A;  4BI3 A;  3VUZ A;  5LJ5 d;  4L5G A;  5CKD A;  2DD4 A;  2X4Y A;  5GAM h;  3JB9 J;  5GAM e;  3OBW A;  3OMG A;  2QQS A;  4C0D B;  2E6N A;  2X35 A;  2LVM A;  1V29 B;  1RI0 A;  3M4Y A;  1YJN T;  4IKF A;  1VQK T;  3X26 B;  3LH0 A;  1I8F A;  3OSS C;  2XIC A;  3CCJ A;  3CCU A;  3X24 B;  5KCH A;  2K3Y A;  4CRI A;  4DOV A;  3CCV T;  2JTF A;  4PKC C;  3N5B B;  2K4Y A;  1N9R A;  3GP8 A;  2DXT A;  2WSE E;  4J6X A;  4XTV A;  3OMC A;  2O01 E;  1VQP T;  5FRN A;  5FRM A;  3GIB A;  1Y71 A;  2NLU A;  3FC3 A;  2MI6 A;  1LJO A;  3Q1J A;  2RI3 A;  3CCR A;  1FX7 A;  2QQA A;  3OYY A;  5D6X A;  5IT9 E;  3URG A;  1YIT T;  2FYK A;  1Q86 U;  4ZGE B;  2GFA A;  1MHN A;  3CPF A;  3LGL A;  4OB1 B;  2ZPI B;  2HAX A;  3JB9 H;  5GAN 2;  3OS2 A;  2E70 A;  1YI2 T;  3QHS A;  4M77 C;  4NS5 A;  2BKD N;  2F5T X;  3QYG B;  3CC7 T;  1YJ9 T;  5A2Q E;  2QI2 A;  1P92 A;  2XDD A;  4IUR A;  4BE2 A;  2DEQ A;  3O8V A;  5I2M A;  3QDR B;  3OBY A;  4M75 D;  1IZ6 A;  2V8I A;  1OYX A;  2K5I A;  3M54 A;  4OGE A;  3VU3 C;  4ELZ C;  1VQK A;  2P4T A;  4E7I A;  1G5V A;  2LQK A;  4HCZ A;  3GNG A;  2P0Q A;  4HT9 A;  4Z02 A;  1FXX A;  2P0K A;  3RUX A;  4CI0 C;  1M1F A;  1BI2 A;  4BE1 A;  3X20 B;  4MZP A;  3CCV A;  4QW2 A;  3CCM T;  1XOV A;  3CXC A;  1W2B S;  4B9X A;  4HKE A;  4PJO F;  2LQ8 A;  1M1K U;  1VQP A;  2K3X A;  3A8M B;  4FT2 A;  3RKX A;  5LJ5 e;  4BDY A;  1KD1 U;  4M7D C;  2QA4 T;  2WSC E;  4RCC A;  3JB9 I;  2XG8 D;  2PVG B;  5GAN h;  1K8A C;  1WJS A;  5FU7 C;  2DIQ A;  2RJE A;  3P8H A;  2IVW A;  1YIT A;  4J5Y A;  4QVZ A;  2QQB A;  4KBM B;  1VQO T;  2YHT A;  5A0G A;  1YI2 A;  1G3W A;  2VC8 A;  1VQM T;  4C8Q E;  3CC7 A;  4C8Q A;  3OB9 A;  4C0G A;  3JCM d;  1YJ9 A;  5GAO q;  2VUB A;  3QZ5 B;  3FJP A;  4BY6 C;  2KMT A;  4C92 F;  3NTK A;  4GLK A;  2OAU A;  2ZPE B;  3OYK A;  1Q82 U;  4KT0 E;  3WVE B;  4JRI A;  4O5V A;  4A4K A;  5GAN 5;  2QEX T;  2QQR A;  2ZPF B;  4BE0 A;  2K5L A;  3JCM c;  1TH7 A;  4PLL A;  2KVQ G;  4N0A A;  4C8Q B;  3S3O A;  4ZN3 A;  4BAC A;  3CCM A;  3R6O A;  3SWN C;  3CCE T;  4II1 A;  3JB9 F;  4EMG A;  5A0L A;  3QJY A;  2XU8 A;  1UGS B;  3E9G A;  2PU9 B;  2EQM A;  2B8A A;  3S6W A;  5GAM j;  3OYN A;  1NPP A;  2QA4 A;  2X4X A;  3A5Z B;  2ZPH B;  2R57 A;  5CCA A;  4ZTJ A;  4E7H A;  2DXC A;  3A8G B;  2ZPB B;  4WF2 A;  1QP2 A;  5GAM d;  3CCQ T;  1YBY A;  2MMP A;  2XID A;  3V8K A;  3L2R A;  3G6E T;  3QG1 A;  1VQO A;  4M78 F;  2FL7 A;  5LJ3 h;  2C06 A;  3MHX A;  4M77 D;  2JVV A;  3EFS A;  4XTW A;  3P8D A;  1VQM A;  5LL6 S;  3ME9 A;  2JTM A;  1M90 C;  3BY7 A;  1Y7X A;  2ZPG B;  1JRI A;  3VKI A;  3CXC S;  4KUI A;  1KQ1 A;  3MEV A;  1WJR A;  4FT4 A;  3NFC A;  5LJ5 g;  3GPL A;  4JUV A;  4N4H A;  4F7U E;  1BIA A;  4F7U A;  2VXE A;  4LDY A;  4LDW A;  1BKB A;  1DJ7 B;  2CZ1 B;  4J6Y A;  4OP0 A;  5CKB A;  1S72 T;  4A4E A;  2FVU A;  3CCE A;  4E7K A;  2DTO A;  3PMT A;  4M7D D;  2F69 A;  3MEW A;  4F7U B;  4BI8 B;  2DXB A;  2IG0 A;  2YLB A;  3PNW C;  4PJO C;  2H3J A;  3JCM e;  3CPW A;  2RI5 A;  3NTI A;  2LX9 A;  1G3S A;  1AHJ B;  2EQU A;  3OYL A;  3CCQ A;  4M7A F;  2D6F A;  3HSB A;  5HKC A;  4ATO A;  3G6E A;  1K9M U;  4LD9 K;  4M75 E;  4M75 A;  1BI1 A;  4GY5 A;  3HP9 A;  4OB0 B;  3BW1 A;  4C0F A;  1EIF A;  3DLL A;  1NJI C;  4IUQ A;  1VQ4 A;  4Q5W A;  1KQS S;  4J8O A;  2DAQ A;  3GNF B;  3QZ9 B;  4J7F A;  3TCJ A;  1VQ7 T;  3OYG A;  1N8R U;  1XTD A;  4OMF B;  5GAN 7;  2RJC A;  4DOW A;  4E7L A;  4M75 B;  5GAN j;  4DQ2 A;  1S72 A;  2DKG A;  3OQ5 A;  4QVC A;  3OYE A;  1SSF A;  4C0D C;  4HCB A;  3VYG A;  3L42 A;  2BUD A;  5GAN d;  2R5A A;  1NE8 A;  3OYH A;  2XHC A;  2KQW A;  3V7R A;  2OTL T;  3X25 B;  2V8J A;  1U1T A;  5HK3 A;  5CAI A;  2PVD B;  2QTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...