1AWWA

Sh3 domain from bruton's tyrosine kinase, nmr, 42 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
GSMSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BRUTON'S TYROSINE KINASE
publication title Solution structure of the SH3 domain from Bruton's tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awwA00
2DRMA 5IHKA 1WX6A 1UJYA 4GBQA 2JTEA 2DL3A 4F16A 2DJQA 2CREA 2JMCA 1TUDA 1G83A 2ABLA 2CUBA 1YN8A 3VS5A 4J9EA 1H92A 1ZUKA 1W6XA 2KROA 4ZNXA 2LJ0A 1T3SA 3QWYA 5IXBA 3VS1A 1A0NB 3TSWA 3H41A 1AWWA 1ZUYA 4R0KA 2ROTA 2CDTA 1SHFA 1VYTA 2AZSA 3M0RA 2L3PA 2JT4A 1JU5C 1QWFA 3M0TA 1K4US 2CH4W 4HVVA 4LUDA 1UDLA 1TUCA 3SEMA 3KFVA 1NLPC 3PVLA 2LQWA 3U23A 2VVKA 2XMFA 1T0HA 4RTXA 4AG1C 2JM8A 3VS3A 2ECZA 2J6FA 2OI3A 3EG2A 4OMNA 4E6RA 4KRTA 1W1FA 2AZVA 2DBKA 4Z89A 1S1NA 1H8KA 3H0FA 3VRZA 3QWXX 1N5ZA 1NYFA 2PZ1A 3M0PA 2KT1A 3EHQA 1YCSB 3UA7A 2V1QA 4RTUA 2GGRA 1CKAA 1X43A 5I22A 1WXUA 2I0NA 4J9GA 2JS2A 1LCKA 4DEXA 4JZ3A 4HVUA 2RQWA 3M0UA 2FEIA 1W70A 2LJ1A 2DL7A 2HBWA 2EYYA 1GBQA 2YUQA 4CC3A 1AWJA 2AKLA 3REBB 1K76A 1SSHA 1SPKA 2KGTA 2KXCA 2DBMA 4HCKA 1QWEA 3VS2A 2K79A 1M3BA 2V1RA 1T0JA 1K0SA 2JXBA 1BK2A 2EYWA 1PKSA 3IQLA 3NHNA 3H0HA 2EKHA 4JJCA 4JJDA 2KNBB 1BB9A 1PRLC 1RLQC 1UJ0A 1Z9ZA 1OPLA 4X1VA 5L23A 1QCFA 1RI9A 5IXFA 2CSIA 1NYGA 2EVRA 4JJBA 2D0NA 2JW4A 1SHGA 2J6OA 1K9AA 2A28A 4WCIA 1E7OA 1WXBA 1UHCA 4RTWA 4AFQC 4LN2A 1WI7A 2GTOA 1JXMA 1WDXA 1Z9QA 1JQQA 2LJ3A 1HD3A 1GCQC 1OOTA 2DL5A 4OMMA 1EFNA 2O88A 2NWMA 2MIOA 1UE9A 2AKKA 3EG1A 5IHIA 3UA6A 2ROLA 1BBZA 1ARKA 1ZUUA 2X3WD 3VS4A 2ENMA 1YP5A 1YWOA 5I11A 2DM1A 1ZLMA 4OMOA 2YUNA 1B3QA 2L3SA 3TVTA 4OMPA 3C0CA 4F17A 1M3AA 2KEAA 2SEMA 5IH2A 1GFDA 1WLPB 2L0AA 1X6BA 1K1ZA 1KJWA 2NUZA 2O9VA 3VS6A 4HXJA 2C0OA 1OV3A 4FSSA 1E6GA 2KR3A 1RUWA 2KYBA 1KSWA 3UATA 1WIEA 4GLMA 1ABQA 2YDLA 1AVZC 2A37A 2DL8A 3EG0A 3TSZA 1GCPA 3VRYA 2BZXA 2JS0A 2RNAA 2VWFA 1BU1A 1RLPC 1X2KA 2EPDA 5GJVB 1SRMA 1ZX6A 2FRYA 4ORZA 4AG2C 1K0XA 2J06A 1MV0B 2YUOA 2OAWA 2RMOA 1YNZA 1NG2A 1UFFA 2DF6A 1AWOA 1PHTA 2F2WA 1WYXA 1Y0MA 4RUGA 2M51A 2CH4A 2DX1A 3I9QA 1M30A 3ULRB 3ZL7C 2EYZA 3RBBB 3A98A 3M0SA 4CC4B 2DILA 2EGEA 5EC7A 2GQIA 4LE9A 1UGVA 2D1XA 1PNJA 2D8JA 2KBTA 2GBQA 4J9HA 4AFSC 2A08A 1GL5A 1VA7A 2CUDA 2CSQA 3GBQA 1ZBJA 1OEBA 2HSPA 4HVWA 2AK5A 2F2XA 2X3XD 1H3HA 2ESWA 2L3QA 3I5SA 1UECA 1UTIA 4JPBW 3JV3A 2B86A 2MOXA 1AOJA 1T3LA 1YWPA 4J9IA 1X6GA 1JEGA 1FYNA 5FWCA 4Z8AA 4IIMA 1PWTA 3EGUA 2EBPA 1J3TA 1SRLA 3I35A 5HCKA 4AFUC 4JZ4A 1PKTA 1UHFA 2RQTA 3NGPA 2HCKA 1IO6A 1KFZA 2RQUA 1Y57A 4J9CA 1V1CA 2FPDA 1AEYA 1AD5A 2FPEA 4K11A 2P4RA 2EYXA 4AFZC 2RQRA 1MV3A 4OMQA 2MCNA 1UG1A 2KRSA 3VS7A 4CC2A 2K2MA 2RQVA 2A36A 3UF4A 2K7AA 4QT7A 1U5SA 1UUEA 2ED0A 1X2QA 1AWXA 2GTJA 4F14A 3RNJA 5FW9A 1GRIA 2BTTA 1GBRA 2J6KA 2YUPA 2YT6A 3M0QA 1NM7A 2OJ2A 1GCQA 2FO0A 1X27A 1QLYA 1E6HA 1ZSGA 2KRMA 2DMOA 2KE9A 2RF0A 2SRCA 1QKXA 1NEBA 2KRNA 2DA9A 1I0CA 3FJ5A 4IIOA 2PNIA 4Z88A 2BZYA 4RTYA 1QKWA 1WA7A 2DRKA 2K6DA 2LX7A 1XOVA 3NPFA 4D8DA 1CKBA 1I1JA 2G6FX 3LH5A 3EG3A 2FG0A 2GNCA 3CQTA 1U3OA 2CT3A 5FWBA 2DE0X 3PE0A 2C0IA 3PVQA 1VYVA 2KYMA 2M0YA 2O9SA 4RTZA 1OPKA 1WFWA 2FRWA 2J05A 4ESRA 1ABOA 1TG0A 2J7IA 4J9BA 2LCSA 1G2BA 3H0IA 5IHNA 1SEMA 3EHRA 1I07A 1WXTA 3R6NA 1AZEA 1B07A 1NLOC 1M8MA 4D8KA 2D8HA 3THKA 2HEQA 2IIMA 3NMZC 4RTTA 2RN8A 1MUZA 4OMLA 2L2PA 2DVJA 3VS0A 2RPNA 2FPFA 2JMAA 2O31A 2LMJA 2LNHB 3O5ZA 2LP5A 2EGAA 4LNPA 2EGCA 2EW3A 4RTVA 1X69A 3I5RA 2F2VA 2KT8A 3REAB 1PRMC 3SHWA 1GFCA 2LQNA 2C0TA 2CT4A 2DL4A 1M3CA 2K9GA 4A63B 2DNUA 1AZGB 2O2OA 1CSKA 2PTKA 1KIKA 1HSQA 2LZ6B 2DLPA 4DEYA 1U06A 1VYUA 2W0ZA 5GJWB 4CC7A 4J9DA 2YSQA 2KXDA 1NEGA 2BZ8A 2QDLA 1JO8A 1M27C 4M4ZA 2W10A 4Y92A 2ED1A 2K3BA 4EIKA 4J9FA 2VKNA 4LUEA 1HJDA 2JM9A 2H8HA 2DYBA 1JXOA 5ECAA 2EQIA 2HDAA 2E5KA 1FMKA
chains in the Genus database with same CATH superfamily
4C0ZA 1LNXA 1YITA 1VQ7A 1N9RA 2JTEA 1PD1A 5GAN6 2ABLA 2X51A 4DQ2A 2CUBA 3SFMA 1M90R 2Y4YA 4R56A 4CI0C 5GAN5 3MPUB 3VS1A 3H41A 2ROTA 3LW5E 2FZCB 1ZQ1A 1JU5C 2K4YA 3X25B 4FL6A 2MI6A 3PVLA 4DBHA 3U23A 4EDUA 1ZSZB 3P8BB 5CKFA 1YHQT 2BE9B 4OB0B 3QZ5B 4AG1C 3VYHB 1S72T 1YJNQ 2ECZA 1VQNA 3EG2A 1I81A 2P0PA 1K8AC 4JLGA 1NJIC 4Z89A 2IG0A 2HL3A 3JCMh 4E7SA 3QWXX 4OVAA 4FU6A 5L8RE 2DAQA 5GAN4 3UPUA 4Y28E 2GGRA 2EKOA 5I22A 2QTXA 3OYMA 1I5OB 3M0UA 3MHXA 3CCMQ 1W70A 3HPWA 2MF2A 4A4FA 4PLLA 5CQXA 2YUQA 1AWJA 2R5MA 4BE2A 1SSHA 2JTFA 2KGTA 2KXCA 2DBMA 2DD5A 4OB1B 2D6FA 3OYFA 2ZPFB 1K0SA 4KBMB 1BK2A 1PKSA 3BY7A 4PJOD 1KHCA 4XTYA 1Q81C 3FIFA 1Z9ZA 2GFUA 5L23A 5IXFA 5GANj 2CSIA 1VQ7Q 3CD6Q 2ZGWA 3CMEA 2D0NA 1VQ6T 4WCIA 3OS2A 4C8QC 4B9XA 5LJ5g 1PG5B 3A8LB 4PNOA 3P8HA 4DBRA 4A53A 5I2MA 2MAMA 3CXCP 2LJ3A 4KUDK 1TOVA 4BY6C 4PL6A 3UA6A 4WTOB 3EG1A 1XTDA 2DIGA 2XKOC 4X9CA 1BBZA 4JLIA 3TCJA 3G71A 3OQ5A 1ZUUA 5HK0A 4RCBA 2ENMA 4BUGA 2L89A 3CPWS 5GAMj 1B3QA 2L3SA 5GMKi 1FMVA 1OX9A 3QHSA 8ATCB 4PFZA 3CCVT 2HBPA 2O01E 4A4HA 1G3WA 1M3AA 2KEAA 1C1AA 2XICA 2MWOA 3CBOA 1BCOA 1YJWT 4PJMA 4C92F 1NPRA 1KJWA 2O9VA 3OYHA 3VS6A 1M1GA 3RR6A 4C92G 1KD1U 3HTRA 4RKUE 4FSSA 1E6GA 2JVVA 2FL7A 3UATA 1U1TA 3J81E 2YDLA 4GY5A 2A37A 2QQSA 3EAEA 5M9OA 2EPDA 4C92B 4ORZA 1SRMA 2FRYA 3G4SQ 1MV0B 2XDPA 5KCOA 1XJWB 4O6JA 3MEWA 1X01A 3HL8A 3EFOA 2K5FA 3M5AA 2GFAA 3L2ZA 3C95A 2L5QA 2CH4A 2M16A 2DX1A 5HKCA 1PSEA 3A98A 3CCLA 1B34A 3CCJT 3DKMA 2XI9A 2EGEA 3AHUA 1UGVA 4M77A 1VQ8T 1M2VB 3TQ7P 3RKWA 4HT9A 2D1XA 1VQOT 2GF7A 1WJSA 5CQYA 3G71Q 1TUGB 1YJ9A 5HY6A 1VA7A 2CUDA 3G1JA 4N4IA 1G3TA 2HSPA 2F2XA 1I8FA 2H3EB 4JPBW 3JV3A 2MOXA 1RABB 4Q5WA 1YWPA 2HMAA 2V26A 2EWNA 1X6GA 2DJZA 5KH6A 4Z8AA 2DERA 4PJLA 1QVFA 2VXFA 1YHQQ 1PWTA 2EBPA 1J3TA 5HCKA 3SWNB 3V7SA 3NGPA 1NJIR 1S72Q 1KK7A 5D7UA 2MWPA 3WXMB 1OYXA 1Y57A 4L6V5 1AD5A 5LJ5h 4BI8B 3EH2A 5KYWA 2HQHA 1Q7YC 1PD0A 4C8QF 2P84A 2MCNA 4C8QA 3CCEA 2A36A 3Q1JA 1U5SA 5CVIA 3META 3CBPA 4F14A 1GRIA 4XU0A 5CR2A 2J6KA 3M0QA 4C92D 2RHYA 3JCMe 1KG1A 1X27A 1SF9A 2DXTA 2JJ9A 3OMGA 3EGXA 1ZSGA 3LWIA 1Q82C 1OZ3A 2DYIA 5AYFA 1QKXA 2ATCB 3VYGA 2DA9A 2GQVA 4VUBA 5KYWB 2PNIA 2QQBA 2LQKA 1TXQA 2M0OA 3CMAT 5GAOr 2K6DA 4HCBA 4GLKA 1CKBA 1I1JA 2G6FX 1KQ2A 1UGQB 2K3YA 5HK3A 1UGPB 2QG9B 4C5IA 5GAN2 3CPWP 1N8RC 2DE0X 4HA8A 2QA4T 1YCYA 3EGDB 1VQPA 2M0YA 1VQ6Q 2F1LA 4RTZA 1OPKA 3MCAB 2BKDN 3L2RA 4EMKC 1QCOA 4M7DG 2F5KA 2E64A 3L2WA 1MMNA 2LC4A 3NTKA 1TG0A 3OBYA 3H0IA 4IKFA 3HRUA 3T9NA 1DJ7B 1N6AA 1B07A 1NLOC 1WHJA 1M8MA 2M1HA 3VV0A 2IIMA 4XTWA 3NMZC 3MJXA 1EZZB 1OULA 1YJNT 2K5LA 2X4WA 2LMJA 1U8RA 3MO8A 2LX9A 4M78F 4LNPA 2EW3A 3CCVQ 1X69A 2F2VA 4M78G 1PRMC 5LJ5j 1D0ZA 1GFCA 1MHNA 4M7AG 4HCCA 4QVCA 3V8KA 1B7TA 1YJWQ 4A63B 2DNUA 1K9MU 1HXDA 2MMPA 2JUFA 1MMDA 1G8XA 1N27A 2DLPA 1MGQA 1VYUA 3E1SA 4DBFA 2DZ9A 4FCYA 3OYJA 4PK4A 2LCCA 4M78B 4LUEA 4M7AB 2AHJB 2JM9A 1VQ5A 1K73U 2Y4XA 4OF1A 2YWWA 4MZPA 1Q95G 2RJFA 3QDFA 2DJQA 5D6YA 1G83A 3HFOA 4UC4A 1YITT 1VQ7T 4J9EA 3KXTA 1H92A 4JJNK 3JAME 3CCRA 4ZNXA 3QWYA 5IXBA 3WVEB 1R0BG 1AHJB 1N9SA 1RAIB 3TSWA 2ZAEA 1D1CA 1ZUYA 2CZ7B 2E1HA 3HP9A 2CDTA 3E19A 1VYTA 4EMGA 1WQWA 4J7FA 3CCJQ 3M0TA 4JDSA 4XK8E 4KT0E 2CH4W 4LUDA 3RIRA 1TUCA 3SDZA 8AT1B 1NLPC 3GLXA 3ZBDA 4DOWA 1RAEB 3VU3C 1IXDA 2BIVA 2VUBA 3M55A 1VQOQ 4RTXA 2XDDA 4XU1A 1IREB 2CP2A 5CKBA 2OI3A 3JB9I 2AZVA 5CO7A 2DBKA 2HSEB 3QYHB 3OS1A 2DVEA 1VQNT 5FLXE 1NBEB 4BI4A 1W4SA 4A4KA 2PZ1A 3M0PA 3EHQA 4FT2A 4RTUA 5GAOp 1TSFA 3JCMP 2XDBA 4ZGJB 5FU7C 3OYNA 4A54A 2QDYB 4OGEA 2LT4A 2O4XA 2JS2A 1KHIA 3VKIA 2E4HA 2RQWA 1XQHA 3EG9B 1PC0A 3RUXA 3JCMX 1Q7YR 3LGFA 5GANf 2EYYA 4CC3A 1G3YA 1XNIA 2QQRA 3J80E 3UDCA 2PVDB 1KD1C 2K79A 4M78D 1T0JA 4FM4B 4M7AD 3H9NA 4IUQA 4M75G 1D1BA 4EMKA 3BDUA 4PJOG 3H0HA 4JJCA 1MNDA 4C0DB 1BB9A 1PRLC 5LJ3e 2YLCA 4XAXB 1RI9A 5LJ5e 4M7DE 2X4YA 1Q82R 2LRQA 4C0GA 2A28A 4KULA 2K2VA 2QEXA 1RL2A 1G5VA 3CMET 4AFQC 5CKHA 5KYXA 3N5BB 4QVDA 3OYGA 1RAGB 4LN2A 1UGRB 2CP5A 2GTOA 1JXMA 1Z9QA 3CC2A 1Y7XA 5I21A 1JQQA 5GAMf 5A0DA 2PVOB 3CMAQ 4OMMA 4M75B 2CZ6B 1EFNA 2NWMA 1UE9A 1BI3A 2ROLA 1KC8C 1N8RR 3QBYA 2WSCE 4F7UE 1ARKA 2X3WD 4N0AC 4DA4A 3OYYA 4ANJA 1YWOA 5FU6B 3G71T 2QA4Q 1BIAA 1MMGA 2R57A 5J39A 4E7LA 3TU4K 3C0CA 3VJPA 3LH0A 4LDYA 3QDRB 2L0AA 1HYOA 1FMWA 2E41A 4HXJA 2C0OA 4LD6A 4V2SA 3M57A 3FB9A 4P5NA 1WZOA 2EJFA 2RHUA 3BW1A 5CCAA 1RUWA 2L8DA 1Q86C 2OTJA 1QVGP 1FWZA 4GLMA 3CCSA 2DL8A 3EG0A 4M77C 3TSZA 4FYVB 4HKEA 2BZXA 3FRNA 4PFOA 2JS0A 2CGHA 1BU1A 1RLPC 1OU9A 3A8GB 4IUVA 5GAOl 2JZ2A 5IN1A 2RMOA 2V8IA 4FW2A 2KI7A 3LX7A 3X24B 2DF6A 1AWOA 1PHTA 4L5GA 1C0MA 2QYZA 1Y0MA 1KQSS 4IUPA 3OS5A 3I9QA 3JSCA 2QEXQ 4LDXA 1ZA1B 4JRPA 5IT9E 3M0SA 5KE3A 3CC2Q 3CCLT 1PCXA 4DBQA 4M75D 3PNWC 2EYQA 4J6XA 2VXEA 2KBTA 4LDWA 1YITQ 4J9HA 4AFSC 1O75A 2FVUA 3DB3A 5C0MA 3MP6A 5LJ3g 1ZBJA 1YJ9T 3OYEA 2E3HA 1AOJA 3NTIA 3OYKA 1RAHB 4HCZA 3OYLA 5GANd 3GF5A 5LL6S 2WACA 1SRLA 3I35A 4QKUA 2EQUA 4LDUA 1JB0E 2RHIA 4FT4A 1IO6A 1KFZA 3QO3A 5GMKl 3URGA 4M75E 4PJOE 2FPEA 4K11A 4AFZC 1VQNQ 4EPCA 2KRSA 2EJ9A 2K2MA 2RQVA 4ZGDB 2K7AA 4QT7A 1UGSB 2ED0A 2VC8A 3BDLA 1X2QA 4FW1A 3CCET 3M9QA 2BTTA 3JB9J 5IAYA 2K3XA 2OJ2A 1GXIE 1ACMB 2FO0A 2NUTA 5GAMd 2KRMA 2KE9A 1G3SA 4N0AA 1OU8A 1KD1R 4IIOA 1JJ2S 1K9MC 1VQ9A 1QKWA 2LX7A 2NUPA 2QGGA 1XOVA 3OMCA 3EG3A 1D1AA 2GNCA 3G6EA 5FWBA 1LVKA 4E7HA 2YXYA 5A2QE 1KQ1A 4ELYC 2C0IA 1EIFA 1VYVA 1YIJA 1K73C 3CMEQ 2FRWA 2J05A 1VQPT 1ABOA 1G2BA 3L2QA 1KC8R 1I5LA 5IHNA 2E6NA 4M77F 2RJDA 3R6NA 1M1KU 3HRSA 3OYCA 1X75C 4D8KA 4MDXA 3MP8A 4RG8A 2RN8A 2DTHA 2DTIA 5KYYA 2OTLA 2RPNA 3EFOB 2JMAA 1VQMA 4FYWB 3OBWA 3O5ZA 2EGAA 1FXXA 4JRQA 3I5RA 3ME9A 4ZGEB 1SG5A 2C0TA 1B34B 2CT4A 2DL4A 1M3CA 2OX7A 3M59A 4KGVB 4NL2A 1X6OA 4M77B 1Q86R 3MEUA 2XK0A 1HSQA 4OMFB 2COYA 1KQSP 1C6VX 4DEYA 1U06A 4CC7A 4KH1B 1K8AR 2KXDA 2BZ8A 3ER0A 1M27C 3SB2A 1ZBXA 5LJ3h 7AT1B 3C4SA 4J9FA 2LCLA 2VKNA 4IUTA 1NJIU 1BI2A 2H8HA 1JXOA 4IUUA 2DK3A 2EQIA 4A4GA 2E5KA 1FMKA 2XG8D 2DRMA 5IHKA 2VYTA 1R77A 5EG2A 2P0KA 1WX6A 4C8QG 1VQ5T 1O9SA 2HL5C 2DL3A 2CREA 2DKGA 1TUDA 3TREA 3VS5A 2YRCA 3CXCA 1IZ6A 1ZUKA 1W6XA 5CKEA 1AWWA 4OGCA 4R0KA 3CCRT 3M0RA 2L3PA 2JT4A 2QGFB 1D3BA 1QP2A 2ZPGB 2QAZA 3LLRA 3SEMA 3KFVA 4C8QB 2HNIA 3CCLQ 2LQWA 4C5HA 1Q81R 1OZ2A 2D9TA 1YI2A 2XMFA 3CC7A 1T0HA 2JM8A 4BY6B 4ZTJA 4J83A 2J6FA 2VGMA 5I2SA 3A8HB 2RM4A 4E6RA 4KRTA 4F04B 1W1FA 4OP0A 3EGXB 2PQWA 2Z0WA 3O8VA 4BACA 1VQKA 2LTOA 1YJ9Q 3P8DA 1H8KA 3FEOA 3H0FA 4C92E 1N5ZA 4X9DA 3JCMW 2KT1A 2HQXA 1YCSB 1W2BS 2EJGA 1BCMA 1WXUA 2LT1A 3I55A 4MMLA 4JZ3A 4M77D 4XTUA 4PJOC 1WHHA 2LJ1A 2DL7A 3UT1A 1VOMA 1JJ2P 1YFNA 1WHKA 3OW2P 3REBB 1VQ8A 5CIUA 1V76A 4JRKA 4HCKA 5LJ3j 3JCMb 1QWEA 2XD0A 5DLOA 2V1RA 2KSSA 3CC4A 2JXBA 2EYWA 4J5YA 5GMKh 2EKHA 1FX7A 4QQDA 4CRIA 3CCEQ 2E70A 1UJ0A 4X1VA 4F7UA 1BIBA 1QCFA 3EFSA 4BDYA 1SHGA 2J6OA 2NLUA 3AT1B 1K9MR 1ZSZC 2EQMA 3JCMJ 2ZZDA 1VQLA 1WI7A 1WDXA 2QEXT 2DD4A 2YRVA 1OOTA 1GCQC 3LGLA 5GANg 1QVGS 2C06A 5C6SA 4Y91A 3CC2T 2O88A 1UB4A 2AKKA 4J7IA 4C8QD 4BI3A 3JB9F 1WPYA 5I11A 2CYZB 2DM1A 3JB9G 1K73R 4OMOA 4NL3A 2YUNA 2E5QA 3F70A 2V8KA 6AT1B 3TVTA 4FSXA 4C0FA 4OMPA 5AT1B 2KDSA 1Y07A 4F17A 1VQPQ 1HK9A 5IH2A 2XIDA 1VQ4A 1KQSA 1IHVA 1TWBA 1X6BA 3HRTA 1H3ZA 1K1ZA 2RI3A 1IRXA 5GAMg 3R6OA 1OV3A 2KAFA 3M4GA 4OB2B 2DZCA 2KYBA 3DB4A 2Y90A 1U1SA 3S3NA 2IVWA 5FRNA 1ABQA 1AVZC 1QCNA 2JNGA 3RMSA 4ME7A 3VRYA 2OTJT 2F5TX 3CCST 4E7IA 1QMCA 2RNAA 1IGUA 2GCXA 3OS0A 2A3LA 1X2KA 2CP6A 1ZX6A 2CP7A 1P92A 2LQ8A 4QVZA 2BUDA 5GMKj 2RHZA 1UFFA 2HKQB 1WGSA 3A8OB 4XTZA 3S3MA 1QW1A 1UEBA 1WYXA 3OSVA 2M51A 3ULRB 3ZL7C 3RBBB 1MMAA 1IB8A 1M4ZA 2FZGB 4CC4B 3CPWA 3CCUA 4JS4A 3L1AA 1VQ5Q 2A0FB 3NTHA 4MZTA 3V8LA 3MP1A 5GAOn 2O4XB 4ATOA 5GAN8 3L42A 2IPOB 1GL5A 2P0QA 2CS7A 4OB3B 1RAFB 2DIQA 2FB7A 2AK5A 1H3HA 3I5SA 3HHTB 1UECA 4PJOA 3CCRQ 1W2BP 2HD0A 1M2OA 1QP3A 3H6ZA 1Y71A 3QPHA 2FZKB 3C12A 3CCMA 1JEGA 5GMKm 4EMKB 3RESA 3JCMf 2MPXC 2V8JA 4AFUC 4JZ4A 1OQKA 2RJCA 3J7AF 3JB9D 4M78E 4C92C 3I56A 4M7AE 4J9CA 4AMCA 1V1CA 3EFRA 5DM7R 4KH0B 3H8ZA 2RQRA 5KYXB 1M1KC 1UG1A 3VS7A 2CZ0B 4PJJA 3OYIA 2HQEA 1M90U 4QW2A 1ZSZA 5GANh 2AIRB 3CD6A 3ASKA 5FW9A 4E7KA 2JN0A 2YUPA 1NM7A 1GCQA 2KMTA 1QLYA 1E6HA 1PM3A 3HSBA 1WJRA 3GPLA 2QQAA 2SRCA 4ZTFA 2KRNA 3QJYA 1I0CA 4Z88A 4MDWA 2D0QB 1WA7A 3CCQA 5GAN7 4ZN1A 3NPFA 2CZ1B 1VQ9T 3LH5A 1WJQA 2FG0A 3CQTA 2AT1B 3CCUQ 2RI2A 1U3OA 1MNEA 3OYAA 5GAMh 3RKYA 4KUIA 3SD4A 1R0CB 3G6ET 3QYGB 2QTVA 4EMHA 2KYMA 5A0GA 2RK2A 1M9SA 2H3JA 2O9SA 3A8MB 5KCHA 2ZPBB 2MK5A 3RDVA 3ZEHA 5GMKe 4ESRA 2COWA 1YIJT 2RB6A 3G7ZA 3SWNC 2QXFA 5GAOq 1I07A 4JRIA 3FC3A 1AZEA 3E2UA 4BE0A 4KGZB 3OY9A 2HEQA 5A0LA 2PU9B 4RTTA 3PIOA 1MUZA 2YRDA 1VUBA 2A7YA 3BFMA 4OMLA 1JRIA 2K5IA 2DVJA 4E47A 3VS0A 2QQ9A 1QVFP 2LNHB 2OTLT 4PKCC 3I56Q 1M8VA 2KT8A 1VQMT 3G4SA 3SHWA 2LQNA 2R5AA 1D09B 2F69A 1I4K1 4DOVA 2K9GA 2O2OA 1CSKA 2PTKA 4FYXB 3MEVA 2NYSA 3BE3A 3PMIA 3A5ZB 2W0ZA 2VV5A 3E9GA 2YSQA 4N4HA 4QQ6A 2QDLA 1BKBA 4NS5A 1NE8A 4M4ZA 3L2UA 2EIFA 1WHGA 2W10A 4Y92A 5FU7B 2ED1A 2K3BA 1RACB 2RD1A 1HJDA 1H641 2OTJQ 2HDAA 2JTMA 3VS4A 3CCSQ 2VGNA 3CCQQ 1UJYA 2QK0A 4GBQA 4F16A 3PT9A 2JMCA 1YN8A 4RCCA 1TTHB 1W2BA 3OYBA 1EX4A 2X35A 2KROA 2LJ0A 1T3SA 2K57A 1A0NB 2X4JA 5KYUA 3D7SB 3M58A 2WSEE 3GP8A 1SHFA 2AZSA 3OYDA 2ZPEB 2PVGB 1QWFA 3JCMd 4XTXA 3DLLA 1K4US 1OX8A 4HVVA 4C92A 1UDLA 3OW2S 1YHQA 2PUOB 1YBYA 3TEEA 4Z02A 4M7DC 2DEQA 2VVKA 1S72A 4RMOA 3CPFA 3C94A 2DO3A 4AT1B 3CEYA 4MMKA 1TS9A 4L59A 4HT8A 1R8OB 4ELZC 1TH7A 1YI2T 4TVRA 3VS3A 5CK9A 4A4EA 2NUTB 3CC7T 4OMNA 4B6MA 5KYUB 1S1NA 1NPPA 3V7CA 2DXUA 3PFSA 1VQKT 3VRZA 1NYFA 3JCMQ 1M2VA 2XU8A 3M54A 2V1QA 3FLGA 2NUPB 3UA7A 1CKAA 1X43A 5LJ3f 2KY9A 2I0NA 5CAIA 5LJ5f 4J9GA 4M78C 1M5Q1 1QVGA 1LCKA 4E7JA 4DEXA 1KC8U 4M7AC 4HVUA 4M77G 1JBMA 2FEIA 2PUKB 3I55T 2HBWA 3KBGA 1GBQA 1M1KR 2QASA 2AKLA 1K76A 1SPKA 1D0XA 4PJNA 3DLMA 2LNVA 4D6WA 3VS2A 1M3BA 2VB6A 4QQGA 2E3IA 3IQLA 4PFPA 3NHNA 4JJDA 2KNBB 3EH1A 1RLQC 4RG2A 1OPLA 2MYSA 3CC4T 3PTAA 1VQ6A 3QXEB 3JRZA 3SWNA 1NYGA 2EVRA 4JJBA 2B8AA 4JS5A 3KUFA 2JW4A 1K9AA 5KYYB 1E7OA 1WXBA 2DXBA 1UHCA 2ZCFB 3RKXA 4RTWA 3ZFJA 1Q86U 5GANe 2RA2A 1M1FA 3WVDB 4IURA 2HKNA 4J6WA 2FHDA 2DETA 1HD3A 1SKUB 2DL5A 1K8AU 1VQLT 5DY9A 4R55A 3GOXA 2MIOA 5IHIA 1VQ9Q 3JCMc 4C5EA 1YP5A 3M4YA 1ZLMA 2E65A 3G6EQ 3CCVA 1WQ7A 1QVPA 1WHLA 2BE7D 3QZ9B 5J26A 2RJEA 1RI0A 1YJWA 1AT1B 5D6WA 2SEMA 4XQ3A 1YIJQ 5GAMe 1GFDA 1WLPB 2X4XA 1VQ4T 2NUZA 2KK4A 2JOYA 3M53A 2CP0A 2KR3A 3EGDA 1Q81U 1KSWA 1WIEA 3JCMV 4C0DC 5FRMA 3FDRA 2OTLQ 5FROA 4C5GA 2COZA 4E7ZA 4N4GA 1GCPA 4BDZA 1SSFA 1VQMQ 2RH2A 2VWFA 3INZA 1D3BB 1V29B 1VIEA 1Y96A 2ZPIB 5GJVB 4AG2C 1K0XA 2J06A 3QIIA 2YUOA 2OAWA 3JB9H 1YNZA 1NG2A 2X9HA 3L2VA 4X34A 4M75C 2HAXA 2F2WA 4M7DF 3HFNA 3OA6A 1VIFA 2DFUA 3VUBA 4M7DA 4RUGA 4B9WA 1M90C 3CCJA 3MEAA 4XU3A 1M30A 4JUVA 2EYZA 1ZHIA 4WF2A 1IGQA 3A1PA 5FU6C 1QQJA 2DILA 5EC7A 2GQIA 4LE9A 1VQOA 1Y96B 2RK1A 1BI0A 3V8JA 3CBMA 2EQKA 1PNJA 4II1A 3CCUT 4XU2A 2HZYA 4F7UF 2D8JA 2RO0A 1WHMA 3VUZA 3OSSC 2GBQA 4F7UG 2A08A 4M7DB 3GIBA 3MKDA 2CSQA 3GBQA 4M7AF 4M78A 3FJPA 1OEBA 2FYKA 4HVWA 4M7AA 2X3XD 2ESWA 2L3QA 5LJ3d 3OB9A 2CKKA 1UTIA 2B86A 2ZPHB 4J6YA 5LJ5d 9ATCB 3X20B 1T3LA 4J8OA 4M77E 2OAUA 4J9IA 2KVQG 1FYNA 5FWCA 4LDVA 4IIMA 3EGUA 4BE1A 3CCMT 4F7UB 2EAYA 3UWNA 1PKTA 1UHFA 2RQTA 2HCKA 1YI2Q 2RQUA 3CC7Q 3HKSA 1BI1A 1AEYA 5GAN3 2FPDA 5KE2A 4NOYA 2P4RA 1RADB 2EYXA 4OMQA 1MV3A 3I56T 1LOJA 4CC2A 4XTVA 3UF4A 1VQKQ 2M02A 3GNFB 1UUEA 1AWXA 2GTJA 2LVMA 3RNJA 1GBRA 2YT6A 5KYNA 4ZN3A 3QUIA 3CD6T 3X26B 2CP3A 2RHXA 4YTLA 2P4TA 2DXCA 2RI5A 4KGXB 2DEUA 3PGGA 3PIPA 3I55Q 3QJ6A 2DMOA 2RF0A 3CMAA 1NEBA 3RMQA 3JCMg 3FJ5A 5GAOm 2BZYA 4RTYA 4C8QE 1QVFS 2R58A 2DRKA 4LD9K 4D8DA 1NZ9A 1VQ8Q 1D0YA 5J3BA 3M56A 4BB7A 3CCQT 3QKJA 2I2LA 2E6ZA 2CT3A 2QA4A 3EG9A 3CC4Q 4FIBA 3PE0A 1IHWA 3S6WA 3PVQA 2WSFE 1WFWA 4M7DD 4O5VA 2DPPB 2EQJA 2J7IA 1TU0B 4J9BA 2LCSA 3E9FA 1SEMA 3EHRA 3CXCS 1VQLQ 1Q7YU 1WXTA 1WNLA 2EFIA 2XHCA 3V7RA 2D8HA 3QG1A 4PLIA 3THKA 3LYIA 4E2FB 1YJNA 2VASA 1OI1A 2DTOA 2E10A 1ZA2B 2L2PA 3GNGA 5CKDA 3QSUA 2FPFA 2O31A 3NFCA 2LP5A 2EGCA 4M75F 2E12A 2G3RA 4RTVA 2YLBA 4FYYB 4M75A 1Q82U 4PJOF 3REAB 2QI2A 1PSFA 2LDMA 3LWHA 3G4ST 3S3OA 3RERA 1AZGB 5D6XA 1VQ4Q 2YHTA 1JJ2A 1KIKA 1BYMA 3OW2A 2LZ6B 1RAAB 1F1BB 2M9UA 5GJWB 4J9DA 1NEGA 2KQWA 4BD3A 1JO8A 1N8RU 4MZMA 2L3RA 4EIKA 1LPLA 4LXCA 5DLQE 2DYBA 3X28B 3PMTA 5ECAA 4PJOB 1LJOA
chains in the Genus database with same CATH topology
2DRMA 5IHKA 1WX6A 1UJYA 4GBQA 2JTEA 2DL3A 4F16A 2DJQA 2CREA 2JMCA 1TUDA 1G83A 2ABLA 2CUBA 1YN8A 3VS5A 4J9EA 1H92A 1ZUKA 1W6XA 2KROA 4ZNXA 2LJ0A 1T3SA 3QWYA 5IXBA 3VS1A 1A0NB 3TSWA 3H41A 1AWWA 1ZUYA 4R0KA 2ROTA 2CDTA 1SHFA 1VYTA 2AZSA 3M0RA 2L3PA 2JT4A 1JU5C 1QWFA 3M0TA 1K4US 2CH4W 4HVVA 4LUDA 1UDLA 1TUCA 3SEMA 3KFVA 1NLPC 3PVLA 2LQWA 3U23A 2VVKA 2XMFA 1T0HA 4RTXA 4AG1C 2JM8A 3VS3A 2ECZA 2J6FA 2OI3A 3EG2A 4OMNA 4E6RA 4KRTA 1W1FA 2AZVA 2DBKA 4Z89A 1S1NA 1H8KA 3H0FA 3VRZA 3QWXX 1N5ZA 1NYFA 2PZ1A 3M0PA 2KT1A 3EHQA 1YCSB 3UA7A 2V1QA 4RTUA 2GGRA 1CKAA 1X43A 5I22A 1WXUA 2I0NA 4J9GA 2JS2A 1LCKA 4DEXA 4JZ3A 4HVUA 2RQWA 3M0UA 2FEIA 1W70A 2LJ1A 2DL7A 2HBWA 2EYYA 1GBQA 2YUQA 4CC3A 1AWJA 2AKLA 3REBB 1K76A 1SSHA 1SPKA 2KGTA 2KXCA 2DBMA 4HCKA 1QWEA 3VS2A 2K79A 1M3BA 2V1RA 1T0JA 1K0SA 2JXBA 1BK2A 2EYWA 1PKSA 3IQLA 3NHNA 3H0HA 2EKHA 4JJCA 4JJDA 2KNBB 1BB9A 1PRLC 1RLQC 1UJ0A 1Z9ZA 1OPLA 4X1VA 5L23A 1QCFA 1RI9A 5IXFA 2CSIA 1NYGA 2EVRA 4JJBA 2D0NA 2JW4A 1SHGA 2J6OA 1K9AA 2A28A 4WCIA 1E7OA 1WXBA 1UHCA 4RTWA 4AFQC 4LN2A 1WI7A 2GTOA 1JXMA 1WDXA 1Z9QA 1JQQA 2LJ3A 1HD3A 1GCQC 1OOTA 2DL5A 4OMMA 1EFNA 2O88A 2NWMA 2MIOA 1UE9A 2AKKA 3EG1A 5IHIA 3UA6A 2ROLA 1BBZA 1ARKA 1ZUUA 2X3WD 3VS4A 2ENMA 1YP5A 1YWOA 5I11A 2DM1A 1ZLMA 4OMOA 2YUNA 1B3QA 2L3SA 3TVTA 4OMPA 3C0CA 4F17A 1M3AA 2KEAA 2SEMA 5IH2A 1GFDA 1WLPB 2L0AA 1X6BA 1K1ZA 1KJWA 2NUZA 2O9VA 3VS6A 4HXJA 2C0OA 1OV3A 4FSSA 1E6GA 2KR3A 1RUWA 2KYBA 1KSWA 3UATA 1WIEA 4GLMA 1ABQA 2YDLA 1AVZC 2A37A 2DL8A 3EG0A 3TSZA 1GCPA 3VRYA 2BZXA 2JS0A 2RNAA 2VWFA 1BU1A 1RLPC 1X2KA 2EPDA 5GJVB 1SRMA 1ZX6A 2FRYA 4ORZA 4AG2C 1K0XA 2J06A 1MV0B 2YUOA 2OAWA 2RMOA 1YNZA 1NG2A 1UFFA 2DF6A 1AWOA 1PHTA 2F2WA 1WYXA 1Y0MA 4RUGA 2M51A 2CH4A 2DX1A 3I9QA 1M30A 3ULRB 3ZL7C 2EYZA 3RBBB 3A98A 3M0SA 4CC4B 2DILA 2EGEA 5EC7A 2GQIA 4LE9A 1UGVA 2D1XA 1PNJA 2D8JA 2KBTA 2GBQA 4J9HA 4AFSC 2A08A 1GL5A 1VA7A 2CUDA 2CSQA 3GBQA 1ZBJA 1OEBA 2HSPA 4HVWA 2AK5A 2F2XA 2X3XD 1H3HA 2ESWA 2L3QA 3I5SA 1UECA 1UTIA 4JPBW 3JV3A 2B86A 2MOXA 1AOJA 1T3LA 1YWPA 4J9IA 1X6GA 1JEGA 1FYNA 5FWCA 4Z8AA 4IIMA 1PWTA 3EGUA 2EBPA 1J3TA 1SRLA 3I35A 5HCKA 4AFUC 4JZ4A 1PKTA 1UHFA 2RQTA 3NGPA 2HCKA 1IO6A 1KFZA 2RQUA 1Y57A 4J9CA 1V1CA 2FPDA 1AEYA 1AD5A 2FPEA 4K11A 2P4RA 2EYXA 4AFZC 2RQRA 1MV3A 4OMQA 2MCNA 1UG1A 2KRSA 3VS7A 4CC2A 2K2MA 2RQVA 2A36A 3UF4A 2K7AA 4QT7A 1U5SA 1UUEA 2ED0A 1X2QA 1AWXA 2GTJA 4F14A 3RNJA 5FW9A 1GRIA 2BTTA 1GBRA 2J6KA 2YUPA 2YT6A 3M0QA 1NM7A 2OJ2A 1GCQA 2FO0A 1X27A 1QLYA 1E6HA 1ZSGA 2KRMA 2DMOA 2KE9A 2RF0A 2SRCA 1QKXA 1NEBA 2KRNA 2DA9A 1I0CA 3FJ5A 4IIOA 2PNIA 4Z88A 2BZYA 4RTYA 1QKWA 1WA7A 2DRKA 2K6DA 2LX7A 1XOVA 3NPFA 4D8DA 1CKBA 1I1JA 2G6FX 3LH5A 3EG3A 2FG0A 2GNCA 3CQTA 1U3OA 2CT3A 5FWBA 2DE0X 3PE0A 2C0IA 3PVQA 1VYVA 2KYMA 2M0YA 2O9SA 4RTZA 1OPKA 1WFWA 2FRWA 2J05A 4ESRA 1ABOA 1TG0A 2J7IA 4J9BA 2LCSA 1G2BA 3H0IA 5IHNA 1SEMA 3EHRA 1I07A 1WXTA 3R6NA 1AZEA 1B07A 1NLOC 1M8MA 4D8KA 2D8HA 3THKA 2HEQA 2IIMA 3NMZC 4RTTA 2RN8A 1MUZA 4OMLA 2L2PA 2DVJA 3VS0A 2RPNA 2FPFA 2JMAA 2O31A 2LMJA 2LNHB 3O5ZA 2LP5A 2EGAA 4LNPA 2EGCA 2EW3A 4RTVA 1X69A 3I5RA 2F2VA 2KT8A 3REAB 1PRMC 3SHWA 1GFCA 2LQNA 2C0TA 2CT4A 2DL4A 1M3CA 2K9GA 4A63B 2DNUA 1AZGB 2O2OA 1CSKA 2PTKA 1KIKA 1HSQA 2LZ6B 2DLPA 4DEYA 1U06A 1VYUA 2W0ZA 5GJWB 4CC7A 4J9DA 2YSQA 2KXDA 1NEGA 2BZ8A 2QDLA 1JO8A 1M27C 4M4ZA 2W10A 4Y92A 2ED1A 2K3BA 4EIKA 4J9FA 2VKNA 4LUEA 1HJDA 2JM9A 2H8HA 2DYBA 1JXOA 5ECAA 2EQIA 2HDAA 2E5KA 1FMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRM A;  5IHK A;  1WX6 A;  1UJY A;  4GBQ A;  2JTE A;  2DL3 A;  4F16 A;  2DJQ A;  2CRE A;  2JMC A;  1TUD A;  1G83 A;  2ABL A;  2CUB A;  1YN8 A;  3VS5 A;  4J9E A;  1H92 A;  1ZUK A;  1W6X A;  2KRO A;  4ZNX A;  2LJ0 A;  1T3S A;  3QWY A;  5IXB A;  3VS1 A;  1A0N B;  3TSW A;  3H41 A;  1AWW A;  1ZUY A;  4R0K A;  2ROT A;  2CDT A;  1SHF A;  1VYT A;  2AZS A;  3M0R A;  2L3P A;  2JT4 A;  1JU5 C;  1QWF A;  3M0T A;  1K4U S;  2CH4 W;  4HVV A;  4LUD A;  1UDL A;  1TUC A;  3SEM A;  3KFV A;  1NLP C;  3PVL A;  2LQW A;  3U23 A;  2VVK A;  2XMF A;  1T0H A;  4RTX A;  4AG1 C;  2JM8 A;  3VS3 A;  2ECZ A;  2J6F A;  2OI3 A;  3EG2 A;  4OMN A;  4E6R A;  4KRT A;  1W1F A;  2AZV A;  2DBK A;  4Z89 A;  1S1N A;  1H8K A;  3H0F A;  3VRZ A;  3QWX X;  1N5Z A;  1NYF A;  2PZ1 A;  3M0P A;  2KT1 A;  3EHQ A;  1YCS B;  3UA7 A;  2V1Q A;  4RTU A;  2GGR A;  1CKA A;  1X43 A;  5I22 A;  1WXU A;  2I0N A;  4J9G A;  2JS2 A;  1LCK A;  4DEX A;  4JZ3 A;  4HVU A;  2RQW A;  3M0U A;  2FEI A;  1W70 A;  2LJ1 A;  2DL7 A;  2HBW A;  2EYY A;  1GBQ A;  2YUQ A;  4CC3 A;  1AWJ A;  2AKL A;  3REB B;  1K76 A;  1SSH A;  1SPK A;  2KGT A;  2KXC A;  2DBM A;  4HCK A;  1QWE A;  3VS2 A;  2K79 A;  1M3B A;  2V1R A;  1T0J A;  1K0S A;  2JXB A;  1BK2 A;  2EYW A;  1PKS A;  3IQL A;  3NHN A;  3H0H A;  2EKH A;  4JJC A;  4JJD A;  2KNB B;  1BB9 A;  1PRL C;  1RLQ C;  1UJ0 A;  1Z9Z A;  1OPL A;  4X1V A;  5L23 A;  1QCF A;  1RI9 A;  5IXF A;  2CSI A;  1NYG A;  2EVR A;  4JJB A;  2D0N A;  2JW4 A;  1SHG A;  2J6O A;  1K9A A;  2A28 A;  4WCI A;  1E7O A;  1WXB A;  1UHC A;  4RTW A;  4AFQ C;  4LN2 A;  1WI7 A;  2GTO A;  1JXM A;  1WDX A;  1Z9Q A;  1JQQ A;  2LJ3 A;  1HD3 A;  1GCQ C;  1OOT A;  2DL5 A;  4OMM A;  1EFN A;  2O88 A;  2NWM A;  2MIO A;  1UE9 A;  2AKK A;  3EG1 A;  5IHI A;  3UA6 A;  2ROL A;  1BBZ A;  1ARK A;  1ZUU A;  2X3W D;  3VS4 A;  2ENM A;  1YP5 A;  1YWO A;  5I11 A;  2DM1 A;  1ZLM A;  4OMO A;  2YUN A;  1B3Q A;  2L3S A;  3TVT A;  4OMP A;  3C0C A;  4F17 A;  1M3A A;  2KEA A;  2SEM A;  5IH2 A;  1GFD A;  1WLP B;  2L0A A;  1X6B A;  1K1Z A;  1KJW A;  2NUZ A;  2O9V A;  3VS6 A;  4HXJ A;  2C0O A;  1OV3 A;  4FSS A;  1E6G A;  2KR3 A;  1RUW A;  2KYB A;  1KSW A;  3UAT A;  1WIE A;  4GLM A;  1ABQ A;  2YDL A;  1AVZ C;  2A37 A;  2DL8 A;  3EG0 A;  3TSZ A;  1GCP A;  3VRY A;  2BZX A;  2JS0 A;  2RNA A;  2VWF A;  1BU1 A;  1RLP C;  1X2K A;  2EPD A;  5GJV B;  1SRM A;  1ZX6 A;  2FRY A;  4ORZ A;  4AG2 C;  1K0X A;  2J06 A;  1MV0 B;  2YUO A;  2OAW A;  2RMO A;  1YNZ A;  1NG2 A;  1UFF A;  2DF6 A;  1AWO A;  1PHT A;  2F2W A;  1WYX A;  1Y0M A;  4RUG A;  2M51 A;  2CH4 A;  2DX1 A;  3I9Q A;  1M30 A;  3ULR B;  3ZL7 C;  2EYZ A;  3RBB B;  3A98 A;  3M0S A;  4CC4 B;  2DIL A;  2EGE A;  5EC7 A;  2GQI A;  4LE9 A;  1UGV A;  2D1X A;  1PNJ A;  2D8J A;  2KBT A;  2GBQ A;  4J9H A;  4AFS C;  2A08 A;  1GL5 A;  1VA7 A;  2CUD A;  2CSQ A;  3GBQ A;  1ZBJ A;  1OEB A;  2HSP A;  4HVW A;  2AK5 A;  2F2X A;  2X3X D;  1H3H A;  2ESW A;  2L3Q A;  3I5S A;  1UEC A;  1UTI A;  4JPB W;  3JV3 A;  2B86 A;  2MOX A;  1AOJ A;  1T3L A;  1YWP A;  4J9I A;  1X6G A;  1JEG A;  1FYN A;  5FWC A;  4Z8A A;  4IIM A;  1PWT A;  3EGU A;  2EBP A;  1J3T A;  1SRL A;  3I35 A;  5HCK A;  4AFU C;  4JZ4 A;  1PKT A;  1UHF A;  2RQT A;  3NGP A;  2HCK A;  1IO6 A;  1KFZ A;  2RQU A;  1Y57 A;  4J9C A;  1V1C A;  2FPD A;  1AEY A;  1AD5 A;  2FPE A;  4K11 A;  2P4R A;  2EYX A;  4AFZ C;  2RQR A;  1MV3 A;  4OMQ A;  2MCN A;  1UG1 A;  2KRS A;  3VS7 A;  4CC2 A;  2K2M A;  2RQV A;  2A36 A;  3UF4 A;  2K7A A;  4QT7 A;  1U5S A;  1UUE A;  2ED0 A;  1X2Q A;  1AWX A;  2GTJ A;  4F14 A;  3RNJ A;  5FW9 A;  1GRI A;  2BTT A;  1GBR A;  2J6K A;  2YUP A;  2YT6 A;  3M0Q A;  1NM7 A;  2OJ2 A;  1GCQ A;  2FO0 A;  1X27 A;  1QLY A;  1E6H A;  1ZSG A;  2KRM A;  2DMO A;  2KE9 A;  2RF0 A;  2SRC A;  1QKX A;  1NEB A;  2KRN A;  2DA9 A;  1I0C A;  3FJ5 A;  4IIO A;  2PNI A;  4Z88 A;  2BZY A;  4RTY A;  1QKW A;  1WA7 A;  2DRK A;  2K6D A;  2LX7 A;  1XOV A;  3NPF A;  4D8D A;  1CKB A;  1I1J A;  2G6F X;  3LH5 A;  3EG3 A;  2FG0 A;  2GNC A;  3CQT A;  1U3O A;  2CT3 A;  5FWB A;  2DE0 X;  3PE0 A;  2C0I A;  3PVQ A;  1VYV A;  2KYM A;  2M0Y A;  2O9S A;  4RTZ A;  1OPK A;  1WFW A;  2FRW A;  2J05 A;  4ESR A;  1ABO A;  1TG0 A;  2J7I A;  4J9B A;  2LCS A;  1G2B A;  3H0I A;  5IHN A;  1SEM A;  3EHR A;  1I07 A;  1WXT A;  3R6N A;  1AZE A;  1B07 A;  1NLO C;  1M8M A;  4D8K A;  2D8H A;  3THK A;  2HEQ A;  2IIM A;  3NMZ C;  4RTT A;  2RN8 A;  1MUZ A;  4OML A;  2L2P A;  2DVJ A;  3VS0 A;  2RPN A;  2FPF A;  2JMA A;  2O31 A;  2LMJ A;  2LNH B;  3O5Z A;  2LP5 A;  2EGA A;  4LNP A;  2EGC A;  2EW3 A;  4RTV A;  1X69 A;  3I5R A;  2F2V A;  2KT8 A;  3REA B;  1PRM C;  3SHW A;  1GFC A;  2LQN A;  2C0T A;  2CT4 A;  2DL4 A;  1M3C A;  2K9G A;  4A63 B;  2DNU A;  1AZG B;  2O2O A;  1CSK A;  2PTK A;  1KIK A;  1HSQ A;  2LZ6 B;  2DLP A;  4DEY A;  1U06 A;  1VYU A;  2W0Z A;  5GJW B;  4CC7 A;  4J9D A;  2YSQ A;  2KXD A;  1NEG A;  2BZ8 A;  2QDL A;  1JO8 A;  1M27 C;  4M4Z A;  2W10 A;  4Y92 A;  2ED1 A;  2K3B A;  4EIK A;  4J9F A;  2VKN A;  4LUE A;  1HJD A;  2JM9 A;  2H8H A;  2DYB A;  1JXO A;  5ECA A;  2EQI A;  2HDA A;  2E5K A;  1FMK A; 
#chains in the Genus database with same CATH topology
 4C0Z A;  1LNX A;  1YIT A;  1VQ7 A;  1N9R A;  2JTE A;  1PD1 A;  5GAN 6;  2ABL A;  2X51 A;  4DQ2 A;  2CUB A;  3SFM A;  1M90 R;  2Y4Y A;  4R56 A;  4CI0 C;  5GAN 5;  3MPU B;  3VS1 A;  3H41 A;  2ROT A;  3LW5 E;  2FZC B;  1ZQ1 A;  1JU5 C;  2K4Y A;  3X25 B;  4FL6 A;  2MI6 A;  3PVL A;  4DBH A;  3U23 A;  4EDU A;  1ZSZ B;  3P8B B;  5CKF A;  1YHQ T;  2BE9 B;  4OB0 B;  3QZ5 B;  4AG1 C;  3VYH B;  1S72 T;  1YJN Q;  2ECZ A;  1VQN A;  3EG2 A;  1I81 A;  2P0P A;  1K8A C;  4JLG A;  1NJI C;  4Z89 A;  2IG0 A;  2HL3 A;  3JCM h;  4E7S A;  3QWX X;  4OVA A;  4FU6 A;  5L8R E;  2DAQ A;  5GAN 4;  3UPU A;  4Y28 E;  2GGR A;  2EKO A;  5I22 A;  2QTX A;  3OYM A;  1I5O B;  3M0U A;  3MHX A;  3CCM Q;  1W70 A;  3HPW A;  2MF2 A;  4A4F A;  4PLL A;  5CQX A;  2YUQ A;  1AWJ A;  2R5M A;  4BE2 A;  1SSH A;  2JTF A;  2KGT A;  2KXC A;  2DBM A;  2DD5 A;  4OB1 B;  2D6F A;  3OYF A;  2ZPF B;  1K0S A;  4KBM B;  1BK2 A;  1PKS A;  3BY7 A;  4PJO D;  1KHC A;  4XTY A;  1Q81 C;  3FIF A;  1Z9Z A;  2GFU A;  5L23 A;  5IXF A;  5GAN j;  2CSI A;  1VQ7 Q;  3CD6 Q;  2ZGW A;  3CME A;  2D0N A;  1VQ6 T;  4WCI A;  3OS2 A;  4C8Q C;  4B9X A;  5LJ5 g;  1PG5 B;  3A8L B;  4PNO A;  3P8H A;  4DBR A;  4A53 A;  5I2M A;  2MAM A;  3CXC P;  2LJ3 A;  4KUD K;  1TOV A;  4BY6 C;  4PL6 A;  3UA6 A;  4WTO B;  3EG1 A;  1XTD A;  2DIG A;  2XKO C;  4X9C A;  1BBZ A;  4JLI A;  3TCJ A;  3G71 A;  3OQ5 A;  1ZUU A;  5HK0 A;  4RCB A;  2ENM A;  4BUG A;  2L89 A;  3CPW S;  5GAM j;  1B3Q A;  2L3S A;  5GMK i;  1FMV A;  1OX9 A;  3QHS A;  8ATC B;  4PFZ A;  3CCV T;  2HBP A;  2O01 E;  4A4H A;  1G3W A;  1M3A A;  2KEA A;  1C1A A;  2XIC A;  2MWO A;  3CBO A;  1BCO A;  1YJW T;  4PJM A;  4C92 F;  1NPR A;  1KJW A;  2O9V A;  3OYH A;  3VS6 A;  1M1G A;  3RR6 A;  4C92 G;  1KD1 U;  3HTR A;  4RKU E;  4FSS A;  1E6G A;  2JVV A;  2FL7 A;  3UAT A;  1U1T A;  3J81 E;  2YDL A;  4GY5 A;  2A37 A;  2QQS A;  3EAE A;  5M9O A;  2EPD A;  4C92 B;  4ORZ A;  1SRM A;  2FRY A;  3G4S Q;  1MV0 B;  2XDP A;  5KCO A;  1XJW B;  4O6J A;  3MEW A;  1X01 A;  3HL8 A;  3EFO A;  2K5F A;  3M5A A;  2GFA A;  3L2Z A;  3C95 A;  2L5Q A;  2CH4 A;  2M16 A;  2DX1 A;  5HKC A;  1PSE A;  3A98 A;  3CCL A;  1B34 A;  3CCJ T;  3DKM A;  2XI9 A;  2EGE A;  3AHU A;  1UGV A;  4M77 A;  1VQ8 T;  1M2V B;  3TQ7 P;  3RKW A;  4HT9 A;  2D1X A;  1VQO T;  2GF7 A;  1WJS A;  5CQY A;  3G71 Q;  1TUG B;  1YJ9 A;  5HY6 A;  1VA7 A;  2CUD A;  3G1J A;  4N4I A;  1G3T A;  2HSP A;  2F2X A;  1I8F A;  2H3E B;  4JPB W;  3JV3 A;  2MOX A;  1RAB B;  4Q5W A;  1YWP A;  2HMA A;  2V26 A;  2EWN A;  1X6G A;  2DJZ A;  5KH6 A;  4Z8A A;  2DER A;  4PJL A;  1QVF A;  2VXF A;  1YHQ Q;  1PWT A;  2EBP A;  1J3T A;  5HCK A;  3SWN B;  3V7S A;  3NGP A;  1NJI R;  1S72 Q;  1KK7 A;  5D7U A;  2MWP A;  3WXM B;  1OYX A;  1Y57 A;  4L6V 5;  1AD5 A;  5LJ5 h;  4BI8 B;  3EH2 A;  5KYW A;  2HQH A;  1Q7Y C;  1PD0 A;  4C8Q F;  2P84 A;  2MCN A;  4C8Q A;  3CCE A;  2A36 A;  3Q1J A;  1U5S A;  5CVI A;  3MET A;  3CBP A;  4F14 A;  1GRI A;  4XU0 A;  5CR2 A;  2J6K A;  3M0Q A;  4C92 D;  2RHY A;  3JCM e;  1KG1 A;  1X27 A;  1SF9 A;  2DXT A;  2JJ9 A;  3OMG A;  3EGX A;  1ZSG A;  3LWI A;  1Q82 C;  1OZ3 A;  2DYI A;  5AYF A;  1QKX A;  2ATC B;  3VYG A;  2DA9 A;  2GQV A;  4VUB A;  5KYW B;  2PNI A;  2QQB A;  2LQK A;  1TXQ A;  2M0O A;  3CMA T;  5GAO r;  2K6D A;  4HCB A;  4GLK A;  1CKB A;  1I1J A;  2G6F X;  1KQ2 A;  1UGQ B;  2K3Y A;  5HK3 A;  1UGP B;  2QG9 B;  4C5I A;  5GAN 2;  3CPW P;  1N8R C;  2DE0 X;  4HA8 A;  2QA4 T;  1YCY A;  3EGD B;  1VQP A;  2M0Y A;  1VQ6 Q;  2F1L A;  4RTZ A;  1OPK A;  3MCA B;  2BKD N;  3L2R A;  4EMK C;  1QCO A;  4M7D G;  2F5K A;  2E64 A;  3L2W A;  1MMN A;  2LC4 A;  3NTK A;  1TG0 A;  3OBY A;  3H0I A;  4IKF A;  3HRU A;  3T9N A;  1DJ7 B;  1N6A A;  1B07 A;  1NLO C;  1WHJ A;  1M8M A;  2M1H A;  3VV0 A;  2IIM A;  4XTW A;  3NMZ C;  3MJX A;  1EZZ B;  1OUL A;  1YJN T;  2K5L A;  2X4W A;  2LMJ A;  1U8R A;  3MO8 A;  2LX9 A;  4M78 F;  4LNP A;  2EW3 A;  3CCV Q;  1X69 A;  2F2V A;  4M78 G;  1PRM C;  5LJ5 j;  1D0Z A;  1GFC A;  1MHN A;  4M7A G;  4HCC A;  4QVC A;  3V8K A;  1B7T A;  1YJW Q;  4A63 B;  2DNU A;  1K9M U;  1HXD A;  2MMP A;  2JUF A;  1MMD A;  1G8X A;  1N27 A;  2DLP A;  1MGQ A;  1VYU A;  3E1S A;  4DBF A;  2DZ9 A;  4FCY A;  3OYJ A;  4PK4 A;  2LCC A;  4M78 B;  4LUE A;  4M7A B;  2AHJ B;  2JM9 A;  1VQ5 A;  1K73 U;  2Y4X A;  4OF1 A;  2YWW A;  4MZP A;  1Q95 G;  2RJF A;  3QDF A;  2DJQ A;  5D6Y A;  1G83 A;  3HFO A;  4UC4 A;  1YIT T;  1VQ7 T;  4J9E A;  3KXT A;  1H92 A;  4JJN K;  3JAM E;  3CCR A;  4ZNX A;  3QWY A;  5IXB A;  3WVE B;  1R0B G;  1AHJ B;  1N9S A;  1RAI B;  3TSW A;  2ZAE A;  1D1C A;  1ZUY A;  2CZ7 B;  2E1H A;  3HP9 A;  2CDT A;  3E19 A;  1VYT A;  4EMG A;  1WQW A;  4J7F A;  3CCJ Q;  3M0T A;  4JDS A;  4XK8 E;  4KT0 E;  2CH4 W;  4LUD A;  3RIR A;  1TUC A;  3SDZ A;  8AT1 B;  1NLP C;  3GLX A;  3ZBD A;  4DOW A;  1RAE B;  3VU3 C;  1IXD A;  2BIV A;  2VUB A;  3M55 A;  1VQO Q;  4RTX A;  2XDD A;  4XU1 A;  1IRE B;  2CP2 A;  5CKB A;  2OI3 A;  3JB9 I;  2AZV A;  5CO7 A;  2DBK A;  2HSE B;  3QYH B;  3OS1 A;  2DVE A;  1VQN T;  5FLX E;  1NBE B;  4BI4 A;  1W4S A;  4A4K A;  2PZ1 A;  3M0P A;  3EHQ A;  4FT2 A;  4RTU A;  5GAO p;  1TSF A;  3JCM P;  2XDB A;  4ZGJ B;  5FU7 C;  3OYN A;  4A54 A;  2QDY B;  4OGE A;  2LT4 A;  2O4X A;  2JS2 A;  1KHI A;  3VKI A;  2E4H A;  2RQW A;  1XQH A;  3EG9 B;  1PC0 A;  3RUX A;  3JCM X;  1Q7Y R;  3LGF A;  5GAN f;  2EYY A;  4CC3 A;  1G3Y A;  1XNI A;  2QQR A;  3J80 E;  3UDC A;  2PVD B;  1KD1 C;  2K79 A;  4M78 D;  1T0J A;  4FM4 B;  4M7A D;  3H9N A;  4IUQ A;  4M75 G;  1D1B A;  4EMK A;  3BDU A;  4PJO G;  3H0H A;  4JJC A;  1MND A;  4C0D B;  1BB9 A;  1PRL C;  5LJ3 e;  2YLC A;  4XAX B;  1RI9 A;  5LJ5 e;  4M7D E;  2X4Y A;  1Q82 R;  2LRQ A;  4C0G A;  2A28 A;  4KUL A;  2K2V A;  2QEX A;  1RL2 A;  1G5V A;  3CME T;  4AFQ C;  5CKH A;  5KYX A;  3N5B B;  4QVD A;  3OYG A;  1RAG B;  4LN2 A;  1UGR B;  2CP5 A;  2GTO A;  1JXM A;  1Z9Q A;  3CC2 A;  1Y7X A;  5I21 A;  1JQQ A;  5GAM f;  5A0D A;  2PVO B;  3CMA Q;  4OMM A;  4M75 B;  2CZ6 B;  1EFN A;  2NWM A;  1UE9 A;  1BI3 A;  2ROL A;  1KC8 C;  1N8R R;  3QBY A;  2WSC E;  4F7U E;  1ARK A;  2X3W D;  4N0A C;  4DA4 A;  3OYY A;  4ANJ A;  1YWO A;  5FU6 B;  3G71 T;  2QA4 Q;  1BIA A;  1MMG A;  2R57 A;  5J39 A;  4E7L A;  3TU4 K;  3C0C A;  3VJP A;  3LH0 A;  4LDY A;  3QDR B;  2L0A A;  1HYO A;  1FMW A;  2E41 A;  4HXJ A;  2C0O A;  4LD6 A;  4V2S A;  3M57 A;  3FB9 A;  4P5N A;  1WZO A;  2EJF A;  2RHU A;  3BW1 A;  5CCA A;  1RUW A;  2L8D A;  1Q86 C;  2OTJ A;  1QVG P;  1FWZ A;  4GLM A;  3CCS A;  2DL8 A;  3EG0 A;  4M77 C;  3TSZ A;  4FYV B;  4HKE A;  2BZX A;  3FRN A;  4PFO A;  2JS0 A;  2CGH A;  1BU1 A;  1RLP C;  1OU9 A;  3A8G B;  4IUV A;  5GAO l;  2JZ2 A;  5IN1 A;  2RMO A;  2V8I A;  4FW2 A;  2KI7 A;  3LX7 A;  3X24 B;  2DF6 A;  1AWO A;  1PHT A;  4L5G A;  1C0M A;  2QYZ A;  1Y0M A;  1KQS S;  4IUP A;  3OS5 A;  3I9Q A;  3JSC A;  2QEX Q;  4LDX A;  1ZA1 B;  4JRP A;  5IT9 E;  3M0S A;  5KE3 A;  3CC2 Q;  3CCL T;  1PCX A;  4DBQ A;  4M75 D;  3PNW C;  2EYQ A;  4J6X A;  2VXE A;  2KBT A;  4LDW A;  1YIT Q;  4J9H A;  4AFS C;  1O75 A;  2FVU A;  3DB3 A;  5C0M A;  3MP6 A;  5LJ3 g;  1ZBJ A;  1YJ9 T;  3OYE A;  2E3H A;  1AOJ A;  3NTI A;  3OYK A;  1RAH B;  4HCZ A;  3OYL A;  5GAN d;  3GF5 A;  5LL6 S;  2WAC A;  1SRL A;  3I35 A;  4QKU A;  2EQU A;  4LDU A;  1JB0 E;  2RHI A;  4FT4 A;  1IO6 A;  1KFZ A;  3QO3 A;  5GMK l;  3URG A;  4M75 E;  4PJO E;  2FPE A;  4K11 A;  4AFZ C;  1VQN Q;  4EPC A;  2KRS A;  2EJ9 A;  2K2M A;  2RQV A;  4ZGD B;  2K7A A;  4QT7 A;  1UGS B;  2ED0 A;  2VC8 A;  3BDL A;  1X2Q A;  4FW1 A;  3CCE T;  3M9Q A;  2BTT A;  3JB9 J;  5IAY A;  2K3X A;  2OJ2 A;  1GXI E;  1ACM B;  2FO0 A;  2NUT A;  5GAM d;  2KRM A;  2KE9 A;  1G3S A;  4N0A A;  1OU8 A;  1KD1 R;  4IIO A;  1JJ2 S;  1K9M C;  1VQ9 A;  1QKW A;  2LX7 A;  2NUP A;  2QGG A;  1XOV A;  3OMC A;  3EG3 A;  1D1A A;  2GNC A;  3G6E A;  5FWB A;  1LVK A;  4E7H A;  2YXY A;  5A2Q E;  1KQ1 A;  4ELY C;  2C0I A;  1EIF A;  1VYV A;  1YIJ A;  1K73 C;  3CME Q;  2FRW A;  2J05 A;  1VQP T;  1ABO A;  1G2B A;  3L2Q A;  1KC8 R;  1I5L A;  5IHN A;  2E6N A;  4M77 F;  2RJD A;  3R6N A;  1M1K U;  3HRS A;  3OYC A;  1X75 C;  4D8K A;  4MDX A;  3MP8 A;  4RG8 A;  2RN8 A;  2DTH A;  2DTI A;  5KYY A;  2OTL A;  2RPN A;  3EFO B;  2JMA A;  1VQM A;  4FYW B;  3OBW A;  3O5Z A;  2EGA A;  1FXX A;  4JRQ A;  3I5R A;  3ME9 A;  4ZGE B;  1SG5 A;  2C0T A;  1B34 B;  2CT4 A;  2DL4 A;  1M3C A;  2OX7 A;  3M59 A;  4KGV B;  4NL2 A;  1X6O A;  4M77 B;  1Q86 R;  3MEU A;  2XK0 A;  1HSQ A;  4OMF B;  2COY A;  1KQS P;  1C6V X;  4DEY A;  1U06 A;  4CC7 A;  4KH1 B;  1K8A R;  2KXD A;  2BZ8 A;  3ER0 A;  1M27 C;  3SB2 A;  1ZBX A;  5LJ3 h;  7AT1 B;  3C4S A;  4J9F A;  2LCL A;  2VKN A;  4IUT A;  1NJI U;  1BI2 A;  2H8H A;  1JXO A;  4IUU A;  2DK3 A;  2EQI A;  4A4G A;  2E5K A;  1FMK A;  2XG8 D;  2DRM A;  5IHK A;  2VYT A;  1R77 A;  5EG2 A;  2P0K A;  1WX6 A;  4C8Q G;  1VQ5 T;  1O9S A;  2HL5 C;  2DL3 A;  2CRE A;  2DKG A;  1TUD A;  3TRE A;  3VS5 A;  2YRC A;  3CXC A;  1IZ6 A;  1ZUK A;  1W6X A;  5CKE A;  1AWW A;  4OGC A;  4R0K A;  3CCR T;  3M0R A;  2L3P A;  2JT4 A;  2QGF B;  1D3B A;  1QP2 A;  2ZPG B;  2QAZ A;  3LLR A;  3SEM A;  3KFV A;  4C8Q B;  2HNI A;  3CCL Q;  2LQW A;  4C5H A;  1Q81 R;  1OZ2 A;  2D9T A;  1YI2 A;  2XMF A;  3CC7 A;  1T0H A;  2JM8 A;  4BY6 B;  4ZTJ A;  4J83 A;  2J6F A;  2VGM A;  5I2S A;  3A8H B;  2RM4 A;  4E6R A;  4KRT A;  4F04 B;  1W1F A;  4OP0 A;  3EGX B;  2PQW A;  2Z0W A;  3O8V A;  4BAC A;  1VQK A;  2LTO A;  1YJ9 Q;  3P8D A;  1H8K A;  3FEO A;  3H0F A;  4C92 E;  1N5Z A;  4X9D A;  3JCM W;  2KT1 A;  2HQX A;  1YCS B;  1W2B S;  2EJG A;  1BCM A;  1WXU A;  2LT1 A;  3I55 A;  4MML A;  4JZ3 A;  4M77 D;  4XTU A;  4PJO C;  1WHH A;  2LJ1 A;  2DL7 A;  3UT1 A;  1VOM A;  1JJ2 P;  1YFN A;  1WHK A;  3OW2 P;  3REB B;  1VQ8 A;  5CIU A;  1V76 A;  4JRK A;  4HCK A;  5LJ3 j;  3JCM b;  1QWE A;  2XD0 A;  5DLO A;  2V1R A;  2KSS A;  3CC4 A;  2JXB A;  2EYW A;  4J5Y A;  5GMK h;  2EKH A;  1FX7 A;  4QQD A;  4CRI A;  3CCE Q;  2E70 A;  1UJ0 A;  4X1V A;  4F7U A;  1BIB A;  1QCF A;  3EFS A;  4BDY A;  1SHG A;  2J6O A;  2NLU A;  3AT1 B;  1K9M R;  1ZSZ C;  2EQM A;  3JCM J;  2ZZD A;  1VQL A;  1WI7 A;  1WDX A;  2QEX T;  2DD4 A;  2YRV A;  1OOT A;  1GCQ C;  3LGL A;  5GAN g;  1QVG S;  2C06 A;  5C6S A;  4Y91 A;  3CC2 T;  2O88 A;  1UB4 A;  2AKK A;  4J7I A;  4C8Q D;  4BI3 A;  3JB9 F;  1WPY A;  5I11 A;  2CYZ B;  2DM1 A;  3JB9 G;  1K73 R;  4OMO A;  4NL3 A;  2YUN A;  2E5Q A;  3F70 A;  2V8K A;  6AT1 B;  3TVT A;  4FSX A;  4C0F A;  4OMP A;  5AT1 B;  2KDS A;  1Y07 A;  4F17 A;  1VQP Q;  1HK9 A;  5IH2 A;  2XID A;  1VQ4 A;  1KQS A;  1IHV A;  1TWB A;  1X6B A;  3HRT A;  1H3Z A;  1K1Z A;  2RI3 A;  1IRX A;  5GAM g;  3R6O A;  1OV3 A;  2KAF A;  3M4G A;  4OB2 B;  2DZC A;  2KYB A;  3DB4 A;  2Y90 A;  1U1S A;  3S3N A;  2IVW A;  5FRN A;  1ABQ A;  1AVZ C;  1QCN A;  2JNG A;  3RMS A;  4ME7 A;  3VRY A;  2OTJ T;  2F5T X;  3CCS T;  4E7I A;  1QMC A;  2RNA A;  1IGU A;  2GCX A;  3OS0 A;  2A3L A;  1X2K A;  2CP6 A;  1ZX6 A;  2CP7 A;  1P92 A;  2LQ8 A;  4QVZ A;  2BUD A;  5GMK j;  2RHZ A;  1UFF A;  2HKQ B;  1WGS A;  3A8O B;  4XTZ A;  3S3M A;  1QW1 A;  1UEB A;  1WYX A;  3OSV A;  2M51 A;  3ULR B;  3ZL7 C;  3RBB B;  1MMA A;  1IB8 A;  1M4Z A;  2FZG B;  4CC4 B;  3CPW A;  3CCU A;  4JS4 A;  3L1A A;  1VQ5 Q;  2A0F B;  3NTH A;  4MZT A;  3V8L A;  3MP1 A;  5GAO n;  2O4X B;  4ATO A;  5GAN 8;  3L42 A;  2IPO B;  1GL5 A;  2P0Q A;  2CS7 A;  4OB3 B;  1RAF B;  2DIQ A;  2FB7 A;  2AK5 A;  1H3H A;  3I5S A;  3HHT B;  1UEC A;  4PJO A;  3CCR Q;  1W2B P;  2HD0 A;  1M2O A;  1QP3 A;  3H6Z A;  1Y71 A;  3QPH A;  2FZK B;  3C12 A;  3CCM A;  1JEG A;  5GMK m;  4EMK B;  3RES A;  3JCM f;  2MPX C;  2V8J A;  4AFU C;  4JZ4 A;  1OQK A;  2RJC A;  3J7A F;  3JB9 D;  4M78 E;  4C92 C;  3I56 A;  4M7A E;  4J9C A;  4AMC A;  1V1C A;  3EFR A;  5DM7 R;  4KH0 B;  3H8Z A;  2RQR A;  5KYX B;  1M1K C;  1UG1 A;  3VS7 A;  2CZ0 B;  4PJJ A;  3OYI A;  2HQE A;  1M90 U;  4QW2 A;  1ZSZ A;  5GAN h;  2AIR B;  3CD6 A;  3ASK A;  5FW9 A;  4E7K A;  2JN0 A;  2YUP A;  1NM7 A;  1GCQ A;  2KMT A;  1QLY A;  1E6H A;  1PM3 A;  3HSB A;  1WJR A;  3GPL A;  2QQA A;  2SRC A;  4ZTF A;  2KRN A;  3QJY A;  1I0C A;  4Z88 A;  4MDW A;  2D0Q B;  1WA7 A;  3CCQ A;  5GAN 7;  4ZN1 A;  3NPF A;  2CZ1 B;  1VQ9 T;  3LH5 A;  1WJQ A;  2FG0 A;  3CQT A;  2AT1 B;  3CCU Q;  2RI2 A;  1U3O A;  1MNE A;  3OYA A;  5GAM h;  3RKY A;  4KUI A;  3SD4 A;  1R0C B;  3G6E T;  3QYG B;  2QTV A;  4EMH A;  2KYM A;  5A0G A;  2RK2 A;  1M9S A;  2H3J A;  2O9S A;  3A8M B;  5KCH A;  2ZPB B;  2MK5 A;  3RDV A;  3ZEH A;  5GMK e;  4ESR A;  2COW A;  1YIJ T;  2RB6 A;  3G7Z A;  3SWN C;  2QXF A;  5GAO q;  1I07 A;  4JRI A;  3FC3 A;  1AZE A;  3E2U A;  4BE0 A;  4KGZ B;  3OY9 A;  2HEQ A;  5A0L A;  2PU9 B;  4RTT A;  3PIO A;  1MUZ A;  2YRD A;  1VUB A;  2A7Y A;  3BFM A;  4OML A;  1JRI A;  2K5I A;  2DVJ A;  4E47 A;  3VS0 A;  2QQ9 A;  1QVF P;  2LNH B;  2OTL T;  4PKC C;  3I56 Q;  1M8V A;  2KT8 A;  1VQM T;  3G4S A;  3SHW A;  2LQN A;  2R5A A;  1D09 B;  2F69 A;  1I4K 1;  4DOV A;  2K9G A;  2O2O A;  1CSK A;  2PTK A;  4FYX B;  3MEV A;  2NYS A;  3BE3 A;  3PMI A;  3A5Z B;  2W0Z A;  2VV5 A;  3E9G A;  2YSQ A;  4N4H A;  4QQ6 A;  2QDL A;  1BKB A;  4NS5 A;  1NE8 A;  4M4Z A;  3L2U A;  2EIF A;  1WHG A;  2W10 A;  4Y92 A;  5FU7 B;  2ED1 A;  2K3B A;  1RAC B;  2RD1 A;  1HJD A;  1H64 1;  2OTJ Q;  2HDA A;  2JTM A;  3VS4 A;  3CCS Q;  2VGN A;  3CCQ Q;  1UJY A;  2QK0 A;  4GBQ A;  4F16 A;  3PT9 A;  2JMC A;  1YN8 A;  4RCC A;  1TTH B;  1W2B A;  3OYB A;  1EX4 A;  2X35 A;  2KRO A;  2LJ0 A;  1T3S A;  2K57 A;  1A0N B;  2X4J A;  5KYU A;  3D7S B;  3M58 A;  2WSE E;  3GP8 A;  1SHF A;  2AZS A;  3OYD A;  2ZPE B;  2PVG B;  1QWF A;  3JCM d;  4XTX A;  3DLL A;  1K4U S;  1OX8 A;  4HVV A;  4C92 A;  1UDL A;  3OW2 S;  1YHQ A;  2PUO B;  1YBY A;  3TEE A;  4Z02 A;  4M7D C;  2DEQ A;  2VVK A;  1S72 A;  4RMO A;  3CPF A;  3C94 A;  2DO3 A;  4AT1 B;  3CEY A;  4MMK A;  1TS9 A;  4L59 A;  4HT8 A;  1R8O B;  4ELZ C;  1TH7 A;  1YI2 T;  4TVR A;  3VS3 A;  5CK9 A;  4A4E A;  2NUT B;  3CC7 T;  4OMN A;  4B6M A;  5KYU B;  1S1N A;  1NPP A;  3V7C A;  2DXU A;  3PFS A;  1VQK T;  3VRZ A;  1NYF A;  3JCM Q;  1M2V A;  2XU8 A;  3M54 A;  2V1Q A;  3FLG A;  2NUP B;  3UA7 A;  1CKA A;  1X43 A;  5LJ3 f;  2KY9 A;  2I0N A;  5CAI A;  5LJ5 f;  4J9G A;  4M78 C;  1M5Q 1;  1QVG A;  1LCK A;  4E7J A;  4DEX A;  1KC8 U;  4M7A C;  4HVU A;  4M77 G;  1JBM A;  2FEI A;  2PUK B;  3I55 T;  2HBW A;  3KBG A;  1GBQ A;  1M1K R;  2QAS A;  2AKL A;  1K76 A;  1SPK A;  1D0X A;  4PJN A;  3DLM A;  2LNV A;  4D6W A;  3VS2 A;  1M3B A;  2VB6 A;  4QQG A;  2E3I A;  3IQL A;  4PFP A;  3NHN A;  4JJD A;  2KNB B;  3EH1 A;  1RLQ C;  4RG2 A;  1OPL A;  2MYS A;  3CC4 T;  3PTA A;  1VQ6 A;  3QXE B;  3JRZ A;  3SWN A;  1NYG A;  2EVR A;  4JJB A;  2B8A A;  4JS5 A;  3KUF A;  2JW4 A;  1K9A A;  5KYY B;  1E7O A;  1WXB A;  2DXB A;  1UHC A;  2ZCF B;  3RKX A;  4RTW A;  3ZFJ A;  1Q86 U;  5GAN e;  2RA2 A;  1M1F A;  3WVD B;  4IUR A;  2HKN A;  4J6W A;  2FHD A;  2DET A;  1HD3 A;  1SKU B;  2DL5 A;  1K8A U;  1VQL T;  5DY9 A;  4R55 A;  3GOX A;  2MIO A;  5IHI A;  1VQ9 Q;  3JCM c;  4C5E A;  1YP5 A;  3M4Y A;  1ZLM A;  2E65 A;  3G6E Q;  3CCV A;  1WQ7 A;  1QVP A;  1WHL A;  2BE7 D;  3QZ9 B;  5J26 A;  2RJE A;  1RI0 A;  1YJW A;  1AT1 B;  5D6W A;  2SEM A;  4XQ3 A;  1YIJ Q;  5GAM e;  1GFD A;  1WLP B;  2X4X A;  1VQ4 T;  2NUZ A;  2KK4 A;  2JOY A;  3M53 A;  2CP0 A;  2KR3 A;  3EGD A;  1Q81 U;  1KSW A;  1WIE A;  3JCM V;  4C0D C;  5FRM A;  3FDR A;  2OTL Q;  5FRO A;  4C5G A;  2COZ A;  4E7Z A;  4N4G A;  1GCP A;  4BDZ A;  1SSF A;  1VQM Q;  2RH2 A;  2VWF A;  3INZ A;  1D3B B;  1V29 B;  1VIE A;  1Y96 A;  2ZPI B;  5GJV B;  4AG2 C;  1K0X A;  2J06 A;  3QII A;  2YUO A;  2OAW A;  3JB9 H;  1YNZ A;  1NG2 A;  2X9H A;  3L2V A;  4X34 A;  4M75 C;  2HAX A;  2F2W A;  4M7D F;  3HFN A;  3OA6 A;  1VIF A;  2DFU A;  3VUB A;  4M7D A;  4RUG A;  4B9W A;  1M90 C;  3CCJ A;  3MEA A;  4XU3 A;  1M30 A;  4JUV A;  2EYZ A;  1ZHI A;  4WF2 A;  1IGQ A;  3A1P A;  5FU6 C;  1QQJ A;  2DIL A;  5EC7 A;  2GQI A;  4LE9 A;  1VQO A;  1Y96 B;  2RK1 A;  1BI0 A;  3V8J A;  3CBM A;  2EQK A;  1PNJ A;  4II1 A;  3CCU T;  4XU2 A;  2HZY A;  4F7U F;  2D8J A;  2RO0 A;  1WHM A;  3VUZ A;  3OSS C;  2GBQ A;  4F7U G;  2A08 A;  4M7D B;  3GIB A;  3MKD A;  2CSQ A;  3GBQ A;  4M7A F;  4M78 A;  3FJP A;  1OEB A;  2FYK A;  4HVW A;  4M7A A;  2X3X D;  2ESW A;  2L3Q A;  5LJ3 d;  3OB9 A;  2CKK A;  1UTI A;  2B86 A;  2ZPH B;  4J6Y A;  5LJ5 d;  9ATC B;  3X20 B;  1T3L A;  4J8O A;  4M77 E;  2OAU A;  4J9I A;  2KVQ G;  1FYN A;  5FWC A;  4LDV A;  4IIM A;  3EGU A;  4BE1 A;  3CCM T;  4F7U B;  2EAY A;  3UWN A;  1PKT A;  1UHF A;  2RQT A;  2HCK A;  1YI2 Q;  2RQU A;  3CC7 Q;  3HKS A;  1BI1 A;  1AEY A;  5GAN 3;  2FPD A;  5KE2 A;  4NOY A;  2P4R A;  1RAD B;  2EYX A;  4OMQ A;  1MV3 A;  3I56 T;  1LOJ A;  4CC2 A;  4XTV A;  3UF4 A;  1VQK Q;  2M02 A;  3GNF B;  1UUE A;  1AWX A;  2GTJ A;  2LVM A;  3RNJ A;  1GBR A;  2YT6 A;  5KYN A;  4ZN3 A;  3QUI A;  3CD6 T;  3X26 B;  2CP3 A;  2RHX A;  4YTL A;  2P4T A;  2DXC A;  2RI5 A;  4KGX B;  2DEU A;  3PGG A;  3PIP A;  3I55 Q;  3QJ6 A;  2DMO A;  2RF0 A;  3CMA A;  1NEB A;  3RMQ A;  3JCM g;  3FJ5 A;  5GAO m;  2BZY A;  4RTY A;  4C8Q E;  1QVF S;  2R58 A;  2DRK A;  4LD9 K;  4D8D A;  1NZ9 A;  1VQ8 Q;  1D0Y A;  5J3B A;  3M56 A;  4BB7 A;  3CCQ T;  3QKJ A;  2I2L A;  2E6Z A;  2CT3 A;  2QA4 A;  3EG9 A;  3CC4 Q;  4FIB A;  3PE0 A;  1IHW A;  3S6W A;  3PVQ A;  2WSF E;  1WFW A;  4M7D D;  4O5V A;  2DPP B;  2EQJ A;  2J7I A;  1TU0 B;  4J9B A;  2LCS A;  3E9F A;  1SEM A;  3EHR A;  3CXC S;  1VQL Q;  1Q7Y U;  1WXT A;  1WNL A;  2EFI A;  2XHC A;  3V7R A;  2D8H A;  3QG1 A;  4PLI A;  3THK A;  3LYI A;  4E2F B;  1YJN A;  2VAS A;  1OI1 A;  2DTO A;  2E10 A;  1ZA2 B;  2L2P A;  3GNG A;  5CKD A;  3QSU A;  2FPF A;  2O31 A;  3NFC A;  2LP5 A;  2EGC A;  4M75 F;  2E12 A;  2G3R A;  4RTV A;  2YLB A;  4FYY B;  4M75 A;  1Q82 U;  4PJO F;  3REA B;  2QI2 A;  1PSF A;  2LDM A;  3LWH A;  3G4S T;  3S3O A;  3RER A;  1AZG B;  5D6X A;  1VQ4 Q;  2YHT A;  1JJ2 A;  1KIK A;  1BYM A;  3OW2 A;  2LZ6 B;  1RAA B;  1F1B B;  2M9U A;  5GJW B;  4J9D A;  1NEG A;  2KQW A;  4BD3 A;  1JO8 A;  1N8R U;  4MZM A;  2L3R A;  4EIK A;  1LPL A;  4LXC A;  5DLQ E;  2DYB A;  3X28 B;  3PMT A;  5ECA A;  4PJO B;  1LJO A; 
#chains in the Genus database with same CATH homology
 2DRM A;  5IHK A;  1WX6 A;  1UJY A;  4GBQ A;  2JTE A;  2DL3 A;  4F16 A;  2DJQ A;  2CRE A;  2JMC A;  1TUD A;  1G83 A;  2ABL A;  2CUB A;  1YN8 A;  3VS5 A;  4J9E A;  1H92 A;  1ZUK A;  1W6X A;  2KRO A;  4ZNX A;  2LJ0 A;  1T3S A;  3QWY A;  5IXB A;  3VS1 A;  1A0N B;  3TSW A;  3H41 A;  1AWW A;  1ZUY A;  4R0K A;  2ROT A;  2CDT A;  1SHF A;  1VYT A;  2AZS A;  3M0R A;  2L3P A;  2JT4 A;  1JU5 C;  1QWF A;  3M0T A;  1K4U S;  2CH4 W;  4HVV A;  4LUD A;  1UDL A;  1TUC A;  3SEM A;  3KFV A;  1NLP C;  3PVL A;  2LQW A;  3U23 A;  2VVK A;  2XMF A;  1T0H A;  4RTX A;  4AG1 C;  2JM8 A;  3VS3 A;  2ECZ A;  2J6F A;  2OI3 A;  3EG2 A;  4OMN A;  4E6R A;  4KRT A;  1W1F A;  2AZV A;  2DBK A;  4Z89 A;  1S1N A;  1H8K A;  3H0F A;  3VRZ A;  3QWX X;  1N5Z A;  1NYF A;  2PZ1 A;  3M0P A;  2KT1 A;  3EHQ A;  1YCS B;  3UA7 A;  2V1Q A;  4RTU A;  2GGR A;  1CKA A;  1X43 A;  5I22 A;  1WXU A;  2I0N A;  4J9G A;  2JS2 A;  1LCK A;  4DEX A;  4JZ3 A;  4HVU A;  2RQW A;  3M0U A;  2FEI A;  1W70 A;  2LJ1 A;  2DL7 A;  2HBW A;  2EYY A;  1GBQ A;  2YUQ A;  4CC3 A;  1AWJ A;  2AKL A;  3REB B;  1K76 A;  1SSH A;  1SPK A;  2KGT A;  2KXC A;  2DBM A;  4HCK A;  1QWE A;  3VS2 A;  2K79 A;  1M3B A;  2V1R A;  1T0J A;  1K0S A;  2JXB A;  1BK2 A;  2EYW A;  1PKS A;  3IQL A;  3NHN A;  3H0H A;  2EKH A;  4JJC A;  4JJD A;  2KNB B;  1BB9 A;  1PRL C;  1RLQ C;  1UJ0 A;  1Z9Z A;  1OPL A;  4X1V A;  5L23 A;  1QCF A;  1RI9 A;  5IXF A;  2CSI A;  1NYG A;  2EVR A;  4JJB A;  2D0N A;  2JW4 A;  1SHG A;  2J6O A;  1K9A A;  2A28 A;  4WCI A;  1E7O A;  1WXB A;  1UHC A;  4RTW A;  4AFQ C;  4LN2 A;  1WI7 A;  2GTO A;  1JXM A;  1WDX A;  1Z9Q A;  1JQQ A;  2LJ3 A;  1HD3 A;  1GCQ C;  1OOT A;  2DL5 A;  4OMM A;  1EFN A;  2O88 A;  2NWM A;  2MIO A;  1UE9 A;  2AKK A;  3EG1 A;  5IHI A;  3UA6 A;  2ROL A;  1BBZ A;  1ARK A;  1ZUU A;  2X3W D;  3VS4 A;  2ENM A;  1YP5 A;  1YWO A;  5I11 A;  2DM1 A;  1ZLM A;  4OMO A;  2YUN A;  1B3Q A;  2L3S A;  3TVT A;  4OMP A;  3C0C A;  4F17 A;  1M3A A;  2KEA A;  2SEM A;  5IH2 A;  1GFD A;  1WLP B;  2L0A A;  1X6B A;  1K1Z A;  1KJW A;  2NUZ A;  2O9V A;  3VS6 A;  4HXJ A;  2C0O A;  1OV3 A;  4FSS A;  1E6G A;  2KR3 A;  1RUW A;  2KYB A;  1KSW A;  3UAT A;  1WIE A;  4GLM A;  1ABQ A;  2YDL A;  1AVZ C;  2A37 A;  2DL8 A;  3EG0 A;  3TSZ A;  1GCP A;  3VRY A;  2BZX A;  2JS0 A;  2RNA A;  2VWF A;  1BU1 A;  1RLP C;  1X2K A;  2EPD A;  5GJV B;  1SRM A;  1ZX6 A;  2FRY A;  4ORZ A;  4AG2 C;  1K0X A;  2J06 A;  1MV0 B;  2YUO A;  2OAW A;  2RMO A;  1YNZ A;  1NG2 A;  1UFF A;  2DF6 A;  1AWO A;  1PHT A;  2F2W A;  1WYX A;  1Y0M A;  4RUG A;  2M51 A;  2CH4 A;  2DX1 A;  3I9Q A;  1M30 A;  3ULR B;  3ZL7 C;  2EYZ A;  3RBB B;  3A98 A;  3M0S A;  4CC4 B;  2DIL A;  2EGE A;  5EC7 A;  2GQI A;  4LE9 A;  1UGV A;  2D1X A;  1PNJ A;  2D8J A;  2KBT A;  2GBQ A;  4J9H A;  4AFS C;  2A08 A;  1GL5 A;  1VA7 A;  2CUD A;  2CSQ A;  3GBQ A;  1ZBJ A;  1OEB A;  2HSP A;  4HVW A;  2AK5 A;  2F2X A;  2X3X D;  1H3H A;  2ESW A;  2L3Q A;  3I5S A;  1UEC A;  1UTI A;  4JPB W;  3JV3 A;  2B86 A;  2MOX A;  1AOJ A;  1T3L A;  1YWP A;  4J9I A;  1X6G A;  1JEG A;  1FYN A;  5FWC A;  4Z8A A;  4IIM A;  1PWT A;  3EGU A;  2EBP A;  1J3T A;  1SRL A;  3I35 A;  5HCK A;  4AFU C;  4JZ4 A;  1PKT A;  1UHF A;  2RQT A;  3NGP A;  2HCK A;  1IO6 A;  1KFZ A;  2RQU A;  1Y57 A;  4J9C A;  1V1C A;  2FPD A;  1AEY A;  1AD5 A;  2FPE A;  4K11 A;  2P4R A;  2EYX A;  4AFZ C;  2RQR A;  1MV3 A;  4OMQ A;  2MCN A;  1UG1 A;  2KRS A;  3VS7 A;  4CC2 A;  2K2M A;  2RQV A;  2A36 A;  3UF4 A;  2K7A A;  4QT7 A;  1U5S A;  1UUE A;  2ED0 A;  1X2Q A;  1AWX A;  2GTJ A;  4F14 A;  3RNJ A;  5FW9 A;  1GRI A;  2BTT A;  1GBR A;  2J6K A;  2YUP A;  2YT6 A;  3M0Q A;  1NM7 A;  2OJ2 A;  1GCQ A;  2FO0 A;  1X27 A;  1QLY A;  1E6H A;  1ZSG A;  2KRM A;  2DMO A;  2KE9 A;  2RF0 A;  2SRC A;  1QKX A;  1NEB A;  2KRN A;  2DA9 A;  1I0C A;  3FJ5 A;  4IIO A;  2PNI A;  4Z88 A;  2BZY A;  4RTY A;  1QKW A;  1WA7 A;  2DRK A;  2K6D A;  2LX7 A;  1XOV A;  3NPF A;  4D8D A;  1CKB A;  1I1J A;  2G6F X;  3LH5 A;  3EG3 A;  2FG0 A;  2GNC A;  3CQT A;  1U3O A;  2CT3 A;  5FWB A;  2DE0 X;  3PE0 A;  2C0I A;  3PVQ A;  1VYV A;  2KYM A;  2M0Y A;  2O9S A;  4RTZ A;  1OPK A;  1WFW A;  2FRW A;  2J05 A;  4ESR A;  1ABO A;  1TG0 A;  2J7I A;  4J9B A;  2LCS A;  1G2B A;  3H0I A;  5IHN A;  1SEM A;  3EHR A;  1I07 A;  1WXT A;  3R6N A;  1AZE A;  1B07 A;  1NLO C;  1M8M A;  4D8K A;  2D8H A;  3THK A;  2HEQ A;  2IIM A;  3NMZ C;  4RTT A;  2RN8 A;  1MUZ A;  4OML A;  2L2P A;  2DVJ A;  3VS0 A;  2RPN A;  2FPF A;  2JMA A;  2O31 A;  2LMJ A;  2LNH B;  3O5Z A;  2LP5 A;  2EGA A;  4LNP A;  2EGC A;  2EW3 A;  4RTV A;  1X69 A;  3I5R A;  2F2V A;  2KT8 A;  3REA B;  1PRM C;  3SHW A;  1GFC A;  2LQN A;  2C0T A;  2CT4 A;  2DL4 A;  1M3C A;  2K9G A;  4A63 B;  2DNU A;  1AZG B;  2O2O A;  1CSK A;  2PTK A;  1KIK A;  1HSQ A;  2LZ6 B;  2DLP A;  4DEY A;  1U06 A;  1VYU A;  2W0Z A;  5GJW B;  4CC7 A;  4J9D A;  2YSQ A;  2KXD A;  1NEG A;  2BZ8 A;  2QDL A;  1JO8 A;  1M27 C;  4M4Z A;  2W10 A;  4Y92 A;  2ED1 A;  2K3B A;  4EIK A;  4J9F A;  2VKN A;  4LUE A;  1HJD A;  2JM9 A;  2H8H A;  2DYB A;  1JXO A;  5ECA A;  2EQI A;  2HDA A;  2E5K A;  1FMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...