1AWWA

Sh3 domain from bruton's tyrosine kinase, nmr, 42 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
GSMSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRUTON'S TYROSINE KINASE
publication title Solution structure of the SH3 domain from Bruton's tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 5
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awwA00
1AWOA 3EG0A 1XOVA 1BU1A 2YUQA 1X2KA 2JXBA 1UTIA 2KYMA 1K0SA 5GJVB 1AVZC 1ARKA 4QT7A 1X27A 2CT4A 2CT3A 2DRKA 5HCKA 2V1QA 4F16A 4J9DA 1AOJA 3I5SA 4AFQC 4F14A 2ROTA 1FYNA 1MV3A 2DL8A 4Y92A 1UECA 3UF4A 4LN2A 1ZUKA 2SRCA 4HCKA 2CUDA 1AWWA 2LP5A 2XMFA 1CSKA 1UUEA 2DX1A 1WIEA 2KEAA 2PNIA 2YUNA 4LE9A 2J7IA 4D8KA 2F2XA 1QWEA 2AKKA 4RUGA 3TVTA 1HD3A 2A08A 2KT8A 3UA6A 2PZ1A 4AFZC 2FG0A 1U06A 2AK5A 2DL7A 2FEIA 3VS3A 4CC4B 1JQQA 2ABLA 2K2MA 4RTZA 4J9EA 2YUPA 2KGTA 2YDLA 2EPDA 2A28A 1K0XA 1GCQA 2H8HA 4AFUC 1YP5A 3NGPA 2FPEA 4F17A 4FSSA 1M27C 1SRMA 2NUZA 1VYVA 1ABQA 2EYWA 2RQVA 4RTXA 4WCIA 1AZGB 2JM9A 2AZVA 1T3LA 2DRMA 2SEMA 2O31A 1RLQC 1OOTA 2FPFA 2GTJA 2EGAA 1WXUA 3NPFA 2E5KA 3QWXX 4DEXA 2HEQA 3EHQA 4OMOA 1I07A 1H8KA 4K11A 2J6FA 1ZUYA 2L2PA 2DMOA 4J9GA 3VS1A 1KFZA 1E6HA 1WI7A 2GBQA 2AKLA 1J3TA 2DYBA 2RF0A 1H3HA 3PVLA 2K7AA 2G6FX 3NHNA 2FO0A 4ZNXA 5L23A 3U23A 2BZXA 5IXFA 3VS6A 1WDXA 2LJ0A 1PKTA 1K1ZA 2PTKA 3R6NA 3ULRB 2W0ZA 2MIOA 2CDTA 1KSWA 2EVRA 1YWOA 1KJWA 1SRLA 2L3PA 1GFCA 1HJDA 1M3BA 1GRIA 2KNBB 3EGUA 3I9QA 1TUDA 3SHWA 2DVJA 1UJYA 2K79A 2MCNA 1GL5A 4KRTA 1UJ0A 3EG1A 4JJCA 2O2OA 2EQIA 3NMZC 4HXJA 1AEYA 2M0YA 5FWBA 1ZX6A 2MOXA 1SEMA 1GBQA 1SHFA 1WA7A 2CH4W 1QLYA 1VYUA 1NLOC 1G2BA 2EYZA 3KFVA 2J06A 4RTYA 3C0CA 3TSWA 2O88A 3VS5A 2JS2A 4RTVA 2RQWA 1PRLC 4HVVA 3REBB 2ED0A 2L0AA 2YSQA 1FMKA 1ZSGA 4R0KA 2GTOA 2D1XA 1JU5C 2P4RA 1MUZA 2ESWA 1UGVA 2JS0A 4CC2A 2DJQA 2O9SA 2DL5A 3RBBB 1UG1A 1YN8A 1JO8A 2VWFA 2KE9A 2VVKA 3M0QA 2HBWA 3A98A 3REAB 2K6DA 2GGRA 1IO6A 4HVWA 1TUCA 1N5ZA 1U5SA 2OAWA 2DBMA 1BK2A 3IQLA 1VA7A 1AD5A 2CUBA 1OV3A 1QKWA 5GJWB 1AZEA 2CSIA 2EYYA 2KROA 2KR3A 1JXMA 2ECZA 2K9GA 3H0FA 1ZBJA 1QCFA 2C0TA 2EBPA 4LNPA 1SHGA 3LH5A 2JT4A 3CQTA 2KRSA 1WYXA 1M3CA 2RMOA 2K3BA 5IHNA 4JZ4A 1M8MA 4JZ3A 2C0IA 2F2WA 1YWPA 2JMCA 2DM1A 4JJDA 5IHKA 1B07A 2JTEA 4JPBW 1QWFA 4OMPA 1E7OA 4JJBA 1I0CA 1M30A 2D8HA 1WFWA 2C0OA 1X6BA 3JV3A 1W70A 2I0NA 3PVQA 2DE0X 5IXBA 2DF6A 1OPKA 1T3SA 2EYXA 2RPNA 3RNJA 1KIKA 1K76A 1UDLA 4OMNA 3FJ5A 2ED1A 1T0HA 1JEGA 4CC7A 2JM8A 2YT6A 4LUEA 2RNAA 2KT1A 1ABOA 2LX7A 2A36A 2EGCA 2KYBA 2DA9A 2J6KA 1UHFA 4OMLA 1K4US 2LQWA 1PRMC 1UFFA 1YNZA 4AG2C 1NYGA 4D8DA 3VS0A 2OI3A 4J9HA 1AWXA 2OJ2A 4Z89A 2FRYA 2LCSA 2ROLA 4ESRA 3M0PA 3SEMA 1NYFA 2DL3A 1WLPB 2M51A 2X3XD 1B3QA 2LZ6B 1JXOA 1QKXA 1BBZA 3ZL7C 2CREA 2KXCA 5I22A 2JMAA 1PKSA 5EC7A 4RTUA 1G83A 5FWCA 2DNUA 1V1CA 2W10A 2BZYA 3PE0A 1BB9A 1NG2A 2BTTA 1ZUUA 2ENMA 2AZSA 1E6GA 3VS7A 1CKAA 3H41A 3UATA 2RN8A 4AFSC 4EIKA 2GQIA 3EG2A 1PHTA 1UHCA 4CC3A 2DL4A 3THKA 1CKBA 5ECAA 3TSZA 1OPLA 1RUWA 3H0HA 1RLPC 2YUOA 3VS4A 2NWMA 1PWTA 2CH4A 2J6OA 2D0NA 4RTWA 5IH2A 4Z88A 1I1JA 1WX6A 4ORZA 3VS2A 1T0JA 1GCPA 2RQTA 1A0NB 2EW3A 1VYTA 2LMJA 1U3OA 2A37A 4X1VA 3VRZA 2DILA 2HDAA 1S1NA 1WXBA 2KRMA 2EGEA 4J9CA 1SSHA 2J05A 4A63B 4IIOA 2LNHB 1Y0MA 2DLPA 1WXTA 2CSQA 2HSPA 2FRWA 2FPDA 2KRNA 4J9IA 2GNCA 3GBQA 2LJ1A 1GBRA 4E6RA 1YCSB 1TG0A 2D8JA 3I5RA 3M0TA 3QWYA 3VRYA 4IIMA 4J9FA 1PNJA 3H0IA 2B86A 2DBKA 3EHRA 4M4ZA 2QDLA 2O9VA 1W6XA 2L3SA 2LJ3A 4AG1C 2X3WD 2LQNA 3M0UA 2RQRA 1NEGA 1GFDA 1MV0B 1EFNA 4RTTA 3I35A 1X43A 4HVUA 2JW4A 2HCKA 4J9BA 2EKHA 1K9AA 1LCKA 1H92A 3O5ZA 2KBTA 1ZLMA 2F2VA 1M3AA 5FW9A 4OMQA 4Z8AA 1SPKA 1Y57A 3M0SA 2IIMA 1GCQC 1UE9A 1X6GA 3EG3A 2V1RA 1AWJA 2L3QA 1HSQA 1X69A 1NLPC 3M0RA 4DEYA 4LUDA 4GLMA 1NEBA 5I11A 1RI9A 2VKNA 2RQUA 2BZ8A 1W1FA 2KXDA 1NM7A 1X2QA 5IHIA 1Z9QA 4OMMA 1Z9ZA 3UA7A 4GBQA 1OEBA
chains in the Genus database with same CATH superfamily
3EG0A 4FM4B 1BU1A 1R0CB 2JXBA 3QJ6A 1OZ3A 1M2OA 2LRQA 4LD6A 1YI2T 4BI4A 1YITQ 4JS5A 2ZPBB 4L6V5 1KD1U 1VQ7A 1IXDA 1AHJB 2V1QA 2CZ0B 1KQ2A 5C0MA 4M7AC 1TOVA 3CCLT 4XAXB 4E7JA 2JUFA 4PJOB 2DL8A 3L2ZA 2A3LA 2E41A 2SRCA 1X6OA 1G3YA 3EH1A 3G6EA 4MDXA 4PNOA 1FMWA 4HT8A 2BKDN 4QQDA 1Q82R 4KUIA 2QQSA 4M7DF 1WIEA 2RHIA 2RH2A 4XU0A 2GFAA 2YUNA 2J7IA 3X26B 4OGCA 4F7UG 2F2XA 3PMIA 2AKKA 1HXDA 3CC2A 3TVTA 1UGSB 3CCMT 2DVEA 2BUDA 2DL7A 2DKGA 4M75E 4OB2B 4CC4B 2LT4A 1JQQA 2K2MA 4J9EA 4FIBA 1VQ4T 1S72T 2YDLA 2GFUA 1K0XA 1GCQA 1YP5A 3NGPA 3CPWS 1M27C 2NUZA 2RQVA 1KHCA 1VQNA 4RTXA 3M59A 2V26A 2JM9A 3CCET 2AZVA 2DK3A 4LDXA 2O31A 4YTLA 5KYYA 2GTJA 3LWIA 5GAN2 2E5KA 3G71A 5A0GA 2LQKA 5KYWA 2OX7A 1KFZA 3RKYA 3E1SA 3SDZA 2GBQA 2AKLA 2V8IA 4ELZC 2FHDA 3NHNA 2G6FX 5AT1B 4ZNXA 2F5TX 3SD4A 1M90C 4M7AA 1WDXA 3O8VA 2H3JA 5FU6C 5LJ3h 2PTKA 3ULRB 1Y71A 4M77F 4BB7A 2L3PA 4M77B 3HTRA 1M3BA 1Q7YU 1GRIA 2KNBB 2FZCB 4J7FA 3VUBA 4M78G 4F04B 2K79A 1JRIA 1GL5A 3JCMW 4JJCA 4FYVB 3NMZC 4C8QF 4HXJA 1AEYA 2M0YA 4PJLA 1QMCA 1ZX6A 3VKIA 1GXIE 1RADB 1WA7A 1VYUA 3MP8A 4XTWA 1YJWT 3TSWA 2O4XB 4DBHA 4ZTFA 3GF5A 2E4HA 3REBB 4MMKA 1ZSGA 5FRNA 5GANe 4R0KA 2CS7A 3CD6T 4Q5WA 1MMDA 2ESWA 1UGVA 2RA2A 3LW5E 2DL5A 3RBBB 1UGRB 1JO8A 5CKEA 4DOWA 3M0QA 4M7DE 2XHCA 3REAB 5I21A 2K6DA 4BY6C 4R55A 5GMKj 1TXQA 2OAUA 1N5ZA 3CC4T 1BK2A 3IQLA 1D3BA 4A53A 1AD5A 3MO8A 1G3TA 3JCMQ 2RHXA 2PQWA 1AZEA 2EYYA 1C1AA 5CQXA 5DY9A 2EBPA 1NJIC 2JT4A 3QIIA 4Z02A 3RIRA 4FYYB 2KRSA 4IURA 4PLIA 1WYXA 1XNIA 2DXCA 2M02A 2RMOA 1KQSS 3E9GA 3EG9A 3QO3A 2LT1A 5IHNA 3CPFA 2CP6A 4M78B 1I5LA 3OSVA 3CMAQ 2M16A 3P8HA 2FYKA 2AHJB 2IG0A 1Q86C 1W2BP 1I4K1 3CMET 1IREB 1QWFA 3V7CA 2DXBA 1HYOA 5GAMh 3OS1A 3JV3A 1N8RR 1W70A 2I0NA 3FB9A 1U8RA 1WHLA 3VYHB 5I2SA 3CCLQ 2EYXA 3HP9A 2L3RA 8AT1B 4GY5A 1JJ2S 1Y96A 3CBPA 2HAXA 1G8XA 4FT4A 2KVQG 5KCHA 4CC7A 3LGLA 4KULA 1VQOA 3OYLA 3X28B 3HPWA 3CPWA 4C8QE 2DA9A 4AG2C 1UFFA 1B34B 4XTVA 4ANJA 1NYGA 4D8DA 2KMTA 4HCBA 3CCUQ 4J9HA 1AWXA 3ZFJA 4Z89A 5IAYA 1S72Q 4LDYA 2ROLA 1M90U 1WLPB 4NS5A 1BBZA 3JCMd 5CKBA 2P0KA 3CCEQ 4DOVA 2HL5C 1PKSA 3N5BB 3CCVT 2LVMA 4M77C 5FWCA 2W10A 4JS4A 4EMHA 2BTTA 4C5HA 3A1PA 4B9XA 4EMKA 3X20B 1VUBA 1CKAA 2VB6A 1I8FA 3UDCA 3OMGA 2E10A 3PIOA 1BI2A 2ZPGB 3MP1A 3EG2A 1UHCA 4C8QC 3THKA 5ECAA 3E2UA 1C0MA 1RUWA 3H0HA 2YUOA 4C92E 3I56A 5GAOm 4RTWA 2J6OA 2NUTB 2D0NA 4RG8A 1I1JA 1WX6A 4J5YA 1K73R 1T0JA 2L89A 2EW3A 1U3OA 1YIJT 3VRZA 1K73C 5LL6S 2EGEA 2ZPEB 4IIOA 3TU4K 2JOYA 4CI0C 1C6VX 2FRWA 3OSSC 4IUTA 3AHUA 1Q95G 2GNCA 3GBQA 1R77A 4NL3A 2EJGA 1QP3A 3OYNA 3JCMg 3ER0A 2PU9B 2PUOB 5LJ3g 4OB3B 4IIMA 4FL6A 3CCLA 1RI0A 2DBKA 5FRMA 4UC4A 1LVKA 4J8OA 1W6XA 3OYHA 1KD1R 4E7KA 2BE7D 2LQNA 1MV0B 1NJIU 4X9CA 3GPLA 3LH0A 1EFNA 2JVVA 3LGFA 3I35A 4M77A 3NTKA 2E65A 2EKHA 1YJ9Q 3O5ZA 3C94A 1ZLMA 3CC7T 1M3AA 3OYCA 1M1GA 1VQPT 1N9RA 4M7AD 2IIMA 3CCMA 4WF2A 5D7UA 4FSXA 1QP2A 5GAOn 1Q86U 1NLPC 4C8QA 3M0RA 1VQ4A 1S72A 4A4EA 2Y4XA 2CP0A 1NEBA 3EFSA 4EMGA 3QXEB 3META 2RQUA 3A8HB 2BZ8A 2R58A 2EJFA 2KXDA 2DEQA 3PNWC 4OMMA 3ME9A 2XDDA 3JB9F 3MEVA 3CCEA 3PFSA 2RM4A 2YUQA 2NYSA 1UTIA 1K0SA 2E6ZA 1KQ1A 5GJVB 2MMPA 1ZSZC 1FXXA 4FYWB 4VUBA 2EQJA 5GAOl 2JN0A 2CT3A 5GMKm 2HL3A 5HCKA 1VQ7Q 1MNEA 1FWZA 3S6WA 3C95A 2ROTA 4P5NA 1FYNA 1MV3A 4Y92A 1JJ2A 3UF4A 1ZUKA 3MEUA 4HCKA 2CUDA 4DBQA 4BE2A 1UUEA 2RI2A 2JNGA 1MMGA 4C5IA 2HNIA 3RUXA 1O75A 5CIUA 4KBMB 4ME7A 1X01A 1XJWB 1PC0A 4D8KA 4II1A 5GAOq 4MZPA 9ATCB 3CCQT 2A08A 2KT8A 3CC2Q 2PZ1A 2RJCA 2H3EB 2AK5A 4M75F 2PVOB 2FEIA 3VS3A 1RAIB 2X4XA 4RTZA 5CR2A 4C0DB 2YUPA 2K5IA 4M75B 4HT9A 1WJRA 5GMKi 2A28A 2CP2A 2L5QA 2RB6A 2FPEA 1VYVA 2EYWA 1Q7YR 3A8MB 2OTJT 1VQNQ 1IZ6A 4J83A 5KCOA 2SEMA 1YJWA 2WSCE 5LJ5g 4E7HA 2EGAA 2YLBA 3NPFA 1WQ7A 4K11A 2PVDB 4M7DG 1ZUYA 3Q1JA 1VOMA 2DMOA 1ZSZA 4N0AC 1JBMA 1J3TA 2DYBA 4Y28E 3RKXA 2BIVA 3CCVQ 3TQ7P 2VYTA 3OYEA 5IXFA 1K73U 3VS6A 3J81E 2RJFA 3EH2A 2LJ0A 2XDBA 4AT1B 4MMLA 1Y96B 2MIOA 5GMKl 2CDTA 1KSWA 1MGQA 1G3WA 1OU9A 1SRLA 3CXCP 5M9OA 1GFCA 1IHVA 1B34A 3EAEA 1TUDA 2XD0A 2CP3A 4OMFB 4BY6B 5I2MA 5CO7A 2QEXT 3CCST 4KRTA 2O2OA 4N4GA 2XKOC 5FWBA 5DM7R 2XICA 3OMCA 1SEMA 2OTLT 1PCXA 4XU2A 1SHFA 1YIJQ 3MKDA 4GLKA 1G2BA 1YHQQ 2J06A 1WHJA 3QUIA 1Y7XA 4FCYA 1ZA2B 2K57A 4NOYA 1LNXA 4M77G 4HVVA 3CMEA 2YSQA 1R0BG 2DZCA 1ACMB 2JTMA 4OB0B 4ZGDB 2D1XA 1JU5C 3ZBDA 4PJOD 4CC2A 2HQHA 4JUVA 1UG1A 4KH0B 4N0AA 1W2BS 2KE9A 2HBWA 2LQ8A 2CGHA 2EQKA 4C8QG 4EMKB 4M7DB 4JJNK 4DQ2A 3OYMA 1IO6A 4C0FA 3HHTB 1BCMA 2NUTA 5DLOA 2DBMA 2M9UA 3ASKA 3CC7Q 2QYZA 5GJWB 2JZ2A 5IT9E 1BI3A 1KK7A 1VQ6T 2KROA 1JXMA 5CK9A 3H0FA 3LH5A 4IUVA 4C5EA 4AMCA 3QSUA 2HKNA 2QTXA 5GAMe 1WJQA 4JZ4A 2R57A 3OW2A 3GNGA 5J3BA 1YWPA 3GIBA 3X25B 2RO0A 2F69A 2COZA 5IHKA 1B07A 3VJPA 4BI3A 4JPBW 3A8OB 2QGGA 3NFCA 3CCVA 1M90R 4MZMA 1TTHB 4MDWA 2DJZA 4ZGEB 1M9SA 2CYZB 3VUZA 3JCMh 5HK3A 4BACA 2Y90A 2EWNA 1ZBXA 2HMAA 4C0DC 2CP7A 4M75C 2RPNA 3RNJA 4OMNA 4C0ZA 4BDYA 2ED1A 1T0HA 4JRPA 2JM8A 3L2QA 2A7YA 3JCMX 2QA4T 2QK0A 2QXFA 4M77D 7AT1B 4KGXB 3EGDA 1VQOQ 3OS0A 1UHFA 4J7IA 1QCNA 2LQWA 3CCQQ 1D0XA 2LTOA 4C8QB 1MHNA 1OX8A 3VS0A 1YIJA 3MEAA 3J80E 2OJ2A 4IKFA 3SWNC 2ZCFB 1YHQA 1YCYA 2QQAA 1MMNA 3RMSA 4D6WA 1TU0B 1K9MC 3PMTA 2DL3A 2M51A 2X3XD 1B3QA 2LZ6B 3R6OA 1UGPB 5CKFA 4J6XA 1KC8C 3L2RA 5I22A 1RABB 2KK4A 1QVGA 1VQ5T 5EC7A 3FDRA 1G5VA 1G83A 4ELYC 2DNUA 2BZYA 4PJOE 1M1KC 2YWWA 1NG2A 2RJDA 3I55T 1E6GA 5KE2A 4OF1A 2RN8A 2GQIA 2RD1A 3NTIA 3CC7A 1PHTA 4CC3A 2DL4A 1VQPA 4M75A 2EFIA 3TSZA 1NJIR 4C92F 2HKQB 1RLPC 1PWTA 1IB8A 2DIGA 2P4TA 4C92B 3I56Q 3VS2A 3FRNA 2LMJA 3EFRA 2A37A 3L42A 4KGVB 1KG1A 4FW2A 1S1NA 2E6NA 2QEXQ 2HQEA 5HKCA 2LNHB 1Q86R 1QQJA 2DLPA 4OVAA 1WXTA 2CSQA 2OTLQ 1D09B 2COYA 4M78D 3SWNA 1YI2Q 3E9FA 1HK9A 1D1BA 1TG0A 3G4ST 4EMKC 4M7DC 3QWYA 3VRYA 1PD0A 4E7IA 5LJ5h 1U1TA 3OY9A 4J9FA 1ZSZB 2B86A 1W2BA 4J6WA 2QDLA 2O9VA 2ATCB 3M5AA 2F5KA 2L3SA 2LJ3A 4AG1C 1YJNT 2X3WD 1NEGA 1EX4A 1M5Q1 1X43A 3KXTA 2HCKA 4J9BA 3BFMA 3UT1A 1LCKA 2KDSA 4Z8AA 2QQRA 1Y57A 4XTUA 5HY6A 3CCQA 1I5OB 4O6JA 3CCMQ 2V1RA 3LWHA 4XTXA 2DZ9A 2WSEE 2L3QA 2X35A 3M4GA 1K8AC 4PJNA 4E2FB 2RHZA 5I11A 1VQ4Q 3OYJA 4ZN3A 1VQ6Q 2DAQA 1Z9ZA 2PVGB 1WZOA 3UA7A 2VC8A 1PM3A 2OTJA 4F7UE 3CCRT 4A54A 1X2KA 2YXYA 4PFPA 1AVZC 1UEBA 3RERA 1X27A 2ZPIB 5A0LA 2DFUA 2CT4A 4LD9K 4F16A 3RKWA 4J9DA 1MMAA 1AOJA 2PUKB 4KUDK 4TVRA 4M7DA 2WSFE 3HKSA 3JB9J 4BDZA 1CSKA 4KH1B 1TWBA 2X4JA 5CVIA 3EFOB 2DX1A 1K9MU 3QZ9B 1QWEA 1Y07A 4IUPA 4RUGA 3OA6A 3JB9G 1V76A 2MYSA 2ZGWA 3CCJT 2AIRB 1KC8U 5IN1A 5KYXB 2QEXA 3CCSA 5J26A 2QA4Q 4BE0A 3V8JA 2CZ6B 1QVPA 3PT9A 3CXCS 3A8LB 4FSSA 2D6FA 1SRMA 2ZZDA 3M54A 1ABQA 1WHKA 3MP6A 5GAN3 2OTLA 3JB9H 2MAMA 1R8OB 1YI2A 1M1KU 4WCIA 1AZGB 1T3LA 1QW1A 4A4HA 2CKKA 1RLQC 1YITT 2KQWA 5GAMf 1YJWQ 1WXUA 3H6ZA 3HSBA 3QWXX 3EHQA 1I07A 2FL7A 1H8KA 5GAOp 4QVCA 2L2PA 1TSFA 4J9GA 2C06A 4PLLA 1LPLA 5GAMj 2VV5A 1E6HA 1WI7A 2KSSA 2VASA 3CD6Q 4M75G 2RF0A 3PVLA 2K7AA 2FO0A 3U23A 2BZXA 4C92C 1Q81C 1K1ZA 2L8DA 3R6NA 3I55Q 4JRIA 2RK2A 2LDMA 2EVRA 1RAAB 3OYAA 3KUFA 1YWOA 2NUPB 1VQKT 4M7AF 1SSFA 4KGZB 2DD5A 3CC4Q 1HJDA 2V8JA 3DB4A 3I9QA 3SHWA 1NPPA 1WGSA 3EGDB 1KQSA 1UJYA 1VQ6A 2MCNA 2DYIA 2X4YA 3EG1A 2G3RA 1ZQ1A 2K5FA 4LDVA 2RHUA 1GBQA 2DXUA 2RK1A 3A5ZB 1TUGB 8ATCB 1QLYA 5GAN8 1NLOC 3KFVA 4HCCA 1QVFP 4XTYA 3F70A 4JLIA 4HCZA 4E7SA 2O88A 4EDUA 5GAMd 2P0PA 3RR6A 1UGQB 1N6AA 2RQWA 4RTVA 1PRLC 2EKOA 3M57A 2HQXA 2BE9B 2L0AA 1VIEA 2KY9A 2X51A 3CMEQ 3G4SQ 5GANf 3PTAA 4XU1A 4XQ3A 1K8AU 5GAOr 2CP5A 2JS0A 2DETA 4RKUE 2DTHA 1YN8A 2VWFA 3C12A 2VVKA 1RAGB 3PIPA 5GANj 1TH7A 1YJNQ 2GGRA 2LC4A 1TUCA 1MNDA 4C92A 2KI7A 2QA4A 3TCJA 3H8ZA 3VYGA 2MPXC 3DKMA 2F1LA 1WHMA 1QKWA 3BE3A 3J7AF 3AT1B 4HA8A 5CAIA 2XU8A 4M75D 2HD0A 4CRIA 1ZBJA 1NPRA 3QYGB 2QI2A 2QG9B 2GCXA 2VXFA 1EIFA 2K2VA 2K3BA 5J39A 3V8LA 1M8MA 2RHYA 3JCMe 2E64A 1ZA1B 5LJ3e 1BIBA 3M53A 3CCRQ 3TEEA 3SWNB 2QQBA 5CCAA 3OYBA 1M2VB 3CD6A 3BW1A 1VQ5A 2D0QB 2JTEA 3LLRA 5CQYA 5KYNA 4JJBA 1I0CA 2D8HA 3FIFA 4RG2A 5GANd 3PVQA 3I55A 5IXBA 1OPKA 2QGFB 3V7RA 2V8KA 1K76A 1UDLA 3M58A 2DO3A 4PJJA 3CC4A 3INZA 1VQMT 1OYXA 2LX9A 3HL8A 4M7AE 3V8KA 2RNAA 1ABOA 2A36A 2EGCA 4WTOB 2X4WA 2KYBA 4OB1B 4OMLA 1K4US 1RAEB 3MJXA 3DB3A 2E3HA 3CCJQ 2OI3A 2KAFA 2EQUA 2FRYA 3S3NA 4JRQA 2LCSA 4KT0E 4BE1A 1NE8A 1PG5B 2YRVA 3H9NA 3QPHA 1NYFA 4NL2A 4BD3A 1ZHIA 1Q81U 3CMAT 2FB7A 2P0QA 1QKXA 3G4SA 2FZGB 2KXCA 3EGXA 4DBRA 3GP8A 2EAYA 2GQVA 2JJ9A 3EFOA 4PJOF 3TREA 1YJNA 1H3ZA 2EQMA 2ENMA 2AZSA 3VS7A 5GANg 2X9HA 3UATA 5D6XA 5CKHA 4AFSC 2MK5A 1VQLT 4M7DD 2D9TA 5GMKh 5CKDA 1CKBA 5KYXA 3JCMb 1VQPQ 1OPLA 4FU6A 4JRKA 3SFMA 1Q82C 3VS4A 3OBYA 1VQKQ 3JCMc 5FROA 2A0FB 1OQKA 5KYUB 4Z88A 2B8AA 3HRUA 1M1FA 1GCPA 2RQTA 2E70A 2DIQA 4E7ZA 1FX7A 3CCUT 2CZ1B 1RAFB 2DILA 3FJPA 2HDAA 1WXBA 4L5GA 4DBFA 2KRMA 4ATOA 3OYGA 3GOXA 5LJ5e 3CCRA 2E1HA 4FW1A 2HSPA 2FPDA 3OYIA 1VQ8T 1GBRA 1VQ9T 3OW2P 2D8JA 3I5RA 3DLMA 3M0TA 1B7TA 3G7ZA 1O9SA 2Y4YA 1PNJA 3H0IA 1N9SA 2K3YA 4M4ZA 4C92G 4OGEA 1YFNA 1GFDA 2RQRA 3QYHB 2NUPA 5L8RE 2AT1B 4HVUA 2JW4A 3QZ5B 3JCMV 3C4SA 1IGQA 4QVZA 2F2VA 4QKUA 4QVDA 1SPKA 3M0SA 2ZPFB 2XK0A 1AWJA 3CCJA 3QKJA 5HK0A 1X69A 4ZGJB 4LUDA 4GLMA 1K9MR 2VKNA 4C8QD 3MCAB 1W1FA 5IHIA 1X2QA 3JB9I 4FYXB 3SB2A 4ZN1A 2DTOA 4F7UF 4EPCA 1AWOA 1KC8R 1XOVA 2OTJQ 2KYMA 5D6YA 3OBWA 4F7UB 1SF9A 1YITA 1BI0A 4QT7A 1ARKA 1WQWA 3RESA 1NBEB 1OI1A 2DRKA 2QTVA 2E3IA 1M1KR 3GNFB 1QVGP 3I5SA 3CEYA 1FMVA 4AFQC 3L1AA 4F14A 4QQ6A 1P92A 5A0DA 1UECA 4LN2A 5AYFA 2XDPA 1AWWA 2LP5A 1U1SA 2LCCA 2MI6A 2XMFA 2EYQA 4BI8B 3OYDA 1PD1A 1YJ9T 3OQ5A 2KEAA 2PNIA 1VQKA 4LE9A 1H641 4PFZA 1VQMQ 3S3MA 1HD3A 2QASA 3VV0A 4AFZC 3UA6A 2FG0A 1U06A 2MWPA 2P84A 5FLXE 4PK4A 2ABLA 2VGNA 3URGA 2KGTA 4C92D 3CCSQ 2EPDA 3M55A 2H8HA 4AFUC 2IVWA 5C6SA 4F17A 4PKCC 4OP0A 4X34A 1YBYA 3P8BB 3HRTA 3QDFA 3MHXA 4QW2A 5KH6A 3PGGA 1M2VA 2DRMA 1XQHA 2FZKB 1OOTA 4M78F 2FPFA 4PJOC 4DEXA 2HEQA 3JCMf 4OMOA 1OU8A 1VQ7T 2J6FA 5LJ3f 5GAN7 1BCOA 2GF7A 1WNLA 1F1BB 3VS1A 2K3XA 1Q82U 1QVFS 4XK8E 4FT2A 3QG1A 5LJ3j 1H3HA 5L23A 4PL6A 1PKTA 2M0OA 1WHGA 3G6ET 3JRZA 1OX9A 2W0ZA 1N8RC 4RCCA 4M77E 3X24B 1K8AR 1KJWA 3FLGA 3OS5A 3RMQA 1VQLQ 3CC2T 3CPWP 3EGUA 1WHHA 2DERA 1V29B 1EZZB 2DVJA 1RACB 3UPUA 4IUUA 1UJ0A 3NTHA 5FU7B 2EQIA 3L2UA 2QDYB 5DLQE 2LCLA 5KE3A 2MOXA 1VQNT 2CH4W 2EYZA 2YLCA 1NZ9A 3LYIA 2RI5A 4RTYA 3OS2A 3C0CA 1BIAA 3G71T 3VS5A 2JS2A 3GLXA 3CBMA 1VIFA 1VQ8Q 3G1JA 3QJYA 2ED0A 1VQ9Q 3EGXB 5LJ3d 2DD4A 4M7AG 4PJOA 1FMKA 3KBGA 2GTOA 2CZ7B 3MEWA 2P4RA 1MUZA 4L59A 4PJMA 3VU3C 2DJQA 2O9SA 3JAME 4E47A 1XTDA 3A98A 3JCMP 3BDLA 1VQMA 4HVWA 3FEOA 3L2WA 1U5SA 2DTIA 5KYUA 2OAWA 5GANh 2IPOB 1VA7A 2CUBA 1OV3A 2YRCA 5A2QE 3FC3A 3QDRB 2WACA 2CSIA 2VXEA 2NLUA 1RL2A 1IGUA 2KR3A 2XG8D 2K9GA 2ECZA 4Y91A 4LNPA 1QCFA 2C0TA 1SHGA 1KHIA 3CQTA 2DEUA 3BY7A 1LJOA 2FVUA 3QBYA 1JB0E 1M3CA 4R56A 3OYFA 4M78E 4BUGA 4RMOA 3CMAA 5LJ5f 4XTZA 4JZ3A 1YHQT 3L2VA 2C0IA 2I2LA 3RDVA 3S3OA 4ZTJA 2F2WA 2XIDA 2JMCA 1OZ2A 2RJEA 2DM1A 2MWOA 4JJDA 5LJ5j 1M8VA 5KYYB 2HZYA 4MZTA 4RCBA 3HFNA 4OMPA 1VQ5Q 1E7OA 2O01E 1M30A 1Q81R 2HSEB 5KYWB 1WFWA 2C0OA 1X6BA 4B6MA 3E19A 3HFOA 3OB9A 2DE0X 1BYMA 2DF6A 1T3SA 1KIKA 1VQLA 3FJ5A 3OYYA 2EJ9A 4QQGA 1KD1C 1JEGA 4M7AB 1TS9A 4PFOA 2YT6A 4B9WA 4LUEA 1SKUB 5GAN5 2DXTA 2KT1A 2LX7A 2JTFA 1X75C 3T9NA 2DPPB 2J6KA 1KQSP 1PRMC 1G3SA 1YNZA 3CCUA 3UWNA 1OULA 4M78C 2MF2A 3MPUB 4C5GA 4A4KA 1LOJA 4F7UA 3D7SB 3WXMB 4ESRA 4A4FA 3M0PA 3SEMA 3JB9D 1D1AA 2K5LA 3JSCA 6AT1B 1VQ8A 1JXOA 2O4XA 1VQ9A 5LJ5d 1N8RU 3ZL7C 4LDWA 2ZPHB 1QVFA 2CREA 1AT1B 3BDUA 3ZEHA 2JMAA 2COWA 1BI1A 1JJ2P 4RTUA 4LXCA 5GMKe 4IUQA 1PSFA 3OW2S 1V1CA 3PE0A 3M4YA 4N4IA 1BB9A 1PSEA 1ZUUA 4J6YA 3DLLA 5FU7C 2Z0WA 3H41A 4EIKA 3M56A 2M1HA 3G6EQ 1I81A 1VQOT 5D6WA 2NWMA 2E5QA 2RI3A 2CH4A 1D1CA 5IH2A 2HBPA 4ORZA 2ZAEA 1D3BB 1A0NB 3HRSA 1VYTA 3LX7A 1WPYA 2QQ9A 2K4YA 4X1VA 5FU6B 1RAHB 4C0GA 5GAN4 4DA4A 4J9CA 4HKEA 1SSHA 2J05A 1IHWA 4A63B 4N4HA 1Y0MA 1QCOA 4XU3A 4M78A 4PJOG 2VGMA 2KRNA 4J9IA 1W4SA 3OYKA 1Q7YC 2LJ1A 1N27A 2VUBA 3M9QA 1DJ7B 4E6RA 1M4ZA 3EG9B 5GAMg 1YCSB 2EIFA 2XI9A 3JCMJ 3G71Q 3A8GB 3QHSA 1UB4A 1SG5A 2YRDA 3EHRA 4JDSA 2R5MA 1BKBA 2LNVA 3M0UA 4LDUA 4X9DA 5EG2A 1QVGS 4RTTA 1YJ9A 3CBOA 1K9AA 1H92A 2KBTA 5FW9A 4OMQA 3CXCA 2YHTA 2E12A 1GCQC 1UE9A 1X6GA 3EG3A 3I56T 4E7LA 1HSQA 1IRXA 4DEYA 4A4GA 2QAZA 1RI9A 4JLGA 3V7SA 1D0YA 2R5AA 1NM7A 1WJSA 3WVEB 1Z9QA 5GAN6 4O5VA 3P8DA 1D0ZA 4GBQA 1OEBA 4V2SA 3WVDB
chains in the Genus database with same CATH topology
1AWOA 3EG0A 1XOVA 1BU1A 2YUQA 1X2KA 2JXBA 1UTIA 2KYMA 1K0SA 5GJVB 1AVZC 1ARKA 4QT7A 1X27A 2CT4A 2CT3A 2DRKA 5HCKA 2V1QA 4F16A 4J9DA 1AOJA 3I5SA 4AFQC 4F14A 2ROTA 1FYNA 1MV3A 2DL8A 4Y92A 1UECA 3UF4A 4LN2A 1ZUKA 2SRCA 4HCKA 2CUDA 1AWWA 2LP5A 2XMFA 1CSKA 1UUEA 2DX1A 1WIEA 2KEAA 2PNIA 2YUNA 4LE9A 2J7IA 4D8KA 2F2XA 1QWEA 2AKKA 4RUGA 3TVTA 1HD3A 2A08A 2KT8A 3UA6A 2PZ1A 4AFZC 2FG0A 1U06A 2AK5A 2DL7A 2FEIA 3VS3A 4CC4B 1JQQA 2ABLA 2K2MA 4RTZA 4J9EA 2YUPA 2KGTA 2YDLA 2EPDA 2A28A 1K0XA 1GCQA 2H8HA 4AFUC 1YP5A 3NGPA 2FPEA 4F17A 4FSSA 1M27C 1SRMA 2NUZA 1VYVA 1ABQA 2EYWA 2RQVA 4RTXA 4WCIA 1AZGB 2JM9A 2AZVA 1T3LA 2DRMA 2SEMA 2O31A 1RLQC 1OOTA 2FPFA 2GTJA 2EGAA 1WXUA 3NPFA 2E5KA 3QWXX 4DEXA 2HEQA 3EHQA 4OMOA 1I07A 1H8KA 4K11A 2J6FA 1ZUYA 2L2PA 2DMOA 4J9GA 3VS1A 1KFZA 1E6HA 1WI7A 2GBQA 2AKLA 1J3TA 2DYBA 2RF0A 1H3HA 3PVLA 2K7AA 2G6FX 3NHNA 2FO0A 4ZNXA 5L23A 3U23A 2BZXA 5IXFA 3VS6A 1WDXA 2LJ0A 1PKTA 1K1ZA 2PTKA 3R6NA 3ULRB 2W0ZA 2MIOA 2CDTA 1KSWA 2EVRA 1YWOA 1KJWA 1SRLA 2L3PA 1GFCA 1HJDA 1M3BA 1GRIA 2KNBB 3EGUA 3I9QA 1TUDA 3SHWA 2DVJA 1UJYA 2K79A 2MCNA 1GL5A 4KRTA 1UJ0A 3EG1A 4JJCA 2O2OA 2EQIA 3NMZC 4HXJA 1AEYA 2M0YA 5FWBA 1ZX6A 2MOXA 1SEMA 1GBQA 1SHFA 1WA7A 2CH4W 1QLYA 1VYUA 1NLOC 1G2BA 2EYZA 3KFVA 2J06A 4RTYA 3C0CA 3TSWA 2O88A 3VS5A 2JS2A 4RTVA 2RQWA 1PRLC 4HVVA 3REBB 2ED0A 2L0AA 2YSQA 1FMKA 1ZSGA 4R0KA 2GTOA 2D1XA 1JU5C 2P4RA 1MUZA 2ESWA 1UGVA 2JS0A 4CC2A 2DJQA 2O9SA 2DL5A 3RBBB 1UG1A 1YN8A 1JO8A 2VWFA 2KE9A 2VVKA 3M0QA 2HBWA 3A98A 3REAB 2K6DA 2GGRA 1IO6A 4HVWA 1TUCA 1N5ZA 1U5SA 2OAWA 2DBMA 1BK2A 3IQLA 1VA7A 1AD5A 2CUBA 1OV3A 1QKWA 5GJWB 1AZEA 2CSIA 2EYYA 2KROA 2KR3A 1JXMA 2ECZA 2K9GA 3H0FA 1ZBJA 1QCFA 2C0TA 2EBPA 4LNPA 1SHGA 3LH5A 2JT4A 3CQTA 2KRSA 1WYXA 1M3CA 2RMOA 2K3BA 5IHNA 4JZ4A 1M8MA 4JZ3A 2C0IA 2F2WA 1YWPA 2JMCA 2DM1A 4JJDA 5IHKA 1B07A 2JTEA 4JPBW 1QWFA 4OMPA 1E7OA 4JJBA 1I0CA 1M30A 2D8HA 1WFWA 2C0OA 1X6BA 3JV3A 1W70A 2I0NA 3PVQA 2DE0X 5IXBA 2DF6A 1OPKA 1T3SA 2EYXA 2RPNA 3RNJA 1KIKA 1K76A 1UDLA 4OMNA 3FJ5A 2ED1A 1T0HA 1JEGA 4CC7A 2JM8A 2YT6A 4LUEA 2RNAA 2KT1A 1ABOA 2LX7A 2A36A 2EGCA 2KYBA 2DA9A 2J6KA 1UHFA 4OMLA 1K4US 2LQWA 1PRMC 1UFFA 1YNZA 4AG2C 1NYGA 4D8DA 3VS0A 2OI3A 4J9HA 1AWXA 2OJ2A 4Z89A 2FRYA 2LCSA 2ROLA 4ESRA 3M0PA 3SEMA 1NYFA 2DL3A 1WLPB 2M51A 2X3XD 1B3QA 2LZ6B 1JXOA 1QKXA 1BBZA 3ZL7C 2CREA 2KXCA 5I22A 2JMAA 1PKSA 5EC7A 4RTUA 1G83A 5FWCA 2DNUA 1V1CA 2W10A 2BZYA 3PE0A 1BB9A 1NG2A 2BTTA 1ZUUA 2ENMA 2AZSA 1E6GA 3VS7A 1CKAA 3H41A 3UATA 2RN8A 4AFSC 4EIKA 2GQIA 3EG2A 1PHTA 1UHCA 4CC3A 2DL4A 3THKA 1CKBA 5ECAA 3TSZA 1OPLA 1RUWA 3H0HA 1RLPC 2YUOA 3VS4A 2NWMA 1PWTA 2CH4A 2J6OA 2D0NA 4RTWA 5IH2A 4Z88A 1I1JA 1WX6A 4ORZA 3VS2A 1T0JA 1GCPA 2RQTA 1A0NB 2EW3A 1VYTA 2LMJA 1U3OA 2A37A 4X1VA 3VRZA 2DILA 2HDAA 1S1NA 1WXBA 2KRMA 2EGEA 4J9CA 1SSHA 2J05A 4A63B 4IIOA 2LNHB 1Y0MA 2DLPA 1WXTA 2CSQA 2HSPA 2FRWA 2FPDA 2KRNA 4J9IA 2GNCA 3GBQA 2LJ1A 1GBRA 4E6RA 1YCSB 1TG0A 2D8JA 3I5RA 3M0TA 3QWYA 3VRYA 4IIMA 4J9FA 1PNJA 3H0IA 2B86A 2DBKA 3EHRA 4M4ZA 2QDLA 2O9VA 1W6XA 2L3SA 2LJ3A 4AG1C 2X3WD 2LQNA 3M0UA 2RQRA 1NEGA 1GFDA 1MV0B 1EFNA 4RTTA 3I35A 1X43A 4HVUA 2JW4A 2HCKA 4J9BA 2EKHA 1K9AA 1LCKA 1H92A 3O5ZA 2KBTA 1ZLMA 2F2VA 1M3AA 5FW9A 4OMQA 4Z8AA 1SPKA 1Y57A 3M0SA 2IIMA 1GCQC 1UE9A 1X6GA 3EG3A 2V1RA 1AWJA 2L3QA 1HSQA 1X69A 1NLPC 3M0RA 4DEYA 4LUDA 4GLMA 1NEBA 5I11A 1RI9A 2VKNA 2RQUA 2BZ8A 1W1FA 2KXDA 1NM7A 1X2QA 5IHIA 1Z9QA 4OMMA 1Z9ZA 3UA7A 4GBQA 1OEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWO A;  3EG0 A;  1XOV A;  1BU1 A;  2YUQ A;  1X2K A;  2JXB A;  1UTI A;  2KYM A;  1K0S A;  5GJV B;  1AVZ C;  1ARK A;  4QT7 A;  1X27 A;  2CT4 A;  2CT3 A;  2DRK A;  5HCK A;  2V1Q A;  4F16 A;  4J9D A;  1AOJ A;  3I5S A;  4AFQ C;  4F14 A;  2ROT A;  1FYN A;  1MV3 A;  2DL8 A;  4Y92 A;  1UEC A;  3UF4 A;  4LN2 A;  1ZUK A;  2SRC A;  4HCK A;  2CUD A;  1AWW A;  2LP5 A;  2XMF A;  1CSK A;  1UUE A;  2DX1 A;  1WIE A;  2KEA A;  2PNI A;  2YUN A;  4LE9 A;  2J7I A;  4D8K A;  2F2X A;  1QWE A;  2AKK A;  4RUG A;  3TVT A;  1HD3 A;  2A08 A;  2KT8 A;  3UA6 A;  2PZ1 A;  4AFZ C;  2FG0 A;  1U06 A;  2AK5 A;  2DL7 A;  2FEI A;  3VS3 A;  4CC4 B;  1JQQ A;  2ABL A;  2K2M A;  4RTZ A;  4J9E A;  2YUP A;  2KGT A;  2YDL A;  2EPD A;  2A28 A;  1K0X A;  1GCQ A;  2H8H A;  4AFU C;  1YP5 A;  3NGP A;  2FPE A;  4F17 A;  4FSS A;  1M27 C;  1SRM A;  2NUZ A;  1VYV A;  1ABQ A;  2EYW A;  2RQV A;  4RTX A;  4WCI A;  1AZG B;  2JM9 A;  2AZV A;  1T3L A;  2DRM A;  2SEM A;  2O31 A;  1RLQ C;  1OOT A;  2FPF A;  2GTJ A;  2EGA A;  1WXU A;  3NPF A;  2E5K A;  3QWX X;  4DEX A;  2HEQ A;  3EHQ A;  4OMO A;  1I07 A;  1H8K A;  4K11 A;  2J6F A;  1ZUY A;  2L2P A;  2DMO A;  4J9G A;  3VS1 A;  1KFZ A;  1E6H A;  1WI7 A;  2GBQ A;  2AKL A;  1J3T A;  2DYB A;  2RF0 A;  1H3H A;  3PVL A;  2K7A A;  2G6F X;  3NHN A;  2FO0 A;  4ZNX A;  5L23 A;  3U23 A;  2BZX A;  5IXF A;  3VS6 A;  1WDX A;  2LJ0 A;  1PKT A;  1K1Z A;  2PTK A;  3R6N A;  3ULR B;  2W0Z A;  2MIO A;  2CDT A;  1KSW A;  2EVR A;  1YWO A;  1KJW A;  1SRL A;  2L3P A;  1GFC A;  1HJD A;  1M3B A;  1GRI A;  2KNB B;  3EGU A;  3I9Q A;  1TUD A;  3SHW A;  2DVJ A;  1UJY A;  2K79 A;  2MCN A;  1GL5 A;  4KRT A;  1UJ0 A;  3EG1 A;  4JJC A;  2O2O A;  2EQI A;  3NMZ C;  4HXJ A;  1AEY A;  2M0Y A;  5FWB A;  1ZX6 A;  2MOX A;  1SEM A;  1GBQ A;  1SHF A;  1WA7 A;  2CH4 W;  1QLY A;  1VYU A;  1NLO C;  1G2B A;  2EYZ A;  3KFV A;  2J06 A;  4RTY A;  3C0C A;  3TSW A;  2O88 A;  3VS5 A;  2JS2 A;  4RTV A;  2RQW A;  1PRL C;  4HVV A;  3REB B;  2ED0 A;  2L0A A;  2YSQ A;  1FMK A;  1ZSG A;  4R0K A;  2GTO A;  2D1X A;  1JU5 C;  2P4R A;  1MUZ A;  2ESW A;  1UGV A;  2JS0 A;  4CC2 A;  2DJQ A;  2O9S A;  2DL5 A;  3RBB B;  1UG1 A;  1YN8 A;  1JO8 A;  2VWF A;  2KE9 A;  2VVK A;  3M0Q A;  2HBW A;  3A98 A;  3REA B;  2K6D A;  2GGR A;  1IO6 A;  4HVW A;  1TUC A;  1N5Z A;  1U5S A;  2OAW A;  2DBM A;  1BK2 A;  3IQL A;  1VA7 A;  1AD5 A;  2CUB A;  1OV3 A;  1QKW A;  5GJW B;  1AZE A;  2CSI A;  2EYY A;  2KRO A;  2KR3 A;  1JXM A;  2ECZ A;  2K9G A;  3H0F A;  1ZBJ A;  1QCF A;  2C0T A;  2EBP A;  4LNP A;  1SHG A;  3LH5 A;  2JT4 A;  3CQT A;  2KRS A;  1WYX A;  1M3C A;  2RMO A;  2K3B A;  5IHN A;  4JZ4 A;  1M8M A;  4JZ3 A;  2C0I A;  2F2W A;  1YWP A;  2JMC A;  2DM1 A;  4JJD A;  5IHK A;  1B07 A;  2JTE A;  4JPB W;  1QWF A;  4OMP A;  1E7O A;  4JJB A;  1I0C A;  1M30 A;  2D8H A;  1WFW A;  2C0O A;  1X6B A;  3JV3 A;  1W70 A;  2I0N A;  3PVQ A;  2DE0 X;  5IXB A;  2DF6 A;  1OPK A;  1T3S A;  2EYX A;  2RPN A;  3RNJ A;  1KIK A;  1K76 A;  1UDL A;  4OMN A;  3FJ5 A;  2ED1 A;  1T0H A;  1JEG A;  4CC7 A;  2JM8 A;  2YT6 A;  4LUE A;  2RNA A;  2KT1 A;  1ABO A;  2LX7 A;  2A36 A;  2EGC A;  2KYB A;  2DA9 A;  2J6K A;  1UHF A;  4OML A;  1K4U S;  2LQW A;  1PRM C;  1UFF A;  1YNZ A;  4AG2 C;  1NYG A;  4D8D A;  3VS0 A;  2OI3 A;  4J9H A;  1AWX A;  2OJ2 A;  4Z89 A;  2FRY A;  2LCS A;  2ROL A;  4ESR A;  3M0P A;  3SEM A;  1NYF A;  2DL3 A;  1WLP B;  2M51 A;  2X3X D;  1B3Q A;  2LZ6 B;  1JXO A;  1QKX A;  1BBZ A;  3ZL7 C;  2CRE A;  2KXC A;  5I22 A;  2JMA A;  1PKS A;  5EC7 A;  4RTU A;  1G83 A;  5FWC A;  2DNU A;  1V1C A;  2W10 A;  2BZY A;  3PE0 A;  1BB9 A;  1NG2 A;  2BTT A;  1ZUU A;  2ENM A;  2AZS A;  1E6G A;  3VS7 A;  1CKA A;  3H41 A;  3UAT A;  2RN8 A;  4AFS C;  4EIK A;  2GQI A;  3EG2 A;  1PHT A;  1UHC A;  4CC3 A;  2DL4 A;  3THK A;  1CKB A;  5ECA A;  3TSZ A;  1OPL A;  1RUW A;  3H0H A;  1RLP C;  2YUO A;  3VS4 A;  2NWM A;  1PWT A;  2CH4 A;  2J6O A;  2D0N A;  4RTW A;  5IH2 A;  4Z88 A;  1I1J A;  1WX6 A;  4ORZ A;  3VS2 A;  1T0J A;  1GCP A;  2RQT A;  1A0N B;  2EW3 A;  1VYT A;  2LMJ A;  1U3O A;  2A37 A;  4X1V A;  3VRZ A;  2DIL A;  2HDA A;  1S1N A;  1WXB A;  2KRM A;  2EGE A;  4J9C A;  1SSH A;  2J05 A;  4A63 B;  4IIO A;  2LNH B;  1Y0M A;  2DLP A;  1WXT A;  2CSQ A;  2HSP A;  2FRW A;  2FPD A;  2KRN A;  4J9I A;  2GNC A;  3GBQ A;  2LJ1 A;  1GBR A;  4E6R A;  1YCS B;  1TG0 A;  2D8J A;  3I5R A;  3M0T A;  3QWY A;  3VRY A;  4IIM A;  4J9F A;  1PNJ A;  3H0I A;  2B86 A;  2DBK A;  3EHR A;  4M4Z A;  2QDL A;  2O9V A;  1W6X A;  2L3S A;  2LJ3 A;  4AG1 C;  2X3W D;  2LQN A;  3M0U A;  2RQR A;  1NEG A;  1GFD A;  1MV0 B;  1EFN A;  4RTT A;  3I35 A;  1X43 A;  4HVU A;  2JW4 A;  2HCK A;  4J9B A;  2EKH A;  1K9A A;  1LCK A;  1H92 A;  3O5Z A;  2KBT A;  1ZLM A;  2F2V A;  1M3A A;  5FW9 A;  4OMQ A;  4Z8A A;  1SPK A;  1Y57 A;  3M0S A;  2IIM A;  1GCQ C;  1UE9 A;  1X6G A;  3EG3 A;  2V1R A;  1AWJ A;  2L3Q A;  1HSQ A;  1X69 A;  1NLP C;  3M0R A;  4DEY A;  4LUD A;  4GLM A;  1NEB A;  5I11 A;  1RI9 A;  2VKN A;  2RQU A;  2BZ8 A;  1W1F A;  2KXD A;  1NM7 A;  1X2Q A;  5IHI A;  1Z9Q A;  4OMM A;  1Z9Z A;  3UA7 A;  4GBQ A;  1OEB A; 
#chains in the Genus database with same CATH topology
 3EG0 A;  4FM4 B;  1BU1 A;  1R0C B;  2JXB A;  3QJ6 A;  1OZ3 A;  1M2O A;  2LRQ A;  4LD6 A;  1YI2 T;  4BI4 A;  1YIT Q;  4JS5 A;  2ZPB B;  4L6V 5;  1KD1 U;  1VQ7 A;  1IXD A;  1AHJ B;  2V1Q A;  2CZ0 B;  1KQ2 A;  5C0M A;  4M7A C;  1TOV A;  3CCL T;  4XAX B;  4E7J A;  2JUF A;  4PJO B;  2DL8 A;  3L2Z A;  2A3L A;  2E41 A;  2SRC A;  1X6O A;  1G3Y A;  3EH1 A;  3G6E A;  4MDX A;  4PNO A;  1FMW A;  4HT8 A;  2BKD N;  4QQD A;  1Q82 R;  4KUI A;  2QQS A;  4M7D F;  1WIE A;  2RHI A;  2RH2 A;  4XU0 A;  2GFA A;  2YUN A;  2J7I A;  3X26 B;  4OGC A;  4F7U G;  2F2X A;  3PMI A;  2AKK A;  1HXD A;  3CC2 A;  3TVT A;  1UGS B;  3CCM T;  2DVE A;  2BUD A;  2DL7 A;  2DKG A;  4M75 E;  4OB2 B;  4CC4 B;  2LT4 A;  1JQQ A;  2K2M A;  4J9E A;  4FIB A;  1VQ4 T;  1S72 T;  2YDL A;  2GFU A;  1K0X A;  1GCQ A;  1YP5 A;  3NGP A;  3CPW S;  1M27 C;  2NUZ A;  2RQV A;  1KHC A;  1VQN A;  4RTX A;  3M59 A;  2V26 A;  2JM9 A;  3CCE T;  2AZV A;  2DK3 A;  4LDX A;  2O31 A;  4YTL A;  5KYY A;  2GTJ A;  3LWI A;  5GAN 2;  2E5K A;  3G71 A;  5A0G A;  2LQK A;  5KYW A;  2OX7 A;  1KFZ A;  3RKY A;  3E1S A;  3SDZ A;  2GBQ A;  2AKL A;  2V8I A;  4ELZ C;  2FHD A;  3NHN A;  2G6F X;  5AT1 B;  4ZNX A;  2F5T X;  3SD4 A;  1M90 C;  4M7A A;  1WDX A;  3O8V A;  2H3J A;  5FU6 C;  5LJ3 h;  2PTK A;  3ULR B;  1Y71 A;  4M77 F;  4BB7 A;  2L3P A;  4M77 B;  3HTR A;  1M3B A;  1Q7Y U;  1GRI A;  2KNB B;  2FZC B;  4J7F A;  3VUB A;  4M78 G;  4F04 B;  2K79 A;  1JRI A;  1GL5 A;  3JCM W;  4JJC A;  4FYV B;  3NMZ C;  4C8Q F;  4HXJ A;  1AEY A;  2M0Y A;  4PJL A;  1QMC A;  1ZX6 A;  3VKI A;  1GXI E;  1RAD B;  1WA7 A;  1VYU A;  3MP8 A;  4XTW A;  1YJW T;  3TSW A;  2O4X B;  4DBH A;  4ZTF A;  3GF5 A;  2E4H A;  3REB B;  4MMK A;  1ZSG A;  5FRN A;  5GAN e;  4R0K A;  2CS7 A;  3CD6 T;  4Q5W A;  1MMD A;  2ESW A;  1UGV A;  2RA2 A;  3LW5 E;  2DL5 A;  3RBB B;  1UGR B;  1JO8 A;  5CKE A;  4DOW A;  3M0Q A;  4M7D E;  2XHC A;  3REA B;  5I21 A;  2K6D A;  4BY6 C;  4R55 A;  5GMK j;  1TXQ A;  2OAU A;  1N5Z A;  3CC4 T;  1BK2 A;  3IQL A;  1D3B A;  4A53 A;  1AD5 A;  3MO8 A;  1G3T A;  3JCM Q;  2RHX A;  2PQW A;  1AZE A;  2EYY A;  1C1A A;  5CQX A;  5DY9 A;  2EBP A;  1NJI C;  2JT4 A;  3QII A;  4Z02 A;  3RIR A;  4FYY B;  2KRS A;  4IUR A;  4PLI A;  1WYX A;  1XNI A;  2DXC A;  2M02 A;  2RMO A;  1KQS S;  3E9G A;  3EG9 A;  3QO3 A;  2LT1 A;  5IHN A;  3CPF A;  2CP6 A;  4M78 B;  1I5L A;  3OSV A;  3CMA Q;  2M16 A;  3P8H A;  2FYK A;  2AHJ B;  2IG0 A;  1Q86 C;  1W2B P;  1I4K 1;  3CME T;  1IRE B;  1QWF A;  3V7C A;  2DXB A;  1HYO A;  5GAM h;  3OS1 A;  3JV3 A;  1N8R R;  1W70 A;  2I0N A;  3FB9 A;  1U8R A;  1WHL A;  3VYH B;  5I2S A;  3CCL Q;  2EYX A;  3HP9 A;  2L3R A;  8AT1 B;  4GY5 A;  1JJ2 S;  1Y96 A;  3CBP A;  2HAX A;  1G8X A;  4FT4 A;  2KVQ G;  5KCH A;  4CC7 A;  3LGL A;  4KUL A;  1VQO A;  3OYL A;  3X28 B;  3HPW A;  3CPW A;  4C8Q E;  2DA9 A;  4AG2 C;  1UFF A;  1B34 B;  4XTV A;  4ANJ A;  1NYG A;  4D8D A;  2KMT A;  4HCB A;  3CCU Q;  4J9H A;  1AWX A;  3ZFJ A;  4Z89 A;  5IAY A;  1S72 Q;  4LDY A;  2ROL A;  1M90 U;  1WLP B;  4NS5 A;  1BBZ A;  3JCM d;  5CKB A;  2P0K A;  3CCE Q;  4DOV A;  2HL5 C;  1PKS A;  3N5B B;  3CCV T;  2LVM A;  4M77 C;  5FWC A;  2W10 A;  4JS4 A;  4EMH A;  2BTT A;  4C5H A;  3A1P A;  4B9X A;  4EMK A;  3X20 B;  1VUB A;  1CKA A;  2VB6 A;  1I8F A;  3UDC A;  3OMG A;  2E10 A;  3PIO A;  1BI2 A;  2ZPG B;  3MP1 A;  3EG2 A;  1UHC A;  4C8Q C;  3THK A;  5ECA A;  3E2U A;  1C0M A;  1RUW A;  3H0H A;  2YUO A;  4C92 E;  3I56 A;  5GAO m;  4RTW A;  2J6O A;  2NUT B;  2D0N A;  4RG8 A;  1I1J A;  1WX6 A;  4J5Y A;  1K73 R;  1T0J A;  2L89 A;  2EW3 A;  1U3O A;  1YIJ T;  3VRZ A;  1K73 C;  5LL6 S;  2EGE A;  2ZPE B;  4IIO A;  3TU4 K;  2JOY A;  4CI0 C;  1C6V X;  2FRW A;  3OSS C;  4IUT A;  3AHU A;  1Q95 G;  2GNC A;  3GBQ A;  1R77 A;  4NL3 A;  2EJG A;  1QP3 A;  3OYN A;  3JCM g;  3ER0 A;  2PU9 B;  2PUO B;  5LJ3 g;  4OB3 B;  4IIM A;  4FL6 A;  3CCL A;  1RI0 A;  2DBK A;  5FRM A;  4UC4 A;  1LVK A;  4J8O A;  1W6X A;  3OYH A;  1KD1 R;  4E7K A;  2BE7 D;  2LQN A;  1MV0 B;  1NJI U;  4X9C A;  3GPL A;  3LH0 A;  1EFN A;  2JVV A;  3LGF A;  3I35 A;  4M77 A;  3NTK A;  2E65 A;  2EKH A;  1YJ9 Q;  3O5Z A;  3C94 A;  1ZLM A;  3CC7 T;  1M3A A;  3OYC A;  1M1G A;  1VQP T;  1N9R A;  4M7A D;  2IIM A;  3CCM A;  4WF2 A;  5D7U A;  4FSX A;  1QP2 A;  5GAO n;  1Q86 U;  1NLP C;  4C8Q A;  3M0R A;  1VQ4 A;  1S72 A;  4A4E A;  2Y4X A;  2CP0 A;  1NEB A;  3EFS A;  4EMG A;  3QXE B;  3MET A;  2RQU A;  3A8H B;  2BZ8 A;  2R58 A;  2EJF A;  2KXD A;  2DEQ A;  3PNW C;  4OMM A;  3ME9 A;  2XDD A;  3JB9 F;  3MEV A;  3CCE A;  3PFS A;  2RM4 A;  2YUQ A;  2NYS A;  1UTI A;  1K0S A;  2E6Z A;  1KQ1 A;  5GJV B;  2MMP A;  1ZSZ C;  1FXX A;  4FYW B;  4VUB A;  2EQJ A;  5GAO l;  2JN0 A;  2CT3 A;  5GMK m;  2HL3 A;  5HCK A;  1VQ7 Q;  1MNE A;  1FWZ A;  3S6W A;  3C95 A;  2ROT A;  4P5N A;  1FYN A;  1MV3 A;  4Y92 A;  1JJ2 A;  3UF4 A;  1ZUK A;  3MEU A;  4HCK A;  2CUD A;  4DBQ A;  4BE2 A;  1UUE A;  2RI2 A;  2JNG A;  1MMG A;  4C5I A;  2HNI A;  3RUX A;  1O75 A;  5CIU A;  4KBM B;  4ME7 A;  1X01 A;  1XJW B;  1PC0 A;  4D8K A;  4II1 A;  5GAO q;  4MZP A;  9ATC B;  3CCQ T;  2A08 A;  2KT8 A;  3CC2 Q;  2PZ1 A;  2RJC A;  2H3E B;  2AK5 A;  4M75 F;  2PVO B;  2FEI A;  3VS3 A;  1RAI B;  2X4X A;  4RTZ A;  5CR2 A;  4C0D B;  2YUP A;  2K5I A;  4M75 B;  4HT9 A;  1WJR A;  5GMK i;  2A28 A;  2CP2 A;  2L5Q A;  2RB6 A;  2FPE A;  1VYV A;  2EYW A;  1Q7Y R;  3A8M B;  2OTJ T;  1VQN Q;  1IZ6 A;  4J83 A;  5KCO A;  2SEM A;  1YJW A;  2WSC E;  5LJ5 g;  4E7H A;  2EGA A;  2YLB A;  3NPF A;  1WQ7 A;  4K11 A;  2PVD B;  4M7D G;  1ZUY A;  3Q1J A;  1VOM A;  2DMO A;  1ZSZ A;  4N0A C;  1JBM A;  1J3T A;  2DYB A;  4Y28 E;  3RKX A;  2BIV A;  3CCV Q;  3TQ7 P;  2VYT A;  3OYE A;  5IXF A;  1K73 U;  3VS6 A;  3J81 E;  2RJF A;  3EH2 A;  2LJ0 A;  2XDB A;  4AT1 B;  4MML A;  1Y96 B;  2MIO A;  5GMK l;  2CDT A;  1KSW A;  1MGQ A;  1G3W A;  1OU9 A;  1SRL A;  3CXC P;  5M9O A;  1GFC A;  1IHV A;  1B34 A;  3EAE A;  1TUD A;  2XD0 A;  2CP3 A;  4OMF B;  4BY6 B;  5I2M A;  5CO7 A;  2QEX T;  3CCS T;  4KRT A;  2O2O A;  4N4G A;  2XKO C;  5FWB A;  5DM7 R;  2XIC A;  3OMC A;  1SEM A;  2OTL T;  1PCX A;  4XU2 A;  1SHF A;  1YIJ Q;  3MKD A;  4GLK A;  1G2B A;  1YHQ Q;  2J06 A;  1WHJ A;  3QUI A;  1Y7X A;  4FCY A;  1ZA2 B;  2K57 A;  4NOY A;  1LNX A;  4M77 G;  4HVV A;  3CME A;  2YSQ A;  1R0B G;  2DZC A;  1ACM B;  2JTM A;  4OB0 B;  4ZGD B;  2D1X A;  1JU5 C;  3ZBD A;  4PJO D;  4CC2 A;  2HQH A;  4JUV A;  1UG1 A;  4KH0 B;  4N0A A;  1W2B S;  2KE9 A;  2HBW A;  2LQ8 A;  2CGH A;  2EQK A;  4C8Q G;  4EMK B;  4M7D B;  4JJN K;  4DQ2 A;  3OYM A;  1IO6 A;  4C0F A;  3HHT B;  1BCM A;  2NUT A;  5DLO A;  2DBM A;  2M9U A;  3ASK A;  3CC7 Q;  2QYZ A;  5GJW B;  2JZ2 A;  5IT9 E;  1BI3 A;  1KK7 A;  1VQ6 T;  2KRO A;  1JXM A;  5CK9 A;  3H0F A;  3LH5 A;  4IUV A;  4C5E A;  4AMC A;  3QSU A;  2HKN A;  2QTX A;  5GAM e;  1WJQ A;  4JZ4 A;  2R57 A;  3OW2 A;  3GNG A;  5J3B A;  1YWP A;  3GIB A;  3X25 B;  2RO0 A;  2F69 A;  2COZ A;  5IHK A;  1B07 A;  3VJP A;  4BI3 A;  4JPB W;  3A8O B;  2QGG A;  3NFC A;  3CCV A;  1M90 R;  4MZM A;  1TTH B;  4MDW A;  2DJZ A;  4ZGE B;  1M9S A;  2CYZ B;  3VUZ A;  3JCM h;  5HK3 A;  4BAC A;  2Y90 A;  2EWN A;  1ZBX A;  2HMA A;  4C0D C;  2CP7 A;  4M75 C;  2RPN A;  3RNJ A;  4OMN A;  4C0Z A;  4BDY A;  2ED1 A;  1T0H A;  4JRP A;  2JM8 A;  3L2Q A;  2A7Y A;  3JCM X;  2QA4 T;  2QK0 A;  2QXF A;  4M77 D;  7AT1 B;  4KGX B;  3EGD A;  1VQO Q;  3OS0 A;  1UHF A;  4J7I A;  1QCN A;  2LQW A;  3CCQ Q;  1D0X A;  2LTO A;  4C8Q B;  1MHN A;  1OX8 A;  3VS0 A;  1YIJ A;  3MEA A;  3J80 E;  2OJ2 A;  4IKF A;  3SWN C;  2ZCF B;  1YHQ A;  1YCY A;  2QQA A;  1MMN A;  3RMS A;  4D6W A;  1TU0 B;  1K9M C;  3PMT A;  2DL3 A;  2M51 A;  2X3X D;  1B3Q A;  2LZ6 B;  3R6O A;  1UGP B;  5CKF A;  4J6X A;  1KC8 C;  3L2R A;  5I22 A;  1RAB B;  2KK4 A;  1QVG A;  1VQ5 T;  5EC7 A;  3FDR A;  1G5V A;  1G83 A;  4ELY C;  2DNU A;  2BZY A;  4PJO E;  1M1K C;  2YWW A;  1NG2 A;  2RJD A;  3I55 T;  1E6G A;  5KE2 A;  4OF1 A;  2RN8 A;  2GQI A;  2RD1 A;  3NTI A;  3CC7 A;  1PHT A;  4CC3 A;  2DL4 A;  1VQP A;  4M75 A;  2EFI A;  3TSZ A;  1NJI R;  4C92 F;  2HKQ B;  1RLP C;  1PWT A;  1IB8 A;  2DIG A;  2P4T A;  4C92 B;  3I56 Q;  3VS2 A;  3FRN A;  2LMJ A;  3EFR A;  2A37 A;  3L42 A;  4KGV B;  1KG1 A;  4FW2 A;  1S1N A;  2E6N A;  2QEX Q;  2HQE A;  5HKC A;  2LNH B;  1Q86 R;  1QQJ A;  2DLP A;  4OVA A;  1WXT A;  2CSQ A;  2OTL Q;  1D09 B;  2COY A;  4M78 D;  3SWN A;  1YI2 Q;  3E9F A;  1HK9 A;  1D1B A;  1TG0 A;  3G4S T;  4EMK C;  4M7D C;  3QWY A;  3VRY A;  1PD0 A;  4E7I A;  5LJ5 h;  1U1T A;  3OY9 A;  4J9F A;  1ZSZ B;  2B86 A;  1W2B A;  4J6W A;  2QDL A;  2O9V A;  2ATC B;  3M5A A;  2F5K A;  2L3S A;  2LJ3 A;  4AG1 C;  1YJN T;  2X3W D;  1NEG A;  1EX4 A;  1M5Q 1;  1X43 A;  3KXT A;  2HCK A;  4J9B A;  3BFM A;  3UT1 A;  1LCK A;  2KDS A;  4Z8A A;  2QQR A;  1Y57 A;  4XTU A;  5HY6 A;  3CCQ A;  1I5O B;  4O6J A;  3CCM Q;  2V1R A;  3LWH A;  4XTX A;  2DZ9 A;  2WSE E;  2L3Q A;  2X35 A;  3M4G A;  1K8A C;  4PJN A;  4E2F B;  2RHZ A;  5I11 A;  1VQ4 Q;  3OYJ A;  4ZN3 A;  1VQ6 Q;  2DAQ A;  1Z9Z A;  2PVG B;  1WZO A;  3UA7 A;  2VC8 A;  1PM3 A;  2OTJ A;  4F7U E;  3CCR T;  4A54 A;  1X2K A;  2YXY A;  4PFP A;  1AVZ C;  1UEB A;  3RER A;  1X27 A;  2ZPI B;  5A0L A;  2DFU A;  2CT4 A;  4LD9 K;  4F16 A;  3RKW A;  4J9D A;  1MMA A;  1AOJ A;  2PUK B;  4KUD K;  4TVR A;  4M7D A;  2WSF E;  3HKS A;  3JB9 J;  4BDZ A;  1CSK A;  4KH1 B;  1TWB A;  2X4J A;  5CVI A;  3EFO B;  2DX1 A;  1K9M U;  3QZ9 B;  1QWE A;  1Y07 A;  4IUP A;  4RUG A;  3OA6 A;  3JB9 G;  1V76 A;  2MYS A;  2ZGW A;  3CCJ T;  2AIR B;  1KC8 U;  5IN1 A;  5KYX B;  2QEX A;  3CCS A;  5J26 A;  2QA4 Q;  4BE0 A;  3V8J A;  2CZ6 B;  1QVP A;  3PT9 A;  3CXC S;  3A8L B;  4FSS A;  2D6F A;  1SRM A;  2ZZD A;  3M54 A;  1ABQ A;  1WHK A;  3MP6 A;  5GAN 3;  2OTL A;  3JB9 H;  2MAM A;  1R8O B;  1YI2 A;  1M1K U;  4WCI A;  1AZG B;  1T3L A;  1QW1 A;  4A4H A;  2CKK A;  1RLQ C;  1YIT T;  2KQW A;  5GAM f;  1YJW Q;  1WXU A;  3H6Z A;  3HSB A;  3QWX X;  3EHQ A;  1I07 A;  2FL7 A;  1H8K A;  5GAO p;  4QVC A;  2L2P A;  1TSF A;  4J9G A;  2C06 A;  4PLL A;  1LPL A;  5GAM j;  2VV5 A;  1E6H A;  1WI7 A;  2KSS A;  2VAS A;  3CD6 Q;  4M75 G;  2RF0 A;  3PVL A;  2K7A A;  2FO0 A;  3U23 A;  2BZX A;  4C92 C;  1Q81 C;  1K1Z A;  2L8D A;  3R6N A;  3I55 Q;  4JRI A;  2RK2 A;  2LDM A;  2EVR A;  1RAA B;  3OYA A;  3KUF A;  1YWO A;  2NUP B;  1VQK T;  4M7A F;  1SSF A;  4KGZ B;  2DD5 A;  3CC4 Q;  1HJD A;  2V8J A;  3DB4 A;  3I9Q A;  3SHW A;  1NPP A;  1WGS A;  3EGD B;  1KQS A;  1UJY A;  1VQ6 A;  2MCN A;  2DYI A;  2X4Y A;  3EG1 A;  2G3R A;  1ZQ1 A;  2K5F A;  4LDV A;  2RHU A;  1GBQ A;  2DXU A;  2RK1 A;  3A5Z B;  1TUG B;  8ATC B;  1QLY A;  5GAN 8;  1NLO C;  3KFV A;  4HCC A;  1QVF P;  4XTY A;  3F70 A;  4JLI A;  4HCZ A;  4E7S A;  2O88 A;  4EDU A;  5GAM d;  2P0P A;  3RR6 A;  1UGQ B;  1N6A A;  2RQW A;  4RTV A;  1PRL C;  2EKO A;  3M57 A;  2HQX A;  2BE9 B;  2L0A A;  1VIE A;  2KY9 A;  2X51 A;  3CME Q;  3G4S Q;  5GAN f;  3PTA A;  4XU1 A;  4XQ3 A;  1K8A U;  5GAO r;  2CP5 A;  2JS0 A;  2DET A;  4RKU E;  2DTH A;  1YN8 A;  2VWF A;  3C12 A;  2VVK A;  1RAG B;  3PIP A;  5GAN j;  1TH7 A;  1YJN Q;  2GGR A;  2LC4 A;  1TUC A;  1MND A;  4C92 A;  2KI7 A;  2QA4 A;  3TCJ A;  3H8Z A;  3VYG A;  2MPX C;  3DKM A;  2F1L A;  1WHM A;  1QKW A;  3BE3 A;  3J7A F;  3AT1 B;  4HA8 A;  5CAI A;  2XU8 A;  4M75 D;  2HD0 A;  4CRI A;  1ZBJ A;  1NPR A;  3QYG B;  2QI2 A;  2QG9 B;  2GCX A;  2VXF A;  1EIF A;  2K2V A;  2K3B A;  5J39 A;  3V8L A;  1M8M A;  2RHY A;  3JCM e;  2E64 A;  1ZA1 B;  5LJ3 e;  1BIB A;  3M53 A;  3CCR Q;  3TEE A;  3SWN B;  2QQB A;  5CCA A;  3OYB A;  1M2V B;  3CD6 A;  3BW1 A;  1VQ5 A;  2D0Q B;  2JTE A;  3LLR A;  5CQY A;  5KYN A;  4JJB A;  1I0C A;  2D8H A;  3FIF A;  4RG2 A;  5GAN d;  3PVQ A;  3I55 A;  5IXB A;  1OPK A;  2QGF B;  3V7R A;  2V8K A;  1K76 A;  1UDL A;  3M58 A;  2DO3 A;  4PJJ A;  3CC4 A;  3INZ A;  1VQM T;  1OYX A;  2LX9 A;  3HL8 A;  4M7A E;  3V8K A;  2RNA A;  1ABO A;  2A36 A;  2EGC A;  4WTO B;  2X4W A;  2KYB A;  4OB1 B;  4OML A;  1K4U S;  1RAE B;  3MJX A;  3DB3 A;  2E3H A;  3CCJ Q;  2OI3 A;  2KAF A;  2EQU A;  2FRY A;  3S3N A;  4JRQ A;  2LCS A;  4KT0 E;  4BE1 A;  1NE8 A;  1PG5 B;  2YRV A;  3H9N A;  3QPH A;  1NYF A;  4NL2 A;  4BD3 A;  1ZHI A;  1Q81 U;  3CMA T;  2FB7 A;  2P0Q A;  1QKX A;  3G4S A;  2FZG B;  2KXC A;  3EGX A;  4DBR A;  3GP8 A;  2EAY A;  2GQV A;  2JJ9 A;  3EFO A;  4PJO F;  3TRE A;  1YJN A;  1H3Z A;  2EQM A;  2ENM A;  2AZS A;  3VS7 A;  5GAN g;  2X9H A;  3UAT A;  5D6X A;  5CKH A;  4AFS C;  2MK5 A;  1VQL T;  4M7D D;  2D9T A;  5GMK h;  5CKD A;  1CKB A;  5KYX A;  3JCM b;  1VQP Q;  1OPL A;  4FU6 A;  4JRK A;  3SFM A;  1Q82 C;  3VS4 A;  3OBY A;  1VQK Q;  3JCM c;  5FRO A;  2A0F B;  1OQK A;  5KYU B;  4Z88 A;  2B8A A;  3HRU A;  1M1F A;  1GCP A;  2RQT A;  2E70 A;  2DIQ A;  4E7Z A;  1FX7 A;  3CCU T;  2CZ1 B;  1RAF B;  2DIL A;  3FJP A;  2HDA A;  1WXB A;  4L5G A;  4DBF A;  2KRM A;  4ATO A;  3OYG A;  3GOX A;  5LJ5 e;  3CCR A;  2E1H A;  4FW1 A;  2HSP A;  2FPD A;  3OYI A;  1VQ8 T;  1GBR A;  1VQ9 T;  3OW2 P;  2D8J A;  3I5R A;  3DLM A;  3M0T A;  1B7T A;  3G7Z A;  1O9S A;  2Y4Y A;  1PNJ A;  3H0I A;  1N9S A;  2K3Y A;  4M4Z A;  4C92 G;  4OGE A;  1YFN A;  1GFD A;  2RQR A;  3QYH B;  2NUP A;  5L8R E;  2AT1 B;  4HVU A;  2JW4 A;  3QZ5 B;  3JCM V;  3C4S A;  1IGQ A;  4QVZ A;  2F2V A;  4QKU A;  4QVD A;  1SPK A;  3M0S A;  2ZPF B;  2XK0 A;  1AWJ A;  3CCJ A;  3QKJ A;  5HK0 A;  1X69 A;  4ZGJ B;  4LUD A;  4GLM A;  1K9M R;  2VKN A;  4C8Q D;  3MCA B;  1W1F A;  5IHI A;  1X2Q A;  3JB9 I;  4FYX B;  3SB2 A;  4ZN1 A;  2DTO A;  4F7U F;  4EPC A;  1AWO A;  1KC8 R;  1XOV A;  2OTJ Q;  2KYM A;  5D6Y A;  3OBW A;  4F7U B;  1SF9 A;  1YIT A;  1BI0 A;  4QT7 A;  1ARK A;  1WQW A;  3RES A;  1NBE B;  1OI1 A;  2DRK A;  2QTV A;  2E3I A;  1M1K R;  3GNF B;  1QVG P;  3I5S A;  3CEY A;  1FMV A;  4AFQ C;  3L1A A;  4F14 A;  4QQ6 A;  1P92 A;  5A0D A;  1UEC A;  4LN2 A;  5AYF A;  2XDP A;  1AWW A;  2LP5 A;  1U1S A;  2LCC A;  2MI6 A;  2XMF A;  2EYQ A;  4BI8 B;  3OYD A;  1PD1 A;  1YJ9 T;  3OQ5 A;  2KEA A;  2PNI A;  1VQK A;  4LE9 A;  1H64 1;  4PFZ A;  1VQM Q;  3S3M A;  1HD3 A;  2QAS A;  3VV0 A;  4AFZ C;  3UA6 A;  2FG0 A;  1U06 A;  2MWP A;  2P84 A;  5FLX E;  4PK4 A;  2ABL A;  2VGN A;  3URG A;  2KGT A;  4C92 D;  3CCS Q;  2EPD A;  3M55 A;  2H8H A;  4AFU C;  2IVW A;  5C6S A;  4F17 A;  4PKC C;  4OP0 A;  4X34 A;  1YBY A;  3P8B B;  3HRT A;  3QDF A;  3MHX A;  4QW2 A;  5KH6 A;  3PGG A;  1M2V A;  2DRM A;  1XQH A;  2FZK B;  1OOT A;  4M78 F;  2FPF A;  4PJO C;  4DEX A;  2HEQ A;  3JCM f;  4OMO A;  1OU8 A;  1VQ7 T;  2J6F A;  5LJ3 f;  5GAN 7;  1BCO A;  2GF7 A;  1WNL A;  1F1B B;  3VS1 A;  2K3X A;  1Q82 U;  1QVF S;  4XK8 E;  4FT2 A;  3QG1 A;  5LJ3 j;  1H3H A;  5L23 A;  4PL6 A;  1PKT A;  2M0O A;  1WHG A;  3G6E T;  3JRZ A;  1OX9 A;  2W0Z A;  1N8R C;  4RCC A;  4M77 E;  3X24 B;  1K8A R;  1KJW A;  3FLG A;  3OS5 A;  3RMQ A;  1VQL Q;  3CC2 T;  3CPW P;  3EGU A;  1WHH A;  2DER A;  1V29 B;  1EZZ B;  2DVJ A;  1RAC B;  3UPU A;  4IUU A;  1UJ0 A;  3NTH A;  5FU7 B;  2EQI A;  3L2U A;  2QDY B;  5DLQ E;  2LCL A;  5KE3 A;  2MOX A;  1VQN T;  2CH4 W;  2EYZ A;  2YLC A;  1NZ9 A;  3LYI A;  2RI5 A;  4RTY A;  3OS2 A;  3C0C A;  1BIA A;  3G71 T;  3VS5 A;  2JS2 A;  3GLX A;  3CBM A;  1VIF A;  1VQ8 Q;  3G1J A;  3QJY A;  2ED0 A;  1VQ9 Q;  3EGX B;  5LJ3 d;  2DD4 A;  4M7A G;  4PJO A;  1FMK A;  3KBG A;  2GTO A;  2CZ7 B;  3MEW A;  2P4R A;  1MUZ A;  4L59 A;  4PJM A;  3VU3 C;  2DJQ A;  2O9S A;  3JAM E;  4E47 A;  1XTD A;  3A98 A;  3JCM P;  3BDL A;  1VQM A;  4HVW A;  3FEO A;  3L2W A;  1U5S A;  2DTI A;  5KYU A;  2OAW A;  5GAN h;  2IPO B;  1VA7 A;  2CUB A;  1OV3 A;  2YRC A;  5A2Q E;  3FC3 A;  3QDR B;  2WAC A;  2CSI A;  2VXE A;  2NLU A;  1RL2 A;  1IGU A;  2KR3 A;  2XG8 D;  2K9G A;  2ECZ A;  4Y91 A;  4LNP A;  1QCF A;  2C0T A;  1SHG A;  1KHI A;  3CQT A;  2DEU A;  3BY7 A;  1LJO A;  2FVU A;  3QBY A;  1JB0 E;  1M3C A;  4R56 A;  3OYF A;  4M78 E;  4BUG A;  4RMO A;  3CMA A;  5LJ5 f;  4XTZ A;  4JZ3 A;  1YHQ T;  3L2V A;  2C0I A;  2I2L A;  3RDV A;  3S3O A;  4ZTJ A;  2F2W A;  2XID A;  2JMC A;  1OZ2 A;  2RJE A;  2DM1 A;  2MWO A;  4JJD A;  5LJ5 j;  1M8V A;  5KYY B;  2HZY A;  4MZT A;  4RCB A;  3HFN A;  4OMP A;  1VQ5 Q;  1E7O A;  2O01 E;  1M30 A;  1Q81 R;  2HSE B;  5KYW B;  1WFW A;  2C0O A;  1X6B A;  4B6M A;  3E19 A;  3HFO A;  3OB9 A;  2DE0 X;  1BYM A;  2DF6 A;  1T3S A;  1KIK A;  1VQL A;  3FJ5 A;  3OYY A;  2EJ9 A;  4QQG A;  1KD1 C;  1JEG A;  4M7A B;  1TS9 A;  4PFO A;  2YT6 A;  4B9W A;  4LUE A;  1SKU B;  5GAN 5;  2DXT A;  2KT1 A;  2LX7 A;  2JTF A;  1X75 C;  3T9N A;  2DPP B;  2J6K A;  1KQS P;  1PRM C;  1G3S A;  1YNZ A;  3CCU A;  3UWN A;  1OUL A;  4M78 C;  2MF2 A;  3MPU B;  4C5G A;  4A4K A;  1LOJ A;  4F7U A;  3D7S B;  3WXM B;  4ESR A;  4A4F A;  3M0P A;  3SEM A;  3JB9 D;  1D1A A;  2K5L A;  3JSC A;  6AT1 B;  1VQ8 A;  1JXO A;  2O4X A;  1VQ9 A;  5LJ5 d;  1N8R U;  3ZL7 C;  4LDW A;  2ZPH B;  1QVF A;  2CRE A;  1AT1 B;  3BDU A;  3ZEH A;  2JMA A;  2COW A;  1BI1 A;  1JJ2 P;  4RTU A;  4LXC A;  5GMK e;  4IUQ A;  1PSF A;  3OW2 S;  1V1C A;  3PE0 A;  3M4Y A;  4N4I A;  1BB9 A;  1PSE A;  1ZUU A;  4J6Y A;  3DLL A;  5FU7 C;  2Z0W A;  3H41 A;  4EIK A;  3M56 A;  2M1H A;  3G6E Q;  1I81 A;  1VQO T;  5D6W A;  2NWM A;  2E5Q A;  2RI3 A;  2CH4 A;  1D1C A;  5IH2 A;  2HBP A;  4ORZ A;  2ZAE A;  1D3B B;  1A0N B;  3HRS A;  1VYT A;  3LX7 A;  1WPY A;  2QQ9 A;  2K4Y A;  4X1V A;  5FU6 B;  1RAH B;  4C0G A;  5GAN 4;  4DA4 A;  4J9C A;  4HKE A;  1SSH A;  2J05 A;  1IHW A;  4A63 B;  4N4H A;  1Y0M A;  1QCO A;  4XU3 A;  4M78 A;  4PJO G;  2VGM A;  2KRN A;  4J9I A;  1W4S A;  3OYK A;  1Q7Y C;  2LJ1 A;  1N27 A;  2VUB A;  3M9Q A;  1DJ7 B;  4E6R A;  1M4Z A;  3EG9 B;  5GAM g;  1YCS B;  2EIF A;  2XI9 A;  3JCM J;  3G71 Q;  3A8G B;  3QHS A;  1UB4 A;  1SG5 A;  2YRD A;  3EHR A;  4JDS A;  2R5M A;  1BKB A;  2LNV A;  3M0U A;  4LDU A;  4X9D A;  5EG2 A;  1QVG S;  4RTT A;  1YJ9 A;  3CBO A;  1K9A A;  1H92 A;  2KBT A;  5FW9 A;  4OMQ A;  3CXC A;  2YHT A;  2E12 A;  1GCQ C;  1UE9 A;  1X6G A;  3EG3 A;  3I56 T;  4E7L A;  1HSQ A;  1IRX A;  4DEY A;  4A4G A;  2QAZ A;  1RI9 A;  4JLG A;  3V7S A;  1D0Y A;  2R5A A;  1NM7 A;  1WJS A;  3WVE B;  1Z9Q A;  5GAN 6;  4O5V A;  3P8D A;  1D0Z A;  4GBQ A;  1OEB A;  4V2S A;  3WVD B; 
#chains in the Genus database with same CATH homology
 1AWO A;  3EG0 A;  1XOV A;  1BU1 A;  2YUQ A;  1X2K A;  2JXB A;  1UTI A;  2KYM A;  1K0S A;  5GJV B;  1AVZ C;  1ARK A;  4QT7 A;  1X27 A;  2CT4 A;  2CT3 A;  2DRK A;  5HCK A;  2V1Q A;  4F16 A;  4J9D A;  1AOJ A;  3I5S A;  4AFQ C;  4F14 A;  2ROT A;  1FYN A;  1MV3 A;  2DL8 A;  4Y92 A;  1UEC A;  3UF4 A;  4LN2 A;  1ZUK A;  2SRC A;  4HCK A;  2CUD A;  1AWW A;  2LP5 A;  2XMF A;  1CSK A;  1UUE A;  2DX1 A;  1WIE A;  2KEA A;  2PNI A;  2YUN A;  4LE9 A;  2J7I A;  4D8K A;  2F2X A;  1QWE A;  2AKK A;  4RUG A;  3TVT A;  1HD3 A;  2A08 A;  2KT8 A;  3UA6 A;  2PZ1 A;  4AFZ C;  2FG0 A;  1U06 A;  2AK5 A;  2DL7 A;  2FEI A;  3VS3 A;  4CC4 B;  1JQQ A;  2ABL A;  2K2M A;  4RTZ A;  4J9E A;  2YUP A;  2KGT A;  2YDL A;  2EPD A;  2A28 A;  1K0X A;  1GCQ A;  2H8H A;  4AFU C;  1YP5 A;  3NGP A;  2FPE A;  4F17 A;  4FSS A;  1M27 C;  1SRM A;  2NUZ A;  1VYV A;  1ABQ A;  2EYW A;  2RQV A;  4RTX A;  4WCI A;  1AZG B;  2JM9 A;  2AZV A;  1T3L A;  2DRM A;  2SEM A;  2O31 A;  1RLQ C;  1OOT A;  2FPF A;  2GTJ A;  2EGA A;  1WXU A;  3NPF A;  2E5K A;  3QWX X;  4DEX A;  2HEQ A;  3EHQ A;  4OMO A;  1I07 A;  1H8K A;  4K11 A;  2J6F A;  1ZUY A;  2L2P A;  2DMO A;  4J9G A;  3VS1 A;  1KFZ A;  1E6H A;  1WI7 A;  2GBQ A;  2AKL A;  1J3T A;  2DYB A;  2RF0 A;  1H3H A;  3PVL A;  2K7A A;  2G6F X;  3NHN A;  2FO0 A;  4ZNX A;  5L23 A;  3U23 A;  2BZX A;  5IXF A;  3VS6 A;  1WDX A;  2LJ0 A;  1PKT A;  1K1Z A;  2PTK A;  3R6N A;  3ULR B;  2W0Z A;  2MIO A;  2CDT A;  1KSW A;  2EVR A;  1YWO A;  1KJW A;  1SRL A;  2L3P A;  1GFC A;  1HJD A;  1M3B A;  1GRI A;  2KNB B;  3EGU A;  3I9Q A;  1TUD A;  3SHW A;  2DVJ A;  1UJY A;  2K79 A;  2MCN A;  1GL5 A;  4KRT A;  1UJ0 A;  3EG1 A;  4JJC A;  2O2O A;  2EQI A;  3NMZ C;  4HXJ A;  1AEY A;  2M0Y A;  5FWB A;  1ZX6 A;  2MOX A;  1SEM A;  1GBQ A;  1SHF A;  1WA7 A;  2CH4 W;  1QLY A;  1VYU A;  1NLO C;  1G2B A;  2EYZ A;  3KFV A;  2J06 A;  4RTY A;  3C0C A;  3TSW A;  2O88 A;  3VS5 A;  2JS2 A;  4RTV A;  2RQW A;  1PRL C;  4HVV A;  3REB B;  2ED0 A;  2L0A A;  2YSQ A;  1FMK A;  1ZSG A;  4R0K A;  2GTO A;  2D1X A;  1JU5 C;  2P4R A;  1MUZ A;  2ESW A;  1UGV A;  2JS0 A;  4CC2 A;  2DJQ A;  2O9S A;  2DL5 A;  3RBB B;  1UG1 A;  1YN8 A;  1JO8 A;  2VWF A;  2KE9 A;  2VVK A;  3M0Q A;  2HBW A;  3A98 A;  3REA B;  2K6D A;  2GGR A;  1IO6 A;  4HVW A;  1TUC A;  1N5Z A;  1U5S A;  2OAW A;  2DBM A;  1BK2 A;  3IQL A;  1VA7 A;  1AD5 A;  2CUB A;  1OV3 A;  1QKW A;  5GJW B;  1AZE A;  2CSI A;  2EYY A;  2KRO A;  2KR3 A;  1JXM A;  2ECZ A;  2K9G A;  3H0F A;  1ZBJ A;  1QCF A;  2C0T A;  2EBP A;  4LNP A;  1SHG A;  3LH5 A;  2JT4 A;  3CQT A;  2KRS A;  1WYX A;  1M3C A;  2RMO A;  2K3B A;  5IHN A;  4JZ4 A;  1M8M A;  4JZ3 A;  2C0I A;  2F2W A;  1YWP A;  2JMC A;  2DM1 A;  4JJD A;  5IHK A;  1B07 A;  2JTE A;  4JPB W;  1QWF A;  4OMP A;  1E7O A;  4JJB A;  1I0C A;  1M30 A;  2D8H A;  1WFW A;  2C0O A;  1X6B A;  3JV3 A;  1W70 A;  2I0N A;  3PVQ A;  2DE0 X;  5IXB A;  2DF6 A;  1OPK A;  1T3S A;  2EYX A;  2RPN A;  3RNJ A;  1KIK A;  1K76 A;  1UDL A;  4OMN A;  3FJ5 A;  2ED1 A;  1T0H A;  1JEG A;  4CC7 A;  2JM8 A;  2YT6 A;  4LUE A;  2RNA A;  2KT1 A;  1ABO A;  2LX7 A;  2A36 A;  2EGC A;  2KYB A;  2DA9 A;  2J6K A;  1UHF A;  4OML A;  1K4U S;  2LQW A;  1PRM C;  1UFF A;  1YNZ A;  4AG2 C;  1NYG A;  4D8D A;  3VS0 A;  2OI3 A;  4J9H A;  1AWX A;  2OJ2 A;  4Z89 A;  2FRY A;  2LCS A;  2ROL A;  4ESR A;  3M0P A;  3SEM A;  1NYF A;  2DL3 A;  1WLP B;  2M51 A;  2X3X D;  1B3Q A;  2LZ6 B;  1JXO A;  1QKX A;  1BBZ A;  3ZL7 C;  2CRE A;  2KXC A;  5I22 A;  2JMA A;  1PKS A;  5EC7 A;  4RTU A;  1G83 A;  5FWC A;  2DNU A;  1V1C A;  2W10 A;  2BZY A;  3PE0 A;  1BB9 A;  1NG2 A;  2BTT A;  1ZUU A;  2ENM A;  2AZS A;  1E6G A;  3VS7 A;  1CKA A;  3H41 A;  3UAT A;  2RN8 A;  4AFS C;  4EIK A;  2GQI A;  3EG2 A;  1PHT A;  1UHC A;  4CC3 A;  2DL4 A;  3THK A;  1CKB A;  5ECA A;  3TSZ A;  1OPL A;  1RUW A;  3H0H A;  1RLP C;  2YUO A;  3VS4 A;  2NWM A;  1PWT A;  2CH4 A;  2J6O A;  2D0N A;  4RTW A;  5IH2 A;  4Z88 A;  1I1J A;  1WX6 A;  4ORZ A;  3VS2 A;  1T0J A;  1GCP A;  2RQT A;  1A0N B;  2EW3 A;  1VYT A;  2LMJ A;  1U3O A;  2A37 A;  4X1V A;  3VRZ A;  2DIL A;  2HDA A;  1S1N A;  1WXB A;  2KRM A;  2EGE A;  4J9C A;  1SSH A;  2J05 A;  4A63 B;  4IIO A;  2LNH B;  1Y0M A;  2DLP A;  1WXT A;  2CSQ A;  2HSP A;  2FRW A;  2FPD A;  2KRN A;  4J9I A;  2GNC A;  3GBQ A;  2LJ1 A;  1GBR A;  4E6R A;  1YCS B;  1TG0 A;  2D8J A;  3I5R A;  3M0T A;  3QWY A;  3VRY A;  4IIM A;  4J9F A;  1PNJ A;  3H0I A;  2B86 A;  2DBK A;  3EHR A;  4M4Z A;  2QDL A;  2O9V A;  1W6X A;  2L3S A;  2LJ3 A;  4AG1 C;  2X3W D;  2LQN A;  3M0U A;  2RQR A;  1NEG A;  1GFD A;  1MV0 B;  1EFN A;  4RTT A;  3I35 A;  1X43 A;  4HVU A;  2JW4 A;  2HCK A;  4J9B A;  2EKH A;  1K9A A;  1LCK A;  1H92 A;  3O5Z A;  2KBT A;  1ZLM A;  2F2V A;  1M3A A;  5FW9 A;  4OMQ A;  4Z8A A;  1SPK A;  1Y57 A;  3M0S A;  2IIM A;  1GCQ C;  1UE9 A;  1X6G A;  3EG3 A;  2V1R A;  1AWJ A;  2L3Q A;  1HSQ A;  1X69 A;  1NLP C;  3M0R A;  4DEY A;  4LUD A;  4GLM A;  1NEB A;  5I11 A;  1RI9 A;  2VKN A;  2RQU A;  2BZ8 A;  1W1F A;  2KXD A;  1NM7 A;  1X2Q A;  5IHI A;  1Z9Q A;  4OMM A;  1Z9Z A;  3UA7 A;  4GBQ A;  1OEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...