2EGCA

Solution structure of the fifth sh3 domain from human kiaa0418 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
GSSGSSGNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SH3 and PX domain-containing protein 2A
publication title Solution structure of the fifth SH3 domain from human KIAA0418 protein
rcsb
source organism Homo sapiens
total genus 6
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egcA00
2LJ0A 1UFFA 4AFSC 4AFUC 1S1NA 4CC3A 2GGRA 1N5ZA 1GCQA 1YCSB 1XOVA 3QWYA 4KRTA 2I0NA 2SEMA 2K2MA 1T0HA 2PZ1A 2K3BA 2MOXA 2EBPA 4RTUA 2C0IA 3JV3A 2DL3A 2L0AA 2CH4A 1WIEA 4IIOA 1FYNA 2DRMA 3PVLA 3M0PA 2GBQA 3VS3A 3UF4A 2GTJA 1H3HA 2CSQA 2DMOA 2EGCA 2O31A 1Z9QA 3EG2A 3QWXX 2HEQA 1QWEA 2RF0A 4RTZA 3I5SA 1ZUYA 1M3CA 1JEGA 1I1JA 4LNPA 3VS7A 4E6RA 4QT7A 3EG3A 2W10A 2EYXA 2JT4A 1PRMC 2FPFA 4J9GA 1OV3A 2YT6A 1QWFA 2DF6A 2L2PA 1GBQA 2KNBB 3NMZC 2FRWA 1CKAA 1E7OA 1WI7A 4F17A 2DLPA 1NLPC 1GFCA 3PVQA 1PKSA 3RNJA 2DBKA 2AZSA 2W0ZA 3I9QA 1QLYA 2KGTA 2CT3A 4J9EA 5HCKA 1TUCA 2BZXA 1UE9A 2KR3A 1X6GA 4RTWA 5ECAA 2CT4A 2EVRA 2NUZA 1AWXA 1UTIA 1A0NB 1JXMA 1K4US 2M51A 2HCKA 2MIOA 2LX7A 2ED1A 5IXBA 2B86A 1BBZA 2D0NA 1WX6A 2ROTA 3A98A 5FWCA 1YWPA 4F14A 1UHFA 2BTTA 4RTTA 1W6XA 2KYBA 5IHIA 4HVWA 1K9AA 1ZUKA 1VYTA 4R0KA 1K0SA 4OMNA 2MCNA 1PKTA 4Z88A 4JZ4A 2F2VA 3M0RA 2BZ8A 1X27A 1ZX6A 2D8JA 1U3OA 2JW4A 2V1RA 4Y92A 1K0XA 2KT1A 2GQIA 1WYXA 2RNAA 2E5KA 5I22A 1U5SA 4J9FA 3CQTA 2QDLA 1YNZA 4J9DA 1KJWA 2O9SA 4JJDA 2EYZA 2G6FX 4OMOA 1WLPB 1OOTA 1NM7A 1NEGA 1HSQA 1X43A 4F16A 1E6HA 1SSHA 1RLQC 2AKKA 2LQWA 1UDLA 2DL5A 1MV0B 2BZYA 2FO0A 1PHTA 2KRMA 2L3SA 1YN8A 3M0SA 4JJBA 2VKNA 3SHWA 3EG1A 1KIKA 2CREA 2GTOA 2DM1A 2KRNA 3H0IA 1WXUA 4RTYA 2RQUA 2VWFA 2L3QA 3UATA 4A63B 2FEIA 2D1XA 4M4ZA 4WCIA 2EPDA 2CUDA 2J6FA 2O2OA 1Y0MA 3VS5A 3H0HA 2JM9A 3ZL7C 1NG2A 3I5RA 2JMAA 3TSZA 4CC4B 1K76A 3O5ZA 1X2QA 1M8MA 1MV3A 1NLOC 2A28A 4Z8AA 3REAB 4AG1C 4OMMA 2JS0A 1UHCA 2DL4A 4LN2A 1WDXA 2PTKA 2FPDA 2DRKA 1ZUUA 1E6GA 1QKWA 2O9VA 2LNHB 3NPFA 4HCKA 2PNIA 4J9HA 2HBWA 2J6KA 4Z89A 3THKA 2RQTA 2RQWA 1JU5C 3M0UA 1OPLA 1W1FA 2JMCA 1B3QA 2P4RA 4LE9A 4FSSA 2JTEA 2KXCA 3VS6A 1Z9ZA 1SHFA 1AZGB 2KROA 2YDLA 4OMPA 4HVUA 1AWJA 1WXBA 4OMLA 4CC7A 1QCFA 2AK5A 2IIMA 2AKLA 2KYMA 2O88A 1M30A 2RMOA 3M0TA 4ZNXA 2RQRA 2FPEA 1PRLC 2RQVA 2AZVA 2CUBA 2M0YA 2HSPA 4RTVA 1NYFA 4HXJA 1WFWA 1AEYA 1V1CA 5EC7A 2CSIA 2A37A 1MUZA 1SHGA 2DL7A 3VS1A 4JZ3A 2DA9A 1SRMA 2YSQA 2HDAA 2RN8A 1LCKA 3IQLA 3TSWA 1G2BA 3REBB 3VS2A 2C0TA 2LJ3A 1B07A 2FG0A 4J9IA 1WXTA 3ULRB 1HD3A 3H0FA 2F2XA 4DEYA 1UECA 2ESWA 2DJQA 1AOJA 1SRLA 1UG1A 1BK2A 2OJ2A 2YUOA 3RBBB 4CC2A 1TG0A 1QKXA 2GNCA 2EYYA 1ABOA 2DE0X 2KEAA 2V1QA 1GFDA 1OEBA 1AD5A 2ECZA 1AWWA 2CDTA 1X2KA 2D8HA 2K6DA 2JM8A 1TUDA 1ZSGA 4ORZA 2K79A 3R6NA 4OMQA 2DBMA 1YWOA 3M0QA 2JXBA 2F2WA 2K9GA 3VS4A 1GBRA 4LUDA 3NGPA 2KRSA 5I11A 1AZEA 2LP5A 1ZBJA 2FRYA 2RPNA 2YUPA 3EHRA 1H8KA 1T0JA 1PWTA 4ESRA 1VYVA 2OAWA 1NEBA 1J3TA 1M3AA 1G83A 1SPKA 2SRCA 1EFNA 1Y57A 2H8HA 1X69A 1ARKA 1NYGA 2XMFA 1GL5A 1AVZC 2KBTA 3H41A 1UJ0A 1CKBA 2LCSA 2ED0A 2X3XD 3SEMA 5L23A 1KFZA 3VRYA 2JS2A 1AWOA 1PNJA 3FJ5A 4LUEA 1U06A 4JJCA 2DNUA 1FMKA 2J7IA 4AFQC 1CSKA 1VA7A 1X6BA 4GBQA 4IIMA 4D8KA 3C0CA 5IH2A 2ROLA 1SEMA 4RTXA 1UGVA 1K1ZA 2X3WD 1BU1A 1W70A 1H92A 1VYUA 4RUGA 1JQQA 1KSWA 4JPBW 2A08A 3LH5A 4J9BA 3NHNA 2LMJA 5GJVB 2EYWA 3I35A 2CH4W 2ABLA 2VVKA 5IXFA 2A36A 2YUNA 2KT8A 2LZ6B 3VS0A 2EQIA 4K11A 2C0OA 1JXOA 1M3BA 1YP5A 1BB9A 1RUWA 2J06A 2LQNA 4HVVA 3GBQA 4AFZC 1ZLMA 2DL8A 4D8DA 2OI3A 1GRIA 2DYBA 1T3SA 2L3PA 1OPKA 1RLPC 1UUEA 2K7AA 2DILA 5IHKA 3UA7A 2DVJA 2EGEA 2EGAA 5GJWB 1WA7A 1HJDA 1GCQC 1ABQA 3UA6A 1I07A 2EW3A 3EG0A 4DEXA 5FWBA 1T3LA 1GCPA 1M27C 3VRZA 2KE9A 4X1VA 2J05A 2YUQA 3TVTA 3U23A 5IHNA 4AG2C 2KXDA 1I0CA 1RI9A 2EKHA 4EIKA 3EHQA 3PE0A 2ENMA 4GLMA 5FW9A 4J9CA 1IO6A 2DX1A 2NWMA 2LJ1A 1UJYA 3EGUA 3KFVA 1JO8A 2J6OA
chains in the Genus database with same CATH superfamily
2LVMA 2YXYA 2GGRA 3NTKA 3FJPA 2I0NA 4FT4A 2PZ1A 2EBPA 1WGSA 2QQBA 1IRXA 3OMGA 2JTMA 2L0AA 2CH4A 2DEQA 4IIOA 2AHJB 2A7YA 4C8QD 3VS3A 3OYHA 1MMDA 2CSQA 3BY7A 2QQRA 3CPWA 3VYGA 2YLCA 3OBWA 1PSEA 2RF0A 5CO7A 2DXUA 3I5SA 1ZUYA 2QTVA 4D6WA 4LNPA 4E6RA 4N4HA 2M9UA 4BY6C 2W10A 2MF2A 2EYXA 4HT8A 2YT6A 1CKAA 2D0QB 1YITA 2HNIA 2B8AA 3SWNC 1NBEB 1NLPC 1Q81R 1GFCA 4N4GA 1Q86R 2R5MA 4BE2A 2CT3A 3CCSA 1YBYA 2LX9A 3CC4T 1G3YA 3X24B 1UE9A 4BY6B 5ECAA 2VYTA 2CT4A 4LDYA 1UTIA 2PQWA 1WHLA 2M51A 2EJGA 2LX7A 2ED1A 1MGQA 4KH0B 3JB9D 3CCMA 5GAMf 4XTWA 3JSCA 4F14A 4RTTA 2DYIA 3SWNA 3G71Q 1W6XA 2X4WA 5IHIA 1NPPA 1K9AA 4HVWA 3PMIA 4PJOC 4OVAA 3CCUA 1PKTA 2DZCA 4Z88A 1Q82R 4C0ZA 1N8RR 4FYWB 2D8JA 1ZX6A 2K2VA 1UGQB 3CXCP 3M54A 2KT1A 3DB4A 3JAME 3JB9J 4ZGDB 4DBFA 1KJWA 2O9SA 3CCJQ 1Q82C 3JCMe 3X25B 4F7UE 1WHJA 2HL5C 5A0DA 2CP3A 2HAXA 1X43A 3CBOA 4F16A 4PJOB 3RMQA 1RABB 2RHXA 2QQSA 2LQWA 1UDLA 4PJOA 2DAQA 4M7AE 4X34A 3CMET 1UEBA 5DLOA 3CCLQ 4C92E 2VKNA 3JCMb 1FWZA 3HHTB 3CC7Q 2GTOA 1VQ7A 4PJNA 2LT1A 2RQUA 1XNIA 4C8QG 3UATA 2NLUA 3G71T 5GANg 4M4ZA 3G6EA 1JJ2P 3RESA 4E7HA 2J6FA 3JCMV 2F5KA 2KAFA 3I5RA 3CCVQ 4C5IA 4CC4B 4C0FA 1MMAA 3O5ZA 1LOJA 5GANf 3J81E 5CKBA 2A28A 4AG1C 2PU9B 4OMMA 1UHCA 3V7SA 3RR6A 4OGEA 3CPFA 3V7RA 2FHDA 3JCMP 1YIJT 1UGPB 4HT9A 1ZUUA 3KBGA 2O9VA 2LNHB 1SKUB 1EZZB 1Q7YU 4EMGA 5J3BA 5CK9A 3VJPA 5LJ3j 2RQWA 4RG2A 1G3WA 3M0UA 1M1KU 1OPLA 2LC4A 2QQ9A 2ZCFB 2P4RA 4CI0C 1BKBA 2KDSA 3FRNA 1C1AA 1YJ9A 1QQJA 1PCXA 2CS7A 3VS6A 3VU3C 1LVKA 1X01A 2KROA 3RMSA 4BI4A 4OMPA 5HK0A 2LT4A 1X6OA 3UWNA 1G3TA 3CC7T 1OULA 1M30A 1VQ6A 4IUUA 2EQKA 2FPEA 4RKUE 4F04B 2RQVA 2AZVA 4M7AD 3OQ5A 3SD4A 1WFWA 4C0GA 4C92D 5KYYB 3E9FA 2L5QA 4LD6A 2DO3A 1FXXA 1MUZA 1TSFA 2DD5A 4JZ3A 4PLIA 2DA9A 2HDAA 1KQSP 2DIQA 3BDLA 4O6JA 4BI8B 1IHVA 3TSWA 1G2BA 2C0TA 1ZA1B 5GAN3 2BUDA 4UC4A 3I56Q 5FRMA 3H0FA 2QEXA 2QK0A 2ESWA 2M16A 2XDBA 5I21A 2CKKA 3BE3A 1BK2A 2OJ2A 2P84A 2XG8D 5KCHA 1VQ5Q 4ZN1A 5DM7R 4M7DC 2EYYA 2QASA 2DE0X 2KEAA 1OEBA 5GAN5 1X2KA 1KC8U 2D8HA 3OS1A 5GMKh 4E7LA 5FU7B 3JCMJ 1RAEB 2EQMA 2DK3A 2K5FA 5D7UA 1QVFA 3LLRA 2YUPA 4LDXA 1H8KA 2X51A 4ESRA 1PWTA 1SPKA 1EFNA 1Y57A 3JCMW 1VQNQ 3M9QA 4M7DA 2JZ2A 4M77E 3CCEA 4M78C 4J6YA 2LCSA 2X3XD 3SEMA 1VIFA 1IREB 5IN1A 5DY9A 3UPUA 2HZYA 2CP7A 2FYKA 1YJWQ 3CMAA 4KGXB 4QVDA 3OS5A 2GFUA 1VQ5T 2EIFA 4IIMA 4OB1B 4C8QF 2HD0A 3C0CA 3EH1A 2ROLA 5LJ5f 4RTXA 1UGVA 5CAIA 2X3WD 1TU0B 5GAMe 4N4IA 1VQPA 1VYUA 5GAN4 3QYGB 3BFMA 1JQQA 4F7UG 3LH5A 3QJYA 3NHNA 2A3LA 2EYWA 3I35A 7AT1B 3VUBA 4M78A 1BI2A 1D3BB 4ATOA 1VQOQ 3CBPA 2YUNA 1N9RA 2CZ0B 3O8VA 3OYIA 4O5VA 4DQ2A 2C0OA 3HP9A 4C92G 3L2WA 3CCSQ 3OYMA 4C0DB 3CCRQ 5GAN8 3M59A 4AFZC 1Y96B 4M75C 2OAUA 3LW5E 5FROA 5KH6A 1T3SA 4DOWA 1OU8A 2E12A 4KH1B 3RUXA 2JNGA 1X75C 1R8OB 3QZ5B 2I2LA 2EGAA 1WA7A 1PM3A 1WHKA 2K3YA 2OTLQ 3OBYA 1I81A 3TU4K 1WQWA 2FZGB 2MMPA 4HCCA 1QP3A 2EW3A 3EG0A 3VRZA 1M1KR 5LJ3e 1OU9A 3QXEB 3CCUQ 2KE9A 2Z0WA 3JB9F 2MAMA 3TVTA 3V7CA 3L2QA 1QVGP 3DKMA 2KXDA 4CRIA 1LPLA 2YRCA 1Q7YC 1FX7A 2E6NA 3PE0A 4M75A 4J9CA 2VGNA 2XKOC 2NWMA 1M1KC 3EGUA 2RK1A 1YITT 2K5IA 2J6OA 1YFNA 1S1NA 4CC3A 2MPXC 4IUTA 1N5ZA 1XOVA 5KYWB 1IHWA 3CCST 2QDYB 3ER0A 4FL6A 2LQ8A 3P8DA 2KK4A 5GAN2 3JCMg 1FYNA 3MEAA 2GBQA 1ZHIA 1R0BG 2GTJA 1H3HA 1XTDA 4XU0A 3I55Q 2V8IA 2G3RA 2XHCA 3CCMT 3S3MA 3LX7A 1JEGA 3TREA 5GAOn 3CCUT 2JT4A 1RADB 1AT1B 2F1LA 1OV3A 2ZPHB 1QWFA 2ZGWA 5HK3A 5GAN7 2L2PA 1GBQA 2KNBB 1WI7A 2GFAA 2ZPFB 3GIBA 1YJNQ 2E5QA 3EFSA 3I9QA 3MP6A 4B9WA 2D9TA 1K8AU 4J9EA 5HCKA 2QI2A 4J7FA 1LNXA 1KC8C 2BZXA 2KR3A 1X6GA 3HRTA 2QA4Q 2E1HA 2NUZA 9ATCB 4QVCA 4A4FA 1A0NB 1YJ9Q 2E10A 1K4US 2COWA 3MEUA 2D0NA 4DBRA 2ROTA 4KUIA 5FWCA 1XJWB 2XI9A 3A5ZB 3OYNA 3JCMh 1VQ7T 3N5BB 1D1AA 1VQKA 2KYBA 4F7UF 4KT0E 1PG5B 4GY5A 1BI3A 1VYTA 2ZPBB 1I8FA 2XICA 4OMNA 3G6ET 4JZ4A 2P0KA 1X27A 2JW4A 2V1RA 3EFOB 3RIRA 4M7AF 2GQIA 2E5KA 1KHCA 1U5SA 4J9FA 4JRPA 2YRVA 1RAGB 3JCMX 2EYZA 4OMOA 1M2VB 1WNLA 2GQVA 1M2VA 1M9SA 1SSHA 1RLQC 4KULA 3CC4Q 2DL5A 1O9SA 3HL8A 2QA4T 2BZYA 2JN0A 3M55A 1PHTA 1QVPA 1YJ9T 1AHJB 2X35A 2L3SA 1WJRA 3PMTA 4JJBA 4QKUA 2R5AA 3EG1A 3LGLA 1WXUA 1D0XA 1YHQA 4OMFB 1VQ6T 5LJ5e 4QQDA 4A63B 2AT1B 3E1SA 2DJZA 1Y0MA 4NL3A 3FEOA 2QG9B 3ZL7C 4A54A 2JMAA 3TSZA 1K76A 3EGXB 1M8MA 1NLOC 4WTOB 1KHIA 5GAN6 2H3JA 4LN2A 4PFOA 2FPDA 2DRKA 1QKWA 1NJIU 2VC8A 3NPFA 4HCKA 3ME9A 2HBWA 2J6KA 4Z89A 3G7ZA 4RCBA 4DOVA 2QEXT 4BE0A 3ZBDA 5CKEA 1JU5C 2HKQB 4J5YA 5CKHA 4PFPA 4DBQA 5LL6S 1Z9ZA 3JCMd 4ZTJA 1WXBA 3CMEQ 4OMLA 2AK5A 1QVFP 3A8GB 3RKXA 3JB9I 4MZMA 2DXCA 1HK9A 4X9DA 1VQ4A 2A37A 3PTAA 1SHGA 5CIUA 3VS1A 2RHUA 1SRMA 3MJXA 2ZPEB 2RN8A 4TVRA 4LXCA 1Y71A 2GF7A 2LJ3A 2FG0A 2K4YA 4FYYB 4E7ZA 1WXTA 4EMHA 1VQLA 5IAYA 3NTHA 3S6WA 2FL7A 1UECA 1YIJQ 3HTRA 1QP2A 2DJQA 1V76A 3CCET 2X4JA 2M02A 1AOJA 3M5AA 1VQ8A 1UG1A 3NTIA 4M78E 2O4XB 3OS2A 3QSUA 2DIGA 2P0PA 1QKXA 2HQXA 2O4XA 4J83A 1YCYA 5GAMj 3OB9A 1ABOA 5DLQE 3JCMQ 1K8AR 2ECZA 1TWBA 2CDTA 3QUIA 2RD1A 1ZSGA 4YTLA 4M77F 4C8QC 3EG9B 3WVDB 2DBMA 1VQPT 2JXBA 2F2WA 3D7SB 4KGVB 2E4HA 3EG9A 3L2UA 1K8AC 3A8OB 3WVEB 1N27A 2X4YA 3NGPA 2JJ9A 5I11A 1ZSZC 4ELYC 4OGCA 2WACA 5KYNA 1T0JA 2PUKB 2NUPB 1G83A 2SRCA 1BCOA 1FMVA 4MMLA 1NYGA 2XMFA 2M1HA 1WZOA 3H6ZA 2WSFE 3H41A 3RKYA 4C8QB 3HSBA 2P4TA 2NUTB 1EIFA 4C8QA 3VRYA 3M4YA 2NUTA 4M75E 5AT1B 1HXDA 1ZSZB 1U06A 4JJCA 4AFQC 1VA7A 1ZSZA 1X6BA 2KVQG 1SEMA 2BIVA 4BACA 1K1ZA 1YI2A 1W70A 3CCQA 1C0MA 2RJEA 4RUGA 2CP5A 4JPBW 4J9BA 2LMJA 3MO8A 2E41A 4JLIA 1M1GA 5GANj 1UGRB 4FM4B 3SDZA 3HFNA 2VVKA 1M8VA 5IXFA 1M90U 2KT8A 5KYXB 2H3EB 2EQIA 2YRDA 3JB9G 2F5TX 1D0ZA 1OX9A 1YP5A 3CD6A 3C12A 1BB9A 1D0YA 1FMWA 5KYYA 2LQNA 5LJ3h 1PC0A 3LYIA 1XQHA 1NPRA 3HPWA 3CC2A 1ZLMA 2DL8A 2ZZDA 2L3PA 1RLPC 3E19A 4JRKA 1UUEA 5FU7C 2DILA 4Z02A 1IB8A 2DVJA 5GJWB 2K3XA 2M0OA 1HJDA 1GCQC 3CXCS 1ABQA 4MZTA 3UA6A 3VYHB 3QO3A 3HKSA 3C95A 1NE8A 3P8HA 3MEVA 3GNGA 3G4SA 4XTZA 3U23A 5IHNA 3T9NA 2L89A 1SSFA 4OB0B 3M53A 2XDPA 3GP8A 2DX1A 3OYYA 3KFVA 4XAXB 1JO8A 2BE9B 1U8RA 3X26B 5GMKi 2LJ0A 2LCCA 1U1SA 1G5VA 2HL3A 5GAMd 1OYXA 2RK2A 1GCQA 1YCSB 3QWYA 4KRTA 1ACMB 1TH7A 4PJLA 2SEMA 1WHHA 2K2MA 3FC3A 1T0HA 2MOXA 1G8XA 2IPOB 2C0IA 4V2SA 2DL3A 2AIRB 1WIEA 2E64A 3L2ZA 3PVLA 2PVDB 3M0PA 1P92A 3FIFA 1OX8A 3UF4A 3UT1A 3ZEHA 2KY9A 2QGFB 2EGCA 3QBYA 3M58A 3EG2A 1Z9QA 3QWXX 3JRZA 2HEQA 1QWEA 3OYEA 1WJQA 2CGHA 3PFSA 1I1JA 2DPPB 1VQKT 3VS7A 2IVWA 4AMCA 2LQKA 2FPFA 3MEWA 4PFZA 4C0DC 4LDWA 1IGUA 1GXIE 2DF6A 2FRWA 3FDRA 3CXCA 1E7OA 1U1TA 3QHSA 4B6MA 3META 1S72A 1TS9A 1PKSA 1KD1U 2RI3A 5LJ3d 4C5EA 2EWNA 3RDVA 1QLYA 3DB3A 4C92C 1YITQ 1D3BA 4M7AG 1Y7XA 1BI0A 1SG5A 4HCZA 4B9XA 4E7SA 4F7UB 2EVRA 1R0CB 1O75A 1JXMA 4F7UA 2HCKA 1K9MU 2EJFA 1TXQA 3G71A 3CPWP 3X20B 2B86A 1BBZA 5GMKl 2IG0A 1WX6A 2RA2A 5LJ5j 3A98A 2KSSA 4FCYA 4M7AB 1RACB 1Y96A 2Y4XA 3GOXA 3JB9H 2EYQA 1UHFA 2BTTA 3LH0A 2K57A 1KQSS 2WSCE 4Q5WA 4C92B 4PLLA 1YHQT 1ZUKA 4M77D 5D6YA 4C92A 3CCMQ 3E2UA 1W2BS 2MCNA 1Q7YR 3M0RA 2RJFA 1U3OA 4KBMB 4Y28E 1B34B 4N0AC 3CCJA 1WYXA 5I22A 3CQTA 2BE7D 5FU6C 2WSEE 1YNZA 4A4HA 2V8KA 4JJDA 2P0QA 4R56A 2EJ9A 1F1BB 1NEGA 5GANe 3CCLA 1M90R 2AKKA 5GMKm 1MV0B 3J80E 3A1PA 4OP0A 5KYWA 1Q81U 1YN8A 3M0SA 5CKDA 1Q86U 3SHWA 1MHNA 1M4ZA 4N0AA 2QTXA 1KIKA 2RB6A 2CREA 5FU6B 2VXFA 1M90C 4XU2A 2KRNA 4QQ6A 1ZQ1A 4RTYA 2E6ZA 3S3OA 1D1BA 2VWFA 2FVUA 3CCVA 5D6WA 1VQ7Q 2FEIA 2D1XA 4WCIA 2EPDA 4MMKA 3JCMf 2DEUA 3H0HA 3OW2S 1VQ4T 3G6EQ 2FB7A 4Z8AA 3REAB 3VKIA 2RI5A 2JS0A 3KUFA 1IZ6A 2X9HA 5A0LA 4MDXA 4ZGJB 2R58A 5AYFA 4PJOE 3FB9A 3VUZA 4A4EA 4Y91A 1KC8R 1VQLT 4M7DF 3C4SA 1W2BA 2PNIA 4J9HA 3THKA 3PIPA 3OSSC 1N8RU 2ATCB 4IUVA 1W1FA 4VUBA 2ZPGB 1B3QA 1VQ8T 1VQ9A 4OF1A 3TCJA 3EFRA 1JRIA 1LJOA 4FSSA 2KXCA 3GPLA 3OYFA 4HVUA 1AWJA 3JCMc 4CC7A 3MPUB 1QCFA 2O88A 2IIMA 4J8OA 2QAZA 2RMOA 3M0TA 2CP0A 2RQRA 4JLGA 4A4GA 1WJSA 1PRLC 4DBHA 5CCAA 1QMCA 2HSPA 3NFCA 2OX7A 5HKCA 3E9GA 1VQ6Q 1AEYA 4X9CA 3LWIA 1V1CA 2L3RA 4LDVA 2CSIA 3H8ZA 4PK4A 1VQMA 2Y90A 4M78F 2YSQA 4M77G 3I56A 2DVEA 1LCKA 3IQLA 4HKEA 3REBB 3VS2A 1B07A 3CD6Q 4KGZB 3G1JA 5LJ5d 1HD3A 3EFOA 4NOYA 3OYJA 2F2XA 1ZA2B 2DTHA 3OW2A 1VQ5A 4M77B 3EAEA 4LDUA 5D6XA 2QEXQ 2YUOA 2HKNA 4CC2A 4J6WA 1QVGS 4XTVA 3OYLA 5GAOp 4PJOD 2GNCA 4C5HA 1GFDA 4BDZA 2LTOA 2K6DA 2JM8A 2QQAA 3OYBA 2MK5A 2VXEA 1TTHB 1YI2T 3RKWA 4OMQA 1KD1C 3CCQT 1QW1A 3M0QA 2MWPA 1GBRA 3AHUA 2VV5A 2OTJA 1VQNA 1DJ7B 3URGA 2LP5A 4M75F 1V29B 1AZEA 4P5NA 2FRYA 4MDWA 2OAWA 3QYHB 3V8JA 1J3TA 1K9MC 2H8HA 2Y4YA 1X69A 1ARKA 3CD6T 3DLLA 3EGXA 2KBTA 1QCNA 2CZ6B 2ED0A 2RH2A 3CC2T 1YJWA 1RAHB 2PUOB 4NS5A 2JS2A 1AWOA 3CCEQ 5A2QE 1PNJA 4LUEA 3OYDA 3OA6A 1RAAB 1KQ1A 3GF5A 2ZPIB 4L5GA 4D8KA 1M5Q1 5A0GA 3QIIA 3CMAQ 3FLGA 3L1AA 3QG1A 1H92A 2KMTA 4JDSA 2JOYA 4JS5A 1KSWA 1VQOA 2FZCB 2A08A 3G4ST 5GJVB 1KG1A 1RAIB 1QVGA 4M7DE 1VQPQ 1D1CA 1OZ3A 4L6V5 4IUPA 3VS0A 4IURA 1S72Q 3CCRA 3MHXA 1D09B 3M57A 1M3BA 1Q81C 1Q86C 1RUWA 2J06A 5GAMg 4HVVA 2QYZA 3RERA 4OB3B 2HBPA 4D8DA 2D6FA 1GRIA 2DYBA 3SWNB 2OTLA 1OPKA 2E3IA 2K7AA 2DXBA 5IHKA 2EQJA 2EGEA 2KQWA 3QZ9B 2HSEB 4DEXA 3PIOA 4ZTFA 2BKDN 4PJOG 4X1VA 3CMAT 2JVVA 2VUBA 2J05A 2DZ9A 4AG2C 2RHIA 1RI9A 3EHQA 4JUVA 1PSFA 5FW9A 1N8RC 1EX4A 1KK7A 4HA8A 2LJ1A 3QDRB 3A8MB 2DD4A 2EKOA 1S72T 4AFSC 1UFFA 4AFUC 3X28B 3OMCA 4L59A 4BE1A 2EAYA 5LJ3g 4JRQA 4M7DD 2K3BA 2LNVA 1H3ZA 4RTUA 1C6VX 3JV3A 4BD3A 2NUPA 3I55A 5LJ3f 2DRMA 5GAMh 4E7KA 2XDDA 1TUGB 2DMOA 3MP1A 1K73U 2O31A 2RHZA 3QPHA 2EFIA 4A53A 2MYSA 4RTZA 1M3CA 4XU1A 1JBMA 2F69A 4DA4A 2XD0A 4EDUA 4QT7A 3MCAB 1BIBA 3EG3A 3Q1JA 5KE3A 1PRMC 4J9GA 1YJNA 2L8DA 3NMZC 3OYKA 4M78D 2COYA 3CCJT 1SF9A 4PKCC 5CVIA 4F17A 2DLPA 3PVQA 3RNJA 2DBKA 3QKJA 2VASA 2AZSA 2W0ZA 2QA4A 2KGTA 5CQXA 6AT1B 3R6OA 1WHMA 1TUCA 1QVFS 2E3HA 3P8BB 5KYXA 2HQEA 4RTWA 3ASKA 2YLBA 3CCLT 1VQ9Q 1AWXA 2RI2A 1BCMA 3OYCA 1Q95G 2MIOA 5J26A 3GNFB 2VGMA 5IXBA 4E47A 4PJMA 4HCBA 1N9SA 2PVGB 2C06A 1YWPA 1JB0E 4RCCA 1NZ9A 4FIBA 3PNWC 1MMGA 2CYZB 4E7IA 1OI1A 5CKFA 3ZFJA 5GMKj 1NJIR 4R0KA 5GAOl 1K0SA 3CCVT 5GANh 1VOMA 4E2FB 2HMAA 2F2VA 2DTOA 3HRSA 1VQKQ 3OSVA 2BZ8A 1VQMQ 4LD9K 3EH2A 1W2BP 4Y92A 1K0XA 2RNAA 4M75D 1HYOA 2RM4A 1NJIC 2XU8A 4XTYA 2QDLA 4XTXA 2A0FB 4J9DA 3HRUA 5I2MA 2G6FX 3CC4A 1BIAA 1IGQA 1WLPB 1OOTA 1NM7A 4WF2A 1HSQA 1E6HA 1MNDA 2LDMA 3L2VA 3M56A 2EQUA 4J6XA 5FLXE 2RJCA 2FO0A 1VQ9T 2KRMA 3DLMA 4M7DG 2E70A 2DM1A 5GAOm 3H0IA 4PJOF 1JJ2S 3A8LB 3OS0A 2L3QA 2DFUA 1RL2A 3OY9A 2CUDA 3LGFA 4EMKC 2O2OA 4M7DB 4FU6A 1YHQQ 3VS5A 2OTJQ 1W4SA 2JM9A 1NG2A 1X2QA 1VQMT 1MV3A 1PD0A 2LRQA 3OW2P 1Y07A 5KYUB 4FW1A 3I56T 5HY6A 2DL4A 1KQ2A 1WDXA 2PTKA 5KYUA 2HQHA 1I4K1 1E6GA 2XIDA 1MMNA 1RI0A 4BB7A 5LJ5g 4ME7A 2QGGA 4M78G 4M7AC 2RQTA 3PT9A 8ATCB 3QJ6A 4E7JA 4EMKB 4EPCA 2DTIA 2JMCA 3CEYA 4LE9A 3MKDA 3CMEA 3J7AF 2V8JA 4EMKA 2JTEA 4XTUA 3OYGA 4AT1B 2K5LA 1SHFA 1AZGB 4C5GA 2YDLA 4M78B 2AKLA 2KYMA 4ZNXA 3GLXA 4ZN3A 5GANd 5I2SA 3L2RA 2CUBA 2M0YA 2RO0A 3M4GA 4RTVA 2GCXA 4NL2A 1NYFA 4HXJA 3OYAA 4PL6A 5EC7A 4M7AA 1TOVA 1K73R 2CZ1B 2ZAEA 2DL7A 2OTJT 4KUDK 2XK0A 1VQNT 5GAOr 1OQKA 1VQ4Q 1YIJA 1JJ2A 5CQYA 4J9IA 3AT1B 3C94A 4R55A 1M2OA 3WXMB 3ULRB 4ANJA 1B34A 1K73C 3CBMA 3UDCA 1G3SA 4DEYA 4OB2B 4M75G 2X4XA 1WHGA 1VQLQ 4JRIA 1SRLA 1YJWT 2R57A 2DXTA 1BI1A 2NYSA 3RBBB 1QCOA 2JUFA 1TG0A 2RHYA 4PNOA 4XK8E 3VV0A 2MWOA 5CR2A 5LJ5h 5GAOq 1VIEA 3PGGA 1VQ8Q 5FRNA 3QDFA 2V1QA 2VB6A 1AD5A 1AWWA 3CC7A 4M75B 1RAFB 3L42A 1TUDA 2LCLA 2RJDA 4ORZA 2K79A 1VUBA 3MP8A 3R6NA 3V8LA 1YWOA 2K9GA 3S3NA 3VS4A 1VQOT 1WPYA 2CP2A 4GLKA 4LUDA 1BYMA 2KRSA 1ZBJA 3EHRA 2RPNA 2E65A 4ZGEB 1VYVA 1NEBA 1M3AA 3LWHA 3CCRT 3V8KA 2DKGA 4BI3A 5GMKe 1GL5A 1AVZC 3SFMA 3KXTA 1MNEA 1UJ0A 1CKBA 1KQSA 5L23A 1KFZA 1WQ7A 1OZ2A 4FW2A 4FYVB 2OTLT 3EGDB 3SB2A 1M1FA 4BUGA 4IKFA 2YWWA 3TEEA 1Q82U 3FJ5A 3EGDA 2DNUA 1FMKA 2J7IA 1CSKA 2JTFA 4GBQA 5IH2A 3F70A 4IUQA 5IT9E 5KCOA 4A4KA 8AT1B 1BU1A 2DERA 2V26A 4MZPA 4QVZA 4RG8A 5L8RE 2CH4W 1B7TA 3A8HB 3HFOA 4BDYA 1YI2Q 3CCQQ 2ABLA 4FYXB 4JS4A 4XU3A 2A36A 2LZ6B 2DETA 2YHTA 4M77C 5C6SA 4K11A 2FZKB 4C8QE 2MI6A 2CP6A 1JXOA 4FSXA 3CPWS 3INZA 5KE2A 2QXFA 3BDUA 4FT2A 4XQ3A 3GBQA 4J7IA 1I5LA 2OI3A 3TQ7P 2KI7A 4QW2A 5J39A 3I55T 3CC2Q 4RMOA 5C0MA 3UA7A 1IXDA 5M9OA 2O01E 3BW1A 5EG2A 2CZ7B 4JJNK 4ELZC 1PD1A 1I5OB 1I07A 1ZBXA 5FWBA 1T3LA 1GCPA 4M77A 1M27C 1KD1R 2PVOB 1R77A 4PJJA 2YUQA 4QQGA 4II1A 4C92F 1I0CA 1N6AA 2EKHA 4EIKA 2ENMA 1UGSB 2COZA 3G4SQ 4GLMA 3H9NA 1IO6A 1YJNT 1UJYA 1H641 1K9MR 1UB4A
chains in the Genus database with same CATH topology
2LJ0A 1UFFA 4AFSC 4AFUC 1S1NA 4CC3A 2GGRA 1N5ZA 1GCQA 1YCSB 1XOVA 3QWYA 4KRTA 2I0NA 2SEMA 2K2MA 1T0HA 2PZ1A 2K3BA 2MOXA 2EBPA 4RTUA 2C0IA 3JV3A 2DL3A 2L0AA 2CH4A 1WIEA 4IIOA 1FYNA 2DRMA 3PVLA 3M0PA 2GBQA 3VS3A 3UF4A 2GTJA 1H3HA 2CSQA 2DMOA 2EGCA 2O31A 1Z9QA 3EG2A 3QWXX 2HEQA 1QWEA 2RF0A 4RTZA 3I5SA 1ZUYA 1M3CA 1JEGA 1I1JA 4LNPA 3VS7A 4E6RA 4QT7A 3EG3A 2W10A 2EYXA 2JT4A 1PRMC 2FPFA 4J9GA 1OV3A 2YT6A 1QWFA 2DF6A 2L2PA 1GBQA 2KNBB 3NMZC 2FRWA 1CKAA 1E7OA 1WI7A 4F17A 2DLPA 1NLPC 1GFCA 3PVQA 1PKSA 3RNJA 2DBKA 2AZSA 2W0ZA 3I9QA 1QLYA 2KGTA 2CT3A 4J9EA 5HCKA 1TUCA 2BZXA 1UE9A 2KR3A 1X6GA 4RTWA 5ECAA 2CT4A 2EVRA 2NUZA 1AWXA 1UTIA 1A0NB 1JXMA 1K4US 2M51A 2HCKA 2MIOA 2LX7A 2ED1A 5IXBA 2B86A 1BBZA 2D0NA 1WX6A 2ROTA 3A98A 5FWCA 1YWPA 4F14A 1UHFA 2BTTA 4RTTA 1W6XA 2KYBA 5IHIA 4HVWA 1K9AA 1ZUKA 1VYTA 4R0KA 1K0SA 4OMNA 2MCNA 1PKTA 4Z88A 4JZ4A 2F2VA 3M0RA 2BZ8A 1X27A 1ZX6A 2D8JA 1U3OA 2JW4A 2V1RA 4Y92A 1K0XA 2KT1A 2GQIA 1WYXA 2RNAA 2E5KA 5I22A 1U5SA 4J9FA 3CQTA 2QDLA 1YNZA 4J9DA 1KJWA 2O9SA 4JJDA 2EYZA 2G6FX 4OMOA 1WLPB 1OOTA 1NM7A 1NEGA 1HSQA 1X43A 4F16A 1E6HA 1SSHA 1RLQC 2AKKA 2LQWA 1UDLA 2DL5A 1MV0B 2BZYA 2FO0A 1PHTA 2KRMA 2L3SA 1YN8A 3M0SA 4JJBA 2VKNA 3SHWA 3EG1A 1KIKA 2CREA 2GTOA 2DM1A 2KRNA 3H0IA 1WXUA 4RTYA 2RQUA 2VWFA 2L3QA 3UATA 4A63B 2FEIA 2D1XA 4M4ZA 4WCIA 2EPDA 2CUDA 2J6FA 2O2OA 1Y0MA 3VS5A 3H0HA 2JM9A 3ZL7C 1NG2A 3I5RA 2JMAA 3TSZA 4CC4B 1K76A 3O5ZA 1X2QA 1M8MA 1MV3A 1NLOC 2A28A 4Z8AA 3REAB 4AG1C 4OMMA 2JS0A 1UHCA 2DL4A 4LN2A 1WDXA 2PTKA 2FPDA 2DRKA 1ZUUA 1E6GA 1QKWA 2O9VA 2LNHB 3NPFA 4HCKA 2PNIA 4J9HA 2HBWA 2J6KA 4Z89A 3THKA 2RQTA 2RQWA 1JU5C 3M0UA 1OPLA 1W1FA 2JMCA 1B3QA 2P4RA 4LE9A 4FSSA 2JTEA 2KXCA 3VS6A 1Z9ZA 1SHFA 1AZGB 2KROA 2YDLA 4OMPA 4HVUA 1AWJA 1WXBA 4OMLA 4CC7A 1QCFA 2AK5A 2IIMA 2AKLA 2KYMA 2O88A 1M30A 2RMOA 3M0TA 4ZNXA 2RQRA 2FPEA 1PRLC 2RQVA 2AZVA 2CUBA 2M0YA 2HSPA 4RTVA 1NYFA 4HXJA 1WFWA 1AEYA 1V1CA 5EC7A 2CSIA 2A37A 1MUZA 1SHGA 2DL7A 3VS1A 4JZ3A 2DA9A 1SRMA 2YSQA 2HDAA 2RN8A 1LCKA 3IQLA 3TSWA 1G2BA 3REBB 3VS2A 2C0TA 2LJ3A 1B07A 2FG0A 4J9IA 1WXTA 3ULRB 1HD3A 3H0FA 2F2XA 4DEYA 1UECA 2ESWA 2DJQA 1AOJA 1SRLA 1UG1A 1BK2A 2OJ2A 2YUOA 3RBBB 4CC2A 1TG0A 1QKXA 2GNCA 2EYYA 1ABOA 2DE0X 2KEAA 2V1QA 1GFDA 1OEBA 1AD5A 2ECZA 1AWWA 2CDTA 1X2KA 2D8HA 2K6DA 2JM8A 1TUDA 1ZSGA 4ORZA 2K79A 3R6NA 4OMQA 2DBMA 1YWOA 3M0QA 2JXBA 2F2WA 2K9GA 3VS4A 1GBRA 4LUDA 3NGPA 2KRSA 5I11A 1AZEA 2LP5A 1ZBJA 2FRYA 2RPNA 2YUPA 3EHRA 1H8KA 1T0JA 1PWTA 4ESRA 1VYVA 2OAWA 1NEBA 1J3TA 1M3AA 1G83A 1SPKA 2SRCA 1EFNA 1Y57A 2H8HA 1X69A 1ARKA 1NYGA 2XMFA 1GL5A 1AVZC 2KBTA 3H41A 1UJ0A 1CKBA 2LCSA 2ED0A 2X3XD 3SEMA 5L23A 1KFZA 3VRYA 2JS2A 1AWOA 1PNJA 3FJ5A 4LUEA 1U06A 4JJCA 2DNUA 1FMKA 2J7IA 4AFQC 1CSKA 1VA7A 1X6BA 4GBQA 4IIMA 4D8KA 3C0CA 5IH2A 2ROLA 1SEMA 4RTXA 1UGVA 1K1ZA 2X3WD 1BU1A 1W70A 1H92A 1VYUA 4RUGA 1JQQA 1KSWA 4JPBW 2A08A 3LH5A 4J9BA 3NHNA 2LMJA 5GJVB 2EYWA 3I35A 2CH4W 2ABLA 2VVKA 5IXFA 2A36A 2YUNA 2KT8A 2LZ6B 3VS0A 2EQIA 4K11A 2C0OA 1JXOA 1M3BA 1YP5A 1BB9A 1RUWA 2J06A 2LQNA 4HVVA 3GBQA 4AFZC 1ZLMA 2DL8A 4D8DA 2OI3A 1GRIA 2DYBA 1T3SA 2L3PA 1OPKA 1RLPC 1UUEA 2K7AA 2DILA 5IHKA 3UA7A 2DVJA 2EGEA 2EGAA 5GJWB 1WA7A 1HJDA 1GCQC 1ABQA 3UA6A 1I07A 2EW3A 3EG0A 4DEXA 5FWBA 1T3LA 1GCPA 1M27C 3VRZA 2KE9A 4X1VA 2J05A 2YUQA 3TVTA 3U23A 5IHNA 4AG2C 2KXDA 1I0CA 1RI9A 2EKHA 4EIKA 3EHQA 3PE0A 2ENMA 4GLMA 5FW9A 4J9CA 1IO6A 2DX1A 2NWMA 2LJ1A 1UJYA 3EGUA 3KFVA 1JO8A 2J6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ0 A;  1UFF A;  4AFS C;  4AFU C;  1S1N A;  4CC3 A;  2GGR A;  1N5Z A;  1GCQ A;  1YCS B;  1XOV A;  3QWY A;  4KRT A;  2I0N A;  2SEM A;  2K2M A;  1T0H A;  2PZ1 A;  2K3B A;  2MOX A;  2EBP A;  4RTU A;  2C0I A;  3JV3 A;  2DL3 A;  2L0A A;  2CH4 A;  1WIE A;  4IIO A;  1FYN A;  2DRM A;  3PVL A;  3M0P A;  2GBQ A;  3VS3 A;  3UF4 A;  2GTJ A;  1H3H A;  2CSQ A;  2DMO A;  2EGC A;  2O31 A;  1Z9Q A;  3EG2 A;  3QWX X;  2HEQ A;  1QWE A;  2RF0 A;  4RTZ A;  3I5S A;  1ZUY A;  1M3C A;  1JEG A;  1I1J A;  4LNP A;  3VS7 A;  4E6R A;  4QT7 A;  3EG3 A;  2W10 A;  2EYX A;  2JT4 A;  1PRM C;  2FPF A;  4J9G A;  1OV3 A;  2YT6 A;  1QWF A;  2DF6 A;  2L2P A;  1GBQ A;  2KNB B;  3NMZ C;  2FRW A;  1CKA A;  1E7O A;  1WI7 A;  4F17 A;  2DLP A;  1NLP C;  1GFC A;  3PVQ A;  1PKS A;  3RNJ A;  2DBK A;  2AZS A;  2W0Z A;  3I9Q A;  1QLY A;  2KGT A;  2CT3 A;  4J9E A;  5HCK A;  1TUC A;  2BZX A;  1UE9 A;  2KR3 A;  1X6G A;  4RTW A;  5ECA A;  2CT4 A;  2EVR A;  2NUZ A;  1AWX A;  1UTI A;  1A0N B;  1JXM A;  1K4U S;  2M51 A;  2HCK A;  2MIO A;  2LX7 A;  2ED1 A;  5IXB A;  2B86 A;  1BBZ A;  2D0N A;  1WX6 A;  2ROT A;  3A98 A;  5FWC A;  1YWP A;  4F14 A;  1UHF A;  2BTT A;  4RTT A;  1W6X A;  2KYB A;  5IHI A;  4HVW A;  1K9A A;  1ZUK A;  1VYT A;  4R0K A;  1K0S A;  4OMN A;  2MCN A;  1PKT A;  4Z88 A;  4JZ4 A;  2F2V A;  3M0R A;  2BZ8 A;  1X27 A;  1ZX6 A;  2D8J A;  1U3O A;  2JW4 A;  2V1R A;  4Y92 A;  1K0X A;  2KT1 A;  2GQI A;  1WYX A;  2RNA A;  2E5K A;  5I22 A;  1U5S A;  4J9F A;  3CQT A;  2QDL A;  1YNZ A;  4J9D A;  1KJW A;  2O9S A;  4JJD A;  2EYZ A;  2G6F X;  4OMO A;  1WLP B;  1OOT A;  1NM7 A;  1NEG A;  1HSQ A;  1X43 A;  4F16 A;  1E6H A;  1SSH A;  1RLQ C;  2AKK A;  2LQW A;  1UDL A;  2DL5 A;  1MV0 B;  2BZY A;  2FO0 A;  1PHT A;  2KRM A;  2L3S A;  1YN8 A;  3M0S A;  4JJB A;  2VKN A;  3SHW A;  3EG1 A;  1KIK A;  2CRE A;  2GTO A;  2DM1 A;  2KRN A;  3H0I A;  1WXU A;  4RTY A;  2RQU A;  2VWF A;  2L3Q A;  3UAT A;  4A63 B;  2FEI A;  2D1X A;  4M4Z A;  4WCI A;  2EPD A;  2CUD A;  2J6F A;  2O2O A;  1Y0M A;  3VS5 A;  3H0H A;  2JM9 A;  3ZL7 C;  1NG2 A;  3I5R A;  2JMA A;  3TSZ A;  4CC4 B;  1K76 A;  3O5Z A;  1X2Q A;  1M8M A;  1MV3 A;  1NLO C;  2A28 A;  4Z8A A;  3REA B;  4AG1 C;  4OMM A;  2JS0 A;  1UHC A;  2DL4 A;  4LN2 A;  1WDX A;  2PTK A;  2FPD A;  2DRK A;  1ZUU A;  1E6G A;  1QKW A;  2O9V A;  2LNH B;  3NPF A;  4HCK A;  2PNI A;  4J9H A;  2HBW A;  2J6K A;  4Z89 A;  3THK A;  2RQT A;  2RQW A;  1JU5 C;  3M0U A;  1OPL A;  1W1F A;  2JMC A;  1B3Q A;  2P4R A;  4LE9 A;  4FSS A;  2JTE A;  2KXC A;  3VS6 A;  1Z9Z A;  1SHF A;  1AZG B;  2KRO A;  2YDL A;  4OMP A;  4HVU A;  1AWJ A;  1WXB A;  4OML A;  4CC7 A;  1QCF A;  2AK5 A;  2IIM A;  2AKL A;  2KYM A;  2O88 A;  1M30 A;  2RMO A;  3M0T A;  4ZNX A;  2RQR A;  2FPE A;  1PRL C;  2RQV A;  2AZV A;  2CUB A;  2M0Y A;  2HSP A;  4RTV A;  1NYF A;  4HXJ A;  1WFW A;  1AEY A;  1V1C A;  5EC7 A;  2CSI A;  2A37 A;  1MUZ A;  1SHG A;  2DL7 A;  3VS1 A;  4JZ3 A;  2DA9 A;  1SRM A;  2YSQ A;  2HDA A;  2RN8 A;  1LCK A;  3IQL A;  3TSW A;  1G2B A;  3REB B;  3VS2 A;  2C0T A;  2LJ3 A;  1B07 A;  2FG0 A;  4J9I A;  1WXT A;  3ULR B;  1HD3 A;  3H0F A;  2F2X A;  4DEY A;  1UEC A;  2ESW A;  2DJQ A;  1AOJ A;  1SRL A;  1UG1 A;  1BK2 A;  2OJ2 A;  2YUO A;  3RBB B;  4CC2 A;  1TG0 A;  1QKX A;  2GNC A;  2EYY A;  1ABO A;  2DE0 X;  2KEA A;  2V1Q A;  1GFD A;  1OEB A;  1AD5 A;  2ECZ A;  1AWW A;  2CDT A;  1X2K A;  2D8H A;  2K6D A;  2JM8 A;  1TUD A;  1ZSG A;  4ORZ A;  2K79 A;  3R6N A;  4OMQ A;  2DBM A;  1YWO A;  3M0Q A;  2JXB A;  2F2W A;  2K9G A;  3VS4 A;  1GBR A;  4LUD A;  3NGP A;  2KRS A;  5I11 A;  1AZE A;  2LP5 A;  1ZBJ A;  2FRY A;  2RPN A;  2YUP A;  3EHR A;  1H8K A;  1T0J A;  1PWT A;  4ESR A;  1VYV A;  2OAW A;  1NEB A;  1J3T A;  1M3A A;  1G83 A;  1SPK A;  2SRC A;  1EFN A;  1Y57 A;  2H8H A;  1X69 A;  1ARK A;  1NYG A;  2XMF A;  1GL5 A;  1AVZ C;  2KBT A;  3H41 A;  1UJ0 A;  1CKB A;  2LCS A;  2ED0 A;  2X3X D;  3SEM A;  5L23 A;  1KFZ A;  3VRY A;  2JS2 A;  1AWO A;  1PNJ A;  3FJ5 A;  4LUE A;  1U06 A;  4JJC A;  2DNU A;  1FMK A;  2J7I A;  4AFQ C;  1CSK A;  1VA7 A;  1X6B A;  4GBQ A;  4IIM A;  4D8K A;  3C0C A;  5IH2 A;  2ROL A;  1SEM A;  4RTX A;  1UGV A;  1K1Z A;  2X3W D;  1BU1 A;  1W70 A;  1H92 A;  1VYU A;  4RUG A;  1JQQ A;  1KSW A;  4JPB W;  2A08 A;  3LH5 A;  4J9B A;  3NHN A;  2LMJ A;  5GJV B;  2EYW A;  3I35 A;  2CH4 W;  2ABL A;  2VVK A;  5IXF A;  2A36 A;  2YUN A;  2KT8 A;  2LZ6 B;  3VS0 A;  2EQI A;  4K11 A;  2C0O A;  1JXO A;  1M3B A;  1YP5 A;  1BB9 A;  1RUW A;  2J06 A;  2LQN A;  4HVV A;  3GBQ A;  4AFZ C;  1ZLM A;  2DL8 A;  4D8D A;  2OI3 A;  1GRI A;  2DYB A;  1T3S A;  2L3P A;  1OPK A;  1RLP C;  1UUE A;  2K7A A;  2DIL A;  5IHK A;  3UA7 A;  2DVJ A;  2EGE A;  2EGA A;  5GJW B;  1WA7 A;  1HJD A;  1GCQ C;  1ABQ A;  3UA6 A;  1I07 A;  2EW3 A;  3EG0 A;  4DEX A;  5FWB A;  1T3L A;  1GCP A;  1M27 C;  3VRZ A;  2KE9 A;  4X1V A;  2J05 A;  2YUQ A;  3TVT A;  3U23 A;  5IHN A;  4AG2 C;  2KXD A;  1I0C A;  1RI9 A;  2EKH A;  4EIK A;  3EHQ A;  3PE0 A;  2ENM A;  4GLM A;  5FW9 A;  4J9C A;  1IO6 A;  2DX1 A;  2NWM A;  2LJ1 A;  1UJY A;  3EGU A;  3KFV A;  1JO8 A;  2J6O A; 
#chains in the Genus database with same CATH topology
 2LVM A;  2YXY A;  2GGR A;  3NTK A;  3FJP A;  2I0N A;  4FT4 A;  2PZ1 A;  2EBP A;  1WGS A;  2QQB A;  1IRX A;  3OMG A;  2JTM A;  2L0A A;  2CH4 A;  2DEQ A;  4IIO A;  2AHJ B;  2A7Y A;  4C8Q D;  3VS3 A;  3OYH A;  1MMD A;  2CSQ A;  3BY7 A;  2QQR A;  3CPW A;  3VYG A;  2YLC A;  3OBW A;  1PSE A;  2RF0 A;  5CO7 A;  2DXU A;  3I5S A;  1ZUY A;  2QTV A;  4D6W A;  4LNP A;  4E6R A;  4N4H A;  2M9U A;  4BY6 C;  2W10 A;  2MF2 A;  2EYX A;  4HT8 A;  2YT6 A;  1CKA A;  2D0Q B;  1YIT A;  2HNI A;  2B8A A;  3SWN C;  1NBE B;  1NLP C;  1Q81 R;  1GFC A;  4N4G A;  1Q86 R;  2R5M A;  4BE2 A;  2CT3 A;  3CCS A;  1YBY A;  2LX9 A;  3CC4 T;  1G3Y A;  3X24 B;  1UE9 A;  4BY6 B;  5ECA A;  2VYT A;  2CT4 A;  4LDY A;  1UTI A;  2PQW A;  1WHL A;  2M51 A;  2EJG A;  2LX7 A;  2ED1 A;  1MGQ A;  4KH0 B;  3JB9 D;  3CCM A;  5GAM f;  4XTW A;  3JSC A;  4F14 A;  4RTT A;  2DYI A;  3SWN A;  3G71 Q;  1W6X A;  2X4W A;  5IHI A;  1NPP A;  1K9A A;  4HVW A;  3PMI A;  4PJO C;  4OVA A;  3CCU A;  1PKT A;  2DZC A;  4Z88 A;  1Q82 R;  4C0Z A;  1N8R R;  4FYW B;  2D8J A;  1ZX6 A;  2K2V A;  1UGQ B;  3CXC P;  3M54 A;  2KT1 A;  3DB4 A;  3JAM E;  3JB9 J;  4ZGD B;  4DBF A;  1KJW A;  2O9S A;  3CCJ Q;  1Q82 C;  3JCM e;  3X25 B;  4F7U E;  1WHJ A;  2HL5 C;  5A0D A;  2CP3 A;  2HAX A;  1X43 A;  3CBO A;  4F16 A;  4PJO B;  3RMQ A;  1RAB B;  2RHX A;  2QQS A;  2LQW A;  1UDL A;  4PJO A;  2DAQ A;  4M7A E;  4X34 A;  3CME T;  1UEB A;  5DLO A;  3CCL Q;  4C92 E;  2VKN A;  3JCM b;  1FWZ A;  3HHT B;  3CC7 Q;  2GTO A;  1VQ7 A;  4PJN A;  2LT1 A;  2RQU A;  1XNI A;  4C8Q G;  3UAT A;  2NLU A;  3G71 T;  5GAN g;  4M4Z A;  3G6E A;  1JJ2 P;  3RES A;  4E7H A;  2J6F A;  3JCM V;  2F5K A;  2KAF A;  3I5R A;  3CCV Q;  4C5I A;  4CC4 B;  4C0F A;  1MMA A;  3O5Z A;  1LOJ A;  5GAN f;  3J81 E;  5CKB A;  2A28 A;  4AG1 C;  2PU9 B;  4OMM A;  1UHC A;  3V7S A;  3RR6 A;  4OGE A;  3CPF A;  3V7R A;  2FHD A;  3JCM P;  1YIJ T;  1UGP B;  4HT9 A;  1ZUU A;  3KBG A;  2O9V A;  2LNH B;  1SKU B;  1EZZ B;  1Q7Y U;  4EMG A;  5J3B A;  5CK9 A;  3VJP A;  5LJ3 j;  2RQW A;  4RG2 A;  1G3W A;  3M0U A;  1M1K U;  1OPL A;  2LC4 A;  2QQ9 A;  2ZCF B;  2P4R A;  4CI0 C;  1BKB A;  2KDS A;  3FRN A;  1C1A A;  1YJ9 A;  1QQJ A;  1PCX A;  2CS7 A;  3VS6 A;  3VU3 C;  1LVK A;  1X01 A;  2KRO A;  3RMS A;  4BI4 A;  4OMP A;  5HK0 A;  2LT4 A;  1X6O A;  3UWN A;  1G3T A;  3CC7 T;  1OUL A;  1M30 A;  1VQ6 A;  4IUU A;  2EQK A;  2FPE A;  4RKU E;  4F04 B;  2RQV A;  2AZV A;  4M7A D;  3OQ5 A;  3SD4 A;  1WFW A;  4C0G A;  4C92 D;  5KYY B;  3E9F A;  2L5Q A;  4LD6 A;  2DO3 A;  1FXX A;  1MUZ A;  1TSF A;  2DD5 A;  4JZ3 A;  4PLI A;  2DA9 A;  2HDA A;  1KQS P;  2DIQ A;  3BDL A;  4O6J A;  4BI8 B;  1IHV A;  3TSW A;  1G2B A;  2C0T A;  1ZA1 B;  5GAN 3;  2BUD A;  4UC4 A;  3I56 Q;  5FRM A;  3H0F A;  2QEX A;  2QK0 A;  2ESW A;  2M16 A;  2XDB A;  5I21 A;  2CKK A;  3BE3 A;  1BK2 A;  2OJ2 A;  2P84 A;  2XG8 D;  5KCH A;  1VQ5 Q;  4ZN1 A;  5DM7 R;  4M7D C;  2EYY A;  2QAS A;  2DE0 X;  2KEA A;  1OEB A;  5GAN 5;  1X2K A;  1KC8 U;  2D8H A;  3OS1 A;  5GMK h;  4E7L A;  5FU7 B;  3JCM J;  1RAE B;  2EQM A;  2DK3 A;  2K5F A;  5D7U A;  1QVF A;  3LLR A;  2YUP A;  4LDX A;  1H8K A;  2X51 A;  4ESR A;  1PWT A;  1SPK A;  1EFN A;  1Y57 A;  3JCM W;  1VQN Q;  3M9Q A;  4M7D A;  2JZ2 A;  4M77 E;  3CCE A;  4M78 C;  4J6Y A;  2LCS A;  2X3X D;  3SEM A;  1VIF A;  1IRE B;  5IN1 A;  5DY9 A;  3UPU A;  2HZY A;  2CP7 A;  2FYK A;  1YJW Q;  3CMA A;  4KGX B;  4QVD A;  3OS5 A;  2GFU A;  1VQ5 T;  2EIF A;  4IIM A;  4OB1 B;  4C8Q F;  2HD0 A;  3C0C A;  3EH1 A;  2ROL A;  5LJ5 f;  4RTX A;  1UGV A;  5CAI A;  2X3W D;  1TU0 B;  5GAM e;  4N4I A;  1VQP A;  1VYU A;  5GAN 4;  3QYG B;  3BFM A;  1JQQ A;  4F7U G;  3LH5 A;  3QJY A;  3NHN A;  2A3L A;  2EYW A;  3I35 A;  7AT1 B;  3VUB A;  4M78 A;  1BI2 A;  1D3B B;  4ATO A;  1VQO Q;  3CBP A;  2YUN A;  1N9R A;  2CZ0 B;  3O8V A;  3OYI A;  4O5V A;  4DQ2 A;  2C0O A;  3HP9 A;  4C92 G;  3L2W A;  3CCS Q;  3OYM A;  4C0D B;  3CCR Q;  5GAN 8;  3M59 A;  4AFZ C;  1Y96 B;  4M75 C;  2OAU A;  3LW5 E;  5FRO A;  5KH6 A;  1T3S A;  4DOW A;  1OU8 A;  2E12 A;  4KH1 B;  3RUX A;  2JNG A;  1X75 C;  1R8O B;  3QZ5 B;  2I2L A;  2EGA A;  1WA7 A;  1PM3 A;  1WHK A;  2K3Y A;  2OTL Q;  3OBY A;  1I81 A;  3TU4 K;  1WQW A;  2FZG B;  2MMP A;  4HCC A;  1QP3 A;  2EW3 A;  3EG0 A;  3VRZ A;  1M1K R;  5LJ3 e;  1OU9 A;  3QXE B;  3CCU Q;  2KE9 A;  2Z0W A;  3JB9 F;  2MAM A;  3TVT A;  3V7C A;  3L2Q A;  1QVG P;  3DKM A;  2KXD A;  4CRI A;  1LPL A;  2YRC A;  1Q7Y C;  1FX7 A;  2E6N A;  3PE0 A;  4M75 A;  4J9C A;  2VGN A;  2XKO C;  2NWM A;  1M1K C;  3EGU A;  2RK1 A;  1YIT T;  2K5I A;  2J6O A;  1YFN A;  1S1N A;  4CC3 A;  2MPX C;  4IUT A;  1N5Z A;  1XOV A;  5KYW B;  1IHW A;  3CCS T;  2QDY B;  3ER0 A;  4FL6 A;  2LQ8 A;  3P8D A;  2KK4 A;  5GAN 2;  3JCM g;  1FYN A;  3MEA A;  2GBQ A;  1ZHI A;  1R0B G;  2GTJ A;  1H3H A;  1XTD A;  4XU0 A;  3I55 Q;  2V8I A;  2G3R A;  2XHC A;  3CCM T;  3S3M A;  3LX7 A;  1JEG A;  3TRE A;  5GAO n;  3CCU T;  2JT4 A;  1RAD B;  1AT1 B;  2F1L A;  1OV3 A;  2ZPH B;  1QWF A;  2ZGW A;  5HK3 A;  5GAN 7;  2L2P A;  1GBQ A;  2KNB B;  1WI7 A;  2GFA A;  2ZPF B;  3GIB A;  1YJN Q;  2E5Q A;  3EFS A;  3I9Q A;  3MP6 A;  4B9W A;  2D9T A;  1K8A U;  4J9E A;  5HCK A;  2QI2 A;  4J7F A;  1LNX A;  1KC8 C;  2BZX A;  2KR3 A;  1X6G A;  3HRT A;  2QA4 Q;  2E1H A;  2NUZ A;  9ATC B;  4QVC A;  4A4F A;  1A0N B;  1YJ9 Q;  2E10 A;  1K4U S;  2COW A;  3MEU A;  2D0N A;  4DBR A;  2ROT A;  4KUI A;  5FWC A;  1XJW B;  2XI9 A;  3A5Z B;  3OYN A;  3JCM h;  1VQ7 T;  3N5B B;  1D1A A;  1VQK A;  2KYB A;  4F7U F;  4KT0 E;  1PG5 B;  4GY5 A;  1BI3 A;  1VYT A;  2ZPB B;  1I8F A;  2XIC A;  4OMN A;  3G6E T;  4JZ4 A;  2P0K A;  1X27 A;  2JW4 A;  2V1R A;  3EFO B;  3RIR A;  4M7A F;  2GQI A;  2E5K A;  1KHC A;  1U5S A;  4J9F A;  4JRP A;  2YRV A;  1RAG B;  3JCM X;  2EYZ A;  4OMO A;  1M2V B;  1WNL A;  2GQV A;  1M2V A;  1M9S A;  1SSH A;  1RLQ C;  4KUL A;  3CC4 Q;  2DL5 A;  1O9S A;  3HL8 A;  2QA4 T;  2BZY A;  2JN0 A;  3M55 A;  1PHT A;  1QVP A;  1YJ9 T;  1AHJ B;  2X35 A;  2L3S A;  1WJR A;  3PMT A;  4JJB A;  4QKU A;  2R5A A;  3EG1 A;  3LGL A;  1WXU A;  1D0X A;  1YHQ A;  4OMF B;  1VQ6 T;  5LJ5 e;  4QQD A;  4A63 B;  2AT1 B;  3E1S A;  2DJZ A;  1Y0M A;  4NL3 A;  3FEO A;  2QG9 B;  3ZL7 C;  4A54 A;  2JMA A;  3TSZ A;  1K76 A;  3EGX B;  1M8M A;  1NLO C;  4WTO B;  1KHI A;  5GAN 6;  2H3J A;  4LN2 A;  4PFO A;  2FPD A;  2DRK A;  1QKW A;  1NJI U;  2VC8 A;  3NPF A;  4HCK A;  3ME9 A;  2HBW A;  2J6K A;  4Z89 A;  3G7Z A;  4RCB A;  4DOV A;  2QEX T;  4BE0 A;  3ZBD A;  5CKE A;  1JU5 C;  2HKQ B;  4J5Y A;  5CKH A;  4PFP A;  4DBQ A;  5LL6 S;  1Z9Z A;  3JCM d;  4ZTJ A;  1WXB A;  3CME Q;  4OML A;  2AK5 A;  1QVF P;  3A8G B;  3RKX A;  3JB9 I;  4MZM A;  2DXC A;  1HK9 A;  4X9D A;  1VQ4 A;  2A37 A;  3PTA A;  1SHG A;  5CIU A;  3VS1 A;  2RHU A;  1SRM A;  3MJX A;  2ZPE B;  2RN8 A;  4TVR A;  4LXC A;  1Y71 A;  2GF7 A;  2LJ3 A;  2FG0 A;  2K4Y A;  4FYY B;  4E7Z A;  1WXT A;  4EMH A;  1VQL A;  5IAY A;  3NTH A;  3S6W A;  2FL7 A;  1UEC A;  1YIJ Q;  3HTR A;  1QP2 A;  2DJQ A;  1V76 A;  3CCE T;  2X4J A;  2M02 A;  1AOJ A;  3M5A A;  1VQ8 A;  1UG1 A;  3NTI A;  4M78 E;  2O4X B;  3OS2 A;  3QSU A;  2DIG A;  2P0P A;  1QKX A;  2HQX A;  2O4X A;  4J83 A;  1YCY A;  5GAM j;  3OB9 A;  1ABO A;  5DLQ E;  3JCM Q;  1K8A R;  2ECZ A;  1TWB A;  2CDT A;  3QUI A;  2RD1 A;  1ZSG A;  4YTL A;  4M77 F;  4C8Q C;  3EG9 B;  3WVD B;  2DBM A;  1VQP T;  2JXB A;  2F2W A;  3D7S B;  4KGV B;  2E4H A;  3EG9 A;  3L2U A;  1K8A C;  3A8O B;  3WVE B;  1N27 A;  2X4Y A;  3NGP A;  2JJ9 A;  5I11 A;  1ZSZ C;  4ELY C;  4OGC A;  2WAC A;  5KYN A;  1T0J A;  2PUK B;  2NUP B;  1G83 A;  2SRC A;  1BCO A;  1FMV A;  4MML A;  1NYG A;  2XMF A;  2M1H A;  1WZO A;  3H6Z A;  2WSF E;  3H41 A;  3RKY A;  4C8Q B;  3HSB A;  2P4T A;  2NUT B;  1EIF A;  4C8Q A;  3VRY A;  3M4Y A;  2NUT A;  4M75 E;  5AT1 B;  1HXD A;  1ZSZ B;  1U06 A;  4JJC A;  4AFQ C;  1VA7 A;  1ZSZ A;  1X6B A;  2KVQ G;  1SEM A;  2BIV A;  4BAC A;  1K1Z A;  1YI2 A;  1W70 A;  3CCQ A;  1C0M A;  2RJE A;  4RUG A;  2CP5 A;  4JPB W;  4J9B A;  2LMJ A;  3MO8 A;  2E41 A;  4JLI A;  1M1G A;  5GAN j;  1UGR B;  4FM4 B;  3SDZ A;  3HFN A;  2VVK A;  1M8V A;  5IXF A;  1M90 U;  2KT8 A;  5KYX B;  2H3E B;  2EQI A;  2YRD A;  3JB9 G;  2F5T X;  1D0Z A;  1OX9 A;  1YP5 A;  3CD6 A;  3C12 A;  1BB9 A;  1D0Y A;  1FMW A;  5KYY A;  2LQN A;  5LJ3 h;  1PC0 A;  3LYI A;  1XQH A;  1NPR A;  3HPW A;  3CC2 A;  1ZLM A;  2DL8 A;  2ZZD A;  2L3P A;  1RLP C;  3E19 A;  4JRK A;  1UUE A;  5FU7 C;  2DIL A;  4Z02 A;  1IB8 A;  2DVJ A;  5GJW B;  2K3X A;  2M0O A;  1HJD A;  1GCQ C;  3CXC S;  1ABQ A;  4MZT A;  3UA6 A;  3VYH B;  3QO3 A;  3HKS A;  3C95 A;  1NE8 A;  3P8H A;  3MEV A;  3GNG A;  3G4S A;  4XTZ A;  3U23 A;  5IHN A;  3T9N A;  2L89 A;  1SSF A;  4OB0 B;  3M53 A;  2XDP A;  3GP8 A;  2DX1 A;  3OYY A;  3KFV A;  4XAX B;  1JO8 A;  2BE9 B;  1U8R A;  3X26 B;  5GMK i;  2LJ0 A;  2LCC A;  1U1S A;  1G5V A;  2HL3 A;  5GAM d;  1OYX A;  2RK2 A;  1GCQ A;  1YCS B;  3QWY A;  4KRT A;  1ACM B;  1TH7 A;  4PJL A;  2SEM A;  1WHH A;  2K2M A;  3FC3 A;  1T0H A;  2MOX A;  1G8X A;  2IPO B;  2C0I A;  4V2S A;  2DL3 A;  2AIR B;  1WIE A;  2E64 A;  3L2Z A;  3PVL A;  2PVD B;  3M0P A;  1P92 A;  3FIF A;  1OX8 A;  3UF4 A;  3UT1 A;  3ZEH A;  2KY9 A;  2QGF B;  2EGC A;  3QBY A;  3M58 A;  3EG2 A;  1Z9Q A;  3QWX X;  3JRZ A;  2HEQ A;  1QWE A;  3OYE A;  1WJQ A;  2CGH A;  3PFS A;  1I1J A;  2DPP B;  1VQK T;  3VS7 A;  2IVW A;  4AMC A;  2LQK A;  2FPF A;  3MEW A;  4PFZ A;  4C0D C;  4LDW A;  1IGU A;  1GXI E;  2DF6 A;  2FRW A;  3FDR A;  3CXC A;  1E7O A;  1U1T A;  3QHS A;  4B6M A;  3MET A;  1S72 A;  1TS9 A;  1PKS A;  1KD1 U;  2RI3 A;  5LJ3 d;  4C5E A;  2EWN A;  3RDV A;  1QLY A;  3DB3 A;  4C92 C;  1YIT Q;  1D3B A;  4M7A G;  1Y7X A;  1BI0 A;  1SG5 A;  4HCZ A;  4B9X A;  4E7S A;  4F7U B;  2EVR A;  1R0C B;  1O75 A;  1JXM A;  4F7U A;  2HCK A;  1K9M U;  2EJF A;  1TXQ A;  3G71 A;  3CPW P;  3X20 B;  2B86 A;  1BBZ A;  5GMK l;  2IG0 A;  1WX6 A;  2RA2 A;  5LJ5 j;  3A98 A;  2KSS A;  4FCY A;  4M7A B;  1RAC B;  1Y96 A;  2Y4X A;  3GOX A;  3JB9 H;  2EYQ A;  1UHF A;  2BTT A;  3LH0 A;  2K57 A;  1KQS S;  2WSC E;  4Q5W A;  4C92 B;  4PLL A;  1YHQ T;  1ZUK A;  4M77 D;  5D6Y A;  4C92 A;  3CCM Q;  3E2U A;  1W2B S;  2MCN A;  1Q7Y R;  3M0R A;  2RJF A;  1U3O A;  4KBM B;  4Y28 E;  1B34 B;  4N0A C;  3CCJ A;  1WYX A;  5I22 A;  3CQT A;  2BE7 D;  5FU6 C;  2WSE E;  1YNZ A;  4A4H A;  2V8K A;  4JJD A;  2P0Q A;  4R56 A;  2EJ9 A;  1F1B B;  1NEG A;  5GAN e;  3CCL A;  1M90 R;  2AKK A;  5GMK m;  1MV0 B;  3J80 E;  3A1P A;  4OP0 A;  5KYW A;  1Q81 U;  1YN8 A;  3M0S A;  5CKD A;  1Q86 U;  3SHW A;  1MHN A;  1M4Z A;  4N0A A;  2QTX A;  1KIK A;  2RB6 A;  2CRE A;  5FU6 B;  2VXF A;  1M90 C;  4XU2 A;  2KRN A;  4QQ6 A;  1ZQ1 A;  4RTY A;  2E6Z A;  3S3O A;  1D1B A;  2VWF A;  2FVU A;  3CCV A;  5D6W A;  1VQ7 Q;  2FEI A;  2D1X A;  4WCI A;  2EPD A;  4MMK A;  3JCM f;  2DEU A;  3H0H A;  3OW2 S;  1VQ4 T;  3G6E Q;  2FB7 A;  4Z8A A;  3REA B;  3VKI A;  2RI5 A;  2JS0 A;  3KUF A;  1IZ6 A;  2X9H A;  5A0L A;  4MDX A;  4ZGJ B;  2R58 A;  5AYF A;  4PJO E;  3FB9 A;  3VUZ A;  4A4E A;  4Y91 A;  1KC8 R;  1VQL T;  4M7D F;  3C4S A;  1W2B A;  2PNI A;  4J9H A;  3THK A;  3PIP A;  3OSS C;  1N8R U;  2ATC B;  4IUV A;  1W1F A;  4VUB A;  2ZPG B;  1B3Q A;  1VQ8 T;  1VQ9 A;  4OF1 A;  3TCJ A;  3EFR A;  1JRI A;  1LJO A;  4FSS A;  2KXC A;  3GPL A;  3OYF A;  4HVU A;  1AWJ A;  3JCM c;  4CC7 A;  3MPU B;  1QCF A;  2O88 A;  2IIM A;  4J8O A;  2QAZ A;  2RMO A;  3M0T A;  2CP0 A;  2RQR A;  4JLG A;  4A4G A;  1WJS A;  1PRL C;  4DBH A;  5CCA A;  1QMC A;  2HSP A;  3NFC A;  2OX7 A;  5HKC A;  3E9G A;  1VQ6 Q;  1AEY A;  4X9C A;  3LWI A;  1V1C A;  2L3R A;  4LDV A;  2CSI A;  3H8Z A;  4PK4 A;  1VQM A;  2Y90 A;  4M78 F;  2YSQ A;  4M77 G;  3I56 A;  2DVE A;  1LCK A;  3IQL A;  4HKE A;  3REB B;  3VS2 A;  1B07 A;  3CD6 Q;  4KGZ B;  3G1J A;  5LJ5 d;  1HD3 A;  3EFO A;  4NOY A;  3OYJ A;  2F2X A;  1ZA2 B;  2DTH A;  3OW2 A;  1VQ5 A;  4M77 B;  3EAE A;  4LDU A;  5D6X A;  2QEX Q;  2YUO A;  2HKN A;  4CC2 A;  4J6W A;  1QVG S;  4XTV A;  3OYL A;  5GAO p;  4PJO D;  2GNC A;  4C5H A;  1GFD A;  4BDZ A;  2LTO A;  2K6D A;  2JM8 A;  2QQA A;  3OYB A;  2MK5 A;  2VXE A;  1TTH B;  1YI2 T;  3RKW A;  4OMQ A;  1KD1 C;  3CCQ T;  1QW1 A;  3M0Q A;  2MWP A;  1GBR A;  3AHU A;  2VV5 A;  2OTJ A;  1VQN A;  1DJ7 B;  3URG A;  2LP5 A;  4M75 F;  1V29 B;  1AZE A;  4P5N A;  2FRY A;  4MDW A;  2OAW A;  3QYH B;  3V8J A;  1J3T A;  1K9M C;  2H8H A;  2Y4Y A;  1X69 A;  1ARK A;  3CD6 T;  3DLL A;  3EGX A;  2KBT A;  1QCN A;  2CZ6 B;  2ED0 A;  2RH2 A;  3CC2 T;  1YJW A;  1RAH B;  2PUO B;  4NS5 A;  2JS2 A;  1AWO A;  3CCE Q;  5A2Q E;  1PNJ A;  4LUE A;  3OYD A;  3OA6 A;  1RAA B;  1KQ1 A;  3GF5 A;  2ZPI B;  4L5G A;  4D8K A;  1M5Q 1;  5A0G A;  3QII A;  3CMA Q;  3FLG A;  3L1A A;  3QG1 A;  1H92 A;  2KMT A;  4JDS A;  2JOY A;  4JS5 A;  1KSW A;  1VQO A;  2FZC B;  2A08 A;  3G4S T;  5GJV B;  1KG1 A;  1RAI B;  1QVG A;  4M7D E;  1VQP Q;  1D1C A;  1OZ3 A;  4L6V 5;  4IUP A;  3VS0 A;  4IUR A;  1S72 Q;  3CCR A;  3MHX A;  1D09 B;  3M57 A;  1M3B A;  1Q81 C;  1Q86 C;  1RUW A;  2J06 A;  5GAM g;  4HVV A;  2QYZ A;  3RER A;  4OB3 B;  2HBP A;  4D8D A;  2D6F A;  1GRI A;  2DYB A;  3SWN B;  2OTL A;  1OPK A;  2E3I A;  2K7A A;  2DXB A;  5IHK A;  2EQJ A;  2EGE A;  2KQW A;  3QZ9 B;  2HSE B;  4DEX A;  3PIO A;  4ZTF A;  2BKD N;  4PJO G;  4X1V A;  3CMA T;  2JVV A;  2VUB A;  2J05 A;  2DZ9 A;  4AG2 C;  2RHI A;  1RI9 A;  3EHQ A;  4JUV A;  1PSF A;  5FW9 A;  1N8R C;  1EX4 A;  1KK7 A;  4HA8 A;  2LJ1 A;  3QDR B;  3A8M B;  2DD4 A;  2EKO A;  1S72 T;  4AFS C;  1UFF A;  4AFU C;  3X28 B;  3OMC A;  4L59 A;  4BE1 A;  2EAY A;  5LJ3 g;  4JRQ A;  4M7D D;  2K3B A;  2LNV A;  1H3Z A;  4RTU A;  1C6V X;  3JV3 A;  4BD3 A;  2NUP A;  3I55 A;  5LJ3 f;  2DRM A;  5GAM h;  4E7K A;  2XDD A;  1TUG B;  2DMO A;  3MP1 A;  1K73 U;  2O31 A;  2RHZ A;  3QPH A;  2EFI A;  4A53 A;  2MYS A;  4RTZ A;  1M3C A;  4XU1 A;  1JBM A;  2F69 A;  4DA4 A;  2XD0 A;  4EDU A;  4QT7 A;  3MCA B;  1BIB A;  3EG3 A;  3Q1J A;  5KE3 A;  1PRM C;  4J9G A;  1YJN A;  2L8D A;  3NMZ C;  3OYK A;  4M78 D;  2COY A;  3CCJ T;  1SF9 A;  4PKC C;  5CVI A;  4F17 A;  2DLP A;  3PVQ A;  3RNJ A;  2DBK A;  3QKJ A;  2VAS A;  2AZS A;  2W0Z A;  2QA4 A;  2KGT A;  5CQX A;  6AT1 B;  3R6O A;  1WHM A;  1TUC A;  1QVF S;  2E3H A;  3P8B B;  5KYX A;  2HQE A;  4RTW A;  3ASK A;  2YLB A;  3CCL T;  1VQ9 Q;  1AWX A;  2RI2 A;  1BCM A;  3OYC A;  1Q95 G;  2MIO A;  5J26 A;  3GNF B;  2VGM A;  5IXB A;  4E47 A;  4PJM A;  4HCB A;  1N9S A;  2PVG B;  2C06 A;  1YWP A;  1JB0 E;  4RCC A;  1NZ9 A;  4FIB A;  3PNW C;  1MMG A;  2CYZ B;  4E7I A;  1OI1 A;  5CKF A;  3ZFJ A;  5GMK j;  1NJI R;  4R0K A;  5GAO l;  1K0S A;  3CCV T;  5GAN h;  1VOM A;  4E2F B;  2HMA A;  2F2V A;  2DTO A;  3HRS A;  1VQK Q;  3OSV A;  2BZ8 A;  1VQM Q;  4LD9 K;  3EH2 A;  1W2B P;  4Y92 A;  1K0X A;  2RNA A;  4M75 D;  1HYO A;  2RM4 A;  1NJI C;  2XU8 A;  4XTY A;  2QDL A;  4XTX A;  2A0F B;  4J9D A;  3HRU A;  5I2M A;  2G6F X;  3CC4 A;  1BIA A;  1IGQ A;  1WLP B;  1OOT A;  1NM7 A;  4WF2 A;  1HSQ A;  1E6H A;  1MND A;  2LDM A;  3L2V A;  3M56 A;  2EQU A;  4J6X A;  5FLX E;  2RJC A;  2FO0 A;  1VQ9 T;  2KRM A;  3DLM A;  4M7D G;  2E70 A;  2DM1 A;  5GAO m;  3H0I A;  4PJO F;  1JJ2 S;  3A8L B;  3OS0 A;  2L3Q A;  2DFU A;  1RL2 A;  3OY9 A;  2CUD A;  3LGF A;  4EMK C;  2O2O A;  4M7D B;  4FU6 A;  1YHQ Q;  3VS5 A;  2OTJ Q;  1W4S A;  2JM9 A;  1NG2 A;  1X2Q A;  1VQM T;  1MV3 A;  1PD0 A;  2LRQ A;  3OW2 P;  1Y07 A;  5KYU B;  4FW1 A;  3I56 T;  5HY6 A;  2DL4 A;  1KQ2 A;  1WDX A;  2PTK A;  5KYU A;  2HQH A;  1I4K 1;  1E6G A;  2XID A;  1MMN A;  1RI0 A;  4BB7 A;  5LJ5 g;  4ME7 A;  2QGG A;  4M78 G;  4M7A C;  2RQT A;  3PT9 A;  8ATC B;  3QJ6 A;  4E7J A;  4EMK B;  4EPC A;  2DTI A;  2JMC A;  3CEY A;  4LE9 A;  3MKD A;  3CME A;  3J7A F;  2V8J A;  4EMK A;  2JTE A;  4XTU A;  3OYG A;  4AT1 B;  2K5L A;  1SHF A;  1AZG B;  4C5G A;  2YDL A;  4M78 B;  2AKL A;  2KYM A;  4ZNX A;  3GLX A;  4ZN3 A;  5GAN d;  5I2S A;  3L2R A;  2CUB A;  2M0Y A;  2RO0 A;  3M4G A;  4RTV A;  2GCX A;  4NL2 A;  1NYF A;  4HXJ A;  3OYA A;  4PL6 A;  5EC7 A;  4M7A A;  1TOV A;  1K73 R;  2CZ1 B;  2ZAE A;  2DL7 A;  2OTJ T;  4KUD K;  2XK0 A;  1VQN T;  5GAO r;  1OQK A;  1VQ4 Q;  1YIJ A;  1JJ2 A;  5CQY A;  4J9I A;  3AT1 B;  3C94 A;  4R55 A;  1M2O A;  3WXM B;  3ULR B;  4ANJ A;  1B34 A;  1K73 C;  3CBM A;  3UDC A;  1G3S A;  4DEY A;  4OB2 B;  4M75 G;  2X4X A;  1WHG A;  1VQL Q;  4JRI A;  1SRL A;  1YJW T;  2R57 A;  2DXT A;  1BI1 A;  2NYS A;  3RBB B;  1QCO A;  2JUF A;  1TG0 A;  2RHY A;  4PNO A;  4XK8 E;  3VV0 A;  2MWO A;  5CR2 A;  5LJ5 h;  5GAO q;  1VIE A;  3PGG A;  1VQ8 Q;  5FRN A;  3QDF A;  2V1Q A;  2VB6 A;  1AD5 A;  1AWW A;  3CC7 A;  4M75 B;  1RAF B;  3L42 A;  1TUD A;  2LCL A;  2RJD A;  4ORZ A;  2K79 A;  1VUB A;  3MP8 A;  3R6N A;  3V8L A;  1YWO A;  2K9G A;  3S3N A;  3VS4 A;  1VQO T;  1WPY A;  2CP2 A;  4GLK A;  4LUD A;  1BYM A;  2KRS A;  1ZBJ A;  3EHR A;  2RPN A;  2E65 A;  4ZGE B;  1VYV A;  1NEB A;  1M3A A;  3LWH A;  3CCR T;  3V8K A;  2DKG A;  4BI3 A;  5GMK e;  1GL5 A;  1AVZ C;  3SFM A;  3KXT A;  1MNE A;  1UJ0 A;  1CKB A;  1KQS A;  5L23 A;  1KFZ A;  1WQ7 A;  1OZ2 A;  4FW2 A;  4FYV B;  2OTL T;  3EGD B;  3SB2 A;  1M1F A;  4BUG A;  4IKF A;  2YWW A;  3TEE A;  1Q82 U;  3FJ5 A;  3EGD A;  2DNU A;  1FMK A;  2J7I A;  1CSK A;  2JTF A;  4GBQ A;  5IH2 A;  3F70 A;  4IUQ A;  5IT9 E;  5KCO A;  4A4K A;  8AT1 B;  1BU1 A;  2DER A;  2V26 A;  4MZP A;  4QVZ A;  4RG8 A;  5L8R E;  2CH4 W;  1B7T A;  3A8H B;  3HFO A;  4BDY A;  1YI2 Q;  3CCQ Q;  2ABL A;  4FYX B;  4JS4 A;  4XU3 A;  2A36 A;  2LZ6 B;  2DET A;  2YHT A;  4M77 C;  5C6S A;  4K11 A;  2FZK B;  4C8Q E;  2MI6 A;  2CP6 A;  1JXO A;  4FSX A;  3CPW S;  3INZ A;  5KE2 A;  2QXF A;  3BDU A;  4FT2 A;  4XQ3 A;  3GBQ A;  4J7I A;  1I5L A;  2OI3 A;  3TQ7 P;  2KI7 A;  4QW2 A;  5J39 A;  3I55 T;  3CC2 Q;  4RMO A;  5C0M A;  3UA7 A;  1IXD A;  5M9O A;  2O01 E;  3BW1 A;  5EG2 A;  2CZ7 B;  4JJN K;  4ELZ C;  1PD1 A;  1I5O B;  1I07 A;  1ZBX A;  5FWB A;  1T3L A;  1GCP A;  4M77 A;  1M27 C;  1KD1 R;  2PVO B;  1R77 A;  4PJJ A;  2YUQ A;  4QQG A;  4II1 A;  4C92 F;  1I0C A;  1N6A A;  2EKH A;  4EIK A;  2ENM A;  1UGS B;  2COZ A;  3G4S Q;  4GLM A;  3H9N A;  1IO6 A;  1YJN T;  1UJY A;  1H64 1;  1K9M R;  1UB4 A; 
#chains in the Genus database with same CATH homology
 2LJ0 A;  1UFF A;  4AFS C;  4AFU C;  1S1N A;  4CC3 A;  2GGR A;  1N5Z A;  1GCQ A;  1YCS B;  1XOV A;  3QWY A;  4KRT A;  2I0N A;  2SEM A;  2K2M A;  1T0H A;  2PZ1 A;  2K3B A;  2MOX A;  2EBP A;  4RTU A;  2C0I A;  3JV3 A;  2DL3 A;  2L0A A;  2CH4 A;  1WIE A;  4IIO A;  1FYN A;  2DRM A;  3PVL A;  3M0P A;  2GBQ A;  3VS3 A;  3UF4 A;  2GTJ A;  1H3H A;  2CSQ A;  2DMO A;  2EGC A;  2O31 A;  1Z9Q A;  3EG2 A;  3QWX X;  2HEQ A;  1QWE A;  2RF0 A;  4RTZ A;  3I5S A;  1ZUY A;  1M3C A;  1JEG A;  1I1J A;  4LNP A;  3VS7 A;  4E6R A;  4QT7 A;  3EG3 A;  2W10 A;  2EYX A;  2JT4 A;  1PRM C;  2FPF A;  4J9G A;  1OV3 A;  2YT6 A;  1QWF A;  2DF6 A;  2L2P A;  1GBQ A;  2KNB B;  3NMZ C;  2FRW A;  1CKA A;  1E7O A;  1WI7 A;  4F17 A;  2DLP A;  1NLP C;  1GFC A;  3PVQ A;  1PKS A;  3RNJ A;  2DBK A;  2AZS A;  2W0Z A;  3I9Q A;  1QLY A;  2KGT A;  2CT3 A;  4J9E A;  5HCK A;  1TUC A;  2BZX A;  1UE9 A;  2KR3 A;  1X6G A;  4RTW A;  5ECA A;  2CT4 A;  2EVR A;  2NUZ A;  1AWX A;  1UTI A;  1A0N B;  1JXM A;  1K4U S;  2M51 A;  2HCK A;  2MIO A;  2LX7 A;  2ED1 A;  5IXB A;  2B86 A;  1BBZ A;  2D0N A;  1WX6 A;  2ROT A;  3A98 A;  5FWC A;  1YWP A;  4F14 A;  1UHF A;  2BTT A;  4RTT A;  1W6X A;  2KYB A;  5IHI A;  4HVW A;  1K9A A;  1ZUK A;  1VYT A;  4R0K A;  1K0S A;  4OMN A;  2MCN A;  1PKT A;  4Z88 A;  4JZ4 A;  2F2V A;  3M0R A;  2BZ8 A;  1X27 A;  1ZX6 A;  2D8J A;  1U3O A;  2JW4 A;  2V1R A;  4Y92 A;  1K0X A;  2KT1 A;  2GQI A;  1WYX A;  2RNA A;  2E5K A;  5I22 A;  1U5S A;  4J9F A;  3CQT A;  2QDL A;  1YNZ A;  4J9D A;  1KJW A;  2O9S A;  4JJD A;  2EYZ A;  2G6F X;  4OMO A;  1WLP B;  1OOT A;  1NM7 A;  1NEG A;  1HSQ A;  1X43 A;  4F16 A;  1E6H A;  1SSH A;  1RLQ C;  2AKK A;  2LQW A;  1UDL A;  2DL5 A;  1MV0 B;  2BZY A;  2FO0 A;  1PHT A;  2KRM A;  2L3S A;  1YN8 A;  3M0S A;  4JJB A;  2VKN A;  3SHW A;  3EG1 A;  1KIK A;  2CRE A;  2GTO A;  2DM1 A;  2KRN A;  3H0I A;  1WXU A;  4RTY A;  2RQU A;  2VWF A;  2L3Q A;  3UAT A;  4A63 B;  2FEI A;  2D1X A;  4M4Z A;  4WCI A;  2EPD A;  2CUD A;  2J6F A;  2O2O A;  1Y0M A;  3VS5 A;  3H0H A;  2JM9 A;  3ZL7 C;  1NG2 A;  3I5R A;  2JMA A;  3TSZ A;  4CC4 B;  1K76 A;  3O5Z A;  1X2Q A;  1M8M A;  1MV3 A;  1NLO C;  2A28 A;  4Z8A A;  3REA B;  4AG1 C;  4OMM A;  2JS0 A;  1UHC A;  2DL4 A;  4LN2 A;  1WDX A;  2PTK A;  2FPD A;  2DRK A;  1ZUU A;  1E6G A;  1QKW A;  2O9V A;  2LNH B;  3NPF A;  4HCK A;  2PNI A;  4J9H A;  2HBW A;  2J6K A;  4Z89 A;  3THK A;  2RQT A;  2RQW A;  1JU5 C;  3M0U A;  1OPL A;  1W1F A;  2JMC A;  1B3Q A;  2P4R A;  4LE9 A;  4FSS A;  2JTE A;  2KXC A;  3VS6 A;  1Z9Z A;  1SHF A;  1AZG B;  2KRO A;  2YDL A;  4OMP A;  4HVU A;  1AWJ A;  1WXB A;  4OML A;  4CC7 A;  1QCF A;  2AK5 A;  2IIM A;  2AKL A;  2KYM A;  2O88 A;  1M30 A;  2RMO A;  3M0T A;  4ZNX A;  2RQR A;  2FPE A;  1PRL C;  2RQV A;  2AZV A;  2CUB A;  2M0Y A;  2HSP A;  4RTV A;  1NYF A;  4HXJ A;  1WFW A;  1AEY A;  1V1C A;  5EC7 A;  2CSI A;  2A37 A;  1MUZ A;  1SHG A;  2DL7 A;  3VS1 A;  4JZ3 A;  2DA9 A;  1SRM A;  2YSQ A;  2HDA A;  2RN8 A;  1LCK A;  3IQL A;  3TSW A;  1G2B A;  3REB B;  3VS2 A;  2C0T A;  2LJ3 A;  1B07 A;  2FG0 A;  4J9I A;  1WXT A;  3ULR B;  1HD3 A;  3H0F A;  2F2X A;  4DEY A;  1UEC A;  2ESW A;  2DJQ A;  1AOJ A;  1SRL A;  1UG1 A;  1BK2 A;  2OJ2 A;  2YUO A;  3RBB B;  4CC2 A;  1TG0 A;  1QKX A;  2GNC A;  2EYY A;  1ABO A;  2DE0 X;  2KEA A;  2V1Q A;  1GFD A;  1OEB A;  1AD5 A;  2ECZ A;  1AWW A;  2CDT A;  1X2K A;  2D8H A;  2K6D A;  2JM8 A;  1TUD A;  1ZSG A;  4ORZ A;  2K79 A;  3R6N A;  4OMQ A;  2DBM A;  1YWO A;  3M0Q A;  2JXB A;  2F2W A;  2K9G A;  3VS4 A;  1GBR A;  4LUD A;  3NGP A;  2KRS A;  5I11 A;  1AZE A;  2LP5 A;  1ZBJ A;  2FRY A;  2RPN A;  2YUP A;  3EHR A;  1H8K A;  1T0J A;  1PWT A;  4ESR A;  1VYV A;  2OAW A;  1NEB A;  1J3T A;  1M3A A;  1G83 A;  1SPK A;  2SRC A;  1EFN A;  1Y57 A;  2H8H A;  1X69 A;  1ARK A;  1NYG A;  2XMF A;  1GL5 A;  1AVZ C;  2KBT A;  3H41 A;  1UJ0 A;  1CKB A;  2LCS A;  2ED0 A;  2X3X D;  3SEM A;  5L23 A;  1KFZ A;  3VRY A;  2JS2 A;  1AWO A;  1PNJ A;  3FJ5 A;  4LUE A;  1U06 A;  4JJC A;  2DNU A;  1FMK A;  2J7I A;  4AFQ C;  1CSK A;  1VA7 A;  1X6B A;  4GBQ A;  4IIM A;  4D8K A;  3C0C A;  5IH2 A;  2ROL A;  1SEM A;  4RTX A;  1UGV A;  1K1Z A;  2X3W D;  1BU1 A;  1W70 A;  1H92 A;  1VYU A;  4RUG A;  1JQQ A;  1KSW A;  4JPB W;  2A08 A;  3LH5 A;  4J9B A;  3NHN A;  2LMJ A;  5GJV B;  2EYW A;  3I35 A;  2CH4 W;  2ABL A;  2VVK A;  5IXF A;  2A36 A;  2YUN A;  2KT8 A;  2LZ6 B;  3VS0 A;  2EQI A;  4K11 A;  2C0O A;  1JXO A;  1M3B A;  1YP5 A;  1BB9 A;  1RUW A;  2J06 A;  2LQN A;  4HVV A;  3GBQ A;  4AFZ C;  1ZLM A;  2DL8 A;  4D8D A;  2OI3 A;  1GRI A;  2DYB A;  1T3S A;  2L3P A;  1OPK A;  1RLP C;  1UUE A;  2K7A A;  2DIL A;  5IHK A;  3UA7 A;  2DVJ A;  2EGE A;  2EGA A;  5GJW B;  1WA7 A;  1HJD A;  1GCQ C;  1ABQ A;  3UA6 A;  1I07 A;  2EW3 A;  3EG0 A;  4DEX A;  5FWB A;  1T3L A;  1GCP A;  1M27 C;  3VRZ A;  2KE9 A;  4X1V A;  2J05 A;  2YUQ A;  3TVT A;  3U23 A;  5IHN A;  4AG2 C;  2KXD A;  1I0C A;  1RI9 A;  2EKH A;  4EIK A;  3EHQ A;  3PE0 A;  2ENM A;  4GLM A;  5FW9 A;  4J9C A;  1IO6 A;  2DX1 A;  2NWM A;  2LJ1 A;  1UJY A;  3EGU A;  3KFV A;  1JO8 A;  2J6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...