2EGCA

Solution structure of the fifth sh3 domain from human kiaa0418 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
GSSGSSGNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 and PX domain-containing protein 2A
publication title Solution structure of the fifth SH3 domain from human KIAA0418 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egcA00
1AVZC 2EGAA 2MIOA 3PVLA 1ZX6A 2BZXA 1NLPC 2GTJA 2J6KA 2P4RA 2CUBA 2EQIA 1TG0A 2ROLA 2K7AA 1M8MA 1YCSB 2YT6A 3UATA 1WXUA 1X43A 2GBQA 1M30A 2LCSA 1AZEA 4JZ3A 1VA7A 3KFVA 2L3PA 3VS4A 1QWFA 4J9EA 2CSQA 2X3WD 1AWXA 4JJCA 4HVWA 1UDLA 2LJ0A 1ARKA 2GNCA 3VS1A 3PVQA 3I35A 4AFUC 1W6XA 3A98A 2O88A 3NPFA 2OI3A 4RTVA 1X27A 2YUPA 1W1FA 4E6RA 2DVJA 2DBMA 1UGVA 2KRNA 5IH2A 5IHIA 1J3TA 2RQUA 5FWCA 1SHGA 3TSZA 2JS2A 1K4US 1FMKA 2GTOA 2DRMA 4DEXA 1Y57A 2DYBA 2J06A 2K9GA 1V1CA 3EG2A 1BK2A 4Z88A 1PRMC 2LNHB 1ZUUA 3NGPA 1G2BA 4GBQA 2ED1A 1VYUA 1TUCA 1BB9A 2JXBA 3QWXX 2JM9A 2RQTA 2RNAA 1UECA 2A36A 1U06A 1I1JA 1EFNA 4HXJA 1YN8A 1ZUYA 2CUDA 4D8DA 4OMNA 2JMAA 1X6GA 3NHNA 1UJ0A 2DNUA 1QLYA 1NG2A 4CC3A 1QWEA 2V1RA 1UHFA 3VS2A 4IIOA 3C0CA 3I9QA 1SSHA 1KFZA 5GJWB 2NUZA 2B86A 1T0JA 3VRZA 3M0PA 1T3LA 3ZL7C 2HDAA 4LN2A 2J6OA 2DM1A 4FSSA 2AKLA 4RTYA 2YUOA 2JM8A 1WI7A 2ECZA 4F17A 2PTKA 3LH5A 2IIMA 2KBTA 3SEMA 4AFQC 1JXOA 2DA9A 1SRMA 2VVKA 2EYYA 4ZNXA 1K0XA 3JV3A 2M0YA 1IO6A 1X6BA 2HBWA 1N5ZA 3GBQA 1NLOC 5HCKA 4RTXA 1VYTA 3VS6A 2KT1A 4ESRA 1PNJA 1JO8A 2EKHA 2KE9A 3H0FA 1YNZA 2HSPA 3THKA 2PNIA 4J9BA 2FG0A 2AZVA 2I0NA 4AG1C 2YDLA 4EIKA 2FPEA 2H8HA 1NEBA 4J9HA 3REAB 1QKXA 2CT4A 2W10A 3VS5A 2O31A 1AOJA 2F2XA 1WXTA 3TSWA 1MUZA 1QCFA 1JQQA 3RBBB 4CC2A 2F2VA 1NYFA 4K11A 2L3QA 4HCKA 2DL5A 1OPLA 2O2OA 2RQWA 1RLPC 4RUGA 4J9CA 4RTUA 1PWTA 4OMQA 2MCNA 2DE0X 1M3BA 1UE9A 1ZBJA 2KROA 4QT7A 2EPDA 2FEIA 2KR3A 1HJDA 1I07A 4CC7A 1WA7A 2EYXA 2HEQA 1H3HA 2DL4A 1QKWA 2C0OA 3VS3A 2KXCA 1YP5A 1K76A 2C0IA 1K9AA 3NMZC 2YUNA 4HVVA 1ZUKA 2FRYA 4HVUA 3UA7A 1E7OA 2LMJA 2RF0A 5IXBA 5L23A 3M0RA 4A63B 2JTEA 1SEMA 2DL8A 2RMOA 1KIKA 1A0NB 1X69A 2LJ1A 1WLPB 4AFSC 1B07A 2LQWA 3TVTA 1S1NA 4J9GA 2KEAA 4J9DA 1T0HA 1UG1A 2A08A 1OV3A 2AKKA 1BBZA 2KRMA 1ZSGA 4AG2C 4DEYA 1MV0B 4OMMA 3EGUA 2D8JA 4X1VA 2KRSA 4ORZA 4RTZA 2CDTA 2OJ2A 5I22A 2LQNA 3QWYA 1B3QA 4LE9A 2J6FA 1K0SA 2JMCA 2VWFA 2O9SA 2JT4A 2MOXA 1CSKA 2L0AA 2KYMA 4WCIA 5GJVB 4D8KA 1AWJA 1OOTA 2SEMA 3M0TA 2K2MA 2GQIA 2L3SA 4JPBW 2F2WA 1RUWA 1FYNA 5IHNA 1MV3A 1WDXA 3SHWA 3VRYA 1PHTA 2BZYA 1ABQA 2K79A 3I5SA 4R0KA 4LNPA 1GBQA 2K6DA 4Z8AA 1NEGA 2EW3A 2LJ3A 3VS0A 5EC7A 3I5RA 2RPNA 2DILA 3H41A 4J9IA 1M3AA 1Y0MA 3O5ZA 1WXBA 2KT8A 1SPKA 4Y92A 5I11A 2KXDA 2KNBB 2VKNA 1UJYA 2EGCA 3PE0A 2YUQA 3FJ5A 2FPDA 5IHKA 2D8HA 2BZ8A 2CH4W 2ED0A 2AZSA 1RLQC 1Z9ZA 1CKAA 1GCQC 4JJBA 1M3CA 1PKSA 1OEBA 2DL7A 1JEGA 2CREA 1NM7A 2J05A 1M27C 4OMOA 1UTIA 2PZ1A 4IIMA 3REBB 1SRLA 1UFFA 2SRCA 1KSWA 4KRTA 1BU1A 1TUDA 2JW4A 1GCQA 2EYZA 2DLPA 3VS7A 2V1QA 1XOVA 2DL3A 2KGTA 4RTWA 4F16A 2J7IA 1GCPA 1H8KA 1SHFA 2DF6A 2K3BA 5ECAA 1AWOA 1U5SA 4LUEA 2C0TA 2EVRA 1E6HA 4AFZC 1GL5A 2A37A 3EHRA 2BTTA 1H92A 1AD5A 1RI9A 2CSIA 4F14A 2M51A 2NWMA 1VYVA 2ENMA 2HCKA 1K1ZA 1WFWA 2W0ZA 3EG0A 2DMOA 2EBPA 2GGRA 5FWBA 4Z89A 2YSQA 2FO0A 1HSQA 4M4ZA 3EG1A 1HD3A 2DJQA 1JXMA 4LUDA 1AEYA 2ROTA 2OAWA 2L2PA 2G6FX 2LP5A 4OMPA 1U3OA 3IQLA 2D1XA 2ESWA 2QDLA 1AZGB 3M0SA 1WYXA 3U23A 1KJWA 1WIEA 2ABLA 2LX7A 3H0IA 1LCKA 1GRIA 1PKTA 3UA6A 1YWPA 3H0HA 2RQRA 3EG3A 2CT3A 4J9FA 1X2QA 2D0NA 1GFDA 1GBRA 1NYGA 2CH4A 2LZ6B 1T3SA 1AWWA 2EGEA 2EYWA 1ABOA 2RN8A 2XMFA 2DX1A 2E5KA 4RTTA 5FW9A 3CQTA 4JZ4A 5IXFA 1OPKA 3RNJA 2JS0A 4JJDA 1ZLMA 2FRWA 1Z9QA 2KYBA 1YWOA 3M0UA 3UF4A 2DBKA 1E6GA 2A28A 1WX6A 1CKBA 1PRLC 1JU5C 3EHQA 3R6NA 1G83A 4OMLA 2DRKA 2X3XD 2FPFA 3M0QA 4GLMA 1W70A 2AK5A 1UHCA 1I0CA 3ULRB 1UUEA 2RQVA 1X2KA 2O9VA 4CC4B 1GFCA
chains in the Genus database with same CATH superfamily
5LJ3h 2MAMA 2EGAA 3PVLA 4A53A 1K8AU 2BZXA 4MDWA 2GTJA 2P4RA 3JCMW 1RAGB 5GAMh 3MO8A 1M8MA 2WACA 3LWIA 4M7DC 3FEOA 5KYWB 1ZSZC 3UATA 3M4YA 2E4HA 4C92C 2GBQA 2QA4T 1M1KR 4FT4A 4A4EA 1AZEA 3MEAA 4J6WA 3C12A 4M78E 3RUXA 1BYMA 1BKBA 3L2VA 5CK9A 4AFUC 3CD6T 4C0FA 1U1TA 2OI3A 1X27A 1W1FA 3CCLT 3PMTA 2KRNA 5IHIA 4A4HA 1PC0A 2COWA 2K2VA 1J3TA 3RDVA 2DJZA 5GAN8 4Y28E 1VQMA 5FWCA 4EPCA 1ZHIA 1M5Q1 2CS7A 2MYSA 2GTOA 2NUTA 2DRMA 1KQSA 1Y57A 1Q95G 5KH6A 1BK2A 4Z88A 2QQAA 2HQEA 2XKOC 4O5VA 3NGPA 3CBPA 2YRVA 2YLBA 5LJ5f 1VQLQ 1YJWA 2ZPGB 3OQ5A 2JXBA 2K3XA 1G3YA 3FDRA 3UWNA 4ZN3A 1RAEB 2RQTA 1U06A 4MZTA 1WGSA 1I1JA 1PG5B 4HXJA 5LJ3e 1YN8A 5CCAA 2DXTA 2CUDA 4OMNA 2CZ7B 4NOYA 3EGDA 4C8QF 3OMCA 4M7AA 1FX7A 3MP1A 5GAMe 4FU6A 3D7SB 5FRNA 3VS2A 1ACMB 3C0CA 2L5QA 4ME7A 3JB9H 5CQYA 1T0JA 3VRZA 2YUOA 4XTZA 1MNEA 1WNLA 3CPWP 2IIMA 2DA9A 1KHIA 1EX4A 2EYYA 2LX9A 2Y90A 4ZNXA 1VQOA 3HRUA 2DZ9A 4C5GA 2X4XA 2K57A 2HBWA 1FMWA 1YIJQ 3BW1A 3GBQA 1NLOC 3OB9A 3QYHB 2KT1A 2EKHA 3A8GB 1NJIC 4DBFA 4J9BA 1W2BP 2G3RA 4AG1C 2YDLA 1RAAB 2O31A 4N0AC 1WXTA 4RG2A 1QCFA 1Q86C 1BI1A 3RBBB 1TS9A 5CR2A 1FXXA 5J39A 2F2VA 1NYFA 4K11A 4HCKA 2XI9A 2GFUA 1YITA 4HT8A 4RTUA 4OMQA 3LWHA 4WF2A 1M3BA 1UE9A 1M1FA 1RL2A 2VXEA 1WPYA 4C8QD 1I07A 4IUUA 3L1AA 2OTJQ 2HEQA 2QQSA 1QKWA 2I2LA 3L2RA 4KGZB 5CIUA 2GF7A 1VQNT 1TTHB 1K9AA 2C0IA 2WSCE 4HVUA 1E7OA 2RF0A 1IXDA 1N6AA 1F1BB 2OAUA 4A63B 1MHNA 5LJ3f 4FYXB 2DTOA 1VQPA 2LJ1A 1N9RA 3CCQQ 3M55A 2KEAA 5CKFA 5GAMf 1T0HA 4E47A 2A08A 1VQ7T 2FZCB 4PJJA 1Q7YR 1ZSGA 3QYGB 4OGEA 4R55A 3CC7Q 3Q1JA 2M16A 1B34A 1B3QA 5C0MA 5FROA 1K0SA 2MOXA 1RACB 1QVFS 2R5MA 3KUFA 3BDLA 2DIGA 4FSXA 2XD0A 2CZ1B 2SEMA 3M0TA 4FL6A 1I5OB 1OX8A 5GAN6 2OX7A 4JPBW 3WXMB 2E6ZA 3OYDA 3CMEA 1PM3A 8ATCB 2LQKA 2E65A 1VQ6Q 4PJOG 1ZQ1A 4J6XA 2BZYA 1ABQA 2NUPB 1ZBXA 1QVGS 2EW3A 1D0YA 3M56A 3CPFA 2CP3A 3VS0A 1YIJT 3AHUA 3GP8A 3I5RA 4OB3B 1X01A 1SKUB 1Q81C 2L3RA 1QP3A 1M3AA 1WXBA 2KXDA 2YUQA 1K73U 2LDMA 1YHQA 5IHKA 1JB0E 2BZ8A 2YXYA 1RLQC 1CKAA 2COZA 4JJBA 1PKSA 2PVGB 2CGHA 1NM7A 4O6JA 4BDZA 4OMOA 4C8QE 2PZ1A 3TCJA 2YHTA 2SRCA 3QPHA 4KRTA 1BU1A 1TUDA 4BACA 1Y71A 1XOVA 2DL3A 2V1QA 4E7KA 2KGTA 2DFUA 2QGFB 2OTJT 3G4SQ 2K3BA 5ECAA 4M78G 3EFSA 4F7UA 4OB0B 2LCCA 3GIBA 2BTTA 1AD5A 1RI9A 2COYA 3OBWA 4BI3A 3EFOA 3CCUQ 3I55Q 1BI0A 1KK7A 1WFWA 3HRTA 2DMOA 3VUZA 5FWBA 1SSFA 2YSQA 4Z89A 1JJ2A 3CCQT 3EG1A 3SDZA 1NPPA 3JB9I 2QGGA 3X20B 5KE3A 1NE8A 2YRDA 3BE3A 1D3BA 2X51A 4M75F 3OYYA 4ZGEB 1S72Q 3RERA 4M7DF 1LVKA 1VQ5Q 3CC7T 1WIEA 4J7IA 4E7HA 2QEXQ 3H0HA 2RQRA 3EG3A 2RHIA 2D0NA 3V7RA 1GFDA 1GBRA 4EDUA 2JNGA 2QG9B 1BI3A 2CKKA 1JJ2P 4JZ4A 3G6ET 2JS0A 4JJDA 2EJGA 1ZLMA 1Z9QA 4MZPA 3OYCA 1PCXA 4OB1B 1X6OA 4QW2A 4L59A 1Q82C 2DBKA 2A28A 2R5AA 1WX6A 1CKBA 2E12A 2FHDA 2NYSA 1I81A 3EHQA 2VB6A 3R6NA 4LD6A 3CMAA 2XU8A 2PQWA 3M0QA 1W70A 1WJSA 2PVDB 2DXCA 4M77G 2GQVA 2RQVA 4CC4B 1U8RA 3JCMV 1AVZC 2MIOA 3A8MB 4PJMA 1NLPC 2J6KA 1M9SA 2CUBA 2OTLQ 1TG0A 2ROLA 2X4YA 2VYTA 2RI5A 3FRNA 1YCSB 3QZ9B 2KI7A 1X43A 2CZ0B 2DO3A 5GAOm 1KG1A 2MI6A 4M75D 1JRIA 3VS4A 3P8DA 4BDYA 4DBQA 2EWNA 4M7DD 1ZSZA 3VUBA 4M78B 3TU4K 4C92A 2LJ0A 5FU7B 3G71Q 2GNCA 4DBRA 3G4ST 1W6XA 3A98A 4RTVA 4ELZC 4E6RA 2DVJA 5KYXB 4QVDA 1UGQB 5IH2A 4OGCA 2K3YA 4FW1A 2RJCA 5A0DA 1SHGA 2M1HA 5FU6B 1Q82R 2DVEA 1K4US 3QG1A 1FMKA 4LDWA 2EJFA 1Y96B 3CC4T 4NL2A 3V8LA 2E41A 5GMKl 1FMVA 2A0FB 2ED1A 3M58A 4BE0A 1BB9A 1VQMQ 1M1KC 4JRQA 5M9OA 3I56A 1VQ5T 2QI2A 2RNAA 3L2ZA 4XTXA 2QEXT 1EFNA 2PUOB 5CAIA 3VJPA 4D8DA 4KGVB 1YJNT 2JMAA 2K5IA 1VQ8A 1IGQA 2CP0A 1UJ0A 4UC4A 5D6YA 1K9MC 1VQ9Q 2DNUA 1NG2A 3QSUA 4HCBA 2V1RA 1YJWQ 2O01E 2A3LA 2QAZA 3G1JA 5HKCA 4PJOC 3UPUA 1QCOA 2B86A 1YJ9Q 3ZL7C 4XTWA 2DM1A 4FSSA 4ANJA 3KXTA 5I2SA 3S3MA 2JM8A 3JCMQ 1WI7A 3OW2S 2ECZA 2HQHA 2RM4A 4F17A 2PTKA 5KYYA 4RCCA 7AT1B 2VVKA 5IN1A 1VQKT 1K0XA 4QQDA 1IO6A 1N5ZA 4FCYA 5HCKA 4RTXA 3VS6A 2XG8D 3OBYA 1JO8A 5D6WA 3CC2T 3THKA 3QJYA 3A8LB 2XDPA 2PNIA 3J7AF 2RJEA 2FG0A 2AZVA 4EIKA 2F5KA 1R0BG 3CCET 3FJPA 2RHYA 4M7AF 3CCMT 4M75E 1IHWA 6AT1B 3JCMJ 1TH7A 4M7DE 1VQOQ 3TSWA 4XTVA 3CD6A 3L2UA 1GXIE 3CCLA 1YI2T 2L3QA 5KYWA 4N0AA 2DL5A 3MPUB 4AMCA 2O2OA 3OS2A 1RLPC 3G71T 1H641 2MCNA 3L2WA 1K9MR 2GFAA 1B7TA 3RKXA 2JVVA 2DD4A 4KUIA 4CC7A 1WA7A 4N4HA 2P4TA 4C8QG 2Y4XA 3ME9A 3MP6A 1YP5A 2EQUA 4KH0B 3MCAB 2NUTB 1K76A 4FT2A 2LT1A 3GLXA 4HVVA 4MZMA 1YITQ 1N8RU 1VQ4Q 4JLGA 3MKDA 3X24B 3PTAA 4JUVA 4DA4A 2IVWA 1X69A 2DETA 1WLPB 3M9QA 3FIFA 4JRKA 1C6VX 3CPWA 4J9GA 3DLMA 1G8XA 3FLGA 3CCVT 1VQMT 1UG1A 1UGSB 1I4K1 1M4ZA 1BBZA 4AG2C 2KDSA 3EGXB 1QVFA 4DEYA 2JTMA 4EMKC 4BB7A 3EGUA 2KRSA 4IUVA 4RTZA 4C5EA 2PU9B 4XU1A 5I22A 2K5FA 1D09B 2BE9B 2DPPB 1VQPQ 2VWFA 4A54A 4M7AD 2JT4A 1W2BA 1QW1A 5D6XA 1VQ9T 1V76A 1G3TA 2EQJA 2ZPEB 4LD9K 4JRIA 1YJ9T 4JJNK 3OYAA 2DYIA 1RUWA 3V7SA 3CCJT 2DKGA 1FYNA 2QK0A 3EG9B 2LRQA 4M77C 2CP6A 3SHWA 2RHZA 3NTHA 1D1AA 2CYZB 3I5SA 4R0KA 4LNPA 2K6DA 5KYNA 1QVFP 4QVCA 3OYHA 2LCLA 4C5HA 3DLLA 2DERA 1M90C 4KT0E 1KC8U 1PSEA 2RPNA 1YBYA 2DILA 1Q7YC 1Q81U 4XAXB 3CMEQ 3O5ZA 1SPKA 2KNBB 1UJYA 2DZCA 3QZ5B 3PE0A 4YTLA 3FJ5A 1K8AC 3LGFA 2X9HA 1VQOT 3BY7A 1IB8A 1Z9ZA 2RK1A 3WVEB 1GCQC 4QQ6A 2HSEB 2L89A 4TVRA 1M27C 2DTIA 1JBMA 4Z02A 1UTIA 4ZGDB 2MPXC 3REBB 4C8QB 2KK4A 2JW4A 2DLPA 1KD1U 1VQNA 2ZPIB 2J7IA 1H8KA 1SHFA 1U5SA 4LUEA 2C0TA 4ZGJB 1E6HA 4AFZC 5GAN7 1IZ6A 3EHRA 4PFOA 5GAN4 3JB9F 3HFNA 1QCNA 2CP7A 3KBGA 2CSIA 5KCOA 1YITT 1M2VA 3OA6A 3EFRA 1VQ4T 1VYVA 5D7UA 3PT9A 2P0KA 1VQ7A 4BE2A 3EG0A 5KYUB 1QVPA 2FO0A 2JTFA 1M90R 4VUBA 1VQLT 1HD3A 4JDSA 1OZ3A 4LUDA 1RI0A 2LTOA 3INZA 2VGMA 2IPOB 2KMTA 3HP9A 5KCHA 1DJ7B 4OMPA 2D1XA 4M7AE 4QVZA 5FRMA 2E3IA 1D1BA 1KQSS 3OYGA 2EQKA 2BIVA 1K8AR 3M0SA 4HT9A 3E19A 2PUKB 4PJLA 4FYWB 3UA6A 1YWPA 2RH2A 1LPLA 1KQ2A 4F7UF 4BE1A 2JOYA 1T3SA 2EGEA 2EYWA 2F1LA 2XMFA 2E5KA 2MMPA 3CQTA 3SWNB 2FRWA 5J3BA 1YIJA 3QXEB 1YWOA 3M0UA 1UB4A 2BKDN 2V8IA 2P0QA 5HK0A 1E6GA 1WHHA 5CVIA 1PRLC 5A0LA 2HAXA 2X3XD 3VV0A 4GLMA 2YRCA 3JB9D 3JAME 4QQGA 1I0CA 3ULRB 2MK5A 2RD1A 3T9NA 3JCMg 1SF9A 3PGGA 3OYJA 3LYIA 4PL6A 1ZX6A 2ZGWA 3JCMd 2EQIA 3OYNA 3OMGA 4N4IA 2O4XB 1H3ZA 2DK3A 1TOVA 3CEYA 4P5NA 3CMAQ 4L6V5 3CXCA 4ZN1A 2LCSA 1VA7A 1HYOA 3KFVA 2L3PA 3QDRB 2OTJA 1QWFA 4J9EA 3GPLA 4C0DB 4PFPA 4NL3A 4PNOA 1G3SA 4M75G 2EAYA 4ZTFA 2VUBA 1G5VA 1UDLA 4M7DG 1C1AA 4WTOB 3VS1A 3PVQA 3I35A 1PSFA 1KQ1A 3NPFA 2YUPA 2FZKB 2DBMA 2ATCB 1UGVA 2D9TA 5I2MA 3FB9A 3CCQA 3EFOB 2RQUA 3CCRA 3OSSC 3TSZA 5CKEA 4DOWA 2RI2A 4AT1B 2KY9A 2DYBA 2K9GA 3M54A 3CXCP 3EG2A 3EH1A 1ZUUA 1Y7XA 3CC7A 4ATOA 3SB2A 1VYUA 1TUCA 3H6ZA 5GMKj 2H3JA 3C95A 1M1KU 2VASA 3QWXX 2FZGB 4C92F 1UECA 5AT1B 2AT1B 5IAYA 3QO3A 3O8VA 5L8RE 2JJ9A 3ASKA 3G6EA 3NHNA 1I8FA 1WJRA 3NFCA 4XU3A 2QXFA 2DXUA 1MGQA 1QLYA 1RAIB 4CC3A 1UHFA 1SSHA 3CCSA 3DB3A 3I56Q 1O9SA 3VKIA 3QDFA 1VQ6T 3SWNC 1RADB 2HDAA 2QQRA 3S3NA 4LN2A 1QQJA 4HCZA 4RTYA 5A2QE 2E1HA 3G7ZA 2DXBA 1VQ8Q 4PJOA 5GAN5 4Q5WA 3LH5A 4PJOD 1KHCA 3JCMb 2DD5A 3SFMA 1SRMA 5A0GA 3H9NA 1M8VA 1D0ZA 4PJNA 2EIFA 2NLUA 4ESRA 1PNJA 2DEQA 1YNZA 3GF5A 3OYLA 2KVQG 2X4WA 3MJXA 3OW2P 1OX9A 3CBMA 1R8OB 3OS5A 2W10A 3VS5A 3RMQA 4M75B 5AYFA 4KUDK 2F2XA 3DB4A 1IRXA 1WQ7A 4M7DB 1MUZA 1XTDA 4KH1B 1XJWB 3G4SA 4CC2A 5GANj 4C92D 4F7UE 3OS0A 3HRSA 1OPLA 3JRZA 2RQWA 4RUGA 2HL3A 4J9CA 3VU3C 4QT7A 2EPDA 2FEIA 2KR3A 1HJDA 3A5ZB 3HTRA 3L2QA 4M78A 1H3HA 3CC4A 2DL4A 2C0OA 4LDUA 3VS3A 3CD6Q 3CCUT 3I55T 2KXCA 3MEVA 3PIOA 3NMZC 5KYXA 2YUNA 5IXBA 1ZUKA 2FRYA 4DOVA 2F5TX 4RKUE 3JCMh 3M0RA 2JTEA 2BE7D 2DL8A 3PFSA 4OVAA 3H8ZA 2RMOA 1KIKA 1VQ5A 1VOMA 3X25B 4AFSC 4XU0A 1B07A 2LQWA 1S1NA 2QEXA 4J9DA 1S72T 1OI1A 2C06A 2QYZA 1Y96A 1V29B 1SG5A 2MWPA 1YJNA 5CKDA 1VIEA 1OV3A 2AKKA 1WZOA 3R6OA 1XQHA 1MV0B 4OMMA 4ORZA 2K4YA 2HL5C 1R0CB 2LQNA 4LE9A 2J6FA 1K73R 3UT1A 3URGA 2JMCA 3N5BB 1P92A 1CSKA 4XK8E 4M7AG 4EMKA 2E64A 5GJVB 4Y91A 4D8KA 1AWJA 4FW2A 2ZCFB 2X4JA 2F2WA 2AHJB 3ZBDA 4PJOE 2DAQA 4J83A 1VQKA 4L5GA 9ATCB 3BDUA 1MV3A 1MNDA 4DBHA 1WDXA 4BI4A 2KSSA 3OYBA 3VRYA 1PHTA 3CC2A 2H3EB 5I21A 1NEGA 4LDXA 3L42A 5C6SA 5EC7A 3CCEA 4M77A 3CCMA 1NJIU 3OS1A 5GAOn 4LDYA 2QA4A 2OTLT 1Q7YU 3A8OB 2LVMA 4E7IA 1M1GA 3J80E 2KT8A 5DLOA 1Y07A 1TWBA 3TEEA 4PKCC 5LJ5j 3HL8A 2EGCA 1YI2A 2FPDA 1Q86U 1YFNA 2HD0A 2V26A 2D8HA 3M57A 3JCMe 3PIPA 4M75C 4C92E 2E3HA 3G71A 2AZSA 2V8JA 1MMNA 3V8JA 4M78C 2CZ6B 5GAN3 1UGPB 5FU7C 1WHKA 4IIMA 1KSWA 1GCQA 2EYZA 1UGRB 3GOXA 4JS4A 4RTWA 4MMKA 4XTUA 4CI0C 4A4GA 4IUTA 4PLLA 2CP2A 2EVRA 1AT1B 1GL5A 5FU6C 2A37A 2KAFA 1H92A 2HKNA 1WHMA 1G3WA 4KGXB 3AT1B 3M53A 4F14A 1RAFB 4FYYB 2NWMA 2B8AA 4XTYA 5CO7A 3CCVA 3P8BB 4OMFB 1VQNQ 4MMLA 2W0ZA 4E2FB 2XDDA 1HSQA 4M4ZA 1TUGB 2HZYA 4JLIA 2DJQA 1JXMA 2ROTA 2RJDA 1VUBA 2OAWA 2L2PA 1C0MA 2JN0A 2VV5A 2LP5A 3EGDB 2ESWA 2QDLA 5EG2A 1VQ9A 4M7AB 3WVDB 3GNFB 3TREA 1VQ7Q 3M59A 5J26A 2ABLA 3H0IA 1LCKA 1YJ9A 3S3OA 1YJWT 5GAOp 2CT3A 3ZEHA 3CCJA 3EGXA 2Y4YA 4IUPA 1NYGA 1ABOA 3HSBA 2DX1A 5GANg 3A1PA 2X35A 3MEWA 1QVGA 4OB2B 5IT9E 2WSEE 3OYKA 5IXFA 1OPKA 3RNJA 5GANd 1KQSP 2P84A 1NPRA 2E5QA 4FIBA 2KYBA 3E1SA 2E10A 4X34A 3NTIA 1OZ2A 4M77E 1JU5C 3JSCA 1G83A 4OMLA 3JCMf 1BIAA 1OQKA 4C0ZA 4B6MA 1BIBA 3EG9A 2RHUA 2AK5A 1BI2A 5LJ3j 3JB9G 2O9VA 4C5IA 3X26B 3QIIA 5KE2A 3JCMP 2D6FA 3OSVA 5GAMj 1D1CA 4GY5A 1BCOA 2K7AA 5GAOq 2ZPFB 1QVGP 2FL7A 2YT6A 3MEUA 1UEBA 3LGLA 2XK0A 3RMSA 1WXUA 3C94A 1M30A 1NZ9A 4JZ3A 2RI3A 2R57A 2CSQA 4GLKA 2X3WD 1AWXA 4JJCA 8AT1B 1YHQQ 4HVWA 1EIFA 1ARKA 4FYVB 2O88A 1VQ4A 4C8QA 4F7UG 2HMAA 2E6NA 4E7JA 1M2VB 3JB9J 1VQLA 2RHXA 1MMAA 3EH2A 2QASA 2JS2A 1PD0A 1TU0B 4DEXA 2JZ2A 4F04B 2J06A 4J8OA 1V1CA 2HQXA 1PRMC 1N8RC 2LNHB 1IGUA 4A4FA 1G2BA 4GBQA 1I5LA 3MHXA 1WQWA 1OULA 4PK4A 4XQ3A 1B34B 5GMKh 3CCRQ 5KYUA 2MWOA 2QDYB 1VQPT 2JM9A 4M7AC 1NJIR 2A36A 2LC4A 5LJ5g 2ZPBB 2M02A 4HCCA 1HXDA 5LJ5d 1QP2A 1ZUYA 3CPWS 2RO0A 1X6GA 2RA2A 3HFOA 2E70A 4B9XA 1ZA2B 3NTKA 1Q86R 3DKMA 1QWEA 3E9FA 4IIOA 1TXQA 3M5AA 3I9QA 4N4GA 1KFZA 3LX7A 5GJWB 2NUZA 2VXFA 4KBMB 2BUDA 4C0GA 1N9SA 3M0PA 1T3LA 1Q82U 1OU8A 2J6OA 2FVUA 2XICA 3GNGA 2AKLA 1W2BS 2LNVA 2RJFA 1EZZB 3G6EQ 1XNIA 4EMGA 2KBTA 1NBEB 3SEMA 3SWNA 4AFQC 1JXOA 2YLCA 4A4KA 3JV3A 2M0YA 3CCSQ 5HY6A 1AHJB 3CMET 2NUPA 1X6BA 1VYTA 2M0OA 1M2OA 2KE9A 3H0FA 1N8RR 2HSPA 1KC8C 4HA8A 4BY6B 4RCBA 4J5YA 2I0NA 3V7CA 4DQ2A 3RESA 2DEUA 2FPEA 2H8HA 1NEBA 1X75C 4J9HA 3REAB 2DIQA 1QKXA 2CT4A 2VC8A 1AOJA 1JQQA 2EFIA 4C8QC 2QTVA 2EKOA 3OYMA 2O4XA 2IG0A 3A8HB 1YHQT 5GANh 3TQ7P 4F7UB 5GMKe 3PMIA 4C92G 1PWTA 4PJOF 2DE0X 1ZBJA 2KROA 1HK9A 4CRIA 3RKWA 2EYXA 1KD1C 5CQXA 4RMOA 4IURA 3VYGA 2Z0WA 4RG8A 3ER0A 3UA7A 2QQ9A 2LMJA 5L23A 2F69A 2RK2A 2ZAEA 1SEMA 2ZZDA 4EMHA 1A0NB 1D3BB 1LJOA 5GAOr 3CC4Q 3TVTA 4JS5A 2PVOB 1OU9A 2MF2A 3OYEA 3QKJA 1YCYA 2FYKA 1BCMA 5LJ3g 3CCRT 1MMGA 1KC8R 3V8KA 4OP0A 1Q81R 1ZA1B 2KRMA 5LJ3d 3QHSA 5GAMg 2D8JA 4X1VA 5GAN2 2CDTA 2OJ2A 4MDXA 5GAMd 3QWYA 1WHJA 4B9WA 3QUIA 1K9MU 3UDCA 2O9SA 4R56A 1VQ6A 2XIDA 4M78F 1IREB 3HPWA 2L0AA 4WCIA 2KYMA 2K5LA 3LH0A 3OW2A 4LXCA 1YJNQ 2XHCA 3E2UA 1OOTA 4BI8B 3PNWC 5HK3A 3E9GA 2K2MA 2GQIA 2L3SA 2QTXA 4PJOB 5DY9A 5IHNA 2LQ8A 2RB6A 1KD1R 5GANe 1W4SA 4E7LA 3QJ6A 2K79A 2V8KA 1GBQA 1WJQA 4Z8AA 2AIRB 5CKBA 2LJ3A 3CCST 3QBYA 4JRPA 3FC3A 2A7YA 3H41A 1VQKQ 4J9IA 2CP5A 4E7ZA 1Y0MA 3JCMX 1PD1A 4Y92A 4BY6C 5I11A 2HNIA 2VKNA 3CMAT 3ZFJA 5LJ5h 1K73C 3CC2Q 3OY9A 4E7SA 1ZSZB 4J7FA 2CH4W 3MP8A 4HKEA 1IHVA 2ED0A 4C92B 3CCEQ 1RABB 4C0DC 4IKFA 4XU2A 1LNXA 3CCMQ 1M3CA 4J6YA 2DL7A 1OEBA 1JEGA 2CREA 2QA4Q 1WHLA 2J05A 4BD3A 1FWZA 1U1SA 5GAOl 4X9DA 2LT4A 3RR6A 2D0QB 2HBPA 1D0XA 4M75A 1SRLA 1UFFA 2FB7A 3BFMA 5LL6S 3S6WA 3CCUA 3I55A 4M7DA 3C4SA 1O75A 3VS7A 1YI2Q 2DTHA 4F16A 3P8HA 4M78D 2EQMA 1GCPA 2ZPHB 2DF6A 3OYFA 2XDBA 3CXCS 1AWOA 3CCLQ 2JUFA 3RKYA 4M77F 5DM7R 3F70A 1RAHB 4D6WA 2EYQA 1N27A 4KULA 5DLQE 1QMCA 2M51A 3SD4A 2WSFE 5GMKm 1S72A 3M4GA 2ENMA 3HKSA 2HCKA 3META 1K1ZA 3RIRA 1VIFA 2M9UA 2EBPA 2GGRA 2VGNA 1AEYA 4LDVA 5CKHA 3HHTB 4PFZA 4ELYC 2KQWA 4OF1A 2G6FX 5GMKi 4PLIA 1U3OA 1OYXA 4BUGA 1WHGA 1JJ2S 3IQLA 1MMDA 1R77A 3VYHB 1AZGB 3CCVQ 1WYXA 4X9CA 3U23A 1KJWA 2LX7A 3JCMc 4V2SA 1GRIA 1PKTA 3EAEA 4EMKB 5GANf 1LOJA 3OYIA 4J9FA 1X2QA 3I56T 4IUQA 4NS5A 5LJ5e 2YWWA 2CH4A 2LZ6B 1AWWA 2RN8A 2HKQB 5KYYB 4RTTA 5FW9A 2R58A 1VQ8T 4FM4B 4ZTJA 3LLRA 2GCXA 1TSFA 3UF4A 3X28B 2OTLA 4II1A 3CCJQ 3CBOA 3J81E 1M90U 2L8DA 4M77B 2EJ9A 4M77D 2DRKA 5FLXE 2P0PA 2FPFA 1UHCA 1UUEA 3LW5E 2QQBA 1X2KA 1GFCA 4QKUA
chains in the Genus database with same CATH topology
1AVZC 2EGAA 2MIOA 3PVLA 1ZX6A 2BZXA 1NLPC 2GTJA 2J6KA 2P4RA 2CUBA 2EQIA 1TG0A 2ROLA 2K7AA 1M8MA 1YCSB 2YT6A 3UATA 1WXUA 1X43A 2GBQA 1M30A 2LCSA 1AZEA 4JZ3A 1VA7A 3KFVA 2L3PA 3VS4A 1QWFA 4J9EA 2CSQA 2X3WD 1AWXA 4JJCA 4HVWA 1UDLA 2LJ0A 1ARKA 2GNCA 3VS1A 3PVQA 3I35A 4AFUC 1W6XA 3A98A 2O88A 3NPFA 2OI3A 4RTVA 1X27A 2YUPA 1W1FA 4E6RA 2DVJA 2DBMA 1UGVA 2KRNA 5IH2A 5IHIA 1J3TA 2RQUA 5FWCA 1SHGA 3TSZA 2JS2A 1K4US 1FMKA 2GTOA 2DRMA 4DEXA 1Y57A 2DYBA 2J06A 2K9GA 1V1CA 3EG2A 1BK2A 4Z88A 1PRMC 2LNHB 1ZUUA 3NGPA 1G2BA 4GBQA 2ED1A 1VYUA 1TUCA 1BB9A 2JXBA 3QWXX 2JM9A 2RQTA 2RNAA 1UECA 2A36A 1U06A 1I1JA 1EFNA 4HXJA 1YN8A 1ZUYA 2CUDA 4D8DA 4OMNA 2JMAA 1X6GA 3NHNA 1UJ0A 2DNUA 1QLYA 1NG2A 4CC3A 1QWEA 2V1RA 1UHFA 3VS2A 4IIOA 3C0CA 3I9QA 1SSHA 1KFZA 5GJWB 2NUZA 2B86A 1T0JA 3VRZA 3M0PA 1T3LA 3ZL7C 2HDAA 4LN2A 2J6OA 2DM1A 4FSSA 2AKLA 4RTYA 2YUOA 2JM8A 1WI7A 2ECZA 4F17A 2PTKA 3LH5A 2IIMA 2KBTA 3SEMA 4AFQC 1JXOA 2DA9A 1SRMA 2VVKA 2EYYA 4ZNXA 1K0XA 3JV3A 2M0YA 1IO6A 1X6BA 2HBWA 1N5ZA 3GBQA 1NLOC 5HCKA 4RTXA 1VYTA 3VS6A 2KT1A 4ESRA 1PNJA 1JO8A 2EKHA 2KE9A 3H0FA 1YNZA 2HSPA 3THKA 2PNIA 4J9BA 2FG0A 2AZVA 2I0NA 4AG1C 2YDLA 4EIKA 2FPEA 2H8HA 1NEBA 4J9HA 3REAB 1QKXA 2CT4A 2W10A 3VS5A 2O31A 1AOJA 2F2XA 1WXTA 3TSWA 1MUZA 1QCFA 1JQQA 3RBBB 4CC2A 2F2VA 1NYFA 4K11A 2L3QA 4HCKA 2DL5A 1OPLA 2O2OA 2RQWA 1RLPC 4RUGA 4J9CA 4RTUA 1PWTA 4OMQA 2MCNA 2DE0X 1M3BA 1UE9A 1ZBJA 2KROA 4QT7A 2EPDA 2FEIA 2KR3A 1HJDA 1I07A 4CC7A 1WA7A 2EYXA 2HEQA 1H3HA 2DL4A 1QKWA 2C0OA 3VS3A 2KXCA 1YP5A 1K76A 2C0IA 1K9AA 3NMZC 2YUNA 4HVVA 1ZUKA 2FRYA 4HVUA 3UA7A 1E7OA 2LMJA 2RF0A 5IXBA 5L23A 3M0RA 4A63B 2JTEA 1SEMA 2DL8A 2RMOA 1KIKA 1A0NB 1X69A 2LJ1A 1WLPB 4AFSC 1B07A 2LQWA 3TVTA 1S1NA 4J9GA 2KEAA 4J9DA 1T0HA 1UG1A 2A08A 1OV3A 2AKKA 1BBZA 2KRMA 1ZSGA 4AG2C 4DEYA 1MV0B 4OMMA 3EGUA 2D8JA 4X1VA 2KRSA 4ORZA 4RTZA 2CDTA 2OJ2A 5I22A 2LQNA 3QWYA 1B3QA 4LE9A 2J6FA 1K0SA 2JMCA 2VWFA 2O9SA 2JT4A 2MOXA 1CSKA 2L0AA 2KYMA 4WCIA 5GJVB 4D8KA 1AWJA 1OOTA 2SEMA 3M0TA 2K2MA 2GQIA 2L3SA 4JPBW 2F2WA 1RUWA 1FYNA 5IHNA 1MV3A 1WDXA 3SHWA 3VRYA 1PHTA 2BZYA 1ABQA 2K79A 3I5SA 4R0KA 4LNPA 1GBQA 2K6DA 4Z8AA 1NEGA 2EW3A 2LJ3A 3VS0A 5EC7A 3I5RA 2RPNA 2DILA 3H41A 4J9IA 1M3AA 1Y0MA 3O5ZA 1WXBA 2KT8A 1SPKA 4Y92A 5I11A 2KXDA 2KNBB 2VKNA 1UJYA 2EGCA 3PE0A 2YUQA 3FJ5A 2FPDA 5IHKA 2D8HA 2BZ8A 2CH4W 2ED0A 2AZSA 1RLQC 1Z9ZA 1CKAA 1GCQC 4JJBA 1M3CA 1PKSA 1OEBA 2DL7A 1JEGA 2CREA 1NM7A 2J05A 1M27C 4OMOA 1UTIA 2PZ1A 4IIMA 3REBB 1SRLA 1UFFA 2SRCA 1KSWA 4KRTA 1BU1A 1TUDA 2JW4A 1GCQA 2EYZA 2DLPA 3VS7A 2V1QA 1XOVA 2DL3A 2KGTA 4RTWA 4F16A 2J7IA 1GCPA 1H8KA 1SHFA 2DF6A 2K3BA 5ECAA 1AWOA 1U5SA 4LUEA 2C0TA 2EVRA 1E6HA 4AFZC 1GL5A 2A37A 3EHRA 2BTTA 1H92A 1AD5A 1RI9A 2CSIA 4F14A 2M51A 2NWMA 1VYVA 2ENMA 2HCKA 1K1ZA 1WFWA 2W0ZA 3EG0A 2DMOA 2EBPA 2GGRA 5FWBA 4Z89A 2YSQA 2FO0A 1HSQA 4M4ZA 3EG1A 1HD3A 2DJQA 1JXMA 4LUDA 1AEYA 2ROTA 2OAWA 2L2PA 2G6FX 2LP5A 4OMPA 1U3OA 3IQLA 2D1XA 2ESWA 2QDLA 1AZGB 3M0SA 1WYXA 3U23A 1KJWA 1WIEA 2ABLA 2LX7A 3H0IA 1LCKA 1GRIA 1PKTA 3UA6A 1YWPA 3H0HA 2RQRA 3EG3A 2CT3A 4J9FA 1X2QA 2D0NA 1GFDA 1GBRA 1NYGA 2CH4A 2LZ6B 1T3SA 1AWWA 2EGEA 2EYWA 1ABOA 2RN8A 2XMFA 2DX1A 2E5KA 4RTTA 5FW9A 3CQTA 4JZ4A 5IXFA 1OPKA 3RNJA 2JS0A 4JJDA 1ZLMA 2FRWA 1Z9QA 2KYBA 1YWOA 3M0UA 3UF4A 2DBKA 1E6GA 2A28A 1WX6A 1CKBA 1PRLC 1JU5C 3EHQA 3R6NA 1G83A 4OMLA 2DRKA 2X3XD 2FPFA 3M0QA 4GLMA 1W70A 2AK5A 1UHCA 1I0CA 3ULRB 1UUEA 2RQVA 1X2KA 2O9VA 4CC4B 1GFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVZ C;  2EGA A;  2MIO A;  3PVL A;  1ZX6 A;  2BZX A;  1NLP C;  2GTJ A;  2J6K A;  2P4R A;  2CUB A;  2EQI A;  1TG0 A;  2ROL A;  2K7A A;  1M8M A;  1YCS B;  2YT6 A;  3UAT A;  1WXU A;  1X43 A;  2GBQ A;  1M30 A;  2LCS A;  1AZE A;  4JZ3 A;  1VA7 A;  3KFV A;  2L3P A;  3VS4 A;  1QWF A;  4J9E A;  2CSQ A;  2X3W D;  1AWX A;  4JJC A;  4HVW A;  1UDL A;  2LJ0 A;  1ARK A;  2GNC A;  3VS1 A;  3PVQ A;  3I35 A;  4AFU C;  1W6X A;  3A98 A;  2O88 A;  3NPF A;  2OI3 A;  4RTV A;  1X27 A;  2YUP A;  1W1F A;  4E6R A;  2DVJ A;  2DBM A;  1UGV A;  2KRN A;  5IH2 A;  5IHI A;  1J3T A;  2RQU A;  5FWC A;  1SHG A;  3TSZ A;  2JS2 A;  1K4U S;  1FMK A;  2GTO A;  2DRM A;  4DEX A;  1Y57 A;  2DYB A;  2J06 A;  2K9G A;  1V1C A;  3EG2 A;  1BK2 A;  4Z88 A;  1PRM C;  2LNH B;  1ZUU A;  3NGP A;  1G2B A;  4GBQ A;  2ED1 A;  1VYU A;  1TUC A;  1BB9 A;  2JXB A;  3QWX X;  2JM9 A;  2RQT A;  2RNA A;  1UEC A;  2A36 A;  1U06 A;  1I1J A;  1EFN A;  4HXJ A;  1YN8 A;  1ZUY A;  2CUD A;  4D8D A;  4OMN A;  2JMA A;  1X6G A;  3NHN A;  1UJ0 A;  2DNU A;  1QLY A;  1NG2 A;  4CC3 A;  1QWE A;  2V1R A;  1UHF A;  3VS2 A;  4IIO A;  3C0C A;  3I9Q A;  1SSH A;  1KFZ A;  5GJW B;  2NUZ A;  2B86 A;  1T0J A;  3VRZ A;  3M0P A;  1T3L A;  3ZL7 C;  2HDA A;  4LN2 A;  2J6O A;  2DM1 A;  4FSS A;  2AKL A;  4RTY A;  2YUO A;  2JM8 A;  1WI7 A;  2ECZ A;  4F17 A;  2PTK A;  3LH5 A;  2IIM A;  2KBT A;  3SEM A;  4AFQ C;  1JXO A;  2DA9 A;  1SRM A;  2VVK A;  2EYY A;  4ZNX A;  1K0X A;  3JV3 A;  2M0Y A;  1IO6 A;  1X6B A;  2HBW A;  1N5Z A;  3GBQ A;  1NLO C;  5HCK A;  4RTX A;  1VYT A;  3VS6 A;  2KT1 A;  4ESR A;  1PNJ A;  1JO8 A;  2EKH A;  2KE9 A;  3H0F A;  1YNZ A;  2HSP A;  3THK A;  2PNI A;  4J9B A;  2FG0 A;  2AZV A;  2I0N A;  4AG1 C;  2YDL A;  4EIK A;  2FPE A;  2H8H A;  1NEB A;  4J9H A;  3REA B;  1QKX A;  2CT4 A;  2W10 A;  3VS5 A;  2O31 A;  1AOJ A;  2F2X A;  1WXT A;  3TSW A;  1MUZ A;  1QCF A;  1JQQ A;  3RBB B;  4CC2 A;  2F2V A;  1NYF A;  4K11 A;  2L3Q A;  4HCK A;  2DL5 A;  1OPL A;  2O2O A;  2RQW A;  1RLP C;  4RUG A;  4J9C A;  4RTU A;  1PWT A;  4OMQ A;  2MCN A;  2DE0 X;  1M3B A;  1UE9 A;  1ZBJ A;  2KRO A;  4QT7 A;  2EPD A;  2FEI A;  2KR3 A;  1HJD A;  1I07 A;  4CC7 A;  1WA7 A;  2EYX A;  2HEQ A;  1H3H A;  2DL4 A;  1QKW A;  2C0O A;  3VS3 A;  2KXC A;  1YP5 A;  1K76 A;  2C0I A;  1K9A A;  3NMZ C;  2YUN A;  4HVV A;  1ZUK A;  2FRY A;  4HVU A;  3UA7 A;  1E7O A;  2LMJ A;  2RF0 A;  5IXB A;  5L23 A;  3M0R A;  4A63 B;  2JTE A;  1SEM A;  2DL8 A;  2RMO A;  1KIK A;  1A0N B;  1X69 A;  2LJ1 A;  1WLP B;  4AFS C;  1B07 A;  2LQW A;  3TVT A;  1S1N A;  4J9G A;  2KEA A;  4J9D A;  1T0H A;  1UG1 A;  2A08 A;  1OV3 A;  2AKK A;  1BBZ A;  2KRM A;  1ZSG A;  4AG2 C;  4DEY A;  1MV0 B;  4OMM A;  3EGU A;  2D8J A;  4X1V A;  2KRS A;  4ORZ A;  4RTZ A;  2CDT A;  2OJ2 A;  5I22 A;  2LQN A;  3QWY A;  1B3Q A;  4LE9 A;  2J6F A;  1K0S A;  2JMC A;  2VWF A;  2O9S A;  2JT4 A;  2MOX A;  1CSK A;  2L0A A;  2KYM A;  4WCI A;  5GJV B;  4D8K A;  1AWJ A;  1OOT A;  2SEM A;  3M0T A;  2K2M A;  2GQI A;  2L3S A;  4JPB W;  2F2W A;  1RUW A;  1FYN A;  5IHN A;  1MV3 A;  1WDX A;  3SHW A;  3VRY A;  1PHT A;  2BZY A;  1ABQ A;  2K79 A;  3I5S A;  4R0K A;  4LNP A;  1GBQ A;  2K6D A;  4Z8A A;  1NEG A;  2EW3 A;  2LJ3 A;  3VS0 A;  5EC7 A;  3I5R A;  2RPN A;  2DIL A;  3H41 A;  4J9I A;  1M3A A;  1Y0M A;  3O5Z A;  1WXB A;  2KT8 A;  1SPK A;  4Y92 A;  5I11 A;  2KXD A;  2KNB B;  2VKN A;  1UJY A;  2EGC A;  3PE0 A;  2YUQ A;  3FJ5 A;  2FPD A;  5IHK A;  2D8H A;  2BZ8 A;  2CH4 W;  2ED0 A;  2AZS A;  1RLQ C;  1Z9Z A;  1CKA A;  1GCQ C;  4JJB A;  1M3C A;  1PKS A;  1OEB A;  2DL7 A;  1JEG A;  2CRE A;  1NM7 A;  2J05 A;  1M27 C;  4OMO A;  1UTI A;  2PZ1 A;  4IIM A;  3REB B;  1SRL A;  1UFF A;  2SRC A;  1KSW A;  4KRT A;  1BU1 A;  1TUD A;  2JW4 A;  1GCQ A;  2EYZ A;  2DLP A;  3VS7 A;  2V1Q A;  1XOV A;  2DL3 A;  2KGT A;  4RTW A;  4F16 A;  2J7I A;  1GCP A;  1H8K A;  1SHF A;  2DF6 A;  2K3B A;  5ECA A;  1AWO A;  1U5S A;  4LUE A;  2C0T A;  2EVR A;  1E6H A;  4AFZ C;  1GL5 A;  2A37 A;  3EHR A;  2BTT A;  1H92 A;  1AD5 A;  1RI9 A;  2CSI A;  4F14 A;  2M51 A;  2NWM A;  1VYV A;  2ENM A;  2HCK A;  1K1Z A;  1WFW A;  2W0Z A;  3EG0 A;  2DMO A;  2EBP A;  2GGR A;  5FWB A;  4Z89 A;  2YSQ A;  2FO0 A;  1HSQ A;  4M4Z A;  3EG1 A;  1HD3 A;  2DJQ A;  1JXM A;  4LUD A;  1AEY A;  2ROT A;  2OAW A;  2L2P A;  2G6F X;  2LP5 A;  4OMP A;  1U3O A;  3IQL A;  2D1X A;  2ESW A;  2QDL A;  1AZG B;  3M0S A;  1WYX A;  3U23 A;  1KJW A;  1WIE A;  2ABL A;  2LX7 A;  3H0I A;  1LCK A;  1GRI A;  1PKT A;  3UA6 A;  1YWP A;  3H0H A;  2RQR A;  3EG3 A;  2CT3 A;  4J9F A;  1X2Q A;  2D0N A;  1GFD A;  1GBR A;  1NYG A;  2CH4 A;  2LZ6 B;  1T3S A;  1AWW A;  2EGE A;  2EYW A;  1ABO A;  2RN8 A;  2XMF A;  2DX1 A;  2E5K A;  4RTT A;  5FW9 A;  3CQT A;  4JZ4 A;  5IXF A;  1OPK A;  3RNJ A;  2JS0 A;  4JJD A;  1ZLM A;  2FRW A;  1Z9Q A;  2KYB A;  1YWO A;  3M0U A;  3UF4 A;  2DBK A;  1E6G A;  2A28 A;  1WX6 A;  1CKB A;  1PRL C;  1JU5 C;  3EHQ A;  3R6N A;  1G83 A;  4OML A;  2DRK A;  2X3X D;  2FPF A;  3M0Q A;  4GLM A;  1W70 A;  2AK5 A;  1UHC A;  1I0C A;  3ULR B;  1UUE A;  2RQV A;  1X2K A;  2O9V A;  4CC4 B;  1GFC A; 
#chains in the Genus database with same CATH topology
 5LJ3 h;  2MAM A;  2EGA A;  3PVL A;  4A53 A;  1K8A U;  2BZX A;  4MDW A;  2GTJ A;  2P4R A;  3JCM W;  1RAG B;  5GAM h;  3MO8 A;  1M8M A;  2WAC A;  3LWI A;  4M7D C;  3FEO A;  5KYW B;  1ZSZ C;  3UAT A;  3M4Y A;  2E4H A;  4C92 C;  2GBQ A;  2QA4 T;  1M1K R;  4FT4 A;  4A4E A;  1AZE A;  3MEA A;  4J6W A;  3C12 A;  4M78 E;  3RUX A;  1BYM A;  1BKB A;  3L2V A;  5CK9 A;  4AFU C;  3CD6 T;  4C0F A;  1U1T A;  2OI3 A;  1X27 A;  1W1F A;  3CCL T;  3PMT A;  2KRN A;  5IHI A;  4A4H A;  1PC0 A;  2COW A;  2K2V A;  1J3T A;  3RDV A;  2DJZ A;  5GAN 8;  4Y28 E;  1VQM A;  5FWC A;  4EPC A;  1ZHI A;  1M5Q 1;  2CS7 A;  2MYS A;  2GTO A;  2NUT A;  2DRM A;  1KQS A;  1Y57 A;  1Q95 G;  5KH6 A;  1BK2 A;  4Z88 A;  2QQA A;  2HQE A;  2XKO C;  4O5V A;  3NGP A;  3CBP A;  2YRV A;  2YLB A;  5LJ5 f;  1VQL Q;  1YJW A;  2ZPG B;  3OQ5 A;  2JXB A;  2K3X A;  1G3Y A;  3FDR A;  3UWN A;  4ZN3 A;  1RAE B;  2RQT A;  1U06 A;  4MZT A;  1WGS A;  1I1J A;  1PG5 B;  4HXJ A;  5LJ3 e;  1YN8 A;  5CCA A;  2DXT A;  2CUD A;  4OMN A;  2CZ7 B;  4NOY A;  3EGD A;  4C8Q F;  3OMC A;  4M7A A;  1FX7 A;  3MP1 A;  5GAM e;  4FU6 A;  3D7S B;  5FRN A;  3VS2 A;  1ACM B;  3C0C A;  2L5Q A;  4ME7 A;  3JB9 H;  5CQY A;  1T0J A;  3VRZ A;  2YUO A;  4XTZ A;  1MNE A;  1WNL A;  3CPW P;  2IIM A;  2DA9 A;  1KHI A;  1EX4 A;  2EYY A;  2LX9 A;  2Y90 A;  4ZNX A;  1VQO A;  3HRU A;  2DZ9 A;  4C5G A;  2X4X A;  2K57 A;  2HBW A;  1FMW A;  1YIJ Q;  3BW1 A;  3GBQ A;  1NLO C;  3OB9 A;  3QYH B;  2KT1 A;  2EKH A;  3A8G B;  1NJI C;  4DBF A;  4J9B A;  1W2B P;  2G3R A;  4AG1 C;  2YDL A;  1RAA B;  2O31 A;  4N0A C;  1WXT A;  4RG2 A;  1QCF A;  1Q86 C;  1BI1 A;  3RBB B;  1TS9 A;  5CR2 A;  1FXX A;  5J39 A;  2F2V A;  1NYF A;  4K11 A;  4HCK A;  2XI9 A;  2GFU A;  1YIT A;  4HT8 A;  4RTU A;  4OMQ A;  3LWH A;  4WF2 A;  1M3B A;  1UE9 A;  1M1F A;  1RL2 A;  2VXE A;  1WPY A;  4C8Q D;  1I07 A;  4IUU A;  3L1A A;  2OTJ Q;  2HEQ A;  2QQS A;  1QKW A;  2I2L A;  3L2R A;  4KGZ B;  5CIU A;  2GF7 A;  1VQN T;  1TTH B;  1K9A A;  2C0I A;  2WSC E;  4HVU A;  1E7O A;  2RF0 A;  1IXD A;  1N6A A;  1F1B B;  2OAU A;  4A63 B;  1MHN A;  5LJ3 f;  4FYX B;  2DTO A;  1VQP A;  2LJ1 A;  1N9R A;  3CCQ Q;  3M55 A;  2KEA A;  5CKF A;  5GAM f;  1T0H A;  4E47 A;  2A08 A;  1VQ7 T;  2FZC B;  4PJJ A;  1Q7Y R;  1ZSG A;  3QYG B;  4OGE A;  4R55 A;  3CC7 Q;  3Q1J A;  2M16 A;  1B34 A;  1B3Q A;  5C0M A;  5FRO A;  1K0S A;  2MOX A;  1RAC B;  1QVF S;  2R5M A;  3KUF A;  3BDL A;  2DIG A;  4FSX A;  2XD0 A;  2CZ1 B;  2SEM A;  3M0T A;  4FL6 A;  1I5O B;  1OX8 A;  5GAN 6;  2OX7 A;  4JPB W;  3WXM B;  2E6Z A;  3OYD A;  3CME A;  1PM3 A;  8ATC B;  2LQK A;  2E65 A;  1VQ6 Q;  4PJO G;  1ZQ1 A;  4J6X A;  2BZY A;  1ABQ A;  2NUP B;  1ZBX A;  1QVG S;  2EW3 A;  1D0Y A;  3M56 A;  3CPF A;  2CP3 A;  3VS0 A;  1YIJ T;  3AHU A;  3GP8 A;  3I5R A;  4OB3 B;  1X01 A;  1SKU B;  1Q81 C;  2L3R A;  1QP3 A;  1M3A A;  1WXB A;  2KXD A;  2YUQ A;  1K73 U;  2LDM A;  1YHQ A;  5IHK A;  1JB0 E;  2BZ8 A;  2YXY A;  1RLQ C;  1CKA A;  2COZ A;  4JJB A;  1PKS A;  2PVG B;  2CGH A;  1NM7 A;  4O6J A;  4BDZ A;  4OMO A;  4C8Q E;  2PZ1 A;  3TCJ A;  2YHT A;  2SRC A;  3QPH A;  4KRT A;  1BU1 A;  1TUD A;  4BAC A;  1Y71 A;  1XOV A;  2DL3 A;  2V1Q A;  4E7K A;  2KGT A;  2DFU A;  2QGF B;  2OTJ T;  3G4S Q;  2K3B A;  5ECA A;  4M78 G;  3EFS A;  4F7U A;  4OB0 B;  2LCC A;  3GIB A;  2BTT A;  1AD5 A;  1RI9 A;  2COY A;  3OBW A;  4BI3 A;  3EFO A;  3CCU Q;  3I55 Q;  1BI0 A;  1KK7 A;  1WFW A;  3HRT A;  2DMO A;  3VUZ A;  5FWB A;  1SSF A;  2YSQ A;  4Z89 A;  1JJ2 A;  3CCQ T;  3EG1 A;  3SDZ A;  1NPP A;  3JB9 I;  2QGG A;  3X20 B;  5KE3 A;  1NE8 A;  2YRD A;  3BE3 A;  1D3B A;  2X51 A;  4M75 F;  3OYY A;  4ZGE B;  1S72 Q;  3RER A;  4M7D F;  1LVK A;  1VQ5 Q;  3CC7 T;  1WIE A;  4J7I A;  4E7H A;  2QEX Q;  3H0H A;  2RQR A;  3EG3 A;  2RHI A;  2D0N A;  3V7R A;  1GFD A;  1GBR A;  4EDU A;  2JNG A;  2QG9 B;  1BI3 A;  2CKK A;  1JJ2 P;  4JZ4 A;  3G6E T;  2JS0 A;  4JJD A;  2EJG A;  1ZLM A;  1Z9Q A;  4MZP A;  3OYC A;  1PCX A;  4OB1 B;  1X6O A;  4QW2 A;  4L59 A;  1Q82 C;  2DBK A;  2A28 A;  2R5A A;  1WX6 A;  1CKB A;  2E12 A;  2FHD A;  2NYS A;  1I81 A;  3EHQ A;  2VB6 A;  3R6N A;  4LD6 A;  3CMA A;  2XU8 A;  2PQW A;  3M0Q A;  1W70 A;  1WJS A;  2PVD B;  2DXC A;  4M77 G;  2GQV A;  2RQV A;  4CC4 B;  1U8R A;  3JCM V;  1AVZ C;  2MIO A;  3A8M B;  4PJM A;  1NLP C;  2J6K A;  1M9S A;  2CUB A;  2OTL Q;  1TG0 A;  2ROL A;  2X4Y A;  2VYT A;  2RI5 A;  3FRN A;  1YCS B;  3QZ9 B;  2KI7 A;  1X43 A;  2CZ0 B;  2DO3 A;  5GAO m;  1KG1 A;  2MI6 A;  4M75 D;  1JRI A;  3VS4 A;  3P8D A;  4BDY A;  4DBQ A;  2EWN A;  4M7D D;  1ZSZ A;  3VUB A;  4M78 B;  3TU4 K;  4C92 A;  2LJ0 A;  5FU7 B;  3G71 Q;  2GNC A;  4DBR A;  3G4S T;  1W6X A;  3A98 A;  4RTV A;  4ELZ C;  4E6R A;  2DVJ A;  5KYX B;  4QVD A;  1UGQ B;  5IH2 A;  4OGC A;  2K3Y A;  4FW1 A;  2RJC A;  5A0D A;  1SHG A;  2M1H A;  5FU6 B;  1Q82 R;  2DVE A;  1K4U S;  3QG1 A;  1FMK A;  4LDW A;  2EJF A;  1Y96 B;  3CC4 T;  4NL2 A;  3V8L A;  2E41 A;  5GMK l;  1FMV A;  2A0F B;  2ED1 A;  3M58 A;  4BE0 A;  1BB9 A;  1VQM Q;  1M1K C;  4JRQ A;  5M9O A;  3I56 A;  1VQ5 T;  2QI2 A;  2RNA A;  3L2Z A;  4XTX A;  2QEX T;  1EFN A;  2PUO B;  5CAI A;  3VJP A;  4D8D A;  4KGV B;  1YJN T;  2JMA A;  2K5I A;  1VQ8 A;  1IGQ A;  2CP0 A;  1UJ0 A;  4UC4 A;  5D6Y A;  1K9M C;  1VQ9 Q;  2DNU A;  1NG2 A;  3QSU A;  4HCB A;  2V1R A;  1YJW Q;  2O01 E;  2A3L A;  2QAZ A;  3G1J A;  5HKC A;  4PJO C;  3UPU A;  1QCO A;  2B86 A;  1YJ9 Q;  3ZL7 C;  4XTW A;  2DM1 A;  4FSS A;  4ANJ A;  3KXT A;  5I2S A;  3S3M A;  2JM8 A;  3JCM Q;  1WI7 A;  3OW2 S;  2ECZ A;  2HQH A;  2RM4 A;  4F17 A;  2PTK A;  5KYY A;  4RCC A;  7AT1 B;  2VVK A;  5IN1 A;  1VQK T;  1K0X A;  4QQD A;  1IO6 A;  1N5Z A;  4FCY A;  5HCK A;  4RTX A;  3VS6 A;  2XG8 D;  3OBY A;  1JO8 A;  5D6W A;  3CC2 T;  3THK A;  3QJY A;  3A8L B;  2XDP A;  2PNI A;  3J7A F;  2RJE A;  2FG0 A;  2AZV A;  4EIK A;  2F5K A;  1R0B G;  3CCE T;  3FJP A;  2RHY A;  4M7A F;  3CCM T;  4M75 E;  1IHW A;  6AT1 B;  3JCM J;  1TH7 A;  4M7D E;  1VQO Q;  3TSW A;  4XTV A;  3CD6 A;  3L2U A;  1GXI E;  3CCL A;  1YI2 T;  2L3Q A;  5KYW A;  4N0A A;  2DL5 A;  3MPU B;  4AMC A;  2O2O A;  3OS2 A;  1RLP C;  3G71 T;  1H64 1;  2MCN A;  3L2W A;  1K9M R;  2GFA A;  1B7T A;  3RKX A;  2JVV A;  2DD4 A;  4KUI A;  4CC7 A;  1WA7 A;  4N4H A;  2P4T A;  4C8Q G;  2Y4X A;  3ME9 A;  3MP6 A;  1YP5 A;  2EQU A;  4KH0 B;  3MCA B;  2NUT B;  1K76 A;  4FT2 A;  2LT1 A;  3GLX A;  4HVV A;  4MZM A;  1YIT Q;  1N8R U;  1VQ4 Q;  4JLG A;  3MKD A;  3X24 B;  3PTA A;  4JUV A;  4DA4 A;  2IVW A;  1X69 A;  2DET A;  1WLP B;  3M9Q A;  3FIF A;  4JRK A;  1C6V X;  3CPW A;  4J9G A;  3DLM A;  1G8X A;  3FLG A;  3CCV T;  1VQM T;  1UG1 A;  1UGS B;  1I4K 1;  1M4Z A;  1BBZ A;  4AG2 C;  2KDS A;  3EGX B;  1QVF A;  4DEY A;  2JTM A;  4EMK C;  4BB7 A;  3EGU A;  2KRS A;  4IUV A;  4RTZ A;  4C5E A;  2PU9 B;  4XU1 A;  5I22 A;  2K5F A;  1D09 B;  2BE9 B;  2DPP B;  1VQP Q;  2VWF A;  4A54 A;  4M7A D;  2JT4 A;  1W2B A;  1QW1 A;  5D6X A;  1VQ9 T;  1V76 A;  1G3T A;  2EQJ A;  2ZPE B;  4LD9 K;  4JRI A;  1YJ9 T;  4JJN K;  3OYA A;  2DYI A;  1RUW A;  3V7S A;  3CCJ T;  2DKG A;  1FYN A;  2QK0 A;  3EG9 B;  2LRQ A;  4M77 C;  2CP6 A;  3SHW A;  2RHZ A;  3NTH A;  1D1A A;  2CYZ B;  3I5S A;  4R0K A;  4LNP A;  2K6D A;  5KYN A;  1QVF P;  4QVC A;  3OYH A;  2LCL A;  4C5H A;  3DLL A;  2DER A;  1M90 C;  4KT0 E;  1KC8 U;  1PSE A;  2RPN A;  1YBY A;  2DIL A;  1Q7Y C;  1Q81 U;  4XAX B;  3CME Q;  3O5Z A;  1SPK A;  2KNB B;  1UJY A;  2DZC A;  3QZ5 B;  3PE0 A;  4YTL A;  3FJ5 A;  1K8A C;  3LGF A;  2X9H A;  1VQO T;  3BY7 A;  1IB8 A;  1Z9Z A;  2RK1 A;  3WVE B;  1GCQ C;  4QQ6 A;  2HSE B;  2L89 A;  4TVR A;  1M27 C;  2DTI A;  1JBM A;  4Z02 A;  1UTI A;  4ZGD B;  2MPX C;  3REB B;  4C8Q B;  2KK4 A;  2JW4 A;  2DLP A;  1KD1 U;  1VQN A;  2ZPI B;  2J7I A;  1H8K A;  1SHF A;  1U5S A;  4LUE A;  2C0T A;  4ZGJ B;  1E6H A;  4AFZ C;  5GAN 7;  1IZ6 A;  3EHR A;  4PFO A;  5GAN 4;  3JB9 F;  3HFN A;  1QCN A;  2CP7 A;  3KBG A;  2CSI A;  5KCO A;  1YIT T;  1M2V A;  3OA6 A;  3EFR A;  1VQ4 T;  1VYV A;  5D7U A;  3PT9 A;  2P0K A;  1VQ7 A;  4BE2 A;  3EG0 A;  5KYU B;  1QVP A;  2FO0 A;  2JTF A;  1M90 R;  4VUB A;  1VQL T;  1HD3 A;  4JDS A;  1OZ3 A;  4LUD A;  1RI0 A;  2LTO A;  3INZ A;  2VGM A;  2IPO B;  2KMT A;  3HP9 A;  5KCH A;  1DJ7 B;  4OMP A;  2D1X A;  4M7A E;  4QVZ A;  5FRM A;  2E3I A;  1D1B A;  1KQS S;  3OYG A;  2EQK A;  2BIV A;  1K8A R;  3M0S A;  4HT9 A;  3E19 A;  2PUK B;  4PJL A;  4FYW B;  3UA6 A;  1YWP A;  2RH2 A;  1LPL A;  1KQ2 A;  4F7U F;  4BE1 A;  2JOY A;  1T3S A;  2EGE A;  2EYW A;  2F1L A;  2XMF A;  2E5K A;  2MMP A;  3CQT A;  3SWN B;  2FRW A;  5J3B A;  1YIJ A;  3QXE B;  1YWO A;  3M0U A;  1UB4 A;  2BKD N;  2V8I A;  2P0Q A;  5HK0 A;  1E6G A;  1WHH A;  5CVI A;  1PRL C;  5A0L A;  2HAX A;  2X3X D;  3VV0 A;  4GLM A;  2YRC A;  3JB9 D;  3JAM E;  4QQG A;  1I0C A;  3ULR B;  2MK5 A;  2RD1 A;  3T9N A;  3JCM g;  1SF9 A;  3PGG A;  3OYJ A;  3LYI A;  4PL6 A;  1ZX6 A;  2ZGW A;  3JCM d;  2EQI A;  3OYN A;  3OMG A;  4N4I A;  2O4X B;  1H3Z A;  2DK3 A;  1TOV A;  3CEY A;  4P5N A;  3CMA Q;  4L6V 5;  3CXC A;  4ZN1 A;  2LCS A;  1VA7 A;  1HYO A;  3KFV A;  2L3P A;  3QDR B;  2OTJ A;  1QWF A;  4J9E A;  3GPL A;  4C0D B;  4PFP A;  4NL3 A;  4PNO A;  1G3S A;  4M75 G;  2EAY A;  4ZTF A;  2VUB A;  1G5V A;  1UDL A;  4M7D G;  1C1A A;  4WTO B;  3VS1 A;  3PVQ A;  3I35 A;  1PSF A;  1KQ1 A;  3NPF A;  2YUP A;  2FZK B;  2DBM A;  2ATC B;  1UGV A;  2D9T A;  5I2M A;  3FB9 A;  3CCQ A;  3EFO B;  2RQU A;  3CCR A;  3OSS C;  3TSZ A;  5CKE A;  4DOW A;  2RI2 A;  4AT1 B;  2KY9 A;  2DYB A;  2K9G A;  3M54 A;  3CXC P;  3EG2 A;  3EH1 A;  1ZUU A;  1Y7X A;  3CC7 A;  4ATO A;  3SB2 A;  1VYU A;  1TUC A;  3H6Z A;  5GMK j;  2H3J A;  3C95 A;  1M1K U;  2VAS A;  3QWX X;  2FZG B;  4C92 F;  1UEC A;  5AT1 B;  2AT1 B;  5IAY A;  3QO3 A;  3O8V A;  5L8R E;  2JJ9 A;  3ASK A;  3G6E A;  3NHN A;  1I8F A;  1WJR A;  3NFC A;  4XU3 A;  2QXF A;  2DXU A;  1MGQ A;  1QLY A;  1RAI B;  4CC3 A;  1UHF A;  1SSH A;  3CCS A;  3DB3 A;  3I56 Q;  1O9S A;  3VKI A;  3QDF A;  1VQ6 T;  3SWN C;  1RAD B;  2HDA A;  2QQR A;  3S3N A;  4LN2 A;  1QQJ A;  4HCZ A;  4RTY A;  5A2Q E;  2E1H A;  3G7Z A;  2DXB A;  1VQ8 Q;  4PJO A;  5GAN 5;  4Q5W A;  3LH5 A;  4PJO D;  1KHC A;  3JCM b;  2DD5 A;  3SFM A;  1SRM A;  5A0G A;  3H9N A;  1M8V A;  1D0Z A;  4PJN A;  2EIF A;  2NLU A;  4ESR A;  1PNJ A;  2DEQ A;  1YNZ A;  3GF5 A;  3OYL A;  2KVQ G;  2X4W A;  3MJX A;  3OW2 P;  1OX9 A;  3CBM A;  1R8O B;  3OS5 A;  2W10 A;  3VS5 A;  3RMQ A;  4M75 B;  5AYF A;  4KUD K;  2F2X A;  3DB4 A;  1IRX A;  1WQ7 A;  4M7D B;  1MUZ A;  1XTD A;  4KH1 B;  1XJW B;  3G4S A;  4CC2 A;  5GAN j;  4C92 D;  4F7U E;  3OS0 A;  3HRS A;  1OPL A;  3JRZ A;  2RQW A;  4RUG A;  2HL3 A;  4J9C A;  3VU3 C;  4QT7 A;  2EPD A;  2FEI A;  2KR3 A;  1HJD A;  3A5Z B;  3HTR A;  3L2Q A;  4M78 A;  1H3H A;  3CC4 A;  2DL4 A;  2C0O A;  4LDU A;  3VS3 A;  3CD6 Q;  3CCU T;  3I55 T;  2KXC A;  3MEV A;  3PIO A;  3NMZ C;  5KYX A;  2YUN A;  5IXB A;  1ZUK A;  2FRY A;  4DOV A;  2F5T X;  4RKU E;  3JCM h;  3M0R A;  2JTE A;  2BE7 D;  2DL8 A;  3PFS A;  4OVA A;  3H8Z A;  2RMO A;  1KIK A;  1VQ5 A;  1VOM A;  3X25 B;  4AFS C;  4XU0 A;  1B07 A;  2LQW A;  1S1N A;  2QEX A;  4J9D A;  1S72 T;  1OI1 A;  2C06 A;  2QYZ A;  1Y96 A;  1V29 B;  1SG5 A;  2MWP A;  1YJN A;  5CKD A;  1VIE A;  1OV3 A;  2AKK A;  1WZO A;  3R6O A;  1XQH A;  1MV0 B;  4OMM A;  4ORZ A;  2K4Y A;  2HL5 C;  1R0C B;  2LQN A;  4LE9 A;  2J6F A;  1K73 R;  3UT1 A;  3URG A;  2JMC A;  3N5B B;  1P92 A;  1CSK A;  4XK8 E;  4M7A G;  4EMK A;  2E64 A;  5GJV B;  4Y91 A;  4D8K A;  1AWJ A;  4FW2 A;  2ZCF B;  2X4J A;  2F2W A;  2AHJ B;  3ZBD A;  4PJO E;  2DAQ A;  4J83 A;  1VQK A;  4L5G A;  9ATC B;  3BDU A;  1MV3 A;  1MND A;  4DBH A;  1WDX A;  4BI4 A;  2KSS A;  3OYB A;  3VRY A;  1PHT A;  3CC2 A;  2H3E B;  5I21 A;  1NEG A;  4LDX A;  3L42 A;  5C6S A;  5EC7 A;  3CCE A;  4M77 A;  3CCM A;  1NJI U;  3OS1 A;  5GAO n;  4LDY A;  2QA4 A;  2OTL T;  1Q7Y U;  3A8O B;  2LVM A;  4E7I A;  1M1G A;  3J80 E;  2KT8 A;  5DLO A;  1Y07 A;  1TWB A;  3TEE A;  4PKC C;  5LJ5 j;  3HL8 A;  2EGC A;  1YI2 A;  2FPD A;  1Q86 U;  1YFN A;  2HD0 A;  2V26 A;  2D8H A;  3M57 A;  3JCM e;  3PIP A;  4M75 C;  4C92 E;  2E3H A;  3G71 A;  2AZS A;  2V8J A;  1MMN A;  3V8J A;  4M78 C;  2CZ6 B;  5GAN 3;  1UGP B;  5FU7 C;  1WHK A;  4IIM A;  1KSW A;  1GCQ A;  2EYZ A;  1UGR B;  3GOX A;  4JS4 A;  4RTW A;  4MMK A;  4XTU A;  4CI0 C;  4A4G A;  4IUT A;  4PLL A;  2CP2 A;  2EVR A;  1AT1 B;  1GL5 A;  5FU6 C;  2A37 A;  2KAF A;  1H92 A;  2HKN A;  1WHM A;  1G3W A;  4KGX B;  3AT1 B;  3M53 A;  4F14 A;  1RAF B;  4FYY B;  2NWM A;  2B8A A;  4XTY A;  5CO7 A;  3CCV A;  3P8B B;  4OMF B;  1VQN Q;  4MML A;  2W0Z A;  4E2F B;  2XDD A;  1HSQ A;  4M4Z A;  1TUG B;  2HZY A;  4JLI A;  2DJQ A;  1JXM A;  2ROT A;  2RJD A;  1VUB A;  2OAW A;  2L2P A;  1C0M A;  2JN0 A;  2VV5 A;  2LP5 A;  3EGD B;  2ESW A;  2QDL A;  5EG2 A;  1VQ9 A;  4M7A B;  3WVD B;  3GNF B;  3TRE A;  1VQ7 Q;  3M59 A;  5J26 A;  2ABL A;  3H0I A;  1LCK A;  1YJ9 A;  3S3O A;  1YJW T;  5GAO p;  2CT3 A;  3ZEH A;  3CCJ A;  3EGX A;  2Y4Y A;  4IUP A;  1NYG A;  1ABO A;  3HSB A;  2DX1 A;  5GAN g;  3A1P A;  2X35 A;  3MEW A;  1QVG A;  4OB2 B;  5IT9 E;  2WSE E;  3OYK A;  5IXF A;  1OPK A;  3RNJ A;  5GAN d;  1KQS P;  2P84 A;  1NPR A;  2E5Q A;  4FIB A;  2KYB A;  3E1S A;  2E10 A;  4X34 A;  3NTI A;  1OZ2 A;  4M77 E;  1JU5 C;  3JSC A;  1G83 A;  4OML A;  3JCM f;  1BIA A;  1OQK A;  4C0Z A;  4B6M A;  1BIB A;  3EG9 A;  2RHU A;  2AK5 A;  1BI2 A;  5LJ3 j;  3JB9 G;  2O9V A;  4C5I A;  3X26 B;  3QII A;  5KE2 A;  3JCM P;  2D6F A;  3OSV A;  5GAM j;  1D1C A;  4GY5 A;  1BCO A;  2K7A A;  5GAO q;  2ZPF B;  1QVG P;  2FL7 A;  2YT6 A;  3MEU A;  1UEB A;  3LGL A;  2XK0 A;  3RMS A;  1WXU A;  3C94 A;  1M30 A;  1NZ9 A;  4JZ3 A;  2RI3 A;  2R57 A;  2CSQ A;  4GLK A;  2X3W D;  1AWX A;  4JJC A;  8AT1 B;  1YHQ Q;  4HVW A;  1EIF A;  1ARK A;  4FYV B;  2O88 A;  1VQ4 A;  4C8Q A;  4F7U G;  2HMA A;  2E6N A;  4E7J A;  1M2V B;  3JB9 J;  1VQL A;  2RHX A;  1MMA A;  3EH2 A;  2QAS A;  2JS2 A;  1PD0 A;  1TU0 B;  4DEX A;  2JZ2 A;  4F04 B;  2J06 A;  4J8O A;  1V1C A;  2HQX A;  1PRM C;  1N8R C;  2LNH B;  1IGU A;  4A4F A;  1G2B A;  4GBQ A;  1I5L A;  3MHX A;  1WQW A;  1OUL A;  4PK4 A;  4XQ3 A;  1B34 B;  5GMK h;  3CCR Q;  5KYU A;  2MWO A;  2QDY B;  1VQP T;  2JM9 A;  4M7A C;  1NJI R;  2A36 A;  2LC4 A;  5LJ5 g;  2ZPB B;  2M02 A;  4HCC A;  1HXD A;  5LJ5 d;  1QP2 A;  1ZUY A;  3CPW S;  2RO0 A;  1X6G A;  2RA2 A;  3HFO A;  2E70 A;  4B9X A;  1ZA2 B;  3NTK A;  1Q86 R;  3DKM A;  1QWE A;  3E9F A;  4IIO A;  1TXQ A;  3M5A A;  3I9Q A;  4N4G A;  1KFZ A;  3LX7 A;  5GJW B;  2NUZ A;  2VXF A;  4KBM B;  2BUD A;  4C0G A;  1N9S A;  3M0P A;  1T3L A;  1Q82 U;  1OU8 A;  2J6O A;  2FVU A;  2XIC A;  3GNG A;  2AKL A;  1W2B S;  2LNV A;  2RJF A;  1EZZ B;  3G6E Q;  1XNI A;  4EMG A;  2KBT A;  1NBE B;  3SEM A;  3SWN A;  4AFQ C;  1JXO A;  2YLC A;  4A4K A;  3JV3 A;  2M0Y A;  3CCS Q;  5HY6 A;  1AHJ B;  3CME T;  2NUP A;  1X6B A;  1VYT A;  2M0O A;  1M2O A;  2KE9 A;  3H0F A;  1N8R R;  2HSP A;  1KC8 C;  4HA8 A;  4BY6 B;  4RCB A;  4J5Y A;  2I0N A;  3V7C A;  4DQ2 A;  3RES A;  2DEU A;  2FPE A;  2H8H A;  1NEB A;  1X75 C;  4J9H A;  3REA B;  2DIQ A;  1QKX A;  2CT4 A;  2VC8 A;  1AOJ A;  1JQQ A;  2EFI A;  4C8Q C;  2QTV A;  2EKO A;  3OYM A;  2O4X A;  2IG0 A;  3A8H B;  1YHQ T;  5GAN h;  3TQ7 P;  4F7U B;  5GMK e;  3PMI A;  4C92 G;  1PWT A;  4PJO F;  2DE0 X;  1ZBJ A;  2KRO A;  1HK9 A;  4CRI A;  3RKW A;  2EYX A;  1KD1 C;  5CQX A;  4RMO A;  4IUR A;  3VYG A;  2Z0W A;  4RG8 A;  3ER0 A;  3UA7 A;  2QQ9 A;  2LMJ A;  5L23 A;  2F69 A;  2RK2 A;  2ZAE A;  1SEM A;  2ZZD A;  4EMH A;  1A0N B;  1D3B B;  1LJO A;  5GAO r;  3CC4 Q;  3TVT A;  4JS5 A;  2PVO B;  1OU9 A;  2MF2 A;  3OYE A;  3QKJ A;  1YCY A;  2FYK A;  1BCM A;  5LJ3 g;  3CCR T;  1MMG A;  1KC8 R;  3V8K A;  4OP0 A;  1Q81 R;  1ZA1 B;  2KRM A;  5LJ3 d;  3QHS A;  5GAM g;  2D8J A;  4X1V A;  5GAN 2;  2CDT A;  2OJ2 A;  4MDX A;  5GAM d;  3QWY A;  1WHJ A;  4B9W A;  3QUI A;  1K9M U;  3UDC A;  2O9S A;  4R56 A;  1VQ6 A;  2XID A;  4M78 F;  1IRE B;  3HPW A;  2L0A A;  4WCI A;  2KYM A;  2K5L A;  3LH0 A;  3OW2 A;  4LXC A;  1YJN Q;  2XHC A;  3E2U A;  1OOT A;  4BI8 B;  3PNW C;  5HK3 A;  3E9G A;  2K2M A;  2GQI A;  2L3S A;  2QTX A;  4PJO B;  5DY9 A;  5IHN A;  2LQ8 A;  2RB6 A;  1KD1 R;  5GAN e;  1W4S A;  4E7L A;  3QJ6 A;  2K79 A;  2V8K A;  1GBQ A;  1WJQ A;  4Z8A A;  2AIR B;  5CKB A;  2LJ3 A;  3CCS T;  3QBY A;  4JRP A;  3FC3 A;  2A7Y A;  3H41 A;  1VQK Q;  4J9I A;  2CP5 A;  4E7Z A;  1Y0M A;  3JCM X;  1PD1 A;  4Y92 A;  4BY6 C;  5I11 A;  2HNI A;  2VKN A;  3CMA T;  3ZFJ A;  5LJ5 h;  1K73 C;  3CC2 Q;  3OY9 A;  4E7S A;  1ZSZ B;  4J7F A;  2CH4 W;  3MP8 A;  4HKE A;  1IHV A;  2ED0 A;  4C92 B;  3CCE Q;  1RAB B;  4C0D C;  4IKF A;  4XU2 A;  1LNX A;  3CCM Q;  1M3C A;  4J6Y A;  2DL7 A;  1OEB A;  1JEG A;  2CRE A;  2QA4 Q;  1WHL A;  2J05 A;  4BD3 A;  1FWZ A;  1U1S A;  5GAO l;  4X9D A;  2LT4 A;  3RR6 A;  2D0Q B;  2HBP A;  1D0X A;  4M75 A;  1SRL A;  1UFF A;  2FB7 A;  3BFM A;  5LL6 S;  3S6W A;  3CCU A;  3I55 A;  4M7D A;  3C4S A;  1O75 A;  3VS7 A;  1YI2 Q;  2DTH A;  4F16 A;  3P8H A;  4M78 D;  2EQM A;  1GCP A;  2ZPH B;  2DF6 A;  3OYF A;  2XDB A;  3CXC S;  1AWO A;  3CCL Q;  2JUF A;  3RKY A;  4M77 F;  5DM7 R;  3F70 A;  1RAH B;  4D6W A;  2EYQ A;  1N27 A;  4KUL A;  5DLQ E;  1QMC A;  2M51 A;  3SD4 A;  2WSF E;  5GMK m;  1S72 A;  3M4G A;  2ENM A;  3HKS A;  2HCK A;  3MET A;  1K1Z A;  3RIR A;  1VIF A;  2M9U A;  2EBP A;  2GGR A;  2VGN A;  1AEY A;  4LDV A;  5CKH A;  3HHT B;  4PFZ A;  4ELY C;  2KQW A;  4OF1 A;  2G6F X;  5GMK i;  4PLI A;  1U3O A;  1OYX A;  4BUG A;  1WHG A;  1JJ2 S;  3IQL A;  1MMD A;  1R77 A;  3VYH B;  1AZG B;  3CCV Q;  1WYX A;  4X9C A;  3U23 A;  1KJW A;  2LX7 A;  3JCM c;  4V2S A;  1GRI A;  1PKT A;  3EAE A;  4EMK B;  5GAN f;  1LOJ A;  3OYI A;  4J9F A;  1X2Q A;  3I56 T;  4IUQ A;  4NS5 A;  5LJ5 e;  2YWW A;  2CH4 A;  2LZ6 B;  1AWW A;  2RN8 A;  2HKQ B;  5KYY B;  4RTT A;  5FW9 A;  2R58 A;  1VQ8 T;  4FM4 B;  4ZTJ A;  3LLR A;  2GCX A;  1TSF A;  3UF4 A;  3X28 B;  2OTL A;  4II1 A;  3CCJ Q;  3CBO A;  3J81 E;  1M90 U;  2L8D A;  4M77 B;  2EJ9 A;  4M77 D;  2DRK A;  5FLX E;  2P0P A;  2FPF A;  1UHC A;  1UUE A;  3LW5 E;  2QQB A;  1X2K A;  1GFC A;  4QKU A; 
#chains in the Genus database with same CATH homology
 1AVZ C;  2EGA A;  2MIO A;  3PVL A;  1ZX6 A;  2BZX A;  1NLP C;  2GTJ A;  2J6K A;  2P4R A;  2CUB A;  2EQI A;  1TG0 A;  2ROL A;  2K7A A;  1M8M A;  1YCS B;  2YT6 A;  3UAT A;  1WXU A;  1X43 A;  2GBQ A;  1M30 A;  2LCS A;  1AZE A;  4JZ3 A;  1VA7 A;  3KFV A;  2L3P A;  3VS4 A;  1QWF A;  4J9E A;  2CSQ A;  2X3W D;  1AWX A;  4JJC A;  4HVW A;  1UDL A;  2LJ0 A;  1ARK A;  2GNC A;  3VS1 A;  3PVQ A;  3I35 A;  4AFU C;  1W6X A;  3A98 A;  2O88 A;  3NPF A;  2OI3 A;  4RTV A;  1X27 A;  2YUP A;  1W1F A;  4E6R A;  2DVJ A;  2DBM A;  1UGV A;  2KRN A;  5IH2 A;  5IHI A;  1J3T A;  2RQU A;  5FWC A;  1SHG A;  3TSZ A;  2JS2 A;  1K4U S;  1FMK A;  2GTO A;  2DRM A;  4DEX A;  1Y57 A;  2DYB A;  2J06 A;  2K9G A;  1V1C A;  3EG2 A;  1BK2 A;  4Z88 A;  1PRM C;  2LNH B;  1ZUU A;  3NGP A;  1G2B A;  4GBQ A;  2ED1 A;  1VYU A;  1TUC A;  1BB9 A;  2JXB A;  3QWX X;  2JM9 A;  2RQT A;  2RNA A;  1UEC A;  2A36 A;  1U06 A;  1I1J A;  1EFN A;  4HXJ A;  1YN8 A;  1ZUY A;  2CUD A;  4D8D A;  4OMN A;  2JMA A;  1X6G A;  3NHN A;  1UJ0 A;  2DNU A;  1QLY A;  1NG2 A;  4CC3 A;  1QWE A;  2V1R A;  1UHF A;  3VS2 A;  4IIO A;  3C0C A;  3I9Q A;  1SSH A;  1KFZ A;  5GJW B;  2NUZ A;  2B86 A;  1T0J A;  3VRZ A;  3M0P A;  1T3L A;  3ZL7 C;  2HDA A;  4LN2 A;  2J6O A;  2DM1 A;  4FSS A;  2AKL A;  4RTY A;  2YUO A;  2JM8 A;  1WI7 A;  2ECZ A;  4F17 A;  2PTK A;  3LH5 A;  2IIM A;  2KBT A;  3SEM A;  4AFQ C;  1JXO A;  2DA9 A;  1SRM A;  2VVK A;  2EYY A;  4ZNX A;  1K0X A;  3JV3 A;  2M0Y A;  1IO6 A;  1X6B A;  2HBW A;  1N5Z A;  3GBQ A;  1NLO C;  5HCK A;  4RTX A;  1VYT A;  3VS6 A;  2KT1 A;  4ESR A;  1PNJ A;  1JO8 A;  2EKH A;  2KE9 A;  3H0F A;  1YNZ A;  2HSP A;  3THK A;  2PNI A;  4J9B A;  2FG0 A;  2AZV A;  2I0N A;  4AG1 C;  2YDL A;  4EIK A;  2FPE A;  2H8H A;  1NEB A;  4J9H A;  3REA B;  1QKX A;  2CT4 A;  2W10 A;  3VS5 A;  2O31 A;  1AOJ A;  2F2X A;  1WXT A;  3TSW A;  1MUZ A;  1QCF A;  1JQQ A;  3RBB B;  4CC2 A;  2F2V A;  1NYF A;  4K11 A;  2L3Q A;  4HCK A;  2DL5 A;  1OPL A;  2O2O A;  2RQW A;  1RLP C;  4RUG A;  4J9C A;  4RTU A;  1PWT A;  4OMQ A;  2MCN A;  2DE0 X;  1M3B A;  1UE9 A;  1ZBJ A;  2KRO A;  4QT7 A;  2EPD A;  2FEI A;  2KR3 A;  1HJD A;  1I07 A;  4CC7 A;  1WA7 A;  2EYX A;  2HEQ A;  1H3H A;  2DL4 A;  1QKW A;  2C0O A;  3VS3 A;  2KXC A;  1YP5 A;  1K76 A;  2C0I A;  1K9A A;  3NMZ C;  2YUN A;  4HVV A;  1ZUK A;  2FRY A;  4HVU A;  3UA7 A;  1E7O A;  2LMJ A;  2RF0 A;  5IXB A;  5L23 A;  3M0R A;  4A63 B;  2JTE A;  1SEM A;  2DL8 A;  2RMO A;  1KIK A;  1A0N B;  1X69 A;  2LJ1 A;  1WLP B;  4AFS C;  1B07 A;  2LQW A;  3TVT A;  1S1N A;  4J9G A;  2KEA A;  4J9D A;  1T0H A;  1UG1 A;  2A08 A;  1OV3 A;  2AKK A;  1BBZ A;  2KRM A;  1ZSG A;  4AG2 C;  4DEY A;  1MV0 B;  4OMM A;  3EGU A;  2D8J A;  4X1V A;  2KRS A;  4ORZ A;  4RTZ A;  2CDT A;  2OJ2 A;  5I22 A;  2LQN A;  3QWY A;  1B3Q A;  4LE9 A;  2J6F A;  1K0S A;  2JMC A;  2VWF A;  2O9S A;  2JT4 A;  2MOX A;  1CSK A;  2L0A A;  2KYM A;  4WCI A;  5GJV B;  4D8K A;  1AWJ A;  1OOT A;  2SEM A;  3M0T A;  2K2M A;  2GQI A;  2L3S A;  4JPB W;  2F2W A;  1RUW A;  1FYN A;  5IHN A;  1MV3 A;  1WDX A;  3SHW A;  3VRY A;  1PHT A;  2BZY A;  1ABQ A;  2K79 A;  3I5S A;  4R0K A;  4LNP A;  1GBQ A;  2K6D A;  4Z8A A;  1NEG A;  2EW3 A;  2LJ3 A;  3VS0 A;  5EC7 A;  3I5R A;  2RPN A;  2DIL A;  3H41 A;  4J9I A;  1M3A A;  1Y0M A;  3O5Z A;  1WXB A;  2KT8 A;  1SPK A;  4Y92 A;  5I11 A;  2KXD A;  2KNB B;  2VKN A;  1UJY A;  2EGC A;  3PE0 A;  2YUQ A;  3FJ5 A;  2FPD A;  5IHK A;  2D8H A;  2BZ8 A;  2CH4 W;  2ED0 A;  2AZS A;  1RLQ C;  1Z9Z A;  1CKA A;  1GCQ C;  4JJB A;  1M3C A;  1PKS A;  1OEB A;  2DL7 A;  1JEG A;  2CRE A;  1NM7 A;  2J05 A;  1M27 C;  4OMO A;  1UTI A;  2PZ1 A;  4IIM A;  3REB B;  1SRL A;  1UFF A;  2SRC A;  1KSW A;  4KRT A;  1BU1 A;  1TUD A;  2JW4 A;  1GCQ A;  2EYZ A;  2DLP A;  3VS7 A;  2V1Q A;  1XOV A;  2DL3 A;  2KGT A;  4RTW A;  4F16 A;  2J7I A;  1GCP A;  1H8K A;  1SHF A;  2DF6 A;  2K3B A;  5ECA A;  1AWO A;  1U5S A;  4LUE A;  2C0T A;  2EVR A;  1E6H A;  4AFZ C;  1GL5 A;  2A37 A;  3EHR A;  2BTT A;  1H92 A;  1AD5 A;  1RI9 A;  2CSI A;  4F14 A;  2M51 A;  2NWM A;  1VYV A;  2ENM A;  2HCK A;  1K1Z A;  1WFW A;  2W0Z A;  3EG0 A;  2DMO A;  2EBP A;  2GGR A;  5FWB A;  4Z89 A;  2YSQ A;  2FO0 A;  1HSQ A;  4M4Z A;  3EG1 A;  1HD3 A;  2DJQ A;  1JXM A;  4LUD A;  1AEY A;  2ROT A;  2OAW A;  2L2P A;  2G6F X;  2LP5 A;  4OMP A;  1U3O A;  3IQL A;  2D1X A;  2ESW A;  2QDL A;  1AZG B;  3M0S A;  1WYX A;  3U23 A;  1KJW A;  1WIE A;  2ABL A;  2LX7 A;  3H0I A;  1LCK A;  1GRI A;  1PKT A;  3UA6 A;  1YWP A;  3H0H A;  2RQR A;  3EG3 A;  2CT3 A;  4J9F A;  1X2Q A;  2D0N A;  1GFD A;  1GBR A;  1NYG A;  2CH4 A;  2LZ6 B;  1T3S A;  1AWW A;  2EGE A;  2EYW A;  1ABO A;  2RN8 A;  2XMF A;  2DX1 A;  2E5K A;  4RTT A;  5FW9 A;  3CQT A;  4JZ4 A;  5IXF A;  1OPK A;  3RNJ A;  2JS0 A;  4JJD A;  1ZLM A;  2FRW A;  1Z9Q A;  2KYB A;  1YWO A;  3M0U A;  3UF4 A;  2DBK A;  1E6G A;  2A28 A;  1WX6 A;  1CKB A;  1PRL C;  1JU5 C;  3EHQ A;  3R6N A;  1G83 A;  4OML A;  2DRK A;  2X3X D;  2FPF A;  3M0Q A;  4GLM A;  1W70 A;  2AK5 A;  1UHC A;  1I0C A;  3ULR B;  1UUE A;  2RQV A;  1X2K A;  2O9V A;  4CC4 B;  1GFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...