2EGCA

Solution structure of the fifth sh3 domain from human kiaa0418 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
b'GSSGSSGNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 and PX domain-containing protein 2A
publication title Solution structure of the fifth SH3 domain from human KIAA0418 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egcA00
2CSQA 1UFFA 2RQWA 4GLMA 1ZUKA 2GTOA 2KGTA 4F14A 1AWXA 1YCSB 2FPFA 3H0HA 2KR3A 4F16A 1FYNA 1LCKA 1X6BA 4AG2C 2KRSA 3NMZC 3VRZA 3C0CA 2YUOA 2HBWA 1Z9ZA 2FPDA 1W70A 1NYGA 5IXFA 2LCSA 5IXBA 2O9SA 4J9GA 1MV0B 2W10A 2DL8A 2VWFA 3H41A 2EVRA 2J7IA 1WXTA 3NPFA 1NLOC 3SHWA 1RUWA 1AZEA 1IO6A 1JO8A 1QCFA 1UGVA 1OOTA 1UG1A 3VS3A 2KT8A 1WA7A 1WYXA 2KEAA 1QKXA 4JJDA 1AZGB 2RQUA 1T0JA 2EQIA 4K11A 2EGEA 4HVVA 2CREA 1SSHA 2DJQA 1V1CA 2M51A 1UHCA 2HDAA 3LH5A 1GL5A 2DILA 2JTEA 4RTXA 4D8DA 2BZ8A 1K76A 2D8HA 2DX1A 1CSKA 2GGRA 2LJ0A 1XOVA 2VKNA 1T3SA 1WXBA 2K6DA 1VYUA 2YUPA 1WX6A 1X6GA 2B86A 2ESWA 1M8MA 1X69A 1M3AA 1U5SA 2DM1A 2EYZA 1ABOA 2AZSA 3VS5A 1K0SA 2C0TA 1GBRA 2PTKA 2C0OA 2EYWA 2DYBA 4J9BA 2DE0X 1JU5C 1QWEA 1W6XA 2EYXA 2DL4A 2OI3A 1TUDA 2LQNA 4RUGA 2YUNA 3VS6A 5IHKA 3FJ5A 2HSPA 1WI7A 1KIKA 1PKTA 5IH2A 4HCKA 1YP5A 4J9IA 2D8JA 2HCKA 2LZ6B 2FPEA 2FG0A 5FW9A 1QKWA 4F17A 1FMKA 2AK5A 2EGAA 3EG1A 2KE9A 2EPDA 3QWXX 2GBQA 2FRWA 2H8HA 3VS0A 2GNCA 2L2PA 2KYBA 4OMQA 2PZ1A 2J05A 2MOXA 4D8KA 1B07A 1WIEA 1GCPA 1WDXA 2DRMA 4AFSC 3REBB 2J6KA 3M0RA 1QWFA 3REAB 1KSWA 2RQVA 4RTTA 5ECAA 4DEXA 3VS1A 3EG2A 4M4ZA 2KYMA 1U06A 2OJ2A 2CH4A 2ECZA 2MIOA 2V1RA 3NHNA 1T0HA 3I35A 4LN2A 2W0ZA 1RLPC 1ZSGA 2A36A 1TUCA 2D0NA 3ZL7C 1CKAA 5EC7A 1X2KA 3UA6A 1JXOA 1JXMA 2CT3A 1K9AA 3M0QA 1QLYA 2LQWA 4WCIA 3EG3A 2ENMA 2A08A 1GBQA 2DF6A 3THKA 3RNJA 4RTUA 4CC2A 3R6NA 3JV3A 3GBQA 2MCNA 2M0YA 1Y57A 1VYTA 1AD5A 1M3CA 3A98A 1X27A 1TG0A 4HXJA 1H3HA 4ZNXA 3M0TA 5GJWB 1ZX6A 1S1NA 1T3LA 2L3PA 1NG2A 2G6FX 1RI9A 2D1XA 2KT1A 2C0IA 3M0PA 1GRIA 2AZVA 3VS7A 4X1VA 3PVLA 1JQQA 2KXCA 4J9DA 3TSWA 2DL3A 2O88A 1HSQA 2JM9A 4CC4B 2DRKA 2LJ3A 1W1FA 2CUBA 2JMAA 1RLQC 4J9EA 3I5RA 2DBMA 3IQLA 1PHTA 3I9QA 1B3QA 2IIMA 2K3BA 1E7OA 3KFVA 1ABQA 3TVTA 1I07A 2LNHB 5L23A 5HCKA 3SEMA 2RF0A 2KNBB 1AOJA 4EIKA 4Z89A 4RTWA 2EGCA 2O31A 2A37A 1NEBA 2CT4A 1YN8A 2JM8A 2BTTA 2YDLA 2QDLA 2DNUA 4CC3A 4LUDA 4Z88A 1AWWA 2E5KA 4IIOA 2DVJA 1WLPB 1ZUYA 2ROLA 4JZ4A 2K79A 2K2MA 1YWOA 2EBPA 2RPNA 2YUQA 3CQTA 1WFWA 2RQRA 1MUZA 3VS2A 1BB9A 1YNZA 1E6GA 1VYVA 4ESRA 2RQTA 1SHFA 1J3TA 1I1JA 4JJBA 3H0FA 1GFCA 4OMNA 1UE9A 4RTYA 4AFZC 2CDTA 3M0UA 4JJCA 2K9GA 3QWYA 1PNJA 1G2BA 1UTIA 1M3BA 2ED1A 2GQIA 2JS0A 2LJ1A 2KBTA 2J06A 4IIMA 1AVZC 1Y0MA 2JMCA 3UATA 3EG0A 1NLPC 1HJDA 1GFDA 5FWBA 2CH4W 2J6FA 4LE9A 4ORZA 4J9FA 2BZYA 2L3QA 4OMOA 1AEYA 2F2VA 2RNAA 2L3SA 5FWCA 1UUEA 1SEMA 3EHRA 4J9HA 3NGPA 1X2QA 2J6OA 2VVKA 2RMOA 1SRMA 1UJ0A 4Z8AA 2P4RA 4HVUA 4LNPA 3RBBB 2NWMA 1SPKA 2DLPA 1SHGA 3TSZA 4HVWA 3H0IA 2L0AA 4GBQA 3O5ZA 5I11A 2GTJA 3U23A 2CSIA 2DMOA 2DA9A 1UJYA 1HD3A 1MV3A 4R0KA 1NYFA 4AFQC 2HEQA 2JS2A 3EHQA 2BZXA 4RTZA 1E6HA 1ZBJA 1JEGA 2JW4A 3VS4A 2KROA 1WXUA 1H92A 2JXBA 4LUEA 1K1ZA 1KJWA 1GCQA 2AKLA 1BU1A 2XMFA 3PE0A 4A63B 1UDLA 2ROTA 4J9CA 1U3OA 1EFNA 3M0SA 2FRYA 2DL5A 2KRNA 2F2WA 4DEYA 4AFUC 1H8KA 5GJVB 1AWOA 1G83A 1AWJA 1PRMC 4OMMA 1X43A 2PNIA 2FO0A 1VA7A 2X3WD 4QT7A 2NUZA 1NEGA 1BBZA 4RTVA 1BK2A 2I0NA 1GCQC 2DL7A 3ULRB 1PKSA 1Z9QA 2AKKA 5I22A 1M30A 1PWTA 2F2XA 2O9VA 2ABLA 2ED0A 4FSSA 1YWPA 2KRMA 1UECA 2RN8A 2X3XD 4Y92A 2EKHA 1A0NB 1OPLA 4CC7A 1M27C 2YT6A 2LX7A 2FEIA 4OMLA 2DBKA 2KXDA 2CUDA 4KRTA 1OEBA 3UA7A 4E6RA 2EYYA 3VRYA 1KFZA 2SRCA 1N5ZA 2YSQA 1ARKA 2O2OA 2SEMA 4OMPA 2OAWA 1OPKA 5IHNA 3UF4A 2V1QA 1I0CA 3EGUA 1NM7A 2JT4A 3I5SA 2A28A 1ZUUA 2LMJA 1SRLA 2EW3A 5IHIA 2LP5A 1K0XA 1ZLMA 1UHFA 4AG1C 4JZ3A 4JPBW 1K4US 1CKBA 3PVQA 2K7AA 1PRLC 1OV3A
chains in the Genus database with same CATH superfamily
2CSQA 4M7AC 4GLMA 2FB7A 2KGTA 3P8BB 2FPFA 2KR3A 1FYNA 3RUXA 4B9XA 2VXEA 3NMZC 4QW2A 3C0CA 3LYIA 2HBWA 1IREB 1VQ8Q 4C92F 3G4SA 4R56A 3M4YA 2X35A 3C95A 5IXFA 1TTHB 1K73R 2CKKA 5IXBA 4J9GA 1MMNA 4C92A 2OAUA 5GMKe 4LD6A 3CCEQ 1IZ6A 2P84A 2VWFA 2J7IA 1HYOA 1D1CA 2CP2A 4KGVB 1BIBA 2HQEA 3JCMd 3CCVA 5CKHA 1UGVA 3CCRQ 2DVEA 2DXBA 5GAOm 4ME7A 1Q82R 4DBHA 2D0QB 1N9RA 4JJDA 3PMIA 3CC7T 2CZ0B 1FMVA 4M75G 4KUDK 3UPUA 1MGQA 3EFOA 3C94A 2DJQA 1KHCA 1IRXA 3G4SQ 4JLIA 2DILA 2JTEA 4RTXA 2E41A 4C92B 5GAN3 1QVFA 3OW2S 3DKMA 3MHXA 2LJ0A 5FLXE 5GANh 1XOVA 1YBYA 2VKNA 4LDWA 1I8FA 2K6DA 1U1SA 3QDRB 2ESWA 3L2UA 3CCVQ 3FC3A 2VGMA 3E9GA 1M3AA 5HKCA 1QCOA 2EYZA 2GFUA 2ZPFB 2HZYA 2K3XA 3VS5A 3CC7A 3X26B 2HMAA 5KYWB 2C0OA 5GAMe 3CXCS 2DE0X 2QAZA 5I2MA 1D0XA 2JZ2A 4B6MA 2LQNA 3VS6A 4RCCA 1WI7A 5FU6C 5L8RE 2XICA 3CD6T 1SKUB 2HCKA 3MP1A 3AHUA 1TOVA 1QKWA 4C0DB 3INZA 1FMKA 3H9NA 1YHQT 3VUBA 5IN1A 2H8HA 3VS0A 2GNCA 4A4GA 2KYBA 3DB3A 1B07A 3CC7Q 1GCPA 2YRDA 2V8KA 1X6OA 5KE2A 2J6KA 1QWFA 3REAB 2RQVA 3CMET 5ECAA 4FM4B 3EG2A 3CD6A 2KYMA 2MIOA 2V1RA 2ZZDA 4LN2A 2LCLA 4M7AD 2A36A 1OU9A 3OS1A 3OYNA 1TUCA 2D0NA 1YHQA 5EC7A 5FU7C 2DPPB 1JXMA 5FRMA 2B8AA 5CCAA 2LQWA 4WCIA 3EG3A 1N27A 1GBQA 2MI6A 3THKA 4RTUA 5CKBA 2AIRB 2EJGA 2MCNA 1Y57A 3L2RA 1WJRA 3CMEA 1TG0A 4HXJA 5GAOl 2HNIA 3V7CA 1YI2A 2DIQA 2L3PA 1Q95G 3WVDB 2RB6A 2KXCA 2RHUA 3TSWA 2O88A 1YHQQ 1W1FA 2CUBA 3UWNA 2JVVA 3RERA 2IIMA 1E7OA 4XAXB 1ABQA 1NJIU 3QBYA 4C8QG 3META 3TU4K 5HCKA 1BI0A 4BY6C 5GMKl 1KQSS 2DD5A 1Q81R 3A8LB 3CMEQ 3CBPA 4QQ6A 5GAN5 3QJYA 4FT4A 4RTWA 4O6JA 4PJNA 2CT4A 3SWNC 1C6VX 3X28B 1YI2Q 3FEOA 1JJ2S 1AWWA 1WPYA 2RJFA 1VQ7T 1VQMT 3MEAA 2RPNA 4AMCA 1BB9A 4F7UG 1YNZA 3CXCP 4C8QF 1VYVA 4ESRA 2LT4A 4C5GA 2MAMA 3H0FA 1GFCA 4OMNA 1VQ5T 2RI3A 1OU8A 4C8QA 1VQ9T 2KAFA 3QWYA 5LJ5f 2HD0A 3VYGA 2E64A 2GQVA 3EG0A 3URGA 2DXUA 4L59A 5GAOq 1VQOA 5M9OA 2F5KA 2CH4W 3OS0A 4LE9A 3OB9A 1VQKT 2L3QA 4OMOA 1ZSZC 1AEYA 1MHNA 3QHSA 5KYXA 4F7UF 4B9WA 1M1FA 3NGPA 1VQ5A 3JRZA 2VB6A 2BE9B 4LDYA 4C8QB 4M7DE 2RMOA 4ZN3A 1SRMA 4F7UA 4N4HA 3JB9F 3G1JA 1PC0A 4LNPA 2NWMA 1SPKA 4FYXB 2BKDN 2DLPA 1SHGA 3ME9A 3EGDB 1Q81C 3TSZA 3O5ZA 5I11A 1BI3A 4XU0A 4XTUA 1GXIE 2DMOA 3OYKA 1UJYA 1HD3A 1VQOQ 4R0KA 1WHHA 4AFQC 2V8JA 3EHQA 4LD9K 3QPHA 3ZBDA 3GPLA 1ZQ1A 1QP3A 3OBYA 4CI0C 3CBMA 1VQ5Q 3PNWC 4F7UB 2L3RA 4KBMB 2HKQB 3QJ6A 5GAOr 1WGSA 1B7TA 5J39A 2DL5A 5CK9A 1Q86U 1RL2A 2LTOA 4C92C 5GJVB 1NZ9A 3DLMA 1UGRB 1WQ7A 3QYHB 3CBOA 2G3RA 5LJ5e 2PUOB 2JOYA 2PNIA 3JCMh 5GAOn 1NEGA 3J7AF 1BBZA 2O01E 2QGFB 1KQSP 4M7DA 4RTVA 2MPXC 1BK2A 2CZ7B 2I0NA 2XI9A 4QVDA 4NOYA 1C1AA 2F2XA 2QQSA 1LPLA 2KRMA 2RN8A 2X3XD 1M1KR 3NTIA 1A0NB 1MMDA 2EWNA 4RCBA 1M27C 1N8RU 2M0OA 2LX7A 1PCXA 2EQUA 3M4GA 1KC8U 2YLCA 3L42A 2RHYA 3G71T 2RJDA 4KH0B 4E6RA 3JCMX 2EYYA 2QQAA 5KYYA 1I4K1 1IGUA 2HSEB 4C0DC 3OYBA 2H3JA 4M78E 1TU0B 2OX7A 4OMPA 3V7RA 2PUKB 2JUFA 4A4EA 2P0KA 4ANJA 1D0ZA 3OYMA 1NM7A 2YRVA 4A4KA 3J81E 3OYYA 1KD1R 2LP5A 3C4SA 4JPBW 4PJOE 4UC4A 4XTVA 3PVQA 3G71A 2K7AA 2DEQA 2ATCB 2E5QA 1PRLC 1Q7YR 1OV3A 5KYYB 2JJ9A 1AWXA 3H0HA 2CYZB 4EMGA 1M2VA 2KRSA 4RMOA 3TREA 2YUOA 1Z9ZA 1W70A 3OA6A 1TXQA 3CCUA 2LCSA 3CMAT 2DL8A 4XTYA 4QQDA 5EG2A 1K9MU 1QVGA 2EVRA 1PD1A 3NPFA 2X4XA 5CKEA 5LJ3g 4M78F 1VQPT 1AZEA 3G71Q 1JO8A 3FDRA 1FXXA 2IVWA 3HSBA 1RAAB 1UG1A 4M78A 5GAN7 3NTKA 4XK8E 4XU1A 2RQUA 2EQMA 8ATCB 4PFZA 2D9TA 2QTXA 4EDUA 2CREA 1V76A 1V1CA 2M51A 4PJOF 3PTAA 3CMAA 2P0QA 2GCXA 3HFNA 3GIBA 4C92D 3CCUQ 1K8AU 4IKFA 4PJOA 2D8HA 1CSKA 4DQ2A 2GGRA 4IUQA 2XD0A 2E6NA 4MDXA 1VQPA 3JSCA 1T3SA 4M77G 1VQ8T 2E6ZA 1VYUA 1KD1C 1MNEA 3M53A 4IURA 4J5YA 4M78B 3LGLA 2EQJA 1U5SA 2DM1A 4FW2A 1ABOA 1I5LA 3CCET 1UEBA 2C0TA 4L5GA 1RADB 3VKIA 2Y4XA 4LDUA 1JU5C 3RKXA 1W6XA 2OI3A 1TUDA 2ZGWA 2YXYA 8AT1B 4OB0B 5IHKA 4JDSA 3FJ5A 2HSPA 3CCRT 1KIKA 3CMAQ 3D7SB 4PJOB 1PKTA 4EMKA 3SDZA 5IH2A 4HCKA 1M1GA 1K73U 4KH1B 4J9IA 5GANf 1VQ8A 1WQWA 1D1BA 4X34A 1M4ZA 1RABB 4NS5A 4C5HA 1VQPQ 2AK5A 2MWOA 4E7LA 1WHGA 2RO0A 2K5FA 2BUDA 3I55T 4MMKA 4RG2A 1BI1A 3LGFA 3HKSA 2MOXA 2PVOB 4D8KA 4DBRA 1WIEA 4FSXA 1Q82U 4AFSC 3GLXA 4BI4A 3REBB 3M0RA 1YIJT 3ASKA 5I21A 1UB4A 2COWA 3CCVT 3CCSA 3CPFA 4EMKB 2CH4A 2ECZA 3I35A 1SSFA 2W0ZA 3A8GB 1FMWA 1VQNA 1VQ6T 3FJPA 1CKAA 2H3EB 3I55A 5CR2A 3UA6A 2L89A 1K9AA 3M0QA 1QLYA 3L2WA 2K4YA 4P5NA 2CP3A 3RMQA 3PIPA 2ENMA 2A08A 3RNJA 1U1TA 1BI2A 2DJZA 3R6NA 4OB2B 1G3SA 2HQHA 1YIJA 3OW2A 1OZ2A 3M58A 3M0TA 3FRNA 4WTOB 2QXFA 3CCSQ 2G6FX 5GMKh 3M0PA 1R8OB 2AZVA 3VS7A 1VQ6A 5KYWA 3PVLA 4L6V5 4J9DA 1VQ4A 3CC4T 5LJ5d 3G6ET 1VQNQ 2DRKA 2LJ3A 2HAXA 5LJ3d 3I55Q 3LLRA 1RLQC 1NE8A 3A8MB 3I5RA 2GF7A 3CXCA 1PHTA 3TVTA 1I07A 5GANe 4J6WA 1PD0A 3OSVA 1AOJA 4A4HA 5GMKm 2JTFA 2V8IA 2XHCA 1YIJQ 2QA4A 3GP8A 3P8DA 1NEBA 3HL8A 1YN8A 2ZAEA 3OYAA 2BTTA 2VGNA 3CC4A 2DNUA 2MWPA 4M75F 3G6EA 1VQ6Q 2ZPBB 2DD4A 3GOXA 3M9QA 2FZCB 1LNXA 2DVJA 1VQ4Q 1AT1B 4M75A 1ZUYA 3M54A 2ROLA 2K79A 2K2MA 1YWOA 2YUQA 3CQTA 4KUIA 2WSFE 2E3HA 1MUZA 3CC2T 2X51A 4HCZA 4ZTFA 3MO8A 4JJBA 1UE9A 4RTYA 2K9GA 1PNJA 5CKDA 4M7DC 2QA4Q 1UTIA 2LJ1A 2J06A 4N4GA 3HFOA 2LDMA 1Y0MA 2JMCA 3MJXA 4J7IA 3CC4Q 1NLPC 1HJDA 3G6EQ 5FWBA 1IXDA 4M75B 1YCYA 2J6FA 1EIFA 4ORZA 1V29B 3EGXA 3LWHA 3CC2A 4N0AA 1YI2T 4X9DA 2HL5C 5FWCA 4J9HA 2XIDA 2VVKA 5A2QE 2DEUA 1UJ0A 2P4RA 3RBBB 4JRQA 2XU8A 2A0FB 1O75A 4HVWA 3A5ZB 2E10A 4GBQA 7AT1B 2GTJA 1B34A 5KCOA 1FX7A 2DO3A 5D7UA 2DA9A 2BIVA 3EGXB 3C12A 5A0DA 4C8QE 2HEQA 2JS2A 2QQBA 1E6HA 3CC2Q 2JW4A 1DJ7B 1WXUA 2JXBA 4E2FB 1W4SA 1MMGA 3H8ZA 5GAOp 2COYA 2QK0A 3KUFA 4LUEA 5GAMg 1PM3A 3L2ZA 1JJ2A 1K1ZA 1GCQA 1BU1A 4KGZB 2YWWA 4A63B 2D6FA 2ROTA 3JB9D 1XNIA 4YTLA 4J7FA 4BE1A 3M0SA 2FRYA 1B34B 2KRNA 1D09B 2K5LA 1G3WA 2P0PA 2KSSA 3M55A 1G3YA 2E65A 4M7AG 2EKOA 3P8HA 4NL2A 1X43A 3OYHA 4F7UE 3OBWA 4BACA 2XG8D 2FO0A 2DK3A 2XDPA 2OTJT 2NUZA 3QG1A 3CCJT 3L1AA 4M78C 1OI1A 1Z9QA 5I22A 1RAIB 1VQOT 1M30A 1PWTA 3EFRA 3RR6A 5LJ3j 4F04B 1OX9A 2NUPB 1BCOA 1G3TA 2FEIA 4OMLA 4PLLA 2KXDA 4DOVA 4PJOC 4KRTA 1PG5B 2E12A 4QVZA 4TVRA 3UA7A 2OTJA 1KFZA 3JCMf 5KCHA 3OYCA 5KYUB 2RK2A 2YSQA 3LX7A 3CCJA 3FB9A 3EGDA 4M7DD 3EH2A 1QVFP 1M90R 1W2BA 1JB0E 3UF4A 1YFNA 3RKYA 4ZN1A 1I0CA 1XJWB 3M5AA 1R0BG 1ZA2B 1ZLMA 4AG1C 1YITT 1KG1A 4PFOA 4EMKC 2RQWA 3ZFJA 2GTOA 3M59A 1YCSB 5CVIA 2FZKB 3HTRA 3X25B 2OTJQ 1LCKA 4AG2C 4OVAA 4M7AB 3QYGB 1Y71A 3QO3A 3I56Q 3CCJQ 4C5IA 2FPDA 2LNVA 4PJJA 1N6AA 2X4YA 2EQKA 2AT1B 2W10A 1YITA 2ZPEB 3OY9A 2BE7D 2RH2A 2RHZA 1M1KU 4XU3A 2NYSA 2ZCFB 1WHKA 1RUWA 3L2VA 5C0MA 4A54A 1M5Q1 4KT0E 4HT8A 3OMGA 5GANd 3VS3A 1VQLA 1P92A 2KT8A 2KEAA 2CP6A 3V8KA 1OX8A 1AZGB 3GNFB 3GF5A 1T0JA 2EQIA 1Y07A 1SSHA 2EFIA 3JCMJ 3LH5A 3OYGA 1GL5A 5IAYA 4D8DA 2BZ8A 5GAMd 4RG8A 3JCMe 1K76A 1M90C 3MEUA 4C5EA 4MZMA 1Y7XA 3ZEHA 1YITQ 1XQHA 2LVMA 3BDUA 2RHIA 1NJIC 4DOWA 3CPWA 2YUPA 2M16A 3BDLA 1EZZB 1M8MA 1X69A 4M78D 3OYLA 1Q7YU 2A3LA 3EH1A 5LJ3h 1VQLQ 1FWZA 2EYWA 1LJOA 1N9SA 2QEXT 4J9BA 1QWEA 2EYXA 3KBGA 4RUGA 1RAHB 1LOJA 4PJOD 1YP5A 2YLBA 1HK9A 2QASA 2LZ6B 2FG0A 5FW9A 4AT1B 5CAIA 4JRKA 1I5OB 3QWXX 1IHVA 3CCUT 2L2PA 5C6SA 2QEXA 1Q86R 4HKEA 1WDXA 4M75C 4RKUE 2FHDA 1F1BB 4BDYA 3OS5A 4RTTA 3ER0A 2WSEE 1BCMA 3RDVA 1U06A 5CQYA 3NHNA 1T0HA 1ZSGA 3OMCA 3X20B 5AT1B 3JAME 2YHTA 3X24B 3QUIA 5DY9A 2CT3A 5LL6S 2CP5A 5GAN6 1RAEB 5FU7B 4MDWA 2DF6A 1YJWQ 5GAN4 3E19A 4JS5A 3GBQA 2QQ9A 2M0YA 5LJ5g 2QEXQ 3A98A 5GAN8 2MF2A 1H3HA 4LXCA 1O9SA 4N0AC 1RI0A 5GJWB 4BD3A 3JCMP 1RACB 1S1NA 2V26A 4Y28E 5GMKj 1OZ3A 1T3LA 1NG2A 5HK3A 2JNGA 2KT1A 4M77E 4GLKA 4X1VA 3QZ9B 1JQQA 3V8LA 1OQKA 2DL3A 1HSQA 2RK1A 2JM9A 5J3BA 4FCYA 2JMAA 4J9EA 4FIBA 2EYQA 2QQRA 3IQLA 3TCJA 3I9QA 1MNDA 4PK4A 1D3BA 4QQGA 5L23A 5A0LA 3SEMA 1QMCA 2KNBB 2WSCE 2K3YA 4EIKA 3VUZA 4Z89A 3CCMQ 2DZ9A 2O4XA 1Q86C 4MZPA 1KQ2A 2EGCA 2O31A 4DBFA 1Y96B 2CP7A 2F69A 5CO7A 3SD4A 1EX4A 4ZTJA 2QDLA 4LUDA 4J83A 1KQ1A 2M9UA 1TH7A 2OTLT 1WLPB 4PLIA 2HQXA 1LVKA 4IUTA 2EBPA 2JTMA 1D3BB 3CCST 2YRCA 1WFWA 3E1SA 5GAMj 3OYFA 4M77F 2F5TX 1VQNT 4AFZC 2RI5A 2CP0A 4JJCA 1TUGB 2O4XB 3M0UA 1N8RC 4HCCA 4PJMA 3V7SA 4J6YA 1S72Q 4M77A 1M3BA 2ED1A 2JS0A 4Y91A 4PKCC 5DLOA 3UATA 3PFSA 2OTLA 1QP2A 3R6OA 1GFDA 4C92G 4XTZA 4GY5A 1ACMB 1K8AR 2BZYA 2RJCA 4HCBA 2F2VA 2L3SA 4C8QC 1I81A 1SEMA 2PU9B 3OYDA 1SG5A 1VQ4T 1OYXA 1VIEA 3FLGA 3GNGA 4M77B 4Z8AA 2E3IA 4E7ZA 3E9FA 4HVUA 4M75E 2PQWA 1WJSA 3A1PA 2A7YA 2OTLQ 2RI2A 2X4JA 4Z02A 2QA4T 2Y90A 1NPRA 4E7IA 1IGQA 4V2SA 2BZXA 2VXFA 2Y4YA 3RESA 1QCNA 2KROA 3WXMB 1G5VA 1IHWA 1H92A 2QGGA 1K9MC 3M56A 4DBQA 5KYNA 2RA2A 2RM4A 4BE0A 1U8RA 2AKLA 2XMFA 5KE3A 3PE0A 1UDLA 4J9CA 4Q5WA 4BB7A 2E4HA 4AFUC 1H8KA 4E47A 1PRMC 2KMTA 4OMMA 2RD1A 3AT1B 1VA7A 2X3WD 1QQJA 3VJPA 5FROA 1K8AC 4OMFB 4BUGA 1PKSA 1QVGP 2XKOC 1D1AA 2EJFA 4EPCA 2LQKA 2KY9A 3JCMc 2O9VA 4FSSA 1YWPA 1VIFA 2IPOB 2EKHA 2FZGB 1MMAA 1OPLA 4CC7A 3EFOB 2YT6A 5GAMh 1QVFS 2JN0A 1OEBA 1H641 3DB4A 4JRIA 3HRTA 1AHJB 2O2OA 5D6WA 3FIFA 1OPKA 5IHNA 1K73C 3LH0A 2V1QA 2MMPA 4IUPA 3JCMV 3EGUA 2JT4A 4BI3A 2A28A 3DLLA 1ZUUA 4JLGA 2P4TA 2LMJA 1SRLA 1X75C 5IHIA 1K0XA 2DAQA 4PFPA 3MEVA 1K4US 1CKBA 4OB3B 1NPPA 4ATOA 3QDFA 4C8QD 2KI7A 3CCQT 1Q82C 1Q81U 1UFFA 4ELYC 4C0FA 1ZUKA 4F14A 3LWIA 4OP0A 4F16A 3JB9I 1X6BA 5IT9E 3MP8A 3T9NA 3UT1A 3VRZA 4IUUA 4HT9A 1WJQA 2R57A 4O5VA 5GMKi 2L5QA 1NYGA 5GANg 2DTOA 2DTHA 4J8OA 4C0GA 1KQSA 2O9SA 1MV0B 3BY7A 2CZ1B 2PVGB 3UDCA 2F1LA 3H41A 1WXTA 1NLOC 3WVEB 3CCQA 3SHWA 4M7AE 2DZCA 1IO6A 1QCFA 1OOTA 2DTIA 1WA7A 3CD6Q 1VUBA 1WYXA 3SB2A 1QKXA 4MMLA 4ELZC 1D0YA 2NUPA 4K11A 2EGEA 4HVVA 1UGPB 5CKFA 1M90U 1UHCA 2HDAA 4OF1A 2QI2A 3RIRA 5KYUA 2DX1A 4MZTA 5AYFA 3I56T 3L2QA 5FRNA 3OYIA 1WXBA 4FL6A 1RAFB 3CCQQ 2X4WA 5CQXA 1WX6A 4A53A 1X6GA 4QVCA 2B86A 4E7SA 5LJ5j 2DYIA 3OW2P 2AZSA 2DFUA 1K0SA 1GBRA 2PTKA 4NL3A 2DYBA 2ZPHB 4FYWB 3SFMA 2DL4A 2R5MA 3HRUA 2YUNA 4BE2A 3JCMb 4M7AF 3E2UA 3I56A 2D8JA 2HBPA 4M7AA 4A4FA 2FPEA 2LC4A 2DXCA 3OS2A 4F17A 2EGAA 3EG1A 2KE9A 3HPWA 5D6XA 1HXDA 2EPDA 3JB9G 2GBQA 2VASA 3PIOA 2FRWA 1NJIR 4OMQA 2PZ1A 2ZPIB 5LJ3f 2J05A 4ZGDB 4R55A 4FYVB 3VU3C 2VYTA 2DRMA 3A8HB 1TSFA 1KSWA 1VQ7A 1VQMA 4DEXA 3MP6A 3VS1A 4E7KA 4M4ZA 2OJ2A 1WNLA 4FW1A 1RLPC 1VQLT 3OYJA 2VV5A 3ZL7C 4M77C 1VOMA 1VQ9A 1X2KA 1JXOA 4WF2A 4LDVA 3QIIA 1BIAA 1W2BS 2VC8A 2K5IA 3QKJA 4KGXB 5J26A 1ZHIA 4CC2A 3JV3A 1VYTA 2KDSA 1AD5A 1M3CA 1X27A 4JS4A 1VQKA 4ZNXA 1NBEB 3JCMQ 4CRIA 1ZX6A 1VQ7Q 1VQMQ 3EG9A 4JRPA 1UGQB 4M7DG 1BYMA 2K2VA 3EFSA 4HA8A 1WZOA 5KYXB 1RI9A 2D1XA 2C0IA 4KULA 1GRIA 3KXTA 4DA4A 1G8XA 4EMHA 3RMSA 4PL6A 3J80E 4FYYB 2QYZA 4CC4B 2HL3A 3N5BB 1C0MA 1VQ9Q 2LCCA 1TS9A 2DBMA 3PGGA 2AHJB 3CEYA 1B3QA 2K3BA 3KFVA 1KD1U 2LNHB 5A0GA 1PSEA 3G7ZA 4LDXA 2RF0A 2M1HA 3A8OB 4PNOA 4XTXA 3EG9B 3VV0A 1VQKQ 4XU2A 2XK0A 2A37A 4M7DF 5LJ5h 6AT1B 3OSSC 2JM8A 5LJ3e 1YJWT 1PSFA 2YDLA 4CC3A 1ZBXA 2NLUA 4Z88A 4J6XA 1R0CB 2L8DA 2RJEA 2HKNA 2E5KA 4IIOA 3VYHB 3PT9A 3JB9J 4FU6A 3HP9A 1R77A 2DXTA 2I2LA 3NTHA 1RAGB 3OQ5A 3MKDA 4JZ4A 2LRQA 4IUVA 1KK7A 2RQRA 3VS2A 1JJ2P 1JRIA 1E6GA 2LT1A 5FU6B 2RQTA 1SHFA 2CGHA 1J3TA 3NFCA 1I1JA 1TWBA 2CDTA 5CIUA 3H6ZA 2Z0WA 1BKBA 3TQ7P 1G2BA 2QG9B 1YJWA 4ZGEB 2GQIA 4IIMA 2KBTA 2WACA 3Q1JA 3CPWS 1AVZC 4M7DB 1M2OA 2XDBA 1UGSB 4BDZA 2X9HA 1X01A 2PVDB 3CCMT 2FVUA 1H3ZA 2FYKA 4J9FA 2VUBA 3TEEA 2XDDA 3S3NA 1JBMA 4PJLA 5DLQE 2RNAA 2CZ6B 2E70A 1IB8A 3S6WA 4D6WA 1YJNT 1UUEA 3EHRA 1X2QA 2DETA 4M78G 2J6OA 1OULA 2DKGA 3LW5E 4M77D 4JJNK 1N8RR 4VUBA 2M02A 3S3OA 3H0IA 2K57A 2L0AA 2LX9A 1KC8R 3JCMg 3CCLT 1WHLA 3U23A 2CSIA 3CCMA 2CS7A 4PJOG 1QVPA 3BFMA 5DM7R 1MV3A 5GAN2 1S72T 3OYEA 1NYFA 1W2BP 2KVQG 4OGEA 1YJNA 1Y96A 3BW1A 4OGCA 4RTZA 1YJ9T 5D6YA 1ZBJA 1JEGA 3JB9H 1M9SA 3VS4A 1ZA1B 3SWNA 3MEWA 4ZGJB 4E7JA 1WHMA 3M57A 1M1KC 1KJWA 2GFAA 2QTVA 1M2VB 2R5AA 3RKWA 4OB1B 2RHXA 4N4IA 1U3OA 3CCLA 4X9CA 1EFNA 1SF9A 4FT2A 2ZPGB 2E1HA 2F2WA 4DEYA 5I2SA 1S72A 3MPUB 1M8VA 1QVGS 3MCAB 1AWOA 1G83A 4BY6B 1AWJA 1YJ9A 1XTDA 9ATCB 5HK0A 3V8JA 4QT7A 3QSUA 4QKUA 5GANj 1YJNQ 2EJ9A 3SWNB 1GCQC 3HHTB 2NUTA 2DL7A 3ULRB 4XQ3A 2AKKA 1WHJA 1K9MR 4XTWA 3S3MA 2MK5A 2ABLA 2ED0A 5HY6A 1UECA 4Y92A 4BI8B 2KQWA 4C92E 1Q7YC 3CCLQ 1ZSZA 3EAEA 2COZA 2DBKA 3BE3A 2IG0A 1KHIA 2CUDA 4II1A 2QDYB 2R58A 1QW1A 3O8VA 3VRYA 2EIFA 2SRCA 1N5ZA 1KC8C 1YJ9Q 1ARKA 3JCMW 4E7HA 2SEMA 2NUTB 2OAWA 5KH6A 2DIGA 2EAYA 3F70A 4C0ZA 4M75D 2MYSA 3HRSA 3I5SA 3G4ST 4JUVA 3CCEA 2C06A 2EW3A 3CPWP 2FL7A 2LQ8A 3PMTA 2KK4A 2DERA 3QZ5B 1UHFA 1ZSZB 3QXEB 5GAMf 4JZ3A 3CCRA
chains in the Genus database with same CATH topology
2CSQA 1UFFA 2RQWA 4GLMA 1ZUKA 2GTOA 2KGTA 4F14A 1AWXA 1YCSB 2FPFA 3H0HA 2KR3A 4F16A 1FYNA 1LCKA 1X6BA 4AG2C 2KRSA 3NMZC 3VRZA 3C0CA 2YUOA 2HBWA 1Z9ZA 2FPDA 1W70A 1NYGA 5IXFA 2LCSA 5IXBA 2O9SA 4J9GA 1MV0B 2W10A 2DL8A 2VWFA 3H41A 2EVRA 2J7IA 1WXTA 3NPFA 1NLOC 3SHWA 1RUWA 1AZEA 1IO6A 1JO8A 1QCFA 1UGVA 1OOTA 1UG1A 3VS3A 2KT8A 1WA7A 1WYXA 2KEAA 1QKXA 4JJDA 1AZGB 2RQUA 1T0JA 2EQIA 4K11A 2EGEA 4HVVA 2CREA 1SSHA 2DJQA 1V1CA 2M51A 1UHCA 2HDAA 3LH5A 1GL5A 2DILA 2JTEA 4RTXA 4D8DA 2BZ8A 1K76A 2D8HA 2DX1A 1CSKA 2GGRA 2LJ0A 1XOVA 2VKNA 1T3SA 1WXBA 2K6DA 1VYUA 2YUPA 1WX6A 1X6GA 2B86A 2ESWA 1M8MA 1X69A 1M3AA 1U5SA 2DM1A 2EYZA 1ABOA 2AZSA 3VS5A 1K0SA 2C0TA 1GBRA 2PTKA 2C0OA 2EYWA 2DYBA 4J9BA 2DE0X 1JU5C 1QWEA 1W6XA 2EYXA 2DL4A 2OI3A 1TUDA 2LQNA 4RUGA 2YUNA 3VS6A 5IHKA 3FJ5A 2HSPA 1WI7A 1KIKA 1PKTA 5IH2A 4HCKA 1YP5A 4J9IA 2D8JA 2HCKA 2LZ6B 2FPEA 2FG0A 5FW9A 1QKWA 4F17A 1FMKA 2AK5A 2EGAA 3EG1A 2KE9A 2EPDA 3QWXX 2GBQA 2FRWA 2H8HA 3VS0A 2GNCA 2L2PA 2KYBA 4OMQA 2PZ1A 2J05A 2MOXA 4D8KA 1B07A 1WIEA 1GCPA 1WDXA 2DRMA 4AFSC 3REBB 2J6KA 3M0RA 1QWFA 3REAB 1KSWA 2RQVA 4RTTA 5ECAA 4DEXA 3VS1A 3EG2A 4M4ZA 2KYMA 1U06A 2OJ2A 2CH4A 2ECZA 2MIOA 2V1RA 3NHNA 1T0HA 3I35A 4LN2A 2W0ZA 1RLPC 1ZSGA 2A36A 1TUCA 2D0NA 3ZL7C 1CKAA 5EC7A 1X2KA 3UA6A 1JXOA 1JXMA 2CT3A 1K9AA 3M0QA 1QLYA 2LQWA 4WCIA 3EG3A 2ENMA 2A08A 1GBQA 2DF6A 3THKA 3RNJA 4RTUA 4CC2A 3R6NA 3JV3A 3GBQA 2MCNA 2M0YA 1Y57A 1VYTA 1AD5A 1M3CA 3A98A 1X27A 1TG0A 4HXJA 1H3HA 4ZNXA 3M0TA 5GJWB 1ZX6A 1S1NA 1T3LA 2L3PA 1NG2A 2G6FX 1RI9A 2D1XA 2KT1A 2C0IA 3M0PA 1GRIA 2AZVA 3VS7A 4X1VA 3PVLA 1JQQA 2KXCA 4J9DA 3TSWA 2DL3A 2O88A 1HSQA 2JM9A 4CC4B 2DRKA 2LJ3A 1W1FA 2CUBA 2JMAA 1RLQC 4J9EA 3I5RA 2DBMA 3IQLA 1PHTA 3I9QA 1B3QA 2IIMA 2K3BA 1E7OA 3KFVA 1ABQA 3TVTA 1I07A 2LNHB 5L23A 5HCKA 3SEMA 2RF0A 2KNBB 1AOJA 4EIKA 4Z89A 4RTWA 2EGCA 2O31A 2A37A 1NEBA 2CT4A 1YN8A 2JM8A 2BTTA 2YDLA 2QDLA 2DNUA 4CC3A 4LUDA 4Z88A 1AWWA 2E5KA 4IIOA 2DVJA 1WLPB 1ZUYA 2ROLA 4JZ4A 2K79A 2K2MA 1YWOA 2EBPA 2RPNA 2YUQA 3CQTA 1WFWA 2RQRA 1MUZA 3VS2A 1BB9A 1YNZA 1E6GA 1VYVA 4ESRA 2RQTA 1SHFA 1J3TA 1I1JA 4JJBA 3H0FA 1GFCA 4OMNA 1UE9A 4RTYA 4AFZC 2CDTA 3M0UA 4JJCA 2K9GA 3QWYA 1PNJA 1G2BA 1UTIA 1M3BA 2ED1A 2GQIA 2JS0A 2LJ1A 2KBTA 2J06A 4IIMA 1AVZC 1Y0MA 2JMCA 3UATA 3EG0A 1NLPC 1HJDA 1GFDA 5FWBA 2CH4W 2J6FA 4LE9A 4ORZA 4J9FA 2BZYA 2L3QA 4OMOA 1AEYA 2F2VA 2RNAA 2L3SA 5FWCA 1UUEA 1SEMA 3EHRA 4J9HA 3NGPA 1X2QA 2J6OA 2VVKA 2RMOA 1SRMA 1UJ0A 4Z8AA 2P4RA 4HVUA 4LNPA 3RBBB 2NWMA 1SPKA 2DLPA 1SHGA 3TSZA 4HVWA 3H0IA 2L0AA 4GBQA 3O5ZA 5I11A 2GTJA 3U23A 2CSIA 2DMOA 2DA9A 1UJYA 1HD3A 1MV3A 4R0KA 1NYFA 4AFQC 2HEQA 2JS2A 3EHQA 2BZXA 4RTZA 1E6HA 1ZBJA 1JEGA 2JW4A 3VS4A 2KROA 1WXUA 1H92A 2JXBA 4LUEA 1K1ZA 1KJWA 1GCQA 2AKLA 1BU1A 2XMFA 3PE0A 4A63B 1UDLA 2ROTA 4J9CA 1U3OA 1EFNA 3M0SA 2FRYA 2DL5A 2KRNA 2F2WA 4DEYA 4AFUC 1H8KA 5GJVB 1AWOA 1G83A 1AWJA 1PRMC 4OMMA 1X43A 2PNIA 2FO0A 1VA7A 2X3WD 4QT7A 2NUZA 1NEGA 1BBZA 4RTVA 1BK2A 2I0NA 1GCQC 2DL7A 3ULRB 1PKSA 1Z9QA 2AKKA 5I22A 1M30A 1PWTA 2F2XA 2O9VA 2ABLA 2ED0A 4FSSA 1YWPA 2KRMA 1UECA 2RN8A 2X3XD 4Y92A 2EKHA 1A0NB 1OPLA 4CC7A 1M27C 2YT6A 2LX7A 2FEIA 4OMLA 2DBKA 2KXDA 2CUDA 4KRTA 1OEBA 3UA7A 4E6RA 2EYYA 3VRYA 1KFZA 2SRCA 1N5ZA 2YSQA 1ARKA 2O2OA 2SEMA 4OMPA 2OAWA 1OPKA 5IHNA 3UF4A 2V1QA 1I0CA 3EGUA 1NM7A 2JT4A 3I5SA 2A28A 1ZUUA 2LMJA 1SRLA 2EW3A 5IHIA 2LP5A 1K0XA 1ZLMA 1UHFA 4AG1C 4JZ3A 4JPBW 1K4US 1CKBA 3PVQA 2K7AA 1PRLC 1OV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSQ A;  1UFF A;  2RQW A;  4GLM A;  1ZUK A;  2GTO A;  2KGT A;  4F14 A;  1AWX A;  1YCS B;  2FPF A;  3H0H A;  2KR3 A;  4F16 A;  1FYN A;  1LCK A;  1X6B A;  4AG2 C;  2KRS A;  3NMZ C;  3VRZ A;  3C0C A;  2YUO A;  2HBW A;  1Z9Z A;  2FPD A;  1W70 A;  1NYG A;  5IXF A;  2LCS A;  5IXB A;  2O9S A;  4J9G A;  1MV0 B;  2W10 A;  2DL8 A;  2VWF A;  3H41 A;  2EVR A;  2J7I A;  1WXT A;  3NPF A;  1NLO C;  3SHW A;  1RUW A;  1AZE A;  1IO6 A;  1JO8 A;  1QCF A;  1UGV A;  1OOT A;  1UG1 A;  3VS3 A;  2KT8 A;  1WA7 A;  1WYX A;  2KEA A;  1QKX A;  4JJD A;  1AZG B;  2RQU A;  1T0J A;  2EQI A;  4K11 A;  2EGE A;  4HVV A;  2CRE A;  1SSH A;  2DJQ A;  1V1C A;  2M51 A;  1UHC A;  2HDA A;  3LH5 A;  1GL5 A;  2DIL A;  2JTE A;  4RTX A;  4D8D A;  2BZ8 A;  1K76 A;  2D8H A;  2DX1 A;  1CSK A;  2GGR A;  2LJ0 A;  1XOV A;  2VKN A;  1T3S A;  1WXB A;  2K6D A;  1VYU A;  2YUP A;  1WX6 A;  1X6G A;  2B86 A;  2ESW A;  1M8M A;  1X69 A;  1M3A A;  1U5S A;  2DM1 A;  2EYZ A;  1ABO A;  2AZS A;  3VS5 A;  1K0S A;  2C0T A;  1GBR A;  2PTK A;  2C0O A;  2EYW A;  2DYB A;  4J9B A;  2DE0 X;  1JU5 C;  1QWE A;  1W6X A;  2EYX A;  2DL4 A;  2OI3 A;  1TUD A;  2LQN A;  4RUG A;  2YUN A;  3VS6 A;  5IHK A;  3FJ5 A;  2HSP A;  1WI7 A;  1KIK A;  1PKT A;  5IH2 A;  4HCK A;  1YP5 A;  4J9I A;  2D8J A;  2HCK A;  2LZ6 B;  2FPE A;  2FG0 A;  5FW9 A;  1QKW A;  4F17 A;  1FMK A;  2AK5 A;  2EGA A;  3EG1 A;  2KE9 A;  2EPD A;  3QWX X;  2GBQ A;  2FRW A;  2H8H A;  3VS0 A;  2GNC A;  2L2P A;  2KYB A;  4OMQ A;  2PZ1 A;  2J05 A;  2MOX A;  4D8K A;  1B07 A;  1WIE A;  1GCP A;  1WDX A;  2DRM A;  4AFS C;  3REB B;  2J6K A;  3M0R A;  1QWF A;  3REA B;  1KSW A;  2RQV A;  4RTT A;  5ECA A;  4DEX A;  3VS1 A;  3EG2 A;  4M4Z A;  2KYM A;  1U06 A;  2OJ2 A;  2CH4 A;  2ECZ A;  2MIO A;  2V1R A;  3NHN A;  1T0H A;  3I35 A;  4LN2 A;  2W0Z A;  1RLP C;  1ZSG A;  2A36 A;  1TUC A;  2D0N A;  3ZL7 C;  1CKA A;  5EC7 A;  1X2K A;  3UA6 A;  1JXO A;  1JXM A;  2CT3 A;  1K9A A;  3M0Q A;  1QLY A;  2LQW A;  4WCI A;  3EG3 A;  2ENM A;  2A08 A;  1GBQ A;  2DF6 A;  3THK A;  3RNJ A;  4RTU A;  4CC2 A;  3R6N A;  3JV3 A;  3GBQ A;  2MCN A;  2M0Y A;  1Y57 A;  1VYT A;  1AD5 A;  1M3C A;  3A98 A;  1X27 A;  1TG0 A;  4HXJ A;  1H3H A;  4ZNX A;  3M0T A;  5GJW B;  1ZX6 A;  1S1N A;  1T3L A;  2L3P A;  1NG2 A;  2G6F X;  1RI9 A;  2D1X A;  2KT1 A;  2C0I A;  3M0P A;  1GRI A;  2AZV A;  3VS7 A;  4X1V A;  3PVL A;  1JQQ A;  2KXC A;  4J9D A;  3TSW A;  2DL3 A;  2O88 A;  1HSQ A;  2JM9 A;  4CC4 B;  2DRK A;  2LJ3 A;  1W1F A;  2CUB A;  2JMA A;  1RLQ C;  4J9E A;  3I5R A;  2DBM A;  3IQL A;  1PHT A;  3I9Q A;  1B3Q A;  2IIM A;  2K3B A;  1E7O A;  3KFV A;  1ABQ A;  3TVT A;  1I07 A;  2LNH B;  5L23 A;  5HCK A;  3SEM A;  2RF0 A;  2KNB B;  1AOJ A;  4EIK A;  4Z89 A;  4RTW A;  2EGC A;  2O31 A;  2A37 A;  1NEB A;  2CT4 A;  1YN8 A;  2JM8 A;  2BTT A;  2YDL A;  2QDL A;  2DNU A;  4CC3 A;  4LUD A;  4Z88 A;  1AWW A;  2E5K A;  4IIO A;  2DVJ A;  1WLP B;  1ZUY A;  2ROL A;  4JZ4 A;  2K79 A;  2K2M A;  1YWO A;  2EBP A;  2RPN A;  2YUQ A;  3CQT A;  1WFW A;  2RQR A;  1MUZ A;  3VS2 A;  1BB9 A;  1YNZ A;  1E6G A;  1VYV A;  4ESR A;  2RQT A;  1SHF A;  1J3T A;  1I1J A;  4JJB A;  3H0F A;  1GFC A;  4OMN A;  1UE9 A;  4RTY A;  4AFZ C;  2CDT A;  3M0U A;  4JJC A;  2K9G A;  3QWY A;  1PNJ A;  1G2B A;  1UTI A;  1M3B A;  2ED1 A;  2GQI A;  2JS0 A;  2LJ1 A;  2KBT A;  2J06 A;  4IIM A;  1AVZ C;  1Y0M A;  2JMC A;  3UAT A;  3EG0 A;  1NLP C;  1HJD A;  1GFD A;  5FWB A;  2CH4 W;  2J6F A;  4LE9 A;  4ORZ A;  4J9F A;  2BZY A;  2L3Q A;  4OMO A;  1AEY A;  2F2V A;  2RNA A;  2L3S A;  5FWC A;  1UUE A;  1SEM A;  3EHR A;  4J9H A;  3NGP A;  1X2Q A;  2J6O A;  2VVK A;  2RMO A;  1SRM A;  1UJ0 A;  4Z8A A;  2P4R A;  4HVU A;  4LNP A;  3RBB B;  2NWM A;  1SPK A;  2DLP A;  1SHG A;  3TSZ A;  4HVW A;  3H0I A;  2L0A A;  4GBQ A;  3O5Z A;  5I11 A;  2GTJ A;  3U23 A;  2CSI A;  2DMO A;  2DA9 A;  1UJY A;  1HD3 A;  1MV3 A;  4R0K A;  1NYF A;  4AFQ C;  2HEQ A;  2JS2 A;  3EHQ A;  2BZX A;  4RTZ A;  1E6H A;  1ZBJ A;  1JEG A;  2JW4 A;  3VS4 A;  2KRO A;  1WXU A;  1H92 A;  2JXB A;  4LUE A;  1K1Z A;  1KJW A;  1GCQ A;  2AKL A;  1BU1 A;  2XMF A;  3PE0 A;  4A63 B;  1UDL A;  2ROT A;  4J9C A;  1U3O A;  1EFN A;  3M0S A;  2FRY A;  2DL5 A;  2KRN A;  2F2W A;  4DEY A;  4AFU C;  1H8K A;  5GJV B;  1AWO A;  1G83 A;  1AWJ A;  1PRM C;  4OMM A;  1X43 A;  2PNI A;  2FO0 A;  1VA7 A;  2X3W D;  4QT7 A;  2NUZ A;  1NEG A;  1BBZ A;  4RTV A;  1BK2 A;  2I0N A;  1GCQ C;  2DL7 A;  3ULR B;  1PKS A;  1Z9Q A;  2AKK A;  5I22 A;  1M30 A;  1PWT A;  2F2X A;  2O9V A;  2ABL A;  2ED0 A;  4FSS A;  1YWP A;  2KRM A;  1UEC A;  2RN8 A;  2X3X D;  4Y92 A;  2EKH A;  1A0N B;  1OPL A;  4CC7 A;  1M27 C;  2YT6 A;  2LX7 A;  2FEI A;  4OML A;  2DBK A;  2KXD A;  2CUD A;  4KRT A;  1OEB A;  3UA7 A;  4E6R A;  2EYY A;  3VRY A;  1KFZ A;  2SRC A;  1N5Z A;  2YSQ A;  1ARK A;  2O2O A;  2SEM A;  4OMP A;  2OAW A;  1OPK A;  5IHN A;  3UF4 A;  2V1Q A;  1I0C A;  3EGU A;  1NM7 A;  2JT4 A;  3I5S A;  2A28 A;  1ZUU A;  2LMJ A;  1SRL A;  2EW3 A;  5IHI A;  2LP5 A;  1K0X A;  1ZLM A;  1UHF A;  4AG1 C;  4JZ3 A;  4JPB W;  1K4U S;  1CKB A;  3PVQ A;  2K7A A;  1PRL C;  1OV3 A; 
#chains in the Genus database with same CATH topology
 2CSQ A;  4M7A C;  4GLM A;  2FB7 A;  2KGT A;  3P8B B;  2FPF A;  2KR3 A;  1FYN A;  3RUX A;  4B9X A;  2VXE A;  3NMZ C;  4QW2 A;  3C0C A;  3LYI A;  2HBW A;  1IRE B;  1VQ8 Q;  4C92 F;  3G4S A;  4R56 A;  3M4Y A;  2X35 A;  3C95 A;  5IXF A;  1TTH B;  1K73 R;  2CKK A;  5IXB A;  4J9G A;  1MMN A;  4C92 A;  2OAU A;  5GMK e;  4LD6 A;  3CCE Q;  1IZ6 A;  2P84 A;  2VWF A;  2J7I A;  1HYO A;  1D1C A;  2CP2 A;  4KGV B;  1BIB A;  2HQE A;  3JCM d;  3CCV A;  5CKH A;  1UGV A;  3CCR Q;  2DVE A;  2DXB A;  5GAO m;  4ME7 A;  1Q82 R;  4DBH A;  2D0Q B;  1N9R A;  4JJD A;  3PMI A;  3CC7 T;  2CZ0 B;  1FMV A;  4M75 G;  4KUD K;  3UPU A;  1MGQ A;  3EFO A;  3C94 A;  2DJQ A;  1KHC A;  1IRX A;  3G4S Q;  4JLI A;  2DIL A;  2JTE A;  4RTX A;  2E41 A;  4C92 B;  5GAN 3;  1QVF A;  3OW2 S;  3DKM A;  3MHX A;  2LJ0 A;  5FLX E;  5GAN h;  1XOV A;  1YBY A;  2VKN A;  4LDW A;  1I8F A;  2K6D A;  1U1S A;  3QDR B;  2ESW A;  3L2U A;  3CCV Q;  3FC3 A;  2VGM A;  3E9G A;  1M3A A;  5HKC A;  1QCO A;  2EYZ A;  2GFU A;  2ZPF B;  2HZY A;  2K3X A;  3VS5 A;  3CC7 A;  3X26 B;  2HMA A;  5KYW B;  2C0O A;  5GAM e;  3CXC S;  2DE0 X;  2QAZ A;  5I2M A;  1D0X A;  2JZ2 A;  4B6M A;  2LQN A;  3VS6 A;  4RCC A;  1WI7 A;  5FU6 C;  5L8R E;  2XIC A;  3CD6 T;  1SKU B;  2HCK A;  3MP1 A;  3AHU A;  1TOV A;  1QKW A;  4C0D B;  3INZ A;  1FMK A;  3H9N A;  1YHQ T;  3VUB A;  5IN1 A;  2H8H A;  3VS0 A;  2GNC A;  4A4G A;  2KYB A;  3DB3 A;  1B07 A;  3CC7 Q;  1GCP A;  2YRD A;  2V8K A;  1X6O A;  5KE2 A;  2J6K A;  1QWF A;  3REA B;  2RQV A;  3CME T;  5ECA A;  4FM4 B;  3EG2 A;  3CD6 A;  2KYM A;  2MIO A;  2V1R A;  2ZZD A;  4LN2 A;  2LCL A;  4M7A D;  2A36 A;  1OU9 A;  3OS1 A;  3OYN A;  1TUC A;  2D0N A;  1YHQ A;  5EC7 A;  5FU7 C;  2DPP B;  1JXM A;  5FRM A;  2B8A A;  5CCA A;  2LQW A;  4WCI A;  3EG3 A;  1N27 A;  1GBQ A;  2MI6 A;  3THK A;  4RTU A;  5CKB A;  2AIR B;  2EJG A;  2MCN A;  1Y57 A;  3L2R A;  1WJR A;  3CME A;  1TG0 A;  4HXJ A;  5GAO l;  2HNI A;  3V7C A;  1YI2 A;  2DIQ A;  2L3P A;  1Q95 G;  3WVD B;  2RB6 A;  2KXC A;  2RHU A;  3TSW A;  2O88 A;  1YHQ Q;  1W1F A;  2CUB A;  3UWN A;  2JVV A;  3RER A;  2IIM A;  1E7O A;  4XAX B;  1ABQ A;  1NJI U;  3QBY A;  4C8Q G;  3MET A;  3TU4 K;  5HCK A;  1BI0 A;  4BY6 C;  5GMK l;  1KQS S;  2DD5 A;  1Q81 R;  3A8L B;  3CME Q;  3CBP A;  4QQ6 A;  5GAN 5;  3QJY A;  4FT4 A;  4RTW A;  4O6J A;  4PJN A;  2CT4 A;  3SWN C;  1C6V X;  3X28 B;  1YI2 Q;  3FEO A;  1JJ2 S;  1AWW A;  1WPY A;  2RJF A;  1VQ7 T;  1VQM T;  3MEA A;  2RPN A;  4AMC A;  1BB9 A;  4F7U G;  1YNZ A;  3CXC P;  4C8Q F;  1VYV A;  4ESR A;  2LT4 A;  4C5G A;  2MAM A;  3H0F A;  1GFC A;  4OMN A;  1VQ5 T;  2RI3 A;  1OU8 A;  4C8Q A;  1VQ9 T;  2KAF A;  3QWY A;  5LJ5 f;  2HD0 A;  3VYG A;  2E64 A;  2GQV A;  3EG0 A;  3URG A;  2DXU A;  4L59 A;  5GAO q;  1VQO A;  5M9O A;  2F5K A;  2CH4 W;  3OS0 A;  4LE9 A;  3OB9 A;  1VQK T;  2L3Q A;  4OMO A;  1ZSZ C;  1AEY A;  1MHN A;  3QHS A;  5KYX A;  4F7U F;  4B9W A;  1M1F A;  3NGP A;  1VQ5 A;  3JRZ A;  2VB6 A;  2BE9 B;  4LDY A;  4C8Q B;  4M7D E;  2RMO A;  4ZN3 A;  1SRM A;  4F7U A;  4N4H A;  3JB9 F;  3G1J A;  1PC0 A;  4LNP A;  2NWM A;  1SPK A;  4FYX B;  2BKD N;  2DLP A;  1SHG A;  3ME9 A;  3EGD B;  1Q81 C;  3TSZ A;  3O5Z A;  5I11 A;  1BI3 A;  4XU0 A;  4XTU A;  1GXI E;  2DMO A;  3OYK A;  1UJY A;  1HD3 A;  1VQO Q;  4R0K A;  1WHH A;  4AFQ C;  2V8J A;  3EHQ A;  4LD9 K;  3QPH A;  3ZBD A;  3GPL A;  1ZQ1 A;  1QP3 A;  3OBY A;  4CI0 C;  3CBM A;  1VQ5 Q;  3PNW C;  4F7U B;  2L3R A;  4KBM B;  2HKQ B;  3QJ6 A;  5GAO r;  1WGS A;  1B7T A;  5J39 A;  2DL5 A;  5CK9 A;  1Q86 U;  1RL2 A;  2LTO A;  4C92 C;  5GJV B;  1NZ9 A;  3DLM A;  1UGR B;  1WQ7 A;  3QYH B;  3CBO A;  2G3R A;  5LJ5 e;  2PUO B;  2JOY A;  2PNI A;  3JCM h;  5GAO n;  1NEG A;  3J7A F;  1BBZ A;  2O01 E;  2QGF B;  1KQS P;  4M7D A;  4RTV A;  2MPX C;  1BK2 A;  2CZ7 B;  2I0N A;  2XI9 A;  4QVD A;  4NOY A;  1C1A A;  2F2X A;  2QQS A;  1LPL A;  2KRM A;  2RN8 A;  2X3X D;  1M1K R;  3NTI A;  1A0N B;  1MMD A;  2EWN A;  4RCB A;  1M27 C;  1N8R U;  2M0O A;  2LX7 A;  1PCX A;  2EQU A;  3M4G A;  1KC8 U;  2YLC A;  3L42 A;  2RHY A;  3G71 T;  2RJD A;  4KH0 B;  4E6R A;  3JCM X;  2EYY A;  2QQA A;  5KYY A;  1I4K 1;  1IGU A;  2HSE B;  4C0D C;  3OYB A;  2H3J A;  4M78 E;  1TU0 B;  2OX7 A;  4OMP A;  3V7R A;  2PUK B;  2JUF A;  4A4E A;  2P0K A;  4ANJ A;  1D0Z A;  3OYM A;  1NM7 A;  2YRV A;  4A4K A;  3J81 E;  3OYY A;  1KD1 R;  2LP5 A;  3C4S A;  4JPB W;  4PJO E;  4UC4 A;  4XTV A;  3PVQ A;  3G71 A;  2K7A A;  2DEQ A;  2ATC B;  2E5Q A;  1PRL C;  1Q7Y R;  1OV3 A;  5KYY B;  2JJ9 A;  1AWX A;  3H0H A;  2CYZ B;  4EMG A;  1M2V A;  2KRS A;  4RMO A;  3TRE A;  2YUO A;  1Z9Z A;  1W70 A;  3OA6 A;  1TXQ A;  3CCU A;  2LCS A;  3CMA T;  2DL8 A;  4XTY A;  4QQD A;  5EG2 A;  1K9M U;  1QVG A;  2EVR A;  1PD1 A;  3NPF A;  2X4X A;  5CKE A;  5LJ3 g;  4M78 F;  1VQP T;  1AZE A;  3G71 Q;  1JO8 A;  3FDR A;  1FXX A;  2IVW A;  3HSB A;  1RAA B;  1UG1 A;  4M78 A;  5GAN 7;  3NTK A;  4XK8 E;  4XU1 A;  2RQU A;  2EQM A;  8ATC B;  4PFZ A;  2D9T A;  2QTX A;  4EDU A;  2CRE A;  1V76 A;  1V1C A;  2M51 A;  4PJO F;  3PTA A;  3CMA A;  2P0Q A;  2GCX A;  3HFN A;  3GIB A;  4C92 D;  3CCU Q;  1K8A U;  4IKF A;  4PJO A;  2D8H A;  1CSK A;  4DQ2 A;  2GGR A;  4IUQ A;  2XD0 A;  2E6N A;  4MDX A;  1VQP A;  3JSC A;  1T3S A;  4M77 G;  1VQ8 T;  2E6Z A;  1VYU A;  1KD1 C;  1MNE A;  3M53 A;  4IUR A;  4J5Y A;  4M78 B;  3LGL A;  2EQJ A;  1U5S A;  2DM1 A;  4FW2 A;  1ABO A;  1I5L A;  3CCE T;  1UEB A;  2C0T A;  4L5G A;  1RAD B;  3VKI A;  2Y4X A;  4LDU A;  1JU5 C;  3RKX A;  1W6X A;  2OI3 A;  1TUD A;  2ZGW A;  2YXY A;  8AT1 B;  4OB0 B;  5IHK A;  4JDS A;  3FJ5 A;  2HSP A;  3CCR T;  1KIK A;  3CMA Q;  3D7S B;  4PJO B;  1PKT A;  4EMK A;  3SDZ A;  5IH2 A;  4HCK A;  1M1G A;  1K73 U;  4KH1 B;  4J9I A;  5GAN f;  1VQ8 A;  1WQW A;  1D1B A;  4X34 A;  1M4Z A;  1RAB B;  4NS5 A;  4C5H A;  1VQP Q;  2AK5 A;  2MWO A;  4E7L A;  1WHG A;  2RO0 A;  2K5F A;  2BUD A;  3I55 T;  4MMK A;  4RG2 A;  1BI1 A;  3LGF A;  3HKS A;  2MOX A;  2PVO B;  4D8K A;  4DBR A;  1WIE A;  4FSX A;  1Q82 U;  4AFS C;  3GLX A;  4BI4 A;  3REB B;  3M0R A;  1YIJ T;  3ASK A;  5I21 A;  1UB4 A;  2COW A;  3CCV T;  3CCS A;  3CPF A;  4EMK B;  2CH4 A;  2ECZ A;  3I35 A;  1SSF A;  2W0Z A;  3A8G B;  1FMW A;  1VQN A;  1VQ6 T;  3FJP A;  1CKA A;  2H3E B;  3I55 A;  5CR2 A;  3UA6 A;  2L89 A;  1K9A A;  3M0Q A;  1QLY A;  3L2W A;  2K4Y A;  4P5N A;  2CP3 A;  3RMQ A;  3PIP A;  2ENM A;  2A08 A;  3RNJ A;  1U1T A;  1BI2 A;  2DJZ A;  3R6N A;  4OB2 B;  1G3S A;  2HQH A;  1YIJ A;  3OW2 A;  1OZ2 A;  3M58 A;  3M0T A;  3FRN A;  4WTO B;  2QXF A;  3CCS Q;  2G6F X;  5GMK h;  3M0P A;  1R8O B;  2AZV A;  3VS7 A;  1VQ6 A;  5KYW A;  3PVL A;  4L6V 5;  4J9D A;  1VQ4 A;  3CC4 T;  5LJ5 d;  3G6E T;  1VQN Q;  2DRK A;  2LJ3 A;  2HAX A;  5LJ3 d;  3I55 Q;  3LLR A;  1RLQ C;  1NE8 A;  3A8M B;  3I5R A;  2GF7 A;  3CXC A;  1PHT A;  3TVT A;  1I07 A;  5GAN e;  4J6W A;  1PD0 A;  3OSV A;  1AOJ A;  4A4H A;  5GMK m;  2JTF A;  2V8I A;  2XHC A;  1YIJ Q;  2QA4 A;  3GP8 A;  3P8D A;  1NEB A;  3HL8 A;  1YN8 A;  2ZAE A;  3OYA A;  2BTT A;  2VGN A;  3CC4 A;  2DNU A;  2MWP A;  4M75 F;  3G6E A;  1VQ6 Q;  2ZPB B;  2DD4 A;  3GOX A;  3M9Q A;  2FZC B;  1LNX A;  2DVJ A;  1VQ4 Q;  1AT1 B;  4M75 A;  1ZUY A;  3M54 A;  2ROL A;  2K79 A;  2K2M A;  1YWO A;  2YUQ A;  3CQT A;  4KUI A;  2WSF E;  2E3H A;  1MUZ A;  3CC2 T;  2X51 A;  4HCZ A;  4ZTF A;  3MO8 A;  4JJB A;  1UE9 A;  4RTY A;  2K9G A;  1PNJ A;  5CKD A;  4M7D C;  2QA4 Q;  1UTI A;  2LJ1 A;  2J06 A;  4N4G A;  3HFO A;  2LDM A;  1Y0M A;  2JMC A;  3MJX A;  4J7I A;  3CC4 Q;  1NLP C;  1HJD A;  3G6E Q;  5FWB A;  1IXD A;  4M75 B;  1YCY A;  2J6F A;  1EIF A;  4ORZ A;  1V29 B;  3EGX A;  3LWH A;  3CC2 A;  4N0A A;  1YI2 T;  4X9D A;  2HL5 C;  5FWC A;  4J9H A;  2XID A;  2VVK A;  5A2Q E;  2DEU A;  1UJ0 A;  2P4R A;  3RBB B;  4JRQ A;  2XU8 A;  2A0F B;  1O75 A;  4HVW A;  3A5Z B;  2E10 A;  4GBQ A;  7AT1 B;  2GTJ A;  1B34 A;  5KCO A;  1FX7 A;  2DO3 A;  5D7U A;  2DA9 A;  2BIV A;  3EGX B;  3C12 A;  5A0D A;  4C8Q E;  2HEQ A;  2JS2 A;  2QQB A;  1E6H A;  3CC2 Q;  2JW4 A;  1DJ7 B;  1WXU A;  2JXB A;  4E2F B;  1W4S A;  1MMG A;  3H8Z A;  5GAO p;  2COY A;  2QK0 A;  3KUF A;  4LUE A;  5GAM g;  1PM3 A;  3L2Z A;  1JJ2 A;  1K1Z A;  1GCQ A;  1BU1 A;  4KGZ B;  2YWW A;  4A63 B;  2D6F A;  2ROT A;  3JB9 D;  1XNI A;  4YTL A;  4J7F A;  4BE1 A;  3M0S A;  2FRY A;  1B34 B;  2KRN A;  1D09 B;  2K5L A;  1G3W A;  2P0P A;  2KSS A;  3M55 A;  1G3Y A;  2E65 A;  4M7A G;  2EKO A;  3P8H A;  4NL2 A;  1X43 A;  3OYH A;  4F7U E;  3OBW A;  4BAC A;  2XG8 D;  2FO0 A;  2DK3 A;  2XDP A;  2OTJ T;  2NUZ A;  3QG1 A;  3CCJ T;  3L1A A;  4M78 C;  1OI1 A;  1Z9Q A;  5I22 A;  1RAI B;  1VQO T;  1M30 A;  1PWT A;  3EFR A;  3RR6 A;  5LJ3 j;  4F04 B;  1OX9 A;  2NUP B;  1BCO A;  1G3T A;  2FEI A;  4OML A;  4PLL A;  2KXD A;  4DOV A;  4PJO C;  4KRT A;  1PG5 B;  2E12 A;  4QVZ A;  4TVR A;  3UA7 A;  2OTJ A;  1KFZ A;  3JCM f;  5KCH A;  3OYC A;  5KYU B;  2RK2 A;  2YSQ A;  3LX7 A;  3CCJ A;  3FB9 A;  3EGD A;  4M7D D;  3EH2 A;  1QVF P;  1M90 R;  1W2B A;  1JB0 E;  3UF4 A;  1YFN A;  3RKY A;  4ZN1 A;  1I0C A;  1XJW B;  3M5A A;  1R0B G;  1ZA2 B;  1ZLM A;  4AG1 C;  1YIT T;  1KG1 A;  4PFO A;  4EMK C;  2RQW A;  3ZFJ A;  2GTO A;  3M59 A;  1YCS B;  5CVI A;  2FZK B;  3HTR A;  3X25 B;  2OTJ Q;  1LCK A;  4AG2 C;  4OVA A;  4M7A B;  3QYG B;  1Y71 A;  3QO3 A;  3I56 Q;  3CCJ Q;  4C5I A;  2FPD A;  2LNV A;  4PJJ A;  1N6A A;  2X4Y A;  2EQK A;  2AT1 B;  2W10 A;  1YIT A;  2ZPE B;  3OY9 A;  2BE7 D;  2RH2 A;  2RHZ A;  1M1K U;  4XU3 A;  2NYS A;  2ZCF B;  1WHK A;  1RUW A;  3L2V A;  5C0M A;  4A54 A;  1M5Q 1;  4KT0 E;  4HT8 A;  3OMG A;  5GAN d;  3VS3 A;  1VQL A;  1P92 A;  2KT8 A;  2KEA A;  2CP6 A;  3V8K A;  1OX8 A;  1AZG B;  3GNF B;  3GF5 A;  1T0J A;  2EQI A;  1Y07 A;  1SSH A;  2EFI A;  3JCM J;  3LH5 A;  3OYG A;  1GL5 A;  5IAY A;  4D8D A;  2BZ8 A;  5GAM d;  4RG8 A;  3JCM e;  1K76 A;  1M90 C;  3MEU A;  4C5E A;  4MZM A;  1Y7X A;  3ZEH A;  1YIT Q;  1XQH A;  2LVM A;  3BDU A;  2RHI A;  1NJI C;  4DOW A;  3CPW A;  2YUP A;  2M16 A;  3BDL A;  1EZZ B;  1M8M A;  1X69 A;  4M78 D;  3OYL A;  1Q7Y U;  2A3L A;  3EH1 A;  5LJ3 h;  1VQL Q;  1FWZ A;  2EYW A;  1LJO A;  1N9S A;  2QEX T;  4J9B A;  1QWE A;  2EYX A;  3KBG A;  4RUG A;  1RAH B;  1LOJ A;  4PJO D;  1YP5 A;  2YLB A;  1HK9 A;  2QAS A;  2LZ6 B;  2FG0 A;  5FW9 A;  4AT1 B;  5CAI A;  4JRK A;  1I5O B;  3QWX X;  1IHV A;  3CCU T;  2L2P A;  5C6S A;  2QEX A;  1Q86 R;  4HKE A;  1WDX A;  4M75 C;  4RKU E;  2FHD A;  1F1B B;  4BDY A;  3OS5 A;  4RTT A;  3ER0 A;  2WSE E;  1BCM A;  3RDV A;  1U06 A;  5CQY A;  3NHN A;  1T0H A;  1ZSG A;  3OMC A;  3X20 B;  5AT1 B;  3JAM E;  2YHT A;  3X24 B;  3QUI A;  5DY9 A;  2CT3 A;  5LL6 S;  2CP5 A;  5GAN 6;  1RAE B;  5FU7 B;  4MDW A;  2DF6 A;  1YJW Q;  5GAN 4;  3E19 A;  4JS5 A;  3GBQ A;  2QQ9 A;  2M0Y A;  5LJ5 g;  2QEX Q;  3A98 A;  5GAN 8;  2MF2 A;  1H3H A;  4LXC A;  1O9S A;  4N0A C;  1RI0 A;  5GJW B;  4BD3 A;  3JCM P;  1RAC B;  1S1N A;  2V26 A;  4Y28 E;  5GMK j;  1OZ3 A;  1T3L A;  1NG2 A;  5HK3 A;  2JNG A;  2KT1 A;  4M77 E;  4GLK A;  4X1V A;  3QZ9 B;  1JQQ A;  3V8L A;  1OQK A;  2DL3 A;  1HSQ A;  2RK1 A;  2JM9 A;  5J3B A;  4FCY A;  2JMA A;  4J9E A;  4FIB A;  2EYQ A;  2QQR A;  3IQL A;  3TCJ A;  3I9Q A;  1MND A;  4PK4 A;  1D3B A;  4QQG A;  5L23 A;  5A0L A;  3SEM A;  1QMC A;  2KNB B;  2WSC E;  2K3Y A;  4EIK A;  3VUZ A;  4Z89 A;  3CCM Q;  2DZ9 A;  2O4X A;  1Q86 C;  4MZP A;  1KQ2 A;  2EGC A;  2O31 A;  4DBF A;  1Y96 B;  2CP7 A;  2F69 A;  5CO7 A;  3SD4 A;  1EX4 A;  4ZTJ A;  2QDL A;  4LUD A;  4J83 A;  1KQ1 A;  2M9U A;  1TH7 A;  2OTL T;  1WLP B;  4PLI A;  2HQX A;  1LVK A;  4IUT A;  2EBP A;  2JTM A;  1D3B B;  3CCS T;  2YRC A;  1WFW A;  3E1S A;  5GAM j;  3OYF A;  4M77 F;  2F5T X;  1VQN T;  4AFZ C;  2RI5 A;  2CP0 A;  4JJC A;  1TUG B;  2O4X B;  3M0U A;  1N8R C;  4HCC A;  4PJM A;  3V7S A;  4J6Y A;  1S72 Q;  4M77 A;  1M3B A;  2ED1 A;  2JS0 A;  4Y91 A;  4PKC C;  5DLO A;  3UAT A;  3PFS A;  2OTL A;  1QP2 A;  3R6O A;  1GFD A;  4C92 G;  4XTZ A;  4GY5 A;  1ACM B;  1K8A R;  2BZY A;  2RJC A;  4HCB A;  2F2V A;  2L3S A;  4C8Q C;  1I81 A;  1SEM A;  2PU9 B;  3OYD A;  1SG5 A;  1VQ4 T;  1OYX A;  1VIE A;  3FLG A;  3GNG A;  4M77 B;  4Z8A A;  2E3I A;  4E7Z A;  3E9F A;  4HVU A;  4M75 E;  2PQW A;  1WJS A;  3A1P A;  2A7Y A;  2OTL Q;  2RI2 A;  2X4J A;  4Z02 A;  2QA4 T;  2Y90 A;  1NPR A;  4E7I A;  1IGQ A;  4V2S A;  2BZX A;  2VXF A;  2Y4Y A;  3RES A;  1QCN A;  2KRO A;  3WXM B;  1G5V A;  1IHW A;  1H92 A;  2QGG A;  1K9M C;  3M56 A;  4DBQ A;  5KYN A;  2RA2 A;  2RM4 A;  4BE0 A;  1U8R A;  2AKL A;  2XMF A;  5KE3 A;  3PE0 A;  1UDL A;  4J9C A;  4Q5W A;  4BB7 A;  2E4H A;  4AFU C;  1H8K A;  4E47 A;  1PRM C;  2KMT A;  4OMM A;  2RD1 A;  3AT1 B;  1VA7 A;  2X3W D;  1QQJ A;  3VJP A;  5FRO A;  1K8A C;  4OMF B;  4BUG A;  1PKS A;  1QVG P;  2XKO C;  1D1A A;  2EJF A;  4EPC A;  2LQK A;  2KY9 A;  3JCM c;  2O9V A;  4FSS A;  1YWP A;  1VIF A;  2IPO B;  2EKH A;  2FZG B;  1MMA A;  1OPL A;  4CC7 A;  3EFO B;  2YT6 A;  5GAM h;  1QVF S;  2JN0 A;  1OEB A;  1H64 1;  3DB4 A;  4JRI A;  3HRT A;  1AHJ B;  2O2O A;  5D6W A;  3FIF A;  1OPK A;  5IHN A;  1K73 C;  3LH0 A;  2V1Q A;  2MMP A;  4IUP A;  3JCM V;  3EGU A;  2JT4 A;  4BI3 A;  2A28 A;  3DLL A;  1ZUU A;  4JLG A;  2P4T A;  2LMJ A;  1SRL A;  1X75 C;  5IHI A;  1K0X A;  2DAQ A;  4PFP A;  3MEV A;  1K4U S;  1CKB A;  4OB3 B;  1NPP A;  4ATO A;  3QDF A;  4C8Q D;  2KI7 A;  3CCQ T;  1Q82 C;  1Q81 U;  1UFF A;  4ELY C;  4C0F A;  1ZUK A;  4F14 A;  3LWI A;  4OP0 A;  4F16 A;  3JB9 I;  1X6B A;  5IT9 E;  3MP8 A;  3T9N A;  3UT1 A;  3VRZ A;  4IUU A;  4HT9 A;  1WJQ A;  2R57 A;  4O5V A;  5GMK i;  2L5Q A;  1NYG A;  5GAN g;  2DTO A;  2DTH A;  4J8O A;  4C0G A;  1KQS A;  2O9S A;  1MV0 B;  3BY7 A;  2CZ1 B;  2PVG B;  3UDC A;  2F1L A;  3H41 A;  1WXT A;  1NLO C;  3WVE B;  3CCQ A;  3SHW A;  4M7A E;  2DZC A;  1IO6 A;  1QCF A;  1OOT A;  2DTI A;  1WA7 A;  3CD6 Q;  1VUB A;  1WYX A;  3SB2 A;  1QKX A;  4MML A;  4ELZ C;  1D0Y A;  2NUP A;  4K11 A;  2EGE A;  4HVV A;  1UGP B;  5CKF A;  1M90 U;  1UHC A;  2HDA A;  4OF1 A;  2QI2 A;  3RIR A;  5KYU A;  2DX1 A;  4MZT A;  5AYF A;  3I56 T;  3L2Q A;  5FRN A;  3OYI A;  1WXB A;  4FL6 A;  1RAF B;  3CCQ Q;  2X4W A;  5CQX A;  1WX6 A;  4A53 A;  1X6G A;  4QVC A;  2B86 A;  4E7S A;  5LJ5 j;  2DYI A;  3OW2 P;  2AZS A;  2DFU A;  1K0S A;  1GBR A;  2PTK A;  4NL3 A;  2DYB A;  2ZPH B;  4FYW B;  3SFM A;  2DL4 A;  2R5M A;  3HRU A;  2YUN A;  4BE2 A;  3JCM b;  4M7A F;  3E2U A;  3I56 A;  2D8J A;  2HBP A;  4M7A A;  4A4F A;  2FPE A;  2LC4 A;  2DXC A;  3OS2 A;  4F17 A;  2EGA A;  3EG1 A;  2KE9 A;  3HPW A;  5D6X A;  1HXD A;  2EPD A;  3JB9 G;  2GBQ A;  2VAS A;  3PIO A;  2FRW A;  1NJI R;  4OMQ A;  2PZ1 A;  2ZPI B;  5LJ3 f;  2J05 A;  4ZGD B;  4R55 A;  4FYV B;  3VU3 C;  2VYT A;  2DRM A;  3A8H B;  1TSF A;  1KSW A;  1VQ7 A;  1VQM A;  4DEX A;  3MP6 A;  3VS1 A;  4E7K A;  4M4Z A;  2OJ2 A;  1WNL A;  4FW1 A;  1RLP C;  1VQL T;  3OYJ A;  2VV5 A;  3ZL7 C;  4M77 C;  1VOM A;  1VQ9 A;  1X2K A;  1JXO A;  4WF2 A;  4LDV A;  3QII A;  1BIA A;  1W2B S;  2VC8 A;  2K5I A;  3QKJ A;  4KGX B;  5J26 A;  1ZHI A;  4CC2 A;  3JV3 A;  1VYT A;  2KDS A;  1AD5 A;  1M3C A;  1X27 A;  4JS4 A;  1VQK A;  4ZNX A;  1NBE B;  3JCM Q;  4CRI A;  1ZX6 A;  1VQ7 Q;  1VQM Q;  3EG9 A;  4JRP A;  1UGQ B;  4M7D G;  1BYM A;  2K2V A;  3EFS A;  4HA8 A;  1WZO A;  5KYX B;  1RI9 A;  2D1X A;  2C0I A;  4KUL A;  1GRI A;  3KXT A;  4DA4 A;  1G8X A;  4EMH A;  3RMS A;  4PL6 A;  3J80 E;  4FYY B;  2QYZ A;  4CC4 B;  2HL3 A;  3N5B B;  1C0M A;  1VQ9 Q;  2LCC A;  1TS9 A;  2DBM A;  3PGG A;  2AHJ B;  3CEY A;  1B3Q A;  2K3B A;  3KFV A;  1KD1 U;  2LNH B;  5A0G A;  1PSE A;  3G7Z A;  4LDX A;  2RF0 A;  2M1H A;  3A8O B;  4PNO A;  4XTX A;  3EG9 B;  3VV0 A;  1VQK Q;  4XU2 A;  2XK0 A;  2A37 A;  4M7D F;  5LJ5 h;  6AT1 B;  3OSS C;  2JM8 A;  5LJ3 e;  1YJW T;  1PSF A;  2YDL A;  4CC3 A;  1ZBX A;  2NLU A;  4Z88 A;  4J6X A;  1R0C B;  2L8D A;  2RJE A;  2HKN A;  2E5K A;  4IIO A;  3VYH B;  3PT9 A;  3JB9 J;  4FU6 A;  3HP9 A;  1R77 A;  2DXT A;  2I2L A;  3NTH A;  1RAG B;  3OQ5 A;  3MKD A;  4JZ4 A;  2LRQ A;  4IUV A;  1KK7 A;  2RQR A;  3VS2 A;  1JJ2 P;  1JRI A;  1E6G A;  2LT1 A;  5FU6 B;  2RQT A;  1SHF A;  2CGH A;  1J3T A;  3NFC A;  1I1J A;  1TWB A;  2CDT A;  5CIU A;  3H6Z A;  2Z0W A;  1BKB A;  3TQ7 P;  1G2B A;  2QG9 B;  1YJW A;  4ZGE B;  2GQI A;  4IIM A;  2KBT A;  2WAC A;  3Q1J A;  3CPW S;  1AVZ C;  4M7D B;  1M2O A;  2XDB A;  1UGS B;  4BDZ A;  2X9H A;  1X01 A;  2PVD B;  3CCM T;  2FVU A;  1H3Z A;  2FYK A;  4J9F A;  2VUB A;  3TEE A;  2XDD A;  3S3N A;  1JBM A;  4PJL A;  5DLQ E;  2RNA A;  2CZ6 B;  2E70 A;  1IB8 A;  3S6W A;  4D6W A;  1YJN T;  1UUE A;  3EHR A;  1X2Q A;  2DET A;  4M78 G;  2J6O A;  1OUL A;  2DKG A;  3LW5 E;  4M77 D;  4JJN K;  1N8R R;  4VUB A;  2M02 A;  3S3O A;  3H0I A;  2K57 A;  2L0A A;  2LX9 A;  1KC8 R;  3JCM g;  3CCL T;  1WHL A;  3U23 A;  2CSI A;  3CCM A;  2CS7 A;  4PJO G;  1QVP A;  3BFM A;  5DM7 R;  1MV3 A;  5GAN 2;  1S72 T;  3OYE A;  1NYF A;  1W2B P;  2KVQ G;  4OGE A;  1YJN A;  1Y96 A;  3BW1 A;  4OGC A;  4RTZ A;  1YJ9 T;  5D6Y A;  1ZBJ A;  1JEG A;  3JB9 H;  1M9S A;  3VS4 A;  1ZA1 B;  3SWN A;  3MEW A;  4ZGJ B;  4E7J A;  1WHM A;  3M57 A;  1M1K C;  1KJW A;  2GFA A;  2QTV A;  1M2V B;  2R5A A;  3RKW A;  4OB1 B;  2RHX A;  4N4I A;  1U3O A;  3CCL A;  4X9C A;  1EFN A;  1SF9 A;  4FT2 A;  2ZPG B;  2E1H A;  2F2W A;  4DEY A;  5I2S A;  1S72 A;  3MPU B;  1M8V A;  1QVG S;  3MCA B;  1AWO A;  1G83 A;  4BY6 B;  1AWJ A;  1YJ9 A;  1XTD A;  9ATC B;  5HK0 A;  3V8J A;  4QT7 A;  3QSU A;  4QKU A;  5GAN j;  1YJN Q;  2EJ9 A;  3SWN B;  1GCQ C;  3HHT B;  2NUT A;  2DL7 A;  3ULR B;  4XQ3 A;  2AKK A;  1WHJ A;  1K9M R;  4XTW A;  3S3M A;  2MK5 A;  2ABL A;  2ED0 A;  5HY6 A;  1UEC A;  4Y92 A;  4BI8 B;  2KQW A;  4C92 E;  1Q7Y C;  3CCL Q;  1ZSZ A;  3EAE A;  2COZ A;  2DBK A;  3BE3 A;  2IG0 A;  1KHI A;  2CUD A;  4II1 A;  2QDY B;  2R58 A;  1QW1 A;  3O8V A;  3VRY A;  2EIF A;  2SRC A;  1N5Z A;  1KC8 C;  1YJ9 Q;  1ARK A;  3JCM W;  4E7H A;  2SEM A;  2NUT B;  2OAW A;  5KH6 A;  2DIG A;  2EAY A;  3F70 A;  4C0Z A;  4M75 D;  2MYS A;  3HRS A;  3I5S A;  3G4S T;  4JUV A;  3CCE A;  2C06 A;  2EW3 A;  3CPW P;  2FL7 A;  2LQ8 A;  3PMT A;  2KK4 A;  2DER A;  3QZ5 B;  1UHF A;  1ZSZ B;  3QXE B;  5GAM f;  4JZ3 A;  3CCR A; 
#chains in the Genus database with same CATH homology
 2CSQ A;  1UFF A;  2RQW A;  4GLM A;  1ZUK A;  2GTO A;  2KGT A;  4F14 A;  1AWX A;  1YCS B;  2FPF A;  3H0H A;  2KR3 A;  4F16 A;  1FYN A;  1LCK A;  1X6B A;  4AG2 C;  2KRS A;  3NMZ C;  3VRZ A;  3C0C A;  2YUO A;  2HBW A;  1Z9Z A;  2FPD A;  1W70 A;  1NYG A;  5IXF A;  2LCS A;  5IXB A;  2O9S A;  4J9G A;  1MV0 B;  2W10 A;  2DL8 A;  2VWF A;  3H41 A;  2EVR A;  2J7I A;  1WXT A;  3NPF A;  1NLO C;  3SHW A;  1RUW A;  1AZE A;  1IO6 A;  1JO8 A;  1QCF A;  1UGV A;  1OOT A;  1UG1 A;  3VS3 A;  2KT8 A;  1WA7 A;  1WYX A;  2KEA A;  1QKX A;  4JJD A;  1AZG B;  2RQU A;  1T0J A;  2EQI A;  4K11 A;  2EGE A;  4HVV A;  2CRE A;  1SSH A;  2DJQ A;  1V1C A;  2M51 A;  1UHC A;  2HDA A;  3LH5 A;  1GL5 A;  2DIL A;  2JTE A;  4RTX A;  4D8D A;  2BZ8 A;  1K76 A;  2D8H A;  2DX1 A;  1CSK A;  2GGR A;  2LJ0 A;  1XOV A;  2VKN A;  1T3S A;  1WXB A;  2K6D A;  1VYU A;  2YUP A;  1WX6 A;  1X6G A;  2B86 A;  2ESW A;  1M8M A;  1X69 A;  1M3A A;  1U5S A;  2DM1 A;  2EYZ A;  1ABO A;  2AZS A;  3VS5 A;  1K0S A;  2C0T A;  1GBR A;  2PTK A;  2C0O A;  2EYW A;  2DYB A;  4J9B A;  2DE0 X;  1JU5 C;  1QWE A;  1W6X A;  2EYX A;  2DL4 A;  2OI3 A;  1TUD A;  2LQN A;  4RUG A;  2YUN A;  3VS6 A;  5IHK A;  3FJ5 A;  2HSP A;  1WI7 A;  1KIK A;  1PKT A;  5IH2 A;  4HCK A;  1YP5 A;  4J9I A;  2D8J A;  2HCK A;  2LZ6 B;  2FPE A;  2FG0 A;  5FW9 A;  1QKW A;  4F17 A;  1FMK A;  2AK5 A;  2EGA A;  3EG1 A;  2KE9 A;  2EPD A;  3QWX X;  2GBQ A;  2FRW A;  2H8H A;  3VS0 A;  2GNC A;  2L2P A;  2KYB A;  4OMQ A;  2PZ1 A;  2J05 A;  2MOX A;  4D8K A;  1B07 A;  1WIE A;  1GCP A;  1WDX A;  2DRM A;  4AFS C;  3REB B;  2J6K A;  3M0R A;  1QWF A;  3REA B;  1KSW A;  2RQV A;  4RTT A;  5ECA A;  4DEX A;  3VS1 A;  3EG2 A;  4M4Z A;  2KYM A;  1U06 A;  2OJ2 A;  2CH4 A;  2ECZ A;  2MIO A;  2V1R A;  3NHN A;  1T0H A;  3I35 A;  4LN2 A;  2W0Z A;  1RLP C;  1ZSG A;  2A36 A;  1TUC A;  2D0N A;  3ZL7 C;  1CKA A;  5EC7 A;  1X2K A;  3UA6 A;  1JXO A;  1JXM A;  2CT3 A;  1K9A A;  3M0Q A;  1QLY A;  2LQW A;  4WCI A;  3EG3 A;  2ENM A;  2A08 A;  1GBQ A;  2DF6 A;  3THK A;  3RNJ A;  4RTU A;  4CC2 A;  3R6N A;  3JV3 A;  3GBQ A;  2MCN A;  2M0Y A;  1Y57 A;  1VYT A;  1AD5 A;  1M3C A;  3A98 A;  1X27 A;  1TG0 A;  4HXJ A;  1H3H A;  4ZNX A;  3M0T A;  5GJW B;  1ZX6 A;  1S1N A;  1T3L A;  2L3P A;  1NG2 A;  2G6F X;  1RI9 A;  2D1X A;  2KT1 A;  2C0I A;  3M0P A;  1GRI A;  2AZV A;  3VS7 A;  4X1V A;  3PVL A;  1JQQ A;  2KXC A;  4J9D A;  3TSW A;  2DL3 A;  2O88 A;  1HSQ A;  2JM9 A;  4CC4 B;  2DRK A;  2LJ3 A;  1W1F A;  2CUB A;  2JMA A;  1RLQ C;  4J9E A;  3I5R A;  2DBM A;  3IQL A;  1PHT A;  3I9Q A;  1B3Q A;  2IIM A;  2K3B A;  1E7O A;  3KFV A;  1ABQ A;  3TVT A;  1I07 A;  2LNH B;  5L23 A;  5HCK A;  3SEM A;  2RF0 A;  2KNB B;  1AOJ A;  4EIK A;  4Z89 A;  4RTW A;  2EGC A;  2O31 A;  2A37 A;  1NEB A;  2CT4 A;  1YN8 A;  2JM8 A;  2BTT A;  2YDL A;  2QDL A;  2DNU A;  4CC3 A;  4LUD A;  4Z88 A;  1AWW A;  2E5K A;  4IIO A;  2DVJ A;  1WLP B;  1ZUY A;  2ROL A;  4JZ4 A;  2K79 A;  2K2M A;  1YWO A;  2EBP A;  2RPN A;  2YUQ A;  3CQT A;  1WFW A;  2RQR A;  1MUZ A;  3VS2 A;  1BB9 A;  1YNZ A;  1E6G A;  1VYV A;  4ESR A;  2RQT A;  1SHF A;  1J3T A;  1I1J A;  4JJB A;  3H0F A;  1GFC A;  4OMN A;  1UE9 A;  4RTY A;  4AFZ C;  2CDT A;  3M0U A;  4JJC A;  2K9G A;  3QWY A;  1PNJ A;  1G2B A;  1UTI A;  1M3B A;  2ED1 A;  2GQI A;  2JS0 A;  2LJ1 A;  2KBT A;  2J06 A;  4IIM A;  1AVZ C;  1Y0M A;  2JMC A;  3UAT A;  3EG0 A;  1NLP C;  1HJD A;  1GFD A;  5FWB A;  2CH4 W;  2J6F A;  4LE9 A;  4ORZ A;  4J9F A;  2BZY A;  2L3Q A;  4OMO A;  1AEY A;  2F2V A;  2RNA A;  2L3S A;  5FWC A;  1UUE A;  1SEM A;  3EHR A;  4J9H A;  3NGP A;  1X2Q A;  2J6O A;  2VVK A;  2RMO A;  1SRM A;  1UJ0 A;  4Z8A A;  2P4R A;  4HVU A;  4LNP A;  3RBB B;  2NWM A;  1SPK A;  2DLP A;  1SHG A;  3TSZ A;  4HVW A;  3H0I A;  2L0A A;  4GBQ A;  3O5Z A;  5I11 A;  2GTJ A;  3U23 A;  2CSI A;  2DMO A;  2DA9 A;  1UJY A;  1HD3 A;  1MV3 A;  4R0K A;  1NYF A;  4AFQ C;  2HEQ A;  2JS2 A;  3EHQ A;  2BZX A;  4RTZ A;  1E6H A;  1ZBJ A;  1JEG A;  2JW4 A;  3VS4 A;  2KRO A;  1WXU A;  1H92 A;  2JXB A;  4LUE A;  1K1Z A;  1KJW A;  1GCQ A;  2AKL A;  1BU1 A;  2XMF A;  3PE0 A;  4A63 B;  1UDL A;  2ROT A;  4J9C A;  1U3O A;  1EFN A;  3M0S A;  2FRY A;  2DL5 A;  2KRN A;  2F2W A;  4DEY A;  4AFU C;  1H8K A;  5GJV B;  1AWO A;  1G83 A;  1AWJ A;  1PRM C;  4OMM A;  1X43 A;  2PNI A;  2FO0 A;  1VA7 A;  2X3W D;  4QT7 A;  2NUZ A;  1NEG A;  1BBZ A;  4RTV A;  1BK2 A;  2I0N A;  1GCQ C;  2DL7 A;  3ULR B;  1PKS A;  1Z9Q A;  2AKK A;  5I22 A;  1M30 A;  1PWT A;  2F2X A;  2O9V A;  2ABL A;  2ED0 A;  4FSS A;  1YWP A;  2KRM A;  1UEC A;  2RN8 A;  2X3X D;  4Y92 A;  2EKH A;  1A0N B;  1OPL A;  4CC7 A;  1M27 C;  2YT6 A;  2LX7 A;  2FEI A;  4OML A;  2DBK A;  2KXD A;  2CUD A;  4KRT A;  1OEB A;  3UA7 A;  4E6R A;  2EYY A;  3VRY A;  1KFZ A;  2SRC A;  1N5Z A;  2YSQ A;  1ARK A;  2O2O A;  2SEM A;  4OMP A;  2OAW A;  1OPK A;  5IHN A;  3UF4 A;  2V1Q A;  1I0C A;  3EGU A;  1NM7 A;  2JT4 A;  3I5S A;  2A28 A;  1ZUU A;  2LMJ A;  1SRL A;  2EW3 A;  5IHI A;  2LP5 A;  1K0X A;  1ZLM A;  1UHF A;  4AG1 C;  4JZ3 A;  4JPB W;  1K4U S;  1CKB A;  3PVQ A;  2K7A A;  1PRL C;  1OV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...