2EGCA

Solution structure of the fifth sh3 domain from human kiaa0418 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
GSSGSSGNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the fifth SH3 domain from human KIAA0418 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SH3 and PX domain-containing protein 2A
total genus 6
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egcA00
1QKWA 2KXDA 2KT8A 1M3AA 2K3BA 4J9GA 4J9CA 2A08A 1PKSA 1WFWA 1YN8A 4J9IA 2HEQA 2L2PA 2O31A 4OMLA 2EGAA 2CREA 1AWOA 1HD3A 4HXJA 1AOJA 1H3HA 2EVRA 4ORZA 1MUZA 4F16A 1OEBA 1XOVA 2C0IA 3I5RA 2RPNA 3O5ZA 2DRKA 1KJWA 2O9VA 1VA7A 2L0AA 4LUDA 1WLPB 2DL4A 2AKLA 1GCQA 2BTTA 1M3CA 3PVQA 2I0NA 4QT7A 3FJ5A 1UJYA 1NM7A 3TVTA 3TSWA 1IO6A 1GCQC 2H8HA 3UATA 2B86A 4F17A 1BB9A 3H0IA 1ABOA 2DLPA 2YSQA 1G83A 1NLPC 2LX7A 2YT6A 3UA7A 2KEAA 2A28A 1ZSGA 2J6OA 3NHNA 1T0HA 3I5SA 2DX1A 2FG0A 3RBBB 1CSKA 4OMOA 2EW3A 2SEMA 2K7AA 4JZ4A 1AWXA 2DL7A 2KNBB 4Y92A 2IIMA 2D1XA 2MCNA 1K0XA 2GTOA 3QWXX 3NPFA 3H0HA 5I22A 1U06A 2K79A 4RTUA 2YUOA 4HVVA 5FW9A 5IHNA 3VRZA 4GLMA 1CKBA 1SSHA 2DL3A 2GBQA 2GGRA 2V1QA 3QWYA 4M4ZA 1U5SA 2RMOA 1WI7A 4DEXA 1S1NA 1M27C 1SHGA 3NGPA 2DNUA 2PNIA 1Y0MA 2GQIA 3SHWA 1YP5A 2QDLA 2JM9A 2CSIA 1AWJA 2KRMA 2BZXA 2F2VA 2EYZA 1T3LA 2FO0A 2HDAA 1WIEA 2YUQA 2DL8A 2FRYA 1UTIA 3R6NA 4WCIA 2AK5A 1WXUA 2KRSA 4JZ3A 1BU1A 2DF6A 2CUBA 2VVKA 4RTZA 1YNZA 2LJ0A 1M30A 1BK2A 2EPDA 1GFDA 2D8HA 4JPBW 2YUPA 3THKA 3JV3A 2HBWA 2JM8A 3IQLA 2ROLA 3VS4A 3VS7A 1AD5A 1J3TA 1HJDA 1NEGA 4ZNXA 1UDLA 5FWCA 4AG2C 2DMOA 4AFZC 2RF0A 2F2WA 2O2OA 4Z88A 4K11A 2KE9A 2CSQA 2K6DA 1QWFA 1M3BA 1YWPA 1GL5A 1PWTA 1SEMA 4RTVA 1JO8A 5IHIA 4D8KA 1OPLA 1I07A 1ZUUA 1UGVA 2J05A 1QLYA 3UF4A 4X1VA 1I1JA 4DEYA 3LH5A 1E6HA 2V1RA 1RUWA 2X3WD 3VS3A 5GJVB 1MV0B 4LE9A 4RTTA 4CC7A 5HCKA 4KRTA 1W6XA 3SEMA 1OV3A 2JMAA 3EHQA 1QKXA 2NUZA 1NG2A 3EG3A 5IXBA 5FWBA 1BBZA 3EG0A 4CC3A 1UHFA 2LNHB 1W1FA 2BZ8A 2PZ1A 3EGUA 1ABQA 1LCKA 1T3SA 1CKAA 2C0OA 2YUNA 3H0FA 2CT3A 2EYXA 2DYBA 1MV3A 2VKNA 2RQUA 1PKTA 1HSQA 2MIOA 1AVZC 2DJQA 1AEYA 3TSZA 2ROTA 1ZLMA 1Z9ZA 4OMQA 1PRLC 2KYMA 2AKKA 1QCFA 1KSWA 2JXBA 1PNJA 2GTJA 2DBMA 3VS1A 2D0NA 2W10A 2FEIA 3EG1A 1Y57A 5ECAA 1JXMA 2ESWA 2DILA 1YWOA 2DVJA 4LN2A 1JU5C 2EQIA 2J6FA 2O88A 1NEBA 1X2QA 2EKHA 4AFUC 1UUEA 2JMCA 4Z89A 2VWFA 2LZ6B 3U23A 1KFZA 1RI9A 2GNCA 1JXOA 1PRMC 5IXFA 2OI3A 1H92A 3CQTA 3M0RA 2KBTA 1SPKA 4FSSA 2DA9A 4HCKA 2OAWA 2DM1A 1VYUA 2KRNA 2X3XD 1K4US 3I9QA 1X2KA 2EYYA 2EGEA 1SRLA 3M0TA 1RLQC 2ECZA 2M0YA 3I35A 3M0SA 2DBKA 4AG1C 1K76A 1GRIA 4J9EA 1UECA 1ZUKA 4R0KA 2A36A 4RUGA 3REAB 2SRCA 2FPDA 1FMKA 1N5ZA 2O9SA 4HVWA 1PHTA 1TUDA 2BZYA 4Z8AA 4JJCA 3VS0A 4RTXA 1YCSB 2CH4A 5L23A 2NWMA 1GBRA 2XMFA 1UG1A 2KXCA 2F2XA 1NYGA 2J06A 2MOXA 4CC4B 1AZEA 1X6GA 1WX6A 3H41A 1V1CA 1T0JA 1I0CA 2FPEA 1SRMA 2J7IA 2RQWA 1TUCA 4OMMA 2L3PA 2FPFA 4RTYA 2PTKA 4LUEA 1ARKA 1TG0A 3EG2A 2RQTA 1ZUYA 3A98A 2KT1A 3KFVA 3M0UA 3RNJA 1ZBJA 4JJDA 2AZSA 2KGTA 1B3QA 2ED0A 2J6KA 2M51A 3C0CA 1G2BA 2LMJA 1X27A 2P4RA 2L3SA 1K1ZA 4A63B 2ED1A 2LJ3A 2EGCA 3VS2A 3VRYA 1AZGB 2JS0A 4J9HA 3M0PA 4ESRA 2CUDA 5GJWB 2LP5A 4RTWA 4D8DA 1VYVA 3UA6A 2LQNA 1X43A 2JTEA 3PE0A 5IH2A 3VS6A 1K0SA 4OMPA 1X6BA 4AFSC 2LQWA 4LNPA 5IHKA 4HVUA 2DL5A 2JT4A 1U3OA 1VYTA 4EIKA 1OOTA 2JW4A 1E7OA 3ZL7C 2EYWA 2KR3A 2RN8A 1GFCA 2JS2A 1WXTA 1M8MA 2OJ2A 1UFFA 2KROA 5I11A 1OPKA 3VS5A 2C0TA 1NYFA 1H8KA 2CT4A 4E6RA 1AWWA 1GBQA 2K9GA 5EC7A 2RQVA 1W70A 4J9BA 1UHCA 2W0ZA 2LCSA 4CC2A 4J9DA 2KYBA 3EHRA 4J9FA 1Z9QA 1GCPA 2RNAA 2K2MA 2HCKA 1B07A 2DRMA 1KIKA 4OMNA 1WXBA 1RLPC 4F14A 1JQQA 1WYXA 2ENMA 2CH4W 2LJ1A 1NLOC 2A37A 2ABLA 4IIOA 1X69A 2L3QA 3NMZC 1FYNA 3REBB 2HSPA 2DE0X 1JEGA 1EFNA 3PVLA 4JJBA 1E6GA 4IIMA 1UJ0A 2E5KA 2FRWA 1WA7A 4GBQA 4AFQC 1SHFA 3M0QA 2AZVA 2G6FX 1WDXA 2CDTA 1QWEA 3GBQA 1A0NB 3ULRB 2D8JA 1ZX6A 1UE9A 2RQRA 1K9AA 2EBPA 2YDLA
chains in the Genus database with same CATH superfamily
2R5MA 4XU3A 4PL6A 4J6XA 3JCMe 1LVKA 1BI2A 4L6V5 1WFWA 2Y4YA 2Z0WA 3ER0A 2L2PA 4N0AC 2O31A 4F7UB 1VQ5A 2DIGA 3I55T 3P8DA 1HD3A 4L5GA 4HXJA 4ORZA 3PIPA 2RJFA 4HT8A 3EG9A 2ZPHB 3KBGA 3PGGA 4C8QE 2RPNA 3MHXA 1BCOA 2AKLA 1GCQA 3PVQA 3TVTA 5GMKe 2OTLA 4MMLA 4M7AG 1RAGB 3H0IA 1ABOA 2LT1A 2YSQA 2OX7A 2FHDA 5KYYB 1G83A 4JRIA 4FSXA 4PJOA 1VQ8Q 2YRVA 1ZSGA 1UB4A 4BI8B 1T0HA 4PJLA 2FG0A 3RBBB 2CS7A 4KBMB 4EMKB 4OMOA 4C92C 2SEMA 1AWXA 3A8LB 2KNBB 2HKNA 2IIMA 2MCNA 3JCMP 1K0XA 4KULA 4RCBA 3QSUA 2XD0A 4M7DA 5FROA 4EMHA 4JRQA 1K9MR 4F7UE 3CC2A 1JRIA 4C8QB 2M9UA 5KYXB 2DL3A 1UEBA 4OGEA 1VQLA 1KHCA 1VQ5T 3OYLA 2WSCE 2PNIA 1Y0MA 2GQIA 2QDLA 2QA4T 2JM9A 2CSIA 4M75B 1NBEB 4XTYA 1D1CA 1T3LA 1WQWA 1WIEA 2EKOA 1YJWT 1UTIA 4WCIA 2AK5A 1WXUA 4C92B 2F5KA 4JZ3A 3GPLA 4FYWB 3V8KA 1WJRA 2LJ0A 3MP8A 1M5Q1 2EPDA 1OU8A 2VGNA 3E19A 2JM8A 2GCXA 1BYMA 2CP7A 2HQXA 2ZPIB 4XTVA 4M7DD 3CBPA 2O4XA 1JJ2P 1UDLA 3SWNC 3JCMc 3EFOB 5GAMh 2CP5A 4PJOC 3E9GA 4OP0A 4M7AA 3C95A 1M3BA 1YWPA 1PWTA 1SEMA 3J7AF 5IHIA 1UGVA 3PT9A 4M78C 5CKDA 1B34B 1KK7A 3LH5A 1E6HA 2X3WD 1TTHB 3VS3A 2HD0A 5GJVB 1MV0B 4C92E 4M7AF 1KQ1A 5GMKh 4FW2A 4PJJA 3CCJA 3EHQA 4NL2A 3OB9A 4NOYA 4OB0B 3BFMA 1VQ6Q 1BBZA 5LJ3d 3EG0A 1IB8A 3NFCA 3LX7A 5HKCA 1BI0A 3UT1A 1LCKA 1B34A 1CKAA 2MI6A 3OYYA 1ZA2B 3H0FA 3QHSA 4KT0E 1RACB 1RL2A 3BY7A 1NE8A 4BY6C 3GOXA 2VKNA 4XQ3A 3Q1JA 1HSQA 2CZ0B 1VQ4Q 3HFOA 1KC8U 2FB7A 1G8XA 1D0XA 2ATCB 3QG1A 1PRLC 2AKKA 1QCFA 1PNJA 2LRQA 1VQ7A 3ME9A 3VS1A 2KVQG 2D0NA 2W10A 3EG1A 3JB9H 5ECAA 2DILA 4M78F 4XTWA 3RUXA 3L2RA 2J6FA 2O88A 3A1PA 4Z89A 4QQ6A 3JCMW 1PC0A 5LJ3h 1RI9A 2P0PA 2YRDA 1O9SA 3CCLA 3L2ZA 2OI3A 3JAME 3DB3A 2M16A 3CQTA 3M0RA 1RABB 3HP9A 4M78A 2QA4Q 1SPKA 5C0MA 3MCAB 3M5AA 1X2KA 2QI2A 1VQLT 2EGEA 2V8IA 1SRLA 3M0TA 4FL6A 3JB9I 1M8VA 2ECZA 3M0SA 3OBYA 1BI1A 2EJGA 4C0GA 2RHYA 3GLXA 3LLRA 4NL3A 1Q82R 2SRCA 2F69A 1TXQA 2YXYA 2XG8D 1VQMA 4IUUA 5GAMd 3CXCS 3EH2A 4FT4A 3V7CA 3MO8A 2D0QB 2NLUA 1WHGA 5L23A 3OW2A 2E70A 2XMFA 1UG1A 1GBRA 4DBHA 1OZ3A 1AZEA 3G6ET 1V1CA 1QVPA 1SRMA 5GAOm 2RQWA 3MPUB 4OMMA 3VUZA 2MMPA 4ZTFA 4BD3A 4WF2A 1M4ZA 4LUEA 1KQSS 2RQTA 4QVZA 4BUGA 2LCCA 1WHHA 2KT1A 3KFVA 3RNJA 1OULA 1ZBJA 4JJDA 4J7FA 1IHWA 4PJOG 4M77E 3QZ5B 1X27A 2QGGA 2X9HA 1QVFA 2Y90A 4A63B 4MDXA 2JS0A 1X75C 2CUDA 5GJWB 1PM3A 1NPPA 2E1HA 1VQ9Q 4F7UA 5GANj 2QTVA 4LDWA 4M7DE 5IH2A 1K0SA 1QP2A 1O75A 3MP1A 1VUBA 2CZ6B 2E10A 2X4YA 4OF1A 5IHKA 4HVUA 1EZZB 4LDVA 2HL5C 1U3OA 1VYTA 1BIAA 1OOTA 1Q95G 2ZPBB 5KCHA 1D0ZA 5LJ5j 3OYIA 4PFOA 3SB2A 1V76A 2JS2A 5KYWB 1M8MA 5HK0A 1OI1A 1UFFA 4ELYC 1IREB 3TEEA 3OYJA 3G71Q 4E7IA 1VQKT 4A4FA 2QQBA 2K4YA 3CXCA 1AWWA 1GBQA 1W70A 4J9BA 1UHCA 3TCJA 4UC4A 2KY9A 4CC2A 2PUOB 4PK4A 1I8FA 3OSSC 2HSEB 3TREA 2KSSA 2DRMA 4VUBA 3CCUA 4OMNA 2LVMA 3HRTA 3M58A 2ENMA 2CH4W 5CIUA 1NLOC 4C92G 4QW2A 2L3QA 3NMZC 4C92D 2K5FA 3MP6A 5LJ5h 2DXUA 3PVLA 3NTKA 2DEQA 4PKCC 1KQSA 1AHJB 4IUVA 3M0QA 5GAMf 2RJDA 3GBQA 3L1AA 1A0NB 2D9TA 3OQ5A 4BDYA 2RQRA 4OB2B 2EBPA 4E47A 2YDLA 1K73U 4BB7A 2KT8A 1VIFA 1IRXA 3QIIA 4J9CA 2A08A 1PKSA 4J9IA 3RR6A 2CREA 1AWOA 1AOJA 1H3HA 1QMCA 3OYKA 4C0DC 4F16A 5KE2A 2AT1B 4C8QD 1XOVA 2DTOA 5KYUB 1UGSB 2DRKA 4E7HA 1VQNT 2XDBA 5CCAA 3OW2P 3EGXA 2DL4A 3LGFA 3L2VA 1M3CA 1RADB 2I0NA 3FJ5A 3X26B 1IO6A 3UATA 2B86A 2WSEE 3LH0A 4R55A 3SWNA 2R57A 1NLPC 2YT6A 2MWOA 4IURA 5LJ3g 2COZA 3I5SA 5CKFA 2KK4A 1VQ9A 4M7AC 4RCCA 3CCMT 3BDLA 3H8ZA 4OMFB 2DL7A 4II1A 5J39A 2GTOA 3ZFJA 4F7UG 1M1KR 3H0HA 5FU6B 3PFSA 1U06A 3RESA 2K79A 4RTUA 4QVDA 2XIDA 2YUOA 3CCQT 5FW9A 1Q82U 5LJ3f 4M4ZA 2OTLQ 3MKDA 1D3BA 2RMOA 3WXMB 2HMAA 3NGPA 4BI3A 2DNUA 2KMTA 5IAYA 1AWJA 4LDUA 2BZXA 2F2VA 2LT4A 2OAUA 1PSEA 1VQNQ 3OYEA 3S3NA 4A4EA 3E1SA 5C6SA 4C5EA 1QVGA 2A0FB 5GANg 3R6NA 3M54A 5GAMe 3QKJA 2VVKA 3QXEB 1YNZA 2D6FA 1WHLA 4ZTJA 1M30A 1VQMQ 3GNFB 1BK2A 2D8HA 1Q81U 1TWBA 3UWNA 1VQNA 2ZPGB 3L42A 2YUPA 4M7AD 3OS2A 2GQVA 3THKA 1OYXA 3GNGA 1VOMA 4J7IA 2DK3A 1HJDA 1NEGA 3MEUA 1M90R 3F70A 4OB1B 3MEWA 2DMOA 4JRKA 2EQUA 5KH6A 2F2WA 1RAAB 2PQWA 2HL3A 2IPOB 1LNXA 3QJ6A 3CCQA 3CD6T 4RTVA 2VV5A 1QVFP 3L2UA 4D8KA 1OPLA 3CCLQ 1YIJQ 2RJCA 5GAN3 2QEXQ 3ZEHA 4XAXB 4M7DF 5KYUA 2IVWA 4DEYA 2V1RA 2EFIA 4LE9A 3LGLA 1MMAA 5HCKA 1W6XA 3SEMA 1XTDA 1OX9A 1B7TA 2WSFE 3INZA 1M1KC 2DZ9A 5FWBA 4B6MA 1H3ZA 4L59A 1N9SA 4ANJA 4CC3A 3PMIA 1UHFA 9ATCB 1W1FA 2R58A 4HA8A 1ABQA 1T3SA 1YBYA 1U1SA 2E65A 2YUNA 1WZOA 3CC7A 2QEXA 4F7UF 1M90C 3S3OA 2BE9B 1MV3A 2RQUA 5GAMj 4PLIA 1PKTA 5J26A 1AVZC 3WVEB 3SD4A 4DBQA 3BDUA 3CBOA 3P8BB 1ZLMA 1ZBXA 1WHKA 3HL8A 3OS0A 2E6NA 1YITT 2DBMA 4X9DA 4E7JA 2G3RA 1UGPB 4PJOD 5A0GA 3CCVA 3JCMJ 3O8VA 1FMVA 3S6WA 2BIVA 2L8DA 2EQIA 3OS1A 2EKHA 1M90U 5I2MA 3V7RA 1MMDA 5J3BA 1GXIE 2FZGB 3U23A 4J6YA 4N4HA 1KC8C 2GNCA 4JLIA 1JXOA 2FZCB 7AT1B 1XJWB 2KQWA 4C5GA 1YI2A 2KBTA 4FSSA 4J6WA 2DA9A 2L5QA 2XDDA 2HQHA 1M2VB 2X3XD 5LJ5f 2DETA 4KGZB 1VQOT 1BCMA 2EYYA 3EFRA 3VV0A 2F1LA 1Y96A 3I35A 3G4ST 4AG1C 1K76A 1GRIA 2A36A 4LDYA 4RUGA 2CGHA 3CCVQ 3SFMA 1RAFB 2O9SA 2QQAA 4KGVB 3M4YA 5CO7A 2BZYA 4GLKA 3VS0A 2OTLT 2ZPFB 3G71A 3OW2S 1YCSB 1VQPA 2CH4A 1OZ2A 4A4KA 1QVFS 5AYFA 5CKBA 2O4XB 2COWA 1WX6A 1T0JA 4KH0B 1TUCA 2FPFA 4B9XA 4CI0C 4RTYA 4NS5A 5CQXA 2PU9B 1ZUYA 3A98A 2VUBA 3FJPA 2AZSA 2ED0A 2M51A 3QYGB 3M55A 1G2BA 2P4RA 3M59A 2L3SA 3X28B 4CRIA 2B8AA 3EGXB 2NUPB 2DJZA 2HQEA 3VS2A 4A53A 1HXDA 3JCMd 4PNOA 1QCNA 1I4K1 1VQ6A 2JTEA 3PE0A 4HT9A 1X6BA 4M75C 3RERA 3OMGA 3I56T 1WJSA 2QTXA 4C8QG 2JT4A 4EIKA 4FYYB 1Y71A 1TU0B 2KR3A 2RN8A 1PD0A 3CC4A 1WXTA 2MF2A 4E7ZA 2QEXT 1ZHIA 2KROA 2ZPEB 5I11A 5GAN8 3VS5A 3OYNA 3CCMA 2CT4A 1YI2Q 3HRSA 1I5OB 5CAIA 5DM7R 1M9SA 3OS5A 2RD1A 5LJ5e 3HRUA 1M1GA 4M77C 4PFZA 4IUPA 5GMKm 4J9DA 2KYBA 4J9FA 1GCPA 3EH1A 1KIKA 1ZSZB 1RLPC 2RK2A 3C94A 2R5AA 5D6XA 1WYXA 2K3YA 5IT9E 2A37A 1OX8A 2AIRB 4E2FB 2RI2A 1FYNA 1EIFA 2OTJT 1KQSP 4M78B 3V8JA 1EFNA 3CPWP 2BUDA 1D0YA 4Y91A 1QCOA 1WA7A 2K2VA 2FVUA 4JS4A 4AFQC 5GAN7 3JCMf 3M56A 5FLXE 1WDXA 2EWNA 2CDTA 3JSCA 5M9OA 1TUGB 1W2BP 3ULRB 1VQ9T 2D8JA 3PMTA 1UE9A 1BIBA 4FM4B 1VQOA 1QVGP 3QPHA 3OBWA 2XHCA 5GMKj 1Q86C 1LJOA 1QKWA 5DY9A 2KXDA 1M3AA 1WNLA 2ZGWA 3QUIA 5GAN5 4BDZA 1YN8A 3FIFA 2EGAA 4OMLA 2QASA 4DOVA 3H6ZA 1MUZA 2CKKA 4PFPA 2DVEA 1VQOQ 1IHVA 3A8OB 3O5ZA 1N6AA 3G1JA 3EFOA 1KJWA 3JCMh 4LUDA 1WLPB 3T9NA 4DA4A 4FYVB 4FT2A 3CCQQ 3EFSA 1VQPT 2XICA 3CPFA 5GAN2 1Q7YR 3TSWA 1BKBA 4PLLA 1GCQC 1X01A 4F17A 1M1KU 1BB9A 3I56Q 1K8AR 4JS5A 4FW1A 2RM4A 1TS9A 1RAHB 3LWIA 4PJOE 3G7ZA 3R6OA 4RG2A 3A8HB 3PTAA 3PNWC 1CSKA 4C0ZA 3RDVA 2EW3A 2VGMA 4M7DC 4OGCA 3CCJT 1PD1A 1I5LA 4YTLA 3BE3A 2QGFB 2KDSA 3QWXX 5I22A 3J80E 1LOJA 3MEVA 4HVVA 2H3JA 2LCLA 5L8RE 1SSHA 2V1QA 1TOVA 2GBQA 4B9WA 2DIQA 4M77D 3CC4Q 4OVAA 1U5SA 2X35A 3VU3C 1M27C 4EDUA 1SHGA 1Q81R 3SHWA 5GMKi 1NZ9A 1N9RA 3L2WA 1YCYA 2KRMA 2EYZA 2FO0A 2RHUA 2HDAA 2Y4XA 2YUQA 2DL8A 3CPWA 1KD1C 2DF6A 1D1BA 4V2SA 5D7UA 2DD5A 4M75D 3C4SA 4EPCA 1GFDA 3MJXA 3UPUA 3GIBA 4JPBW 1P92A 3JV3A 2HBWA 2ROLA 1W2BS 1J3TA 1Q7YU 4ZNXA 5FWCA 2BE7D 2FL7A 3FC3A 4AFZC 1VQLQ 2O2OA 4PJNA 2KE9A 2K6DA 1QWFA 1GL5A 4N4IA 2EIFA 1FX7A 2EAYA 2EQJA 2NYSA 5KYYA 1JB0E 1Q81C 5CQYA 4M75E 1I07A 1ZUUA 3UF4A 4PJOB 1H641 1C0MA 4X1VA 4EMKA 1RUWA 1ZA1B 4RTTA 4LD9K 5DLQE 4CC7A 2HKQB 3VYGA 1K9MU 2YLBA 3P8HA 5HY6A 3RKXA 1K9MC 1QKXA 3M4GA 3X25B 2P4TA 3JB9G 5IXBA 4J83A 1MGQA 5A0DA 2RH2A 2JOYA 3CCJQ 1C1AA 2HAXA 2LNHB 3JCMV 2BZ8A 2LQ8A 4GY5A 2NUPA 2CZ1B 3EGDB 4LXCA 2C0OA 3TQ7P 1JJ2S 3JB9J 2EYXA 1YJNT 5D6YA 3QDRB 2MIOA 4XTZA 2DJQA 2JN0A 1K8AC 1ZSZA 4M7AB 2HBPA 3CMET 3TSZA 4FU6A 2QYZA 2ROTA 1Q7YC 1Z9ZA 3MEAA 4OMQA 4X9CA 2KYMA 2X4XA 5GANh 1VQ7T 2JXBA 1G5VA 3EGDA 2FEIA 1Y57A 3VKIA 4A54A 1MMNA 1KD1R 1YWOA 2DVJA 3I55A 2E3IA 2X4WA 4IUQA 3CCUQ 1X2QA 2JMCA 3CMEA 3CCSQ 3LYIA 3OYBA 1G3TA 3C12A 2L3RA 1YHQT 5GANd 2XK0A 2KI7A 3DKMA 5IXFA 3CCLT 1H92A 1WJQA 3CBMA 2LQKA 2QA4A 2LDMA 2X4JA 4HCKA 2DXCA 3JCMQ 2OAWA 2DM1A 2P0KA 2EQMA 1K4US 1W4SA 3H9NA 3CEYA 4M75G 5GAOn 4M75A 3JCMX 2NUTA 4KH1B 1RLQC 2M0YA 4M77B 3VJPA 2DBKA 5FU7B 3VYHB 1LPLA 1UECA 1ZUKA 4R0KA 2LX9A 2RO0A 1FMKA 1PHTA 1TUDA 2MAMA 3V7SA 2DPPB 2MPXC 1VQ4T 1G3WA 3N5BB 5KE3A 4M75F 4XK8E 2NUTB 1UGQB 2E6ZA 1NJIC 1K8AU 3OY9A 3TU4K 4M77A 4XTUA 2MOXA 2VYTA 5LL6S 1X6GA 1YIJA 1I0CA 3DLLA 1MNDA 2J7IA 1N8RR 3FLGA 3JB9F 2M0OA 4Y28E 4JDSA 2DERA 2V8KA 4WTOB 2RHIA 4JRPA 2O01E 3CCRQ 3CCRT 1TG0A 4ZGEB 2DXBA 1M2VA 3QBYA 4O5VA 5FU7C 1KQ2A 2RJEA 5FRNA 2RA2A 2KGTA 3OYDA 2CZ7B 1K1ZA 1N27A 2LJ3A 4C8QF 4DBFA 1Q86R 2PVDB 4D6WA 2QDYB 4J9HA 3QZ9B 4ESRA 2KAFA 4RTWA 3CXCP 1YI2T 2RHXA 1VYVA 1ACMB 2CP2A 2VB6A 2LQNA 1X43A 3VS6A 3AHUA 4AFSC 3DLMA 1QP3A 1YJ9T 2LQWA 4LNPA 4M7AE 2DL5A 5GAOl 2VXEA 5KYXA 4R56A 2QAZA 4KGXB 3ZL7C 2EYWA 1X6OA 1YFNA 4N4GA 1NPRA 2RI3A 2DFUA 3OA6A 1S72T 2DEUA 1S72Q 2OJ2A 5CK9A 4A4GA 1YITQ 2CP0A 2P0QA 4QKUA 2C0TA 1NYFA 1H8KA 1YJWA 5CKHA 2QK0A 4E6RA 5EC7A 2RQVA 4BY6B 2W0ZA 5KCOA 4A4HA 3EHRA 5GAN6 2XKOC 1IXDA 1U8RA 2HZYA 2JUFA 3RIRA 2RNAA 1RAIB 1YIJT 1WXBA 2XU8A 4HKEA 2QQSA 1JQQA 4F14A 4BE2A 4OB3B 1VQMT 3OMCA 3CCEQ 2ABLA 3QJYA 4M7DG 1X69A 1VQ7Q 3REBB 2DE0X 2COYA 1JEGA 4ELZC 4X34A 4JJBA 4IIMA 3CC4T 4EMGA 4GBQA 1MHNA 2JVVA 2QQRA 1SHFA 1R8OB 2QXFA 2F5TX 1QQJA 2G6FX 4JUVA 5EG2A 1V29B 3SWNB 1QWEA 3AT1B 1ZX6A 2A7YA 3FB9A 2K57A 2DTIA 1AT1B 4DQ2A 1G3SA 2K3BA 2CP3A 3E2UA 4J9GA 3CCVT 1VQ8A 2HEQA 5IN1A 1YHQA 4FYXB 5LJ3e 2I2LA 1KC8R 2EVRA 1I81A 2XDPA 3QYHB 2OTJA 1OEBA 2LTOA 2QG9B 2C0IA 3JRZA 4MMKA 3I5RA 2E41A 3M57A 4ATOA 1YITA 4LD6A 3GP8A 4O6JA 4RMOA 2O9VA 5FRMA 1VA7A 3JCMg 2L0AA 2DD4A 2VC8A 3ASKA 4ZN1A 1RI0A 3CD6Q 5GAOr 1YJ9Q 1PCXA 2BTTA 5GAOp 2VXFA 2EJ9A 4QT7A 1UJYA 1NM7A 1U1TA 3HFNA 5I2SA 2H8HA 3URGA 3RMSA 2BKDN 2DLPA 3E9FA 1WHJA 3EG9B 3PIOA 2LX7A 3CCET 3UA7A 2K3XA 2KEAA 2A28A 2J6OA 3NHNA 2DX1A 3M9QA 4ZGDB 1IGQA 4QQDA 3OSVA 2K7AA 4JZ4A 2RI5A 1WQ7A 1VIEA 3HTRA 4Y92A 3DB4A 2D1XA 3CMAQ 3G4SQ 3NPFA 2ZAEA 5GMKl 1MNEA 4EMKC 2MYSA 3CPWS 2YRCA 4P5NA 1YHQQ 4XU0A 5IHNA 3VRZA 3I56A 4GLMA 1CKBA 3QWYA 2GGRA 1TSFA 3KXTA 4ZGJB 1K73C 2YWWA 4IUTA 1WI7A 4DEXA 2IG0A 5CKEA 1S1NA 4C8QC 2LC4A 1YP5A 4J8OA 1FWZA 1Y96B 4KUIA 1PSFA 2FRYA 2JNGA 1OQKA 3CC2Q 2V8JA 4AT1B 2KRSA 3OYAA 1BU1A 2CUBA 4RTZA 5HK3A 5LJ5d 4BI4A 4ME7A 4M77G 2M02A 1JJ2A 5AT1B 2DZCA 3IQLA 2JJ9A 1WPYA 3D7SB 3VS4A 5A2QE 3VS7A 1AD5A 3OYMA 2ZCFB 3NTIA 1WGSA 4F04B 4AG2C 5GAN4 2RF0A 4Z88A 2C06A 4K11A 4J5YA 2CSQA 4M77F 3HSBA 5GAMg 1WHMA 4E7SA 2EQKA 1NJIU 2CP6A 3RMQA 3RKYA 3V8LA 1JO8A 1UGRB 1VQKA 2J05A 1QLYA 3KUFA 4BE0A 1W2BA 3LW5E 3CC7T 1I1JA 4E7LA 3BW1A 3CMEQ 3CCSA 4AMCA 4RKUE 3OYGA 3I55Q 4KRTA 1R0CB 1OV3A 2GFAA 2JMAA 2X51A 2NUZA 4MZPA 1NG2A 3EG3A 1VQ5Q 4MZTA 2YHTA 4KUDK 5D6WA 4C8QA 3CCUT 1KG1A 2PZ1A 3EGUA 3CCMQ 3S3MA 5GANf 1SF9A 2DKGA 3A8MB 3CD6A 2CT3A 2DYBA 2PUKB 1HK9A 1AEYA 3LWHA 1KHIA 1BI3A 2OTJQ 4M7DB 1KSWA 1ZSZC 4BE1A 1EX4A 2GTJA 1MMGA 1D09B 3FEOA 2H3EB 2JTMA 5DLOA 2A3LA 1VQ6T 1M1FA 1JXMA 1IGUA 2ESWA 3GF5A 2ZZDA 4ZN3A 4LN2A 1JU5C 2HNIA 1NEBA 4AFUC 1UUEA 4HCBA 3A5ZB 2VWFA 3X24B 3WVDB 2LZ6B 1KFZA 3G6EA 1FMWA 2RB6A 1PRMC 1XQHA 5A0LA 1K73R 1D1AA 3UDCA 1KD1U 4LDXA 4M78G 1D3BB 1VQ4A 1VYUA 3HKSA 2KRNA 1YJNA 5FU6C 3I9QA 3G6EQ 1DJ7B 2MWPA 2E12A 5KYWA 3JB9D 1HYOA 1RAEB 4QVCA 1XNIA 4DOWA 4J9EA 3EAEA 1SG5A 4JLGA 3REAB 2FPDA 1N5ZA 1N8RU 4HVWA 2E64A 1VQPQ 4C0FA 4Z8AA 4JJCA 3JCMb 4XU1A 4RTXA 2AHJB 1R77A 2WACA 4FIBA 4Z02A 2NWMA 2KXCA 2F2XA 1NYGA 2J06A 4CC4B 1TH7A 3H41A 5LJ3j 2FPEA 5KYNA 2GFUA 2L3PA 4C0DB 4C5HA 2PTKA 2EYQA 2E4HA 1ARKA 2VASA 3EG2A 1PG5B 4PJMA 3M0UA 2DXTA 1B3QA 3CCST 2J6KA 3C0CA 1YJ9A 4FCYA 2RHZA 2LMJA 4QQGA 4C5IA 3J81E 4BACA 6AT1B 2DAQA 2ED1A 2EGCA 3OYHA 3VRYA 1AZGB 2DYIA 3M53A 3M0PA 1OU9A 2LP5A 5CR2A 1VQKQ 4E7KA 4D8DA 2FYKA 2E5QA 1G3YA 3UA6A 2GF7A 3HPWA 2V26A 2MK5A 3CMAT 4PJOF 3A8GB 2RK1A 3NTHA 4OMPA 4JJNK 2P84A 2QQ9A 3ZBDA 3RKWA 1Y07A 2EJFA 3QDFA 2FZKB 4M78E 3CCRA 1QW1A 4N0AA 2CYZB 2JW4A 4XTXA 1Q86U 4MZMA 1Y7XA 3L2QA 1E7OA 3FDRA 1YJNQ 2K5LA 1GFCA 2E3HA 3X20B 1FXXA 3CC7Q 1R0BG 1OPKA 2LNVA 1C6VX 1QVGS 5CVIA 3CC2T 4HCCA 2DTHA 1M2OA 4MDWA 2K9GA 1JBMA 4RG8A 3OYFA 4Q5WA 2XI9A 4DBRA 2LCSA 1N8RC 3CCEA 3FRNA 3OYCA 1Z9QA 2JZ2A 2JTFA 3META 2PVOB 4M78D 2K2MA 2HCKA 1B07A 2YLCA 8AT1B 2PVGB 1NJIR 1SKUB 1IZ6A 3HHTB 2L89A 8ATCB 3QO3A 4HCZA 2LJ1A 3G71T 1SSFA 4C92A 4IIOA 5GANe 2HSPA 1E6GA 1UJ0A 1Q82C 1F1BB 2E5KA 2K5IA 4XU2A 1YJWQ 2FRWA 1ZQ1A 3SDZA 1VQ8T 1S72A 2AZVA 5LJ5g 4TVRA 5I21A 2M1HA 3G4SA 3CMAA 2DO3A 4C92F 5GAOq 1K9AA 3VUBA 4IKFA
chains in the Genus database with same CATH topology
1QKWA 2KXDA 2KT8A 1M3AA 2K3BA 4J9GA 4J9CA 2A08A 1PKSA 1WFWA 1YN8A 4J9IA 2HEQA 2L2PA 2O31A 4OMLA 2EGAA 2CREA 1AWOA 1HD3A 4HXJA 1AOJA 1H3HA 2EVRA 4ORZA 1MUZA 4F16A 1OEBA 1XOVA 2C0IA 3I5RA 2RPNA 3O5ZA 2DRKA 1KJWA 2O9VA 1VA7A 2L0AA 4LUDA 1WLPB 2DL4A 2AKLA 1GCQA 2BTTA 1M3CA 3PVQA 2I0NA 4QT7A 3FJ5A 1UJYA 1NM7A 3TVTA 3TSWA 1IO6A 1GCQC 2H8HA 3UATA 2B86A 4F17A 1BB9A 3H0IA 1ABOA 2DLPA 2YSQA 1G83A 1NLPC 2LX7A 2YT6A 3UA7A 2KEAA 2A28A 1ZSGA 2J6OA 3NHNA 1T0HA 3I5SA 2DX1A 2FG0A 3RBBB 1CSKA 4OMOA 2EW3A 2SEMA 2K7AA 4JZ4A 1AWXA 2DL7A 2KNBB 4Y92A 2IIMA 2D1XA 2MCNA 1K0XA 2GTOA 3QWXX 3NPFA 3H0HA 5I22A 1U06A 2K79A 4RTUA 2YUOA 4HVVA 5FW9A 5IHNA 3VRZA 4GLMA 1CKBA 1SSHA 2DL3A 2GBQA 2GGRA 2V1QA 3QWYA 4M4ZA 1U5SA 2RMOA 1WI7A 4DEXA 1S1NA 1M27C 1SHGA 3NGPA 2DNUA 2PNIA 1Y0MA 2GQIA 3SHWA 1YP5A 2QDLA 2JM9A 2CSIA 1AWJA 2KRMA 2BZXA 2F2VA 2EYZA 1T3LA 2FO0A 2HDAA 1WIEA 2YUQA 2DL8A 2FRYA 1UTIA 3R6NA 4WCIA 2AK5A 1WXUA 2KRSA 4JZ3A 1BU1A 2DF6A 2CUBA 2VVKA 4RTZA 1YNZA 2LJ0A 1M30A 1BK2A 2EPDA 1GFDA 2D8HA 4JPBW 2YUPA 3THKA 3JV3A 2HBWA 2JM8A 3IQLA 2ROLA 3VS4A 3VS7A 1AD5A 1J3TA 1HJDA 1NEGA 4ZNXA 1UDLA 5FWCA 4AG2C 2DMOA 4AFZC 2RF0A 2F2WA 2O2OA 4Z88A 4K11A 2KE9A 2CSQA 2K6DA 1QWFA 1M3BA 1YWPA 1GL5A 1PWTA 1SEMA 4RTVA 1JO8A 5IHIA 4D8KA 1OPLA 1I07A 1ZUUA 1UGVA 2J05A 1QLYA 3UF4A 4X1VA 1I1JA 4DEYA 3LH5A 1E6HA 2V1RA 1RUWA 2X3WD 3VS3A 5GJVB 1MV0B 4LE9A 4RTTA 4CC7A 5HCKA 4KRTA 1W6XA 3SEMA 1OV3A 2JMAA 3EHQA 1QKXA 2NUZA 1NG2A 3EG3A 5IXBA 5FWBA 1BBZA 3EG0A 4CC3A 1UHFA 2LNHB 1W1FA 2BZ8A 2PZ1A 3EGUA 1ABQA 1LCKA 1T3SA 1CKAA 2C0OA 2YUNA 3H0FA 2CT3A 2EYXA 2DYBA 1MV3A 2VKNA 2RQUA 1PKTA 1HSQA 2MIOA 1AVZC 2DJQA 1AEYA 3TSZA 2ROTA 1ZLMA 1Z9ZA 4OMQA 1PRLC 2KYMA 2AKKA 1QCFA 1KSWA 2JXBA 1PNJA 2GTJA 2DBMA 3VS1A 2D0NA 2W10A 2FEIA 3EG1A 1Y57A 5ECAA 1JXMA 2ESWA 2DILA 1YWOA 2DVJA 4LN2A 1JU5C 2EQIA 2J6FA 2O88A 1NEBA 1X2QA 2EKHA 4AFUC 1UUEA 2JMCA 4Z89A 2VWFA 2LZ6B 3U23A 1KFZA 1RI9A 2GNCA 1JXOA 1PRMC 5IXFA 2OI3A 1H92A 3CQTA 3M0RA 2KBTA 1SPKA 4FSSA 2DA9A 4HCKA 2OAWA 2DM1A 1VYUA 2KRNA 2X3XD 1K4US 3I9QA 1X2KA 2EYYA 2EGEA 1SRLA 3M0TA 1RLQC 2ECZA 2M0YA 3I35A 3M0SA 2DBKA 4AG1C 1K76A 1GRIA 4J9EA 1UECA 1ZUKA 4R0KA 2A36A 4RUGA 3REAB 2SRCA 2FPDA 1FMKA 1N5ZA 2O9SA 4HVWA 1PHTA 1TUDA 2BZYA 4Z8AA 4JJCA 3VS0A 4RTXA 1YCSB 2CH4A 5L23A 2NWMA 1GBRA 2XMFA 1UG1A 2KXCA 2F2XA 1NYGA 2J06A 2MOXA 4CC4B 1AZEA 1X6GA 1WX6A 3H41A 1V1CA 1T0JA 1I0CA 2FPEA 1SRMA 2J7IA 2RQWA 1TUCA 4OMMA 2L3PA 2FPFA 4RTYA 2PTKA 4LUEA 1ARKA 1TG0A 3EG2A 2RQTA 1ZUYA 3A98A 2KT1A 3KFVA 3M0UA 3RNJA 1ZBJA 4JJDA 2AZSA 2KGTA 1B3QA 2ED0A 2J6KA 2M51A 3C0CA 1G2BA 2LMJA 1X27A 2P4RA 2L3SA 1K1ZA 4A63B 2ED1A 2LJ3A 2EGCA 3VS2A 3VRYA 1AZGB 2JS0A 4J9HA 3M0PA 4ESRA 2CUDA 5GJWB 2LP5A 4RTWA 4D8DA 1VYVA 3UA6A 2LQNA 1X43A 2JTEA 3PE0A 5IH2A 3VS6A 1K0SA 4OMPA 1X6BA 4AFSC 2LQWA 4LNPA 5IHKA 4HVUA 2DL5A 2JT4A 1U3OA 1VYTA 4EIKA 1OOTA 2JW4A 1E7OA 3ZL7C 2EYWA 2KR3A 2RN8A 1GFCA 2JS2A 1WXTA 1M8MA 2OJ2A 1UFFA 2KROA 5I11A 1OPKA 3VS5A 2C0TA 1NYFA 1H8KA 2CT4A 4E6RA 1AWWA 1GBQA 2K9GA 5EC7A 2RQVA 1W70A 4J9BA 1UHCA 2W0ZA 2LCSA 4CC2A 4J9DA 2KYBA 3EHRA 4J9FA 1Z9QA 1GCPA 2RNAA 2K2MA 2HCKA 1B07A 2DRMA 1KIKA 4OMNA 1WXBA 1RLPC 4F14A 1JQQA 1WYXA 2ENMA 2CH4W 2LJ1A 1NLOC 2A37A 2ABLA 4IIOA 1X69A 2L3QA 3NMZC 1FYNA 3REBB 2HSPA 2DE0X 1JEGA 1EFNA 3PVLA 4JJBA 1E6GA 4IIMA 1UJ0A 2E5KA 2FRWA 1WA7A 4GBQA 4AFQC 1SHFA 3M0QA 2AZVA 2G6FX 1WDXA 2CDTA 1QWEA 3GBQA 1A0NB 3ULRB 2D8JA 1ZX6A 1UE9A 2RQRA 1K9AA 2EBPA 2YDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKW A;  2KXD A;  2KT8 A;  1M3A A;  2K3B A;  4J9G A;  4J9C A;  2A08 A;  1PKS A;  1WFW A;  1YN8 A;  4J9I A;  2HEQ A;  2L2P A;  2O31 A;  4OML A;  2EGA A;  2CRE A;  1AWO A;  1HD3 A;  4HXJ A;  1AOJ A;  1H3H A;  2EVR A;  4ORZ A;  1MUZ A;  4F16 A;  1OEB A;  1XOV A;  2C0I A;  3I5R A;  2RPN A;  3O5Z A;  2DRK A;  1KJW A;  2O9V A;  1VA7 A;  2L0A A;  4LUD A;  1WLP B;  2DL4 A;  2AKL A;  1GCQ A;  2BTT A;  1M3C A;  3PVQ A;  2I0N A;  4QT7 A;  3FJ5 A;  1UJY A;  1NM7 A;  3TVT A;  3TSW A;  1IO6 A;  1GCQ C;  2H8H A;  3UAT A;  2B86 A;  4F17 A;  1BB9 A;  3H0I A;  1ABO A;  2DLP A;  2YSQ A;  1G83 A;  1NLP C;  2LX7 A;  2YT6 A;  3UA7 A;  2KEA A;  2A28 A;  1ZSG A;  2J6O A;  3NHN A;  1T0H A;  3I5S A;  2DX1 A;  2FG0 A;  3RBB B;  1CSK A;  4OMO A;  2EW3 A;  2SEM A;  2K7A A;  4JZ4 A;  1AWX A;  2DL7 A;  2KNB B;  4Y92 A;  2IIM A;  2D1X A;  2MCN A;  1K0X A;  2GTO A;  3QWX X;  3NPF A;  3H0H A;  5I22 A;  1U06 A;  2K79 A;  4RTU A;  2YUO A;  4HVV A;  5FW9 A;  5IHN A;  3VRZ A;  4GLM A;  1CKB A;  1SSH A;  2DL3 A;  2GBQ A;  2GGR A;  2V1Q A;  3QWY A;  4M4Z A;  1U5S A;  2RMO A;  1WI7 A;  4DEX A;  1S1N A;  1M27 C;  1SHG A;  3NGP A;  2DNU A;  2PNI A;  1Y0M A;  2GQI A;  3SHW A;  1YP5 A;  2QDL A;  2JM9 A;  2CSI A;  1AWJ A;  2KRM A;  2BZX A;  2F2V A;  2EYZ A;  1T3L A;  2FO0 A;  2HDA A;  1WIE A;  2YUQ A;  2DL8 A;  2FRY A;  1UTI A;  3R6N A;  4WCI A;  2AK5 A;  1WXU A;  2KRS A;  4JZ3 A;  1BU1 A;  2DF6 A;  2CUB A;  2VVK A;  4RTZ A;  1YNZ A;  2LJ0 A;  1M30 A;  1BK2 A;  2EPD A;  1GFD A;  2D8H A;  4JPB W;  2YUP A;  3THK A;  3JV3 A;  2HBW A;  2JM8 A;  3IQL A;  2ROL A;  3VS4 A;  3VS7 A;  1AD5 A;  1J3T A;  1HJD A;  1NEG A;  4ZNX A;  1UDL A;  5FWC A;  4AG2 C;  2DMO A;  4AFZ C;  2RF0 A;  2F2W A;  2O2O A;  4Z88 A;  4K11 A;  2KE9 A;  2CSQ A;  2K6D A;  1QWF A;  1M3B A;  1YWP A;  1GL5 A;  1PWT A;  1SEM A;  4RTV A;  1JO8 A;  5IHI A;  4D8K A;  1OPL A;  1I07 A;  1ZUU A;  1UGV A;  2J05 A;  1QLY A;  3UF4 A;  4X1V A;  1I1J A;  4DEY A;  3LH5 A;  1E6H A;  2V1R A;  1RUW A;  2X3W D;  3VS3 A;  5GJV B;  1MV0 B;  4LE9 A;  4RTT A;  4CC7 A;  5HCK A;  4KRT A;  1W6X A;  3SEM A;  1OV3 A;  2JMA A;  3EHQ A;  1QKX A;  2NUZ A;  1NG2 A;  3EG3 A;  5IXB A;  5FWB A;  1BBZ A;  3EG0 A;  4CC3 A;  1UHF A;  2LNH B;  1W1F A;  2BZ8 A;  2PZ1 A;  3EGU A;  1ABQ A;  1LCK A;  1T3S A;  1CKA A;  2C0O A;  2YUN A;  3H0F A;  2CT3 A;  2EYX A;  2DYB A;  1MV3 A;  2VKN A;  2RQU A;  1PKT A;  1HSQ A;  2MIO A;  1AVZ C;  2DJQ A;  1AEY A;  3TSZ A;  2ROT A;  1ZLM A;  1Z9Z A;  4OMQ A;  1PRL C;  2KYM A;  2AKK A;  1QCF A;  1KSW A;  2JXB A;  1PNJ A;  2GTJ A;  2DBM A;  3VS1 A;  2D0N A;  2W10 A;  2FEI A;  3EG1 A;  1Y57 A;  5ECA A;  1JXM A;  2ESW A;  2DIL A;  1YWO A;  2DVJ A;  4LN2 A;  1JU5 C;  2EQI A;  2J6F A;  2O88 A;  1NEB A;  1X2Q A;  2EKH A;  4AFU C;  1UUE A;  2JMC A;  4Z89 A;  2VWF A;  2LZ6 B;  3U23 A;  1KFZ A;  1RI9 A;  2GNC A;  1JXO A;  1PRM C;  5IXF A;  2OI3 A;  1H92 A;  3CQT A;  3M0R A;  2KBT A;  1SPK A;  4FSS A;  2DA9 A;  4HCK A;  2OAW A;  2DM1 A;  1VYU A;  2KRN A;  2X3X D;  1K4U S;  3I9Q A;  1X2K A;  2EYY A;  2EGE A;  1SRL A;  3M0T A;  1RLQ C;  2ECZ A;  2M0Y A;  3I35 A;  3M0S A;  2DBK A;  4AG1 C;  1K76 A;  1GRI A;  4J9E A;  1UEC A;  1ZUK A;  4R0K A;  2A36 A;  4RUG A;  3REA B;  2SRC A;  2FPD A;  1FMK A;  1N5Z A;  2O9S A;  4HVW A;  1PHT A;  1TUD A;  2BZY A;  4Z8A A;  4JJC A;  3VS0 A;  4RTX A;  1YCS B;  2CH4 A;  5L23 A;  2NWM A;  1GBR A;  2XMF A;  1UG1 A;  2KXC A;  2F2X A;  1NYG A;  2J06 A;  2MOX A;  4CC4 B;  1AZE A;  1X6G A;  1WX6 A;  3H41 A;  1V1C A;  1T0J A;  1I0C A;  2FPE A;  1SRM A;  2J7I A;  2RQW A;  1TUC A;  4OMM A;  2L3P A;  2FPF A;  4RTY A;  2PTK A;  4LUE A;  1ARK A;  1TG0 A;  3EG2 A;  2RQT A;  1ZUY A;  3A98 A;  2KT1 A;  3KFV A;  3M0U A;  3RNJ A;  1ZBJ A;  4JJD A;  2AZS A;  2KGT A;  1B3Q A;  2ED0 A;  2J6K A;  2M51 A;  3C0C A;  1G2B A;  2LMJ A;  1X27 A;  2P4R A;  2L3S A;  1K1Z A;  4A63 B;  2ED1 A;  2LJ3 A;  2EGC A;  3VS2 A;  3VRY A;  1AZG B;  2JS0 A;  4J9H A;  3M0P A;  4ESR A;  2CUD A;  5GJW B;  2LP5 A;  4RTW A;  4D8D A;  1VYV A;  3UA6 A;  2LQN A;  1X43 A;  2JTE A;  3PE0 A;  5IH2 A;  3VS6 A;  1K0S A;  4OMP A;  1X6B A;  4AFS C;  2LQW A;  4LNP A;  5IHK A;  4HVU A;  2DL5 A;  2JT4 A;  1U3O A;  1VYT A;  4EIK A;  1OOT A;  2JW4 A;  1E7O A;  3ZL7 C;  2EYW A;  2KR3 A;  2RN8 A;  1GFC A;  2JS2 A;  1WXT A;  1M8M A;  2OJ2 A;  1UFF A;  2KRO A;  5I11 A;  1OPK A;  3VS5 A;  2C0T A;  1NYF A;  1H8K A;  2CT4 A;  4E6R A;  1AWW A;  1GBQ A;  2K9G A;  5EC7 A;  2RQV A;  1W70 A;  4J9B A;  1UHC A;  2W0Z A;  2LCS A;  4CC2 A;  4J9D A;  2KYB A;  3EHR A;  4J9F A;  1Z9Q A;  1GCP A;  2RNA A;  2K2M A;  2HCK A;  1B07 A;  2DRM A;  1KIK A;  4OMN A;  1WXB A;  1RLP C;  4F14 A;  1JQQ A;  1WYX A;  2ENM A;  2CH4 W;  2LJ1 A;  1NLO C;  2A37 A;  2ABL A;  4IIO A;  1X69 A;  2L3Q A;  3NMZ C;  1FYN A;  3REB B;  2HSP A;  2DE0 X;  1JEG A;  1EFN A;  3PVL A;  4JJB A;  1E6G A;  4IIM A;  1UJ0 A;  2E5K A;  2FRW A;  1WA7 A;  4GBQ A;  4AFQ C;  1SHF A;  3M0Q A;  2AZV A;  2G6F X;  1WDX A;  2CDT A;  1QWE A;  3GBQ A;  1A0N B;  3ULR B;  2D8J A;  1ZX6 A;  1UE9 A;  2RQR A;  1K9A A;  2EBP A;  2YDL A; 
#chains in the Genus database with same CATH topology
 2R5M A;  4XU3 A;  4PL6 A;  4J6X A;  3JCM e;  1LVK A;  1BI2 A;  4L6V 5;  1WFW A;  2Y4Y A;  2Z0W A;  3ER0 A;  2L2P A;  4N0A C;  2O31 A;  4F7U B;  1VQ5 A;  2DIG A;  3I55 T;  3P8D A;  1HD3 A;  4L5G A;  4HXJ A;  4ORZ A;  3PIP A;  2RJF A;  4HT8 A;  3EG9 A;  2ZPH B;  3KBG A;  3PGG A;  4C8Q E;  2RPN A;  3MHX A;  1BCO A;  2AKL A;  1GCQ A;  3PVQ A;  3TVT A;  5GMK e;  2OTL A;  4MML A;  4M7A G;  1RAG B;  3H0I A;  1ABO A;  2LT1 A;  2YSQ A;  2OX7 A;  2FHD A;  5KYY B;  1G83 A;  4JRI A;  4FSX A;  4PJO A;  1VQ8 Q;  2YRV A;  1ZSG A;  1UB4 A;  4BI8 B;  1T0H A;  4PJL A;  2FG0 A;  3RBB B;  2CS7 A;  4KBM B;  4EMK B;  4OMO A;  4C92 C;  2SEM A;  1AWX A;  3A8L B;  2KNB B;  2HKN A;  2IIM A;  2MCN A;  3JCM P;  1K0X A;  4KUL A;  4RCB A;  3QSU A;  2XD0 A;  4M7D A;  5FRO A;  4EMH A;  4JRQ A;  1K9M R;  4F7U E;  3CC2 A;  1JRI A;  4C8Q B;  2M9U A;  5KYX B;  2DL3 A;  1UEB A;  4OGE A;  1VQL A;  1KHC A;  1VQ5 T;  3OYL A;  2WSC E;  2PNI A;  1Y0M A;  2GQI A;  2QDL A;  2QA4 T;  2JM9 A;  2CSI A;  4M75 B;  1NBE B;  4XTY A;  1D1C A;  1T3L A;  1WQW A;  1WIE A;  2EKO A;  1YJW T;  1UTI A;  4WCI A;  2AK5 A;  1WXU A;  4C92 B;  2F5K A;  4JZ3 A;  3GPL A;  4FYW B;  3V8K A;  1WJR A;  2LJ0 A;  3MP8 A;  1M5Q 1;  2EPD A;  1OU8 A;  2VGN A;  3E19 A;  2JM8 A;  2GCX A;  1BYM A;  2CP7 A;  2HQX A;  2ZPI B;  4XTV A;  4M7D D;  3CBP A;  2O4X A;  1JJ2 P;  1UDL A;  3SWN C;  3JCM c;  3EFO B;  5GAM h;  2CP5 A;  4PJO C;  3E9G A;  4OP0 A;  4M7A A;  3C95 A;  1M3B A;  1YWP A;  1PWT A;  1SEM A;  3J7A F;  5IHI A;  1UGV A;  3PT9 A;  4M78 C;  5CKD A;  1B34 B;  1KK7 A;  3LH5 A;  1E6H A;  2X3W D;  1TTH B;  3VS3 A;  2HD0 A;  5GJV B;  1MV0 B;  4C92 E;  4M7A F;  1KQ1 A;  5GMK h;  4FW2 A;  4PJJ A;  3CCJ A;  3EHQ A;  4NL2 A;  3OB9 A;  4NOY A;  4OB0 B;  3BFM A;  1VQ6 Q;  1BBZ A;  5LJ3 d;  3EG0 A;  1IB8 A;  3NFC A;  3LX7 A;  5HKC A;  1BI0 A;  3UT1 A;  1LCK A;  1B34 A;  1CKA A;  2MI6 A;  3OYY A;  1ZA2 B;  3H0F A;  3QHS A;  4KT0 E;  1RAC B;  1RL2 A;  3BY7 A;  1NE8 A;  4BY6 C;  3GOX A;  2VKN A;  4XQ3 A;  3Q1J A;  1HSQ A;  2CZ0 B;  1VQ4 Q;  3HFO A;  1KC8 U;  2FB7 A;  1G8X A;  1D0X A;  2ATC B;  3QG1 A;  1PRL C;  2AKK A;  1QCF A;  1PNJ A;  2LRQ A;  1VQ7 A;  3ME9 A;  3VS1 A;  2KVQ G;  2D0N A;  2W10 A;  3EG1 A;  3JB9 H;  5ECA A;  2DIL A;  4M78 F;  4XTW A;  3RUX A;  3L2R A;  2J6F A;  2O88 A;  3A1P A;  4Z89 A;  4QQ6 A;  3JCM W;  1PC0 A;  5LJ3 h;  1RI9 A;  2P0P A;  2YRD A;  1O9S A;  3CCL A;  3L2Z A;  2OI3 A;  3JAM E;  3DB3 A;  2M16 A;  3CQT A;  3M0R A;  1RAB B;  3HP9 A;  4M78 A;  2QA4 Q;  1SPK A;  5C0M A;  3MCA B;  3M5A A;  1X2K A;  2QI2 A;  1VQL T;  2EGE A;  2V8I A;  1SRL A;  3M0T A;  4FL6 A;  3JB9 I;  1M8V A;  2ECZ A;  3M0S A;  3OBY A;  1BI1 A;  2EJG A;  4C0G A;  2RHY A;  3GLX A;  3LLR A;  4NL3 A;  1Q82 R;  2SRC A;  2F69 A;  1TXQ A;  2YXY A;  2XG8 D;  1VQM A;  4IUU A;  5GAM d;  3CXC S;  3EH2 A;  4FT4 A;  3V7C A;  3MO8 A;  2D0Q B;  2NLU A;  1WHG A;  5L23 A;  3OW2 A;  2E70 A;  2XMF A;  1UG1 A;  1GBR A;  4DBH A;  1OZ3 A;  1AZE A;  3G6E T;  1V1C A;  1QVP A;  1SRM A;  5GAO m;  2RQW A;  3MPU B;  4OMM A;  3VUZ A;  2MMP A;  4ZTF A;  4BD3 A;  4WF2 A;  1M4Z A;  4LUE A;  1KQS S;  2RQT A;  4QVZ A;  4BUG A;  2LCC A;  1WHH A;  2KT1 A;  3KFV A;  3RNJ A;  1OUL A;  1ZBJ A;  4JJD A;  4J7F A;  1IHW A;  4PJO G;  4M77 E;  3QZ5 B;  1X27 A;  2QGG A;  2X9H A;  1QVF A;  2Y90 A;  4A63 B;  4MDX A;  2JS0 A;  1X75 C;  2CUD A;  5GJW B;  1PM3 A;  1NPP A;  2E1H A;  1VQ9 Q;  4F7U A;  5GAN j;  2QTV A;  4LDW A;  4M7D E;  5IH2 A;  1K0S A;  1QP2 A;  1O75 A;  3MP1 A;  1VUB A;  2CZ6 B;  2E10 A;  2X4Y A;  4OF1 A;  5IHK A;  4HVU A;  1EZZ B;  4LDV A;  2HL5 C;  1U3O A;  1VYT A;  1BIA A;  1OOT A;  1Q95 G;  2ZPB B;  5KCH A;  1D0Z A;  5LJ5 j;  3OYI A;  4PFO A;  3SB2 A;  1V76 A;  2JS2 A;  5KYW B;  1M8M A;  5HK0 A;  1OI1 A;  1UFF A;  4ELY C;  1IRE B;  3TEE A;  3OYJ A;  3G71 Q;  4E7I A;  1VQK T;  4A4F A;  2QQB A;  2K4Y A;  3CXC A;  1AWW A;  1GBQ A;  1W70 A;  4J9B A;  1UHC A;  3TCJ A;  4UC4 A;  2KY9 A;  4CC2 A;  2PUO B;  4PK4 A;  1I8F A;  3OSS C;  2HSE B;  3TRE A;  2KSS A;  2DRM A;  4VUB A;  3CCU A;  4OMN A;  2LVM A;  3HRT A;  3M58 A;  2ENM A;  2CH4 W;  5CIU A;  1NLO C;  4C92 G;  4QW2 A;  2L3Q A;  3NMZ C;  4C92 D;  2K5F A;  3MP6 A;  5LJ5 h;  2DXU A;  3PVL A;  3NTK A;  2DEQ A;  4PKC C;  1KQS A;  1AHJ B;  4IUV A;  3M0Q A;  5GAM f;  2RJD A;  3GBQ A;  3L1A A;  1A0N B;  2D9T A;  3OQ5 A;  4BDY A;  2RQR A;  4OB2 B;  2EBP A;  4E47 A;  2YDL A;  1K73 U;  4BB7 A;  2KT8 A;  1VIF A;  1IRX A;  3QII A;  4J9C A;  2A08 A;  1PKS A;  4J9I A;  3RR6 A;  2CRE A;  1AWO A;  1AOJ A;  1H3H A;  1QMC A;  3OYK A;  4C0D C;  4F16 A;  5KE2 A;  2AT1 B;  4C8Q D;  1XOV A;  2DTO A;  5KYU B;  1UGS B;  2DRK A;  4E7H A;  1VQN T;  2XDB A;  5CCA A;  3OW2 P;  3EGX A;  2DL4 A;  3LGF A;  3L2V A;  1M3C A;  1RAD B;  2I0N A;  3FJ5 A;  3X26 B;  1IO6 A;  3UAT A;  2B86 A;  2WSE E;  3LH0 A;  4R55 A;  3SWN A;  2R57 A;  1NLP C;  2YT6 A;  2MWO A;  4IUR A;  5LJ3 g;  2COZ A;  3I5S A;  5CKF A;  2KK4 A;  1VQ9 A;  4M7A C;  4RCC A;  3CCM T;  3BDL A;  3H8Z A;  4OMF B;  2DL7 A;  4II1 A;  5J39 A;  2GTO A;  3ZFJ A;  4F7U G;  1M1K R;  3H0H A;  5FU6 B;  3PFS A;  1U06 A;  3RES A;  2K79 A;  4RTU A;  4QVD A;  2XID A;  2YUO A;  3CCQ T;  5FW9 A;  1Q82 U;  5LJ3 f;  4M4Z A;  2OTL Q;  3MKD A;  1D3B A;  2RMO A;  3WXM B;  2HMA A;  3NGP A;  4BI3 A;  2DNU A;  2KMT A;  5IAY A;  1AWJ A;  4LDU A;  2BZX A;  2F2V A;  2LT4 A;  2OAU A;  1PSE A;  1VQN Q;  3OYE A;  3S3N A;  4A4E A;  3E1S A;  5C6S A;  4C5E A;  1QVG A;  2A0F B;  5GAN g;  3R6N A;  3M54 A;  5GAM e;  3QKJ A;  2VVK A;  3QXE B;  1YNZ A;  2D6F A;  1WHL A;  4ZTJ A;  1M30 A;  1VQM Q;  3GNF B;  1BK2 A;  2D8H A;  1Q81 U;  1TWB A;  3UWN A;  1VQN A;  2ZPG B;  3L42 A;  2YUP A;  4M7A D;  3OS2 A;  2GQV A;  3THK A;  1OYX A;  3GNG A;  1VOM A;  4J7I A;  2DK3 A;  1HJD A;  1NEG A;  3MEU A;  1M90 R;  3F70 A;  4OB1 B;  3MEW A;  2DMO A;  4JRK A;  2EQU A;  5KH6 A;  2F2W A;  1RAA B;  2PQW A;  2HL3 A;  2IPO B;  1LNX A;  3QJ6 A;  3CCQ A;  3CD6 T;  4RTV A;  2VV5 A;  1QVF P;  3L2U A;  4D8K A;  1OPL A;  3CCL Q;  1YIJ Q;  2RJC A;  5GAN 3;  2QEX Q;  3ZEH A;  4XAX B;  4M7D F;  5KYU A;  2IVW A;  4DEY A;  2V1R A;  2EFI A;  4LE9 A;  3LGL A;  1MMA A;  5HCK A;  1W6X A;  3SEM A;  1XTD A;  1OX9 A;  1B7T A;  2WSF E;  3INZ A;  1M1K C;  2DZ9 A;  5FWB A;  4B6M A;  1H3Z A;  4L59 A;  1N9S A;  4ANJ A;  4CC3 A;  3PMI A;  1UHF A;  9ATC B;  1W1F A;  2R58 A;  4HA8 A;  1ABQ A;  1T3S A;  1YBY A;  1U1S A;  2E65 A;  2YUN A;  1WZO A;  3CC7 A;  2QEX A;  4F7U F;  1M90 C;  3S3O A;  2BE9 B;  1MV3 A;  2RQU A;  5GAM j;  4PLI A;  1PKT A;  5J26 A;  1AVZ C;  3WVE B;  3SD4 A;  4DBQ A;  3BDU A;  3CBO A;  3P8B B;  1ZLM A;  1ZBX A;  1WHK A;  3HL8 A;  3OS0 A;  2E6N A;  1YIT T;  2DBM A;  4X9D A;  4E7J A;  2G3R A;  1UGP B;  4PJO D;  5A0G A;  3CCV A;  3JCM J;  3O8V A;  1FMV A;  3S6W A;  2BIV A;  2L8D A;  2EQI A;  3OS1 A;  2EKH A;  1M90 U;  5I2M A;  3V7R A;  1MMD A;  5J3B A;  1GXI E;  2FZG B;  3U23 A;  4J6Y A;  4N4H A;  1KC8 C;  2GNC A;  4JLI A;  1JXO A;  2FZC B;  7AT1 B;  1XJW B;  2KQW A;  4C5G A;  1YI2 A;  2KBT A;  4FSS A;  4J6W A;  2DA9 A;  2L5Q A;  2XDD A;  2HQH A;  1M2V B;  2X3X D;  5LJ5 f;  2DET A;  4KGZ B;  1VQO T;  1BCM A;  2EYY A;  3EFR A;  3VV0 A;  2F1L A;  1Y96 A;  3I35 A;  3G4S T;  4AG1 C;  1K76 A;  1GRI A;  2A36 A;  4LDY A;  4RUG A;  2CGH A;  3CCV Q;  3SFM A;  1RAF B;  2O9S A;  2QQA A;  4KGV B;  3M4Y A;  5CO7 A;  2BZY A;  4GLK A;  3VS0 A;  2OTL T;  2ZPF B;  3G71 A;  3OW2 S;  1YCS B;  1VQP A;  2CH4 A;  1OZ2 A;  4A4K A;  1QVF S;  5AYF A;  5CKB A;  2O4X B;  2COW A;  1WX6 A;  1T0J A;  4KH0 B;  1TUC A;  2FPF A;  4B9X A;  4CI0 C;  4RTY A;  4NS5 A;  5CQX A;  2PU9 B;  1ZUY A;  3A98 A;  2VUB A;  3FJP A;  2AZS A;  2ED0 A;  2M51 A;  3QYG B;  3M55 A;  1G2B A;  2P4R A;  3M59 A;  2L3S A;  3X28 B;  4CRI A;  2B8A A;  3EGX B;  2NUP B;  2DJZ A;  2HQE A;  3VS2 A;  4A53 A;  1HXD A;  3JCM d;  4PNO A;  1QCN A;  1I4K 1;  1VQ6 A;  2JTE A;  3PE0 A;  4HT9 A;  1X6B A;  4M75 C;  3RER A;  3OMG A;  3I56 T;  1WJS A;  2QTX A;  4C8Q G;  2JT4 A;  4EIK A;  4FYY B;  1Y71 A;  1TU0 B;  2KR3 A;  2RN8 A;  1PD0 A;  3CC4 A;  1WXT A;  2MF2 A;  4E7Z A;  2QEX T;  1ZHI A;  2KRO A;  2ZPE B;  5I11 A;  5GAN 8;  3VS5 A;  3OYN A;  3CCM A;  2CT4 A;  1YI2 Q;  3HRS A;  1I5O B;  5CAI A;  5DM7 R;  1M9S A;  3OS5 A;  2RD1 A;  5LJ5 e;  3HRU A;  1M1G A;  4M77 C;  4PFZ A;  4IUP A;  5GMK m;  4J9D A;  2KYB A;  4J9F A;  1GCP A;  3EH1 A;  1KIK A;  1ZSZ B;  1RLP C;  2RK2 A;  3C94 A;  2R5A A;  5D6X A;  1WYX A;  2K3Y A;  5IT9 E;  2A37 A;  1OX8 A;  2AIR B;  4E2F B;  2RI2 A;  1FYN A;  1EIF A;  2OTJ T;  1KQS P;  4M78 B;  3V8J A;  1EFN A;  3CPW P;  2BUD A;  1D0Y A;  4Y91 A;  1QCO A;  1WA7 A;  2K2V A;  2FVU A;  4JS4 A;  4AFQ C;  5GAN 7;  3JCM f;  3M56 A;  5FLX E;  1WDX A;  2EWN A;  2CDT A;  3JSC A;  5M9O A;  1TUG B;  1W2B P;  3ULR B;  1VQ9 T;  2D8J A;  3PMT A;  1UE9 A;  1BIB A;  4FM4 B;  1VQO A;  1QVG P;  3QPH A;  3OBW A;  2XHC A;  5GMK j;  1Q86 C;  1LJO A;  1QKW A;  5DY9 A;  2KXD A;  1M3A A;  1WNL A;  2ZGW A;  3QUI A;  5GAN 5;  4BDZ A;  1YN8 A;  3FIF A;  2EGA A;  4OML A;  2QAS A;  4DOV A;  3H6Z A;  1MUZ A;  2CKK A;  4PFP A;  2DVE A;  1VQO Q;  1IHV A;  3A8O B;  3O5Z A;  1N6A A;  3G1J A;  3EFO A;  1KJW A;  3JCM h;  4LUD A;  1WLP B;  3T9N A;  4DA4 A;  4FYV B;  4FT2 A;  3CCQ Q;  3EFS A;  1VQP T;  2XIC A;  3CPF A;  5GAN 2;  1Q7Y R;  3TSW A;  1BKB A;  4PLL A;  1GCQ C;  1X01 A;  4F17 A;  1M1K U;  1BB9 A;  3I56 Q;  1K8A R;  4JS5 A;  4FW1 A;  2RM4 A;  1TS9 A;  1RAH B;  3LWI A;  4PJO E;  3G7Z A;  3R6O A;  4RG2 A;  3A8H B;  3PTA A;  3PNW C;  1CSK A;  4C0Z A;  3RDV A;  2EW3 A;  2VGM A;  4M7D C;  4OGC A;  3CCJ T;  1PD1 A;  1I5L A;  4YTL A;  3BE3 A;  2QGF B;  2KDS A;  3QWX X;  5I22 A;  3J80 E;  1LOJ A;  3MEV A;  4HVV A;  2H3J A;  2LCL A;  5L8R E;  1SSH A;  2V1Q A;  1TOV A;  2GBQ A;  4B9W A;  2DIQ A;  4M77 D;  3CC4 Q;  4OVA A;  1U5S A;  2X35 A;  3VU3 C;  1M27 C;  4EDU A;  1SHG A;  1Q81 R;  3SHW A;  5GMK i;  1NZ9 A;  1N9R A;  3L2W A;  1YCY A;  2KRM A;  2EYZ A;  2FO0 A;  2RHU A;  2HDA A;  2Y4X A;  2YUQ A;  2DL8 A;  3CPW A;  1KD1 C;  2DF6 A;  1D1B A;  4V2S A;  5D7U A;  2DD5 A;  4M75 D;  3C4S A;  4EPC A;  1GFD A;  3MJX A;  3UPU A;  3GIB A;  4JPB W;  1P92 A;  3JV3 A;  2HBW A;  2ROL A;  1W2B S;  1J3T A;  1Q7Y U;  4ZNX A;  5FWC A;  2BE7 D;  2FL7 A;  3FC3 A;  4AFZ C;  1VQL Q;  2O2O A;  4PJN A;  2KE9 A;  2K6D A;  1QWF A;  1GL5 A;  4N4I A;  2EIF A;  1FX7 A;  2EAY A;  2EQJ A;  2NYS A;  5KYY A;  1JB0 E;  1Q81 C;  5CQY A;  4M75 E;  1I07 A;  1ZUU A;  3UF4 A;  4PJO B;  1H64 1;  1C0M A;  4X1V A;  4EMK A;  1RUW A;  1ZA1 B;  4RTT A;  4LD9 K;  5DLQ E;  4CC7 A;  2HKQ B;  3VYG A;  1K9M U;  2YLB A;  3P8H A;  5HY6 A;  3RKX A;  1K9M C;  1QKX A;  3M4G A;  3X25 B;  2P4T A;  3JB9 G;  5IXB A;  4J83 A;  1MGQ A;  5A0D A;  2RH2 A;  2JOY A;  3CCJ Q;  1C1A A;  2HAX A;  2LNH B;  3JCM V;  2BZ8 A;  2LQ8 A;  4GY5 A;  2NUP A;  2CZ1 B;  3EGD B;  4LXC A;  2C0O A;  3TQ7 P;  1JJ2 S;  3JB9 J;  2EYX A;  1YJN T;  5D6Y A;  3QDR B;  2MIO A;  4XTZ A;  2DJQ A;  2JN0 A;  1K8A C;  1ZSZ A;  4M7A B;  2HBP A;  3CME T;  3TSZ A;  4FU6 A;  2QYZ A;  2ROT A;  1Q7Y C;  1Z9Z A;  3MEA A;  4OMQ A;  4X9C A;  2KYM A;  2X4X A;  5GAN h;  1VQ7 T;  2JXB A;  1G5V A;  3EGD A;  2FEI A;  1Y57 A;  3VKI A;  4A54 A;  1MMN A;  1KD1 R;  1YWO A;  2DVJ A;  3I55 A;  2E3I A;  2X4W A;  4IUQ A;  3CCU Q;  1X2Q A;  2JMC A;  3CME A;  3CCS Q;  3LYI A;  3OYB A;  1G3T A;  3C12 A;  2L3R A;  1YHQ T;  5GAN d;  2XK0 A;  2KI7 A;  3DKM A;  5IXF A;  3CCL T;  1H92 A;  1WJQ A;  3CBM A;  2LQK A;  2QA4 A;  2LDM A;  2X4J A;  4HCK A;  2DXC A;  3JCM Q;  2OAW A;  2DM1 A;  2P0K A;  2EQM A;  1K4U S;  1W4S A;  3H9N A;  3CEY A;  4M75 G;  5GAO n;  4M75 A;  3JCM X;  2NUT A;  4KH1 B;  1RLQ C;  2M0Y A;  4M77 B;  3VJP A;  2DBK A;  5FU7 B;  3VYH B;  1LPL A;  1UEC A;  1ZUK A;  4R0K A;  2LX9 A;  2RO0 A;  1FMK A;  1PHT A;  1TUD A;  2MAM A;  3V7S A;  2DPP B;  2MPX C;  1VQ4 T;  1G3W A;  3N5B B;  5KE3 A;  4M75 F;  4XK8 E;  2NUT B;  1UGQ B;  2E6Z A;  1NJI C;  1K8A U;  3OY9 A;  3TU4 K;  4M77 A;  4XTU A;  2MOX A;  2VYT A;  5LL6 S;  1X6G A;  1YIJ A;  1I0C A;  3DLL A;  1MND A;  2J7I A;  1N8R R;  3FLG A;  3JB9 F;  2M0O A;  4Y28 E;  4JDS A;  2DER A;  2V8K A;  4WTO B;  2RHI A;  4JRP A;  2O01 E;  3CCR Q;  3CCR T;  1TG0 A;  4ZGE B;  2DXB A;  1M2V A;  3QBY A;  4O5V A;  5FU7 C;  1KQ2 A;  2RJE A;  5FRN A;  2RA2 A;  2KGT A;  3OYD A;  2CZ7 B;  1K1Z A;  1N27 A;  2LJ3 A;  4C8Q F;  4DBF A;  1Q86 R;  2PVD B;  4D6W A;  2QDY B;  4J9H A;  3QZ9 B;  4ESR A;  2KAF A;  4RTW A;  3CXC P;  1YI2 T;  2RHX A;  1VYV A;  1ACM B;  2CP2 A;  2VB6 A;  2LQN A;  1X43 A;  3VS6 A;  3AHU A;  4AFS C;  3DLM A;  1QP3 A;  1YJ9 T;  2LQW A;  4LNP A;  4M7A E;  2DL5 A;  5GAO l;  2VXE A;  5KYX A;  4R56 A;  2QAZ A;  4KGX B;  3ZL7 C;  2EYW A;  1X6O A;  1YFN A;  4N4G A;  1NPR A;  2RI3 A;  2DFU A;  3OA6 A;  1S72 T;  2DEU A;  1S72 Q;  2OJ2 A;  5CK9 A;  4A4G A;  1YIT Q;  2CP0 A;  2P0Q A;  4QKU A;  2C0T A;  1NYF A;  1H8K A;  1YJW A;  5CKH A;  2QK0 A;  4E6R A;  5EC7 A;  2RQV A;  4BY6 B;  2W0Z A;  5KCO A;  4A4H A;  3EHR A;  5GAN 6;  2XKO C;  1IXD A;  1U8R A;  2HZY A;  2JUF A;  3RIR A;  2RNA A;  1RAI B;  1YIJ T;  1WXB A;  2XU8 A;  4HKE A;  2QQS A;  1JQQ A;  4F14 A;  4BE2 A;  4OB3 B;  1VQM T;  3OMC A;  3CCE Q;  2ABL A;  3QJY A;  4M7D G;  1X69 A;  1VQ7 Q;  3REB B;  2DE0 X;  2COY A;  1JEG A;  4ELZ C;  4X34 A;  4JJB A;  4IIM A;  3CC4 T;  4EMG A;  4GBQ A;  1MHN A;  2JVV A;  2QQR A;  1SHF A;  1R8O B;  2QXF A;  2F5T X;  1QQJ A;  2G6F X;  4JUV A;  5EG2 A;  1V29 B;  3SWN B;  1QWE A;  3AT1 B;  1ZX6 A;  2A7Y A;  3FB9 A;  2K57 A;  2DTI A;  1AT1 B;  4DQ2 A;  1G3S A;  2K3B A;  2CP3 A;  3E2U A;  4J9G A;  3CCV T;  1VQ8 A;  2HEQ A;  5IN1 A;  1YHQ A;  4FYX B;  5LJ3 e;  2I2L A;  1KC8 R;  2EVR A;  1I81 A;  2XDP A;  3QYH B;  2OTJ A;  1OEB A;  2LTO A;  2QG9 B;  2C0I A;  3JRZ A;  4MMK A;  3I5R A;  2E41 A;  3M57 A;  4ATO A;  1YIT A;  4LD6 A;  3GP8 A;  4O6J A;  4RMO A;  2O9V A;  5FRM A;  1VA7 A;  3JCM g;  2L0A A;  2DD4 A;  2VC8 A;  3ASK A;  4ZN1 A;  1RI0 A;  3CD6 Q;  5GAO r;  1YJ9 Q;  1PCX A;  2BTT A;  5GAO p;  2VXF A;  2EJ9 A;  4QT7 A;  1UJY A;  1NM7 A;  1U1T A;  3HFN A;  5I2S A;  2H8H A;  3URG A;  3RMS A;  2BKD N;  2DLP A;  3E9F A;  1WHJ A;  3EG9 B;  3PIO A;  2LX7 A;  3CCE T;  3UA7 A;  2K3X A;  2KEA A;  2A28 A;  2J6O A;  3NHN A;  2DX1 A;  3M9Q A;  4ZGD B;  1IGQ A;  4QQD A;  3OSV A;  2K7A A;  4JZ4 A;  2RI5 A;  1WQ7 A;  1VIE A;  3HTR A;  4Y92 A;  3DB4 A;  2D1X A;  3CMA Q;  3G4S Q;  3NPF A;  2ZAE A;  5GMK l;  1MNE A;  4EMK C;  2MYS A;  3CPW S;  2YRC A;  4P5N A;  1YHQ Q;  4XU0 A;  5IHN A;  3VRZ A;  3I56 A;  4GLM A;  1CKB A;  3QWY A;  2GGR A;  1TSF A;  3KXT A;  4ZGJ B;  1K73 C;  2YWW A;  4IUT A;  1WI7 A;  4DEX A;  2IG0 A;  5CKE A;  1S1N A;  4C8Q C;  2LC4 A;  1YP5 A;  4J8O A;  1FWZ A;  1Y96 B;  4KUI A;  1PSF A;  2FRY A;  2JNG A;  1OQK A;  3CC2 Q;  2V8J A;  4AT1 B;  2KRS A;  3OYA A;  1BU1 A;  2CUB A;  4RTZ A;  5HK3 A;  5LJ5 d;  4BI4 A;  4ME7 A;  4M77 G;  2M02 A;  1JJ2 A;  5AT1 B;  2DZC A;  3IQL A;  2JJ9 A;  1WPY A;  3D7S B;  3VS4 A;  5A2Q E;  3VS7 A;  1AD5 A;  3OYM A;  2ZCF B;  3NTI A;  1WGS A;  4F04 B;  4AG2 C;  5GAN 4;  2RF0 A;  4Z88 A;  2C06 A;  4K11 A;  4J5Y A;  2CSQ A;  4M77 F;  3HSB A;  5GAM g;  1WHM A;  4E7S A;  2EQK A;  1NJI U;  2CP6 A;  3RMQ A;  3RKY A;  3V8L A;  1JO8 A;  1UGR B;  1VQK A;  2J05 A;  1QLY A;  3KUF A;  4BE0 A;  1W2B A;  3LW5 E;  3CC7 T;  1I1J A;  4E7L A;  3BW1 A;  3CME Q;  3CCS A;  4AMC A;  4RKU E;  3OYG A;  3I55 Q;  4KRT A;  1R0C B;  1OV3 A;  2GFA A;  2JMA A;  2X51 A;  2NUZ A;  4MZP A;  1NG2 A;  3EG3 A;  1VQ5 Q;  4MZT A;  2YHT A;  4KUD K;  5D6W A;  4C8Q A;  3CCU T;  1KG1 A;  2PZ1 A;  3EGU A;  3CCM Q;  3S3M A;  5GAN f;  1SF9 A;  2DKG A;  3A8M B;  3CD6 A;  2CT3 A;  2DYB A;  2PUK B;  1HK9 A;  1AEY A;  3LWH A;  1KHI A;  1BI3 A;  2OTJ Q;  4M7D B;  1KSW A;  1ZSZ C;  4BE1 A;  1EX4 A;  2GTJ A;  1MMG A;  1D09 B;  3FEO A;  2H3E B;  2JTM A;  5DLO A;  2A3L A;  1VQ6 T;  1M1F A;  1JXM A;  1IGU A;  2ESW A;  3GF5 A;  2ZZD A;  4ZN3 A;  4LN2 A;  1JU5 C;  2HNI A;  1NEB A;  4AFU C;  1UUE A;  4HCB A;  3A5Z B;  2VWF A;  3X24 B;  3WVD B;  2LZ6 B;  1KFZ A;  3G6E A;  1FMW A;  2RB6 A;  1PRM C;  1XQH A;  5A0L A;  1K73 R;  1D1A A;  3UDC A;  1KD1 U;  4LDX A;  4M78 G;  1D3B B;  1VQ4 A;  1VYU A;  3HKS A;  2KRN A;  1YJN A;  5FU6 C;  3I9Q A;  3G6E Q;  1DJ7 B;  2MWP A;  2E12 A;  5KYW A;  3JB9 D;  1HYO A;  1RAE B;  4QVC A;  1XNI A;  4DOW A;  4J9E A;  3EAE A;  1SG5 A;  4JLG A;  3REA B;  2FPD A;  1N5Z A;  1N8R U;  4HVW A;  2E64 A;  1VQP Q;  4C0F A;  4Z8A A;  4JJC A;  3JCM b;  4XU1 A;  4RTX A;  2AHJ B;  1R77 A;  2WAC A;  4FIB A;  4Z02 A;  2NWM A;  2KXC A;  2F2X A;  1NYG A;  2J06 A;  4CC4 B;  1TH7 A;  3H41 A;  5LJ3 j;  2FPE A;  5KYN A;  2GFU A;  2L3P A;  4C0D B;  4C5H A;  2PTK A;  2EYQ A;  2E4H A;  1ARK A;  2VAS A;  3EG2 A;  1PG5 B;  4PJM A;  3M0U A;  2DXT A;  1B3Q A;  3CCS T;  2J6K A;  3C0C A;  1YJ9 A;  4FCY A;  2RHZ A;  2LMJ A;  4QQG A;  4C5I A;  3J81 E;  4BAC A;  6AT1 B;  2DAQ A;  2ED1 A;  2EGC A;  3OYH A;  3VRY A;  1AZG B;  2DYI A;  3M53 A;  3M0P A;  1OU9 A;  2LP5 A;  5CR2 A;  1VQK Q;  4E7K A;  4D8D A;  2FYK A;  2E5Q A;  1G3Y A;  3UA6 A;  2GF7 A;  3HPW A;  2V26 A;  2MK5 A;  3CMA T;  4PJO F;  3A8G B;  2RK1 A;  3NTH A;  4OMP A;  4JJN K;  2P84 A;  2QQ9 A;  3ZBD A;  3RKW A;  1Y07 A;  2EJF A;  3QDF A;  2FZK B;  4M78 E;  3CCR A;  1QW1 A;  4N0A A;  2CYZ B;  2JW4 A;  4XTX A;  1Q86 U;  4MZM A;  1Y7X A;  3L2Q A;  1E7O A;  3FDR A;  1YJN Q;  2K5L A;  1GFC A;  2E3H A;  3X20 B;  1FXX A;  3CC7 Q;  1R0B G;  1OPK A;  2LNV A;  1C6V X;  1QVG S;  5CVI A;  3CC2 T;  4HCC A;  2DTH A;  1M2O A;  4MDW A;  2K9G A;  1JBM A;  4RG8 A;  3OYF A;  4Q5W A;  2XI9 A;  4DBR A;  2LCS A;  1N8R C;  3CCE A;  3FRN A;  3OYC A;  1Z9Q A;  2JZ2 A;  2JTF A;  3MET A;  2PVO B;  4M78 D;  2K2M A;  2HCK A;  1B07 A;  2YLC A;  8AT1 B;  2PVG B;  1NJI R;  1SKU B;  1IZ6 A;  3HHT B;  2L89 A;  8ATC B;  3QO3 A;  4HCZ A;  2LJ1 A;  3G71 T;  1SSF A;  4C92 A;  4IIO A;  5GAN e;  2HSP A;  1E6G A;  1UJ0 A;  1Q82 C;  1F1B B;  2E5K A;  2K5I A;  4XU2 A;  1YJW Q;  2FRW A;  1ZQ1 A;  3SDZ A;  1VQ8 T;  1S72 A;  2AZV A;  5LJ5 g;  4TVR A;  5I21 A;  2M1H A;  3G4S A;  3CMA A;  2DO3 A;  4C92 F;  5GAO q;  1K9A A;  3VUB A;  4IKF A; 
#chains in the Genus database with same CATH homology
 1QKW A;  2KXD A;  2KT8 A;  1M3A A;  2K3B A;  4J9G A;  4J9C A;  2A08 A;  1PKS A;  1WFW A;  1YN8 A;  4J9I A;  2HEQ A;  2L2P A;  2O31 A;  4OML A;  2EGA A;  2CRE A;  1AWO A;  1HD3 A;  4HXJ A;  1AOJ A;  1H3H A;  2EVR A;  4ORZ A;  1MUZ A;  4F16 A;  1OEB A;  1XOV A;  2C0I A;  3I5R A;  2RPN A;  3O5Z A;  2DRK A;  1KJW A;  2O9V A;  1VA7 A;  2L0A A;  4LUD A;  1WLP B;  2DL4 A;  2AKL A;  1GCQ A;  2BTT A;  1M3C A;  3PVQ A;  2I0N A;  4QT7 A;  3FJ5 A;  1UJY A;  1NM7 A;  3TVT A;  3TSW A;  1IO6 A;  1GCQ C;  2H8H A;  3UAT A;  2B86 A;  4F17 A;  1BB9 A;  3H0I A;  1ABO A;  2DLP A;  2YSQ A;  1G83 A;  1NLP C;  2LX7 A;  2YT6 A;  3UA7 A;  2KEA A;  2A28 A;  1ZSG A;  2J6O A;  3NHN A;  1T0H A;  3I5S A;  2DX1 A;  2FG0 A;  3RBB B;  1CSK A;  4OMO A;  2EW3 A;  2SEM A;  2K7A A;  4JZ4 A;  1AWX A;  2DL7 A;  2KNB B;  4Y92 A;  2IIM A;  2D1X A;  2MCN A;  1K0X A;  2GTO A;  3QWX X;  3NPF A;  3H0H A;  5I22 A;  1U06 A;  2K79 A;  4RTU A;  2YUO A;  4HVV A;  5FW9 A;  5IHN A;  3VRZ A;  4GLM A;  1CKB A;  1SSH A;  2DL3 A;  2GBQ A;  2GGR A;  2V1Q A;  3QWY A;  4M4Z A;  1U5S A;  2RMO A;  1WI7 A;  4DEX A;  1S1N A;  1M27 C;  1SHG A;  3NGP A;  2DNU A;  2PNI A;  1Y0M A;  2GQI A;  3SHW A;  1YP5 A;  2QDL A;  2JM9 A;  2CSI A;  1AWJ A;  2KRM A;  2BZX A;  2F2V A;  2EYZ A;  1T3L A;  2FO0 A;  2HDA A;  1WIE A;  2YUQ A;  2DL8 A;  2FRY A;  1UTI A;  3R6N A;  4WCI A;  2AK5 A;  1WXU A;  2KRS A;  4JZ3 A;  1BU1 A;  2DF6 A;  2CUB A;  2VVK A;  4RTZ A;  1YNZ A;  2LJ0 A;  1M30 A;  1BK2 A;  2EPD A;  1GFD A;  2D8H A;  4JPB W;  2YUP A;  3THK A;  3JV3 A;  2HBW A;  2JM8 A;  3IQL A;  2ROL A;  3VS4 A;  3VS7 A;  1AD5 A;  1J3T A;  1HJD A;  1NEG A;  4ZNX A;  1UDL A;  5FWC A;  4AG2 C;  2DMO A;  4AFZ C;  2RF0 A;  2F2W A;  2O2O A;  4Z88 A;  4K11 A;  2KE9 A;  2CSQ A;  2K6D A;  1QWF A;  1M3B A;  1YWP A;  1GL5 A;  1PWT A;  1SEM A;  4RTV A;  1JO8 A;  5IHI A;  4D8K A;  1OPL A;  1I07 A;  1ZUU A;  1UGV A;  2J05 A;  1QLY A;  3UF4 A;  4X1V A;  1I1J A;  4DEY A;  3LH5 A;  1E6H A;  2V1R A;  1RUW A;  2X3W D;  3VS3 A;  5GJV B;  1MV0 B;  4LE9 A;  4RTT A;  4CC7 A;  5HCK A;  4KRT A;  1W6X A;  3SEM A;  1OV3 A;  2JMA A;  3EHQ A;  1QKX A;  2NUZ A;  1NG2 A;  3EG3 A;  5IXB A;  5FWB A;  1BBZ A;  3EG0 A;  4CC3 A;  1UHF A;  2LNH B;  1W1F A;  2BZ8 A;  2PZ1 A;  3EGU A;  1ABQ A;  1LCK A;  1T3S A;  1CKA A;  2C0O A;  2YUN A;  3H0F A;  2CT3 A;  2EYX A;  2DYB A;  1MV3 A;  2VKN A;  2RQU A;  1PKT A;  1HSQ A;  2MIO A;  1AVZ C;  2DJQ A;  1AEY A;  3TSZ A;  2ROT A;  1ZLM A;  1Z9Z A;  4OMQ A;  1PRL C;  2KYM A;  2AKK A;  1QCF A;  1KSW A;  2JXB A;  1PNJ A;  2GTJ A;  2DBM A;  3VS1 A;  2D0N A;  2W10 A;  2FEI A;  3EG1 A;  1Y57 A;  5ECA A;  1JXM A;  2ESW A;  2DIL A;  1YWO A;  2DVJ A;  4LN2 A;  1JU5 C;  2EQI A;  2J6F A;  2O88 A;  1NEB A;  1X2Q A;  2EKH A;  4AFU C;  1UUE A;  2JMC A;  4Z89 A;  2VWF A;  2LZ6 B;  3U23 A;  1KFZ A;  1RI9 A;  2GNC A;  1JXO A;  1PRM C;  5IXF A;  2OI3 A;  1H92 A;  3CQT A;  3M0R A;  2KBT A;  1SPK A;  4FSS A;  2DA9 A;  4HCK A;  2OAW A;  2DM1 A;  1VYU A;  2KRN A;  2X3X D;  1K4U S;  3I9Q A;  1X2K A;  2EYY A;  2EGE A;  1SRL A;  3M0T A;  1RLQ C;  2ECZ A;  2M0Y A;  3I35 A;  3M0S A;  2DBK A;  4AG1 C;  1K76 A;  1GRI A;  4J9E A;  1UEC A;  1ZUK A;  4R0K A;  2A36 A;  4RUG A;  3REA B;  2SRC A;  2FPD A;  1FMK A;  1N5Z A;  2O9S A;  4HVW A;  1PHT A;  1TUD A;  2BZY A;  4Z8A A;  4JJC A;  3VS0 A;  4RTX A;  1YCS B;  2CH4 A;  5L23 A;  2NWM A;  1GBR A;  2XMF A;  1UG1 A;  2KXC A;  2F2X A;  1NYG A;  2J06 A;  2MOX A;  4CC4 B;  1AZE A;  1X6G A;  1WX6 A;  3H41 A;  1V1C A;  1T0J A;  1I0C A;  2FPE A;  1SRM A;  2J7I A;  2RQW A;  1TUC A;  4OMM A;  2L3P A;  2FPF A;  4RTY A;  2PTK A;  4LUE A;  1ARK A;  1TG0 A;  3EG2 A;  2RQT A;  1ZUY A;  3A98 A;  2KT1 A;  3KFV A;  3M0U A;  3RNJ A;  1ZBJ A;  4JJD A;  2AZS A;  2KGT A;  1B3Q A;  2ED0 A;  2J6K A;  2M51 A;  3C0C A;  1G2B A;  2LMJ A;  1X27 A;  2P4R A;  2L3S A;  1K1Z A;  4A63 B;  2ED1 A;  2LJ3 A;  2EGC A;  3VS2 A;  3VRY A;  1AZG B;  2JS0 A;  4J9H A;  3M0P A;  4ESR A;  2CUD A;  5GJW B;  2LP5 A;  4RTW A;  4D8D A;  1VYV A;  3UA6 A;  2LQN A;  1X43 A;  2JTE A;  3PE0 A;  5IH2 A;  3VS6 A;  1K0S A;  4OMP A;  1X6B A;  4AFS C;  2LQW A;  4LNP A;  5IHK A;  4HVU A;  2DL5 A;  2JT4 A;  1U3O A;  1VYT A;  4EIK A;  1OOT A;  2JW4 A;  1E7O A;  3ZL7 C;  2EYW A;  2KR3 A;  2RN8 A;  1GFC A;  2JS2 A;  1WXT A;  1M8M A;  2OJ2 A;  1UFF A;  2KRO A;  5I11 A;  1OPK A;  3VS5 A;  2C0T A;  1NYF A;  1H8K A;  2CT4 A;  4E6R A;  1AWW A;  1GBQ A;  2K9G A;  5EC7 A;  2RQV A;  1W70 A;  4J9B A;  1UHC A;  2W0Z A;  2LCS A;  4CC2 A;  4J9D A;  2KYB A;  3EHR A;  4J9F A;  1Z9Q A;  1GCP A;  2RNA A;  2K2M A;  2HCK A;  1B07 A;  2DRM A;  1KIK A;  4OMN A;  1WXB A;  1RLP C;  4F14 A;  1JQQ A;  1WYX A;  2ENM A;  2CH4 W;  2LJ1 A;  1NLO C;  2A37 A;  2ABL A;  4IIO A;  1X69 A;  2L3Q A;  3NMZ C;  1FYN A;  3REB B;  2HSP A;  2DE0 X;  1JEG A;  1EFN A;  3PVL A;  4JJB A;  1E6G A;  4IIM A;  1UJ0 A;  2E5K A;  2FRW A;  1WA7 A;  4GBQ A;  4AFQ C;  1SHF A;  3M0Q A;  2AZV A;  2G6F X;  1WDX A;  2CDT A;  1QWE A;  3GBQ A;  1A0N B;  3ULR B;  2D8J A;  1ZX6 A;  1UE9 A;  2RQR A;  1K9A A;  2EBP A;  2YDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...