1SSFA

Solution structure of the mouse 53bp1 fragment (residues 1463-1617)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
123
structure length
123
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tudor Tandem of 53BP1; A New Structural Motif Involved in DNA and RG-Rich Peptide Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
molecule keywords Transformation related protein 53 binding protein 1
total genus 16
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA01
3PMTA 1M1GA 3G6EA 5D6YA 5KE2A 4EDUA 4A4GA 3CPWS 4HCZA 5FRMA 3H6ZA 2BKDN 3DB4A 1VQPT 2RO0A 4IUPA 5DM7R 1N27A 2E70A 5C0MA 3CMAA 4IURA 3G6ET 1QVGA 5KCOA 2RHUA 2L3RA 2WACA 1OYXA 3O8VA 1YI2T 3MEUA 3HKSA 3UT1A 3UWNA 1VQNT 1KD1C 2LTOA 2MWOA 4CRIA 3G4SA 1Q82U 5FROA 2BUDA 3LX7A 1VQ8T 3CC7T 4BDZA 3NTHA 3CCVA 2R58A 3OMCA 3G71A 3QKJA 3LGFA 4QVZA 3CCUA 3CCET 2E6ZA 2DIQA 1KQSS 5J39A 3LH0A 2XHCA 3C4SA 1NJIC 3CCQT 2JNGA 3CD6A 2X4YA 3M9QA 3MP1A 1YBYA 3OYGA 3S3OA 4X34A 4QQ6A 1K73C 3FEOA 3MEWA 3CCSA 2LCCA 3OY9A 5J3BA 4PL6A 2EQUA 3EAEA 2R57A 2RJFA 3OA6A 3PMIA 1BKBA 2EQMA 3J80E 3OS1A 1NPRA 1Q86C 3L2WA 2RHYA 3CMEA 3PIPA 3OYDA 3BDLA 3L2QA 4BE2A 3PNWC 1WJQA 1K9MC 2VYTA 2RHXA 3CCRT 4II1A 4A4HA 1W2BS 3Q1JA 5FRNA 1YHQA 1YITA 2R5AA 5D6XA 3MEVA 2O4XA 2L8DA 2RI3A 4ZTFA 3KBGA 1KC8C 1VQKA 3SD4A 2K3XA 3CCST 1KC8U 3TREA 2QQRA 2QA4A 1YJ9A 5A2QE 2X35A 3A5ZB 1Q82C 2KDSA 3OYJA 4A4EA 1JJ2S 2QEXT 3CMET 4C5HA 3S6WA 3CPFA 2GF7A 1OZ2A 2YRVA 1IZ6A 5M9OA 2RHZA 4YTLA 5J26A 4UC4A 3G71T 3LLRA 3OS2A 1M90C 1VQLA 3ASKA 4N4GA 1VQ8A 4Z02A 2MWPA 3META 1XNIA 1K73U 1H3ZA 1QVGS 1VQ5A 4RG2A 2RI2A 5D6WA 1VQ7A 3QIIA 1RI0A 2RJDA 3CCLT 3OYEA 4GY5A 1YJWT 3NTKA 1RL2A 3CCJT 4QQDA 2DAQA 3FLGA 2RJEA 2P0KA 4ZN1A 2OTJT 3QBYA 1KHIA 1YJ9T 1VQ5T 3OB9A 3L2UA 1Q7YC 3CCLA 2D9TA 1Q86U 1KQSA 3MEAA 2X4XA 1YHQT 3OYNA 3OW2A 2QQSA 1VQMT 1K9MU 2XK0A 1VQLT 1YI2A 5KE3A 2B8AA 3J7AF 1WJRA 5C6SA 3DB3A 4BE0A 3G4ST 4BE1A 2GFAA 4OVAA 3L42A 3E9FA 4NS5A 3LYIA 3JAME 1VQPA 1SSFA 4FU6A 3FC3A 3L2RA 4IUVA 2E5QA 2E6NA 4TVRA 4ZTJA 5HY6A 2DIGA 4N4IA 3MO8A 3CCMT 1VQOT 1KHCA 3PFSA 2FHDA 1K8AU 3H8ZA 3CXCS 4B9WA 3I55T 2RJCA 1VQ4T 1K8AC 3OYIA 3OS0A 3I56T 3J81E 2O4XB 3S3MA 1YITT 3E9GA 4BD3A 1VQMA 3OYAA 2RI5A 4QW2A 3CCJA 4IUUA 2PQWA 1UEBA 1M90U 3OYKA 3CCMA 1VQOA 5LL6S 3L2VA 1QVFA 1VQ9T 2NLUA 3CD6T 1S72T 1W2BA 3CMAT 3OYLA 4BACA 4L59A 1X6OA 1YJWA 2JVVA 1G5VA 1VQ6T 1EIFA 2R5MA 1YJNA 3DLMA 3CPWA 3OMGA 1VQNA 5KH6A 5IN1A 3CCRA 2M16A 1YJNT 3OYFA 1Q7YU 4FL6A 3QJ6A 2XDPA 1M1KU 2OTJA 2LRQA 5DLQE 3S3NA 1M1KC 4B9XA 2JTFA 2OTLA 4LD6A 1S72A 3GOXA 2JZ2A 1OZ3A 2QA4T 2HQEA 4PLIA 3CC2A 4C5GA 5KCHA 2MI6A 1JJ2A 2LDMA 2M1HA 4N4HA 3OQ5A 2K3YA 3MP8A 5FLXE 3CCVT 3OYMA 2DO3A 3F70A 4E7HA 4E7KA 2M0OA 1XTDA 2EQJA 3LGLA 2CKKA 2KVQG 1WGSA 3NTIA 4PLLA 3ME9A 1NPPA 3CC2T 2LQ8A 2EFIA 2LVMA 2EIFA 4E7LA 3I55A 1VQ7T 3MP6A 2RHIA 3OW2S 1KD1U 4C5IA 4E7IA 2X4WA 3CC4A 3FDRA 5CIUA 1VQKT 2GFUA 4E7JA 2JUFA 4BDYA 1NJIU 2LCLA 3ZEHA 1Q81U 3CC4T 2JOYA 1MHNA 1Q81C 1N8RU 2HQXA 1NZ9A 3PIOA 1YIJA 1N8RC 3ER0A 3CCQA 3OYBA 1VQ9A 2QEXA 3DLLA 3P8DA 4IUTA 1VQ6A 2OTLT 4Q5WA 1YIJT 4A4FA 2L89A 3CC7A 5IT9E 4QQGA 1OI1A 2EQKA 3P8BB 2BIVA 1QVFS 2EKOA 2IG0A 3KUFA 5IAYA 3CCEA 3CCUT 1WJSA 3CXCA 3P8HA 1VQ4A 2F5KA 3CEYA 2G3RA 3OYCA 3OYHA 4IUQA 3OYYA 4IKFA 4ZN3A 3I56A 4C5EA
chains in the Genus database with same CATH superfamily
2DL4A 3PMTA 4O5VA 3SB2A 5D6YA 3SDZA 1RABB 1SF9A 1E7OA 4M4ZA 4A4GA 2X4JA 3CC7Q 2DILA 1QVPA 2DMOA 1VQPT 1UECA 1N27A 5C0MA 2E70A 5DM7R 4PJLA 1OPKA 4IURA 3I5RA 3HFOA 1Q81R 2EYWA 2RHUA 4KRTA 3CCUQ 2QI2A 3M53A 1KSWA 4KH1B 1OYXA 3O8VA 2E12A 3HTRA 2ZAEA 4KBMB 3IQLA 1D1CA 3QZ5B 2DF6A 1YIJQ 3HKSA 1KD1C 2MWOA 4JRKA 4M78E 5I2SA 4EMGA 3BW1A 5FROA 2ROTA 4OF1A 4FIBA 1UHCA 3CC7T 3NTHA 3GP8A 2OJ2A 3OMCA 3G71A 3LGFA 4RCBA 3M0RA 2EVRA 2K5LA 2XHCA 3C4SA 1NJIC 5LJ3j 5IHIA 9ATCB 2JNGA 2QA4Q 3CC4Q 3M9QA 1VQNQ 3RBBB 1TS9A 2PVOB 5L8RE 3S3OA 2A7YA 2FZCB 4QQ6A 1ZUYA 4D8DA 1Q86R 2LCSA 2J6FA 4ESRA 2EWNA 2RH2A 2AZSA 2RA2A 1UB4A 3CCSA 1H8KA 3MKDA 2XG8D 1UUEA 4ELZC 2CS7A 2OAWA 3V7CA 2QG9B 4J9BA 4PL6A 5AYFA 2ZPGB 4FYXB 4MZTA 1KQSP 2CP6A 3JCMJ 1BYMA 1U8RA 1N9RA 4N0AA 2LJ0A 3UA7A 1Q86C 3PIPA 1C1AA 3L2QA 4M75B 2BZ8A 1K9MC 1ARKA 2ED0A 4V2SA 1BI3A 2LNHB 4E7ZA 4LDWA 1TUCA 1RAEB 3GLXA 4J9IA 1BU1A 1X75C 1WLPB 4XQ3A 1YHQA 3RERA 3AT1B 4XTZA 2O4XA 1KFZA 2ENMA 5CKDA 3URGA 3JB9D 1NEBA 3TREA 4C8QC 2QQRA 2MOXA 5A2QE 2FG0A 3VRZA 3EGUA 2DBMA 5HKCA 2KEAA 3QPHA 1PD0A 4C5HA 3S6WA 5LJ5j 1Y57A 2C0TA 1WNLA 2RHZA 2D0QB 1RLPC 4YTLA 4UC4A 5J26A 5GJWB 4RG8A 2F5TX 4LN2A 3VYGA 1M1FA 1VQ8A 1VQ7Q 2KT8A 3A8GB 3M5AA 4Z02A 1XNIA 5CAIA 2V8JA 3X25B 1Y71A 4HXJA 2ZGWA 2DE0X 3JCMg 3A1PA 3QWXX 5D6WA 4J9HA 3VS2A 1X2QA 1AWJA 1C6VX 4AMCA 4M7AA 4GY5A 1X01A 2DD5A 1S72Q 3BFMA 1RL2A 4QQDA 1YP5A 5FU6C 1ZX6A 2OTJT 2V8IA 1YJ9T 1RAFB 3OB9A 3L2UA 4EMKA 3TU4K 1VQ5T 3LH5A 2J6KA 3OBYA 4WTOB 1I4K1 3OW2A 1U1TA 2A36A 1VQLT 1NYFA 1J3TA 5CK9A 3DB3A 1Y07A 4J9FA 2MAMA 2XD0A 4OVAA 3CCVQ 1BBZA 4M7AF 4B6MA 4RTWA 4LXCA 4HKEA 1QCNA 3E1SA 1K73R 2E5QA 1D3BA 4M78B 4CI0C 4TVRA 5GAMj 4N4IA 5KYYA 3MO8A 3CCMT 2FHDA 2DM1A 3CXCS 4B9WA 3I55T 2P84A 1WXTA 2RJCA 2EJGA 2RM4A 2QQAA 3OYIA 5GAOl 4JRIA 2LJ1A 4C8QB 2V26A 3OS0A 4M7AE 2O4XB 3CMAQ 3E9GA 2KNBB 1WQ7A 3OS5A 2NUZA 4ATOA 4QW2A 3UA6A 1M90U 3JCMc 1VQOA 2CUBA 2Y4XA 3M59A 4L5GA 1YJWQ 2CH4W 2VXFA 2RQTA 2A37A 1B3QA 4ME7A 4C0ZA 1YJWA 2JVVA 5GAN4 1TTHB 1VQ6T 2QAZA 1RAHB 2PNIA 3MJXA 1K0XA 4WF2A 1N5ZA 4OMNA 3CBMA 1YWOA 2VGMA 2QEXQ 2RF0A 4PJOA 4RTVA 2QTXA 3CCRA 2M16A 2YLCA 1YN8A 4XTXA 2K79A 2J6OA 3OYFA 1M1KU 4AFZC 2K9GA 2H3EB 2FRYA 2VUBA 5GAOq 4DOWA 4LDVA 1QMCA 2C0IA 3RKXA 3HRUA 4M78D 4OMPA 2COWA 1UDLA 4PJNA 2OTLA 2K6DA 1TUGB 2HEQA 2FVUA 2JZ2A 3RIRA 4BY6B 3CC2A 4C5GA 2K7AA 2LDMA 4N4HA 2ZPEB 4KGZB 2OX7A 4E6RA 3TCJA 5FLXE 3X28B 1I1JA 3CCVT 1OEBA 4N0AC 2DL7A 3QG1A 2EQJA 1FMWA 1X69A 1BI2A 2F2WA 1AWWA 1ACMB 1QLYA 2IPOB 1AT1B 3ME9A 2DL8A 2LQ8A 2EFIA 1KG1A 2LVMA 1G3TA 2QQBA 5LJ3d 1IHWA 3EFOB 3V8LA 4E2FB 5GANh 2CREA 2QTVA 1TUDA 1R8OB 4C92A 3INZA 1VQ7T 2KSSA 3MP6A 2F1LA 4DQ2A 2RHIA 2PTKA 2WSFE 2CP5A 4OB2B 2HMAA 2HZYA 5I21A 3JCMf 1M2VB 2A0FB 5GMKh 1JEGA 1VIEA 2KMTA 1YJ9Q 4M78A 4PJOD 3TSWA 3FIFA 2KRMA 2XKOC 2DEUA 2GFUA 4JLGA 2JUFA 2NUPA 2CH4A 5GAN2 1NJIU 1XJWB 1V1CA 2MYSA 2RQVA 1PSEA 2MPXC 1ZA2B 3ZEHA 2NUTA 1MHNA 4HA8A 4F7UG 2HQXA 2DERA 1KQ1A 2AHJB 2XICA 5GANd 3RDVA 1MNDA 2KI7A 3HL8A 1VOMA 1GBQA 3ER0A 1PRLC 3OYBA 1VQ9A 3JB9J 2BE9B 4Q5WA 1ZHIA 5DY9A 2KK4A 4R55A 4J6YA 2L0AA 2CZ7B 1WFWA 2L89A 5IT9E 1OI1A 3P8BB 3PE0A 2LT4A 5FU7B 4KT0E 1WPYA 3CXCA 2VVKA 2HSPA 1K76A 1E6GA 1OPLA 2RK2A 1G83A 1BCMA 2P0QA 2LMJA 3VS4A 1JRIA 4FSXA 4C92F 3GNFB 2FEIA 2XIDA 3QWYA 3BE3A 1WDXA 5AT1B 4EDUA 4HCZA 1PKTA 2BKDN 3PVQA 3DB4A 2RO0A 1W6XA 2Z0WA 2L3RA 2WACA 4P5NA 1W70A 1RLQC 4K11A 4M78F 2XU8A 4E7SA 2F69A 4EMHA 1OOTA 3UT1A 4C0GA 1ZLMA 4CRIA 2DX1A 3EHRA 3CPWP 1O9SA 3FB9A 4PJJA 3E2UA 3VS5A 1QWFA 1VA7A 3CCVA 2R58A 2AK5A 4A63B 4EMKB 1VIFA 4CC2A 3CCUA 3CMEQ 4JJCA 4RTUA 2DTHA 4F16A 2CUDA 3CD6A 4X1VA 5CQXA 3MP1A 1YBYA 3OYGA 1Q95G 3V7RA 2JXBA 1TWBA 4X34A 3CCQQ 2O9SA 1UJ0A 2DJQA 2EYXA 2E64A 1PHTA 3TSZA 4AG2C 4PFPA 1GXIE 2GTOA 2VGNA 2ATCB 2X51A 3FJ5A 4DBHA 4HVVA 2ESWA 2L5QA 5CQYA 5LJ3g 3GNGA 4M7AD 3A8HB 1W2BP 1AWOA 1GCQC 5I11A 3OA6A 3MHXA 2MF2A 1BKBA 1CKBA 4M7DE 4PFOA 2JM8A 4C8QA 1OX8A 3OS1A 4A53A 3BDUA 1NPRA 1I8FA 3L2WA 2RHYA 1Q7YR 2VASA 1JXOA 3OYDA 2HKNA 3BDLA 4C92G 2F2XA 4D6WA 1GBRA 2SRCA 3PNWC 5GMKj 3CCRT 1UGQB 1SRLA 5FWCA 3I9QA 2RK1A 1W2BS 3Q1JA 1RUWA 3LW5E 4MDXA 4J83A 4ZTFA 2RI3A 4XU3A 2E3IA 4M75A 3V7SA 1KC8C 2A28A 4M7DB 3QYHB 2GBQA 2QGFB 3HHTB 3A5ZB 3JCMh 2RD1A 4BUGA 1TU0B 3OYJA 3WXMB 1U5SA 2ZCFB 3MCAB 1SHFA 2K3BA 2OI3A 1G8XA 5GMKl 3CPFA 1T0HA 2GF7A 4C8QD 4ANJA 1OZ2A 3REBB 2YRVA 3O5ZA 1C0MA 3EG0A 1BIAA 1IZ6A 1LCKA 3TVTA 3SWNA 3H0FA 4RTYA 1D09B 3LLRA 1M90C 4E47A 4EMKC 1JB0E 4Y28E 4N4GA 2CYZB 4DBQA 2MWPA 1K73U 1JQQA 1VQ5A 4FM4B 4L6V5 4RG2A 2MK5A 2RI2A 1VQ7A 5GMKe 1QKWA 2CDTA 2SEMA 4C92D 4JLIA 3N5BB 3FRNA 1GL5A 2DAQA 2RJEA 5GMKm 3PT9A 1Y7XA 1X6GA 2EGAA 2CZ0B 2J05A 1KHIA 1YCYA 1UGVA 4LUEA 1V76A 2KE9A 2DVJA 4M75D 2JS2A 2LX7A 3CCMQ 2D9TA 1Q86U 3JSCA 1QCOA 2X4XA 3R6OA 5KYUA 1YHQT 4DEXA 2XDDA 1M9SA 1VQMT 3QDRB 5A0DA 4MZMA 3GBQA 5KE3A 2B8AA 3J7AF 1WJRA 1PC0A 4J6XA 2HQHA 2PUKB 2K5IA 3G4ST 4BE1A 2GFAA 3VS6A 3JCMV 3CBOA 1S1NA 2QDYB 4M7DG 4NS5A 4NL2A 3LYIA 3JAME 2DVEA 3G4SQ 1VQPA 1SSFA 4FU6A 5FWBA 2E65A 3L2RA 5KYXA 2E6NA 5IHNA 4OMOA 1SSHA 4BY6C 5HY6A 2KRNA 3A8MB 3M57A 5GAMg 1KHCA 1VQOT 1K8AU 1K8AR 3HPWA 1RAGB 4RTTA 3J81E 4M75G 2K2MA 2VB6A 2DXBA 1PD1A 2X3XD 3OYAA 1VYUA 2RI5A 1JO8A 4IUUA 4M77C 3L2VA 5GANf 3OYLA 2ZZDA 3HRSA 4OMMA 2OAUA 1MUZA 1X6OA 2MMPA 2DD4A 2R5MA 3UDCA 1EZZB 3QXEB 1FX7A 1VQNA 2DFUA 3SWNB 3VRYA 1DJ7B 5KH6A 5IN1A 1QCFA 2KXCA 2QDLA 3H0HA 3R6NA 3G71Q 2PUOB 2LX9A 2CP3A 1ABOA 4HVUA 5CCAA 2LRQA 5DLQE 1T3SA 2AZVA 2ED1A 3HP9A 4NL3A 3S3NA 4PKCC 3I56Q 3NGPA 2DTIA 2JTFA 4M77A 4R0KA 3RNJA 4XU0A 1ZA1B 5A0LA 2HQEA 2QA4T 6AT1B 4PLIA 2MI6A 1ZSZB 3OW2P 1KIKA 4M7DD 4JS4A 2DO3A 2V8KA 3F70A 7AT1B 4E7HA 2HL5C 2M0OA 2CKKA 1VQLQ 4HCBA 5ECAA 2O2OA 3OSVA 1HSQA 5GAOn 3NTIA 1YHQQ 1M30A 2W0ZA 4PLLA 1GFCA 1I5OB 1B34B 3QSUA 1KQ2A 2EIFA 3CCSQ 1TH7A 2GCXA 4XTUA 1WZOA 4PNOA 4EPCA 3KXTA 2HAXA 1AEYA 1UHFA 2EJ9A 2PVGB 2QGGA 3WVDB 4WCIA 3UATA 3VS7A 2X4WA 1PM3A 3GIBA 2QXFA 5KYWB 1ZUKA 3CC4A 4JJDA 1FWZA 3FDRA 1K0SA 2BTTA 5HK3A 4RCCA 3A8OB 1EFNA 2HDAA 2COYA 1H92A 5LJ5f 4C92B 1Q81U 2HBWA 3CC4T 1D0ZA 2D6FA 2YHTA 1KC8R 2LT1A 3QJYA 3REAB 2CZ6B 3PIOA 5HCKA 1N8RC 5KYUB 1BCOA 3RKYA 3EG9A 3U23A 2DXUA 3EFOA 2KRSA 2DNUA 3CCQA 3VS0A 3SFMA 4JS5A 3DLLA 3PVLA 2OTLT 1R0BG 1HD3A 5LJ5g 4QQGA 3CC7A 2EQKA 3JCMe 2AKLA 1SHGA 1X27A 3JCMP 2IG0A 4C92E 4Z89A 3CCEA 3C0CA 3M4YA 3MPUB 2F5KA 1OV3A 2AT1B 2I2LA 1HJDA 4QKUA 3H9NA 4IUQA 4C8QE 4ZN3A 1RAAB 4C5EA 5L23A 1A0NB 1IRXA 3G6EA 2EJFA 3G7ZA 4Y92A 3CCEQ 4ZGJB 4M7AG 5KE2A 4FYVB 3CCJQ 5GAMe 3CPWS 5FRMA 4J9EA 2LJ3A 3QUIA 4IUPA 4OB1B 2JTEA 1QVFP 3CMAA 2RNAA 3RMSA 3G6ET 1QVGA 4HCKA 1YI2T 1ZSZA 3MEUA 3ULRB 3HRTA 3X26B 1WHKA 2RQRA 2EGCA 3UWNA 1VQNT 3RKWA 3G4SA 1VQPQ 1QWEA 1Q82U 4JUVA 2P4RA 1VQ8T 4BDZA 1HXDA 2DJZA 3RUXA 4QVZA 2J7IA 2DIQA 5J39A 2C06A 2NUPB 3TEEA 3CCQT 1HYOA 3M55A 4OGCA 1MNEA 4KH0B 2FL7A 2HSEB 4F04B 1K73C 2O01E 3MEWA 3G6EQ 1AHJB 5GAMf 5IH2A 2DA9A 1JJ2P 3EGXA 2V1QA 2YSQA 2CSIA 3OBWA 1IREB 5J3BA 1JBMA 4JDSA 3JCMb 1SKUB 4KUIA 4PJOG 2R57A 2RJFA 4M75C 5CKBA 1K4US 3CCRQ 4PJOE 4QT7A 3NHNA 2EQMA 1VQ6Q 3J80E 2J06A 4JPBW 2M9UA 3CMEA 5FW9A 4NOYA 2K57A 2YXYA 4X9DA 2JW4A 4RKUE 1WJQA 1SRMA 2VYTA 4II1A 4MMKA 4A4HA 1X6BA 4RMOA 1NYGA 2NWMA 5FRNA 1M2OA 2D8HA 1FYNA 1YITA 2R5AA 2KY9A 1WHHA 4MMLA 2D1XA 4F7UB 3SD4A 2K3XA 3CCST 2P0PA 2Y4YA 1Y96A 2Y90A 2ZPFB 4ZGDB 2QA4A 4IIOA 2X35A 4Z8AA 2KDSA 1PSFA 5IXFA 2MCNA 3VS3A 1RAIB 2YUQA 2VXEA 2QEXT 3RMQA 1ABQA 2YLBA 5M9OA 3KFVA 3THKA 1M5Q1 2CP7A 4A4KA 3OS2A 4VUBA 3VJPA 3C95A 3ASKA 1ZUUA 3TQ7P 3META 1OULA 1D3BB 5D7UA 2FPEA 1YI2Q 1QVGS 3X20B 1WHGA 1UGPB 1I0CA 1Z9QA 2ECZA 2DL5A 2JM9A 2VV5A 1RI0A 4C0DB 3D7SB 4PJOF 2O88A 3OYEA 1M4ZA 1UG1A 1YITQ 1WI7A 3HSBA 2YWWA 1BK2A 3FLGA 1GCQA 2P0KA 3EG2A 3QBYA 1K9AA 3QZ9B 1Q7YC 2JS0A 1VQOQ 1QVGP 3CCLA 2LQKA 1N9SA 4FT4A 3SWNC 1D1AA 3MEAA 1T3LA 1UJYA 3EG1A 4DBRA 2ZPHB 2NYSA 4R56A 3OYNA 2QQSA 5LJ5h 5GAOm 5GAOr 3WVEB 1YI2A 3PTAA 5C6SA 4BE0A 1MMNA 4M77E 3L42A 3SHWA 4XU1A 2EQIA 2PU9B 1AD5A 2QK0A 4M77G 2WSCE 3I35A 4IUVA 1OX9A 2KBTA 1WHLA 3BY7A 1T0JA 5I2MA 1VQ4Q 2DIGA 5FU7C 1VQ4T 1SEMA 2FRWA 4KGVB 5CKHA 8ATCB 4BD3A 2KYBA 3CD6Q 2HNIA 2CGHA 1VQMA 1UGRB 4F7UA 1I07A 2COZA 2L2PA 2JN0A 3CCJA 1UEBA 1UFFA 5GAOp 1CSKA 5LL6S 2NLUA 5GAN7 3CD6T 1NG2A 5LJ5e 1Q82R 1S72T 2RPNA 2X3WD 3CMAT 1I81A 2IVWA 1P92A 4L59A 4OB3B 1U06A 5KYXB 1G5VA 1EIFA 1G3WA 2E4HA 3DLMA 1VQ5Q 3OMGA 3CPWA 5CVIA 3M0PA 2KQWA 2EW3A 2DLPA 5GAN3 1D0XA 4F17A 1I5LA 4ZGEB 3M54A 2EBPA 1YJNT 1LJOA 1W4SA 4DEYA 1UTIA 3I55Q 2JJ9A 3QJ6A 2FZKB 2WSEE 4JZ3A 1SPKA 2XDPA 4KGXB 4FYYB 2OTJA 5LJ3h 4JJBA 1VYVA 1M1KC 1CKAA 4B9XA 5GANg 2E3HA 4LD6A 1YWPA 4LDYA 5LJ5d 3GOXA 1SG5A 1H3HA 5KCHA 2F2VA 2GNCA 2M1HA 3C94A 2DYIA 1O75A 2K3YA 3MP8A 4F7UE 1NE8A 1IGUA 1WQWA 3OYMA 3RESA 3EGDB 5I22A 1VQ8Q 4XAXB 4RTZA 3V8KA 1M8VA 4A54A 4M78G 2KROA 2LZ6B 1MV3A 4J9GA 4M77B 1XQHA 1NPPA 1OU9A 4GLMA 2CT4A 2RQWA 1AWXA 4KUDK 3EGXB 4PJOC 4E7LA 4JZ4A 2PZ1A 4M75E 1M90R 4FSSA 1M3AA 1N6AA 2FB7A 3I55A 1B07A 2GTJA 5DLOA 4C5IA 1KD1U 5KYNA 2LP5A 4OB0B 1ZQ1A 2JT4A 3CBPA 2H3JA 3EFSA 5FU6B 2IIMA 5CIUA 1X2KA 1VQKT 1WA7A 3I5SA 4BDYA 2YDLA 2YUPA 3HFNA 2JOYA 4M7DC 3M0TA 2B86A 1NZ9A 1M3BA 3RR6A 3UF4A 3LWHA 3JB9H 1QP2A 3EG3A 2E5KA 3JB9G 1LOJA 4C8QG 4AT1B 3NFCA 1ZSZC 1ZBXA 2QEXA 3P8DA 1VQ6A 1PRMC 1YNZA 2RQUA 1AZGB 4M78C 4CC7A 5GJVB 1OQKA 1RACB 1KJWA 2GQVA 1WYXA 1R0CB 2EKOA 2FYKA 1QVFS 2LNVA 5IAYA 3QHSA 4M7DF 2K2VA 3M4GA 1VQ4A 3CEYA 3OYCA 3OYHA 3OYYA 4O6JA 1WIEA 4XTVA 1M1GA 2OTJQ 1BIBA 2H8HA 4XU2A 4J6WA 4PFZA 1PG5B 2VKNA 3H6ZA 1E6HA 2DRMA 2DXTA 2KGTA 2DKGA 4M75F 2E41A 4OP0A 4HT8A 3ZBDA 5CR2A 5KCOA 2M0YA 1TSFA 2M51A 2EGEA 4LE9A 3E19A 1NM7A 4CC4B 4BB7A 2KYMA 4XTYA 3AHUA 1GCPA 2LTOA 1RI9A 2XI9A 2JMCA 5GAMd 1V29B 2JMAA 2RN8A 2DL3A 2BUDA 3LX7A 3OSSC 2G6FX 5GAN5 4LDUA 1LNXA 2YT6A 4M7AC 3QKJA 2YRDA 3VUZA 5GANj 2RB6A 2A08A 2A3LA 2M02A 3CCET 2E6ZA 1KQSS 1Y0MA 3M58A 3LH0A 1BB9A 3QO3A 2X4YA 1HK9A 1B7TA 3JCMd 1QP3A 1MMDA 1PWTA 1WX6A 2ZPIB 1NLPC 1FMVA 3FJPA 4MZPA 3GF5A 5KYYB 3FEOA 2FZGB 3JB9I 2XDBA 2V1RA 1VUBA 2O31A 1AVZC 2LCCA 3NPFA 3ZL7C 2GQIA 2RMOA 3OY9A 5CKEA 4FCYA 1Z9ZA 2ZPBB 1AOJA 2EQUA 4QVDA 1ZSGA 2HKQB 3EAEA 4J7FA 3JCMX 4RTXA 3PMIA 4J5YA 4EIKA 4OGEA 1IO6A 1N8RR 1JU5C 3X24B 4BE2A 2QQ9A 1FMKA 2FPDA 4FW2A 2RHXA 2DZCA 5EC7A 2I0NA 8AT1B 2K4YA 4C0FA 2DK3A 4OMQA 2QYZA 3SEMA 5D6XA 3MEVA 2EAYA 1X43A 2EYYA 4QVCA 2L8DA 2YRCA 1YCSB 3KBGA 1UE9A 1EX4A 4M77D 1VQKA 4LD9K 1KC8U 2AIRB 2L3PA 2DPPB 5GAN8 1YJ9A 4AFUC 1Q82C 5CO7A 2HBPA 2X9HA 4A4EA 2OTLQ 3A98A 1JJ2S 2XMFA 3JCMW 1AZEA 3VUBA 3CMET 3G1JA 2D0NA 2DXCA 1R77A 4FT2A 3JV3A 2BZYA 5GMKi 3G71T 3L2ZA 1Y96B 1KD1R 1VQLA 4M7AB 2KR3A 1WXBA 1H3ZA 3CXCP 3JCMQ 1VQKQ 1MMGA 2E1HA 2VC8A 3EGDA 2PVDB 1M1KR 3QIIA 4X9CA 2RJDA 2KXDA 2CP0A 3CCLT 1W1FA 1IB8A 2BE7D 5A0GA 4PJMA 1YJWT 3NTKA 3PGGA 5GAN6 3CCJT 4M7DA 2VWFA 4ZN1A 2AKKA 4J7IA 3VU3C 5HK0A 1BI0A 2DTOA 1G2BA 2HD0A 1JXMA 1KQSA 1M8MA 4C8QF 3V8JA 4DA4A 4RUGA 1PNJA 2EPDA 1K9MU 1TXQA 2XK0A 2LQNA 2ABLA 2MIOA 2NUTB 1LVKA 3CC2Q 1F1BB 2DRKA 3E9FA 2FO0A 2EYQA 1OU8A 2E10A 4Y91A 2YUOA 4AFQC 3EHQA 4XK8E 4BI8B 3FC3A 2ROLA 5LJ3e 2BZXA 4ZTJA 1D0YA 1LPLA 3PFSA 4OMFB 1IHVA 2CZ1B 3H8ZA 1XOVA 1WHJA 3H41A 1K8AC 1VQMQ 4OMLA 3T9NA 1H641 1MMAA 3I56T 2FPFA 3S3MA 1G3SA 1YITT 1UGSB 1U3OA 4LDXA 3CCLQ 2CP2A 4C0DC 3M0SA 1YJNQ 2PQWA 3OYKA 3CCMA 3JB9F 4PK4A 1QVFA 1VQ9T 1W2BA 4PJOB 1MGQA 4BACA 2KT1A 3GPLA 1K9MR 1ZBJA 4JRQA 4LNPA 3LWIA 1YJNA 2L3QA 4HT9A 3H0IA 3QDFA 4GLKA 5KYWA 1M27C 4HCCA 2DZ9A 4GBQA 2DEQA 3A8LB 5GANe 2LQWA 1NLOC 1VQ9Q 4F14A 2LC4A 3L1AA 1IXDA 1Q7YU 5IHKA 3C12A 2CT3A 2K5FA 4FL6A 2P4TA 3VV0A 1PCXA 3ZFJA 3DKMA 1TOVA 4M77F 2HCKA 2DYBA 4ORZA 1FXXA 2EYZA 4CC3A 4J9DA 1NBEB 3CQTA 1S72A 1QW1A 3JRZA 1OZ3A 2YUNA 3VS1A 2C0OA 4DBFA 4J8OA 1NEGA 1JJ2A 3OQ5A 1KK7A 3M0UA 2W10A 2DETA 2EKHA 1PKSA 2D8JA 1QQJA 3QYGB 1TG0A 4E7KA 1M2VA 1XTDA 3LGLA 3EG9B 1GRIA 1WGSA 2KVQG 1RADB 4XTWA 3CC2T 5LJ3f 1VYTA 1D1BA 4ZNXA 2HL3A 3NMZC 1WXUA 1NJIR 1BI1A 4MDWA 1IGQA 5CKFA 4HVWA 3OW2S 1WHMA 1U1SA 4E7IA 4C92C 3M56A 4E7JA 2GGRA 2LCLA 3EFRA 1MV0B 4FYWB 2QASA 2JTMA 4AFSC 1YFNA 3EH1A 3M0QA 4D8KA 2L3SA 2CSQA 1Q81C 1N8RU 4Z88A 5IXBA 1QKXA 1YIJA 5EG2A 4DOVA 2O9VA 4AG1C 3UPUA 4IIMA 4KULA 4JJNK 1G3YA 4IUTA 4BI4A 4J9CA 4JRPA 4ELYC 4BI3A 3VYHB 4A4FA 1YIJT 2DBKA 1GFDA 2BIVA 3KUFA 4F7UF 4FW1A 1WJSA 3CCUT 3VKIA 3P8HA 1K1ZA 2G3RA 5GAMh 3EH2A 2KAFA 4IKFA 4LUDA 1B34A 1M3CA 3I56A
chains in the Genus database with same CATH topology
4FSXA 4C92F 3GNFB 3PMTA 4O5VA 2XIDA 1M1GA 3G6EA 2EJFA 3G7ZA 3SB2A 4ZGJB 1BIBA 5D6YA 3SDZA 4M7AG 5KE2A 4XU2A 4EDUA 5GAMe 4A4GA 4J6WA 3CPWS 2X4JA 4HCZA 5FRMA 3H6ZA 2BKDN 2DXTA 1QVPA 2DKGA 3DB4A 1VQPT 2RO0A 3QUIA 4IUPA 1N27A 5C0MA 2E70A 4OB1B 5DM7R 4M75F 2E41A 3CMAA 4OP0A 4HT8A 4IURA 3RMSA 3ZBDA 5CR2A 3HFOA 5KCOA 3G6ET 1QVGA 2RHUA 2L3RA 2WACA 2QI2A 3M53A 4P5NA 4M78F 2XU8A 1OYXA 2F69A 3O8VA 1YI2T 3MEUA 3E19A 2E12A 4EMHA 3HRTA 4KBMB 4BB7A 3QZ5B 3X26B 4XTYA 3AHUA 3HKSA 3UT1A 3UWNA 1VQNT 1KD1C 2LTOA 4C0GA 2MWOA 4JRKA 4M78E 4CRIA 5I2SA 2XI9A 5GAMd 1V29B 1O9SA 3FB9A 3RKWA 3BW1A 4EMGA 3G4SA 1Q82U 5FROA 4JUVA 2BUDA 3LX7A 4OF1A 3OSSC 1VQ8T 4FIBA 3CC7T 4BDZA 5GAN5 3NTHA 3CCVA 4LDUA 2R58A 1HXDA 1LNXA 4EMKB 1VIFA 2DJZA 3OMCA 3RUXA 3GP8A 3QKJA 3LGFA 4RCBA 4QVZA 3VUZA 3G71A 2RB6A 5GANj 2A3LA 3CCUA 3CCET 2DIQA 2E6ZA 2K5LA 1KQSS 5J39A 3M58A 3LH0A 2C06A 2XHCA 2DTHA 3C4SA 3QO3A 1NJIC 5LJ3j 3TEEA 2JNGA 3CCQT 3CD6A 3M55A 2X4YA 3M9QA 4OGCA 1HK9A 5CQXA 3JCMd 2PVOB 1YBYA 3MP1A 5L8RE 1QP3A 3OYGA 3S3OA 3V7RA 2A7YA 2ZPIB 4X34A 4QQ6A 3FJPA 2E64A 2FL7A 1GXIE 4MZPA 3GF5A 1K73C 3FEOA 2O01E 2EWNA 2RH2A 1VUBA 2VGNA 2RA2A 3MEWA 3JB9I 2XDBA 1UB4A 1AHJB 3CCSA 5GAMf 2LCCA 2XG8D 2L5QA 3OY9A 5CKEA 4ELZC 5CQYA 3OBWA 1IREB 2CS7A 5LJ3g 3GNGA 5J3BA 1JBMA 4JDSA 2ZPBB 3V7CA 3JCMb 4PL6A 2EQUA 3A8HB 5AYFA 4QVDA 4M7AD 2ZPGB 3EAEA 4J7FA 4KUIA 3JCMX 4MZTA 4PJOG 2R57A 2RJFA 4M75C 5CKBA 3OA6A 3PMIA 3MHXA 4J5YA 4PJOE 2MF2A 3JCMJ 1BKBA 2EQMA 4OGEA 4M7DE 1BYMA 1U8RA 1N9RA 3J80E 4C8QA 4N0AA 3OS1A 4A53A 3BDUA 1NPRA 2M9UA 1Q86C 1I8FA 3L2WA 2RHYA 3CMEA 3X24B 3PIPA 3OYDA 3BDLA 4M75B 3L2QA 4BE2A 4NOYA 2QQ9A 4C92G 2K57A 4D6WA 4X9DA 4RKUE 3I56A 1WJQA 3PNWC 1K9MC 2VYTA 5GMKj 2RHXA 2DZCA 3CCRT 1UGQB 4V2SA 2K4YA 1BI3A 4II1A 4C0FA 2DK3A 4LDWA 3GLXA 4MMKA 4A4HA 2RK1A 1W2BS 4RMOA 1X75C 3Q1JA 4XQ3A 5FRNA 1YHQA 5D6XA 2R5AA 1YITA 3RERA 3MEVA 4XTZA 2O4XA 3LW5E 2EAYA 4MDXA 4J83A 4QVCA 2L8DA 2RI3A 4XU3A 4ZTFA 2KY9A 5CKDA 3URGA 3KBGA 3JB9D 4M75A 4MMLA 3V7SA 1KC8C 4M77D 1VQKA 4F7UB 3SD4A 2K3XA 4M7DB 3CCST 2P0PA 2Y4YA 1KC8U 3TREA 1Y96A 2QQRA 2Y90A 4C8QC 2ZPFB 3QYHB 4ZGDB 2QA4A 3HHTB 1QVFA 2DPPB 5GAN8 2X35A 5A2QE 1YJ9A 3A5ZB 3JCMh 2RD1A 1Q82C 2KDSA 1PSFA 5HKCA 5CO7A 2HBPA 4BUGA 3OYJA 3WXMB 4A4EA 1QVFS 1JJ2S 2ZCFB 3MCAB 3JCMW 3VUBA 2VXEA 3QPHA 5GMKl 3RMQA 2QEXT 3CMET 4C5HA 3S6WA 3CPFA 2DXCA 2GF7A 4C8QD 5LJ5j 1OZ2A 2YRVA 1BIAA 1IZ6A 1WNLA 2D0QB 2RHZA 2YLBA 4YTLA 4UC4A 5J26A 3SWNA 5M9OA 5GMKi 3G71T 3L2ZA 4RG8A 1M5Q1 1Y96B 2F5TX 4A4KA 3LLRA 3VYGA 3OS2A 1M90C 1VQLA 4VUBA 4E47A 4M7AB 1JB0E 3C95A 3VJPA 1M1FA 3ASKA 4N4GA 4Y28E 4EMKC 1VQ8A 2CYZB 3A8GB 3M5AA 3CCUT 4Z02A 2MWPA 3META 1XNIA 5CAIA 1D3BB 2V8JA 1K73U 1H3ZA 3X25B 1Y71A 3JCMQ 3X20B 2ZGWA 4FM4B 1QVGS 4L6V5 1UGPB 4RG2A 1VQ5A 3JCMg 2E1HA 2VC8A 2PVDB 2RI2A 5D6WA 1VQ7A 5GMKe 2VV5A 3QIIA 1VQ7T 1RI0A 4C0DB 4X9CA 4PJOF 2RJDA 3CCLT 4M7AA 4C92D 3OYEA 4JLIA 4GY5A 1M4ZA 3N5BB 3FRNA 5A0GA 1X01A 1YJWT 2DD5A 3HSBA 3NTKA 3BFMA 3PGGA 5GAN6 1RL2A 3CCJT 4QQDA 2DAQA 3FLGA 4M7DA 2RJEA 5GMKm 3PT9A 1Y7XA 2P0KA 5FU6C 4ZN1A 4J7IA 3QBYA 2CZ0B 3KXTA 2OTJT 1KHIA 1YCYA 2V8IA 4XTVA 3VU3C 5HK0A 1BI0A 1YJ9T 3OB9A 2DTOA 3QZ9B 4EMKA 3L2UA 3TU4K 1VQ5T 1Q7YC 2HD0A 4M75D 3OBYA 3CCLA 2D9TA 1Q86U 2LQKA 1N9SA 1I4K1 4FT4A 3SWNC 3MEAA 1KQSA 4C8QF 3JSCA 3V8JA 2X4XA 2ZPHB 3R6OA 4R56A 3OYNA 3OW2A 2XDDA 1M9SA 4DA4A 2QQSA 1U1TA 1YHQT 1VQMT 1K9MU 3QDRB 5A0DA 5LJ5h 4MZMA 2XK0A 5GAOm 1VQLT 5GAOr 3WVEB 1YI2A 5KE3A 3PTAA 2B8AA 3J7AF 5CK9A 1WJRA 5C6SA 3DB3A 4J6XA 4BE0A 2PUKB 1Y07A 2K5IA 2MAMA 3G4ST 2XD0A 4BE1A 2GFAA 4M77E 4OVAA 3L42A 3JCMV 3E9FA 3CBOA 2QDYB 4M7DG 4NS5A 4NL2A 2EYQA 3LYIA 4XU1A 2E10A 4Y91A 2PU9B 4M7AF 3JAME 2DVEA 1VQPA 4M77G 4XK8E 4BI8B 2WSCE 1SSFA 4FU6A 4HKEA 2E65A 3FC3A 3E1SA 4IUVA 3L2RA 2E5QA 1D3BA 2E6NA 3BY7A 4M78B 4CI0C 5LJ3e 4TVRA 5I2MA 4ZTJA 4BY6C 5HY6A 2DIGA 3A8MB 3M57A 5GAMj 4N4IA 3MO8A 5GAMg 1KHCA 3CCMT 3PFSA 1VQOT 2FHDA 4OMFB 1K8AU 2CZ1B 3H8ZA 3HPWA 3CXCS 5FU7C 4B9WA 1XOVA 3I55T 2RJCA 1VQ4T 1K8AC 2EJGA 2RM4A 2QQAA 3OYIA 5GAOl 4JRIA 3T9NA 1VQ9A 4C8QB 1H641 3OS0A 3I56T 3J81E 4M7AE 2O4XB 3S3MA 1G3SA 4M75G 3E9GA 5CKHA 4BD3A 1UGSB 1YITT 2DXBA 2HNIA 1WQ7A 4LDXA 3OS5A 2CGHA 1VQMA 1UGRB 4F7UA 4C0DC 3OYAA 4ATOA 2RI5A 4QW2A 2JN0A 3CCJA 4IUUA 2PQWA 1UEBA 4M77C 3JCMc 5GAOp 3OYKA 5LL6S 3L2VA 3CCMA 1VQOA 5GANf 1VQ9T 2NLUA 2Y4XA 3M59A 5GAN7 5LJ5e 4L5GA 3CD6T 1S72T 1W2BA 3CMAT 4PJOB 1I81A 2IVWA 2VXFA 3OYLA 1MGQA 4BACA 4LD9K 1P92A 2ZZDA 4L59A 4OB3B 3HRSA 3GPLA 4ME7A 2OAUA 4C0ZA 1X6OA 2MMPA 1YJWA 2JVVA 5GAN4 2DD4A 1G5VA 4JRQA 1VQ6T 1EIFA 2R5MA 3LWIA 3UDCA 1YJNA 4HT9A 1G3WA 3DLMA 3QXEB 3OMGA 3CPWA 1FX7A 5CVIA 1VQNA 4WF2A 3SWNB 4GLKA 2KQWA 1DJ7B 3CBMA 5KH6A 5IN1A 5GAN3 2VGMA 4HCCA 4PJOA 2DZ9A 1I5LA 2QTXA 2DEQA 3CCRA 3JB9F 3A8LB 4ZGEB 5GANe 2M16A 3M54A 2YLCA 2PUOB 4XTXA 2LC4A 3L1AA 1YJNT 1LJOA 1W4SA 3OYFA 2LX9A 1Q7YU 3C12A 2K5FA 4FL6A 3QJ6A 2WSEE 1M90U 2P4TA 2XDPA 1M1KU 2OTJA 3VV0A 3ZFJA 2VUBA 2LRQA 3DKMA 5DLQE 4LDVA 4M77F 5LJ3h 4DOWA 3HP9A 5CCAA 4NL3A 3S3NA 3RKXA 4PKCC 3HRUA 4M78D 1M1KC 2DTIA 4B9XA 5GANg 1FXXA 2JTFA 2OTLA 4M77A 4LD6A 4LDYA 5LJ5d 4XU0A 1S72A 2FVUA 3GOXA 1QW1A 5A0LA 3JRZA 2JZ2A 1OZ3A 2HQEA 3RIRA 4BY6B 2QA4T 4PLIA 5KCHA 4C5GA 3CC2A 2MI6A 4J8OA 2LDMA 1JJ2A 2M1HA 4N4HA 3C94A 3OQ5A 2ZPEB 1O75A 2K3YA 3MP8A 3TCJA 5FLXE 3X28B 4F7UE 3CCVT 4M7DD 1NE8A 1WQWA 3OYMA 4N0AC 3RESA 4JS4A 2DO3A 2V8KA 3F70A 3QYGB 4E7HA 4E7KA 2M0OA 3QG1A 1XTDA 2EQJA 4XAXB 3V8KA 3LGLA 1M8VA 4A54A 1BI2A 2CKKA 4M78G 4HCBA 3OSVA 4M77B 5GAOn 1WGSA 2KVQG 3NTIA 4XTWA 1XQHA 4PLLA 3ME9A 1NPPA 5LJ3f 2LQ8A 2EFIA 3CC2T 1KG1A 1B34B 2LVMA 1G3TA 2QQBA 3QSUA 5LJ3d 1KQ2A 2EIFA 4KUDK 1TH7A 4PJOC 2GCXA 3V8LA 4E7LA 5GANh 4XTUA 4M75E 1N6AA 1R8OB 2FB7A 3INZA 4PNOA 4C92A 4EPCA 1BI1A 2KSSA 3MP6A 4DQ2A 3I55A 4MDWA 2HAXA 2RHIA 2WSFE 5CKFA 2EJ9A 4OB2B 5I21A 3JCMf 3OW2S 2PVGB 4C5IA 5DLOA 1KD1U 3WVDB 1U1SA 5GMKh 4OB0B 4E7IA 1VIEA 2KMTA 2X4WA 1ZQ1A 4PJOD 4M78A 3GIBA 3CBPA 2QXFA 4C92C 3CC4A 2H3JA 3EFSA 5FU6B 1FWZA 3FDRA 3FIFA 2XKOC 5CIUA 5HK3A 1VQKT 2GFUA 3A8OB 4JLGA 4RCCA 3M56A 4E7JA 2JUFA 5GAN2 5LJ5f 4BDYA 1NJIU 2LCLA 3EFRA 4C92B 1PSEA 3ZEHA 1Q81U 3CC4T 3HFNA 2JOYA 2JTMA 1MHNA 2D6FA 4M7DC 4HA8A 2YHTA 4F7UG 1Q81C 1N8RU 2LT1A 2HQXA 1NZ9A 3QJYA 1KQ1A 2CZ6B 3PIOA 2XICA 2AHJB 1YIJA 5GANd 5EG2A 1N8RC 3LWHA 3JB9H 1QP2A 4C8QE 3JB9G 3HL8A 1LOJA 4C8QG 4DOVA 3RKYA 2DXUA 3NFCA 3ER0A 3CCQA 3SFMA 4JS5A 3UPUA 3OYBA 4KULA 1ZBXA 2QEXA 1G3YA 3P8DA 4IUTA 4BI4A 3DLLA 4JJNK 4JRPA 3JB9J 2OTLT 1VQ6A 4Q5WA 4ELYC 1ZHIA 5DY9A 4BI3A 3VYHB 4M78C 4A4FA 2KK4A 4R55A 4J6YA 1YIJT 2CZ7B 5LJ5g 2L89A 4QQGA 3CC7A 5IT9E 1OI1A 2EQKA 3P8BB 2GQVA 3JCMe 2LT4A 2BIVA 3JCMP 2EKOA 2FYKA 2IG0A 3KUFA 4KT0E 1WPYA 5FU7B 2LNVA 1WJSA 4C92E 3QHSA 3VKIA 4F7UF 5IAYA 5GAOq 3CXCA 2K2VA 3M4GA 3CCEA 3M4YA 3P8HA 4M7DF 1VQ4A 2F5KA 3CEYA 2RK2A 2G3RA 4M7AC 3OYCA 2I2LA 3OYHA 2P0QA 5GAMh 4IUQA 3OYYA 2KAFA 4IKFA 4O6JA 4FT2A 1B34A 4ZN3A 1JRIA 4C5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMT A;  1M1G A;  3G6E A;  5D6Y A;  5KE2 A;  4EDU A;  4A4G A;  3CPW S;  4HCZ A;  5FRM A;  3H6Z A;  2BKD N;  3DB4 A;  1VQP T;  2RO0 A;  4IUP A;  5DM7 R;  1N27 A;  2E70 A;  5C0M A;  3CMA A;  4IUR A;  3G6E T;  1QVG A;  5KCO A;  2RHU A;  2L3R A;  2WAC A;  1OYX A;  3O8V A;  1YI2 T;  3MEU A;  3HKS A;  3UT1 A;  3UWN A;  1VQN T;  1KD1 C;  2LTO A;  2MWO A;  4CRI A;  3G4S A;  1Q82 U;  5FRO A;  2BUD A;  3LX7 A;  1VQ8 T;  3CC7 T;  4BDZ A;  3NTH A;  3CCV A;  2R58 A;  3OMC A;  3G71 A;  3QKJ A;  3LGF A;  4QVZ A;  3CCU A;  3CCE T;  2E6Z A;  2DIQ A;  1KQS S;  5J39 A;  3LH0 A;  2XHC A;  3C4S A;  1NJI C;  3CCQ T;  2JNG A;  3CD6 A;  2X4Y A;  3M9Q A;  3MP1 A;  1YBY A;  3OYG A;  3S3O A;  4X34 A;  4QQ6 A;  1K73 C;  3FEO A;  3MEW A;  3CCS A;  2LCC A;  3OY9 A;  5J3B A;  4PL6 A;  2EQU A;  3EAE A;  2R57 A;  2RJF A;  3OA6 A;  3PMI A;  1BKB A;  2EQM A;  3J80 E;  3OS1 A;  1NPR A;  1Q86 C;  3L2W A;  2RHY A;  3CME A;  3PIP A;  3OYD A;  3BDL A;  3L2Q A;  4BE2 A;  3PNW C;  1WJQ A;  1K9M C;  2VYT A;  2RHX A;  3CCR T;  4II1 A;  4A4H A;  1W2B S;  3Q1J A;  5FRN A;  1YHQ A;  1YIT A;  2R5A A;  5D6X A;  3MEV A;  2O4X A;  2L8D A;  2RI3 A;  4ZTF A;  3KBG A;  1KC8 C;  1VQK A;  3SD4 A;  2K3X A;  3CCS T;  1KC8 U;  3TRE A;  2QQR A;  2QA4 A;  1YJ9 A;  5A2Q E;  2X35 A;  3A5Z B;  1Q82 C;  2KDS A;  3OYJ A;  4A4E A;  1JJ2 S;  2QEX T;  3CME T;  4C5H A;  3S6W A;  3CPF A;  2GF7 A;  1OZ2 A;  2YRV A;  1IZ6 A;  5M9O A;  2RHZ A;  4YTL A;  5J26 A;  4UC4 A;  3G71 T;  3LLR A;  3OS2 A;  1M90 C;  1VQL A;  3ASK A;  4N4G A;  1VQ8 A;  4Z02 A;  2MWP A;  3MET A;  1XNI A;  1K73 U;  1H3Z A;  1QVG S;  1VQ5 A;  4RG2 A;  2RI2 A;  5D6W A;  1VQ7 A;  3QII A;  1RI0 A;  2RJD A;  3CCL T;  3OYE A;  4GY5 A;  1YJW T;  3NTK A;  1RL2 A;  3CCJ T;  4QQD A;  2DAQ A;  3FLG A;  2RJE A;  2P0K A;  4ZN1 A;  2OTJ T;  3QBY A;  1KHI A;  1YJ9 T;  1VQ5 T;  3OB9 A;  3L2U A;  1Q7Y C;  3CCL A;  2D9T A;  1Q86 U;  1KQS A;  3MEA A;  2X4X A;  1YHQ T;  3OYN A;  3OW2 A;  2QQS A;  1VQM T;  1K9M U;  2XK0 A;  1VQL T;  1YI2 A;  5KE3 A;  2B8A A;  3J7A F;  1WJR A;  5C6S A;  3DB3 A;  4BE0 A;  3G4S T;  4BE1 A;  2GFA A;  4OVA A;  3L42 A;  3E9F A;  4NS5 A;  3LYI A;  3JAM E;  1VQP A;  1SSF A;  4FU6 A;  3FC3 A;  3L2R A;  4IUV A;  2E5Q A;  2E6N A;  4TVR A;  4ZTJ A;  5HY6 A;  2DIG A;  4N4I A;  3MO8 A;  3CCM T;  1VQO T;  1KHC A;  3PFS A;  2FHD A;  1K8A U;  3H8Z A;  3CXC S;  4B9W A;  3I55 T;  2RJC A;  1VQ4 T;  1K8A C;  3OYI A;  3OS0 A;  3I56 T;  3J81 E;  2O4X B;  3S3M A;  1YIT T;  3E9G A;  4BD3 A;  1VQM A;  3OYA A;  2RI5 A;  4QW2 A;  3CCJ A;  4IUU A;  2PQW A;  1UEB A;  1M90 U;  3OYK A;  3CCM A;  1VQO A;  5LL6 S;  3L2V A;  1QVF A;  1VQ9 T;  2NLU A;  3CD6 T;  1S72 T;  1W2B A;  3CMA T;  3OYL A;  4BAC A;  4L59 A;  1X6O A;  1YJW A;  2JVV A;  1G5V A;  1VQ6 T;  1EIF A;  2R5M A;  1YJN A;  3DLM A;  3CPW A;  3OMG A;  1VQN A;  5KH6 A;  5IN1 A;  3CCR A;  2M16 A;  1YJN T;  3OYF A;  1Q7Y U;  4FL6 A;  3QJ6 A;  2XDP A;  1M1K U;  2OTJ A;  2LRQ A;  5DLQ E;  3S3N A;  1M1K C;  4B9X A;  2JTF A;  2OTL A;  4LD6 A;  1S72 A;  3GOX A;  2JZ2 A;  1OZ3 A;  2QA4 T;  2HQE A;  4PLI A;  3CC2 A;  4C5G A;  5KCH A;  2MI6 A;  1JJ2 A;  2LDM A;  2M1H A;  4N4H A;  3OQ5 A;  2K3Y A;  3MP8 A;  5FLX E;  3CCV T;  3OYM A;  2DO3 A;  3F70 A;  4E7H A;  4E7K A;  2M0O A;  1XTD A;  2EQJ A;  3LGL A;  2CKK A;  2KVQ G;  1WGS A;  3NTI A;  4PLL A;  3ME9 A;  1NPP A;  3CC2 T;  2LQ8 A;  2EFI A;  2LVM A;  2EIF A;  4E7L A;  3I55 A;  1VQ7 T;  3MP6 A;  2RHI A;  3OW2 S;  1KD1 U;  4C5I A;  4E7I A;  2X4W A;  3CC4 A;  3FDR A;  5CIU A;  1VQK T;  2GFU A;  4E7J A;  2JUF A;  4BDY A;  1NJI U;  2LCL A;  3ZEH A;  1Q81 U;  3CC4 T;  2JOY A;  1MHN A;  1Q81 C;  1N8R U;  2HQX A;  1NZ9 A;  3PIO A;  1YIJ A;  1N8R C;  3ER0 A;  3CCQ A;  3OYB A;  1VQ9 A;  2QEX A;  3DLL A;  3P8D A;  4IUT A;  1VQ6 A;  2OTL T;  4Q5W A;  1YIJ T;  4A4F A;  2L89 A;  3CC7 A;  5IT9 E;  4QQG A;  1OI1 A;  2EQK A;  3P8B B;  2BIV A;  1QVF S;  2EKO A;  2IG0 A;  3KUF A;  5IAY A;  3CCE A;  3CCU T;  1WJS A;  3CXC A;  3P8H A;  1VQ4 A;  2F5K A;  3CEY A;  2G3R A;  3OYC A;  3OYH A;  4IUQ A;  3OYY A;  4IKF A;  4ZN3 A;  3I56 A;  4C5E A; 
#chains in the Genus database with same CATH topology
 2DL4 A;  3PMT A;  4O5V A;  3SB2 A;  5D6Y A;  3SDZ A;  1RAB B;  1SF9 A;  1E7O A;  4M4Z A;  4A4G A;  2X4J A;  3CC7 Q;  2DIL A;  1QVP A;  2DMO A;  1VQP T;  1UEC A;  1N27 A;  5C0M A;  2E70 A;  5DM7 R;  4PJL A;  1OPK A;  4IUR A;  3I5R A;  3HFO A;  1Q81 R;  2EYW A;  2RHU A;  4KRT A;  3CCU Q;  2QI2 A;  3M53 A;  1KSW A;  4KH1 B;  1OYX A;  3O8V A;  2E12 A;  3HTR A;  2ZAE A;  4KBM B;  3IQL A;  1D1C A;  3QZ5 B;  2DF6 A;  1YIJ Q;  3HKS A;  1KD1 C;  2MWO A;  4JRK A;  4M78 E;  5I2S A;  4EMG A;  3BW1 A;  5FRO A;  2ROT A;  4OF1 A;  4FIB A;  1UHC A;  3CC7 T;  3NTH A;  3GP8 A;  2OJ2 A;  3OMC A;  3G71 A;  3LGF A;  4RCB A;  3M0R A;  2EVR A;  2K5L A;  2XHC A;  3C4S A;  1NJI C;  5LJ3 j;  5IHI A;  9ATC B;  2JNG A;  2QA4 Q;  3CC4 Q;  3M9Q A;  1VQN Q;  3RBB B;  1TS9 A;  2PVO B;  5L8R E;  3S3O A;  2A7Y A;  2FZC B;  4QQ6 A;  1ZUY A;  4D8D A;  1Q86 R;  2LCS A;  2J6F A;  4ESR A;  2EWN A;  2RH2 A;  2AZS A;  2RA2 A;  1UB4 A;  3CCS A;  1H8K A;  3MKD A;  2XG8 D;  1UUE A;  4ELZ C;  2CS7 A;  2OAW A;  3V7C A;  2QG9 B;  4J9B A;  4PL6 A;  5AYF A;  2ZPG B;  4FYX B;  4MZT A;  1KQS P;  2CP6 A;  3JCM J;  1BYM A;  1U8R A;  1N9R A;  4N0A A;  2LJ0 A;  3UA7 A;  1Q86 C;  3PIP A;  1C1A A;  3L2Q A;  4M75 B;  2BZ8 A;  1K9M C;  1ARK A;  2ED0 A;  4V2S A;  1BI3 A;  2LNH B;  4E7Z A;  4LDW A;  1TUC A;  1RAE B;  3GLX A;  4J9I A;  1BU1 A;  1X75 C;  1WLP B;  4XQ3 A;  1YHQ A;  3RER A;  3AT1 B;  4XTZ A;  2O4X A;  1KFZ A;  2ENM A;  5CKD A;  3URG A;  3JB9 D;  1NEB A;  3TRE A;  4C8Q C;  2QQR A;  2MOX A;  5A2Q E;  2FG0 A;  3VRZ A;  3EGU A;  2DBM A;  5HKC A;  2KEA A;  3QPH A;  1PD0 A;  4C5H A;  3S6W A;  5LJ5 j;  1Y57 A;  2C0T A;  1WNL A;  2RHZ A;  2D0Q B;  1RLP C;  4YTL A;  4UC4 A;  5J26 A;  5GJW B;  4RG8 A;  2F5T X;  4LN2 A;  3VYG A;  1M1F A;  1VQ8 A;  1VQ7 Q;  2KT8 A;  3A8G B;  3M5A A;  4Z02 A;  1XNI A;  5CAI A;  2V8J A;  3X25 B;  1Y71 A;  4HXJ A;  2ZGW A;  2DE0 X;  3JCM g;  3A1P A;  3QWX X;  5D6W A;  4J9H A;  3VS2 A;  1X2Q A;  1AWJ A;  1C6V X;  4AMC A;  4M7A A;  4GY5 A;  1X01 A;  2DD5 A;  1S72 Q;  3BFM A;  1RL2 A;  4QQD A;  1YP5 A;  5FU6 C;  1ZX6 A;  2OTJ T;  2V8I A;  1YJ9 T;  1RAF B;  3OB9 A;  3L2U A;  4EMK A;  3TU4 K;  1VQ5 T;  3LH5 A;  2J6K A;  3OBY A;  4WTO B;  1I4K 1;  3OW2 A;  1U1T A;  2A36 A;  1VQL T;  1NYF A;  1J3T A;  5CK9 A;  3DB3 A;  1Y07 A;  4J9F A;  2MAM A;  2XD0 A;  4OVA A;  3CCV Q;  1BBZ A;  4M7A F;  4B6M A;  4RTW A;  4LXC A;  4HKE A;  1QCN A;  3E1S A;  1K73 R;  2E5Q A;  1D3B A;  4M78 B;  4CI0 C;  4TVR A;  5GAM j;  4N4I A;  5KYY A;  3MO8 A;  3CCM T;  2FHD A;  2DM1 A;  3CXC S;  4B9W A;  3I55 T;  2P84 A;  1WXT A;  2RJC A;  2EJG A;  2RM4 A;  2QQA A;  3OYI A;  5GAO l;  4JRI A;  2LJ1 A;  4C8Q B;  2V26 A;  3OS0 A;  4M7A E;  2O4X B;  3CMA Q;  3E9G A;  2KNB B;  1WQ7 A;  3OS5 A;  2NUZ A;  4ATO A;  4QW2 A;  3UA6 A;  1M90 U;  3JCM c;  1VQO A;  2CUB A;  2Y4X A;  3M59 A;  4L5G A;  1YJW Q;  2CH4 W;  2VXF A;  2RQT A;  2A37 A;  1B3Q A;  4ME7 A;  4C0Z A;  1YJW A;  2JVV A;  5GAN 4;  1TTH B;  1VQ6 T;  2QAZ A;  1RAH B;  2PNI A;  3MJX A;  1K0X A;  4WF2 A;  1N5Z A;  4OMN A;  3CBM A;  1YWO A;  2VGM A;  2QEX Q;  2RF0 A;  4PJO A;  4RTV A;  2QTX A;  3CCR A;  2M16 A;  2YLC A;  1YN8 A;  4XTX A;  2K79 A;  2J6O A;  3OYF A;  1M1K U;  4AFZ C;  2K9G A;  2H3E B;  2FRY A;  2VUB A;  5GAO q;  4DOW A;  4LDV A;  1QMC A;  2C0I A;  3RKX A;  3HRU A;  4M78 D;  4OMP A;  2COW A;  1UDL A;  4PJN A;  2OTL A;  2K6D A;  1TUG B;  2HEQ A;  2FVU A;  2JZ2 A;  3RIR A;  4BY6 B;  3CC2 A;  4C5G A;  2K7A A;  2LDM A;  4N4H A;  2ZPE B;  4KGZ B;  2OX7 A;  4E6R A;  3TCJ A;  5FLX E;  3X28 B;  1I1J A;  3CCV T;  1OEB A;  4N0A C;  2DL7 A;  3QG1 A;  2EQJ A;  1FMW A;  1X69 A;  1BI2 A;  2F2W A;  1AWW A;  1ACM B;  1QLY A;  2IPO B;  1AT1 B;  3ME9 A;  2DL8 A;  2LQ8 A;  2EFI A;  1KG1 A;  2LVM A;  1G3T A;  2QQB A;  5LJ3 d;  1IHW A;  3EFO B;  3V8L A;  4E2F B;  5GAN h;  2CRE A;  2QTV A;  1TUD A;  1R8O B;  4C92 A;  3INZ A;  1VQ7 T;  2KSS A;  3MP6 A;  2F1L A;  4DQ2 A;  2RHI A;  2PTK A;  2WSF E;  2CP5 A;  4OB2 B;  2HMA A;  2HZY A;  5I21 A;  3JCM f;  1M2V B;  2A0F B;  5GMK h;  1JEG A;  1VIE A;  2KMT A;  1YJ9 Q;  4M78 A;  4PJO D;  3TSW A;  3FIF A;  2KRM A;  2XKO C;  2DEU A;  2GFU A;  4JLG A;  2JUF A;  2NUP A;  2CH4 A;  5GAN 2;  1NJI U;  1XJW B;  1V1C A;  2MYS A;  2RQV A;  1PSE A;  2MPX C;  1ZA2 B;  3ZEH A;  2NUT A;  1MHN A;  4HA8 A;  4F7U G;  2HQX A;  2DER A;  1KQ1 A;  2AHJ B;  2XIC A;  5GAN d;  3RDV A;  1MND A;  2KI7 A;  3HL8 A;  1VOM A;  1GBQ A;  3ER0 A;  1PRL C;  3OYB A;  1VQ9 A;  3JB9 J;  2BE9 B;  4Q5W A;  1ZHI A;  5DY9 A;  2KK4 A;  4R55 A;  4J6Y A;  2L0A A;  2CZ7 B;  1WFW A;  2L89 A;  5IT9 E;  1OI1 A;  3P8B B;  3PE0 A;  2LT4 A;  5FU7 B;  4KT0 E;  1WPY A;  3CXC A;  2VVK A;  2HSP A;  1K76 A;  1E6G A;  1OPL A;  2RK2 A;  1G83 A;  1BCM A;  2P0Q A;  2LMJ A;  3VS4 A;  1JRI A;  4FSX A;  4C92 F;  3GNF B;  2FEI A;  2XID A;  3QWY A;  3BE3 A;  1WDX A;  5AT1 B;  4EDU A;  4HCZ A;  1PKT A;  2BKD N;  3PVQ A;  3DB4 A;  2RO0 A;  1W6X A;  2Z0W A;  2L3R A;  2WAC A;  4P5N A;  1W70 A;  1RLQ C;  4K11 A;  4M78 F;  2XU8 A;  4E7S A;  2F69 A;  4EMH A;  1OOT A;  3UT1 A;  4C0G A;  1ZLM A;  4CRI A;  2DX1 A;  3EHR A;  3CPW P;  1O9S A;  3FB9 A;  4PJJ A;  3E2U A;  3VS5 A;  1QWF A;  1VA7 A;  3CCV A;  2R58 A;  2AK5 A;  4A63 B;  4EMK B;  1VIF A;  4CC2 A;  3CCU A;  3CME Q;  4JJC A;  4RTU A;  2DTH A;  4F16 A;  2CUD A;  3CD6 A;  4X1V A;  5CQX A;  3MP1 A;  1YBY A;  3OYG A;  1Q95 G;  3V7R A;  2JXB A;  1TWB A;  4X34 A;  3CCQ Q;  2O9S A;  1UJ0 A;  2DJQ A;  2EYX A;  2E64 A;  1PHT A;  3TSZ A;  4AG2 C;  4PFP A;  1GXI E;  2GTO A;  2VGN A;  2ATC B;  2X51 A;  3FJ5 A;  4DBH A;  4HVV A;  2ESW A;  2L5Q A;  5CQY A;  5LJ3 g;  3GNG A;  4M7A D;  3A8H B;  1W2B P;  1AWO A;  1GCQ C;  5I11 A;  3OA6 A;  3MHX A;  2MF2 A;  1BKB A;  1CKB A;  4M7D E;  4PFO A;  2JM8 A;  4C8Q A;  1OX8 A;  3OS1 A;  4A53 A;  3BDU A;  1NPR A;  1I8F A;  3L2W A;  2RHY A;  1Q7Y R;  2VAS A;  1JXO A;  3OYD A;  2HKN A;  3BDL A;  4C92 G;  2F2X A;  4D6W A;  1GBR A;  2SRC A;  3PNW C;  5GMK j;  3CCR T;  1UGQ B;  1SRL A;  5FWC A;  3I9Q A;  2RK1 A;  1W2B S;  3Q1J A;  1RUW A;  3LW5 E;  4MDX A;  4J83 A;  4ZTF A;  2RI3 A;  4XU3 A;  2E3I A;  4M75 A;  3V7S A;  1KC8 C;  2A28 A;  4M7D B;  3QYH B;  2GBQ A;  2QGF B;  3HHT B;  3A5Z B;  3JCM h;  2RD1 A;  4BUG A;  1TU0 B;  3OYJ A;  3WXM B;  1U5S A;  2ZCF B;  3MCA B;  1SHF A;  2K3B A;  2OI3 A;  1G8X A;  5GMK l;  3CPF A;  1T0H A;  2GF7 A;  4C8Q D;  4ANJ A;  1OZ2 A;  3REB B;  2YRV A;  3O5Z A;  1C0M A;  3EG0 A;  1BIA A;  1IZ6 A;  1LCK A;  3TVT A;  3SWN A;  3H0F A;  4RTY A;  1D09 B;  3LLR A;  1M90 C;  4E47 A;  4EMK C;  1JB0 E;  4Y28 E;  4N4G A;  2CYZ B;  4DBQ A;  2MWP A;  1K73 U;  1JQQ A;  1VQ5 A;  4FM4 B;  4L6V 5;  4RG2 A;  2MK5 A;  2RI2 A;  1VQ7 A;  5GMK e;  1QKW A;  2CDT A;  2SEM A;  4C92 D;  4JLI A;  3N5B B;  3FRN A;  1GL5 A;  2DAQ A;  2RJE A;  5GMK m;  3PT9 A;  1Y7X A;  1X6G A;  2EGA A;  2CZ0 B;  2J05 A;  1KHI A;  1YCY A;  1UGV A;  4LUE A;  1V76 A;  2KE9 A;  2DVJ A;  4M75 D;  2JS2 A;  2LX7 A;  3CCM Q;  2D9T A;  1Q86 U;  3JSC A;  1QCO A;  2X4X A;  3R6O A;  5KYU A;  1YHQ T;  4DEX A;  2XDD A;  1M9S A;  1VQM T;  3QDR B;  5A0D A;  4MZM A;  3GBQ A;  5KE3 A;  2B8A A;  3J7A F;  1WJR A;  1PC0 A;  4J6X A;  2HQH A;  2PUK B;  2K5I A;  3G4S T;  4BE1 A;  2GFA A;  3VS6 A;  3JCM V;  3CBO A;  1S1N A;  2QDY B;  4M7D G;  4NS5 A;  4NL2 A;  3LYI A;  3JAM E;  2DVE A;  3G4S Q;  1VQP A;  1SSF A;  4FU6 A;  5FWB A;  2E65 A;  3L2R A;  5KYX A;  2E6N A;  5IHN A;  4OMO A;  1SSH A;  4BY6 C;  5HY6 A;  2KRN A;  3A8M B;  3M57 A;  5GAM g;  1KHC A;  1VQO T;  1K8A U;  1K8A R;  3HPW A;  1RAG B;  4RTT A;  3J81 E;  4M75 G;  2K2M A;  2VB6 A;  2DXB A;  1PD1 A;  2X3X D;  3OYA A;  1VYU A;  2RI5 A;  1JO8 A;  4IUU A;  4M77 C;  3L2V A;  5GAN f;  3OYL A;  2ZZD A;  3HRS A;  4OMM A;  2OAU A;  1MUZ A;  1X6O A;  2MMP A;  2DD4 A;  2R5M A;  3UDC A;  1EZZ B;  3QXE B;  1FX7 A;  1VQN A;  2DFU A;  3SWN B;  3VRY A;  1DJ7 B;  5KH6 A;  5IN1 A;  1QCF A;  2KXC A;  2QDL A;  3H0H A;  3R6N A;  3G71 Q;  2PUO B;  2LX9 A;  2CP3 A;  1ABO A;  4HVU A;  5CCA A;  2LRQ A;  5DLQ E;  1T3S A;  2AZV A;  2ED1 A;  3HP9 A;  4NL3 A;  3S3N A;  4PKC C;  3I56 Q;  3NGP A;  2DTI A;  2JTF A;  4M77 A;  4R0K A;  3RNJ A;  4XU0 A;  1ZA1 B;  5A0L A;  2HQE A;  2QA4 T;  6AT1 B;  4PLI A;  2MI6 A;  1ZSZ B;  3OW2 P;  1KIK A;  4M7D D;  4JS4 A;  2DO3 A;  2V8K A;  3F70 A;  7AT1 B;  4E7H A;  2HL5 C;  2M0O A;  2CKK A;  1VQL Q;  4HCB A;  5ECA A;  2O2O A;  3OSV A;  1HSQ A;  5GAO n;  3NTI A;  1YHQ Q;  1M30 A;  2W0Z A;  4PLL A;  1GFC A;  1I5O B;  1B34 B;  3QSU A;  1KQ2 A;  2EIF A;  3CCS Q;  1TH7 A;  2GCX A;  4XTU A;  1WZO A;  4PNO A;  4EPC A;  3KXT A;  2HAX A;  1AEY A;  1UHF A;  2EJ9 A;  2PVG B;  2QGG A;  3WVD B;  4WCI A;  3UAT A;  3VS7 A;  2X4W A;  1PM3 A;  3GIB A;  2QXF A;  5KYW B;  1ZUK A;  3CC4 A;  4JJD A;  1FWZ A;  3FDR A;  1K0S A;  2BTT A;  5HK3 A;  4RCC A;  3A8O B;  1EFN A;  2HDA A;  2COY A;  1H92 A;  5LJ5 f;  4C92 B;  1Q81 U;  2HBW A;  3CC4 T;  1D0Z A;  2D6F A;  2YHT A;  1KC8 R;  2LT1 A;  3QJY A;  3REA B;  2CZ6 B;  3PIO A;  5HCK A;  1N8R C;  5KYU B;  1BCO A;  3RKY A;  3EG9 A;  3U23 A;  2DXU A;  3EFO A;  2KRS A;  2DNU A;  3CCQ A;  3VS0 A;  3SFM A;  4JS5 A;  3DLL A;  3PVL A;  2OTL T;  1R0B G;  1HD3 A;  5LJ5 g;  4QQG A;  3CC7 A;  2EQK A;  3JCM e;  2AKL A;  1SHG A;  1X27 A;  3JCM P;  2IG0 A;  4C92 E;  4Z89 A;  3CCE A;  3C0C A;  3M4Y A;  3MPU B;  2F5K A;  1OV3 A;  2AT1 B;  2I2L A;  1HJD A;  4QKU A;  3H9N A;  4IUQ A;  4C8Q E;  4ZN3 A;  1RAA B;  4C5E A;  5L23 A;  1A0N B;  1IRX A;  3G6E A;  2EJF A;  3G7Z A;  4Y92 A;  3CCE Q;  4ZGJ B;  4M7A G;  5KE2 A;  4FYV B;  3CCJ Q;  5GAM e;  3CPW S;  5FRM A;  4J9E A;  2LJ3 A;  3QUI A;  4IUP A;  4OB1 B;  2JTE A;  1QVF P;  3CMA A;  2RNA A;  3RMS A;  3G6E T;  1QVG A;  4HCK A;  1YI2 T;  1ZSZ A;  3MEU A;  3ULR B;  3HRT A;  3X26 B;  1WHK A;  2RQR A;  2EGC A;  3UWN A;  1VQN T;  3RKW A;  3G4S A;  1VQP Q;  1QWE A;  1Q82 U;  4JUV A;  2P4R A;  1VQ8 T;  4BDZ A;  1HXD A;  2DJZ A;  3RUX A;  4QVZ A;  2J7I A;  2DIQ A;  5J39 A;  2C06 A;  2NUP B;  3TEE A;  3CCQ T;  1HYO A;  3M55 A;  4OGC A;  1MNE A;  4KH0 B;  2FL7 A;  2HSE B;  4F04 B;  1K73 C;  2O01 E;  3MEW A;  3G6E Q;  1AHJ B;  5GAM f;  5IH2 A;  2DA9 A;  1JJ2 P;  3EGX A;  2V1Q A;  2YSQ A;  2CSI A;  3OBW A;  1IRE B;  5J3B A;  1JBM A;  4JDS A;  3JCM b;  1SKU B;  4KUI A;  4PJO G;  2R57 A;  2RJF A;  4M75 C;  5CKB A;  1K4U S;  3CCR Q;  4PJO E;  4QT7 A;  3NHN A;  2EQM A;  1VQ6 Q;  3J80 E;  2J06 A;  4JPB W;  2M9U A;  3CME A;  5FW9 A;  4NOY A;  2K57 A;  2YXY A;  4X9D A;  2JW4 A;  4RKU E;  1WJQ A;  1SRM A;  2VYT A;  4II1 A;  4MMK A;  4A4H A;  1X6B A;  4RMO A;  1NYG A;  2NWM A;  5FRN A;  1M2O A;  2D8H A;  1FYN A;  1YIT A;  2R5A A;  2KY9 A;  1WHH A;  4MML A;  2D1X A;  4F7U B;  3SD4 A;  2K3X A;  3CCS T;  2P0P A;  2Y4Y A;  1Y96 A;  2Y90 A;  2ZPF B;  4ZGD B;  2QA4 A;  4IIO A;  2X35 A;  4Z8A A;  2KDS A;  1PSF A;  5IXF A;  2MCN A;  3VS3 A;  1RAI B;  2YUQ A;  2VXE A;  2QEX T;  3RMQ A;  1ABQ A;  2YLB A;  5M9O A;  3KFV A;  3THK A;  1M5Q 1;  2CP7 A;  4A4K A;  3OS2 A;  4VUB A;  3VJP A;  3C95 A;  3ASK A;  1ZUU A;  3TQ7 P;  3MET A;  1OUL A;  1D3B B;  5D7U A;  2FPE A;  1YI2 Q;  1QVG S;  3X20 B;  1WHG A;  1UGP B;  1I0C A;  1Z9Q A;  2ECZ A;  2DL5 A;  2JM9 A;  2VV5 A;  1RI0 A;  4C0D B;  3D7S B;  4PJO F;  2O88 A;  3OYE A;  1M4Z A;  1UG1 A;  1YIT Q;  1WI7 A;  3HSB A;  2YWW A;  1BK2 A;  3FLG A;  1GCQ A;  2P0K A;  3EG2 A;  3QBY A;  1K9A A;  3QZ9 B;  1Q7Y C;  2JS0 A;  1VQO Q;  1QVG P;  3CCL A;  2LQK A;  1N9S A;  4FT4 A;  3SWN C;  1D1A A;  3MEA A;  1T3L A;  1UJY A;  3EG1 A;  4DBR A;  2ZPH B;  2NYS A;  4R56 A;  3OYN A;  2QQS A;  5LJ5 h;  5GAO m;  5GAO r;  3WVE B;  1YI2 A;  3PTA A;  5C6S A;  4BE0 A;  1MMN A;  4M77 E;  3L42 A;  3SHW A;  4XU1 A;  2EQI A;  2PU9 B;  1AD5 A;  2QK0 A;  4M77 G;  2WSC E;  3I35 A;  4IUV A;  1OX9 A;  2KBT A;  1WHL A;  3BY7 A;  1T0J A;  5I2M A;  1VQ4 Q;  2DIG A;  5FU7 C;  1VQ4 T;  1SEM A;  2FRW A;  4KGV B;  5CKH A;  8ATC B;  4BD3 A;  2KYB A;  3CD6 Q;  2HNI A;  2CGH A;  1VQM A;  1UGR B;  4F7U A;  1I07 A;  2COZ A;  2L2P A;  2JN0 A;  3CCJ A;  1UEB A;  1UFF A;  5GAO p;  1CSK A;  5LL6 S;  2NLU A;  5GAN 7;  3CD6 T;  1NG2 A;  5LJ5 e;  1Q82 R;  1S72 T;  2RPN A;  2X3W D;  3CMA T;  1I81 A;  2IVW A;  1P92 A;  4L59 A;  4OB3 B;  1U06 A;  5KYX B;  1G5V A;  1EIF A;  1G3W A;  2E4H A;  3DLM A;  1VQ5 Q;  3OMG A;  3CPW A;  5CVI A;  3M0P A;  2KQW A;  2EW3 A;  2DLP A;  5GAN 3;  1D0X A;  4F17 A;  1I5L A;  4ZGE B;  3M54 A;  2EBP A;  1YJN T;  1LJO A;  1W4S A;  4DEY A;  1UTI A;  3I55 Q;  2JJ9 A;  3QJ6 A;  2FZK B;  2WSE E;  4JZ3 A;  1SPK A;  2XDP A;  4KGX B;  4FYY B;  2OTJ A;  5LJ3 h;  4JJB A;  1VYV A;  1M1K C;  1CKA A;  4B9X A;  5GAN g;  2E3H A;  4LD6 A;  1YWP A;  4LDY A;  5LJ5 d;  3GOX A;  1SG5 A;  1H3H A;  5KCH A;  2F2V A;  2GNC A;  2M1H A;  3C94 A;  2DYI A;  1O75 A;  2K3Y A;  3MP8 A;  4F7U E;  1NE8 A;  1IGU A;  1WQW A;  3OYM A;  3RES A;  3EGD B;  5I22 A;  1VQ8 Q;  4XAX B;  4RTZ A;  3V8K A;  1M8V A;  4A54 A;  4M78 G;  2KRO A;  2LZ6 B;  1MV3 A;  4J9G A;  4M77 B;  1XQH A;  1NPP A;  1OU9 A;  4GLM A;  2CT4 A;  2RQW A;  1AWX A;  4KUD K;  3EGX B;  4PJO C;  4E7L A;  4JZ4 A;  2PZ1 A;  4M75 E;  1M90 R;  4FSS A;  1M3A A;  1N6A A;  2FB7 A;  3I55 A;  1B07 A;  2GTJ A;  5DLO A;  4C5I A;  1KD1 U;  5KYN A;  2LP5 A;  4OB0 B;  1ZQ1 A;  2JT4 A;  3CBP A;  2H3J A;  3EFS A;  5FU6 B;  2IIM A;  5CIU A;  1X2K A;  1VQK T;  1WA7 A;  3I5S A;  4BDY A;  2YDL A;  2YUP A;  3HFN A;  2JOY A;  4M7D C;  3M0T A;  2B86 A;  1NZ9 A;  1M3B A;  3RR6 A;  3UF4 A;  3LWH A;  3JB9 H;  1QP2 A;  3EG3 A;  2E5K A;  3JB9 G;  1LOJ A;  4C8Q G;  4AT1 B;  3NFC A;  1ZSZ C;  1ZBX A;  2QEX A;  3P8D A;  1VQ6 A;  1PRM C;  1YNZ A;  2RQU A;  1AZG B;  4M78 C;  4CC7 A;  5GJV B;  1OQK A;  1RAC B;  1KJW A;  2GQV A;  1WYX A;  1R0C B;  2EKO A;  2FYK A;  1QVF S;  2LNV A;  5IAY A;  3QHS A;  4M7D F;  2K2V A;  3M4G A;  1VQ4 A;  3CEY A;  3OYC A;  3OYH A;  3OYY A;  4O6J A;  1WIE A;  4XTV A;  1M1G A;  2OTJ Q;  1BIB A;  2H8H A;  4XU2 A;  4J6W A;  4PFZ A;  1PG5 B;  2VKN A;  3H6Z A;  1E6H A;  2DRM A;  2DXT A;  2KGT A;  2DKG A;  4M75 F;  2E41 A;  4OP0 A;  4HT8 A;  3ZBD A;  5CR2 A;  5KCO A;  2M0Y A;  1TSF A;  2M51 A;  2EGE A;  4LE9 A;  3E19 A;  1NM7 A;  4CC4 B;  4BB7 A;  2KYM A;  4XTY A;  3AHU A;  1GCP A;  2LTO A;  1RI9 A;  2XI9 A;  2JMC A;  5GAM d;  1V29 B;  2JMA A;  2RN8 A;  2DL3 A;  2BUD A;  3LX7 A;  3OSS C;  2G6F X;  5GAN 5;  4LDU A;  1LNX A;  2YT6 A;  4M7A C;  3QKJ A;  2YRD A;  3VUZ A;  5GAN j;  2RB6 A;  2A08 A;  2A3L A;  2M02 A;  3CCE T;  2E6Z A;  1KQS S;  1Y0M A;  3M58 A;  3LH0 A;  1BB9 A;  3QO3 A;  2X4Y A;  1HK9 A;  1B7T A;  3JCM d;  1QP3 A;  1MMD A;  1PWT A;  1WX6 A;  2ZPI B;  1NLP C;  1FMV A;  3FJP A;  4MZP A;  3GF5 A;  5KYY B;  3FEO A;  2FZG B;  3JB9 I;  2XDB A;  2V1R A;  1VUB A;  2O31 A;  1AVZ C;  2LCC A;  3NPF A;  3ZL7 C;  2GQI A;  2RMO A;  3OY9 A;  5CKE A;  4FCY A;  1Z9Z A;  2ZPB B;  1AOJ A;  2EQU A;  4QVD A;  1ZSG A;  2HKQ B;  3EAE A;  4J7F A;  3JCM X;  4RTX A;  3PMI A;  4J5Y A;  4EIK A;  4OGE A;  1IO6 A;  1N8R R;  1JU5 C;  3X24 B;  4BE2 A;  2QQ9 A;  1FMK A;  2FPD A;  4FW2 A;  2RHX A;  2DZC A;  5EC7 A;  2I0N A;  8AT1 B;  2K4Y A;  4C0F A;  2DK3 A;  4OMQ A;  2QYZ A;  3SEM A;  5D6X A;  3MEV A;  2EAY A;  1X43 A;  2EYY A;  4QVC A;  2L8D A;  2YRC A;  1YCS B;  3KBG A;  1UE9 A;  1EX4 A;  4M77 D;  1VQK A;  4LD9 K;  1KC8 U;  2AIR B;  2L3P A;  2DPP B;  5GAN 8;  1YJ9 A;  4AFU C;  1Q82 C;  5CO7 A;  2HBP A;  2X9H A;  4A4E A;  2OTL Q;  3A98 A;  1JJ2 S;  2XMF A;  3JCM W;  1AZE A;  3VUB A;  3CME T;  3G1J A;  2D0N A;  2DXC A;  1R77 A;  4FT2 A;  3JV3 A;  2BZY A;  5GMK i;  3G71 T;  3L2Z A;  1Y96 B;  1KD1 R;  1VQL A;  4M7A B;  2KR3 A;  1WXB A;  1H3Z A;  3CXC P;  3JCM Q;  1VQK Q;  1MMG A;  2E1H A;  2VC8 A;  3EGD A;  2PVD B;  1M1K R;  3QII A;  4X9C A;  2RJD A;  2KXD A;  2CP0 A;  3CCL T;  1W1F A;  1IB8 A;  2BE7 D;  5A0G A;  4PJM A;  1YJW T;  3NTK A;  3PGG A;  5GAN 6;  3CCJ T;  4M7D A;  2VWF A;  4ZN1 A;  2AKK A;  4J7I A;  3VU3 C;  5HK0 A;  1BI0 A;  2DTO A;  1G2B A;  2HD0 A;  1JXM A;  1KQS A;  1M8M A;  4C8Q F;  3V8J A;  4DA4 A;  4RUG A;  1PNJ A;  2EPD A;  1K9M U;  1TXQ A;  2XK0 A;  2LQN A;  2ABL A;  2MIO A;  2NUT B;  1LVK A;  3CC2 Q;  1F1B B;  2DRK A;  3E9F A;  2FO0 A;  2EYQ A;  1OU8 A;  2E10 A;  4Y91 A;  2YUO A;  4AFQ C;  3EHQ A;  4XK8 E;  4BI8 B;  3FC3 A;  2ROL A;  5LJ3 e;  2BZX A;  4ZTJ A;  1D0Y A;  1LPL A;  3PFS A;  4OMF B;  1IHV A;  2CZ1 B;  3H8Z A;  1XOV A;  1WHJ A;  3H41 A;  1K8A C;  1VQM Q;  4OML A;  3T9N A;  1H64 1;  1MMA A;  3I56 T;  2FPF A;  3S3M A;  1G3S A;  1YIT T;  1UGS B;  1U3O A;  4LDX A;  3CCL Q;  2CP2 A;  4C0D C;  3M0S A;  1YJN Q;  2PQW A;  3OYK A;  3CCM A;  3JB9 F;  4PK4 A;  1QVF A;  1VQ9 T;  1W2B A;  4PJO B;  1MGQ A;  4BAC A;  2KT1 A;  3GPL A;  1K9M R;  1ZBJ A;  4JRQ A;  4LNP A;  3LWI A;  1YJN A;  2L3Q A;  4HT9 A;  3H0I A;  3QDF A;  4GLK A;  5KYW A;  1M27 C;  4HCC A;  2DZ9 A;  4GBQ A;  2DEQ A;  3A8L B;  5GAN e;  2LQW A;  1NLO C;  1VQ9 Q;  4F14 A;  2LC4 A;  3L1A A;  1IXD A;  1Q7Y U;  5IHK A;  3C12 A;  2CT3 A;  2K5F A;  4FL6 A;  2P4T A;  3VV0 A;  1PCX A;  3ZFJ A;  3DKM A;  1TOV A;  4M77 F;  2HCK A;  2DYB A;  4ORZ A;  1FXX A;  2EYZ A;  4CC3 A;  4J9D A;  1NBE B;  3CQT A;  1S72 A;  1QW1 A;  3JRZ A;  1OZ3 A;  2YUN A;  3VS1 A;  2C0O A;  4DBF A;  4J8O A;  1NEG A;  1JJ2 A;  3OQ5 A;  1KK7 A;  3M0U A;  2W10 A;  2DET A;  2EKH A;  1PKS A;  2D8J A;  1QQJ A;  3QYG B;  1TG0 A;  4E7K A;  1M2V A;  1XTD A;  3LGL A;  3EG9 B;  1GRI A;  1WGS A;  2KVQ G;  1RAD B;  4XTW A;  3CC2 T;  5LJ3 f;  1VYT A;  1D1B A;  4ZNX A;  2HL3 A;  3NMZ C;  1WXU A;  1NJI R;  1BI1 A;  4MDW A;  1IGQ A;  5CKF A;  4HVW A;  3OW2 S;  1WHM A;  1U1S A;  4E7I A;  4C92 C;  3M56 A;  4E7J A;  2GGR A;  2LCL A;  3EFR A;  1MV0 B;  4FYW B;  2QAS A;  2JTM A;  4AFS C;  1YFN A;  3EH1 A;  3M0Q A;  4D8K A;  2L3S A;  2CSQ A;  1Q81 C;  1N8R U;  4Z88 A;  5IXB A;  1QKX A;  1YIJ A;  5EG2 A;  4DOV A;  2O9V A;  4AG1 C;  3UPU A;  4IIM A;  4KUL A;  4JJN K;  1G3Y A;  4IUT A;  4BI4 A;  4J9C A;  4JRP A;  4ELY C;  4BI3 A;  3VYH B;  4A4F A;  1YIJ T;  2DBK A;  1GFD A;  2BIV A;  3KUF A;  4F7U F;  4FW1 A;  1WJS A;  3CCU T;  3VKI A;  3P8H A;  1K1Z A;  2G3R A;  5GAM h;  3EH2 A;  2KAF A;  4IKF A;  4LUD A;  1B34 A;  1M3C A;  3I56 A; 
#chains in the Genus database with same CATH homology
 4FSX A;  4C92 F;  3GNF B;  3PMT A;  4O5V A;  2XID A;  1M1G A;  3G6E A;  2EJF A;  3G7Z A;  3SB2 A;  4ZGJ B;  1BIB A;  5D6Y A;  3SDZ A;  4M7A G;  5KE2 A;  4XU2 A;  4EDU A;  5GAM e;  4A4G A;  4J6W A;  3CPW S;  2X4J A;  4HCZ A;  5FRM A;  3H6Z A;  2BKD N;  2DXT A;  1QVP A;  2DKG A;  3DB4 A;  1VQP T;  2RO0 A;  3QUI A;  4IUP A;  1N27 A;  5C0M A;  2E70 A;  4OB1 B;  5DM7 R;  4M75 F;  2E41 A;  3CMA A;  4OP0 A;  4HT8 A;  4IUR A;  3RMS A;  3ZBD A;  5CR2 A;  3HFO A;  5KCO A;  3G6E T;  1QVG A;  2RHU A;  2L3R A;  2WAC A;  2QI2 A;  3M53 A;  4P5N A;  4M78 F;  2XU8 A;  1OYX A;  2F69 A;  3O8V A;  1YI2 T;  3MEU A;  3E19 A;  2E12 A;  4EMH A;  3HRT A;  4KBM B;  4BB7 A;  3QZ5 B;  3X26 B;  4XTY A;  3AHU A;  3HKS A;  3UT1 A;  3UWN A;  1VQN T;  1KD1 C;  2LTO A;  4C0G A;  2MWO A;  4JRK A;  4M78 E;  4CRI A;  5I2S A;  2XI9 A;  5GAM d;  1V29 B;  1O9S A;  3FB9 A;  3RKW A;  3BW1 A;  4EMG A;  3G4S A;  1Q82 U;  5FRO A;  4JUV A;  2BUD A;  3LX7 A;  4OF1 A;  3OSS C;  1VQ8 T;  4FIB A;  3CC7 T;  4BDZ A;  5GAN 5;  3NTH A;  3CCV A;  4LDU A;  2R58 A;  1HXD A;  1LNX A;  4EMK B;  1VIF A;  2DJZ A;  3OMC A;  3RUX A;  3GP8 A;  3QKJ A;  3LGF A;  4RCB A;  4QVZ A;  3VUZ A;  3G71 A;  2RB6 A;  5GAN j;  2A3L A;  3CCU A;  3CCE T;  2DIQ A;  2E6Z A;  2K5L A;  1KQS S;  5J39 A;  3M58 A;  3LH0 A;  2C06 A;  2XHC A;  2DTH A;  3C4S A;  3QO3 A;  1NJI C;  5LJ3 j;  3TEE A;  2JNG A;  3CCQ T;  3CD6 A;  3M55 A;  2X4Y A;  3M9Q A;  4OGC A;  1HK9 A;  5CQX A;  3JCM d;  2PVO B;  1YBY A;  3MP1 A;  5L8R E;  1QP3 A;  3OYG A;  3S3O A;  3V7R A;  2A7Y A;  2ZPI B;  4X34 A;  4QQ6 A;  3FJP A;  2E64 A;  2FL7 A;  1GXI E;  4MZP A;  3GF5 A;  1K73 C;  3FEO A;  2O01 E;  2EWN A;  2RH2 A;  1VUB A;  2VGN A;  2RA2 A;  3MEW A;  3JB9 I;  2XDB A;  1UB4 A;  1AHJ B;  3CCS A;  5GAM f;  2LCC A;  2XG8 D;  2L5Q A;  3OY9 A;  5CKE A;  4ELZ C;  5CQY A;  3OBW A;  1IRE B;  2CS7 A;  5LJ3 g;  3GNG A;  5J3B A;  1JBM A;  4JDS A;  2ZPB B;  3V7C A;  3JCM b;  4PL6 A;  2EQU A;  3A8H B;  5AYF A;  4QVD A;  4M7A D;  2ZPG B;  3EAE A;  4J7F A;  4KUI A;  3JCM X;  4MZT A;  4PJO G;  2R57 A;  2RJF A;  4M75 C;  5CKB A;  3OA6 A;  3PMI A;  3MHX A;  4J5Y A;  4PJO E;  2MF2 A;  3JCM J;  1BKB A;  2EQM A;  4OGE A;  4M7D E;  1BYM A;  1U8R A;  1N9R A;  3J80 E;  4C8Q A;  4N0A A;  3OS1 A;  4A53 A;  3BDU A;  1NPR A;  2M9U A;  1Q86 C;  1I8F A;  3L2W A;  2RHY A;  3CME A;  3X24 B;  3PIP A;  3OYD A;  3BDL A;  4M75 B;  3L2Q A;  4BE2 A;  4NOY A;  2QQ9 A;  4C92 G;  2K57 A;  4D6W A;  4X9D A;  4RKU E;  3I56 A;  1WJQ A;  3PNW C;  1K9M C;  2VYT A;  5GMK j;  2RHX A;  2DZC A;  3CCR T;  1UGQ B;  4V2S A;  2K4Y A;  1BI3 A;  4II1 A;  4C0F A;  2DK3 A;  4LDW A;  3GLX A;  4MMK A;  4A4H A;  2RK1 A;  1W2B S;  4RMO A;  1X75 C;  3Q1J A;  4XQ3 A;  5FRN A;  1YHQ A;  5D6X A;  2R5A A;  1YIT A;  3RER A;  3MEV A;  4XTZ A;  2O4X A;  3LW5 E;  2EAY A;  4MDX A;  4J83 A;  4QVC A;  2L8D A;  2RI3 A;  4XU3 A;  4ZTF A;  2KY9 A;  5CKD A;  3URG A;  3KBG A;  3JB9 D;  4M75 A;  4MML A;  3V7S A;  1KC8 C;  4M77 D;  1VQK A;  4F7U B;  3SD4 A;  2K3X A;  4M7D B;  3CCS T;  2P0P A;  2Y4Y A;  1KC8 U;  3TRE A;  1Y96 A;  2QQR A;  2Y90 A;  4C8Q C;  2ZPF B;  3QYH B;  4ZGD B;  2QA4 A;  3HHT B;  1QVF A;  2DPP B;  5GAN 8;  2X35 A;  5A2Q E;  1YJ9 A;  3A5Z B;  3JCM h;  2RD1 A;  1Q82 C;  2KDS A;  1PSF A;  5HKC A;  5CO7 A;  2HBP A;  4BUG A;  3OYJ A;  3WXM B;  4A4E A;  1QVF S;  1JJ2 S;  2ZCF B;  3MCA B;  3JCM W;  3VUB A;  2VXE A;  3QPH A;  5GMK l;  3RMQ A;  2QEX T;  3CME T;  4C5H A;  3S6W A;  3CPF A;  2DXC A;  2GF7 A;  4C8Q D;  5LJ5 j;  1OZ2 A;  2YRV A;  1BIA A;  1IZ6 A;  1WNL A;  2D0Q B;  2RHZ A;  2YLB A;  4YTL A;  4UC4 A;  5J26 A;  3SWN A;  5M9O A;  5GMK i;  3G71 T;  3L2Z A;  4RG8 A;  1M5Q 1;  1Y96 B;  2F5T X;  4A4K A;  3LLR A;  3VYG A;  3OS2 A;  1M90 C;  1VQL A;  4VUB A;  4E47 A;  4M7A B;  1JB0 E;  3C95 A;  3VJP A;  1M1F A;  3ASK A;  4N4G A;  4Y28 E;  4EMK C;  1VQ8 A;  2CYZ B;  3A8G B;  3M5A A;  3CCU T;  4Z02 A;  2MWP A;  3MET A;  1XNI A;  5CAI A;  1D3B B;  2V8J A;  1K73 U;  1H3Z A;  3X25 B;  1Y71 A;  3JCM Q;  3X20 B;  2ZGW A;  4FM4 B;  1QVG S;  4L6V 5;  1UGP B;  4RG2 A;  1VQ5 A;  3JCM g;  2E1H A;  2VC8 A;  2PVD B;  2RI2 A;  5D6W A;  1VQ7 A;  5GMK e;  2VV5 A;  3QII A;  1VQ7 T;  1RI0 A;  4C0D B;  4X9C A;  4PJO F;  2RJD A;  3CCL T;  4M7A A;  4C92 D;  3OYE A;  4JLI A;  4GY5 A;  1M4Z A;  3N5B B;  3FRN A;  5A0G A;  1X01 A;  1YJW T;  2DD5 A;  3HSB A;  3NTK A;  3BFM A;  3PGG A;  5GAN 6;  1RL2 A;  3CCJ T;  4QQD A;  2DAQ A;  3FLG A;  4M7D A;  2RJE A;  5GMK m;  3PT9 A;  1Y7X A;  2P0K A;  5FU6 C;  4ZN1 A;  4J7I A;  3QBY A;  2CZ0 B;  3KXT A;  2OTJ T;  1KHI A;  1YCY A;  2V8I A;  4XTV A;  3VU3 C;  5HK0 A;  1BI0 A;  1YJ9 T;  3OB9 A;  2DTO A;  3QZ9 B;  4EMK A;  3L2U A;  3TU4 K;  1VQ5 T;  1Q7Y C;  2HD0 A;  4M75 D;  3OBY A;  3CCL A;  2D9T A;  1Q86 U;  2LQK A;  1N9S A;  1I4K 1;  4FT4 A;  3SWN C;  3MEA A;  1KQS A;  4C8Q F;  3JSC A;  3V8J A;  2X4X A;  2ZPH B;  3R6O A;  4R56 A;  3OYN A;  3OW2 A;  2XDD A;  1M9S A;  4DA4 A;  2QQS A;  1U1T A;  1YHQ T;  1VQM T;  1K9M U;  3QDR B;  5A0D A;  5LJ5 h;  4MZM A;  2XK0 A;  5GAO m;  1VQL T;  5GAO r;  3WVE B;  1YI2 A;  5KE3 A;  3PTA A;  2B8A A;  3J7A F;  5CK9 A;  1WJR A;  5C6S A;  3DB3 A;  4J6X A;  4BE0 A;  2PUK B;  1Y07 A;  2K5I A;  2MAM A;  3G4S T;  2XD0 A;  4BE1 A;  2GFA A;  4M77 E;  4OVA A;  3L42 A;  3JCM V;  3E9F A;  3CBO A;  2QDY B;  4M7D G;  4NS5 A;  4NL2 A;  2EYQ A;  3LYI A;  4XU1 A;  2E10 A;  4Y91 A;  2PU9 B;  4M7A F;  3JAM E;  2DVE A;  1VQP A;  4M77 G;  4XK8 E;  4BI8 B;  2WSC E;  1SSF A;  4FU6 A;  4HKE A;  2E65 A;  3FC3 A;  3E1S A;  4IUV A;  3L2R A;  2E5Q A;  1D3B A;  2E6N A;  3BY7 A;  4M78 B;  4CI0 C;  5LJ3 e;  4TVR A;  5I2M A;  4ZTJ A;  4BY6 C;  5HY6 A;  2DIG A;  3A8M B;  3M57 A;  5GAM j;  4N4I A;  3MO8 A;  5GAM g;  1KHC A;  3CCM T;  3PFS A;  1VQO T;  2FHD A;  4OMF B;  1K8A U;  2CZ1 B;  3H8Z A;  3HPW A;  3CXC S;  5FU7 C;  4B9W A;  1XOV A;  3I55 T;  2RJC A;  1VQ4 T;  1K8A C;  2EJG A;  2RM4 A;  2QQA A;  3OYI A;  5GAO l;  4JRI A;  3T9N A;  1VQ9 A;  4C8Q B;  1H64 1;  3OS0 A;  3I56 T;  3J81 E;  4M7A E;  2O4X B;  3S3M A;  1G3S A;  4M75 G;  3E9G A;  5CKH A;  4BD3 A;  1UGS B;  1YIT T;  2DXB A;  2HNI A;  1WQ7 A;  4LDX A;  3OS5 A;  2CGH A;  1VQM A;  1UGR B;  4F7U A;  4C0D C;  3OYA A;  4ATO A;  2RI5 A;  4QW2 A;  2JN0 A;  3CCJ A;  4IUU A;  2PQW A;  1UEB A;  4M77 C;  3JCM c;  5GAO p;  3OYK A;  5LL6 S;  3L2V A;  3CCM A;  1VQO A;  5GAN f;  1VQ9 T;  2NLU A;  2Y4X A;  3M59 A;  5GAN 7;  5LJ5 e;  4L5G A;  3CD6 T;  1S72 T;  1W2B A;  3CMA T;  4PJO B;  1I81 A;  2IVW A;  2VXF A;  3OYL A;  1MGQ A;  4BAC A;  4LD9 K;  1P92 A;  2ZZD A;  4L59 A;  4OB3 B;  3HRS A;  3GPL A;  4ME7 A;  2OAU A;  4C0Z A;  1X6O A;  2MMP A;  1YJW A;  2JVV A;  5GAN 4;  2DD4 A;  1G5V A;  4JRQ A;  1VQ6 T;  1EIF A;  2R5M A;  3LWI A;  3UDC A;  1YJN A;  4HT9 A;  1G3W A;  3DLM A;  3QXE B;  3OMG A;  3CPW A;  1FX7 A;  5CVI A;  1VQN A;  4WF2 A;  3SWN B;  4GLK A;  2KQW A;  1DJ7 B;  3CBM A;  5KH6 A;  5IN1 A;  5GAN 3;  2VGM A;  4HCC A;  4PJO A;  2DZ9 A;  1I5L A;  2QTX A;  2DEQ A;  3CCR A;  3JB9 F;  3A8L B;  4ZGE B;  5GAN e;  2M16 A;  3M54 A;  2YLC A;  2PUO B;  4XTX A;  2LC4 A;  3L1A A;  1YJN T;  1LJO A;  1W4S A;  3OYF A;  2LX9 A;  1Q7Y U;  3C12 A;  2K5F A;  4FL6 A;  3QJ6 A;  2WSE E;  1M90 U;  2P4T A;  2XDP A;  1M1K U;  2OTJ A;  3VV0 A;  3ZFJ A;  2VUB A;  2LRQ A;  3DKM A;  5DLQ E;  4LDV A;  4M77 F;  5LJ3 h;  4DOW A;  3HP9 A;  5CCA A;  4NL3 A;  3S3N A;  3RKX A;  4PKC C;  3HRU A;  4M78 D;  1M1K C;  2DTI A;  4B9X A;  5GAN g;  1FXX A;  2JTF A;  2OTL A;  4M77 A;  4LD6 A;  4LDY A;  5LJ5 d;  4XU0 A;  1S72 A;  2FVU A;  3GOX A;  1QW1 A;  5A0L A;  3JRZ A;  2JZ2 A;  1OZ3 A;  2HQE A;  3RIR A;  4BY6 B;  2QA4 T;  4PLI A;  5KCH A;  4C5G A;  3CC2 A;  2MI6 A;  4J8O A;  2LDM A;  1JJ2 A;  2M1H A;  4N4H A;  3C94 A;  3OQ5 A;  2ZPE B;  1O75 A;  2K3Y A;  3MP8 A;  3TCJ A;  5FLX E;  3X28 B;  4F7U E;  3CCV T;  4M7D D;  1NE8 A;  1WQW A;  3OYM A;  4N0A C;  3RES A;  4JS4 A;  2DO3 A;  2V8K A;  3F70 A;  3QYG B;  4E7H A;  4E7K A;  2M0O A;  3QG1 A;  1XTD A;  2EQJ A;  4XAX B;  3V8K A;  3LGL A;  1M8V A;  4A54 A;  1BI2 A;  2CKK A;  4M78 G;  4HCB A;  3OSV A;  4M77 B;  5GAO n;  1WGS A;  2KVQ G;  3NTI A;  4XTW A;  1XQH A;  4PLL A;  3ME9 A;  1NPP A;  5LJ3 f;  2LQ8 A;  2EFI A;  3CC2 T;  1KG1 A;  1B34 B;  2LVM A;  1G3T A;  2QQB A;  3QSU A;  5LJ3 d;  1KQ2 A;  2EIF A;  4KUD K;  1TH7 A;  4PJO C;  2GCX A;  3V8L A;  4E7L A;  5GAN h;  4XTU A;  4M75 E;  1N6A A;  1R8O B;  2FB7 A;  3INZ A;  4PNO A;  4C92 A;  4EPC A;  1BI1 A;  2KSS A;  3MP6 A;  4DQ2 A;  3I55 A;  4MDW A;  2HAX A;  2RHI A;  2WSF E;  5CKF A;  2EJ9 A;  4OB2 B;  5I21 A;  3JCM f;  3OW2 S;  2PVG B;  4C5I A;  5DLO A;  1KD1 U;  3WVD B;  1U1S A;  5GMK h;  4OB0 B;  4E7I A;  1VIE A;  2KMT A;  2X4W A;  1ZQ1 A;  4PJO D;  4M78 A;  3GIB A;  3CBP A;  2QXF A;  4C92 C;  3CC4 A;  2H3J A;  3EFS A;  5FU6 B;  1FWZ A;  3FDR A;  3FIF A;  2XKO C;  5CIU A;  5HK3 A;  1VQK T;  2GFU A;  3A8O B;  4JLG A;  4RCC A;  3M56 A;  4E7J A;  2JUF A;  5GAN 2;  5LJ5 f;  4BDY A;  1NJI U;  2LCL A;  3EFR A;  4C92 B;  1PSE A;  3ZEH A;  1Q81 U;  3CC4 T;  3HFN A;  2JOY A;  2JTM A;  1MHN A;  2D6F A;  4M7D C;  4HA8 A;  2YHT A;  4F7U G;  1Q81 C;  1N8R U;  2LT1 A;  2HQX A;  1NZ9 A;  3QJY A;  1KQ1 A;  2CZ6 B;  3PIO A;  2XIC A;  2AHJ B;  1YIJ A;  5GAN d;  5EG2 A;  1N8R C;  3LWH A;  3JB9 H;  1QP2 A;  4C8Q E;  3JB9 G;  3HL8 A;  1LOJ A;  4C8Q G;  4DOV A;  3RKY A;  2DXU A;  3NFC A;  3ER0 A;  3CCQ A;  3SFM A;  4JS5 A;  3UPU A;  3OYB A;  4KUL A;  1ZBX A;  2QEX A;  1G3Y A;  3P8D A;  4IUT A;  4BI4 A;  3DLL A;  4JJN K;  4JRP A;  3JB9 J;  2OTL T;  1VQ6 A;  4Q5W A;  4ELY C;  1ZHI A;  5DY9 A;  4BI3 A;  3VYH B;  4M78 C;  4A4F A;  2KK4 A;  4R55 A;  4J6Y A;  1YIJ T;  2CZ7 B;  5LJ5 g;  2L89 A;  4QQG A;  3CC7 A;  5IT9 E;  1OI1 A;  2EQK A;  3P8B B;  2GQV A;  3JCM e;  2LT4 A;  2BIV A;  3JCM P;  2EKO A;  2FYK A;  2IG0 A;  3KUF A;  4KT0 E;  1WPY A;  5FU7 B;  2LNV A;  1WJS A;  4C92 E;  3QHS A;  3VKI A;  4F7U F;  5IAY A;  5GAO q;  3CXC A;  2K2V A;  3M4G A;  3CCE A;  3M4Y A;  3P8H A;  4M7D F;  1VQ4 A;  2F5K A;  3CEY A;  2RK2 A;  2G3R A;  4M7A C;  3OYC A;  2I2L A;  3OYH A;  2P0Q A;  5GAM h;  4IUQ A;  3OYY A;  2KAF A;  4IKF A;  4O6J A;  4FT2 A;  1B34 A;  4ZN3 A;  1JRI A;  4C5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...