1SSFA

Solution structure of the mouse 53bp1 fragment (residues 1463-1617)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
123
structure length
123
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Transformation related protein 53 binding protein 1
publication title The Tudor Tandem of 53BP1; A New Structural Motif Involved in DNA and RG-Rich Peptide Binding
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA01
3CCQT 4E7IA 3OQ5A 5J3BA 1YITA 3LX7A 4PLLA 3DB3A 1Q82C 1VQ6T 2RHIA 3CEYA 2XHCA 2RJFA 3PFSA 3MP6A 2EQKA 2KDSA 3PIPA 3CC7A 2XK0A 2QA4T 2LCCA 2JNGA 1VQ7T 1N27A 3G71T 1YITT 1W2BA 2WACA 4X34A 4N4HA 5HY6A 4PL6A 2LTOA 1W2BS 3L2RA 4II1A 2RHYA 4A4HA 5KCHA 2RJEA 3MP8A 3OS1A 3HKSA 4C5HA 4LD6A 3CCEA 3P8DA 5J39A 2QEXA 2X4WA 2GF7A 1M1KC 4YTLA 3CCUA 2HQEA 1UEBA 2JOYA 5C0MA 4BDZA 3E9FA 3OY9A 2HQXA 2FHDA 2LRQA 3KBGA 3OB9A 2RHXA 4RG2A 3CCET 2RO0A 2O4XB 3OYLA 3CC4A 1H3ZA 2QEXT 4C5IA 1K9MU 3CCUT 4UC4A 1YJWA 5D6YA 1VQ5A 4E7HA 2M1HA 2L8DA 3I56A 1OI1A 2OTJA 1OZ3A 3CCMA 1QVFA 2RJCA 3L2UA 3L42A 3CCVA 1M90C 3CXCA 1VQKA 3L2QA 1QVFS 1YJWT 4NS5A 5C6SA 1S72A 2G3RA 1VQ5T 3LLRA 2X4XA 3CXCS 4IUVA 3I56T 5FRMA 2E70A 1KHCA 2EKOA 2OTJT 4OVAA 3UT1A 3MEWA 3CCMT 2QQSA 1VQ4A 3CCVT 4E7KA 3CPWA 2BUDA 1VQKT 2K3XA 2P0KA 2EQMA 1S72T 3P8HA 3CPWS 3ZEHA 2XDPA 4IUUA 4ZN1A 3DLMA 4QVZA 1VQ7A 3G71A 1M90U 3G6EA 3H8ZA 3OYIA 3LGFA 4BE1A 3FLGA 2RHUA 2E6NA 1EIFA 1VQ8A 1WGSA 3F70A 3CPFA 3GOXA 4A4GA 5LL6S 3MO8A 3NTHA 2JTFA 2JVVA 3G6ET 3BDLA 4BE2A 4E7LA 1K8AC 2O4XA 1K9MC 2MI6A 1QVGA 3FC3A 2QA4A 5J26A 1NPRA 5IAYA 3PMIA 3QBYA 3CCST 1VQ8T 2YRVA 3QKJA 2MWOA 1QVGS 2F5KA 4QQGA 4Z02A 1VQOA 2EFIA 3PNWC 4IURA 3J81E 1YI2A 2IG0A 3OW2A 1NJIU 1JJ2A 3DB4A 1M1GA 4A4FA 4ZTFA 1Q7YC 3A5ZB 1VQMT 4QQDA 3FDRA 3OW2S 1JJ2S 2X35A 3OYEA 3OMGA 2L3RA 3QJ6A 1VQOT 2M16A 4N4IA 2EIFA 3H6ZA 2LDMA 1YI2T 1K8AU 5FROA 3J7AF 1VQPA 1YBYA 2R5MA 2CKKA 2R5AA 3J80E 3L2WA 4ZTJA 3OYGA 3MEUA 1YIJA 3CCRA 3OYAA 1VQPT 3ASKA 3E9GA 1NPPA 1KHIA 1Q7YU 3CMAA 1KC8U 2BIVA 5KH6A 4QQ6A 3OYFA 2LQ8A 3CCLT 3OS2A 4BACA 2GFUA 1YIJT 4B9XA 2MWPA 1VQNA 5KE2A 1MHNA 3OYNA 1G5VA 4IUPA 3CCRT 3S3NA 4BE0A 4A4EA 5M9OA 2KVQG 1VQLA 3CMAT 1XTDA 2E6ZA 3Q1JA 3OYDA 1WJSA 1XNIA 3CMEA 3QIIA 3CC2A 4IUQA 1VQNT 2DAQA 3SD4A 4PLIA 2PQWA 5IN1A 3EAEA 1NJIC 1VQLT 1OYXA 4QW2A 3OYMA 3CMET 3CC2T 3META 3CCSA 2RHZA 3OMCA 4Q5WA 5KE3A 4FL6A 5A2QE 3NTKA 2X4YA 4BD3A 1K73C 1WJQA 2BKDN 2LCLA 1VQMA 4HCZA 2VYTA 2RJDA 3I55A 2QQRA 3OS0A 3O8VA 2JZ2A 4N4GA 3CCJA 1X6OA 3LGLA 3CD6A 3KUFA 4FU6A 3S6WA 2K3YA 5FRNA 3FEOA 1KC8C 2R58A 3I55T 1Q86U 3CC7T 4EDUA 2RI2A 4IUTA 1BKBA 2EQUA 3OYJA 1WJRA 3C4SA 3CCJT 2E5QA 1YHQA 4E7JA 3CD6T 3OYKA 2B8AA 5IT9E 2D9TA 3ER0A 3G4SA 1Q82U 1KD1C 4ZN3A 3OYHA 1K73U 5DLQE 3DLLA 1YJNA 1Q81C 1N8RC 2RI3A 3PMTA 3TREA 2DIGA 3CCLA 1RI0A 1VQ9A 2RI5A 2DIQA 3OA6A 1YHQT 1IZ6A 3MEVA 3OYBA 3G4ST 1OZ2A 3OYCA 3ME9A 2JUFA 1YJNT 3PIOA 2OTLA 3UWNA 4B9WA 2DO3A 1KQSA 3L2VA 2GFAA 1VQ9T 5D6XA 3LH0A 4C5EA 1YJ9A 1KQSS 4CRIA 4IKFA 3CC4T 3NTIA 5KCOA 1RL2A 1KD1U 3M9QA 3LYIA 1M1KU 1SSFA 2OTLT 1Q81U 1N8RU 4TVRA 3P8BB 5CIUA 2NLUA 4GY5A 3S3OA 2LVMA 5FLXE 1YJ9T 4C5GA 2EQJA 5DM7R 3CCQA 2R57A 3JAME 5D6WA 3MEAA 3MP1A 1VQ6A 2L89A 3OYYA 4L59A 1NZ9A 3S3MA 4BDYA 1Q86C 1VQ4T 2M0OA
chains in the Genus database with same CATH superfamily
2VB6A 1QKWA 5J3BA 5LJ3g 1YITA 1PSEA 4NL2A 2LCSA 2RHIA 4ANJA 2O31A 2K5LA 1UHFA 2HMAA 2P4RA 2FVUA 1ZBXA 2KDSA 3PIPA 1Y57A 2XK0A 1VQOQ 2COWA 2KRNA 3G71T 1YITT 2IIMA 1OOTA 3BFMA 4OMNA 4DOVA 2RQUA 1W2BS 4A4HA 2P4TA 2FZGB 1C0MA 3H0HA 4LN2A 4EMKC 3M57A 1FXXA 2BE7D 1N8RR 4M7AG 4FYYB 2DL7A 3C0CA 1YP5A 1UGVA 2DTIA 2DEUA 3JRZA 1VQPQ 3CCUA 5LJ5e 3NMZC 1FMKA 2DNUA 2HQEA 2FZCB 2JOYA 1QW1A 4C0DC 1I07A 2LZ6B 5HK3A 5I2SA 4GBQA 2O4XB 4N0AC 3V8KA 2V8IA 5FU7C 1YWPA 3CCRQ 5A0DA 3EG0A 2DD5A 3CCUT 2QQAA 2SRCA 1YJWA 1WNLA 7AT1B 1VQ5A 3JCMe 4E7HA 2PUOB 2M1HA 3HRUA 2L8DA 3I56A 2GTOA 2DK3A 4F17A 5CK9A 2EYWA 3QWYA 1FMWA 1JB0E 1IHVA 3FRNA 2G6FX 1M8MA 1VQKA 1YJWT 4PJOF 1AD5A 2FRYA 1VQ5T 4X1VA 1CSKA 2YXYA 1UE9A 2EAYA 3I56T 3CMEQ 2DL5A 3CC2Q 2EKOA 3M4YA 3VS3A 2LQNA 2QQSA 1VQ4A 2DEQA 2P0QA 3GBQA 4M78A 4HCKA 2QASA 1VQKT 3QJYA 1J3TA 1BCMA 2P0KA 1RAIB 4PJNA 2M9UA 4IUUA 3KFVA 2X9HA 4QVZA 2WSEE 1TH7A 2DL3A 3UPUA 1GCQC 1SHGA 4PJJA 1SPKA 2EPDA 4HVVA 4KULA 2CP2A 2CH4W 2CZ6B 3FLGA 3M0SA 4C0ZA 4D6WA 3F70A 4F7UF 2AHJB 2DL8A 2KK4A 2YLCA 1WX6A 4RCCA 2HKQB 4M4ZA 2JVVA 5IHIA 2LX7A 2RNAA 2WSFE 5FWCA 5GMKi 4E7LA 2X3XD 3OSSC 1QCNA 1B34A 1UHCA 1VOMA 3QXEB 5IAYA 3QBYA 2GTJA 5GAOq 2DXUA 5GAMe 3JV3A 1BI0A 1HSQA 3RUXA 5CKFA 4A4KA 4KGVB 4LE9A 4KH0B 4KRTA 1JJ2A 3VYHB 5GAN6 2EWNA 2NYSA 5GJWB 3VS5A 4ZTFA 1Q7YC 1QWFA 4QQDA 5A0LA 3FDRA 3OW2S 2X35A 2AIRB 1WIEA 5EG2A 1Y96B 2X3WD 1JO8A 1JRIA 2FO0A 2DYBA 2GQVA 2EYZA 4OGEA 3H9NA 4M75B 1G2BA 2OTLQ 4M75D 4PKCC 1GCQA 2OAWA 2B86A 2BZ8A 3M0UA 2R5AA 3L2WA 5HCKA 3OYGA 4J83A 2C0IA 2LQWA 1YIJA 1BI2A 2MPXC 3HP9A 2GNCA 1RLPC 3HFNA 2C06A 1ZUKA 3HL8A 5KYXA 3E9GA 2GQIA 1TTHB 3VS7A 2M0YA 3OYFA 1B7TA 4JDSA 1QCFA 4CI0C 3VRYA 1I0CA 2WSCE 1YIJT 2CS7A 4WF2A 1VQNA 1RAHB 5M9OA 2LQKA 2D8JA 5AT1B 1M4ZA 3BE3A 1VYUA 3EG9A 4CC2A 1HYOA 2E6ZA 4NL3A 1K76A 1X2QA 4F14A 4BB7A 2YLBA 4EMHA 1ZQ1A 1VQNT 1CKBA 5LJ5g 1OV3A 2QQ9A 1Z9ZA 4DEXA 4QW2A 3X24B 2D1XA 3OMCA 3CBMA 1WHMA 2RD1A 1O75A 1PRLC 4JJBA 4KH1B 1WHGA 2F2WA 3NTKA 3JCMg 4BD3A 1WJQA 2BKDN 3CBPA 1VQMA 4OMFB 3REBB 3I55A 1MMNA 1T3LA 2ZPBB 2FPFA 3H41A 3QSUA 2ZPFB 3O5ZA 3CCJA 3CCEQ 3CD6A 3RNJA 4FU6A 4J9CA 2CP3A 3FEOA 4LD9K 3TCJA 2R58A 2LX9A 3I55T 1M2VB 1QVFP 2RI2A 3EG3A 1WJRA 2V1QA 3CCJT 2EYYA 2EGCA 3CD6T 1WQ7A 2B8AA 3CC4Q 2D9TA 5IT9E 3ER0A 4KUIA 5EC7A 5GANd 1AWOA 4ZN3A 1K73U 4M77D 3DLLA 1YJNA 1QP3A 2F1LA 1AZGB 1MUZA 2DTHA 1F1BB 1RI0A 4C8QD 1ACMB 5A0GA 3OA6A 3EGXB 3OSVA 2CSQA 4HA8A 1GBQA 3CCVQ 1NEBA 3DKMA 3RDVA 4C92B 4GLKA 5AYFA 5L23A 3MHXA 4ZGEB 1YJNT 3PIOA 2RF0A 1S72Q 4OMOA 2HBWA 2LJ0A 1PCXA 5GMKl 2XU8A 4J6XA 1TU0B 3M55A 2VWFA 4M7DG 2ENMA 1KQ1A 1KQSS 3ZBDA 4IKFA 3CC4T 2AZVA 3M9QA 3LYIA 1FWZA 1M1KU 1RABB 2YUQA 3P8BB 5CIUA 2NLUA 5GAMg 5LJ3h 2XIDA 5FLXE 3EGUA 3VUBA 3JCMP 3SFMA 4M7AD 2EQJA 1BB9A 4B6MA 4HVUA 4XTVA 2O2OA 1UB4A 2E65A 2HL3A 4XAXB 5GANf 4AMCA 2VC8A 4HT8A 4L59A 3EGDA 4J9IA 1M2OA 3M54A 5GAN2 2ABLA 4AFZC 1VQ8Q 1K73R 8ATCB 2QA4A 2DILA 1GXIE 2QDLA 4E7IA 3LX7A 3UA7A 8AT1B 2Y90A 1GFCA 1FMVA 4JRKA 4J9GA 4AFUC 3BW1A 1N6AA 4HKEA 3RBBB 3MPUB 1EZZB 3CC7A 2QA4T 1N27A 1X43A 1YI2Q 4X34A 4N4HA 2EGEA 4PL6A 2VXEA 2F2XA 2PZ1A 2YT6A 5GAN7 4II1A 1S1NA 2RHYA 3JB9I 3OS1A 4QVCA 3AHUA 4WCIA 2LT4A 1M1KR 2KE9A 1I81A 1LJOA 1X6BA 2DJQA 2DZCA 9ATCB 2HD0A 1DJ7B 2QEXA 2E41A 2FEIA 4JZ4A 5CQYA 1UECA 1ZBJA 3SWNB 1M1KC 1U1SA 5IHNA 3FIFA 1U8RA 4RUGA 5C0MA 2QK0A 4BDZA 3OY9A 2KROA 1UTIA 1H641 3UATA 2ED1A 2OX7A 4RG2A 2RO0A 1ZX6A 3RKYA 1R0CB 2BTTA 3OYLA 2QEXT 1WHKA 1I8FA 2NUPA 3CMAQ 2NUZA 3JCMb 3I5RA 2CP5A 1MV0B 1OI1A 3L1AA 3MJXA 2EYXA 5GMKh 4PJOB 1QMCA 2OTJA 1QKXA 5GAMd 1A0NB 3CCMA 3C95A 3L2UA 3GPLA 5IHKA 2LC4A 4M78G 3QYHB 4FIBA 3CXCA 2PTKA 3GLXA 4M75C 3L2QA 5CKHA 2QXFA 4NS5A 4Z89A 3FJ5A 3JCMX 3QO3A 1VQLQ 2G3RA 3CBOA 2RQWA 3LLRA 2CREA 4R55A 5ECAA 1KHCA 4OVAA 2OTJT 3M58A 3UT1A 3HTRA 3MEWA 3CCMT 2V26A 4FM4B 4X9CA 2DMOA 1M27C 3VS6A 2COZA 3CPWA 2P84A 2ROTA 3M0TA 3FJPA 2KQWA 4DBHA 2CP7A 3ZEHA 2XDPA 3EFRA 3CCSQ 1AVZC 3DLMA 4ZN1A 1UGPB 4D8DA 1TS9A 3G71A 1VA7A 1YCSB 4F7UB 2J06A 2DPPB 2VXFA 4C92G 1OX8A 2ZGWA 2O9VA 3LGFA 2RHUA 3GOXA 1WGSA 3CPFA 4HCBA 1N9SA 5GAMf 2M02A 1K8AC 2K2VA 3TQ7P 3EG1A 4OMMA 1QVGA 1D1CA 3FC3A 3THKA 1O9SA 1NPRA 1WXBA 1WLPB 3CCST 2GGRA 2KYBA 2DD4A 1Y0MA 1WXUA 3TSWA 4M75E 4KBMB 1TWBA 2COYA 3GNGA 3PNWC 2EFIA 1VQOA 4IURA 2KSSA 1YCYA 4KGXB 1YHQQ 3J81E 4XTXA 4EMGA 4HT9A 1R77A 2FPDA 3QZ5B 1M1GA 2JJ9A 2DX1A 5GANh 3PT9A 1WDXA 1JJ2S 3OYEA 3QJ6A 1VQOT 2EIFA 3EH1A 2LDMA 1RAEB 3NPFA 5CKBA 1D0XA 3RKXA 5FW9A 2FB7A 3RIRA 5IH2A 1VQPA 1B07A 3LH5A 1OPKA 3EHQA 1U1TA 1SSHA 4RKUE 4Z88A 2YWWA 3MEUA 1D0YA 2ZAEA 4M77C 1XQHA 4A63B 3CCRA 2JTMA 1ZUUA 3BDUA 1VQPT 5GAOp 1NPPA 1KHIA 2DVJA 1Q7YU 3ULRB 4C8QC 5I2MA 1GL5A 3NHNA 5LJ5h 2ATCB 4BACA 2AK5A 3QWXX 1G3YA 2W0ZA 2MWPA 1TUDA 3VS4A 3RMQA 3I35A 1PHTA 5KE2A 1G5VA 3X20B 3CCQQ 3CCRT 5L8RE 4BE0A 1NE8A 4EMKA 2ZPEB 2F5TX 4DBFA 4QKUA 4EIKA 5LJ3d 1VQ6Q 1XTDA 3VS2A 2XDBA 2HBPA 3CMEA 2SEMA 3CC2A 2P0PA 4IUQA 3JCMh 1W2BP 2MAMA 2DAQA 2DRKA 1AOJA 2D8HA 2NUTB 1OEBA 4IIOA 4N0AA 2KAFA 5KYWB 2XDDA 4ELYC 1KSWA 3CMET 3CC2T 4M7AC 1M3BA 2HSEB 2RHZA 4JJDA 4V2SA 4Q5WA 5KE3A 4FL6A 4PJOG 4X9DA 3JCMW 2YDLA 5A2QE 1ZA1B 2E5KA 2X4YA 3V8JA 4M77A 2A0FB 4M7DB 4HCZA 2VYTA 1LPLA 4FT4A 4PJMA 4M77E 1X27A 4J8OA 4M7DD 1RACB 1M1FA 2DFUA 2JZ2A 4C8QA 1Q7YR 4OMPA 3SB2A 2VASA 1QWEA 4C8QE 2KRMA 2DVEA 2LNHB 2L0AA 5FRNA 3GP8A 5LJ3f 4JLIA 3ZFJA 1W70A 4XTZA 1KD1R 5CQXA 4EDUA 4IUTA 2QDYB 2EQUA 3X26B 1OQKA 3OYJA 4FW1A 3QUIA 4E7JA 2KY9A 1KG1A 2ROLA 2YRDA 1KD1C 3OYHA 3A1PA 2DERA 2FG0A 1OULA 2JM9A 4R56A 1UJ0A 1BYMA 1Q81C 1NEGA 4F7UG 2DJZA 1K9AA 3TREA 5I22A 5FU6C 1KJWA 1WHLA 4ESRA 1R0BG 5KYUB 2DIQA 1ARKA 4M7AA 3OYBA 2CGHA 5GAMh 3OYCA 3SWNC 3ME9A 3V7CA 4M7AE 2IVWA 2OTLA 3UWNA 2E12A 4JLGA 4B9WA 4BUGA 3KXTA 1AHJB 4PFPA 4XTUA 3AT1B 4KT0E 2J05A 2I2LA 4C5EA 1MMDA 2L3QA 2Z0WA 3A8LB 2KT8A 4FSXA 2V8KA 1FYNA 3M4GA 4KUDK 1UDLA 4E7ZA 2OTLT 5HKCA 2VV5A 1UGQB 4MZPA 2L3PA 2RMOA 3M56A 1ZSZB 3M53A 1I5LA 4PK4A 4RMOA 1SRLA 2A28A 5DM7R 2E64A 5FWBA 4J6YA 1VQ7Q 2R57A 3JAME 3GF5A 5D6WA 3G6EQ 3EFSA 4EPCA 1XOVA 2FRWA 2ZPIB 1WPYA 4AG1C 5GMKj 2RQTA 2L89A 4BI3A 2K6DA 3EG2A 3S3MA 2PU9B 1WHHA 2DYIA 3VJPA 3HRSA 4BDYA 2VGMA 3OW2P 2JW4A 1PG5B 4PLLA 2BZYA 1I1JA 2V8JA 1D1BA 3DB3A 1KK7A 4XK8E 2EW3A 5KYYA 2A3LA 2RJFA 3PFSA 1NLOC 2EQKA 4M78B 3QPHA 4J9EA 4J9FA 1D3BA 4FYXB 2LCCA 1JXMA 4M78D 3H0IA 1GCPA 1VQ7T 2PUKB 2K57A 2WACA 2K9GA 3E2UA 5HY6A 4LDUA 4ATOA 1RAGB 3EHRA 2DL4A 1X6GA 3N5BB 5GAN8 3EFOA 2E3IA 3LWHA 2HZYA 4DQ2A 3EH2A 2KNBB 4C0DB 4C5HA 2D0QB 3CCEA 1N9RA 3P8DA 4OMQA 1NLPC 1UUEA 5J39A 4ME7A 5FU7B 2ZZDA 2X4WA 2GF7A 4F04B 2K5IA 3A8HB 4Y92A 1SHFA 4FYVB 2RHXA 1V1CA 3CCET 2OI3A 3CC4A 1H3ZA 2DXBA 4WTOB 5DLOA 1D0ZA 2L5QA 4UC4A 4C92D 2PVGB 1VIEA 4OB0B 3IQLA 2EVRA 1AT1B 1IGUA 2QYZA 1QVFA 1MV3A 3L42A 2DTOA 2DXTA 3CCVA 1UJYA 5GANj 1MMAA 1K4US 1IREB 1BBZA 1M90C 4MZMA 2KI7A 5C6SA 3QDRB 1IHWA 5LJ5d 1S72A 1TXQA 3PGGA 1IRXA 1E6HA 1OPLA 4IUVA 3CXCS 3SHWA 5FRMA 5CKEA 4LXCA 2RQRA 2VVKA 1OU9A 3REAB 4LUDA 3CCVT 2L3SA 3TU4K 4RTTA 2CP0A 3RMSA 3BY7A 2YUPA 2BUDA 4CC4B 2QGFB 2K3XA 4LDXA 2LNVA 1S72T 3P8HA 1BI1A 3CPWS 2DZ9A 3JCMd 1TUCA 2A36A 1E7OA 4P5NA 4HVWA 4RG8A 4E2FB 4OMLA 3X28B 2DA9A 1T0HA 3OYIA 3UDCA 5GAN5 3JCMc 2DF6A 2E6NA 1EIFA 3M0PA 1VQ8A 4A4GA 1LVKA 4JRPA 2EJ9A 3EG9B 5D7UA 2O4XA 2LJ3A 4PFOA 2EKHA 3SEMA 4NOYA 4XU3A 2J6OA 5LJ5f 1UFFA 2A08A 1HXDA 2GBQA 3MCAB 1VQ8T 2YRVA 2XG8D 2F5KA 1QVGS 4QQGA 1QCOA 2Y4XA 1YI2A 1BCOA 1NJIU 1E6GA 3G4SQ 4XTYA 1UGRB 2QQBA 3DB4A 2ECZA 4BI8B 1SF9A 1KQSP 2MF2A 4M7DC 3A5ZB 4RTVA 4AT1B 1JEGA 3JCMf 2L3RA 2D0NA 3CCLQ 1VQ9Q 2M16A 4DEYA 1YI2T 2MMPA 2O9SA 4J9BA 1K8AU 5FROA 2CUBA 2EGAA 3J7AF 2ESWA 2M51A 1MMGA 1YBYA 1NM7A 3NGPA 2R5MA 5GJVB 2JMAA 4M77F 2RK1A 2CKKA 2XMFA 3J80E 1VYVA 3TSZA 1YJ9Q 4PJOD 1JXOA 3I9QA 2CT4A 2KR3A 1SEMA 2QAZA 1K0SA 4C8QF 1ZUYA 3I5SA 2KMTA 2HNIA 1GRIA 3CMAA 1KC8U 2DE0X 4FSSA 2OJ2A 2E1HA 3CCLT 2J7IA 4A54A 4AFQC 1UGSB 2GFUA 5CCAA 2CZ7B 1C1AA 1W6XA 2DXCA 2YUOA 4AG2C 1NYFA 2JN0A 2EBPA 1FX7A 2KVQG 1VQLA 3CMAT 1QP2A 2QI2A 1UG1A 4C0FA 2HDAA 3JCMV 3Q1JA 3OYDA 1WJSA 1XNIA 4JS4A 3QIIA 5GAMj 1NJIR 1PSFA 3SD4A 4M7DE 2PQWA 1IO6A 5IN1A 1YITQ 2DRMA 1D1AA 3EAEA 1D09B 4RCBA 1H92A 5GMKm 3QDFA 1NJIC 1VQLT 4M7AF 5CR2A 3RKWA 3GIBA 1U06A 1IGQA 1X2KA 3OYMA 2AKKA 2W10A 1ZSZC 4J5YA 5CO7A 1K8AR 3META 3CCSA 2YUNA 1X75C 3JB9F 3VUZA 4JRIA 1Y96A 2KBTA 5GANe 2DM1A 4L5GA 4LUEA 4KGZB 2RM4A 4OB1B 2GCXA 1AWWA 2E3HA 4M75A 3PVLA 2FPEA 2QQRA 4OGCA 2KT1A 4FW2A 4N4GA 1X6OA 2CUDA 6AT1B 3LGLA 1KC8R 2A37A 5KYUA 1JU5C 3KUFA 4AFSC 1G8XA 1BK2A 3EGDB 2CDTA 3VKIA 5KYNA 2CT3A 1PD1A 4PNOA 1WFWA 3CCUQ 3TVTA 4ZNXA 3PTAA 3JCMJ 1KC8C 4M78C 2ZPHB 4MDWA 4OB2B 1BIBA 3C4SA 1G3SA 3C94A 1YHQA 3OYKA 1H8KA 1Q82U 3A8MB 3VU3C 1EX4A 3UA6A 1PWTA 2HCKA 2XICA 5DLQE 1NYGA 1YJWQ 2XI9A 1N8RC 2RI3A 1VQ5Q 2DLPA 2PNIA 2QG9B 3JB9G 2DIGA 3JSCA 1XJWB 3VYGA 3I56Q 1YHQT 1IZ6A 2AKLA 3E19A 4C0GA 2YHTA 1ZSZA 5GAOm 1OZ2A 1PD0A 2JUFA 4ELZC 1VQKQ 5DY9A 1K1ZA 1B3QA 4R0KA 2LP5A 2RQVA 4OB3B 3V8LA 3L2VA 1RAFB 2GFAA 4XU2A 4DBQA 3LH0A 1H3HA 2BZXA 1WQWA 1VQ4Q 4CRIA 2FZKB 3NTIA 4C92C 1RL2A 2KXDA 5GAN3 1KD1U 3V7SA 4PFZA 3URGA 1SSFA 1TUGB 2X4JA 1GFDA 1Q81U 3G1JA 3FB9A 3UF4A 2YSQA 1YWOA 1MNEA 4MMLA 2K3BA 1PKSA 4C5GA 2CP6A 5I11A 4GLMA 1RUWA 4XU0A 3CCQA 1YFNA 4LDWA 3PE0A 1TOVA 1P92A 2NUPB 4M78E 3E1SA 1VQ6A 1Y07A 5I21A 4HCCA 3OYYA 1NZ9A 1U5SA 2CZ1B 1Q82R 2DETA 1SG5A 1VQ4T 2M0OA 1M2VA 1AWXA 3CCQT 2DKGA 3OQ5A 3R6NA 1JJ2P 4RTZA 1KFZA 2HQHA 5LJ3j 2EYQA 4JUVA 1Q82C 1VQ6T 2MOXA 2JM8A 1NG2A 3CEYA 1RI9A 2XHCA 3MP6A 2QTVA 4MDXA 2JNGA 3MKDA 1W2BA 2JMCA 4K11A 4Y91A 3EGXA 1C6VX 2LTOA 3QYGB 4C92A 3L2RA 5KCHA 1GBRA 2RJEA 1PRMC 4FYWB 3HRTA 3LWIA 3MP8A 4C92E 3HKSA 2HL5C 1WZOA 4LD6A 1Q81R 2F69A 4HXJA 1CKAA 3CQTA 4LDVA 3TEEA 4RTUA 3NFCA 4YTLA 2K7AA 1TG0A 2VUBA 1UEBA 3E9FA 2HQXA 2FHDA 2LRQA 3KBGA 3OB9A 5IXFA 3RR6A 1I4K1 1YIJQ 3G7ZA 1HK9A 4C5IA 1K9MU 3JB9H 2FL7A 3VV0A 5D6YA 1PC0A 2F2VA 4ZGJB 1WXTA 1RADB 1EFNA 1AWJA 4FT2A 1OZ3A 5IXBA 2RJCA 2IPOB 5GANg 1K0XA 1VQNQ 1LCKA 2JXBA 3X25B 2D6FA 3QG1A 2JTEA 1QVFS 2DBMA 4JRQA 2I0NA 2X4XA 3U23A 3WVDB 1MGQA 4BY6B 2RPNA 2ZCFB 2E70A 4PJOC 4FCYA 1PKTA 2O88A 1LOJA 4E7KA 4JZ3A 2JS2A 4CC3A 3OS5A 3PVQA 1RAAB 2EQMA 3LW5E 1VIFA 2K5FA 2J6KA 1MNDA 2HEQA 5CAIA 4E47A 1ZLMA 2RK2A 1M9SA 3A98A 2H3JA 1VQ7A 2FYKA 1M90U 3G6EA 4MZTA 3H8ZA 4J7IA 1WI7A 2E4HA 3V7RA 1VQMQ 2C0TA 3SWNA 4BE1A 1WHJA 4J7FA 3I55Q 1K9MR 1ZSGA 3MO8A 5LL6S 2EQIA 3NTHA 4EMKB 5CKDA 2JTFA 3CCJQ 1KQ2A 4A53A 3CD6Q 3G6ET 3BDLA 4BE2A 1LNXA 1K9MC 2MI6A 2V1RA 2XD0A 2NWMA 4J9DA 4XU1A 4JPBW 3M0RA 5J26A 2AT1B 3PMIA 3QKJA 2EJFA 2YRCA 2MWOA 2RB6A 1T3SA 2BE9B 4Z02A 2OAUA 4JJCA 2O01E 4JJNK 3OBYA 2IG0A 4M7DF 4PJOA 2RN8A 1M5Q1 3OW2A 3M5AA 1YN8A 3RESA 4PJOE 3INZA 2KXCA 4A4FA 1YJNQ 1VQMT 1TSFA 2HSPA 3OMGA 4VUBA 2E10A 1M3AA 4N4IA 1Q95G 1SKUB 3A8GB 3OBWA 3H6ZA 4JS5A 4XTWA 4M77B 1B34B 1N5ZA 1M8VA 1W1FA 2QTXA 5LJ3e 1X69A 4O6JA 2CZ0B 4C8QB 1M90R 4ZTJA 3VRZA 1WYXA 4M75F 1JBMA 1X01A 3OYAA 2MK5A 3ASKA 2BIVA 2JS0A 5GAOn 5KH6A 4QQ6A 4F7UA 3R6OA 2LQ8A 2KGTA 1QVPA 2MYSA 1HD3A 2KYMA 1G83A 2QGGA 4F7UE 3ZL7C 3OS2A 3A8OB 4B9XA 4PJLA 4DBRA 3OYNA 2X51A 1MHNA 4IUPA 3S3NA 3VS1A 4A4EA 3JB9J 1SRMA 1VUBA 4QT7A 4ZGDB 1Y7XA 2K2MA 2ZPGB 4M7AB 1KIKA 2HKNA 1OX9A 1PNJA 2QA4Q 4OP0A 2JT4A 4MMKA 5KYXB 4PLIA 2K4YA 2MCNA 5LJ5j 1OYXA 4ORZA 3SDZA 4DA4A 5GAOr 2KRSA 3JB9D 3L2ZA 4M75G 3D7SB 2LMJA 2AZSA 2K79A 1BU1A 4E7SA 3CC7Q 3HFOA 4BI4A 3C12A 1OU8A 1QQJA 3JCMQ 2VGNA 2C0OA 3QZ9B 2ED0A 2RA2A 1U3OA 4DOWA 2H8HA 4RTWA 1K73C 2LCLA 1QLYA 1Y71A 2CH4A 2LJ1A 1ZHIA 2RJDA 3M0QA 2Y4YA 3H0FA 1W4SA 1ABOA 4Y28E 3OS0A 3O8VA 1ZA2B 2A7YA 5CVIA 2J6FA 2H3EB 5HK0A 2QEXQ 4J9HA 1V76A 2EJGA 3T9NA 4M78F 4QVDA 2LT1A 1ABQA 2K3YA 3S6WA 3WVEB 5GMKe 3M59A 5GAOl 2MIOA 1YNZA 1HJDA 3WXMB 1Q86U 3CC7T 1JQQA 5FU6B 1BKBA 2E5QA 5GAN4 1IB8A 3CXCP 5KYYB 3G4SA 3RERA 1AEYA 3PMTA 1M3CA 1D3BB 1VYTA 1IXDA 3CCLA 1VQ9A 2RI5A 2OTJQ 4D8KA 2HAXA 3CCMQ 3CPWP 3MEVA 1WA7A 2VKNA 2RH2A 1I5OB 2XKOC 4L6V5 3G4ST 4O5VA 3GNFB 3EFOB 2NUTA 4J6WA 2DO3A 4LNPA 1KQSA 4XQ3A 1BIAA 1BI3A 2CYZB 5KYWA 4C92F 1VQ9T 4RTYA 5D6XA 3HSBA 1YJ9A 1Z9QA 3VS0A 5KCOA 3HPWA 4E6RA 1G3TA 4LDYA 1N8RU 4TVRA 4GY5A 2PVDB 3S3OA 2CSIA 1NBEB 2LVMA 4OF1A 4M7DA 1YJ9T 4Z8AA 4RTXA 1V29B 1RLQC 2DBKA 4IIMA 4F16A 2KEAA 2L2PA 1G3WA 1M30A 3G71Q 3MEAA 3MP1A 1QVGP 1Q86R 4M77G 1PM3A 3QHSA 1T0JA 4BY6C 4CC7A 1R8OB 1AZEA 2PVOB 1Q86C 3HHTB 4C8QG
chains in the Genus database with same CATH topology
1GXIE 3CCQT 4E7IA 2DKGA 3OQ5A 5J3BA 5LJ3g 3LX7A 1PSEA 4PLLA 1YITA 2V8JA 5LJ3j 3DB3A 2EYQA 4NL2A 4XK8E 4JUVA 1Q82C 1VQ6T 2RHIA 2A3LA 2K5LA 3CEYA 2Y90A 4JRKA 2XHCA 2RJFA 3PFSA 3BW1A 3MP6A 2FVUA 1N6AA 2EQKA 1ZBXA 4HKEA 4MDXA 2KDSA 3PIPA 4M78B 3QPHA 3CC7A 2XK0A 1D3BA 2QA4T 2LCCA 4M78D 2JNGA 1N27A 1VQ7T 2PUKB 3G71T 1YITT 2K57A 2WACA 1W2BA 3BFMA 4N4HA 4X34A 4Y91A 5HY6A 4PL6A 2VXEA 4DOVA 2LTOA 4LDUA 4ATOA 3QYGB 1W2BS 4C92A 5GAN7 4II1A 2RHYA 4A4HA 5KCHA 2RJEA 3N5BB 3JB9I 3L2RA 2P4TA 5GAN8 3HRTA 3LWIA 3MP8A 3LWHA 4C92E 3OS1A 4DQ2A 3HKSA 4QVCA 4EMKC 3M57A 4C0DB 3AHUA 4C5HA 2LT4A 1FXXA 2D0QB 1I81A 1LJOA 4LD6A 5GAMe 3CCEA 1N9RA 2DZCA 3P8DA 4M7AG 2F69A 5J39A 2HD0A 4ME7A 1DJ7B 5FU7B 2QEXA 2ZZDA 4LDVA 2X4WA 2E41A 2GF7A 5CQYA 2DTIA 3TEEA 3JRZA 3SWNB 1M1KC 1U1SA 3NFCA 2K5IA 4YTLA 3CCUA 5LJ5e 3FIFA 2HQEA 2VUBA 1UEBA 1U8RA 2JOYA 3A8HB 5C0MA 1QW1A 4BDZA 3E9FA 4C0DC 3OY9A 2HQXA 2FHDA 1H641 2LRQA 3KBGA 3OB9A 2RHXA 5HK3A 5I2SA 4RG2A 3CCET 1I4K1 2RO0A 3G7ZA 2O4XB 4N0AC 3RKYA 3V8KA 2V8IA 5FU7C 3OYLA 3CC4A 1H3ZA 2QEXT 2DXBA 1HK9A 5A0DA 4C5IA 5DLOA 1K9MU 2DD5A 1I8FA 3JB9H 2FL7A 2L5QA 4UC4A 4C92D 3CCUT 2PVGB 2QQAA 3VV0A 1YJWA 1VIEA 1WNLA 5D6YA 4OB0B 3JCMb 1VQ5A 3JCMe 4ZGJB 4E7HA 2PUOB 2M1HA 3HRUA 2L8DA 1OI1A 3L1AA 3I56A 5GMKh 2DK3A 4PJOB 2OTJA 4FT2A 1OZ3A 5GAMd 3CCMA 1QVFA 2RJCA 3C95A 3L42A 5GANg 3L2UA 2DTOA 5CK9A 2DXTA 3GPLA 2LC4A 3QYHB 4M78G 1JB0E 3X25B 3CCVA 5GANj 2D6FA 3FRNA 1IREB 4FIBA 1M90C 3QG1A 3CXCA 4MZMA 3GLXA 4M75C 3L2QA 1VQKA 1QVFS 5CKHA 2QXFA 4NS5A 3QDRB 4PJOF 5C6SA 3QO3A 3JCMX 1YJWT 5LJ5d 1S72A 2G3RA 3CBOA 4JRQA 1VQ5T 3LLRA 3PGGA 2X4XA 4IUVA 3WVDB 1MGQA 4R55A 2EAYA 3CXCS 4BY6B 3I56T 2ZCFB 2E70A 5CKEA 5FRMA 1KHCA 4PJOC 2EKOA 4OVAA 2OTJT 3M58A 3M4YA 3UT1A 3MEWA 3CCMT 4FM4B 1LOJA 2QQSA 4X9CA 2DEQA 3CCVT 2P0QA 4E7KA 3TU4K 1VQ4A 4M78A 3RMSA 3BY7A 3OS5A 2BUDA 3CPWA 1VQKT 3QJYA 2K3XA 2P0KA 4LDXA 2EQMA 3LW5E 2LNVA 1S72T 3P8HA 1VIFA 3FJPA 1BI1A 2K5FA 3CPWS 2KQWA 2DZ9A 3JCMd 5CAIA 2M9UA 3ZEHA 2XDPA 3EFRA 4E47A 4IUUA 2RK2A 1M9SA 3DLMA 4ZN1A 4QVZA 2H3JA 4P5NA 1UGPB 1VQ7A 2WSEE 3G71A 2FYKA 4RG8A 1M90U 1TH7A 3G6EA 3UPUA 4F7UB 3X28B 4MZTA 3H8ZA 3OYIA 2DPPB 4J7IA 4KULA 2VXFA 4C92G 2ZGWA 3UDCA 3LGFA 5GAN5 3V7RA 3SWNA 2CZ6B 3JCMc 4BE1A 3FLGA 4C0ZA 2RHUA 4D6WA 4J7FA 2E6NA 1EIFA 3F70A 1WGSA 3GOXA 3CPFA 1VQ8A 4F7UF 2AHJB 2KK4A 4A4GA 4HCBA 5CKDA 3MO8A 5LL6S 2YLCA 3NTHA 4EMKB 4RCCA 1N9SA 4JRPA 2JTFA 5GAMf 2EJ9A 2JVVA 1KQ2A 4A53A 2WSFE 3G6ET 3BDLA 5GMKi 4BE2A 4E7LA 1K8AC 2O4XA 1LNXA 2K2VA 1K9MC 2MI6A 3OSSC 2XD0A 1QVGA 1B34A 3FC3A 4XU1A 2QA4A 4NOYA 4XU3A 5J26A 5LJ5f 1O9SA 1NPRA 3QXEB 5IAYA 1HXDA 3PMIA 3QBYA 3MCAB 3CCST 2YRVA 3QKJA 2EJFA 1VQ8T 2DD4A 5GAOq 2MWOA 2F5KA 2RB6A 2XG8D 4M75E 4KBMB 3GNGA 2DXUA 4QQGA 2Y4XA 2EFIA 3PNWC 4Z02A 2OAUA 4IURA 1BI0A 1YCYA 2KSSA 1VQOA 2O01E 3RUXA 3J81E 4JJNK 1YI2A 3OBYA 2IG0A 4XTXA 5CKFA 4A4KA 4EMGA 4HT9A 4M7DF 1M5Q1 4PJOA 3OW2A 1NJIU 1JJ2A 3M5AA 4XTYA 3VYHB 1UGRB 2EWNA 3QZ5B 2QQBA 3RESA 5GAN6 3DB4A 1M1GA 4PJOE 3INZA 4BI8B 4A4FA 2MF2A 4ZTFA 4M7DC 1Q7YC 3A5ZB 1VQMT 5GANh 4QQDA 5A0LA 3FDRA 3PT9A 3OW2S 1JJ2S 2X35A 3OYEA 3JCMf 3OMGA 4VUBA 2L3RA 5EG2A 3QJ6A 2E10A 1VQOT 1Y96B 2M16A 4N4IA 2EIFA 3A8GB 3OBWA 3H6ZA 2LDMA 4JS5A 4XTWA 1YI2T 2MMPA 1JRIA 5CKBA 1K8AU 3RKXA 5FROA 4M77B 1B34B 2GQVA 2FB7A 1M8VA 3RIRA 4OGEA 3J7AF 2QTXA 5LJ3e 1VQPA 4M75B 1YBYA 4M75D 4PKCC 4O6JA 2CZ0B 2R5MA 1U1TA 4C8QB 4M77F 2RK1A 2CKKA 2R5AA 3J80E 3L2WA 4ZTJA 3OYGA 4J83A 4RKUE 4M75F 3MEUA 1YIJA 1JBMA 4PJOD 1X01A 1BI2A 4M77C 3HP9A 1XQHA 2C06A 3HFNA 3CCRA 3OYAA 2JTMA 3BDUA 4C8QF 3HL8A 3ASKA 3E9GA 5GAOp 1VQPT 2KMTA 1NPPA 1KHIA 2HNIA 1Q7YU 3CMAA 2BIVA 5GAOn 1KC8U 5KH6A 4QQ6A 4F7UA 3R6OA 4C8QC 3OYFA 2LQ8A 1QVPA 4JDSA 4CI0C 5I2MA 2E1HA 5LJ5h 3CCLT 2WSCE 4A54A 4F7UE 3OS2A 4BACA 1UGSB 2GFUA 3A8OB 1YIJT 1G3YA 4B9XA 2CS7A 2MWPA 5CCAA 2CZ7B 3RMQA 4WF2A 5KE2A 1MHNA 2DXCA 3OYNA 4IUPA 3X20B 3CCRT 1VQNA 5L8RE 1G5VA 3S3NA 4BE0A 4A4EA 1NE8A 2LQKA 2JN0A 4EMKA 5M9OA 2ZPEB 3JB9J 1M4ZA 1VUBA 1FX7A 2F5TX 2KVQG 1VQLA 5LJ3d 4ZGDB 3CMAT 1QP2A 2QI2A 1XTDA 2E6ZA 4C0FA 4NL3A 1Y7XA 3JCMV 2XDBA 3Q1JA 3OYDA 1WJSA 2HBPA 2ZPGB 1XNIA 4BB7A 4JS4A 3CMEA 3QIIA 2YLBA 5GAMj 3CC2A 4M7AB 2P0PA 4IUQA 1PSFA 3JCMh 4EMHA 1ZQ1A 1VQNT 4OP0A 2MAMA 4MMKA 2DAQA 3SD4A 4M7DE 4PLIA 2PQWA 5IN1A 2K4YA 3EAEA 4RCBA 5LJ5g 5GMKm 1NJIC 5LJ5j 2QQ9A 1VQLT 1OYXA 4M7AF 5CR2A 3RKWA 3SDZA 4N0AA 4DA4A 3GIBA 5GAOr 4QW2A 2KAFA 3OYMA 3X24B 2XDDA 4ELYC 3JB9D 3L2ZA 4M75G 3CMET 3CC2T 4M7AC 4J5YA 5CO7A 3META 3CCSA 2RHZA 3HFOA 4BI4A 3C12A 1X75C 3OMCA 3JB9F 3VUZA 3CBMA 4JRIA 3JCMQ 4V2SA 4Q5WA 5KE3A 2RD1A 4FL6A 4X9DA 4PJOG 1O75A 1Y96A 2VGNA 3QZ9B 3JCMW 2RA2A 5GANe 5A2QE 4DOWA 4L5GA 3NTKA 2X4YA 3JCMg 3V8JA 4BD3A 1K73C 2RM4A 4OB1B 1WJQA 4M77A 2BKDN 2LCLA 3CBPA 2GCXA 1Y71A 1VQMA 4OMFB 4M7DB 4HCZA 2VYTA 4M75A 4FT4A 1ZHIA 2RJDA 4M77E 4J8OA 4M7DD 3I55A 2Y4YA 4Y28E 1M1FA 1W4SA 2QQRA 3OS0A 2ZPBB 3QSUA 3O8VA 4OGCA 2ZPFB 2A7YA 2JZ2A 4N4GA 5CVIA 4C8QA 3CCJA 1X6OA 3SB2A 3LGLA 3CD6A 3KUFA 5HK0A 4C8QE 2EJGA 2DVEA 3T9NA 3VKIA 4FU6A 4M78F 4QVDA 2LT1A 3S6WA 2K3YA 4PNOA 5FRNA 3GP8A 3WVEB 5LJ3f 3PTAA 3JCMJ 3FEOA 5GMKe 1KC8C 3TCJA 4LD9K 3M59A 2R58A 5GAOl 2LX9A 4JLIA 4M78C 3ZFJA 3I55T 3WXMB 4XTZA 1Q86U 3CC7T 2ZPHB 5CQXA 4EDUA 2RI2A 2QDYB 4IUTA 4MDWA 1BKBA 1BIBA 2EQUA 4OB2B 5FU6B 3X26B 1WJRA 3OYJA 3C4SA 1G3SA 3CCJT 2E5QA 3C94A 1YHQA 3QUIA 4E7JA 5GAN4 3OYKA 2KY9A 3CD6T 1KG1A 1WQ7A 2B8AA 2D9TA 5IT9E 3ER0A 4KUIA 3G4SA 1Q82U 3A8MB 3VU3C 5GANd 4ZN3A 3OYHA 1K73U 1KD1C 3RERA 4M77D 2XICA 5DLQE 4R56A 3DLLA 1YJNA 1BYMA 2XI9A 1Q81C 1N8RC 1QP3A 2RI3A 3PMTA 4F7UG 2DJZA 3TREA 1D3BB 2DTHA 3JB9G 5FU6C 2DIGA 3JSCA 3VYGA 3CCLA 1RI0A 4C8QD 1VQ9A 2RI5A 2DIQA 5A0GA 3OA6A 1YHQT 2HAXA 1IZ6A 3OSVA 4HA8A 3E19A 4C0GA 2YHTA 4M7AA 3MEVA 2RH2A 2XKOC 3DKMA 4L6V5 5GAOm 3OYBA 3G4ST 2CGHA 4O5VA 1OZ2A 5GAMh 4C92B 3OYCA 4GLKA 3ME9A 2JUFA 3SWNC 3V7CA 5AYFA 4M7AE 4ELZC 3MHXA 5DY9A 4ZGEB 3GNFB 2IVWA 3PIOA 1YJNT 2OTLA 3UWNA 2E12A 4J6WA 4JLGA 4B9WA 4BUGA 3KXTA 2DO3A 1AHJB 4OB3B 3V8LA 1KQSA 3L2VA 4XQ3A 1BIAA 1BI3A 4XTUA 4XU2A 2GFAA 2CYZB 5GMKl 2XU8A 4J6XA 3M55A 4C92F 4KT0E 1VQ9T 4M7DG 5D6XA 2I2LA 3LH0A 4C5EA 3HSBA 1YJ9A 1KQ1A 1WQWA 1KQSS 3A8LB 3ZBDA 4CRIA 4IKFA 3CC4T 3NTIA 2V8KA 3M4GA 4FSXA 5KCOA 1QVGS 4C92C 4KUDK 1RL2A 3M9QA 5GAN3 1KD1U 3LYIA 3V7SA 1FWZA 3URGA 1M1KU 1SSFA 2X4JA 3HPWA 2OTLT 5HKCA 1Q81U 1G3TA 4LDYA 1N8RU 4TVRA 2VV5A 3FB9A 3P8BB 5CIUA 1UGQB 2NLUA 4GY5A 2PVDB 3S3OA 4MZPA 4MMLA 5GAMg 5LJ3h 2LVMA 4OF1A 2XIDA 3M56A 5FLXE 4M7DA 3M53A 3VUBA 4C5GA 1YJ9T 1I5LA 3JCMP 3SFMA 4RMOA 4M7AD 1V29B 2EQJA 4XU0A 5DM7R 2E64A 3CCQA 4J6YA 4XTVA 1G3WA 1UB4A 2E65A 2R57A 3GF5A 1P92A 4LDWA 3JAME 5D6WA 3EFSA 3MEAA 1XOVA 4EPCA 3MP1A 2ZPIB 3E1SA 4M78E 1WPYA 4XAXB 5GANf 5GMKj 1VQ6A 2VC8A 1Y07A 2L89A 4M77G 4BI3A 5I21A 4HCCA 3OYYA 4HT8A 4L59A 3QHSA 1NZ9A 4BY6C 3S3MA 2PU9B 3M54A 5GAN2 1R8OB 3VJPA 2PVOB 3HRSA 4BDYA 1Q86C 2CZ1B 2VGMA 1VQ4T 3HHTB 2M0OA 4C8QG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ T;  4E7I A;  3OQ5 A;  5J3B A;  1YIT A;  3LX7 A;  4PLL A;  3DB3 A;  1Q82 C;  1VQ6 T;  2RHI A;  3CEY A;  2XHC A;  2RJF A;  3PFS A;  3MP6 A;  2EQK A;  2KDS A;  3PIP A;  3CC7 A;  2XK0 A;  2QA4 T;  2LCC A;  2JNG A;  1VQ7 T;  1N27 A;  3G71 T;  1YIT T;  1W2B A;  2WAC A;  4X34 A;  4N4H A;  5HY6 A;  4PL6 A;  2LTO A;  1W2B S;  3L2R A;  4II1 A;  2RHY A;  4A4H A;  5KCH A;  2RJE A;  3MP8 A;  3OS1 A;  3HKS A;  4C5H A;  4LD6 A;  3CCE A;  3P8D A;  5J39 A;  2QEX A;  2X4W A;  2GF7 A;  1M1K C;  4YTL A;  3CCU A;  2HQE A;  1UEB A;  2JOY A;  5C0M A;  4BDZ A;  3E9F A;  3OY9 A;  2HQX A;  2FHD A;  2LRQ A;  3KBG A;  3OB9 A;  2RHX A;  4RG2 A;  3CCE T;  2RO0 A;  2O4X B;  3OYL A;  3CC4 A;  1H3Z A;  2QEX T;  4C5I A;  1K9M U;  3CCU T;  4UC4 A;  1YJW A;  5D6Y A;  1VQ5 A;  4E7H A;  2M1H A;  2L8D A;  3I56 A;  1OI1 A;  2OTJ A;  1OZ3 A;  3CCM A;  1QVF A;  2RJC A;  3L2U A;  3L42 A;  3CCV A;  1M90 C;  3CXC A;  1VQK A;  3L2Q A;  1QVF S;  1YJW T;  4NS5 A;  5C6S A;  1S72 A;  2G3R A;  1VQ5 T;  3LLR A;  2X4X A;  3CXC S;  4IUV A;  3I56 T;  5FRM A;  2E70 A;  1KHC A;  2EKO A;  2OTJ T;  4OVA A;  3UT1 A;  3MEW A;  3CCM T;  2QQS A;  1VQ4 A;  3CCV T;  4E7K A;  3CPW A;  2BUD A;  1VQK T;  2K3X A;  2P0K A;  2EQM A;  1S72 T;  3P8H A;  3CPW S;  3ZEH A;  2XDP A;  4IUU A;  4ZN1 A;  3DLM A;  4QVZ A;  1VQ7 A;  3G71 A;  1M90 U;  3G6E A;  3H8Z A;  3OYI A;  3LGF A;  4BE1 A;  3FLG A;  2RHU A;  2E6N A;  1EIF A;  1VQ8 A;  1WGS A;  3F70 A;  3CPF A;  3GOX A;  4A4G A;  5LL6 S;  3MO8 A;  3NTH A;  2JTF A;  2JVV A;  3G6E T;  3BDL A;  4BE2 A;  4E7L A;  1K8A C;  2O4X A;  1K9M C;  2MI6 A;  1QVG A;  3FC3 A;  2QA4 A;  5J26 A;  1NPR A;  5IAY A;  3PMI A;  3QBY A;  3CCS T;  1VQ8 T;  2YRV A;  3QKJ A;  2MWO A;  1QVG S;  2F5K A;  4QQG A;  4Z02 A;  1VQO A;  2EFI A;  3PNW C;  4IUR A;  3J81 E;  1YI2 A;  2IG0 A;  3OW2 A;  1NJI U;  1JJ2 A;  3DB4 A;  1M1G A;  4A4F A;  4ZTF A;  1Q7Y C;  3A5Z B;  1VQM T;  4QQD A;  3FDR A;  3OW2 S;  1JJ2 S;  2X35 A;  3OYE A;  3OMG A;  2L3R A;  3QJ6 A;  1VQO T;  2M16 A;  4N4I A;  2EIF A;  3H6Z A;  2LDM A;  1YI2 T;  1K8A U;  5FRO A;  3J7A F;  1VQP A;  1YBY A;  2R5M A;  2CKK A;  2R5A A;  3J80 E;  3L2W A;  4ZTJ A;  3OYG A;  3MEU A;  1YIJ A;  3CCR A;  3OYA A;  1VQP T;  3ASK A;  3E9G A;  1NPP A;  1KHI A;  1Q7Y U;  3CMA A;  1KC8 U;  2BIV A;  5KH6 A;  4QQ6 A;  3OYF A;  2LQ8 A;  3CCL T;  3OS2 A;  4BAC A;  2GFU A;  1YIJ T;  4B9X A;  2MWP A;  1VQN A;  5KE2 A;  1MHN A;  3OYN A;  1G5V A;  4IUP A;  3CCR T;  3S3N A;  4BE0 A;  4A4E A;  5M9O A;  2KVQ G;  1VQL A;  3CMA T;  1XTD A;  2E6Z A;  3Q1J A;  3OYD A;  1WJS A;  1XNI A;  3CME A;  3QII A;  3CC2 A;  4IUQ A;  1VQN T;  2DAQ A;  3SD4 A;  4PLI A;  2PQW A;  5IN1 A;  3EAE A;  1NJI C;  1VQL T;  1OYX A;  4QW2 A;  3OYM A;  3CME T;  3CC2 T;  3MET A;  3CCS A;  2RHZ A;  3OMC A;  4Q5W A;  5KE3 A;  4FL6 A;  5A2Q E;  3NTK A;  2X4Y A;  4BD3 A;  1K73 C;  1WJQ A;  2BKD N;  2LCL A;  1VQM A;  4HCZ A;  2VYT A;  2RJD A;  3I55 A;  2QQR A;  3OS0 A;  3O8V A;  2JZ2 A;  4N4G A;  3CCJ A;  1X6O A;  3LGL A;  3CD6 A;  3KUF A;  4FU6 A;  3S6W A;  2K3Y A;  5FRN A;  3FEO A;  1KC8 C;  2R58 A;  3I55 T;  1Q86 U;  3CC7 T;  4EDU A;  2RI2 A;  4IUT A;  1BKB A;  2EQU A;  3OYJ A;  1WJR A;  3C4S A;  3CCJ T;  2E5Q A;  1YHQ A;  4E7J A;  3CD6 T;  3OYK A;  2B8A A;  5IT9 E;  2D9T A;  3ER0 A;  3G4S A;  1Q82 U;  1KD1 C;  4ZN3 A;  3OYH A;  1K73 U;  5DLQ E;  3DLL A;  1YJN A;  1Q81 C;  1N8R C;  2RI3 A;  3PMT A;  3TRE A;  2DIG A;  3CCL A;  1RI0 A;  1VQ9 A;  2RI5 A;  2DIQ A;  3OA6 A;  1YHQ T;  1IZ6 A;  3MEV A;  3OYB A;  3G4S T;  1OZ2 A;  3OYC A;  3ME9 A;  2JUF A;  1YJN T;  3PIO A;  2OTL A;  3UWN A;  4B9W A;  2DO3 A;  1KQS A;  3L2V A;  2GFA A;  1VQ9 T;  5D6X A;  3LH0 A;  4C5E A;  1YJ9 A;  1KQS S;  4CRI A;  4IKF A;  3CC4 T;  3NTI A;  5KCO A;  1RL2 A;  1KD1 U;  3M9Q A;  3LYI A;  1M1K U;  1SSF A;  2OTL T;  1Q81 U;  1N8R U;  4TVR A;  3P8B B;  5CIU A;  2NLU A;  4GY5 A;  3S3O A;  2LVM A;  5FLX E;  1YJ9 T;  4C5G A;  2EQJ A;  5DM7 R;  3CCQ A;  2R57 A;  3JAM E;  5D6W A;  3MEA A;  3MP1 A;  1VQ6 A;  2L89 A;  3OYY A;  4L59 A;  1NZ9 A;  3S3M A;  4BDY A;  1Q86 C;  1VQ4 T;  2M0O A; 
#chains in the Genus database with same CATH topology
 2VB6 A;  1QKW A;  5J3B A;  5LJ3 g;  1YIT A;  1PSE A;  4NL2 A;  2LCS A;  2RHI A;  4ANJ A;  2O31 A;  2K5L A;  1UHF A;  2HMA A;  2P4R A;  2FVU A;  1ZBX A;  2KDS A;  3PIP A;  1Y57 A;  2XK0 A;  1VQO Q;  2COW A;  2KRN A;  3G71 T;  1YIT T;  2IIM A;  1OOT A;  3BFM A;  4OMN A;  4DOV A;  2RQU A;  1W2B S;  4A4H A;  2P4T A;  2FZG B;  1C0M A;  3H0H A;  4LN2 A;  4EMK C;  3M57 A;  1FXX A;  2BE7 D;  1N8R R;  4M7A G;  4FYY B;  2DL7 A;  3C0C A;  1YP5 A;  1UGV A;  2DTI A;  2DEU A;  3JRZ A;  1VQP Q;  3CCU A;  5LJ5 e;  3NMZ C;  1FMK A;  2DNU A;  2HQE A;  2FZC B;  2JOY A;  1QW1 A;  4C0D C;  1I07 A;  2LZ6 B;  5HK3 A;  5I2S A;  4GBQ A;  2O4X B;  4N0A C;  3V8K A;  2V8I A;  5FU7 C;  1YWP A;  3CCR Q;  5A0D A;  3EG0 A;  2DD5 A;  3CCU T;  2QQA A;  2SRC A;  1YJW A;  1WNL A;  7AT1 B;  1VQ5 A;  3JCM e;  4E7H A;  2PUO B;  2M1H A;  3HRU A;  2L8D A;  3I56 A;  2GTO A;  2DK3 A;  4F17 A;  5CK9 A;  2EYW A;  3QWY A;  1FMW A;  1JB0 E;  1IHV A;  3FRN A;  2G6F X;  1M8M A;  1VQK A;  1YJW T;  4PJO F;  1AD5 A;  2FRY A;  1VQ5 T;  4X1V A;  1CSK A;  2YXY A;  1UE9 A;  2EAY A;  3I56 T;  3CME Q;  2DL5 A;  3CC2 Q;  2EKO A;  3M4Y A;  3VS3 A;  2LQN A;  2QQS A;  1VQ4 A;  2DEQ A;  2P0Q A;  3GBQ A;  4M78 A;  4HCK A;  2QAS A;  1VQK T;  3QJY A;  1J3T A;  1BCM A;  2P0K A;  1RAI B;  4PJN A;  2M9U A;  4IUU A;  3KFV A;  2X9H A;  4QVZ A;  2WSE E;  1TH7 A;  2DL3 A;  3UPU A;  1GCQ C;  1SHG A;  4PJJ A;  1SPK A;  2EPD A;  4HVV A;  4KUL A;  2CP2 A;  2CH4 W;  2CZ6 B;  3FLG A;  3M0S A;  4C0Z A;  4D6W A;  3F70 A;  4F7U F;  2AHJ B;  2DL8 A;  2KK4 A;  2YLC A;  1WX6 A;  4RCC A;  2HKQ B;  4M4Z A;  2JVV A;  5IHI A;  2LX7 A;  2RNA A;  2WSF E;  5FWC A;  5GMK i;  4E7L A;  2X3X D;  3OSS C;  1QCN A;  1B34 A;  1UHC A;  1VOM A;  3QXE B;  5IAY A;  3QBY A;  2GTJ A;  5GAO q;  2DXU A;  5GAM e;  3JV3 A;  1BI0 A;  1HSQ A;  3RUX A;  5CKF A;  4A4K A;  4KGV B;  4LE9 A;  4KH0 B;  4KRT A;  1JJ2 A;  3VYH B;  5GAN 6;  2EWN A;  2NYS A;  5GJW B;  3VS5 A;  4ZTF A;  1Q7Y C;  1QWF A;  4QQD A;  5A0L A;  3FDR A;  3OW2 S;  2X35 A;  2AIR B;  1WIE A;  5EG2 A;  1Y96 B;  2X3W D;  1JO8 A;  1JRI A;  2FO0 A;  2DYB A;  2GQV A;  2EYZ A;  4OGE A;  3H9N A;  4M75 B;  1G2B A;  2OTL Q;  4M75 D;  4PKC C;  1GCQ A;  2OAW A;  2B86 A;  2BZ8 A;  3M0U A;  2R5A A;  3L2W A;  5HCK A;  3OYG A;  4J83 A;  2C0I A;  2LQW A;  1YIJ A;  1BI2 A;  2MPX C;  3HP9 A;  2GNC A;  1RLP C;  3HFN A;  2C06 A;  1ZUK A;  3HL8 A;  5KYX A;  3E9G A;  2GQI A;  1TTH B;  3VS7 A;  2M0Y A;  3OYF A;  1B7T A;  4JDS A;  1QCF A;  4CI0 C;  3VRY A;  1I0C A;  2WSC E;  1YIJ T;  2CS7 A;  4WF2 A;  1VQN A;  1RAH B;  5M9O A;  2LQK A;  2D8J A;  5AT1 B;  1M4Z A;  3BE3 A;  1VYU A;  3EG9 A;  4CC2 A;  1HYO A;  2E6Z A;  4NL3 A;  1K76 A;  1X2Q A;  4F14 A;  4BB7 A;  2YLB A;  4EMH A;  1ZQ1 A;  1VQN T;  1CKB A;  5LJ5 g;  1OV3 A;  2QQ9 A;  1Z9Z A;  4DEX A;  4QW2 A;  3X24 B;  2D1X A;  3OMC A;  3CBM A;  1WHM A;  2RD1 A;  1O75 A;  1PRL C;  4JJB A;  4KH1 B;  1WHG A;  2F2W A;  3NTK A;  3JCM g;  4BD3 A;  1WJQ A;  2BKD N;  3CBP A;  1VQM A;  4OMF B;  3REB B;  3I55 A;  1MMN A;  1T3L A;  2ZPB B;  2FPF A;  3H41 A;  3QSU A;  2ZPF B;  3O5Z A;  3CCJ A;  3CCE Q;  3CD6 A;  3RNJ A;  4FU6 A;  4J9C A;  2CP3 A;  3FEO A;  4LD9 K;  3TCJ A;  2R58 A;  2LX9 A;  3I55 T;  1M2V B;  1QVF P;  2RI2 A;  3EG3 A;  1WJR A;  2V1Q A;  3CCJ T;  2EYY A;  2EGC A;  3CD6 T;  1WQ7 A;  2B8A A;  3CC4 Q;  2D9T A;  5IT9 E;  3ER0 A;  4KUI A;  5EC7 A;  5GAN d;  1AWO A;  4ZN3 A;  1K73 U;  4M77 D;  3DLL A;  1YJN A;  1QP3 A;  2F1L A;  1AZG B;  1MUZ A;  2DTH A;  1F1B B;  1RI0 A;  4C8Q D;  1ACM B;  5A0G A;  3OA6 A;  3EGX B;  3OSV A;  2CSQ A;  4HA8 A;  1GBQ A;  3CCV Q;  1NEB A;  3DKM A;  3RDV A;  4C92 B;  4GLK A;  5AYF A;  5L23 A;  3MHX A;  4ZGE B;  1YJN T;  3PIO A;  2RF0 A;  1S72 Q;  4OMO A;  2HBW A;  2LJ0 A;  1PCX A;  5GMK l;  2XU8 A;  4J6X A;  1TU0 B;  3M55 A;  2VWF A;  4M7D G;  2ENM A;  1KQ1 A;  1KQS S;  3ZBD A;  4IKF A;  3CC4 T;  2AZV A;  3M9Q A;  3LYI A;  1FWZ A;  1M1K U;  1RAB B;  2YUQ A;  3P8B B;  5CIU A;  2NLU A;  5GAM g;  5LJ3 h;  2XID A;  5FLX E;  3EGU A;  3VUB A;  3JCM P;  3SFM A;  4M7A D;  2EQJ A;  1BB9 A;  4B6M A;  4HVU A;  4XTV A;  2O2O A;  1UB4 A;  2E65 A;  2HL3 A;  4XAX B;  5GAN f;  4AMC A;  2VC8 A;  4HT8 A;  4L59 A;  3EGD A;  4J9I A;  1M2O A;  3M54 A;  5GAN 2;  2ABL A;  4AFZ C;  1VQ8 Q;  1K73 R;  8ATC B;  2QA4 A;  2DIL A;  1GXI E;  2QDL A;  4E7I A;  3LX7 A;  3UA7 A;  8AT1 B;  2Y90 A;  1GFC A;  1FMV A;  4JRK A;  4J9G A;  4AFU C;  3BW1 A;  1N6A A;  4HKE A;  3RBB B;  3MPU B;  1EZZ B;  3CC7 A;  2QA4 T;  1N27 A;  1X43 A;  1YI2 Q;  4X34 A;  4N4H A;  2EGE A;  4PL6 A;  2VXE A;  2F2X A;  2PZ1 A;  2YT6 A;  5GAN 7;  4II1 A;  1S1N A;  2RHY A;  3JB9 I;  3OS1 A;  4QVC A;  3AHU A;  4WCI A;  2LT4 A;  1M1K R;  2KE9 A;  1I81 A;  1LJO A;  1X6B A;  2DJQ A;  2DZC A;  9ATC B;  2HD0 A;  1DJ7 B;  2QEX A;  2E41 A;  2FEI A;  4JZ4 A;  5CQY A;  1UEC A;  1ZBJ A;  3SWN B;  1M1K C;  1U1S A;  5IHN A;  3FIF A;  1U8R A;  4RUG A;  5C0M A;  2QK0 A;  4BDZ A;  3OY9 A;  2KRO A;  1UTI A;  1H64 1;  3UAT A;  2ED1 A;  2OX7 A;  4RG2 A;  2RO0 A;  1ZX6 A;  3RKY A;  1R0C B;  2BTT A;  3OYL A;  2QEX T;  1WHK A;  1I8F A;  2NUP A;  3CMA Q;  2NUZ A;  3JCM b;  3I5R A;  2CP5 A;  1MV0 B;  1OI1 A;  3L1A A;  3MJX A;  2EYX A;  5GMK h;  4PJO B;  1QMC A;  2OTJ A;  1QKX A;  5GAM d;  1A0N B;  3CCM A;  3C95 A;  3L2U A;  3GPL A;  5IHK A;  2LC4 A;  4M78 G;  3QYH B;  4FIB A;  3CXC A;  2PTK A;  3GLX A;  4M75 C;  3L2Q A;  5CKH A;  2QXF A;  4NS5 A;  4Z89 A;  3FJ5 A;  3JCM X;  3QO3 A;  1VQL Q;  2G3R A;  3CBO A;  2RQW A;  3LLR A;  2CRE A;  4R55 A;  5ECA A;  1KHC A;  4OVA A;  2OTJ T;  3M58 A;  3UT1 A;  3HTR A;  3MEW A;  3CCM T;  2V26 A;  4FM4 B;  4X9C A;  2DMO A;  1M27 C;  3VS6 A;  2COZ A;  3CPW A;  2P84 A;  2ROT A;  3M0T A;  3FJP A;  2KQW A;  4DBH A;  2CP7 A;  3ZEH A;  2XDP A;  3EFR A;  3CCS Q;  1AVZ C;  3DLM A;  4ZN1 A;  1UGP B;  4D8D A;  1TS9 A;  3G71 A;  1VA7 A;  1YCS B;  4F7U B;  2J06 A;  2DPP B;  2VXF A;  4C92 G;  1OX8 A;  2ZGW A;  2O9V A;  3LGF A;  2RHU A;  3GOX A;  1WGS A;  3CPF A;  4HCB A;  1N9S A;  5GAM f;  2M02 A;  1K8A C;  2K2V A;  3TQ7 P;  3EG1 A;  4OMM A;  1QVG A;  1D1C A;  3FC3 A;  3THK A;  1O9S A;  1NPR A;  1WXB A;  1WLP B;  3CCS T;  2GGR A;  2KYB A;  2DD4 A;  1Y0M A;  1WXU A;  3TSW A;  4M75 E;  4KBM B;  1TWB A;  2COY A;  3GNG A;  3PNW C;  2EFI A;  1VQO A;  4IUR A;  2KSS A;  1YCY A;  4KGX B;  1YHQ Q;  3J81 E;  4XTX A;  4EMG A;  4HT9 A;  1R77 A;  2FPD A;  3QZ5 B;  1M1G A;  2JJ9 A;  2DX1 A;  5GAN h;  3PT9 A;  1WDX A;  1JJ2 S;  3OYE A;  3QJ6 A;  1VQO T;  2EIF A;  3EH1 A;  2LDM A;  1RAE B;  3NPF A;  5CKB A;  1D0X A;  3RKX A;  5FW9 A;  2FB7 A;  3RIR A;  5IH2 A;  1VQP A;  1B07 A;  3LH5 A;  1OPK A;  3EHQ A;  1U1T A;  1SSH A;  4RKU E;  4Z88 A;  2YWW A;  3MEU A;  1D0Y A;  2ZAE A;  4M77 C;  1XQH A;  4A63 B;  3CCR A;  2JTM A;  1ZUU A;  3BDU A;  1VQP T;  5GAO p;  1NPP A;  1KHI A;  2DVJ A;  1Q7Y U;  3ULR B;  4C8Q C;  5I2M A;  1GL5 A;  3NHN A;  5LJ5 h;  2ATC B;  4BAC A;  2AK5 A;  3QWX X;  1G3Y A;  2W0Z A;  2MWP A;  1TUD A;  3VS4 A;  3RMQ A;  3I35 A;  1PHT A;  5KE2 A;  1G5V A;  3X20 B;  3CCQ Q;  3CCR T;  5L8R E;  4BE0 A;  1NE8 A;  4EMK A;  2ZPE B;  2F5T X;  4DBF A;  4QKU A;  4EIK A;  5LJ3 d;  1VQ6 Q;  1XTD A;  3VS2 A;  2XDB A;  2HBP A;  3CME A;  2SEM A;  3CC2 A;  2P0P A;  4IUQ A;  3JCM h;  1W2B P;  2MAM A;  2DAQ A;  2DRK A;  1AOJ A;  2D8H A;  2NUT B;  1OEB A;  4IIO A;  4N0A A;  2KAF A;  5KYW B;  2XDD A;  4ELY C;  1KSW A;  3CME T;  3CC2 T;  4M7A C;  1M3B A;  2HSE B;  2RHZ A;  4JJD A;  4V2S A;  4Q5W A;  5KE3 A;  4FL6 A;  4PJO G;  4X9D A;  3JCM W;  2YDL A;  5A2Q E;  1ZA1 B;  2E5K A;  2X4Y A;  3V8J A;  4M77 A;  2A0F B;  4M7D B;  4HCZ A;  2VYT A;  1LPL A;  4FT4 A;  4PJM A;  4M77 E;  1X27 A;  4J8O A;  4M7D D;  1RAC B;  1M1F A;  2DFU A;  2JZ2 A;  4C8Q A;  1Q7Y R;  4OMP A;  3SB2 A;  2VAS A;  1QWE A;  4C8Q E;  2KRM A;  2DVE A;  2LNH B;  2L0A A;  5FRN A;  3GP8 A;  5LJ3 f;  4JLI A;  3ZFJ A;  1W70 A;  4XTZ A;  1KD1 R;  5CQX A;  4EDU A;  4IUT A;  2QDY B;  2EQU A;  3X26 B;  1OQK A;  3OYJ A;  4FW1 A;  3QUI A;  4E7J A;  2KY9 A;  1KG1 A;  2ROL A;  2YRD A;  1KD1 C;  3OYH A;  3A1P A;  2DER A;  2FG0 A;  1OUL A;  2JM9 A;  4R56 A;  1UJ0 A;  1BYM A;  1Q81 C;  1NEG A;  4F7U G;  2DJZ A;  1K9A A;  3TRE A;  5I22 A;  5FU6 C;  1KJW A;  1WHL A;  4ESR A;  1R0B G;  5KYU B;  2DIQ A;  1ARK A;  4M7A A;  3OYB A;  2CGH A;  5GAM h;  3OYC A;  3SWN C;  3ME9 A;  3V7C A;  4M7A E;  2IVW A;  2OTL A;  3UWN A;  2E12 A;  4JLG A;  4B9W A;  4BUG A;  3KXT A;  1AHJ B;  4PFP A;  4XTU A;  3AT1 B;  4KT0 E;  2J05 A;  2I2L A;  4C5E A;  1MMD A;  2L3Q A;  2Z0W A;  3A8L B;  2KT8 A;  4FSX A;  2V8K A;  1FYN A;  3M4G A;  4KUD K;  1UDL A;  4E7Z A;  2OTL T;  5HKC A;  2VV5 A;  1UGQ B;  4MZP A;  2L3P A;  2RMO A;  3M56 A;  1ZSZ B;  3M53 A;  1I5L A;  4PK4 A;  4RMO A;  1SRL A;  2A28 A;  5DM7 R;  2E64 A;  5FWB A;  4J6Y A;  1VQ7 Q;  2R57 A;  3JAM E;  3GF5 A;  5D6W A;  3G6E Q;  3EFS A;  4EPC A;  1XOV A;  2FRW A;  2ZPI B;  1WPY A;  4AG1 C;  5GMK j;  2RQT A;  2L89 A;  4BI3 A;  2K6D A;  3EG2 A;  3S3M A;  2PU9 B;  1WHH A;  2DYI A;  3VJP A;  3HRS A;  4BDY A;  2VGM A;  3OW2 P;  2JW4 A;  1PG5 B;  4PLL A;  2BZY A;  1I1J A;  2V8J A;  1D1B A;  3DB3 A;  1KK7 A;  4XK8 E;  2EW3 A;  5KYY A;  2A3L A;  2RJF A;  3PFS A;  1NLO C;  2EQK A;  4M78 B;  3QPH A;  4J9E A;  4J9F A;  1D3B A;  4FYX B;  2LCC A;  1JXM A;  4M78 D;  3H0I A;  1GCP A;  1VQ7 T;  2PUK B;  2K57 A;  2WAC A;  2K9G A;  3E2U A;  5HY6 A;  4LDU A;  4ATO A;  1RAG B;  3EHR A;  2DL4 A;  1X6G A;  3N5B B;  5GAN 8;  3EFO A;  2E3I A;  3LWH A;  2HZY A;  4DQ2 A;  3EH2 A;  2KNB B;  4C0D B;  4C5H A;  2D0Q B;  3CCE A;  1N9R A;  3P8D A;  4OMQ A;  1NLP C;  1UUE A;  5J39 A;  4ME7 A;  5FU7 B;  2ZZD A;  2X4W A;  2GF7 A;  4F04 B;  2K5I A;  3A8H B;  4Y92 A;  1SHF A;  4FYV B;  2RHX A;  1V1C A;  3CCE T;  2OI3 A;  3CC4 A;  1H3Z A;  2DXB A;  4WTO B;  5DLO A;  1D0Z A;  2L5Q A;  4UC4 A;  4C92 D;  2PVG B;  1VIE A;  4OB0 B;  3IQL A;  2EVR A;  1AT1 B;  1IGU A;  2QYZ A;  1QVF A;  1MV3 A;  3L42 A;  2DTO A;  2DXT A;  3CCV A;  1UJY A;  5GAN j;  1MMA A;  1K4U S;  1IRE B;  1BBZ A;  1M90 C;  4MZM A;  2KI7 A;  5C6S A;  3QDR B;  1IHW A;  5LJ5 d;  1S72 A;  1TXQ A;  3PGG A;  1IRX A;  1E6H A;  1OPL A;  4IUV A;  3CXC S;  3SHW A;  5FRM A;  5CKE A;  4LXC A;  2RQR A;  2VVK A;  1OU9 A;  3REA B;  4LUD A;  3CCV T;  2L3S A;  3TU4 K;  4RTT A;  2CP0 A;  3RMS A;  3BY7 A;  2YUP A;  2BUD A;  4CC4 B;  2QGF B;  2K3X A;  4LDX A;  2LNV A;  1S72 T;  3P8H A;  1BI1 A;  3CPW S;  2DZ9 A;  3JCM d;  1TUC A;  2A36 A;  1E7O A;  4P5N A;  4HVW A;  4RG8 A;  4E2F B;  4OML A;  3X28 B;  2DA9 A;  1T0H A;  3OYI A;  3UDC A;  5GAN 5;  3JCM c;  2DF6 A;  2E6N A;  1EIF A;  3M0P A;  1VQ8 A;  4A4G A;  1LVK A;  4JRP A;  2EJ9 A;  3EG9 B;  5D7U A;  2O4X A;  2LJ3 A;  4PFO A;  2EKH A;  3SEM A;  4NOY A;  4XU3 A;  2J6O A;  5LJ5 f;  1UFF A;  2A08 A;  1HXD A;  2GBQ A;  3MCA B;  1VQ8 T;  2YRV A;  2XG8 D;  2F5K A;  1QVG S;  4QQG A;  1QCO A;  2Y4X A;  1YI2 A;  1BCO A;  1NJI U;  1E6G A;  3G4S Q;  4XTY A;  1UGR B;  2QQB A;  3DB4 A;  2ECZ A;  4BI8 B;  1SF9 A;  1KQS P;  2MF2 A;  4M7D C;  3A5Z B;  4RTV A;  4AT1 B;  1JEG A;  3JCM f;  2L3R A;  2D0N A;  3CCL Q;  1VQ9 Q;  2M16 A;  4DEY A;  1YI2 T;  2MMP A;  2O9S A;  4J9B A;  1K8A U;  5FRO A;  2CUB A;  2EGA A;  3J7A F;  2ESW A;  2M51 A;  1MMG A;  1YBY A;  1NM7 A;  3NGP A;  2R5M A;  5GJV B;  2JMA A;  4M77 F;  2RK1 A;  2CKK A;  2XMF A;  3J80 E;  1VYV A;  3TSZ A;  1YJ9 Q;  4PJO D;  1JXO A;  3I9Q A;  2CT4 A;  2KR3 A;  1SEM A;  2QAZ A;  1K0S A;  4C8Q F;  1ZUY A;  3I5S A;  2KMT A;  2HNI A;  1GRI A;  3CMA A;  1KC8 U;  2DE0 X;  4FSS A;  2OJ2 A;  2E1H A;  3CCL T;  2J7I A;  4A54 A;  4AFQ C;  1UGS B;  2GFU A;  5CCA A;  2CZ7 B;  1C1A A;  1W6X A;  2DXC A;  2YUO A;  4AG2 C;  1NYF A;  2JN0 A;  2EBP A;  1FX7 A;  2KVQ G;  1VQL A;  3CMA T;  1QP2 A;  2QI2 A;  1UG1 A;  4C0F A;  2HDA A;  3JCM V;  3Q1J A;  3OYD A;  1WJS A;  1XNI A;  4JS4 A;  3QII A;  5GAM j;  1NJI R;  1PSF A;  3SD4 A;  4M7D E;  2PQW A;  1IO6 A;  5IN1 A;  1YIT Q;  2DRM A;  1D1A A;  3EAE A;  1D09 B;  4RCB A;  1H92 A;  5GMK m;  3QDF A;  1NJI C;  1VQL T;  4M7A F;  5CR2 A;  3RKW A;  3GIB A;  1U06 A;  1IGQ A;  1X2K A;  3OYM A;  2AKK A;  2W10 A;  1ZSZ C;  4J5Y A;  5CO7 A;  1K8A R;  3MET A;  3CCS A;  2YUN A;  1X75 C;  3JB9 F;  3VUZ A;  4JRI A;  1Y96 A;  2KBT A;  5GAN e;  2DM1 A;  4L5G A;  4LUE A;  4KGZ B;  2RM4 A;  4OB1 B;  2GCX A;  1AWW A;  2E3H A;  4M75 A;  3PVL A;  2FPE A;  2QQR A;  4OGC A;  2KT1 A;  4FW2 A;  4N4G A;  1X6O A;  2CUD A;  6AT1 B;  3LGL A;  1KC8 R;  2A37 A;  5KYU A;  1JU5 C;  3KUF A;  4AFS C;  1G8X A;  1BK2 A;  3EGD B;  2CDT A;  3VKI A;  5KYN A;  2CT3 A;  1PD1 A;  4PNO A;  1WFW A;  3CCU Q;  3TVT A;  4ZNX A;  3PTA A;  3JCM J;  1KC8 C;  4M78 C;  2ZPH B;  4MDW A;  4OB2 B;  1BIB A;  3C4S A;  1G3S A;  3C94 A;  1YHQ A;  3OYK A;  1H8K A;  1Q82 U;  3A8M B;  3VU3 C;  1EX4 A;  3UA6 A;  1PWT A;  2HCK A;  2XIC A;  5DLQ E;  1NYG A;  1YJW Q;  2XI9 A;  1N8R C;  2RI3 A;  1VQ5 Q;  2DLP A;  2PNI A;  2QG9 B;  3JB9 G;  2DIG A;  3JSC A;  1XJW B;  3VYG A;  3I56 Q;  1YHQ T;  1IZ6 A;  2AKL A;  3E19 A;  4C0G A;  2YHT A;  1ZSZ A;  5GAO m;  1OZ2 A;  1PD0 A;  2JUF A;  4ELZ C;  1VQK Q;  5DY9 A;  1K1Z A;  1B3Q A;  4R0K A;  2LP5 A;  2RQV A;  4OB3 B;  3V8L A;  3L2V A;  1RAF B;  2GFA A;  4XU2 A;  4DBQ A;  3LH0 A;  1H3H A;  2BZX A;  1WQW A;  1VQ4 Q;  4CRI A;  2FZK B;  3NTI A;  4C92 C;  1RL2 A;  2KXD A;  5GAN 3;  1KD1 U;  3V7S A;  4PFZ A;  3URG A;  1SSF A;  1TUG B;  2X4J A;  1GFD A;  1Q81 U;  3G1J A;  3FB9 A;  3UF4 A;  2YSQ A;  1YWO A;  1MNE A;  4MML A;  2K3B A;  1PKS A;  4C5G A;  2CP6 A;  5I11 A;  4GLM A;  1RUW A;  4XU0 A;  3CCQ A;  1YFN A;  4LDW A;  3PE0 A;  1TOV A;  1P92 A;  2NUP B;  4M78 E;  3E1S A;  1VQ6 A;  1Y07 A;  5I21 A;  4HCC A;  3OYY A;  1NZ9 A;  1U5S A;  2CZ1 B;  1Q82 R;  2DET A;  1SG5 A;  1VQ4 T;  2M0O A;  1M2V A;  1AWX A;  3CCQ T;  2DKG A;  3OQ5 A;  3R6N A;  1JJ2 P;  4RTZ A;  1KFZ A;  2HQH A;  5LJ3 j;  2EYQ A;  4JUV A;  1Q82 C;  1VQ6 T;  2MOX A;  2JM8 A;  1NG2 A;  3CEY A;  1RI9 A;  2XHC A;  3MP6 A;  2QTV A;  4MDX A;  2JNG A;  3MKD A;  1W2B A;  2JMC A;  4K11 A;  4Y91 A;  3EGX A;  1C6V X;  2LTO A;  3QYG B;  4C92 A;  3L2R A;  5KCH A;  1GBR A;  2RJE A;  1PRM C;  4FYW B;  3HRT A;  3LWI A;  3MP8 A;  4C92 E;  3HKS A;  2HL5 C;  1WZO A;  4LD6 A;  1Q81 R;  2F69 A;  4HXJ A;  1CKA A;  3CQT A;  4LDV A;  3TEE A;  4RTU A;  3NFC A;  4YTL A;  2K7A A;  1TG0 A;  2VUB A;  1UEB A;  3E9F A;  2HQX A;  2FHD A;  2LRQ A;  3KBG A;  3OB9 A;  5IXF A;  3RR6 A;  1I4K 1;  1YIJ Q;  3G7Z A;  1HK9 A;  4C5I A;  1K9M U;  3JB9 H;  2FL7 A;  3VV0 A;  5D6Y A;  1PC0 A;  2F2V A;  4ZGJ B;  1WXT A;  1RAD B;  1EFN A;  1AWJ A;  4FT2 A;  1OZ3 A;  5IXB A;  2RJC A;  2IPO B;  5GAN g;  1K0X A;  1VQN Q;  1LCK A;  2JXB A;  3X25 B;  2D6F A;  3QG1 A;  2JTE A;  1QVF S;  2DBM A;  4JRQ A;  2I0N A;  2X4X A;  3U23 A;  3WVD B;  1MGQ A;  4BY6 B;  2RPN A;  2ZCF B;  2E70 A;  4PJO C;  4FCY A;  1PKT A;  2O88 A;  1LOJ A;  4E7K A;  4JZ3 A;  2JS2 A;  4CC3 A;  3OS5 A;  3PVQ A;  1RAA B;  2EQM A;  3LW5 E;  1VIF A;  2K5F A;  2J6K A;  1MND A;  2HEQ A;  5CAI A;  4E47 A;  1ZLM A;  2RK2 A;  1M9S A;  3A98 A;  2H3J A;  1VQ7 A;  2FYK A;  1M90 U;  3G6E A;  4MZT A;  3H8Z A;  4J7I A;  1WI7 A;  2E4H A;  3V7R A;  1VQM Q;  2C0T A;  3SWN A;  4BE1 A;  1WHJ A;  4J7F A;  3I55 Q;  1K9M R;  1ZSG A;  3MO8 A;  5LL6 S;  2EQI A;  3NTH A;  4EMK B;  5CKD A;  2JTF A;  3CCJ Q;  1KQ2 A;  4A53 A;  3CD6 Q;  3G6E T;  3BDL A;  4BE2 A;  1LNX A;  1K9M C;  2MI6 A;  2V1R A;  2XD0 A;  2NWM A;  4J9D A;  4XU1 A;  4JPB W;  3M0R A;  5J26 A;  2AT1 B;  3PMI A;  3QKJ A;  2EJF A;  2YRC A;  2MWO A;  2RB6 A;  1T3S A;  2BE9 B;  4Z02 A;  2OAU A;  4JJC A;  2O01 E;  4JJN K;  3OBY A;  2IG0 A;  4M7D F;  4PJO A;  2RN8 A;  1M5Q 1;  3OW2 A;  3M5A A;  1YN8 A;  3RES A;  4PJO E;  3INZ A;  2KXC A;  4A4F A;  1YJN Q;  1VQM T;  1TSF A;  2HSP A;  3OMG A;  4VUB A;  2E10 A;  1M3A A;  4N4I A;  1Q95 G;  1SKU B;  3A8G B;  3OBW A;  3H6Z A;  4JS5 A;  4XTW A;  4M77 B;  1B34 B;  1N5Z A;  1M8V A;  1W1F A;  2QTX A;  5LJ3 e;  1X69 A;  4O6J A;  2CZ0 B;  4C8Q B;  1M90 R;  4ZTJ A;  3VRZ A;  1WYX A;  4M75 F;  1JBM A;  1X01 A;  3OYA A;  2MK5 A;  3ASK A;  2BIV A;  2JS0 A;  5GAO n;  5KH6 A;  4QQ6 A;  4F7U A;  3R6O A;  2LQ8 A;  2KGT A;  1QVP A;  2MYS A;  1HD3 A;  2KYM A;  1G83 A;  2QGG A;  4F7U E;  3ZL7 C;  3OS2 A;  3A8O B;  4B9X A;  4PJL A;  4DBR A;  3OYN A;  2X51 A;  1MHN A;  4IUP A;  3S3N A;  3VS1 A;  4A4E A;  3JB9 J;  1SRM A;  1VUB A;  4QT7 A;  4ZGD B;  1Y7X A;  2K2M A;  2ZPG B;  4M7A B;  1KIK A;  2HKN A;  1OX9 A;  1PNJ A;  2QA4 Q;  4OP0 A;  2JT4 A;  4MMK A;  5KYX B;  4PLI A;  2K4Y A;  2MCN A;  5LJ5 j;  1OYX A;  4ORZ A;  3SDZ A;  4DA4 A;  5GAO r;  2KRS A;  3JB9 D;  3L2Z A;  4M75 G;  3D7S B;  2LMJ A;  2AZS A;  2K79 A;  1BU1 A;  4E7S A;  3CC7 Q;  3HFO A;  4BI4 A;  3C12 A;  1OU8 A;  1QQJ A;  3JCM Q;  2VGN A;  2C0O A;  3QZ9 B;  2ED0 A;  2RA2 A;  1U3O A;  4DOW A;  2H8H A;  4RTW A;  1K73 C;  2LCL A;  1QLY A;  1Y71 A;  2CH4 A;  2LJ1 A;  1ZHI A;  2RJD A;  3M0Q A;  2Y4Y A;  3H0F A;  1W4S A;  1ABO A;  4Y28 E;  3OS0 A;  3O8V A;  1ZA2 B;  2A7Y A;  5CVI A;  2J6F A;  2H3E B;  5HK0 A;  2QEX Q;  4J9H A;  1V76 A;  2EJG A;  3T9N A;  4M78 F;  4QVD A;  2LT1 A;  1ABQ A;  2K3Y A;  3S6W A;  3WVE B;  5GMK e;  3M59 A;  5GAO l;  2MIO A;  1YNZ A;  1HJD A;  3WXM B;  1Q86 U;  3CC7 T;  1JQQ A;  5FU6 B;  1BKB A;  2E5Q A;  5GAN 4;  1IB8 A;  3CXC P;  5KYY B;  3G4S A;  3RER A;  1AEY A;  3PMT A;  1M3C A;  1D3B B;  1VYT A;  1IXD A;  3CCL A;  1VQ9 A;  2RI5 A;  2OTJ Q;  4D8K A;  2HAX A;  3CCM Q;  3CPW P;  3MEV A;  1WA7 A;  2VKN A;  2RH2 A;  1I5O B;  2XKO C;  4L6V 5;  3G4S T;  4O5V A;  3GNF B;  3EFO B;  2NUT A;  4J6W A;  2DO3 A;  4LNP A;  1KQS A;  4XQ3 A;  1BIA A;  1BI3 A;  2CYZ B;  5KYW A;  4C92 F;  1VQ9 T;  4RTY A;  5D6X A;  3HSB A;  1YJ9 A;  1Z9Q A;  3VS0 A;  5KCO A;  3HPW A;  4E6R A;  1G3T A;  4LDY A;  1N8R U;  4TVR A;  4GY5 A;  2PVD B;  3S3O A;  2CSI A;  1NBE B;  2LVM A;  4OF1 A;  4M7D A;  1YJ9 T;  4Z8A A;  4RTX A;  1V29 B;  1RLQ C;  2DBK A;  4IIM A;  4F16 A;  2KEA A;  2L2P A;  1G3W A;  1M30 A;  3G71 Q;  3MEA A;  3MP1 A;  1QVG P;  1Q86 R;  4M77 G;  1PM3 A;  3QHS A;  1T0J A;  4BY6 C;  4CC7 A;  1R8O B;  1AZE A;  2PVO B;  1Q86 C;  3HHT B;  4C8Q G; 
#chains in the Genus database with same CATH homology
 1GXI E;  3CCQ T;  4E7I A;  2DKG A;  3OQ5 A;  5J3B A;  5LJ3 g;  3LX7 A;  1PSE A;  4PLL A;  1YIT A;  2V8J A;  5LJ3 j;  3DB3 A;  2EYQ A;  4NL2 A;  4XK8 E;  4JUV A;  1Q82 C;  1VQ6 T;  2RHI A;  2A3L A;  2K5L A;  3CEY A;  2Y90 A;  4JRK A;  2XHC A;  2RJF A;  3PFS A;  3BW1 A;  3MP6 A;  2FVU A;  1N6A A;  2EQK A;  1ZBX A;  4HKE A;  4MDX A;  2KDS A;  3PIP A;  4M78 B;  3QPH A;  3CC7 A;  2XK0 A;  1D3B A;  2QA4 T;  2LCC A;  4M78 D;  2JNG A;  1N27 A;  1VQ7 T;  2PUK B;  3G71 T;  1YIT T;  2K57 A;  2WAC A;  1W2B A;  3BFM A;  4N4H A;  4X34 A;  4Y91 A;  5HY6 A;  4PL6 A;  2VXE A;  4DOV A;  2LTO A;  4LDU A;  4ATO A;  3QYG B;  1W2B S;  4C92 A;  5GAN 7;  4II1 A;  2RHY A;  4A4H A;  5KCH A;  2RJE A;  3N5B B;  3JB9 I;  3L2R A;  2P4T A;  5GAN 8;  3HRT A;  3LWI A;  3MP8 A;  3LWH A;  4C92 E;  3OS1 A;  4DQ2 A;  3HKS A;  4QVC A;  4EMK C;  3M57 A;  4C0D B;  3AHU A;  4C5H A;  2LT4 A;  1FXX A;  2D0Q B;  1I81 A;  1LJO A;  4LD6 A;  5GAM e;  3CCE A;  1N9R A;  2DZC A;  3P8D A;  4M7A G;  2F69 A;  5J39 A;  2HD0 A;  4ME7 A;  1DJ7 B;  5FU7 B;  2QEX A;  2ZZD A;  4LDV A;  2X4W A;  2E41 A;  2GF7 A;  5CQY A;  2DTI A;  3TEE A;  3JRZ A;  3SWN B;  1M1K C;  1U1S A;  3NFC A;  2K5I A;  4YTL A;  3CCU A;  5LJ5 e;  3FIF A;  2HQE A;  2VUB A;  1UEB A;  1U8R A;  2JOY A;  3A8H B;  5C0M A;  1QW1 A;  4BDZ A;  3E9F A;  4C0D C;  3OY9 A;  2HQX A;  2FHD A;  1H64 1;  2LRQ A;  3KBG A;  3OB9 A;  2RHX A;  5HK3 A;  5I2S A;  4RG2 A;  3CCE T;  1I4K 1;  2RO0 A;  3G7Z A;  2O4X B;  4N0A C;  3RKY A;  3V8K A;  2V8I A;  5FU7 C;  3OYL A;  3CC4 A;  1H3Z A;  2QEX T;  2DXB A;  1HK9 A;  5A0D A;  4C5I A;  5DLO A;  1K9M U;  2DD5 A;  1I8F A;  3JB9 H;  2FL7 A;  2L5Q A;  4UC4 A;  4C92 D;  3CCU T;  2PVG B;  2QQA A;  3VV0 A;  1YJW A;  1VIE A;  1WNL A;  5D6Y A;  4OB0 B;  3JCM b;  1VQ5 A;  3JCM e;  4ZGJ B;  4E7H A;  2PUO B;  2M1H A;  3HRU A;  2L8D A;  1OI1 A;  3L1A A;  3I56 A;  5GMK h;  2DK3 A;  4PJO B;  2OTJ A;  4FT2 A;  1OZ3 A;  5GAM d;  3CCM A;  1QVF A;  2RJC A;  3C95 A;  3L42 A;  5GAN g;  3L2U A;  2DTO A;  5CK9 A;  2DXT A;  3GPL A;  2LC4 A;  3QYH B;  4M78 G;  1JB0 E;  3X25 B;  3CCV A;  5GAN j;  2D6F A;  3FRN A;  1IRE B;  4FIB A;  1M90 C;  3QG1 A;  3CXC A;  4MZM A;  3GLX A;  4M75 C;  3L2Q A;  1VQK A;  1QVF S;  5CKH A;  2QXF A;  4NS5 A;  3QDR B;  4PJO F;  5C6S A;  3QO3 A;  3JCM X;  1YJW T;  5LJ5 d;  1S72 A;  2G3R A;  3CBO A;  4JRQ A;  1VQ5 T;  3LLR A;  3PGG A;  2X4X A;  4IUV A;  3WVD B;  1MGQ A;  4R55 A;  2EAY A;  3CXC S;  4BY6 B;  3I56 T;  2ZCF B;  2E70 A;  5CKE A;  5FRM A;  1KHC A;  4PJO C;  2EKO A;  4OVA A;  2OTJ T;  3M58 A;  3M4Y A;  3UT1 A;  3MEW A;  3CCM T;  4FM4 B;  1LOJ A;  2QQS A;  4X9C A;  2DEQ A;  3CCV T;  2P0Q A;  4E7K A;  3TU4 K;  1VQ4 A;  4M78 A;  3RMS A;  3BY7 A;  3OS5 A;  2BUD A;  3CPW A;  1VQK T;  3QJY A;  2K3X A;  2P0K A;  4LDX A;  2EQM A;  3LW5 E;  2LNV A;  1S72 T;  3P8H A;  1VIF A;  3FJP A;  1BI1 A;  2K5F A;  3CPW S;  2KQW A;  2DZ9 A;  3JCM d;  5CAI A;  2M9U A;  3ZEH A;  2XDP A;  3EFR A;  4E47 A;  4IUU A;  2RK2 A;  1M9S A;  3DLM A;  4ZN1 A;  4QVZ A;  2H3J A;  4P5N A;  1UGP B;  1VQ7 A;  2WSE E;  3G71 A;  2FYK A;  4RG8 A;  1M90 U;  1TH7 A;  3G6E A;  3UPU A;  4F7U B;  3X28 B;  4MZT A;  3H8Z A;  3OYI A;  2DPP B;  4J7I A;  4KUL A;  2VXF A;  4C92 G;  2ZGW A;  3UDC A;  3LGF A;  5GAN 5;  3V7R A;  3SWN A;  2CZ6 B;  3JCM c;  4BE1 A;  3FLG A;  4C0Z A;  2RHU A;  4D6W A;  4J7F A;  2E6N A;  1EIF A;  3F70 A;  1WGS A;  3GOX A;  3CPF A;  1VQ8 A;  4F7U F;  2AHJ B;  2KK4 A;  4A4G A;  4HCB A;  5CKD A;  3MO8 A;  5LL6 S;  2YLC A;  3NTH A;  4EMK B;  4RCC A;  1N9S A;  4JRP A;  2JTF A;  5GAM f;  2EJ9 A;  2JVV A;  1KQ2 A;  4A53 A;  2WSF E;  3G6E T;  3BDL A;  5GMK i;  4BE2 A;  4E7L A;  1K8A C;  2O4X A;  1LNX A;  2K2V A;  1K9M C;  2MI6 A;  3OSS C;  2XD0 A;  1QVG A;  1B34 A;  3FC3 A;  4XU1 A;  2QA4 A;  4NOY A;  4XU3 A;  5J26 A;  5LJ5 f;  1O9S A;  1NPR A;  3QXE B;  5IAY A;  1HXD A;  3PMI A;  3QBY A;  3MCA B;  3CCS T;  2YRV A;  3QKJ A;  2EJF A;  1VQ8 T;  2DD4 A;  5GAO q;  2MWO A;  2F5K A;  2RB6 A;  2XG8 D;  4M75 E;  4KBM B;  3GNG A;  2DXU A;  4QQG A;  2Y4X A;  2EFI A;  3PNW C;  4Z02 A;  2OAU A;  4IUR A;  1BI0 A;  1YCY A;  2KSS A;  1VQO A;  2O01 E;  3RUX A;  3J81 E;  4JJN K;  1YI2 A;  3OBY A;  2IG0 A;  4XTX A;  5CKF A;  4A4K A;  4EMG A;  4HT9 A;  4M7D F;  1M5Q 1;  4PJO A;  3OW2 A;  1NJI U;  1JJ2 A;  3M5A A;  4XTY A;  3VYH B;  1UGR B;  2EWN A;  3QZ5 B;  2QQB A;  3RES A;  5GAN 6;  3DB4 A;  1M1G A;  4PJO E;  3INZ A;  4BI8 B;  4A4F A;  2MF2 A;  4ZTF A;  4M7D C;  1Q7Y C;  3A5Z B;  1VQM T;  5GAN h;  4QQD A;  5A0L A;  3FDR A;  3PT9 A;  3OW2 S;  1JJ2 S;  2X35 A;  3OYE A;  3JCM f;  3OMG A;  4VUB A;  2L3R A;  5EG2 A;  3QJ6 A;  2E10 A;  1VQO T;  1Y96 B;  2M16 A;  4N4I A;  2EIF A;  3A8G B;  3OBW A;  3H6Z A;  2LDM A;  4JS5 A;  4XTW A;  1YI2 T;  2MMP A;  1JRI A;  5CKB A;  1K8A U;  3RKX A;  5FRO A;  4M77 B;  1B34 B;  2GQV A;  2FB7 A;  1M8V A;  3RIR A;  4OGE A;  3J7A F;  2QTX A;  5LJ3 e;  1VQP A;  4M75 B;  1YBY A;  4M75 D;  4PKC C;  4O6J A;  2CZ0 B;  2R5M A;  1U1T A;  4C8Q B;  4M77 F;  2RK1 A;  2CKK A;  2R5A A;  3J80 E;  3L2W A;  4ZTJ A;  3OYG A;  4J83 A;  4RKU E;  4M75 F;  3MEU A;  1YIJ A;  1JBM A;  4PJO D;  1X01 A;  1BI2 A;  4M77 C;  3HP9 A;  1XQH A;  2C06 A;  3HFN A;  3CCR A;  3OYA A;  2JTM A;  3BDU A;  4C8Q F;  3HL8 A;  3ASK A;  3E9G A;  5GAO p;  1VQP T;  2KMT A;  1NPP A;  1KHI A;  2HNI A;  1Q7Y U;  3CMA A;  2BIV A;  5GAO n;  1KC8 U;  5KH6 A;  4QQ6 A;  4F7U A;  3R6O A;  4C8Q C;  3OYF A;  2LQ8 A;  1QVP A;  4JDS A;  4CI0 C;  5I2M A;  2E1H A;  5LJ5 h;  3CCL T;  2WSC E;  4A54 A;  4F7U E;  3OS2 A;  4BAC A;  1UGS B;  2GFU A;  3A8O B;  1YIJ T;  1G3Y A;  4B9X A;  2CS7 A;  2MWP A;  5CCA A;  2CZ7 B;  3RMQ A;  4WF2 A;  5KE2 A;  1MHN A;  2DXC A;  3OYN A;  4IUP A;  3X20 B;  3CCR T;  1VQN A;  5L8R E;  1G5V A;  3S3N A;  4BE0 A;  4A4E A;  1NE8 A;  2LQK A;  2JN0 A;  4EMK A;  5M9O A;  2ZPE B;  3JB9 J;  1M4Z A;  1VUB A;  1FX7 A;  2F5T X;  2KVQ G;  1VQL A;  5LJ3 d;  4ZGD B;  3CMA T;  1QP2 A;  2QI2 A;  1XTD A;  2E6Z A;  4C0F A;  4NL3 A;  1Y7X A;  3JCM V;  2XDB A;  3Q1J A;  3OYD A;  1WJS A;  2HBP A;  2ZPG B;  1XNI A;  4BB7 A;  4JS4 A;  3CME A;  3QII A;  2YLB A;  5GAM j;  3CC2 A;  4M7A B;  2P0P A;  4IUQ A;  1PSF A;  3JCM h;  4EMH A;  1ZQ1 A;  1VQN T;  4OP0 A;  2MAM A;  4MMK A;  2DAQ A;  3SD4 A;  4M7D E;  4PLI A;  2PQW A;  5IN1 A;  2K4Y A;  3EAE A;  4RCB A;  5LJ5 g;  5GMK m;  1NJI C;  5LJ5 j;  2QQ9 A;  1VQL T;  1OYX A;  4M7A F;  5CR2 A;  3RKW A;  3SDZ A;  4N0A A;  4DA4 A;  3GIB A;  5GAO r;  4QW2 A;  2KAF A;  3OYM A;  3X24 B;  2XDD A;  4ELY C;  3JB9 D;  3L2Z A;  4M75 G;  3CME T;  3CC2 T;  4M7A C;  4J5Y A;  5CO7 A;  3MET A;  3CCS A;  2RHZ A;  3HFO A;  4BI4 A;  3C12 A;  1X75 C;  3OMC A;  3JB9 F;  3VUZ A;  3CBM A;  4JRI A;  3JCM Q;  4V2S A;  4Q5W A;  5KE3 A;  2RD1 A;  4FL6 A;  4X9D A;  4PJO G;  1O75 A;  1Y96 A;  2VGN A;  3QZ9 B;  3JCM W;  2RA2 A;  5GAN e;  5A2Q E;  4DOW A;  4L5G A;  3NTK A;  2X4Y A;  3JCM g;  3V8J A;  4BD3 A;  1K73 C;  2RM4 A;  4OB1 B;  1WJQ A;  4M77 A;  2BKD N;  2LCL A;  3CBP A;  2GCX A;  1Y71 A;  1VQM A;  4OMF B;  4M7D B;  4HCZ A;  2VYT A;  4M75 A;  4FT4 A;  1ZHI A;  2RJD A;  4M77 E;  4J8O A;  4M7D D;  3I55 A;  2Y4Y A;  4Y28 E;  1M1F A;  1W4S A;  2QQR A;  3OS0 A;  2ZPB B;  3QSU A;  3O8V A;  4OGC A;  2ZPF B;  2A7Y A;  2JZ2 A;  4N4G A;  5CVI A;  4C8Q A;  3CCJ A;  1X6O A;  3SB2 A;  3LGL A;  3CD6 A;  3KUF A;  5HK0 A;  4C8Q E;  2EJG A;  2DVE A;  3T9N A;  3VKI A;  4FU6 A;  4M78 F;  4QVD A;  2LT1 A;  3S6W A;  2K3Y A;  4PNO A;  5FRN A;  3GP8 A;  3WVE B;  5LJ3 f;  3PTA A;  3JCM J;  3FEO A;  5GMK e;  1KC8 C;  3TCJ A;  4LD9 K;  3M59 A;  2R58 A;  5GAO l;  2LX9 A;  4JLI A;  4M78 C;  3ZFJ A;  3I55 T;  3WXM B;  4XTZ A;  1Q86 U;  3CC7 T;  2ZPH B;  5CQX A;  4EDU A;  2RI2 A;  2QDY B;  4IUT A;  4MDW A;  1BKB A;  1BIB A;  2EQU A;  4OB2 B;  5FU6 B;  3X26 B;  1WJR A;  3OYJ A;  3C4S A;  1G3S A;  3CCJ T;  2E5Q A;  3C94 A;  1YHQ A;  3QUI A;  4E7J A;  5GAN 4;  3OYK A;  2KY9 A;  3CD6 T;  1KG1 A;  1WQ7 A;  2B8A A;  2D9T A;  5IT9 E;  3ER0 A;  4KUI A;  3G4S A;  1Q82 U;  3A8M B;  3VU3 C;  5GAN d;  4ZN3 A;  3OYH A;  1K73 U;  1KD1 C;  3RER A;  4M77 D;  2XIC A;  5DLQ E;  4R56 A;  3DLL A;  1YJN A;  1BYM A;  2XI9 A;  1Q81 C;  1N8R C;  1QP3 A;  2RI3 A;  3PMT A;  4F7U G;  2DJZ A;  3TRE A;  1D3B B;  2DTH A;  3JB9 G;  5FU6 C;  2DIG A;  3JSC A;  3VYG A;  3CCL A;  1RI0 A;  4C8Q D;  1VQ9 A;  2RI5 A;  2DIQ A;  5A0G A;  3OA6 A;  1YHQ T;  2HAX A;  1IZ6 A;  3OSV A;  4HA8 A;  3E19 A;  4C0G A;  2YHT A;  4M7A A;  3MEV A;  2RH2 A;  2XKO C;  3DKM A;  4L6V 5;  5GAO m;  3OYB A;  3G4S T;  2CGH A;  4O5V A;  1OZ2 A;  5GAM h;  4C92 B;  3OYC A;  4GLK A;  3ME9 A;  2JUF A;  3SWN C;  3V7C A;  5AYF A;  4M7A E;  4ELZ C;  3MHX A;  5DY9 A;  4ZGE B;  3GNF B;  2IVW A;  3PIO A;  1YJN T;  2OTL A;  3UWN A;  2E12 A;  4J6W A;  4JLG A;  4B9W A;  4BUG A;  3KXT A;  2DO3 A;  1AHJ B;  4OB3 B;  3V8L A;  1KQS A;  3L2V A;  4XQ3 A;  1BIA A;  1BI3 A;  4XTU A;  4XU2 A;  2GFA A;  2CYZ B;  5GMK l;  2XU8 A;  4J6X A;  3M55 A;  4C92 F;  4KT0 E;  1VQ9 T;  4M7D G;  5D6X A;  2I2L A;  3LH0 A;  4C5E A;  3HSB A;  1YJ9 A;  1KQ1 A;  1WQW A;  1KQS S;  3A8L B;  3ZBD A;  4CRI A;  4IKF A;  3CC4 T;  3NTI A;  2V8K A;  3M4G A;  4FSX A;  5KCO A;  1QVG S;  4C92 C;  4KUD K;  1RL2 A;  3M9Q A;  5GAN 3;  1KD1 U;  3LYI A;  3V7S A;  1FWZ A;  3URG A;  1M1K U;  1SSF A;  2X4J A;  3HPW A;  2OTL T;  5HKC A;  1Q81 U;  1G3T A;  4LDY A;  1N8R U;  4TVR A;  2VV5 A;  3FB9 A;  3P8B B;  5CIU A;  1UGQ B;  2NLU A;  4GY5 A;  2PVD B;  3S3O A;  4MZP A;  4MML A;  5GAM g;  5LJ3 h;  2LVM A;  4OF1 A;  2XID A;  3M56 A;  5FLX E;  4M7D A;  3M53 A;  3VUB A;  4C5G A;  1YJ9 T;  1I5L A;  3JCM P;  3SFM A;  4RMO A;  4M7A D;  1V29 B;  2EQJ A;  4XU0 A;  5DM7 R;  2E64 A;  3CCQ A;  4J6Y A;  4XTV A;  1G3W A;  1UB4 A;  2E65 A;  2R57 A;  3GF5 A;  1P92 A;  4LDW A;  3JAM E;  5D6W A;  3EFS A;  3MEA A;  1XOV A;  4EPC A;  3MP1 A;  2ZPI B;  3E1S A;  4M78 E;  1WPY A;  4XAX B;  5GAN f;  5GMK j;  1VQ6 A;  2VC8 A;  1Y07 A;  2L89 A;  4M77 G;  4BI3 A;  5I21 A;  4HCC A;  3OYY A;  4HT8 A;  4L59 A;  3QHS A;  1NZ9 A;  4BY6 C;  3S3M A;  2PU9 B;  3M54 A;  5GAN 2;  1R8O B;  3VJP A;  2PVO B;  3HRS A;  4BDY A;  1Q86 C;  2CZ1 B;  2VGM A;  1VQ4 T;  3HHT B;  2M0O A;  4C8Q G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...