1SSFA

Solution structure of the mouse 53bp1 fragment (residues 1463-1617)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
123
structure length
123
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tudor Tandem of 53BP1; A New Structural Motif Involved in DNA and RG-Rich Peptide Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
molecule keywords Transformation related protein 53 binding protein 1
total genus 16
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA01
1VQ4A 1YJWT 1VQKA 1EIFA 3HKSA 4ZTJA 3I56A 1OI1A 1UEBA 3C4SA 3OYIA 4QQDA 3E9FA 1H3ZA 2M1HA 5CIUA 4B9XA 2RI3A 3CD6A 1VQNT 1QVFS 4Z02A 3PFSA 2IG0A 2O4XA 3OS1A 3CMAT 2E6NA 3CCEA 1YI2T 1X6OA 1WJSA 3S3MA 2CKKA 3OYFA 4EDUA 4E7HA 1RI0A 3J81E 3ER0A 2MWOA 3G6EA 3NTHA 3OYCA 2E70A 3CD6T 3Q1JA 5D6XA 3I55A 2F5KA 1VQ9A 2DO3A 5FROA 3UWNA 2P0KA 3CCET 3LLRA 3ASKA 5IN1A 5A2QE 3CC2A 2OTJT 3OY9A 1QVGS 3CC7A 2RHZA 2BUDA 2D9TA 4E7KA 1KD1C 3OYKA 2DIQA 4IKFA 3OW2S 4BD3A 3CCMT 2R57A 2EFIA 1OYXA 3CCLT 3ME9A 4L59A 2OTLA 3CCVA 2LQ8A 2FHDA 4YTLA 2RO0A 1VQPT 3FLGA 2RHUA 3G4ST 5KE2A 3L2QA 2EQJA 2BKDN 2X4XA 3CCJT 3MO8A 3L2VA 1N8RU 1M1KC 3CCRT 3GOXA 5FLXE 2RJDA 1QVGA 3L42A 5DLQE 2O4XB 3NTKA 3G4SA 4IUVA 4PL6A 1YJNA 5J26A 3MP1A 2EIFA 3PMTA 5IT9E 4II1A 1WJQA 2RHXA 2L3RA 1VQKT 4BDYA 1VQ6A 1K73U 3I56T 3CMET 3QBYA 2MI6A 1W2BA 3G71A 3OYDA 4TVRA 4C5GA 5J3BA 4IUQA 3CCQT 3CCSA 3OS0A 3CEYA 3EAEA 3META 1NJIU 2JZ2A 4A4GA 3OYMA 3L2RA 2RJEA 4IUUA 2MWPA 1NPPA 1Q86C 1VQNA 3F70A 1SSFA 2RI5A 2HQXA 3PNWC 4NS5A 1K9MU 3H6ZA 4GY5A 3S3NA 1YHQT 3CXCA 3MEVA 1VQMT 1VQ5A 3J80E 4CRIA 3OMGA 1YJ9T 3UT1A 1JJ2A 1S72A 4B9WA 3CMAA 3DB4A 2QEXT 1YJNT 2LCCA 2G3RA 3MEUA 2RJCA 3TREA 3DLMA 3CPFA 3M9QA 2RHIA 4ZTFA 4HCZA 1WGSA 5KE3A 1YI2A 4QW2A 3FC3A 4BDZA 5FRNA 1K73C 4E7LA 1VQPA 2R5MA 2QA4T 4E7IA 3PIOA 2LRQA 5DM7R 3ZEHA 2KDSA 1VQOA 3CC7T 2LDMA 1OZ2A 1YIJA 1VQLT 2B8AA 4X34A 3CC4T 3OQ5A 2RJFA 2K3XA 3P8DA 2JUFA 2JNGA 4FU6A 1YJWA 2EQUA 4N4IA 2E6ZA 2VYTA 3CCVT 3QKJA 2EKOA 3I55T 5D6YA 1IZ6A 4UC4A 2X4WA 4C5IA 1QVFA 4Q5WA 2WACA 2PQWA 2GFAA 4BE1A 1VQ8T 5C0MA 2JTFA 1NJIC 2QQRA 1JJ2S 1MHNA 3QIIA 3CCRA 1VQ7A 1Q86U 2EQKA 1M90C 4FL6A 1WJRA 3CPWS 3CXCS 1W2BS 2LVMA 3CCJA 3OYEA 4N4HA 2DAQA 4E7JA 1XTDA 2XHCA 4IUPA 3OMCA 1NPRA 1Q81U 3MEWA 3OS2A 2M0OA 5KCHA 3O8VA 4QVZA 3CMEA 1NZ9A 3S3OA 3CPWA 5M9OA 3G6ET 1YJ9A 3PMIA 1XNIA 4QQGA 1N8RC 1VQMA 1YITA 4PLIA 2L89A 1VQ4T 2JVVA 1Q7YU 1KC8C 3CCQA 2LTOA 4PLLA 3NTIA 2GF7A 4C5HA 4A4HA 3E9GA 1Q81C 2BIVA 3OYBA 3MP8A 3CC2T 1M1GA 2E5QA 3OYNA 3LGFA 3OYLA 4BACA 3DB3A 1S72T 2R58A 2QA4A 1Q82U 1KD1U 3OYYA 2NLUA 3S6WA 1YHQA 5KCOA 1KQSA 1G5VA 1VQ9T 3OYAA 1K8AC 4RG2A 1M1KU 5C6SA 1M90U 1Q7YC 3DLLA 3CC4A 3J7AF 3QJ6A 4IUTA 3JAME 4ZN3A 1VQOT 2OTLT 2HQEA 3OYJA 5IAYA 4LD6A 2L8DA 5LL6S 3BDLA 2R5AA 1K9MC 1BKBA 3LYIA 3H8ZA 3LH0A 2K3YA 1OZ3A 3KUFA 5D6WA 3OW2A 2XK0A 4N4GA 5J39A 3CCMA 2RI2A 4ZN1A 1YBYA 3CCLA 3MP6A 5FRMA 4A4EA 3OYGA 1YIJT 1VQLA 3KBGA 2JOYA 1Q82C 3FEOA 3CCUT 2RHYA 3L2WA 2EQMA 2KVQG 1VQ7T 1KQSS 3MEAA 4OVAA 2QQSA 3LGLA 1VQ8A 2M16A 2YRVA 1RL2A 3CCST 3PIPA 1KHIA 3L2UA 3OA6A 1VQ5T 1N27A 5HY6A 4BE0A 4QQ6A 3LX7A 4A4FA 4IURA 2LCLA 5KH6A 3P8HA 3P8BB 3CCUA 3OYHA 3OB9A 2XDPA 2DIGA 3SD4A 2QEXA 4C5EA 3A5ZB 1K8AU 2X35A 3FDRA 2OTJA 1VQ6T 2X4YA 1KHCA 4BE2A 1KC8U 1YITT 2GFUA 3G71T
chains in the Genus database with same CATH superfamily
1YCSB 1EX4A 2F2WA 3EGDA 3MHXA 1EIFA 1I81A 1KJWA 1JQQA 1MMAA 4CC2A 4JRIA 5HKCA 1WHGA 1M4ZA 2QAZA 1GL5A 4L6V5 1OU9A 2HEQA 4Z02A 2IG0A 4LDYA 2O4XA 3OS1A 1YJ9Q 3V8JA 3X28B 3CMAT 1IHVA 3CCEA 1QWEA 3V8LA 4X9CA 1NE8A 2QGGA 2NUPB 2DA9A 2YUOA 2PVOB 2CSIA 3NTHA 3OYCA 2DBKA 2DE0X 5LJ5h 4C8QA 3CD6T 3SDZA 2LQWA 1VQ9A 2DL3A 3I35A 2K7AA 1YIJQ 2ED1A 4IIOA 5IN1A 3OSSC 4OMFB 5LJ5d 3PE0A 2DD4A 4Z88A 2OTJT 3OY9A 2RQUA 4QVDA 2RK1A 3CC7A 2RHZA 4EMHA 1FYNA 1X27A 4OMQA 1TXQA 1Q81R 2EGAA 4M78D 2LT4A 5GAMg 2GTOA 4HA8A 3OW2S 4BD3A 3JCMb 2R57A 2EW3A 1BIBA 1WQWA 3ME9A 3SWNA 2W10A 1KFZA 1PRLC 5CQYA 3JB9F 2HKNA 1D1BA 3RR6A 3FLGA 2RHUA 2DYBA 1OPLA 4ZGDB 2LJ3A 4AFZC 1NM7A 5GAN2 2CT4A 1TUGB 3UF4A 2M9UA 2D8HA 3MO8A 2HSPA 2JS2A 4A4KA 1IGUA 3I9QA 1LVKA 1B7TA 3CCRT 3GOXA 3NGPA 5FLXE 1QVGA 4M7DE 1G3WA 7AT1B 2CS7A 2DVEA 5GAMe 2XDDA 2RK2A 1P92A 2JW4A 1I4K1 5KYYB 3SHWA 2CP3A 5GAN4 4KUIA 1VQMQ 3M4GA 1K73U 4JPBW 2GQVA 4AFUC 2COYA 2I0NA 4IUQA 1TS9A 1PG5B 3LWIA 3CEYA 1M3AA 3EAEA 3META 4A4GA 2JZ2A 5HK3A 5CAIA 3L2RA 4IUUA 2LQNA 2MWPA 1NPPA 1B34A 2DL4A 3CQTA 2YSQA 1JEGA 1V29B 2FZKB 1NEGA 3CCQQ 2O88A 2D1XA 4HT8A 4D8DA 3PNWC 3QWXX 3GNGA 5GAN7 3H6ZA 1R77A 1TUCA 2MAMA 4M75A 1VQ5A 1PWTA 4C8QD 2QQBA 2L0AA 1VQ5Q 3UT1A 5FU6B 1JJ2A 4RMOA 3JB9H 2SEMA 1M9SA 4XU1A 3HL8A 2ZPEB 3PVQA 2EGCA 3DB4A 2LCCA 3C95A 1XJWB 2RHIA 1UJYA 2P0QA 1I1JA 4C0FA 3M56A 2HZYA 1WA7A 1HK9A 4OMOA 2EVRA 2X3WD 4J83A 2R5MA 4M75C 2QA4T 3BDUA 2EYWA 5DM7R 1CSKA 2KDSA 2CH4W 4C0DC 2GTJA 2JMAA 3V7SA 2IPOB 5CK9A 3VU3C 2AZVA 4JRPA 4K11A 3OQ5A 4N0AC 1IXDA 2KSSA 1T3LA 2YRDA 4FU6A 4DBFA 2P84A 1YJWA 2QQAA 4JZ4A 4N4IA 2YRCA 2VYTA 2OAWA 2EYYA 3I55T 1KIKA 4FYYB 3V8KA 1RLQC 4OMLA 2DTIA 4C5IA 5L23A 1I5OB 1Y96A 1NLPC 1U1TA 2G6FX 2QTXA 1VQ8T 4ATOA 3ZL7C 1D1CA 2XMFA 2JTFA 1AWWA 3HFNA 1JJ2S 5I22A 3EG3A 4BI4A 1ZA2B 3H0HA 4Z89A 4FL6A 3JB9G 3JRZA 4N0AA 3CPWS 4OB1B 2V8IA 2ED0A 2F2VA 2HCKA 2XHCA 2ZGWA 1WYXA 5GAOq 5CKEA 5GMKl 1X6GA 1NZ9A 1FXXA 2DL8A 3OW2P 1ZBXA 1QCOA 1T0JA 2CUDA 2E64A 2DL5A 4MDXA 2DBMA 1VQ4T 2DK3A 3FJ5A 1F1BB 1KC8C 3CCQA 3NTIA 4C5HA 1CKBA 4NOYA 1HJDA 1GCPA 4A63B 3M0UA 3OYBA 3QZ5B 2J06A 3X25B 1W70A 2PVGB 5IH2A 1RAEB 4EPCA 2H8HA 2GQIA 2X9HA 2M51A 2Y4YA 3OYLA 1ZX6A 1OULA 1UUEA 2DTHA 3SWNB 1S1NA 3A8LB 4M7DD 3VRYA 4QT7A 1M1KU 1M90U 4HVVA 3QJ6A 4E47A 5KYXA 1QW1A 2JS0A 3QYGB 3JAME 1VQ7Q 5IAYA 5LL6S 2E12A 2ZPFB 1UE9A 1UTIA 2R5AA 4PJJA 4RTYA 4MMLA 1FX7A 2K2VA 1OZ3A 5D6WA 3OW2A 3CMEQ 3CCMA 1HSQA 1JU5C 4JS4A 1ACMB 5ECAA 4BY6C 1SHGA 1Q86R 2AT1B 1IRXA 2K5IA 4M78G 1I07A 1BYMA 4C0GA 1D0XA 2QXFA 4PJNA 1UDLA 1Q82C 3I55Q 3BFMA 3CCUT 3L2WA 1EFNA 2KVQG 1VQ7T 2QQSA 2M16A 3LGLA 1VQ8A 1FWZA 1HXDA 2ROLA 2VC8A 3OA6A 1N27A 5GANj 3L1AA 2LCLA 1XQHA 3P8HA 4R56A 2QA4Q 2NYSA 1VYTA 2XDPA 1QVGP 3VS2A 2AIRB 2BE9B 2DPPB 2WSCE 2FEIA 4PJOA 1NJIR 2DJQA 3FDRA 4C92F 2DMOA 2W0ZA 4Z8AA 1C6VX 4BE2A 1YHQQ 1YITT 1KSWA 1VQKA 2C0IA 4ZGJB 1VYUA 2OTLQ 3E9FA 1YNZA 4KGZB 3D7SB 1RAIB 1AVZC 3CCEQ 1QLYA 4J7IA 2KXDA 3GF5A 3TSWA 3M0RA 3VRZA 1YJNQ 1VOMA 3EH1A 1QKXA 4DEYA 4DBQA 1RI0A 3J81E 3VJPA 4LDXA 3ER0A 3EGXA 1ABOA 4LDVA 2MWOA 2KRMA 2E70A 4JRQA 3Q1JA 4DBRA 1G3YA 2DO3A 5GMKj 1M3BA 2AKLA 2P0KA 3CCET 3LLRA 3SEMA 1ABQA 3QXEB 1E6GA 3QUIA 1Y71A 3URGA 3CC2A 3EFSA 2LJ1A 1QVGS 2PU9B 2MYSA 3CPWP 5GANd 2D9TA 2V26A 1X2KA 2K6DA 4E7KA 2DXUA 2LQKA 3HSBA 2DIQA 5KYNA 3VUBA 2EBPA 3CCMT 1U5SA 1O9SA 2D8JA 1VQNQ 3NFCA 2FHDA 1M1FA 4DBHA 2L3QA 4M7AF 1N9RA 4YTLA 1W4SA 2QG9B 1H8KA 5FWBA 1GXIE 5KE2A 5I21A 3NPFA 3A8HB 3L2QA 4RTTA 2CUBA 1M3CA 1WQ7A 1NG2A 1K9AA 1R0CB 4XU0A 2X4XA 2CP7A 3L2VA 1U8RA 3R6NA 2JXBA 4GBQA 5CR2A 1QMCA 2J6KA 1D09B 2O4XB 5I2SA 4CC3A 3MP1A 3AT1B 2RHXA 2L3RA 4A54A 1FMVA 4RTUA 3I56T 3CMET 1W2BA 1FMWA 5DLOA 3CCQT 1N9SA 3E2UA 4OB2B 1WZOA 4ELYC 4RCBA 1K76A 2DYIA 2D6FA 4FT4A 2CP6A 1NJIU 3JB9D 2RJEA 4XAXB 1PKTA 4XTUA 1LPLA 4PFPA 2MK5A 1V76A 4KT0E 5LJ3d 4RUGA 3VS5A 1ZSZA 1Y0MA 3JCMP 4GY5A 4PNOA 2O2OA 3CXCA 3MEVA 4ORZA 1WXUA 3J80E 2KE9A 4BB7A 4F7UE 4CRIA 2E5KA 2BTTA 1SF9A 4KULA 1YJ9T 2ENMA 2E3HA 3HPWA 3HHTB 1YCYA 2KR3A 1WXBA 2CREA 3JCMJ 4M75E 1RLPC 3QZ9B 4FM4B 3VYGA 3RNJA 2PZ1A 2QEXT 4XU3A 3GBQA 3I5RA 4DEXA 2XDBA 2RJCA 3TREA 2CZ0B 4HCZA 2CP2A 4OB3B 1YI2A 5GAOm 2HSEB 3MCAB 3THKA 4E7LA 1WDXA 1VQPA 3HTRA 2K3BA 4PJLA 4C0ZA 3G6EQ 1WLPB 4E7IA 3PIOA 2LRQA 3UATA 4M77A 4LNPA 4PJOG 3VS4A 5A0LA 2DM1A 1PC0A 4E7ZA 2CT3A 2CH4A 2RJFA 4LUEA 3WVDB 1JRIA 3R6OA 4M77E 2JNGA 4PJOC 1MV0B 4LUDA 3UA6A 3NHNA 4OMPA 4C8QF 4J8OA 4CI0C 4KBMB 2NUTB 1UGRB 3RDVA 2E6ZA 1B34B 3JCMV 2LJ0A 2EKOA 2KNBB 1YFNA 1IO6A 2VVKA 4RTVA 4BI3A 4PJOB 5LJ3h 2ZZDA 4Q5WA 4JLGA 2PQWA 2GFAA 1WHKA 3VS1A 2DJZA 4M75B 4M77C 4PJOE 1ZUKA 1BI3A 3M0QA 2I2LA 5IXFA 1M90C 2YWWA 1WI7A 4FYWB 4HVWA 1QCNA 2LVMA 2RQRA 5GJWB 3OYEA 4OGEA 1M8MA 1NEBA 1XTDA 4RKUE 4F04B 4M7DF 4IUPA 2FPDA 4R55A 1WPYA 3OMCA 3MEWA 4JJCA 3EG1A 3EHQA 2M0OA 5KCHA 3O8VA 4E2FB 2KMTA 4RTXA 1W6XA 3BW1A 1VQOQ 2V8JA 2KGTA 1QKWA 5M9OA 3RERA 4QQGA 2BZ8A 1AHJB 4AMCA 5GJVB 5GAOr 1QQJA 4XTWA 1N8RC 3EG2A 5CQXA 2VGNA 3QG1A 2JVVA 3M58A 2LTOA 2A7YA 4DA4A 1YITQ 1ZUYA 2GF7A 3H9NA 4A4HA 4M4ZA 3E9GA 2VUBA 1K9MR 1Q81C 4BY6B 2QASA 5AYFA 3MKDA 2KROA 1LCKA 1NLOC 4C92E 3CC2T 4OB0B 4J9HA 3M54A 4BACA 2K5LA 1VQ4Q 3C12A 1SRLA 5KCOA 2LX9A 3OYAA 2VKNA 2KYMA 4JUVA 2F5TX 1VA7A 1PD0A 3DLLA 3CC4A 3J7AF 1M90R 2HQEA 5D7UA 2L8DA 2PNIA 4FYXB 1S72Q 3BDLA 3CCMQ 2PUOB 3BE3A 1BKBA 3H8ZA 1WHHA 3M57A 2K3YA 1K0XA 4N4GA 1KG1A 2DETA 3JCMf 3RIRA 2CGHA 4ZNXA 5LJ3f 1G3SA 3CCLA 1W1FA 5GMKm 4AT1B 1N6AA 2VGMA 4A4EA 5LJ5f 1I0CA 4FIBA 1U3OA 1VQLA 2JOYA 2H3JA 3FEOA 2E3IA 1G2BA 3M0PA 3OBYA 2EQMA 1RAFB 1XOVA 2YRVA 2VXFA 3M5AA 3PIPA 1KHIA 2RQWA 4JJNK 2MMPA 2FB7A 1RACB 1VQ5T 1VQ9Q 4OGCA 1D3BA 3V7RA 2ZPGB 1PCXA 2RM4A 4BUGA 3CC7Q 1K0SA 2SRCA 2XD0A 3O5ZA 5GANf 3CCUA 3OYHA 2RN8A 3CCSQ 2FYKA 1ZSZB 4FW1A 1OV3A 2X35A 2LX7A 4DQ2A 5CKBA 1M2OA 4MZPA 3QJYA 1M5Q1 4J9DA 2GFUA 1NYGA 1Y07A 2D0NA 5KYWA 2CP5A 2MOXA 3TEEA 3VKIA 3VS3A 3HKSA 6AT1B 1UFFA 1OI1A 3OYIA 3VV0A 1H3ZA 2OX7A 2CZ1B 2L3SA 2M1HA 2J6FA 2OJ2A 1BI2A 2DX1A 4CC7A 4DOWA 2RI3A 3I56Q 1N5ZA 4ZGEB 2KXCA 2QDYB 1QVFS 4A53A 5GAMj 1ZBJA 2E6NA 1YI2T 3JCMX 2RD1A 4FCYA 3VYHB 3JCMc 1QP3A 3HFOA 1H641 1BK2A 2OI3A 3TVTA 9ATCB 1WJSA 1X6OA 3S3MA 3OYFA 4EDUA 2EJGA 4E7HA 2V1RA 4C92B 2YUNA 2X3XD 2KYBA 5EG2A 5GAMh 1SRMA 3G6EA 4FT2A 4D8KA 3FB9A 1BBZA 1Q7YR 4M77G 3I55A 2F5KA 3JCMg 4HCBA 3QSUA 5LJ3g 3EHRA 5FROA 1BU1A 2RH2A 2P4TA 3QWYA 3ASKA 1UG1A 2F2XA 1VQ8Q 4GLMA 4OMMA 1JO8A 2KQWA 3WVEB 1VIEA 4DOVA 1KD1C 3OYKA 4IKFA 3EFRA 2RPNA 2O31A 4P5NA 4EMKB 4JS5A 3CCLT 2ECZA 2RF0A 4PKCC 1VIFA 3M55A 4L59A 3CBPA 2LQ8A 3M59A 2RQVA 5IXBA 3FIFA 4M75F 3G4ST 2NUZA 3EG9B 3X26B 2EJFA 2CP0A 2EQJA 2BKDN 3RBBB 1YWOA 3KFVA 2B86A 1JXOA 2Y4XA 2YDLA 2HL3A 4QVCA 4M78E 3RUXA 1AZEA 3WXMB 3RKXA 2EGEA 2L2PA 3L42A 1OX9A 5HCKA 4J9CA 1K4US 4JZ3A 4IUVA 2L5QA 4J7FA 4RTWA 2DXTA 1YJNA 5J26A 5IT9E 2MF2A 1CKAA 4BDYA 2DVJA 3EGXB 5CO7A 3QBYA 2DF6A 1TTHB 3OYDA 4TVRA 4C5GA 5J3BA 4M77F 2GNCA 1M27C 4PK4A 3CCSA 1AZGB 3OS0A 4JJBA 3UPUA 4AFSC 1X69A 1SG5A 3G71Q 1TOVA 2YLBA 3M0TA 1SSHA 1SSFA 2RI5A 2LMJA 2JM9A 4NS5A 4PFOA 4B6MA 1K9MU 2HQHA 4HCCA 1PHTA 4C8QC 2P0PA 1VQMT 2O9VA 8AT1B 2V1QA 3JCMd 2QQ9A 1OX8A 3OMGA 2EKHA 1M2VA 3A8MB 3VUZA 4B9WA 2MCNA 3INZA 1MUZA 3M0SA 1KD1R 2ROTA 1YJNT 1YP5A 4ESRA 2KY9A 1UECA 2ZCFB 2CDTA 3DLMA 3H41A 1WHJA 3CPFA 3I5SA 1TUDA 5LJ5e 5KE3A 4QW2A 3FC3A 4BDZA 3CCLQ 1K73C 1WIEA 1K8AR 1BB9A 1GFCA 2J7IA 2DZCA 2A0FB 2QTVA 3X20B 3TCJA 1G8XA 2YLCA 1SKUB 4M75D 3ZEHA 2LP5A 3G7ZA 1GCQC 4HCKA 3RKWA 1OZ2A 2A08A 1Z9ZA 1VQLT 1RADB 2NWMA 4X34A 1M8VA 3TU4K 1VYVA 4J9EA 1U06A 4L5GA 2A37A 3P8DA 2JUFA 5CKDA 1D3BB 2YHTA 3A8GB 1Q82R 4AG2C 1ZQ1A 2LNVA 4KGVB 3CCVT 1TH7A 4X9DA 2KRSA 3QKJA 2ESWA 5AT1B 5D6YA 4UC4A 2GBQA 2KEAA 2MPXC 2PTKA 3A98A 2CYZB 1VQKQ 2WACA 2RQTA 3EFOA 2DEQA 1OU8A 3QPHA 4BE1A 3FJPA 2P4RA 2QQRA 3HP9A 2LZ6B 2Z0WA 3JB9I 3QIIA 1VQ7A 2KT1A 1HD3A 3OSVA 2HMAA 4BI8B 4MMKA 1W2BS 2V8KA 3CCJA 2H3EB 4N4HA 3CCJQ 2O01E 4E7JA 1WX6A 2XU8A 1M1KR 1BCMA 5IHNA 1E6HA 1WNLA 2RA2A 2M02A 3G4SQ 2J05A 2DL7A 4J9IA 1IB8A 1QWFA 4JJDA 1UJ0A 3CMEA 1G83A 3OBWA 4HKEA 3C0CA 3G6ET 4E7SA 1VQ6Q 1Y7XA 4RG8A 1VQMA 3QDRB 2ATCB 2XKOC 1YITA 2BE7D 4M7AD 4FSSA 4M77B 2K4YA 4CC4B 2EPDA 1UHFA 1UGQB 2XG8D 2FO0A 2CSQA 4Y91A 4ANJA 4C92C 1M30A 5FU7C 1MMDA 1ZSGA 3MP8A 2NUTA 3TSZA 1T0HA 2ZPHB 4FW2A 2HBPA 4J6XA 3OYNA 5EC7A 1AWOA 1IGQA 1S72T 1K1ZA 2QA4A 2E41A 1KD1U 3OYYA 3S6WA 5GAN5 1YHQA 5FU7B 5LJ3e 1X2QA 4F7UF 1IHWA 5C6SA 2FG0A 5DY9A 1QCFA 1RABB 4M7DC 2E1HA 2ABLA 3EG9A 4IUTA 2JT4A 3OYJA 5GAN3 4LD6A 1GRIA 4LDWA 1AWJA 3CMAQ 2J6OA 2WSEE 2YT6A 4LXCA 1JXMA 4EMKC 3RKYA 2JJ9A 1K9MC 3LYIA 2OAUA 4ME7A 5FWCA 1LNXA 1UHCA 3LH0A 4E6RA 2XK0A 2GGRA 4F14A 5GMKe 3A8OB 4XK8E 2RI2A 5FW9A 1YBYA 3MP6A 4ZN1A 1PSEA 2KK4A 5GAOn 3OYGA 1N8RR 1YIJT 1RI9A 4F7UA 3REBB 4Y92A 5L8RE 4KGXB 1FMKA 2DZ9A 3PT9A 2DNUA 5CCAA 1Q95G 2RHYA 2K9GA 1U1SA 1WXTA 2QDLA 1YWPA 2VXEA 2A28A 1RL2A 3CCST 3L2UA 3CXCP 1C1AA 2HD0A 4C8QE 5HY6A 4HXJA 4QQ6A 2QGFB 3M53A 5IHKA 1JJ2P 3LX7A 4A4FA 2D0QB 5KH6A 1YJWQ 3CC2Q 4V2SA 3OB9A 2XIDA 2QEXA 2E4HA 4C5EA 3A5ZB 1K8AU 1X75C 2AZSA 1VQ6T 2X4YA 2QI2A 2DXCA 5I2MA 2LT1A 1KC8U 2LC4A 3G71T 2EYXA 1VQ4A 1YJWT 3VS7A 4PJOF 4C0DB 2DD5A 4ZTJA 4M7DG 3I56A 1TU0B 1UEBA 3C4SA 3T9NA 4QQDA 2QK0A 3E19A 4JDSA 4HVUA 1I5LA 1JB0E 5KYUA 2FVUA 8ATCB 4KUDK 1JBMA 4AFQC 5GAN8 5CIUA 4B9XA 1OPKA 3CD6A 2KAFA 1B3QA 4XTZA 1VQNT 3PFSA 1NBEB 1H3HA 1NYFA 1GBRA 3HRSA 2K2MA 1UGPB 4KRTA 3LWHA 2CKKA 1ZSZC 1D0ZA 2DKGA 1MNEA 2C0TA 2CZ6B 2K57A 2DXBA 4M7DA 1D1AA 2COZA 5D6XA 3SFMA 4JRKA 1IREB 4LE9A 2EJ9A 4M78A 1MMGA 2YXYA 2KI7A 1BCOA 3UWNA 1KK7A 1QVFP 1WHLA 3G1JA 5A2QE 1ZHIA 2DILA 2BUDA 2HDAA 2LCSA 2E10A 2EQIA 2DERA 2EFIA 1OYXA 1ZUUA 5GANe 3LH5A 2AKKA 2OTLA 3CCVA 2RO0A 2X4JA 3EFOB 2HAXA 1MGQA 1VQPT 1GBQA 1RAAB 2JTMA 4GLKA 4M75G 5KYWB 5GAMd 1PKSA 2DEUA 1TSFA 4MZTA 1H92A 2AHJB 2XI9A 4M7AG 4C92D 3AHUA 1BI0A 4WF2A 3CCJT 1BIAA 1OEBA 1I8FA 3LW5E 1N8RU 1D0YA 1ZLMA 1M1KC 2RJDA 4M7AA 1GCQA 3HRTA 5DLQE 2Y90A 2ZPBB 3NTKA 3G4SA 5CKHA 3JCMh 4PL6A 1G3TA 3JB9J 2EIFA 3PMTA 2DRKA 4II1A 1WJQA 2HBWA 1VUBA 1VQKT 4NL2A 4C92A 2HL5C 1VQ6A 1QVPA 4F17A 2MI6A 2YUPA 3G71A 5LJ3j 2VB6A 3JCMW 1ZA1B 5IHIA 5LJ5j 3EGUA 4F16A 1LJOA 1DJ7B 3OYMA 2IIMA 4HT9A 3VS0A 2EWNA 1A0NB 5GAN6 1LOJA 4PJMA 1Q86C 2DLPA 4WTOB 1ARKA 4OMNA 3ULRB 2KT8A 1KQ1A 1VQNA 3F70A 3RMSA 5GANh 1WHMA 3V7CA 2MIOA 2HQXA 3KXTA 2M0YA 1Y96B 3EG0A 3JSCA 1PM3A 1SHFA 3S3NA 1YHQT 2F69A 4EMKA 1W2BP 2IVWA 1UGSB 1PRMC 3CD6Q 3EGDB 4EMGA 1Z9QA 5CKFA 4LN2A 3UDCA 5GMKi 1S72A 1TWBA 3BY7A 2GCXA 5I11A 3CMAA 1X43A 1K73R 2G3RA 3UA7A 3JV3A 3SWNC 3MEUA 3REAB 3M9QA 3H0IA 3GP8A 1TG0A 4ZTFA 2AK5A 4Y28E 1WGSA 3GLXA 4VUBA 5FRNA 3DKMA 5GAOl 2NUPA 2DTOA 1J3TA 4F7UB 1KC8R 1X6BA 3QHSA 2JN0A 4C8QB 5GAMf 4OF1A 4X1VA 1VQOA 2LDMA 2FZCB 3CC7T 2FRWA 2B8AA 1YIJA 4XTYA 3CC4T 2EAYA 4PJOD 1OQKA 2HNIA 2K3XA 3ZFJA 3CBOA 2EQUA 3PTAA 3CCVQ 1B07A 4XQ3A 4RTZA 4JLIA 3QYHB 4J6YA 2JTEA 2QEXQ 1IZ6A 1RAGB 2X4WA 2A36A 2COWA 4J9GA 1O75A 4KH0B 3H0FA 2XICA 3IQLA 1QVFA 4FYVB 5C0MA 1AT1B 1X01A 5KYXB 1RUWA 2C0OA 2EYQA 3EH2A 4EIKA 4ELZC 1NJIC 4AG1C 2A3LA 3GIBA 1MHNA 2KBTA 4M77D 3CCRA 1Q86U 2EQKA 2BZXA 3M4YA 5KYUB 1M2VB 4PFZA 1WJRA 2K79A 3CCRQ 2PVDB 3CXCS 1AEYA 2CZ7B 2RNAA 3NMZC 4M78F 3PVLA 1YN8A 2DAQA 3GPLA 2ZAEA 1HYOA 1SPKA 1NPRA 1SEMA 1Q81U 3OS2A 1YI2Q 1Y57A 4M78C 4QVZA 4IIMA 4J9BA 3QDFA 5KYYA 3S3OA 3CPWA 2DFUA 3PMIA 1YJ9A 1XNIA 3GNFB 2L3PA 3HRUA 5GMKh 4M7DB 4MZMA 1PSFA 3MJXA 2HKQB 4PLIA 1KQSP 2L89A 1VQLQ 4M78B 1MNDA 5LJ5g 1UGVA 1Q7YU 2WSFE 2K5FA 2PUKB 4XU2A 4XTVA 4J6WA 4PLLA 3ZBDA 3JCMQ 3VS6A 1QP2A 5GANg 2FZGB 2BIVA 1AWXA 1OOTA 4FSXA 1WFWA 2E65A 1RAHB 1M1GA 2E5QA 2RMOA 1AD5A 3LGFA 3DB3A 5A0DA 2R58A 4RCCA 1MMNA 3CCUQ 2NLUA 1Q82U 4NL3A 3U23A 2JMCA 4OP0A 1KQSA 4M7AE 1G5VA 1VQ9T 3RMQA 1K8AC 4RG2A 1Q7YC 4M7AC 2JM8A 3PGGA 3MPUB 2FPEA 2F1LA 4ZN3A 1VQOT 2OTLT 2BZYA 4LDUA 3JCMe 4O5VA 3E1SA 3OS5A 4J9FA 4KH1B 1BI1A 2VWFA 1PD1A 1V1CA 2C06A 3QO3A 5A0GA 3KUFA 4O6JA 2FRYA 2ZPIB 4M7AB 2VASA 5J39A 4R0KA 3TQ7P 5HK0A 5GAOp 2FL7A 2DRMA 2FPFA 3SB2A 2YUQA 5FRMA 4D6WA 4J5YA 4C8QG 3KBGA 2VV5A 1UB4A 3X24B 3N5BB 1AOJA 2EYZA 1EZZB 1VQPQ 2RB6A 1KQSS 3MEAA 5FU6C 4OVAA 4LD9K 4WCIA 1PNJA 1E7OA 4MDWA 3C94A 3CBMA 1R0BG 2QYZA 4C92G 4BE0A 3FRNA 3L2ZA 4IURA 3RESA 3A1PA 2O9SA 3P8BB 2LNHB 4F7UG 2DIGA 3SD4A 4XTXA 2OTJQ 1KQ2A 4QKUA 3CC4Q 1GFDA 2X51A 2OTJA 5CVIA 1KHCA 2KRNA 1T3SA 1R8OB 1C0MA 1MV3A
chains in the Genus database with same CATH topology
1Y07A 1VQ4A 1YJWT 1VQKA 3TEEA 4ZGJB 3MHXA 3VKIA 1EIFA 1I81A 3HKSA 4PJOF 2DD5A 4C0DB 4ZTJA 3I56A 4M7DG 1OI1A 1UEBA 3C4SA 3T9NA 3OYIA 4QQDA 3E9FA 3VV0A 3E19A 4JDSA 1H3ZA 4JRIA 5HKCA 2CZ1B 1I5LA 2M1HA 1JB0E 2FVUA 4KUDK 1BI2A 1M4ZA 1JBMA 5GAN8 5CIUA 4B9XA 4DOWA 2RI3A 4L6V5 3CD6A 2KAFA 4J7IA 4ZGEB 4XTZA 2QDYB 1VQNT 1QVFS 4Z02A 3PFSA 2IG0A 3GF5A 4LDYA 2O4XA 3OS1A 4A53A 3V8JA 5GAMj 3X28B 3CMAT 2E6NA 3HRSA 3CCEA 1YI2T 3JCMX 2RD1A 3L2RA 3VYHB 3JCMc 1QP3A 3V8LA 4X9CA 3HFOA 1H641 1NE8A 1UGPB 1WJSA 1X6OA 3LWHA 3S3MA 2CKKA 3OYFA 4EDUA 2EJGA 4E7HA 4C92B 1RI0A 3J81E 3VJPA 2DKGA 4LDXA 2CZ6B 2K57A 2PVOB 3ER0A 4LDVA 5EG2A 5GAMh 2MWOA 3NTHA 3G6EA 4FT2A 3OYCA 2E70A 2DXBA 5LJ5h 3FB9A 4C8QA 4JRQA 4M7DA 4M77G 3CD6T 3Q1JA 5D6XA 3SDZA 2F5KA 3SFMA 3I55A 4JRKA 1IREB 3JCMg 4HCBA 1VQ9A 2EJ9A 3QSUA 1G3YA 5LJ3g 4M78A 2DO3A 5FROA 5GMKj 2RH2A 2P4TA 3UWNA 2P0KA 3CCET 3LLRA 3ASKA 5IN1A 3OSSC 4OMFB 3QXEB 5LJ5d 3QUIA 1Y71A 3URGA 2DD4A 5A2QE 3EFSA 3CC2A 1ZHIA 2OTJT 3OY9A 4QVDA 1QVGS 2RK1A 2KQWA 2PU9B 3CC7A 5GANd 3WVEB 2RHZA 2BUDA 1VIEA 2D9TA 4DOVA 4EMHA 4E7KA 2DXUA 1KD1C 2LQKA 4M78D 3OYKA 3HSBA 2DIQA 2LT4A 3EFRA 5GAMg 2E10A 4IKFA 4HA8A 3VUBA 3OW2S 4BD3A 3CCMT 3JCMb 2R57A 1O9SA 4P5NA 2EFIA 4EMKB 1OYXA 1BIBA 4JS5A 3CCLT 4PKCC 1WQWA 1VIFA 3M55A 3ME9A 4L59A 3SWNA 3CBPA 5GANe 3CCVA 2OTLA 2LQ8A 2FHDA 1M1FA 3NFCA 4M7AF 1N9RA 2RO0A 2X4JA 4YTLA 5CQYA 2HAXA 3JB9F 3M59A 1MGQA 1W4SA 3FLGA 1VQPT 3FIFA 2RHUA 4M75F 1GXIE 3G4ST 4ZGDB 5KE2A 2JTMA 4GLKA 4M75G 5I21A 5GAMd 3X26B 2EJFA 3A8HB 4MZTA 2EQJA 2AHJB 3L2QA 2BKDN 2XI9A 5GAN2 1WQ7A 4M7AG 4C92D 4XU0A 2X4XA 1BI0A 4WF2A 3CCJT 3AHUA 1BIAA 2M9UA 2Y4XA 3MO8A 3L2VA 1I8FA 3LW5E 4A4KA 1N8RU 1U8RA 4QVCA 4M78E 1M1KC 3CCRT 3RUXA 3GOXA 5FLXE 3WXMB 2RJDA 3RKXA 1QVGA 4M7AA 5CR2A 3L42A 4M7DE 3HRTA 5DLQE 1G3WA 2Y90A 2O4XB 2CS7A 2DVEA 5GAMe 5I2SA 2ZPBB 2XDDA 2RK2A 3NTKA 5CKHA 1P92A 3JCMh 3G4SA 4IUVA 2L5QA 4J7FA 2DXTA 1I4K1 4PL6A 1YJNA 1G3TA 3MP1A 5J26A 3JB9J 2EIFA 3PMTA 5GAN4 5IT9E 4II1A 1WJQA 2RHXA 2L3RA 2MF2A 1VUBA 4KUIA 1VQKT 4BDYA 4NL2A 3M4GA 4A54A 4C92A 1VQ6A 1K73U 3I56T 3CMET 5CO7A 1QVPA 3QBYA 2MI6A 1W2BA 2GQVA 3G71A 5DLOA 4TVRA 4C5GA 3OYDA 5LJ3j 5J3BA 4IUQA 3JCMW 4M77F 1N9SA 3CCQT 3LWIA 4OB2B 3CCSA 5LJ5j 4ELYC 4RCBA 3OS0A 3CEYA 2D6FA 1LJOA 3EAEA 3META 4FT4A 1DJ7B 2JZ2A 4A4GA 5CAIA 2RJEA 5HK3A 3OYMA 4IUUA 4XAXB 2EWNA 3JB9D 2MWPA 1NPPA 1KQSA 1B34A 4M7AE 5GAN6 1G5VA 1LOJA 4XTUA 1Q86C 2YLBA 1V29B 1KQ1A 1VQNA 3F70A 3RMSA 5GANh 3V7CA 1SSFA 2RI5A 2HQXA 4KT0E 5LJ3d 3UPUA 4HT8A 3PNWC 3JCMP 3KXTA 3GNGA 4NS5A 5GAN7 1Y96B 1K9MU 4HCCA 3H6ZA 3JSCA 4GY5A 4PNOA 3S3NA 1YHQT 3CXCA 3MEVA 4C8QC 2P0PA 2F69A 2MAMA 4EMKA 4M75A 1VQMT 3J80E 1VQ5A 4BB7A 3JCMd 4F7UE 2IVWA 2QQ9A 1UGSB 3OMGA 4C8QD 4CRIA 2QQBA 4KULA 1YJ9T 3UT1A 4EMGA 5FU6B 1JJ2A 3HPWA 4RMOA 3HHTB 1YCYA 3JB9H 4HT9A 5CKFA 3A8MB 3UDCA 3VUZA 4B9WA 1M9SA 5GMKi 3JCMJ 3BY7A 1S72A 2GCXA 4M75E 4XU1A 3INZA 3HL8A 2ZPEB 3QZ9B 3CMAA 4FM4B 3VYGA 3DB4A 2QEXT 4XU3A 1YJNT 2LCCA 3C95A 2G3RA 2KY9A 2XDBA 3SWNC 3MEUA 2ZCFB 2RJCA 3DLMA 3TREA 2CZ0B 3CPFA 3M9QA 2RHIA 3GP8A 4ZTFA 4HCZA 2P0QA 4Y28E 4C0FA 3M56A 5LJ5e 1WGSA 5KE3A 4OB3B 1YI2A 4QW2A 5GAOm 3GLXA 4VUBA 3FC3A 4BDZA 5FRNA 1HK9A 3DKMA 1K73C 3MCAB 5GAOl 2DTOA 4J83A 4E7LA 2DZCA 4F7UB 1VQPA 2R5MA 4C0ZA 4M75C 3X20B 3TCJA 2QA4T 4E7IA 3PIOA 2LRQA 3QHSA 2JN0A 4C8QB 3BDUA 5GAMf 2YLCA 4OF1A 4M75D 4M77A 4PJOG 5DM7R 3ZEHA 2KDSA 1VQOA 4C0DC 2LDMA 3G7ZA 3CC7T 5A0LA 3RKWA 1OZ2A 2B8AA 1YIJA 1VQLT 4X34A 4XTYA 3V7SA 3CC4T 3TU4K 1M8VA 5CK9A 2EAYA 3VU3C 4JRPA 4PJOD 4L5GA 2HNIA 3OQ5A 2RJFA 2K3XA 2KSSA 4N0AC 3P8DA 3WVDB 3ZFJA 1JRIA 2JUFA 3R6OA 2JNGA 4FU6A 4M77E 5CKDA 4PJOC 3CBOA 1D3BB 2YHTA 4C8QF 3A8GB 1YJWA 2QQAA 2EQUA 4J8OA 4N4IA 1ZQ1A 4CI0C 4KBMB 2LNVA 3PTAA 1UGRB 2E6ZA 1B34B 4XQ3A 2VYTA 3CCVT 1TH7A 4X9DA 3JCMV 3QKJA 2EKOA 4JLIA 3I55T 3QYHB 4J6YA 5D6YA 1IZ6A 4BI3A 4UC4A 3V8KA 2X4WA 4PJOB 2DTIA 1O75A 4C5IA 2XICA 5LJ3h 2CYZB 2ZZDA 1Y96A 1QVFA 4Q5WA 2WACA 1U1TA 4JLGA 2DEQA 3QPHA 2PQWA 2GFAA 3FJPA 4BE1A 2QTXA 1VQ8T 5C0MA 4ATOA 1X01A 2DJZA 4M75B 2EYQA 2JTFA 4M77C 4ELZC 1NJIC 4PJOE 2A3LA 2QQRA 3GIBA 3HP9A 3HFNA 1JJ2S 1BI3A 1MHNA 3JB9I 3QIIA 4M77D 4BI4A 3CCRA 1VQ7A 1Q86U 2I2LA 2EQKA 3M4YA 1M90C 4FL6A 3OSVA 3JB9G 1WJRA 3JRZA 4N0AA 4BI8B 4MMKA 3CPWS 2PVDB 3CXCS 1W2BS 2CZ7B 2V8KA 4OB1B 2LVMA 3CCJA 3OYEA 4N4HA 2V8IA 4M78F 4OGEA 2DAQA 2O01E 3GPLA 4E7JA 1XTDA 4RKUE 2XHCA 2XU8A 4M7DF 4IUPA 4R55A 1WPYA 1NPRA 3OMCA 3MEWA 2ZGWA 1Q81U 3OS2A 2M0OA 4M78C 3O8VA 1WNLA 2RA2A 5KCHA 5GAOq 4QVZA 2KMTA 5CKEA 5GMKl 3BW1A 3CMEA 1NZ9A 1FXXA 3S3OA 2V8JA 3CPWA 3OBWA 4HKEA 5M9OA 3G6ET 3PMIA 1YJ9A 3RERA 1XNIA 3GNFB 4QQGA 1AHJB 1ZBXA 3HRUA 5GAOr 5GMKh 4M7DB 1Y7XA 4MZMA 4RG8A 4XTWA 1VQMA 3QDRB 1N8RC 5CQXA 1PSFA 2XKOC 4PLIA 1YITA 4M7AD 2E64A 2L89A 4MDXA 4M78B 2VGNA 3QG1A 1VQ4T 2JVVA 2DK3A 4M77B 5LJ5g 1Q7YU 2WSFE 2K5FA 1KC8C 3CCQA 2PUKB 4XU2A 3M58A 2K4YA 2LTOA 4XTVA 4J6WA 2A7YA 1UGQB 4PLLA 2XG8D 3ZBDA 4DA4A 3NTIA 4Y91A 3JCMQ 2GF7A 4C5HA 4A4HA 4NOYA 4C92C 1QP2A 5GANg 3E9GA 2VUBA 1Q81C 2BIVA 5FU7C 4BY6B 3OYBA 3QZ5B 4FSXA 3X25B 2E65A 5AYFA 3MP8A 2PVGB 2ZPHB 4EPCA 4C92E 3CC2T 1M1GA 2E5QA 4OB0B 2HBPA 3M54A 4J6XA 3OYNA 2Y4YA 3LGFA 3OYLA 4BACA 3DB3A 2K5LA 5A0DA 2DTHA 2R58A 1S72T 4RCCA 2QA4A 2E41A 2NLUA 3SWNB 3OYYA 1Q82U 1KD1U 3S6WA 3C12A 5GAN5 4OP0A 5KCOA 5FU7B 4NL3A 1YHQA 2LX9A 3A8LB 3RMQA 5LJ3e 4RG2A 4F7UF 3OYAA 1VQ9T 1K8AC 4M7DD 1M1KU 5C6SA 1M90U 4JUVA 2F5TX 5DY9A 1Q7YC 3DLLA 3CC4A 3J7AF 4M7DC 2E1HA 3QJ6A 4M7AC 3PGGA 4E47A 4IUTA 1QW1A 3JAME 3QYGB 4ZN3A 1VQOT 2HQEA 2OTLT 3OYJA 5IAYA 5GAN3 4LDUA 2L8DA 4LD6A 4LDWA 3JCMe 2E12A 2ZPFB 4O5VA 2WSEE 3E1SA 3OS5A 5LL6S 3BDLA 2PUOB 2R5AA 4EMKC 3RKYA 1BI1A 3G71T 1K9MC 1BKBA 4MMLA 3LYIA 1FX7A 2OAUA 3H8ZA 4ME7A 1LNXA 2K2VA 3LH0A 2K3YA 3M57A 3QO3A 5A0GA 2C06A 1OZ3A 3KUFA 5D6WA 4O6JA 2XK0A 3OW2A 4N4GA 2ZPIB 4M7AB 5J39A 5HK0A 3CCMA 5GAOp 4JS4A 4BY6C 2FL7A 5GMKe 1KG1A 3A8OB 4XK8E 3RIRA 3JCMf 2CGHA 2RI2A 2K5IA 4M78G 5LJ3f 3SB2A 1G3SA 1YBYA 3MP6A 4ZN1A 3CCLA 1BYMA 5GMKm 5FRMA 1PSEA 4D6WA 2KK4A 4J5YA 4C0GA 1N6AA 2VGMA 2QXFA 4A4EA 4C8QG 5LJ5f 5GAOn 4FIBA 3OYGA 1YIJT 1VQLA 3KBGA 2JOYA 2VV5A 2H3JA 4F7UA 1UB4A 3FEOA 1Q82C 3X24B 5L8RE 3N5BB 2DZ9A 3BFMA 3CCUT 3PT9A 3OBYA 5CCAA 2RHYA 3L2WA 2EQMA 2KVQG 1VQ7T 2RB6A 1KQSS 1U1SA 1XOVA 3MEAA 4OVAA 2QQSA 5FU6C 4LD9K 2M16A 2YRVA 3LGLA 1VQ8A 1FWZA 2VXFA 2VXEA 3M5AA 1RL2A 3CCST 3PIPA 1KHIA 4JJNK 3L2UA 4MDWA 2MMPA 2FB7A 1HXDA 2VC8A 3OA6A 1N27A 1VQ5T 2HD0A 3C94A 3CBMA 4OGCA 1D3BA 3V7RA 4C92G 4C8QE 2ZPGB 5HY6A 2RM4A 4BUGA 4BE0A 3FRNA 4QQ6A 3M53A 5GANj 3L1AA 3LX7A 3L2ZA 2D0QB 2LCLA 4IURA 4A4FA 1XQHA 5KH6A 2XD0A 5GANf 3P8HA 3RESA 3P8BB 4R56A 3CCUA 3OYHA 4V2SA 2FYKA 3OB9A 2XDPA 4F7UG 2DIGA 2XIDA 3SD4A 1NJIU 2DPPB 2WSCE 4XTXA 2QEXA 4C5EA 1KQ2A 3A5ZB 4PJOA 1K8AU 2X35A 3FDRA 4C92F 4DQ2A 5CKBA 2OTJA 1X75C 1VQ6T 5CVIA 2X4YA 1KHCA 2QI2A 2DXCA 3QJYA 4MZPA 1M5Q1 5I2MA 2LT1A 1R8OB 4BE2A 1KC8U 1YITT 2GFUA 2LC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 A;  1YJW T;  1VQK A;  1EIF A;  3HKS A;  4ZTJ A;  3I56 A;  1OI1 A;  1UEB A;  3C4S A;  3OYI A;  4QQD A;  3E9F A;  1H3Z A;  2M1H A;  5CIU A;  4B9X A;  2RI3 A;  3CD6 A;  1VQN T;  1QVF S;  4Z02 A;  3PFS A;  2IG0 A;  2O4X A;  3OS1 A;  3CMA T;  2E6N A;  3CCE A;  1YI2 T;  1X6O A;  1WJS A;  3S3M A;  2CKK A;  3OYF A;  4EDU A;  4E7H A;  1RI0 A;  3J81 E;  3ER0 A;  2MWO A;  3G6E A;  3NTH A;  3OYC A;  2E70 A;  3CD6 T;  3Q1J A;  5D6X A;  3I55 A;  2F5K A;  1VQ9 A;  2DO3 A;  5FRO A;  3UWN A;  2P0K A;  3CCE T;  3LLR A;  3ASK A;  5IN1 A;  5A2Q E;  3CC2 A;  2OTJ T;  3OY9 A;  1QVG S;  3CC7 A;  2RHZ A;  2BUD A;  2D9T A;  4E7K A;  1KD1 C;  3OYK A;  2DIQ A;  4IKF A;  3OW2 S;  4BD3 A;  3CCM T;  2R57 A;  2EFI A;  1OYX A;  3CCL T;  3ME9 A;  4L59 A;  2OTL A;  3CCV A;  2LQ8 A;  2FHD A;  4YTL A;  2RO0 A;  1VQP T;  3FLG A;  2RHU A;  3G4S T;  5KE2 A;  3L2Q A;  2EQJ A;  2BKD N;  2X4X A;  3CCJ T;  3MO8 A;  3L2V A;  1N8R U;  1M1K C;  3CCR T;  3GOX A;  5FLX E;  2RJD A;  1QVG A;  3L42 A;  5DLQ E;  2O4X B;  3NTK A;  3G4S A;  4IUV A;  4PL6 A;  1YJN A;  5J26 A;  3MP1 A;  2EIF A;  3PMT A;  5IT9 E;  4II1 A;  1WJQ A;  2RHX A;  2L3R A;  1VQK T;  4BDY A;  1VQ6 A;  1K73 U;  3I56 T;  3CME T;  3QBY A;  2MI6 A;  1W2B A;  3G71 A;  3OYD A;  4TVR A;  4C5G A;  5J3B A;  4IUQ A;  3CCQ T;  3CCS A;  3OS0 A;  3CEY A;  3EAE A;  3MET A;  1NJI U;  2JZ2 A;  4A4G A;  3OYM A;  3L2R A;  2RJE A;  4IUU A;  2MWP A;  1NPP A;  1Q86 C;  1VQN A;  3F70 A;  1SSF A;  2RI5 A;  2HQX A;  3PNW C;  4NS5 A;  1K9M U;  3H6Z A;  4GY5 A;  3S3N A;  1YHQ T;  3CXC A;  3MEV A;  1VQM T;  1VQ5 A;  3J80 E;  4CRI A;  3OMG A;  1YJ9 T;  3UT1 A;  1JJ2 A;  1S72 A;  4B9W A;  3CMA A;  3DB4 A;  2QEX T;  1YJN T;  2LCC A;  2G3R A;  3MEU A;  2RJC A;  3TRE A;  3DLM A;  3CPF A;  3M9Q A;  2RHI A;  4ZTF A;  4HCZ A;  1WGS A;  5KE3 A;  1YI2 A;  4QW2 A;  3FC3 A;  4BDZ A;  5FRN A;  1K73 C;  4E7L A;  1VQP A;  2R5M A;  2QA4 T;  4E7I A;  3PIO A;  2LRQ A;  5DM7 R;  3ZEH A;  2KDS A;  1VQO A;  3CC7 T;  2LDM A;  1OZ2 A;  1YIJ A;  1VQL T;  2B8A A;  4X34 A;  3CC4 T;  3OQ5 A;  2RJF A;  2K3X A;  3P8D A;  2JUF A;  2JNG A;  4FU6 A;  1YJW A;  2EQU A;  4N4I A;  2E6Z A;  2VYT A;  3CCV T;  3QKJ A;  2EKO A;  3I55 T;  5D6Y A;  1IZ6 A;  4UC4 A;  2X4W A;  4C5I A;  1QVF A;  4Q5W A;  2WAC A;  2PQW A;  2GFA A;  4BE1 A;  1VQ8 T;  5C0M A;  2JTF A;  1NJI C;  2QQR A;  1JJ2 S;  1MHN A;  3QII A;  3CCR A;  1VQ7 A;  1Q86 U;  2EQK A;  1M90 C;  4FL6 A;  1WJR A;  3CPW S;  3CXC S;  1W2B S;  2LVM A;  3CCJ A;  3OYE A;  4N4H A;  2DAQ A;  4E7J A;  1XTD A;  2XHC A;  4IUP A;  3OMC A;  1NPR A;  1Q81 U;  3MEW A;  3OS2 A;  2M0O A;  5KCH A;  3O8V A;  4QVZ A;  3CME A;  1NZ9 A;  3S3O A;  3CPW A;  5M9O A;  3G6E T;  1YJ9 A;  3PMI A;  1XNI A;  4QQG A;  1N8R C;  1VQM A;  1YIT A;  4PLI A;  2L89 A;  1VQ4 T;  2JVV A;  1Q7Y U;  1KC8 C;  3CCQ A;  2LTO A;  4PLL A;  3NTI A;  2GF7 A;  4C5H A;  4A4H A;  3E9G A;  1Q81 C;  2BIV A;  3OYB A;  3MP8 A;  3CC2 T;  1M1G A;  2E5Q A;  3OYN A;  3LGF A;  3OYL A;  4BAC A;  3DB3 A;  1S72 T;  2R58 A;  2QA4 A;  1Q82 U;  1KD1 U;  3OYY A;  2NLU A;  3S6W A;  1YHQ A;  5KCO A;  1KQS A;  1G5V A;  1VQ9 T;  3OYA A;  1K8A C;  4RG2 A;  1M1K U;  5C6S A;  1M90 U;  1Q7Y C;  3DLL A;  3CC4 A;  3J7A F;  3QJ6 A;  4IUT A;  3JAM E;  4ZN3 A;  1VQO T;  2OTL T;  2HQE A;  3OYJ A;  5IAY A;  4LD6 A;  2L8D A;  5LL6 S;  3BDL A;  2R5A A;  1K9M C;  1BKB A;  3LYI A;  3H8Z A;  3LH0 A;  2K3Y A;  1OZ3 A;  3KUF A;  5D6W A;  3OW2 A;  2XK0 A;  4N4G A;  5J39 A;  3CCM A;  2RI2 A;  4ZN1 A;  1YBY A;  3CCL A;  3MP6 A;  5FRM A;  4A4E A;  3OYG A;  1YIJ T;  1VQL A;  3KBG A;  2JOY A;  1Q82 C;  3FEO A;  3CCU T;  2RHY A;  3L2W A;  2EQM A;  2KVQ G;  1VQ7 T;  1KQS S;  3MEA A;  4OVA A;  2QQS A;  3LGL A;  1VQ8 A;  2M16 A;  2YRV A;  1RL2 A;  3CCS T;  3PIP A;  1KHI A;  3L2U A;  3OA6 A;  1VQ5 T;  1N27 A;  5HY6 A;  4BE0 A;  4QQ6 A;  3LX7 A;  4A4F A;  4IUR A;  2LCL A;  5KH6 A;  3P8H A;  3P8B B;  3CCU A;  3OYH A;  3OB9 A;  2XDP A;  2DIG A;  3SD4 A;  2QEX A;  4C5E A;  3A5Z B;  1K8A U;  2X35 A;  3FDR A;  2OTJ A;  1VQ6 T;  2X4Y A;  1KHC A;  4BE2 A;  1KC8 U;  1YIT T;  2GFU A;  3G71 T; 
#chains in the Genus database with same CATH topology
 1YCS B;  1EX4 A;  2F2W A;  3EGD A;  3MHX A;  1EIF A;  1I81 A;  1KJW A;  1JQQ A;  1MMA A;  4CC2 A;  4JRI A;  5HKC A;  1WHG A;  1M4Z A;  2QAZ A;  1GL5 A;  4L6V 5;  1OU9 A;  2HEQ A;  4Z02 A;  2IG0 A;  4LDY A;  2O4X A;  3OS1 A;  1YJ9 Q;  3V8J A;  3X28 B;  3CMA T;  1IHV A;  3CCE A;  1QWE A;  3V8L A;  4X9C A;  1NE8 A;  2QGG A;  2NUP B;  2DA9 A;  2YUO A;  2PVO B;  2CSI A;  3NTH A;  3OYC A;  2DBK A;  2DE0 X;  5LJ5 h;  4C8Q A;  3CD6 T;  3SDZ A;  2LQW A;  1VQ9 A;  2DL3 A;  3I35 A;  2K7A A;  1YIJ Q;  2ED1 A;  4IIO A;  5IN1 A;  3OSS C;  4OMF B;  5LJ5 d;  3PE0 A;  2DD4 A;  4Z88 A;  2OTJ T;  3OY9 A;  2RQU A;  4QVD A;  2RK1 A;  3CC7 A;  2RHZ A;  4EMH A;  1FYN A;  1X27 A;  4OMQ A;  1TXQ A;  1Q81 R;  2EGA A;  4M78 D;  2LT4 A;  5GAM g;  2GTO A;  4HA8 A;  3OW2 S;  4BD3 A;  3JCM b;  2R57 A;  2EW3 A;  1BIB A;  1WQW A;  3ME9 A;  3SWN A;  2W10 A;  1KFZ A;  1PRL C;  5CQY A;  3JB9 F;  2HKN A;  1D1B A;  3RR6 A;  3FLG A;  2RHU A;  2DYB A;  1OPL A;  4ZGD B;  2LJ3 A;  4AFZ C;  1NM7 A;  5GAN 2;  2CT4 A;  1TUG B;  3UF4 A;  2M9U A;  2D8H A;  3MO8 A;  2HSP A;  2JS2 A;  4A4K A;  1IGU A;  3I9Q A;  1LVK A;  1B7T A;  3CCR T;  3GOX A;  3NGP A;  5FLX E;  1QVG A;  4M7D E;  1G3W A;  7AT1 B;  2CS7 A;  2DVE A;  5GAM e;  2XDD A;  2RK2 A;  1P92 A;  2JW4 A;  1I4K 1;  5KYY B;  3SHW A;  2CP3 A;  5GAN 4;  4KUI A;  1VQM Q;  3M4G A;  1K73 U;  4JPB W;  2GQV A;  4AFU C;  2COY A;  2I0N A;  4IUQ A;  1TS9 A;  1PG5 B;  3LWI A;  3CEY A;  1M3A A;  3EAE A;  3MET A;  4A4G A;  2JZ2 A;  5HK3 A;  5CAI A;  3L2R A;  4IUU A;  2LQN A;  2MWP A;  1NPP A;  1B34 A;  2DL4 A;  3CQT A;  2YSQ A;  1JEG A;  1V29 B;  2FZK B;  1NEG A;  3CCQ Q;  2O88 A;  2D1X A;  4HT8 A;  4D8D A;  3PNW C;  3QWX X;  3GNG A;  5GAN 7;  3H6Z A;  1R77 A;  1TUC A;  2MAM A;  4M75 A;  1VQ5 A;  1PWT A;  4C8Q D;  2QQB A;  2L0A A;  1VQ5 Q;  3UT1 A;  5FU6 B;  1JJ2 A;  4RMO A;  3JB9 H;  2SEM A;  1M9S A;  4XU1 A;  3HL8 A;  2ZPE B;  3PVQ A;  2EGC A;  3DB4 A;  2LCC A;  3C95 A;  1XJW B;  2RHI A;  1UJY A;  2P0Q A;  1I1J A;  4C0F A;  3M56 A;  2HZY A;  1WA7 A;  1HK9 A;  4OMO A;  2EVR A;  2X3W D;  4J83 A;  2R5M A;  4M75 C;  2QA4 T;  3BDU A;  2EYW A;  5DM7 R;  1CSK A;  2KDS A;  2CH4 W;  4C0D C;  2GTJ A;  2JMA A;  3V7S A;  2IPO B;  5CK9 A;  3VU3 C;  2AZV A;  4JRP A;  4K11 A;  3OQ5 A;  4N0A C;  1IXD A;  2KSS A;  1T3L A;  2YRD A;  4FU6 A;  4DBF A;  2P84 A;  1YJW A;  2QQA A;  4JZ4 A;  4N4I A;  2YRC A;  2VYT A;  2OAW A;  2EYY A;  3I55 T;  1KIK A;  4FYY B;  3V8K A;  1RLQ C;  4OML A;  2DTI A;  4C5I A;  5L23 A;  1I5O B;  1Y96 A;  1NLP C;  1U1T A;  2G6F X;  2QTX A;  1VQ8 T;  4ATO A;  3ZL7 C;  1D1C A;  2XMF A;  2JTF A;  1AWW A;  3HFN A;  1JJ2 S;  5I22 A;  3EG3 A;  4BI4 A;  1ZA2 B;  3H0H A;  4Z89 A;  4FL6 A;  3JB9 G;  3JRZ A;  4N0A A;  3CPW S;  4OB1 B;  2V8I A;  2ED0 A;  2F2V A;  2HCK A;  2XHC A;  2ZGW A;  1WYX A;  5GAO q;  5CKE A;  5GMK l;  1X6G A;  1NZ9 A;  1FXX A;  2DL8 A;  3OW2 P;  1ZBX A;  1QCO A;  1T0J A;  2CUD A;  2E64 A;  2DL5 A;  4MDX A;  2DBM A;  1VQ4 T;  2DK3 A;  3FJ5 A;  1F1B B;  1KC8 C;  3CCQ A;  3NTI A;  4C5H A;  1CKB A;  4NOY A;  1HJD A;  1GCP A;  4A63 B;  3M0U A;  3OYB A;  3QZ5 B;  2J06 A;  3X25 B;  1W70 A;  2PVG B;  5IH2 A;  1RAE B;  4EPC A;  2H8H A;  2GQI A;  2X9H A;  2M51 A;  2Y4Y A;  3OYL A;  1ZX6 A;  1OUL A;  1UUE A;  2DTH A;  3SWN B;  1S1N A;  3A8L B;  4M7D D;  3VRY A;  4QT7 A;  1M1K U;  1M90 U;  4HVV A;  3QJ6 A;  4E47 A;  5KYX A;  1QW1 A;  2JS0 A;  3QYG B;  3JAM E;  1VQ7 Q;  5IAY A;  5LL6 S;  2E12 A;  2ZPF B;  1UE9 A;  1UTI A;  2R5A A;  4PJJ A;  4RTY A;  4MML A;  1FX7 A;  2K2V A;  1OZ3 A;  5D6W A;  3OW2 A;  3CME Q;  3CCM A;  1HSQ A;  1JU5 C;  4JS4 A;  1ACM B;  5ECA A;  4BY6 C;  1SHG A;  1Q86 R;  2AT1 B;  1IRX A;  2K5I A;  4M78 G;  1I07 A;  1BYM A;  4C0G A;  1D0X A;  2QXF A;  4PJN A;  1UDL A;  1Q82 C;  3I55 Q;  3BFM A;  3CCU T;  3L2W A;  1EFN A;  2KVQ G;  1VQ7 T;  2QQS A;  2M16 A;  3LGL A;  1VQ8 A;  1FWZ A;  1HXD A;  2ROL A;  2VC8 A;  3OA6 A;  1N27 A;  5GAN j;  3L1A A;  2LCL A;  1XQH A;  3P8H A;  4R56 A;  2QA4 Q;  2NYS A;  1VYT A;  2XDP A;  1QVG P;  3VS2 A;  2AIR B;  2BE9 B;  2DPP B;  2WSC E;  2FEI A;  4PJO A;  1NJI R;  2DJQ A;  3FDR A;  4C92 F;  2DMO A;  2W0Z A;  4Z8A A;  1C6V X;  4BE2 A;  1YHQ Q;  1YIT T;  1KSW A;  1VQK A;  2C0I A;  4ZGJ B;  1VYU A;  2OTL Q;  3E9F A;  1YNZ A;  4KGZ B;  3D7S B;  1RAI B;  1AVZ C;  3CCE Q;  1QLY A;  4J7I A;  2KXD A;  3GF5 A;  3TSW A;  3M0R A;  3VRZ A;  1YJN Q;  1VOM A;  3EH1 A;  1QKX A;  4DEY A;  4DBQ A;  1RI0 A;  3J81 E;  3VJP A;  4LDX A;  3ER0 A;  3EGX A;  1ABO A;  4LDV A;  2MWO A;  2KRM A;  2E70 A;  4JRQ A;  3Q1J A;  4DBR A;  1G3Y A;  2DO3 A;  5GMK j;  1M3B A;  2AKL A;  2P0K A;  3CCE T;  3LLR A;  3SEM A;  1ABQ A;  3QXE B;  1E6G A;  3QUI A;  1Y71 A;  3URG A;  3CC2 A;  3EFS A;  2LJ1 A;  1QVG S;  2PU9 B;  2MYS A;  3CPW P;  5GAN d;  2D9T A;  2V26 A;  1X2K A;  2K6D A;  4E7K A;  2DXU A;  2LQK A;  3HSB A;  2DIQ A;  5KYN A;  3VUB A;  2EBP A;  3CCM T;  1U5S A;  1O9S A;  2D8J A;  1VQN Q;  3NFC A;  2FHD A;  1M1F A;  4DBH A;  2L3Q A;  4M7A F;  1N9R A;  4YTL A;  1W4S A;  2QG9 B;  1H8K A;  5FWB A;  1GXI E;  5KE2 A;  5I21 A;  3NPF A;  3A8H B;  3L2Q A;  4RTT A;  2CUB A;  1M3C A;  1WQ7 A;  1NG2 A;  1K9A A;  1R0C B;  4XU0 A;  2X4X A;  2CP7 A;  3L2V A;  1U8R A;  3R6N A;  2JXB A;  4GBQ A;  5CR2 A;  1QMC A;  2J6K A;  1D09 B;  2O4X B;  5I2S A;  4CC3 A;  3MP1 A;  3AT1 B;  2RHX A;  2L3R A;  4A54 A;  1FMV A;  4RTU A;  3I56 T;  3CME T;  1W2B A;  1FMW A;  5DLO A;  3CCQ T;  1N9S A;  3E2U A;  4OB2 B;  1WZO A;  4ELY C;  4RCB A;  1K76 A;  2DYI A;  2D6F A;  4FT4 A;  2CP6 A;  1NJI U;  3JB9 D;  2RJE A;  4XAX B;  1PKT A;  4XTU A;  1LPL A;  4PFP A;  2MK5 A;  1V76 A;  4KT0 E;  5LJ3 d;  4RUG A;  3VS5 A;  1ZSZ A;  1Y0M A;  3JCM P;  4GY5 A;  4PNO A;  2O2O A;  3CXC A;  3MEV A;  4ORZ A;  1WXU A;  3J80 E;  2KE9 A;  4BB7 A;  4F7U E;  4CRI A;  2E5K A;  2BTT A;  1SF9 A;  4KUL A;  1YJ9 T;  2ENM A;  2E3H A;  3HPW A;  3HHT B;  1YCY A;  2KR3 A;  1WXB A;  2CRE A;  3JCM J;  4M75 E;  1RLP C;  3QZ9 B;  4FM4 B;  3VYG A;  3RNJ A;  2PZ1 A;  2QEX T;  4XU3 A;  3GBQ A;  3I5R A;  4DEX A;  2XDB A;  2RJC A;  3TRE A;  2CZ0 B;  4HCZ A;  2CP2 A;  4OB3 B;  1YI2 A;  5GAO m;  2HSE B;  3MCA B;  3THK A;  4E7L A;  1WDX A;  1VQP A;  3HTR A;  2K3B A;  4PJL A;  4C0Z A;  3G6E Q;  1WLP B;  4E7I A;  3PIO A;  2LRQ A;  3UAT A;  4M77 A;  4LNP A;  4PJO G;  3VS4 A;  5A0L A;  2DM1 A;  1PC0 A;  4E7Z A;  2CT3 A;  2CH4 A;  2RJF A;  4LUE A;  3WVD B;  1JRI A;  3R6O A;  4M77 E;  2JNG A;  4PJO C;  1MV0 B;  4LUD A;  3UA6 A;  3NHN A;  4OMP A;  4C8Q F;  4J8O A;  4CI0 C;  4KBM B;  2NUT B;  1UGR B;  3RDV A;  2E6Z A;  1B34 B;  3JCM V;  2LJ0 A;  2EKO A;  2KNB B;  1YFN A;  1IO6 A;  2VVK A;  4RTV A;  4BI3 A;  4PJO B;  5LJ3 h;  2ZZD A;  4Q5W A;  4JLG A;  2PQW A;  2GFA A;  1WHK A;  3VS1 A;  2DJZ A;  4M75 B;  4M77 C;  4PJO E;  1ZUK A;  1BI3 A;  3M0Q A;  2I2L A;  5IXF A;  1M90 C;  2YWW A;  1WI7 A;  4FYW B;  4HVW A;  1QCN A;  2LVM A;  2RQR A;  5GJW B;  3OYE A;  4OGE A;  1M8M A;  1NEB A;  1XTD A;  4RKU E;  4F04 B;  4M7D F;  4IUP A;  2FPD A;  4R55 A;  1WPY A;  3OMC A;  3MEW A;  4JJC A;  3EG1 A;  3EHQ A;  2M0O A;  5KCH A;  3O8V A;  4E2F B;  2KMT A;  4RTX A;  1W6X A;  3BW1 A;  1VQO Q;  2V8J A;  2KGT A;  1QKW A;  5M9O A;  3RER A;  4QQG A;  2BZ8 A;  1AHJ B;  4AMC A;  5GJV B;  5GAO r;  1QQJ A;  4XTW A;  1N8R C;  3EG2 A;  5CQX A;  2VGN A;  3QG1 A;  2JVV A;  3M58 A;  2LTO A;  2A7Y A;  4DA4 A;  1YIT Q;  1ZUY A;  2GF7 A;  3H9N A;  4A4H A;  4M4Z A;  3E9G A;  2VUB A;  1K9M R;  1Q81 C;  4BY6 B;  2QAS A;  5AYF A;  3MKD A;  2KRO A;  1LCK A;  1NLO C;  4C92 E;  3CC2 T;  4OB0 B;  4J9H A;  3M54 A;  4BAC A;  2K5L A;  1VQ4 Q;  3C12 A;  1SRL A;  5KCO A;  2LX9 A;  3OYA A;  2VKN A;  2KYM A;  4JUV A;  2F5T X;  1VA7 A;  1PD0 A;  3DLL A;  3CC4 A;  3J7A F;  1M90 R;  2HQE A;  5D7U A;  2L8D A;  2PNI A;  4FYX B;  1S72 Q;  3BDL A;  3CCM Q;  2PUO B;  3BE3 A;  1BKB A;  3H8Z A;  1WHH A;  3M57 A;  2K3Y A;  1K0X A;  4N4G A;  1KG1 A;  2DET A;  3JCM f;  3RIR A;  2CGH A;  4ZNX A;  5LJ3 f;  1G3S A;  3CCL A;  1W1F A;  5GMK m;  4AT1 B;  1N6A A;  2VGM A;  4A4E A;  5LJ5 f;  1I0C A;  4FIB A;  1U3O A;  1VQL A;  2JOY A;  2H3J A;  3FEO A;  2E3I A;  1G2B A;  3M0P A;  3OBY A;  2EQM A;  1RAF B;  1XOV A;  2YRV A;  2VXF A;  3M5A A;  3PIP A;  1KHI A;  2RQW A;  4JJN K;  2MMP A;  2FB7 A;  1RAC B;  1VQ5 T;  1VQ9 Q;  4OGC A;  1D3B A;  3V7R A;  2ZPG B;  1PCX A;  2RM4 A;  4BUG A;  3CC7 Q;  1K0S A;  2SRC A;  2XD0 A;  3O5Z A;  5GAN f;  3CCU A;  3OYH A;  2RN8 A;  3CCS Q;  2FYK A;  1ZSZ B;  4FW1 A;  1OV3 A;  2X35 A;  2LX7 A;  4DQ2 A;  5CKB A;  1M2O A;  4MZP A;  3QJY A;  1M5Q 1;  4J9D A;  2GFU A;  1NYG A;  1Y07 A;  2D0N A;  5KYW A;  2CP5 A;  2MOX A;  3TEE A;  3VKI A;  3VS3 A;  3HKS A;  6AT1 B;  1UFF A;  1OI1 A;  3OYI A;  3VV0 A;  1H3Z A;  2OX7 A;  2CZ1 B;  2L3S A;  2M1H A;  2J6F A;  2OJ2 A;  1BI2 A;  2DX1 A;  4CC7 A;  4DOW A;  2RI3 A;  3I56 Q;  1N5Z A;  4ZGE B;  2KXC A;  2QDY B;  1QVF S;  4A53 A;  5GAM j;  1ZBJ A;  2E6N A;  1YI2 T;  3JCM X;  2RD1 A;  4FCY A;  3VYH B;  3JCM c;  1QP3 A;  3HFO A;  1H64 1;  1BK2 A;  2OI3 A;  3TVT A;  9ATC B;  1WJS A;  1X6O A;  3S3M A;  3OYF A;  4EDU A;  2EJG A;  4E7H A;  2V1R A;  4C92 B;  2YUN A;  2X3X D;  2KYB A;  5EG2 A;  5GAM h;  1SRM A;  3G6E A;  4FT2 A;  4D8K A;  3FB9 A;  1BBZ A;  1Q7Y R;  4M77 G;  3I55 A;  2F5K A;  3JCM g;  4HCB A;  3QSU A;  5LJ3 g;  3EHR A;  5FRO A;  1BU1 A;  2RH2 A;  2P4T A;  3QWY A;  3ASK A;  1UG1 A;  2F2X A;  1VQ8 Q;  4GLM A;  4OMM A;  1JO8 A;  2KQW A;  3WVE B;  1VIE A;  4DOV A;  1KD1 C;  3OYK A;  4IKF A;  3EFR A;  2RPN A;  2O31 A;  4P5N A;  4EMK B;  4JS5 A;  3CCL T;  2ECZ A;  2RF0 A;  4PKC C;  1VIF A;  3M55 A;  4L59 A;  3CBP A;  2LQ8 A;  3M59 A;  2RQV A;  5IXB A;  3FIF A;  4M75 F;  3G4S T;  2NUZ A;  3EG9 B;  3X26 B;  2EJF A;  2CP0 A;  2EQJ A;  2BKD N;  3RBB B;  1YWO A;  3KFV A;  2B86 A;  1JXO A;  2Y4X A;  2YDL A;  2HL3 A;  4QVC A;  4M78 E;  3RUX A;  1AZE A;  3WXM B;  3RKX A;  2EGE A;  2L2P A;  3L42 A;  1OX9 A;  5HCK A;  4J9C A;  1K4U S;  4JZ3 A;  4IUV A;  2L5Q A;  4J7F A;  4RTW A;  2DXT A;  1YJN A;  5J26 A;  5IT9 E;  2MF2 A;  1CKA A;  4BDY A;  2DVJ A;  3EGX B;  5CO7 A;  3QBY A;  2DF6 A;  1TTH B;  3OYD A;  4TVR A;  4C5G A;  5J3B A;  4M77 F;  2GNC A;  1M27 C;  4PK4 A;  3CCS A;  1AZG B;  3OS0 A;  4JJB A;  3UPU A;  4AFS C;  1X69 A;  1SG5 A;  3G71 Q;  1TOV A;  2YLB A;  3M0T A;  1SSH A;  1SSF A;  2RI5 A;  2LMJ A;  2JM9 A;  4NS5 A;  4PFO A;  4B6M A;  1K9M U;  2HQH A;  4HCC A;  1PHT A;  4C8Q C;  2P0P A;  1VQM T;  2O9V A;  8AT1 B;  2V1Q A;  3JCM d;  2QQ9 A;  1OX8 A;  3OMG A;  2EKH A;  1M2V A;  3A8M B;  3VUZ A;  4B9W A;  2MCN A;  3INZ A;  1MUZ A;  3M0S A;  1KD1 R;  2ROT A;  1YJN T;  1YP5 A;  4ESR A;  2KY9 A;  1UEC A;  2ZCF B;  2CDT A;  3DLM A;  3H41 A;  1WHJ A;  3CPF A;  3I5S A;  1TUD A;  5LJ5 e;  5KE3 A;  4QW2 A;  3FC3 A;  4BDZ A;  3CCL Q;  1K73 C;  1WIE A;  1K8A R;  1BB9 A;  1GFC A;  2J7I A;  2DZC A;  2A0F B;  2QTV A;  3X20 B;  3TCJ A;  1G8X A;  2YLC A;  1SKU B;  4M75 D;  3ZEH A;  2LP5 A;  3G7Z A;  1GCQ C;  4HCK A;  3RKW A;  1OZ2 A;  2A08 A;  1Z9Z A;  1VQL T;  1RAD B;  2NWM A;  4X34 A;  1M8V A;  3TU4 K;  1VYV A;  4J9E A;  1U06 A;  4L5G A;  2A37 A;  3P8D A;  2JUF A;  5CKD A;  1D3B B;  2YHT A;  3A8G B;  1Q82 R;  4AG2 C;  1ZQ1 A;  2LNV A;  4KGV B;  3CCV T;  1TH7 A;  4X9D A;  2KRS A;  3QKJ A;  2ESW A;  5AT1 B;  5D6Y A;  4UC4 A;  2GBQ A;  2KEA A;  2MPX C;  2PTK A;  3A98 A;  2CYZ B;  1VQK Q;  2WAC A;  2RQT A;  3EFO A;  2DEQ A;  1OU8 A;  3QPH A;  4BE1 A;  3FJP A;  2P4R A;  2QQR A;  3HP9 A;  2LZ6 B;  2Z0W A;  3JB9 I;  3QII A;  1VQ7 A;  2KT1 A;  1HD3 A;  3OSV A;  2HMA A;  4BI8 B;  4MMK A;  1W2B S;  2V8K A;  3CCJ A;  2H3E B;  4N4H A;  3CCJ Q;  2O01 E;  4E7J A;  1WX6 A;  2XU8 A;  1M1K R;  1BCM A;  5IHN A;  1E6H A;  1WNL A;  2RA2 A;  2M02 A;  3G4S Q;  2J05 A;  2DL7 A;  4J9I A;  1IB8 A;  1QWF A;  4JJD A;  1UJ0 A;  3CME A;  1G83 A;  3OBW A;  4HKE A;  3C0C A;  3G6E T;  4E7S A;  1VQ6 Q;  1Y7X A;  4RG8 A;  1VQM A;  3QDR B;  2ATC B;  2XKO C;  1YIT A;  2BE7 D;  4M7A D;  4FSS A;  4M77 B;  2K4Y A;  4CC4 B;  2EPD A;  1UHF A;  1UGQ B;  2XG8 D;  2FO0 A;  2CSQ A;  4Y91 A;  4ANJ A;  4C92 C;  1M30 A;  5FU7 C;  1MMD A;  1ZSG A;  3MP8 A;  2NUT A;  3TSZ A;  1T0H A;  2ZPH B;  4FW2 A;  2HBP A;  4J6X A;  3OYN A;  5EC7 A;  1AWO A;  1IGQ A;  1S72 T;  1K1Z A;  2QA4 A;  2E41 A;  1KD1 U;  3OYY A;  3S6W A;  5GAN 5;  1YHQ A;  5FU7 B;  5LJ3 e;  1X2Q A;  4F7U F;  1IHW A;  5C6S A;  2FG0 A;  5DY9 A;  1QCF A;  1RAB B;  4M7D C;  2E1H A;  2ABL A;  3EG9 A;  4IUT A;  2JT4 A;  3OYJ A;  5GAN 3;  4LD6 A;  1GRI A;  4LDW A;  1AWJ A;  3CMA Q;  2J6O A;  2WSE E;  2YT6 A;  4LXC A;  1JXM A;  4EMK C;  3RKY A;  2JJ9 A;  1K9M C;  3LYI A;  2OAU A;  4ME7 A;  5FWC A;  1LNX A;  1UHC A;  3LH0 A;  4E6R A;  2XK0 A;  2GGR A;  4F14 A;  5GMK e;  3A8O B;  4XK8 E;  2RI2 A;  5FW9 A;  1YBY A;  3MP6 A;  4ZN1 A;  1PSE A;  2KK4 A;  5GAO n;  3OYG A;  1N8R R;  1YIJ T;  1RI9 A;  4F7U A;  3REB B;  4Y92 A;  5L8R E;  4KGX B;  1FMK A;  2DZ9 A;  3PT9 A;  2DNU A;  5CCA A;  1Q95 G;  2RHY A;  2K9G A;  1U1S A;  1WXT A;  2QDL A;  1YWP A;  2VXE A;  2A28 A;  1RL2 A;  3CCS T;  3L2U A;  3CXC P;  1C1A A;  2HD0 A;  4C8Q E;  5HY6 A;  4HXJ A;  4QQ6 A;  2QGF B;  3M53 A;  5IHK A;  1JJ2 P;  3LX7 A;  4A4F A;  2D0Q B;  5KH6 A;  1YJW Q;  3CC2 Q;  4V2S A;  3OB9 A;  2XID A;  2QEX A;  2E4H A;  4C5E A;  3A5Z B;  1K8A U;  1X75 C;  2AZS A;  1VQ6 T;  2X4Y A;  2QI2 A;  2DXC A;  5I2M A;  2LT1 A;  1KC8 U;  2LC4 A;  3G71 T;  2EYX A;  1VQ4 A;  1YJW T;  3VS7 A;  4PJO F;  4C0D B;  2DD5 A;  4ZTJ A;  4M7D G;  3I56 A;  1TU0 B;  1UEB A;  3C4S A;  3T9N A;  4QQD A;  2QK0 A;  3E19 A;  4JDS A;  4HVU A;  1I5L A;  1JB0 E;  5KYU A;  2FVU A;  8ATC B;  4KUD K;  1JBM A;  4AFQ C;  5GAN 8;  5CIU A;  4B9X A;  1OPK A;  3CD6 A;  2KAF A;  1B3Q A;  4XTZ A;  1VQN T;  3PFS A;  1NBE B;  1H3H A;  1NYF A;  1GBR A;  3HRS A;  2K2M A;  1UGP B;  4KRT A;  3LWH A;  2CKK A;  1ZSZ C;  1D0Z A;  2DKG A;  1MNE A;  2C0T A;  2CZ6 B;  2K57 A;  2DXB A;  4M7D A;  1D1A A;  2COZ A;  5D6X A;  3SFM A;  4JRK A;  1IRE B;  4LE9 A;  2EJ9 A;  4M78 A;  1MMG A;  2YXY A;  2KI7 A;  1BCO A;  3UWN A;  1KK7 A;  1QVF P;  1WHL A;  3G1J A;  5A2Q E;  1ZHI A;  2DIL A;  2BUD A;  2HDA A;  2LCS A;  2E10 A;  2EQI A;  2DER A;  2EFI A;  1OYX A;  1ZUU A;  5GAN e;  3LH5 A;  2AKK A;  2OTL A;  3CCV A;  2RO0 A;  2X4J A;  3EFO B;  2HAX A;  1MGQ A;  1VQP T;  1GBQ A;  1RAA B;  2JTM A;  4GLK A;  4M75 G;  5KYW B;  5GAM d;  1PKS A;  2DEU A;  1TSF A;  4MZT A;  1H92 A;  2AHJ B;  2XI9 A;  4M7A G;  4C92 D;  3AHU A;  1BI0 A;  4WF2 A;  3CCJ T;  1BIA A;  1OEB A;  1I8F A;  3LW5 E;  1N8R U;  1D0Y A;  1ZLM A;  1M1K C;  2RJD A;  4M7A A;  1GCQ A;  3HRT A;  5DLQ E;  2Y90 A;  2ZPB B;  3NTK A;  3G4S A;  5CKH A;  3JCM h;  4PL6 A;  1G3T A;  3JB9 J;  2EIF A;  3PMT A;  2DRK A;  4II1 A;  1WJQ A;  2HBW A;  1VUB A;  1VQK T;  4NL2 A;  4C92 A;  2HL5 C;  1VQ6 A;  1QVP A;  4F17 A;  2MI6 A;  2YUP A;  3G71 A;  5LJ3 j;  2VB6 A;  3JCM W;  1ZA1 B;  5IHI A;  5LJ5 j;  3EGU A;  4F16 A;  1LJO A;  1DJ7 B;  3OYM A;  2IIM A;  4HT9 A;  3VS0 A;  2EWN A;  1A0N B;  5GAN 6;  1LOJ A;  4PJM A;  1Q86 C;  2DLP A;  4WTO B;  1ARK A;  4OMN A;  3ULR B;  2KT8 A;  1KQ1 A;  1VQN A;  3F70 A;  3RMS A;  5GAN h;  1WHM A;  3V7C A;  2MIO A;  2HQX A;  3KXT A;  2M0Y A;  1Y96 B;  3EG0 A;  3JSC A;  1PM3 A;  1SHF A;  3S3N A;  1YHQ T;  2F69 A;  4EMK A;  1W2B P;  2IVW A;  1UGS B;  1PRM C;  3CD6 Q;  3EGD B;  4EMG A;  1Z9Q A;  5CKF A;  4LN2 A;  3UDC A;  5GMK i;  1S72 A;  1TWB A;  3BY7 A;  2GCX A;  5I11 A;  3CMA A;  1X43 A;  1K73 R;  2G3R A;  3UA7 A;  3JV3 A;  3SWN C;  3MEU A;  3REA B;  3M9Q A;  3H0I A;  3GP8 A;  1TG0 A;  4ZTF A;  2AK5 A;  4Y28 E;  1WGS A;  3GLX A;  4VUB A;  5FRN A;  3DKM A;  5GAO l;  2NUP A;  2DTO A;  1J3T A;  4F7U B;  1KC8 R;  1X6B A;  3QHS A;  2JN0 A;  4C8Q B;  5GAM f;  4OF1 A;  4X1V A;  1VQO A;  2LDM A;  2FZC B;  3CC7 T;  2FRW A;  2B8A A;  1YIJ A;  4XTY A;  3CC4 T;  2EAY A;  4PJO D;  1OQK A;  2HNI A;  2K3X A;  3ZFJ A;  3CBO A;  2EQU A;  3PTA A;  3CCV Q;  1B07 A;  4XQ3 A;  4RTZ A;  4JLI A;  3QYH B;  4J6Y A;  2JTE A;  2QEX Q;  1IZ6 A;  1RAG B;  2X4W A;  2A36 A;  2COW A;  4J9G A;  1O75 A;  4KH0 B;  3H0F A;  2XIC A;  3IQL A;  1QVF A;  4FYV B;  5C0M A;  1AT1 B;  1X01 A;  5KYX B;  1RUW A;  2C0O A;  2EYQ A;  3EH2 A;  4EIK A;  4ELZ C;  1NJI C;  4AG1 C;  2A3L A;  3GIB A;  1MHN A;  2KBT A;  4M77 D;  3CCR A;  1Q86 U;  2EQK A;  2BZX A;  3M4Y A;  5KYU B;  1M2V B;  4PFZ A;  1WJR A;  2K79 A;  3CCR Q;  2PVD B;  3CXC S;  1AEY A;  2CZ7 B;  2RNA A;  3NMZ C;  4M78 F;  3PVL A;  1YN8 A;  2DAQ A;  3GPL A;  2ZAE A;  1HYO A;  1SPK A;  1NPR A;  1SEM A;  1Q81 U;  3OS2 A;  1YI2 Q;  1Y57 A;  4M78 C;  4QVZ A;  4IIM A;  4J9B A;  3QDF A;  5KYY A;  3S3O A;  3CPW A;  2DFU A;  3PMI A;  1YJ9 A;  1XNI A;  3GNF B;  2L3P A;  3HRU A;  5GMK h;  4M7D B;  4MZM A;  1PSF A;  3MJX A;  2HKQ B;  4PLI A;  1KQS P;  2L89 A;  1VQL Q;  4M78 B;  1MND A;  5LJ5 g;  1UGV A;  1Q7Y U;  2WSF E;  2K5F A;  2PUK B;  4XU2 A;  4XTV A;  4J6W A;  4PLL A;  3ZBD A;  3JCM Q;  3VS6 A;  1QP2 A;  5GAN g;  2FZG B;  2BIV A;  1AWX A;  1OOT A;  4FSX A;  1WFW A;  2E65 A;  1RAH B;  1M1G A;  2E5Q A;  2RMO A;  1AD5 A;  3LGF A;  3DB3 A;  5A0D A;  2R58 A;  4RCC A;  1MMN A;  3CCU Q;  2NLU A;  1Q82 U;  4NL3 A;  3U23 A;  2JMC A;  4OP0 A;  1KQS A;  4M7A E;  1G5V A;  1VQ9 T;  3RMQ A;  1K8A C;  4RG2 A;  1Q7Y C;  4M7A C;  2JM8 A;  3PGG A;  3MPU B;  2FPE A;  2F1L A;  4ZN3 A;  1VQO T;  2OTL T;  2BZY A;  4LDU A;  3JCM e;  4O5V A;  3E1S A;  3OS5 A;  4J9F A;  4KH1 B;  1BI1 A;  2VWF A;  1PD1 A;  1V1C A;  2C06 A;  3QO3 A;  5A0G A;  3KUF A;  4O6J A;  2FRY A;  2ZPI B;  4M7A B;  2VAS A;  5J39 A;  4R0K A;  3TQ7 P;  5HK0 A;  5GAO p;  2FL7 A;  2DRM A;  2FPF A;  3SB2 A;  2YUQ A;  5FRM A;  4D6W A;  4J5Y A;  4C8Q G;  3KBG A;  2VV5 A;  1UB4 A;  3X24 B;  3N5B B;  1AOJ A;  2EYZ A;  1EZZ B;  1VQP Q;  2RB6 A;  1KQS S;  3MEA A;  5FU6 C;  4OVA A;  4LD9 K;  4WCI A;  1PNJ A;  1E7O A;  4MDW A;  3C94 A;  3CBM A;  1R0B G;  2QYZ A;  4C92 G;  4BE0 A;  3FRN A;  3L2Z A;  4IUR A;  3RES A;  3A1P A;  2O9S A;  3P8B B;  2LNH B;  4F7U G;  2DIG A;  3SD4 A;  4XTX A;  2OTJ Q;  1KQ2 A;  4QKU A;  3CC4 Q;  1GFD A;  2X51 A;  2OTJ A;  5CVI A;  1KHC A;  2KRN A;  1T3S A;  1R8O B;  1C0M A;  1MV3 A; 
#chains in the Genus database with same CATH homology
 1Y07 A;  1VQ4 A;  1YJW T;  1VQK A;  3TEE A;  4ZGJ B;  3MHX A;  3VKI A;  1EIF A;  1I81 A;  3HKS A;  4PJO F;  2DD5 A;  4C0D B;  4ZTJ A;  3I56 A;  4M7D G;  1OI1 A;  1UEB A;  3C4S A;  3T9N A;  3OYI A;  4QQD A;  3E9F A;  3VV0 A;  3E19 A;  4JDS A;  1H3Z A;  4JRI A;  5HKC A;  2CZ1 B;  1I5L A;  2M1H A;  1JB0 E;  2FVU A;  4KUD K;  1BI2 A;  1M4Z A;  1JBM A;  5GAN 8;  5CIU A;  4B9X A;  4DOW A;  2RI3 A;  4L6V 5;  3CD6 A;  2KAF A;  4J7I A;  4ZGE B;  4XTZ A;  2QDY B;  1VQN T;  1QVF S;  4Z02 A;  3PFS A;  2IG0 A;  3GF5 A;  4LDY A;  2O4X A;  3OS1 A;  4A53 A;  3V8J A;  5GAM j;  3X28 B;  3CMA T;  2E6N A;  3HRS A;  3CCE A;  1YI2 T;  3JCM X;  2RD1 A;  3L2R A;  3VYH B;  3JCM c;  1QP3 A;  3V8L A;  4X9C A;  3HFO A;  1H64 1;  1NE8 A;  1UGP B;  1WJS A;  1X6O A;  3LWH A;  3S3M A;  2CKK A;  3OYF A;  4EDU A;  2EJG A;  4E7H A;  4C92 B;  1RI0 A;  3J81 E;  3VJP A;  2DKG A;  4LDX A;  2CZ6 B;  2K57 A;  2PVO B;  3ER0 A;  4LDV A;  5EG2 A;  5GAM h;  2MWO A;  3NTH A;  3G6E A;  4FT2 A;  3OYC A;  2E70 A;  2DXB A;  5LJ5 h;  3FB9 A;  4C8Q A;  4JRQ A;  4M7D A;  4M77 G;  3CD6 T;  3Q1J A;  5D6X A;  3SDZ A;  2F5K A;  3SFM A;  3I55 A;  4JRK A;  1IRE B;  3JCM g;  4HCB A;  1VQ9 A;  2EJ9 A;  3QSU A;  1G3Y A;  5LJ3 g;  4M78 A;  2DO3 A;  5FRO A;  5GMK j;  2RH2 A;  2P4T A;  3UWN A;  2P0K A;  3CCE T;  3LLR A;  3ASK A;  5IN1 A;  3OSS C;  4OMF B;  3QXE B;  5LJ5 d;  3QUI A;  1Y71 A;  3URG A;  2DD4 A;  5A2Q E;  3EFS A;  3CC2 A;  1ZHI A;  2OTJ T;  3OY9 A;  4QVD A;  1QVG S;  2RK1 A;  2KQW A;  2PU9 B;  3CC7 A;  5GAN d;  3WVE B;  2RHZ A;  2BUD A;  1VIE A;  2D9T A;  4DOV A;  4EMH A;  4E7K A;  2DXU A;  1KD1 C;  2LQK A;  4M78 D;  3OYK A;  3HSB A;  2DIQ A;  2LT4 A;  3EFR A;  5GAM g;  2E10 A;  4IKF A;  4HA8 A;  3VUB A;  3OW2 S;  4BD3 A;  3CCM T;  3JCM b;  2R57 A;  1O9S A;  4P5N A;  2EFI A;  4EMK B;  1OYX A;  1BIB A;  4JS5 A;  3CCL T;  4PKC C;  1WQW A;  1VIF A;  3M55 A;  3ME9 A;  4L59 A;  3SWN A;  3CBP A;  5GAN e;  3CCV A;  2OTL A;  2LQ8 A;  2FHD A;  1M1F A;  3NFC A;  4M7A F;  1N9R A;  2RO0 A;  2X4J A;  4YTL A;  5CQY A;  2HAX A;  3JB9 F;  3M59 A;  1MGQ A;  1W4S A;  3FLG A;  1VQP T;  3FIF A;  2RHU A;  4M75 F;  1GXI E;  3G4S T;  4ZGD B;  5KE2 A;  2JTM A;  4GLK A;  4M75 G;  5I21 A;  5GAM d;  3X26 B;  2EJF A;  3A8H B;  4MZT A;  2EQJ A;  2AHJ B;  3L2Q A;  2BKD N;  2XI9 A;  5GAN 2;  1WQ7 A;  4M7A G;  4C92 D;  4XU0 A;  2X4X A;  1BI0 A;  4WF2 A;  3CCJ T;  3AHU A;  1BIA A;  2M9U A;  2Y4X A;  3MO8 A;  3L2V A;  1I8F A;  3LW5 E;  4A4K A;  1N8R U;  1U8R A;  4QVC A;  4M78 E;  1M1K C;  3CCR T;  3RUX A;  3GOX A;  5FLX E;  3WXM B;  2RJD A;  3RKX A;  1QVG A;  4M7A A;  5CR2 A;  3L42 A;  4M7D E;  3HRT A;  5DLQ E;  1G3W A;  2Y90 A;  2O4X B;  2CS7 A;  2DVE A;  5GAM e;  5I2S A;  2ZPB B;  2XDD A;  2RK2 A;  3NTK A;  5CKH A;  1P92 A;  3JCM h;  3G4S A;  4IUV A;  2L5Q A;  4J7F A;  2DXT A;  1I4K 1;  4PL6 A;  1YJN A;  1G3T A;  3MP1 A;  5J26 A;  3JB9 J;  2EIF A;  3PMT A;  5GAN 4;  5IT9 E;  4II1 A;  1WJQ A;  2RHX A;  2L3R A;  2MF2 A;  1VUB A;  4KUI A;  1VQK T;  4BDY A;  4NL2 A;  3M4G A;  4A54 A;  4C92 A;  1VQ6 A;  1K73 U;  3I56 T;  3CME T;  5CO7 A;  1QVP A;  3QBY A;  2MI6 A;  1W2B A;  2GQV A;  3G71 A;  5DLO A;  4TVR A;  4C5G A;  3OYD A;  5LJ3 j;  5J3B A;  4IUQ A;  3JCM W;  4M77 F;  1N9S A;  3CCQ T;  3LWI A;  4OB2 B;  3CCS A;  5LJ5 j;  4ELY C;  4RCB A;  3OS0 A;  3CEY A;  2D6F A;  1LJO A;  3EAE A;  3MET A;  4FT4 A;  1DJ7 B;  2JZ2 A;  4A4G A;  5CAI A;  2RJE A;  5HK3 A;  3OYM A;  4IUU A;  4XAX B;  2EWN A;  3JB9 D;  2MWP A;  1NPP A;  1KQS A;  1B34 A;  4M7A E;  5GAN 6;  1G5V A;  1LOJ A;  4XTU A;  1Q86 C;  2YLB A;  1V29 B;  1KQ1 A;  1VQN A;  3F70 A;  3RMS A;  5GAN h;  3V7C A;  1SSF A;  2RI5 A;  2HQX A;  4KT0 E;  5LJ3 d;  3UPU A;  4HT8 A;  3PNW C;  3JCM P;  3KXT A;  3GNG A;  4NS5 A;  5GAN 7;  1Y96 B;  1K9M U;  4HCC A;  3H6Z A;  3JSC A;  4GY5 A;  4PNO A;  3S3N A;  1YHQ T;  3CXC A;  3MEV A;  4C8Q C;  2P0P A;  2F69 A;  2MAM A;  4EMK A;  4M75 A;  1VQM T;  3J80 E;  1VQ5 A;  4BB7 A;  3JCM d;  4F7U E;  2IVW A;  2QQ9 A;  1UGS B;  3OMG A;  4C8Q D;  4CRI A;  2QQB A;  4KUL A;  1YJ9 T;  3UT1 A;  4EMG A;  5FU6 B;  1JJ2 A;  3HPW A;  4RMO A;  3HHT B;  1YCY A;  3JB9 H;  4HT9 A;  5CKF A;  3A8M B;  3UDC A;  3VUZ A;  4B9W A;  1M9S A;  5GMK i;  3JCM J;  3BY7 A;  1S72 A;  2GCX A;  4M75 E;  4XU1 A;  3INZ A;  3HL8 A;  2ZPE B;  3QZ9 B;  3CMA A;  4FM4 B;  3VYG A;  3DB4 A;  2QEX T;  4XU3 A;  1YJN T;  2LCC A;  3C95 A;  2G3R A;  2KY9 A;  2XDB A;  3SWN C;  3MEU A;  2ZCF B;  2RJC A;  3DLM A;  3TRE A;  2CZ0 B;  3CPF A;  3M9Q A;  2RHI A;  3GP8 A;  4ZTF A;  4HCZ A;  2P0Q A;  4Y28 E;  4C0F A;  3M56 A;  5LJ5 e;  1WGS A;  5KE3 A;  4OB3 B;  1YI2 A;  4QW2 A;  5GAO m;  3GLX A;  4VUB A;  3FC3 A;  4BDZ A;  5FRN A;  1HK9 A;  3DKM A;  1K73 C;  3MCA B;  5GAO l;  2DTO A;  4J83 A;  4E7L A;  2DZC A;  4F7U B;  1VQP A;  2R5M A;  4C0Z A;  4M75 C;  3X20 B;  3TCJ A;  2QA4 T;  4E7I A;  3PIO A;  2LRQ A;  3QHS A;  2JN0 A;  4C8Q B;  3BDU A;  5GAM f;  2YLC A;  4OF1 A;  4M75 D;  4M77 A;  4PJO G;  5DM7 R;  3ZEH A;  2KDS A;  1VQO A;  4C0D C;  2LDM A;  3G7Z A;  3CC7 T;  5A0L A;  3RKW A;  1OZ2 A;  2B8A A;  1YIJ A;  1VQL T;  4X34 A;  4XTY A;  3V7S A;  3CC4 T;  3TU4 K;  1M8V A;  5CK9 A;  2EAY A;  3VU3 C;  4JRP A;  4PJO D;  4L5G A;  2HNI A;  3OQ5 A;  2RJF A;  2K3X A;  2KSS A;  4N0A C;  3P8D A;  3WVD B;  3ZFJ A;  1JRI A;  2JUF A;  3R6O A;  2JNG A;  4FU6 A;  4M77 E;  5CKD A;  4PJO C;  3CBO A;  1D3B B;  2YHT A;  4C8Q F;  3A8G B;  1YJW A;  2QQA A;  2EQU A;  4J8O A;  4N4I A;  1ZQ1 A;  4CI0 C;  4KBM B;  2LNV A;  3PTA A;  1UGR B;  2E6Z A;  1B34 B;  4XQ3 A;  2VYT A;  3CCV T;  1TH7 A;  4X9D A;  3JCM V;  3QKJ A;  2EKO A;  4JLI A;  3I55 T;  3QYH B;  4J6Y A;  5D6Y A;  1IZ6 A;  4BI3 A;  4UC4 A;  3V8K A;  2X4W A;  4PJO B;  2DTI A;  1O75 A;  4C5I A;  2XIC A;  5LJ3 h;  2CYZ B;  2ZZD A;  1Y96 A;  1QVF A;  4Q5W A;  2WAC A;  1U1T A;  4JLG A;  2DEQ A;  3QPH A;  2PQW A;  2GFA A;  3FJP A;  4BE1 A;  2QTX A;  1VQ8 T;  5C0M A;  4ATO A;  1X01 A;  2DJZ A;  4M75 B;  2EYQ A;  2JTF A;  4M77 C;  4ELZ C;  1NJI C;  4PJO E;  2A3L A;  2QQR A;  3GIB A;  3HP9 A;  3HFN A;  1JJ2 S;  1BI3 A;  1MHN A;  3JB9 I;  3QII A;  4M77 D;  4BI4 A;  3CCR A;  1VQ7 A;  1Q86 U;  2I2L A;  2EQK A;  3M4Y A;  1M90 C;  4FL6 A;  3OSV A;  3JB9 G;  1WJR A;  3JRZ A;  4N0A A;  4BI8 B;  4MMK A;  3CPW S;  2PVD B;  3CXC S;  1W2B S;  2CZ7 B;  2V8K A;  4OB1 B;  2LVM A;  3CCJ A;  3OYE A;  4N4H A;  2V8I A;  4M78 F;  4OGE A;  2DAQ A;  2O01 E;  3GPL A;  4E7J A;  1XTD A;  4RKU E;  2XHC A;  2XU8 A;  4M7D F;  4IUP A;  4R55 A;  1WPY A;  1NPR A;  3OMC A;  3MEW A;  2ZGW A;  1Q81 U;  3OS2 A;  2M0O A;  4M78 C;  3O8V A;  1WNL A;  2RA2 A;  5KCH A;  5GAO q;  4QVZ A;  2KMT A;  5CKE A;  5GMK l;  3BW1 A;  3CME A;  1NZ9 A;  1FXX A;  3S3O A;  2V8J A;  3CPW A;  3OBW A;  4HKE A;  5M9O A;  3G6E T;  3PMI A;  1YJ9 A;  3RER A;  1XNI A;  3GNF B;  4QQG A;  1AHJ B;  1ZBX A;  3HRU A;  5GAO r;  5GMK h;  4M7D B;  1Y7X A;  4MZM A;  4RG8 A;  4XTW A;  1VQM A;  3QDR B;  1N8R C;  5CQX A;  1PSF A;  2XKO C;  4PLI A;  1YIT A;  4M7A D;  2E64 A;  2L89 A;  4MDX A;  4M78 B;  2VGN A;  3QG1 A;  1VQ4 T;  2JVV A;  2DK3 A;  4M77 B;  5LJ5 g;  1Q7Y U;  2WSF E;  2K5F A;  1KC8 C;  3CCQ A;  2PUK B;  4XU2 A;  3M58 A;  2K4Y A;  2LTO A;  4XTV A;  4J6W A;  2A7Y A;  1UGQ B;  4PLL A;  2XG8 D;  3ZBD A;  4DA4 A;  3NTI A;  4Y91 A;  3JCM Q;  2GF7 A;  4C5H A;  4A4H A;  4NOY A;  4C92 C;  1QP2 A;  5GAN g;  3E9G A;  2VUB A;  1Q81 C;  2BIV A;  5FU7 C;  4BY6 B;  3OYB A;  3QZ5 B;  4FSX A;  3X25 B;  2E65 A;  5AYF A;  3MP8 A;  2PVG B;  2ZPH B;  4EPC A;  4C92 E;  3CC2 T;  1M1G A;  2E5Q A;  4OB0 B;  2HBP A;  3M54 A;  4J6X A;  3OYN A;  2Y4Y A;  3LGF A;  3OYL A;  4BAC A;  3DB3 A;  2K5L A;  5A0D A;  2DTH A;  2R58 A;  1S72 T;  4RCC A;  2QA4 A;  2E41 A;  2NLU A;  3SWN B;  3OYY A;  1Q82 U;  1KD1 U;  3S6W A;  3C12 A;  5GAN 5;  4OP0 A;  5KCO A;  5FU7 B;  4NL3 A;  1YHQ A;  2LX9 A;  3A8L B;  3RMQ A;  5LJ3 e;  4RG2 A;  4F7U F;  3OYA A;  1VQ9 T;  1K8A C;  4M7D D;  1M1K U;  5C6S A;  1M90 U;  4JUV A;  2F5T X;  5DY9 A;  1Q7Y C;  3DLL A;  3CC4 A;  3J7A F;  4M7D C;  2E1H A;  3QJ6 A;  4M7A C;  3PGG A;  4E47 A;  4IUT A;  1QW1 A;  3JAM E;  3QYG B;  4ZN3 A;  1VQO T;  2HQE A;  2OTL T;  3OYJ A;  5IAY A;  5GAN 3;  4LDU A;  2L8D A;  4LD6 A;  4LDW A;  3JCM e;  2E12 A;  2ZPF B;  4O5V A;  2WSE E;  3E1S A;  3OS5 A;  5LL6 S;  3BDL A;  2PUO B;  2R5A A;  4EMK C;  3RKY A;  1BI1 A;  3G71 T;  1K9M C;  1BKB A;  4MML A;  3LYI A;  1FX7 A;  2OAU A;  3H8Z A;  4ME7 A;  1LNX A;  2K2V A;  3LH0 A;  2K3Y A;  3M57 A;  3QO3 A;  5A0G A;  2C06 A;  1OZ3 A;  3KUF A;  5D6W A;  4O6J A;  2XK0 A;  3OW2 A;  4N4G A;  2ZPI B;  4M7A B;  5J39 A;  5HK0 A;  3CCM A;  5GAO p;  4JS4 A;  4BY6 C;  2FL7 A;  5GMK e;  1KG1 A;  3A8O B;  4XK8 E;  3RIR A;  3JCM f;  2CGH A;  2RI2 A;  2K5I A;  4M78 G;  5LJ3 f;  3SB2 A;  1G3S A;  1YBY A;  3MP6 A;  4ZN1 A;  3CCL A;  1BYM A;  5GMK m;  5FRM A;  1PSE A;  4D6W A;  2KK4 A;  4J5Y A;  4C0G A;  1N6A A;  2VGM A;  2QXF A;  4A4E A;  4C8Q G;  5LJ5 f;  5GAO n;  4FIB A;  3OYG A;  1YIJ T;  1VQL A;  3KBG A;  2JOY A;  2VV5 A;  2H3J A;  4F7U A;  1UB4 A;  3FEO A;  1Q82 C;  3X24 B;  5L8R E;  3N5B B;  2DZ9 A;  3BFM A;  3CCU T;  3PT9 A;  3OBY A;  5CCA A;  2RHY A;  3L2W A;  2EQM A;  2KVQ G;  1VQ7 T;  2RB6 A;  1KQS S;  1U1S A;  1XOV A;  3MEA A;  4OVA A;  2QQS A;  5FU6 C;  4LD9 K;  2M16 A;  2YRV A;  3LGL A;  1VQ8 A;  1FWZ A;  2VXF A;  2VXE A;  3M5A A;  1RL2 A;  3CCS T;  3PIP A;  1KHI A;  4JJN K;  3L2U A;  4MDW A;  2MMP A;  2FB7 A;  1HXD A;  2VC8 A;  3OA6 A;  1N27 A;  1VQ5 T;  2HD0 A;  3C94 A;  3CBM A;  4OGC A;  1D3B A;  3V7R A;  4C92 G;  4C8Q E;  2ZPG B;  5HY6 A;  2RM4 A;  4BUG A;  4BE0 A;  3FRN A;  4QQ6 A;  3M53 A;  5GAN j;  3L1A A;  3LX7 A;  3L2Z A;  2D0Q B;  2LCL A;  4IUR A;  4A4F A;  1XQH A;  5KH6 A;  2XD0 A;  5GAN f;  3P8H A;  3RES A;  3P8B B;  4R56 A;  3CCU A;  3OYH A;  4V2S A;  2FYK A;  3OB9 A;  2XDP A;  4F7U G;  2DIG A;  2XID A;  3SD4 A;  1NJI U;  2DPP B;  2WSC E;  4XTX A;  2QEX A;  4C5E A;  1KQ2 A;  3A5Z B;  4PJO A;  1K8A U;  2X35 A;  3FDR A;  4C92 F;  4DQ2 A;  5CKB A;  2OTJ A;  1X75 C;  1VQ6 T;  5CVI A;  2X4Y A;  1KHC A;  2QI2 A;  2DXC A;  3QJY A;  4MZP A;  1M5Q 1;  5I2M A;  2LT1 A;  1R8O B;  4BE2 A;  1KC8 U;  1YIT T;  2GFU A;  2LC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...