1SSFA

Solution structure of the mouse 53bp1 fragment (residues 1463-1617)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
123
structure length
123
Chain Sequence
b'NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transformation related protein 53 binding protein 1
publication title The Tudor Tandem of 53BP1; A New Structural Motif Involved in DNA and RG-Rich Peptide Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 16
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA01
1YJ9A 1Q82U 1QVGA 2L8DA 3CMET 3OS2A 3OYDA 3CC4A 1VQ9A 3MP8A 3PMIA 3CCLA 3OS1A 3MEUA 2RJDA 3H6ZA 2L3RA 2QEXT 4ZN1A 3ER0A 2JNGA 4OVAA 2RJCA 1VQLA 1EIFA 3MEWA 4E7IA 1YJWA 2BKDN 5FRMA 2RHIA 3G6ET 3LYIA 1VQ9T 4PL6A 3OYHA 1XNIA 5D6XA 1KQSS 1KHIA 2BUDA 2LCLA 3KUFA 2YRVA 1NPPA 3J7AF 2X35A 3CCQT 1YHQA 3OYMA 3DLLA 2G3RA 1H3ZA 4C5EA 1VQ7A 2LVMA 2MI6A 2EQMA 2RO0A 2JOYA 1Q86C 2RHYA 3CCMA 4PLIA 5M9OA 1JJ2A 3P8DA 1M1KU 2X4WA 3MEAA 1M90C 1NJIC 3MO8A 3S3OA 4B9WA 3OS0A 3LX7A 1VQ6T 2EQUA 1VQ7T 2VYTA 1S72T 4ZTFA 1XTDA 3CCVT 3OQ5A 2WACA 3CD6A 3L2RA 1RI0A 2GF7A 3CCMT 3C4SA 2O4XB 3M9QA 1YIJA 2JUFA 3L2QA 2JTFA 4BD3A 3OYBA 1BKBA 2PQWA 1M1GA 3NTIA 1VQ4A 2RHZA 3BDLA 5IAYA 3OA6A 3CCRT 3CCJA 2QA4T 3CC7A 1NZ9A 4IUUA 3ASKA 2K3YA 1VQKT 5CIUA 4A4GA 2M16A 3CMEA 4N4HA 1Q81U 4IUTA 2XK0A 4IUQA 4C5IA 5KH6A 3E9FA 2O4XA 3E9GA 1Q86U 5IT9E 5FROA 3OYNA 1NPRA 1YBYA 2QQSA 2OTLT 3OB9A 3OYEA 1UEBA 3LGLA 4E7JA 2M1HA 2LTOA 3PMTA 3G6EA 5D6YA 1K8AC 2E6NA 1VQOA 3FDRA 3LH0A 3JAME 3PIOA 2XDPA 1YITT 3OYGA 3Q1JA 3CCQA 4IURA 3OMGA 4QQDA 5IN1A 1QVFS 5KE3A 3CXCA 3G4SA 3CPFA 2LQ8A 4A4HA 2EQJA 1QVGS 1VQOT 3QJ6A 4A4FA 2KDSA 4ZN3A 3FEOA 3J81E 3META 3I55T 3P8BB 3I56T 4LD6A 1G5VA 3G4ST 1VQ6A 4BDYA 1VQMT 5KCOA 3GOXA 1S72A 2OTJA 1OZ2A 3PNWC 3OYJA 3CCVA 4NS5A 2R5AA 1KD1C 1WJRA 3CEYA 2EKOA 2NLUA 4EDUA 1VQNT 3EAEA 3CC2T 4B9XA 3CCET 2RI3A 4C5HA 3LLRA 2B8AA 2DIQA 4RG2A 1K8AU 1X6OA 2OTJT 2KVQG 1Q7YC 5KE2A 2GFAA 2R5MA 3CCRA 2QA4A 4TVRA 3CPWA 2EQKA 4HCZA 3SD4A 2R57A 1VQ5A 2E6ZA 4Z02A 4C5GA 1VQKA 1Q82C 2X4XA 1JJ2S 2BIVA 2MWPA 2X4YA 1K73C 3L42A 3QKJA 3OMCA 2D9TA 3F70A 4X34A 1YI2T 2DO3A 2RI5A 1KHCA 2OTLA 4PLLA 4QW2A 3OW2A 4BE2A 1VQ5T 5J39A 1VQPT 5KCHA 2HQXA 2K3XA 3G71T 4Q5WA 3OYCA 5A2QE 3TREA 1MHNA 5FRNA 1YITA 2QQRA 3FLGA 4QQGA 1SSFA 1VQ8T 1W2BS 4GY5A 1KC8C 1M90U 2GFUA 1NJIU 3MP1A 2M0OA 3DLMA 3OYAA 1WJQA 3CCUT 5FLXE 3FC3A 1Q7YU 2DIGA 3HKSA 3ZEHA 3L2VA 3I55A 4FL6A 3A5ZB 3I56A 3QIIA 2RHUA 3UWNA 3OYKA 1KQSA 1VQMA 1K73U 2RJFA 1RL2A 3CMAT 4L59A 5J26A 4IKFA 1IZ6A 4QQ6A 5LL6S 2JZ2A 2LCCA 3J80E 2HQEA 1VQNA 2DAQA 3DB3A 3CC2A 1YJ9T 3CCEA 3UT1A 1OZ3A 1N8RC 3PFSA 3CC4T 3CXCS 5J3BA 3CCSA 2E5QA 1N27A 3CCLT 4E7KA 5HY6A 3L2WA 2CKKA 5C0MA 1KC8U 4BDZA 2MWOA 3H8ZA 4BACA 2RI2A 1VQLT 1OI1A 1Q81C 1WGSA 1YJWT 1K9MC 2EIFA 3CCST 2IG0A 3KBGA 1YI2A 3OY9A 3S3MA 2LDMA 3ME9A 4FU6A 4E7HA 1VQPA 2L89A 1WJSA 3QBYA 2R58A 4ZTJA 1YHQT 3G71A 3MP6A 3L2UA 1YJNA 4UC4A 2FHDA 1OYXA 2LRQA 1VQ8A 3OYYA 3S6WA 2XHCA 4BE0A 3CPWS 4YTLA 5DLQE 4N4GA 4IUPA 4A4EA 5C6SA 1N8RU 3CCUA 1W2BA 1YJNT 3P8HA 1KD1U 4CRIA 3OYLA 3CD6T 3O8VA 3PIPA 2F5KA 2P0KA 4II1A 1YIJT 3OW2S 5D6WA 1K9MU 4IUVA 5DM7R 2RHXA 3DB4A 3CMAA 3MEVA 3LGFA 3OYIA 4BE1A 2RJEA 4E7LA 4N4IA 3NTHA 1VQ4T 2QEXA 2JVVA 1QVFA 4QVZA 2E70A 2EFIA 3CC7T 3CCJT 1M1KC 3S3NA 3OYFA 3NTKA
chains in the Genus database with same CATH superfamily
1YJ9A 1ZLMA 2C06A 1YI2Q 4C8QB 3OYDA 2MF2A 3QYHB 1Y0MA 4JUVA 1VQ9A 3MP8A 3PMIA 1JRIA 1WHHA 3N5BB 3MEUA 1HXDA 5GANj 5GANg 1M90R 2CT4A 1WQ7A 4ZN1A 2DK3A 2KI7A 3OSVA 2JNGA 4F7UG 2RJCA 1QWFA 1WHJA 4C8QF 4E7IA 3JB9D 1YJWA 3VYHB 3FRNA 2GBQA 1HJDA 3LYIA 1NYGA 2J05A 1FYNA 4PFZA 1YIJQ 1RAFB 1ABQA 2HBPA 3KUFA 2EPDA 4E6RA 1ZBXA 4GBQA 2M02A 3DLLA 1JQQA 4C5EA 5GANh 2CZ0B 4D8KA 3EFOA 3CC7Q 3JCMV 1GFDA 4M75D 2JOYA 1ABOA 4M4ZA 1SG5A 4CC7A 2RHYA 3CCMA 3UATA 1RUWA 4OGCA 2X4WA 1I1JA 3S3OA 4C8QG 2DXUA 1TOVA 4B9WA 3VS4A 3BDUA 2QEXQ 2K5FA 2VYTA 3RIRA 1VQ7T 4JZ4A 4Z89A 1V76A 4JZ3A 3UA7A 3HPWA 2F2VA 4ZGEB 3TQ7P 3G6EQ 3C4SA 1X2KA 2O4XB 3IQLA 4OB2B 2I0NA 1K8AR 2DTIA 2DXTA 2JTFA 2JTEA 4PJOC 1OX9A 1M1GA 3JCMd 3NTIA 1BI0A 3JSCA 3CCQQ 2V26A 1X43A 1B07A 3EGDB 1VQLQ 5IAYA 4XTVA 3M0PA 1M8MA 1PG5B 3THKA 1QQJA 1IHWA 1X01A 1Q81U 2MOXA 3QSUA 1ZBJA 4RTWA 2XK0A 3NGPA 5KYXB 4L6V5 3HTRA 3OBYA 4OMLA 5IT9E 3M0TA 2QQSA 2CP3A 1VQ6Q 4PK4A 5IHIA 1ZSGA 2GTJA 4BI4A 3LGLA 4LNPA 5IHKA 1X6BA 2HMAA 1M1FA 1B34B 2E6NA 1VQOA 4ZGJB 3OYGA 1K4US 2OJ2A 1WNLA 3M59A 3Q1JA 4OGEA 4IURA 4QQDA 1QVFS 3CXCA 3CPFA 2YRCA 1ZHIA 2ZCFB 4A4FA 1Q82R 4QVCA 2QQAA 4DBHA 3VS7A 3J81E 2RQWA 3P8BB 3A8HB 4LD6A 1G5VA 2A3LA 2DJZA 2K2MA 1VQMT 1X27A 4C92E 2AZSA 3JCMh 2OTLQ 3PNWC 1IREB 3TVTA 4WCIA 2CP5A 1KD1C 1WJRA 4LDUA 3A8GB 3WXMB 3EFSA 5GJVB 1TUGB 2NLUA 4F17A 4EDUA 1N6AA 2YXYA 1YITQ 1OEBA 3CCET 3VS2A 1NYFA 4RG2A 1K8AU 2OTJT 2DBKA 2K5IA 2GFAA 5I2SA 2CSIA 1PC0A 2ESWA 4TVRA 3CPWA 5GAN4 3HP9A 2R57A 4M77E 1SEMA 2E1HA 1N9SA 4RTUA 1QLYA 4PJOB 1K73C 1SRLA 3MPUB 3L42A 2EAYA 1QP3A 2FPEA 1UDLA 1QKWA 4KGVB 3I55Q 1YI2T 2ROLA 4PLLA 3ZBDA 4HCBA 4IIMA 3OW2A 2DRMA 2DE0X 4PJOF 2DPPB 2K3XA 2LC4A 4Q5WA 3SFMA 3G71T 2COWA 4A53A 1NLPC 2ECZA 1LPLA 1HK9A 1WI7A 3M0RA 4PNOA 1VQNQ 2M51A 1GBRA 3FLGA 1E7OA 4GY5A 3CXCP 2HEQA 2HAXA 2KT1A 4M7AA 1PWTA 1WJQA 2QGFB 2YUNA 1KJWA 2QQ9A 2F2WA 4M7DA 2DIGA 3HKSA 4J9GA 2QXFA 1K9MR 4ME7A 4PJOG 2XMFA 1BI3A 3HSBA 1PKSA 1ZA1B 2IIMA 2YRDA 3UWNA 5KYXA 1VQMA 2QAZA 3G7ZA 1RL2A 1G8XA 1JXOA 3VRYA 4L59A 2MYSA 2E64A 4J9IA 4QQ6A 2JZ2A 2LCCA 1I4K1 2DAQA 4JJNK 2PVGB 4OMNA 4MZPA 3CCEA 1OZ3A 4MDWA 2OX7A 1N8RC 1VQ8Q 4XQ3A 2BZ8A 3A98A 3LW5E 1FMKA 2IVWA 3H0FA 4JRIA 3RNJA 3MKDA 3UPUA 4E7KA 3L2WA 3CPWP 2COYA 5LJ5j 1D0YA 5CQXA 5LJ5g 5C0MA 4AMCA 2CYZB 2EYZA 1RI9A 2RI2A 4KUIA 4R0KA 1VQLT 5GANf 1Q81C 1G2BA 2GNCA 2X9HA 3CCST 2IG0A 2RQRA 2ZZDA 1YI2A 1VUBA 3OW2P 2LDMA 4FU6A 4E7HA 3CBMA 3SHWA 4ELYC 2DL7A 1SRMA 1BBZA 1MV0B 2FPDA 4ZTJA 3VJPA 1YHQT 2ED1A 3G71A 7AT1B 2FG0A 1D0ZA 1RAEB 5LJ5h 1KQ2A 1SHGA 5GAN3 1MNDA 2WSFE 4C8QE 1TSFA 1ZSZA 1PKTA 4C0DC 3C95A 3CC4Q 3M53A 1Y7XA 3QDRB 4M75A 1MMNA 5IH2A 1NEGA 2DD5A 1UHCA 2CP6A 2QYZA 1U06A 3CD6T 4J9FA 2F5KA 2FYKA 2E3HA 5GMKj 4M78C 1WXUA 3INZA 1HSQA 1K9MU 3TSWA 5DM7R 1UFFA 2O9VA 2Y4XA 4LN2A 2RJEA 1CKAA 2K7AA 4RUGA 1VQ4T 2QEXA 1X6GA 1QVFA 2XD0A 2E70A 4DOVA 1M1KC 5DLOA 2LX7A 4JPBW 1U3OA 4OMOA 3NTKA 4DA4A 2PVOB 3EG3A 3CMET 3OS2A 3EHRA 2W0ZA 2JJ9A 3OS1A 3V8JA 2RJDA 3H6ZA 2L3RA 4C92G 2HKQB 1NJIR 3EFOB 1PNJA 4O5VA 2DZCA 5GMKh 4PJLA 2OAUA 1VQLA 1EIFA 2E4HA 2GCXA 1T0HA 2RN8A 1I81A 2BKDN 2RHIA 3QHSA 1AZGB 2RK2A 3REAB 3RDVA 1VQ9T 3JCMQ 2YUPA 5KYUA 1JEGA 3D7SB 2JW4A 4E47A 1U5SA 1PCXA 2X35A 1PSEA 2HSPA 2NUTA 2SEMA 1YHQA 3OYMA 3JCMf 3VS5A 1H3ZA 3SEMA 2MI6A 1K76A 1Q86C 2VUBA 4PLIA 5CKHA 4JJDA 4A63B 4O6JA 4RKUE 2AT1B 3A8OB 4FYWB 4ZTFA 1S72T 1XTDA 2JTMA 4EMKA 3H0IA 1O9SA 4JLIA 2WACA 2LT4A 3CD6A 3L2RA 1RI0A 3CCMT 1ARKA 4LUEA 1VOMA 1KIKA 2RH2A 1WFWA 1FMWA 5HCKA 2DVJA 2O2OA 1TTHB 2M9UA 2RNAA 2VXFA 1QVFP 4M7AC 1VQ4A 2RQVA 1NZ9A 2AK5A 3UA6A 4M7DC 2K3YA 1D3BA 3CMEA 4M78B 2NWMA 3HRTA 3X20B 1AWWA 2K4YA 2QDLA 1JO8A 2XI9A 3C94A 5KH6A 1M4ZA 4LDYA 1UJYA 1CKBA 3QYGB 2DLPA 5CQYA 2L5QA 2DXCA 3OYEA 1UEBA 4M78F 2K79A 3CCVQ 2K6DA 4A54A 1OPLA 4J6YA 1QMCA 3A8MB 1M8VA 5D6YA 2LNVA 1Z9ZA 2LP5A 3FDRA 4R56A 4QT7A 3JAME 3PIOA 2XDPA 2XKOC 2YT6A 1I07A 1WHLA 2DEQA 2SRCA 3OMGA 1PHTA 1VA7A 2CZ7B 2RQUA 3NHNA 5HK0A 5GAOn 4HA8A 4Z8AA 2J6OA 2LQ8A 3CCRQ 4A4HA 3JRZA 4K11A 1VQOT 3QJ6A 2AHJB 2KGTA 4PJOE 1IRXA 3CQTA 1SPKA 1VQKQ 4FT2A 4OMMA 2D0QB 2CSQA 3JV3A 2DEUA 4HT8A 2X4JA 1S72A 1FMVA 4C0FA 2DX1A 1QCNA 1G3YA 1RLQC 4XTUA 2OAWA 3EAEA 1JXMA 3CC2T 2VGNA 1WX6A 4B9XA 1SHFA 1ZSZC 2DIQA 5GAOl 2KVQG 1Q7YC 1X2QA 1YWPA 2R5MA 1KC8R 2WSCE 4M75C 3TSZA 2YWWA 3M0SA 4HCZA 3SD4A 4LDWA 4V2SA 2DL3A 4FT4A 2E6ZA 2KROA 2QTVA 9ATCB 3PVLA 4FSSA 1M3CA 5LJ5f 2HL5C 2KSSA 3M54A 2ZPEB 1C0MA 3OMCA 4M7AB 3AT1B 1OOTA 2HBWA 3I56Q 2DO3A 3G4SQ 1KHCA 1UGRB 2EGCA 1UB4A 4M7DB 2V1RA 4PFPA 2FZCB 1GRIA 1NEBA 2YUOA 3EG1A 1C1AA 4M7AF 3OYCA 1R77A 1MHNA 4E2FB 2FPFA 4PJNA 3EGUA 1XOVA 2QQRA 4QQGA 1AWJA 1SSFA 4M7DF 3M58A 2HQHA 1P92A 2RQTA 1Y07A 4HVVA 1M90U 2GFUA 1KK7A 2M0OA 3JCMX 3T9NA 4HVWA 3BY7A 2YDLA 4RCCA 3NMZC 4F16A 2P4RA 4Y91A 3RBBB 2KAFA 4J9DA 3JCMg 1UTIA 2LQNA 4M78A 2E5KA 1N9RA 5HKCA 3TU4K 3OYKA 2XU8A 4J8OA 5GAMd 4M7AG 4RG8A 4Y28E 3CMAT 5J26A 4E7SA 4BY6C 4IKFA 1VQ5Q 4VUBA 4BUGA 4XAXB 4M7DG 4HCCA 3EFRA 1N5ZA 3L1AA 3J80E 3QWYA 2HQEA 5AT1B 1MUZA 3DB3A 3CC2A 5LJ3d 4X9DA 1I0CA 4JRKA 4J7FA 2E5QA 2EKHA 1N27A 3CCLT 1VIFA 1Z9QA 3C12A 5HY6A 2C0TA 1C6VX 3M57A 3JCMc 1YN8A 4J6XA 2IPOB 4EMKC 1KC8U 2MWOA 6AT1B 3CCUQ 4BACA 3JB9F 1OI1A 4AG2C 1ZSZB 1H3HA 2E12A 4LXCA 2F69A 1V29B 4D8DA 4OMQA 3M4YA 4M75B 3KBGA 3OY9A 3S3MA 4NL3A 4WF2A 4QKUA 1OULA 2L89A 3QBYA 1G3WA 3NFCA 5GAOm 2KXCA 4FYYB 4JJBA 4M75F 1AHJB 3OBWA 5IHNA 3V8LA 2FHDA 2CP0A 1YJ9Q 2DZ9A 1AWXA 3S6WA 2V8IA 2MIOA 3RMQA 4C92D 4KULA 3JB9G 2XHCA 1YCYA 2KNBB 2Y4YA 1Y96A 2CZ1B 5DLQE 4IUPA 5GMKl 3H41A 2K3BA 4A4EA 4PJJA 4EMGA 2RB6A 1MMAA 3RKYA 1W2BA 3VS0A 3EHQA 4J83A 3OYLA 1BCMA 1H92A 5FU7C 2DXBA 1YJWQ 3O8VA 5KYYA 2A36A 5CKFA 1YIJT 5CVIA 2QASA 2CT3A 1PD1A 5I21A 1BIAA 1VIEA 1WPYA 2C0IA 2E3IA 4M75G 3CMAA 4DOWA 2DJQA 2X3WD 4M77D 3OYIA 1X75C 3SWNA 1RAIB 1I5LA 3NTHA 2EFIA 3CC7T 5KYUB 5KCOA 2CH4A 2AIRB 2LCSA 1Q82U 2L2PA 4BB7A 2QTXA 4KT0E 1LCKA 2NUTB 1NE8A 2HKNA 3HFOA 3CBOA 3CCLA 1TWBA 1Y71A 2QEXT 3JB9I 3ER0A 4D6WA 1R0CB 3MEWA 1CSKA 1YJNQ 5GAOr 1JB0E 3G6ET 1TUDA 4BI3A 1JBMA 4PL6A 3OYHA 4XTZA 1KQSS 1KHIA 2BUDA 2LCLA 1TXQA 2YRVA 4EMKB 2QK0A 2A0FB 4FYXB 3CCQT 2VWFA 2KK4A 2BZYA 4FYVB 1LVKA 2MK5A 4ZNXA 5ECAA 4OF1A 2RF0A 5IXBA 2DD4A 3I5SA 2EQMA 4M78E 1YP5A 4L5GA 4LDVA 2CP2A 3E2UA 5GJWB 3HRUA 3P8DA 2YSQA 1OV3A 3MEAA 1M90C 3MO8A 5CO7A 4IIOA 3OS0A 3LX7A 1VQ6T 2DKGA 2JM8A 1D3BB 2O9SA 1BCOA 3DKMA 1IXDA 1KFZA 3OQ5A 2DTHA 5CKDA 3V7SA 3QO3A 2ATCB 2X51A 2E65A 2FRWA 5GAMe 3L2QA 1YIJA 2EJ9A 4CC2A 4A4KA 3E19A 1SF9A 2M0YA 1WYXA 1BKBA 2PQWA 2DILA 4MZMA 3KXTA 1K1ZA 2RHZA 3OA6A 1Y57A 5FU7B 2KY9A 3PGGA 3CC7A 5LJ3e 3MHXA 3ASKA 3ZL7C 4RTYA 5GMKm 5DY9A 2M16A 1RAAB 1AT1B 3JCMJ 1ZA2B 1PM3A 4IUTA 1PRMC 1M27C 2LMJA 2ZPGB 2BTTA 3E9FA 3SDZA 3E9GA 1WHKA 5FROA 1NPRA 4GLMA 2OTLT 4J9EA 1NM7A 3OB9A 1VQ7Q 4E7JA 1GFCA 2LTOA 3PMTA 3HHTB 1K0XA 4C8QD 3G6EA 1KD1R 1MV3A 1K8AC 2GQVA 2HD0A 2KEAA 3LH0A 1YITT 2XDBA 3JCMW 3GP8A 3CCQA 4OB3B 3X28B 2COZA 4OB0B 1WXBA 2K5LA 5KE3A 3G4SA 3VV0A 3QDFA 4GLKA 4FM4B 2EQJA 1QVGS 2QDYB 3I35A 3PE0A 2KDSA 4ANJA 4ZN3A 1WQWA 2HCKA 4C0GA 4M7AE 1K73R 3META 3I55T 4BDYA 1VQ6A 3VUBA 4M7DE 1UGVA 3CCJQ 2FO0A 3OYJA 2L0AA 2H3EB 4KUDK 4NS5A 2BE7D 2R5AA 1UG1A 1NBEB 1D1BA 2YLCA 2L3QA 5FWCA 1BU1A 3CEYA 1I8FA 3X26B 1PRLC 2EKOA 2CH4W 2DFUA 1QW1A 2D0NA 3KFVA 5L23A 3BE3A 1VQNT 2J7IA 3EGXA 5A0GA 2I2LA 2NYSA 2RI3A 4C5HA 2W10A 3LLRA 2DNUA 4CC3A 2B8AA 2PU9B 2FZKB 1X6OA 2CUDA 3RR6A 2G6FX 4MMLA 2NUPA 1GL5A 1EX4A 2LZ6B 1M9SA 2EQKA 4C0DB 1I5OB 4KGZB 1R0BG 1VQ5A 4ORZA 4C5GA 1OU9A 1Q82C 2X4XA 1JJ2S 3EG9A 2MWPA 2X4YA 1T0JA 4HT9A 5FWBA 1LJOA 5GAN8 4HKEA 5I22A 3LH5A 3HL8A 5KYWA 1UHFA 2RI5A 3QZ5B 4QW2A 2OTLA 1VQMQ 3SWNC 4BE2A 1WLPB 1VYVA 2CS7A 3M4GA 1AOJA 3H0HA 2EGEA 2MCNA 2HQXA 1W4SA 4XTXA 1M3BA 3R6OA 5GANd 2ED0A 2LJ0A 3TREA 5FRNA 1GCQA 1YITA 2EJGA 1QVPA 1MNEA 2KXDA 1VQ8T 3PVQA 2RD1A 4J5YA 3CCEQ 2MAMA 1W2BS 3E1SA 2OTJQ 1N8RR 4F7UF 1NJIU 2F1LA 2J6KA 1WDXA 1MMDA 4RTTA 1RABB 3OYAA 1M3AA 3GBQA 2L3PA 4C92A 4X1VA 1M2VA 1WHMA 1U8RA 2EYXA 2PZ1A 1Q81R 1M30A 2AZVA 4M75E 2XG8D 3I55A 3A5ZB 1B3QA 1SSHA 2ZAEA 1GBQA 5AYFA 1UGPB 4J9CA 1KQSA 1K73U 2QA4Q 2FL7A 3FJPA 1WZOA 1W70A 4KRTA 4KGXB 2CP7A 4B6MA 4R55A 1LOJA 1LNXA 5GMKe 2DA9A 3O5ZA 3G71Q 4M78G 3M0UA 4XU1A 1VQNA 2DRKA 3URGA 2DETA 3LWHA 3UT1A 1KG1A 4M77A 4BI8B 3PT9A 1OU8A 2KYMA 3CC4T 5I11A 4ATOA 2CKKA 1KSWA 1DJ7B 2ROTA 4OMFB 4LD9K 3EG2A 2V8JA 4JDSA 5I2MA 4BDZA 1R8OB 2DYBA 3GIBA 1WGSA 1K9MC 1AD5A 2Y90A 1Y96B 2OI3A 5A0DA 2FB7A 2EQIA 3NPFA 4HXJA 3GF5A 1YCSB 5GMKi 4ELZC 4J9HA 2JM9A 2A08A 4PJOD 2DERA 5KYYB 2KRNA 1RAGB 1TG0A 2ABLA 2JT4A 3JCMb 5GAN2 1YJNA 1M1KR 2EBPA 3WVEB 1OYXA 3UF4A 4DBRA 1VQ8A 3M5AA 3SWNB 4BE0A 4YTLA 5C6SA 1N8RU 2RMOA 1UECA 4KH0B 2KYBA 1ZUUA 4CRIA 1AVZC 2CUBA 1U1TA 3QG1A 4XTYA 2D8HA 1TS9A 2VV5A 1QKXA 2P0KA 5EC7A 3ZFJA 2PTKA 4NL2A 3R6NA 1KQSP 3CCSQ 4DBFA 1SKUB 2CGHA 4RTZA 2RHXA 3DB4A 2CZ6B 3VKIA 2QI2A 4FIBA 1RACB 1U1SA 3LGFA 1XQHA 4E7LA 3QJYA 4N4IA 4JRPA 2JVVA 1YHQQ 4QVZA 3SB2A 3CCJT 4F7UA 2K2VA 2XIDA 2BE9B 2FZGB 3S3NA 2L8DA 2DM1A 1QVGA 5CKEA 5L8RE 2B86A 1Q86R 5FU6C 3CC4A 3MJXA 4LDXA 3EG0A 4EPCA 4AFQC 1VQPQ 1QP2A 4MZTA 2D8JA 4AFSC 4X9CA 4OVAA 5GAOq 2VASA 4F14A 4FCYA 1UUEA 1G83A 2KT8A 2PUOB 4NOYA 5FRMA 2EWNA 3CD6Q 1AZEA 3GLXA 1XNIA 1W6XA 5D6XA 1H641 2K57A 2ZPHB 3TCJA 1NPPA 3J7AF 4LE9A 4XU0A 1V1CA 3M0QA 2LQWA 4C8QA 5GANe 2V1QA 4DEYA 1M5Q1 2G3RA 1VQ4Q 1VQ7A 1AWOA 2LVMA 3FB9A 5GAMj 3RUXA 5CKBA 5GAMg 2RO0A 2JMAA 4AFZC 2JS0A 1BYMA 5CR2A 5M9OA 2A28A 3CMEQ 3VU3C 1JJ2A 2WSEE 1M1KU 3L2ZA 2JMCA 5CK9A 1MGQA 1NJIC 3BFMA 5LJ3j 2EQUA 5LJ3g 3G1JA 3X24B 3CCVT 3RMSA 2DL5A 3RKXA 2YUQA 2GF7A 1GCQC 3GPLA 3M9QA 1VQ9Q 2JUFA 4OMPA 4EMHA 3PTAA 1IB8A 5GAMh 2O01E 3A1PA 4BD3A 3OYBA 3CBPA 1YFNA 4XK8E 1J3TA 1BK2A 1K9AA 4N0AC 2HL3A 1OQKA 2H8HA 3BDLA 3FJ5A 3JB9H 1K0SA 2LJ3A 3CCRT 2FVUA 4IUUA 1QCOA 4C0ZA 2XDDA 3CCJA 2QA4T 4AFUC 2EVRA 1QVGP 2E41A 1UGQB 5LJ3h 1KQ1A 4C92C 2DYIA 3UDCA 1VQKT 1TH7A 5CIUA 4A4GA 4CI0C 1H8KA 4N4HA 4KH1B 1T3SA 4IUQA 4C5IA 2P84A 2O4XA 1F1BB 1Q86U 3QZ9B 1NLOC 3OYNA 1YBYA 2ENMA 4PFOA 3REBB 1S72Q 3ULRB 1E6GA 2VVKA 4XU2A 4J9BA 2M1HA 2P4TA 3VUZA 3HRSA 5FU6B 2E10A 3EGDA 2F2XA 3CCMQ 3VS1A 4BY6B 4PKCC 4WTOB 8ATCB 5LJ5d 2FEIA 4M77C 4RMOA 4JJCA 1EFNA 1W1FA 2KRSA 4MDXA 3M55A 1BIBA 1G3TA 4RCBA 4MMKA 4XU3A 5IN1A 1Q7YR 1WIEA 3V7RA 2GGRA 3EGXB 2LNHB 2J06A 1IGUA 3BW1A 1ACMB 2GQIA 5A0LA 2BZXA 1JJ2P 5FW9A 2DTOA 2KBTA 1WHGA 2L3SA 5CCAA 3X25B 3FEOA 1RADB 4E7ZA 2D6FA 2JXBA 2NUPB 1ZQ1A 4JRQA 3QWXX 1B34A 4RTXA 3I56T 5GAN7 3JCMe 3G4ST 2PNIA 3GOXA 1WA7A 2HDAA 2OTJA 1BB9A 1OZ2A 3CCVA 3EG9B 4F7UE 1ZUYA 5HK3A 3RERA 3JCMP 2EW3A 1YNZA 1O75A 1B7TA 5KYWB 1E6HA 2YHTA 3A8LB 2MPXC 2CDTA 1W2BP 5KE2A 2XICA 3GNGA 2JS2A 1TUCA 2GTOA 3FIFA 3CCRA 2QA4A 2DL4A 1GCPA 3TEEA 2JN0A 3VS6A 4J7IA 2V8KA 4J6WA 1EZZB 4Z02A 4HCKA 1VQKA 1VQOQ 4RTVA 2BIVA 2K9GA 2DL8A 2H3JA 2J6FA 3RESA 5GAN5 3QKJA 2D9TA 3VYGA 3F70A 2EJFA 5KYNA 4X34A 4HVUA 2AKKA 4ZGDB 3QUIA 4C92B 2KMTA 2VGMA 5J39A 1VQ5T 2DBMA 1M2VB 2RPNA 1VQPT 1HYOA 1YWOA 4M78D 1BI2A 5KCHA 4KBMB 5A2QE 2NUZA 4FW2A 1QCFA 1FX7A 2FRYA 3HFNA 3CC2Q 2RA2A 4C92F 1S1NA 1FWZA 2P0QA 2EGAA 4PJOA 1KC8C 1OX8A 2ZPIB 1AEYA 2KE9A 2D1XA 4AT1B 5GAOp 3MP1A 3DLMA 4P5NA 2DVEA 1FXXA 1ZUKA 4F04B 3CCUT 5FLXE 2MMPA 2EYYA 3FC3A 1Q7YU 4M77B 2VC8A 4CC4B 3ZEHA 1HD3A 2ZPFB 3C0CA 3L2VA 4XTWA 4FL6A 2EYQA 1T3LA 3I56A 3QIIA 1IGQA 2RHUA 2P0PA 1X69A 2YLBA 3MCAB 2VKNA 2RJFA 2KR3A 3I5RA 4M77F 4C8QC 5GAN6 1IZ6A 2HSEB 2F5TX 3WVDB 5LL6S 3M56A 1G3SA 2X3XD 3QXEB 1A0NB 2A37A 1RAHB 2RK1A 4EIKA 4QVDA 1YJ9T 1VYUA 1D0XA 1NG2A 4Z88A 1UGSB 1TU0B 2C0OA 1OPKA 1UE9A 4ESRA 1M2OA 2QQBA 4FW1A 1MMGA 3EH1A 3PFSA 3CXCS 5J3BA 1PD0A 5IXFA 3CCSA 4DQ2A 2PUKB 1IO6A 4AG1C 2VB6A 1Q95G 3V7CA 2CREA 3H8ZA 2DF6A 2QGGA 1ZX6A 2HZYA 3VRZA 1YJWT 8AT1B 4M77G 4PJMA 1UJ0A 2EIFA 2QG9B 2PVDB 3H9NA 2VXEA 3RKWA 3V8KA 1PSFA 2LX9A 1RLPC 2O31A 4JS4A 3ME9A 2LT1A 3OSSC 3CMAQ 1VQPA 1WJSA 4Y92A 5D7UA 2R58A 1GXIE 4FSXA 5LJ5e 3GNFB 3MP6A 1JU5C 1D1AA 4JLGA 1D1CA 2KRMA 2DMOA 2LJ1A 4M7AD 3U23A 3L2UA 3QPHA 4OB1B 4DEXA 4UC4A 2Z0WA 2LRQA 1WXTA 2ZGWA 3OYYA 4JS5A 4M7DD 3I9QA 3EH2A 5GAMf 2O88A 3CPWS 1BI1A 3CCLQ 4N4GA 4DBQA 4F7UB 3AHUA 3JB9J 3CCUA 2RM4A 1IHVA 2EYWA 1YJNT 3P8HA 2HNIA 1KD1U 1XJWB 5LJ3f 5EG2A 1D09B 2A7YA 2KQWA 1QWEA 3PIPA 4II1A 4N0AA 5CAIA 3OW2S 2ZPBB 5D6WA 4IUVA 3MEVA 4BE1A 3LWIA 2AKLA 1VYTA 4LUDA 3OS5A 4OP0A 2LQKA 3OYFA 3VS3A
chains in the Genus database with same CATH topology
1YJ9A 4DA4A 2PVOB 2L8DA 1Q82U 1QVGA 2C06A 4BB7A 2QTXA 5CKEA 5L8RE 4KT0E 3OS2A 3CMET 4C8QB 3OYDA 2MF2A 5FU6C 3QYHB 3CC4A 4JUVA 1VQ9A 1NE8A 3MP8A 3PMIA 4LDXA 3HFOA 1JRIA 3CBOA 3OS1A 3CCLA 3V8JA 3N5BB 3MEUA 1HXDA 2RJDA 3H6ZA 4EPCA 2L3RA 1QP2A 5GANg 5GANj 4ATOA 1WQ7A 1Y71A 4MZTA 4C92G 2QEXT 4ZN1A 2DK3A 3JB9I 3ER0A 4D6WA 3OSVA 4O5VA 2JNGA 2DZCA 4OVAA 4X9CA 5GMKh 4F7UG 2RJCA 5GAOq 2OAUA 1VQLA 1EIFA 2GCXA 3MEWA 4E7IA 4C8QF 5GAOr 1JB0E 3JB9D 1YJWA 3VYHB 2PUOB 1KG1A 1I81A 2BKDN 4NOYA 3FRNA 2EWNA 2RHIA 3G6ET 5FRMA 3QHSA 4BI3A 3LYIA 2RK2A 1JBMA 1VQ9T 3JCMQ 3GLXA 4PL6A 1XNIA 4XTZA 5D6XA 3OYHA 1KQSS 1KHIA 1H641 2BUDA 4PJOD 2LCLA 2K57A 2ZPHB 2HBPA 3KUFA 3TCJA 2YRVA 4E47A 1NPPA 4EMKB 3J7AF 2X35A 4XU0A 3CCQT 1ZBXA 1PSEA 4C8QA 2KK4A 5GANe 1YHQA 3OYMA 3JCMf 1M5Q1 2G3RA 3DLLA 1QVFS 1H3ZA 4C5EA 5GANh 1VQ7A 4OF1A 2CZ0B 2LVMA 3JCMV 2MI6A 3FB9A 5GAMj 2DD4A 4M75D 5CKBA 3RUXA 2EQMA 4M78E 5GAMg 2RO0A 2JOYA 1Q86C 2VUBA 4L5GA 1BYMA 2RHYA 4LDVA 4PLIA 5M9OA 5CR2A 3CCMA 3VU3C 3HRUA 1JJ2A 3P8DA 2WSEE 1M1KU 3L2ZA 2X4WA 3MEAA 4OGCA 5CKHA 5CK9A 1M90C 1MGQA 1NJIC 3MO8A 3S3OA 4C8QG 2DXUA 5CO7A 3BFMA 4B9WA 3OS0A 3LX7A 4O6JA 1VQ6T 4RKUE 2DKGA 3BDUA 2K5FA 2EQUA 3A8OB 5LJ3j 5LJ3g 2VYTA 3RIRA 4ZTFA 1S72T 1XTDA 1VQ7T 1D3BB 3X24B 2JTMA 3CCVT 4EMKA 3DKMA 3RMSA 1O9SA 3OQ5A 4JLIA 2WACA 2DTHA 2LT4A 5CKDA 3CD6A 3V7SA 3L2RA 3RKXA 3HPWA 1RI0A 3QO3A 2GF7A 4ZGEB 3CCMT 3C4SA 2E65A 2O4XB 3GPLA 4OB2B 3M9QA 5GAMe 3L2QA 2JUFA 4EMHA 2DTIA 1YIJA 2DXTA 2EJ9A 3PTAA 4A4KA 2RH2A 5GAMh 3E19A 2O01E 2JTFA 4BD3A 3CCRT 3OYBA 4PJOC 1BKBA 3CBPA 2PQWA 1M1GA 3JCMd 2M9UA 3NTIA 4XK8E 1BI0A 2VXFA 3JSCA 4MZMA 4N0AC 4M7AC 3KXTA 1VQ4A 3JB9H 2RHZA 3BDLA 5IAYA 3OA6A 5FU7B 2KY9A 3PGGA 4XTVA 2FVUA 4IUUA 4C0ZA 1NZ9A 5LJ3e 2XDDA 3MHXA 3CC7A 3CCJA 3ASKA 4M7DC 3L2VA 2E41A 1UGQB 2K3YA 1KQ1A 5LJ3h 4C92C 1D3BA 3UDCA 1TH7A 5GMKm 1VQKT 5CIUA 1X01A 2M16A 5DY9A 4M78B 4A4GA 4N4HA 4CI0C 3CMEA 3HRTA 1Q81U 3X20B 3JCMJ 3QSUA 4IUTA 2XK0A 4IUQA 4C5IA 2K4YA 2XI9A 3C94A 5KH6A 2ZPGB 3E9FA 3SDZA 4L6V5 1M4ZA 4LDYA 2O4XA 3OBYA 3E9GA 1Q86U 5IT9E 3QYGB 3QZ9B 5FROA 3OYNA 1NPRA 1YBYA 2QQSA 2OTLT 5CQYA 2L5QA 2DXCA 3OB9A 3OYEA 1UEBA 4M78F 4BI4A 3LGLA 4E7JA 4A54A 4XU2A 2M1HA 2P4TA 2LTOA 3VUZA 3PMTA 4J6YA 3HHTB 3HRSA 3A8MB 4C8QD 1M8VA 3G6EA 5FU6B 2E10A 5D6YA 1K8AC 1M1FA 2GQVA 2HD0A 2LNVA 1B34B 2E6NA 4BY6B 4PKCC 5LJ5d 3FDRA 4R56A 3LH0A 1VQOA 3JAME 3PIOA 2XDPA 2XKOC 1YITT 4ZGJB 4M77C 4RMOA 3OYGA 2XDBA 1WNLA 3JCMW 2DEQA 3M59A 3GP8A 3Q1JA 4OGEA 4IURA 4OB3B 3X28B 3OMGA 3CCQA 4MDXA 2CZ7B 4OB0B 3M55A 2K5LA 1BIBA 1G3TA 4QQDA 4MMKA 4RCBA 4XU3A 5IN1A 5KE3A 5HK0A 3CXCA 3G4SA 5GAOn 3VV0A 3V7RA 3CPFA 4HA8A 2LQ8A 4GLKA 4A4HA 1ZHIA 4FM4B 2EQJA 3JRZA 3BW1A 1QVGS 5A0LA 1VQOT 3QJ6A 2AHJB 2QDYB 2ZCFB 4PJOE 4A4FA 2KDSA 2DTOA 4ZN3A 4FT2A 2QQAA 3X25B 4QVCA 3FEOA 5CCAA 1WQWA 4C0GA 4M7AE 4M7DB 2D6FA 3J81E 3META 1ZQ1A 3I55T 4JRQA 3OW2S 3P8BB 1B34A 2D0QB 3A8HB 4LD6A 3I56T 5GAN7 1G5VA 2A3LA 2DJZA 3JCMe 3G4ST 4BDYA 1VQ6A 3VUBA 5KCOA 3GOXA 1VQMT 4HT8A 4M7DE 2X4JA 4C92E 1S72A 2OTJA 1OZ2A 3JCMh 3PNWC 4C0FA 1IREB 3OYJA 3CCVA 4KUDK 4NS5A 2R5AA 1G3YA 4F7UE 1KD1C 1WJRA 2YLCA 4LDUA 3A8GB 3WXMB 3EFSA 3CEYA 1I8FA 4XTUA 3X26B 5HK3A 3JCMP 2EKOA 3RERA 2NLUA 4EDUA 1QW1A 1O75A 1VQNT 3EAEA 5A0GA 3CC2T 2VGNA 1N6AA 2I2LA 2YHTA 4B9XA 3A8LB 2RI3A 4C5HA 3CCET 3LLRA 2B8AA 2PU9B 2DIQA 4RG2A 5GAOl 1X6OA 1K8AU 2KVQG 2OTJT 1Q7YC 1GXIE 5KE2A 2K5IA 2GFAA 2XICA 3CPWS 3GNGA 4MMLA 2R5MA 2WSCE 5I2SA 4M75C 3FIFA 3CCRA 2QA4A 1M9SA 4TVRA 4HCZA 2EQKA 4C0DB 3CPWA 3SD4A 5GAN4 3HP9A 2R57A 3TEEA 4LDWA 2JN0A 4M77E 1VQ5A 4V2SA 4J7IA 4FT4A 2E6ZA 2V8KA 4J6WA 4Z02A 4C5GA 1VQKA 1Q82C 2E1HA 1N9SA 2X4XA 1JJ2S 2BIVA 2MWPA 4PJOB 2X4YA 5LJ5f 1K73C 2H3JA 2KSSA 3M54A 2ZPEB 3L42A 4HT9A 2EAYA 3RESA 1QP3A 1LJOA 5GAN8 5GAN5 3QKJA 3OMCA 4M7AB 2D9TA 4HKEA 3VYGA 3F70A 2EJFA 4X34A 3HL8A 1YI2T 2DO3A 2RI5A 3QZ5B 1KHCA 4QW2A 4PLLA 2OTLA 1UGRB 3ZBDA 4ZGDB 1UB4A 3SWNC 4BE2A 3OW2A 4HCBA 2CS7A 3QUIA 2KMTA 2VGMA 4C92B 5J39A 1VQ5T 3M4GA 4PJOF 1VQPT 2DPPB 4M78D 1BI2A 5KCHA 2HQXA 4KBMB 1W4SA 2K3XA 2LC4A 4Q5WA 4XTXA 3SFMA 3G71T 4M7AF 3R6OA 4A53A 5GANd 5A2QE 3OYCA 3TREA 1MHNA 5FRNA 1HK9A 1FX7A 4PNOA 1YITA 1XOVA 2EJGA 2QQRA 3FLGA 4QQGA 1QVPA 3HFNA 1SSFA 2RA2A 4M7DF 3M58A 1VQ8T 2RD1A 4J5YA 4C92F 2MAMA 4GY5A 1W2BS 1FWZA 2P0QA 1P92A 4PJOA 1KC8C 3E1SA 1Y07A 2ZPIB 2HAXA 4F7UF 1M90U 2GFUA 1NJIU 5GAOp 3MP1A 2M0OA 4M7AA 3JCMX 3T9NA 3BY7A 3DLMA 3OYAA 4P5NA 2DVEA 1FXXA 4RCCA 1WJQA 3CCUT 2QQ9A 5FLXE 2MMPA 3FC3A 1Q7YU 4Y91A 4M77B 2VC8A 4M7DA 4C92A 2KAFA 3JCMg 2DIGA 3HKSA 1U8RA 4M78A 3ZEHA 2ZPFB 2QXFA 4XTWA 4M75E 4FL6A 2EYQA 1N9RA 2XG8D 4ME7A 3A5ZB 4PJOG 5HKCA 1BI3A 3I55A 3HSBA 5AYFA 3I56A 1UGPB 3QIIA 2RHUA 3TU4K 2P0PA 3UWNA 3OYKA 2XU8A 4J8OA 2YLBA 3MCAB 5GAMd 1VQMA 4RG8A 1KQSA 4M7AG 1K73U 3G7ZA 2RJFA 1RL2A 2FL7A 3FJPA 4M77F 4Y28E 4C8QC 3CMAT 5GAN6 4L59A 5J26A 4BY6C 1IZ6A 4IKFA 4VUBA 4R55A 1LOJA 1LNXA 2E64A 4XAXB 4BUGA 4QQ6A 4M7DG 5GMKe 2F5TX 3WVDB 5LL6S 4HCCA 2JZ2A 3M56A 2LCCA 1G3SA 3EFRA 3QXEB 3L1AA 1I4K1 3J80E 2HQEA 4M78G 4XU1A 1VQNA 2DAQA 2RK1A 3DB3A 4QVDA 3CC2A 5LJ3d 1YJ9T 3URGA 4JJNK 2PVGB 3LWHA 4MZPA 3UT1A 1OZ3A 4M77A 4MDWA 4X9DA 3CCEA 1UGSB 3PT9A 4BI8B 4JRKA 1N8RC 2QQBA 4J7FA 3PFSA 4XQ3A 3LW5E 3CC4T 3CXCS 5J3BA 2IVWA 4JRIA 3CCSA 2E5QA 1N27A 3UPUA 4DQ2A 1VIFA 3C12A 2PUKB 5HY6A 3L2WA 3CCLT 4E7KA 3M57A 3JCMc 5LJ5j 2CKKA 5CQXA 5LJ5g 5C0MA 4J6XA 2CYZB 3V7CA 1DJ7B 4EMKC 4OMFB 4LD9K 2V8JA 4JDSA 5I2MA 2MWOA 3H8ZA 4BDZA 1KC8U 1R8OB 4BACA 3JB9F 2RI2A 4KUIA 1VQLT 3GIBA 5GANf 1OI1A 1Q81C 1WGSA 2E12A 1YJWT 1K9MC 4M77G 2EIFA 2F69A 1V29B 2Y90A 1Y96B 3M4YA 3CCST 2PVDB 2IG0A 4M75B 2ZZDA 3KBGA 5A0DA 2VXEA 3RKWA 1YI2A 2FB7A 3OY9A 3S3MA 1VUBA 3V8KA 3GF5A 2LDMA 1PSFA 5GMKi 2LX9A 4ELZC 4NL3A 4JS4A 3ME9A 2LT1A 4FU6A 4E7HA 3OSSC 4WF2A 3CBMA 4ELYC 2L89A 1VQPA 1WJSA 3QBYA 2R58A 4ZTJA 1YHQT 3VJPA 1G3WA 4FSXA 3NFCA 3GNFB 5LJ5e 5GAOm 3MP6A 3G71A 4JLGA 1AHJB 4M75F 3OBWA 3JCMb 5LJ5h 4M7AD 5GAN2 3L2UA 3QPHA 4OB1B 1KQ2A 1YJNA 3V8LA 4UC4A 2FHDA 3WVEB 5GAN3 1OYXA 2WSFE 2LRQA 4C8QE 1VQ8A 2DZ9A 2ZGWA 3OYYA 4JS5A 3S6WA 2V8IA 3M5AA 3SWNB 4C0DC 4M7DD 3RMQA 4C92D 4KULA 3JB9G 3C95A 2XHCA 5GAMf 1YCYA 3M53A 4BE0A 2Y4YA 1BI1A 1Y7XA 1Y96A 4YTLA 2CZ1B 4N4GA 5DLQE 4F7UB 3QDRB 4IUPA 4M75A 3JB9J 5GMKl 3AHUA 4A4EA 5C6SA 1N8RU 4EMGA 3CCUA 2RB6A 2RM4A 3RKYA 1W2BA 2DD5A 1YJNT 3P8HA 2HNIA 4J83A 1KD1U 4CRIA 3OYLA 3CD6T 1U1TA 3QG1A 4XTYA 5FU7C 2DXBA 5LJ3f 5EG2A 2VV5A 3O8VA 2A7YA 2F5KA 2KQWA 3PIPA 2FYKA 2P0KA 3ZFJA 4II1A 4NL2A 5CKFA 1YIJT 5CVIA 4N0AA 2CGHA 5GMKj 5CAIA 4M78C 3INZA 1BIAA 1VIEA 1WPYA 2ZPBB 5D6WA 5I21A 4IUVA 2RHXA 4M75G 3DB4A 5DM7R 1K9MU 3MEVA 2CZ6B 3VKIA 2QI2A 4FIBA 4DOWA 2Y4XA 3CMAA 1U1SA 3LGFA 1XQHA 4M77D 3OYIA 4BE1A 1X75C 2RJEA 3SWNA 3LWIA 2QA4T 4E7LA 3QJYA 1I5LA 4N4IA 3NTHA 1VQ4T 2QEXA 4JRPA 2JVVA 1QVFA 2XD0A 4QVZA 2E70A 2EFIA 3OS5A 4OP0A 3SB2A 4DOVA 3CCJT 3CC7T 4F7UA 1M1KC 5DLOA 2K2VA 2XIDA 2LQKA 3S3NA 3OYFA 3NTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 A;  1Q82 U;  1QVG A;  2L8D A;  3CME T;  3OS2 A;  3OYD A;  3CC4 A;  1VQ9 A;  3MP8 A;  3PMI A;  3CCL A;  3OS1 A;  3MEU A;  2RJD A;  3H6Z A;  2L3R A;  2QEX T;  4ZN1 A;  3ER0 A;  2JNG A;  4OVA A;  2RJC A;  1VQL A;  1EIF A;  3MEW A;  4E7I A;  1YJW A;  2BKD N;  5FRM A;  2RHI A;  3G6E T;  3LYI A;  1VQ9 T;  4PL6 A;  3OYH A;  1XNI A;  5D6X A;  1KQS S;  1KHI A;  2BUD A;  2LCL A;  3KUF A;  2YRV A;  1NPP A;  3J7A F;  2X35 A;  3CCQ T;  1YHQ A;  3OYM A;  3DLL A;  2G3R A;  1H3Z A;  4C5E A;  1VQ7 A;  2LVM A;  2MI6 A;  2EQM A;  2RO0 A;  2JOY A;  1Q86 C;  2RHY A;  3CCM A;  4PLI A;  5M9O A;  1JJ2 A;  3P8D A;  1M1K U;  2X4W A;  3MEA A;  1M90 C;  1NJI C;  3MO8 A;  3S3O A;  4B9W A;  3OS0 A;  3LX7 A;  1VQ6 T;  2EQU A;  1VQ7 T;  2VYT A;  1S72 T;  4ZTF A;  1XTD A;  3CCV T;  3OQ5 A;  2WAC A;  3CD6 A;  3L2R A;  1RI0 A;  2GF7 A;  3CCM T;  3C4S A;  2O4X B;  3M9Q A;  1YIJ A;  2JUF A;  3L2Q A;  2JTF A;  4BD3 A;  3OYB A;  1BKB A;  2PQW A;  1M1G A;  3NTI A;  1VQ4 A;  2RHZ A;  3BDL A;  5IAY A;  3OA6 A;  3CCR T;  3CCJ A;  2QA4 T;  3CC7 A;  1NZ9 A;  4IUU A;  3ASK A;  2K3Y A;  1VQK T;  5CIU A;  4A4G A;  2M16 A;  3CME A;  4N4H A;  1Q81 U;  4IUT A;  2XK0 A;  4IUQ A;  4C5I A;  5KH6 A;  3E9F A;  2O4X A;  3E9G A;  1Q86 U;  5IT9 E;  5FRO A;  3OYN A;  1NPR A;  1YBY A;  2QQS A;  2OTL T;  3OB9 A;  3OYE A;  1UEB A;  3LGL A;  4E7J A;  2M1H A;  2LTO A;  3PMT A;  3G6E A;  5D6Y A;  1K8A C;  2E6N A;  1VQO A;  3FDR A;  3LH0 A;  3JAM E;  3PIO A;  2XDP A;  1YIT T;  3OYG A;  3Q1J A;  3CCQ A;  4IUR A;  3OMG A;  4QQD A;  5IN1 A;  1QVF S;  5KE3 A;  3CXC A;  3G4S A;  3CPF A;  2LQ8 A;  4A4H A;  2EQJ A;  1QVG S;  1VQO T;  3QJ6 A;  4A4F A;  2KDS A;  4ZN3 A;  3FEO A;  3J81 E;  3MET A;  3I55 T;  3P8B B;  3I56 T;  4LD6 A;  1G5V A;  3G4S T;  1VQ6 A;  4BDY A;  1VQM T;  5KCO A;  3GOX A;  1S72 A;  2OTJ A;  1OZ2 A;  3PNW C;  3OYJ A;  3CCV A;  4NS5 A;  2R5A A;  1KD1 C;  1WJR A;  3CEY A;  2EKO A;  2NLU A;  4EDU A;  1VQN T;  3EAE A;  3CC2 T;  4B9X A;  3CCE T;  2RI3 A;  4C5H A;  3LLR A;  2B8A A;  2DIQ A;  4RG2 A;  1K8A U;  1X6O A;  2OTJ T;  2KVQ G;  1Q7Y C;  5KE2 A;  2GFA A;  2R5M A;  3CCR A;  2QA4 A;  4TVR A;  3CPW A;  2EQK A;  4HCZ A;  3SD4 A;  2R57 A;  1VQ5 A;  2E6Z A;  4Z02 A;  4C5G A;  1VQK A;  1Q82 C;  2X4X A;  1JJ2 S;  2BIV A;  2MWP A;  2X4Y A;  1K73 C;  3L42 A;  3QKJ A;  3OMC A;  2D9T A;  3F70 A;  4X34 A;  1YI2 T;  2DO3 A;  2RI5 A;  1KHC A;  2OTL A;  4PLL A;  4QW2 A;  3OW2 A;  4BE2 A;  1VQ5 T;  5J39 A;  1VQP T;  5KCH A;  2HQX A;  2K3X A;  3G71 T;  4Q5W A;  3OYC A;  5A2Q E;  3TRE A;  1MHN A;  5FRN A;  1YIT A;  2QQR A;  3FLG A;  4QQG A;  1SSF A;  1VQ8 T;  1W2B S;  4GY5 A;  1KC8 C;  1M90 U;  2GFU A;  1NJI U;  3MP1 A;  2M0O A;  3DLM A;  3OYA A;  1WJQ A;  3CCU T;  5FLX E;  3FC3 A;  1Q7Y U;  2DIG A;  3HKS A;  3ZEH A;  3L2V A;  3I55 A;  4FL6 A;  3A5Z B;  3I56 A;  3QII A;  2RHU A;  3UWN A;  3OYK A;  1KQS A;  1VQM A;  1K73 U;  2RJF A;  1RL2 A;  3CMA T;  4L59 A;  5J26 A;  4IKF A;  1IZ6 A;  4QQ6 A;  5LL6 S;  2JZ2 A;  2LCC A;  3J80 E;  2HQE A;  1VQN A;  2DAQ A;  3DB3 A;  3CC2 A;  1YJ9 T;  3CCE A;  3UT1 A;  1OZ3 A;  1N8R C;  3PFS A;  3CC4 T;  3CXC S;  5J3B A;  3CCS A;  2E5Q A;  1N27 A;  3CCL T;  4E7K A;  5HY6 A;  3L2W A;  2CKK A;  5C0M A;  1KC8 U;  4BDZ A;  2MWO A;  3H8Z A;  4BAC A;  2RI2 A;  1VQL T;  1OI1 A;  1Q81 C;  1WGS A;  1YJW T;  1K9M C;  2EIF A;  3CCS T;  2IG0 A;  3KBG A;  1YI2 A;  3OY9 A;  3S3M A;  2LDM A;  3ME9 A;  4FU6 A;  4E7H A;  1VQP A;  2L89 A;  1WJS A;  3QBY A;  2R58 A;  4ZTJ A;  1YHQ T;  3G71 A;  3MP6 A;  3L2U A;  1YJN A;  4UC4 A;  2FHD A;  1OYX A;  2LRQ A;  1VQ8 A;  3OYY A;  3S6W A;  2XHC A;  4BE0 A;  3CPW S;  4YTL A;  5DLQ E;  4N4G A;  4IUP A;  4A4E A;  5C6S A;  1N8R U;  3CCU A;  1W2B A;  1YJN T;  3P8H A;  1KD1 U;  4CRI A;  3OYL A;  3CD6 T;  3O8V A;  3PIP A;  2F5K A;  2P0K A;  4II1 A;  1YIJ T;  3OW2 S;  5D6W A;  1K9M U;  4IUV A;  5DM7 R;  2RHX A;  3DB4 A;  3CMA A;  3MEV A;  3LGF A;  3OYI A;  4BE1 A;  2RJE A;  4E7L A;  4N4I A;  3NTH A;  1VQ4 T;  2QEX A;  2JVV A;  1QVF A;  4QVZ A;  2E70 A;  2EFI A;  3CC7 T;  3CCJ T;  1M1K C;  3S3N A;  3OYF A;  3NTK A; 
#chains in the Genus database with same CATH topology
 1YJ9 A;  1ZLM A;  2C06 A;  1YI2 Q;  4C8Q B;  3OYD A;  2MF2 A;  3QYH B;  1Y0M A;  4JUV A;  1VQ9 A;  3MP8 A;  3PMI A;  1JRI A;  1WHH A;  3N5B B;  3MEU A;  1HXD A;  5GAN j;  5GAN g;  1M90 R;  2CT4 A;  1WQ7 A;  4ZN1 A;  2DK3 A;  2KI7 A;  3OSV A;  2JNG A;  4F7U G;  2RJC A;  1QWF A;  1WHJ A;  4C8Q F;  4E7I A;  3JB9 D;  1YJW A;  3VYH B;  3FRN A;  2GBQ A;  1HJD A;  3LYI A;  1NYG A;  2J05 A;  1FYN A;  4PFZ A;  1YIJ Q;  1RAF B;  1ABQ A;  2HBP A;  3KUF A;  2EPD A;  4E6R A;  1ZBX A;  4GBQ A;  2M02 A;  3DLL A;  1JQQ A;  4C5E A;  5GAN h;  2CZ0 B;  4D8K A;  3EFO A;  3CC7 Q;  3JCM V;  1GFD A;  4M75 D;  2JOY A;  1ABO A;  4M4Z A;  1SG5 A;  4CC7 A;  2RHY A;  3CCM A;  3UAT A;  1RUW A;  4OGC A;  2X4W A;  1I1J A;  3S3O A;  4C8Q G;  2DXU A;  1TOV A;  4B9W A;  3VS4 A;  3BDU A;  2QEX Q;  2K5F A;  2VYT A;  3RIR A;  1VQ7 T;  4JZ4 A;  4Z89 A;  1V76 A;  4JZ3 A;  3UA7 A;  3HPW A;  2F2V A;  4ZGE B;  3TQ7 P;  3G6E Q;  3C4S A;  1X2K A;  2O4X B;  3IQL A;  4OB2 B;  2I0N A;  1K8A R;  2DTI A;  2DXT A;  2JTF A;  2JTE A;  4PJO C;  1OX9 A;  1M1G A;  3JCM d;  3NTI A;  1BI0 A;  3JSC A;  3CCQ Q;  2V26 A;  1X43 A;  1B07 A;  3EGD B;  1VQL Q;  5IAY A;  4XTV A;  3M0P A;  1M8M A;  1PG5 B;  3THK A;  1QQJ A;  1IHW A;  1X01 A;  1Q81 U;  2MOX A;  3QSU A;  1ZBJ A;  4RTW A;  2XK0 A;  3NGP A;  5KYX B;  4L6V 5;  3HTR A;  3OBY A;  4OML A;  5IT9 E;  3M0T A;  2QQS A;  2CP3 A;  1VQ6 Q;  4PK4 A;  5IHI A;  1ZSG A;  2GTJ A;  4BI4 A;  3LGL A;  4LNP A;  5IHK A;  1X6B A;  2HMA A;  1M1F A;  1B34 B;  2E6N A;  1VQO A;  4ZGJ B;  3OYG A;  1K4U S;  2OJ2 A;  1WNL A;  3M59 A;  3Q1J A;  4OGE A;  4IUR A;  4QQD A;  1QVF S;  3CXC A;  3CPF A;  2YRC A;  1ZHI A;  2ZCF B;  4A4F A;  1Q82 R;  4QVC A;  2QQA A;  4DBH A;  3VS7 A;  3J81 E;  2RQW A;  3P8B B;  3A8H B;  4LD6 A;  1G5V A;  2A3L A;  2DJZ A;  2K2M A;  1VQM T;  1X27 A;  4C92 E;  2AZS A;  3JCM h;  2OTL Q;  3PNW C;  1IRE B;  3TVT A;  4WCI A;  2CP5 A;  1KD1 C;  1WJR A;  4LDU A;  3A8G B;  3WXM B;  3EFS A;  5GJV B;  1TUG B;  2NLU A;  4F17 A;  4EDU A;  1N6A A;  2YXY A;  1YIT Q;  1OEB A;  3CCE T;  3VS2 A;  1NYF A;  4RG2 A;  1K8A U;  2OTJ T;  2DBK A;  2K5I A;  2GFA A;  5I2S A;  2CSI A;  1PC0 A;  2ESW A;  4TVR A;  3CPW A;  5GAN 4;  3HP9 A;  2R57 A;  4M77 E;  1SEM A;  2E1H A;  1N9S A;  4RTU A;  1QLY A;  4PJO B;  1K73 C;  1SRL A;  3MPU B;  3L42 A;  2EAY A;  1QP3 A;  2FPE A;  1UDL A;  1QKW A;  4KGV B;  3I55 Q;  1YI2 T;  2ROL A;  4PLL A;  3ZBD A;  4HCB A;  4IIM A;  3OW2 A;  2DRM A;  2DE0 X;  4PJO F;  2DPP B;  2K3X A;  2LC4 A;  4Q5W A;  3SFM A;  3G71 T;  2COW A;  4A53 A;  1NLP C;  2ECZ A;  1LPL A;  1HK9 A;  1WI7 A;  3M0R A;  4PNO A;  1VQN Q;  2M51 A;  1GBR A;  3FLG A;  1E7O A;  4GY5 A;  3CXC P;  2HEQ A;  2HAX A;  2KT1 A;  4M7A A;  1PWT A;  1WJQ A;  2QGF B;  2YUN A;  1KJW A;  2QQ9 A;  2F2W A;  4M7D A;  2DIG A;  3HKS A;  4J9G A;  2QXF A;  1K9M R;  4ME7 A;  4PJO G;  2XMF A;  1BI3 A;  3HSB A;  1PKS A;  1ZA1 B;  2IIM A;  2YRD A;  3UWN A;  5KYX A;  1VQM A;  2QAZ A;  3G7Z A;  1RL2 A;  1G8X A;  1JXO A;  3VRY A;  4L59 A;  2MYS A;  2E64 A;  4J9I A;  4QQ6 A;  2JZ2 A;  2LCC A;  1I4K 1;  2DAQ A;  4JJN K;  2PVG B;  4OMN A;  4MZP A;  3CCE A;  1OZ3 A;  4MDW A;  2OX7 A;  1N8R C;  1VQ8 Q;  4XQ3 A;  2BZ8 A;  3A98 A;  3LW5 E;  1FMK A;  2IVW A;  3H0F A;  4JRI A;  3RNJ A;  3MKD A;  3UPU A;  4E7K A;  3L2W A;  3CPW P;  2COY A;  5LJ5 j;  1D0Y A;  5CQX A;  5LJ5 g;  5C0M A;  4AMC A;  2CYZ B;  2EYZ A;  1RI9 A;  2RI2 A;  4KUI A;  4R0K A;  1VQL T;  5GAN f;  1Q81 C;  1G2B A;  2GNC A;  2X9H A;  3CCS T;  2IG0 A;  2RQR A;  2ZZD A;  1YI2 A;  1VUB A;  3OW2 P;  2LDM A;  4FU6 A;  4E7H A;  3CBM A;  3SHW A;  4ELY C;  2DL7 A;  1SRM A;  1BBZ A;  1MV0 B;  2FPD A;  4ZTJ A;  3VJP A;  1YHQ T;  2ED1 A;  3G71 A;  7AT1 B;  2FG0 A;  1D0Z A;  1RAE B;  5LJ5 h;  1KQ2 A;  1SHG A;  5GAN 3;  1MND A;  2WSF E;  4C8Q E;  1TSF A;  1ZSZ A;  1PKT A;  4C0D C;  3C95 A;  3CC4 Q;  3M53 A;  1Y7X A;  3QDR B;  4M75 A;  1MMN A;  5IH2 A;  1NEG A;  2DD5 A;  1UHC A;  2CP6 A;  2QYZ A;  1U06 A;  3CD6 T;  4J9F A;  2F5K A;  2FYK A;  2E3H A;  5GMK j;  4M78 C;  1WXU A;  3INZ A;  1HSQ A;  1K9M U;  3TSW A;  5DM7 R;  1UFF A;  2O9V A;  2Y4X A;  4LN2 A;  2RJE A;  1CKA A;  2K7A A;  4RUG A;  1VQ4 T;  2QEX A;  1X6G A;  1QVF A;  2XD0 A;  2E70 A;  4DOV A;  1M1K C;  5DLO A;  2LX7 A;  4JPB W;  1U3O A;  4OMO A;  3NTK A;  4DA4 A;  2PVO B;  3EG3 A;  3CME T;  3OS2 A;  3EHR A;  2W0Z A;  2JJ9 A;  3OS1 A;  3V8J A;  2RJD A;  3H6Z A;  2L3R A;  4C92 G;  2HKQ B;  1NJI R;  3EFO B;  1PNJ A;  4O5V A;  2DZC A;  5GMK h;  4PJL A;  2OAU A;  1VQL A;  1EIF A;  2E4H A;  2GCX A;  1T0H A;  2RN8 A;  1I81 A;  2BKD N;  2RHI A;  3QHS A;  1AZG B;  2RK2 A;  3REA B;  3RDV A;  1VQ9 T;  3JCM Q;  2YUP A;  5KYU A;  1JEG A;  3D7S B;  2JW4 A;  4E47 A;  1U5S A;  1PCX A;  2X35 A;  1PSE A;  2HSP A;  2NUT A;  2SEM A;  1YHQ A;  3OYM A;  3JCM f;  3VS5 A;  1H3Z A;  3SEM A;  2MI6 A;  1K76 A;  1Q86 C;  2VUB A;  4PLI A;  5CKH A;  4JJD A;  4A63 B;  4O6J A;  4RKU E;  2AT1 B;  3A8O B;  4FYW B;  4ZTF A;  1S72 T;  1XTD A;  2JTM A;  4EMK A;  3H0I A;  1O9S A;  4JLI A;  2WAC A;  2LT4 A;  3CD6 A;  3L2R A;  1RI0 A;  3CCM T;  1ARK A;  4LUE A;  1VOM A;  1KIK A;  2RH2 A;  1WFW A;  1FMW A;  5HCK A;  2DVJ A;  2O2O A;  1TTH B;  2M9U A;  2RNA A;  2VXF A;  1QVF P;  4M7A C;  1VQ4 A;  2RQV A;  1NZ9 A;  2AK5 A;  3UA6 A;  4M7D C;  2K3Y A;  1D3B A;  3CME A;  4M78 B;  2NWM A;  3HRT A;  3X20 B;  1AWW A;  2K4Y A;  2QDL A;  1JO8 A;  2XI9 A;  3C94 A;  5KH6 A;  1M4Z A;  4LDY A;  1UJY A;  1CKB A;  3QYG B;  2DLP A;  5CQY A;  2L5Q A;  2DXC A;  3OYE A;  1UEB A;  4M78 F;  2K79 A;  3CCV Q;  2K6D A;  4A54 A;  1OPL A;  4J6Y A;  1QMC A;  3A8M B;  1M8V A;  5D6Y A;  2LNV A;  1Z9Z A;  2LP5 A;  3FDR A;  4R56 A;  4QT7 A;  3JAM E;  3PIO A;  2XDP A;  2XKO C;  2YT6 A;  1I07 A;  1WHL A;  2DEQ A;  2SRC A;  3OMG A;  1PHT A;  1VA7 A;  2CZ7 B;  2RQU A;  3NHN A;  5HK0 A;  5GAO n;  4HA8 A;  4Z8A A;  2J6O A;  2LQ8 A;  3CCR Q;  4A4H A;  3JRZ A;  4K11 A;  1VQO T;  3QJ6 A;  2AHJ B;  2KGT A;  4PJO E;  1IRX A;  3CQT A;  1SPK A;  1VQK Q;  4FT2 A;  4OMM A;  2D0Q B;  2CSQ A;  3JV3 A;  2DEU A;  4HT8 A;  2X4J A;  1S72 A;  1FMV A;  4C0F A;  2DX1 A;  1QCN A;  1G3Y A;  1RLQ C;  4XTU A;  2OAW A;  3EAE A;  1JXM A;  3CC2 T;  2VGN A;  1WX6 A;  4B9X A;  1SHF A;  1ZSZ C;  2DIQ A;  5GAO l;  2KVQ G;  1Q7Y C;  1X2Q A;  1YWP A;  2R5M A;  1KC8 R;  2WSC E;  4M75 C;  3TSZ A;  2YWW A;  3M0S A;  4HCZ A;  3SD4 A;  4LDW A;  4V2S A;  2DL3 A;  4FT4 A;  2E6Z A;  2KRO A;  2QTV A;  9ATC B;  3PVL A;  4FSS A;  1M3C A;  5LJ5 f;  2HL5 C;  2KSS A;  3M54 A;  2ZPE B;  1C0M A;  3OMC A;  4M7A B;  3AT1 B;  1OOT A;  2HBW A;  3I56 Q;  2DO3 A;  3G4S Q;  1KHC A;  1UGR B;  2EGC A;  1UB4 A;  4M7D B;  2V1R A;  4PFP A;  2FZC B;  1GRI A;  1NEB A;  2YUO A;  3EG1 A;  1C1A A;  4M7A F;  3OYC A;  1R77 A;  1MHN A;  4E2F B;  2FPF A;  4PJN A;  3EGU A;  1XOV A;  2QQR A;  4QQG A;  1AWJ A;  1SSF A;  4M7D F;  3M58 A;  2HQH A;  1P92 A;  2RQT A;  1Y07 A;  4HVV A;  1M90 U;  2GFU A;  1KK7 A;  2M0O A;  3JCM X;  3T9N A;  4HVW A;  3BY7 A;  2YDL A;  4RCC A;  3NMZ C;  4F16 A;  2P4R A;  4Y91 A;  3RBB B;  2KAF A;  4J9D A;  3JCM g;  1UTI A;  2LQN A;  4M78 A;  2E5K A;  1N9R A;  5HKC A;  3TU4 K;  3OYK A;  2XU8 A;  4J8O A;  5GAM d;  4M7A G;  4RG8 A;  4Y28 E;  3CMA T;  5J26 A;  4E7S A;  4BY6 C;  4IKF A;  1VQ5 Q;  4VUB A;  4BUG A;  4XAX B;  4M7D G;  4HCC A;  3EFR A;  1N5Z A;  3L1A A;  3J80 E;  3QWY A;  2HQE A;  5AT1 B;  1MUZ A;  3DB3 A;  3CC2 A;  5LJ3 d;  4X9D A;  1I0C A;  4JRK A;  4J7F A;  2E5Q A;  2EKH A;  1N27 A;  3CCL T;  1VIF A;  1Z9Q A;  3C12 A;  5HY6 A;  2C0T A;  1C6V X;  3M57 A;  3JCM c;  1YN8 A;  4J6X A;  2IPO B;  4EMK C;  1KC8 U;  2MWO A;  6AT1 B;  3CCU Q;  4BAC A;  3JB9 F;  1OI1 A;  4AG2 C;  1ZSZ B;  1H3H A;  2E12 A;  4LXC A;  2F69 A;  1V29 B;  4D8D A;  4OMQ A;  3M4Y A;  4M75 B;  3KBG A;  3OY9 A;  3S3M A;  4NL3 A;  4WF2 A;  4QKU A;  1OUL A;  2L89 A;  3QBY A;  1G3W A;  3NFC A;  5GAO m;  2KXC A;  4FYY B;  4JJB A;  4M75 F;  1AHJ B;  3OBW A;  5IHN A;  3V8L A;  2FHD A;  2CP0 A;  1YJ9 Q;  2DZ9 A;  1AWX A;  3S6W A;  2V8I A;  2MIO A;  3RMQ A;  4C92 D;  4KUL A;  3JB9 G;  2XHC A;  1YCY A;  2KNB B;  2Y4Y A;  1Y96 A;  2CZ1 B;  5DLQ E;  4IUP A;  5GMK l;  3H41 A;  2K3B A;  4A4E A;  4PJJ A;  4EMG A;  2RB6 A;  1MMA A;  3RKY A;  1W2B A;  3VS0 A;  3EHQ A;  4J83 A;  3OYL A;  1BCM A;  1H92 A;  5FU7 C;  2DXB A;  1YJW Q;  3O8V A;  5KYY A;  2A36 A;  5CKF A;  1YIJ T;  5CVI A;  2QAS A;  2CT3 A;  1PD1 A;  5I21 A;  1BIA A;  1VIE A;  1WPY A;  2C0I A;  2E3I A;  4M75 G;  3CMA A;  4DOW A;  2DJQ A;  2X3W D;  4M77 D;  3OYI A;  1X75 C;  3SWN A;  1RAI B;  1I5L A;  3NTH A;  2EFI A;  3CC7 T;  5KYU B;  5KCO A;  2CH4 A;  2AIR B;  2LCS A;  1Q82 U;  2L2P A;  4BB7 A;  2QTX A;  4KT0 E;  1LCK A;  2NUT B;  1NE8 A;  2HKN A;  3HFO A;  3CBO A;  3CCL A;  1TWB A;  1Y71 A;  2QEX T;  3JB9 I;  3ER0 A;  4D6W A;  1R0C B;  3MEW A;  1CSK A;  1YJN Q;  5GAO r;  1JB0 E;  3G6E T;  1TUD A;  4BI3 A;  1JBM A;  4PL6 A;  3OYH A;  4XTZ A;  1KQS S;  1KHI A;  2BUD A;  2LCL A;  1TXQ A;  2YRV A;  4EMK B;  2QK0 A;  2A0F B;  4FYX B;  3CCQ T;  2VWF A;  2KK4 A;  2BZY A;  4FYV B;  1LVK A;  2MK5 A;  4ZNX A;  5ECA A;  4OF1 A;  2RF0 A;  5IXB A;  2DD4 A;  3I5S A;  2EQM A;  4M78 E;  1YP5 A;  4L5G A;  4LDV A;  2CP2 A;  3E2U A;  5GJW B;  3HRU A;  3P8D A;  2YSQ A;  1OV3 A;  3MEA A;  1M90 C;  3MO8 A;  5CO7 A;  4IIO A;  3OS0 A;  3LX7 A;  1VQ6 T;  2DKG A;  2JM8 A;  1D3B B;  2O9S A;  1BCO A;  3DKM A;  1IXD A;  1KFZ A;  3OQ5 A;  2DTH A;  5CKD A;  3V7S A;  3QO3 A;  2ATC B;  2X51 A;  2E65 A;  2FRW A;  5GAM e;  3L2Q A;  1YIJ A;  2EJ9 A;  4CC2 A;  4A4K A;  3E19 A;  1SF9 A;  2M0Y A;  1WYX A;  1BKB A;  2PQW A;  2DIL A;  4MZM A;  3KXT A;  1K1Z A;  2RHZ A;  3OA6 A;  1Y57 A;  5FU7 B;  2KY9 A;  3PGG A;  3CC7 A;  5LJ3 e;  3MHX A;  3ASK A;  3ZL7 C;  4RTY A;  5GMK m;  5DY9 A;  2M16 A;  1RAA B;  1AT1 B;  3JCM J;  1ZA2 B;  1PM3 A;  4IUT A;  1PRM C;  1M27 C;  2LMJ A;  2ZPG B;  2BTT A;  3E9F A;  3SDZ A;  3E9G A;  1WHK A;  5FRO A;  1NPR A;  4GLM A;  2OTL T;  4J9E A;  1NM7 A;  3OB9 A;  1VQ7 Q;  4E7J A;  1GFC A;  2LTO A;  3PMT A;  3HHT B;  1K0X A;  4C8Q D;  3G6E A;  1KD1 R;  1MV3 A;  1K8A C;  2GQV A;  2HD0 A;  2KEA A;  3LH0 A;  1YIT T;  2XDB A;  3JCM W;  3GP8 A;  3CCQ A;  4OB3 B;  3X28 B;  2COZ A;  4OB0 B;  1WXB A;  2K5L A;  5KE3 A;  3G4S A;  3VV0 A;  3QDF A;  4GLK A;  4FM4 B;  2EQJ A;  1QVG S;  2QDY B;  3I35 A;  3PE0 A;  2KDS A;  4ANJ A;  4ZN3 A;  1WQW A;  2HCK A;  4C0G A;  4M7A E;  1K73 R;  3MET A;  3I55 T;  4BDY A;  1VQ6 A;  3VUB A;  4M7D E;  1UGV A;  3CCJ Q;  2FO0 A;  3OYJ A;  2L0A A;  2H3E B;  4KUD K;  4NS5 A;  2BE7 D;  2R5A A;  1UG1 A;  1NBE B;  1D1B A;  2YLC A;  2L3Q A;  5FWC A;  1BU1 A;  3CEY A;  1I8F A;  3X26 B;  1PRL C;  2EKO A;  2CH4 W;  2DFU A;  1QW1 A;  2D0N A;  3KFV A;  5L23 A;  3BE3 A;  1VQN T;  2J7I A;  3EGX A;  5A0G A;  2I2L A;  2NYS A;  2RI3 A;  4C5H A;  2W10 A;  3LLR A;  2DNU A;  4CC3 A;  2B8A A;  2PU9 B;  2FZK B;  1X6O A;  2CUD A;  3RR6 A;  2G6F X;  4MML A;  2NUP A;  1GL5 A;  1EX4 A;  2LZ6 B;  1M9S A;  2EQK A;  4C0D B;  1I5O B;  4KGZ B;  1R0B G;  1VQ5 A;  4ORZ A;  4C5G A;  1OU9 A;  1Q82 C;  2X4X A;  1JJ2 S;  3EG9 A;  2MWP A;  2X4Y A;  1T0J A;  4HT9 A;  5FWB A;  1LJO A;  5GAN 8;  4HKE A;  5I22 A;  3LH5 A;  3HL8 A;  5KYW A;  1UHF A;  2RI5 A;  3QZ5 B;  4QW2 A;  2OTL A;  1VQM Q;  3SWN C;  4BE2 A;  1WLP B;  1VYV A;  2CS7 A;  3M4G A;  1AOJ A;  3H0H A;  2EGE A;  2MCN A;  2HQX A;  1W4S A;  4XTX A;  1M3B A;  3R6O A;  5GAN d;  2ED0 A;  2LJ0 A;  3TRE A;  5FRN A;  1GCQ A;  1YIT A;  2EJG A;  1QVP A;  1MNE A;  2KXD A;  1VQ8 T;  3PVQ A;  2RD1 A;  4J5Y A;  3CCE Q;  2MAM A;  1W2B S;  3E1S A;  2OTJ Q;  1N8R R;  4F7U F;  1NJI U;  2F1L A;  2J6K A;  1WDX A;  1MMD A;  4RTT A;  1RAB B;  3OYA A;  1M3A A;  3GBQ A;  2L3P A;  4C92 A;  4X1V A;  1M2V A;  1WHM A;  1U8R A;  2EYX A;  2PZ1 A;  1Q81 R;  1M30 A;  2AZV A;  4M75 E;  2XG8 D;  3I55 A;  3A5Z B;  1B3Q A;  1SSH A;  2ZAE A;  1GBQ A;  5AYF A;  1UGP B;  4J9C A;  1KQS A;  1K73 U;  2QA4 Q;  2FL7 A;  3FJP A;  1WZO A;  1W70 A;  4KRT A;  4KGX B;  2CP7 A;  4B6M A;  4R55 A;  1LOJ A;  1LNX A;  5GMK e;  2DA9 A;  3O5Z A;  3G71 Q;  4M78 G;  3M0U A;  4XU1 A;  1VQN A;  2DRK A;  3URG A;  2DET A;  3LWH A;  3UT1 A;  1KG1 A;  4M77 A;  4BI8 B;  3PT9 A;  1OU8 A;  2KYM A;  3CC4 T;  5I11 A;  4ATO A;  2CKK A;  1KSW A;  1DJ7 B;  2ROT A;  4OMF B;  4LD9 K;  3EG2 A;  2V8J A;  4JDS A;  5I2M A;  4BDZ A;  1R8O B;  2DYB A;  3GIB A;  1WGS A;  1K9M C;  1AD5 A;  2Y90 A;  1Y96 B;  2OI3 A;  5A0D A;  2FB7 A;  2EQI A;  3NPF A;  4HXJ A;  3GF5 A;  1YCS B;  5GMK i;  4ELZ C;  4J9H A;  2JM9 A;  2A08 A;  4PJO D;  2DER A;  5KYY B;  2KRN A;  1RAG B;  1TG0 A;  2ABL A;  2JT4 A;  3JCM b;  5GAN 2;  1YJN A;  1M1K R;  2EBP A;  3WVE B;  1OYX A;  3UF4 A;  4DBR A;  1VQ8 A;  3M5A A;  3SWN B;  4BE0 A;  4YTL A;  5C6S A;  1N8R U;  2RMO A;  1UEC A;  4KH0 B;  2KYB A;  1ZUU A;  4CRI A;  1AVZ C;  2CUB A;  1U1T A;  3QG1 A;  4XTY A;  2D8H A;  1TS9 A;  2VV5 A;  1QKX A;  2P0K A;  5EC7 A;  3ZFJ A;  2PTK A;  4NL2 A;  3R6N A;  1KQS P;  3CCS Q;  4DBF A;  1SKU B;  2CGH A;  4RTZ A;  2RHX A;  3DB4 A;  2CZ6 B;  3VKI A;  2QI2 A;  4FIB A;  1RAC B;  1U1S A;  3LGF A;  1XQH A;  4E7L A;  3QJY A;  4N4I A;  4JRP A;  2JVV A;  1YHQ Q;  4QVZ A;  3SB2 A;  3CCJ T;  4F7U A;  2K2V A;  2XID A;  2BE9 B;  2FZG B;  3S3N A;  2L8D A;  2DM1 A;  1QVG A;  5CKE A;  5L8R E;  2B86 A;  1Q86 R;  5FU6 C;  3CC4 A;  3MJX A;  4LDX A;  3EG0 A;  4EPC A;  4AFQ C;  1VQP Q;  1QP2 A;  4MZT A;  2D8J A;  4AFS C;  4X9C A;  4OVA A;  5GAO q;  2VAS A;  4F14 A;  4FCY A;  1UUE A;  1G83 A;  2KT8 A;  2PUO B;  4NOY A;  5FRM A;  2EWN A;  3CD6 Q;  1AZE A;  3GLX A;  1XNI A;  1W6X A;  5D6X A;  1H64 1;  2K57 A;  2ZPH B;  3TCJ A;  1NPP A;  3J7A F;  4LE9 A;  4XU0 A;  1V1C A;  3M0Q A;  2LQW A;  4C8Q A;  5GAN e;  2V1Q A;  4DEY A;  1M5Q 1;  2G3R A;  1VQ4 Q;  1VQ7 A;  1AWO A;  2LVM A;  3FB9 A;  5GAM j;  3RUX A;  5CKB A;  5GAM g;  2RO0 A;  2JMA A;  4AFZ C;  2JS0 A;  1BYM A;  5CR2 A;  5M9O A;  2A28 A;  3CME Q;  3VU3 C;  1JJ2 A;  2WSE E;  1M1K U;  3L2Z A;  2JMC A;  5CK9 A;  1MGQ A;  1NJI C;  3BFM A;  5LJ3 j;  2EQU A;  5LJ3 g;  3G1J A;  3X24 B;  3CCV T;  3RMS A;  2DL5 A;  3RKX A;  2YUQ A;  2GF7 A;  1GCQ C;  3GPL A;  3M9Q A;  1VQ9 Q;  2JUF A;  4OMP A;  4EMH A;  3PTA A;  1IB8 A;  5GAM h;  2O01 E;  3A1P A;  4BD3 A;  3OYB A;  3CBP A;  1YFN A;  4XK8 E;  1J3T A;  1BK2 A;  1K9A A;  4N0A C;  2HL3 A;  1OQK A;  2H8H A;  3BDL A;  3FJ5 A;  3JB9 H;  1K0S A;  2LJ3 A;  3CCR T;  2FVU A;  4IUU A;  1QCO A;  4C0Z A;  2XDD A;  3CCJ A;  2QA4 T;  4AFU C;  2EVR A;  1QVG P;  2E41 A;  1UGQ B;  5LJ3 h;  1KQ1 A;  4C92 C;  2DYI A;  3UDC A;  1VQK T;  1TH7 A;  5CIU A;  4A4G A;  4CI0 C;  1H8K A;  4N4H A;  4KH1 B;  1T3S A;  4IUQ A;  4C5I A;  2P84 A;  2O4X A;  1F1B B;  1Q86 U;  3QZ9 B;  1NLO C;  3OYN A;  1YBY A;  2ENM A;  4PFO A;  3REB B;  1S72 Q;  3ULR B;  1E6G A;  2VVK A;  4XU2 A;  4J9B A;  2M1H A;  2P4T A;  3VUZ A;  3HRS A;  5FU6 B;  2E10 A;  3EGD A;  2F2X A;  3CCM Q;  3VS1 A;  4BY6 B;  4PKC C;  4WTO B;  8ATC B;  5LJ5 d;  2FEI A;  4M77 C;  4RMO A;  4JJC A;  1EFN A;  1W1F A;  2KRS A;  4MDX A;  3M55 A;  1BIB A;  1G3T A;  4RCB A;  4MMK A;  4XU3 A;  5IN1 A;  1Q7Y R;  1WIE A;  3V7R A;  2GGR A;  3EGX B;  2LNH B;  2J06 A;  1IGU A;  3BW1 A;  1ACM B;  2GQI A;  5A0L A;  2BZX A;  1JJ2 P;  5FW9 A;  2DTO A;  2KBT A;  1WHG A;  2L3S A;  5CCA A;  3X25 B;  3FEO A;  1RAD B;  4E7Z A;  2D6F A;  2JXB A;  2NUP B;  1ZQ1 A;  4JRQ A;  3QWX X;  1B34 A;  4RTX A;  3I56 T;  5GAN 7;  3JCM e;  3G4S T;  2PNI A;  3GOX A;  1WA7 A;  2HDA A;  2OTJ A;  1BB9 A;  1OZ2 A;  3CCV A;  3EG9 B;  4F7U E;  1ZUY A;  5HK3 A;  3RER A;  3JCM P;  2EW3 A;  1YNZ A;  1O75 A;  1B7T A;  5KYW B;  1E6H A;  2YHT A;  3A8L B;  2MPX C;  2CDT A;  1W2B P;  5KE2 A;  2XIC A;  3GNG A;  2JS2 A;  1TUC A;  2GTO A;  3FIF A;  3CCR A;  2QA4 A;  2DL4 A;  1GCP A;  3TEE A;  2JN0 A;  3VS6 A;  4J7I A;  2V8K A;  4J6W A;  1EZZ B;  4Z02 A;  4HCK A;  1VQK A;  1VQO Q;  4RTV A;  2BIV A;  2K9G A;  2DL8 A;  2H3J A;  2J6F A;  3RES A;  5GAN 5;  3QKJ A;  2D9T A;  3VYG A;  3F70 A;  2EJF A;  5KYN A;  4X34 A;  4HVU A;  2AKK A;  4ZGD B;  3QUI A;  4C92 B;  2KMT A;  2VGM A;  5J39 A;  1VQ5 T;  2DBM A;  1M2V B;  2RPN A;  1VQP T;  1HYO A;  1YWO A;  4M78 D;  1BI2 A;  5KCH A;  4KBM B;  5A2Q E;  2NUZ A;  4FW2 A;  1QCF A;  1FX7 A;  2FRY A;  3HFN A;  3CC2 Q;  2RA2 A;  4C92 F;  1S1N A;  1FWZ A;  2P0Q A;  2EGA A;  4PJO A;  1KC8 C;  1OX8 A;  2ZPI B;  1AEY A;  2KE9 A;  2D1X A;  4AT1 B;  5GAO p;  3MP1 A;  3DLM A;  4P5N A;  2DVE A;  1FXX A;  1ZUK A;  4F04 B;  3CCU T;  5FLX E;  2MMP A;  2EYY A;  3FC3 A;  1Q7Y U;  4M77 B;  2VC8 A;  4CC4 B;  3ZEH A;  1HD3 A;  2ZPF B;  3C0C A;  3L2V A;  4XTW A;  4FL6 A;  2EYQ A;  1T3L A;  3I56 A;  3QII A;  1IGQ A;  2RHU A;  2P0P A;  1X69 A;  2YLB A;  3MCA B;  2VKN A;  2RJF A;  2KR3 A;  3I5R A;  4M77 F;  4C8Q C;  5GAN 6;  1IZ6 A;  2HSE B;  2F5T X;  3WVD B;  5LL6 S;  3M56 A;  1G3S A;  2X3X D;  3QXE B;  1A0N B;  2A37 A;  1RAH B;  2RK1 A;  4EIK A;  4QVD A;  1YJ9 T;  1VYU A;  1D0X A;  1NG2 A;  4Z88 A;  1UGS B;  1TU0 B;  2C0O A;  1OPK A;  1UE9 A;  4ESR A;  1M2O A;  2QQB A;  4FW1 A;  1MMG A;  3EH1 A;  3PFS A;  3CXC S;  5J3B A;  1PD0 A;  5IXF A;  3CCS A;  4DQ2 A;  2PUK B;  1IO6 A;  4AG1 C;  2VB6 A;  1Q95 G;  3V7C A;  2CRE A;  3H8Z A;  2DF6 A;  2QGG A;  1ZX6 A;  2HZY A;  3VRZ A;  1YJW T;  8AT1 B;  4M77 G;  4PJM A;  1UJ0 A;  2EIF A;  2QG9 B;  2PVD B;  3H9N A;  2VXE A;  3RKW A;  3V8K A;  1PSF A;  2LX9 A;  1RLP C;  2O31 A;  4JS4 A;  3ME9 A;  2LT1 A;  3OSS C;  3CMA Q;  1VQP A;  1WJS A;  4Y92 A;  5D7U A;  2R58 A;  1GXI E;  4FSX A;  5LJ5 e;  3GNF B;  3MP6 A;  1JU5 C;  1D1A A;  4JLG A;  1D1C A;  2KRM A;  2DMO A;  2LJ1 A;  4M7A D;  3U23 A;  3L2U A;  3QPH A;  4OB1 B;  4DEX A;  4UC4 A;  2Z0W A;  2LRQ A;  1WXT A;  2ZGW A;  3OYY A;  4JS5 A;  4M7D D;  3I9Q A;  3EH2 A;  5GAM f;  2O88 A;  3CPW S;  1BI1 A;  3CCL Q;  4N4G A;  4DBQ A;  4F7U B;  3AHU A;  3JB9 J;  3CCU A;  2RM4 A;  1IHV A;  2EYW A;  1YJN T;  3P8H A;  2HNI A;  1KD1 U;  1XJW B;  5LJ3 f;  5EG2 A;  1D09 B;  2A7Y A;  2KQW A;  1QWE A;  3PIP A;  4II1 A;  4N0A A;  5CAI A;  3OW2 S;  2ZPB B;  5D6W A;  4IUV A;  3MEV A;  4BE1 A;  3LWI A;  2AKL A;  1VYT A;  4LUD A;  3OS5 A;  4OP0 A;  2LQK A;  3OYF A;  3VS3 A; 
#chains in the Genus database with same CATH homology
 1YJ9 A;  4DA4 A;  2PVO B;  2L8D A;  1Q82 U;  1QVG A;  2C06 A;  4BB7 A;  2QTX A;  5CKE A;  5L8R E;  4KT0 E;  3OS2 A;  3CME T;  4C8Q B;  3OYD A;  2MF2 A;  5FU6 C;  3QYH B;  3CC4 A;  4JUV A;  1VQ9 A;  1NE8 A;  3MP8 A;  3PMI A;  4LDX A;  3HFO A;  1JRI A;  3CBO A;  3OS1 A;  3CCL A;  3V8J A;  3N5B B;  3MEU A;  1HXD A;  2RJD A;  3H6Z A;  4EPC A;  2L3R A;  1QP2 A;  5GAN g;  5GAN j;  4ATO A;  1WQ7 A;  1Y71 A;  4MZT A;  4C92 G;  2QEX T;  4ZN1 A;  2DK3 A;  3JB9 I;  3ER0 A;  4D6W A;  3OSV A;  4O5V A;  2JNG A;  2DZC A;  4OVA A;  4X9C A;  5GMK h;  4F7U G;  2RJC A;  5GAO q;  2OAU A;  1VQL A;  1EIF A;  2GCX A;  3MEW A;  4E7I A;  4C8Q F;  5GAO r;  1JB0 E;  3JB9 D;  1YJW A;  3VYH B;  2PUO B;  1KG1 A;  1I81 A;  2BKD N;  4NOY A;  3FRN A;  2EWN A;  2RHI A;  3G6E T;  5FRM A;  3QHS A;  4BI3 A;  3LYI A;  2RK2 A;  1JBM A;  1VQ9 T;  3JCM Q;  3GLX A;  4PL6 A;  1XNI A;  4XTZ A;  5D6X A;  3OYH A;  1KQS S;  1KHI A;  1H64 1;  2BUD A;  4PJO D;  2LCL A;  2K57 A;  2ZPH B;  2HBP A;  3KUF A;  3TCJ A;  2YRV A;  4E47 A;  1NPP A;  4EMK B;  3J7A F;  2X35 A;  4XU0 A;  3CCQ T;  1ZBX A;  1PSE A;  4C8Q A;  2KK4 A;  5GAN e;  1YHQ A;  3OYM A;  3JCM f;  1M5Q 1;  2G3R A;  3DLL A;  1QVF S;  1H3Z A;  4C5E A;  5GAN h;  1VQ7 A;  4OF1 A;  2CZ0 B;  2LVM A;  3JCM V;  2MI6 A;  3FB9 A;  5GAM j;  2DD4 A;  4M75 D;  5CKB A;  3RUX A;  2EQM A;  4M78 E;  5GAM g;  2RO0 A;  2JOY A;  1Q86 C;  2VUB A;  4L5G A;  1BYM A;  2RHY A;  4LDV A;  4PLI A;  5M9O A;  5CR2 A;  3CCM A;  3VU3 C;  3HRU A;  1JJ2 A;  3P8D A;  2WSE E;  1M1K U;  3L2Z A;  2X4W A;  3MEA A;  4OGC A;  5CKH A;  5CK9 A;  1M90 C;  1MGQ A;  1NJI C;  3MO8 A;  3S3O A;  4C8Q G;  2DXU A;  5CO7 A;  3BFM A;  4B9W A;  3OS0 A;  3LX7 A;  4O6J A;  1VQ6 T;  4RKU E;  2DKG A;  3BDU A;  2K5F A;  2EQU A;  3A8O B;  5LJ3 j;  5LJ3 g;  2VYT A;  3RIR A;  4ZTF A;  1S72 T;  1XTD A;  1VQ7 T;  1D3B B;  3X24 B;  2JTM A;  3CCV T;  4EMK A;  3DKM A;  3RMS A;  1O9S A;  3OQ5 A;  4JLI A;  2WAC A;  2DTH A;  2LT4 A;  5CKD A;  3CD6 A;  3V7S A;  3L2R A;  3RKX A;  3HPW A;  1RI0 A;  3QO3 A;  2GF7 A;  4ZGE B;  3CCM T;  3C4S A;  2E65 A;  2O4X B;  3GPL A;  4OB2 B;  3M9Q A;  5GAM e;  3L2Q A;  2JUF A;  4EMH A;  2DTI A;  1YIJ A;  2DXT A;  2EJ9 A;  3PTA A;  4A4K A;  2RH2 A;  5GAM h;  3E19 A;  2O01 E;  2JTF A;  4BD3 A;  3CCR T;  3OYB A;  4PJO C;  1BKB A;  3CBP A;  2PQW A;  1M1G A;  3JCM d;  2M9U A;  3NTI A;  4XK8 E;  1BI0 A;  2VXF A;  3JSC A;  4MZM A;  4N0A C;  4M7A C;  3KXT A;  1VQ4 A;  3JB9 H;  2RHZ A;  3BDL A;  5IAY A;  3OA6 A;  5FU7 B;  2KY9 A;  3PGG A;  4XTV A;  2FVU A;  4IUU A;  4C0Z A;  1NZ9 A;  5LJ3 e;  2XDD A;  3MHX A;  3CC7 A;  3CCJ A;  3ASK A;  4M7D C;  3L2V A;  2E41 A;  1UGQ B;  2K3Y A;  1KQ1 A;  5LJ3 h;  4C92 C;  1D3B A;  3UDC A;  1TH7 A;  5GMK m;  1VQK T;  5CIU A;  1X01 A;  2M16 A;  5DY9 A;  4M78 B;  4A4G A;  4N4H A;  4CI0 C;  3CME A;  3HRT A;  1Q81 U;  3X20 B;  3JCM J;  3QSU A;  4IUT A;  2XK0 A;  4IUQ A;  4C5I A;  2K4Y A;  2XI9 A;  3C94 A;  5KH6 A;  2ZPG B;  3E9F A;  3SDZ A;  4L6V 5;  1M4Z A;  4LDY A;  2O4X A;  3OBY A;  3E9G A;  1Q86 U;  5IT9 E;  3QYG B;  3QZ9 B;  5FRO A;  3OYN A;  1NPR A;  1YBY A;  2QQS A;  2OTL T;  5CQY A;  2L5Q A;  2DXC A;  3OB9 A;  3OYE A;  1UEB A;  4M78 F;  4BI4 A;  3LGL A;  4E7J A;  4A54 A;  4XU2 A;  2M1H A;  2P4T A;  2LTO A;  3VUZ A;  3PMT A;  4J6Y A;  3HHT B;  3HRS A;  3A8M B;  4C8Q D;  1M8V A;  3G6E A;  5FU6 B;  2E10 A;  5D6Y A;  1K8A C;  1M1F A;  2GQV A;  2HD0 A;  2LNV A;  1B34 B;  2E6N A;  4BY6 B;  4PKC C;  5LJ5 d;  3FDR A;  4R56 A;  3LH0 A;  1VQO A;  3JAM E;  3PIO A;  2XDP A;  2XKO C;  1YIT T;  4ZGJ B;  4M77 C;  4RMO A;  3OYG A;  2XDB A;  1WNL A;  3JCM W;  2DEQ A;  3M59 A;  3GP8 A;  3Q1J A;  4OGE A;  4IUR A;  4OB3 B;  3X28 B;  3OMG A;  3CCQ A;  4MDX A;  2CZ7 B;  4OB0 B;  3M55 A;  2K5L A;  1BIB A;  1G3T A;  4QQD A;  4MMK A;  4RCB A;  4XU3 A;  5IN1 A;  5KE3 A;  5HK0 A;  3CXC A;  3G4S A;  5GAO n;  3VV0 A;  3V7R A;  3CPF A;  4HA8 A;  2LQ8 A;  4GLK A;  4A4H A;  1ZHI A;  4FM4 B;  2EQJ A;  3JRZ A;  3BW1 A;  1QVG S;  5A0L A;  1VQO T;  3QJ6 A;  2AHJ B;  2QDY B;  2ZCF B;  4PJO E;  4A4F A;  2KDS A;  2DTO A;  4ZN3 A;  4FT2 A;  2QQA A;  3X25 B;  4QVC A;  3FEO A;  5CCA A;  1WQW A;  4C0G A;  4M7A E;  4M7D B;  2D6F A;  3J81 E;  3MET A;  1ZQ1 A;  3I55 T;  4JRQ A;  3OW2 S;  3P8B B;  1B34 A;  2D0Q B;  3A8H B;  4LD6 A;  3I56 T;  5GAN 7;  1G5V A;  2A3L A;  2DJZ A;  3JCM e;  3G4S T;  4BDY A;  1VQ6 A;  3VUB A;  5KCO A;  3GOX A;  1VQM T;  4HT8 A;  4M7D E;  2X4J A;  4C92 E;  1S72 A;  2OTJ A;  1OZ2 A;  3JCM h;  3PNW C;  4C0F A;  1IRE B;  3OYJ A;  3CCV A;  4KUD K;  4NS5 A;  2R5A A;  1G3Y A;  4F7U E;  1KD1 C;  1WJR A;  2YLC A;  4LDU A;  3A8G B;  3WXM B;  3EFS A;  3CEY A;  1I8F A;  4XTU A;  3X26 B;  5HK3 A;  3JCM P;  2EKO A;  3RER A;  2NLU A;  4EDU A;  1QW1 A;  1O75 A;  1VQN T;  3EAE A;  5A0G A;  3CC2 T;  2VGN A;  1N6A A;  2I2L A;  2YHT A;  4B9X A;  3A8L B;  2RI3 A;  4C5H A;  3CCE T;  3LLR A;  2B8A A;  2PU9 B;  2DIQ A;  4RG2 A;  5GAO l;  1X6O A;  1K8A U;  2KVQ G;  2OTJ T;  1Q7Y C;  1GXI E;  5KE2 A;  2K5I A;  2GFA A;  2XIC A;  3CPW S;  3GNG A;  4MML A;  2R5M A;  2WSC E;  5I2S A;  4M75 C;  3FIF A;  3CCR A;  2QA4 A;  1M9S A;  4TVR A;  4HCZ A;  2EQK A;  4C0D B;  3CPW A;  3SD4 A;  5GAN 4;  3HP9 A;  2R57 A;  3TEE A;  4LDW A;  2JN0 A;  4M77 E;  1VQ5 A;  4V2S A;  4J7I A;  4FT4 A;  2E6Z A;  2V8K A;  4J6W A;  4Z02 A;  4C5G A;  1VQK A;  1Q82 C;  2E1H A;  1N9S A;  2X4X A;  1JJ2 S;  2BIV A;  2MWP A;  4PJO B;  2X4Y A;  5LJ5 f;  1K73 C;  2H3J A;  2KSS A;  3M54 A;  2ZPE B;  3L42 A;  4HT9 A;  2EAY A;  3RES A;  1QP3 A;  1LJO A;  5GAN 8;  5GAN 5;  3QKJ A;  3OMC A;  4M7A B;  2D9T A;  4HKE A;  3VYG A;  3F70 A;  2EJF A;  4X34 A;  3HL8 A;  1YI2 T;  2DO3 A;  2RI5 A;  3QZ5 B;  1KHC A;  4QW2 A;  4PLL A;  2OTL A;  1UGR B;  3ZBD A;  4ZGD B;  1UB4 A;  3SWN C;  4BE2 A;  3OW2 A;  4HCB A;  2CS7 A;  3QUI A;  2KMT A;  2VGM A;  4C92 B;  5J39 A;  1VQ5 T;  3M4G A;  4PJO F;  1VQP T;  2DPP B;  4M78 D;  1BI2 A;  5KCH A;  2HQX A;  4KBM B;  1W4S A;  2K3X A;  2LC4 A;  4Q5W A;  4XTX A;  3SFM A;  3G71 T;  4M7A F;  3R6O A;  4A53 A;  5GAN d;  5A2Q E;  3OYC A;  3TRE A;  1MHN A;  5FRN A;  1HK9 A;  1FX7 A;  4PNO A;  1YIT A;  1XOV A;  2EJG A;  2QQR A;  3FLG A;  4QQG A;  1QVP A;  3HFN A;  1SSF A;  2RA2 A;  4M7D F;  3M58 A;  1VQ8 T;  2RD1 A;  4J5Y A;  4C92 F;  2MAM A;  4GY5 A;  1W2B S;  1FWZ A;  2P0Q A;  1P92 A;  4PJO A;  1KC8 C;  3E1S A;  1Y07 A;  2ZPI B;  2HAX A;  4F7U F;  1M90 U;  2GFU A;  1NJI U;  5GAO p;  3MP1 A;  2M0O A;  4M7A A;  3JCM X;  3T9N A;  3BY7 A;  3DLM A;  3OYA A;  4P5N A;  2DVE A;  1FXX A;  4RCC A;  1WJQ A;  3CCU T;  2QQ9 A;  5FLX E;  2MMP A;  3FC3 A;  1Q7Y U;  4Y91 A;  4M77 B;  2VC8 A;  4M7D A;  4C92 A;  2KAF A;  3JCM g;  2DIG A;  3HKS A;  1U8R A;  4M78 A;  3ZEH A;  2ZPF B;  2QXF A;  4XTW A;  4M75 E;  4FL6 A;  2EYQ A;  1N9R A;  2XG8 D;  4ME7 A;  3A5Z B;  4PJO G;  5HKC A;  1BI3 A;  3I55 A;  3HSB A;  5AYF A;  3I56 A;  1UGP B;  3QII A;  2RHU A;  3TU4 K;  2P0P A;  3UWN A;  3OYK A;  2XU8 A;  4J8O A;  2YLB A;  3MCA B;  5GAM d;  1VQM A;  4RG8 A;  1KQS A;  4M7A G;  1K73 U;  3G7Z A;  2RJF A;  1RL2 A;  2FL7 A;  3FJP A;  4M77 F;  4Y28 E;  4C8Q C;  3CMA T;  5GAN 6;  4L59 A;  5J26 A;  4BY6 C;  1IZ6 A;  4IKF A;  4VUB A;  4R55 A;  1LOJ A;  1LNX A;  2E64 A;  4XAX B;  4BUG A;  4QQ6 A;  4M7D G;  5GMK e;  2F5T X;  3WVD B;  5LL6 S;  4HCC A;  2JZ2 A;  3M56 A;  2LCC A;  1G3S A;  3EFR A;  3QXE B;  3L1A A;  1I4K 1;  3J80 E;  2HQE A;  4M78 G;  4XU1 A;  1VQN A;  2DAQ A;  2RK1 A;  3DB3 A;  4QVD A;  3CC2 A;  5LJ3 d;  1YJ9 T;  3URG A;  4JJN K;  2PVG B;  3LWH A;  4MZP A;  3UT1 A;  1OZ3 A;  4M77 A;  4MDW A;  4X9D A;  3CCE A;  1UGS B;  3PT9 A;  4BI8 B;  4JRK A;  1N8R C;  2QQB A;  4J7F A;  3PFS A;  4XQ3 A;  3LW5 E;  3CC4 T;  3CXC S;  5J3B A;  2IVW A;  4JRI A;  3CCS A;  2E5Q A;  1N27 A;  3UPU A;  4DQ2 A;  1VIF A;  3C12 A;  2PUK B;  5HY6 A;  3L2W A;  3CCL T;  4E7K A;  3M57 A;  3JCM c;  5LJ5 j;  2CKK A;  5CQX A;  5LJ5 g;  5C0M A;  4J6X A;  2CYZ B;  3V7C A;  1DJ7 B;  4EMK C;  4OMF B;  4LD9 K;  2V8J A;  4JDS A;  5I2M A;  2MWO A;  3H8Z A;  4BDZ A;  1KC8 U;  1R8O B;  4BAC A;  3JB9 F;  2RI2 A;  4KUI A;  1VQL T;  3GIB A;  5GAN f;  1OI1 A;  1Q81 C;  1WGS A;  2E12 A;  1YJW T;  1K9M C;  4M77 G;  2EIF A;  2F69 A;  1V29 B;  2Y90 A;  1Y96 B;  3M4Y A;  3CCS T;  2PVD B;  2IG0 A;  4M75 B;  2ZZD A;  3KBG A;  5A0D A;  2VXE A;  3RKW A;  1YI2 A;  2FB7 A;  3OY9 A;  3S3M A;  1VUB A;  3V8K A;  3GF5 A;  2LDM A;  1PSF A;  5GMK i;  2LX9 A;  4ELZ C;  4NL3 A;  4JS4 A;  3ME9 A;  2LT1 A;  4FU6 A;  4E7H A;  3OSS C;  4WF2 A;  3CBM A;  4ELY C;  2L89 A;  1VQP A;  1WJS A;  3QBY A;  2R58 A;  4ZTJ A;  1YHQ T;  3VJP A;  1G3W A;  4FSX A;  3NFC A;  3GNF B;  5LJ5 e;  5GAO m;  3MP6 A;  3G71 A;  4JLG A;  1AHJ B;  4M75 F;  3OBW A;  3JCM b;  5LJ5 h;  4M7A D;  5GAN 2;  3L2U A;  3QPH A;  4OB1 B;  1KQ2 A;  1YJN A;  3V8L A;  4UC4 A;  2FHD A;  3WVE B;  5GAN 3;  1OYX A;  2WSF E;  2LRQ A;  4C8Q E;  1VQ8 A;  2DZ9 A;  2ZGW A;  3OYY A;  4JS5 A;  3S6W A;  2V8I A;  3M5A A;  3SWN B;  4C0D C;  4M7D D;  3RMQ A;  4C92 D;  4KUL A;  3JB9 G;  3C95 A;  2XHC A;  5GAM f;  1YCY A;  3M53 A;  4BE0 A;  2Y4Y A;  1BI1 A;  1Y7X A;  1Y96 A;  4YTL A;  2CZ1 B;  4N4G A;  5DLQ E;  4F7U B;  3QDR B;  4IUP A;  4M75 A;  3JB9 J;  5GMK l;  3AHU A;  4A4E A;  5C6S A;  1N8R U;  4EMG A;  3CCU A;  2RB6 A;  2RM4 A;  3RKY A;  1W2B A;  2DD5 A;  1YJN T;  3P8H A;  2HNI A;  4J83 A;  1KD1 U;  4CRI A;  3OYL A;  3CD6 T;  1U1T A;  3QG1 A;  4XTY A;  5FU7 C;  2DXB A;  5LJ3 f;  5EG2 A;  2VV5 A;  3O8V A;  2A7Y A;  2F5K A;  2KQW A;  3PIP A;  2FYK A;  2P0K A;  3ZFJ A;  4II1 A;  4NL2 A;  5CKF A;  1YIJ T;  5CVI A;  4N0A A;  2CGH A;  5GMK j;  5CAI A;  4M78 C;  3INZ A;  1BIA A;  1VIE A;  1WPY A;  2ZPB B;  5D6W A;  5I21 A;  4IUV A;  2RHX A;  4M75 G;  3DB4 A;  5DM7 R;  1K9M U;  3MEV A;  2CZ6 B;  3VKI A;  2QI2 A;  4FIB A;  4DOW A;  2Y4X A;  3CMA A;  1U1S A;  3LGF A;  1XQH A;  4M77 D;  3OYI A;  4BE1 A;  1X75 C;  2RJE A;  3SWN A;  3LWI A;  2QA4 T;  4E7L A;  3QJY A;  1I5L A;  4N4I A;  3NTH A;  1VQ4 T;  2QEX A;  4JRP A;  2JVV A;  1QVF A;  2XD0 A;  4QVZ A;  2E70 A;  2EFI A;  3OS5 A;  4OP0 A;  3SB2 A;  4DOV A;  3CCJ T;  3CC7 T;  4F7U A;  1M1K C;  5DLO A;  2K2V A;  2XID A;  2LQK A;  3S3N A;  3OYF A;  3NTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...