1SSFA

Solution structure of the mouse 53bp1 fragment (residues 1463-1617)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
123
structure length
123
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transformation related protein 53 binding protein 1
publication title The Tudor Tandem of 53BP1; A New Structural Motif Involved in DNA and RG-Rich Peptide Binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 16
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ssfA01
3LH0A 3S6WA 3CD6T 2G3RA 3DLLA 1VQPT 3OYFA 1YBYA 3MP1A 1Q82C 3OYKA 2JTFA 4HCZA 4BACA 1EIFA 2OTJA 1VQNT 1VQKA 3OYLA 2DIGA 3CEYA 3S3NA 4TVRA 2X4YA 3CD6A 1YI2T 1VQPA 1OZ2A 4Z02A 2KVQG 2M0OA 5J39A 1VQ9A 1M90U 4CRIA 1K9MC 3CPFA 1VQNA 3G6ET 1KHCA 2E70A 3OYAA 1W2BA 2E5QA 3I56T 2OTLT 3DB3A 3OYDA 3P8DA 3M9QA 1YI2A 2LQ8A 3GOXA 3J80E 2EQKA 4QQGA 2R58A 2X4XA 3UWNA 3CCET 1Q82U 2LTOA 4IUUA 1KC8C 3G6EA 1K8AC 5IN1A 3LGFA 3OA6A 3CXCA 1YJ9T 1VQ5T 3I56A 1N8RU 1WJQA 2KDSA 2XK0A 1KQSA 1YIJT 1VQ4T 4QQ6A 3PNWC 3L2VA 4IKFA 3PIPA 3OQ5A 3A5ZB 2RHYA 3OYMA 3LYIA 5KH6A 3CCEA 3CCRA 5IT9E 1K9MU 1OYXA 3ZEHA 1VQ5A 3S3OA 1X6OA 1QVGS 3LX7A 1SSFA 2EQUA 2RO0A 1WJRA 1Q81U 2RJFA 5C6SA 1YJWT 4C5GA 1IZ6A 4RG2A 3PFSA 4E7JA 3CC4A 3CXCS 2P0KA 3CC7T 4FL6A 4IURA 4N4GA 3JAME 1K8AU 5FRMA 2RHIA 2D9TA 4QQDA 1KQSS 4UC4A 2DO3A 1KD1C 4NS5A 1YJWA 1VQOA 1WJSA 3QJ6A 5KCHA 4C5EA 2GFUA 2BIVA 5DLQE 4ZTJA 3CC2T 5J26A 1RI0A 3CC7A 2LCLA 3NTIA 2F5KA 3H6ZA 4E7IA 3OMCA 3QIIA 3J7AF 3OMGA 3OYCA 2E6ZA 5DM7R 3G4ST 4IUPA 5KE2A 3CC2A 3H8ZA 5D6YA 5M9OA 1VQ9T 4L59A 4BDZA 3DB4A 1S72A 3MEAA 2MWPA 1KD1U 3S3MA 2O4XA 2JOYA 3G4SA 4C5IA 3L2RA 3MEWA 3OYNA 2RJCA 3CPWS 3ASKA 4PL6A 3FC3A 2RI3A 3OS0A 2MI6A 2PQWA 1UEBA 2RJEA 2QA4T 2DAQA 3P8BB 3CCMT 2LCCA 2EIFA 3F70A 1QVGA 3QKJA 3CMAT 5D6XA 4IUQA 3BDLA 4A4GA 1M1KC 4BE1A 4EDUA 1Q86C 3CCRT 2QA4A 3P8HA 1XNIA 3MO8A 3G71T 2B8AA 3LLRA 3CCMA 1YITT 3L2QA 2JZ2A 2RHXA 3PMIA 2QEXT 1QVFS 3CMAA 3E9FA 4BDYA 3FDRA 3CCVT 2R5MA 1VQ8T 2XHCA 3CC4T 3G71A 3CCQT 1Q7YC 1YITA 1MHNA 1YHQA 1NPPA 2QEXA 1VQOT 3CCST 3CCVA 2VYTA 5FROA 2L89A 1VQ8A 2JVVA 3CCLA 1M1KU 2O4XB 3L42A 1Q86U 5A2QE 3OYYA 5J3BA 3CCQA 1KC8U 4QW2A 3NTKA 3MP8A 3OYEA 4C5HA 1KHIA 4A4HA 3ME9A 3CCSA 3HKSA 3E9GA 4X34A 3MP6A 4IUVA 2RI5A 2BKDN 3CPWA 1NZ9A 1N27A 2M16A 4IUTA 2L8DA 1NJIC 4ZTFA 1BKBA 3OYHA 1Q7YU 1S72T 1JJ2S 2L3RA 2QQSA 3LGLA 2XDPA 1H3ZA 2CKKA 2FHDA 5C0MA 2M1HA 3OY9A 2MWOA 3FLGA 2YRVA 2BUDA 2JUFA 2RI2A 2QQRA 3META 5IAYA 3MEVA 3ER0A 2X35A 1K73C 2LDMA 2EQMA 2EQJA 3UT1A 4A4FA 1QVFA 4OVAA 1NPRA 3KUFA 1NJIU 5HY6A 3SD4A 3DLMA 1N8RC 4LD6A 4ZN1A 4E7KA 4BE2A 3OYIA 1VQLT 4FU6A 2GFAA 3OYGA 2HQXA 2RHUA 1WGSA 1VQMT 4B9WA 4E7HA 1OZ3A 4E7LA 3L2WA 1YHQT 1Q81C 1K73U 3NTHA 3EAEA 4BD3A 3KBGA 3L2UA 1VQLA 1VQ7T 2WACA 1RL2A 4II1A 1VQMA 2EKOA 3MEUA 1VQ6T 5LL6S 2HQEA 3CCLT 3Q1JA 2JNGA 2EFIA 1XTDA 3CCJT 3J81E 2OTLA 2RJDA 1VQ7A 1JJ2A 2E6NA 4ZN3A 3OYBA 3CMET 1VQ6A 3CCUT 2K3YA 3OB9A 1W2BS 2LRQA 4PLIA 1YJ9A 3CCJA 4QVZA 4B9XA 2X4WA 3QBYA 1YIJA 1VQ4A 5D6WA 3OW2A 4PLLA 3TREA 1G5VA 4Q5WA 4GY5A 3PMTA 3CMEA 3C4SA 3CCUA 4N4HA 3I55T 1YJNT 3OYJA 4A4EA 3FEOA 5KE3A 1M1GA 5KCOA 4YTLA 2R57A 3OS1A 3O8VA 3PIOA 2GF7A 2DIQA 2K3XA 1OI1A 5FRNA 5CIUA 4BE0A 3I55A 2R5AA 1YJNA 2NLUA 1M90C 2LVMA 4N4IA 5FLXE 2OTJT 3OS2A 3OW2S 2RHZA 2IG0A 1VQKT
chains in the Genus database with same CATH superfamily
3LH0A 2MPXC 1HJDA 1WHLA 2EAYA 2G3RA 1YITQ 5CQYA 1VQPT 1JXOA 3OYFA 1YHQQ 1RAAB 1TOVA 1PKTA 3FRNA 3RUXA 1WXBA 1Q82C 4XU1A 1G83A 2A37A 1HYOA 2ESWA 4JRPA 1EIFA 3CCVQ 2QQBA 2EW3A 1VQNT 3A8LB 2IVWA 2DIGA 4JJNK 1UFFA 4M7AG 2LNVA 3SWNB 1FMWA 4C0FA 3TEEA 4Z02A 3PTAA 1LJOA 1XQHA 4OMOA 1M90U 4PNOA 1BI1A 2DK3A 3CCSQ 1KHCA 2LX9A 5GAMh 1PM3A 2K3BA 3X26B 1G3SA 2FRWA 3DB3A 1SEMA 2NUPA 4LUDA 1YI2A 3EFOB 1PRMC 2HSPA 4JZ4A 1C1AA 2R58A 2A0FB 1OQKA 2KT8A 3UWNA 1PHTA 3CCET 1WQWA 3E1SA 2F5TX 5GANh 1C0MA 3OA6A 1UJ0A 2D8JA 1YJ9T 1FWZA 1R0BG 1WA7A 2XK0A 5FU6B 3L2VA 3E2UA 4EMHA 2RHYA 3OYMA 3LYIA 1YP5A 3M58A 1G3TA 2JS0A 4LE9A 4BY6C 2LJ1A 3ZEHA 2KQWA 2IPOB 1SSFA 2EQUA 4KT0E 1SHFA 2OAUA 1GFCA 3H0HA 3NMZC 3N5BB 2GNCA 3ZFJA 2QK0A 1SF9A 2JMAA 2KEAA 4FL6A 4X1VA 4N4GA 3JAME 1EX4A 5FRMA 4HCKA 4QQDA 2DL5A 1QKWA 2RQTA 3VJPA 1D3BA 1ZLMA 2KXCA 1YJWA 1QLYA 5GMKh 3I9QA 2XKOC 3BY7A 1V1CA 2BIVA 1PRLC 2JTEA 2QG9B 3RDVA 3M0SA 4F7UG 5J26A 2NUPB 2ZCFB 1U1TA 1KJWA 2F5KA 4PJLA 4OMFB 1Z9QA 2WSFE 1M5Q1 2E6ZA 5LJ5g 2KXDA 1WLPB 4KGVB 5KE2A 2OTLQ 4OMMA 3CC2A 1VOMA 5D6YA 5M9OA 5GAN3 1WX6A 2E10A 1XJWB 1S72A 4PJOA 2M51A 1BK2A 1VQ6Q 2EYQA 2DJZA 1N9RA 4MDXA 1KD1U 1NE8A 1K4US 4C5IA 1WXTA 2KBTA 2GQVA 2RJCA 2HBPA 4OB1B 2DYBA 1I8FA 4PL6A 2D0NA 2A3LA 5GAOn 1S1NA 1PSFA 1VQ4Q 3VS6A 3L2ZA 1X2QA 3RMQA 1JJ2P 3G7ZA 1YWOA 2D1XA 2GTJA 2CZ0B 2KRSA 3F70A 1ZBXA 1T3LA 4F04B 8ATCB 1TUGB 2EVRA 3CMAT 4JLIA 3BDLA 1Y71A 4LDVA 1D3BB 5ECAA 2QA4A 3X25B 1YITT 2O2OA 2JZ2A 2X3XD 2C06A 1QCFA 2RH2A 2EKHA 2W0ZA 2C0IA 3CCVT 4Z88A 4CC4B 3C0CA 5LJ3e 3CC4T 1E6GA 3G71A 4M7DA 4N0AA 5CKDA 1JB0E 1NPPA 1RABB 2Y90A 4M77E 4LDXA 1OPLA 4HA8A 3CCST 4PJOB 4OF1A 4DBFA 1FX7A 2MAMA 1VQ8A 2KYBA 4CC7A 3CCLA 1M1KU 2COYA 4JLGA 5A2QE 4Z89A 2HL5C 3RR6A 2CSIA 4M77F 4QW2A 2RD1A 3OYEA 4C5HA 1UGPB 4LDWA 5FW9A 2YUNA 3RESA 1M8VA 1X27A 1YI2Q 2LNHB 1NZ9A 1N27A 1VYTA 4IUTA 1WHKA 2GGRA 4C8QA 1JJ2S 2L3RA 4KRTA 1ZUKA 3LGLA 4M7AA 2XDPA 2MWOA 2YRVA 1Q95G 2E3HA 4OMLA 2F1LA 4HVWA 1MNEA 4AT1B 3MEVA 5IAYA 3ER0A 2QQAA 3T9NA 1WHJA 2B86A 1K8AR 4E6RA 5GAN7 5GAOr 4M7DB 4OVAA 4E7SA 1W6XA 4Y28E 1WQ7A 3CXCP 4OB0B 4FYXB 4FSSA 3HL8A 1KQSP 2K5LA 1WI7A 1V76A 4BE2A 4GLMA 4LXCA 2JN0A 4HCBA 3CBPA 1RAIB 1M1FA 1YJWQ 5A0DA 3URGA 2YDLA 4RTVA 5GAMj 2JMCA 3NTHA 4RCCA 3RKWA 1UECA 3TQ7P 1R0CB 1RL2A 1LVKA 4JRIA 1AWJA 4II1A 4C8QB 1VQMA 2RK2A 4HKEA 2GTOA 3MEUA 2HKQB 1VQ6T 5LL6S 1M8MA 2DLPA 3C95A 2YUQA 3Q1JA 2QYZA 4M7AB 2EFIA 2V8IA 3M0QA 4ATOA 5GANj 3CC2Q 5GANg 3LH5A 1VQ7A 1JJ2A 2BE7D 2E6NA 3QUIA 3I35A 4C92A 1OV3A 4ZN3A 1S72Q 3V7RA 2ECZA 4BI4A 5LJ5e 4O5VA 5KYUA 2DRKA 4LDUA 1XOVA 1RAEB 5HK0A 3OB9A 1IXDA 2LRQA 3CCJA 2L5QA 5HCKA 1NEBA 1WHMA 1YIJA 1WYXA 1AHJB 4V2SA 5D6WA 4PLLA 1VA7A 2K6DA 3A8GB 4GY5A 3JCMP 2PVGB 3MHXA 3GLXA 2CP6A 4M77C 1KQ1A 1SG5A 3QG1A 4J9CA 5L8RE 2QA4Q 1BYMA 5KYYA 2YHTA 2HAXA 2K3XA 1OI1A 1OX9A 1M4ZA 1TU0B 2FO0A 5GMKj 1OEBA 2QXFA 3THKA 3I55A 4DEYA 1M90C 1PWTA 1FMKA 4N4IA 5CKHA 2RPNA 1JBMA 1U3OA 3QWXX 3I5SA 2HEQA 1RAGB 2IG0A 3CCRQ 2OAWA 3G71Q 2CH4A 2CP3A 3MP1A 3V8LA 4CC3A 5CCAA 3OYKA 2XICA 4C92B 2E1HA 4BACA 3V8JA 2LP5A 4BY6B 1VQ8Q 3CCLQ 5KYUB 4AFQC 3CD6A 1YI2T 2DL8A 2GQIA 3TVTA 2OJ2A 4M78G 4ORZA 2E64A 1TUDA 5J39A 4FT4A 3SFMA 3EHRA 1VQOQ 4Y91A 3CPFA 4M78D 3OYAA 1B07A 3NGPA 2LT4A 3P8DA 3M59A 2VKNA 4F7UE 2EQKA 5LJ5f 2YUPA 1E7OA 1KQ2A 5KYYB 2L0AA 2LQKA 1IRXA 3CXCA 1M27C 4M75D 3I56A 1WJQA 1KQSA 4WTOB 2QI2A 4QQ6A 3A8HB 3PNWC 1NJIR 3CPWP 1GCQA 3AHUA 3EGXA 2L2PA 5IT9E 1OYXA 1C6VX 5GAOq 5FWCA 3LX7A 1QVGS 3QSUA 2RO0A 4J9DA 3QDRB 3M4GA 5C6SA 4JRKA 1YJWT 2GBQA 1I07A 3KFVA 1W1FA 5GAN8 3OSVA 2QTVA 1AWXA 2P0KA 3JCMf 1K8AU 3M5AA 2D9TA 4MDWA 3JCMX 1MMNA 4J9IA 5GAN4 2DYIA 2HMAA 1KD1C 4NS5A 2MF2A 3M0PA 3WXMB 2CT3A 5KCHA 1I5OB 2GFUA 3H41A 5LJ3g 2DNUA 1NEGA 3JCMW 2YRDA 1Y7XA 5DLQE 3CC2T 1RI0A 3CC7A 5AT1B 1VQMQ 1QW1A 5A0GA 5I21A 1T3SA 1G2BA 2DZ9A 5I11A 1M1KR 4XU0A 3OMGA 4RUGA 4A63B 2VC8A 1P92A 1GXIE 4F16A 1WIEA 2WSEE 1VQ7Q 1WFWA 3H8ZA 2P0PA 3X28B 1VQ9T 4L59A 1W2BP 2XDBA 4BDZA 3DB4A 2DL7A 3OSSC 4J8OA 4PJMA 3EGXB 2LT1A 4KULA 9ATCB 4HT8A 2JOYA 2DPPB 1AT1B 1CKBA 5GANe 3G4SA 3CCJQ 3INZA 5CKFA 1JO8A 3CPWS 1MV3A 2CT4A 1F1BB 3EH2A 1YIJQ 2KROA 3FC3A 4M4ZA 2PU9B 2DXTA 2LJ3A 2QA4T 5FU7B 1UTIA 2YUOA 1QVGA 4OMPA 1MUZA 4C8QD 4IIMA 2X9HA 2LX7A 1PCXA 1VYVA 5CKBA 5CK9A 2ROTA 4AFSC 1M1KC 2M02A 4PFZA 2HZYA 1AZGB 3CCRT 2BZXA 3MO8A 1R77A 3G71T 3JCMJ 3LLRA 3I55Q 4KUDK 2SEMA 1UHCA 1OPKA 1HSQA 3PMIA 2P0QA 4LNPA 2FL7A 2H8HA 4BDYA 3FDRA 2DKGA 2R5MA 4KGXB 2VXFA 1VQ8T 1YFNA 2XHCA 5GMKe 2PUOB 2BZYA 1BI3A 2RA2A 4B6MA 1K9AA 3FB9A 3R6NA 2QEXA 1SHGA 2DVEA 2IIMA 1VQOT 4HT9A 3HFNA 4AFUC 7AT1B 2VYTA 5FROA 5GAOp 4JUVA 2FVUA 5GMKi 3CD6Q 8AT1B 3L42A 2CSQA 1ABQA 3CCQA 2ZPEB 2X4JA 2YRCA 4KGZB 1NM7A 1QCOA 4OMQA 4A4HA 1V29B 2DBMA 3E9GA 3GBQA 4M77A 4IUVA 2QQ9A 2A08A 3CPWA 4HXJA 4JRQA 2M16A 1RLPC 4D8KA 2BTTA 1RI9A 2OX7A 1UDLA 4QKUA 3OYHA 1VIEA 2JM9A 4DBHA 4NOYA 1N5ZA 5IHNA 1H3ZA 5C0MA 2M1HA 3VKIA 3I56Q 2BUDA 4C92D 1G8XA 1Q81R 2J6FA 3EG9A 3JRZA 2F2XA 1SRLA 4FCYA 3HPWA 1M3CA 2Z0WA 2ZPHB 3RIRA 1I1JA 2EQJA 1U5SA 2FPEA 1PD1A 2EJGA 1NYFA 2AIRB 2E65A 4ELZC 2QGGA 1G3WA 1A0NB 5I2MA 1UB4A 1X6GA 3NPFA 1NJIU 1D1AA 3SD4A 2KSSA 3EGUA 4E7KA 3OYIA 1D1BA 2P84A 4FU6A 2XU8A 4XTWA 2GFAA 1RADB 4FSXA 1WGSA 1AWWA 2JTMA 1VQMT 1T0HA 1BU1A 1ZSGA 2EGEA 2W10A 1RAFB 3AT1B 2PZ1A 2MOXA 4XQ3A 4M77B 1JRIA 1YHQT 1Q81C 1K73U 3CC7Q 4BD3A 4GLKA 1I5LA 1VQ7T 5HKCA 3R6OA 4RTUA 3VS1A 1ARKA 4RTXA 3VUBA 3JCMd 2M9UA 1O9SA 2EKOA 3MJXA 4J6XA 1OOTA 1HD3A 2O31A 2HQEA 4JS5A 3CCJT 4L5GA 3J81E 3JCMQ 3EG9B 4D8DA 4ZGDB 3BW1A 4WF2A 4OGCA 2RQVA 2FZKB 4C0DB 4BUGA 2K3YA 3HRUA 1UGRB 2E3IA 3TSZA 3G4SQ 4PLIA 1YJ9A 2CYZB 4QVZA 2X4WA 2KYMA 3QWYA 4E47A 4M78E 4XTVA 3TREA 1G5VA 3PMTA 3PT9A 1BB9A 3EG2A 4EMKC 4E2FB 3JB9D 3I55T 4RG8A 4A4EA 1M9SA 2LC4A 1TH7A 3PVLA 4XU3A 4M78F 1M1GA 3HTRA 5IH2A 4RTYA 1YCSB 3M56A 2CZ1B 3QO3A 4BI3A 2EQIA 4OB3B 5IXFA 3MPUB 2GF7A 3PIOA 2EPDA 5FRNA 1N9SA 2F2WA 4DOVA 1YJNA 2X3WD 2LVMA 4J7IA 2ENMA 5FLXE 1X6BA 3JV3A 3OS2A 2RHZA 4RTWA 4M75F 3JSCA 1Q86R 2QDYB 2F2VA 1KC8R 3CD6T 3DLLA 1UG1A 5IXBA 3A8OB 1PSEA 4EMGA 2QEXQ 4ANJA 2JTFA 4D6WA 5FWBA 4HCZA 1VIFA 4FYYB 4MZPA 3M55A 2OTJA 4BB7A 2DM1A 2BE9B 2LCSA 3S3NA 2PNIA 3VUZA 1WPYA 1BBZA 3CCQQ 2DL3A 1EFNA 1Q7YR 5L23A 1TWBA 1OZ2A 1PNJA 2MYSA 3HHTB 2KVQG 2M0OA 3GIBA 3NHNA 4CRIA 4P5NA 5LJ3f 3GPLA 4MZMA 5IHIA 3E19A 2E70A 2E5QA 1NBEB 3I56T 2OTLT 5GAMg 2DXBA 1RACB 2LQ8A 3MCAB 1YCYA 3J80E 2O01E 1YN8A 2RK1A 2X4XA 1Y57A 2LTOA 1NLPC 2DL4A 4IUUA 1KC8C 3G6EA 1K8AC 3LGFA 2YSQA 4JJDA 1FMVA 2O9VA 2KDSA 1VQ4T 1FXXA 1MV0B 1TTHB 4IKFA 3PIPA 2D0QB 3OQ5A 3A5ZB 2E5KA 3HRSA 2M0YA 1AOJA 5KH6A 1D0ZA 2KAFA 4F7UA 4ESRA 1K9MU 1GBQA 2K57A 1VQ5A 3S3OA 1X6OA 3BDUA 2SRCA 4K11A 4DA4A 2QDLA 1WJRA 2CZ7B 1Q81U 1GL5A 2RJFA 4OB2B 4ZGEB 1FYNA 1RUWA 2JM8A 4JJCA 1IZ6A 4RG2A 1OU8A 2DZCA 3CC4A 2AHJB 3CXCS 4IURA 3CC7T 3QYHB 1LOJA 3M0RA 4XU2A 5I22A 1M3AA 2RHIA 4UC4A 1KQSS 2DO3A 2CP2A 4HCCA 4EPCA 2KMTA 2QAZA 1QVFP 3HFOA 1WJSA 4C8QF 3QJ6A 3VS3A 4C5EA 2JXBA 4XTZA 4ZTJA 3H0IA 2LCLA 2XDDA 4M78C 3H6ZA 1SPKA 3VS5A 3UPUA 2AK5A 3UA6A 2ZGWA 5DLOA 4ELYC 5LJ5h 1ABOA 4ZNXA 2YLBA 4WCIA 5DM7R 3VS0A 3GP8A 3G4ST 2V8KA 4XTUA 1Y0MA 3EG3A 3FJ5A 2H3JA 2EGCA 2DD4A 3D7SB 1PKSA 4L6V5 1U06A 2MWPA 4M75C 2JW4A 2DEUA 4DEXA 2CP7A 4F7UB 2RMOA 1YJ9Q 3L2RA 3OBYA 3MEWA 3OYNA 1WDXA 2RNAA 3EFSA 1JXMA 2RI3A 2FPFA 4XTXA 1UEBA 2DAQA 3M4YA 2LCCA 2EIFA 2HL3A 2JS2A 2DTHA 2DFUA 3JCMh 2NWMA 2V26A 3UF4A 4M75G 3UDCA 4EDUA 4J6YA 3P8HA 4PJOG 2B8AA 3OW2P 2WSCE 4FT2A 3CCMA 1YJNQ 3QDFA 1ZSZC 2HQHA 4PJOD 2XG8D 2QEXT 2RQWA 1QVFS 1MNDA 2CS7A 2YLCA 1KK7A 3A8MB 1GRIA 1QQJA 1Y07A 4C92F 3JB9H 2VXEA 3CCQT 2DRMA 3QPHA 3GNGA 2DF6A 4J9FA 2HDAA 4N0AC 3UA7A 4J9GA 3VV0A 2OTJQ 2A36A 2K9GA 1AD5A 1K73R 2L89A 1U8RA 2VB6A 2JVVA 3EG0A 1ZBJA 3RKYA 1Q86U 1BIBA 3PE0A 1KC8U 1AWOA 2CUBA 1H8KA 1T0JA 3CBOA 3NTKA 3MP8A 2EJ9A 1Q82R 4EMKA 2P4TA 1KHIA 2QASA 3HKSA 4PKCC 3MP6A 1K76A 4X34A 1X69A 3ZBDA 1N8RR 2L3QA 2L8DA 4PK4A 1WXUA 1NJIC 2LQNA 4PJNA 1Q7YU 1S72T 2VWFA 3HSBA 2QQSA 4M7DD 4C8QC 1OU9A 5CQXA 3G6EQ 5LJ3d 5GAMe 3OY9A 3V7CA 3FLGA 1JQQA 2JUFA 5GMKm 2VV5A 5GMKl 3QJYA 2XI9A 3SB2A 4FYWB 3RNJA 2EYYA 3LW5E 2X35A 2PUKB 4F17A 4ZGJB 1K73C 4AG1C 2LDMA 2EQMA 2XMFA 1IHWA 2XIDA 1Z9ZA 1Y96A 1VQ5Q 2VGMA 1QVFA 4XK8E 4MMKA 1W70A 1NPRA 2I0NA 4NL3A 1BIAA 4C8QG 4JJBA 5HY6A 1NYGA 3DLMA 4LD6A 1LPLA 1N8RC 4J5YA 2ED0A 3CC4Q 2XD0A 3VYGA 3OYGA 2A28A 4DQ2A 2NUTA 1N6AA 4RKUE 1BCMA 1ZHIA 1D0YA 1B3QA 4B9WA 5GJVB 5CR2A 1M3BA 4M7AD 3REAB 4EMKB 3JB9F 4E7HA 4HVUA 1ZQ1A 3U23A 3REBB 1OZ3A 3A98A 1IO6A 2J06A 1MGQA 4A54A 4LDYA 2HSEB 3EAEA 1VQLA 2WACA 3V7SA 5HK3A 1QWFA 1JU5C 3PVQA 5KYXA 3CCLT 4FIBA 2JNGA 1KG1A 4LUEA 2FZGB 2RJDA 1D1CA 3A1PA 5DY9A 2PVOB 4CI0C 5CAIA 2ABLA 3EHQA 4JPBW 2Y4XA 3QXEB 2KRNA 2I2LA 3VRZA 2ZPGB 5AYFA 5IHKA 4C92C 1G3YA 4ME7A 1HK9A 1BI0A 1W2BS 2QTXA 1UJYA 3O5ZA 1Y96B 1IREB 1PD0A 1RAHB 2X51A 2YWWA 2FRYA 2DVJA 3DKMA 4J9EA 3OW2A 1QMCA 3CMEA 1AVZC 4DBRA 3SDZA 5GAMf 3C4SA 4R56A 3CCUA 2MIOA 1D0XA 1OULA 1YJNT 3OYJA 2FYKA 3FEOA 2NUTB 5KCOA 3EG1A 5CO7A 2RF0A 4BI8B 2R57A 3OS1A 3M54A 4O6JA 2LZ6B 1KSWA 3O8VA 4C92G 1K9MR 5GANf 2DIQA 1GBRA 3CCMQ 2YT6A 4HVVA 2JJ9A 4M78A 3HRTA 4BE0A 4Y92A 2DD5A 2NYSA 1KFZA 3GNFB 1X2KA 1WHGA 1D09B 6AT1B 1B34A 2OTJT 1X01A 4FYVB 5KYXB 1K0XA 3HP9A 2DX1A 2J7IA 3S6WA 5LJ5d 5LJ5j 2D6FA 1UE9A 1YBYA 4R55A 1BI2A 5CVIA 5KYNA 1GFDA 2DILA 4M75A 3IQLA 2J05A 1VQKA 3OYLA 3CEYA 2MK5A 4TVRA 2X4YA 2V8JA 2DXUA 1VQPA 4A53A 2ZZDA 2Y4YA 1U1SA 3UATA 1VQ9A 1UHFA 3CQTA 1K9MC 3TU4K 3X20B 5KYWA 4NL2A 1YWPA 1ZUYA 1VQNA 3G6ET 1PG5B 3M0UA 1W2BA 2EYZA 4VUBA 4X9CA 3EGDA 3NFCA 3OYDA 2V1QA 3M9QA 3ULRB 2K7AA 3FIFA 3FJPA 3SHWA 1DJ7B 1WNLA 2EBPA 3GOXA 4QQGA 3JCMg 3C94A 1O75A 1Q82U 2KY9A 1ZSZA 3L1AA 5GAOm 5IN1A 1AEYA 5GAN2 5GAOl 2DETA 1VQ5T 4M78B 1N8RU 3M0TA 2DXCA 1YIJT 3EFRA 2DERA 2DE0X 1GCPA 3QZ5B 1B34B 3BE3A 3CCEA 4LD9K 3CCRA 1QP3A 1GCQC 2GCXA 2RM4A 3I5RA 2V1RA 3SWNC 4DBQA 2DEQA 4M75B 4AFZC 2KRMA 3JB9G 4C5GA 3PFSA 4X9DA 4E7JA 5FU7C 2LQWA 2RQRA 5GAN6 1K1ZA 2DJQA 4FM4B 2VUBA 1TXQA 2CUDA 5A0LA 1M2VA 3QZ9B 1QCNA 1TUCA 2A7YA 1QKXA 3JCMc 4PJJA 2DBKA 5LJ3h 1VQOA 4M75E 5KYWB 1ZX6A 2VVKA 5GAN5 4A4KA 2ZAEA 4PJOE 3TSWA 3EGDB 4OGEA 1TG0A 1TSFA 1VQLQ 3SEMA 2KR3A 3NTIA 4E7IA 1VYUA 3OMCA 3QIIA 4AMCA 5FU6C 4JS4A 3J7AF 4QVCA 2CP5A 3JCMb 3OYCA 1ZSZB 4PJOF 4IUPA 1IB8A 1K0SA 4Z8AA 3JB9I 4PFOA 3X24B 2C0OA 2KNBB 5EG2A 4LN2A 3MEAA 4R0KA 2KT1A 4RTZA 2ATCB 2O4XA 3S3MA 2LMJA 1QWEA 2RQUA 2FB7A 3ASKA 1H641 1ZA2B 2K5FA 1UGQB 3OS0A 2MI6A 2PQWA 2RJEA 3CMEQ 2MCNA 3P8BB 3CBMA 3CCUQ 5D7UA 3CCMT 5EC7A 4KBMB 2FG0A 2EYXA 2E4HA 3QKJA 5D6XA 3VU3C 1W4SA 3PGGA 3G1JA 1UGSB 4IUQA 4M7DE 2CP0A 4A4GA 1M2VB 4RCBA 4BE1A 1Q86C 2FZCB 4E7ZA 1AZEA 1XNIA 4PFPA 3L2QA 5GAMd 3QYGB 2L3SA 2RHXA 3BFMA 2ZPIB 4OP0A 4M7DF 2DTIA 3CMAA 4JDSA 2MMPA 3E9FA 4F14A 3RKXA 2EJFA 4GBQA 5GJWB 1MHNA 1YITA 3EH1A 5GANd 1Q7YC 3VS2A 1YHQA 4J6WA 2HBWA 2YXYA 1M90R 1B7TA 4KH1B 1I0CA 2E41A 2O88A 1NG2A 1CSKA 1VQKQ 3CCVA 4C8QE 2HKNA 2KGTA 1WHHA 2QGFB 2O4XB 1VQPQ 3OYYA 2K79A 5J3BA 2CGHA 2F69A 5I2SA 4M7AE 1E6HA 2K4YA 1VQ9Q 2J6KA 3RBBB 3H9NA 1PC0A 1EZZB 3LWHA 2H3EB 1QP2A 3ME9A 3CCSA 1VQNQ 1KIKA 1CKAA 1ZUUA 2RI5A 2BKDN 4FW2A 2DTOA 4M7AF 2ZPBB 2AKLA 1MMGA 4ZTFA 1BKBA 1H92A 2CH4W 3RERA 4MMLA 4EIKA 4RMOA 2FPDA 2HD0A 3VYHB 1UUEA 2DMOA 2CKKA 2FHDA 2PVDB 1VUBA 4XAXB 4AG2C 1M2OA 4C0ZA 2CZ6B 4RTTA 4XTYA 2BZ8A 2K2MA 2RI2A 2QQRA 3JCMe 3META 1J3TA 1TS9A 2D8HA 3JCMV 1QVGP 2O9SA 1HXDA 2ROLA 3CCEQ 1MMAA 1NLOC 4IIOA 4PJOC 2ZPFB 1IGQA 2RN8A 1JEGA 3V8KA 1LNXA 3WVEB 2E12A 1R8OB 1M30A 3UT1A 2ED1A 4A4FA 4M77G 2K5IA 4C0DC 1X75C 2G6FX 2AT1B 4J9HA 1ZA1B 4C0GA 3H0FA 2J6OA 1H3HA 3KUFA 2P4RA 4M77D 1X43A 2C0TA 2L3PA 4ZN1A 1IGUA 1YNZA 4KUIA 3GF5A 3M53A 2COZA 3C12A 4QVDA 1VQLT 2HQXA 2RB6A 2RHUA 4FW1A 4JZ3A 2CDTA 2KI7A 1SSHA 2KK4A 2NUZA 3KXTA 1QVPA 3VRYA 2CREA 1I4K1 3MKDA 4MZTA 3LWIA 4C92E 3QHSA 4E7LA 4J7FA 3L2WA 1WZOA 3L2UA 2AZVA 3KBGA 2EYWA 3OS5A 3M57A 4J9BA 1KD1R 2K2VA 1ACMB 1XTDA 2FEIA 4QT7A 3TCJA 2OTLA 1BCOA 4KH0B 4F7UF 2AKKA 4M7DC 2OI3A 3OYBA 3CMET 1VQ6A 2VASA 2HCKA 3WVDB 2AZSA 3CCUT 1LCKA 3SWNA 2EWNA 4B9XA 1MMDA 4DOWA 3QBYA 3VS7A 2VGNA 4OMNA 5CKEA 1VQ4A 2LJ0A 4Q5WA 1RLQC 3JB9J 1OX8A 3OBWA 1UGVA 4N4HA 2JT4A 2PTKA 3EFOA 4M7DG 3ZL7C 1I81A 1SRMA 2EGAA 4J83A 5KE3A 1IHVA 4YTLA 3RMSA 4CC2A 2DA9A 2COWA 5LJ3j 2KE9A 5CIUA 2R5AA 2NLUA 4M7AC 1SKUB 3CMAQ 3VS4A 3OW2S 2HNIA 1VQKT
chains in the Genus database with same CATH topology
3HP9A 3JSCA 3LH0A 3S6WA 5LJ5d 2QDYB 2EAYA 5LJ5j 2D6FA 3CD6T 2G3RA 3DLLA 5CQYA 1VQPT 3JCMf 3OYFA 1YBYA 4R55A 3MP1A 3A8OB 1BI2A 5CVIA 3FRNA 1PSEA 3V8LA 3RUXA 4EMGA 5CCAA 3OYKA 4M75A 1Q82C 2JTFA 2XICA 4XU1A 4D6WA 4C92B 4HCZA 1VIFA 4JRPA 2E1HA 4MZPA 3M55A 1EIFA 4BACA 3V8JA 2OTJA 4BB7A 2QQBA 4BY6B 1VQNT 3A8LB 1VQKA 2IVWA 3OYLA 2DIGA 3CEYA 4JJNK 3S3NA 4TVRA 2X4YA 3VUZA 2V8JA 1WPYA 2DXUA 4M7AG 2LNVA 3CD6A 3SWNB 1VQPA 1YI2T 4A53A 4C0FA 2ZZDA 4M78G 3TEEA 1OZ2A 3HHTB 4Z02A 2Y4YA 2E64A 2KVQG 1U1SA 3PTAA 2M0OA 1LJOA 1XQHA 5J39A 1VQ9A 3GIBA 1M90U 4CRIA 4FT4A 4P5NA 4PNOA 1BI1A 2DK3A 4MZMA 5LJ3f 3SFMA 4Y91A 3X20B 3CPFA 4M78D 3GPLA 4NL2A 3E19A 1VQNA 1KHCA 3G6ET 2E70A 2LX9A 3OYAA 5GAMh 1W2BA 4VUBA 1G3SA 4X9CA 2E5QA 3X26B 3NFCA 3I56T 3OYDA 3DB3A 5GAMg 2OTLT 2LT4A 3P8DA 3M59A 3M9QA 1YI2A 2DXBA 3FIFA 3FJPA 2LQ8A 3MCAB 1YCYA 1DJ7B 4F7UE 1WNLA 3GOXA 2EQKA 3J80E 4QQGA 2O01E 2R58A 3JCMg 3C94A 2RK1A 1O75A 5LJ5f 2X4XA 3UWNA 3CCET 1Q82U 2KY9A 2LTOA 1KQ2A 3L1AA 4IUUA 5GAOm 3G6EA 1WQWA 3E1SA 2F5TX 5IN1A 5GANh 2LQKA 3LGFA 5GAN2 5GAOl 3OA6A 3CXCA 1YJ9T 1VQ5T 4M75D 4M78B 3I56A 1FWZA 1N8RU 1WJQA 2KDSA 2XK0A 1KQSA 2DXCA 1YIJT 2QI2A 3EFRA 4QQ6A 1VQ4T 3A8HB 3PNWC 5FU6B 1FXXA 3L2VA 4IKFA 3QZ5B 3PIPA 2D0QB 1B34B 3AHUA 3OQ5A 3A5ZB 3HRSA 4EMHA 2RHYA 3OYMA 3LYIA 5KH6A 3M58A 3CCEA 4LD9K 3CCRA 2KAFA 4F7UA 5IT9E 1QP3A 1G3TA 2GCXA 1K9MU 2K57A 4BY6C 1OYXA 2RM4A 5GAOq 3ZEHA 2KQWA 1VQ5A 3S3OA 1X6OA 3BDUA 3LX7A 1QVGS 1SSFA 2EQUA 4DA4A 3QSUA 4KT0E 3SWNC 2RO0A 1WJRA 2OAUA 3QDRB 2CZ7B 1Q81U 3M4GA 2DEQA 2RJFA 5C6SA 4M75B 4OB2B 4ZGEB 3JB9G 4JRKA 1YJWT 4C5GA 1IZ6A 4RG2A 3PFSA 3N5BB 4X9DA 4E7JA 3ZFJA 5GAN8 3OSVA 2DZCA 5FU7C 3CC4A 2AHJB 5GAN6 3CXCS 2P0KA 2VUBA 4FL6A 3QYHB 4FM4B 1LOJA 4IURA 4N4GA 4XU2A 3M5AA 2RHIA 3JAME 2D9TA 1K73U 4MDWA 3JCMX 4QQDA 4UC4A 5A0LA 1KQSS 5GAN4 3VJPA 2DO3A 3QZ9B 1KD1C 1D3BA 4HCCA 4NS5A 2A7YA 2KMTA 4EPCA 3JCMc 2MF2A 1YJWA 3HFOA 5LJ3h 1WJSA 3WXMB 4C8QF 3QJ6A 5GMKh 4M75E 1VQOA 5KCHA 4C5EA 2GFUA 5LJ3g 3JCMW 2XKOC 4A4KA 5GAN5 3BY7A 2BIVA 4PJOE 1Y7XA 4XTZA 5DLQE 4ZTJA 4F7UG 3CC2T 4OGEA 5J26A 1RI0A 3CC7A 2LCLA 2XDDA 2ZCFB 1U1TA 4M78C 3NTIA 2F5KA 3H6ZA 1QW1A 5A0GA 5I21A 4OMFB 4E7IA 3OMCA 3UPUA 3QIIA 2DZ9A 2WSFE 5FU6C 4XU0A 2ZGWA 5DLOA 4JS4A 4ELYC 5LJ5h 3J7AF 3OMGA 4QVCA 3OYCA 2VC8A 3JCMb 2YLBA 1M5Q1 2E6ZA 5DM7R 4PJOF 5LJ5g 3GP8A 1P92A 3G4ST 1GXIE 2V8KA 4IUPA 5KE2A 4XTUA 3CC2A 2WSEE 3H8ZA 2P0PA 5D6YA 3X28B 5M9OA 1VQ9T 5GAN3 4L59A 2XDBA 2H3JA 3JB9I 4BDZA 2E10A 2DD4A 3X24B 3DB4A 4L6V5 3OSSC 5EG2A 1S72A 4PJOA 4J8OA 3MEAA 2MWPA 2EYQA 4M75C 2DJZA 2LT1A 1N9RA 4MDXA 3S3MA 1KD1U 2O4XA 4KULA 1NE8A 4F7UB 4HT8A 2JOYA 2DPPB 5GANe 3G4SA 4C5IA 3INZA 5CKFA 3OBYA 3L2RA 2GQVA 3MEWA 2RJCA 3OYNA 3CPWS 2FB7A 2HBPA 4OB1B 3ASKA 1I8FA 4PL6A 3FC3A 2A3LA 1H641 2K5FA 3EFSA 2RI3A 1PSFA 2PU9B 5GAOn 1UGQB 2DXTA 4XTXA 2MI6A 3OS0A 2PQWA 3L2ZA 1UEBA 2RJEA 2QA4T 5FU7B 2DAQA 3RMQA 3G7ZA 3P8BB 1K8AU 3CBMA 3M4YA 2CZ0B 3CCMT 2LCCA 2EIFA 3F70A 1QVGA 4KBMB 1ZBXA 4C8QD 2DTHA 3JCMh 3QKJA 5D6XA 3VU3C 4JLIA 3CMAT 1W4SA 3PGGA 4IUQA 1UGSB 3BDLA 5CKBA 4M7DE 1Y71A 4LDVA 4A4GA 5CK9A 4M75G 4RCBA 1M1KC 1D3BB 4BE1A 3UDCA 4EDUA 4J6YA 1Q86C 3CCRT 2QA4A 3P8HA 1XNIA 3MO8A 4PJOG 3G71T 3JCMJ 3X25B 2B8AA 3LLRA 2WSCE 4FT2A 3CCMA 1YITT 3L2QA 5GAMd 3QYGB 4KUDK 2JZ2A 2RHXA 2C06A 3PMIA 4PJOD 2XG8D 2ZPIB 3BFMA 4OP0A 2QEXT 2DTIA 2P0QA 1QVFS 4M7DF 2FL7A 3CMAA 4JDSA 2MMPA 2RH2A 3E9FA 4BDYA 2CS7A 2YLCA 3FDRA 3A8MB 3CCVT 3RKXA 2EJFA 2DKGA 1Y07A 2R5MA 4C92F 2VXFA 5LJ3e 1VQ8T 2XHCA 5GMKe 3JB9H 3CC4T 3G71A 1K9MC 4M7DA 2VXEA 2PUOB 1MHNA 4N0AA 3QPHA 5CKDA 5GANd 1JB0E 3GNGA 3CCQT 1YITA 1Q7YC 1YHQA 4J6WA 1BI3A 1NPPA 2Y90A 2RA2A 4M77E 3FB9A 2QEXA 2E41A 4N0AC 4LDXA 2DVEA 4HA8A 3VV0A 1VQOT 4HT9A 3CCST 3HFNA 4PJOB 4OF1A 3CCVA 1FX7A 2VYTA 4C8QE 5FROA 5GAOp 2MAMA 2L89A 4JUVA 2FVUA 1U8RA 1VQ8A 2JVVA 3CCLA 1M1KU 2O4XB 5GMKi 3L42A 3RKYA 1Q86U 4JLGA 1BIBA 5A2QE 3OYYA 2ZPEB 5J3BA 3CCQA 2X4JA 2CGHA 1KC8U 2F69A 4M77F 5I2SA 4M7AE 4QW2A 2K4YA 3CBOA 3NTKA 3MP8A 2RD1A 3OYEA 2EJ9A 4C5HA 4EMKA 2P4TA 3LWHA 1KHIA 1UGPB 1QP2A 4A4HA 3ME9A 3CCSA 1V29B 4LDWA 3HKSA 4PKCC 3E9GA 3MP6A 4X34A 3ZBDA 4M77A 3RESA 4IUVA 1M8VA 2QQ9A 2RI5A 2BKDN 3CPWA 1NZ9A 1N27A 4JRQA 2M16A 2DTOA 4IUTA 2L8DA 2ZPBB 4M7AF 1NJIC 4ZTFA 4C8QA 1BKBA 3OYHA 1Q7YU 3RERA 1S72T 1VIEA 4MMLA 1JJ2S 4RMOA 3HSBA 5FRMA 2L3RA 4NOYA 2HD0A 2QQSA 3VYHB 4M7DD 4C8QC 5CQXA 3LGLA 4M7AA 2XDPA 5LJ3d 1H3ZA 2CKKA 2PVDB 2FHDA 5GAMe 5C0MA 2M1HA 3OY9A 2MWOA 3FLGA 2YRVA 3V7CA 3VKIA 2BUDA 1VUBA 4XAXB 4C92D 1K8AC 2JUFA 4C0ZA 5GMKm 2VV5A 2CZ6B 5GMKl 4XTYA 3QJYA 2RI2A 2QQRA 2XI9A 3SB2A 3META 3JCMe 3MEVA 3JCMV 5IAYA 3ER0A 3LW5E 3JRZA 3CC7T 2X35A 2PUKB 1HXDA 3HPWA 4ZGJB 1K73C 2LDMA 2QQAA 3T9NA 2ZPHB 2EQMA 3RIRA 4PJOC 2ZPFB 3V8KA 1LNXA 2EQJA 2XIDA 3WVEB 1Y96A 2E12A 2VGMA 1R8OB 3UT1A 5GAN7 5GAOr 4A4FA 4M77G 4M7DB 2K5IA 4C0DC 1QVFA 4OVAA 1X75C 4XK8E 4Y28E 2EJGA 4MMKA 1NPRA 1WQ7A 2E65A 4ELZC 4NL3A 4C0GA 1G3WA 4OB0B 3KUFA 1BIAA 4C8QG 4M77D 1UB4A 5I2MA 3HL8A 1NJIU 5HY6A 2K5LA 3SD4A 2KSSA 3DLMA 4LD6A 1N8RC 4ZN1A 4J5YA 4E7KA 2HNIA 4KUIA 2XD0A 3GF5A 3VYGA 4BE2A 3OYIA 3M53A 3C12A 4FU6A 4QVDA 1VQLT 2XU8A 4XTWA 2GFAA 3OYGA 4DQ2A 2HQXA 1N6AA 2RB6A 2JN0A 2RHUA 4FSXA 4RKUE 1WGSA 1ZHIA 2JTMA 1VQMT 4HCBA 4B9WA 2KK4A 3CBPA 5CR2A 3KXTA 1QVPA 4M7AD 1M1FA 4EMKB 3JB9F 3TU4K 4E7HA 1I4K1 5A0DA 3URGA 1ZQ1A 4MZTA 3LWIA 4C92E 1OZ3A 3QHSA 4XQ3A 4E7LA 4M77B 4J7FA 1MGQA 1JRIA 4A54A 5GAMj 3L2WA 4LDYA 1YHQT 3NTHA 4RCCA 1Q81C 3RKWA 3EAEA 4BD3A 3KBGA 4GLKA 3L2UA 1I5LA 2WACA 5HKCA 3R6OA 1VQ7T 1VQLA 3V7SA 1RL2A 5HK3A 4JRIA 3VUBA 3JCMd 2M9UA 4II1A 4C8QB 1VQMA 1O9SA 2RK2A 4HKEA 2EKOA 3MEUA 3OS5A 3M57A 1VQ6T 2K2VA 4J6XA 5LL6S 3C95A 2HQEA 3Q1JA 3CCLT 4FIBA 2JNGA 4M7AB 2EFIA 2V8IA 1KG1A 4JS5A 1XTDA 4ATOA 5GANj 3CCJT 4L5GA 3TCJA 5GANg 3J81E 2OTLA 2RJDA 4F7UF 1VQ7A 1JJ2A 2E6NA 3JCMQ 4M7DC 3QUIA 4C92A 5DY9A 2PVOB 4CI0C 4ZGDB 4ZN3A 3OYBA 3BW1A 5CAIA 3V7RA 2Y4XA 4WF2A 3CMET 3QXEB 4OGCA 1VQ6A 2I2LA 2ZPGB 5AYFA 4BI4A 4C92C 5LJ5e 4O5VA 3WVDB 4LDUA 3CCUT 1G3YA 4C0DB 4ME7A 1HK9A 4BUGA 2K3YA 3HRUA 1UGRB 1XOVA 1BI0A 3SWNA 3OB9A 5HK0A 1W2BS 2QTXA 2LRQA 4PLIA 2EWNA 1Y96B 1IREB 2CYZB 4QVZA 2L5QA 4B9XA 3CCJA 2X4WA 1YJ9A 4DOWA 3QBYA 4E47A 1YIJA 2VGNA 4M78E 1AHJB 5CKEA 4V2SA 5D6WA 3DKMA 1VQ4A 3OW2A 4XTVA 4PLLA 3TREA 1KC8C 1G5VA 4Q5WA 3A8GB 3PMTA 3PT9A 4GY5A 3CMEA 3JB9J 3SDZA 5GAMf 3C4SA 3JCMP 4EMKC 4R56A 3OBWA 3CCUA 2PVGB 3MHXA 3GLXA 4N4HA 3JB9D 3I55T 4RG8A 1YJNT 3OYJA 4A4EA 2FYKA 3FEOA 1M9SA 2LC4A 1TH7A 4M7DG 4M77C 1KQ1A 1I81A 4XU3A 4J83A 5KE3A 4M78F 1M1GA 5KCOA 5CO7A 4YTLA 4BI8B 2R57A 3M56A 3OS1A 3RMSA 2CZ1B 3M54A 3QO3A 4O6JA 3QG1A 3O8VA 5L8RE 4BI3A 4C92G 1BYMA 4OB3B 2YHTA 2HAXA 2GF7A 3PIOA 5GANf 2DIQA 5LJ3j 2K3XA 1N9SA 1OI1A 1M4ZA 5CIUA 5GMKj 4M78A 5FRNA 3HRTA 4DOVA 4BE0A 2QXFA 3I55A 2R5AA 1YJNA 2DD5A 2NLUA 1M90C 3GNFB 4M7AC 2LVMA 4J7IA 5CKHA 4N4IA 1JBMA 5FLXE 1B34A 2OTJT 1X01A 3OS2A 3OW2S 2RHZA 2IG0A 1VQKT 4M75F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH0 A;  3S6W A;  3CD6 T;  2G3R A;  3DLL A;  1VQP T;  3OYF A;  1YBY A;  3MP1 A;  1Q82 C;  3OYK A;  2JTF A;  4HCZ A;  4BAC A;  1EIF A;  2OTJ A;  1VQN T;  1VQK A;  3OYL A;  2DIG A;  3CEY A;  3S3N A;  4TVR A;  2X4Y A;  3CD6 A;  1YI2 T;  1VQP A;  1OZ2 A;  4Z02 A;  2KVQ G;  2M0O A;  5J39 A;  1VQ9 A;  1M90 U;  4CRI A;  1K9M C;  3CPF A;  1VQN A;  3G6E T;  1KHC A;  2E70 A;  3OYA A;  1W2B A;  2E5Q A;  3I56 T;  2OTL T;  3DB3 A;  3OYD A;  3P8D A;  3M9Q A;  1YI2 A;  2LQ8 A;  3GOX A;  3J80 E;  2EQK A;  4QQG A;  2R58 A;  2X4X A;  3UWN A;  3CCE T;  1Q82 U;  2LTO A;  4IUU A;  1KC8 C;  3G6E A;  1K8A C;  5IN1 A;  3LGF A;  3OA6 A;  3CXC A;  1YJ9 T;  1VQ5 T;  3I56 A;  1N8R U;  1WJQ A;  2KDS A;  2XK0 A;  1KQS A;  1YIJ T;  1VQ4 T;  4QQ6 A;  3PNW C;  3L2V A;  4IKF A;  3PIP A;  3OQ5 A;  3A5Z B;  2RHY A;  3OYM A;  3LYI A;  5KH6 A;  3CCE A;  3CCR A;  5IT9 E;  1K9M U;  1OYX A;  3ZEH A;  1VQ5 A;  3S3O A;  1X6O A;  1QVG S;  3LX7 A;  1SSF A;  2EQU A;  2RO0 A;  1WJR A;  1Q81 U;  2RJF A;  5C6S A;  1YJW T;  4C5G A;  1IZ6 A;  4RG2 A;  3PFS A;  4E7J A;  3CC4 A;  3CXC S;  2P0K A;  3CC7 T;  4FL6 A;  4IUR A;  4N4G A;  3JAM E;  1K8A U;  5FRM A;  2RHI A;  2D9T A;  4QQD A;  1KQS S;  4UC4 A;  2DO3 A;  1KD1 C;  4NS5 A;  1YJW A;  1VQO A;  1WJS A;  3QJ6 A;  5KCH A;  4C5E A;  2GFU A;  2BIV A;  5DLQ E;  4ZTJ A;  3CC2 T;  5J26 A;  1RI0 A;  3CC7 A;  2LCL A;  3NTI A;  2F5K A;  3H6Z A;  4E7I A;  3OMC A;  3QII A;  3J7A F;  3OMG A;  3OYC A;  2E6Z A;  5DM7 R;  3G4S T;  4IUP A;  5KE2 A;  3CC2 A;  3H8Z A;  5D6Y A;  5M9O A;  1VQ9 T;  4L59 A;  4BDZ A;  3DB4 A;  1S72 A;  3MEA A;  2MWP A;  1KD1 U;  3S3M A;  2O4X A;  2JOY A;  3G4S A;  4C5I A;  3L2R A;  3MEW A;  3OYN A;  2RJC A;  3CPW S;  3ASK A;  4PL6 A;  3FC3 A;  2RI3 A;  3OS0 A;  2MI6 A;  2PQW A;  1UEB A;  2RJE A;  2QA4 T;  2DAQ A;  3P8B B;  3CCM T;  2LCC A;  2EIF A;  3F70 A;  1QVG A;  3QKJ A;  3CMA T;  5D6X A;  4IUQ A;  3BDL A;  4A4G A;  1M1K C;  4BE1 A;  4EDU A;  1Q86 C;  3CCR T;  2QA4 A;  3P8H A;  1XNI A;  3MO8 A;  3G71 T;  2B8A A;  3LLR A;  3CCM A;  1YIT T;  3L2Q A;  2JZ2 A;  2RHX A;  3PMI A;  2QEX T;  1QVF S;  3CMA A;  3E9F A;  4BDY A;  3FDR A;  3CCV T;  2R5M A;  1VQ8 T;  2XHC A;  3CC4 T;  3G71 A;  3CCQ T;  1Q7Y C;  1YIT A;  1MHN A;  1YHQ A;  1NPP A;  2QEX A;  1VQO T;  3CCS T;  3CCV A;  2VYT A;  5FRO A;  2L89 A;  1VQ8 A;  2JVV A;  3CCL A;  1M1K U;  2O4X B;  3L42 A;  1Q86 U;  5A2Q E;  3OYY A;  5J3B A;  3CCQ A;  1KC8 U;  4QW2 A;  3NTK A;  3MP8 A;  3OYE A;  4C5H A;  1KHI A;  4A4H A;  3ME9 A;  3CCS A;  3HKS A;  3E9G A;  4X34 A;  3MP6 A;  4IUV A;  2RI5 A;  2BKD N;  3CPW A;  1NZ9 A;  1N27 A;  2M16 A;  4IUT A;  2L8D A;  1NJI C;  4ZTF A;  1BKB A;  3OYH A;  1Q7Y U;  1S72 T;  1JJ2 S;  2L3R A;  2QQS A;  3LGL A;  2XDP A;  1H3Z A;  2CKK A;  2FHD A;  5C0M A;  2M1H A;  3OY9 A;  2MWO A;  3FLG A;  2YRV A;  2BUD A;  2JUF A;  2RI2 A;  2QQR A;  3MET A;  5IAY A;  3MEV A;  3ER0 A;  2X35 A;  1K73 C;  2LDM A;  2EQM A;  2EQJ A;  3UT1 A;  4A4F A;  1QVF A;  4OVA A;  1NPR A;  3KUF A;  1NJI U;  5HY6 A;  3SD4 A;  3DLM A;  1N8R C;  4LD6 A;  4ZN1 A;  4E7K A;  4BE2 A;  3OYI A;  1VQL T;  4FU6 A;  2GFA A;  3OYG A;  2HQX A;  2RHU A;  1WGS A;  1VQM T;  4B9W A;  4E7H A;  1OZ3 A;  4E7L A;  3L2W A;  1YHQ T;  1Q81 C;  1K73 U;  3NTH A;  3EAE A;  4BD3 A;  3KBG A;  3L2U A;  1VQL A;  1VQ7 T;  2WAC A;  1RL2 A;  4II1 A;  1VQM A;  2EKO A;  3MEU A;  1VQ6 T;  5LL6 S;  2HQE A;  3CCL T;  3Q1J A;  2JNG A;  2EFI A;  1XTD A;  3CCJ T;  3J81 E;  2OTL A;  2RJD A;  1VQ7 A;  1JJ2 A;  2E6N A;  4ZN3 A;  3OYB A;  3CME T;  1VQ6 A;  3CCU T;  2K3Y A;  3OB9 A;  1W2B S;  2LRQ A;  4PLI A;  1YJ9 A;  3CCJ A;  4QVZ A;  4B9X A;  2X4W A;  3QBY A;  1YIJ A;  1VQ4 A;  5D6W A;  3OW2 A;  4PLL A;  3TRE A;  1G5V A;  4Q5W A;  4GY5 A;  3PMT A;  3CME A;  3C4S A;  3CCU A;  4N4H A;  3I55 T;  1YJN T;  3OYJ A;  4A4E A;  3FEO A;  5KE3 A;  1M1G A;  5KCO A;  4YTL A;  2R57 A;  3OS1 A;  3O8V A;  3PIO A;  2GF7 A;  2DIQ A;  2K3X A;  1OI1 A;  5FRN A;  5CIU A;  4BE0 A;  3I55 A;  2R5A A;  1YJN A;  2NLU A;  1M90 C;  2LVM A;  4N4I A;  5FLX E;  2OTJ T;  3OS2 A;  3OW2 S;  2RHZ A;  2IG0 A;  1VQK T; 
#chains in the Genus database with same CATH topology
 3LH0 A;  2MPX C;  1HJD A;  1WHL A;  2EAY A;  2G3R A;  1YIT Q;  5CQY A;  1VQP T;  1JXO A;  3OYF A;  1YHQ Q;  1RAA B;  1TOV A;  1PKT A;  3FRN A;  3RUX A;  1WXB A;  1Q82 C;  4XU1 A;  1G83 A;  2A37 A;  1HYO A;  2ESW A;  4JRP A;  1EIF A;  3CCV Q;  2QQB A;  2EW3 A;  1VQN T;  3A8L B;  2IVW A;  2DIG A;  4JJN K;  1UFF A;  4M7A G;  2LNV A;  3SWN B;  1FMW A;  4C0F A;  3TEE A;  4Z02 A;  3PTA A;  1LJO A;  1XQH A;  4OMO A;  1M90 U;  4PNO A;  1BI1 A;  2DK3 A;  3CCS Q;  1KHC A;  2LX9 A;  5GAM h;  1PM3 A;  2K3B A;  3X26 B;  1G3S A;  2FRW A;  3DB3 A;  1SEM A;  2NUP A;  4LUD A;  1YI2 A;  3EFO B;  1PRM C;  2HSP A;  4JZ4 A;  1C1A A;  2R58 A;  2A0F B;  1OQK A;  2KT8 A;  3UWN A;  1PHT A;  3CCE T;  1WQW A;  3E1S A;  2F5T X;  5GAN h;  1C0M A;  3OA6 A;  1UJ0 A;  2D8J A;  1YJ9 T;  1FWZ A;  1R0B G;  1WA7 A;  2XK0 A;  5FU6 B;  3L2V A;  3E2U A;  4EMH A;  2RHY A;  3OYM A;  3LYI A;  1YP5 A;  3M58 A;  1G3T A;  2JS0 A;  4LE9 A;  4BY6 C;  2LJ1 A;  3ZEH A;  2KQW A;  2IPO B;  1SSF A;  2EQU A;  4KT0 E;  1SHF A;  2OAU A;  1GFC A;  3H0H A;  3NMZ C;  3N5B B;  2GNC A;  3ZFJ A;  2QK0 A;  1SF9 A;  2JMA A;  2KEA A;  4FL6 A;  4X1V A;  4N4G A;  3JAM E;  1EX4 A;  5FRM A;  4HCK A;  4QQD A;  2DL5 A;  1QKW A;  2RQT A;  3VJP A;  1D3B A;  1ZLM A;  2KXC A;  1YJW A;  1QLY A;  5GMK h;  3I9Q A;  2XKO C;  3BY7 A;  1V1C A;  2BIV A;  1PRL C;  2JTE A;  2QG9 B;  3RDV A;  3M0S A;  4F7U G;  5J26 A;  2NUP B;  2ZCF B;  1U1T A;  1KJW A;  2F5K A;  4PJL A;  4OMF B;  1Z9Q A;  2WSF E;  1M5Q 1;  2E6Z A;  5LJ5 g;  2KXD A;  1WLP B;  4KGV B;  5KE2 A;  2OTL Q;  4OMM A;  3CC2 A;  1VOM A;  5D6Y A;  5M9O A;  5GAN 3;  1WX6 A;  2E10 A;  1XJW B;  1S72 A;  4PJO A;  2M51 A;  1BK2 A;  1VQ6 Q;  2EYQ A;  2DJZ A;  1N9R A;  4MDX A;  1KD1 U;  1NE8 A;  1K4U S;  4C5I A;  1WXT A;  2KBT A;  2GQV A;  2RJC A;  2HBP A;  4OB1 B;  2DYB A;  1I8F A;  4PL6 A;  2D0N A;  2A3L A;  5GAO n;  1S1N A;  1PSF A;  1VQ4 Q;  3VS6 A;  3L2Z A;  1X2Q A;  3RMQ A;  1JJ2 P;  3G7Z A;  1YWO A;  2D1X A;  2GTJ A;  2CZ0 B;  2KRS A;  3F70 A;  1ZBX A;  1T3L A;  4F04 B;  8ATC B;  1TUG B;  2EVR A;  3CMA T;  4JLI A;  3BDL A;  1Y71 A;  4LDV A;  1D3B B;  5ECA A;  2QA4 A;  3X25 B;  1YIT T;  2O2O A;  2JZ2 A;  2X3X D;  2C06 A;  1QCF A;  2RH2 A;  2EKH A;  2W0Z A;  2C0I A;  3CCV T;  4Z88 A;  4CC4 B;  3C0C A;  5LJ3 e;  3CC4 T;  1E6G A;  3G71 A;  4M7D A;  4N0A A;  5CKD A;  1JB0 E;  1NPP A;  1RAB B;  2Y90 A;  4M77 E;  4LDX A;  1OPL A;  4HA8 A;  3CCS T;  4PJO B;  4OF1 A;  4DBF A;  1FX7 A;  2MAM A;  1VQ8 A;  2KYB A;  4CC7 A;  3CCL A;  1M1K U;  2COY A;  4JLG A;  5A2Q E;  4Z89 A;  2HL5 C;  3RR6 A;  2CSI A;  4M77 F;  4QW2 A;  2RD1 A;  3OYE A;  4C5H A;  1UGP B;  4LDW A;  5FW9 A;  2YUN A;  3RES A;  1M8V A;  1X27 A;  1YI2 Q;  2LNH B;  1NZ9 A;  1N27 A;  1VYT A;  4IUT A;  1WHK A;  2GGR A;  4C8Q A;  1JJ2 S;  2L3R A;  4KRT A;  1ZUK A;  3LGL A;  4M7A A;  2XDP A;  2MWO A;  2YRV A;  1Q95 G;  2E3H A;  4OML A;  2F1L A;  4HVW A;  1MNE A;  4AT1 B;  3MEV A;  5IAY A;  3ER0 A;  2QQA A;  3T9N A;  1WHJ A;  2B86 A;  1K8A R;  4E6R A;  5GAN 7;  5GAO r;  4M7D B;  4OVA A;  4E7S A;  1W6X A;  4Y28 E;  1WQ7 A;  3CXC P;  4OB0 B;  4FYX B;  4FSS A;  3HL8 A;  1KQS P;  2K5L A;  1WI7 A;  1V76 A;  4BE2 A;  4GLM A;  4LXC A;  2JN0 A;  4HCB A;  3CBP A;  1RAI B;  1M1F A;  1YJW Q;  5A0D A;  3URG A;  2YDL A;  4RTV A;  5GAM j;  2JMC A;  3NTH A;  4RCC A;  3RKW A;  1UEC A;  3TQ7 P;  1R0C B;  1RL2 A;  1LVK A;  4JRI A;  1AWJ A;  4II1 A;  4C8Q B;  1VQM A;  2RK2 A;  4HKE A;  2GTO A;  3MEU A;  2HKQ B;  1VQ6 T;  5LL6 S;  1M8M A;  2DLP A;  3C95 A;  2YUQ A;  3Q1J A;  2QYZ A;  4M7A B;  2EFI A;  2V8I A;  3M0Q A;  4ATO A;  5GAN j;  3CC2 Q;  5GAN g;  3LH5 A;  1VQ7 A;  1JJ2 A;  2BE7 D;  2E6N A;  3QUI A;  3I35 A;  4C92 A;  1OV3 A;  4ZN3 A;  1S72 Q;  3V7R A;  2ECZ A;  4BI4 A;  5LJ5 e;  4O5V A;  5KYU A;  2DRK A;  4LDU A;  1XOV A;  1RAE B;  5HK0 A;  3OB9 A;  1IXD A;  2LRQ A;  3CCJ A;  2L5Q A;  5HCK A;  1NEB A;  1WHM A;  1YIJ A;  1WYX A;  1AHJ B;  4V2S A;  5D6W A;  4PLL A;  1VA7 A;  2K6D A;  3A8G B;  4GY5 A;  3JCM P;  2PVG B;  3MHX A;  3GLX A;  2CP6 A;  4M77 C;  1KQ1 A;  1SG5 A;  3QG1 A;  4J9C A;  5L8R E;  2QA4 Q;  1BYM A;  5KYY A;  2YHT A;  2HAX A;  2K3X A;  1OI1 A;  1OX9 A;  1M4Z A;  1TU0 B;  2FO0 A;  5GMK j;  1OEB A;  2QXF A;  3THK A;  3I55 A;  4DEY A;  1M90 C;  1PWT A;  1FMK A;  4N4I A;  5CKH A;  2RPN A;  1JBM A;  1U3O A;  3QWX X;  3I5S A;  2HEQ A;  1RAG B;  2IG0 A;  3CCR Q;  2OAW A;  3G71 Q;  2CH4 A;  2CP3 A;  3MP1 A;  3V8L A;  4CC3 A;  5CCA A;  3OYK A;  2XIC A;  4C92 B;  2E1H A;  4BAC A;  3V8J A;  2LP5 A;  4BY6 B;  1VQ8 Q;  3CCL Q;  5KYU B;  4AFQ C;  3CD6 A;  1YI2 T;  2DL8 A;  2GQI A;  3TVT A;  2OJ2 A;  4M78 G;  4ORZ A;  2E64 A;  1TUD A;  5J39 A;  4FT4 A;  3SFM A;  3EHR A;  1VQO Q;  4Y91 A;  3CPF A;  4M78 D;  3OYA A;  1B07 A;  3NGP A;  2LT4 A;  3P8D A;  3M59 A;  2VKN A;  4F7U E;  2EQK A;  5LJ5 f;  2YUP A;  1E7O A;  1KQ2 A;  5KYY B;  2L0A A;  2LQK A;  1IRX A;  3CXC A;  1M27 C;  4M75 D;  3I56 A;  1WJQ A;  1KQS A;  4WTO B;  2QI2 A;  4QQ6 A;  3A8H B;  3PNW C;  1NJI R;  3CPW P;  1GCQ A;  3AHU A;  3EGX A;  2L2P A;  5IT9 E;  1OYX A;  1C6V X;  5GAO q;  5FWC A;  3LX7 A;  1QVG S;  3QSU A;  2RO0 A;  4J9D A;  3QDR B;  3M4G A;  5C6S A;  4JRK A;  1YJW T;  2GBQ A;  1I07 A;  3KFV A;  1W1F A;  5GAN 8;  3OSV A;  2QTV A;  1AWX A;  2P0K A;  3JCM f;  1K8A U;  3M5A A;  2D9T A;  4MDW A;  3JCM X;  1MMN A;  4J9I A;  5GAN 4;  2DYI A;  2HMA A;  1KD1 C;  4NS5 A;  2MF2 A;  3M0P A;  3WXM B;  2CT3 A;  5KCH A;  1I5O B;  2GFU A;  3H41 A;  5LJ3 g;  2DNU A;  1NEG A;  3JCM W;  2YRD A;  1Y7X A;  5DLQ E;  3CC2 T;  1RI0 A;  3CC7 A;  5AT1 B;  1VQM Q;  1QW1 A;  5A0G A;  5I21 A;  1T3S A;  1G2B A;  2DZ9 A;  5I11 A;  1M1K R;  4XU0 A;  3OMG A;  4RUG A;  4A63 B;  2VC8 A;  1P92 A;  1GXI E;  4F16 A;  1WIE A;  2WSE E;  1VQ7 Q;  1WFW A;  3H8Z A;  2P0P A;  3X28 B;  1VQ9 T;  4L59 A;  1W2B P;  2XDB A;  4BDZ A;  3DB4 A;  2DL7 A;  3OSS C;  4J8O A;  4PJM A;  3EGX B;  2LT1 A;  4KUL A;  9ATC B;  4HT8 A;  2JOY A;  2DPP B;  1AT1 B;  1CKB A;  5GAN e;  3G4S A;  3CCJ Q;  3INZ A;  5CKF A;  1JO8 A;  3CPW S;  1MV3 A;  2CT4 A;  1F1B B;  3EH2 A;  1YIJ Q;  2KRO A;  3FC3 A;  4M4Z A;  2PU9 B;  2DXT A;  2LJ3 A;  2QA4 T;  5FU7 B;  1UTI A;  2YUO A;  1QVG A;  4OMP A;  1MUZ A;  4C8Q D;  4IIM A;  2X9H A;  2LX7 A;  1PCX A;  1VYV A;  5CKB A;  5CK9 A;  2ROT A;  4AFS C;  1M1K C;  2M02 A;  4PFZ A;  2HZY A;  1AZG B;  3CCR T;  2BZX A;  3MO8 A;  1R77 A;  3G71 T;  3JCM J;  3LLR A;  3I55 Q;  4KUD K;  2SEM A;  1UHC A;  1OPK A;  1HSQ A;  3PMI A;  2P0Q A;  4LNP A;  2FL7 A;  2H8H A;  4BDY A;  3FDR A;  2DKG A;  2R5M A;  4KGX B;  2VXF A;  1VQ8 T;  1YFN A;  2XHC A;  5GMK e;  2PUO B;  2BZY A;  1BI3 A;  2RA2 A;  4B6M A;  1K9A A;  3FB9 A;  3R6N A;  2QEX A;  1SHG A;  2DVE A;  2IIM A;  1VQO T;  4HT9 A;  3HFN A;  4AFU C;  7AT1 B;  2VYT A;  5FRO A;  5GAO p;  4JUV A;  2FVU A;  5GMK i;  3CD6 Q;  8AT1 B;  3L42 A;  2CSQ A;  1ABQ A;  3CCQ A;  2ZPE B;  2X4J A;  2YRC A;  4KGZ B;  1NM7 A;  1QCO A;  4OMQ A;  4A4H A;  1V29 B;  2DBM A;  3E9G A;  3GBQ A;  4M77 A;  4IUV A;  2QQ9 A;  2A08 A;  3CPW A;  4HXJ A;  4JRQ A;  2M16 A;  1RLP C;  4D8K A;  2BTT A;  1RI9 A;  2OX7 A;  1UDL A;  4QKU A;  3OYH A;  1VIE A;  2JM9 A;  4DBH A;  4NOY A;  1N5Z A;  5IHN A;  1H3Z A;  5C0M A;  2M1H A;  3VKI A;  3I56 Q;  2BUD A;  4C92 D;  1G8X A;  1Q81 R;  2J6F A;  3EG9 A;  3JRZ A;  2F2X A;  1SRL A;  4FCY A;  3HPW A;  1M3C A;  2Z0W A;  2ZPH B;  3RIR A;  1I1J A;  2EQJ A;  1U5S A;  2FPE A;  1PD1 A;  2EJG A;  1NYF A;  2AIR B;  2E65 A;  4ELZ C;  2QGG A;  1G3W A;  1A0N B;  5I2M A;  1UB4 A;  1X6G A;  3NPF A;  1NJI U;  1D1A A;  3SD4 A;  2KSS A;  3EGU A;  4E7K A;  3OYI A;  1D1B A;  2P84 A;  4FU6 A;  2XU8 A;  4XTW A;  2GFA A;  1RAD B;  4FSX A;  1WGS A;  1AWW A;  2JTM A;  1VQM T;  1T0H A;  1BU1 A;  1ZSG A;  2EGE A;  2W10 A;  1RAF B;  3AT1 B;  2PZ1 A;  2MOX A;  4XQ3 A;  4M77 B;  1JRI A;  1YHQ T;  1Q81 C;  1K73 U;  3CC7 Q;  4BD3 A;  4GLK A;  1I5L A;  1VQ7 T;  5HKC A;  3R6O A;  4RTU A;  3VS1 A;  1ARK A;  4RTX A;  3VUB A;  3JCM d;  2M9U A;  1O9S A;  2EKO A;  3MJX A;  4J6X A;  1OOT A;  1HD3 A;  2O31 A;  2HQE A;  4JS5 A;  3CCJ T;  4L5G A;  3J81 E;  3JCM Q;  3EG9 B;  4D8D A;  4ZGD B;  3BW1 A;  4WF2 A;  4OGC A;  2RQV A;  2FZK B;  4C0D B;  4BUG A;  2K3Y A;  3HRU A;  1UGR B;  2E3I A;  3TSZ A;  3G4S Q;  4PLI A;  1YJ9 A;  2CYZ B;  4QVZ A;  2X4W A;  2KYM A;  3QWY A;  4E47 A;  4M78 E;  4XTV A;  3TRE A;  1G5V A;  3PMT A;  3PT9 A;  1BB9 A;  3EG2 A;  4EMK C;  4E2F B;  3JB9 D;  3I55 T;  4RG8 A;  4A4E A;  1M9S A;  2LC4 A;  1TH7 A;  3PVL A;  4XU3 A;  4M78 F;  1M1G A;  3HTR A;  5IH2 A;  4RTY A;  1YCS B;  3M56 A;  2CZ1 B;  3QO3 A;  4BI3 A;  2EQI A;  4OB3 B;  5IXF A;  3MPU B;  2GF7 A;  3PIO A;  2EPD A;  5FRN A;  1N9S A;  2F2W A;  4DOV A;  1YJN A;  2X3W D;  2LVM A;  4J7I A;  2ENM A;  5FLX E;  1X6B A;  3JV3 A;  3OS2 A;  2RHZ A;  4RTW A;  4M75 F;  3JSC A;  1Q86 R;  2QDY B;  2F2V A;  1KC8 R;  3CD6 T;  3DLL A;  1UG1 A;  5IXB A;  3A8O B;  1PSE A;  4EMG A;  2QEX Q;  4ANJ A;  2JTF A;  4D6W A;  5FWB A;  4HCZ A;  1VIF A;  4FYY B;  4MZP A;  3M55 A;  2OTJ A;  4BB7 A;  2DM1 A;  2BE9 B;  2LCS A;  3S3N A;  2PNI A;  3VUZ A;  1WPY A;  1BBZ A;  3CCQ Q;  2DL3 A;  1EFN A;  1Q7Y R;  5L23 A;  1TWB A;  1OZ2 A;  1PNJ A;  2MYS A;  3HHT B;  2KVQ G;  2M0O A;  3GIB A;  3NHN A;  4CRI A;  4P5N A;  5LJ3 f;  3GPL A;  4MZM A;  5IHI A;  3E19 A;  2E70 A;  2E5Q A;  1NBE B;  3I56 T;  2OTL T;  5GAM g;  2DXB A;  1RAC B;  2LQ8 A;  3MCA B;  1YCY A;  3J80 E;  2O01 E;  1YN8 A;  2RK1 A;  2X4X A;  1Y57 A;  2LTO A;  1NLP C;  2DL4 A;  4IUU A;  1KC8 C;  3G6E A;  1K8A C;  3LGF A;  2YSQ A;  4JJD A;  1FMV A;  2O9V A;  2KDS A;  1VQ4 T;  1FXX A;  1MV0 B;  1TTH B;  4IKF A;  3PIP A;  2D0Q B;  3OQ5 A;  3A5Z B;  2E5K A;  3HRS A;  2M0Y A;  1AOJ A;  5KH6 A;  1D0Z A;  2KAF A;  4F7U A;  4ESR A;  1K9M U;  1GBQ A;  2K57 A;  1VQ5 A;  3S3O A;  1X6O A;  3BDU A;  2SRC A;  4K11 A;  4DA4 A;  2QDL A;  1WJR A;  2CZ7 B;  1Q81 U;  1GL5 A;  2RJF A;  4OB2 B;  4ZGE B;  1FYN A;  1RUW A;  2JM8 A;  4JJC A;  1IZ6 A;  4RG2 A;  1OU8 A;  2DZC A;  3CC4 A;  2AHJ B;  3CXC S;  4IUR A;  3CC7 T;  3QYH B;  1LOJ A;  3M0R A;  4XU2 A;  5I22 A;  1M3A A;  2RHI A;  4UC4 A;  1KQS S;  2DO3 A;  2CP2 A;  4HCC A;  4EPC A;  2KMT A;  2QAZ A;  1QVF P;  3HFO A;  1WJS A;  4C8Q F;  3QJ6 A;  3VS3 A;  4C5E A;  2JXB A;  4XTZ A;  4ZTJ A;  3H0I A;  2LCL A;  2XDD A;  4M78 C;  3H6Z A;  1SPK A;  3VS5 A;  3UPU A;  2AK5 A;  3UA6 A;  2ZGW A;  5DLO A;  4ELY C;  5LJ5 h;  1ABO A;  4ZNX A;  2YLB A;  4WCI A;  5DM7 R;  3VS0 A;  3GP8 A;  3G4S T;  2V8K A;  4XTU A;  1Y0M A;  3EG3 A;  3FJ5 A;  2H3J A;  2EGC A;  2DD4 A;  3D7S B;  1PKS A;  4L6V 5;  1U06 A;  2MWP A;  4M75 C;  2JW4 A;  2DEU A;  4DEX A;  2CP7 A;  4F7U B;  2RMO A;  1YJ9 Q;  3L2R A;  3OBY A;  3MEW A;  3OYN A;  1WDX A;  2RNA A;  3EFS A;  1JXM A;  2RI3 A;  2FPF A;  4XTX A;  1UEB A;  2DAQ A;  3M4Y A;  2LCC A;  2EIF A;  2HL3 A;  2JS2 A;  2DTH A;  2DFU A;  3JCM h;  2NWM A;  2V26 A;  3UF4 A;  4M75 G;  3UDC A;  4EDU A;  4J6Y A;  3P8H A;  4PJO G;  2B8A A;  3OW2 P;  2WSC E;  4FT2 A;  3CCM A;  1YJN Q;  3QDF A;  1ZSZ C;  2HQH A;  4PJO D;  2XG8 D;  2QEX T;  2RQW A;  1QVF S;  1MND A;  2CS7 A;  2YLC A;  1KK7 A;  3A8M B;  1GRI A;  1QQJ A;  1Y07 A;  4C92 F;  3JB9 H;  2VXE A;  3CCQ T;  2DRM A;  3QPH A;  3GNG A;  2DF6 A;  4J9F A;  2HDA A;  4N0A C;  3UA7 A;  4J9G A;  3VV0 A;  2OTJ Q;  2A36 A;  2K9G A;  1AD5 A;  1K73 R;  2L89 A;  1U8R A;  2VB6 A;  2JVV A;  3EG0 A;  1ZBJ A;  3RKY A;  1Q86 U;  1BIB A;  3PE0 A;  1KC8 U;  1AWO A;  2CUB A;  1H8K A;  1T0J A;  3CBO A;  3NTK A;  3MP8 A;  2EJ9 A;  1Q82 R;  4EMK A;  2P4T A;  1KHI A;  2QAS A;  3HKS A;  4PKC C;  3MP6 A;  1K76 A;  4X34 A;  1X69 A;  3ZBD A;  1N8R R;  2L3Q A;  2L8D A;  4PK4 A;  1WXU A;  1NJI C;  2LQN A;  4PJN A;  1Q7Y U;  1S72 T;  2VWF A;  3HSB A;  2QQS A;  4M7D D;  4C8Q C;  1OU9 A;  5CQX A;  3G6E Q;  5LJ3 d;  5GAM e;  3OY9 A;  3V7C A;  3FLG A;  1JQQ A;  2JUF A;  5GMK m;  2VV5 A;  5GMK l;  3QJY A;  2XI9 A;  3SB2 A;  4FYW B;  3RNJ A;  2EYY A;  3LW5 E;  2X35 A;  2PUK B;  4F17 A;  4ZGJ B;  1K73 C;  4AG1 C;  2LDM A;  2EQM A;  2XMF A;  1IHW A;  2XID A;  1Z9Z A;  1Y96 A;  1VQ5 Q;  2VGM A;  1QVF A;  4XK8 E;  4MMK A;  1W70 A;  1NPR A;  2I0N A;  4NL3 A;  1BIA A;  4C8Q G;  4JJB A;  5HY6 A;  1NYG A;  3DLM A;  4LD6 A;  1LPL A;  1N8R C;  4J5Y A;  2ED0 A;  3CC4 Q;  2XD0 A;  3VYG A;  3OYG A;  2A28 A;  4DQ2 A;  2NUT A;  1N6A A;  4RKU E;  1BCM A;  1ZHI A;  1D0Y A;  1B3Q A;  4B9W A;  5GJV B;  5CR2 A;  1M3B A;  4M7A D;  3REA B;  4EMK B;  3JB9 F;  4E7H A;  4HVU A;  1ZQ1 A;  3U23 A;  3REB B;  1OZ3 A;  3A98 A;  1IO6 A;  2J06 A;  1MGQ A;  4A54 A;  4LDY A;  2HSE B;  3EAE A;  1VQL A;  2WAC A;  3V7S A;  5HK3 A;  1QWF A;  1JU5 C;  3PVQ A;  5KYX A;  3CCL T;  4FIB A;  2JNG A;  1KG1 A;  4LUE A;  2FZG B;  2RJD A;  1D1C A;  3A1P A;  5DY9 A;  2PVO B;  4CI0 C;  5CAI A;  2ABL A;  3EHQ A;  4JPB W;  2Y4X A;  3QXE B;  2KRN A;  2I2L A;  3VRZ A;  2ZPG B;  5AYF A;  5IHK A;  4C92 C;  1G3Y A;  4ME7 A;  1HK9 A;  1BI0 A;  1W2B S;  2QTX A;  1UJY A;  3O5Z A;  1Y96 B;  1IRE B;  1PD0 A;  1RAH B;  2X51 A;  2YWW A;  2FRY A;  2DVJ A;  3DKM A;  4J9E A;  3OW2 A;  1QMC A;  3CME A;  1AVZ C;  4DBR A;  3SDZ A;  5GAM f;  3C4S A;  4R56 A;  3CCU A;  2MIO A;  1D0X A;  1OUL A;  1YJN T;  3OYJ A;  2FYK A;  3FEO A;  2NUT B;  5KCO A;  3EG1 A;  5CO7 A;  2RF0 A;  4BI8 B;  2R57 A;  3OS1 A;  3M54 A;  4O6J A;  2LZ6 B;  1KSW A;  3O8V A;  4C92 G;  1K9M R;  5GAN f;  2DIQ A;  1GBR A;  3CCM Q;  2YT6 A;  4HVV A;  2JJ9 A;  4M78 A;  3HRT A;  4BE0 A;  4Y92 A;  2DD5 A;  2NYS A;  1KFZ A;  3GNF B;  1X2K A;  1WHG A;  1D09 B;  6AT1 B;  1B34 A;  2OTJ T;  1X01 A;  4FYV B;  5KYX B;  1K0X A;  3HP9 A;  2DX1 A;  2J7I A;  3S6W A;  5LJ5 d;  5LJ5 j;  2D6F A;  1UE9 A;  1YBY A;  4R55 A;  1BI2 A;  5CVI A;  5KYN A;  1GFD A;  2DIL A;  4M75 A;  3IQL A;  2J05 A;  1VQK A;  3OYL A;  3CEY A;  2MK5 A;  4TVR A;  2X4Y A;  2V8J A;  2DXU A;  1VQP A;  4A53 A;  2ZZD A;  2Y4Y A;  1U1S A;  3UAT A;  1VQ9 A;  1UHF A;  3CQT A;  1K9M C;  3TU4 K;  3X20 B;  5KYW A;  4NL2 A;  1YWP A;  1ZUY A;  1VQN A;  3G6E T;  1PG5 B;  3M0U A;  1W2B A;  2EYZ A;  4VUB A;  4X9C A;  3EGD A;  3NFC A;  3OYD A;  2V1Q A;  3M9Q A;  3ULR B;  2K7A A;  3FIF A;  3FJP A;  3SHW A;  1DJ7 B;  1WNL A;  2EBP A;  3GOX A;  4QQG A;  3JCM g;  3C94 A;  1O75 A;  1Q82 U;  2KY9 A;  1ZSZ A;  3L1A A;  5GAO m;  5IN1 A;  1AEY A;  5GAN 2;  5GAO l;  2DET A;  1VQ5 T;  4M78 B;  1N8R U;  3M0T A;  2DXC A;  1YIJ T;  3EFR A;  2DER A;  2DE0 X;  1GCP A;  3QZ5 B;  1B34 B;  3BE3 A;  3CCE A;  4LD9 K;  3CCR A;  1QP3 A;  1GCQ C;  2GCX A;  2RM4 A;  3I5R A;  2V1R A;  3SWN C;  4DBQ A;  2DEQ A;  4M75 B;  4AFZ C;  2KRM A;  3JB9 G;  4C5G A;  3PFS A;  4X9D A;  4E7J A;  5FU7 C;  2LQW A;  2RQR A;  5GAN 6;  1K1Z A;  2DJQ A;  4FM4 B;  2VUB A;  1TXQ A;  2CUD A;  5A0L A;  1M2V A;  3QZ9 B;  1QCN A;  1TUC A;  2A7Y A;  1QKX A;  3JCM c;  4PJJ A;  2DBK A;  5LJ3 h;  1VQO A;  4M75 E;  5KYW B;  1ZX6 A;  2VVK A;  5GAN 5;  4A4K A;  2ZAE A;  4PJO E;  3TSW A;  3EGD B;  4OGE A;  1TG0 A;  1TSF A;  1VQL Q;  3SEM A;  2KR3 A;  3NTI A;  4E7I A;  1VYU A;  3OMC A;  3QII A;  4AMC A;  5FU6 C;  4JS4 A;  3J7A F;  4QVC A;  2CP5 A;  3JCM b;  3OYC A;  1ZSZ B;  4PJO F;  4IUP A;  1IB8 A;  1K0S A;  4Z8A A;  3JB9 I;  4PFO A;  3X24 B;  2C0O A;  2KNB B;  5EG2 A;  4LN2 A;  3MEA A;  4R0K A;  2KT1 A;  4RTZ A;  2ATC B;  2O4X A;  3S3M A;  2LMJ A;  1QWE A;  2RQU A;  2FB7 A;  3ASK A;  1H64 1;  1ZA2 B;  2K5F A;  1UGQ B;  3OS0 A;  2MI6 A;  2PQW A;  2RJE A;  3CME Q;  2MCN A;  3P8B B;  3CBM A;  3CCU Q;  5D7U A;  3CCM T;  5EC7 A;  4KBM B;  2FG0 A;  2EYX A;  2E4H A;  3QKJ A;  5D6X A;  3VU3 C;  1W4S A;  3PGG A;  3G1J A;  1UGS B;  4IUQ A;  4M7D E;  2CP0 A;  4A4G A;  1M2V B;  4RCB A;  4BE1 A;  1Q86 C;  2FZC B;  4E7Z A;  1AZE A;  1XNI A;  4PFP A;  3L2Q A;  5GAM d;  3QYG B;  2L3S A;  2RHX A;  3BFM A;  2ZPI B;  4OP0 A;  4M7D F;  2DTI A;  3CMA A;  4JDS A;  2MMP A;  3E9F A;  4F14 A;  3RKX A;  2EJF A;  4GBQ A;  5GJW B;  1MHN A;  1YIT A;  3EH1 A;  5GAN d;  1Q7Y C;  3VS2 A;  1YHQ A;  4J6W A;  2HBW A;  2YXY A;  1M90 R;  1B7T A;  4KH1 B;  1I0C A;  2E41 A;  2O88 A;  1NG2 A;  1CSK A;  1VQK Q;  3CCV A;  4C8Q E;  2HKN A;  2KGT A;  1WHH A;  2QGF B;  2O4X B;  1VQP Q;  3OYY A;  2K79 A;  5J3B A;  2CGH A;  2F69 A;  5I2S A;  4M7A E;  1E6H A;  2K4Y A;  1VQ9 Q;  2J6K A;  3RBB B;  3H9N A;  1PC0 A;  1EZZ B;  3LWH A;  2H3E B;  1QP2 A;  3ME9 A;  3CCS A;  1VQN Q;  1KIK A;  1CKA A;  1ZUU A;  2RI5 A;  2BKD N;  4FW2 A;  2DTO A;  4M7A F;  2ZPB B;  2AKL A;  1MMG A;  4ZTF A;  1BKB A;  1H92 A;  2CH4 W;  3RER A;  4MML A;  4EIK A;  4RMO A;  2FPD A;  2HD0 A;  3VYH B;  1UUE A;  2DMO A;  2CKK A;  2FHD A;  2PVD B;  1VUB A;  4XAX B;  4AG2 C;  1M2O A;  4C0Z A;  2CZ6 B;  4RTT A;  4XTY A;  2BZ8 A;  2K2M A;  2RI2 A;  2QQR A;  3JCM e;  3MET A;  1J3T A;  1TS9 A;  2D8H A;  3JCM V;  1QVG P;  2O9S A;  1HXD A;  2ROL A;  3CCE Q;  1MMA A;  1NLO C;  4IIO A;  4PJO C;  2ZPF B;  1IGQ A;  2RN8 A;  1JEG A;  3V8K A;  1LNX A;  3WVE B;  2E12 A;  1R8O B;  1M30 A;  3UT1 A;  2ED1 A;  4A4F A;  4M77 G;  2K5I A;  4C0D C;  1X75 C;  2G6F X;  2AT1 B;  4J9H A;  1ZA1 B;  4C0G A;  3H0F A;  2J6O A;  1H3H A;  3KUF A;  2P4R A;  4M77 D;  1X43 A;  2C0T A;  2L3P A;  4ZN1 A;  1IGU A;  1YNZ A;  4KUI A;  3GF5 A;  3M53 A;  2COZ A;  3C12 A;  4QVD A;  1VQL T;  2HQX A;  2RB6 A;  2RHU A;  4FW1 A;  4JZ3 A;  2CDT A;  2KI7 A;  1SSH A;  2KK4 A;  2NUZ A;  3KXT A;  1QVP A;  3VRY A;  2CRE A;  1I4K 1;  3MKD A;  4MZT A;  3LWI A;  4C92 E;  3QHS A;  4E7L A;  4J7F A;  3L2W A;  1WZO A;  3L2U A;  2AZV A;  3KBG A;  2EYW A;  3OS5 A;  3M57 A;  4J9B A;  1KD1 R;  2K2V A;  1ACM B;  1XTD A;  2FEI A;  4QT7 A;  3TCJ A;  2OTL A;  1BCO A;  4KH0 B;  4F7U F;  2AKK A;  4M7D C;  2OI3 A;  3OYB A;  3CME T;  1VQ6 A;  2VAS A;  2HCK A;  3WVD B;  2AZS A;  3CCU T;  1LCK A;  3SWN A;  2EWN A;  4B9X A;  1MMD A;  4DOW A;  3QBY A;  3VS7 A;  2VGN A;  4OMN A;  5CKE A;  1VQ4 A;  2LJ0 A;  4Q5W A;  1RLQ C;  3JB9 J;  1OX8 A;  3OBW A;  1UGV A;  4N4H A;  2JT4 A;  2PTK A;  3EFO A;  4M7D G;  3ZL7 C;  1I81 A;  1SRM A;  2EGA A;  4J83 A;  5KE3 A;  1IHV A;  4YTL A;  3RMS A;  4CC2 A;  2DA9 A;  2COW A;  5LJ3 j;  2KE9 A;  5CIU A;  2R5A A;  2NLU A;  4M7A C;  1SKU B;  3CMA Q;  3VS4 A;  3OW2 S;  2HNI A;  1VQK T; 
#chains in the Genus database with same CATH homology
 3HP9 A;  3JSC A;  3LH0 A;  3S6W A;  5LJ5 d;  2QDY B;  2EAY A;  5LJ5 j;  2D6F A;  3CD6 T;  2G3R A;  3DLL A;  5CQY A;  1VQP T;  3JCM f;  3OYF A;  1YBY A;  4R55 A;  3MP1 A;  3A8O B;  1BI2 A;  5CVI A;  3FRN A;  1PSE A;  3V8L A;  3RUX A;  4EMG A;  5CCA A;  3OYK A;  4M75 A;  1Q82 C;  2JTF A;  2XIC A;  4XU1 A;  4D6W A;  4C92 B;  4HCZ A;  1VIF A;  4JRP A;  2E1H A;  4MZP A;  3M55 A;  1EIF A;  4BAC A;  3V8J A;  2OTJ A;  4BB7 A;  2QQB A;  4BY6 B;  1VQN T;  3A8L B;  1VQK A;  2IVW A;  3OYL A;  2DIG A;  3CEY A;  4JJN K;  3S3N A;  4TVR A;  2X4Y A;  3VUZ A;  2V8J A;  1WPY A;  2DXU A;  4M7A G;  2LNV A;  3CD6 A;  3SWN B;  1VQP A;  1YI2 T;  4A53 A;  4C0F A;  2ZZD A;  4M78 G;  3TEE A;  1OZ2 A;  3HHT B;  4Z02 A;  2Y4Y A;  2E64 A;  2KVQ G;  1U1S A;  3PTA A;  2M0O A;  1LJO A;  1XQH A;  5J39 A;  1VQ9 A;  3GIB A;  1M90 U;  4CRI A;  4FT4 A;  4P5N A;  4PNO A;  1BI1 A;  2DK3 A;  4MZM A;  5LJ3 f;  3SFM A;  4Y91 A;  3X20 B;  3CPF A;  4M78 D;  3GPL A;  4NL2 A;  3E19 A;  1VQN A;  1KHC A;  3G6E T;  2E70 A;  2LX9 A;  3OYA A;  5GAM h;  1W2B A;  4VUB A;  1G3S A;  4X9C A;  2E5Q A;  3X26 B;  3NFC A;  3I56 T;  3OYD A;  3DB3 A;  5GAM g;  2OTL T;  2LT4 A;  3P8D A;  3M59 A;  3M9Q A;  1YI2 A;  2DXB A;  3FIF A;  3FJP A;  2LQ8 A;  3MCA B;  1YCY A;  1DJ7 B;  4F7U E;  1WNL A;  3GOX A;  2EQK A;  3J80 E;  4QQG A;  2O01 E;  2R58 A;  3JCM g;  3C94 A;  2RK1 A;  1O75 A;  5LJ5 f;  2X4X A;  3UWN A;  3CCE T;  1Q82 U;  2KY9 A;  2LTO A;  1KQ2 A;  3L1A A;  4IUU A;  5GAO m;  3G6E A;  1WQW A;  3E1S A;  2F5T X;  5IN1 A;  5GAN h;  2LQK A;  3LGF A;  5GAN 2;  5GAO l;  3OA6 A;  3CXC A;  1YJ9 T;  1VQ5 T;  4M75 D;  4M78 B;  3I56 A;  1FWZ A;  1N8R U;  1WJQ A;  2KDS A;  2XK0 A;  1KQS A;  2DXC A;  1YIJ T;  2QI2 A;  3EFR A;  4QQ6 A;  1VQ4 T;  3A8H B;  3PNW C;  5FU6 B;  1FXX A;  3L2V A;  4IKF A;  3QZ5 B;  3PIP A;  2D0Q B;  1B34 B;  3AHU A;  3OQ5 A;  3A5Z B;  3HRS A;  4EMH A;  2RHY A;  3OYM A;  3LYI A;  5KH6 A;  3M58 A;  3CCE A;  4LD9 K;  3CCR A;  2KAF A;  4F7U A;  5IT9 E;  1QP3 A;  1G3T A;  2GCX A;  1K9M U;  2K57 A;  4BY6 C;  1OYX A;  2RM4 A;  5GAO q;  3ZEH A;  2KQW A;  1VQ5 A;  3S3O A;  1X6O A;  3BDU A;  3LX7 A;  1QVG S;  1SSF A;  2EQU A;  4DA4 A;  3QSU A;  4KT0 E;  3SWN C;  2RO0 A;  1WJR A;  2OAU A;  3QDR B;  2CZ7 B;  1Q81 U;  3M4G A;  2DEQ A;  2RJF A;  5C6S A;  4M75 B;  4OB2 B;  4ZGE B;  3JB9 G;  4JRK A;  1YJW T;  4C5G A;  1IZ6 A;  4RG2 A;  3PFS A;  3N5B B;  4X9D A;  4E7J A;  3ZFJ A;  5GAN 8;  3OSV A;  2DZC A;  5FU7 C;  3CC4 A;  2AHJ B;  5GAN 6;  3CXC S;  2P0K A;  2VUB A;  4FL6 A;  3QYH B;  4FM4 B;  1LOJ A;  4IUR A;  4N4G A;  4XU2 A;  3M5A A;  2RHI A;  3JAM E;  2D9T A;  1K73 U;  4MDW A;  3JCM X;  4QQD A;  4UC4 A;  5A0L A;  1KQS S;  5GAN 4;  3VJP A;  2DO3 A;  3QZ9 B;  1KD1 C;  1D3B A;  4HCC A;  4NS5 A;  2A7Y A;  2KMT A;  4EPC A;  3JCM c;  2MF2 A;  1YJW A;  3HFO A;  5LJ3 h;  1WJS A;  3WXM B;  4C8Q F;  3QJ6 A;  5GMK h;  4M75 E;  1VQO A;  5KCH A;  4C5E A;  2GFU A;  5LJ3 g;  3JCM W;  2XKO C;  4A4K A;  5GAN 5;  3BY7 A;  2BIV A;  4PJO E;  1Y7X A;  4XTZ A;  5DLQ E;  4ZTJ A;  4F7U G;  3CC2 T;  4OGE A;  5J26 A;  1RI0 A;  3CC7 A;  2LCL A;  2XDD A;  2ZCF B;  1U1T A;  4M78 C;  3NTI A;  2F5K A;  3H6Z A;  1QW1 A;  5A0G A;  5I21 A;  4OMF B;  4E7I A;  3OMC A;  3UPU A;  3QII A;  2DZ9 A;  2WSF E;  5FU6 C;  4XU0 A;  2ZGW A;  5DLO A;  4JS4 A;  4ELY C;  5LJ5 h;  3J7A F;  3OMG A;  4QVC A;  3OYC A;  2VC8 A;  3JCM b;  2YLB A;  1M5Q 1;  2E6Z A;  5DM7 R;  4PJO F;  5LJ5 g;  3GP8 A;  1P92 A;  3G4S T;  1GXI E;  2V8K A;  4IUP A;  5KE2 A;  4XTU A;  3CC2 A;  2WSE E;  3H8Z A;  2P0P A;  5D6Y A;  3X28 B;  5M9O A;  1VQ9 T;  5GAN 3;  4L59 A;  2XDB A;  2H3J A;  3JB9 I;  4BDZ A;  2E10 A;  2DD4 A;  3X24 B;  3DB4 A;  4L6V 5;  3OSS C;  5EG2 A;  1S72 A;  4PJO A;  4J8O A;  3MEA A;  2MWP A;  2EYQ A;  4M75 C;  2DJZ A;  2LT1 A;  1N9R A;  4MDX A;  3S3M A;  1KD1 U;  2O4X A;  4KUL A;  1NE8 A;  4F7U B;  4HT8 A;  2JOY A;  2DPP B;  5GAN e;  3G4S A;  4C5I A;  3INZ A;  5CKF A;  3OBY A;  3L2R A;  2GQV A;  3MEW A;  2RJC A;  3OYN A;  3CPW S;  2FB7 A;  2HBP A;  4OB1 B;  3ASK A;  1I8F A;  4PL6 A;  3FC3 A;  2A3L A;  1H64 1;  2K5F A;  3EFS A;  2RI3 A;  1PSF A;  2PU9 B;  5GAO n;  1UGQ B;  2DXT A;  4XTX A;  2MI6 A;  3OS0 A;  2PQW A;  3L2Z A;  1UEB A;  2RJE A;  2QA4 T;  5FU7 B;  2DAQ A;  3RMQ A;  3G7Z A;  3P8B B;  1K8A U;  3CBM A;  3M4Y A;  2CZ0 B;  3CCM T;  2LCC A;  2EIF A;  3F70 A;  1QVG A;  4KBM B;  1ZBX A;  4C8Q D;  2DTH A;  3JCM h;  3QKJ A;  5D6X A;  3VU3 C;  4JLI A;  3CMA T;  1W4S A;  3PGG A;  4IUQ A;  1UGS B;  3BDL A;  5CKB A;  4M7D E;  1Y71 A;  4LDV A;  4A4G A;  5CK9 A;  4M75 G;  4RCB A;  1M1K C;  1D3B B;  4BE1 A;  3UDC A;  4EDU A;  4J6Y A;  1Q86 C;  3CCR T;  2QA4 A;  3P8H A;  1XNI A;  3MO8 A;  4PJO G;  3G71 T;  3JCM J;  3X25 B;  2B8A A;  3LLR A;  2WSC E;  4FT2 A;  3CCM A;  1YIT T;  3L2Q A;  5GAM d;  3QYG B;  4KUD K;  2JZ2 A;  2RHX A;  2C06 A;  3PMI A;  4PJO D;  2XG8 D;  2ZPI B;  3BFM A;  4OP0 A;  2QEX T;  2DTI A;  2P0Q A;  1QVF S;  4M7D F;  2FL7 A;  3CMA A;  4JDS A;  2MMP A;  2RH2 A;  3E9F A;  4BDY A;  2CS7 A;  2YLC A;  3FDR A;  3A8M B;  3CCV T;  3RKX A;  2EJF A;  2DKG A;  1Y07 A;  2R5M A;  4C92 F;  2VXF A;  5LJ3 e;  1VQ8 T;  2XHC A;  5GMK e;  3JB9 H;  3CC4 T;  3G71 A;  1K9M C;  4M7D A;  2VXE A;  2PUO B;  1MHN A;  4N0A A;  3QPH A;  5CKD A;  5GAN d;  1JB0 E;  3GNG A;  3CCQ T;  1YIT A;  1Q7Y C;  1YHQ A;  4J6W A;  1BI3 A;  1NPP A;  2Y90 A;  2RA2 A;  4M77 E;  3FB9 A;  2QEX A;  2E41 A;  4N0A C;  4LDX A;  2DVE A;  4HA8 A;  3VV0 A;  1VQO T;  4HT9 A;  3CCS T;  3HFN A;  4PJO B;  4OF1 A;  3CCV A;  1FX7 A;  2VYT A;  4C8Q E;  5FRO A;  5GAO p;  2MAM A;  2L89 A;  4JUV A;  2FVU A;  1U8R A;  1VQ8 A;  2JVV A;  3CCL A;  1M1K U;  2O4X B;  5GMK i;  3L42 A;  3RKY A;  1Q86 U;  4JLG A;  1BIB A;  5A2Q E;  3OYY A;  2ZPE B;  5J3B A;  3CCQ A;  2X4J A;  2CGH A;  1KC8 U;  2F69 A;  4M77 F;  5I2S A;  4M7A E;  4QW2 A;  2K4Y A;  3CBO A;  3NTK A;  3MP8 A;  2RD1 A;  3OYE A;  2EJ9 A;  4C5H A;  4EMK A;  2P4T A;  3LWH A;  1KHI A;  1UGP B;  1QP2 A;  4A4H A;  3ME9 A;  3CCS A;  1V29 B;  4LDW A;  3HKS A;  4PKC C;  3E9G A;  3MP6 A;  4X34 A;  3ZBD A;  4M77 A;  3RES A;  4IUV A;  1M8V A;  2QQ9 A;  2RI5 A;  2BKD N;  3CPW A;  1NZ9 A;  1N27 A;  4JRQ A;  2M16 A;  2DTO A;  4IUT A;  2L8D A;  2ZPB B;  4M7A F;  1NJI C;  4ZTF A;  4C8Q A;  1BKB A;  3OYH A;  1Q7Y U;  3RER A;  1S72 T;  1VIE A;  4MML A;  1JJ2 S;  4RMO A;  3HSB A;  5FRM A;  2L3R A;  4NOY A;  2HD0 A;  2QQS A;  3VYH B;  4M7D D;  4C8Q C;  5CQX A;  3LGL A;  4M7A A;  2XDP A;  5LJ3 d;  1H3Z A;  2CKK A;  2PVD B;  2FHD A;  5GAM e;  5C0M A;  2M1H A;  3OY9 A;  2MWO A;  3FLG A;  2YRV A;  3V7C A;  3VKI A;  2BUD A;  1VUB A;  4XAX B;  4C92 D;  1K8A C;  2JUF A;  4C0Z A;  5GMK m;  2VV5 A;  2CZ6 B;  5GMK l;  4XTY A;  3QJY A;  2RI2 A;  2QQR A;  2XI9 A;  3SB2 A;  3MET A;  3JCM e;  3MEV A;  3JCM V;  5IAY A;  3ER0 A;  3LW5 E;  3JRZ A;  3CC7 T;  2X35 A;  2PUK B;  1HXD A;  3HPW A;  4ZGJ B;  1K73 C;  2LDM A;  2QQA A;  3T9N A;  2ZPH B;  2EQM A;  3RIR A;  4PJO C;  2ZPF B;  3V8K A;  1LNX A;  2EQJ A;  2XID A;  3WVE B;  1Y96 A;  2E12 A;  2VGM A;  1R8O B;  3UT1 A;  5GAN 7;  5GAO r;  4A4F A;  4M77 G;  4M7D B;  2K5I A;  4C0D C;  1QVF A;  4OVA A;  1X75 C;  4XK8 E;  4Y28 E;  2EJG A;  4MMK A;  1NPR A;  1WQ7 A;  2E65 A;  4ELZ C;  4NL3 A;  4C0G A;  1G3W A;  4OB0 B;  3KUF A;  1BIA A;  4C8Q G;  4M77 D;  1UB4 A;  5I2M A;  3HL8 A;  1NJI U;  5HY6 A;  2K5L A;  3SD4 A;  2KSS A;  3DLM A;  4LD6 A;  1N8R C;  4ZN1 A;  4J5Y A;  4E7K A;  2HNI A;  4KUI A;  2XD0 A;  3GF5 A;  3VYG A;  4BE2 A;  3OYI A;  3M53 A;  3C12 A;  4FU6 A;  4QVD A;  1VQL T;  2XU8 A;  4XTW A;  2GFA A;  3OYG A;  4DQ2 A;  2HQX A;  1N6A A;  2RB6 A;  2JN0 A;  2RHU A;  4FSX A;  4RKU E;  1WGS A;  1ZHI A;  2JTM A;  1VQM T;  4HCB A;  4B9W A;  2KK4 A;  3CBP A;  5CR2 A;  3KXT A;  1QVP A;  4M7A D;  1M1F A;  4EMK B;  3JB9 F;  3TU4 K;  4E7H A;  1I4K 1;  5A0D A;  3URG A;  1ZQ1 A;  4MZT A;  3LWI A;  4C92 E;  1OZ3 A;  3QHS A;  4XQ3 A;  4E7L A;  4M77 B;  4J7F A;  1MGQ A;  1JRI A;  4A54 A;  5GAM j;  3L2W A;  4LDY A;  1YHQ T;  3NTH A;  4RCC A;  1Q81 C;  3RKW A;  3EAE A;  4BD3 A;  3KBG A;  4GLK A;  3L2U A;  1I5L A;  2WAC A;  5HKC A;  3R6O A;  1VQ7 T;  1VQL A;  3V7S A;  1RL2 A;  5HK3 A;  4JRI A;  3VUB A;  3JCM d;  2M9U A;  4II1 A;  4C8Q B;  1VQM A;  1O9S A;  2RK2 A;  4HKE A;  2EKO A;  3MEU A;  3OS5 A;  3M57 A;  1VQ6 T;  2K2V A;  4J6X A;  5LL6 S;  3C95 A;  2HQE A;  3Q1J A;  3CCL T;  4FIB A;  2JNG A;  4M7A B;  2EFI A;  2V8I A;  1KG1 A;  4JS5 A;  1XTD A;  4ATO A;  5GAN j;  3CCJ T;  4L5G A;  3TCJ A;  5GAN g;  3J81 E;  2OTL A;  2RJD A;  4F7U F;  1VQ7 A;  1JJ2 A;  2E6N A;  3JCM Q;  4M7D C;  3QUI A;  4C92 A;  5DY9 A;  2PVO B;  4CI0 C;  4ZGD B;  4ZN3 A;  3OYB A;  3BW1 A;  5CAI A;  3V7R A;  2Y4X A;  4WF2 A;  3CME T;  3QXE B;  4OGC A;  1VQ6 A;  2I2L A;  2ZPG B;  5AYF A;  4BI4 A;  4C92 C;  5LJ5 e;  4O5V A;  3WVD B;  4LDU A;  3CCU T;  1G3Y A;  4C0D B;  4ME7 A;  1HK9 A;  4BUG A;  2K3Y A;  3HRU A;  1UGR B;  1XOV A;  1BI0 A;  3SWN A;  3OB9 A;  5HK0 A;  1W2B S;  2QTX A;  2LRQ A;  4PLI A;  2EWN A;  1Y96 B;  1IRE B;  2CYZ B;  4QVZ A;  2L5Q A;  4B9X A;  3CCJ A;  2X4W A;  1YJ9 A;  4DOW A;  3QBY A;  4E47 A;  1YIJ A;  2VGN A;  4M78 E;  1AHJ B;  5CKE A;  4V2S A;  5D6W A;  3DKM A;  1VQ4 A;  3OW2 A;  4XTV A;  4PLL A;  3TRE A;  1KC8 C;  1G5V A;  4Q5W A;  3A8G B;  3PMT A;  3PT9 A;  4GY5 A;  3CME A;  3JB9 J;  3SDZ A;  5GAM f;  3C4S A;  3JCM P;  4EMK C;  4R56 A;  3OBW A;  3CCU A;  2PVG B;  3MHX A;  3GLX A;  4N4H A;  3JB9 D;  3I55 T;  4RG8 A;  1YJN T;  3OYJ A;  4A4E A;  2FYK A;  3FEO A;  1M9S A;  2LC4 A;  1TH7 A;  4M7D G;  4M77 C;  1KQ1 A;  1I81 A;  4XU3 A;  4J83 A;  5KE3 A;  4M78 F;  1M1G A;  5KCO A;  5CO7 A;  4YTL A;  4BI8 B;  2R57 A;  3M56 A;  3OS1 A;  3RMS A;  2CZ1 B;  3M54 A;  3QO3 A;  4O6J A;  3QG1 A;  3O8V A;  5L8R E;  4BI3 A;  4C92 G;  1BYM A;  4OB3 B;  2YHT A;  2HAX A;  2GF7 A;  3PIO A;  5GAN f;  2DIQ A;  5LJ3 j;  2K3X A;  1N9S A;  1OI1 A;  1M4Z A;  5CIU A;  5GMK j;  4M78 A;  5FRN A;  3HRT A;  4DOV A;  4BE0 A;  2QXF A;  3I55 A;  2R5A A;  1YJN A;  2DD5 A;  2NLU A;  1M90 C;  3GNF B;  4M7A C;  2LVM A;  4J7I A;  5CKH A;  4N4I A;  1JBM A;  5FLX E;  1B34 A;  2OTJ T;  1X01 A;  3OS2 A;  3OW2 S;  2RHZ A;  2IG0 A;  1VQK T;  4M75 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...