2QTXA

Crystal structure of an hfq-like protein from methanococcus jannaschii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
publication title An Hfq-like protein in archaea: Crystal structure and functional characterization of the Sm protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 13
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qtxA00
4M7AB 4M7AC 5GAN7 2VXFA 1WQWA 4JRKA 2E1HA 4M77B 2DTHA 4M77C 1WQ7A 4C8QA 2YLCA 5GAOp 1KQ2A 1D3BB 2EJFA 1WPYA 4XTUA 4F7UF 5GAOl 3HFOA 4C8QG 1M8VA 5LJ3j 1KQ1A 4J6XA 5GAN8 4HA8A 4M7AE 3JB9F 4M77E 4PJOA 4C8QB 2VXEA 2EJ9A 4XU3A 2K57A 3QO3A 1U1TA 3RUXA 4C8QC 5LJ5f 1JBMA 5GMKl 3JCMh 4A53A 4M75F 4PJOG 4OP0A 4C92A 4NL3A 5GANf 3JB9J 4C8QE 4PJOB 1Y96A 2CGHA 1TH7A 4PJOC 1B34B 3BFMA 4EMKB 4EMKC 3JCMd 2JN0A 3PGGA 4C92D 2DJZA 4WF2A 1BIAA 1N9RA 1U1SA 1LNXA 5GAOr 4M7DF 1WNLA 2RB6A 4X9DA 3QUIA 1Y96B 2ZGWA 5DY9A 4JUVA 4M7AD 4XTVA 5LJ5e 4J6WA 5GAMh 4M77D 3V7RA 2EWNA 4C92E 2EAYA 1HXDA 2E10A 4XTZA 2E65A 5GANe 3RKYA 2DZCA 2RM4A 3JCMg 5GAMd 1I4K1 5LJ3h 4C8QD 1LJOA 3JCMV 1B34A 3JCMJ 3JB9G 4EMKA 5GMKe 5GAN4 1MGQA 4QVCA 2QTXA 4XU2A 3V7CA 5GANj 4HT9A 3FIFA 4NL2A 5I21A 5LJ3d 4PJOD 3RKXA 3JCMQ 4A54A 4M7AF 4M78A 3L2ZA 4MMKA 4PNOA 4M77F 5GMKj 4Y91A 5GMKi 2E41A 2DEQA 2FYKA 4J5YA 5GAMg 3HFNA 4M78G 3SWNC 1H641 3SWNB 4PJOE 4M7DG 2EJGA 1HK9A 2Y90A 4M78C 2RD1A 3BDUA 4M78B 4C8QF 3V8LA 3JCMe 5GAN3 4M7DC 4M7DB 5GAOn 4V2SA 4F7UA 5LJ3g 4QVDA 3HSBA 5GAN5 1YCYA 2DZ9A 3INZA 4XU1A 2FB7A 4XU0A 4M78E 4RCBA 4PJOF 1I8FA 3M4GA 4F7UG 5LJ5h 5LJ5j 3JCMf 4XQ3A 4XTXA 4F7UB 4M75A 3BW1A 3RESA 1BIBA 4C92F 3JCMP 4N0AA 3RIRA 5GANh 3JB9D 3JCMb 4RCCA 4XTWA 5LJ5d 4M75G 3EFSA 3SWNA 3EFRA 3V7SA 3V8KA 4MMLA 4F7UE 5GAN2 2YLBA 4M75B 4M75C 2YHTA 3JCMW 5GMKh 4EMHA 4M7AG 4M7DA 4N0AC 5GANd 4M77G 5LJ3e 3QSUA 1JRIA 3GIBA 5GAOm 5GAMf 4J6YA 4M78D 4M75E 5CAIA 1X01A 1N9SA 4M7DD 2DKGA 1I5LA 4NOYA 4EMGA 5LJ5g 5GMKm 3JB9I 2RA2A 2E64A 4XTYA 5LJ3f 3SB2A 3AHUA 3JCMX 2HNIA 3L1AA 4HT8A 4M7DE 5GANg 4DQ2A 3RKWA 3BY7A 1M5Q1 2DTIA 3FJPA 3JCMc 2DVEA 3VU3C 2VC8A 5GAMe 4C92G 3QHSA 5GAN6 4M7AA 2DTOA 2DXUA 2DXTA 4M78F 4M77A 5GAOq 4M75D 4C92C 1LOJA 4C92B 3JB9H 3FB9A 1D3BA 4X9CA 4JRIA 2I2LA 3V8JA 3RERA 4JLIA 1I81A 5GAMj
chains in the Genus database with same CATH superfamily
5GAN7 4M77C 2DTHA 1GCPA 1KQSS 5GAOl 3HFOA 1UHCA 2Z0WA 4PJMA 2EJ9A 3ZEHA 1ZBXA 2K57A 1YIJQ 4F16A 3CMAQ 1RUWA 1UB4A 4HVVA 1C6VX 1LCKA 3G1JA 1W2BA 3NTIA 4LDXA 1TU0B 1AHJB 1YJWA 2RQTA 3MCAB 2MWOA 5GAMh 3PVQA 2OTJQ 2HBWA 2MK5A 1VQ6Q 1X6BA 2RHZA 2COYA 2ZPGB 1PCXA 2C0OA 3QG1A 2PU9B 2BUDA 1YP5A 4F04B 1WA7A 3J7AF 4BY6B 4BI4A 5I21A 1K73C 2WSEE 3EG0A 3M9QA 2SEMA 1K9MR 4M78A 1BBZA 2DEQA 2FYKA 1KC8U 4DOVA 4M78G 2JUFA 2CUBA 2GFUA 1UECA 1N5ZA 1ZBJA 2AZVA 5GAN5 2DZ9A 2JTMA 1W6XA 1VQNQ 2EGEA 3CCMT 9ATCB 2KGTA 2O01E 2CZ6B 3G6ET 4EPCA 4M75A 1NYGA 1PRMC 1QWEA 4C92F 2CH4A 1VQOQ 4M75G 1JXMA 3TCJA 1UJ0A 4NS5A 2EYXA 2DK3A 2LQWA 2RO0A 5FLXE 3TREA 2C0IA 1IXDA 3DLLA 4QQ6A 4BB7A 1X01A 2XDDA 5CCAA 2RQWA 3O5ZA 2JJ9A 5IH2A 2GNCA 2YUQA 1CKAA 4KUIA 2DE0X 2XHCA 5FWCA 1GCQC 3JCMc 3EHQA 2JVVA 2M02A 4ORZA 5CKBA 2RMOA 3I35A 4HKEA 2AZSA 4RTUA 4D8DA 1X27A 4JRIA 4JLIA 2LCCA 4Y91A 1YITT 1SF9A 1ZQ1A 2K6DA 4C8QA 5CR2A 1RLQC 3OYFA 1QCOA 4C8QG 1NJIC 4II1A 5GAN8 3L2VA 3QO3A 2A3LA 4OB2B 3JCMh 3CCST 4MDWA 1X2QA 2L8DA 3G6EA 3LW5E 4OP0A 3G4SQ 1KHIA 4BDZA 1Y57A 1XTDA 4J9FA 1P92A 3CCEQ 1BIAA 2NUZA 2C06A 2W0ZA 2RH2A 1Y96B 4WTOB 4AT1B 3MPUB 2AK5A 1GBRA 1HYOA 4AG2C 3VUBA 2LJ0A 2FZCB 3MP6A 3RR6A 1VYVA 1YIJT 2EYWA 1WXUA 4DBFA 3CMAT 3CBOA 4J83A 4MMKA 3REBB 4M77F 1VQ8Q 3C0CA 1WGSA 7AT1B 1MHNA 3HFNA 1YITA 3GNGA 1K9MU 1KJWA 4CC3A 1M8MA 2HSPA 2OTJT 2XDPA 3EGXA 5D6XA 4RMOA 2L5QA 1VQ6T 3EG9A 4LUEA 3CXCA 2FPEA 3CCSA 1TS9A 1IHWA 4XTWA 3G71Q 2GQVA 3V8KA 3VS3A 1M3AA 2YLBA 1RAAB 2EIFA 2YHTA 3A98A 4MDXA 3QZ5B 3QSUA 2OX7A 2MCNA 2A7YA 2LJ3A 1ZSGA 1JJ2P 2RN8A 5A0LA 4XTYA 1Q81R 2NUTA 1VYUA 2IPOB 3ULRB 1T0HA 4E7LA 1VQNT 3EG2A 2VC8A 1YIJA 2X4WA 2LRQA 2L3QA 2LX9A 4J7IA 3CMAA 2L0AA 1B07A 1VQOT 2V8IA 1M27C 1TUDA 3BE3A 3CC4Q 1IGUA 1ZSZC 2O88A 2DNUA 1JU5C 1WJQA 2OTJA 5FROA 2P4RA 1JBMA 5CQYA 2AHJB 1VQ6A 3HTRA 3X24B 1RACB 2VASA 4FU6A 3QWYA 4PJOC 4E2FB 3VS2A 3EH2A 4EMKC 1XOVA 1U1SA 2ATCB 1NPRA 4RTWA 3E9GA 2EBPA 2EGCA 2COZA 4LN2A 1PD0A 4C92E 3CPWA 1QQJA 3GBQA 2HQEA 2LT4A 2QASA 1I4K1 2EQKA 3KUFA 1WHLA 1NPPA 3VS6A 3J81E 3OA6A 1VQNA 5FW9A 3OS2A 4NL2A 1OQKA 4AG1C 2ZAEA 4B9WA 4A54A 3NPFA 1JO8A 3G4ST 2LQNA 1VQ7Q 2LCSA 4D6WA 4J5YA 1WJRA 5GAMg 4DBHA 1VQOA 2X9HA 4OMQA 3CCET 2CSQA 2XK0A 1MMAA 2VGMA 3HPWA 1ARKA 3PVLA 4XU1A 3NHNA 2XMFA 3LWIA 3NFCA 3M57A 1D1AA 2L3PA 4RCCA 1UGQB 1CSKA 1M1KR 1PM3A 1X69A 1B3QA 2X4YA 3A5ZB 1Q7YC 1K0XA 2KQWA 2RI5A 1VQ8T 3PE0A 3KXTA 3J80E 3LGLA 4FIBA 4N4GA 2KSSA 2I0NA 2LNVA 2P0QA 2C0TA 2HNIA 1XJWB 1NEBA 4MZTA 2DXUA 2OTLA 1VA7A 2EQIA 2YWWA 2RHUA 3G4SA 3G71T 4X9CA 3RERA 1TOVA 3JRZA 1WI7A 1WHHA 2BIVA 4M7AC 2NUPA 4M77B 3CCEA 3OYYA 1D3BB 1AT1B 1EIFA 4M77E 3ME9A 4L59A 4XAXB 1U1TA 3N5BB 5KE3A 3QDRB 5GANf 2LNHB 5FRMA 2ZPHB 1W70A 1QW1A 2ZPEB 4GLKA 4J9CA 3CCJQ 4ZTJA 2PVGB 1KQSP 4E47A 3KBGA 3M0RA 1RAGB 2K2MA 1BKBA 4J6WA 5LJ5e 1V29B 3EAEA 4M77D 3V7RA 1VQ8A 3CC4T 1MNEA 1MMGA 2EQJA 4F14A 5I11A 3JCMg 5LJ3h 4EMKA 4QVCA 3V7CA 3EGXB 4OMOA 2A0FB 4Q5WA 2DL5A 3FEOA 1HJDA 3G71A 2X3XD 5KYXA 4EIKA 3V8LA 4M7DC 1FYNA 1NEGA 2YUPA 4PJOF 3M4GA 1WZOA 1NYFA 4O6JA 2F2VA 4LDWA 3GNFB 4J9HA 2X3WD 4YTLA 2ZPIB 1VQ7T 4HCZA 2EKHA 1M1KU 1N9SA 3QXEB 5IHNA 3CC4A 4FW1A 4OGCA 4J8OA 3VS0A 1MUZA 1JJ2S 1FMKA 1PKTA 2ECZA 1VIEA 2G3RA 1SPKA 1YWPA 1QVGP 2QK0A 4QKUA 2XDBA 3MP8A 3P8HA 1LOJA 2OAWA 5FRNA 3WVDB 5FU6C 1S1NA 1JEGA 1WQWA 2QI2A 2QEXQ 1U5SA 2CSIA 2VWFA 1WPYA 4VUBA 4J9GA 5GJVB 2DA9A 5IAYA 2AKLA 4R0KA 2XKOC 3OYAA 4KUDK 3CCVT 2P0KA 2CYZB 2PVOB 2DJZA 4JJDA 2LJ1A 4DBQA 1FWZA 4JUVA 3I56Q 1VQ7A 3L42A 2LTOA 3UWNA 1D09B 3PMTA 1KHCA 2MOXA 2KNBB 2K2VA 1UGPB 2FEIA 1G5VA 1G8XA 1TUGB 2KRMA 1MGQA 4LE9A 4XU2A 3FIFA 2HQXA 2K3BA 2K3XA 2RJCA 4AFZC 4M7AF 2EYYA 3UPUA 4C0DC 3META 3QPHA 1WXBA 3LLRA 3SWNC 2XD0A 4MZPA 3CCJT 4M78C 4AFSC 3BDUA 5GAN3 2RQUA 5AT1B 1AWXA 4PJJA 1GXIE 2FB7A 2DEUA 8ATCB 3WVEB 3EG3A 2RK1A 2HSEB 5HCKA 3M55A 2JW4A 4FT4A 4EDUA 2VV5A 4M75C 1IZ6A 4M7DA 3A8OB 5GANd 5FWBA 3GIBA 4QQDA 2QA4Q 2O2OA 2NUPB 2RA2A 2RI2A 4PKCC 3U23A 2A37A 3JCMX 1NLPC 4C0FA 3M54A 3PIPA 2EVRA 4ANJA 2DVEA 1OYXA 1ABQA 2RPNA 2PQWA 1OU9A 1K76A 1R8OB 3DLMA 2I2LA 5J39A 3I5RA 3OW2P 3FC3A 1VQ4Q 1ZSZB 1Q82R 3MEAA 3OS1A 3CCJA 4HXJA 1BK2A 1RAFB 4C8QC 2MIOA 2M51A 2DMOA 1Q95G 3OMCA 3HRSA 1U8RA 2M9UA 3UT1A 4PJOB 2ED1A 4EMKB 4C0ZA 2QQ9A 1LNXA 4FT2A 4L6V5 2RB6A 1PSEA 5IXBA 1KD1R 3UF4A 1FX7A 1W1FA 3C94A 2QEXT 2LX7A 4J7FA 1OPKA 3WXMB 3P8DA 4RTVA 1QP3A 1DJ7B 4PJOD 3L2ZA 4JZ3A 2KAFA 1PD1A 1K8AC 5D6WA 1AWJA 1MMNA 4Y28E 3ZL7C 1OU8A 4F7UA 5LJ3g 1RAEB 1S72Q 1O75A 3I56T 4RCBA 1BU1A 4F7UG 5LJ5h 5LJ5j 3OYEA 5CIUA 1BIBA 3JB9D 1ABOA 4QW2A 4A63B 1EZZB 2LMJA 3SWNA 4JS4A 3JV3A 1QP2A 1IO6A 1SSHA 3GP8A 3MKDA 1G83A 2O4XA 2CREA 2CP6A 2QEXA 3AHUA 1BI1A 4DQ2A 4O5VA 1GRIA 1YBYA 4C92G 1AD5A 4M78F 4E7JA 4IUPA 2CP5A 3M0TA 2LC4A 3JB9H 1K73R 2F5TX 1QVGS 2KXCA 3M4YA 4M7AB 5GAOp 1K9AA 1KQ1A 4M7AE 2QA4T 1ACMB 2JMCA 4KT0E 3I56A 2E5KA 1Q82U 4OMPA 4M75F 3X25B 4Z8AA 3PTAA 1UE9A 1BYMA 4ME7A 2GTOA 3CBPA 4J9EA 2O31A 3A8LB 4M7AD 5CVIA 3L2UA 3SDZA 5KYWA 1MNDA 4Z89A 3TSZA 1VQ4T 1AVZC 4CC2A 3JCMV 2EPDA 1KD1U 1B34A 2OTLQ 1ZUYA 3BDLA 3HRTA 3RKXA 2DILA 3OYGA 2JOYA 2CDTA 5GMKj 2WACA 2LP5A 2DD4A 4E7HA 4QVZA 3X20B 5C6SA 1PRLC 4PL6A 4E7KA 2M16A 4C8QF 4JPBW 2E3HA 4M7DB 2MYSA 3GLXA 3ASKA 2QA4A 2K7AA 3HHTB 2QAZA 1JQQA 4ZGDB 2PTKA 4JJNK 3OS0A 5GAN2 4PK4A 2Y4YA 4M77G 1PC0A 1AWWA 5GAMf 4OB1B 1NBEB 2ROLA 2HKNA 4M7DD 2DKGA 3VRYA 1UUEA 1TSFA 2MAMA 5GMKm 1VQ4A 2GGRA 2PVDB 3CCQQ 1T3SA 1S72T 3THKA 2DL3A 2EFIA 3FLGA 2KDSA 4KGZB 1ZLMA 3VYHB 1M1FA 2DXTA 2P84A 1N6AA 1YNZA 4JJCA 4HVUA 5FU6B 3CBMA 1Q81C 1QVFP 4ZNXA 2V26A 2XICA 4JJBA 1QKXA 4JS5A 3TU4K 4JLGA 3OW2S 1K73U 2GF7A 3S3OA 3IQLA 3RNJA 4GLMA 4XU3A 2DX1A 3RUXA 2OJ2A 1X6OA 2A08A 2MF2A 2R5MA 1OEBA 3BFMA 4PLLA 4AFUC 2CT4A 2CUDA 1QWFA 4BD3A 1X6GA 4F17A 4XTZA 2FPFA 2RM4A 3UATA 1X2KA 1TUCA 1LJOA 2VVKA 1I0CA 3JAME 3AT1B 5GANj 2QTXA 1S72A 2AKKA 3EGDA 2IG0A 2X4XA 2RNAA 3FJ5A 4BE1A 4C0DB 5IXFA 3CCLQ 4BE0A 1TG0A 3SWNB 4M78B 1VYTA 4MZMA 3VS7A 2BZ8A 2B8AA 4M78E 3H0FA 2YRDA 3OSVA 3JCMf 2O4XB 3OBWA 4N0AA 3OSSC 3A8MB 4RG8A 1UEBA 1H8KA 2OTLT 2JM9A 4M75B 3REAB 3QZ9B 1NJIU 4KH1B 5HK3A 1SEMA 4J6YA 1OZ3A 4M78D 1GFCA 4M75E 3OYIA 2JTEA 2HD0A 3OYMA 4ELZC 4EMGA 5LJ5g 4N4HA 2D6FA 4ZTFA 1M5Q1 5CK9A 1IB8A 2DRKA 5CO7A 3HL8A 5HY6A 4M75D 2DERA 1JJ2A 2CP7A 2KE9A 2YRCA 3G7ZA 1QMCA 2V8JA 1OPLA 2HQHA 3OY9A 5KYWB 3E19A 4C8QB 1UG1A 2VXEA 2CP0A 5GMKl 3HP9A 1Y0MA 1ZUKA 1WHJA 4C8QE 3CCQT 1B34B 2FRYA 2FZKB 5GAOr 3OYDA 3TQ7P 2QXFA 4E6RA 4ATOA 4PFOA 5CKFA 4N4IA 1M90R 2EKOA 4A4HA 5GAMd 3R6NA 2PUKB 4C8QD 1M3BA 2V1RA 3ZFJA 5IN1A 1ZA2B 2MMPA 2K9GA 1AOJA 1PKSA 4K11A 2E41A 1VQPQ 4IKFA 2HEQA 1OX9A 3L2RA 2RD1A 3S3MA 4QVDA 1R77A 1U06A 4LNPA 2MPXC 1KG1A 4J9DA 5DM7R 2D9TA 3CCQA 3EG9B 1NE8A 2O9SA 2IVWA 3M53A 4OMLA 4D8KA 5HK0A 4B6MA 2FPDA 1I1JA 1K0SA 3JB9I 3OYBA 2KBTA 2QQRA 1XNIA 3M0UA 4LXCA 5HKCA 5CQXA 2E12A 2GQIA 2NUTB 4OMNA 2DXCA 1SG5A 2JS0A 3NGPA 2HAXA 2P4TA 2ABLA 2QTVA 1I81A 5CKDA 2ED0A 2YRVA 2YLCA 5C0MA 1KQ2A 4XTUA 4IUVA 1TWBA 2X4JA 1H3ZA 1QVFS 3CQTA 3E1SA 1Q86C 3JB9F 1N8RC 4Y92A 4OMMA 3M0QA 2R58A 2L89A 3A8GB 3JCMd 1WHMA 1OV3A 3EGDB 5M9OA 1WIEA 1VQLQ 2DJQA 8AT1B 2EWNA 3CCLA 3RKYA 2VGNA 2LDMA 4C5GA 5IHIA 3D7SB 3JCMJ 5GMKe 1GBQA 3OB9A 1ZA1B 1M90U 1KQSA 3FDRA 3CD6Q 2COWA 2VUBA 3M0PA 2X51A 4DEXA 1QKWA 3EGUA 2EJGA 1HK9A 3JCMe 2JS2A 4M4ZA 3QDFA 5I2MA 1W4SA 2VKNA 2F2XA 3H8ZA 3R6OA 3CEYA 1VQ5A 1IRXA 1BI2A 3EFSA 3EFRA 5L8RE 2QGGA 4M7AG 2J6OA 1QCFA 2E70A 2RJFA 5CAIA 1VQPT 4BACA 4A4FA 3L2WA 1JXOA 1KC8C 5LJ3f 4DA4A 4PFZA 1VQKQ 4BDYA 2HL3A 4LDUA 4FYVB 1YJ9Q 4C92C 4ZGEB 3FB9A 2DAQA 1D1CA 2DD5A 1W2BP 3VYGA 2E1HA 4C5IA 2PUOB 2D1XA 4HA8A 2XU8A 1QVGA 1SHGA 1WXTA 1PSFA 2K3YA 2YT6A 3OS5A 3H9NA 4JDSA 3H41A 2M0YA 2QGFB 1RI9A 2V1QA 3GPLA 5KCHA 1KK7A 1Y96A 1C0MA 1OZ2A 1NLOC 2DBMA 4M7DF 1UHFA 3VS1A 5J26A 4KGVB 1M1GA 1M2OA 1RAHB 2J05A 1G3TA 2XIDA 4ESRA 1EX4A 5IT9E 1PWTA 2RHIA 2QG9B 1VQPA 3TSWA 2E65A 5GANe 2WSCE 1U3OA 2HL5C 2OI3A 5GAN4 1UDLA 1SRLA 5J3BA 1RAIB 3QJ6A 3JCMQ 5EC7A 2K5LA 1WDXA 1OOTA 3C95A 1E6HA 4A4GA 4PJOE 5GJWB 4DBRA 5AYFA 4PLIA 2DFUA 1VQLT 3INZA 2ZPFB 2DL4A 5KYXB 1I8FA 3I5SA 2CKKA 1T0JA 2CS7A 3CCRQ 2KK4A 2J6KA 1KFZA 2PZ1A 3QYHB 1UGVA 2V8KA 1WHGA 4EMHA 1RADB 1UJYA 2E6ZA 3H0IA 3QIIA 3CD6T 4IIOA 2A36A 3I9QA 2E4HA 1K1ZA 2KYMA 4ELYC 3JSCA 4QT7A 1OI1A 2AIRB 2DXBA 1FMVA 1K9MC 4RG2A 3DB3A 2JZ2A 3BY7A 2EW3A 3VU3C 2H8HA 3QHSA 1WHKA 2DTOA 1WFWA 3QJYA 3V8JA 6AT1B 2KVQG 5GAMj 2DIQA 2WSFE 2H3EB 5KYUA 4CC4B 4R56A 4F7UF 2JTFA 4RTZA 1K8AR 2FHDA 2AT1B 1VQLA 1FXXA 3UDCA 3C4SA 1PHTA 2KY9A 3M58A 4LDVA 2LCLA 3QYGB 4C92A 3JB9J 3OW2A 2LQ8A 2KRSA 1QVPA 5I2SA 1VQKT 2JN0A 4WF2A 1N9RA 1D0XA 2GTJA 4X9DA 1YJ9T 1OULA 3OBYA 3EFOA 4IUUA 3CD6A 2EAYA 2ESWA 3TVTA 4L5GA 2M1HA 2ZCFB 2BTTA 3QBYA 1WX6A 4B9XA 5LJ3d 2EYZA 1AEYA 1NM7A 5A0GA 2PNIA 3CXCP 2DPPB 2CP3A 2MWPA 1H641 1Y71A 2DL7A 2GBQA 4V2SA 2EQMA 2ZPBB 1YI2Q 2RQVA 2DLPA 4KULA 3QWXX 3OYHA 3JCMP 3MEWA 3SD4A 3OYNA 3RMQA 2LVMA 5GMKh 1VQKA 4N0AC 5KCOA 5LJ3e 2DYIA 3EHRA 1YJ9A 4JZ4A 1VIFA 2HCKA 1VQ9Q 4TVRA 3SB2A 1BB9A 4FYXB 3CCMA 3PFSA 1R0CB 4M7DE 3RBBB 2BZYA 3X26B 2XG8D 1RLPC 1NJIR 2JMAA 2K5FA 2K4YA 3CCRT 4M77A 4KH0B 2IIMA 4IURA 4E7IA 1D3BA 3OMGA 1Y07A 1M9SA 3E9FA 2W10A 3VRZA 2FVUA 2QDLA 1G3WA 1LPLA 3VS5A 1BCOA 4PJNA 3MEUA 1W2BS 2L3RA 2KMTA 5LJ5f 5KH6A 3CPWP 2DETA 1Y7XA 1K8AU 2CGHA 1M30A 2HBPA 3S3NA 1IREB 1G3YA 5I22A 1YCSB 1I5OB 2ZGWA 3H0HA 4XTVA 1YWOA 4RTXA 4HVWA 4FL6A 1KSWA 3I55Q 3OYLA 1YFNA 2DZCA 1TXQA 5KYYA 1PG5B 1ZHIA 4HCCA 3OYCA 2RQRA 4J9IA 1BI3A 2DL8A 2L2PA 2LQKA 2D8JA 5GMKi 3CCRA 5EG2A 4WCIA 1YN8A 2QQSA 4LD6A 1KIKA 2E5QA 3F70A 1K4US 4X1VA 2LZ6B 3HKSA 1GFDA 4X34A 2RJDA 5KE2A 2O9VA 5A0DA 3SEMA 1QLYA 4E7SA 4F7UB 5FU7C 3BW1A 2DVJA 5GANh 3OYKA 4OMFB 3A8HB 4MMLA 4F7UE 1QCNA 4CI0C 3M59A 1JRIA 2KRNA 3PMIA 1SRMA 3RMSA 3SFMA 1MV0B 3O8VA 5D7UA 1ZUUA 3PT9A 1GCQA 2VYTA 3H6ZA 2DYBA 5KYUB 1YI2T 4PFPA 3L1AA 3P8BB 5IHKA 1TTHB 2HDAA 1E6GA 2KROA 3OYJA 3FJPA 2RI3A 3GF5A 4C92B 2ROTA 1M2VA 2JT4A 4IIMA 1RL2A 1VQ5Q 4GBQA 2BKDN 3EFOB 1UTIA 2A28A 1VQ9T 1E7OA 1M1KC 1G2BA 1G3SA 1TH7A 3SHWA 4RTTA 2YUNA 1QVFA 4Z88A 4C92D 5D6YA 2JM8A 1OX8A 3LH5A 4IUQA 1BCMA 3HRUA 4OVAA 4XK8E 1HD3A 5L23A 4OB0B 2HMAA 5CKEA 1B7TA 2E10A 3NTHA 2EGAA 3Q1JA 1YI2A 2L3SA 1VQMQ 4FW2A 4HT9A 4BY6C 1UGRB 1T3LA 1BI0A 3LH0A 2YUOA 3CC7Q 1M90C 3EH1A 3LX7A 2KEAA 2HZYA 2XI9A 1YJNQ 2Y90A 3CXCS 1Q7YR 1AZEA 1N27A 1M4ZA 3GOXA 2QQBA 2F2WA 2DRMA 2P0PA 3I55T 3CMEQ 4ZN1A 3L2QA 1YHQQ 1H3HA 4XTXA 4FM4B 2G6FX 3CCVQ 1VQ9A 3RESA 5A2QE 2B86A 4OB3B 1Q81U 2GCXA 1I07A 5LJ5d 5KYNA 3CC2Q 3T9NA 1PNJA 2F69A 2DBKA 5ECAA 2CP2A 4BI3A 2NLUA 2DM1A 1WLPB 1I5LA 2RK2A 1A0NB 2D0QB 3VS4A 4ZN3A 2X35A 2RHXA 1UFFA 2EYQA 5GAMe 1ZSZA 5GAOq 2E3IA 1EFNA 2CZ7B 4KRTA 4OGEA 2CZ1B 3CCUQ 2ZZDA 2F1LA 2KT1A 3CCLT 4CC7A 2EJFA 2QYZA 3S6WA 5LJ3j 3UA7A 4J6XA 2QQAA 2QDYB 2SRCA 4PJOA 3URGA 2FG0A 4A53A 3I55A 4R55A 2CT3A 4LD9K 4LDYA 4PJOG 2BZXA 3QKJA 2KYBA 5KYYB 3DKMA 3CPWS 3PGGA 2FL7A 4DEYA 1MMDA 5DLOA 3QUIA 3M0SA 2J06A 3VUZA 1HXDA 1IHVA 4JRPA 1VQ5T 4Z02A 3DB4A 2Y4XA 1CKBA 4RKUE 1WJSA 2R57A 3JB9G 1AZGB 1ZX6A 3EG1A 1YJWQ 3X28B 2RHYA 4PNOA 4E7ZA 3CPFA 3MJXA 3VJPA 4KGXB 4DOWA 1SSFA 2KXDA 1SHFA 3MP1A 2CH4W 4BI8B 2GFAA 4GY5A 4C5EA 2BE7D 4FSXA 2KR3A 4J9BA 1Q7YU 3LGFA 2F5KA 1D0YA 1Q86R 4CRIA 2J7IA 2K5IA 1N8RR 3V7SA 1VQMT 5DLQE 1Z9QA 3RDVA 4FYWB 3LWHA 3VKIA 2KT8A 5GAOm 3CC7T 1M2VB 3PNWC 1YJNT 2DF6A 4A4KA 3KFVA 4JRQA 2ENMA 5GANg 2J6FA 3RKWA 3CMET 2RF0A 3MEVA 1YHQT 2EQUA 4M7AA 4FYYB 1O9SA 3MHXA 3CC2T 1XQHA 4OF1A 1D1BA 1NG2A 4RTYA 2BE9B 2VXFA 2E6NA 4JRKA 1WQ7A 4C5HA 1M8VA 3PIOA 3M56A 1H92A 1V1CA 4NL3A 2FO0A 3M5AA 2DIGA 5CKHA 4UC4A 2KI7A 1VQMA 4QQGA 1MV3A 1WNLA 1V76A 3VV0A 3LYIA 5DY9A 2D0NA 1R0BG 3CCMQ 3CC7A 4PJLA 3CCUT 1RABB 3G6EQ 1FMWA 1YJNA 3NMZC 4BE2A 1KC8R 5LL6S 1NZ9A 2YSQA 3CMEA 3E2UA 1YHQA 3TEEA 3CCVA 1Q82C 4P5NA 3MO8A 1VUBA 3CC2A 1AWOA 2HKQB 4M7DG 2MI6A 4AFQC 5GAOn 1LVKA 4BUGA 2RJEA 3HSBA 1YCYA 1M3CA 2K79A 4AMCA 1UGSB 2H3JA 4XU0A 1IGQA 1C1AA 3A1PA 3ER0A 1X75C 4XQ3A 5FU7B 3ZBDA 3RIRA 2NYSA 3FRNA 3JCMb 1X43A 3OQ5A 4IUTA 1F1BB 1HSQA 1SKUB 1YITQ 3JCMW 1RI0A 4FCYA 1YJWT 1KD1C 2CZ0B 2M0OA 2R5AA 4HCKA 2D8HA 4A4EA 1Q86U 2NWMA 1N8RU 1Z9ZA 1VOMA 2OAUA 4RUGA 2YXYA 4NOYA 4ZGJB 2DO3A 3CCUA 1JB0E 3CCSQ 2E64A 1WYXA 4LUDA 1D0ZA 4HT8A 4KBMB 3C12A 3UA6A 4FSSA 2DTIA 2YDLA 2JXBA 5GAN6 4C0GA 2LT1A 2JNGA 2FRWA 4HCBA 2FZGB 1J3TA 1GL5A 2VB6A 3NTKA
chains in the Genus database with same CATH topology
5GAN7 1WQWA 2FVUA 2QI2A 1G3WA 2DTHA 4M77C 4M7AE 1KQSS 1WPYA 4VUBA 5GAOl 3HFOA 1W2BS 3MEUA 3OY9A 2L3RA 3E19A 5IAYA 4C8QB 2KMTA 2EJ9A 2VXEA 1ZBXA 2K57A 3ZEHA 5LJ5f 2XKOC 5KH6A 5GMKl 3HP9A 1UB4A 1Y7XA 1K8AU 3OYAA 4C8QE 3CCQT 2CGHA 4KUDK 2HBPA 1W2BA 1B34B 3NTIA 3CCVT 3S3NA 4LDXA 1IREB 2P0KA 2CYZB 2PVOB 2DJZA 5GAOr 1AHJB 1YJWA 1G3YA 3MCAB 2MWOA 2ZGWA 3OYDA 1FWZA 2QXFA 4JUVA 4XTVA 5GAMh 4ATOA 1VQ7A 5CKFA 3L42A 2LTOA 4N4IA 4FL6A 3UWNA 3OYLA 3PMTA 1KHCA 2DZCA 2EKOA 4A4HA 5GAMd 2PUKB 4C8QD 4PJOA 2RHZA 2K2VA 1UGPB 2ZPGB 3ZFJA 1G5VA 5IN1A 3QG1A 2PU9B 1MGQA 2BUDA 1ZHIA 4XU2A 3OYCA 4HCCA 3FIFA 3J7AF 4BY6B 4BI4A 5I21A 1K73C 2MMPA 1BI3A 2WSEE 2HQXA 2RJCA 2K3XA 3M9QA 4M78A 4M7AF 2LQKA 3UPUA 5GMKi 3CCRA 4C0DC 5EG2A 3META 2E41A 3QPHA 2DEQA 2FYKA 2QQSA 1KC8U 4DOVA 4LD6A 4M78G 3LLRA 4IKFA 3SWNC 2JUFA 2XD0A 2E5QA 2GFUA 3F70A 4MZPA 3CCJT 4M78C 3HKSA 3L2RA 2RD1A 3BDUA 4X34A 5GAN3 2RJDA 3S3MA 5KE2A 4QVDA 5A0DA 5GAN5 2DZ9A 2JTMA 1GXIE 2FB7A 3CCMT 3WVEB 2RK1A 2O01E 2CZ6B 3M55A 3G6ET 4EPCA 4F7UB 4M75A 4FT4A 5FU7C 1KG1A 3BW1A 4EDUA 4C92F 5GANh 3OYKA 4OMFB 5DM7R 2VV5A 2D9TA 3A8HB 4M75G 3TCJA 3CCQA 4NS5A 4MMLA 4F7UE 1NE8A 4M75C 2IVWA 2DK3A 4CI0C 1IZ6A 3M59A 4M7DA 3A8OB 5GANd 3M53A 2RO0A 1JRIA 5FLXE 3TREA 3GIBA 5HK0A 3DLLA 4QQ6A 4BB7A 3PMIA 4QQDA 1X01A 3RMSA 3SFMA 3O8VA 2XDDA 5CCAA 3PT9A 2VYTA 3H6ZA 3JB9I 2RA2A 2RI2A 4PKCC 3OYBA 2QQRA 1YI2T 3JCMX 1XNIA 4KUIA 3L1AA 3P8BB 2XHCA 4C0FA 3M54A 3PIPA 3OYJA 5HKCA 3FJPA 2RI3A 3GF5A 3JCMc 5CQXA 2DVEA 2E12A 2JVVA 1OYXA 5CKBA 2DXCA 4HKEA 2PQWA 1R8OB 3DLMA 4C92B 2HAXA 2P4TA 2I2LA 4JRIA 5J39A 4JLIA 2LCCA 1I81A 4Y91A 1YITT 3FC3A 1ZQ1A 5CKDA 3MEAA 3OS1A 4C8QA 5CR2A 1RL2A 2YRVA 3OYFA 3CCJA 2YLCA 5C0MA 1KQ2A 4XTUA 4IUVA 2X4JA 4C8QG 1NJIC 1H3ZA 2BKDN 4II1A 5GAN8 3L2VA 1QVFS 3E1SA 1Q86C 3JB9F 4C8QC 3QO3A 3OMCA 1VQ9T 2A3LA 4OB2B 3JCMh 1N8RC 3CCST 1M1KC 4MDWA 3HRSA 1U8RA 2L8DA 2M9UA 3G6EA 3LW5E 4OP0A 3UT1A 1KHIA 4BDZA 4PJOB 1G3SA 1TH7A 2R58A 1XTDA 4EMKB 4C0ZA 2L89A 3A8GB 3JCMd 1QVFA 2QQ9A 1P92A 4C92D 5D6YA 5M9OA 1BIAA 2C06A 1LNXA 4FT2A 3HRUA 4IUQA 4L6V5 2RB6A 4OVAA 2RH2A 1Y96B 4XK8E 1PSEA 4OB0B 2EWNA 3CCLA 1FX7A 5CKEA 2E10A 3C94A 3RKYA 2QEXT 2VGNA 2LDMA 3NTHA 4C5GA 3Q1JA 3VUBA 4J7FA 1YI2A 3MP6A 3JCMJ 3WXMB 5GMKe 3P8DA 1YIJT 4HT9A 1QP3A 4BY6C 3OB9A 1M90U 1DJ7B 1KQSA 4PJOD 3CMAT 3CBOA 4J83A 1UGRB 4MMKA 3L2ZA 3LH0A 1BI0A 4M77F 3FDRA 1WGSA 2VUBA 1MHNA 2KAFA 3HFNA 1M90C 3LX7A 1K8AC 5D6WA 2XI9A 4Y28E 2EJGA 1HK9A 2Y90A 3JCMe 3GNGA 3CXCS 1YITA 5I2MA 1K9MU 1W4SA 1N27A 4F7UA 5LJ3g 1M4ZA 3H8ZA 2QQBA 3R6OA 3GOXA 1O75A 3CEYA 3I56T 2OTJT 2XDPA 5D6XA 4RCBA 4RMOA 1VQ5A 2P0PA 4F7UG 2L5QA 5LJ5h 5LJ5j 4ZN1A 3OYEA 3I55T 3L2QA 1VQ6T 4XTXA 4FM4B 3CXCA 1VQ9A 5CIUA 1VQ6A 3RESA 5A2QE 1BIBA 3CCSA 3JB9D 4OB3B 4QW2A 4XTWA 1Q81U 2GCXA 5LJ5d 1BI2A 2GQVA 3EFSA 3SWNA 3EFRA 3T9NA 3V8KA 4JS4A 5L8RE 2F69A 2YLBA 2EIFA 2YHTA 4M7AG 4MDXA 3QZ5B 4BI3A 1QP2A 3QSUA 2NLUA 2E70A 2A7YA 2RJFA 5CAIA 1VQPT 1I5LA 4BACA 4A4FA 3GP8A 5A0LA 3L2WA 2RK2A 2O4XA 1KC8C 5LJ3f 2D0QB 4XTYA 2QEXA 4ZN3A 3AHUA 2X35A 1BI1A 4E7LA 1VQNT 2RHXA 4DQ2A 4DA4A 4O5VA 2EYQA 4BDYA 2VC8A 1YIJA 2X4WA 5GAMe 4LDUA 1YBYA 2LRQA 4C92G 2LX9A 4J7IA 4M78F 3CMAA 5GAOq 4E7JA 4C92C 4IUPA 2CZ7B 2V8IA 2LC4A 4ZGEB 3FB9A 1VQOT 3JB9H 2DAQA 4OGEA 2CZ1B 2F5TX 1QVGS 2DD5A 2ZZDA 3M4YA 4M7AB 3VYGA 2E1HA 4C5IA 3CCLT 5GAOp 2EJFA 2PUOB 1WJQA 3S6WA 1KQ1A 5LJ3j 4J6XA 2QQAA 2QDYB 2XU8A 4HA8A 2QA4T 2K3YA 1QVGA 1PSFA 3OS5A 4JDSA 4KT0E 5FROA 3URGA 3I56A 1Q82U 1JBMA 5CQYA 2AHJB 4A53A 3I55A 4M75F 4R55A 3X24B 4LDYA 3X25B 4LD9K 4PJOG 4FU6A 3GPLA 3QKJA 5KCHA 1Y96A 3PTAA 4PJOC 1BYMA 4ME7A 4EMKC 3DKMA 3CPWS 3PGGA 3CBPA 1OZ2A 2FL7A 1XOVA 1U1SA 4M7DF 5J26A 5DLOA 1NPRA 1M1GA 3QUIA 1G3TA 3E9GA 3A8LB 4M7AD 2XIDA 5CVIA 3L2UA 5IT9E 3SDZA 2RHIA 4C92E 3VUZA 3CPWA 1VQ4T 1HXDA 1VQPA 2E65A 5GANe 4JRPA 2HQEA 2LT4A 2WSCE 1VQ5T 1I4K1 4Z02A 3DB4A 2Y4XA 3JCMV 1KD1U 1B34A 2EQKA 3KUFA 1WJSA 2R57A 4RKUE 5GAN4 3JB9G 1NPPA 3J81E 1VQNA 3BDLA 3OA6A 3OS2A 4NL2A 5J3BA 3HRTA 3X28B 3QJ6A 3RKXA 3JCMQ 4B9WA 3OYGA 2JOYA 2RHYA 4A54A 2K5LA 4PNOA 3G4ST 5GMKj 2WACA 3CPFA 2DD4A 4D6WA 4QVZA 3X20B 4J5YA 1WJRA 3VJPA 5C6SA 5GAMg 4E7HA 3C95A 1VQOA 4PJOE 4A4GA 3NTKA 4PL6A 3CCET 4E7KA 2M16A 4C8QF 1SSFA 4DOWA 4M7DB 5AYFA 2XK0A 4PLIA 3MP1A 2VGMA 3HPWA 1VQLT 4BI8B 3INZA 4XU1A 2GFAA 2ZPFB 3GLXA 4GY5A 4C5EA 3LWIA 1I8FA 2CKKA 3NFCA 3ASKA 2QA4A 4FSXA 3HHTB 1Q7YU 3M57A 3LGFA 2CS7A 2F5KA 2KK4A 4CRIA 4ZGDB 4RCCA 1UGQB 2K5IA 3OS0A 3QYHB 3V7SA 4JJNK 5DLQE 1VQMT 2X4YA 3A5ZB 5GAN2 1Q7YC 2V8KA 4EMHA 2Y4YA 2E6ZA 4M77G 3LWHA 2KQWA 2RI5A 3VKIA 3QIIA 5GAOm 5GAMf 1VQ8T 4OB1B 3CD6T 3KXTA 3CC7T 3J80E 4M7DD 3LGLA 4FIBA 4N4GA 2KSSA 3PNWC 2DKGA 1YJNT 2LNVA 2MAMA 2P0QA 4ELYC 5GMKm 4A4KA 3JSCA 1VQ4A 2HNIA 4JRQA 2PVDB 1OI1A 5GANg 2DXBA 1S72T 1K9MC 3RKWA 4RG2A 3DB3A 2EFIA 2JZ2A 3BY7A 3FLGA 3CMET 3VU3C 3MEVA 1YHQT 2EQUA 2KDSA 4MZTA 3QHSA 3VYHB 4M7AA 2DTOA 2DXUA 1M1FA 2DXTA 2OTLA 2OTJA 1O9SA 2RHUA 3G4SA 1N6AA 3G71T 3MHXA 4X9CA 3QJYA 3CC2T 3V8JA 1XQHA 3RERA 4OF1A 2KVQG 3JRZA 5GAMj 2DIQA 5FU6B 2WSFE 2BIVA 3CBMA 4M7AC 1Q81C 2VXFA 2E6NA 4JRKA 4M77B 1WQ7A 3CCEA 2XICA 3OYYA 4R56A 1D3BB 4JS5A 4F7UF 2JTFA 4JLGA 3TU4K 4C5HA 3OW2S 1K73U 2FHDA 2GF7A 3S3OA 1M8VA 1EIFA 1VQLA 4M77E 3ME9A 1FXXA 4L59A 3M56A 4XAXB 1U1TA 4XU3A 3RUXA 3UDCA 3PIOA 3C4SA 1X6OA 3N5BB 5KE3A 2KY9A 3M58A 4LDVA 2LCLA 3QYGB 3QDRB 4C92A 4NL3A 5GANf 2MF2A 3JB9J 2R5MA 5FRMA 3OW2A 2LQ8A 2ZPHB 3BFMA 1QW1A 2DIGA 3M5AA 1QVPA 4PLLA 5CKHA 2ZPEB 2JN0A 4GLKA 5I2SA 1VQKT 4UC4A 1VQMA 4WF2A 1N9RA 4BD3A 4ZTJA 4QQGA 1WNLA 2PVGB 4X9DA 3VV0A 1YJ9T 4E47A 3KBGA 3LYIA 3OBYA 5DY9A 5LJ5e 1BKBA 4IUUA 4J6WA 1V29B 3EAEA 4M77D 3V7RA 1VQ8A 3CD6A 2EAYA 3CC4T 3CC7A 3CCUT 4XTZA 2EQJA 1YJNA 2RM4A 3JCMg 4L5GA 5LJ3h 2M1HA 1LJOA 2ZCFB 4BE2A 4EMKA 3JAME 3QBYA 4QVCA 5LL6S 2QTXA 5GANj 3V7CA 1S72A 4B9XA 1NZ9A 5LJ3d 2IG0A 2X4XA 3CMEA 1YHQA 4Q5WA 3TEEA 3CCVA 4BE1A 1Q82C 5A0GA 3FEOA 4P5NA 3MO8A 4C0DB 1VUBA 2DPPB 4BE0A 3G71A 2MWPA 3CC2A 3SWNB 1H641 1Y71A 4M7DG 4M78B 2MI6A 4MZMA 3V8LA 4M7DC 4V2SA 2EQMA 2ZPBB 4BUGA 5GAOn 2RJEA 3HSBA 1YCYA 4KULA 1UGSB 2B8AA 2H3JA 4M78E 4XU0A 4PJOF 3M4GA 3OSVA 3ER0A 3JCMf 1X75C 4XQ3A 3OYHA 5FU7B 3ZBDA 2O4XB 4O6JA 3JCMP 3OBWA 3FRNA 3OSSC 3MEWA 3A8MB 4N0AA 3RIRA 4RG8A 3JCMb 1UEBA 3GNFB 4LDWA 3OQ5A 3SD4A 4IUTA 3OYNA 2OTLT 3RMQA 4M75B 3JCMW 1RI0A 3QZ9B 1YJWT 2LVMA 2CZ0B 2M0OA 5GMKh 1KD1C 2R5AA 1NJIU 4N0AC 5KCOA 1VQKA 4YTLA 4A4EA 5LJ3e 5HK3A 1Q86U 2ZPIB 1VQ7T 4HCZA 4J6YA 1OZ3A 4M78D 1YJ9A 4M75E 3OYIA 1N8RU 1N9SA 1M1KU 3QXEB 2HD0A 2OAUA 3OYMA 4ELZC 4NOYA 1VIFA 3CC4A 4EMGA 4ZGJB 2DO3A 4TVRA 5LJ5g 3CCUA 1JB0E 4OGCA 2E64A 3SB2A 4J8OA 3CCMA 4N4HA 3PFSA 2D6FA 4HT8A 4KBMB 3C12A 1JJ2S 4M7DE 4ZTFA 3X26B 2XG8D 1M5Q1 2DTIA 1VIEA 2K5FA 2G3RA 2K4YA 5CK9A 5GAN6 4C0GA 3CCRT 5CO7A 2XDBA 4M77A 2LT1A 3HL8A 3MP8A 3P8HA 4IURA 1LOJA 4M75D 5HY6A 4E7IA 1D3BA 1JJ2A 2JNGA 3G7ZA 3OMGA 1Y07A 4HCBA 5FRNA 1M9SA 3WVDB 5FU6C 3E9FA 2V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  4M7A C;  5GAN 7;  2VXF A;  1WQW A;  4JRK A;  2E1H A;  4M77 B;  2DTH A;  4M77 C;  1WQ7 A;  4C8Q A;  2YLC A;  5GAO p;  1KQ2 A;  1D3B B;  2EJF A;  1WPY A;  4XTU A;  4F7U F;  5GAO l;  3HFO A;  4C8Q G;  1M8V A;  5LJ3 j;  1KQ1 A;  4J6X A;  5GAN 8;  4HA8 A;  4M7A E;  3JB9 F;  4M77 E;  4PJO A;  4C8Q B;  2VXE A;  2EJ9 A;  4XU3 A;  2K57 A;  3QO3 A;  1U1T A;  3RUX A;  4C8Q C;  5LJ5 f;  1JBM A;  5GMK l;  3JCM h;  4A53 A;  4M75 F;  4PJO G;  4OP0 A;  4C92 A;  4NL3 A;  5GAN f;  3JB9 J;  4C8Q E;  4PJO B;  1Y96 A;  2CGH A;  1TH7 A;  4PJO C;  1B34 B;  3BFM A;  4EMK B;  4EMK C;  3JCM d;  2JN0 A;  3PGG A;  4C92 D;  2DJZ A;  4WF2 A;  1BIA A;  1N9R A;  1U1S A;  1LNX A;  5GAO r;  4M7D F;  1WNL A;  2RB6 A;  4X9D A;  3QUI A;  1Y96 B;  2ZGW A;  5DY9 A;  4JUV A;  4M7A D;  4XTV A;  5LJ5 e;  4J6W A;  5GAM h;  4M77 D;  3V7R A;  2EWN A;  4C92 E;  2EAY A;  1HXD A;  2E10 A;  4XTZ A;  2E65 A;  5GAN e;  3RKY A;  2DZC A;  2RM4 A;  3JCM g;  5GAM d;  1I4K 1;  5LJ3 h;  4C8Q D;  1LJO A;  3JCM V;  1B34 A;  3JCM J;  3JB9 G;  4EMK A;  5GMK e;  5GAN 4;  1MGQ A;  4QVC A;  2QTX A;  4XU2 A;  3V7C A;  5GAN j;  4HT9 A;  3FIF A;  4NL2 A;  5I21 A;  5LJ3 d;  4PJO D;  3RKX A;  3JCM Q;  4A54 A;  4M7A F;  4M78 A;  3L2Z A;  4MMK A;  4PNO A;  4M77 F;  5GMK j;  4Y91 A;  5GMK i;  2E41 A;  2DEQ A;  2FYK A;  4J5Y A;  5GAM g;  3HFN A;  4M78 G;  3SWN C;  1H64 1;  3SWN B;  4PJO E;  4M7D G;  2EJG A;  1HK9 A;  2Y90 A;  4M78 C;  2RD1 A;  3BDU A;  4M78 B;  4C8Q F;  3V8L A;  3JCM e;  5GAN 3;  4M7D C;  4M7D B;  5GAO n;  4V2S A;  4F7U A;  5LJ3 g;  4QVD A;  3HSB A;  5GAN 5;  1YCY A;  2DZ9 A;  3INZ A;  4XU1 A;  2FB7 A;  4XU0 A;  4M78 E;  4RCB A;  4PJO F;  1I8F A;  3M4G A;  4F7U G;  5LJ5 h;  5LJ5 j;  3JCM f;  4XQ3 A;  4XTX A;  4F7U B;  4M75 A;  3BW1 A;  3RES A;  1BIB A;  4C92 F;  3JCM P;  4N0A A;  3RIR A;  5GAN h;  3JB9 D;  3JCM b;  4RCC A;  4XTW A;  5LJ5 d;  4M75 G;  3EFS A;  3SWN A;  3EFR A;  3V7S A;  3V8K A;  4MML A;  4F7U E;  5GAN 2;  2YLB A;  4M75 B;  4M75 C;  2YHT A;  3JCM W;  5GMK h;  4EMH A;  4M7A G;  4M7D A;  4N0A C;  5GAN d;  4M77 G;  5LJ3 e;  3QSU A;  1JRI A;  3GIB A;  5GAO m;  5GAM f;  4J6Y A;  4M78 D;  4M75 E;  5CAI A;  1X01 A;  1N9S A;  4M7D D;  2DKG A;  1I5L A;  4NOY A;  4EMG A;  5LJ5 g;  5GMK m;  3JB9 I;  2RA2 A;  2E64 A;  4XTY A;  5LJ3 f;  3SB2 A;  3AHU A;  3JCM X;  2HNI A;  3L1A A;  4HT8 A;  4M7D E;  5GAN g;  4DQ2 A;  3RKW A;  3BY7 A;  1M5Q 1;  2DTI A;  3FJP A;  3JCM c;  2DVE A;  3VU3 C;  2VC8 A;  5GAM e;  4C92 G;  3QHS A;  5GAN 6;  4M7A A;  2DTO A;  2DXU A;  2DXT A;  4M78 F;  4M77 A;  5GAO q;  4M75 D;  4C92 C;  1LOJ A;  4C92 B;  3JB9 H;  3FB9 A;  1D3B A;  4X9C A;  4JRI A;  2I2L A;  3V8J A;  3RER A;  4JLI A;  1I81 A;  5GAM j; 
#chains in the Genus database with same CATH topology
 5GAN 7;  4M77 C;  2DTH A;  1GCP A;  1KQS S;  5GAO l;  3HFO A;  1UHC A;  2Z0W A;  4PJM A;  2EJ9 A;  3ZEH A;  1ZBX A;  2K57 A;  1YIJ Q;  4F16 A;  3CMA Q;  1RUW A;  1UB4 A;  4HVV A;  1C6V X;  1LCK A;  3G1J A;  1W2B A;  3NTI A;  4LDX A;  1TU0 B;  1AHJ B;  1YJW A;  2RQT A;  3MCA B;  2MWO A;  5GAM h;  3PVQ A;  2OTJ Q;  2HBW A;  2MK5 A;  1VQ6 Q;  1X6B A;  2RHZ A;  2COY A;  2ZPG B;  1PCX A;  2C0O A;  3QG1 A;  2PU9 B;  2BUD A;  1YP5 A;  4F04 B;  1WA7 A;  3J7A F;  4BY6 B;  4BI4 A;  5I21 A;  1K73 C;  2WSE E;  3EG0 A;  3M9Q A;  2SEM A;  1K9M R;  4M78 A;  1BBZ A;  2DEQ A;  2FYK A;  1KC8 U;  4DOV A;  4M78 G;  2JUF A;  2CUB A;  2GFU A;  1UEC A;  1N5Z A;  1ZBJ A;  2AZV A;  5GAN 5;  2DZ9 A;  2JTM A;  1W6X A;  1VQN Q;  2EGE A;  3CCM T;  9ATC B;  2KGT A;  2O01 E;  2CZ6 B;  3G6E T;  4EPC A;  4M75 A;  1NYG A;  1PRM C;  1QWE A;  4C92 F;  2CH4 A;  1VQO Q;  4M75 G;  1JXM A;  3TCJ A;  1UJ0 A;  4NS5 A;  2EYX A;  2DK3 A;  2LQW A;  2RO0 A;  5FLX E;  3TRE A;  2C0I A;  1IXD A;  3DLL A;  4QQ6 A;  4BB7 A;  1X01 A;  2XDD A;  5CCA A;  2RQW A;  3O5Z A;  2JJ9 A;  5IH2 A;  2GNC A;  2YUQ A;  1CKA A;  4KUI A;  2DE0 X;  2XHC A;  5FWC A;  1GCQ C;  3JCM c;  3EHQ A;  2JVV A;  2M02 A;  4ORZ A;  5CKB A;  2RMO A;  3I35 A;  4HKE A;  2AZS A;  4RTU A;  4D8D A;  1X27 A;  4JRI A;  4JLI A;  2LCC A;  4Y91 A;  1YIT T;  1SF9 A;  1ZQ1 A;  2K6D A;  4C8Q A;  5CR2 A;  1RLQ C;  3OYF A;  1QCO A;  4C8Q G;  1NJI C;  4II1 A;  5GAN 8;  3L2V A;  3QO3 A;  2A3L A;  4OB2 B;  3JCM h;  3CCS T;  4MDW A;  1X2Q A;  2L8D A;  3G6E A;  3LW5 E;  4OP0 A;  3G4S Q;  1KHI A;  4BDZ A;  1Y57 A;  1XTD A;  4J9F A;  1P92 A;  3CCE Q;  1BIA A;  2NUZ A;  2C06 A;  2W0Z A;  2RH2 A;  1Y96 B;  4WTO B;  4AT1 B;  3MPU B;  2AK5 A;  1GBR A;  1HYO A;  4AG2 C;  3VUB A;  2LJ0 A;  2FZC B;  3MP6 A;  3RR6 A;  1VYV A;  1YIJ T;  2EYW A;  1WXU A;  4DBF A;  3CMA T;  3CBO A;  4J83 A;  4MMK A;  3REB B;  4M77 F;  1VQ8 Q;  3C0C A;  1WGS A;  7AT1 B;  1MHN A;  3HFN A;  1YIT A;  3GNG A;  1K9M U;  1KJW A;  4CC3 A;  1M8M A;  2HSP A;  2OTJ T;  2XDP A;  3EGX A;  5D6X A;  4RMO A;  2L5Q A;  1VQ6 T;  3EG9 A;  4LUE A;  3CXC A;  2FPE A;  3CCS A;  1TS9 A;  1IHW A;  4XTW A;  3G71 Q;  2GQV A;  3V8K A;  3VS3 A;  1M3A A;  2YLB A;  1RAA B;  2EIF A;  2YHT A;  3A98 A;  4MDX A;  3QZ5 B;  3QSU A;  2OX7 A;  2MCN A;  2A7Y A;  2LJ3 A;  1ZSG A;  1JJ2 P;  2RN8 A;  5A0L A;  4XTY A;  1Q81 R;  2NUT A;  1VYU A;  2IPO B;  3ULR B;  1T0H A;  4E7L A;  1VQN T;  3EG2 A;  2VC8 A;  1YIJ A;  2X4W A;  2LRQ A;  2L3Q A;  2LX9 A;  4J7I A;  3CMA A;  2L0A A;  1B07 A;  1VQO T;  2V8I A;  1M27 C;  1TUD A;  3BE3 A;  3CC4 Q;  1IGU A;  1ZSZ C;  2O88 A;  2DNU A;  1JU5 C;  1WJQ A;  2OTJ A;  5FRO A;  2P4R A;  1JBM A;  5CQY A;  2AHJ B;  1VQ6 A;  3HTR A;  3X24 B;  1RAC B;  2VAS A;  4FU6 A;  3QWY A;  4PJO C;  4E2F B;  3VS2 A;  3EH2 A;  4EMK C;  1XOV A;  1U1S A;  2ATC B;  1NPR A;  4RTW A;  3E9G A;  2EBP A;  2EGC A;  2COZ A;  4LN2 A;  1PD0 A;  4C92 E;  3CPW A;  1QQJ A;  3GBQ A;  2HQE A;  2LT4 A;  2QAS A;  1I4K 1;  2EQK A;  3KUF A;  1WHL A;  1NPP A;  3VS6 A;  3J81 E;  3OA6 A;  1VQN A;  5FW9 A;  3OS2 A;  4NL2 A;  1OQK A;  4AG1 C;  2ZAE A;  4B9W A;  4A54 A;  3NPF A;  1JO8 A;  3G4S T;  2LQN A;  1VQ7 Q;  2LCS A;  4D6W A;  4J5Y A;  1WJR A;  5GAM g;  4DBH A;  1VQO A;  2X9H A;  4OMQ A;  3CCE T;  2CSQ A;  2XK0 A;  1MMA A;  2VGM A;  3HPW A;  1ARK A;  3PVL A;  4XU1 A;  3NHN A;  2XMF A;  3LWI A;  3NFC A;  3M57 A;  1D1A A;  2L3P A;  4RCC A;  1UGQ B;  1CSK A;  1M1K R;  1PM3 A;  1X69 A;  1B3Q A;  2X4Y A;  3A5Z B;  1Q7Y C;  1K0X A;  2KQW A;  2RI5 A;  1VQ8 T;  3PE0 A;  3KXT A;  3J80 E;  3LGL A;  4FIB A;  4N4G A;  2KSS A;  2I0N A;  2LNV A;  2P0Q A;  2C0T A;  2HNI A;  1XJW B;  1NEB A;  4MZT A;  2DXU A;  2OTL A;  1VA7 A;  2EQI A;  2YWW A;  2RHU A;  3G4S A;  3G71 T;  4X9C A;  3RER A;  1TOV A;  3JRZ A;  1WI7 A;  1WHH A;  2BIV A;  4M7A C;  2NUP A;  4M77 B;  3CCE A;  3OYY A;  1D3B B;  1AT1 B;  1EIF A;  4M77 E;  3ME9 A;  4L59 A;  4XAX B;  1U1T A;  3N5B B;  5KE3 A;  3QDR B;  5GAN f;  2LNH B;  5FRM A;  2ZPH B;  1W70 A;  1QW1 A;  2ZPE B;  4GLK A;  4J9C A;  3CCJ Q;  4ZTJ A;  2PVG B;  1KQS P;  4E47 A;  3KBG A;  3M0R A;  1RAG B;  2K2M A;  1BKB A;  4J6W A;  5LJ5 e;  1V29 B;  3EAE A;  4M77 D;  3V7R A;  1VQ8 A;  3CC4 T;  1MNE A;  1MMG A;  2EQJ A;  4F14 A;  5I11 A;  3JCM g;  5LJ3 h;  4EMK A;  4QVC A;  3V7C A;  3EGX B;  4OMO A;  2A0F B;  4Q5W A;  2DL5 A;  3FEO A;  1HJD A;  3G71 A;  2X3X D;  5KYX A;  4EIK A;  3V8L A;  4M7D C;  1FYN A;  1NEG A;  2YUP A;  4PJO F;  3M4G A;  1WZO A;  1NYF A;  4O6J A;  2F2V A;  4LDW A;  3GNF B;  4J9H A;  2X3W D;  4YTL A;  2ZPI B;  1VQ7 T;  4HCZ A;  2EKH A;  1M1K U;  1N9S A;  3QXE B;  5IHN A;  3CC4 A;  4FW1 A;  4OGC A;  4J8O A;  3VS0 A;  1MUZ A;  1JJ2 S;  1FMK A;  1PKT A;  2ECZ A;  1VIE A;  2G3R A;  1SPK A;  1YWP A;  1QVG P;  2QK0 A;  4QKU A;  2XDB A;  3MP8 A;  3P8H A;  1LOJ A;  2OAW A;  5FRN A;  3WVD B;  5FU6 C;  1S1N A;  1JEG A;  1WQW A;  2QI2 A;  2QEX Q;  1U5S A;  2CSI A;  2VWF A;  1WPY A;  4VUB A;  4J9G A;  5GJV B;  2DA9 A;  5IAY A;  2AKL A;  4R0K A;  2XKO C;  3OYA A;  4KUD K;  3CCV T;  2P0K A;  2CYZ B;  2PVO B;  2DJZ A;  4JJD A;  2LJ1 A;  4DBQ A;  1FWZ A;  4JUV A;  3I56 Q;  1VQ7 A;  3L42 A;  2LTO A;  3UWN A;  1D09 B;  3PMT A;  1KHC A;  2MOX A;  2KNB B;  2K2V A;  1UGP B;  2FEI A;  1G5V A;  1G8X A;  1TUG B;  2KRM A;  1MGQ A;  4LE9 A;  4XU2 A;  3FIF A;  2HQX A;  2K3B A;  2K3X A;  2RJC A;  4AFZ C;  4M7A F;  2EYY A;  3UPU A;  4C0D C;  3MET A;  3QPH A;  1WXB A;  3LLR A;  3SWN C;  2XD0 A;  4MZP A;  3CCJ T;  4M78 C;  4AFS C;  3BDU A;  5GAN 3;  2RQU A;  5AT1 B;  1AWX A;  4PJJ A;  1GXI E;  2FB7 A;  2DEU A;  8ATC B;  3WVE B;  3EG3 A;  2RK1 A;  2HSE B;  5HCK A;  3M55 A;  2JW4 A;  4FT4 A;  4EDU A;  2VV5 A;  4M75 C;  1IZ6 A;  4M7D A;  3A8O B;  5GAN d;  5FWB A;  3GIB A;  4QQD A;  2QA4 Q;  2O2O A;  2NUP B;  2RA2 A;  2RI2 A;  4PKC C;  3U23 A;  2A37 A;  3JCM X;  1NLP C;  4C0F A;  3M54 A;  3PIP A;  2EVR A;  4ANJ A;  2DVE A;  1OYX A;  1ABQ A;  2RPN A;  2PQW A;  1OU9 A;  1K76 A;  1R8O B;  3DLM A;  2I2L A;  5J39 A;  3I5R A;  3OW2 P;  3FC3 A;  1VQ4 Q;  1ZSZ B;  1Q82 R;  3MEA A;  3OS1 A;  3CCJ A;  4HXJ A;  1BK2 A;  1RAF B;  4C8Q C;  2MIO A;  2M51 A;  2DMO A;  1Q95 G;  3OMC A;  3HRS A;  1U8R A;  2M9U A;  3UT1 A;  4PJO B;  2ED1 A;  4EMK B;  4C0Z A;  2QQ9 A;  1LNX A;  4FT2 A;  4L6V 5;  2RB6 A;  1PSE A;  5IXB A;  1KD1 R;  3UF4 A;  1FX7 A;  1W1F A;  3C94 A;  2QEX T;  2LX7 A;  4J7F A;  1OPK A;  3WXM B;  3P8D A;  4RTV A;  1QP3 A;  1DJ7 B;  4PJO D;  3L2Z A;  4JZ3 A;  2KAF A;  1PD1 A;  1K8A C;  5D6W A;  1AWJ A;  1MMN A;  4Y28 E;  3ZL7 C;  1OU8 A;  4F7U A;  5LJ3 g;  1RAE B;  1S72 Q;  1O75 A;  3I56 T;  4RCB A;  1BU1 A;  4F7U G;  5LJ5 h;  5LJ5 j;  3OYE A;  5CIU A;  1BIB A;  3JB9 D;  1ABO A;  4QW2 A;  4A63 B;  1EZZ B;  2LMJ A;  3SWN A;  4JS4 A;  3JV3 A;  1QP2 A;  1IO6 A;  1SSH A;  3GP8 A;  3MKD A;  1G83 A;  2O4X A;  2CRE A;  2CP6 A;  2QEX A;  3AHU A;  1BI1 A;  4DQ2 A;  4O5V A;  1GRI A;  1YBY A;  4C92 G;  1AD5 A;  4M78 F;  4E7J A;  4IUP A;  2CP5 A;  3M0T A;  2LC4 A;  3JB9 H;  1K73 R;  2F5T X;  1QVG S;  2KXC A;  3M4Y A;  4M7A B;  5GAO p;  1K9A A;  1KQ1 A;  4M7A E;  2QA4 T;  1ACM B;  2JMC A;  4KT0 E;  3I56 A;  2E5K A;  1Q82 U;  4OMP A;  4M75 F;  3X25 B;  4Z8A A;  3PTA A;  1UE9 A;  1BYM A;  4ME7 A;  2GTO A;  3CBP A;  4J9E A;  2O31 A;  3A8L B;  4M7A D;  5CVI A;  3L2U A;  3SDZ A;  5KYW A;  1MND A;  4Z89 A;  3TSZ A;  1VQ4 T;  1AVZ C;  4CC2 A;  3JCM V;  2EPD A;  1KD1 U;  1B34 A;  2OTL Q;  1ZUY A;  3BDL A;  3HRT A;  3RKX A;  2DIL A;  3OYG A;  2JOY A;  2CDT A;  5GMK j;  2WAC A;  2LP5 A;  2DD4 A;  4E7H A;  4QVZ A;  3X20 B;  5C6S A;  1PRL C;  4PL6 A;  4E7K A;  2M16 A;  4C8Q F;  4JPB W;  2E3H A;  4M7D B;  2MYS A;  3GLX A;  3ASK A;  2QA4 A;  2K7A A;  3HHT B;  2QAZ A;  1JQQ A;  4ZGD B;  2PTK A;  4JJN K;  3OS0 A;  5GAN 2;  4PK4 A;  2Y4Y A;  4M77 G;  1PC0 A;  1AWW A;  5GAM f;  4OB1 B;  1NBE B;  2ROL A;  2HKN A;  4M7D D;  2DKG A;  3VRY A;  1UUE A;  1TSF A;  2MAM A;  5GMK m;  1VQ4 A;  2GGR A;  2PVD B;  3CCQ Q;  1T3S A;  1S72 T;  3THK A;  2DL3 A;  2EFI A;  3FLG A;  2KDS A;  4KGZ B;  1ZLM A;  3VYH B;  1M1F A;  2DXT A;  2P84 A;  1N6A A;  1YNZ A;  4JJC A;  4HVU A;  5FU6 B;  3CBM A;  1Q81 C;  1QVF P;  4ZNX A;  2V26 A;  2XIC A;  4JJB A;  1QKX A;  4JS5 A;  3TU4 K;  4JLG A;  3OW2 S;  1K73 U;  2GF7 A;  3S3O A;  3IQL A;  3RNJ A;  4GLM A;  4XU3 A;  2DX1 A;  3RUX A;  2OJ2 A;  1X6O A;  2A08 A;  2MF2 A;  2R5M A;  1OEB A;  3BFM A;  4PLL A;  4AFU C;  2CT4 A;  2CUD A;  1QWF A;  4BD3 A;  1X6G A;  4F17 A;  4XTZ A;  2FPF A;  2RM4 A;  3UAT A;  1X2K A;  1TUC A;  1LJO A;  2VVK A;  1I0C A;  3JAM E;  3AT1 B;  5GAN j;  2QTX A;  1S72 A;  2AKK A;  3EGD A;  2IG0 A;  2X4X A;  2RNA A;  3FJ5 A;  4BE1 A;  4C0D B;  5IXF A;  3CCL Q;  4BE0 A;  1TG0 A;  3SWN B;  4M78 B;  1VYT A;  4MZM A;  3VS7 A;  2BZ8 A;  2B8A A;  4M78 E;  3H0F A;  2YRD A;  3OSV A;  3JCM f;  2O4X B;  3OBW A;  4N0A A;  3OSS C;  3A8M B;  4RG8 A;  1UEB A;  1H8K A;  2OTL T;  2JM9 A;  4M75 B;  3REA B;  3QZ9 B;  1NJI U;  4KH1 B;  5HK3 A;  1SEM A;  4J6Y A;  1OZ3 A;  4M78 D;  1GFC A;  4M75 E;  3OYI A;  2JTE A;  2HD0 A;  3OYM A;  4ELZ C;  4EMG A;  5LJ5 g;  4N4H A;  2D6F A;  4ZTF A;  1M5Q 1;  5CK9 A;  1IB8 A;  2DRK A;  5CO7 A;  3HL8 A;  5HY6 A;  4M75 D;  2DER A;  1JJ2 A;  2CP7 A;  2KE9 A;  2YRC A;  3G7Z A;  1QMC A;  2V8J A;  1OPL A;  2HQH A;  3OY9 A;  5KYW B;  3E19 A;  4C8Q B;  1UG1 A;  2VXE A;  2CP0 A;  5GMK l;  3HP9 A;  1Y0M A;  1ZUK A;  1WHJ A;  4C8Q E;  3CCQ T;  1B34 B;  2FRY A;  2FZK B;  5GAO r;  3OYD A;  3TQ7 P;  2QXF A;  4E6R A;  4ATO A;  4PFO A;  5CKF A;  4N4I A;  1M90 R;  2EKO A;  4A4H A;  5GAM d;  3R6N A;  2PUK B;  4C8Q D;  1M3B A;  2V1R A;  3ZFJ A;  5IN1 A;  1ZA2 B;  2MMP A;  2K9G A;  1AOJ A;  1PKS A;  4K11 A;  2E41 A;  1VQP Q;  4IKF A;  2HEQ A;  1OX9 A;  3L2R A;  2RD1 A;  3S3M A;  4QVD A;  1R77 A;  1U06 A;  4LNP A;  2MPX C;  1KG1 A;  4J9D A;  5DM7 R;  2D9T A;  3CCQ A;  3EG9 B;  1NE8 A;  2O9S A;  2IVW A;  3M53 A;  4OML A;  4D8K A;  5HK0 A;  4B6M A;  2FPD A;  1I1J A;  1K0S A;  3JB9 I;  3OYB A;  2KBT A;  2QQR A;  1XNI A;  3M0U A;  4LXC A;  5HKC A;  5CQX A;  2E12 A;  2GQI A;  2NUT B;  4OMN A;  2DXC A;  1SG5 A;  2JS0 A;  3NGP A;  2HAX A;  2P4T A;  2ABL A;  2QTV A;  1I81 A;  5CKD A;  2ED0 A;  2YRV A;  2YLC A;  5C0M A;  1KQ2 A;  4XTU A;  4IUV A;  1TWB A;  2X4J A;  1H3Z A;  1QVF S;  3CQT A;  3E1S A;  1Q86 C;  3JB9 F;  1N8R C;  4Y92 A;  4OMM A;  3M0Q A;  2R58 A;  2L89 A;  3A8G B;  3JCM d;  1WHM A;  1OV3 A;  3EGD B;  5M9O A;  1WIE A;  1VQL Q;  2DJQ A;  8AT1 B;  2EWN A;  3CCL A;  3RKY A;  2VGN A;  2LDM A;  4C5G A;  5IHI A;  3D7S B;  3JCM J;  5GMK e;  1GBQ A;  3OB9 A;  1ZA1 B;  1M90 U;  1KQS A;  3FDR A;  3CD6 Q;  2COW A;  2VUB A;  3M0P A;  2X51 A;  4DEX A;  1QKW A;  3EGU A;  2EJG A;  1HK9 A;  3JCM e;  2JS2 A;  4M4Z A;  3QDF A;  5I2M A;  1W4S A;  2VKN A;  2F2X A;  3H8Z A;  3R6O A;  3CEY A;  1VQ5 A;  1IRX A;  1BI2 A;  3EFS A;  3EFR A;  5L8R E;  2QGG A;  4M7A G;  2J6O A;  1QCF A;  2E70 A;  2RJF A;  5CAI A;  1VQP T;  4BAC A;  4A4F A;  3L2W A;  1JXO A;  1KC8 C;  5LJ3 f;  4DA4 A;  4PFZ A;  1VQK Q;  4BDY A;  2HL3 A;  4LDU A;  4FYV B;  1YJ9 Q;  4C92 C;  4ZGE B;  3FB9 A;  2DAQ A;  1D1C A;  2DD5 A;  1W2B P;  3VYG A;  2E1H A;  4C5I A;  2PUO B;  2D1X A;  4HA8 A;  2XU8 A;  1QVG A;  1SHG A;  1WXT A;  1PSF A;  2K3Y A;  2YT6 A;  3OS5 A;  3H9N A;  4JDS A;  3H41 A;  2M0Y A;  2QGF B;  1RI9 A;  2V1Q A;  3GPL A;  5KCH A;  1KK7 A;  1Y96 A;  1C0M A;  1OZ2 A;  1NLO C;  2DBM A;  4M7D F;  1UHF A;  3VS1 A;  5J26 A;  4KGV B;  1M1G A;  1M2O A;  1RAH B;  2J05 A;  1G3T A;  2XID A;  4ESR A;  1EX4 A;  5IT9 E;  1PWT A;  2RHI A;  2QG9 B;  1VQP A;  3TSW A;  2E65 A;  5GAN e;  2WSC E;  1U3O A;  2HL5 C;  2OI3 A;  5GAN 4;  1UDL A;  1SRL A;  5J3B A;  1RAI B;  3QJ6 A;  3JCM Q;  5EC7 A;  2K5L A;  1WDX A;  1OOT A;  3C95 A;  1E6H A;  4A4G A;  4PJO E;  5GJW B;  4DBR A;  5AYF A;  4PLI A;  2DFU A;  1VQL T;  3INZ A;  2ZPF B;  2DL4 A;  5KYX B;  1I8F A;  3I5S A;  2CKK A;  1T0J A;  2CS7 A;  3CCR Q;  2KK4 A;  2J6K A;  1KFZ A;  2PZ1 A;  3QYH B;  1UGV A;  2V8K A;  1WHG A;  4EMH A;  1RAD B;  1UJY A;  2E6Z A;  3H0I A;  3QII A;  3CD6 T;  4IIO A;  2A36 A;  3I9Q A;  2E4H A;  1K1Z A;  2KYM A;  4ELY C;  3JSC A;  4QT7 A;  1OI1 A;  2AIR B;  2DXB A;  1FMV A;  1K9M C;  4RG2 A;  3DB3 A;  2JZ2 A;  3BY7 A;  2EW3 A;  3VU3 C;  2H8H A;  3QHS A;  1WHK A;  2DTO A;  1WFW A;  3QJY A;  3V8J A;  6AT1 B;  2KVQ G;  5GAM j;  2DIQ A;  2WSF E;  2H3E B;  5KYU A;  4CC4 B;  4R56 A;  4F7U F;  2JTF A;  4RTZ A;  1K8A R;  2FHD A;  2AT1 B;  1VQL A;  1FXX A;  3UDC A;  3C4S A;  1PHT A;  2KY9 A;  3M58 A;  4LDV A;  2LCL A;  3QYG B;  4C92 A;  3JB9 J;  3OW2 A;  2LQ8 A;  2KRS A;  1QVP A;  5I2S A;  1VQK T;  2JN0 A;  4WF2 A;  1N9R A;  1D0X A;  2GTJ A;  4X9D A;  1YJ9 T;  1OUL A;  3OBY A;  3EFO A;  4IUU A;  3CD6 A;  2EAY A;  2ESW A;  3TVT A;  4L5G A;  2M1H A;  2ZCF B;  2BTT A;  3QBY A;  1WX6 A;  4B9X A;  5LJ3 d;  2EYZ A;  1AEY A;  1NM7 A;  5A0G A;  2PNI A;  3CXC P;  2DPP B;  2CP3 A;  2MWP A;  1H64 1;  1Y71 A;  2DL7 A;  2GBQ A;  4V2S A;  2EQM A;  2ZPB B;  1YI2 Q;  2RQV A;  2DLP A;  4KUL A;  3QWX X;  3OYH A;  3JCM P;  3MEW A;  3SD4 A;  3OYN A;  3RMQ A;  2LVM A;  5GMK h;  1VQK A;  4N0A C;  5KCO A;  5LJ3 e;  2DYI A;  3EHR A;  1YJ9 A;  4JZ4 A;  1VIF A;  2HCK A;  1VQ9 Q;  4TVR A;  3SB2 A;  1BB9 A;  4FYX B;  3CCM A;  3PFS A;  1R0C B;  4M7D E;  3RBB B;  2BZY A;  3X26 B;  2XG8 D;  1RLP C;  1NJI R;  2JMA A;  2K5F A;  2K4Y A;  3CCR T;  4M77 A;  4KH0 B;  2IIM A;  4IUR A;  4E7I A;  1D3B A;  3OMG A;  1Y07 A;  1M9S A;  3E9F A;  2W10 A;  3VRZ A;  2FVU A;  2QDL A;  1G3W A;  1LPL A;  3VS5 A;  1BCO A;  4PJN A;  3MEU A;  1W2B S;  2L3R A;  2KMT A;  5LJ5 f;  5KH6 A;  3CPW P;  2DET A;  1Y7X A;  1K8A U;  2CGH A;  1M30 A;  2HBP A;  3S3N A;  1IRE B;  1G3Y A;  5I22 A;  1YCS B;  1I5O B;  2ZGW A;  3H0H A;  4XTV A;  1YWO A;  4RTX A;  4HVW A;  4FL6 A;  1KSW A;  3I55 Q;  3OYL A;  1YFN A;  2DZC A;  1TXQ A;  5KYY A;  1PG5 B;  1ZHI A;  4HCC A;  3OYC A;  2RQR A;  4J9I A;  1BI3 A;  2DL8 A;  2L2P A;  2LQK A;  2D8J A;  5GMK i;  3CCR A;  5EG2 A;  4WCI A;  1YN8 A;  2QQS A;  4LD6 A;  1KIK A;  2E5Q A;  3F70 A;  1K4U S;  4X1V A;  2LZ6 B;  3HKS A;  1GFD A;  4X34 A;  2RJD A;  5KE2 A;  2O9V A;  5A0D A;  3SEM A;  1QLY A;  4E7S A;  4F7U B;  5FU7 C;  3BW1 A;  2DVJ A;  5GAN h;  3OYK A;  4OMF B;  3A8H B;  4MML A;  4F7U E;  1QCN A;  4CI0 C;  3M59 A;  1JRI A;  2KRN A;  3PMI A;  1SRM A;  3RMS A;  3SFM A;  1MV0 B;  3O8V A;  5D7U A;  1ZUU A;  3PT9 A;  1GCQ A;  2VYT A;  3H6Z A;  2DYB A;  5KYU B;  1YI2 T;  4PFP A;  3L1A A;  3P8B B;  5IHK A;  1TTH B;  2HDA A;  1E6G A;  2KRO A;  3OYJ A;  3FJP A;  2RI3 A;  3GF5 A;  4C92 B;  2ROT A;  1M2V A;  2JT4 A;  4IIM A;  1RL2 A;  1VQ5 Q;  4GBQ A;  2BKD N;  3EFO B;  1UTI A;  2A28 A;  1VQ9 T;  1E7O A;  1M1K C;  1G2B A;  1G3S A;  1TH7 A;  3SHW A;  4RTT A;  2YUN A;  1QVF A;  4Z88 A;  4C92 D;  5D6Y A;  2JM8 A;  1OX8 A;  3LH5 A;  4IUQ A;  1BCM A;  3HRU A;  4OVA A;  4XK8 E;  1HD3 A;  5L23 A;  4OB0 B;  2HMA A;  5CKE A;  1B7T A;  2E10 A;  3NTH A;  2EGA A;  3Q1J A;  1YI2 A;  2L3S A;  1VQM Q;  4FW2 A;  4HT9 A;  4BY6 C;  1UGR B;  1T3L A;  1BI0 A;  3LH0 A;  2YUO A;  3CC7 Q;  1M90 C;  3EH1 A;  3LX7 A;  2KEA A;  2HZY A;  2XI9 A;  1YJN Q;  2Y90 A;  3CXC S;  1Q7Y R;  1AZE A;  1N27 A;  1M4Z A;  3GOX A;  2QQB A;  2F2W A;  2DRM A;  2P0P A;  3I55 T;  3CME Q;  4ZN1 A;  3L2Q A;  1YHQ Q;  1H3H A;  4XTX A;  4FM4 B;  2G6F X;  3CCV Q;  1VQ9 A;  3RES A;  5A2Q E;  2B86 A;  4OB3 B;  1Q81 U;  2GCX A;  1I07 A;  5LJ5 d;  5KYN A;  3CC2 Q;  3T9N A;  1PNJ A;  2F69 A;  2DBK A;  5ECA A;  2CP2 A;  4BI3 A;  2NLU A;  2DM1 A;  1WLP B;  1I5L A;  2RK2 A;  1A0N B;  2D0Q B;  3VS4 A;  4ZN3 A;  2X35 A;  2RHX A;  1UFF A;  2EYQ A;  5GAM e;  1ZSZ A;  5GAO q;  2E3I A;  1EFN A;  2CZ7 B;  4KRT A;  4OGE A;  2CZ1 B;  3CCU Q;  2ZZD A;  2F1L A;  2KT1 A;  3CCL T;  4CC7 A;  2EJF A;  2QYZ A;  3S6W A;  5LJ3 j;  3UA7 A;  4J6X A;  2QQA A;  2QDY B;  2SRC A;  4PJO A;  3URG A;  2FG0 A;  4A53 A;  3I55 A;  4R55 A;  2CT3 A;  4LD9 K;  4LDY A;  4PJO G;  2BZX A;  3QKJ A;  2KYB A;  5KYY B;  3DKM A;  3CPW S;  3PGG A;  2FL7 A;  4DEY A;  1MMD A;  5DLO A;  3QUI A;  3M0S A;  2J06 A;  3VUZ A;  1HXD A;  1IHV A;  4JRP A;  1VQ5 T;  4Z02 A;  3DB4 A;  2Y4X A;  1CKB A;  4RKU E;  1WJS A;  2R57 A;  3JB9 G;  1AZG B;  1ZX6 A;  3EG1 A;  1YJW Q;  3X28 B;  2RHY A;  4PNO A;  4E7Z A;  3CPF A;  3MJX A;  3VJP A;  4KGX B;  4DOW A;  1SSF A;  2KXD A;  1SHF A;  3MP1 A;  2CH4 W;  4BI8 B;  2GFA A;  4GY5 A;  4C5E A;  2BE7 D;  4FSX A;  2KR3 A;  4J9B A;  1Q7Y U;  3LGF A;  2F5K A;  1D0Y A;  1Q86 R;  4CRI A;  2J7I A;  2K5I A;  1N8R R;  3V7S A;  1VQM T;  5DLQ E;  1Z9Q A;  3RDV A;  4FYW B;  3LWH A;  3VKI A;  2KT8 A;  5GAO m;  3CC7 T;  1M2V B;  3PNW C;  1YJN T;  2DF6 A;  4A4K A;  3KFV A;  4JRQ A;  2ENM A;  5GAN g;  2J6F A;  3RKW A;  3CME T;  2RF0 A;  3MEV A;  1YHQ T;  2EQU A;  4M7A A;  4FYY B;  1O9S A;  3MHX A;  3CC2 T;  1XQH A;  4OF1 A;  1D1B A;  1NG2 A;  4RTY A;  2BE9 B;  2VXF A;  2E6N A;  4JRK A;  1WQ7 A;  4C5H A;  1M8V A;  3PIO A;  3M56 A;  1H92 A;  1V1C A;  4NL3 A;  2FO0 A;  3M5A A;  2DIG A;  5CKH A;  4UC4 A;  2KI7 A;  1VQM A;  4QQG A;  1MV3 A;  1WNL A;  1V76 A;  3VV0 A;  3LYI A;  5DY9 A;  2D0N A;  1R0B G;  3CCM Q;  3CC7 A;  4PJL A;  3CCU T;  1RAB B;  3G6E Q;  1FMW A;  1YJN A;  3NMZ C;  4BE2 A;  1KC8 R;  5LL6 S;  1NZ9 A;  2YSQ A;  3CME A;  3E2U A;  1YHQ A;  3TEE A;  3CCV A;  1Q82 C;  4P5N A;  3MO8 A;  1VUB A;  3CC2 A;  1AWO A;  2HKQ B;  4M7D G;  2MI6 A;  4AFQ C;  5GAO n;  1LVK A;  4BUG A;  2RJE A;  3HSB A;  1YCY A;  1M3C A;  2K79 A;  4AMC A;  1UGS B;  2H3J A;  4XU0 A;  1IGQ A;  1C1A A;  3A1P A;  3ER0 A;  1X75 C;  4XQ3 A;  5FU7 B;  3ZBD A;  3RIR A;  2NYS A;  3FRN A;  3JCM b;  1X43 A;  3OQ5 A;  4IUT A;  1F1B B;  1HSQ A;  1SKU B;  1YIT Q;  3JCM W;  1RI0 A;  4FCY A;  1YJW T;  1KD1 C;  2CZ0 B;  2M0O A;  2R5A A;  4HCK A;  2D8H A;  4A4E A;  1Q86 U;  2NWM A;  1N8R U;  1Z9Z A;  1VOM A;  2OAU A;  4RUG A;  2YXY A;  4NOY A;  4ZGJ B;  2DO3 A;  3CCU A;  1JB0 E;  3CCS Q;  2E64 A;  1WYX A;  4LUD A;  1D0Z A;  4HT8 A;  4KBM B;  3C12 A;  3UA6 A;  4FSS A;  2DTI A;  2YDL A;  2JXB A;  5GAN 6;  4C0G A;  2LT1 A;  2JNG A;  2FRW A;  4HCB A;  2FZG B;  1J3T A;  1GL5 A;  2VB6 A;  3NTK A; 
#chains in the Genus database with same CATH homology
 5GAN 7;  1WQW A;  2FVU A;  2QI2 A;  1G3W A;  2DTH A;  4M77 C;  4M7A E;  1KQS S;  1WPY A;  4VUB A;  5GAO l;  3HFO A;  1W2B S;  3MEU A;  3OY9 A;  2L3R A;  3E19 A;  5IAY A;  4C8Q B;  2KMT A;  2EJ9 A;  2VXE A;  1ZBX A;  2K57 A;  3ZEH A;  5LJ5 f;  2XKO C;  5KH6 A;  5GMK l;  3HP9 A;  1UB4 A;  1Y7X A;  1K8A U;  3OYA A;  4C8Q E;  3CCQ T;  2CGH A;  4KUD K;  2HBP A;  1W2B A;  1B34 B;  3NTI A;  3CCV T;  3S3N A;  4LDX A;  1IRE B;  2P0K A;  2CYZ B;  2PVO B;  2DJZ A;  5GAO r;  1AHJ B;  1YJW A;  1G3Y A;  3MCA B;  2MWO A;  2ZGW A;  3OYD A;  1FWZ A;  2QXF A;  4JUV A;  4XTV A;  5GAM h;  4ATO A;  1VQ7 A;  5CKF A;  3L42 A;  2LTO A;  4N4I A;  4FL6 A;  3UWN A;  3OYL A;  3PMT A;  1KHC A;  2DZC A;  2EKO A;  4A4H A;  5GAM d;  2PUK B;  4C8Q D;  4PJO A;  2RHZ A;  2K2V A;  1UGP B;  2ZPG B;  3ZFJ A;  1G5V A;  5IN1 A;  3QG1 A;  2PU9 B;  1MGQ A;  2BUD A;  1ZHI A;  4XU2 A;  3OYC A;  4HCC A;  3FIF A;  3J7A F;  4BY6 B;  4BI4 A;  5I21 A;  1K73 C;  2MMP A;  1BI3 A;  2WSE E;  2HQX A;  2RJC A;  2K3X A;  3M9Q A;  4M78 A;  4M7A F;  2LQK A;  3UPU A;  5GMK i;  3CCR A;  4C0D C;  5EG2 A;  3MET A;  2E41 A;  3QPH A;  2DEQ A;  2FYK A;  2QQS A;  1KC8 U;  4DOV A;  4LD6 A;  4M78 G;  3LLR A;  4IKF A;  3SWN C;  2JUF A;  2XD0 A;  2E5Q A;  2GFU A;  3F70 A;  4MZP A;  3CCJ T;  4M78 C;  3HKS A;  3L2R A;  2RD1 A;  3BDU A;  4X34 A;  5GAN 3;  2RJD A;  3S3M A;  5KE2 A;  4QVD A;  5A0D A;  5GAN 5;  2DZ9 A;  2JTM A;  1GXI E;  2FB7 A;  3CCM T;  3WVE B;  2RK1 A;  2O01 E;  2CZ6 B;  3M55 A;  3G6E T;  4EPC A;  4F7U B;  4M75 A;  4FT4 A;  5FU7 C;  1KG1 A;  3BW1 A;  4EDU A;  4C92 F;  5GAN h;  3OYK A;  4OMF B;  5DM7 R;  2VV5 A;  2D9T A;  3A8H B;  4M75 G;  3TCJ A;  3CCQ A;  4NS5 A;  4MML A;  4F7U E;  1NE8 A;  4M75 C;  2IVW A;  2DK3 A;  4CI0 C;  1IZ6 A;  3M59 A;  4M7D A;  3A8O B;  5GAN d;  3M53 A;  2RO0 A;  1JRI A;  5FLX E;  3TRE A;  3GIB A;  5HK0 A;  3DLL A;  4QQ6 A;  4BB7 A;  3PMI A;  4QQD A;  1X01 A;  3RMS A;  3SFM A;  3O8V A;  2XDD A;  5CCA A;  3PT9 A;  2VYT A;  3H6Z A;  3JB9 I;  2RA2 A;  2RI2 A;  4PKC C;  3OYB A;  2QQR A;  1YI2 T;  3JCM X;  1XNI A;  4KUI A;  3L1A A;  3P8B B;  2XHC A;  4C0F A;  3M54 A;  3PIP A;  3OYJ A;  5HKC A;  3FJP A;  2RI3 A;  3GF5 A;  3JCM c;  5CQX A;  2DVE A;  2E12 A;  2JVV A;  1OYX A;  5CKB A;  2DXC A;  4HKE A;  2PQW A;  1R8O B;  3DLM A;  4C92 B;  2HAX A;  2P4T A;  2I2L A;  4JRI A;  5J39 A;  4JLI A;  2LCC A;  1I81 A;  4Y91 A;  1YIT T;  3FC3 A;  1ZQ1 A;  5CKD A;  3MEA A;  3OS1 A;  4C8Q A;  5CR2 A;  1RL2 A;  2YRV A;  3OYF A;  3CCJ A;  2YLC A;  5C0M A;  1KQ2 A;  4XTU A;  4IUV A;  2X4J A;  4C8Q G;  1NJI C;  1H3Z A;  2BKD N;  4II1 A;  5GAN 8;  3L2V A;  1QVF S;  3E1S A;  1Q86 C;  3JB9 F;  4C8Q C;  3QO3 A;  3OMC A;  1VQ9 T;  2A3L A;  4OB2 B;  3JCM h;  1N8R C;  3CCS T;  1M1K C;  4MDW A;  3HRS A;  1U8R A;  2L8D A;  2M9U A;  3G6E A;  3LW5 E;  4OP0 A;  3UT1 A;  1KHI A;  4BDZ A;  4PJO B;  1G3S A;  1TH7 A;  2R58 A;  1XTD A;  4EMK B;  4C0Z A;  2L89 A;  3A8G B;  3JCM d;  1QVF A;  2QQ9 A;  1P92 A;  4C92 D;  5D6Y A;  5M9O A;  1BIA A;  2C06 A;  1LNX A;  4FT2 A;  3HRU A;  4IUQ A;  4L6V 5;  2RB6 A;  4OVA A;  2RH2 A;  1Y96 B;  4XK8 E;  1PSE A;  4OB0 B;  2EWN A;  3CCL A;  1FX7 A;  5CKE A;  2E10 A;  3C94 A;  3RKY A;  2QEX T;  2VGN A;  2LDM A;  3NTH A;  4C5G A;  3Q1J A;  3VUB A;  4J7F A;  1YI2 A;  3MP6 A;  3JCM J;  3WXM B;  5GMK e;  3P8D A;  1YIJ T;  4HT9 A;  1QP3 A;  4BY6 C;  3OB9 A;  1M90 U;  1DJ7 B;  1KQS A;  4PJO D;  3CMA T;  3CBO A;  4J83 A;  1UGR B;  4MMK A;  3L2Z A;  3LH0 A;  1BI0 A;  4M77 F;  3FDR A;  1WGS A;  2VUB A;  1MHN A;  2KAF A;  3HFN A;  1M90 C;  3LX7 A;  1K8A C;  5D6W A;  2XI9 A;  4Y28 E;  2EJG A;  1HK9 A;  2Y90 A;  3JCM e;  3GNG A;  3CXC S;  1YIT A;  5I2M A;  1K9M U;  1W4S A;  1N27 A;  4F7U A;  5LJ3 g;  1M4Z A;  3H8Z A;  2QQB A;  3R6O A;  3GOX A;  1O75 A;  3CEY A;  3I56 T;  2OTJ T;  2XDP A;  5D6X A;  4RCB A;  4RMO A;  1VQ5 A;  2P0P A;  4F7U G;  2L5Q A;  5LJ5 h;  5LJ5 j;  4ZN1 A;  3OYE A;  3I55 T;  3L2Q A;  1VQ6 T;  4XTX A;  4FM4 B;  3CXC A;  1VQ9 A;  5CIU A;  1VQ6 A;  3RES A;  5A2Q E;  1BIB A;  3CCS A;  3JB9 D;  4OB3 B;  4QW2 A;  4XTW A;  1Q81 U;  2GCX A;  5LJ5 d;  1BI2 A;  2GQV A;  3EFS A;  3SWN A;  3EFR A;  3T9N A;  3V8K A;  4JS4 A;  5L8R E;  2F69 A;  2YLB A;  2EIF A;  2YHT A;  4M7A G;  4MDX A;  3QZ5 B;  4BI3 A;  1QP2 A;  3QSU A;  2NLU A;  2E70 A;  2A7Y A;  2RJF A;  5CAI A;  1VQP T;  1I5L A;  4BAC A;  4A4F A;  3GP8 A;  5A0L A;  3L2W A;  2RK2 A;  2O4X A;  1KC8 C;  5LJ3 f;  2D0Q B;  4XTY A;  2QEX A;  4ZN3 A;  3AHU A;  2X35 A;  1BI1 A;  4E7L A;  1VQN T;  2RHX A;  4DQ2 A;  4DA4 A;  4O5V A;  2EYQ A;  4BDY A;  2VC8 A;  1YIJ A;  2X4W A;  5GAM e;  4LDU A;  1YBY A;  2LRQ A;  4C92 G;  2LX9 A;  4J7I A;  4M78 F;  3CMA A;  5GAO q;  4E7J A;  4C92 C;  4IUP A;  2CZ7 B;  2V8I A;  2LC4 A;  4ZGE B;  3FB9 A;  1VQO T;  3JB9 H;  2DAQ A;  4OGE A;  2CZ1 B;  2F5T X;  1QVG S;  2DD5 A;  2ZZD A;  3M4Y A;  4M7A B;  3VYG A;  2E1H A;  4C5I A;  3CCL T;  5GAO p;  2EJF A;  2PUO B;  1WJQ A;  3S6W A;  1KQ1 A;  5LJ3 j;  4J6X A;  2QQA A;  2QDY B;  2XU8 A;  4HA8 A;  2QA4 T;  2K3Y A;  1QVG A;  1PSF A;  3OS5 A;  4JDS A;  4KT0 E;  5FRO A;  3URG A;  3I56 A;  1Q82 U;  1JBM A;  5CQY A;  2AHJ B;  4A53 A;  3I55 A;  4M75 F;  4R55 A;  3X24 B;  4LDY A;  3X25 B;  4LD9 K;  4PJO G;  4FU6 A;  3GPL A;  3QKJ A;  5KCH A;  1Y96 A;  3PTA A;  4PJO C;  1BYM A;  4ME7 A;  4EMK C;  3DKM A;  3CPW S;  3PGG A;  3CBP A;  1OZ2 A;  2FL7 A;  1XOV A;  1U1S A;  4M7D F;  5J26 A;  5DLO A;  1NPR A;  1M1G A;  3QUI A;  1G3T A;  3E9G A;  3A8L B;  4M7A D;  2XID A;  5CVI A;  3L2U A;  5IT9 E;  3SDZ A;  2RHI A;  4C92 E;  3VUZ A;  3CPW A;  1VQ4 T;  1HXD A;  1VQP A;  2E65 A;  5GAN e;  4JRP A;  2HQE A;  2LT4 A;  2WSC E;  1VQ5 T;  1I4K 1;  4Z02 A;  3DB4 A;  2Y4X A;  3JCM V;  1KD1 U;  1B34 A;  2EQK A;  3KUF A;  1WJS A;  2R57 A;  4RKU E;  5GAN 4;  3JB9 G;  1NPP A;  3J81 E;  1VQN A;  3BDL A;  3OA6 A;  3OS2 A;  4NL2 A;  5J3B A;  3HRT A;  3X28 B;  3QJ6 A;  3RKX A;  3JCM Q;  4B9W A;  3OYG A;  2JOY A;  2RHY A;  4A54 A;  2K5L A;  4PNO A;  3G4S T;  5GMK j;  2WAC A;  3CPF A;  2DD4 A;  4D6W A;  4QVZ A;  3X20 B;  4J5Y A;  1WJR A;  3VJP A;  5C6S A;  5GAM g;  4E7H A;  3C95 A;  1VQO A;  4PJO E;  4A4G A;  3NTK A;  4PL6 A;  3CCE T;  4E7K A;  2M16 A;  4C8Q F;  1SSF A;  4DOW A;  4M7D B;  5AYF A;  2XK0 A;  4PLI A;  3MP1 A;  2VGM A;  3HPW A;  1VQL T;  4BI8 B;  3INZ A;  4XU1 A;  2GFA A;  2ZPF B;  3GLX A;  4GY5 A;  4C5E A;  3LWI A;  1I8F A;  2CKK A;  3NFC A;  3ASK A;  2QA4 A;  4FSX A;  3HHT B;  1Q7Y U;  3M57 A;  3LGF A;  2CS7 A;  2F5K A;  2KK4 A;  4CRI A;  4ZGD B;  4RCC A;  1UGQ B;  2K5I A;  3OS0 A;  3QYH B;  3V7S A;  4JJN K;  5DLQ E;  1VQM T;  2X4Y A;  3A5Z B;  5GAN 2;  1Q7Y C;  2V8K A;  4EMH A;  2Y4Y A;  2E6Z A;  4M77 G;  3LWH A;  2KQW A;  2RI5 A;  3VKI A;  3QII A;  5GAO m;  5GAM f;  1VQ8 T;  4OB1 B;  3CD6 T;  3KXT A;  3CC7 T;  3J80 E;  4M7D D;  3LGL A;  4FIB A;  4N4G A;  2KSS A;  3PNW C;  2DKG A;  1YJN T;  2LNV A;  2MAM A;  2P0Q A;  4ELY C;  5GMK m;  4A4K A;  3JSC A;  1VQ4 A;  2HNI A;  4JRQ A;  2PVD B;  1OI1 A;  5GAN g;  2DXB A;  1S72 T;  1K9M C;  3RKW A;  4RG2 A;  3DB3 A;  2EFI A;  2JZ2 A;  3BY7 A;  3FLG A;  3CME T;  3VU3 C;  3MEV A;  1YHQ T;  2EQU A;  2KDS A;  4MZT A;  3QHS A;  3VYH B;  4M7A A;  2DTO A;  2DXU A;  1M1F A;  2DXT A;  2OTL A;  2OTJ A;  1O9S A;  2RHU A;  3G4S A;  1N6A A;  3G71 T;  3MHX A;  4X9C A;  3QJY A;  3CC2 T;  3V8J A;  1XQH A;  3RER A;  4OF1 A;  2KVQ G;  3JRZ A;  5GAM j;  2DIQ A;  5FU6 B;  2WSF E;  2BIV A;  3CBM A;  4M7A C;  1Q81 C;  2VXF A;  2E6N A;  4JRK A;  4M77 B;  1WQ7 A;  3CCE A;  2XIC A;  3OYY A;  4R56 A;  1D3B B;  4JS5 A;  4F7U F;  2JTF A;  4JLG A;  3TU4 K;  4C5H A;  3OW2 S;  1K73 U;  2FHD A;  2GF7 A;  3S3O A;  1M8V A;  1EIF A;  1VQL A;  4M77 E;  3ME9 A;  1FXX A;  4L59 A;  3M56 A;  4XAX B;  1U1T A;  4XU3 A;  3RUX A;  3UDC A;  3PIO A;  3C4S A;  1X6O A;  3N5B B;  5KE3 A;  2KY9 A;  3M58 A;  4LDV A;  2LCL A;  3QYG B;  3QDR B;  4C92 A;  4NL3 A;  5GAN f;  2MF2 A;  3JB9 J;  2R5M A;  5FRM A;  3OW2 A;  2LQ8 A;  2ZPH B;  3BFM A;  1QW1 A;  2DIG A;  3M5A A;  1QVP A;  4PLL A;  5CKH A;  2ZPE B;  2JN0 A;  4GLK A;  5I2S A;  1VQK T;  4UC4 A;  1VQM A;  4WF2 A;  1N9R A;  4BD3 A;  4ZTJ A;  4QQG A;  1WNL A;  2PVG B;  4X9D A;  3VV0 A;  1YJ9 T;  4E47 A;  3KBG A;  3LYI A;  3OBY A;  5DY9 A;  5LJ5 e;  1BKB A;  4IUU A;  4J6W A;  1V29 B;  3EAE A;  4M77 D;  3V7R A;  1VQ8 A;  3CD6 A;  2EAY A;  3CC4 T;  3CC7 A;  3CCU T;  4XTZ A;  2EQJ A;  1YJN A;  2RM4 A;  3JCM g;  4L5G A;  5LJ3 h;  2M1H A;  1LJO A;  2ZCF B;  4BE2 A;  4EMK A;  3JAM E;  3QBY A;  4QVC A;  5LL6 S;  2QTX A;  5GAN j;  3V7C A;  1S72 A;  4B9X A;  1NZ9 A;  5LJ3 d;  2IG0 A;  2X4X A;  3CME A;  1YHQ A;  4Q5W A;  3TEE A;  3CCV A;  4BE1 A;  1Q82 C;  5A0G A;  3FEO A;  4P5N A;  3MO8 A;  4C0D B;  1VUB A;  2DPP B;  4BE0 A;  3G71 A;  2MWP A;  3CC2 A;  3SWN B;  1H64 1;  1Y71 A;  4M7D G;  4M78 B;  2MI6 A;  4MZM A;  3V8L A;  4M7D C;  4V2S A;  2EQM A;  2ZPB B;  4BUG A;  5GAO n;  2RJE A;  3HSB A;  1YCY A;  4KUL A;  1UGS B;  2B8A A;  2H3J A;  4M78 E;  4XU0 A;  4PJO F;  3M4G A;  3OSV A;  3ER0 A;  3JCM f;  1X75 C;  4XQ3 A;  3OYH A;  5FU7 B;  3ZBD A;  2O4X B;  4O6J A;  3JCM P;  3OBW A;  3FRN A;  3OSS C;  3MEW A;  3A8M B;  4N0A A;  3RIR A;  4RG8 A;  3JCM b;  1UEB A;  3GNF B;  4LDW A;  3OQ5 A;  3SD4 A;  4IUT A;  3OYN A;  2OTL T;  3RMQ A;  4M75 B;  3JCM W;  1RI0 A;  3QZ9 B;  1YJW T;  2LVM A;  2CZ0 B;  2M0O A;  5GMK h;  1KD1 C;  2R5A A;  1NJI U;  4N0A C;  5KCO A;  1VQK A;  4YTL A;  4A4E A;  5LJ3 e;  5HK3 A;  1Q86 U;  2ZPI B;  1VQ7 T;  4HCZ A;  4J6Y A;  1OZ3 A;  4M78 D;  1YJ9 A;  4M75 E;  3OYI A;  1N8R U;  1N9S A;  1M1K U;  3QXE B;  2HD0 A;  2OAU A;  3OYM A;  4ELZ C;  4NOY A;  1VIF A;  3CC4 A;  4EMG A;  4ZGJ B;  2DO3 A;  4TVR A;  5LJ5 g;  3CCU A;  1JB0 E;  4OGC A;  2E64 A;  3SB2 A;  4J8O A;  3CCM A;  4N4H A;  3PFS A;  2D6F A;  4HT8 A;  4KBM B;  3C12 A;  1JJ2 S;  4M7D E;  4ZTF A;  3X26 B;  2XG8 D;  1M5Q 1;  2DTI A;  1VIE A;  2K5F A;  2G3R A;  2K4Y A;  5CK9 A;  5GAN 6;  4C0G A;  3CCR T;  5CO7 A;  2XDB A;  4M77 A;  2LT1 A;  3HL8 A;  3MP8 A;  3P8H A;  4IUR A;  1LOJ A;  4M75 D;  5HY6 A;  4E7I A;  1D3B A;  1JJ2 A;  2JNG A;  3G7Z A;  3OMG A;  1Y07 A;  4HCB A;  5FRN A;  1M9S A;  3WVD B;  5FU6 C;  3E9F A;  2V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...