2QTXA

Crystal structure of an hfq-like protein from methanococcus jannaschii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Hfq-like protein in archaea: Crystal structure and functional characterization of the Sm protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
total genus 13
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qtxA00
4M75C 2YHTA 4M77D 5GAN8 5GAN2 4C92C 1MGQA 2I2LA 3JB9I 3JCMJ 4WF2A 5GANj 4M77A 2DTIA 4J6WA 4EMKB 3INZA 5GANe 5LJ3h 3JCMX 3JB9D 4A53A 5GANd 4C8QE 3RIRA 3JB9F 5GAMd 4M7AA 2E41A 3RESA 3SWNC 4XU3A 2DXUA 4DQ2A 4EMKC 2Y90A 2HNIA 4M7AD 4PJOA 3JCMh 5GAN7 4MMLA 4JLIA 3SWNB 3JCMd 1X01A 4XQ3A 4X9CA 3JB9G 3RERA 4M7DE 3AHUA 1N9SA 4C92G 4PJOD 3VU3C 4M7DD 4PJOF 4PJOB 4XTXA 4M77E 4XU0A 3FIFA 4M78E 5GMKi 1WPYA 2VXEA 1Y96A 4C8QG 4HT9A 1JRIA 3M4GA 4X9DA 4NL2A 4XTYA 3JCMb 4XU2A 1KQ2A 4M7DA 2YLBA 5GAN6 1U1SA 4C8QB 4C8QF 4EMKA 5GAN5 4M7DG 2EWNA 2DXTA 1Y96B 3V7SA 2K57A 3FJPA 3JCMP 4JRKA 1I81A 4M78C 4RCCA 4N0AA 3RKXA 4M75E 3JCMW 4M7AB 5GANf 4M7AF 2ZGWA 2CGHA 2RM4A 4A54A 1BIBA 1BIAA 3HFOA 1I8FA 4JUVA 4PNOA 5LJ5f 3JCMc 2VXFA 4C92A 4NL3A 1LNXA 4F7UE 1M8VA 4M75D 4NOYA 5LJ5d 3JCMQ 4C92F 4Y91A 4C92B 5GAOm 4M7AE 4C92D 4C8QA 2VC8A 5LJ3d 3FB9A 1M5Q1 5GAOr 2EJFA 4M75A 5GANg 2RA2A 5LJ5j 4M7AG 4C8QD 4XU1A 1JBMA 2DZ9A 5LJ3j 5GAMj 1LOJA 4M78B 4M78F 5LJ5e 4PJOG 5CAIA 2DKGA 4J6XA 1KQ1A 1D3BA 2DTHA 5I21A 3V7RA 3EFSA 4PJOC 3JCMf 4F7UG 2JN0A 3HSBA 1LJOA 3BDUA 4RCBA 4EMHA 3JCMV 5LJ5g 2E64A 4XTVA 2EJGA 4HT8A 3QSUA 3RUXA 3JB9H 2DEQA 4M75B 4M75F 5GAOq 1WNLA 5GAMg 3GIBA 4QVCA 4XTWA 4M75G 4M7AC 4EMGA 3V8JA 5GAN3 5GAOn 3QO3A 4M7DC 3V8KA 4F7UB 4F7UF 3L2ZA 4M78D 5GAOp 4C92E 3JB9J 2FYKA 4PJOE 4M77F 4M77B 1TH7A 4F7UA 4MMKA 2DTOA 3BFMA 3RKYA 3L1AA 1I4K1 4M78A 1I5LA 2EJ9A 4M77C 5DY9A 3SB2A 5GAMf 3JCMe 4M78G 5GANh 1B34A 1D3BB 1WQ7A 1HK9A 3QUIA 4M77G 2EAYA 3V7CA 4JRIA 4OP0A 3EFRA 5LJ5h 5GMKl 3SWNA 4XTUA 5LJ3g 5GAMe 5GAN4 4HA8A 2E10A 2RD1A 2YLCA 1U1TA 3QHSA 4V2SA 3RKWA 1WQWA 1YCYA 2DVEA 5GAOl 1N9RA 5GMKh 4QVDA 1HXDA 4C8QC 5LJ3e 5GMKj 2FB7A 4XTZA 3V8LA 3HFNA 2E1HA 2E65A 3BW1A 2QTXA 2DJZA 3BY7A 4J5YA 1H641 3PGGA 4J6YA 4N0AC 5GMKm 3JCMg 5GMKe 5GAMh 4M7DF 4M7DB 2RB6A 5LJ3f 1B34B 2DZCA
chains in the Genus database with same CATH superfamily
5HK3A 3L2WA 5GANe 2X4YA 3I5RA 3OYAA 3CCQQ 3S6WA 3CD6T 3TSWA 1K9MC 4JLIA 4XQ3A 4RG2A 1QW1A 2NYSA 2XDPA 2YT6A 3J81E 1SRLA 3M0UA 5IHNA 1G3WA 5GAN6 4EMKA 2DYIA 1QCNA 2LT4A 3JCMP 4RUGA 1VQOA 1OU9A 1RL2A 5EC7A 1ZSZB 4M7AF 2HCKA 2RM4A 1BIAA 2GQVA 3H0IA 4QW2A 1QP3A 4LDYA 5J26A 3JCMQ 4C92D 5HY6A 3E1SA 1O9SA 2XU8A 1AEYA 4C8QD 4OMLA 3CD6Q 1AWWA 2XD0A 4J83A 5DM7R 4BDZA 5L23A 2H8HA 2BUDA 1VQNT 2XHCA 1Q7YC 1FMWA 1VQPA 1UHFA 1KHCA 4M75B 1QMCA 2LT1A 4FU6A 3CCST 3RDVA 1PRLC 7AT1B 1MNEA 2LTOA 2CP6A 3VS7A 1WHGA 3MEUA 1XJWB 1ZUKA 1C0MA 3WXMB 4VUBA 2J6KA 2EYYA 4RMOA 1TUCA 3OSVA 4A4GA 2DIQA 3EHRA 5GAN4 3DLLA 2M51A 1WQWA 3M54A 4QQ6A 2HEQA 4QVDA 4OVAA 1OU8A 1T0JA 2KNBB 2VGMA 4ZGJB 5GMKm 4B6MA 2D8JA 3M0SA 1T0HA 3LLRA 4M77D 4KGXB 1QKWA 2AK5A 3RMQA 1QVGS 1Y7XA 2M9UA 3RIRA 5GAMd 4IUVA 3NTHA 1Q86R 2DNUA 2HNIA 3WVEB 5GAN7 3H41A 3KBGA 4GLMA 2Y4YA 1VQ6A 1PD1A 3A8GB 1K8AC 2XKOC 1D09B 5KYUB 3M4GA 3QIIA 2YLBA 2YUNA 2CH4A 2JVVA 3DB4A 1ZA2B 2FPFA 2D9TA 2KR3A 3OB9A 4O5VA 3CCLT 2HSPA 2JTMA 1JJ2S 2VC8A 1GFCA 1UJYA 4M75A 3DLMA 4RTVA 2E12A 4C0ZA 4L59A 4OMOA 1Q7YR 1VQMA 1KC8C 1X6BA 1UGSB 4TVRA 2OTJQ 4BE2A 3CCRT 1ACMB 2XDDA 3CCUT 3HSBA 1LJOA 3JCMV 4FYVB 4FSSA 3NHNA 3ZEHA 1X2QA 2KSSA 4L6V5 1EX4A 3CPWA 3UATA 1N5ZA 2RHIA 2YRDA 5LL6S 2MIOA 5D6YA 3VUZA 2O4XA 5CCAA 1WHJA 3VRZA 1M3BA 5GMKl 2ENMA 3OYYA 5HCKA 2AZSA 1UJ0A 3OY9A 2JW4A 1X43A 1SG5A 1BI3A 1QKXA 2DL5A 3PVLA 3UF4A 3BY7A 3QZ9B 3H9NA 3META 5IT9E 3JV3A 3REAB 3FDRA 1SEMA 2X4XA 1U5SA 1S72Q 4M7AA 2J7IA 4DBHA 4E2FB 4J8OA 3SWNB 4PLIA 1T3LA 5DLQE 1NG2A 2B8AA 1Q7YU 4PJLA 1C1AA 1WHMA 4XTYA 3QJYA 1QVPA 4AFSC 2J05A 1U1SA 5CKBA 3TQ7P 4N4HA 5FU6B 4QQGA 1JEGA 3OYHA 1U3OA 3G6ET 3EH1A 3FEOA 2NUTB 1N8RU 3QJ6A 5J3BA 3CCUQ 3OYLA 4F7UE 3LW5E 5GAOm 2FVUA 3GPLA 1AVZC 1NLOC 3CC2Q 2D0NA 4DBFA 2RA2A 1WHKA 2COWA 4AMCA 1BI2A 2V8KA 2P84A 4J7FA 1KQ1A 2RH2A 3H6ZA 2VYTA 2DF6A 5D6WA 3CCUA 2KY9A 3OYIA 3G4SA 1PKSA 4WTOB 1WIEA 2COZA 3QBYA 1VQ9T 3QO3A 5GAOp 3JB9J 4AFQC 1OULA 3KUFA 3L1AA 1NYFA 1K8AU 3CCQA 2MF2A 4LE9A 3GOXA 3C4SA 3VS5A 3CBMA 2JT4A 5A0GA 3G71Q 3CCVA 1VQOT 1AWXA 1RLPC 4E7JA 4DEXA 2K4YA 2OAWA 3M58A 3L42A 3NFCA 4R0KA 1YJ9T 3L2QA 4AT1B 4JS4A 3ME9A 2BZYA 4M7DE 2LX9A 1KC8U 1AWOA 2CYZB 3J80E 3H8ZA 1K0XA 1I5OB 5A0LA 1E6HA 2VXEA 4AG1C 2DIGA 1KD1C 1K76A 2LQWA 1M90R 4OGEA 4Z88A 2O01E 4E7IA 4R56A 5IHKA 2BIVA 3TEEA 1VOMA 1VQOQ 1Q95G 1TWBA 2MWPA 2P4TA 1JXOA 2RJDA 3OSSC 1LVKA 3U23A 4M7AB 4X34A 3OMGA 1VQKA 4KH1B 1X6GA 2XICA 1K9AA 3JCMc 1YNZA 2YUPA 3VJPA 1ZHIA 1VQNQ 2KMTA 1M1FA 4OB2B 2ZPBB 3SFMA 4RTTA 3CC7T 1VQ9Q 3C94A 2HD0A 3J7AF 3M4YA 1YJWT 1OQKA 4OGCA 1YN8A 3EFSA 4AFZC 3QZ5B 2L3SA 5IXFA 1UUEA 2LVMA 2RQWA 1YIJA 3JB9H 2E5QA 4QQDA 2RPNA 3X25B 4M7AC 4LUDA 1TOVA 1VQ9A 1BB9A 1WGSA 1MV3A 1VYUA 5KYYA 3FJ5A 1R0BG 4M77G 3V7CA 1PRMC 4QKUA 3SWNA 1G83A 3VS0A 3OBYA 4CC4B 3CPFA 3LH5A 4JS5A 2FPDA 2R5MA 2FRYA 2ZCFB 1H92A 2DFUA 1QVFS 5CK9A 3HRTA 3OQ5A 1MMNA 2ROLA 4C92C 1MGQA 1YWPA 4DOVA 1YBYA 4MZTA 2RO0A 2YRCA 2LMJA 2DILA 2NWMA 5LJ3h 1UDLA 3UA7A 1QWEA 4Z8AA 4M7AD 5GJVB 1AZEA 1X01A 2FZGB 2M16A 5KYWB 2LX7A 2FO0A 3QYGB 5IH2A 1GBQA 3A8LB 3MEAA 1VQPT 2WSFE 1R0CB 1YITQ 3KFVA 2BE7D 2KT1A 1PHTA 4C8QF 4BE1A 5IHIA 1SKUB 3EH2A 2KBTA 2RHZA 3GP8A 1M90C 1W2BP 2DEUA 3OYKA 1KIKA 3ZL7C 1KSWA 1SSFA 2A3LA 4C92A 2D6FA 1D0YA 3X28B 3MKDA 4Y91A 4C8QA 5LJ3d 3FB9A 1VQ5T 3CCEQ 5I2MA 2F2XA 1PWTA 3Q1JA 2GF7A 1ZLMA 5FRNA 5GAMj 1KFZA 5CAIA 1VQMQ 2K3XA 4RTXA 1KJWA 3P8DA 3EG3A 1KD1R 2ZZDA 2EGAA 5CIUA 2ABLA 1Y07A 1F1BB 3CCJT 1IB8A 2QA4T 4A63B 1LPLA 1TUDA 5FRMA 4M75G 5IN1A 1S1NA 1BYMA 4IUQA 5GAN3 3UDCA 3OA6A 3G4SQ 2FYKA 1UFFA 2PVDB 4M77F 5DLOA 4F7UA 1VQ6T 1RAAB 3M59A 1K8AR 1H3ZA 4OB0B 1TS9A 5CKEA 2OTLQ 4E7SA 5GAMe 3OS1A 2E10A 1OOTA 1NPPA 1PSEA 4MDWA 2H3EB 4LNPA 2IG0A 1ZBJA 5EG2A 4C8QC 1QVFP 2C06A 2QTXA 1RLQC 4FSXA 2CS7A 1IGUA 4FIBA 2RQTA 4RCBA 2DO3A 5D7UA 2M0YA 5GJWB 2DXBA 1WFWA 2EVRA 1S72A 1BKBA 1NYGA 2ESWA 4C8QE 3O8VA 4DEYA 2JTEA 2DXUA 4PJJA 1OV3A 4IIOA 1YP5A 2KYMA 1WJSA 8ATCB 3JB9G 3E9GA 1PSFA 4RTYA 1OPKA 2JS2A 4C92G 3HRSA 3VU3C 2MYSA 4GY5A 3G7ZA 4XU0A 1NJIR 2LQNA 3GF5A 4E47A 2KRMA 1KQ2A 1UECA 1V1CA 1ZA1B 4C8QB 4A4HA 2K2VA 3KXTA 3D7SB 1GXIE 2ED0A 3CXCS 3JCMW 1VQ8T 3CMEA 2K7AA 4F04B 1M1KR 2QQRA 1V76A 4PNOA 4AFUC 3CCQT 4HCZA 2F5KA 3P8BB 2PVGB 3PNWC 4M75D 2A37A 5LJ5j 1K9MU 5I22A 4J9DA 1GCQC 2GFAA 2QEXT 2LDMA 2LP5A 5AT1B 2X3XD 4F14A 3QSUA 2EJGA 1E7OA 1D1AA 4IUTA 1YJ9A 2HKQB 2CUBA 2MOXA 2GGRA 3NMZC 3QDFA 4OMMA 3EGXA 2DVJA 5GAOn 1I0CA 2L3PA 4JJCA 4MMKA 2HQXA 4M78A 5KYUA 3SB2A 4AG2C 2V8IA 5HKCA 1EZZB 2HL3A 4Y28E 2MPXC 2A36A 2DMOA 1RUWA 2RD1A 1RI0A 2PUOB 2RQVA 3G71A 1ABOA 1HXDA 3MP6A 4BE0A 5GMKj 2E1HA 4J5YA 4BI8B 4FW1A 1YWOA 1O75A 2QYZA 1VUBA 2L0AA 4FL6A 2YUOA 1QCFA 1KQSP 2ROTA 2A7YA 1YJNT 3JB9D 2DL7A 3O5ZA 3ER0A 2E41A 1VQ8Q 3MP8A 1MMDA 1JJ2P 2RHYA 3SDZA 2L89A 5GMKi 2RK2A 1Y96A 5A0DA 2KDSA 3TCJA 5GAN5 1QCOA 4BACA 1AOJA 1VQLQ 2GCXA 4ZGEB 1H3HA 1IGQA 4LN2A 3M5AA 4N0AA 3RKXA 1TUGB 4IIMA 4RKUE 1UE9A 4OMQA 4QT7A 3EGDA 1VQ8A 2HZYA 4ZN1A 4IUUA 5LJ5d 1WDXA 1N8RR 1Q86U 1YI2T 3CQTA 4M78F 2EQMA 2CZ1B 3CC4T 1NBEB 3CC7Q 2X3WD 2FL7A 2PUKB 2OTLT 2LCCA 4JJDA 5GAMg 4K11A 2CKKA 3CCJQ 3PE0A 3EFOA 2V8JA 5A2QE 2QQBA 1BU1A 3DB3A 2L2PA 1SPKA 2K3YA 1D1CA 1B34A 1D3BB 1CKBA 3CC2T 2JOYA 4LDWA 2AKKA 2MMPA 1P92A 3EG2A 1YJWQ 4LD9K 3G71T 1WJRA 3V8LA 4DBQA 1PG5B 1YJNQ 3QWXX 5HK0A 3H0FA 1LCKA 2K5LA 4A4FA 2KXDA 2DZCA 1W4SA 3X26B 1YHQA 4HVWA 2MCNA 1WLPB 2HBWA 4PJNA 2VUBA 1EFNA 2XI9A 4JZ4A 2QI2A 2CDTA 4Q5WA 3JCMh 4JPBW 1YJWA 3LX7A 4DOWA 5CKDA 4PJOB 4ZNXA 3LGFA 3PIOA 3CCJA 1GCPA 2JJ9A 4CRIA 4PJMA 4B9WA 1FXXA 1JB0E 2KRNA 1X27A 4RCCA 1GCQA 1WZOA 2FHDA 4JUVA 3ZBDA 4NOYA 2LJ3A 3E9FA 3LWHA 1UGVA 1ZQ1A 3GLXA 4M7AG 1MV0B 4J9HA 2QEXQ 2X51A 1VQ7A 2RJEA 1PKTA 1NPRA 2NUPA 2DM1A 4PJOC 2QQAA 3BDUA 4EMHA 1UGPB 2IVWA 2DRMA 2DXCA 5CKFA 3QXEB 4L5GA 1M2VA 4EMGA 1H8KA 1Z9ZA 4JZ3A 1W2BA 2DE0X 4PJOE 1TH7A 2C0OA 2YDLA 1VQNA 3UPUA 2X9HA 3FC3A 1M27C 3CPWP 2EAYA 4JRIA 1GL5A 1CKAA 2LZ6B 3I56T 4C0DB 3CCSA 2W10A 1HYOA 1VQLT 4ESRA 3CMET 4KT0E 3JCMg 5I2SA 2RB6A 1VIFA 4HT9A 3HPWA 3THKA 1BK2A 3IQLA 2P4RA 1G5VA 3L2RA 2DYBA 2F2VA 3SWNC 2CT3A 5FLXE 3FLGA 3G1JA 1KG1A 2CSQA 4BY6B 4IKFA 1Y0MA 2F5TX 4HCCA 2E6ZA 1JJ2A 1K9MR 1WPYA 3QWYA 1UG1A 2EQJA 5FU6C 2EQKA 3CCRQ 1WA7A 4E6RA 3PTAA 1M2VB 3RR6A 2D0QB 2X4JA 3CEYA 5KYWA 4GLKA 1M1KU 2ATCB 1I8FA 2HSEB 2DD5A 2IPOB 3M55A 1G3YA 4M7AE 1M5Q1 3VYHB 2LQ8A 4XU1A 1ZSZA 2D8HA 1UEBA 3CC4Q 2JS0A 1W6XA 1NJIU 1VYTA 1QVGA 4X1VA 3OYFA 2OTJA 4E7ZA 1NJIC 2VVKA 5I21A 4BI3A 1I07A 4FT2A 3UWNA 4ORZA 4Z89A 5C0MA 2KT8A 3BDLA 2DEQA 1Q81C 5L8RE 3M57A 3V8JA 1RAHB 1K73R 4EPCA 3VV0A 3L2ZA 1BCMA 2RNAA 4C92E 3HTRA 1EIFA 3RKYA 1YITA 2CP2A 2RQRA 4J9CA 1WX6A 4OB1B 3MJXA 1JO8A 4HVVA 4OP0A 3CCEA 2NUTA 2YUQA 4JJNK 2QDLA 1U1TA 2O88A 3CD6A 3RBBB 5CQYA 2JNGA 4XTZA 2FG0A 2JTFA 1H641 4HVUA 1VQLA 4M75C 2YHTA 4KUIA 3BE3A 1NZ9A 5GANj 1BI0A 1OEBA 1XOVA 2OI3A 4UC4A 2DTIA 2JMCA 3MO8A 4FW2A 3JB9F 1YI2A 4PFPA 1ZX6A 4DQ2A 4EMKC 1AHJB 2FPEA 1PC0A 1N9SA 2EPDA 2XMFA 3M53A 4XTXA 5FROA 4C8QG 2XDBA 2LNHB 1G3TA 3RMSA 2J6FA 4XK8E 2K57A 3EGXB 1KQSS 4C5EA 2HBPA 1I1JA 1YI2Q 2RHUA 2ED1A 1JU5C 4M7DC 5LJ5f 5KYXB 1M3AA 2ECZA 1AT1B 3CC2A 1ABQA 1PD0A 1JBMA 2CP0A 1DJ7B 3VS4A 4M78B 3V7RA 4QVZA 3NGPA 1YHQT 4FYYB 2JN0A 1Y71A 4LUEA 2E64A 2NLUA 1YJNA 4M75F 3TSZA 4FYXB 2E3HA 4XTWA 2WACA 5KYYB 3CMEQ 1R77A 5FWCA 2EYQA 1VQ5Q 3P8HA 4J9BA 2LCLA 4LXCA 1G8XA 5J39A 4ELZC 1ZSGA 2BE9B 4XTUA 4ATOA 2DBMA 3CCET 2LQKA 1SRMA 2VV5A 4KRTA 4PFOA 2ZPFB 3I56Q 4ZGDB 1YCSB 1OPLA 3LYIA 1TTHB 2FRWA 3CCMT 2R5AA 2LJ1A 4JRQA 4HCKA 1WXBA 3PVQA 1UHCA 3C12A 3JSCA 3I35A 1BCOA 1RAIB 4C5IA 1RI9A 1VQ7T 1M4ZA 3JCMd 3AHUA 2MK5A 5FU7C 4Y92A 2DBKA 2LNVA 1RADB 2KRSA 1VQKQ 3JCMb 4M7DA 1MMAA 3L2VA 4N4IA 1IZ6A 4LDXA 3OYCA 2EWNA 3SHWA 4LD6A 4RTWA 1OI1A 1I81A 5CR2A 4M75E 4BD3A 1VQ6Q 2PQWA 1K4US 1G2BA 3I55Q 1D0ZA 3CCRA 5GANf 2ZGWA 1N8RC 3MCAB 1ZUUA 4C92B 2HAXA 1KQSA 3EGDB 1IO6A 2QA4Q 4MZMA 4GBQA 4F17A 1E6GA 3I56A 2VGNA 1NE8A 2IIMA 2HDAA 2DZ9A 4FCYA 1QVGP 4ELYC 1UGQB 1MHNA 2Z0WA 3E2UA 4KULA 2DKGA 2A0FB 2K3BA 1D3BA 2OAUA 1B3QA 1WXUA 3WVDB 4F7UG 1W2BS 1FMKA 1AWJA 3RUXA 2M02A 1M3CA 3C95A 2CZ7B 2KI7A 2YRVA 3SD4A 2DK3A 2EKHA 1GRIA 2VKNA 2DL8A 3EGUA 3GNFB 1QVFA 1J3TA 1WJQA 1MMGA 3X20B 3MHXA 5LJ5h 1YIJT 3H0HA 4D6WA 2YLCA 2DA9A 2RJFA 3TU4K 4V2SA 1HJDA 4OMFB 2DVEA 1U8RA 4KGZB 3JAME 5LJ3e 1IREB 3HFNA 4PLLA 2E65A 1IRXA 1SHFA 3A8OB 5FWBA 2RK1A 4M7DB 3MPUB 1B34B 4YTLA 1IHWA 4WF2A 2V1QA 3F70A 2LCSA 4JLGA 1QP2A 2DPPB 1N6AA 2A28A 5IXBA 3OYNA 3HKSA 4XU3A 1ZSZC 2MI6A 3OS2A 1B07A 2CP3A 2AT1B 4PJOD 1ZBXA 1JQQA 4M77E 1KK7A 4M78E 3OW2S 2W0ZA 3EG1A 3MP1A 2Y4XA 2DXTA 1WHLA 2RI2A 2HQEA 4OMPA 3FJPA 3CCVQ 3L2UA 2ZPEB 2CP7A 2WSCE 5KYNA 4A54A 2J06A 1YHQQ 1M9SA 3E19A 2LRQA 1N27A 3C0CA 3G4ST 2CUDA 2KROA 1NEBA 5GANg 4BDYA 3QG1A 4Z02A 1OYXA 4LDUA 3M56A 4KBMB 1D0XA 2H3JA 2KK4A 2YSQA 1GFDA 2NUPB 1VQ5A 4JRPA 1KC8R 3CCVT 1QQJA 2DD4A 3V8KA 1U06A 4OF1A 2KXCA 1PM3A 4BUGA 3OW2P 4M77B 5M9OA 1M1KC 3CMAQ 1R8OB 1IXDA 5DY9A 3JCMe 5GANh 3ZFJA 2QG9B 2PZ1A 2JMAA 4JJBA 4KUDK 4C0FA 3RKWA 3VRYA 2QDYB 2JZ2A 2JUFA 2AIRB 3VS1A 3S3MA 3A5ZB 2DRKA 3ASKA 2EKOA 5GAN2 3JCMJ 1Q82R 5CO7A 1TSFA 3R6NA 1D1BA 2E5KA 1FX7A 2M0OA 2HMAA 1XQHA 4J6WA 3JCMX 2GBQA 2RMOA 3OYDA 1T3SA 2FZCB 5GANd 1VQ7Q 1FWZA 3RESA 2PVOB 2DL3A 1RACB 4DA4A 2F1LA 2QQ9A 2QQSA 3QYHB 2NUZA 3UA6A 4BY6C 1GBRA 3GNGA 2KEAA 3OYEA 4X9DA 4XU2A 2EYWA 3CXCA 3PIPA 4M7DG 3EG0A 1S72T 1VIEA 3CCSQ 2I0NA 2K5IA 4M78C 2RI3A 4C0GA 3OYJA 3QKJA 1RAEB 2EW3A 3A8MB 1YITT 5ECAA 2JXBA 4EIKA 2QASA 3QPHA 3M0QA 2J6OA 2PU9B 2KE9A 2R57A 2RI5A 2RN8A 4PK4A 4C5HA 4EDUA 2R58A 3HP9A 1PCXA 2CP5A 5KYXA 2LJ0A 2KQWA 3CCMA 2DERA 4HT8A 2P0QA 1ARKA 4NS5A 3OYGA 4ZTJA 2QGFB 4O6JA 2L8DA 5IAYA 2EYZA 2C0IA 4N4GA 3ULRB 1VA7A 3EFOB 4M78D 2HL5C 3NTIA 2EGCA 1M30A 1RABB 3BFMA 3X24B 2EFIA 3PT9A 1I4K1 1I5LA 1Q82U 5GAMf 3QUIA 4F16A 3MEVA 3VS2A 1WI7A 3I5SA 2K2MA 3CCLQ 5I11A 4E7HA 2D1XA 4BB7A 5GAOl 1QWFA 2CZ0B 2DJZA 3PGGA 4DBRA 5GMKe 2JM8A 4J9GA 1KD1U 1NM7A 3CPWS 3I55A 4M77A 2E4HA 3R6OA 4EMKB 2RQUA 4A53A 5CVIA 2PTKA 3OBWA 1SF9A 4MMLA 3M9QA 3REBB 4CC7A 2EYXA 1SHGA 3OMCA 1JRIA 3S3NA 3EG9A 5CQXA 2QXFA 2COYA 1YJ9Q 1HSQA 1A0NB 2OJ2A 3LH0A 3SEMA 3URGA 3OYBA 4E7KA 2WSEE 2CGHA 2CREA 2G3RA 3PMIA 2VXFA 4NL3A 2KVQG 4D8DA 1VQ4T 4HCBA 4C92F 2QA4A 4XAXB 2EJFA 3JRZA 3OYMA 2JM9A 1X6OA 2DJQA 1OX8A 1IHVA 1LOJA 1K0SA 2K6DA 2M1HA 4J6XA 2AZVA 2E3IA 1Q81R 1K1ZA 4OMNA 2CZ6B 3NTKA 4MDXA 1VQPQ 4XTVA 4HXJA 2XIDA 5GAOq 1WNLA 3RNJA 3GIBA 4QVCA 1MNDA 2DETA 3S3OA 2OX7A 4BI4A 4F7UF 2RJCA 1NLPC 5KE3A 1X75C 1WXTA 5CKHA 5FW9A 2RF0A 1K73U 4ZTFA 2K79A 1K73C 2BZ8A 4M77C 2EBPA 2GTJA 1HK9A 3GBQA 1FMVA 2FZKB 3LGLA 3N5BB 2OTLA 3T9NA 2RHXA 1TXQA 4ME7A 1OZ2A 2O31A 1UGRB 2CT4A 1YFNA 1N9RA 4FYWB 1W1FA 3EHQA 1M2OA 4N0AC 1VQMT 1HD3A 3EG9B 5D6XA 3CBOA 1M8VA 5GAN8 4HKEA 2O9VA 3JB9I 4J7IA 1CSKA 3INZA 1NEGA 1RAGB 2EQIA 2O4XB 1VQ4Q 4J9EA 3LWIA 4M4ZA 2F69A 2X35A 4ZN3A 3UT1A 2K5FA 3VS3A 2KGTA 4MZPA 2C0TA 4M7DD 4PJOF 4LDVA 1XNIA 3FIFA 5KE2A 4KGVB 2GFUA 8AT1B 1B7TA 1Y96B 1Y57A 1KHIA 4JRKA 1FYNA 2BKDN 4D8KA 4CC2A 2BTTA 1M90U 2CH4W 2QEXA 4FT4A 1LNXA 1WYXA 3NPFA 2F2WA 2KAFA 1VQ4A 5GAOr 4J9IA 5KCHA 2XK0A 2EQUA 4PJOG 3OS5A 3A98A 2A08A 2O9SA 1OZ3A 1XTDA 3HL8A 3JCMf 1AD5A 3VUBA 3CBPA 3HHTB 3TREA 2FEIA 1Q86C 2HKNA 4JDSA 2YXYA 4F7UB 3G6EA 2VB6A 2EIFA 3CCLA 2DAQA 4FM4B 2SEMA 4CC3A 3CMAA 3I9QA 2XG8D 1W70A 3PFSA 3CXCP 1WQ7A 1AZGB 3TVTA 1WHHA 1Z9QA 5LJ3g 2L5QA 4HA8A 3OS0A 3QHSA 2QAZA 1YCYA 3A1PA 1Q81U 5GMKh 2FB7A 3BW1A 4P5NA 1MUZA 1X2KA 4OB3B 2ZAEA 4CI0C 9ATCB 2MWOA 3MEWA 1VYVA 3G6EQ 6AT1B 2I2LA 2QGGA 2QK0A 1BBZA 2P0KA 2V1RA 1M1GA 2GNCA 1M8MA 4PKCC 2LC4A 4ANJA 4RG8A 2Y90A 2DLPA 4PJOA 2E70A 2GTOA 2PNIA 4KH0B 4B9XA 3RERA 4X9CA 2ZPIB 5KCOA 1BI1A 4R55A 3PMTA 2VASA 4NL2A 4RTUA 3M0RA 1YIJQ 3AT1B 4C5GA 2X4WA 3V7SA 5KH6A 3CCMQ 2L3RA 1OX9A 4RTZA 1V29B 2DX1A 2B86A 2MAMA 3CC4A 1BIBA 2SRCA 1PNJA 3FRNA 3HFOA 1Q82C 5FU7B 1SSHA 3VYGA 1JXMA 3A8HB 2KYBA 4II1A 1QLYA 2GQIA 3DKMA 2VWFA 3M0TA 5LJ3j 3QDRB 1G3SA 4PFZA 5C6SA 5LJ5e 2CSIA 5AYFA 1UB4A 4C0DC 2DTHA 1X69A 2QTVA 2YWWA 4PL6A 5LJ5g 1TG0A 3I55T 1UTIA 2K9GA 2DL4A 4IUPA 4A4KA 4E7LA 2L3QA 3OW2A 4A4EA 2AKLA 2E6NA 2BZXA 1C6VX 4IURA 2OTJT 2ZPGB 2DTOA 1VQKT 2P0PA 2EJ9A 2ZPHB 3CMAT 4M78G 3VKIA 1TU0B 3EFRA 3VS6A 2O2OA 2AHJB 3M0PA 1ZUYA 2EGEA 2G6FX 4WCIA 3CC7A 1RAFB 4J9FA 2HQHA 4J6YA 3EAEA 5GAMh 4M7DF 3HRUA 5LJ3f 2V26A
chains in the Genus database with same CATH topology
3HPWA 2EKOA 5HK3A 5GAN2 4C92C 1MGQA 4DOVA 3L2WA 3JCMJ 5CO7A 1G5VA 1YBYA 4MZTA 1FX7A 2M0OA 2RO0A 3L2RA 4J6WA 1XQHA 5GANe 2X4YA 3JCMX 5LJ3h 3OYDA 5GANd 1FWZA 3OYAA 3S6WA 3RESA 3SWNC 3CD6T 2PVOB 5FLXE 3FLGA 1K9MC 4M7AD 4DA4A 1KG1A 4JLIA 1X01A 4XQ3A 2M16A 4RG2A 2QQ9A 4BY6B 4IKFA 1QW1A 2QQSA 3QYGB 2F5TX 2XDPA 2E6ZA 3QYHB 4HCCA 4BY6C 3J81E 1JJ2A 3A8LB 3MEAA 3GNGA 1VQPT 1WPYA 3OYEA 2WSFE 4X9DA 4XU2A 3CXCA 2EQJA 1G3WA 5GAN6 5FU6C 3PIPA 4C8QF 4M7DG 4EMKA 4BE1A 2EQKA 1S72T 3PTAA 1VIEA 2LT4A 3JCMP 2K5IA 1VQOA 2D0QB 2RHZA 1RL2A 4M78C 2RI3A 4C0GA 3OYJA 2X4JA 3CEYA 3QKJA 3OYKA 1M90C 4GLKA 4M7AF 1SSFA 3A8MB 1YITT 2RM4A 1M1KU 2A3LA 1BIAA 2GQVA 1I8FA 4QW2A 3QPHA 4C92A 1QP3A 2DD5A 3M55A 1G3YA 2D6FA 4LDYA 5J26A 3JCMQ 3X28B 4Y91A 4M7AE 4C92D 4C8QA 5HY6A 3E1SA 1O9SA 1M5Q1 3FB9A 2PU9B 5LJ3d 5I2MA 1VQ5T 3VYHB 2LQ8A 2XU8A 3Q1JA 2GF7A 4C8QD 4XU1A 1UEBA 2R57A 2RI5A 4J83A 5DM7R 5FRNA 2XD0A 4BDZA 5GAMj 5CAIA 1NJIU 1QVGA 2K3XA 3OYFA 4C5HA 4EDUA 2OTJA 1NJIC 2BUDA 3P8DA 2R58A 3HP9A 5I21A 1VQNT 4BI3A 2ZZDA 2XHCA 5CIUA 2KQWA 4FT2A 3UWNA 3CCMA 1Q7YC 1VQPA 1Y07A 4HT8A 2P0QA 4NS5A 5C0MA 3BDLA 3CCJT 1KHCA 3OYGA 2DEQA 4ZTJA 4M75B 2QA4T 4O6JA 2L8DA 1Q81C 5IAYA 5FRMA 4M75G 5IN1A 2LT1A 4FU6A 3CCST 5L8RE 1BYMA 2LTOA 3M57A 4IUQA 4N4GA 3UDCA 3V8JA 4EPCA 5GAN3 3VV0A 3L2ZA 4M78D 3OA6A 4C92E 3NTIA 2FYKA 1EIFA 2PVDB 4M77F 3MEUA 4F7UA 5DLOA 3RKYA 3BFMA 3X24B 1YITA 3M59A 2EFIA 3PT9A 1H3ZA 1I4K1 3WXMB 1I5LA 4VUBA 4OB0B 4OB1B 5GAMf 1Q82U 4RMOA 3QUIA 3MEVA 3OSVA 4OP0A 5CKEA 3CCEA 4A4GA 2DIQA 4JJNK 5GAMe 3OS1A 5GAN4 2E10A 1NPPA 1U1TA 1PSEA 3DLLA 4E7HA 3CD6A 4MDWA 1WQWA 4BB7A 3M54A 4QQ6A 5GAOl 5CQYA 2IG0A 2JNGA 4OVAA 5EG2A 4C8QC 4QVDA 4XTZA 2VGMA 2JTFA 4ZGJB 5GMKm 2QTXA 2CZ0B 2DJZA 2C06A 1H641 3PGGA 4FSXA 2CS7A 5GMKe 1VQLA 4FIBA 4RCBA 4M75C 2YHTA 3LLRA 1KD1U 4KUIA 4M77D 1NZ9A 2DO3A 5GANj 1BI0A 1XOVA 3RMQA 3CPWS 1QVGS 2DXBA 4UC4A 3I55A 4M77A 3R6OA 1S72A 1Y7XA 1BKBA 2DTIA 4EMKB 2M9UA 3MO8A 4A53A 3O8VA 3RIRA 5CVIA 4IUVA 4C8QE 3NTHA 5GAMd 1YI2A 3JB9F 4EMKC 4DQ2A 2DXUA 1AHJB 2HNIA 3WVEB 3OBWA 1WJSA 5GAN7 4MMLA 3KBGA 3JB9G 3E9GA 1PSFA 3M9QA 1N9SA 2Y4YA 4C92G 3HRSA 3M53A 3VU3C 4GY5A 1VQ6A 3G7ZA 4XTXA 3A8GB 4XU0A 1K8AC 2XKOC 5FROA 3OMCA 4C8QG 3GF5A 1JRIA 3M4GA 4E47A 5CQXA 3S3NA 1KQ2A 2QXFA 3QIIA 2YLBA 4C8QB 2XDBA 1G3TA 3RMSA 4A4HA 2JVVA 3DB4A 4XK8E 2K2VA 2K57A 1KQSS 3KXTA 4C5EA 2D9TA 1GXIE 2HBPA 3LH0A 3URGA 3OYBA 3OB9A 3CXCS 4E7KA 2RHUA 2WSEE 4O5VA 3CCLT 3CMEA 3JCMW 1VQ8T 2CGHA 2QQRA 2JTMA 2G3RA 4M7DC 4PNOA 1JJ2S 5LJ5f 3PMIA 2VXFA 4NL3A 3CCQT 2KVQG 4HCZA 2F5KA 3P8BB 1VQ4T 2PVGB 3PNWC 4M75D 4HCBA 4C92F 2QA4A 2VC8A 4XAXB 2EJFA 3JRZA 3OYMA 4M75A 3CC2A 1X6OA 3DLMA 2E12A 5LJ5j 4C0ZA 1JBMA 1DJ7B 1VQ6T 4L59A 1LOJA 4M78B 1K9MU 1VQMA 2M1HA 1KC8C 1UGSB 4J6XA 4TVRA 4BE2A 3CCRT 2GFAA 2QEXT 2LDMA 3V7RA 4QVZA 1YHQT 2XDDA 3CCUT 2CZ6B 2JN0A 3NTKA 4MDXA 1Y71A 3HSBA 1LJOA 3QSUA 3JCMV 2E64A 2NLUA 2EJGA 4XTVA 1YJNA 2XIDA 4IUTA 4M75F 1YJ9A 3ZEHA 5GAOq 1WNLA 3GIBA 4QVCA 2KSSA 4L6V5 4XTWA 3CPWA 3S3OA 4BI4A 2WACA 5GAOn 4F7UF 2RJCA 2RHIA 5KE3A 1X75C 2EYQA 5CKHA 3P8HA 5LL6S 4MMKA 1K73U 2HQXA 2LCLA 4M78A 5D6YA 4ZTFA 3VUZA 1K73C 4M77C 3SB2A 2O4XA 5CCAA 5J39A 4ELZC 2V8IA 1HK9A 5HKCA 4Y28E 3LGLA 3N5BB 5GMKl 3T9NA 4XTUA 2RHXA 2OTLA 4ATOA 4ME7A 3CCET 2RD1A 3OYYA 1OZ2A 1RI0A 2LQKA 2PUOB 1UGRB 2VV5A 3OY9A 3G71A 1N9RA 1BI3A 1HXDA 3MP6A 5GMKj 4BE0A 2ZPFB 2E1HA 4N0AC 3BY7A 4J5YA 4ZGDB 4BI8B 1VQMT 1O75A 3QZ9B 5D6XA 3CBOA 1VUBA 1M8VA 3LYIA 3META 5IT9E 4FL6A 5GAN8 4HKEA 3CCMT 2R5AA 3JB9I 3FDRA 4JRQA 2X4XA 4J7IA 2A7YA 1YJNT 3INZA 3JB9D 2O4XB 4M7AA 3C12A 3ER0A 3JSCA 2E41A 4C5IA 3LWIA 2F69A 2X35A 4J8OA 4ZN3A 1VQ7T 1M4ZA 3JCMd 3SWNB 3UT1A 2K5FA 4PLIA 3MP8A 3AHUA 4MZPA 2RHYA 5DLQE 5FU7C 4PJOF 4M7DD 2LNVA 4LDVA 1XNIA 3FIFA 2B8AA 3SDZA 2L89A 5KE2A 5GMKi 2RK2A 1Q7YU 1Y96A 3JCMb 4M7DA 4XTYA 5A0DA 2GFUA 2KDSA 3QJYA 1QVPA 4N4IA 1IZ6A 3L2VA 3OYCA 1U1SA 3TCJA 4LDXA 5GAN5 2EWNA 4BACA 5CKBA 1Y96B 4N4HA 5FU6B 4QQGA 4LD6A 2GCXA 4ZGEB 1KHIA 1OI1A 4JRKA 1I81A 3OYHA 5CR2A 2BKDN 3M5AA 4N0AA 3RKXA 4M75E 3G6ET 4BD3A 3FEOA 2PQWA 4RKUE 1M90U 3CCRA 1N8RU 5GANf 2QEXA 2ZGWA 3QJ6A 4FT4A 5J3BA 1N8RC 1VQ8A 3MCAB 4ZN1A 3OYLA 1LNXA 4F7UE 2KAFA 3LW5E 4IUUA 5LJ5d 5GAOm 4C92B 2HAXA 2FVUA 3GPLA 1KQSA 1VQ4A 4MZMA 5GAOr 5KCHA 2XK0A 1Q86U 2RA2A 3I56A 2VGNA 1NE8A 1YI2T 2EQUA 2DZ9A 4ELYC 1UGQB 1MHNA 4M78F 1BI2A 2EQMA 3OS5A 2DKGA 2V8KA 4KULA 4PJOG 4J7FA 1KQ1A 1D3BA 2CZ1B 3CC4T 2OAUA 2RH2A 1OZ3A 1XTDA 3HL8A 3WVDB 3H6ZA 3JCMf 4F7UG 1W2BS 2VYTA 2FL7A 2PUKB 3VUBA 5D6WA 3CCUA 3CBPA 2OTLT 2LCCA 3HHTB 3RUXA 3TREA 2KY9A 3OYIA 3C95A 3G4SA 5GAMg 2CZ7B 2CKKA 2YRVA 3SD4A 1Q86C 3QBYA 2DK3A 2V8JA 1VQ9T 3QO3A 5A2QE 4JDSA 2QQBA 4F7UB 3G6EA 3DB3A 5GAOp 3JB9J 2EIFA 3CCLA 2DAQA 3GNFB 3KUFA 4FM4B 3L1AA 3CMAA 2K3YA 1QVFA 1K8AU 3CCQA 2XG8D 3PFSA 1WJQA 1B34A 1D3BB 1WQ7A 2MF2A 3MHXA 3X20B 3GOXA 5LJ5h 3C4SA 1YIJT 5LJ3g 3CC2T 2JOYA 2L5QA 4HA8A 4D6WA 2YLCA 4LDWA 3CBMA 2MMPA 2RJFA 1P92A 3QHSA 3OS0A 3TU4K 1Q81U 1YCYA 4V2SA 4OMFB 2DVEA 5A0GA 3CCVA 5GMKh 1VQOT 1U8RA 4LD9K 3JAME 5LJ3e 1IREB 2FB7A 1WJRA 3HFNA 3V8LA 3G71T 4E7JA 4PLLA 2E65A 3BW1A 4P5NA 5HK0A 4OB3B 3A8OB 4CI0C 2RK1A 4M7DB 2K4YA 2MWOA 2K5LA 3MEWA 4A4FA 1B34B 2DZCA 1W4SA 4YTLA 3X26B 1YHQA 2I2LA 3M58A 3L42A 4WF2A 3F70A 1QP2A 2P0KA 2DPPB 1N6AA 2VUBA 1M1GA 3NFCA 4JLGA 1YJ9T 2XI9A 4PKCC 2LC4A 3OYNA 3L2QA 4JS4A 3ME9A 3HKSA 4XU3A 4RG8A 2QI2A 2Y90A 4PJOA 4Q5WA 2MI6A 2E70A 3JCMh 3OS2A 4B9XA 3RERA 2LX9A 4M7DE 1KC8U 4X9CA 2CYZB 3J80E 3H8ZA 3LX7A 4DOWA 1YJWA 4PJOD 5CKDA 1ZBXA 2ZPIB 4PJOB 4M77E 5KCOA 4M78E 5A0LA 1BI1A 3LGFA 4R55A 1KD1C 2VXEA 3PMTA 2DIGA 3PIOA 4NL2A 3OW2S 3CCJA 4OGEA 3MP1A 2O01E 4CRIA 2Y4XA 4B9WA 4E7IA 1FXXA 2DXTA 1JB0E 2RI2A 2HQEA 4C5GA 2X4WA 3V7SA 4R56A 3FJPA 2BIVA 3TEEA 3L2UA 5KH6A 2ZPEB 2MWPA 2P4TA 2L3RA 3OSSC 2RJDA 4RCCA 2WSCE 1V29B 2FHDA 2MAMA 4X34A 3OMGA 4M7AB 1VQKA 3CC4A 4A54A 2XICA 1BIBA 3FRNA 3HFOA 4JUVA 1Q82C 5FU7B 3JCMc 3ZBDA 1M9SA 1ZHIA 4NOYA 3E19A 3VJPA 3E9FA 2LRQA 1N27A 3LWHA 2KMTA 3VYGA 3G4ST 1M1FA 1ZQ1A 3A8HB 4OB2B 4II1A 2ZPBB 5GANg 3DKMA 3GLXA 3SFMA 4BDYA 4M7AG 3QG1A 3CC7T 3C94A 4Z02A 5LJ3j 3QDRB 1G3SA 2HD0A 1OYXA 5C6SA 5LJ5e 1VQ7A 3J7AF 5AYFA 2RJEA 3M4YA 1UB4A 4LDUA 3M56A 2DTHA 4C0DC 1NPRA 4KBMB 1YJWT 4OGCA 3EFSA 4PJOC 2H3JA 2KK4A 3QZ5B 2QQAA 3BDUA 2LVMA 4EMHA 4PL6A 1UGPB 5LJ5g 1YIJA 2IVWA 3I55T 3JB9H 2E5QA 4QQDA 2DXCA 1VQ5A 4JRPA 5CKFA 3X25B 3QXEB 3CCVT 4M7AC 4IUPA 4A4KA 4L5GA 4E7LA 2DD4A 4EMGA 3OW2A 3V8KA 4A4EA 3GP8A 4OF1A 2E6NA 1WGSA 1W2BA 1VQ9A 4BUGA 4PJOE 4IURA 4M77B 2OTJT 1TH7A 2ZPGB 2DTOA 5M9OA 1M1KC 2P0PA 3UPUA 1VQKT 1VQNA 1R8OB 2EJ9A 2ZPHB 5DY9A 3JCMe 5GANh 4M78G 3CMAT 3FC3A 4M77G 2EAYA 3V7CA 3VKIA 4JRIA 3ZFJA 3EFRA 3SWNA 2AHJB 4KUDK 3OBYA 3I56T 4C0FA 3RKWA 4C0DB 3CPFA 3CC7A 3CCSA 4JS5A 2QDYB 2R5MA 2ZCFB 2JZ2A 2JUFA 1QVFS 1VQLT 4J6YA 3S3MA 3EAEA 5CK9A 3A5ZB 5GAMh 4KT0E 3JCMg 3HRUA 5I2SA 3ASKA 3CMET 2RB6A 5LJ3f 3HRTA 1VIFA 4M7DF 4HT9A 3OQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 C;  2YHT A;  4M77 D;  5GAN 8;  5GAN 2;  4C92 C;  1MGQ A;  2I2L A;  3JB9 I;  3JCM J;  4WF2 A;  5GAN j;  4M77 A;  2DTI A;  4J6W A;  4EMK B;  3INZ A;  5GAN e;  5LJ3 h;  3JCM X;  3JB9 D;  4A53 A;  5GAN d;  4C8Q E;  3RIR A;  3JB9 F;  5GAM d;  4M7A A;  2E41 A;  3RES A;  3SWN C;  4XU3 A;  2DXU A;  4DQ2 A;  4EMK C;  2Y90 A;  2HNI A;  4M7A D;  4PJO A;  3JCM h;  5GAN 7;  4MML A;  4JLI A;  3SWN B;  3JCM d;  1X01 A;  4XQ3 A;  4X9C A;  3JB9 G;  3RER A;  4M7D E;  3AHU A;  1N9S A;  4C92 G;  4PJO D;  3VU3 C;  4M7D D;  4PJO F;  4PJO B;  4XTX A;  4M77 E;  4XU0 A;  3FIF A;  4M78 E;  5GMK i;  1WPY A;  2VXE A;  1Y96 A;  4C8Q G;  4HT9 A;  1JRI A;  3M4G A;  4X9D A;  4NL2 A;  4XTY A;  3JCM b;  4XU2 A;  1KQ2 A;  4M7D A;  2YLB A;  5GAN 6;  1U1S A;  4C8Q B;  4C8Q F;  4EMK A;  5GAN 5;  4M7D G;  2EWN A;  2DXT A;  1Y96 B;  3V7S A;  2K57 A;  3FJP A;  3JCM P;  4JRK A;  1I81 A;  4M78 C;  4RCC A;  4N0A A;  3RKX A;  4M75 E;  3JCM W;  4M7A B;  5GAN f;  4M7A F;  2ZGW A;  2CGH A;  2RM4 A;  4A54 A;  1BIB A;  1BIA A;  3HFO A;  1I8F A;  4JUV A;  4PNO A;  5LJ5 f;  3JCM c;  2VXF A;  4C92 A;  4NL3 A;  1LNX A;  4F7U E;  1M8V A;  4M75 D;  4NOY A;  5LJ5 d;  3JCM Q;  4C92 F;  4Y91 A;  4C92 B;  5GAO m;  4M7A E;  4C92 D;  4C8Q A;  2VC8 A;  5LJ3 d;  3FB9 A;  1M5Q 1;  5GAO r;  2EJF A;  4M75 A;  5GAN g;  2RA2 A;  5LJ5 j;  4M7A G;  4C8Q D;  4XU1 A;  1JBM A;  2DZ9 A;  5LJ3 j;  5GAM j;  1LOJ A;  4M78 B;  4M78 F;  5LJ5 e;  4PJO G;  5CAI A;  2DKG A;  4J6X A;  1KQ1 A;  1D3B A;  2DTH A;  5I21 A;  3V7R A;  3EFS A;  4PJO C;  3JCM f;  4F7U G;  2JN0 A;  3HSB A;  1LJO A;  3BDU A;  4RCB A;  4EMH A;  3JCM V;  5LJ5 g;  2E64 A;  4XTV A;  2EJG A;  4HT8 A;  3QSU A;  3RUX A;  3JB9 H;  2DEQ A;  4M75 B;  4M75 F;  5GAO q;  1WNL A;  5GAM g;  3GIB A;  4QVC A;  4XTW A;  4M75 G;  4M7A C;  4EMG A;  3V8J A;  5GAN 3;  5GAO n;  3QO3 A;  4M7D C;  3V8K A;  4F7U B;  4F7U F;  3L2Z A;  4M78 D;  5GAO p;  4C92 E;  3JB9 J;  2FYK A;  4PJO E;  4M77 F;  4M77 B;  1TH7 A;  4F7U A;  4MMK A;  2DTO A;  3BFM A;  3RKY A;  3L1A A;  1I4K 1;  4M78 A;  1I5L A;  2EJ9 A;  4M77 C;  5DY9 A;  3SB2 A;  5GAM f;  3JCM e;  4M78 G;  5GAN h;  1B34 A;  1D3B B;  1WQ7 A;  1HK9 A;  3QUI A;  4M77 G;  2EAY A;  3V7C A;  4JRI A;  4OP0 A;  3EFR A;  5LJ5 h;  5GMK l;  3SWN A;  4XTU A;  5LJ3 g;  5GAM e;  5GAN 4;  4HA8 A;  2E10 A;  2RD1 A;  2YLC A;  1U1T A;  3QHS A;  4V2S A;  3RKW A;  1WQW A;  1YCY A;  2DVE A;  5GAO l;  1N9R A;  5GMK h;  4QVD A;  1HXD A;  4C8Q C;  5LJ3 e;  5GMK j;  2FB7 A;  4XTZ A;  3V8L A;  3HFN A;  2E1H A;  2E65 A;  3BW1 A;  2QTX A;  2DJZ A;  3BY7 A;  4J5Y A;  1H64 1;  3PGG A;  4J6Y A;  4N0A C;  5GMK m;  3JCM g;  5GMK e;  5GAM h;  4M7D F;  4M7D B;  2RB6 A;  5LJ3 f;  1B34 B;  2DZC A; 
#chains in the Genus database with same CATH topology
 5HK3 A;  3L2W A;  5GAN e;  2X4Y A;  3I5R A;  3OYA A;  3CCQ Q;  3S6W A;  3CD6 T;  3TSW A;  1K9M C;  4JLI A;  4XQ3 A;  4RG2 A;  1QW1 A;  2NYS A;  2XDP A;  2YT6 A;  3J81 E;  1SRL A;  3M0U A;  5IHN A;  1G3W A;  5GAN 6;  4EMK A;  2DYI A;  1QCN A;  2LT4 A;  3JCM P;  4RUG A;  1VQO A;  1OU9 A;  1RL2 A;  5EC7 A;  1ZSZ B;  4M7A F;  2HCK A;  2RM4 A;  1BIA A;  2GQV A;  3H0I A;  4QW2 A;  1QP3 A;  4LDY A;  5J26 A;  3JCM Q;  4C92 D;  5HY6 A;  3E1S A;  1O9S A;  2XU8 A;  1AEY A;  4C8Q D;  4OML A;  3CD6 Q;  1AWW A;  2XD0 A;  4J83 A;  5DM7 R;  4BDZ A;  5L23 A;  2H8H A;  2BUD A;  1VQN T;  2XHC A;  1Q7Y C;  1FMW A;  1VQP A;  1UHF A;  1KHC A;  4M75 B;  1QMC A;  2LT1 A;  4FU6 A;  3CCS T;  3RDV A;  1PRL C;  7AT1 B;  1MNE A;  2LTO A;  2CP6 A;  3VS7 A;  1WHG A;  3MEU A;  1XJW B;  1ZUK A;  1C0M A;  3WXM B;  4VUB A;  2J6K A;  2EYY A;  4RMO A;  1TUC A;  3OSV A;  4A4G A;  2DIQ A;  3EHR A;  5GAN 4;  3DLL A;  2M51 A;  1WQW A;  3M54 A;  4QQ6 A;  2HEQ A;  4QVD A;  4OVA A;  1OU8 A;  1T0J A;  2KNB B;  2VGM A;  4ZGJ B;  5GMK m;  4B6M A;  2D8J A;  3M0S A;  1T0H A;  3LLR A;  4M77 D;  4KGX B;  1QKW A;  2AK5 A;  3RMQ A;  1QVG S;  1Y7X A;  2M9U A;  3RIR A;  5GAM d;  4IUV A;  3NTH A;  1Q86 R;  2DNU A;  2HNI A;  3WVE B;  5GAN 7;  3H41 A;  3KBG A;  4GLM A;  2Y4Y A;  1VQ6 A;  1PD1 A;  3A8G B;  1K8A C;  2XKO C;  1D09 B;  5KYU B;  3M4G A;  3QII A;  2YLB A;  2YUN A;  2CH4 A;  2JVV A;  3DB4 A;  1ZA2 B;  2FPF A;  2D9T A;  2KR3 A;  3OB9 A;  4O5V A;  3CCL T;  2HSP A;  2JTM A;  1JJ2 S;  2VC8 A;  1GFC A;  1UJY A;  4M75 A;  3DLM A;  4RTV A;  2E12 A;  4C0Z A;  4L59 A;  4OMO A;  1Q7Y R;  1VQM A;  1KC8 C;  1X6B A;  1UGS B;  4TVR A;  2OTJ Q;  4BE2 A;  3CCR T;  1ACM B;  2XDD A;  3CCU T;  3HSB A;  1LJO A;  3JCM V;  4FYV B;  4FSS A;  3NHN A;  3ZEH A;  1X2Q A;  2KSS A;  4L6V 5;  1EX4 A;  3CPW A;  3UAT A;  1N5Z A;  2RHI A;  2YRD A;  5LL6 S;  2MIO A;  5D6Y A;  3VUZ A;  2O4X A;  5CCA A;  1WHJ A;  3VRZ A;  1M3B A;  5GMK l;  2ENM A;  3OYY A;  5HCK A;  2AZS A;  1UJ0 A;  3OY9 A;  2JW4 A;  1X43 A;  1SG5 A;  1BI3 A;  1QKX A;  2DL5 A;  3PVL A;  3UF4 A;  3BY7 A;  3QZ9 B;  3H9N A;  3MET A;  5IT9 E;  3JV3 A;  3REA B;  3FDR A;  1SEM A;  2X4X A;  1U5S A;  1S72 Q;  4M7A A;  2J7I A;  4DBH A;  4E2F B;  4J8O A;  3SWN B;  4PLI A;  1T3L A;  5DLQ E;  1NG2 A;  2B8A A;  1Q7Y U;  4PJL A;  1C1A A;  1WHM A;  4XTY A;  3QJY A;  1QVP A;  4AFS C;  2J05 A;  1U1S A;  5CKB A;  3TQ7 P;  4N4H A;  5FU6 B;  4QQG A;  1JEG A;  3OYH A;  1U3O A;  3G6E T;  3EH1 A;  3FEO A;  2NUT B;  1N8R U;  3QJ6 A;  5J3B A;  3CCU Q;  3OYL A;  4F7U E;  3LW5 E;  5GAO m;  2FVU A;  3GPL A;  1AVZ C;  1NLO C;  3CC2 Q;  2D0N A;  4DBF A;  2RA2 A;  1WHK A;  2COW A;  4AMC A;  1BI2 A;  2V8K A;  2P84 A;  4J7F A;  1KQ1 A;  2RH2 A;  3H6Z A;  2VYT A;  2DF6 A;  5D6W A;  3CCU A;  2KY9 A;  3OYI A;  3G4S A;  1PKS A;  4WTO B;  1WIE A;  2COZ A;  3QBY A;  1VQ9 T;  3QO3 A;  5GAO p;  3JB9 J;  4AFQ C;  1OUL A;  3KUF A;  3L1A A;  1NYF A;  1K8A U;  3CCQ A;  2MF2 A;  4LE9 A;  3GOX A;  3C4S A;  3VS5 A;  3CBM A;  2JT4 A;  5A0G A;  3G71 Q;  3CCV A;  1VQO T;  1AWX A;  1RLP C;  4E7J A;  4DEX A;  2K4Y A;  2OAW A;  3M58 A;  3L42 A;  3NFC A;  4R0K A;  1YJ9 T;  3L2Q A;  4AT1 B;  4JS4 A;  3ME9 A;  2BZY A;  4M7D E;  2LX9 A;  1KC8 U;  1AWO A;  2CYZ B;  3J80 E;  3H8Z A;  1K0X A;  1I5O B;  5A0L A;  1E6H A;  2VXE A;  4AG1 C;  2DIG A;  1KD1 C;  1K76 A;  2LQW A;  1M90 R;  4OGE A;  4Z88 A;  2O01 E;  4E7I A;  4R56 A;  5IHK A;  2BIV A;  3TEE A;  1VOM A;  1VQO Q;  1Q95 G;  1TWB A;  2MWP A;  2P4T A;  1JXO A;  2RJD A;  3OSS C;  1LVK A;  3U23 A;  4M7A B;  4X34 A;  3OMG A;  1VQK A;  4KH1 B;  1X6G A;  2XIC A;  1K9A A;  3JCM c;  1YNZ A;  2YUP A;  3VJP A;  1ZHI A;  1VQN Q;  2KMT A;  1M1F A;  4OB2 B;  2ZPB B;  3SFM A;  4RTT A;  3CC7 T;  1VQ9 Q;  3C94 A;  2HD0 A;  3J7A F;  3M4Y A;  1YJW T;  1OQK A;  4OGC A;  1YN8 A;  3EFS A;  4AFZ C;  3QZ5 B;  2L3S A;  5IXF A;  1UUE A;  2LVM A;  2RQW A;  1YIJ A;  3JB9 H;  2E5Q A;  4QQD A;  2RPN A;  3X25 B;  4M7A C;  4LUD A;  1TOV A;  1VQ9 A;  1BB9 A;  1WGS A;  1MV3 A;  1VYU A;  5KYY A;  3FJ5 A;  1R0B G;  4M77 G;  3V7C A;  1PRM C;  4QKU A;  3SWN A;  1G83 A;  3VS0 A;  3OBY A;  4CC4 B;  3CPF A;  3LH5 A;  4JS5 A;  2FPD A;  2R5M A;  2FRY A;  2ZCF B;  1H92 A;  2DFU A;  1QVF S;  5CK9 A;  3HRT A;  3OQ5 A;  1MMN A;  2ROL A;  4C92 C;  1MGQ A;  1YWP A;  4DOV A;  1YBY A;  4MZT A;  2RO0 A;  2YRC A;  2LMJ A;  2DIL A;  2NWM A;  5LJ3 h;  1UDL A;  3UA7 A;  1QWE A;  4Z8A A;  4M7A D;  5GJV B;  1AZE A;  1X01 A;  2FZG B;  2M16 A;  5KYW B;  2LX7 A;  2FO0 A;  3QYG B;  5IH2 A;  1GBQ A;  3A8L B;  3MEA A;  1VQP T;  2WSF E;  1R0C B;  1YIT Q;  3KFV A;  2BE7 D;  2KT1 A;  1PHT A;  4C8Q F;  4BE1 A;  5IHI A;  1SKU B;  3EH2 A;  2KBT A;  2RHZ A;  3GP8 A;  1M90 C;  1W2B P;  2DEU A;  3OYK A;  1KIK A;  3ZL7 C;  1KSW A;  1SSF A;  2A3L A;  4C92 A;  2D6F A;  1D0Y A;  3X28 B;  3MKD A;  4Y91 A;  4C8Q A;  5LJ3 d;  3FB9 A;  1VQ5 T;  3CCE Q;  5I2M A;  2F2X A;  1PWT A;  3Q1J A;  2GF7 A;  1ZLM A;  5FRN A;  5GAM j;  1KFZ A;  5CAI A;  1VQM Q;  2K3X A;  4RTX A;  1KJW A;  3P8D A;  3EG3 A;  1KD1 R;  2ZZD A;  2EGA A;  5CIU A;  2ABL A;  1Y07 A;  1F1B B;  3CCJ T;  1IB8 A;  2QA4 T;  4A63 B;  1LPL A;  1TUD A;  5FRM A;  4M75 G;  5IN1 A;  1S1N A;  1BYM A;  4IUQ A;  5GAN 3;  3UDC A;  3OA6 A;  3G4S Q;  2FYK A;  1UFF A;  2PVD B;  4M77 F;  5DLO A;  4F7U A;  1VQ6 T;  1RAA B;  3M59 A;  1K8A R;  1H3Z A;  4OB0 B;  1TS9 A;  5CKE A;  2OTL Q;  4E7S A;  5GAM e;  3OS1 A;  2E10 A;  1OOT A;  1NPP A;  1PSE A;  4MDW A;  2H3E B;  4LNP A;  2IG0 A;  1ZBJ A;  5EG2 A;  4C8Q C;  1QVF P;  2C06 A;  2QTX A;  1RLQ C;  4FSX A;  2CS7 A;  1IGU A;  4FIB A;  2RQT A;  4RCB A;  2DO3 A;  5D7U A;  2M0Y A;  5GJW B;  2DXB A;  1WFW A;  2EVR A;  1S72 A;  1BKB A;  1NYG A;  2ESW A;  4C8Q E;  3O8V A;  4DEY A;  2JTE A;  2DXU A;  4PJJ A;  1OV3 A;  4IIO A;  1YP5 A;  2KYM A;  1WJS A;  8ATC B;  3JB9 G;  3E9G A;  1PSF A;  4RTY A;  1OPK A;  2JS2 A;  4C92 G;  3HRS A;  3VU3 C;  2MYS A;  4GY5 A;  3G7Z A;  4XU0 A;  1NJI R;  2LQN A;  3GF5 A;  4E47 A;  2KRM A;  1KQ2 A;  1UEC A;  1V1C A;  1ZA1 B;  4C8Q B;  4A4H A;  2K2V A;  3KXT A;  3D7S B;  1GXI E;  2ED0 A;  3CXC S;  3JCM W;  1VQ8 T;  3CME A;  2K7A A;  4F04 B;  1M1K R;  2QQR A;  1V76 A;  4PNO A;  4AFU C;  3CCQ T;  4HCZ A;  2F5K A;  3P8B B;  2PVG B;  3PNW C;  4M75 D;  2A37 A;  5LJ5 j;  1K9M U;  5I22 A;  4J9D A;  1GCQ C;  2GFA A;  2QEX T;  2LDM A;  2LP5 A;  5AT1 B;  2X3X D;  4F14 A;  3QSU A;  2EJG A;  1E7O A;  1D1A A;  4IUT A;  1YJ9 A;  2HKQ B;  2CUB A;  2MOX A;  2GGR A;  3NMZ C;  3QDF A;  4OMM A;  3EGX A;  2DVJ A;  5GAO n;  1I0C A;  2L3P A;  4JJC A;  4MMK A;  2HQX A;  4M78 A;  5KYU A;  3SB2 A;  4AG2 C;  2V8I A;  5HKC A;  1EZZ B;  2HL3 A;  4Y28 E;  2MPX C;  2A36 A;  2DMO A;  1RUW A;  2RD1 A;  1RI0 A;  2PUO B;  2RQV A;  3G71 A;  1ABO A;  1HXD A;  3MP6 A;  4BE0 A;  5GMK j;  2E1H A;  4J5Y A;  4BI8 B;  4FW1 A;  1YWO A;  1O75 A;  2QYZ A;  1VUB A;  2L0A A;  4FL6 A;  2YUO A;  1QCF A;  1KQS P;  2ROT A;  2A7Y A;  1YJN T;  3JB9 D;  2DL7 A;  3O5Z A;  3ER0 A;  2E41 A;  1VQ8 Q;  3MP8 A;  1MMD A;  1JJ2 P;  2RHY A;  3SDZ A;  2L89 A;  5GMK i;  2RK2 A;  1Y96 A;  5A0D A;  2KDS A;  3TCJ A;  5GAN 5;  1QCO A;  4BAC A;  1AOJ A;  1VQL Q;  2GCX A;  4ZGE B;  1H3H A;  1IGQ A;  4LN2 A;  3M5A A;  4N0A A;  3RKX A;  1TUG B;  4IIM A;  4RKU E;  1UE9 A;  4OMQ A;  4QT7 A;  3EGD A;  1VQ8 A;  2HZY A;  4ZN1 A;  4IUU A;  5LJ5 d;  1WDX A;  1N8R R;  1Q86 U;  1YI2 T;  3CQT A;  4M78 F;  2EQM A;  2CZ1 B;  3CC4 T;  1NBE B;  3CC7 Q;  2X3W D;  2FL7 A;  2PUK B;  2OTL T;  2LCC A;  4JJD A;  5GAM g;  4K11 A;  2CKK A;  3CCJ Q;  3PE0 A;  3EFO A;  2V8J A;  5A2Q E;  2QQB A;  1BU1 A;  3DB3 A;  2L2P A;  1SPK A;  2K3Y A;  1D1C A;  1B34 A;  1D3B B;  1CKB A;  3CC2 T;  2JOY A;  4LDW A;  2AKK A;  2MMP A;  1P92 A;  3EG2 A;  1YJW Q;  4LD9 K;  3G71 T;  1WJR A;  3V8L A;  4DBQ A;  1PG5 B;  1YJN Q;  3QWX X;  5HK0 A;  3H0F A;  1LCK A;  2K5L A;  4A4F A;  2KXD A;  2DZC A;  1W4S A;  3X26 B;  1YHQ A;  4HVW A;  2MCN A;  1WLP B;  2HBW A;  4PJN A;  2VUB A;  1EFN A;  2XI9 A;  4JZ4 A;  2QI2 A;  2CDT A;  4Q5W A;  3JCM h;  4JPB W;  1YJW A;  3LX7 A;  4DOW A;  5CKD A;  4PJO B;  4ZNX A;  3LGF A;  3PIO A;  3CCJ A;  1GCP A;  2JJ9 A;  4CRI A;  4PJM A;  4B9W A;  1FXX A;  1JB0 E;  2KRN A;  1X27 A;  4RCC A;  1GCQ A;  1WZO A;  2FHD A;  4JUV A;  3ZBD A;  4NOY A;  2LJ3 A;  3E9F A;  3LWH A;  1UGV A;  1ZQ1 A;  3GLX A;  4M7A G;  1MV0 B;  4J9H A;  2QEX Q;  2X51 A;  1VQ7 A;  2RJE A;  1PKT A;  1NPR A;  2NUP A;  2DM1 A;  4PJO C;  2QQA A;  3BDU A;  4EMH A;  1UGP B;  2IVW A;  2DRM A;  2DXC A;  5CKF A;  3QXE B;  4L5G A;  1M2V A;  4EMG A;  1H8K A;  1Z9Z A;  4JZ3 A;  1W2B A;  2DE0 X;  4PJO E;  1TH7 A;  2C0O A;  2YDL A;  1VQN A;  3UPU A;  2X9H A;  3FC3 A;  1M27 C;  3CPW P;  2EAY A;  4JRI A;  1GL5 A;  1CKA A;  2LZ6 B;  3I56 T;  4C0D B;  3CCS A;  2W10 A;  1HYO A;  1VQL T;  4ESR A;  3CME T;  4KT0 E;  3JCM g;  5I2S A;  2RB6 A;  1VIF A;  4HT9 A;  3HPW A;  3THK A;  1BK2 A;  3IQL A;  2P4R A;  1G5V A;  3L2R A;  2DYB A;  2F2V A;  3SWN C;  2CT3 A;  5FLX E;  3FLG A;  3G1J A;  1KG1 A;  2CSQ A;  4BY6 B;  4IKF A;  1Y0M A;  2F5T X;  4HCC A;  2E6Z A;  1JJ2 A;  1K9M R;  1WPY A;  3QWY A;  1UG1 A;  2EQJ A;  5FU6 C;  2EQK A;  3CCR Q;  1WA7 A;  4E6R A;  3PTA A;  1M2V B;  3RR6 A;  2D0Q B;  2X4J A;  3CEY A;  5KYW A;  4GLK A;  1M1K U;  2ATC B;  1I8F A;  2HSE B;  2DD5 A;  2IPO B;  3M55 A;  1G3Y A;  4M7A E;  1M5Q 1;  3VYH B;  2LQ8 A;  4XU1 A;  1ZSZ A;  2D8H A;  1UEB A;  3CC4 Q;  2JS0 A;  1W6X A;  1NJI U;  1VYT A;  1QVG A;  4X1V A;  3OYF A;  2OTJ A;  4E7Z A;  1NJI C;  2VVK A;  5I21 A;  4BI3 A;  1I07 A;  4FT2 A;  3UWN A;  4ORZ A;  4Z89 A;  5C0M A;  2KT8 A;  3BDL A;  2DEQ A;  1Q81 C;  5L8R E;  3M57 A;  3V8J A;  1RAH B;  1K73 R;  4EPC A;  3VV0 A;  3L2Z A;  1BCM A;  2RNA A;  4C92 E;  3HTR A;  1EIF A;  3RKY A;  1YIT A;  2CP2 A;  2RQR A;  4J9C A;  1WX6 A;  4OB1 B;  3MJX A;  1JO8 A;  4HVV A;  4OP0 A;  3CCE A;  2NUT A;  2YUQ A;  4JJN K;  2QDL A;  1U1T A;  2O88 A;  3CD6 A;  3RBB B;  5CQY A;  2JNG A;  4XTZ A;  2FG0 A;  2JTF A;  1H64 1;  4HVU A;  1VQL A;  4M75 C;  2YHT A;  4KUI A;  3BE3 A;  1NZ9 A;  5GAN j;  1BI0 A;  1OEB A;  1XOV A;  2OI3 A;  4UC4 A;  2DTI A;  2JMC A;  3MO8 A;  4FW2 A;  3JB9 F;  1YI2 A;  4PFP A;  1ZX6 A;  4DQ2 A;  4EMK C;  1AHJ B;  2FPE A;  1PC0 A;  1N9S A;  2EPD A;  2XMF A;  3M53 A;  4XTX A;  5FRO A;  4C8Q G;  2XDB A;  2LNH B;  1G3T A;  3RMS A;  2J6F A;  4XK8 E;  2K57 A;  3EGX B;  1KQS S;  4C5E A;  2HBP A;  1I1J A;  1YI2 Q;  2RHU A;  2ED1 A;  1JU5 C;  4M7D C;  5LJ5 f;  5KYX B;  1M3A A;  2ECZ A;  1AT1 B;  3CC2 A;  1ABQ A;  1PD0 A;  1JBM A;  2CP0 A;  1DJ7 B;  3VS4 A;  4M78 B;  3V7R A;  4QVZ A;  3NGP A;  1YHQ T;  4FYY B;  2JN0 A;  1Y71 A;  4LUE A;  2E64 A;  2NLU A;  1YJN A;  4M75 F;  3TSZ A;  4FYX B;  2E3H A;  4XTW A;  2WAC A;  5KYY B;  3CME Q;  1R77 A;  5FWC A;  2EYQ A;  1VQ5 Q;  3P8H A;  4J9B A;  2LCL A;  4LXC A;  1G8X A;  5J39 A;  4ELZ C;  1ZSG A;  2BE9 B;  4XTU A;  4ATO A;  2DBM A;  3CCE T;  2LQK A;  1SRM A;  2VV5 A;  4KRT A;  4PFO A;  2ZPF B;  3I56 Q;  4ZGD B;  1YCS B;  1OPL A;  3LYI A;  1TTH B;  2FRW A;  3CCM T;  2R5A A;  2LJ1 A;  4JRQ A;  4HCK A;  1WXB A;  3PVQ A;  1UHC A;  3C12 A;  3JSC A;  3I35 A;  1BCO A;  1RAI B;  4C5I A;  1RI9 A;  1VQ7 T;  1M4Z A;  3JCM d;  3AHU A;  2MK5 A;  5FU7 C;  4Y92 A;  2DBK A;  2LNV A;  1RAD B;  2KRS A;  1VQK Q;  3JCM b;  4M7D A;  1MMA A;  3L2V A;  4N4I A;  1IZ6 A;  4LDX A;  3OYC A;  2EWN A;  3SHW A;  4LD6 A;  4RTW A;  1OI1 A;  1I81 A;  5CR2 A;  4M75 E;  4BD3 A;  1VQ6 Q;  2PQW A;  1K4U S;  1G2B A;  3I55 Q;  1D0Z A;  3CCR A;  5GAN f;  2ZGW A;  1N8R C;  3MCA B;  1ZUU A;  4C92 B;  2HAX A;  1KQS A;  3EGD B;  1IO6 A;  2QA4 Q;  4MZM A;  4GBQ A;  4F17 A;  1E6G A;  3I56 A;  2VGN A;  1NE8 A;  2IIM A;  2HDA A;  2DZ9 A;  4FCY A;  1QVG P;  4ELY C;  1UGQ B;  1MHN A;  2Z0W A;  3E2U A;  4KUL A;  2DKG A;  2A0F B;  2K3B A;  1D3B A;  2OAU A;  1B3Q A;  1WXU A;  3WVD B;  4F7U G;  1W2B S;  1FMK A;  1AWJ A;  3RUX A;  2M02 A;  1M3C A;  3C95 A;  2CZ7 B;  2KI7 A;  2YRV A;  3SD4 A;  2DK3 A;  2EKH A;  1GRI A;  2VKN A;  2DL8 A;  3EGU A;  3GNF B;  1QVF A;  1J3T A;  1WJQ A;  1MMG A;  3X20 B;  3MHX A;  5LJ5 h;  1YIJ T;  3H0H A;  4D6W A;  2YLC A;  2DA9 A;  2RJF A;  3TU4 K;  4V2S A;  1HJD A;  4OMF B;  2DVE A;  1U8R A;  4KGZ B;  3JAM E;  5LJ3 e;  1IRE B;  3HFN A;  4PLL A;  2E65 A;  1IRX A;  1SHF A;  3A8O B;  5FWB A;  2RK1 A;  4M7D B;  3MPU B;  1B34 B;  4YTL A;  1IHW A;  4WF2 A;  2V1Q A;  3F70 A;  2LCS A;  4JLG A;  1QP2 A;  2DPP B;  1N6A A;  2A28 A;  5IXB A;  3OYN A;  3HKS A;  4XU3 A;  1ZSZ C;  2MI6 A;  3OS2 A;  1B07 A;  2CP3 A;  2AT1 B;  4PJO D;  1ZBX A;  1JQQ A;  4M77 E;  1KK7 A;  4M78 E;  3OW2 S;  2W0Z A;  3EG1 A;  3MP1 A;  2Y4X A;  2DXT A;  1WHL A;  2RI2 A;  2HQE A;  4OMP A;  3FJP A;  3CCV Q;  3L2U A;  2ZPE B;  2CP7 A;  2WSC E;  5KYN A;  4A54 A;  2J06 A;  1YHQ Q;  1M9S A;  3E19 A;  2LRQ A;  1N27 A;  3C0C A;  3G4S T;  2CUD A;  2KRO A;  1NEB A;  5GAN g;  4BDY A;  3QG1 A;  4Z02 A;  1OYX A;  4LDU A;  3M56 A;  4KBM B;  1D0X A;  2H3J A;  2KK4 A;  2YSQ A;  1GFD A;  2NUP B;  1VQ5 A;  4JRP A;  1KC8 R;  3CCV T;  1QQJ A;  2DD4 A;  3V8K A;  1U06 A;  4OF1 A;  2KXC A;  1PM3 A;  4BUG A;  3OW2 P;  4M77 B;  5M9O A;  1M1K C;  3CMA Q;  1R8O B;  1IXD A;  5DY9 A;  3JCM e;  5GAN h;  3ZFJ A;  2QG9 B;  2PZ1 A;  2JMA A;  4JJB A;  4KUD K;  4C0F A;  3RKW A;  3VRY A;  2QDY B;  2JZ2 A;  2JUF A;  2AIR B;  3VS1 A;  3S3M A;  3A5Z B;  2DRK A;  3ASK A;  2EKO A;  5GAN 2;  3JCM J;  1Q82 R;  5CO7 A;  1TSF A;  3R6N A;  1D1B A;  2E5K A;  1FX7 A;  2M0O A;  2HMA A;  1XQH A;  4J6W A;  3JCM X;  2GBQ A;  2RMO A;  3OYD A;  1T3S A;  2FZC B;  5GAN d;  1VQ7 Q;  1FWZ A;  3RES A;  2PVO B;  2DL3 A;  1RAC B;  4DA4 A;  2F1L A;  2QQ9 A;  2QQS A;  3QYH B;  2NUZ A;  3UA6 A;  4BY6 C;  1GBR A;  3GNG A;  2KEA A;  3OYE A;  4X9D A;  4XU2 A;  2EYW A;  3CXC A;  3PIP A;  4M7D G;  3EG0 A;  1S72 T;  1VIE A;  3CCS Q;  2I0N A;  2K5I A;  4M78 C;  2RI3 A;  4C0G A;  3OYJ A;  3QKJ A;  1RAE B;  2EW3 A;  3A8M B;  1YIT T;  5ECA A;  2JXB A;  4EIK A;  2QAS A;  3QPH A;  3M0Q A;  2J6O A;  2PU9 B;  2KE9 A;  2R57 A;  2RI5 A;  2RN8 A;  4PK4 A;  4C5H A;  4EDU A;  2R58 A;  3HP9 A;  1PCX A;  2CP5 A;  5KYX A;  2LJ0 A;  2KQW A;  3CCM A;  2DER A;  4HT8 A;  2P0Q A;  1ARK A;  4NS5 A;  3OYG A;  4ZTJ A;  2QGF B;  4O6J A;  2L8D A;  5IAY A;  2EYZ A;  2C0I A;  4N4G A;  3ULR B;  1VA7 A;  3EFO B;  4M78 D;  2HL5 C;  3NTI A;  2EGC A;  1M30 A;  1RAB B;  3BFM A;  3X24 B;  2EFI A;  3PT9 A;  1I4K 1;  1I5L A;  1Q82 U;  5GAM f;  3QUI A;  4F16 A;  3MEV A;  3VS2 A;  1WI7 A;  3I5S A;  2K2M A;  3CCL Q;  5I11 A;  4E7H A;  2D1X A;  4BB7 A;  5GAO l;  1QWF A;  2CZ0 B;  2DJZ A;  3PGG A;  4DBR A;  5GMK e;  2JM8 A;  4J9G A;  1KD1 U;  1NM7 A;  3CPW S;  3I55 A;  4M77 A;  2E4H A;  3R6O A;  4EMK B;  2RQU A;  4A53 A;  5CVI A;  2PTK A;  3OBW A;  1SF9 A;  4MML A;  3M9Q A;  3REB B;  4CC7 A;  2EYX A;  1SHG A;  3OMC A;  1JRI A;  3S3N A;  3EG9 A;  5CQX A;  2QXF A;  2COY A;  1YJ9 Q;  1HSQ A;  1A0N B;  2OJ2 A;  3LH0 A;  3SEM A;  3URG A;  3OYB A;  4E7K A;  2WSE E;  2CGH A;  2CRE A;  2G3R A;  3PMI A;  2VXF A;  4NL3 A;  2KVQ G;  4D8D A;  1VQ4 T;  4HCB A;  4C92 F;  2QA4 A;  4XAX B;  2EJF A;  3JRZ A;  3OYM A;  2JM9 A;  1X6O A;  2DJQ A;  1OX8 A;  1IHV A;  1LOJ A;  1K0S A;  2K6D A;  2M1H A;  4J6X A;  2AZV A;  2E3I A;  1Q81 R;  1K1Z A;  4OMN A;  2CZ6 B;  3NTK A;  4MDX A;  1VQP Q;  4XTV A;  4HXJ A;  2XID A;  5GAO q;  1WNL A;  3RNJ A;  3GIB A;  4QVC A;  1MND A;  2DET A;  3S3O A;  2OX7 A;  4BI4 A;  4F7U F;  2RJC A;  1NLP C;  5KE3 A;  1X75 C;  1WXT A;  5CKH A;  5FW9 A;  2RF0 A;  1K73 U;  4ZTF A;  2K79 A;  1K73 C;  2BZ8 A;  4M77 C;  2EBP A;  2GTJ A;  1HK9 A;  3GBQ A;  1FMV A;  2FZK B;  3LGL A;  3N5B B;  2OTL A;  3T9N A;  2RHX A;  1TXQ A;  4ME7 A;  1OZ2 A;  2O31 A;  1UGR B;  2CT4 A;  1YFN A;  1N9R A;  4FYW B;  1W1F A;  3EHQ A;  1M2O A;  4N0A C;  1VQM T;  1HD3 A;  3EG9 B;  5D6X A;  3CBO A;  1M8V A;  5GAN 8;  4HKE A;  2O9V A;  3JB9 I;  4J7I A;  1CSK A;  3INZ A;  1NEG A;  1RAG B;  2EQI A;  2O4X B;  1VQ4 Q;  4J9E A;  3LWI A;  4M4Z A;  2F69 A;  2X35 A;  4ZN3 A;  3UT1 A;  2K5F A;  3VS3 A;  2KGT A;  4MZP A;  2C0T A;  4M7D D;  4PJO F;  4LDV A;  1XNI A;  3FIF A;  5KE2 A;  4KGV B;  2GFU A;  8AT1 B;  1B7T A;  1Y96 B;  1Y57 A;  1KHI A;  4JRK A;  1FYN A;  2BKD N;  4D8K A;  4CC2 A;  2BTT A;  1M90 U;  2CH4 W;  2QEX A;  4FT4 A;  1LNX A;  1WYX A;  3NPF A;  2F2W A;  2KAF A;  1VQ4 A;  5GAO r;  4J9I A;  5KCH A;  2XK0 A;  2EQU A;  4PJO G;  3OS5 A;  3A98 A;  2A08 A;  2O9S A;  1OZ3 A;  1XTD A;  3HL8 A;  3JCM f;  1AD5 A;  3VUB A;  3CBP A;  3HHT B;  3TRE A;  2FEI A;  1Q86 C;  2HKN A;  4JDS A;  2YXY A;  4F7U B;  3G6E A;  2VB6 A;  2EIF A;  3CCL A;  2DAQ A;  4FM4 B;  2SEM A;  4CC3 A;  3CMA A;  3I9Q A;  2XG8 D;  1W70 A;  3PFS A;  3CXC P;  1WQ7 A;  1AZG B;  3TVT A;  1WHH A;  1Z9Q A;  5LJ3 g;  2L5Q A;  4HA8 A;  3OS0 A;  3QHS A;  2QAZ A;  1YCY A;  3A1P A;  1Q81 U;  5GMK h;  2FB7 A;  3BW1 A;  4P5N A;  1MUZ A;  1X2K A;  4OB3 B;  2ZAE A;  4CI0 C;  9ATC B;  2MWO A;  3MEW A;  1VYV A;  3G6E Q;  6AT1 B;  2I2L A;  2QGG A;  2QK0 A;  1BBZ A;  2P0K A;  2V1R A;  1M1G A;  2GNC A;  1M8M A;  4PKC C;  2LC4 A;  4ANJ A;  4RG8 A;  2Y90 A;  2DLP A;  4PJO A;  2E70 A;  2GTO A;  2PNI A;  4KH0 B;  4B9X A;  3RER A;  4X9C A;  2ZPI B;  5KCO A;  1BI1 A;  4R55 A;  3PMT A;  2VAS A;  4NL2 A;  4RTU A;  3M0R A;  1YIJ Q;  3AT1 B;  4C5G A;  2X4W A;  3V7S A;  5KH6 A;  3CCM Q;  2L3R A;  1OX9 A;  4RTZ A;  1V29 B;  2DX1 A;  2B86 A;  2MAM A;  3CC4 A;  1BIB A;  2SRC A;  1PNJ A;  3FRN A;  3HFO A;  1Q82 C;  5FU7 B;  1SSH A;  3VYG A;  1JXM A;  3A8H B;  2KYB A;  4II1 A;  1QLY A;  2GQI A;  3DKM A;  2VWF A;  3M0T A;  5LJ3 j;  3QDR B;  1G3S A;  4PFZ A;  5C6S A;  5LJ5 e;  2CSI A;  5AYF A;  1UB4 A;  4C0D C;  2DTH A;  1X69 A;  2QTV A;  2YWW A;  4PL6 A;  5LJ5 g;  1TG0 A;  3I55 T;  1UTI A;  2K9G A;  2DL4 A;  4IUP A;  4A4K A;  4E7L A;  2L3Q A;  3OW2 A;  4A4E A;  2AKL A;  2E6N A;  2BZX A;  1C6V X;  4IUR A;  2OTJ T;  2ZPG B;  2DTO A;  1VQK T;  2P0P A;  2EJ9 A;  2ZPH B;  3CMA T;  4M78 G;  3VKI A;  1TU0 B;  3EFR A;  3VS6 A;  2O2O A;  2AHJ B;  3M0P A;  1ZUY A;  2EGE A;  2G6F X;  4WCI A;  3CC7 A;  1RAF B;  4J9F A;  2HQH A;  4J6Y A;  3EAE A;  5GAM h;  4M7D F;  3HRU A;  5LJ3 f;  2V26 A; 
#chains in the Genus database with same CATH homology
 3HPW A;  2EKO A;  5HK3 A;  5GAN 2;  4C92 C;  1MGQ A;  4DOV A;  3L2W A;  3JCM J;  5CO7 A;  1G5V A;  1YBY A;  4MZT A;  1FX7 A;  2M0O A;  2RO0 A;  3L2R A;  4J6W A;  1XQH A;  5GAN e;  2X4Y A;  3JCM X;  5LJ3 h;  3OYD A;  5GAN d;  1FWZ A;  3OYA A;  3S6W A;  3RES A;  3SWN C;  3CD6 T;  2PVO B;  5FLX E;  3FLG A;  1K9M C;  4M7A D;  4DA4 A;  1KG1 A;  4JLI A;  1X01 A;  4XQ3 A;  2M16 A;  4RG2 A;  2QQ9 A;  4BY6 B;  4IKF A;  1QW1 A;  2QQS A;  3QYG B;  2F5T X;  2XDP A;  2E6Z A;  3QYH B;  4HCC A;  4BY6 C;  3J81 E;  1JJ2 A;  3A8L B;  3MEA A;  3GNG A;  1VQP T;  1WPY A;  3OYE A;  2WSF E;  4X9D A;  4XU2 A;  3CXC A;  2EQJ A;  1G3W A;  5GAN 6;  5FU6 C;  3PIP A;  4C8Q F;  4M7D G;  4EMK A;  4BE1 A;  2EQK A;  1S72 T;  3PTA A;  1VIE A;  2LT4 A;  3JCM P;  2K5I A;  1VQO A;  2D0Q B;  2RHZ A;  1RL2 A;  4M78 C;  2RI3 A;  4C0G A;  3OYJ A;  2X4J A;  3CEY A;  3QKJ A;  3OYK A;  1M90 C;  4GLK A;  4M7A F;  1SSF A;  3A8M B;  1YIT T;  2RM4 A;  1M1K U;  2A3L A;  1BIA A;  2GQV A;  1I8F A;  4QW2 A;  3QPH A;  4C92 A;  1QP3 A;  2DD5 A;  3M55 A;  1G3Y A;  2D6F A;  4LDY A;  5J26 A;  3JCM Q;  3X28 B;  4Y91 A;  4M7A E;  4C92 D;  4C8Q A;  5HY6 A;  3E1S A;  1O9S A;  1M5Q 1;  3FB9 A;  2PU9 B;  5LJ3 d;  5I2M A;  1VQ5 T;  3VYH B;  2LQ8 A;  2XU8 A;  3Q1J A;  2GF7 A;  4C8Q D;  4XU1 A;  1UEB A;  2R57 A;  2RI5 A;  4J83 A;  5DM7 R;  5FRN A;  2XD0 A;  4BDZ A;  5GAM j;  5CAI A;  1NJI U;  1QVG A;  2K3X A;  3OYF A;  4C5H A;  4EDU A;  2OTJ A;  1NJI C;  2BUD A;  3P8D A;  2R58 A;  3HP9 A;  5I21 A;  1VQN T;  4BI3 A;  2ZZD A;  2XHC A;  5CIU A;  2KQW A;  4FT2 A;  3UWN A;  3CCM A;  1Q7Y C;  1VQP A;  1Y07 A;  4HT8 A;  2P0Q A;  4NS5 A;  5C0M A;  3BDL A;  3CCJ T;  1KHC A;  3OYG A;  2DEQ A;  4ZTJ A;  4M75 B;  2QA4 T;  4O6J A;  2L8D A;  1Q81 C;  5IAY A;  5FRM A;  4M75 G;  5IN1 A;  2LT1 A;  4FU6 A;  3CCS T;  5L8R E;  1BYM A;  2LTO A;  3M57 A;  4IUQ A;  4N4G A;  3UDC A;  3V8J A;  4EPC A;  5GAN 3;  3VV0 A;  3L2Z A;  4M78 D;  3OA6 A;  4C92 E;  3NTI A;  2FYK A;  1EIF A;  2PVD B;  4M77 F;  3MEU A;  4F7U A;  5DLO A;  3RKY A;  3BFM A;  3X24 B;  1YIT A;  3M59 A;  2EFI A;  3PT9 A;  1H3Z A;  1I4K 1;  3WXM B;  1I5L A;  4VUB A;  4OB0 B;  4OB1 B;  5GAM f;  1Q82 U;  4RMO A;  3QUI A;  3MEV A;  3OSV A;  4OP0 A;  5CKE A;  3CCE A;  4A4G A;  2DIQ A;  4JJN K;  5GAM e;  3OS1 A;  5GAN 4;  2E10 A;  1NPP A;  1U1T A;  1PSE A;  3DLL A;  4E7H A;  3CD6 A;  4MDW A;  1WQW A;  4BB7 A;  3M54 A;  4QQ6 A;  5GAO l;  5CQY A;  2IG0 A;  2JNG A;  4OVA A;  5EG2 A;  4C8Q C;  4QVD A;  4XTZ A;  2VGM A;  2JTF A;  4ZGJ B;  5GMK m;  2QTX A;  2CZ0 B;  2DJZ A;  2C06 A;  1H64 1;  3PGG A;  4FSX A;  2CS7 A;  5GMK e;  1VQL A;  4FIB A;  4RCB A;  4M75 C;  2YHT A;  3LLR A;  1KD1 U;  4KUI A;  4M77 D;  1NZ9 A;  2DO3 A;  5GAN j;  1BI0 A;  1XOV A;  3RMQ A;  3CPW S;  1QVG S;  2DXB A;  4UC4 A;  3I55 A;  4M77 A;  3R6O A;  1S72 A;  1Y7X A;  1BKB A;  2DTI A;  4EMK B;  2M9U A;  3MO8 A;  4A53 A;  3O8V A;  3RIR A;  5CVI A;  4IUV A;  4C8Q E;  3NTH A;  5GAM d;  1YI2 A;  3JB9 F;  4EMK C;  4DQ2 A;  2DXU A;  1AHJ B;  2HNI A;  3WVE B;  3OBW A;  1WJS A;  5GAN 7;  4MML A;  3KBG A;  3JB9 G;  3E9G A;  1PSF A;  3M9Q A;  1N9S A;  2Y4Y A;  4C92 G;  3HRS A;  3M53 A;  3VU3 C;  4GY5 A;  1VQ6 A;  3G7Z A;  4XTX A;  3A8G B;  4XU0 A;  1K8A C;  2XKO C;  5FRO A;  3OMC A;  4C8Q G;  3GF5 A;  1JRI A;  3M4G A;  4E47 A;  5CQX A;  3S3N A;  1KQ2 A;  2QXF A;  3QII A;  2YLB A;  4C8Q B;  2XDB A;  1G3T A;  3RMS A;  4A4H A;  2JVV A;  3DB4 A;  4XK8 E;  2K2V A;  2K57 A;  1KQS S;  3KXT A;  4C5E A;  2D9T A;  1GXI E;  2HBP A;  3LH0 A;  3URG A;  3OYB A;  3OB9 A;  3CXC S;  4E7K A;  2RHU A;  2WSE E;  4O5V A;  3CCL T;  3CME A;  3JCM W;  1VQ8 T;  2CGH A;  2QQR A;  2JTM A;  2G3R A;  4M7D C;  4PNO A;  1JJ2 S;  5LJ5 f;  3PMI A;  2VXF A;  4NL3 A;  3CCQ T;  2KVQ G;  4HCZ A;  2F5K A;  3P8B B;  1VQ4 T;  2PVG B;  3PNW C;  4M75 D;  4HCB A;  4C92 F;  2QA4 A;  2VC8 A;  4XAX B;  2EJF A;  3JRZ A;  3OYM A;  4M75 A;  3CC2 A;  1X6O A;  3DLM A;  2E12 A;  5LJ5 j;  4C0Z A;  1JBM A;  1DJ7 B;  1VQ6 T;  4L59 A;  1LOJ A;  4M78 B;  1K9M U;  1VQM A;  2M1H A;  1KC8 C;  1UGS B;  4J6X A;  4TVR A;  4BE2 A;  3CCR T;  2GFA A;  2QEX T;  2LDM A;  3V7R A;  4QVZ A;  1YHQ T;  2XDD A;  3CCU T;  2CZ6 B;  2JN0 A;  3NTK A;  4MDX A;  1Y71 A;  3HSB A;  1LJO A;  3QSU A;  3JCM V;  2E64 A;  2NLU A;  2EJG A;  4XTV A;  1YJN A;  2XID A;  4IUT A;  4M75 F;  1YJ9 A;  3ZEH A;  5GAO q;  1WNL A;  3GIB A;  4QVC A;  2KSS A;  4L6V 5;  4XTW A;  3CPW A;  3S3O A;  4BI4 A;  2WAC A;  5GAO n;  4F7U F;  2RJC A;  2RHI A;  5KE3 A;  1X75 C;  2EYQ A;  5CKH A;  3P8H A;  5LL6 S;  4MMK A;  1K73 U;  2HQX A;  2LCL A;  4M78 A;  5D6Y A;  4ZTF A;  3VUZ A;  1K73 C;  4M77 C;  3SB2 A;  2O4X A;  5CCA A;  5J39 A;  4ELZ C;  2V8I A;  1HK9 A;  5HKC A;  4Y28 E;  3LGL A;  3N5B B;  5GMK l;  3T9N A;  4XTU A;  2RHX A;  2OTL A;  4ATO A;  4ME7 A;  3CCE T;  2RD1 A;  3OYY A;  1OZ2 A;  1RI0 A;  2LQK A;  2PUO B;  1UGR B;  2VV5 A;  3OY9 A;  3G71 A;  1N9R A;  1BI3 A;  1HXD A;  3MP6 A;  5GMK j;  4BE0 A;  2ZPF B;  2E1H A;  4N0A C;  3BY7 A;  4J5Y A;  4ZGD B;  4BI8 B;  1VQM T;  1O75 A;  3QZ9 B;  5D6X A;  3CBO A;  1VUB A;  1M8V A;  3LYI A;  3MET A;  5IT9 E;  4FL6 A;  5GAN 8;  4HKE A;  3CCM T;  2R5A A;  3JB9 I;  3FDR A;  4JRQ A;  2X4X A;  4J7I A;  2A7Y A;  1YJN T;  3INZ A;  3JB9 D;  2O4X B;  4M7A A;  3C12 A;  3ER0 A;  3JSC A;  2E41 A;  4C5I A;  3LWI A;  2F69 A;  2X35 A;  4J8O A;  4ZN3 A;  1VQ7 T;  1M4Z A;  3JCM d;  3SWN B;  3UT1 A;  2K5F A;  4PLI A;  3MP8 A;  3AHU A;  4MZP A;  2RHY A;  5DLQ E;  5FU7 C;  4PJO F;  4M7D D;  2LNV A;  4LDV A;  1XNI A;  3FIF A;  2B8A A;  3SDZ A;  2L89 A;  5KE2 A;  5GMK i;  2RK2 A;  1Q7Y U;  1Y96 A;  3JCM b;  4M7D A;  4XTY A;  5A0D A;  2GFU A;  2KDS A;  3QJY A;  1QVP A;  4N4I A;  1IZ6 A;  3L2V A;  3OYC A;  1U1S A;  3TCJ A;  4LDX A;  5GAN 5;  2EWN A;  4BAC A;  5CKB A;  1Y96 B;  4N4H A;  5FU6 B;  4QQG A;  4LD6 A;  2GCX A;  4ZGE B;  1KHI A;  1OI1 A;  4JRK A;  1I81 A;  3OYH A;  5CR2 A;  2BKD N;  3M5A A;  4N0A A;  3RKX A;  4M75 E;  3G6E T;  4BD3 A;  3FEO A;  2PQW A;  4RKU E;  1M90 U;  3CCR A;  1N8R U;  5GAN f;  2QEX A;  2ZGW A;  3QJ6 A;  4FT4 A;  5J3B A;  1N8R C;  1VQ8 A;  3MCA B;  4ZN1 A;  3OYL A;  1LNX A;  4F7U E;  2KAF A;  3LW5 E;  4IUU A;  5LJ5 d;  5GAO m;  4C92 B;  2HAX A;  2FVU A;  3GPL A;  1KQS A;  1VQ4 A;  4MZM A;  5GAO r;  5KCH A;  2XK0 A;  1Q86 U;  2RA2 A;  3I56 A;  2VGN A;  1NE8 A;  1YI2 T;  2EQU A;  2DZ9 A;  4ELY C;  1UGQ B;  1MHN A;  4M78 F;  1BI2 A;  2EQM A;  3OS5 A;  2DKG A;  2V8K A;  4KUL A;  4PJO G;  4J7F A;  1KQ1 A;  1D3B A;  2CZ1 B;  3CC4 T;  2OAU A;  2RH2 A;  1OZ3 A;  1XTD A;  3HL8 A;  3WVD B;  3H6Z A;  3JCM f;  4F7U G;  1W2B S;  2VYT A;  2FL7 A;  2PUK B;  3VUB A;  5D6W A;  3CCU A;  3CBP A;  2OTL T;  2LCC A;  3HHT B;  3RUX A;  3TRE A;  2KY9 A;  3OYI A;  3C95 A;  3G4S A;  5GAM g;  2CZ7 B;  2CKK A;  2YRV A;  3SD4 A;  1Q86 C;  3QBY A;  2DK3 A;  2V8J A;  1VQ9 T;  3QO3 A;  5A2Q E;  4JDS A;  2QQB A;  4F7U B;  3G6E A;  3DB3 A;  5GAO p;  3JB9 J;  2EIF A;  3CCL A;  2DAQ A;  3GNF B;  3KUF A;  4FM4 B;  3L1A A;  3CMA A;  2K3Y A;  1QVF A;  1K8A U;  3CCQ A;  2XG8 D;  3PFS A;  1WJQ A;  1B34 A;  1D3B B;  1WQ7 A;  2MF2 A;  3MHX A;  3X20 B;  3GOX A;  5LJ5 h;  3C4S A;  1YIJ T;  5LJ3 g;  3CC2 T;  2JOY A;  2L5Q A;  4HA8 A;  4D6W A;  2YLC A;  4LDW A;  3CBM A;  2MMP A;  2RJF A;  1P92 A;  3QHS A;  3OS0 A;  3TU4 K;  1Q81 U;  1YCY A;  4V2S A;  4OMF B;  2DVE A;  5A0G A;  3CCV A;  5GMK h;  1VQO T;  1U8R A;  4LD9 K;  3JAM E;  5LJ3 e;  1IRE B;  2FB7 A;  1WJR A;  3HFN A;  3V8L A;  3G71 T;  4E7J A;  4PLL A;  2E65 A;  3BW1 A;  4P5N A;  5HK0 A;  4OB3 B;  3A8O B;  4CI0 C;  2RK1 A;  4M7D B;  2K4Y A;  2MWO A;  2K5L A;  3MEW A;  4A4F A;  1B34 B;  2DZC A;  1W4S A;  4YTL A;  3X26 B;  1YHQ A;  2I2L A;  3M58 A;  3L42 A;  4WF2 A;  3F70 A;  1QP2 A;  2P0K A;  2DPP B;  1N6A A;  2VUB A;  1M1G A;  3NFC A;  4JLG A;  1YJ9 T;  2XI9 A;  4PKC C;  2LC4 A;  3OYN A;  3L2Q A;  4JS4 A;  3ME9 A;  3HKS A;  4XU3 A;  4RG8 A;  2QI2 A;  2Y90 A;  4PJO A;  4Q5W A;  2MI6 A;  2E70 A;  3JCM h;  3OS2 A;  4B9X A;  3RER A;  2LX9 A;  4M7D E;  1KC8 U;  4X9C A;  2CYZ B;  3J80 E;  3H8Z A;  3LX7 A;  4DOW A;  1YJW A;  4PJO D;  5CKD A;  1ZBX A;  2ZPI B;  4PJO B;  4M77 E;  5KCO A;  4M78 E;  5A0L A;  1BI1 A;  3LGF A;  4R55 A;  1KD1 C;  2VXE A;  3PMT A;  2DIG A;  3PIO A;  4NL2 A;  3OW2 S;  3CCJ A;  4OGE A;  3MP1 A;  2O01 E;  4CRI A;  2Y4X A;  4B9W A;  4E7I A;  1FXX A;  2DXT A;  1JB0 E;  2RI2 A;  2HQE A;  4C5G A;  2X4W A;  3V7S A;  4R56 A;  3FJP A;  2BIV A;  3TEE A;  3L2U A;  5KH6 A;  2ZPE B;  2MWP A;  2P4T A;  2L3R A;  3OSS C;  2RJD A;  4RCC A;  2WSC E;  1V29 B;  2FHD A;  2MAM A;  4X34 A;  3OMG A;  4M7A B;  1VQK A;  3CC4 A;  4A54 A;  2XIC A;  1BIB A;  3FRN A;  3HFO A;  4JUV A;  1Q82 C;  5FU7 B;  3JCM c;  3ZBD A;  1M9S A;  1ZHI A;  4NOY A;  3E19 A;  3VJP A;  3E9F A;  2LRQ A;  1N27 A;  3LWH A;  2KMT A;  3VYG A;  3G4S T;  1M1F A;  1ZQ1 A;  3A8H B;  4OB2 B;  4II1 A;  2ZPB B;  5GAN g;  3DKM A;  3GLX A;  3SFM A;  4BDY A;  4M7A G;  3QG1 A;  3CC7 T;  3C94 A;  4Z02 A;  5LJ3 j;  3QDR B;  1G3S A;  2HD0 A;  1OYX A;  5C6S A;  5LJ5 e;  1VQ7 A;  3J7A F;  5AYF A;  2RJE A;  3M4Y A;  1UB4 A;  4LDU A;  3M56 A;  2DTH A;  4C0D C;  1NPR A;  4KBM B;  1YJW T;  4OGC A;  3EFS A;  4PJO C;  2H3J A;  2KK4 A;  3QZ5 B;  2QQA A;  3BDU A;  2LVM A;  4EMH A;  4PL6 A;  1UGP B;  5LJ5 g;  1YIJ A;  2IVW A;  3I55 T;  3JB9 H;  2E5Q A;  4QQD A;  2DXC A;  1VQ5 A;  4JRP A;  5CKF A;  3X25 B;  3QXE B;  3CCV T;  4M7A C;  4IUP A;  4A4K A;  4L5G A;  4E7L A;  2DD4 A;  4EMG A;  3OW2 A;  3V8K A;  4A4E A;  3GP8 A;  4OF1 A;  2E6N A;  1WGS A;  1W2B A;  1VQ9 A;  4BUG A;  4PJO E;  4IUR A;  4M77 B;  2OTJ T;  1TH7 A;  2ZPG B;  2DTO A;  5M9O A;  1M1K C;  2P0P A;  3UPU A;  1VQK T;  1VQN A;  1R8O B;  2EJ9 A;  2ZPH B;  5DY9 A;  3JCM e;  5GAN h;  4M78 G;  3CMA T;  3FC3 A;  4M77 G;  2EAY A;  3V7C A;  3VKI A;  4JRI A;  3ZFJ A;  3EFR A;  3SWN A;  2AHJ B;  4KUD K;  3OBY A;  3I56 T;  4C0F A;  3RKW A;  4C0D B;  3CPF A;  3CC7 A;  3CCS A;  4JS5 A;  2QDY B;  2R5M A;  2ZCF B;  2JZ2 A;  2JUF A;  1QVF S;  1VQL T;  4J6Y A;  3S3M A;  3EAE A;  5CK9 A;  3A5Z B;  5GAM h;  4KT0 E;  3JCM g;  3HRU A;  5I2S A;  3ASK A;  3CME T;  2RB6 A;  5LJ3 f;  3HRT A;  1VIF A;  4M7D F;  4HT9 A;  3OQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...