2QTXA

Crystal structure of an hfq-like protein from methanococcus jannaschii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1435
publication title An Hfq-like protein in archaea: Crystal structure and functional characterization of the Sm protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 13
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qtxA00
4M7AB 5GAN4 4M7AA 4J6YA 2EAYA 2DTHA 4M75D 1MGQA 5GAN8 4M7AF 4M75B 1JRIA 4F7UB 4PJOG 3SWNC 4M7DB 4C8QD 4M7DA 1M8VA 1N9RA 4M78G 3EFRA 2ZGWA 4NL2A 4NOYA 4XU2A 4C8QB 4F7UF 5GAN6 5GANd 5GAN5 4M7DF 4C8QF 2E41A 3JCMW 2DZ9A 5GMKl 3JCMQ 4XTVA 2DZCA 3V8JA 5GAOn 3QUIA 5GANh 3RIRA 3JCMc 3V8KA 5CAIA 4N0AA 2JN0A 5GMKm 5GAN7 1N9SA 2DXUA 2EJGA 5GAOm 3M4GA 4PJOC 2RA2A 4JLIA 2Y90A 3FJPA 1B34B 3SB2A 4C92B 5GAOp 4C92A 4QVDA 5DY9A 4C92F 4OP0A 1TH7A 4J5YA 4M77D 4M75E 4DQ2A 1I5LA 4M77C 4EMKC 2CGHA 3HFNA 5LJ3d 4XU1A 4F7UE 4M7DE 3BW1A 5GANe 3HFOA 3GIBA 3BFMA 3QHSA 2YLCA 4C8QE 3QSUA 4HT9A 1I81A 2K57A 3JCMJ 2DKGA 5GANj 5LJ3h 4NL3A 1KQ1A 4PNOA 4M75A 3JB9D 2I2LA 3SWNB 2YHTA 4M75F 2DJZA 3BDUA 3SWNA 4F7UA 5LJ5d 3JCMV 4C8QA 2EJFA 5GANf 3AHUA 5GAN3 1LNXA 4M7AG 4JRKA 2EWNA 3BY7A 5GAOl 2FB7A 4C92E 4JRIA 4M75G 1M5Q1 1BIAA 4MMKA 4XTZA 3V7SA 3JCMb 3JCMd 4M78C 4F7UG 5LJ3e 4M7DG 3RUXA 4C8QG 5GANg 5LJ3j 2E64A 3FIFA 3JCMh 5GAMd 1B34A 3QO3A 2DTOA 5GAMf 1U1TA 2FYKA 4M77B 4EMKB 5LJ5e 4A54A 4M77A 4EMKA 3V7RA 1I4K1 5GAMh 4J6XA 1U1SA 4M77F 2DTIA 4XQ3A 5LJ3f 5GMKh 5LJ5j 1WQ7A 4C92G 5GAOr 4EMHA 2VXEA 1X01A 4X9CA 4EMGA 3JCMe 2QTXA 3V8LA 3JB9F 2DXTA 5GAN2 5LJ5f 5LJ3g 2RB6A 4RCBA 1WQWA 3RKXA 4Y91A 3JB9H 5LJ5h 5GAMe 5I21A 1LOJA 4WF2A 4QVCA 3INZA 4PJOD 2E65A 5GMKe 2VC8A 3JB9I 4M78D 5GAMj 1KQ2A 4PJOB 4V2SA 4M78B 3JCMf 5LJ5g 5GMKj 1LJOA 4M77E 4M78F 3RKWA 3L2ZA 2EJ9A 4RCCA 1BIBA 4M7AD 4M7AC 2HNIA 4A53A 3JCMX 3JCMP 2RM4A 4M75C 4M7DD 3JCMg 4M7DC 2DVEA 1WNLA 2YLBA 4XTWA 4C8QC 3VU3C 4J6WA 4XTXA 4MMLA 1JBMA 1HK9A 3L1AA 5GAMg 1WPYA 3EFSA 2VXFA 1Y96B 4N0AC 1Y96A 4HT8A 4M77G 4PJOE 1H641 4HA8A 4M78E 1YCYA 4XU3A 3JB9J 2RD1A 2E10A 3FB9A 3RKYA 4XU0A 4X9DA 4C92D 4XTUA 5GAOq 2E1HA 4C92C 5GMKi 2DEQA 4M7AE 4PJOA 3PGGA 4JUVA 3RESA 3JB9G 4M78A 4PJOF 3RERA 1D3BB 1D3BA 3V7CA 1I8FA 1HXDA 3HSBA 4XTYA
chains in the Genus database with same CATH superfamily
2KXCA 4Z88A 1R77A 4L59A 4NOYA 2EQUA 2FL7A 2RQVA 2JTFA 2VUBA 3M57A 2LCLA 3M53A 2JZ2A 2CKKA 3FJPA 1B34B 4C0DB 4QVDA 4AFUC 1NYFA 4XU1A 3EHRA 3BW1A 4BI3A 1C0MA 4FYVB 1E7OA 4NL3A 1X69A 3JB9D 1TUGB 1T0HA 5I22A 1E6HA 2EYYA 2YUNA 5GANf 5CKFA 3OYEA 2CYZB 1Q82C 1M90U 1VQOT 4B9XA 2NLUA 2JMCA 3V7SA 3CD6Q 2RJCA 4KGXB 3E9FA 2HQHA 5GANg 2A28A 3JCMh 2YDLA 1B34A 1FMWA 2D6FA 3A98A 3A1PA 1P92A 5KE3A 4A54A 1VQ6A 2AKKA 3QBYA 3RMSA 3WVEB 5D6YA 4X9CA 2J05A 2K4YA 1D0XA 3PMTA 1LOJA 3CC2T 3DB3A 4HCKA 4TVRA 1KHIA 2DERA 3TU4K 2K3XA 3JCMP 3L2VA 3VV0A 1PD0A 2P84A 4XTXA 1BKBA 2J6KA 4RMOA 2BUDA 4HCCA 3ZL7C 2HMAA 5KE2A 2RD1A 2RH2A 2VB6A 1IRXA 1YWOA 3CCVA 3RERA 4XTYA 2F1LA 1K9MR 4GBQA 1GBQA 2OTLQ 4CRIA 1YHQA 3VYHB 2OTLT 4N4GA 1TSFA 3EGDB 1X43A 1Q86R 1UGVA 3I9QA 3HL8A 4FCYA 1X27A 1D0ZA 2MYSA 1G3YA 2RI5A 2F2WA 4JLIA 2M0YA 4J5YA 2NUPA 2RN8A 4AMCA 2YLCA 4C8QE 2HQEA 1A0NB 2DO3A 3VUBA 2EKOA 4ME7A 3HRTA 3BDUA 3HPWA 1K0SA 2CUDA 3AHUA 2CP0A 4YTLA 2RPNA 3EGDA 4C92E 3CCRQ 4DA4A 2HAXA 2JUFA 2YSQA 3MO8A 3PVLA 2OTJQ 2QDLA 4C0GA 3CCJT 2OTJT 5GJVB 4EMKA 5GAMh 2P0PA 5GMKh 1ZBXA 3I56Q 1RLPC 3LX7A 2YUOA 3V8LA 5LJ5f 4C0ZA 1VQ4A 1WHHA 4F14A 3CCQQ 1K0XA 4JDSA 4II1A 4WTOB 3CCQT 2M9UA 2PUKB 3FEOA 3CMEA 3INZA 4Z89A 3OS1A 5LJ5g 2XK0A 2KAFA 3MP6A 3MJXA 2CZ1B 2K7AA 2CS7A 2JM9A 1ZLMA 4M7DC 4XTWA 1YIJT 3L2QA 1LVKA 2KI7A 3NPFA 3EFSA 1VQKT 3MEVA 5D7UA 1H641 1AWJA 3CMAT 4C92D 4IURA 4HCBA 3PGGA 3KUFA 5EG2A 2AZSA 3QIIA 4M75D 4AT1B 3OBYA 1RUWA 4ZN1A 2Y4XA 4J9HA 2DZ9A 2XIDA 1JQQA 3JCMc 2D1XA 1AWXA 4FSSA 3TQ7P 2ATCB 3QDRB 1WXBA 2P0KA 4PLIA 3J81E 3M56A 3C94A 3QYHB 1VQNQ 1ZSZC 4N4HA 1CSKA 1OPLA 3E19A 2I2LA 2FPDA 3PTAA 1Q7YR 3H0FA 1N8RR 2EWNA 1K4US 1UEBA 2VV5A 2PVDB 1G5VA 5FU6C 3OYIA 1YJ9Q 2M0OA 3OY9A 2FYKA 2HBWA 4BE2A 3QZ5B 1VQPA 4NS5A 2JJ9A 2IIMA 5GAOr 4DEXA 2DL3A 3OW2S 2MPXC 2E12A 3ZEHA 4D8DA 5FLXE 2DNUA 2PTKA 3EH1A 2C0OA 5IXFA 2ESWA 1GXIE 2E6NA 5D6XA 1VQOA 2DXBA 1B07A 3EHQA 4M77E 4M78F 4B6MA 1IZ6A 3EG9B 4M7AD 1TS9A 2OX7A 1CKBA 2PUOB 2ZPBB 2K5IA 4M75C 2BIVA 1VYTA 2QDYB 4BY6C 3L1AA 4J9DA 4RTWA 3VS5A 3SD4A 2R5AA 1M2OA 4J7FA 2KE9A 2RHXA 4JJNK 4ZGDB 4KT0E 3P8DA 2A0FB 3M9QA 4E7SA 1M1FA 1U5SA 1TXQA 5CKHA 4BI4A 3CC2A 2MIOA 1WGSA 4E2FB 3GPLA 2GCXA 2DTHA 2EGEA 3CCEQ 4M7DB 3GOXA 2LDMA 4OMMA 4F7UF 3M55A 3OW2A 2CT3A 1V76A 1QVFS 2LQKA 1JO8A 2SRCA 3PFSA 5CAIA 2FEIA 2HL5C 5GAOm 2MOXA 1EZZB 2QI2A 2R57A 1W1FA 3SB2A 1ABOA 4EIKA 3VS2A 4M77D 1QCNA 1I5LA 1UHCA 1VQ7T 3QHSA 4A4KA 4ELZC 1H8KA 1KQ1A 5FU7C 3M0RA 3J80E 1D1BA 1NZ9A 3C0CA 1GCQA 4KBMB 5KYNA 1NPRA 3GF5A 4Y92A 3O8VA 5GAMf 5CQYA 3H0HA 3PE0A 2DX1A 2BZXA 2LP5A 2NUTB 1V29B 4RTZA 4A4FA 4ZGEB 5LJ3f 3ZBDA 4ATOA 1IHWA 5FRNA 1ZSZB 2FHDA 4C5GA 1KC8R 3MPUB 1QVFA 3S3MA 4K11A 3JB9F 2DXTA 5GAN2 2QK0A 1BK2A 5LJ3g 1QW1A 4IUQA 4XAXB 1S72Q 4PJOD 1UGSB 1IO6A 3PT9A 4OMPA 1PCXA 3QKJA 2MF2A 5FU6B 1OYXA 1BIBA 2EPDA 2E5KA 3REAB 5CK9A 4O6JA 1JXMA 2KT1A 2RO0A 4OMNA 5KCOA 4J6WA 1IGQA 3CQTA 3CCJA 3UA6A 4FW1A 1LPLA 1ZA2B 2ROTA 3OS0A 2L3PA 1UECA 1C6VX 3X20B 4C5IA 1SSHA 3MKDA 1QP3A 4XTUA 2J6FA 4CC3A 1GCPA 2IPOB 1D3BA 3HSBA 1WDXA 1WHLA 2QEXT 4J9CA 4M75B 3VRZA 4OMLA 5IT9E 2JTMA 1N9RA 2K6DA 5HK3A 1YFNA 5GAN5 5GANd 4AFQC 4BY6B 2E41A 1Q81C 2DZCA 1UGRB 4FYXB 2CDTA 1YIJA 3G4SA 4N0AA 1BCOA 2XG8D 1QLYA 1VQKA 4J9IA 5KYUB 1NJIC 4C92A 1PKTA 5DY9A 1GFCA 1KSWA 5D6WA 4GY5A 1FYNA 5GANj 1VQMQ 4L5GA 4M75A 2ZAEA 2PZ1A 4PKCC 2EJFA 2ZZDA 4J83A 1LNXA 4PJOC 1BYMA 2CREA 4M7DG 5IHNA 3DLMA 1NE8A 2RQTA 2DTOA 1B7TA 3V7RA 5I2SA 1Q82R 2KNBB 4JZ4A 2QXFA 4EMHA 1RL2A 1D1AA 3G71Q 1X6OA 3HKSA 5J3BA 3RKXA 2WSEE 3G71T 1OOTA 2RQWA 3O5ZA 2DYIA 4M78D 2COYA 1KD1C 4FM4B 1YI2Q 4MZMA 2EJ9A 3FRNA 4A53A 3E9GA 5L23A 4DBFA 3CMEQ 3VS1A 5LL6S 2DE0X 4PK4A 1WPYA 3CC4A 3CPWP 3OSVA 1YJWT 2DFUA 5GMKi 4DOWA 2ZPHB 2GGRA 2XMFA 4M7AA 5CVIA 1MGQA 2GQIA 3FC3A 4BE1A 2GNCA 2XDPA 1MMAA 3A8GB 3CCST 4C8QF 4DOVA 4ZTJA 4RTXA 1FMKA 2O01E 3NHNA 3G6ET 1KIKA 1MMDA 1R0BG 2CH4A 2R5MA 5CIUA 5GAOp 1XJWB 2L5QA 2VYTA 4C92F 2PNIA 1JU5C 2CGHA 4EMKC 5GANe 2LX9A 4GLKA 2FG0A 4M75F 3CCLQ 5LJ5d 4X1VA 2V8KA 2O4XA 2H3EB 2ZCFB 4J8OA 1VQ8A 4M75G 1M1GA 4M78C 4A4EA 1M90R 1OULA 1SG5A 2DL8A 4M77A 5HY6A 5A2QE 2XDBA 2L8DA 2DTIA 2KGTA 2YWWA 3P8HA 2JTEA 5LJ5j 1WQ7A 2D8HA 1VQ7A 1OV3A 4F04B 1OX9A 2HL3A 3JB9H 2DM1A 1WQWA 1VQPQ 2E65A 4PJOB 4R0KA 1BI1A 3CD6T 3RKWA 2CP5A 1ZHIA 1JBMA 5I11A 1O75A 2X4YA 2YRVA 3UA7A 3QDFA 4PJOA 1I8FA 3OYDA 1D09B 2BZYA 3M0UA 4J6YA 2CUBA 2LJ1A 1K8AU 4M7AF 2CZ7B 1JRIA 3QXEB 4PLLA 1PKSA 1VQLQ 3VS4A 1BBZA 3OS2A 3LWHA 1VQLT 2A3LA 3V8KA 2OAUA 5GMKm 2EJGA 2M51A 4LD9K 2DETA 4J9GA 1PNJA 3CCMA 3TSWA 4X34A 4OP0A 2RF0A 4ELYC 2LVMA 2NUPB 2HQXA 3JCMJ 1KG1A 2DVJA 2FVUA 1PRMC 3WXMB 2QEXA 1RLQC 2D0NA 8ATCB 3LH0A 4GLMA 4LN2A 4RTYA 4KH0B 1SPKA 2CSQA 1YITA 4LDXA 1N5ZA 3NMZC 2CT4A 2V8IA 3OYFA 2KROA 3I5SA 4EMKB 5LJ5e 4M77F 3HRSA 1JJ2P 1I07A 2DEUA 3TSZA 2NUZA 2RB6A 1WXUA 2AT1B 2IVWA 2X4WA 4IUTA 1U3OA 3OYBA 4M78B 1K73U 2COWA 3CCRT 3L2ZA 2PVOB 1VA7A 3GBQA 2RQRA 3I55Q 2WSCE 4LDUA 1WNLA 1TTHB 1Y57A 2RNAA 1VQ9A 3L2RA 3I56T 4AG2C 2EKHA 4JLGA 4RG8A 4E7LA 7AT1B 1M3AA 1K8AC 4JS5A 1TWBA 3NTHA 4OMOA 1IREB 2LJ3A 2EQMA 4ZN3A 3PIOA 4M78A 4PJOF 2CP6A 2HDAA 4IUUA 3E1SA 8AT1B 5GAN4 2ED0A 4QVZA 4OB2B 4F7UB 4PJOG 3ME9A 2RK2A 4C8QD 2LX7A 3EFRA 2ZGWA 4FYYB 3OB9A 2KDSA 4BI8B 2DIQA 3MP1A 3OMGA 2LQNA 3X28B 1C1AA 3CC7Q 2YUPA 1N9SA 1GCQC 1SHFA 4FL6A 3HP9A 1UJYA 2ECZA 2EYWA 4DEYA 2QA4Q 1VOMA 3CXCS 1YJWA 5LJ3d 4CI0C 2EBPA 2RQUA 2X3WD 1PD1A 3OYCA 2DKGA 1YCSB 2DBKA 4F7UA 3PMIA 1OZ3A 3DKMA 2C0TA 1G83A 2LJ0A 1YJNA 4LDWA 3M0PA 3CCSA 4JRIA 3LGLA 2PVGB 2XKOC 3RUXA 3VS3A 3L42A 3LLRA 5LJ3j 3LW5E 3H9NA 3G6EA 3NFCA 4J9EA 4QQDA 1G3SA 4OB3B 1H92A 3OYJA 2M1HA 2DPPB 1K73C 1VQNT 1HD3A 4OVAA 4QW2A 1EIFA 2HKQB 3RBBB 3RNJA 1KQ2A 1Q86C 1WXTA 2GF7A 3JCMf 3CCUQ 3CXCA 1AOJA 5IAYA 3CCUT 1BI3A 4IIOA 1YJ9T 3JCMg 2DVEA 3OYLA 4C8QC 5CO7A 4ZTFA 2MAMA 4N0AC 2E4HA 2ED1A 3FB9A 3FDRA 4XU0A 2MWOA 4C92C 4JUVA 2KVQG 2O9VA 1VQ5Q 1TU0B 2J06A 1VQ5T 1JEGA 3CD6A 1M2VA 2HEQA 4M78G 1NM7A 2DLPA 2JS2A 5KYXB 5C0MA 1AWOA 1HJDA 2LNHB 4VUBA 5FRMA 2EFIA 3QWYA 1QVGS 2CP3A 2JNGA 1M30A 1T0JA 1UDLA 3TVTA 2DIGA 3HFOA 1TG0A 3QSUA 1N6AA 2RJDA 3S3NA 3CCET 3SWNA 3EGUA 2XD0A 4OGEA 4C5EA 2JOYA 5KYXA 4OF1A 3EH2A 4HKEA 1T3SA 1PSFA 2D0QB 4LXCA 4XTZA 1GFDA 1RADB 4FSXA 4F7UG 1YN8A 5LJ3e 1M1KR 1OQKA 1AT1B 2FO0A 2ZPIB 2LT4A 2QQBA 1WJQA 2LQWA 4JJCA 1OPKA 1Q81U 1U1TA 1WLPB 3H0IA 4XQ3A 3C12A 1NLOC 5KYWA 3VKIA 2CH4W 1NJIU 2VXEA 1X01A 2EQJA 2PQWA 1W2BP 4J9BA 1VYVA 1Y7XA 5IN1A 2GFAA 2BKDN 2VC8A 2OTLA 2ZPGB 3SHWA 3R6OA 3UDCA 1QVGA 4RCCA 2JVVA 3EG0A 4M7AC 2LT1A 2I0NA 3BDLA 2JW4A 4PJJA 2HSPA 1YP5A 2BTTA 1HK9A 5GAMg 2MI6A 3IQLA 2YRDA 4BACA 2VKNA 2EW3A 1Y96A 1H3HA 2W0ZA 2QQSA 3RKYA 1VQ6Q 5GAOq 3RESA 1S72T 3JB9G 5AYFA 3LWIA 2A08A 1D3BB 2XU8A 3X24B 5FWBA 3X26B 2F5TX 1G3WA 4UC4A 3OYAA 5C6SA 4XK8E 3ER0A 5GJWB 4NL2A 5GAN6 4C8QB 1NBEB 1KD1U 2OTJA 4JRQA 1M3CA 4E7KA 3JCMW 2A36A 2P0QA 5FROA 1K1ZA 1DJ7B 3QWXX 5GANh 1PC0A 4RTTA 4A63B 3N5BB 1X2QA 4Z8AA 5GAN7 5M9OA 3I56A 4CC4B 2H3JA 2W10A 3FJ5A 2Y90A 4C92B 1HSQA 1TH7A 1AHJB 2HD0A 3GNFB 3CCQA 3L2UA 4M77C 1U8RA 2QGFB 2MMPA 4LDVA 3WVDB 4IIMA 3M58A 1KK7A 2DRMA 2YT6A 3CCVQ 4MDXA 4C8QA 2AIRB 1QVFP 3M5AA 3S3OA 3SFMA 3OQ5A 3VS7A 2RHIA 4LDYA 1KQSS 1WYXA 5FW9A 1TUCA 2HBPA 3VJPA 1MHNA 1YHQQ 2KMTA 2LCCA 1QMCA 1UJ0A 3J7AF 4ESRA 3CMAA 3M59A 1I4K1 1NEBA 1YITQ 1RI0A 1K76A 2FPFA 4EMGA 3D7SB 1VQMT 3OYGA 1IGUA 1OU8A 1QVPA 2QQRA 4ORZA 2JMAA 1QCOA 2E6ZA 4PJNA 3OSSC 2BE7D 2DXCA 2CP2A 3JV3A 1Y07A 4E47A 2XICA 1HYOA 1H3ZA 5FU7B 2ROLA 3M4YA 3UATA 4HT8A 3OYNA 1FWZA 1KQSA 1BU1A 1SRMA 1QWEA 2RI3A 2E3IA 1RAAB 2JM8A 1HXDA 2EGCA 2L89A 4KUIA 4M7AB 1YI2T 1VQ4Q 5KCHA 2DBMA 1WHKA 3M54A 1YJ9A 2SEMA 4XU2A 3CMET 4LUDA 5CQXA 2DL7A 1MV3A 3QUIA 3URGA 3L2WA 2GQVA 2MWPA 3CPFA 2DXUA 2L3QA 3M4GA 4ZGJB 3RMQA 1MNDA 2F5KA 5FWCA 1ZQ1A 4C5HA 2BZ8A 1NPPA 3QJYA 2JS0A 5CR2A 1VUBA 5IXBA 2DL5A 2K57A 3CEYA 1UGPB 3MHXA 1GBRA 3Q1JA 2LTOA 2X9HA 1ZA1B 4E7ZA 2O4XB 3EGXA 4DBRA 1JXOA 2AK5A 3NGPA 3G7ZA 1WJSA 1SKUB 3HRUA 4C8QG 4AG1C 1ACMB 3HHTB 1RAIB 3DB4A 1IB8A 2DK3A 4M77B 2F2XA 2FZCB 4J6XA 4KH1B 4CC2A 2O2OA 3MEAA 2FRYA 2LC4A 4C92G 2JT4A 2QTXA 3HTRA 4PFPA 3CCLT 1RABB 1E6GA 1NLPC 4ANJA 3CCEA 2OI3A 3EFOA 1I5OB 2KEAA 2DD5A 2X51A 4DBHA 4E7JA 5J39A 3REBB 4CC7A 2XHCA 3GP8A 3TCJA 2ABLA 1OI1A 1YWPA 1SEMA 3VRYA 3QG1A 4HCZA 1CKAA 1PG5B 4HVUA 4EPCA 4OMFB 3VYGA 1VQPT 3OMCA 3UF4A 1MNEA 5A0GA 1JJ2S 1SRLA 3MEUA 2VGMA 2VVKA 1K8AR 1VQOQ 4BUGA 2K3BA 5GMKl 1WI7A 3EAEA 1T3LA 1MMGA 3RIRA 2YRCA 2JN0A 4OMQA 1PWTA 2RA2A 2LZ6B 2YUQA 3KBGA 2RJEA 4RG2A 2G6FX 4M7DE 1S72A 2VWFA 4QQGA 1UHFA 1EX4A 4PNOA 4R56A 1B3QA 1KJWA 2QTVA 1OX8A 5CKBA 3JCMV 4LD6A 4M7AG 4JRKA 3CC2Q 1ZSGA 2FB7A 2X3XD 3JCMd 2EYXA 2Z0WA 4IUPA 2E70A 4F17A 3VUZA 3QO3A 1MUZA 3NTKA 2DF6A 2EQKA 1G8XA 3OA6A 9ATCB 4L6V5 1JJ2A 2CP7A 1ARKA 1WHJA 1BI0A 2X35A 3ZFJA 2FZGB 1XNIA 2QYZA 4KRTA 2ZPFB 3BE3A 2O31A 4D6WA 1K73R 1D0YA 1RAGB 4M7DD 1UGQB 2AKLA 4WCIA 2O88A 1IXDA 2B8AA 2J7IA 2M16A 3H41A 4KGVB 4M77G 3SDZA 2NYSA 5KYYB 1WFWA 1VQMA 1RAEB 1YNZA 1MMNA 2E1HA 2DEQA 1K9MU 2RI2A 2EVRA 2DL4A 3META 3T9NA 3THKA 1FX7A 1R0CB 4JJDA 1M90C 4PFOA 2IG0A 3SWNC 3I55T 3S6WA 1Q86U 1UFFA 1ZX6A 1M8MA 3A5ZB 4P5NA 2E5QA 1X6BA 5DLQE 2D9TA 5KYYA 4A4GA 3LYIA 2K5FA 1U06A 2L3RA 3CCJQ 1X75C 3G71A 4M75E 2KK4A 1NG2A 5LJ3h 4HVWA 2EYQA 1YI2A 2DJZA 2DYBA 1K9AA 4BDZA 4B9WA 2GBQA 4FT4A 2KQWA 3BY7A 4ZNXA 3VS6A 2DILA 1M5Q1 1BIAA 4FYWB 1QCFA 2EQIA 3CC7T 2DA9A 4PJMA 5GAMd 3ULRB 2QA4T 3A8HB 1YIJQ 3G4SQ 1MV0B 4QT7A 4OB1B 3G4ST 5HCKA 3U23A 5IHIA 1VQKQ 2RK1A 3JCMe 4HVVA 4Y91A 3CMAQ 3UWNA 3OYMA 3A8OB 4WF2A 1NYGA 4OGCA 5GAMj 1ZBJA 5IHKA 3ASKA 4J9FA 2K9GA 2VGNA 5GMKj 2XI9A 1RAFB 4Z02A 2HNIA 2A37A 1M27C 2KYBA 1VIFA 1G3TA 2LCSA 4N4IA 1TUDA 3VU3C 1OU9A 1SHGA 2F69A 2KYMA 1K9MC 2H8HA 2DAQA 2VXFA 1W4SA 3PIPA 2ZPEB 4XU3A 2EGAA 1AVZC 3CCLA 4M7AE 3VS0A 4RKUE 4E7HA 5DM7R 4M4ZA 6AT1B 3DLLA 1M2VB 2V1RA 4BDYA 5CKDA 5J26A 1RAHB 3SEMA 2QASA 2OJ2A 1W2BS 3RDVA 4MZTA 3V8JA 1V1CA 4BE0A 1Z9ZA 4LUEA 5GAOn 1SF9A 2NWMA 2KT8A 2K3YA 2LNVA 5CCAA 5ECAA 2E3HA 2DMOA 4Y28E 2KR3A 2QGGA 1WJRA 4DQ2A 1OEBA 3CC4Q 5KH6A 1Q7YU 3CC4T 2AZVA 3SWNB 2OAWA 2JXBA 1N8RU 4FIBA 1S1NA 3RR6A 1FMVA 5GAN3 4E7IA 2O9SA 5GAOl 4KUDK 2P4RA 2EYZA 3JCMb 4MMKA 2V8JA 3I5RA 1VYUA 1M3BA 5DLOA 2E64A 3CXCP 4C0FA 3EG2A 1PSEA 1WZOA 4LE9A 5KYWB 1Y71A 1EFNA 1Q81R 2G3RA 1LCKA 3H8ZA 1RI9A 4BD3A 1QP2A 3A8MB 1W2BA 2CZ6B 3CBOA 1G2BA 4RTUA 1WIEA 5AT1B 1NJIR 2F2VA 5GAMe 5I21A 4MDWA 4PFZA 3F70A 4D8KA 5GMKe 4OB0B 2LMJA 1VQLA 1M4ZA 4LNPA 2QG9B 3EG9A 3JCMX 3UT1A 3E2UA 2LQ8A 4BB7A 3QPHA 2RHZA 4IUVA 1W6XA 1VQ8Q 3LGFA 1VQ8T 4HXJA 1Y96B 4PJOE 1UUEA 4Q5WA 4HA8A 3JB9J 2E10A 1RACB 1UE9A 3C95A 4X9DA 3CBPA 1J3TA 1VQ7Q 2DJQA 3OS5A 4AFZC 4AFSC 1QWFA 1ZUUA 1KHCA 2GTJA 1N27A 4M7DA 1M8VA 1UG1A 1AZGB 3JAME 3JCMQ 3OW2P 1M1KU 2V1QA 2X4JA 1KD1R 1AD5A 1UB4A 1Q7YC 3P8BB 2GTOA 1N8RC 1VQ6T 4KGZB 3PNWC 3GIBA 3CCRA 1XQHA 2L0AA 1I0CA 4F16A 1OZ2A 3I55A 4PL6A 2RHUA 2P4TA 3FLGA 2M02A 1TOVA 3QZ9B 4FU6A 2VASA 4R55A 2FRWA 2V26A 1X2KA 1KFZA 3H6ZA 3LH5A 3R6NA 1QVGP 5HKCA 1KC8U 3JSCA 2NUTA 3JRZA 1W70A 5A0LA 1R8OB 2L2PA 3G1JA 1ZSZA 1YBYA 2K2VA 3C4SA 3CCMQ 3X25B 1ZUKA 4KULA 2QAZA 1O9SA 3CPWS 3CCMT 2FPEA 3CCVT 1Z9QA 3KXTA 1BI2A 2HZYA 4QVCA 3JB9I 2RMOA 3OBWA 5A0DA 1PHTA 4JPBW 2MK5A 1NEGA 1LJOA 2YXYA 2QEXQ 3EG1A 1WHGA 4DBQA 3CC7A 2L3SA 2RM4A 3EG3A 4JS4A 1YHQT 1IHVA 1Y0MA 2KXDA 2YLBA 4J7IA 2QA4A 4MMLA 1FXXA 1YITT 4QKUA 3QJ6A 1UTIA 5HK0A 2AHJB 2RHYA 2Y4YA 2GFUA 3I35A 4M78E 1YCYA 4QQ6A 5EC7A 4IKFA 4C0DC 5I2MA 1QKXA 3OYYA 2WSFE 4PJLA 2KY9A 1M1KC 1QKWA 2EAYA 5GAN8 3OYKA 4RUGA 2K79A 3M0QA 2MCNA 2X4XA 1QQJA 4M7DF 1AWWA 5CKEA 5IH2A 3PVQA 2QQ9A 3CPWA 4XTVA 4O5VA 2B86A 2CZ0B 3TEEA 4JRPA 1VQNA 4MZPA 3A8LB 3UPUA 2LRQA 2R58A 2XDDA 5KYUA 1GRIA 3MEWA 1M9SA 1WHMA 1VQ9Q 1PRLC 1GL5A 3HFNA 4F7UE 1VQ9T 2C06A 4HT9A 4EDUA 3BFMA 2RJFA 2DD4A 1I81A 2WACA 2DRKA 1VQ4T 3AT1B 3CCUA 2YHTA 1X6GA 1ZUYA 2J6OA 3EGXB 2KBTA 1KC8C 4E6RA 1WA7A 2ENMA 1F1BB 3CBMA 3FIFA 2K2MA 3NTIA 1WX6A 1Q82U 3M0TA 4RTVA 2KRSA 2QQAA 4FT2A 2C0IA 4A4HA 1U1SA 2BE9B 3GLXA 1Q95G 3KFVA 1AZEA 3MCAB 1ABQA 1VQ5A 4JJBA 2EIFA 1I1JA 1YJWQ 4RCBA 5LJ5h 1JB0E 3EFOB 1AEYA 4V2SA 1KQSP 2HCKA 2KSSA 5L8RE 1XTDA 3OYHA 3MP8A 2D8JA 2HKNA 3GNGA 1YJNQ 1YJNT 1XOVA 3CCSQ 2FZKB 1VIEA 2K5LA 1BB9A 1PM3A 3G6EQ 2CSIA 2KRMA 3TREA 2HSEB 2KRNA 2PU9B 3M0SA 4JZ3A 3QYGB 1D1CA 1BCMA 2A7YA 1SSFA 4FW2A 3V7CA 2COZA
chains in the Genus database with same CATH topology
2IG0A 1VQ5T 3CD6A 2QEXT 4M75B 4L59A 3SWNC 5IT9E 2JTMA 3I55T 3S6WA 1N9RA 4M78G 4NOYA 5HK3A 1Q86U 5GAN5 2EQUA 5GANd 4BY6B 2FL7A 2E41A 1Q81C 2JTFA 2DZCA 2VUBA 1UGRB 3A5ZB 3M57A 4P5NA 2E5QA 2LCLA 3M53A 1YIJA 3G4SA 4N0AA 5C0MA 5DLQE 2JZ2A 2D9TA 2XG8D 4A4GA 4VUBA 5FRMA 2CKKA 2EFIA 3LYIA 2K5FA 1VQKA 3FJPA 1NJIC 1B34B 4C0DB 4C92A 4QVDA 2L3RA 5DY9A 1X75C 3G71A 1QVGS 2JNGA 4M75E 4XU1A 2DIGA 2KK4A 3BW1A 3HFOA 4BI3A 3QSUA 1N6AA 5D6WA 2RJDA 4GY5A 5GANj 5LJ3h 3S3NA 4NL3A 2EYQA 1Q82C 4L5GA 4M75A 3JB9D 1YI2A 3CCET 2DJZA 3SWNA 2XD0A 4PKCC 4BDZA 4B9WA 2EJFA 2ZZDA 5GANf 3OYEA 4OGEA 5CKFA 2CYZB 4J83A 4C5EA 1LNXA 2JOYA 4FT4A 4B9XA 2KQWA 4OF1A 3BY7A 2NLUA 1VQOT 4HKEA 1PSFA 2D0QB 3V7SA 1M5Q1 1BIAA 4XTZA 4PJOC 1BYMA 4FSXA 2RJCA 4F7UG 3E9FA 5LJ3e 3CC7T 4M7DG 3DLMA 5GANg 2ZPIB 2LT4A 1NE8A 2QQBA 1WJQA 3JCMh 5GAMd 1B34A 2D6FA 2DTOA 1Q81U 1U1TA 1P92A 5KE3A 4A54A 2QA4T 3V7RA 5I2SA 1VQ6A 3A8HB 4XQ3A 3C12A 3QBYA 3RMSA 3WVEB 3VKIA 5D6YA 4OB1B 3G4ST 2QXFA 1NJIU 4EMHA 2VXEA 1X01A 4X9CA 2RK1A 1RL2A 3JCMe 2EQJA 1X6OA 2PQWA 2K4YA 3HKSA 5J3BA 3RKXA 2WSEE 4Y91A 3PMTA 3UWNA 3OYMA 3A8OB 3G71T 1LOJA 4WF2A 1Y7XA 4OGCA 2GFAA 2BKDN 5IN1A 2VC8A 2OTLA 4M78D 5GAMj 2ZPGB 3DB3A 3CC2T 3ASKA 1KD1C 4FM4B 4TVRA 2VGNA 3R6OA 5GMKj 3UDCA 1QVGA 4MZMA 2EJ9A 4RCCA 1KHIA 2XI9A 3TU4K 2JVVA 3FRNA 4Z02A 2HNIA 4A53A 4M7AC 2K3XA 3JCMP 3E9GA 3L2VA 1VIFA 3VV0A 2LT1A 1G3TA 4N4IA 5LL6S 3VU3C 3BDLA 4XTXA 1BKBA 2F69A 1HK9A 5GAMg 1K9MC 4RMOA 2BUDA 1WPYA 2DAQA 2MI6A 4HCCA 4BACA 3CC4A 2VXFA 1W4SA 5KE2A 3PIPA 1Y96A 2ZPEB 2QQSA 4XU3A 2RD1A 2RH2A 3RKYA 3OSVA 1YJWT 3CCLA 5GAOq 5GMKi 3CCVA 4M7AE 4DOWA 3RESA 1S72T 3JB9G 5AYFA 3LWIA 4RKUE 1D3BB 2XU8A 5DM7R 2ZPHB 4E7HA 3RERA 4XTYA 3X24B 3X26B 3DLLA 5CVIA 4M7AA 4BDYA 1MGQA 2F5TX 3FC3A 1G3WA 4UC4A 3OYAA 5C6SA 4XK8E 4BE1A 2XDPA 3ER0A 4NL2A 5GAN6 4C8QB 5CKDA 5J26A 4CRIA 1YHQA 1KD1U 3A8GB 3CCST 4C8QF 4JRQA 2OTJA 3VYHB 4DOVA 2P0QA 4E7KA 4N4GA 5FROA 3JCMW 1W2BS 2OTLT 4MZTA 3V8JA 4ZTJA 1DJ7B 5GAOn 4BE0A 5GANh 3N5BB 2O01E 3HL8A 5GAN7 3G6ET 5M9OA 3I56A 2K3YA 2LNVA 1G3YA 2H3JA 5CCAA 2RI5A 4JLIA 2Y90A 2R5MA 5CIUA 4C92B 5GAOp 2L5QA 2VYTA 4C92F 1TH7A 4J5YA 1AHJB 2HD0A 3GNFB 4Y28E 3CCQA 1WJRA 4DQ2A 3L2UA 4M77C 4EMKC 2CGHA 1U8RA 2MMPA 5GANe 4LDVA 2YLCA 4C8QE 3WVDB 2LX9A 5KH6A 1Q7YU 2HQEA 4GLKA 3CC4T 3M58A 2DO3A 3VUBA 2EKOA 4ME7A 3SWNB 3HRTA 4M75F 3BDUA 1N8RU 3HPWA 4FIBA 5LJ5d 4MDXA 4C8QA 2V8KA 3M5AA 3AHUA 4YTLA 5GAN3 3SFMA 3S3OA 2O4XA 2ZCFB 4E7IA 4J8OA 5GAOl 4KUDK 3OQ5A 4C92E 4DA4A 2RHIA 4M75G 4LDYA 3JCMb 4MMKA 1VQ8A 2V8JA 1KQSS 1M1GA 4M78C 4A4EA 2HAXA 2JUFA 3MO8A 2HBPA 3VJPA 5DLOA 2E64A 1MHNA 2KMTA 2LCCA 3J7AF 4C0GA 4C0FA 3CMAA 3CCJT 2OTJT 3M59A 4M77A 5HY6A 1I4K1 4EMKA 5GAMh 5A2QE 2L8DA 1PSEA 2DTIA 2XDBA 2P0PA 3P8HA 5GMKh 5LJ5j 1Y71A 1ZBXA 1RI0A 2G3RA 3H8ZA 1WQ7A 3LX7A 1VQ7A 4BD3A 1QP2A 4EMGA 3A8MB 1W2BA 3V8LA 1VQMT 3OYGA 2CZ6B 4C0ZA 3CBOA 5LJ5f 1VQ4A 4JDSA 4II1A 1WQWA 3JB9H 5GAMe 3CCQT 5I21A 2M9UA 1QVPA 2PUKB 3FEOA 4MDWA 3INZA 3F70A 2E65A 2QQRA 5GMKe 4OB0B 4PJOB 1BI1A 3OS1A 5LJ5g 1VQLA 3CD6T 3RKWA 2XK0A 1M4ZA 2E6ZA 2KAFA 3MP6A 3JCMX 2CZ1B 3OSSC 3UT1A 2LQ8A 2CS7A 4BB7A 3QPHA 2RHZA 4IUVA 4M7DC 4XTWA 1ZHIA 2DXCA 3LGFA 1Y07A 4E47A 2XICA 1YIJT 3L2QA 1JBMA 1VQ8T 1H3ZA 5FU7B 1O75A 2X4YA 3EFSA 3M4YA 1VQKT 1Y96B 4PJOE 4HT8A 3MEVA 4Q5WA 2YRVA 1H641 4HA8A 3OYNA 3JB9J 1FWZA 2E10A 1KQSA 3C95A 2RI3A 3CBPA 4X9DA 4C92D 4IURA 3CMAT 4HCBA 4PJOA 3PGGA 3KUFA 5EG2A 3OS5A 1I8FA 1HXDA 2L89A 3OYDA 4KUIA 4M7AB 1YI2T 4J6YA 5KCHA 3QIIA 1K8AU 4M75D 4M7AF 2CZ7B 1JRIA 1KHCA 3OBYA 3QXEB 1N27A 4ZN1A 4M7DA 1M8VA 2Y4XA 3M54A 1YJ9A 4XU2A 4PLLA 3CMET 3JAME 5CQXA 2DZ9A 2XIDA 3JCMQ 3OS2A 1M1KU 3LWHA 1VQLT 2A3LA 3QUIA 3URGA 2X4JA 3JCMc 3V8KA 2GQVA 2MWPA 2OAUA 3L2WA 5GMKm 3CPFA 2DXUA 1UB4A 2EJGA 1Q7YC 3P8BB 3M4GA 3QDRB 4LD9K 4ZGJB 3CCMA 3RMQA 2P0KA 4PLIA 1N8RC 1VQ6T 2F5KA 4X34A 4OP0A 3J81E 3M56A 1ZQ1A 4C5HA 4ELYC 2LVMA 3PNWC 1NPPA 3C94A 3QJYA 5CR2A 1VUBA 2HQXA 3GIBA 3QYHB 3CCRA 2K57A 4N4HA 1XQHA 3JCMJ 1KG1A 2FVUA 3CEYA 1UGPB 3E19A 2I2LA 3MHXA 3Q1JA 2LTOA 3WXMB 3PTAA 2QEXA 1OZ2A 3LH0A 3I55A 2O4XB 4PL6A 2EWNA 3G7ZA 2RHUA 1UEBA 2P4TA 1YITA 2VV5A 4LDXA 2PVDB 1WJSA 3FLGA 1G5VA 3QZ9B 3HRUA 5FU6C 4FU6A 4C8QG 4R55A 3HHTB 3OYIA 2M0OA 3DB4A 3H6ZA 3OY9A 2V8IA 3OYFA 5HKCA 2DK3A 2FYKA 4M77B 3JSCA 4EMKB 5LJ5e 1KC8U 4BE2A 3JRZA 4J6XA 4M77F 3QZ5B 5A0LA 1VQPA 1R8OB 3MEAA 4NS5A 2LC4A 1YBYA 3HRSA 4C92G 5GAOr 2K2VA 3C4SA 3OW2S 3X25B 2QTXA 2E12A 3ZEHA 4KULA 3CCLT 3CPWS 1O9SA 5FLXE 3CCMT 3CCVT 2RB6A 3CCEA 3KXTA 1BI2A 2IVWA 2X4WA 4QVCA 1GXIE 4IUTA 2E6NA 5A0DA 3OBWA 3JB9I 3OYBA 1K73U 4M78B 5D6XA 1VQOA 2DD5A 2DXBA 3CCRT 1LJOA 4M77E 4M78F 3L2ZA 2PVOB 1IZ6A 4E7JA 4M7AD 3CC7A 2PUOB 4JS4A 2RM4A 5J39A 1YHQT 2ZPBB 2K5IA 4M75C 2WSCE 2XHCA 4LDUA 1WNLA 2YLBA 4J7IA 3TCJA 2BIVA 3GP8A 2QDYB 2QA4A 4BY6C 4MMLA 3L2RA 1FXXA 1VQ9A 3L1AA 1YITT 3I56T 1OI1A 3QJ6A 3QG1A 4HCZA 5HK0A 4JLGA 2AHJB 4RG8A 2RHYA 3SD4A 4E7LA 2Y4YA 2GFUA 4M78E 1YCYA 1K8AC 4JS5A 2R5AA 3NTHA 4J7FA 2RHXA 1IREB 4QQ6A 4EPCA 4ZGDB 4JJNK 4IKFA 4KT0E 3P8DA 2EQMA 4ZN3A 3M9QA 4OMFB 4C0DC 3VYGA 5I2MA 1M1FA 3PIOA 1VQPT 4M78A 4PJOF 5CKHA 3OYYA 4IUUA 2WSFE 4BI4A 2KY9A 3E1SA 3OMCA 1M1KC 3CC2A 1WGSA 5GAN4 3GPLA 2EAYA 2GCXA 2DTHA 5GAN8 5A0GA 3OYKA 4QVZA 4OB2B 1JJ2S 4F7UB 4PJOG 3ME9A 4M7DB 2RK2A 4C8QD 3GOXA 2LDMA 2VGMA 2X4XA 3EFRA 2ZGWA 3M55A 3MEUA 4F7UF 3OW2A 4M7DF 1QVFS 3OB9A 4BUGA 5CKEA 2KDSA 2QQ9A 4BI8B 3CPWA 5GMKl 2DIQA 4XTVA 3MP1A 3OMGA 4O5VA 3EAEA 2LQKA 3X28B 3RIRA 2CZ0B 3PFSA 3TEEA 5CAIA 2JN0A 4JRPA 1VQNA 1N9SA 4MZPA 3A8LB 3UPUA 2LRQA 5GAOm 4FL6A 2R58A 2QI2A 2R57A 3HP9A 2RA2A 3SB2A 2XDDA 3MEWA 1M9SA 3KBGA 3CXCS 4M77D 1YJWA 2RJEA 1I5LA 4RG2A 3HFNA 5LJ3d 4F7UE 1VQ9T 2C06A 4M7DE 4HT9A 4EDUA 4CI0C 1VQ7T 3BFMA 3QHSA 1S72A 4A4KA 2RJFA 2DD4A 1I81A 2WACA 4QQGA 4ELZC 2DKGA 3OYCA 1VQ4T 1KQ1A 4PNOA 4R56A 3CCUA 5FU7C 2YHTA 4F7UA 3PMIA 1OZ3A 3DKMA 5CKBA 3JCMV 1M90U 1YJNA 4LDWA 3J80E 4LD6A 4M7AG 4JRKA 1KC8C 2FB7A 3CCSA 4JRIA 3LGLA 1NZ9A 3JCMd 2PVGB 4KBMB 2XKOC 3RUXA 1NPRA 3GF5A 3L42A 3LLRA 4IUPA 3CBMA 2E70A 3FIFA 3LW5E 5LJ3j 3G6EA 3VUZA 3NTIA 3QO3A 3O8VA 3NFCA 1Q82U 5GAMf 5CQYA 3NTKA 2QQAA 4FT2A 4A4HA 1V29B 2EQKA 4A4FA 1U1SA 4ZGEB 4QQDA 5LJ3f 4L6V5 3ZBDA 1G3SA 3GLXA 3OA6A 4OB3B 1JJ2A 5FRNA 4ATOA 2FHDA 3OYJA 2M1HA 2DPPB 1K73C 3MCAB 4C5GA 1VQNT 1QVFA 3S3MA 4OVAA 1VQ5A 3JB9F 2DXTA 2EIFA 5GAN2 5LJ3g 1QW1A 4RCBA 4QW2A 1JB0E 1BI0A 1EIFA 4IUQA 5LJ5h 2X35A 4XAXB 3ZFJA 4PJOD 1UGSB 1XNIA 1KQ2A 4V2SA 1Q86C 3PT9A 2GF7A 3JCMf 2ZPFB 3QKJA 2MF2A 5FU6B 2KSSA 3CXCA 1OYXA 1BIBA 3CCUT 5IAYA 1BI3A 5L8RE 1XTDA 4O6JA 4D6WA 5CK9A 3MP8A 3GNGA 3OYHA 1YJ9T 2RO0A 1YJNT 1XOVA 3JCMg 4M7DD 2DVEA 3OYLA 1UGQB 5KCOA 4C8QC 4J6WA 5CO7A 3CCJA 1VIEA 3CMEA 4ZTFA 2K5LA 2B8AA 2MAMA 2M16A 3OS0A 4N0AC 4M77G 3TREA 3X20B 3SDZA 4C5IA 3FB9A 3FDRA 4XU0A 1VQMA 2MWOA 1QP3A 2PU9B 4XTUA 2E1HA 4C92C 2DEQA 3QYGB 4JUVA 2RI2A 1K9MU 2A7YA 1SSFA 2KVQG 3META 3T9NA 1D3BA 1FX7A 3V7CA 1M90C 3HSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  5GAN 4;  4M7A A;  4J6Y A;  2EAY A;  2DTH A;  4M75 D;  1MGQ A;  5GAN 8;  4M7A F;  4M75 B;  1JRI A;  4F7U B;  4PJO G;  3SWN C;  4M7D B;  4C8Q D;  4M7D A;  1M8V A;  1N9R A;  4M78 G;  3EFR A;  2ZGW A;  4NL2 A;  4NOY A;  4XU2 A;  4C8Q B;  4F7U F;  5GAN 6;  5GAN d;  5GAN 5;  4M7D F;  4C8Q F;  2E41 A;  3JCM W;  2DZ9 A;  5GMK l;  3JCM Q;  4XTV A;  2DZC A;  3V8J A;  5GAO n;  3QUI A;  5GAN h;  3RIR A;  3JCM c;  3V8K A;  5CAI A;  4N0A A;  2JN0 A;  5GMK m;  5GAN 7;  1N9S A;  2DXU A;  2EJG A;  5GAO m;  3M4G A;  4PJO C;  2RA2 A;  4JLI A;  2Y90 A;  3FJP A;  1B34 B;  3SB2 A;  4C92 B;  5GAO p;  4C92 A;  4QVD A;  5DY9 A;  4C92 F;  4OP0 A;  1TH7 A;  4J5Y A;  4M77 D;  4M75 E;  4DQ2 A;  1I5L A;  4M77 C;  4EMK C;  2CGH A;  3HFN A;  5LJ3 d;  4XU1 A;  4F7U E;  4M7D E;  3BW1 A;  5GAN e;  3HFO A;  3GIB A;  3BFM A;  3QHS A;  2YLC A;  4C8Q E;  3QSU A;  4HT9 A;  1I81 A;  2K57 A;  3JCM J;  2DKG A;  5GAN j;  5LJ3 h;  4NL3 A;  1KQ1 A;  4PNO A;  4M75 A;  3JB9 D;  2I2L A;  3SWN B;  2YHT A;  4M75 F;  2DJZ A;  3BDU A;  3SWN A;  4F7U A;  5LJ5 d;  3JCM V;  4C8Q A;  2EJF A;  5GAN f;  3AHU A;  5GAN 3;  1LNX A;  4M7A G;  4JRK A;  2EWN A;  3BY7 A;  5GAO l;  2FB7 A;  4C92 E;  4JRI A;  4M75 G;  1M5Q 1;  1BIA A;  4MMK A;  4XTZ A;  3V7S A;  3JCM b;  3JCM d;  4M78 C;  4F7U G;  5LJ3 e;  4M7D G;  3RUX A;  4C8Q G;  5GAN g;  5LJ3 j;  2E64 A;  3FIF A;  3JCM h;  5GAM d;  1B34 A;  3QO3 A;  2DTO A;  5GAM f;  1U1T A;  2FYK A;  4M77 B;  4EMK B;  5LJ5 e;  4A54 A;  4M77 A;  4EMK A;  3V7R A;  1I4K 1;  5GAM h;  4J6X A;  1U1S A;  4M77 F;  2DTI A;  4XQ3 A;  5LJ3 f;  5GMK h;  5LJ5 j;  1WQ7 A;  4C92 G;  5GAO r;  4EMH A;  2VXE A;  1X01 A;  4X9C A;  4EMG A;  3JCM e;  2QTX A;  3V8L A;  3JB9 F;  2DXT A;  5GAN 2;  5LJ5 f;  5LJ3 g;  2RB6 A;  4RCB A;  1WQW A;  3RKX A;  4Y91 A;  3JB9 H;  5LJ5 h;  5GAM e;  5I21 A;  1LOJ A;  4WF2 A;  4QVC A;  3INZ A;  4PJO D;  2E65 A;  5GMK e;  2VC8 A;  3JB9 I;  4M78 D;  5GAM j;  1KQ2 A;  4PJO B;  4V2S A;  4M78 B;  3JCM f;  5LJ5 g;  5GMK j;  1LJO A;  4M77 E;  4M78 F;  3RKW A;  3L2Z A;  2EJ9 A;  4RCC A;  1BIB A;  4M7A D;  4M7A C;  2HNI A;  4A53 A;  3JCM X;  3JCM P;  2RM4 A;  4M75 C;  4M7D D;  3JCM g;  4M7D C;  2DVE A;  1WNL A;  2YLB A;  4XTW A;  4C8Q C;  3VU3 C;  4J6W A;  4XTX A;  4MML A;  1JBM A;  1HK9 A;  3L1A A;  5GAM g;  1WPY A;  3EFS A;  2VXF A;  1Y96 B;  4N0A C;  1Y96 A;  4HT8 A;  4M77 G;  4PJO E;  1H64 1;  4HA8 A;  4M78 E;  1YCY A;  4XU3 A;  3JB9 J;  2RD1 A;  2E10 A;  3FB9 A;  3RKY A;  4XU0 A;  4X9D A;  4C92 D;  4XTU A;  5GAO q;  2E1H A;  4C92 C;  5GMK i;  2DEQ A;  4M7A E;  4PJO A;  3PGG A;  4JUV A;  3RES A;  3JB9 G;  4M78 A;  4PJO F;  3RER A;  1D3B B;  1D3B A;  3V7C A;  1I8F A;  1HXD A;  3HSB A;  4XTY A; 
#chains in the Genus database with same CATH topology
 2KXC A;  4Z88 A;  1R77 A;  4L59 A;  4NOY A;  2EQU A;  2FL7 A;  2RQV A;  2JTF A;  2VUB A;  3M57 A;  2LCL A;  3M53 A;  2JZ2 A;  2CKK A;  3FJP A;  1B34 B;  4C0D B;  4QVD A;  4AFU C;  1NYF A;  4XU1 A;  3EHR A;  3BW1 A;  4BI3 A;  1C0M A;  4FYV B;  1E7O A;  4NL3 A;  1X69 A;  3JB9 D;  1TUG B;  1T0H A;  5I22 A;  1E6H A;  2EYY A;  2YUN A;  5GAN f;  5CKF A;  3OYE A;  2CYZ B;  1Q82 C;  1M90 U;  1VQO T;  4B9X A;  2NLU A;  2JMC A;  3V7S A;  3CD6 Q;  2RJC A;  4KGX B;  3E9F A;  2HQH A;  5GAN g;  2A28 A;  3JCM h;  2YDL A;  1B34 A;  1FMW A;  2D6F A;  3A98 A;  3A1P A;  1P92 A;  5KE3 A;  4A54 A;  1VQ6 A;  2AKK A;  3QBY A;  3RMS A;  3WVE B;  5D6Y A;  4X9C A;  2J05 A;  2K4Y A;  1D0X A;  3PMT A;  1LOJ A;  3CC2 T;  3DB3 A;  4HCK A;  4TVR A;  1KHI A;  2DER A;  3TU4 K;  2K3X A;  3JCM P;  3L2V A;  3VV0 A;  1PD0 A;  2P84 A;  4XTX A;  1BKB A;  2J6K A;  4RMO A;  2BUD A;  4HCC A;  3ZL7 C;  2HMA A;  5KE2 A;  2RD1 A;  2RH2 A;  2VB6 A;  1IRX A;  1YWO A;  3CCV A;  3RER A;  4XTY A;  2F1L A;  1K9M R;  4GBQ A;  1GBQ A;  2OTL Q;  4CRI A;  1YHQ A;  3VYH B;  2OTL T;  4N4G A;  1TSF A;  3EGD B;  1X43 A;  1Q86 R;  1UGV A;  3I9Q A;  3HL8 A;  4FCY A;  1X27 A;  1D0Z A;  2MYS A;  1G3Y A;  2RI5 A;  2F2W A;  4JLI A;  2M0Y A;  4J5Y A;  2NUP A;  2RN8 A;  4AMC A;  2YLC A;  4C8Q E;  2HQE A;  1A0N B;  2DO3 A;  3VUB A;  2EKO A;  4ME7 A;  3HRT A;  3BDU A;  3HPW A;  1K0S A;  2CUD A;  3AHU A;  2CP0 A;  4YTL A;  2RPN A;  3EGD A;  4C92 E;  3CCR Q;  4DA4 A;  2HAX A;  2JUF A;  2YSQ A;  3MO8 A;  3PVL A;  2OTJ Q;  2QDL A;  4C0G A;  3CCJ T;  2OTJ T;  5GJV B;  4EMK A;  5GAM h;  2P0P A;  5GMK h;  1ZBX A;  3I56 Q;  1RLP C;  3LX7 A;  2YUO A;  3V8L A;  5LJ5 f;  4C0Z A;  1VQ4 A;  1WHH A;  4F14 A;  3CCQ Q;  1K0X A;  4JDS A;  4II1 A;  4WTO B;  3CCQ T;  2M9U A;  2PUK B;  3FEO A;  3CME A;  3INZ A;  4Z89 A;  3OS1 A;  5LJ5 g;  2XK0 A;  2KAF A;  3MP6 A;  3MJX A;  2CZ1 B;  2K7A A;  2CS7 A;  2JM9 A;  1ZLM A;  4M7D C;  4XTW A;  1YIJ T;  3L2Q A;  1LVK A;  2KI7 A;  3NPF A;  3EFS A;  1VQK T;  3MEV A;  5D7U A;  1H64 1;  1AWJ A;  3CMA T;  4C92 D;  4IUR A;  4HCB A;  3PGG A;  3KUF A;  5EG2 A;  2AZS A;  3QII A;  4M75 D;  4AT1 B;  3OBY A;  1RUW A;  4ZN1 A;  2Y4X A;  4J9H A;  2DZ9 A;  2XID A;  1JQQ A;  3JCM c;  2D1X A;  1AWX A;  4FSS A;  3TQ7 P;  2ATC B;  3QDR B;  1WXB A;  2P0K A;  4PLI A;  3J81 E;  3M56 A;  3C94 A;  3QYH B;  1VQN Q;  1ZSZ C;  4N4H A;  1CSK A;  1OPL A;  3E19 A;  2I2L A;  2FPD A;  3PTA A;  1Q7Y R;  3H0F A;  1N8R R;  2EWN A;  1K4U S;  1UEB A;  2VV5 A;  2PVD B;  1G5V A;  5FU6 C;  3OYI A;  1YJ9 Q;  2M0O A;  3OY9 A;  2FYK A;  2HBW A;  4BE2 A;  3QZ5 B;  1VQP A;  4NS5 A;  2JJ9 A;  2IIM A;  5GAO r;  4DEX A;  2DL3 A;  3OW2 S;  2MPX C;  2E12 A;  3ZEH A;  4D8D A;  5FLX E;  2DNU A;  2PTK A;  3EH1 A;  2C0O A;  5IXF A;  2ESW A;  1GXI E;  2E6N A;  5D6X A;  1VQO A;  2DXB A;  1B07 A;  3EHQ A;  4M77 E;  4M78 F;  4B6M A;  1IZ6 A;  3EG9 B;  4M7A D;  1TS9 A;  2OX7 A;  1CKB A;  2PUO B;  2ZPB B;  2K5I A;  4M75 C;  2BIV A;  1VYT A;  2QDY B;  4BY6 C;  3L1A A;  4J9D A;  4RTW A;  3VS5 A;  3SD4 A;  2R5A A;  1M2O A;  4J7F A;  2KE9 A;  2RHX A;  4JJN K;  4ZGD B;  4KT0 E;  3P8D A;  2A0F B;  3M9Q A;  4E7S A;  1M1F A;  1U5S A;  1TXQ A;  5CKH A;  4BI4 A;  3CC2 A;  2MIO A;  1WGS A;  4E2F B;  3GPL A;  2GCX A;  2DTH A;  2EGE A;  3CCE Q;  4M7D B;  3GOX A;  2LDM A;  4OMM A;  4F7U F;  3M55 A;  3OW2 A;  2CT3 A;  1V76 A;  1QVF S;  2LQK A;  1JO8 A;  2SRC A;  3PFS A;  5CAI A;  2FEI A;  2HL5 C;  5GAO m;  2MOX A;  1EZZ B;  2QI2 A;  2R57 A;  1W1F A;  3SB2 A;  1ABO A;  4EIK A;  3VS2 A;  4M77 D;  1QCN A;  1I5L A;  1UHC A;  1VQ7 T;  3QHS A;  4A4K A;  4ELZ C;  1H8K A;  1KQ1 A;  5FU7 C;  3M0R A;  3J80 E;  1D1B A;  1NZ9 A;  3C0C A;  1GCQ A;  4KBM B;  5KYN A;  1NPR A;  3GF5 A;  4Y92 A;  3O8V A;  5GAM f;  5CQY A;  3H0H A;  3PE0 A;  2DX1 A;  2BZX A;  2LP5 A;  2NUT B;  1V29 B;  4RTZ A;  4A4F A;  4ZGE B;  5LJ3 f;  3ZBD A;  4ATO A;  1IHW A;  5FRN A;  1ZSZ B;  2FHD A;  4C5G A;  1KC8 R;  3MPU B;  1QVF A;  3S3M A;  4K11 A;  3JB9 F;  2DXT A;  5GAN 2;  2QK0 A;  1BK2 A;  5LJ3 g;  1QW1 A;  4IUQ A;  4XAX B;  1S72 Q;  4PJO D;  1UGS B;  1IO6 A;  3PT9 A;  4OMP A;  1PCX A;  3QKJ A;  2MF2 A;  5FU6 B;  1OYX A;  1BIB A;  2EPD A;  2E5K A;  3REA B;  5CK9 A;  4O6J A;  1JXM A;  2KT1 A;  2RO0 A;  4OMN A;  5KCO A;  4J6W A;  1IGQ A;  3CQT A;  3CCJ A;  3UA6 A;  4FW1 A;  1LPL A;  1ZA2 B;  2ROT A;  3OS0 A;  2L3P A;  1UEC A;  1C6V X;  3X20 B;  4C5I A;  1SSH A;  3MKD A;  1QP3 A;  4XTU A;  2J6F A;  4CC3 A;  1GCP A;  2IPO B;  1D3B A;  3HSB A;  1WDX A;  1WHL A;  2QEX T;  4J9C A;  4M75 B;  3VRZ A;  4OML A;  5IT9 E;  2JTM A;  1N9R A;  2K6D A;  5HK3 A;  1YFN A;  5GAN 5;  5GAN d;  4AFQ C;  4BY6 B;  2E41 A;  1Q81 C;  2DZC A;  1UGR B;  4FYX B;  2CDT A;  1YIJ A;  3G4S A;  4N0A A;  1BCO A;  2XG8 D;  1QLY A;  1VQK A;  4J9I A;  5KYU B;  1NJI C;  4C92 A;  1PKT A;  5DY9 A;  1GFC A;  1KSW A;  5D6W A;  4GY5 A;  1FYN A;  5GAN j;  1VQM Q;  4L5G A;  4M75 A;  2ZAE A;  2PZ1 A;  4PKC C;  2EJF A;  2ZZD A;  4J83 A;  1LNX A;  4PJO C;  1BYM A;  2CRE A;  4M7D G;  5IHN A;  3DLM A;  1NE8 A;  2RQT A;  2DTO A;  1B7T A;  3V7R A;  5I2S A;  1Q82 R;  2KNB B;  4JZ4 A;  2QXF A;  4EMH A;  1RL2 A;  1D1A A;  3G71 Q;  1X6O A;  3HKS A;  5J3B A;  3RKX A;  2WSE E;  3G71 T;  1OOT A;  2RQW A;  3O5Z A;  2DYI A;  4M78 D;  2COY A;  1KD1 C;  4FM4 B;  1YI2 Q;  4MZM A;  2EJ9 A;  3FRN A;  4A53 A;  3E9G A;  5L23 A;  4DBF A;  3CME Q;  3VS1 A;  5LL6 S;  2DE0 X;  4PK4 A;  1WPY A;  3CC4 A;  3CPW P;  3OSV A;  1YJW T;  2DFU A;  5GMK i;  4DOW A;  2ZPH B;  2GGR A;  2XMF A;  4M7A A;  5CVI A;  1MGQ A;  2GQI A;  3FC3 A;  4BE1 A;  2GNC A;  2XDP A;  1MMA A;  3A8G B;  3CCS T;  4C8Q F;  4DOV A;  4ZTJ A;  4RTX A;  1FMK A;  2O01 E;  3NHN A;  3G6E T;  1KIK A;  1MMD A;  1R0B G;  2CH4 A;  2R5M A;  5CIU A;  5GAO p;  1XJW B;  2L5Q A;  2VYT A;  4C92 F;  2PNI A;  1JU5 C;  2CGH A;  4EMK C;  5GAN e;  2LX9 A;  4GLK A;  2FG0 A;  4M75 F;  3CCL Q;  5LJ5 d;  4X1V A;  2V8K A;  2O4X A;  2H3E B;  2ZCF B;  4J8O A;  1VQ8 A;  4M75 G;  1M1G A;  4M78 C;  4A4E A;  1M90 R;  1OUL A;  1SG5 A;  2DL8 A;  4M77 A;  5HY6 A;  5A2Q E;  2XDB A;  2L8D A;  2DTI A;  2KGT A;  2YWW A;  3P8H A;  2JTE A;  5LJ5 j;  1WQ7 A;  2D8H A;  1VQ7 A;  1OV3 A;  4F04 B;  1OX9 A;  2HL3 A;  3JB9 H;  2DM1 A;  1WQW A;  1VQP Q;  2E65 A;  4PJO B;  4R0K A;  1BI1 A;  3CD6 T;  3RKW A;  2CP5 A;  1ZHI A;  1JBM A;  5I11 A;  1O75 A;  2X4Y A;  2YRV A;  3UA7 A;  3QDF A;  4PJO A;  1I8F A;  3OYD A;  1D09 B;  2BZY A;  3M0U A;  4J6Y A;  2CUB A;  2LJ1 A;  1K8A U;  4M7A F;  2CZ7 B;  1JRI A;  3QXE B;  4PLL A;  1PKS A;  1VQL Q;  3VS4 A;  1BBZ A;  3OS2 A;  3LWH A;  1VQL T;  2A3L A;  3V8K A;  2OAU A;  5GMK m;  2EJG A;  2M51 A;  4LD9 K;  2DET A;  4J9G A;  1PNJ A;  3CCM A;  3TSW A;  4X34 A;  4OP0 A;  2RF0 A;  4ELY C;  2LVM A;  2NUP B;  2HQX A;  3JCM J;  1KG1 A;  2DVJ A;  2FVU A;  1PRM C;  3WXM B;  2QEX A;  1RLQ C;  2D0N A;  8ATC B;  3LH0 A;  4GLM A;  4LN2 A;  4RTY A;  4KH0 B;  1SPK A;  2CSQ A;  1YIT A;  4LDX A;  1N5Z A;  3NMZ C;  2CT4 A;  2V8I A;  3OYF A;  2KRO A;  3I5S A;  4EMK B;  5LJ5 e;  4M77 F;  3HRS A;  1JJ2 P;  1I07 A;  2DEU A;  3TSZ A;  2NUZ A;  2RB6 A;  1WXU A;  2AT1 B;  2IVW A;  2X4W A;  4IUT A;  1U3O A;  3OYB A;  4M78 B;  1K73 U;  2COW A;  3CCR T;  3L2Z A;  2PVO B;  1VA7 A;  3GBQ A;  2RQR A;  3I55 Q;  2WSC E;  4LDU A;  1WNL A;  1TTH B;  1Y57 A;  2RNA A;  1VQ9 A;  3L2R A;  3I56 T;  4AG2 C;  2EKH A;  4JLG A;  4RG8 A;  4E7L A;  7AT1 B;  1M3A A;  1K8A C;  4JS5 A;  1TWB A;  3NTH A;  4OMO A;  1IRE B;  2LJ3 A;  2EQM A;  4ZN3 A;  3PIO A;  4M78 A;  4PJO F;  2CP6 A;  2HDA A;  4IUU A;  3E1S A;  8AT1 B;  5GAN 4;  2ED0 A;  4QVZ A;  4OB2 B;  4F7U B;  4PJO G;  3ME9 A;  2RK2 A;  4C8Q D;  2LX7 A;  3EFR A;  2ZGW A;  4FYY B;  3OB9 A;  2KDS A;  4BI8 B;  2DIQ A;  3MP1 A;  3OMG A;  2LQN A;  3X28 B;  1C1A A;  3CC7 Q;  2YUP A;  1N9S A;  1GCQ C;  1SHF A;  4FL6 A;  3HP9 A;  1UJY A;  2ECZ A;  2EYW A;  4DEY A;  2QA4 Q;  1VOM A;  3CXC S;  1YJW A;  5LJ3 d;  4CI0 C;  2EBP A;  2RQU A;  2X3W D;  1PD1 A;  3OYC A;  2DKG A;  1YCS B;  2DBK A;  4F7U A;  3PMI A;  1OZ3 A;  3DKM A;  2C0T A;  1G83 A;  2LJ0 A;  1YJN A;  4LDW A;  3M0P A;  3CCS A;  4JRI A;  3LGL A;  2PVG B;  2XKO C;  3RUX A;  3VS3 A;  3L42 A;  3LLR A;  5LJ3 j;  3LW5 E;  3H9N A;  3G6E A;  3NFC A;  4J9E A;  4QQD A;  1G3S A;  4OB3 B;  1H92 A;  3OYJ A;  2M1H A;  2DPP B;  1K73 C;  1VQN T;  1HD3 A;  4OVA A;  4QW2 A;  1EIF A;  2HKQ B;  3RBB B;  3RNJ A;  1KQ2 A;  1Q86 C;  1WXT A;  2GF7 A;  3JCM f;  3CCU Q;  3CXC A;  1AOJ A;  5IAY A;  3CCU T;  1BI3 A;  4IIO A;  1YJ9 T;  3JCM g;  2DVE A;  3OYL A;  4C8Q C;  5CO7 A;  4ZTF A;  2MAM A;  4N0A C;  2E4H A;  2ED1 A;  3FB9 A;  3FDR A;  4XU0 A;  2MWO A;  4C92 C;  4JUV A;  2KVQ G;  2O9V A;  1VQ5 Q;  1TU0 B;  2J06 A;  1VQ5 T;  1JEG A;  3CD6 A;  1M2V A;  2HEQ A;  4M78 G;  1NM7 A;  2DLP A;  2JS2 A;  5KYX B;  5C0M A;  1AWO A;  1HJD A;  2LNH B;  4VUB A;  5FRM A;  2EFI A;  3QWY A;  1QVG S;  2CP3 A;  2JNG A;  1M30 A;  1T0J A;  1UDL A;  3TVT A;  2DIG A;  3HFO A;  1TG0 A;  3QSU A;  1N6A A;  2RJD A;  3S3N A;  3CCE T;  3SWN A;  3EGU A;  2XD0 A;  4OGE A;  4C5E A;  2JOY A;  5KYX A;  4OF1 A;  3EH2 A;  4HKE A;  1T3S A;  1PSF A;  2D0Q B;  4LXC A;  4XTZ A;  1GFD A;  1RAD B;  4FSX A;  4F7U G;  1YN8 A;  5LJ3 e;  1M1K R;  1OQK A;  1AT1 B;  2FO0 A;  2ZPI B;  2LT4 A;  2QQB A;  1WJQ A;  2LQW A;  4JJC A;  1OPK A;  1Q81 U;  1U1T A;  1WLP B;  3H0I A;  4XQ3 A;  3C12 A;  1NLO C;  5KYW A;  3VKI A;  2CH4 W;  1NJI U;  2VXE A;  1X01 A;  2EQJ A;  2PQW A;  1W2B P;  4J9B A;  1VYV A;  1Y7X A;  5IN1 A;  2GFA A;  2BKD N;  2VC8 A;  2OTL A;  2ZPG B;  3SHW A;  3R6O A;  3UDC A;  1QVG A;  4RCC A;  2JVV A;  3EG0 A;  4M7A C;  2LT1 A;  2I0N A;  3BDL A;  2JW4 A;  4PJJ A;  2HSP A;  1YP5 A;  2BTT A;  1HK9 A;  5GAM g;  2MI6 A;  3IQL A;  2YRD A;  4BAC A;  2VKN A;  2EW3 A;  1Y96 A;  1H3H A;  2W0Z A;  2QQS A;  3RKY A;  1VQ6 Q;  5GAO q;  3RES A;  1S72 T;  3JB9 G;  5AYF A;  3LWI A;  2A08 A;  1D3B B;  2XU8 A;  3X24 B;  5FWB A;  3X26 B;  2F5T X;  1G3W A;  4UC4 A;  3OYA A;  5C6S A;  4XK8 E;  3ER0 A;  5GJW B;  4NL2 A;  5GAN 6;  4C8Q B;  1NBE B;  1KD1 U;  2OTJ A;  4JRQ A;  1M3C A;  4E7K A;  3JCM W;  2A36 A;  2P0Q A;  5FRO A;  1K1Z A;  1DJ7 B;  3QWX X;  5GAN h;  1PC0 A;  4RTT A;  4A63 B;  3N5B B;  1X2Q A;  4Z8A A;  5GAN 7;  5M9O A;  3I56 A;  4CC4 B;  2H3J A;  2W10 A;  3FJ5 A;  2Y90 A;  4C92 B;  1HSQ A;  1TH7 A;  1AHJ B;  2HD0 A;  3GNF B;  3CCQ A;  3L2U A;  4M77 C;  1U8R A;  2QGF B;  2MMP A;  4LDV A;  3WVD B;  4IIM A;  3M58 A;  1KK7 A;  2DRM A;  2YT6 A;  3CCV Q;  4MDX A;  4C8Q A;  2AIR B;  1QVF P;  3M5A A;  3S3O A;  3SFM A;  3OQ5 A;  3VS7 A;  2RHI A;  4LDY A;  1KQS S;  1WYX A;  5FW9 A;  1TUC A;  2HBP A;  3VJP A;  1MHN A;  1YHQ Q;  2KMT A;  2LCC A;  1QMC A;  1UJ0 A;  3J7A F;  4ESR A;  3CMA A;  3M59 A;  1I4K 1;  1NEB A;  1YIT Q;  1RI0 A;  1K76 A;  2FPF A;  4EMG A;  3D7S B;  1VQM T;  3OYG A;  1IGU A;  1OU8 A;  1QVP A;  2QQR A;  4ORZ A;  2JMA A;  1QCO A;  2E6Z A;  4PJN A;  3OSS C;  2BE7 D;  2DXC A;  2CP2 A;  3JV3 A;  1Y07 A;  4E47 A;  2XIC A;  1HYO A;  1H3Z A;  5FU7 B;  2ROL A;  3M4Y A;  3UAT A;  4HT8 A;  3OYN A;  1FWZ A;  1KQS A;  1BU1 A;  1SRM A;  1QWE A;  2RI3 A;  2E3I A;  1RAA B;  2JM8 A;  1HXD A;  2EGC A;  2L89 A;  4KUI A;  4M7A B;  1YI2 T;  1VQ4 Q;  5KCH A;  2DBM A;  1WHK A;  3M54 A;  1YJ9 A;  2SEM A;  4XU2 A;  3CME T;  4LUD A;  5CQX A;  2DL7 A;  1MV3 A;  3QUI A;  3URG A;  3L2W A;  2GQV A;  2MWP A;  3CPF A;  2DXU A;  2L3Q A;  3M4G A;  4ZGJ B;  3RMQ A;  1MND A;  2F5K A;  5FWC A;  1ZQ1 A;  4C5H A;  2BZ8 A;  1NPP A;  3QJY A;  2JS0 A;  5CR2 A;  1VUB A;  5IXB A;  2DL5 A;  2K57 A;  3CEY A;  1UGP B;  3MHX A;  1GBR A;  3Q1J A;  2LTO A;  2X9H A;  1ZA1 B;  4E7Z A;  2O4X B;  3EGX A;  4DBR A;  1JXO A;  2AK5 A;  3NGP A;  3G7Z A;  1WJS A;  1SKU B;  3HRU A;  4C8Q G;  4AG1 C;  1ACM B;  3HHT B;  1RAI B;  3DB4 A;  1IB8 A;  2DK3 A;  4M77 B;  2F2X A;  2FZC B;  4J6X A;  4KH1 B;  4CC2 A;  2O2O A;  3MEA A;  2FRY A;  2LC4 A;  4C92 G;  2JT4 A;  2QTX A;  3HTR A;  4PFP A;  3CCL T;  1RAB B;  1E6G A;  1NLP C;  4ANJ A;  3CCE A;  2OI3 A;  3EFO A;  1I5O B;  2KEA A;  2DD5 A;  2X51 A;  4DBH A;  4E7J A;  5J39 A;  3REB B;  4CC7 A;  2XHC A;  3GP8 A;  3TCJ A;  2ABL A;  1OI1 A;  1YWP A;  1SEM A;  3VRY A;  3QG1 A;  4HCZ A;  1CKA A;  1PG5 B;  4HVU A;  4EPC A;  4OMF B;  3VYG A;  1VQP T;  3OMC A;  3UF4 A;  1MNE A;  5A0G A;  1JJ2 S;  1SRL A;  3MEU A;  2VGM A;  2VVK A;  1K8A R;  1VQO Q;  4BUG A;  2K3B A;  5GMK l;  1WI7 A;  3EAE A;  1T3L A;  1MMG A;  3RIR A;  2YRC A;  2JN0 A;  4OMQ A;  1PWT A;  2RA2 A;  2LZ6 B;  2YUQ A;  3KBG A;  2RJE A;  4RG2 A;  2G6F X;  4M7D E;  1S72 A;  2VWF A;  4QQG A;  1UHF A;  1EX4 A;  4PNO A;  4R56 A;  1B3Q A;  1KJW A;  2QTV A;  1OX8 A;  5CKB A;  3JCM V;  4LD6 A;  4M7A G;  4JRK A;  3CC2 Q;  1ZSG A;  2FB7 A;  2X3X D;  3JCM d;  2EYX A;  2Z0W A;  4IUP A;  2E70 A;  4F17 A;  3VUZ A;  3QO3 A;  1MUZ A;  3NTK A;  2DF6 A;  2EQK A;  1G8X A;  3OA6 A;  9ATC B;  4L6V 5;  1JJ2 A;  2CP7 A;  1ARK A;  1WHJ A;  1BI0 A;  2X35 A;  3ZFJ A;  2FZG B;  1XNI A;  2QYZ A;  4KRT A;  2ZPF B;  3BE3 A;  2O31 A;  4D6W A;  1K73 R;  1D0Y A;  1RAG B;  4M7D D;  1UGQ B;  2AKL A;  4WCI A;  2O88 A;  1IXD A;  2B8A A;  2J7I A;  2M16 A;  3H41 A;  4KGV B;  4M77 G;  3SDZ A;  2NYS A;  5KYY B;  1WFW A;  1VQM A;  1RAE B;  1YNZ A;  1MMN A;  2E1H A;  2DEQ A;  1K9M U;  2RI2 A;  2EVR A;  2DL4 A;  3MET A;  3T9N A;  3THK A;  1FX7 A;  1R0C B;  4JJD A;  1M90 C;  4PFO A;  2IG0 A;  3SWN C;  3I55 T;  3S6W A;  1Q86 U;  1UFF A;  1ZX6 A;  1M8M A;  3A5Z B;  4P5N A;  2E5Q A;  1X6B A;  5DLQ E;  2D9T A;  5KYY A;  4A4G A;  3LYI A;  2K5F A;  1U06 A;  2L3R A;  3CCJ Q;  1X75 C;  3G71 A;  4M75 E;  2KK4 A;  1NG2 A;  5LJ3 h;  4HVW A;  2EYQ A;  1YI2 A;  2DJZ A;  2DYB A;  1K9A A;  4BDZ A;  4B9W A;  2GBQ A;  4FT4 A;  2KQW A;  3BY7 A;  4ZNX A;  3VS6 A;  2DIL A;  1M5Q 1;  1BIA A;  4FYW B;  1QCF A;  2EQI A;  3CC7 T;  2DA9 A;  4PJM A;  5GAM d;  3ULR B;  2QA4 T;  3A8H B;  1YIJ Q;  3G4S Q;  1MV0 B;  4QT7 A;  4OB1 B;  3G4S T;  5HCK A;  3U23 A;  5IHI A;  1VQK Q;  2RK1 A;  3JCM e;  4HVV A;  4Y91 A;  3CMA Q;  3UWN A;  3OYM A;  3A8O B;  4WF2 A;  1NYG A;  4OGC A;  5GAM j;  1ZBJ A;  5IHK A;  3ASK A;  4J9F A;  2K9G A;  2VGN A;  5GMK j;  2XI9 A;  1RAF B;  4Z02 A;  2HNI A;  2A37 A;  1M27 C;  2KYB A;  1VIF A;  1G3T A;  2LCS A;  4N4I A;  1TUD A;  3VU3 C;  1OU9 A;  1SHG A;  2F69 A;  2KYM A;  1K9M C;  2H8H A;  2DAQ A;  2VXF A;  1W4S A;  3PIP A;  2ZPE B;  4XU3 A;  2EGA A;  1AVZ C;  3CCL A;  4M7A E;  3VS0 A;  4RKU E;  4E7H A;  5DM7 R;  4M4Z A;  6AT1 B;  3DLL A;  1M2V B;  2V1R A;  4BDY A;  5CKD A;  5J26 A;  1RAH B;  3SEM A;  2QAS A;  2OJ2 A;  1W2B S;  3RDV A;  4MZT A;  3V8J A;  1V1C A;  4BE0 A;  1Z9Z A;  4LUE A;  5GAO n;  1SF9 A;  2NWM A;  2KT8 A;  2K3Y A;  2LNV A;  5CCA A;  5ECA A;  2E3H A;  2DMO A;  4Y28 E;  2KR3 A;  2QGG A;  1WJR A;  4DQ2 A;  1OEB A;  3CC4 Q;  5KH6 A;  1Q7Y U;  3CC4 T;  2AZV A;  3SWN B;  2OAW A;  2JXB A;  1N8R U;  4FIB A;  1S1N A;  3RR6 A;  1FMV A;  5GAN 3;  4E7I A;  2O9S A;  5GAO l;  4KUD K;  2P4R A;  2EYZ A;  3JCM b;  4MMK A;  2V8J A;  3I5R A;  1VYU A;  1M3B A;  5DLO A;  2E64 A;  3CXC P;  4C0F A;  3EG2 A;  1PSE A;  1WZO A;  4LE9 A;  5KYW B;  1Y71 A;  1EFN A;  1Q81 R;  2G3R A;  1LCK A;  3H8Z A;  1RI9 A;  4BD3 A;  1QP2 A;  3A8M B;  1W2B A;  2CZ6 B;  3CBO A;  1G2B A;  4RTU A;  1WIE A;  5AT1 B;  1NJI R;  2F2V A;  5GAM e;  5I21 A;  4MDW A;  4PFZ A;  3F70 A;  4D8K A;  5GMK e;  4OB0 B;  2LMJ A;  1VQL A;  1M4Z A;  4LNP A;  2QG9 B;  3EG9 A;  3JCM X;  3UT1 A;  3E2U A;  2LQ8 A;  4BB7 A;  3QPH A;  2RHZ A;  4IUV A;  1W6X A;  1VQ8 Q;  3LGF A;  1VQ8 T;  4HXJ A;  1Y96 B;  4PJO E;  1UUE A;  4Q5W A;  4HA8 A;  3JB9 J;  2E10 A;  1RAC B;  1UE9 A;  3C95 A;  4X9D A;  3CBP A;  1J3T A;  1VQ7 Q;  2DJQ A;  3OS5 A;  4AFZ C;  4AFS C;  1QWF A;  1ZUU A;  1KHC A;  2GTJ A;  1N27 A;  4M7D A;  1M8V A;  1UG1 A;  1AZG B;  3JAM E;  3JCM Q;  3OW2 P;  1M1K U;  2V1Q A;  2X4J A;  1KD1 R;  1AD5 A;  1UB4 A;  1Q7Y C;  3P8B B;  2GTO A;  1N8R C;  1VQ6 T;  4KGZ B;  3PNW C;  3GIB A;  3CCR A;  1XQH A;  2L0A A;  1I0C A;  4F16 A;  1OZ2 A;  3I55 A;  4PL6 A;  2RHU A;  2P4T A;  3FLG A;  2M02 A;  1TOV A;  3QZ9 B;  4FU6 A;  2VAS A;  4R55 A;  2FRW A;  2V26 A;  1X2K A;  1KFZ A;  3H6Z A;  3LH5 A;  3R6N A;  1QVG P;  5HKC A;  1KC8 U;  3JSC A;  2NUT A;  3JRZ A;  1W70 A;  5A0L A;  1R8O B;  2L2P A;  3G1J A;  1ZSZ A;  1YBY A;  2K2V A;  3C4S A;  3CCM Q;  3X25 B;  1ZUK A;  4KUL A;  2QAZ A;  1O9S A;  3CPW S;  3CCM T;  2FPE A;  3CCV T;  1Z9Q A;  3KXT A;  1BI2 A;  2HZY A;  4QVC A;  3JB9 I;  2RMO A;  3OBW A;  5A0D A;  1PHT A;  4JPB W;  2MK5 A;  1NEG A;  1LJO A;  2YXY A;  2QEX Q;  3EG1 A;  1WHG A;  4DBQ A;  3CC7 A;  2L3S A;  2RM4 A;  3EG3 A;  4JS4 A;  1YHQ T;  1IHV A;  1Y0M A;  2KXD A;  2YLB A;  4J7I A;  2QA4 A;  4MML A;  1FXX A;  1YIT T;  4QKU A;  3QJ6 A;  1UTI A;  5HK0 A;  2AHJ B;  2RHY A;  2Y4Y A;  2GFU A;  3I35 A;  4M78 E;  1YCY A;  4QQ6 A;  5EC7 A;  4IKF A;  4C0D C;  5I2M A;  1QKX A;  3OYY A;  2WSF E;  4PJL A;  2KY9 A;  1M1K C;  1QKW A;  2EAY A;  5GAN 8;  3OYK A;  4RUG A;  2K79 A;  3M0Q A;  2MCN A;  2X4X A;  1QQJ A;  4M7D F;  1AWW A;  5CKE A;  5IH2 A;  3PVQ A;  2QQ9 A;  3CPW A;  4XTV A;  4O5V A;  2B86 A;  2CZ0 B;  3TEE A;  4JRP A;  1VQN A;  4MZP A;  3A8L B;  3UPU A;  2LRQ A;  2R58 A;  2XDD A;  5KYU A;  1GRI A;  3MEW A;  1M9S A;  1WHM A;  1VQ9 Q;  1PRL C;  1GL5 A;  3HFN A;  4F7U E;  1VQ9 T;  2C06 A;  4HT9 A;  4EDU A;  3BFM A;  2RJF A;  2DD4 A;  1I81 A;  2WAC A;  2DRK A;  1VQ4 T;  3AT1 B;  3CCU A;  2YHT A;  1X6G A;  1ZUY A;  2J6O A;  3EGX B;  2KBT A;  1KC8 C;  4E6R A;  1WA7 A;  2ENM A;  1F1B B;  3CBM A;  3FIF A;  2K2M A;  3NTI A;  1WX6 A;  1Q82 U;  3M0T A;  4RTV A;  2KRS A;  2QQA A;  4FT2 A;  2C0I A;  4A4H A;  1U1S A;  2BE9 B;  3GLX A;  1Q95 G;  3KFV A;  1AZE A;  3MCA B;  1ABQ A;  1VQ5 A;  4JJB A;  2EIF A;  1I1J A;  1YJW Q;  4RCB A;  5LJ5 h;  1JB0 E;  3EFO B;  1AEY A;  4V2S A;  1KQS P;  2HCK A;  2KSS A;  5L8R E;  1XTD A;  3OYH A;  3MP8 A;  2D8J A;  2HKN A;  3GNG A;  1YJN Q;  1YJN T;  1XOV A;  3CCS Q;  2FZK B;  1VIE A;  2K5L A;  1BB9 A;  1PM3 A;  3G6E Q;  2CSI A;  2KRM A;  3TRE A;  2HSE B;  2KRN A;  2PU9 B;  3M0S A;  4JZ3 A;  3QYG B;  1D1C A;  1BCM A;  2A7Y A;  1SSF A;  4FW2 A;  3V7C A;  2COZ A; 
#chains in the Genus database with same CATH homology
 2IG0 A;  1VQ5 T;  3CD6 A;  2QEX T;  4M75 B;  4L59 A;  3SWN C;  5IT9 E;  2JTM A;  3I55 T;  3S6W A;  1N9R A;  4M78 G;  4NOY A;  5HK3 A;  1Q86 U;  5GAN 5;  2EQU A;  5GAN d;  4BY6 B;  2FL7 A;  2E41 A;  1Q81 C;  2JTF A;  2DZC A;  2VUB A;  1UGR B;  3A5Z B;  3M57 A;  4P5N A;  2E5Q A;  2LCL A;  3M53 A;  1YIJ A;  3G4S A;  4N0A A;  5C0M A;  5DLQ E;  2JZ2 A;  2D9T A;  2XG8 D;  4A4G A;  4VUB A;  5FRM A;  2CKK A;  2EFI A;  3LYI A;  2K5F A;  1VQK A;  3FJP A;  1NJI C;  1B34 B;  4C0D B;  4C92 A;  4QVD A;  2L3R A;  5DY9 A;  1X75 C;  3G71 A;  1QVG S;  2JNG A;  4M75 E;  4XU1 A;  2DIG A;  2KK4 A;  3BW1 A;  3HFO A;  4BI3 A;  3QSU A;  1N6A A;  5D6W A;  2RJD A;  4GY5 A;  5GAN j;  5LJ3 h;  3S3N A;  4NL3 A;  2EYQ A;  1Q82 C;  4L5G A;  4M75 A;  3JB9 D;  1YI2 A;  3CCE T;  2DJZ A;  3SWN A;  2XD0 A;  4PKC C;  4BDZ A;  4B9W A;  2EJF A;  2ZZD A;  5GAN f;  3OYE A;  4OGE A;  5CKF A;  2CYZ B;  4J83 A;  4C5E A;  1LNX A;  2JOY A;  4FT4 A;  4B9X A;  2KQW A;  4OF1 A;  3BY7 A;  2NLU A;  1VQO T;  4HKE A;  1PSF A;  2D0Q B;  3V7S A;  1M5Q 1;  1BIA A;  4XTZ A;  4PJO C;  1BYM A;  4FSX A;  2RJC A;  4F7U G;  3E9F A;  5LJ3 e;  3CC7 T;  4M7D G;  3DLM A;  5GAN g;  2ZPI B;  2LT4 A;  1NE8 A;  2QQB A;  1WJQ A;  3JCM h;  5GAM d;  1B34 A;  2D6F A;  2DTO A;  1Q81 U;  1U1T A;  1P92 A;  5KE3 A;  4A54 A;  2QA4 T;  3V7R A;  5I2S A;  1VQ6 A;  3A8H B;  4XQ3 A;  3C12 A;  3QBY A;  3RMS A;  3WVE B;  3VKI A;  5D6Y A;  4OB1 B;  3G4S T;  2QXF A;  1NJI U;  4EMH A;  2VXE A;  1X01 A;  4X9C A;  2RK1 A;  1RL2 A;  3JCM e;  2EQJ A;  1X6O A;  2PQW A;  2K4Y A;  3HKS A;  5J3B A;  3RKX A;  2WSE E;  4Y91 A;  3PMT A;  3UWN A;  3OYM A;  3A8O B;  3G71 T;  1LOJ A;  4WF2 A;  1Y7X A;  4OGC A;  2GFA A;  2BKD N;  5IN1 A;  2VC8 A;  2OTL A;  4M78 D;  5GAM j;  2ZPG B;  3DB3 A;  3CC2 T;  3ASK A;  1KD1 C;  4FM4 B;  4TVR A;  2VGN A;  3R6O A;  5GMK j;  3UDC A;  1QVG A;  4MZM A;  2EJ9 A;  4RCC A;  1KHI A;  2XI9 A;  3TU4 K;  2JVV A;  3FRN A;  4Z02 A;  2HNI A;  4A53 A;  4M7A C;  2K3X A;  3JCM P;  3E9G A;  3L2V A;  1VIF A;  3VV0 A;  2LT1 A;  1G3T A;  4N4I A;  5LL6 S;  3VU3 C;  3BDL A;  4XTX A;  1BKB A;  2F69 A;  1HK9 A;  5GAM g;  1K9M C;  4RMO A;  2BUD A;  1WPY A;  2DAQ A;  2MI6 A;  4HCC A;  4BAC A;  3CC4 A;  2VXF A;  1W4S A;  5KE2 A;  3PIP A;  1Y96 A;  2ZPE B;  2QQS A;  4XU3 A;  2RD1 A;  2RH2 A;  3RKY A;  3OSV A;  1YJW T;  3CCL A;  5GAO q;  5GMK i;  3CCV A;  4M7A E;  4DOW A;  3RES A;  1S72 T;  3JB9 G;  5AYF A;  3LWI A;  4RKU E;  1D3B B;  2XU8 A;  5DM7 R;  2ZPH B;  4E7H A;  3RER A;  4XTY A;  3X24 B;  3X26 B;  3DLL A;  5CVI A;  4M7A A;  4BDY A;  1MGQ A;  2F5T X;  3FC3 A;  1G3W A;  4UC4 A;  3OYA A;  5C6S A;  4XK8 E;  4BE1 A;  2XDP A;  3ER0 A;  4NL2 A;  5GAN 6;  4C8Q B;  5CKD A;  5J26 A;  4CRI A;  1YHQ A;  1KD1 U;  3A8G B;  3CCS T;  4C8Q F;  4JRQ A;  2OTJ A;  3VYH B;  4DOV A;  2P0Q A;  4E7K A;  4N4G A;  5FRO A;  3JCM W;  1W2B S;  2OTL T;  4MZT A;  3V8J A;  4ZTJ A;  1DJ7 B;  5GAO n;  4BE0 A;  5GAN h;  3N5B B;  2O01 E;  3HL8 A;  5GAN 7;  3G6E T;  5M9O A;  3I56 A;  2K3Y A;  2LNV A;  1G3Y A;  2H3J A;  5CCA A;  2RI5 A;  4JLI A;  2Y90 A;  2R5M A;  5CIU A;  4C92 B;  5GAO p;  2L5Q A;  2VYT A;  4C92 F;  1TH7 A;  4J5Y A;  1AHJ B;  2HD0 A;  3GNF B;  4Y28 E;  3CCQ A;  1WJR A;  4DQ2 A;  3L2U A;  4M77 C;  4EMK C;  2CGH A;  1U8R A;  2MMP A;  5GAN e;  4LDV A;  2YLC A;  4C8Q E;  3WVD B;  2LX9 A;  5KH6 A;  1Q7Y U;  2HQE A;  4GLK A;  3CC4 T;  3M58 A;  2DO3 A;  3VUB A;  2EKO A;  4ME7 A;  3SWN B;  3HRT A;  4M75 F;  3BDU A;  1N8R U;  3HPW A;  4FIB A;  5LJ5 d;  4MDX A;  4C8Q A;  2V8K A;  3M5A A;  3AHU A;  4YTL A;  5GAN 3;  3SFM A;  3S3O A;  2O4X A;  2ZCF B;  4E7I A;  4J8O A;  5GAO l;  4KUD K;  3OQ5 A;  4C92 E;  4DA4 A;  2RHI A;  4M75 G;  4LDY A;  3JCM b;  4MMK A;  1VQ8 A;  2V8J A;  1KQS S;  1M1G A;  4M78 C;  4A4E A;  2HAX A;  2JUF A;  3MO8 A;  2HBP A;  3VJP A;  5DLO A;  2E64 A;  1MHN A;  2KMT A;  2LCC A;  3J7A F;  4C0G A;  4C0F A;  3CMA A;  3CCJ T;  2OTJ T;  3M59 A;  4M77 A;  5HY6 A;  1I4K 1;  4EMK A;  5GAM h;  5A2Q E;  2L8D A;  1PSE A;  2DTI A;  2XDB A;  2P0P A;  3P8H A;  5GMK h;  5LJ5 j;  1Y71 A;  1ZBX A;  1RI0 A;  2G3R A;  3H8Z A;  1WQ7 A;  3LX7 A;  1VQ7 A;  4BD3 A;  1QP2 A;  4EMG A;  3A8M B;  1W2B A;  3V8L A;  1VQM T;  3OYG A;  2CZ6 B;  4C0Z A;  3CBO A;  5LJ5 f;  1VQ4 A;  4JDS A;  4II1 A;  1WQW A;  3JB9 H;  5GAM e;  3CCQ T;  5I21 A;  2M9U A;  1QVP A;  2PUK B;  3FEO A;  4MDW A;  3INZ A;  3F70 A;  2E65 A;  2QQR A;  5GMK e;  4OB0 B;  4PJO B;  1BI1 A;  3OS1 A;  5LJ5 g;  1VQL A;  3CD6 T;  3RKW A;  2XK0 A;  1M4Z A;  2E6Z A;  2KAF A;  3MP6 A;  3JCM X;  2CZ1 B;  3OSS C;  3UT1 A;  2LQ8 A;  2CS7 A;  4BB7 A;  3QPH A;  2RHZ A;  4IUV A;  4M7D C;  4XTW A;  1ZHI A;  2DXC A;  3LGF A;  1Y07 A;  4E47 A;  2XIC A;  1YIJ T;  3L2Q A;  1JBM A;  1VQ8 T;  1H3Z A;  5FU7 B;  1O75 A;  2X4Y A;  3EFS A;  3M4Y A;  1VQK T;  1Y96 B;  4PJO E;  4HT8 A;  3MEV A;  4Q5W A;  2YRV A;  1H64 1;  4HA8 A;  3OYN A;  3JB9 J;  1FWZ A;  2E10 A;  1KQS A;  3C95 A;  2RI3 A;  3CBP A;  4X9D A;  4C92 D;  4IUR A;  3CMA T;  4HCB A;  4PJO A;  3PGG A;  3KUF A;  5EG2 A;  3OS5 A;  1I8F A;  1HXD A;  2L89 A;  3OYD A;  4KUI A;  4M7A B;  1YI2 T;  4J6Y A;  5KCH A;  3QII A;  1K8A U;  4M75 D;  4M7A F;  2CZ7 B;  1JRI A;  1KHC A;  3OBY A;  3QXE B;  1N27 A;  4ZN1 A;  4M7D A;  1M8V A;  2Y4X A;  3M54 A;  1YJ9 A;  4XU2 A;  4PLL A;  3CME T;  3JAM E;  5CQX A;  2DZ9 A;  2XID A;  3JCM Q;  3OS2 A;  1M1K U;  3LWH A;  1VQL T;  2A3L A;  3QUI A;  3URG A;  2X4J A;  3JCM c;  3V8K A;  2GQV A;  2MWP A;  2OAU A;  3L2W A;  5GMK m;  3CPF A;  2DXU A;  1UB4 A;  2EJG A;  1Q7Y C;  3P8B B;  3M4G A;  3QDR B;  4LD9 K;  4ZGJ B;  3CCM A;  3RMQ A;  2P0K A;  4PLI A;  1N8R C;  1VQ6 T;  2F5K A;  4X34 A;  4OP0 A;  3J81 E;  3M56 A;  1ZQ1 A;  4C5H A;  4ELY C;  2LVM A;  3PNW C;  1NPP A;  3C94 A;  3QJY A;  5CR2 A;  1VUB A;  2HQX A;  3GIB A;  3QYH B;  3CCR A;  2K57 A;  4N4H A;  1XQH A;  3JCM J;  1KG1 A;  2FVU A;  3CEY A;  1UGP B;  3E19 A;  2I2L A;  3MHX A;  3Q1J A;  2LTO A;  3WXM B;  3PTA A;  2QEX A;  1OZ2 A;  3LH0 A;  3I55 A;  2O4X B;  4PL6 A;  2EWN A;  3G7Z A;  2RHU A;  1UEB A;  2P4T A;  1YIT A;  2VV5 A;  4LDX A;  2PVD B;  1WJS A;  3FLG A;  1G5V A;  3QZ9 B;  3HRU A;  5FU6 C;  4FU6 A;  4C8Q G;  4R55 A;  3HHT B;  3OYI A;  2M0O A;  3DB4 A;  3H6Z A;  3OY9 A;  2V8I A;  3OYF A;  5HKC A;  2DK3 A;  2FYK A;  4M77 B;  3JSC A;  4EMK B;  5LJ5 e;  1KC8 U;  4BE2 A;  3JRZ A;  4J6X A;  4M77 F;  3QZ5 B;  5A0L A;  1VQP A;  1R8O B;  3MEA A;  4NS5 A;  2LC4 A;  1YBY A;  3HRS A;  4C92 G;  5GAO r;  2K2V A;  3C4S A;  3OW2 S;  3X25 B;  2QTX A;  2E12 A;  3ZEH A;  4KUL A;  3CCL T;  3CPW S;  1O9S A;  5FLX E;  3CCM T;  3CCV T;  2RB6 A;  3CCE A;  3KXT A;  1BI2 A;  2IVW A;  2X4W A;  4QVC A;  1GXI E;  4IUT A;  2E6N A;  5A0D A;  3OBW A;  3JB9 I;  3OYB A;  1K73 U;  4M78 B;  5D6X A;  1VQO A;  2DD5 A;  2DXB A;  3CCR T;  1LJO A;  4M77 E;  4M78 F;  3L2Z A;  2PVO B;  1IZ6 A;  4E7J A;  4M7A D;  3CC7 A;  2PUO B;  4JS4 A;  2RM4 A;  5J39 A;  1YHQ T;  2ZPB B;  2K5I A;  4M75 C;  2WSC E;  2XHC A;  4LDU A;  1WNL A;  2YLB A;  4J7I A;  3TCJ A;  2BIV A;  3GP8 A;  2QDY B;  2QA4 A;  4BY6 C;  4MML A;  3L2R A;  1FXX A;  1VQ9 A;  3L1A A;  1YIT T;  3I56 T;  1OI1 A;  3QJ6 A;  3QG1 A;  4HCZ A;  5HK0 A;  4JLG A;  2AHJ B;  4RG8 A;  2RHY A;  3SD4 A;  4E7L A;  2Y4Y A;  2GFU A;  4M78 E;  1YCY A;  1K8A C;  4JS5 A;  2R5A A;  3NTH A;  4J7F A;  2RHX A;  1IRE B;  4QQ6 A;  4EPC A;  4ZGD B;  4JJN K;  4IKF A;  4KT0 E;  3P8D A;  2EQM A;  4ZN3 A;  3M9Q A;  4OMF B;  4C0D C;  3VYG A;  5I2M A;  1M1F A;  3PIO A;  1VQP T;  4M78 A;  4PJO F;  5CKH A;  3OYY A;  4IUU A;  2WSF E;  4BI4 A;  2KY9 A;  3E1S A;  3OMC A;  1M1K C;  3CC2 A;  1WGS A;  5GAN 4;  3GPL A;  2EAY A;  2GCX A;  2DTH A;  5GAN 8;  5A0G A;  3OYK A;  4QVZ A;  4OB2 B;  1JJ2 S;  4F7U B;  4PJO G;  3ME9 A;  4M7D B;  2RK2 A;  4C8Q D;  3GOX A;  2LDM A;  2VGM A;  2X4X A;  3EFR A;  2ZGW A;  3M55 A;  3MEU A;  4F7U F;  3OW2 A;  4M7D F;  1QVF S;  3OB9 A;  4BUG A;  5CKE A;  2KDS A;  2QQ9 A;  4BI8 B;  3CPW A;  5GMK l;  2DIQ A;  4XTV A;  3MP1 A;  3OMG A;  4O5V A;  3EAE A;  2LQK A;  3X28 B;  3RIR A;  2CZ0 B;  3PFS A;  3TEE A;  5CAI A;  2JN0 A;  4JRP A;  1VQN A;  1N9S A;  4MZP A;  3A8L B;  3UPU A;  2LRQ A;  5GAO m;  4FL6 A;  2R58 A;  2QI2 A;  2R57 A;  3HP9 A;  2RA2 A;  3SB2 A;  2XDD A;  3MEW A;  1M9S A;  3KBG A;  3CXC S;  4M77 D;  1YJW A;  2RJE A;  1I5L A;  4RG2 A;  3HFN A;  5LJ3 d;  4F7U E;  1VQ9 T;  2C06 A;  4M7D E;  4HT9 A;  4EDU A;  4CI0 C;  1VQ7 T;  3BFM A;  3QHS A;  1S72 A;  4A4K A;  2RJF A;  2DD4 A;  1I81 A;  2WAC A;  4QQG A;  4ELZ C;  2DKG A;  3OYC A;  1VQ4 T;  1KQ1 A;  4PNO A;  4R56 A;  3CCU A;  5FU7 C;  2YHT A;  4F7U A;  3PMI A;  1OZ3 A;  3DKM A;  5CKB A;  3JCM V;  1M90 U;  1YJN A;  4LDW A;  3J80 E;  4LD6 A;  4M7A G;  4JRK A;  1KC8 C;  2FB7 A;  3CCS A;  4JRI A;  3LGL A;  1NZ9 A;  3JCM d;  2PVG B;  4KBM B;  2XKO C;  3RUX A;  1NPR A;  3GF5 A;  3L42 A;  3LLR A;  4IUP A;  3CBM A;  2E70 A;  3FIF A;  3LW5 E;  5LJ3 j;  3G6E A;  3VUZ A;  3NTI A;  3QO3 A;  3O8V A;  3NFC A;  1Q82 U;  5GAM f;  5CQY A;  3NTK A;  2QQA A;  4FT2 A;  4A4H A;  1V29 B;  2EQK A;  4A4F A;  1U1S A;  4ZGE B;  4QQD A;  5LJ3 f;  4L6V 5;  3ZBD A;  1G3S A;  3GLX A;  3OA6 A;  4OB3 B;  1JJ2 A;  5FRN A;  4ATO A;  2FHD A;  3OYJ A;  2M1H A;  2DPP B;  1K73 C;  3MCA B;  4C5G A;  1VQN T;  1QVF A;  3S3M A;  4OVA A;  1VQ5 A;  3JB9 F;  2DXT A;  2EIF A;  5GAN 2;  5LJ3 g;  1QW1 A;  4RCB A;  4QW2 A;  1JB0 E;  1BI0 A;  1EIF A;  4IUQ A;  5LJ5 h;  2X35 A;  4XAX B;  3ZFJ A;  4PJO D;  1UGS B;  1XNI A;  1KQ2 A;  4V2S A;  1Q86 C;  3PT9 A;  2GF7 A;  3JCM f;  2ZPF B;  3QKJ A;  2MF2 A;  5FU6 B;  2KSS A;  3CXC A;  1OYX A;  1BIB A;  3CCU T;  5IAY A;  1BI3 A;  5L8R E;  1XTD A;  4O6J A;  4D6W A;  5CK9 A;  3MP8 A;  3GNG A;  3OYH A;  1YJ9 T;  2RO0 A;  1YJN T;  1XOV A;  3JCM g;  4M7D D;  2DVE A;  3OYL A;  1UGQ B;  5KCO A;  4C8Q C;  4J6W A;  5CO7 A;  3CCJ A;  1VIE A;  3CME A;  4ZTF A;  2K5L A;  2B8A A;  2MAM A;  2M16 A;  3OS0 A;  4N0A C;  4M77 G;  3TRE A;  3X20 B;  3SDZ A;  4C5I A;  3FB9 A;  3FDR A;  4XU0 A;  1VQM A;  2MWO A;  1QP3 A;  2PU9 B;  4XTU A;  2E1H A;  4C92 C;  2DEQ A;  3QYG B;  4JUV A;  2RI2 A;  1K9M U;  2A7Y A;  1SSF A;  2KVQ G;  3MET A;  3T9N A;  1D3B A;  1FX7 A;  3V7C A;  1M90 C;  3HSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...