3HPWA

Ccdb dimer in complex with one c-terminal ccda domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/toxin repressor
molecule keywords Cytotoxic protein ccdB
publication title Rejuvenation of CcdB-Poisoned Gyrase by an Intrinsically Disordered Protein Domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hpwA00
4HKEA 3G7ZA 1VUBA 3VUBA 2C06A 5HKCA 1NE8A 1X75C 2VUBA 3JRZA 5CK9A 5CCAA 5HK3A 5CKBA 5CKFA 5CKHA 2KMTA 5CKDA 4VUBA 3TCJA 1M1FA 5HK0A 4MZPA 4MDXA 2MF2A 1UB4A 4ELYC 3NFCA 4MZTA 5CO7A 4ELZC 5DLOA 4MZMA 4OF1A 3JSCA 4ME7A 5CQXA 5CQYA 5CR2A 3HPWA 5CKEA
chains in the Genus database with same CATH superfamily
3CCJA 2KR3A 1M2OA 3EH2A 3NTHA 5GAOq 4C92C 1WGSA 1X2QA 1WA7A 1LVKA 2VVKA 3DB4A 4AFUC 4BDYA 1MGQA 2Y4XA 1Z9QA 1M3AA 3JAME 1PNJA 4C0DB 2ROLA 2CZ7B 2X51A 2LT4A 3ME9A 3CPWP 1YFNA 1S72A 2DJZA 2FRWA 2DEUA 2MPXC 2NUPB 2JTEA 1RAFB 1UGVA 1VQ8Q 1Q82R 3CD6Q 4C92G 4J9GA 5CKHA 1GCQC 2KRNA 2KXCA 4MZPA 4M7DA 1WHKA 2EQKA 3NFCA 2COWA 4N0AC 3M0TA 3EGDA 4M7DD 4V2SA 2XDPA 1ZA2B 2J7IA 4OF1A 1PWTA 2LRQA 4KUIA 3MCAB 3VRZA 5DY9A 1K0SA 2QG9B 2RK1A 1MMGA 2P4RA 2EGEA 1I5LA 5GAN2 2EQIA 2AKLA 2CYZB 5CIUA 2QYZA 3RKYA 2ATCB 4ZN1A 3M5AA 3WXMB 5GAN6 4RMOA 5KYXA 1AOJA 1M3BA 2XKOC 3CBOA 1E7OA 1LJOA 3S6WA 1K9MU 1K73C 2AZSA 1WPYA 1VQNQ 1Y07A 6AT1B 2O4XB 5CR2A 2HQHA 1QQJA 2JT4A 5J3BA 4BE1A 1UECA 1X69A 3V8LA 5GAN4 4B9XA 3N5BB 3SEMA 1I5OB 2DJQA 3EGXA 1XQHA 2P0PA 4RTXA 1B34B 2EJ9A 5IHIA 3CCEQ 3OMGA 4L59A 1MNEA 5FW9A 1NLOC 2YWWA 4J5YA 4RCBA 1IRXA 5A0LA 1ABOA 4ORZA 1UE9A 1C1AA 3X26B 3NTIA 3TQ7P 1EZZB 2JVVA 2YSQA 4M4ZA 5HY6A 1G3SA 3CXCA 1YJNQ 2NUTA 2GCXA 2OJ2A 3WVEB 4DQ2A 1Y0MA 2DTIA 3M0RA 2V1QA 2NWMA 1QVFP 2DD4A 1M5Q1 3M53A 3META 1N8RU 1VQ5T 3REAB 1OEBA 1SHGA 2ZGWA 4PJOE 2DRMA 1YHQT 5M9OA 1HJDA 3OW2P 1FMVA 2K5LA 4F7UA 1QKXA 2W10A 4PJJA 3UPUA 3VUBA 3CPWS 3PVQA 1RAAB 2VGMA 3HKSA 1UTIA 4HA8A 8AT1B 1M90R 1QKWA 2F2XA 2P0QA 2KRSA 3JV3A 1OZ2A 2L3SA 3BDLA 3I55T 3CMET 4HCCA 4JDSA 4IUTA 4NS5A 1Q82U 1WQWA 2ZPHB 5GMKj 3H41A 3NHNA 3MP6A 7AT1B 3CCRQ 1XJWB 4KUDK 2CP3A 4C0DC 5KYYA 3OYEA 1WI7A 2HBPA 2JM8A 3EG3A 4E2FB 2KI7A 3VS2A 1VQ4T 1JEGA 2DVEA 1XTDA 2OX7A 4PJMA 3HPWA 1I07A 1ABQA 2MK5A 4IURA 2JZ2A 4CRIA 1QCFA 3JCMV 2H3JA 1X75C 3H8ZA 2RD1A 1WIEA 2KQWA 1UHCA 2HKQB 3FRNA 3MPUB 2QA4T 2CREA 4AT1B 1U5SA 2XIDA 2D1XA 2DK3A 2LTOA 3EFSA 3L2UA 1BKBA 2X3WD 1VQ7Q 2DKGA 2EYQA 4CC3A 1M4ZA 3HL8A 4L5GA 4M7AF 4JPBW 2BIVA 1YITT 1G3YA 2DL7A 2HZYA 1X43A 1GBRA 2L89A 4Z02A 3WVDB 2OTLA 3RMQA 4J6YA 1QVPA 1R0CB 3V8KA 4ZTFA 3E2UA 4HXJA 3QJYA 4JRIA 3SWNA 4M77E 2VXEA 2R5MA 2EJGA 3CBPA 4A54A 2DNUA 2QAZA 2RN8A 1JBMA 3SWNC 4J9IA 1B3QA 5CKBA 5IHNA 3CCSA 4M78F 2KE9A 2WSCE 5I11A 5LJ3d 2DL3A 2P84A 2LCSA 2X4WA 2BKDN 2RQVA 1VQKA 3M57A 3OS1A 2YT6A 1VQ6A 5A0GA 1E6HA 5FRNA 5ECAA 2E4HA 2O2OA 1M90U 3JCMX 2M51A 2RJDA 1T3LA 1NEGA 5HK0A 1TWBA 3PGGA 3CCQQ 5GAMh 2VC8A 1Q7YR 1ZBJA 1VQ8T 3CD6T 3LYIA 1SHFA 5GJWB 5LJ5g 3M0QA 3JCMP 1AWJA 4A4FA 1UGPB 5D7UA 4J8OA 3OYMA 2YHTA 3MEAA 1VQLQ 1MHNA 1HYOA 1K9AA 1T0HA 2AT1B 1AHJB 2L3PA 2CT4A 3LGLA 2LQKA 5GAN3 2D8JA 2CP2A 2DD5A 2ZPIB 3H0HA 4E7ZA 1Q86U 1K9MC 1VQNT 4BE0A 2GQIA 1KD1R 2CP5A 3BDUA 5IN1A 1JXOA 1UB4A 4EMHA 1SRLA 2GTJA 5DM7R 3EG0A 2EYWA 4XK8E 1OPLA 2GTOA 4C8QE 3OYHA 1JXMA 1Q95G 3CCET 4ME7A 5FWCA 2MIOA 3HSBA 4N4GA 1NE8A 3ULRB 5GMKi 3FJ5A 3J80E 1TTHB 2DETA 3OMCA 4LDVA 2E70A 3A8MB 3JCMf 2DZCA 1YJNT 2OTJQ 1PCXA 5GAMf 3A1PA 2G6FX 1SEMA 2JS0A 1ZHIA 2DRKA 4NL3A 1ZSGA 1PD0A 1KK7A 3OQ5A 2QTXA 1YN8A 2BZ8A 3E19A 1ZUYA 3CBMA 1UJYA 4N4HA 4A4KA 1RACB 4J83A 1UGRB 1G5VA 4XAXB 1WHHA 4K11A 3NTKA 3V8JA 3TVTA 2A28A 3VU3C 3CXCP 2E12A 3EG1A 4BY6C 4EDUA 2RI2A 3JCMJ 4M75E 5IXBA 3L2RA 4C5GA 3TCJA 1Q7YU 1PSFA 2K57A 3OYYA 3I56Q 2PVDB 1Q82C 3CC4Q 1ZSZA 2EFIA 2K9GA 2QK0A 3UWNA 4X9DA 3CCRT 4E7JA 1K8AR 2DZ9A 4X9CA 3RESA 1RI9A 1D3BA 2E41A 4BACA 1U8RA 4EMGA 2KYMA 4PKCC 2FG0A 2CDTA 2YRDA 3C95A 1YHQA 2KAFA 3A98A 1AT1B 2DF6A 3CC7A 2YDLA 2SRCA 1TUDA 4M7DB 1MMDA 3VKIA 3EGDB 4QW2A 1WHGA 2XK0A 3M0UA 3CC2Q 4GBQA 1VQ7T 4XTVA 2O88A 4F17A 5IT9E 4LE9A 3QJ6A 2QQAA 5KYUB 4LXCA 3A8LB 5KYXB 4NOYA 2DE0X 4PJNA 2CZ6B 1D09B 4HCZA 3TEEA 3G71A 5GANg 2KK4A 2OAUA 2ZAEA 3I9QA 3OA6A 1W4SA 4IIOA 1FX7A 2DXTA 4OB0B 4M7AA 2BUDA 3EGXB 3QUIA 4CC4B 3MKDA 2KSSA 4PFOA 4PJLA 4ZNXA 3HFOA 4QVCA 1IZ6A 3JB9J 2HKNA 2KMTA 2RNAA 1SSFA 1KQ2A 1JO8A 2YRVA 4JUVA 1NYGA 3PE0A 5GAN5 4M77F 2DL5A 2E3HA 3O5ZA 1YITA 2KNBB 1Z9ZA 2ZPBB 3CCQT 3OS0A 5GAOn 1Q81U 2CH4W 1VQPQ 3J7AF 4M78A 2M02A 1YJWA 3DKMA 2JW4A 4M78D 1Y57A 2PU9B 2F2WA 4F7UB 2MCNA 3QO3A 2DTHA 5KYWA 2EGAA 3VS4A 1VQOA 5LJ3g 1K8AU 4BI8B 4KGXB 1IO6A 4EMKA 3MP8A 1IHWA 1D1AA 2F5KA 1VQLT 3A8OB 1CKAA 1WXTA 5GAMd 1W2BA 3OBYA 2LNHB 2XDDA 2O9VA 1KC8R 4BI3A 2LX7A 3O8VA 3CCMA 2CP0A 3PMTA 5EG2A 2WSFE 2JMCA 4C92E 4PFZA 1BYMA 2FZKB 2ABLA 2ENMA 2K7AA 2KT8A 2QGGA 4BI4A 2JS2A 2LJ3A 1UEBA 1ARKA 3CCJQ 1YI2A 2R5AA 3FLGA 5KYYB 3ZEHA 5GMKe 2LDMA 2E3IA 2X4YA 3ZFJA 3EFRA 2Y90A 3HTRA 1VQ9T 5IAYA 1R77A 2HL5C 2VWFA 2DBKA 1YCSB 1NEBA 2QEXA 1S72Q 3EG9A 4M7DC 1QWEA 2OTJT 4FT2A 4OMFB 2JJ9A 1AWOA 2PVOB 2WSEE 2KRMA 3G6EQ 1N27A 4QVDA 4HVVA 2FB7A 2EQJA 5I21A 1WJSA 2HSEB 4C8QF 4D8KA 2CP7A 3TREA 4M7DG 2E6ZA 3C0CA 2LMJA 3PIOA 1RAIB 1N9RA 3CCVA 1VQNA 2V1RA 2IIMA 1GRIA 3SDZA 2XG8D 5KH6A 2E64A 3FJPA 3SWNB 1I0CA 1LPLA 3M0SA 3PNWC 2A3LA 3H6ZA 3GNGA 2MF2A 1KHIA 3CCEA 2P0KA 4MZMA 2L2PA 2XMFA 3KUFA 3OS2A 2E5QA 2EQUA 4XTZA 2PUOB 3I56T 4WCIA 2F2VA 4Y92A 2RHXA 2QASA 1KIKA 3CC4T 1E6GA 2RB6A 1YJNA 3JB9D 5LL6S 1GL5A 2FO0A 4J6WA 2BZYA 4ZGJB 5A0DA 3MJXA 2CZ1B 1YCYA 2ED1A 2BZXA 4O6JA 1KC8U 4M75F 2RJCA 1H641 4PJOA 4PLLA 1Y96A 4JLGA 2RM4A 4TVRA 4PJOD 3JB9G 1WHMA 2JN0A 1M1FA 4PJOC 4HCBA 3UA7A 4DEYA 3CC2T 4FT4A 2PTKA 5FWBA 1KD1C 1M1KC 2E6NA 2EGCA 3VS0A 4QQDA 2K3XA 3VS6A 5CKEA 3TSWA 3CCUA 4E47A 3MO8A 2BTTA 4MMKA 4Z8AA 4F7UG 1HD3A 3OYBA 3RNJA 4OMPA 4OMOA 4CC2A 3CCRA 3BW1A 3PT9A 1RAEB 4DEXA 4A4HA 1WZOA 3EFOA 4R56A 3EGUA 1WQ7A 1VQMQ 1JB0E 2W0ZA 5GANd 3G7ZA 2DIQA 1NM7A 4MDWA 5FLXE 1LCKA 2ZPGB 1YIJQ 4LN2A 2QI2A 3H0IA 2AK5A 3JCMW 1Q86R 2A0FB 4A4GA 4HT9A 2K6DA 3L2ZA 2HAXA 1TOVA 1IXDA 3SB2A 4Q5WA 1QWFA 3LWIA 4E7KA 2YUOA 1WXUA 1KJWA 4OGCA 4ZGEB 1PRMC 2DVJA 4JZ4A 1TG0A 1RLPC 2JNGA 2K79A 2VUBA 3V7SA 5FU7C 1BIAA 1NLPC 1TXQA 2RQUA 5AT1B 4RTZA 3EHQA 4J9BA 3NGPA 1VQPT 2C0OA 3CCLT 3ZBDA 5D6XA 1PC0A 2HQEA 4AMCA 3UT1A 4QVZA 2KYBA 3LWHA 3C94A 1OX9A 4BY6B 3L2WA 5LJ3j 3KFVA 4M77A 2WACA 3QDRB 3DLMA 1EX4A 4OMNA 4ELYC 4HVUA 2YLCA 1G3TA 2YRCA 2LC4A 4ELZC 1M8MA 2K2VA 2O01E 5I22A 1ZUUA 2EJFA 3OYCA 2X4JA 4WTOB 1WFWA 4J9FA 2E65A 1G3WA 4RTYA 3CCSQ 1BI1A 4MMLA 5FU6B 4N4IA 3CCJT 1KFZA 4XTYA 2MMPA 3CMAA 4AFZC 1VIFA 1OULA 1D3BB 4JRQA 3JCMh 3MEWA 1UUEA 5GAOp 1U3OA 1Y71A 3CCQA 4AFSC 4C0ZA 3VS1A 2RQTA 4PK4A 2DLPA 3I5RA 3G4SA 2HNIA 3QXEB 3CEYA 2XDBA 3REBB 3JCMg 1S72T 3EAEA 2IG0A 5GAMg 1W2BP 4PL6A 3OYDA 4C92F 1WHJA 2XICA 1KG1A 1WNLA 1RUWA 3RUXA 4BDZA 1OU8A 2KVQG 1VQLA 4XU1A 1LNXA 3G6ET 1OV3A 2M16A 4ZTJA 1VYUA 3QHSA 4QQ6A 2PVGB 2V8JA 5KYNA 2FPDA 1HSQA 1QVGS 1CKBA 2XHCA 3OSVA 3S3NA 4JJNK 2R57A 2O31A 5D6YA 4R55A 3UF4A 2PZ1A 1MMAA 2V8IA 5GMKm 1X27A 5D6WA 1RAGB 4WF2A 4M7AB 1VQ9A 2ED0A 5CVIA 1H92A 2LJ0A 4C8QA 2K4YA 4KGVB 1GCPA 3NPFA 4C8QD 2JOYA 2VYTA 3CPFA 2CH4A 1WHLA 4Y28E 2GFAA 4FYXB 4D6WA 2LCCA 4QKUA 3A8HB 4R0KA 3X24B 3QIIA 4JZ3A 1N8RC 3M59A 2LQNA 4E7SA 1N5ZA 3FDRA 1WJRA 3VYHB 2FZCB 5CK9A 1FXXA 3LLRA 3OYJA 1BIBA 3PVLA 2J05A 3M4YA 1M27C 3FC3A 1IGQA 3TU4K 1PKTA 2DXCA 1SRMA 4M78B 1KC8C 2EWNA 5J26A 1SSHA 4LUDA 1UG1A 2QTVA 2O9SA 2L8DA 3RR6A 2YXYA 1BU1A 4KH1B 5KYWB 2FL7A 2DEQA 2VASA 5HKCA 2B86A 1H3HA 4EMKB 4RG8A 2JUFA 5C0MA 2B8AA 1H8KA 2DYBA 3GBQA 4IUPA 4XU0A 1Q81R 1OOTA 1W2BS 2A37A 1TUGB 4JLIA 1JQQA 3VUZA 4XTWA 5LJ5e 4DBQA 4C5IA 3QKJA 1RL2A 4M75A 2EYXA 3I5SA 5GAOm 3FEOA 5IXFA 3CC4A 2ZZDA 1NJIR 3MEVA 4PNOA 1KSWA 2H8HA 1ZSZC 4C0GA 1AWWA 1ZLMA 5FU6C 1PSEA 1BI0A 2HCKA 1X6OA 1VQ5A 5HK3A 2LVMA 3MEUA 1VQMT 3UDCA 3P8HA 1S1NA 4MZTA 5GMKl 3I35A 1EIFA 5KE3A 1YIJT 4OB3B 2VV5A 2XU8A 1ZUKA 2OAWA 1U06A 1D0XA 1V29B 1M2VA 2YLBA 3EG9B 1OU9A 2RHYA 1YHQQ 1I81A 1D0ZA 3DB3A 3CC7Q 3I55A 3VJPA 3QWXX 3HRUA 2CT3A 2M0OA 2JMAA 3CMEA 2RO0A 4IUVA 5GMKh 1KQSS 2VXFA 1QVGA 3OS5A 2HD0A 4KULA 3NMZC 4O5VA 1NPRA 3JCMb 1YJ9Q 2RHZA 2LX9A 4JJCA 2RA2A 5DLQE 1RABB 4C5HA 4IUUA 3QPHA 3JB9H 2FPFA 5IH2A 2NUZA 2QDLA 4CC7A 3VYGA 1VQ4A 4FU6A 1SF9A 3L1AA 2ESWA 2QQ9A 2PNIA 1GFCA 1UGQB 2GGRA 4HVWA 4ANJA 3EHRA 4M7AD 1FYNA 3G71Q 1AVZC 2F1LA 2DILA 4M7AC 2CUDA 2DAQA 3HP9A 2ZPEB 2HDAA 4IIMA 3URGA 4E6RA 4D8DA 4XTUA 2QA4A 4LDYA 1EFNA 1BB9A 2NUTB 3M55A 3VS3A 1B7TA 3CCST 5GAOl 2FPEA 4XQ3A 1O9SA 4II1A 1M90C 4M7AG 4RUGA 3SHWA 1FMWA 3GIBA 2RJEA 5FRMA 2HL3A 4QT7A 1N6AA 3OYNA 5AYFA 3CCLA 3R6NA 1GBQA 1UJ0A 2EIFA 4M78C 1HXDA 1HK9A 1YITQ 4PJOB 5CO7A 9ATCB 2D8HA 3E9GA 1Y96B 3OY9A 1NJIU 5LJ5j 1MV0B 4YTLA 1YJWQ 3RBBB 3JCMd 4EMKC 4BB7A 2KROA 5L23A 3M4GA 2FVUA 4IUQA 4LDXA 2A7YA 1K0XA 3GNFB 4EPCA 1VQOQ 4M78G 3L2VA 2LP5A 1NPPA 5CAIA 3QDFA 2HMAA 2SEMA 3S3OA 1OZ3A 2MYSA 3C4SA 2HBWA 1WXBA 4FW1A 4RG2A 2PQWA 4JRPA 1Q86C 3JCMQ 5GAN8 4C92A 4DBFA 4FCYA 1JJ2S 1ZA1B 4C92D 3CCMQ 2I0NA 3EFOB 1X6BA 2CSIA 2KY9A 1VQ8A 3OBWA 4HT8A 3CD6A 1T3SA 4DOVA 1W70A 4KBMB 1YI2Q 4DOWA 2RI5A 3L42A 5GANe 4ZN3A 2KEAA 5I2SA 2P4TA 3ER0A 4FSSA 2DBMA 3OSSC 4OMQA 4M7DE 1GCQA 3BE3A 1GFDA 2ROTA 4F16A 2VB6A 1CSKA 2LT1A 4N0AA 2MWOA 4DBRA 2E5KA 1IB8A 3OYIA 4VUBA 2QEXQ 2AKKA 2EYYA 5FU7B 3G6EA 4OMLA 2RF0A 2ZCFB 1KQSA 2D0QB 3GOXA 1R8OB 3QSUA 2RK2A 4F04B 2K3YA 1TS9A 3OYLA 5LJ3f 2KT1A 2V26A 5KYUA 2RHUA 1U1TA 2EVRA 1QP2A 2RPNA 5CKFA 4LNPA 4OP0A 2DXBA 1PG5B 5I2MA 4FW2A 5FROA 1C0MA 1M3CA 4RTVA 3CCVQ 1T0JA 4M77B 2EBPA 3MHXA 3IQLA 1SG5A 1Q7YC 4JS5A 3SFMA 4BE2A 3HRTA 2GFUA 1X01A 1WDXA 2ZPFB 4FYVB 3V7RA 5LJ3e 5CKDA 1D0YA 2CZ0B 2YUNA 4J9EA 3GPLA 2HEQA 2J6KA 1TH7A 2MAMA 5KCHA 1UGSB 3JB9I 1BCOA 4OB2B 3LH5A 3MP1A 1IREB 2KXDA 1M9SA 2RH2A 2AIRB 3RDVA 5L8RE 1BCMA 2G3RA 1RI0A 1WYXA 4RTUA 4P5NA 4RTWA 3HHTB 3RIRA 4F7UE 1JU5C 1PD1A 4JJBA 1D1BA 3CC7T 4XU3A 5GAN7 2XI9A 1QP3A 2DL4A 3V7CA 1M8VA 1FWZA 1AD5A 3UA6A 1AEYA 3VS5A 1WLPB 2EPDA 2DTOA 4XTXA 5EC7A 3PIPA 4PJOG 1BK2A 2MWPA 4C5EA 1YJ9T 1JJ2A 1KHCA 1VIEA 3X28B 5GANj 1G8XA 3CCUQ 4ATOA 3VS7A 1MNDA 2EKHA 4MDXA 4RKUE 2EW3A 1VQMA 4J9CA 2LZ6B 2CUBA 2OI3A 4J7FA 2LCLA 3G71T 2M1HA 2DYIA 2HQXA 2K3BA 1F1BB 4GLKA 1YIJA 3P8BB 2NUPA 1W1FA 1GXIE 4C8QB 3LW5E 2LNVA 4ZGDB 2L0AA 2AHJB 1VQ7A 4HKEA 4IKFA 1QVGP 1K76A 1DJ7B 4BD3A 3H9NA 2JTMA 2AZVA 4KGZB 5KE2A 1P92A 2LJ1A 1MV3A 3THKA 1O75A 1Q81C 1B07A 3KBGA 3UATA 1Y7XA 1AZGB 2IPOB 2FRYA 2IVWA 2QQBA 2GBQA 1VYVA 3RKXA 1K1ZA 4X34A 5CCAA 1NJIC 1K8AC 1FMKA 2M9UA 2OTLQ 1YJWT 4OB1B 2O4XA 4JRKA 3DLLA 3OYAA 5IHKA 4M77D 4XU2A 3M9QA 1QVFS 1PM3A 1NZ9A 4M77C 3M58A 1VQOT 1B34A 2V8KA 2KGTA 3GF5A 3OW2S 3HRSA 2MOXA 2GQVA 1YWPA 2DL8A 1ZSZB 4M75B 1TSFA 3INZA 5A2QE 1K73R 2D0NA 2JXBA 1VQKQ 4OVAA 3CCMT 1VQ6Q 1XNIA 1UDLA 4M77G 2KDSA 1RAHB 4LDUA 2R58A 2DM1A 4OGEA 1YI2T 4GLMA 1UFFA 1G2BA 3A8GB 1BBZA 3J81E 3CMAQ 2D6FA 2M0YA 2RQRA 2RMOA 4PLIA 4KRTA 5LJ5h 3ZL7C 1M2VB 3P8DA 4Z89A 2CGHA 3G4SQ 3CPWA 2QEXT 3JSCA 2DA9A 2K5FA 1YNZA 1A0NB 2CKKA 1OPKA 1ZQ1A 1J3TA 2L5QA 3RMSA 3L2QA 1N9SA 3LH0A 2X3XD 1RLQC 4C0FA 2J6OA 2L3QA 4LD9K 2K2MA 1VOMA 4F14A 2VGNA 1LOJA 2Y4YA 1H3ZA 1PRLC 4KT0E 3VV0A 4M7DF 4AG1C 1SPKA 1VUBA 1YBYA 1ACMB 3JRZA 1W6XA 3CCVT 2C0IA 3D7SB 3BY7A 1M1KR 2DERA 4GY5A 4E7LA 2QQSA 2MI6A 1KQ1A 3F70A 1UHFA 2X9HA 2YUQA 1XOVA 2XD0A 4C8QC 3G1JA 2OTJA 1KQSP 2I2LA 1VQ9Q 1OYXA 3JCMc 1TUCA 5GAOr 1AWXA 2JTFA 5LJ5f 1IHVA 4EIKA 3QBYA 1PHTA 4C8QG 4QQGA 1NYFA 2X4XA 4DA4A 3U23A 4RCCA 2HSPA 2FZGB 1MMNA 1I1JA 2RI3A 3QYHB 4A53A 3CQTA 4FL6A 2GNCA 2E10A 1K73U 5J39A 4B9WA 1OX8A 4FM4B 1YP5A 4HCKA 4B6MA 1QVFA 3JB9F 2COZA 3PFSA 2DXUA 1NBEB 4LDWA 1PKSA 4DBHA 5C6SA 3OW2A 2JM9A 2DPPB 3JCMe 3I56A 3X20B 5GAMe 2FYKA 4OMMA 3KXTA 2BE9B 4M75D 4JJDA 4FIBA 4M75C 1SKUB 2C06A 1ZBXA 1I4K1 1IGUA 3FIFA 3CCUT 4F7UF 4NL2A 2EKOA 4PJOF 2CS7A 4C92B 4J9HA 2F5TX 1WX6A 2Z0WA 1QCNA 2D9TA 3LGFA 1VYTA 3A5ZB 3PTAA 3X25B 4X1VA 1VQ5Q 3LX7A 4M75G 3T9NA 2DMOA 1YWOA 2COYA 2QGFB 1X2KA 3E9FA 2BE7D 1QMCA 2A36A 3Q1JA 3CC2A 1RADB 3VRYA 4Z88A 4UC4A 1JRIA 4LD6A 2GF7A 1JJ2P 1VA7A 4LUEA 3QZ5B 1OQKA 2J06A 4JS4A 1D1CA 2E1HA 3AT1B 2QDYB 1QCOA 3RKWA 3M54A 1QW1A 1KD1U 1M1KU 2RJFA 4PFPA 2FHDA 3FB9A 4AG2C 3I55Q 1YJ9A 3AHUA 1K4US 2NLUA 4KH0B 3GP8A 4CI0C 3CMEQ 4BUGA 5GANh 4ESRA 2C0TA 2ECZA 4FSXA 3ASKA 2LQWA 1TU0B 2LQ8A 4J7IA 3QWYA 3QZ9B 8ATCB 1I8FA 2OTLT 4J9DA 2K5IA 5CQYA 3QG1A 1NG2A 3R6OA 2FEIA 3OB9A 4RTTA 2CP6A 2YUPA 3SD4A 4M7AE 1V76A 1OI1A 5GJVB 3OYFA 1R0BG 1VQ4Q 4J6XA 2L3RA 3PMIA 3BFMA 1M1GA 3S3MA 4E7IA 2F69A 5DLOA 2RQWA 1MUZA 2X35A 3EG2A 2NYSA 3H0FA 3M0PA 5CQXA 1K9MR 1X6GA 4FYWB 3HFNA 1VQKT 2A08A 1VQ6T 1WJQA 2DO3A 1BI3A 2QXFA 2QA4Q 2RHIA 4E7HA 1AZEA 3CXCS 2CSQA 1G83A 1U1SA 4Y91A 2DX1A 1VQPA 1M30A 5HCKA 2DFUA 3OYGA 2VKNA 4A63B 3CMAT 4AFQC 4M78E 1BI2A 2QQRA 5GAMj 3RERA 2EYZA 3GLXA 3QYGB 3TSZA 5LJ3h 3G4ST 1V1CA 2DIGA 2PUKB 3E1SA 3CCLQ 3EH1A 3OYKA 1ZX6A 3C12A 2EQMA 5GANf 2H3EB 5KCOA 2KBTA 2J6FA 1QLYA 2EAYA 1N8RR 3M56A 1C6VX 4FYYB 4L6V5 4A4EA 5LJ5d
chains in the Genus database with same CATH topology
1D3BA 1QP3A 3CEYA 3CCJA 2XDBA 3JCMg 1S72T 3V7CA 2E41A 3EAEA 1M8VA 1FWZA 2IG0A 5GAMg 4BACA 1U8RA 3NTHA 4PL6A 3OYDA 4C92F 4C92C 4EMGA 5GAOq 2DTOA 1WGSA 4PKCC 2XICA 1KG1A 3C95A 4XTXA 1WNLA 3DB4A 3PIPA 4PJOG 4BDYA 2KAFA 1YHQA 3RUXA 1MGQA 4BDZA 2Y4XA 2MWPA 2KVQG 3JAME 3CC7A 1VQLA 4C0DB 4XU1A 1LNXA 4C5EA 1YJ9T 1JJ2A 1KHCA 2CZ7B 1VIEA 2LT4A 3ME9A 3G6ET 3X28B 2M16A 5GANj 4ZTJA 4ATOA 1S72A 2DJZA 4M7DB 4MDXA 3VKIA 3QHSA 4RKUE 4QW2A 1VQMA 2XK0A 4QQ6A 2PVGB 2V8JA 4J7FA 1VQ7T 4XTVA 2LCLA 4C92G 2M1HA 3G71T 2HQXA 5CKHA 5IT9E 1QVGS 2XHCA 3OSVA 4GLKA 4MZPA 3S3NA 4JJNK 4M7DA 3QJ6A 2EQKA 2R57A 1YIJA 3NFCA 3P8BB 4N0AC 2QQAA 5D6YA 4M7DD 4V2SA 1GXIE 4R55A 4C8QB 2XDPA 3A8LB 2V8IA 3LW5E 4OF1A 2LRQA 4KUIA 3MCAB 4NOYA 5DY9A 2LNVA 4ZGDB 5GMKm 5D6WA 2CZ6B 2AHJB 2RK1A 1VQ7A 4HCZA 4HKEA 3TEEA 4WF2A 4M7AB 5GANg 2KK4A 3G71A 4IKFA 1DJ7B 4BD3A 2OAUA 1I5LA 1VQ9A 5GAN2 2CYZB 5CVIA 3OA6A 1W4SA 2JTMA 4C8QA 2K4YA 5CIUA 3RKYA 4ZN1A 3M5AA 3WXMB 5GAN6 1P92A 5KE2A 4RMOA 4C8QD 2XKOC 3CBOA 1FX7A 2JOYA 2VYTA 1LJOA 2DXTA 3CPFA 1O75A 4OB0B 4M7AA 4Y28E 3S6WA 1K9MU 2BUDA 2GFAA 1K73C 1Q81C 4D6WA 1WPYA 3KBGA 2LCCA 3QUIA 2KSSA 1Y07A 2O4XB 3A8HB 5CR2A 1Y7XA 5J3BA 3X24B 3HFOA 2IVWA 4QVCA 4BE1A 3QIIA 2QQBA 1N8RC 3M59A 3V8LA 5GAN4 4B9XA 3N5BB 3FDRA 1WJRA 1IZ6A 3RKXA 3VYHB 5CK9A 4X34A 1FXXA 3LLRA 5CCAA 3JB9J 1NJIC 1XQHA 2P0PA 1K8AC 2M9UA 1B34B 2KMTA 1BIBA 3OYJA 2EJ9A 1KQ2A 1SSFA 3M4YA 1YJWT 3OMGA 4OB1B 2O4XA 4JRKA 4L59A 3FC3A 3DLLA 3OYAA 2YRVA 4JUVA 4J5YA 3TU4K 4RCBA 2DXCA 4M77D 4M78B 3M9QA 2EWNA 4XU2A 5J26A 5A0LA 5GAN5 1KC8C 1QVFS 1NZ9A 4M77F 4M77C 3X26B 3NTIA 2L8DA 1YITA 3M58A 1VQOT 2JVVA 1B34A 5HY6A 1G3SA 3CXCA 2V8KA 2ZPBB 3GF5A 3CCQT 3OS0A 5GAOn 2FL7A 3OW2S 2GCXA 3HRSA 1Q81U 2DEQA 3WVEB 4DQ2A 2GQVA 5HKCA 3J7AF 4M78A 2DTIA 4EMKB 4M75B 1YJWA 4RG8A 3DKMA 3INZA 4M78D 5A2QE 2JUFA 5C0MA 2B8AA 2PU9B 4XU0A 4IUPA 2DD4A 4F7UB 1M5Q1 3M53A 3META 1N8RU 1VQ5T 3QO3A 2DTHA 1W2BS 4JLIA 4OVAA 3VUZA 3CCMT 4XTWA 1XNIA 1VQOA 5LJ3g 5LJ5e 4C5IA 2ZGWA 1K8AU 4BI8B 4M77G 3QKJA 2KDSA 4PJOE 1RL2A 4EMKA 3MP8A 4M75A 1YHQT 5M9OA 5GAOm 3FEOA 3CC4A 2F5KA 1VQLT 2ZZDA 3A8OB 2K5LA 3MEVA 4F7UA 4LDUA 4PNOA 4C0GA 2R58A 4OGEA 5FU6C 5GAMd 1YI2T 1PSEA 3UPUA 3VUBA 3CPWS 1W2BA 3OBYA 1BI0A 3A8GB 1X6OA 3J81E 2VGMA 2XDDA 1VQ5A 2D6FA 5HK3A 3HKSA 5GAN7 4BI3A 4PLIA 2LVMA 3MEUA 4HA8A 1VQMT 3O8VA 3UDCA 3CCMA 3PMTA 5LJ5h 3P8HA 5EG2A 2WSFE 2P0QA 4C92E 1OZ2A 3P8DA 4MZTA 2CGHA 1BYMA 3BDLA 5GMKl 4BI4A 3I55T 3CPWA 1EIFA 5KE3A 1YIJT 4OB3B 1UEBA 2VV5A 3JSCA 2XU8A 2QEXT 1YI2A 2K5FA 3CMET 4HCCA 4JDSA 4IUTA 2R5AA 3FLGA 4NS5A 1Q82U 1WQWA 2ZPHB 3ZEHA 5GMKe 1V29B 5GMKj 2CKKA 2YLBA 3MP6A 1ZQ1A 2LDMA 2L5QA 3RMSA 3L2QA 2RHYA 1I81A 2X4YA 3ZFJA 1N9SA 3EFRA 2Y90A 3DB3A 3LH0A 4C0FA 1VQ9T 4KUDK 4C0DC 5IAYA 3I55A 3VJPA 3OYEA 3HRUA 4LD9K 2QEXA 2M0OA 2VGNA 2HBPA 3CMEA 1LOJA 2RO0A 2Y4YA 1H3ZA 4KT0E 4IUVA 3VV0A 4M7DF 4M7DC 1VQ4T 5GMKh 2OTJT 1KQSS 2DVEA 4FT2A 4OMFB 1XTDA 2VXFA 1QVGA 3HPWA 3OS5A 2HD0A 4KULA 1VUBA 2JZ2A 2PVOB 2WSEE 4IURA 1NPRA 4O5VA 4CRIA 3JCMb 3JCMV 2H3JA 1X75C 1YBYA 3H8ZA 3JRZA 2RHZA 3CCVT 2LX9A 2RD1A 3BY7A 1N27A 2RA2A 2KQWA 4GY5A 5DLQE 4C5HA 2QQSA 4QVDA 4IUUA 2MI6A 4E7LA 1KQ1A 2FB7A 3F70A 3QPHA 3JB9H 2EQJA 5I21A 3FRNA 1XOVA 1WJSA 2XD0A 4C8QF 3VYGA 4C8QC 2QA4T 1VQ4A 4FU6A 2OTJA 3L1AA 2QQ9A 2XIDA 1UGQB 2DK3A 2LTOA 3TREA 3EFSA 3L2UA 4M7DG 1BKBA 4M7AD 2DKGA 2EYQA 2E6ZA 1M4ZA 3HL8A 4L5GA 2I2LA 3PIOA 4M7AF 4M7AC 2DAQA 2BIVA 3HP9A 1OYXA 1N9RA 3JCMc 3CCVA 1VQNA 2ZPEB 1YITT 1G3YA 5GAOr 3SDZA 3URGA 2XG8D 4XTUA 2JTFA 5KH6A 2E64A 3FJPA 2L89A 5LJ5f 2QA4A 3SWNB 3QBYA 3PNWC 2A3LA 4LDYA 3H6ZA 4Z02A 3GNGA 3WVDB 2MF2A 3M55A 2OTLA 1KHIA 3RMQA 4C8QG 5GAOl 4QQGA 3CCST 4J6YA 2P0KA 3CCEA 1QVPA 2X4XA 4DA4A 4RCCA 4MZMA 4XQ3A 1O9SA 4II1A 3KUFA 3V8KA 3OS2A 2E5QA 2EQUA 4XTZA 4ZTFA 1M90C 3QJYA 4JRIA 3SWNA 4M7AG 2PUOB 2RI3A 4M77E 3QYHB 3I56T 4A53A 2VXEA 4FL6A 3GIBA 2R5MA 2EJGA 2E10A 2RHXA 3CBPA 3CC4T 1K73U 4A54A 2RB6A 1YJNA 5J39A 1JBMA 3SWNC 2RJEA 4B9WA 4FM4B 3JB9D 5LL6S 5FRMA 1QVFA 5CKBA 1N6AA 3PFSA 3CCSA 3OYNA 3JB9F 2DXUA 4J6WA 5AYFA 4ZGJB 3CCLA 5A0DA 2EIFA 4M78C 1HXDA 4M78F 2WSCE 1HK9A 4LDWA 5LJ3d 4PJOB 5CO7A 2X4WA 3E9GA 1Y96B 2BKDN 3OY9A 1VQKA 3M57A 5C6SA 3OS1A 5LJ5j 2DPPB 3JCMe 3I56A 3OW2A 1NJIU 1VQ6A 3X20B 5GAMe 4YTLA 2FYKA 5A0GA 2CZ1B 1YCYA 3KXTA 5FRNA 4M75D 4O6JA 4FIBA 3JCMd 1KC8U 4EMKC 4M75F 4M75C 2RJCA 2C06A 4BB7A 1H641 1ZBXA 4PJOA 1I4K1 4PLLA 1M90U 3M4GA 3JCMX 1Y96A 2FVUA 4IUQA 3FIFA 4JLGA 2A7YA 2RM4A 4TVRA 4F7UF 3CCUT 4LDXA 4PJOD 3GNFB 3JB9G 4EPCA 4NL2A 2JN0A 2RJDA 2EKOA 1M1FA 4PJOF 5HK0A 2CS7A 4C92B 4PJOC 4M78G 4HCBA 3L2VA 3PGGA 1NPPA 2F5TX 5GAMh 2VC8A 5CAIA 3CC2T 1VQ8T 3S3OA 4FT4A 3CD6T 2D9TA 3LGFA 1KD1C 1M1KC 1OZ3A 3C4SA 3A5ZB 2E6NA 2PQWA 3LYIA 4RG2A 4JRPA 1Q86C 3JCMQ 3PTAA 3X25B 4QQDA 2K3XA 5GAN8 4C92A 5CKEA 5LJ5g 1JJ2S 3CCUA 3LX7A 4M75G 3T9NA 4E47A 3MO8A 4C92D 3JCMP 4MMKA 3E9FA 4A4FA 4F7UG 1UGPB 4J8OA 3OYBA 2KY9A 3Q1JA 3OYMA 3CC2A 2YHTA 3MEAA 3OBWA 1VQ8A 4HT8A 1MHNA 3CD6A 4UC4A 4DOVA 3CCRA 1JRIA 3BW1A 3PT9A 4KBMB 4LD6A 4DOWA 2GF7A 2RI5A 3L42A 5GANe 1AHJB 4ZN3A 4A4HA 3QZ5B 5I2SA 2P4TA 3ER0A 4JS4A 3LGLA 2E1HA 2LQKA 5GAN3 4R56A 1WQ7A 2QDYB 3OSSC 3RKWA 2DD5A 1JB0E 5GANd 3M54A 4M7DE 1QW1A 3G7ZA 2ZPIB 1KD1U 2DIQA 1M1KU 2RJFA 2LT1A 2FHDA 4N0AA 3FB9A 2MWOA 1Q86U 1K9MC 4MDWA 5FLXE 1VQNT 4BE0A 2ZPGB 3OYIA 1YJ9A 3AHUA 4VUBA 5IN1A 3BDUA 2NLUA 2QI2A 4CI0C 3GP8A 3JCMW 4BUGA 5GANh 5FU7B 3G6EA 1UB4A 2ZCFB 4A4GA 4EMHA 4HT9A 1KQSA 4FSXA 3L2ZA 2HAXA 2D0QB 3ASKA 5DM7R 3GOXA 2LQ8A 1R8OB 4J7IA 3SB2A 4XK8E 3QZ9B 2RK2A 4Q5WA 1I8FA 3QSUA 4C8QE 2OTLT 2K3YA 3OYHA 3LWIA 3CCET 4ME7A 4E7KA 2K5IA 5CQYA 3QG1A 5LJ3f 3R6OA 3OYLA 4OGCA 3OB9A 4ZGEB 3HSBA 4N4GA 2JNGA 1NE8A 3SD4A 2RHUA 4M7AE 5GMKi 3J80E 1U1TA 2VUBA 1QP2A 5CKFA 3V7SA 1OI1A 5FU7C 3OMCA 1BIAA 4LDVA 3OYFA 4OP0A 2E70A 3A8MB 3JCMf 2DXBA 2DZCA 1YJNT 5I2MA 4J6XA 5GAMf 2L3RA 3PMIA 3BFMA 1VQPT 1M1GA 3S3MA 5FROA 4E7IA 2F69A 5DLOA 3CCLT 3ZBDA 5D6XA 2HQEA 2X35A 4M77B 1ZHIA 5CQXA 3MHXA 3UT1A 3HFNA 1VQKT 4NL3A 4QVZA 1Q7YC 1WJQA 1VQ6T 4JS5A 2DO3A 3SFMA 1BI3A 3LWHA 2QXFA 4E7HA 2RHIA 3C94A 4BE2A 3HRTA 2GFUA 1X01A 3CXCS 3OQ5A 2QTXA 2ZPFB 3V7RA 1U1SA 4BY6B 4Y91A 5LJ3e 5LJ3j 3L2WA 1VQPA 5CKDA 3E19A 4M77A 2WACA 2CZ0B 3QDRB 3CBMA 3DLMA 3OYGA 4N4HA 4A4KA 4ELYC 3GPLA 2YLCA 4J83A 1UGRB 1G3TA 1TH7A 2MAMA 5KCHA 1G5VA 2LC4A 1UGSB 4XAXB 3JB9I 4ELZC 4M78E 3CMAT 2K2VA 2O01E 3NTKA 4OB2B 3V8JA 1BI2A 3MP1A 1IREB 2QQRA 5GAMj 3RERA 2EJFA 3GLXA 1M9SA 2RH2A 2X4JA 3QYGB 3VU3C 3OYCA 2E65A 2E12A 1G3WA 5LJ3h 3G4ST 4BY6C 4EDUA 2DIGA 1BI1A 2RI2A 2PUKB 3E1SA 4MMLA 5FU6B 5L8RE 3JCMJ 2G3RA 1RI0A 4N4IA 4M75E 4XTYA 3OYKA 3CCJT 3L2RA 4P5NA 3C12A 2EQMA 4C5GA 3TCJA 5GANf 2MMPA 1Q7YU 3CMAA 4JRQA 1VIFA 3HHTB 1D3BB 3RIRA 1PSFA 4F7UE 5KCOA 2K57A 3OYYA 3JCMh 2PVDB 1Q82C 3MEWA 5GAOp 1Y71A 2EAYA 3CCQA 2EFIA 3M56A 4C0ZA 4L6V5 3UWNA 4X9DA 4A4EA 3CC7T 3CCRT 4E7JA 3G4SA 5LJ5d 2DZ9A 4X9CA 4XU3A 3RESA 2HNIA 2XI9A 3QXEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKE A;  3G7Z A;  1VUB A;  3VUB A;  2C06 A;  5HKC A;  1NE8 A;  1X75 C;  2VUB A;  3JRZ A;  5CK9 A;  5CCA A;  5HK3 A;  5CKB A;  5CKF A;  5CKH A;  2KMT A;  5CKD A;  4VUB A;  3TCJ A;  1M1F A;  5HK0 A;  4MZP A;  4MDX A;  2MF2 A;  1UB4 A;  4ELY C;  3NFC A;  4MZT A;  5CO7 A;  4ELZ C;  5DLO A;  4MZM A;  4OF1 A;  3JSC A;  4ME7 A;  5CQX A;  5CQY A;  5CR2 A;  3HPW A;  5CKE A; 
#chains in the Genus database with same CATH topology
 3CCJ A;  2KR3 A;  1M2O A;  3EH2 A;  3NTH A;  5GAO q;  4C92 C;  1WGS A;  1X2Q A;  1WA7 A;  1LVK A;  2VVK A;  3DB4 A;  4AFU C;  4BDY A;  1MGQ A;  2Y4X A;  1Z9Q A;  1M3A A;  3JAM E;  1PNJ A;  4C0D B;  2ROL A;  2CZ7 B;  2X51 A;  2LT4 A;  3ME9 A;  3CPW P;  1YFN A;  1S72 A;  2DJZ A;  2FRW A;  2DEU A;  2MPX C;  2NUP B;  2JTE A;  1RAF B;  1UGV A;  1VQ8 Q;  1Q82 R;  3CD6 Q;  4C92 G;  4J9G A;  5CKH A;  1GCQ C;  2KRN A;  2KXC A;  4MZP A;  4M7D A;  1WHK A;  2EQK A;  3NFC A;  2COW A;  4N0A C;  3M0T A;  3EGD A;  4M7D D;  4V2S A;  2XDP A;  1ZA2 B;  2J7I A;  4OF1 A;  1PWT A;  2LRQ A;  4KUI A;  3MCA B;  3VRZ A;  5DY9 A;  1K0S A;  2QG9 B;  2RK1 A;  1MMG A;  2P4R A;  2EGE A;  1I5L A;  5GAN 2;  2EQI A;  2AKL A;  2CYZ B;  5CIU A;  2QYZ A;  3RKY A;  2ATC B;  4ZN1 A;  3M5A A;  3WXM B;  5GAN 6;  4RMO A;  5KYX A;  1AOJ A;  1M3B A;  2XKO C;  3CBO A;  1E7O A;  1LJO A;  3S6W A;  1K9M U;  1K73 C;  2AZS A;  1WPY A;  1VQN Q;  1Y07 A;  6AT1 B;  2O4X B;  5CR2 A;  2HQH A;  1QQJ A;  2JT4 A;  5J3B A;  4BE1 A;  1UEC A;  1X69 A;  3V8L A;  5GAN 4;  4B9X A;  3N5B B;  3SEM A;  1I5O B;  2DJQ A;  3EGX A;  1XQH A;  2P0P A;  4RTX A;  1B34 B;  2EJ9 A;  5IHI A;  3CCE Q;  3OMG A;  4L59 A;  1MNE A;  5FW9 A;  1NLO C;  2YWW A;  4J5Y A;  4RCB A;  1IRX A;  5A0L A;  1ABO A;  4ORZ A;  1UE9 A;  1C1A A;  3X26 B;  3NTI A;  3TQ7 P;  1EZZ B;  2JVV A;  2YSQ A;  4M4Z A;  5HY6 A;  1G3S A;  3CXC A;  1YJN Q;  2NUT A;  2GCX A;  2OJ2 A;  3WVE B;  4DQ2 A;  1Y0M A;  2DTI A;  3M0R A;  2V1Q A;  2NWM A;  1QVF P;  2DD4 A;  1M5Q 1;  3M53 A;  3MET A;  1N8R U;  1VQ5 T;  3REA B;  1OEB A;  1SHG A;  2ZGW A;  4PJO E;  2DRM A;  1YHQ T;  5M9O A;  1HJD A;  3OW2 P;  1FMV A;  2K5L A;  4F7U A;  1QKX A;  2W10 A;  4PJJ A;  3UPU A;  3VUB A;  3CPW S;  3PVQ A;  1RAA B;  2VGM A;  3HKS A;  1UTI A;  4HA8 A;  8AT1 B;  1M90 R;  1QKW A;  2F2X A;  2P0Q A;  2KRS A;  3JV3 A;  1OZ2 A;  2L3S A;  3BDL A;  3I55 T;  3CME T;  4HCC A;  4JDS A;  4IUT A;  4NS5 A;  1Q82 U;  1WQW A;  2ZPH B;  5GMK j;  3H41 A;  3NHN A;  3MP6 A;  7AT1 B;  3CCR Q;  1XJW B;  4KUD K;  2CP3 A;  4C0D C;  5KYY A;  3OYE A;  1WI7 A;  2HBP A;  2JM8 A;  3EG3 A;  4E2F B;  2KI7 A;  3VS2 A;  1VQ4 T;  1JEG A;  2DVE A;  1XTD A;  2OX7 A;  4PJM A;  3HPW A;  1I07 A;  1ABQ A;  2MK5 A;  4IUR A;  2JZ2 A;  4CRI A;  1QCF A;  3JCM V;  2H3J A;  1X75 C;  3H8Z A;  2RD1 A;  1WIE A;  2KQW A;  1UHC A;  2HKQ B;  3FRN A;  3MPU B;  2QA4 T;  2CRE A;  4AT1 B;  1U5S A;  2XID A;  2D1X A;  2DK3 A;  2LTO A;  3EFS A;  3L2U A;  1BKB A;  2X3W D;  1VQ7 Q;  2DKG A;  2EYQ A;  4CC3 A;  1M4Z A;  3HL8 A;  4L5G A;  4M7A F;  4JPB W;  2BIV A;  1YIT T;  1G3Y A;  2DL7 A;  2HZY A;  1X43 A;  1GBR A;  2L89 A;  4Z02 A;  3WVD B;  2OTL A;  3RMQ A;  4J6Y A;  1QVP A;  1R0C B;  3V8K A;  4ZTF A;  3E2U A;  4HXJ A;  3QJY A;  4JRI A;  3SWN A;  4M77 E;  2VXE A;  2R5M A;  2EJG A;  3CBP A;  4A54 A;  2DNU A;  2QAZ A;  2RN8 A;  1JBM A;  3SWN C;  4J9I A;  1B3Q A;  5CKB A;  5IHN A;  3CCS A;  4M78 F;  2KE9 A;  2WSC E;  5I11 A;  5LJ3 d;  2DL3 A;  2P84 A;  2LCS A;  2X4W A;  2BKD N;  2RQV A;  1VQK A;  3M57 A;  3OS1 A;  2YT6 A;  1VQ6 A;  5A0G A;  1E6H A;  5FRN A;  5ECA A;  2E4H A;  2O2O A;  1M90 U;  3JCM X;  2M51 A;  2RJD A;  1T3L A;  1NEG A;  5HK0 A;  1TWB A;  3PGG A;  3CCQ Q;  5GAM h;  2VC8 A;  1Q7Y R;  1ZBJ A;  1VQ8 T;  3CD6 T;  3LYI A;  1SHF A;  5GJW B;  5LJ5 g;  3M0Q A;  3JCM P;  1AWJ A;  4A4F A;  1UGP B;  5D7U A;  4J8O A;  3OYM A;  2YHT A;  3MEA A;  1VQL Q;  1MHN A;  1HYO A;  1K9A A;  1T0H A;  2AT1 B;  1AHJ B;  2L3P A;  2CT4 A;  3LGL A;  2LQK A;  5GAN 3;  2D8J A;  2CP2 A;  2DD5 A;  2ZPI B;  3H0H A;  4E7Z A;  1Q86 U;  1K9M C;  1VQN T;  4BE0 A;  2GQI A;  1KD1 R;  2CP5 A;  3BDU A;  5IN1 A;  1JXO A;  1UB4 A;  4EMH A;  1SRL A;  2GTJ A;  5DM7 R;  3EG0 A;  2EYW A;  4XK8 E;  1OPL A;  2GTO A;  4C8Q E;  3OYH A;  1JXM A;  1Q95 G;  3CCE T;  4ME7 A;  5FWC A;  2MIO A;  3HSB A;  4N4G A;  1NE8 A;  3ULR B;  5GMK i;  3FJ5 A;  3J80 E;  1TTH B;  2DET A;  3OMC A;  4LDV A;  2E70 A;  3A8M B;  3JCM f;  2DZC A;  1YJN T;  2OTJ Q;  1PCX A;  5GAM f;  3A1P A;  2G6F X;  1SEM A;  2JS0 A;  1ZHI A;  2DRK A;  4NL3 A;  1ZSG A;  1PD0 A;  1KK7 A;  3OQ5 A;  2QTX A;  1YN8 A;  2BZ8 A;  3E19 A;  1ZUY A;  3CBM A;  1UJY A;  4N4H A;  4A4K A;  1RAC B;  4J83 A;  1UGR B;  1G5V A;  4XAX B;  1WHH A;  4K11 A;  3NTK A;  3V8J A;  3TVT A;  2A28 A;  3VU3 C;  3CXC P;  2E12 A;  3EG1 A;  4BY6 C;  4EDU A;  2RI2 A;  3JCM J;  4M75 E;  5IXB A;  3L2R A;  4C5G A;  3TCJ A;  1Q7Y U;  1PSF A;  2K57 A;  3OYY A;  3I56 Q;  2PVD B;  1Q82 C;  3CC4 Q;  1ZSZ A;  2EFI A;  2K9G A;  2QK0 A;  3UWN A;  4X9D A;  3CCR T;  4E7J A;  1K8A R;  2DZ9 A;  4X9C A;  3RES A;  1RI9 A;  1D3B A;  2E41 A;  4BAC A;  1U8R A;  4EMG A;  2KYM A;  4PKC C;  2FG0 A;  2CDT A;  2YRD A;  3C95 A;  1YHQ A;  2KAF A;  3A98 A;  1AT1 B;  2DF6 A;  3CC7 A;  2YDL A;  2SRC A;  1TUD A;  4M7D B;  1MMD A;  3VKI A;  3EGD B;  4QW2 A;  1WHG A;  2XK0 A;  3M0U A;  3CC2 Q;  4GBQ A;  1VQ7 T;  4XTV A;  2O88 A;  4F17 A;  5IT9 E;  4LE9 A;  3QJ6 A;  2QQA A;  5KYU B;  4LXC A;  3A8L B;  5KYX B;  4NOY A;  2DE0 X;  4PJN A;  2CZ6 B;  1D09 B;  4HCZ A;  3TEE A;  3G71 A;  5GAN g;  2KK4 A;  2OAU A;  2ZAE A;  3I9Q A;  3OA6 A;  1W4S A;  4IIO A;  1FX7 A;  2DXT A;  4OB0 B;  4M7A A;  2BUD A;  3EGX B;  3QUI A;  4CC4 B;  3MKD A;  2KSS A;  4PFO A;  4PJL A;  4ZNX A;  3HFO A;  4QVC A;  1IZ6 A;  3JB9 J;  2HKN A;  2KMT A;  2RNA A;  1SSF A;  1KQ2 A;  1JO8 A;  2YRV A;  4JUV A;  1NYG A;  3PE0 A;  5GAN 5;  4M77 F;  2DL5 A;  2E3H A;  3O5Z A;  1YIT A;  2KNB B;  1Z9Z A;  2ZPB B;  3CCQ T;  3OS0 A;  5GAO n;  1Q81 U;  2CH4 W;  1VQP Q;  3J7A F;  4M78 A;  2M02 A;  1YJW A;  3DKM A;  2JW4 A;  4M78 D;  1Y57 A;  2PU9 B;  2F2W A;  4F7U B;  2MCN A;  3QO3 A;  2DTH A;  5KYW A;  2EGA A;  3VS4 A;  1VQO A;  5LJ3 g;  1K8A U;  4BI8 B;  4KGX B;  1IO6 A;  4EMK A;  3MP8 A;  1IHW A;  1D1A A;  2F5K A;  1VQL T;  3A8O B;  1CKA A;  1WXT A;  5GAM d;  1W2B A;  3OBY A;  2LNH B;  2XDD A;  2O9V A;  1KC8 R;  4BI3 A;  2LX7 A;  3O8V A;  3CCM A;  2CP0 A;  3PMT A;  5EG2 A;  2WSF E;  2JMC A;  4C92 E;  4PFZ A;  1BYM A;  2FZK B;  2ABL A;  2ENM A;  2K7A A;  2KT8 A;  2QGG A;  4BI4 A;  2JS2 A;  2LJ3 A;  1UEB A;  1ARK A;  3CCJ Q;  1YI2 A;  2R5A A;  3FLG A;  5KYY B;  3ZEH A;  5GMK e;  2LDM A;  2E3I A;  2X4Y A;  3ZFJ A;  3EFR A;  2Y90 A;  3HTR A;  1VQ9 T;  5IAY A;  1R77 A;  2HL5 C;  2VWF A;  2DBK A;  1YCS B;  1NEB A;  2QEX A;  1S72 Q;  3EG9 A;  4M7D C;  1QWE A;  2OTJ T;  4FT2 A;  4OMF B;  2JJ9 A;  1AWO A;  2PVO B;  2WSE E;  2KRM A;  3G6E Q;  1N27 A;  4QVD A;  4HVV A;  2FB7 A;  2EQJ A;  5I21 A;  1WJS A;  2HSE B;  4C8Q F;  4D8K A;  2CP7 A;  3TRE A;  4M7D G;  2E6Z A;  3C0C A;  2LMJ A;  3PIO A;  1RAI B;  1N9R A;  3CCV A;  1VQN A;  2V1R A;  2IIM A;  1GRI A;  3SDZ A;  2XG8 D;  5KH6 A;  2E64 A;  3FJP A;  3SWN B;  1I0C A;  1LPL A;  3M0S A;  3PNW C;  2A3L A;  3H6Z A;  3GNG A;  2MF2 A;  1KHI A;  3CCE A;  2P0K A;  4MZM A;  2L2P A;  2XMF A;  3KUF A;  3OS2 A;  2E5Q A;  2EQU A;  4XTZ A;  2PUO B;  3I56 T;  4WCI A;  2F2V A;  4Y92 A;  2RHX A;  2QAS A;  1KIK A;  3CC4 T;  1E6G A;  2RB6 A;  1YJN A;  3JB9 D;  5LL6 S;  1GL5 A;  2FO0 A;  4J6W A;  2BZY A;  4ZGJ B;  5A0D A;  3MJX A;  2CZ1 B;  1YCY A;  2ED1 A;  2BZX A;  4O6J A;  1KC8 U;  4M75 F;  2RJC A;  1H64 1;  4PJO A;  4PLL A;  1Y96 A;  4JLG A;  2RM4 A;  4TVR A;  4PJO D;  3JB9 G;  1WHM A;  2JN0 A;  1M1F A;  4PJO C;  4HCB A;  3UA7 A;  4DEY A;  3CC2 T;  4FT4 A;  2PTK A;  5FWB A;  1KD1 C;  1M1K C;  2E6N A;  2EGC A;  3VS0 A;  4QQD A;  2K3X A;  3VS6 A;  5CKE A;  3TSW A;  3CCU A;  4E47 A;  3MO8 A;  2BTT A;  4MMK A;  4Z8A A;  4F7U G;  1HD3 A;  3OYB A;  3RNJ A;  4OMP A;  4OMO A;  4CC2 A;  3CCR A;  3BW1 A;  3PT9 A;  1RAE B;  4DEX A;  4A4H A;  1WZO A;  3EFO A;  4R56 A;  3EGU A;  1WQ7 A;  1VQM Q;  1JB0 E;  2W0Z A;  5GAN d;  3G7Z A;  2DIQ A;  1NM7 A;  4MDW A;  5FLX E;  1LCK A;  2ZPG B;  1YIJ Q;  4LN2 A;  2QI2 A;  3H0I A;  2AK5 A;  3JCM W;  1Q86 R;  2A0F B;  4A4G A;  4HT9 A;  2K6D A;  3L2Z A;  2HAX A;  1TOV A;  1IXD A;  3SB2 A;  4Q5W A;  1QWF A;  3LWI A;  4E7K A;  2YUO A;  1WXU A;  1KJW A;  4OGC A;  4ZGE B;  1PRM C;  2DVJ A;  4JZ4 A;  1TG0 A;  1RLP C;  2JNG A;  2K79 A;  2VUB A;  3V7S A;  5FU7 C;  1BIA A;  1NLP C;  1TXQ A;  2RQU A;  5AT1 B;  4RTZ A;  3EHQ A;  4J9B A;  3NGP A;  1VQP T;  2C0O A;  3CCL T;  3ZBD A;  5D6X A;  1PC0 A;  2HQE A;  4AMC A;  3UT1 A;  4QVZ A;  2KYB A;  3LWH A;  3C94 A;  1OX9 A;  4BY6 B;  3L2W A;  5LJ3 j;  3KFV A;  4M77 A;  2WAC A;  3QDR B;  3DLM A;  1EX4 A;  4OMN A;  4ELY C;  4HVU A;  2YLC A;  1G3T A;  2YRC A;  2LC4 A;  4ELZ C;  1M8M A;  2K2V A;  2O01 E;  5I22 A;  1ZUU A;  2EJF A;  3OYC A;  2X4J A;  4WTO B;  1WFW A;  4J9F A;  2E65 A;  1G3W A;  4RTY A;  3CCS Q;  1BI1 A;  4MML A;  5FU6 B;  4N4I A;  3CCJ T;  1KFZ A;  4XTY A;  2MMP A;  3CMA A;  4AFZ C;  1VIF A;  1OUL A;  1D3B B;  4JRQ A;  3JCM h;  3MEW A;  1UUE A;  5GAO p;  1U3O A;  1Y71 A;  3CCQ A;  4AFS C;  4C0Z A;  3VS1 A;  2RQT A;  4PK4 A;  2DLP A;  3I5R A;  3G4S A;  2HNI A;  3QXE B;  3CEY A;  2XDB A;  3REB B;  3JCM g;  1S72 T;  3EAE A;  2IG0 A;  5GAM g;  1W2B P;  4PL6 A;  3OYD A;  4C92 F;  1WHJ A;  2XIC A;  1KG1 A;  1WNL A;  1RUW A;  3RUX A;  4BDZ A;  1OU8 A;  2KVQ G;  1VQL A;  4XU1 A;  1LNX A;  3G6E T;  1OV3 A;  2M16 A;  4ZTJ A;  1VYU A;  3QHS A;  4QQ6 A;  2PVG B;  2V8J A;  5KYN A;  2FPD A;  1HSQ A;  1QVG S;  1CKB A;  2XHC A;  3OSV A;  3S3N A;  4JJN K;  2R57 A;  2O31 A;  5D6Y A;  4R55 A;  3UF4 A;  2PZ1 A;  1MMA A;  2V8I A;  5GMK m;  1X27 A;  5D6W A;  1RAG B;  4WF2 A;  4M7A B;  1VQ9 A;  2ED0 A;  5CVI A;  1H92 A;  2LJ0 A;  4C8Q A;  2K4Y A;  4KGV B;  1GCP A;  3NPF A;  4C8Q D;  2JOY A;  2VYT A;  3CPF A;  2CH4 A;  1WHL A;  4Y28 E;  2GFA A;  4FYX B;  4D6W A;  2LCC A;  4QKU A;  3A8H B;  4R0K A;  3X24 B;  3QII A;  4JZ3 A;  1N8R C;  3M59 A;  2LQN A;  4E7S A;  1N5Z A;  3FDR A;  1WJR A;  3VYH B;  2FZC B;  5CK9 A;  1FXX A;  3LLR A;  3OYJ A;  1BIB A;  3PVL A;  2J05 A;  3M4Y A;  1M27 C;  3FC3 A;  1IGQ A;  3TU4 K;  1PKT A;  2DXC A;  1SRM A;  4M78 B;  1KC8 C;  2EWN A;  5J26 A;  1SSH A;  4LUD A;  1UG1 A;  2QTV A;  2O9S A;  2L8D A;  3RR6 A;  2YXY A;  1BU1 A;  4KH1 B;  5KYW B;  2FL7 A;  2DEQ A;  2VAS A;  5HKC A;  2B86 A;  1H3H A;  4EMK B;  4RG8 A;  2JUF A;  5C0M A;  2B8A A;  1H8K A;  2DYB A;  3GBQ A;  4IUP A;  4XU0 A;  1Q81 R;  1OOT A;  1W2B S;  2A37 A;  1TUG B;  4JLI A;  1JQQ A;  3VUZ A;  4XTW A;  5LJ5 e;  4DBQ A;  4C5I A;  3QKJ A;  1RL2 A;  4M75 A;  2EYX A;  3I5S A;  5GAO m;  3FEO A;  5IXF A;  3CC4 A;  2ZZD A;  1NJI R;  3MEV A;  4PNO A;  1KSW A;  2H8H A;  1ZSZ C;  4C0G A;  1AWW A;  1ZLM A;  5FU6 C;  1PSE A;  1BI0 A;  2HCK A;  1X6O A;  1VQ5 A;  5HK3 A;  2LVM A;  3MEU A;  1VQM T;  3UDC A;  3P8H A;  1S1N A;  4MZT A;  5GMK l;  3I35 A;  1EIF A;  5KE3 A;  1YIJ T;  4OB3 B;  2VV5 A;  2XU8 A;  1ZUK A;  2OAW A;  1U06 A;  1D0X A;  1V29 B;  1M2V A;  2YLB A;  3EG9 B;  1OU9 A;  2RHY A;  1YHQ Q;  1I81 A;  1D0Z A;  3DB3 A;  3CC7 Q;  3I55 A;  3VJP A;  3QWX X;  3HRU A;  2CT3 A;  2M0O A;  2JMA A;  3CME A;  2RO0 A;  4IUV A;  5GMK h;  1KQS S;  2VXF A;  1QVG A;  3OS5 A;  2HD0 A;  4KUL A;  3NMZ C;  4O5V A;  1NPR A;  3JCM b;  1YJ9 Q;  2RHZ A;  2LX9 A;  4JJC A;  2RA2 A;  5DLQ E;  1RAB B;  4C5H A;  4IUU A;  3QPH A;  3JB9 H;  2FPF A;  5IH2 A;  2NUZ A;  2QDL A;  4CC7 A;  3VYG A;  1VQ4 A;  4FU6 A;  1SF9 A;  3L1A A;  2ESW A;  2QQ9 A;  2PNI A;  1GFC A;  1UGQ B;  2GGR A;  4HVW A;  4ANJ A;  3EHR A;  4M7A D;  1FYN A;  3G71 Q;  1AVZ C;  2F1L A;  2DIL A;  4M7A C;  2CUD A;  2DAQ A;  3HP9 A;  2ZPE B;  2HDA A;  4IIM A;  3URG A;  4E6R A;  4D8D A;  4XTU A;  2QA4 A;  4LDY A;  1EFN A;  1BB9 A;  2NUT B;  3M55 A;  3VS3 A;  1B7T A;  3CCS T;  5GAO l;  2FPE A;  4XQ3 A;  1O9S A;  4II1 A;  1M90 C;  4M7A G;  4RUG A;  3SHW A;  1FMW A;  3GIB A;  2RJE A;  5FRM A;  2HL3 A;  4QT7 A;  1N6A A;  3OYN A;  5AYF A;  3CCL A;  3R6N A;  1GBQ A;  1UJ0 A;  2EIF A;  4M78 C;  1HXD A;  1HK9 A;  1YIT Q;  4PJO B;  5CO7 A;  9ATC B;  2D8H A;  3E9G A;  1Y96 B;  3OY9 A;  1NJI U;  5LJ5 j;  1MV0 B;  4YTL A;  1YJW Q;  3RBB B;  3JCM d;  4EMK C;  4BB7 A;  2KRO A;  5L23 A;  3M4G A;  2FVU A;  4IUQ A;  4LDX A;  2A7Y A;  1K0X A;  3GNF B;  4EPC A;  1VQO Q;  4M78 G;  3L2V A;  2LP5 A;  1NPP A;  5CAI A;  3QDF A;  2HMA A;  2SEM A;  3S3O A;  1OZ3 A;  2MYS A;  3C4S A;  2HBW A;  1WXB A;  4FW1 A;  4RG2 A;  2PQW A;  4JRP A;  1Q86 C;  3JCM Q;  5GAN 8;  4C92 A;  4DBF A;  4FCY A;  1JJ2 S;  1ZA1 B;  4C92 D;  3CCM Q;  2I0N A;  3EFO B;  1X6B A;  2CSI A;  2KY9 A;  1VQ8 A;  3OBW A;  4HT8 A;  3CD6 A;  1T3S A;  4DOV A;  1W70 A;  4KBM B;  1YI2 Q;  4DOW A;  2RI5 A;  3L42 A;  5GAN e;  4ZN3 A;  2KEA A;  5I2S A;  2P4T A;  3ER0 A;  4FSS A;  2DBM A;  3OSS C;  4OMQ A;  4M7D E;  1GCQ A;  3BE3 A;  1GFD A;  2ROT A;  4F16 A;  2VB6 A;  1CSK A;  2LT1 A;  4N0A A;  2MWO A;  4DBR A;  2E5K A;  1IB8 A;  3OYI A;  4VUB A;  2QEX Q;  2AKK A;  2EYY A;  5FU7 B;  3G6E A;  4OML A;  2RF0 A;  2ZCF B;  1KQS A;  2D0Q B;  3GOX A;  1R8O B;  3QSU A;  2RK2 A;  4F04 B;  2K3Y A;  1TS9 A;  3OYL A;  5LJ3 f;  2KT1 A;  2V26 A;  5KYU A;  2RHU A;  1U1T A;  2EVR A;  1QP2 A;  2RPN A;  5CKF A;  4LNP A;  4OP0 A;  2DXB A;  1PG5 B;  5I2M A;  4FW2 A;  5FRO A;  1C0M A;  1M3C A;  4RTV A;  3CCV Q;  1T0J A;  4M77 B;  2EBP A;  3MHX A;  3IQL A;  1SG5 A;  1Q7Y C;  4JS5 A;  3SFM A;  4BE2 A;  3HRT A;  2GFU A;  1X01 A;  1WDX A;  2ZPF B;  4FYV B;  3V7R A;  5LJ3 e;  5CKD A;  1D0Y A;  2CZ0 B;  2YUN A;  4J9E A;  3GPL A;  2HEQ A;  2J6K A;  1TH7 A;  2MAM A;  5KCH A;  1UGS B;  3JB9 I;  1BCO A;  4OB2 B;  3LH5 A;  3MP1 A;  1IRE B;  2KXD A;  1M9S A;  2RH2 A;  2AIR B;  3RDV A;  5L8R E;  1BCM A;  2G3R A;  1RI0 A;  1WYX A;  4RTU A;  4P5N A;  4RTW A;  3HHT B;  3RIR A;  4F7U E;  1JU5 C;  1PD1 A;  4JJB A;  1D1B A;  3CC7 T;  4XU3 A;  5GAN 7;  2XI9 A;  1QP3 A;  2DL4 A;  3V7C A;  1M8V A;  1FWZ A;  1AD5 A;  3UA6 A;  1AEY A;  3VS5 A;  1WLP B;  2EPD A;  2DTO A;  4XTX A;  5EC7 A;  3PIP A;  4PJO G;  1BK2 A;  2MWP A;  4C5E A;  1YJ9 T;  1JJ2 A;  1KHC A;  1VIE A;  3X28 B;  5GAN j;  1G8X A;  3CCU Q;  4ATO A;  3VS7 A;  1MND A;  2EKH A;  4MDX A;  4RKU E;  2EW3 A;  1VQM A;  4J9C A;  2LZ6 B;  2CUB A;  2OI3 A;  4J7F A;  2LCL A;  3G71 T;  2M1H A;  2DYI A;  2HQX A;  2K3B A;  1F1B B;  4GLK A;  1YIJ A;  3P8B B;  2NUP A;  1W1F A;  1GXI E;  4C8Q B;  3LW5 E;  2LNV A;  4ZGD B;  2L0A A;  2AHJ B;  1VQ7 A;  4HKE A;  4IKF A;  1QVG P;  1K76 A;  1DJ7 B;  4BD3 A;  3H9N A;  2JTM A;  2AZV A;  4KGZ B;  5KE2 A;  1P92 A;  2LJ1 A;  1MV3 A;  3THK A;  1O75 A;  1Q81 C;  1B07 A;  3KBG A;  3UAT A;  1Y7X A;  1AZG B;  2IPO B;  2FRY A;  2IVW A;  2QQB A;  2GBQ A;  1VYV A;  3RKX A;  1K1Z A;  4X34 A;  5CCA A;  1NJI C;  1K8A C;  1FMK A;  2M9U A;  2OTL Q;  1YJW T;  4OB1 B;  2O4X A;  4JRK A;  3DLL A;  3OYA A;  5IHK A;  4M77 D;  4XU2 A;  3M9Q A;  1QVF S;  1PM3 A;  1NZ9 A;  4M77 C;  3M58 A;  1VQO T;  1B34 A;  2V8K A;  2KGT A;  3GF5 A;  3OW2 S;  3HRS A;  2MOX A;  2GQV A;  1YWP A;  2DL8 A;  1ZSZ B;  4M75 B;  1TSF A;  3INZ A;  5A2Q E;  1K73 R;  2D0N A;  2JXB A;  1VQK Q;  4OVA A;  3CCM T;  1VQ6 Q;  1XNI A;  1UDL A;  4M77 G;  2KDS A;  1RAH B;  4LDU A;  2R58 A;  2DM1 A;  4OGE A;  1YI2 T;  4GLM A;  1UFF A;  1G2B A;  3A8G B;  1BBZ A;  3J81 E;  3CMA Q;  2D6F A;  2M0Y A;  2RQR A;  2RMO A;  4PLI A;  4KRT A;  5LJ5 h;  3ZL7 C;  1M2V B;  3P8D A;  4Z89 A;  2CGH A;  3G4S Q;  3CPW A;  2QEX T;  3JSC A;  2DA9 A;  2K5F A;  1YNZ A;  1A0N B;  2CKK A;  1OPK A;  1ZQ1 A;  1J3T A;  2L5Q A;  3RMS A;  3L2Q A;  1N9S A;  3LH0 A;  2X3X D;  1RLQ C;  4C0F A;  2J6O A;  2L3Q A;  4LD9 K;  2K2M A;  1VOM A;  4F14 A;  2VGN A;  1LOJ A;  2Y4Y A;  1H3Z A;  1PRL C;  4KT0 E;  3VV0 A;  4M7D F;  4AG1 C;  1SPK A;  1VUB A;  1YBY A;  1ACM B;  3JRZ A;  1W6X A;  3CCV T;  2C0I A;  3D7S B;  3BY7 A;  1M1K R;  2DER A;  4GY5 A;  4E7L A;  2QQS A;  2MI6 A;  1KQ1 A;  3F70 A;  1UHF A;  2X9H A;  2YUQ A;  1XOV A;  2XD0 A;  4C8Q C;  3G1J A;  2OTJ A;  1KQS P;  2I2L A;  1VQ9 Q;  1OYX A;  3JCM c;  1TUC A;  5GAO r;  1AWX A;  2JTF A;  5LJ5 f;  1IHV A;  4EIK A;  3QBY A;  1PHT A;  4C8Q G;  4QQG A;  1NYF A;  2X4X A;  4DA4 A;  3U23 A;  4RCC A;  2HSP A;  2FZG B;  1MMN A;  1I1J A;  2RI3 A;  3QYH B;  4A53 A;  3CQT A;  4FL6 A;  2GNC A;  2E10 A;  1K73 U;  5J39 A;  4B9W A;  1OX8 A;  4FM4 B;  1YP5 A;  4HCK A;  4B6M A;  1QVF A;  3JB9 F;  2COZ A;  3PFS A;  2DXU A;  1NBE B;  4LDW A;  1PKS A;  4DBH A;  5C6S A;  3OW2 A;  2JM9 A;  2DPP B;  3JCM e;  3I56 A;  3X20 B;  5GAM e;  2FYK A;  4OMM A;  3KXT A;  2BE9 B;  4M75 D;  4JJD A;  4FIB A;  4M75 C;  1SKU B;  2C06 A;  1ZBX A;  1I4K 1;  1IGU A;  3FIF A;  3CCU T;  4F7U F;  4NL2 A;  2EKO A;  4PJO F;  2CS7 A;  4C92 B;  4J9H A;  2F5T X;  1WX6 A;  2Z0W A;  1QCN A;  2D9T A;  3LGF A;  1VYT A;  3A5Z B;  3PTA A;  3X25 B;  4X1V A;  1VQ5 Q;  3LX7 A;  4M75 G;  3T9N A;  2DMO A;  1YWO A;  2COY A;  2QGF B;  1X2K A;  3E9F A;  2BE7 D;  1QMC A;  2A36 A;  3Q1J A;  3CC2 A;  1RAD B;  3VRY A;  4Z88 A;  4UC4 A;  1JRI A;  4LD6 A;  2GF7 A;  1JJ2 P;  1VA7 A;  4LUE A;  3QZ5 B;  1OQK A;  2J06 A;  4JS4 A;  1D1C A;  2E1H A;  3AT1 B;  2QDY B;  1QCO A;  3RKW A;  3M54 A;  1QW1 A;  1KD1 U;  1M1K U;  2RJF A;  4PFP A;  2FHD A;  3FB9 A;  4AG2 C;  3I55 Q;  1YJ9 A;  3AHU A;  1K4U S;  2NLU A;  4KH0 B;  3GP8 A;  4CI0 C;  3CME Q;  4BUG A;  5GAN h;  4ESR A;  2C0T A;  2ECZ A;  4FSX A;  3ASK A;  2LQW A;  1TU0 B;  2LQ8 A;  4J7I A;  3QWY A;  3QZ9 B;  8ATC B;  1I8F A;  2OTL T;  4J9D A;  2K5I A;  5CQY A;  3QG1 A;  1NG2 A;  3R6O A;  2FEI A;  3OB9 A;  4RTT A;  2CP6 A;  2YUP A;  3SD4 A;  4M7A E;  1V76 A;  1OI1 A;  5GJV B;  3OYF A;  1R0B G;  1VQ4 Q;  4J6X A;  2L3R A;  3PMI A;  3BFM A;  1M1G A;  3S3M A;  4E7I A;  2F69 A;  5DLO A;  2RQW A;  1MUZ A;  2X35 A;  3EG2 A;  2NYS A;  3H0F A;  3M0P A;  5CQX A;  1K9M R;  1X6G A;  4FYW B;  3HFN A;  1VQK T;  2A08 A;  1VQ6 T;  1WJQ A;  2DO3 A;  1BI3 A;  2QXF A;  2QA4 Q;  2RHI A;  4E7H A;  1AZE A;  3CXC S;  2CSQ A;  1G83 A;  1U1S A;  4Y91 A;  2DX1 A;  1VQP A;  1M30 A;  5HCK A;  2DFU A;  3OYG A;  2VKN A;  4A63 B;  3CMA T;  4AFQ C;  4M78 E;  1BI2 A;  2QQR A;  5GAM j;  3RER A;  2EYZ A;  3GLX A;  3QYG B;  3TSZ A;  5LJ3 h;  3G4S T;  1V1C A;  2DIG A;  2PUK B;  3E1S A;  3CCL Q;  3EH1 A;  3OYK A;  1ZX6 A;  3C12 A;  2EQM A;  5GAN f;  2H3E B;  5KCO A;  2KBT A;  2J6F A;  1QLY A;  2EAY A;  1N8R R;  3M56 A;  1C6V X;  4FYY B;  4L6V 5;  4A4E A;  5LJ5 d; 
#chains in the Genus database with same CATH homology
 1D3B A;  1QP3 A;  3CEY A;  3CCJ A;  2XDB A;  3JCM g;  1S72 T;  3V7C A;  2E41 A;  3EAE A;  1M8V A;  1FWZ A;  2IG0 A;  5GAM g;  4BAC A;  1U8R A;  3NTH A;  4PL6 A;  3OYD A;  4C92 F;  4C92 C;  4EMG A;  5GAO q;  2DTO A;  1WGS A;  4PKC C;  2XIC A;  1KG1 A;  3C95 A;  4XTX A;  1WNL A;  3DB4 A;  3PIP A;  4PJO G;  4BDY A;  2KAF A;  1YHQ A;  3RUX A;  1MGQ A;  4BDZ A;  2Y4X A;  2MWP A;  2KVQ G;  3JAM E;  3CC7 A;  1VQL A;  4C0D B;  4XU1 A;  1LNX A;  4C5E A;  1YJ9 T;  1JJ2 A;  1KHC A;  2CZ7 B;  1VIE A;  2LT4 A;  3ME9 A;  3G6E T;  3X28 B;  2M16 A;  5GAN j;  4ZTJ A;  4ATO A;  1S72 A;  2DJZ A;  4M7D B;  4MDX A;  3VKI A;  3QHS A;  4RKU E;  4QW2 A;  1VQM A;  2XK0 A;  4QQ6 A;  2PVG B;  2V8J A;  4J7F A;  1VQ7 T;  4XTV A;  2LCL A;  4C92 G;  2M1H A;  3G71 T;  2HQX A;  5CKH A;  5IT9 E;  1QVG S;  2XHC A;  3OSV A;  4GLK A;  4MZP A;  3S3N A;  4JJN K;  4M7D A;  3QJ6 A;  2EQK A;  2R57 A;  1YIJ A;  3NFC A;  3P8B B;  4N0A C;  2QQA A;  5D6Y A;  4M7D D;  4V2S A;  1GXI E;  4R55 A;  4C8Q B;  2XDP A;  3A8L B;  2V8I A;  3LW5 E;  4OF1 A;  2LRQ A;  4KUI A;  3MCA B;  4NOY A;  5DY9 A;  2LNV A;  4ZGD B;  5GMK m;  5D6W A;  2CZ6 B;  2AHJ B;  2RK1 A;  1VQ7 A;  4HCZ A;  4HKE A;  3TEE A;  4WF2 A;  4M7A B;  5GAN g;  2KK4 A;  3G71 A;  4IKF A;  1DJ7 B;  4BD3 A;  2OAU A;  1I5L A;  1VQ9 A;  5GAN 2;  2CYZ B;  5CVI A;  3OA6 A;  1W4S A;  2JTM A;  4C8Q A;  2K4Y A;  5CIU A;  3RKY A;  4ZN1 A;  3M5A A;  3WXM B;  5GAN 6;  1P92 A;  5KE2 A;  4RMO A;  4C8Q D;  2XKO C;  3CBO A;  1FX7 A;  2JOY A;  2VYT A;  1LJO A;  2DXT A;  3CPF A;  1O75 A;  4OB0 B;  4M7A A;  4Y28 E;  3S6W A;  1K9M U;  2BUD A;  2GFA A;  1K73 C;  1Q81 C;  4D6W A;  1WPY A;  3KBG A;  2LCC A;  3QUI A;  2KSS A;  1Y07 A;  2O4X B;  3A8H B;  5CR2 A;  1Y7X A;  5J3B A;  3X24 B;  3HFO A;  2IVW A;  4QVC A;  4BE1 A;  3QII A;  2QQB A;  1N8R C;  3M59 A;  3V8L A;  5GAN 4;  4B9X A;  3N5B B;  3FDR A;  1WJR A;  1IZ6 A;  3RKX A;  3VYH B;  5CK9 A;  4X34 A;  1FXX A;  3LLR A;  5CCA A;  3JB9 J;  1NJI C;  1XQH A;  2P0P A;  1K8A C;  2M9U A;  1B34 B;  2KMT A;  1BIB A;  3OYJ A;  2EJ9 A;  1KQ2 A;  1SSF A;  3M4Y A;  1YJW T;  3OMG A;  4OB1 B;  2O4X A;  4JRK A;  4L59 A;  3FC3 A;  3DLL A;  3OYA A;  2YRV A;  4JUV A;  4J5Y A;  3TU4 K;  4RCB A;  2DXC A;  4M77 D;  4M78 B;  3M9Q A;  2EWN A;  4XU2 A;  5J26 A;  5A0L A;  5GAN 5;  1KC8 C;  1QVF S;  1NZ9 A;  4M77 F;  4M77 C;  3X26 B;  3NTI A;  2L8D A;  1YIT A;  3M58 A;  1VQO T;  2JVV A;  1B34 A;  5HY6 A;  1G3S A;  3CXC A;  2V8K A;  2ZPB B;  3GF5 A;  3CCQ T;  3OS0 A;  5GAO n;  2FL7 A;  3OW2 S;  2GCX A;  3HRS A;  1Q81 U;  2DEQ A;  3WVE B;  4DQ2 A;  2GQV A;  5HKC A;  3J7A F;  4M78 A;  2DTI A;  4EMK B;  4M75 B;  1YJW A;  4RG8 A;  3DKM A;  3INZ A;  4M78 D;  5A2Q E;  2JUF A;  5C0M A;  2B8A A;  2PU9 B;  4XU0 A;  4IUP A;  2DD4 A;  4F7U B;  1M5Q 1;  3M53 A;  3MET A;  1N8R U;  1VQ5 T;  3QO3 A;  2DTH A;  1W2B S;  4JLI A;  4OVA A;  3VUZ A;  3CCM T;  4XTW A;  1XNI A;  1VQO A;  5LJ3 g;  5LJ5 e;  4C5I A;  2ZGW A;  1K8A U;  4BI8 B;  4M77 G;  3QKJ A;  2KDS A;  4PJO E;  1RL2 A;  4EMK A;  3MP8 A;  4M75 A;  1YHQ T;  5M9O A;  5GAO m;  3FEO A;  3CC4 A;  2F5K A;  1VQL T;  2ZZD A;  3A8O B;  2K5L A;  3MEV A;  4F7U A;  4LDU A;  4PNO A;  4C0G A;  2R58 A;  4OGE A;  5FU6 C;  5GAM d;  1YI2 T;  1PSE A;  3UPU A;  3VUB A;  3CPW S;  1W2B A;  3OBY A;  1BI0 A;  3A8G B;  1X6O A;  3J81 E;  2VGM A;  2XDD A;  1VQ5 A;  2D6F A;  5HK3 A;  3HKS A;  5GAN 7;  4BI3 A;  4PLI A;  2LVM A;  3MEU A;  4HA8 A;  1VQM T;  3O8V A;  3UDC A;  3CCM A;  3PMT A;  5LJ5 h;  3P8H A;  5EG2 A;  2WSF E;  2P0Q A;  4C92 E;  1OZ2 A;  3P8D A;  4MZT A;  2CGH A;  1BYM A;  3BDL A;  5GMK l;  4BI4 A;  3I55 T;  3CPW A;  1EIF A;  5KE3 A;  1YIJ T;  4OB3 B;  1UEB A;  2VV5 A;  3JSC A;  2XU8 A;  2QEX T;  1YI2 A;  2K5F A;  3CME T;  4HCC A;  4JDS A;  4IUT A;  2R5A A;  3FLG A;  4NS5 A;  1Q82 U;  1WQW A;  2ZPH B;  3ZEH A;  5GMK e;  1V29 B;  5GMK j;  2CKK A;  2YLB A;  3MP6 A;  1ZQ1 A;  2LDM A;  2L5Q A;  3RMS A;  3L2Q A;  2RHY A;  1I81 A;  2X4Y A;  3ZFJ A;  1N9S A;  3EFR A;  2Y90 A;  3DB3 A;  3LH0 A;  4C0F A;  1VQ9 T;  4KUD K;  4C0D C;  5IAY A;  3I55 A;  3VJP A;  3OYE A;  3HRU A;  4LD9 K;  2QEX A;  2M0O A;  2VGN A;  2HBP A;  3CME A;  1LOJ A;  2RO0 A;  2Y4Y A;  1H3Z A;  4KT0 E;  4IUV A;  3VV0 A;  4M7D F;  4M7D C;  1VQ4 T;  5GMK h;  2OTJ T;  1KQS S;  2DVE A;  4FT2 A;  4OMF B;  1XTD A;  2VXF A;  1QVG A;  3HPW A;  3OS5 A;  2HD0 A;  4KUL A;  1VUB A;  2JZ2 A;  2PVO B;  2WSE E;  4IUR A;  1NPR A;  4O5V A;  4CRI A;  3JCM b;  3JCM V;  2H3J A;  1X75 C;  1YBY A;  3H8Z A;  3JRZ A;  2RHZ A;  3CCV T;  2LX9 A;  2RD1 A;  3BY7 A;  1N27 A;  2RA2 A;  2KQW A;  4GY5 A;  5DLQ E;  4C5H A;  2QQS A;  4QVD A;  4IUU A;  2MI6 A;  4E7L A;  1KQ1 A;  2FB7 A;  3F70 A;  3QPH A;  3JB9 H;  2EQJ A;  5I21 A;  3FRN A;  1XOV A;  1WJS A;  2XD0 A;  4C8Q F;  3VYG A;  4C8Q C;  2QA4 T;  1VQ4 A;  4FU6 A;  2OTJ A;  3L1A A;  2QQ9 A;  2XID A;  1UGQ B;  2DK3 A;  2LTO A;  3TRE A;  3EFS A;  3L2U A;  4M7D G;  1BKB A;  4M7A D;  2DKG A;  2EYQ A;  2E6Z A;  1M4Z A;  3HL8 A;  4L5G A;  2I2L A;  3PIO A;  4M7A F;  4M7A C;  2DAQ A;  2BIV A;  3HP9 A;  1OYX A;  1N9R A;  3JCM c;  3CCV A;  1VQN A;  2ZPE B;  1YIT T;  1G3Y A;  5GAO r;  3SDZ A;  3URG A;  2XG8 D;  4XTU A;  2JTF A;  5KH6 A;  2E64 A;  3FJP A;  2L89 A;  5LJ5 f;  2QA4 A;  3SWN B;  3QBY A;  3PNW C;  2A3L A;  4LDY A;  3H6Z A;  4Z02 A;  3GNG A;  3WVD B;  2MF2 A;  3M55 A;  2OTL A;  1KHI A;  3RMQ A;  4C8Q G;  5GAO l;  4QQG A;  3CCS T;  4J6Y A;  2P0K A;  3CCE A;  1QVP A;  2X4X A;  4DA4 A;  4RCC A;  4MZM A;  4XQ3 A;  1O9S A;  4II1 A;  3KUF A;  3V8K A;  3OS2 A;  2E5Q A;  2EQU A;  4XTZ A;  4ZTF A;  1M90 C;  3QJY A;  4JRI A;  3SWN A;  4M7A G;  2PUO B;  2RI3 A;  4M77 E;  3QYH B;  3I56 T;  4A53 A;  2VXE A;  4FL6 A;  3GIB A;  2R5M A;  2EJG A;  2E10 A;  2RHX A;  3CBP A;  3CC4 T;  1K73 U;  4A54 A;  2RB6 A;  1YJN A;  5J39 A;  1JBM A;  3SWN C;  2RJE A;  4B9W A;  4FM4 B;  3JB9 D;  5LL6 S;  5FRM A;  1QVF A;  5CKB A;  1N6A A;  3PFS A;  3CCS A;  3OYN A;  3JB9 F;  2DXU A;  4J6W A;  5AYF A;  4ZGJ B;  3CCL A;  5A0D A;  2EIF A;  4M78 C;  1HXD A;  4M78 F;  2WSC E;  1HK9 A;  4LDW A;  5LJ3 d;  4PJO B;  5CO7 A;  2X4W A;  3E9G A;  1Y96 B;  2BKD N;  3OY9 A;  1VQK A;  3M57 A;  5C6S A;  3OS1 A;  5LJ5 j;  2DPP B;  3JCM e;  3I56 A;  3OW2 A;  1NJI U;  1VQ6 A;  3X20 B;  5GAM e;  4YTL A;  2FYK A;  5A0G A;  2CZ1 B;  1YCY A;  3KXT A;  5FRN A;  4M75 D;  4O6J A;  4FIB A;  3JCM d;  1KC8 U;  4EMK C;  4M75 F;  4M75 C;  2RJC A;  2C06 A;  4BB7 A;  1H64 1;  1ZBX A;  4PJO A;  1I4K 1;  4PLL A;  1M90 U;  3M4G A;  3JCM X;  1Y96 A;  2FVU A;  4IUQ A;  3FIF A;  4JLG A;  2A7Y A;  2RM4 A;  4TVR A;  4F7U F;  3CCU T;  4LDX A;  4PJO D;  3GNF B;  3JB9 G;  4EPC A;  4NL2 A;  2JN0 A;  2RJD A;  2EKO A;  1M1F A;  4PJO F;  5HK0 A;  2CS7 A;  4C92 B;  4PJO C;  4M78 G;  4HCB A;  3L2V A;  3PGG A;  1NPP A;  2F5T X;  5GAM h;  2VC8 A;  5CAI A;  3CC2 T;  1VQ8 T;  3S3O A;  4FT4 A;  3CD6 T;  2D9T A;  3LGF A;  1KD1 C;  1M1K C;  1OZ3 A;  3C4S A;  3A5Z B;  2E6N A;  2PQW A;  3LYI A;  4RG2 A;  4JRP A;  1Q86 C;  3JCM Q;  3PTA A;  3X25 B;  4QQD A;  2K3X A;  5GAN 8;  4C92 A;  5CKE A;  5LJ5 g;  1JJ2 S;  3CCU A;  3LX7 A;  4M75 G;  3T9N A;  4E47 A;  3MO8 A;  4C92 D;  3JCM P;  4MMK A;  3E9F A;  4A4F A;  4F7U G;  1UGP B;  4J8O A;  3OYB A;  2KY9 A;  3Q1J A;  3OYM A;  3CC2 A;  2YHT A;  3MEA A;  3OBW A;  1VQ8 A;  4HT8 A;  1MHN A;  3CD6 A;  4UC4 A;  4DOV A;  3CCR A;  1JRI A;  3BW1 A;  3PT9 A;  4KBM B;  4LD6 A;  4DOW A;  2GF7 A;  2RI5 A;  3L42 A;  5GAN e;  1AHJ B;  4ZN3 A;  4A4H A;  3QZ5 B;  5I2S A;  2P4T A;  3ER0 A;  4JS4 A;  3LGL A;  2E1H A;  2LQK A;  5GAN 3;  4R56 A;  1WQ7 A;  2QDY B;  3OSS C;  3RKW A;  2DD5 A;  1JB0 E;  5GAN d;  3M54 A;  4M7D E;  1QW1 A;  3G7Z A;  2ZPI B;  1KD1 U;  2DIQ A;  1M1K U;  2RJF A;  2LT1 A;  2FHD A;  4N0A A;  3FB9 A;  2MWO A;  1Q86 U;  1K9M C;  4MDW A;  5FLX E;  1VQN T;  4BE0 A;  2ZPG B;  3OYI A;  1YJ9 A;  3AHU A;  4VUB A;  5IN1 A;  3BDU A;  2NLU A;  2QI2 A;  4CI0 C;  3GP8 A;  3JCM W;  4BUG A;  5GAN h;  5FU7 B;  3G6E A;  1UB4 A;  2ZCF B;  4A4G A;  4EMH A;  4HT9 A;  1KQS A;  4FSX A;  3L2Z A;  2HAX A;  2D0Q B;  3ASK A;  5DM7 R;  3GOX A;  2LQ8 A;  1R8O B;  4J7I A;  3SB2 A;  4XK8 E;  3QZ9 B;  2RK2 A;  4Q5W A;  1I8F A;  3QSU A;  4C8Q E;  2OTL T;  2K3Y A;  3OYH A;  3LWI A;  3CCE T;  4ME7 A;  4E7K A;  2K5I A;  5CQY A;  3QG1 A;  5LJ3 f;  3R6O A;  3OYL A;  4OGC A;  3OB9 A;  4ZGE B;  3HSB A;  4N4G A;  2JNG A;  1NE8 A;  3SD4 A;  2RHU A;  4M7A E;  5GMK i;  3J80 E;  1U1T A;  2VUB A;  1QP2 A;  5CKF A;  3V7S A;  1OI1 A;  5FU7 C;  3OMC A;  1BIA A;  4LDV A;  3OYF A;  4OP0 A;  2E70 A;  3A8M B;  3JCM f;  2DXB A;  2DZC A;  1YJN T;  5I2M A;  4J6X A;  5GAM f;  2L3R A;  3PMI A;  3BFM A;  1VQP T;  1M1G A;  3S3M A;  5FRO A;  4E7I A;  2F69 A;  5DLO A;  3CCL T;  3ZBD A;  5D6X A;  2HQE A;  2X35 A;  4M77 B;  1ZHI A;  5CQX A;  3MHX A;  3UT1 A;  3HFN A;  1VQK T;  4NL3 A;  4QVZ A;  1Q7Y C;  1WJQ A;  1VQ6 T;  4JS5 A;  2DO3 A;  3SFM A;  1BI3 A;  3LWH A;  2QXF A;  4E7H A;  2RHI A;  3C94 A;  4BE2 A;  3HRT A;  2GFU A;  1X01 A;  3CXC S;  3OQ5 A;  2QTX A;  2ZPF B;  3V7R A;  1U1S A;  4BY6 B;  4Y91 A;  5LJ3 e;  5LJ3 j;  3L2W A;  1VQP A;  5CKD A;  3E19 A;  4M77 A;  2WAC A;  2CZ0 B;  3QDR B;  3CBM A;  3DLM A;  3OYG A;  4N4H A;  4A4K A;  4ELY C;  3GPL A;  2YLC A;  4J83 A;  1UGR B;  1G3T A;  1TH7 A;  2MAM A;  5KCH A;  1G5V A;  2LC4 A;  1UGS B;  4XAX B;  3JB9 I;  4ELZ C;  4M78 E;  3CMA T;  2K2V A;  2O01 E;  3NTK A;  4OB2 B;  3V8J A;  1BI2 A;  3MP1 A;  1IRE B;  2QQR A;  5GAM j;  3RER A;  2EJF A;  3GLX A;  1M9S A;  2RH2 A;  2X4J A;  3QYG B;  3VU3 C;  3OYC A;  2E65 A;  2E12 A;  1G3W A;  5LJ3 h;  3G4S T;  4BY6 C;  4EDU A;  2DIG A;  1BI1 A;  2RI2 A;  2PUK B;  3E1S A;  4MML A;  5FU6 B;  5L8R E;  3JCM J;  2G3R A;  1RI0 A;  4N4I A;  4M75 E;  4XTY A;  3OYK A;  3CCJ T;  3L2R A;  4P5N A;  3C12 A;  2EQM A;  4C5G A;  3TCJ A;  5GAN f;  2MMP A;  1Q7Y U;  3CMA A;  4JRQ A;  1VIF A;  3HHT B;  1D3B B;  3RIR A;  1PSF A;  4F7U E;  5KCO A;  2K57 A;  3OYY A;  3JCM h;  2PVD B;  1Q82 C;  3MEW A;  5GAO p;  1Y71 A;  2EAY A;  3CCQ A;  2EFI A;  3M56 A;  4C0Z A;  4L6V 5;  3UWN A;  4X9D A;  4A4E A;  3CC7 T;  3CCR T;  4E7J A;  3G4S A;  5LJ5 d;  2DZ9 A;  4X9C A;  4XU3 A;  3RES A;  2HNI A;  2XI9 A;  3QXE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...