3HPWA

Ccdb dimer in complex with one c-terminal ccda domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxic protein ccdB
publication title Rejuvenation of CcdB-Poisoned Gyrase by an Intrinsically Disordered Protein Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin repressor
total genus 29
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hpwA00
5HK3A 5CO7A 3VUBA 5CKEA 3G7ZA 3JRZA 5CKDA 1NE8A 4ELYC 3HPWA 4MDXA 5HK0A 4MZPA 2C06A 4ELZC 4OF1A 3TCJA 2VUBA 5CKBA 5CK9A 1UB4A 4ME7A 5CQXA 4MZTA 5CKHA 3NFCA 5CCAA 1X75C 4VUBA 2KMTA 5CR2A 5HKCA 4HKEA 2MF2A 4MZMA 1VUBA 3JSCA 5DLOA 5CQYA 5CKFA 1M1FA
chains in the Genus database with same CATH superfamily
1OYXA 4PK4A 4MDWA 4DBQA 2HBWA 4MMLA 1ZHIA 2LT4A 4J8OA 2R57A 2CSQA 2RM4A 4M7AG 2DL7A 4N4GA 3CCQQ 4PJOD 3CCEQ 2KSSA 1MHNA 2E70A 3CPFA 3QJ6A 1QVGS 2J7IA 3U23A 2X3XD 4RMOA 1VQPA 2RN8A 1YWPA 2DJZA 1G3SA 2RQTA 5KE2A 5LJ5d 2PNIA 4A4GA 1M9SA 3A98A 2E10A 3CC4A 2RF0A 1UB4A 1FX7A 4JJNK 2QQ9A 3L2QA 1MMNA 4M78D 3G6EA 1YBYA 3NTHA 2CP6A 4J6WA 2QASA 4Z02A 1VQ7Q 2CUBA 1VQ9T 3LH0A 4J83A 2FEIA 4HCZA 4IIOA 3RESA 2DFUA 3EAEA 3JRZA 3D7SB 3CD6A 3ZFJA 4M77D 1CSKA 4RCBA 5GAOr 1SPKA 4PKCC 4XAXB 5KCOA 2ROTA 4JRQA 5ECAA 1JRIA 2MOXA 1MNEA 2R5AA 3CC4Q 4F14A 3SEMA 2DKGA 2J06A 3V8JA 3SWNA 4J6XA 2HKNA 3M56A 1MUZA 2FZGB 2MIOA 3OYGA 3G6EQ 2K3XA 4EPCA 4C8QA 1LCKA 1HK9A 1YIJT 2XICA 1Q82C 4JS5A 3HHTB 2LMJA 2CP0A 4ME7A 3SWNB 2HSPA 2X9HA 2EIFA 4C8QB 4DQ2A 2H8HA 1WLPB 1WQ7A 2LJ1A 2RJFA 3OY9A 1NYFA 1OULA 2DL3A 1VQ9A 3EG2A 5HCKA 3PFSA 3PIOA 2LRQA 4HCKA 2CP3A 2DTOA 2V26A 1BB9A 3C12A 4PFOA 2FPFA 4RCCA 2XIDA 1ZX6A 1RI0A 4WCIA 1LNXA 1XJWB 2BE7D 4C92F 3VYGA 2COWA 3G4SA 5J39A 3M0TA 4EMHA 4O5VA 1TXQA 3FJPA 3WXMB 4L6V5 2DZCA 4KGXB 2W0ZA 1OX8A 2B8AA 2FL7A 1VQ9Q 4C8QE 3CPWS 3PE0A 2EYQA 3JCMh 5GMKm 3V8LA 1VYTA 2PUOB 4JPBW 3SHWA 2BZYA 1KQ2A 4LDYA 2YSQA 1YI2T 2PVOB 2ATCB 2HQXA 4L59A 5I21A 4KT0E 1W2BP 1I4K1 2E3IA 5CKHA 3G4SQ 3LX7A 2RI5A 4Z88A 3ZBDA 1VQLT 3HFNA 1YN8A 2DILA 2KYBA 1B07A 2L3RA 2LDMA 4XTXA 2HZYA 2JNGA 3F70A 4BY6C 4KULA 3EHRA 3CEYA 5A0LA 3CQTA 3S3MA 3DB4A 4E2FB 1BYMA 3X20B 3PGGA 4N0AC 1Q81R 5FU7B 3QDRB 4O6JA 5GJWB 4ZN1A 3JCMQ 5AYFA 3KFVA 3CBPA 4KBMB 4JDSA 2EYZA 3CXCP 2L3SA 4ORZA 3CC2T 4LDXA 1YI2A 4MZMA 2CZ1B 3M5AA 4IUTA 3X25B 5L8RE 3L1AA 5LJ5h 2VGMA 4RG8A 4A63B 2YXYA 2OTLA 2ECZA 2MMPA 3X26B 4KGVB 1GCQA 1NM7A 3DB3A 3C94A 3M54A 4OMPA 3REAB 5LJ3h 1UHFA 1VQ6T 3TSZA 5KYXA 1PC0A 2JXBA 3JSCA 4D8KA 3GF5A 2QAZA 1HYOA 3H8ZA 1M1FA 4LDVA 2L3PA 3ULRB 3VUZA 1YI2Q 1VQ5T 3TU4K 4DBFA 4JUVA 5FLXE 1I81A 3CCST 5KYXB 2SEMA 3VJPA 1S72T 2OTLQ 2FPEA 2XU8A 2ZPHB 1MV0B 1RI9A 2KBTA 1PSEA 6AT1B 1WIEA 1T3LA 2QXFA 1V76A 2WSCE 1VA7A 3CXCA 4HCCA 3CC2A 2FG0A 1LOJA 1WNLA 3I56T 4DEYA 1RADB 3HTRA 4OMLA 4N4IA 2QGFB 2VC8A 2X4XA 1ZSGA 2EKHA 4AFSC 4RUGA 1W2BS 1I5OB 1UGRB 5IHKA 1TS9A 4XK8E 2DD5A 4PNOA 2MK5A 2J05A 2J6OA 4FU6A 1RABB 1X27A 1NPPA 5DY9A 2EGEA 2MWPA 2LX9A 1XQHA 3CC2Q 2KI7A 1FYNA 3MEAA 4LD6A 2HNIA 1G3TA 1WX6A 4IIMA 2M16A 2JTEA 5IHIA 1OEBA 2HL5C 4KRTA 4AFZC 1AZEA 2DO3A 1S72A 4R55A 5GJVB 5GAOq 2JW4A 3OSVA 4C8QG 1K8AU 1UJ0A 2E4HA 3LGLA 2KEAA 1N8RU 1NPRA 4M7AE 3I56A 4J7IA 4KUDK 1AZGB 4AG2C 5FWBA 4FT4A 4R0KA 1VQ5Q 2K3BA 5KYYA 1KD1R 1RAFB 4LNPA 3TCJA 4FSSA 4V2SA 3CCMT 1N27A 1S72Q 1K9MU 2YLCA 1YCYA 4C92D 4A4KA 2EQUA 2E12A 2B86A 1JBMA 2D0QB 2YUQA 1M90R 2KXDA 2A37A 5GAN5 1VQKT 2EVRA 2EJFA 2HQEA 3I56Q 5CVIA 1D0ZA 1AWOA 2PZ1A 4JJDA 4EMKC 1X43A 2DF6A 3GP8A 1H92A 1G8XA 4ZNXA 1KQSP 5GAMe 4D6WA 5I22A 2YLBA 2XDDA 3GIBA 3BDUA 2DNUA 3JCMc 4M7AF 2RO0A 3VS4A 1X01A 1M2OA 2KRSA 1A0NB 1WQWA 4GY5A 1TUCA 3OS2A 4QKUA 2LZ6B 2NUZA 4BB7A 1YP5A 1U3OA 2EYYA 5KCHA 1UFFA 5CK9A 1NEBA 4LUEA 2L2PA 3VU3C 1BCMA 1QVGP 4A53A 3JCMV 2KNBB 5EC7A 3J81E 3CCVT 1TUDA 4JLGA 2I2LA 4A4EA 1M1KU 1YWOA 1O9SA 4TVRA 2XD0A 2M0YA 2RJDA 3RNJA 2CT3A 2DPPB 4E7IA 1VQKA 2QYZA 3HP9A 1ABOA 5I2SA 4ZGEB 1T3SA 2HBPA 3CCQT 1AD5A 3CCET 2K5LA 1KQSA 1UHCA 3JB9H 1P92A 1SHGA 1Q7YU 2HSEB 2YRVA 1K9MC 2GQVA 4A4FA 3OYDA 2DMOA 2GNCA 2PUKB 2QK0A 2LX7A 4OMMA 3QO3A 5FW9A 4AG1C 1KC8R 1JU5C 4LUDA 2CS7A 3VS3A 3QWYA 2O2OA 4M77C 3RMSA 3QZ9B 4Q5WA 5CCAA 2X4YA 1YJNA 1YHQA 2EQIA 2VXEA 1VQKQ 3L42A 4B9XA 4JJCA 3QUIA 1UDLA 4PJOG 1NJIU 1QVGA 4RG2A 4C5EA 3H6ZA 2HDAA 1PCXA 5FU6C 3DLLA 4A54A 1VQPT 1BK2A 3CBOA 3X24B 4D8DA 4F04B 2IG0A 2CZ0B 3NHNA 1M3AA 2DRKA 1BBZA 2ENMA 1WGSA 3G71T 3NMZC 2E65A 1VIFA 4PL6A 1WXUA 3MEWA 1YHQQ 4M78G 5KYNA 1Y57A 1GFCA 3J7AF 2OAUA 3EGUA 2L5QA 3OYIA 3CCUA 2EKOA 5LL6S 1Z9QA 3V7CA 4FM4B 1Q82U 4N0AA 3CD6T 1RAEB 3LWHA 2K2VA 4ANJA 1M1KC 4J9GA 1E6GA 2CUDA 5C6SA 3FJ5A 2ZZDA 3OQ5A 1D1AA 2HD0A 4BY6B 4AFUC 2J6KA 4UC4A 1ZA2B 2F2WA 3E19A 5GANh 5D6XA 2KT1A 4XU1A 1I8FA 3MP6A 2CREA 1G5VA 1MNDA 3CC7A 1Q95G 3CCUQ 1Q7YC 3CPWP 2RI3A 4BI3A 2F1LA 4FYVB 2DRMA 1OX9A 3OBYA 1VUBA 1SEMA 1X6BA 3HKSA 4WF2A 1TSFA 3JV3A 1ZLMA 2EAYA 3G71A 1IGQA 4ZTFA 2KR3A 3OYHA 3OYMA 1NJIC 2JJ9A 3RR6A 1VYVA 2DL8A 4NL3A 1KSWA 3CC7Q 8ATCB 2CSIA 2AT1B 2L3QA 4HT9A 1GFDA 1TG0A 3OYBA 2GGRA 5GAOn 5IHNA 1KJWA 1NZ9A 3GNGA 1BI3A 3ER0A 2K7AA 1VQPQ 4J9FA 1AWWA 1WI7A 1AVZC 2CP2A 1WPYA 1NYGA 2LTOA 3EFSA 3G71Q 1QKWA 1Q86U 1UUEA 4XTVA 4HXJA 3NPFA 3G4ST 4EMGA 2DIGA 1UJYA 1Y7XA 2DL5A 1E7OA 2YHTA 5GMKh 1C6VX 3WVDB 3CPWA 4DOVA 1QW1A 4J9IA 1PD0A 3CD6Q 3A8HB 1K73R 1ZA1B 4LDUA 3QKJA 1J3TA 2F69A 2EPDA 1GBRA 1SSHA 2VYTA 2I0NA 2EQMA 5IT9E 1WHHA 1BU1A 5GAN2 4M7AD 4HT8A 1I5LA 4FW2A 4J9DA 4AT1B 4FL6A 4C0ZA 3UDCA 2RI2A 4BE0A 1WHKA 2F2VA 3NFCA 2ZGWA 2VB6A 4EIKA 4J6YA 5CR2A 5GAMh 2ESWA 3ZL7C 3MO8A 2IVWA 3QBYA 3PTAA 2P4TA 2RK2A 2K5IA 2X4JA 2EBPA 3I5SA 2JUFA 2KAFA 4C5GA 1G83A 1R0CB 5HK0A 1ZUUA 2C06A 2ZCFB 2X51A 2V8IA 3RBBB 2R5MA 4OB1B 2KMTA 1CKBA 4DBHA 1WA7A 3JCMg 1BKBA 3UPUA 4OMOA 1IO6A 4BDYA 4M75A 1PKTA 4QQDA 1OPKA 2CT4A 1Q86C 2QEXA 1QCNA 1SF9A 1YJ9T 1UG1A 1U8RA 3UATA 1R0BG 2CGHA 3FIFA 3H0FA 1OU8A 1YITA 4FT2A 2JOYA 2RPNA 3MKDA 4M75B 3MEVA 4PJMA 4M7DA 4ATOA 2OTLT 1RAAB 2E5QA 5CQYA 1WJQA 4Y28E 1M4ZA 3QDFA 1PHTA 4BDZA 3SD4A 2OAWA 4C5HA 1M2VA 2MCNA 2PU9B 2VWFA 2DEUA 1FMWA 4M7DB 2FO0A 1QVFS 1N9RA 2PVDB 1WHLA 4CC7A 4C8QF 1M2VB 3N5BB 3I35A 2RQVA 4XTUA 2HCKA 4BI4A 2ZAEA 1C0MA 2F2XA 3X28B 3LGFA 3PT9A 2O88A 3EGXA 2DM1A 4RTTA 1U1TA 4P5NA 8AT1B 1VQOA 3OYJA 2RHIA 4PJOA 4RTWA 3OYEA 1Y0MA 1YJ9A 4M75E 1OPLA 3EGXB 1SG5A 2H3JA 1K4US 2LCSA 1W2BA 3M4GA 2EYWA 2DXUA 4PJJA 1AWJA 1EFNA 3M0PA 1MMAA 3LWIA 3EFOA 3RMQA 2K3YA 4PJOB 1B34A 5LJ3g 4M7DE 2DIQA 3PMIA 1FWZA 4M78A 1OV3A 1K8AR 4C92C 1KIKA 3I5RA 2LVMA 3UWNA 4GBQA 3QSUA 3BE3A 3EFOB 3M59A 3FLGA 1X69A 2FRWA 1NE8A 2EQKA 1YJ9Q 1N8RR 1B34B 5KYWA 2LJ3A 4E6RA 4M77A 3HRUA 1IXDA 5I11A 4M78B 2YRCA 4F7UA 2ZPEB 3QXEB 4Z8AA 3EGDA 5HKCA 1VQ4A 5KYWB 3A8OB 3S3NA 4M77B 3P8HA 3MCAB 2DK3A 3LYIA 3VS1A 4JRKA 4MZPA 1SRLA 3VS2A 2RHZA 1V29B 2ZPBB 5IN1A 2DEQA 2K4YA 4F7UB 4PJOE 3MP1A 2EQJA 3EGDB 4X9CA 5GAOl 4XTZA 2XDBA 2LCCA 2M9UA 2JTFA 2O31A 4RTXA 5D6YA 3MHXA 5FU6B 1JXOA 2LQ8A 1VYUA 2GTOA 3PMTA 4QVCA 1WJRA 1VQ4Q 4HCBA 4IUVA 5IH2A 2DZ9A 4ESRA 1VQNA 3CCLT 1HXDA 1MMDA 2XK0A 3E9FA 2JMAA 2J6FA 4M78E 1KQ1A 5GMKl 2CZ7B 4X34A 3C95A 3JB9J 2XG8D 2AIRB 1M5Q1 3SB2A 1I07A 4M77E 2V1RA 3P8BB 3OYYA 3O8VA 3FB9A 3A1PA 4J7FA 3JB9I 2M02A 1CKAA 2LT1A 4OP0A 4XQ3A 3TQ7P 4F7UE 3VS5A 3J80E 2VV5A 1AHJB 3M53A 4J9CA 4KH0B 3M9QA 4QW2A 1MGQA 2FRYA 2QDLA 2JT4A 3O5ZA 2EWNA 1UECA 3INZA 4B6MA 4JRPA 1N6AA 3QPHA 2RA2A 4BE1A 1KK7A 5I2MA 4A4HA 3HSBA 2K2MA 2JZ2A 4ZTJA 3EG1A 1RL2A 2NLUA 1D09B 3CCLA 2A28A 3RKYA 1N9SA 2ZPFB 4OMNA 5GAN3 4HVWA 1IREB 3VS6A 4E7ZA 2Y90A 4PLIA 3OYCA 3OBWA 3R6NA 5GAN8 3H0HA 3HFOA 2P0KA 1V1CA 2X4WA 2GF7A 2AKKA 5LJ5j 4IUQA 1X75C 3TVTA 2MF2A 3LW5E 1F1BB 3VV0A 2ED1A 4GLKA 4DBRA 3QYGB 2LC4A 2D6FA 2LJ0A 2QA4A 1Q81C 3CCLQ 1YJNT 1YHQT 5LJ3j 2DXBA 4BACA 1AWXA 5FU7C 3JCMf 4M75G 1UGVA 4XTWA 2FPDA 4VUBA 3VS0A 3V7RA 4OMFB 3VYHB 3EH1A 4C8QD 4EDUA 1UEBA 1M1GA 1OZ2A 1Q82R 1OU9A 3OYAA 4M7DG 1SSFA 1TH7A 2EFIA 3JB9G 1MMGA 2RD1A 2SRCA 1NG2A 2CH4A 2DYBA 4XU0A 1FMKA 2DVEA 2DXCA 2PVGB 2FVUA 2O01E 3CCUT 3M55A 3PVLA 1G3YA 3SFMA 2QDYB 1X2QA 3QYHB 2M0OA 2AHJB 1D0XA 1K0SA 2YRDA 4BD3A 2AZSA 4ZGJB 2KE9A 3R6OA 2GQIA 3H9NA 1GCQC 2COZA 1UGPB 1KD1U 2QQSA 2RQUA 1H8KA 1IRXA 1D0YA 3CC7T 4C0DC 4J9EA 5GAN4 2LP5A 1BI2A 5D6WA 1U06A 1K1ZA 2DL4A 4JJBA 3CMEA 2EGCA 3PNWC 4HVUA 1B3QA 1QKXA 1TU0B 3M4YA 4II1A 4OB3B 2QI2A 5HK3A 3JCMd 3I55A 1YJNQ 2LNHB 1Q86R 5A0GA 1Z9ZA 4GLMA 2DE0X 1T0HA 5LJ3f 4M7AC 3FEOA 3M0SA 4PJNA 3S3OA 3E1SA 2CP5A 4R56A 4M77G 1Y96A 4MZTA 1QWFA 3CMEQ 1ZBXA 2DTIA 2V1QA 2M51A 3WVEB 2A08A 2DX1A 1M8VA 3META 3CMAT 3G7ZA 1JXMA 4F7UG 4IUPA 5GANg 2OTJT 1JJ2S 1T0JA 1Y96B 2E5KA 1IB8A 3I55Q 3PVQA 3V7SA 1BI1A 2YUNA 3NTKA 2CH4W 2K79A 1PWTA 4N4HA 3I9QA 2GFUA 1BIBA 3BDLA 2CKKA 3EFRA 3QJYA 2K9GA 2YWWA 5EG2A 2CP7A 2RQRA 2BUDA 4L5GA 1H3ZA 3CCRT 1WJSA 1WZOA 2O9VA 2E64A 4JZ3A 5A2QE 2EW3A 1KD1C 2K6DA 2OJ2A 1ZSZC 3QG1A 1VQ7A 1QWEA 1UGQB 1QP3A 4C92A 3PIPA 1LPLA 3OYNA 1BI0A 2GTJA 4Y92A 2CDTA 2FZKB 1QCFA 1KC8U 5FRNA 1X2KA 2DBKA 1M90C 3RKXA 4CI0C 2JMCA 5C0MA 4F16A 2LQNA 1DJ7B 1WXTA 4M4ZA 3CCJA 4C92B 1SRMA 3L2ZA 4OF1A 2XKOC 3TSWA 1C1AA 3CBMA 1QVFP 2DLPA 1ZUYA 3M57A 3CMAA 3REBB 1WHJA 2XMFA 2OTJA 1NBEB 1UTIA 5LJ3d 4OVAA 2COYA 2BTTA 1OOTA 3RIRA 4NS5A 1I0CA 3EG0A 2BE9B 2QQBA 1M3BA 2RH2A 2WSFE 4ELYC 2RB6A 3UT1A 3C4SA 1AEYA 3ME9A 2X3WD 4E7KA 1VQMT 1GRIA 4CRIA 2E6ZA 4DOWA 2MYSA 4RKUE 3KXTA 3CCJQ 3H41A 1XOVA 3L2RA 3G1JA 3CCRA 5M9OA 2ZPGB 1WHGA 3OW2P 3CMAQ 2QEXT 2C0IA 2OTJQ 2YT6A 1M3CA 1YITT 5CIUA 3OMGA 4C92E 4KUIA 3RERA 2YDLA 5GAMg 4PLLA 3SDZA 1TOVA 3OB9A 3GOXA 1K0XA 4E7SA 1QVFA 4JS4A 2HAXA 3JCMX 3CCRQ 5L23A 2HMAA 2QQRA 2JS0A 2DTHA 1WFWA 3MEUA 1RAHB 3VRYA 2FHDA 1JQQA 2D0NA 3BY7A 2P84A 5DLQE 2HL3A 2KROA 3JCMP 1KC8C 3QHSA 2JS2A 3KUFA 3IQLA 4NOYA 1AT1B 5GAOm 5A0DA 1HD3A 2KYMA 2LNVA 1VQMA 2KQWA 1RLQC 4C0FA 2VGNA 1VQOT 4MMKA 3QIIA 1SHFA 3ZEHA 2A7YA 2RQWA 3OW2A 4E7JA 1PSFA 1LVKA 2ABLA 3VS7A 1YIJA 2CZ6B 2KGTA 4LDWA 4XTYA 5GANj 2CYZB 2BIVA 1O75A 2BZ8A 3RUXA 5CKEA 5KE3A 2C0OA 1K9AA 2Y4YA 1VQMQ 1YFNA 4EMKA 2P0QA 1PRLC 3AHUA 1U1SA 2ZPIB 3T9NA 1K76A 3P8DA 3OYKA 4X9DA 1FXXA 2QEXQ 3HRTA 3M0RA 4EMKB 1VIEA 4OGEA 1BCOA 1YITQ 2DERA 1YCSB 4FIBA 1AOJA 1YIJQ 2VVKA 4OMQA 1H3HA 1K73U 1JEGA 2DAQA 3L2UA 3FDRA 2Y4XA 1VQ4T 2VUBA 3L2VA 4OB2B 2RHXA 2DD4A 3E9GA 3QWXX 2RK1A 2NYSA 2A36A 2JM9A 2RHUA 1OI1A 3M0UA 1YJWT 3A8GB 2ROLA 5GAN7 5LJ5g 5J26A 4KGZB 4DEXA 1EIFA 3OW2S 2C0TA 2G3RA 4E7HA 3ASKA 4OB0B 4MDXA 5KH6A 3TEEA 1R8OB 2EJ9A 4BUGA 1PG5B 3AT1B 3OS0A 1M27C 1QCOA 3EHQA 1W4SA 5GMKj 3TREA 1VQNT 3UF4A 1VQOQ 3NGPA 3URGA 3HRSA 2FB7A 2RJEA 3UA6A 3UA7A 1WHMA 5CAIA 1KHCA 4LD9K 4C5IA 5GAN6 2V8JA 1G2BA 1E6HA 4Z89A 1IZ6A 2M1HA 1VQLA 1QVPA 1UGSB 4J5YA 3BFMA 4HVVA 3LH5A 1XNIA 1GCPA 4X1VA 1JB0E 3H0IA 2QG9B 5GANf 4M75F 2YUPA 2LQKA 4XU2A 2PTKA 1K9MR 3RKWA 1PNJA 2AZVA 3OA6A 4BI8B 4CC2A 2MAMA 1GBQA 2QTXA 2KXCA 5GAMj 2JTMA 1YJWA 1QLYA 1WXBA 4M7DF 3JB9F 5CQXA 4C0DB 1RAIB 4RTZA 1VQLQ 3LLRA 1K73C 2K5FA 1Y71A 2A3LA 1EZZB 3S6WA 3THKA 1WYXA 4C92G 5GANe 3JCMW 4B9WA 3SWNC 4M7AA 2A0FB 2FYKA 1W70A 2XHCA 5FWCA 3OMCA 4C8QC 4IKFA 1VOMA 1Q81U 2EJGA 4IUUA 2H3EB 4LXCA 1X6OA 3VRZA 2D8HA 1YJWQ 4KH1B 4JRIA 4QQGA 2JN0A 1S1NA 2KK4A 3KBGA 4M7AB 1NLPC 2RHYA 3BW1A 2QTVA 4PFPA 2MPXC 3GNFB 3RDVA 2JM8A 1HJDA 2L89A 3VUBA 2BZXA 4FYXB 4IURA 1ABQA 2EGAA 2XI9A 1VQ6A 1ACMB 2NUPA 5DM7R 4RTUA 1MV3A 4PJOF 3DLMA 2LQWA 2R58A 1TUGB 4QVZA 4QVDA 2DVJA 2QA4T 1M1KR 3L2WA 1Y07A 4F17A 1VQ5A 1VQNQ 1R77A 2P4RA 3M58A 4C0GA 3JCMJ 2D8JA 1QMCA 2BKDN 2NUPB 3CCSA 4K11A 2QGGA 2L0AA 1YNZA 1HSQA 4FW1A 2PQWA 2V8KA 1ZSZA 5GAOp 5GANd 4M78F 2KY9A 2YUOA 4BE2A 4LE9A 1Q7YR 1VQ6Q 2VKNA 1ZBJA 2O4XA 4QT7A 1KG1A 4J9BA 2OI3A 5IXBA 5GMKe 7AT1B 3CXCS 2DETA 3VKIA 1D1BA 5DLOA 4M77F 1ZSZB 5KYUA 3E2UA 3MP8A 1OZ3A 2K57A 1BIAA 3EG9A 1RACB 5GAMf 3CCSQ 1PD1A 2JVVA 2O4XB 4M75C 2DBMA 1RUWA 2AK5A 1I1JA 5CKBA 4F7UF 4FYYB 2HEQA 1X6GA 1NJIR 3Q1JA 1RLPC 2XDPA 2Z0WA 5KYUB 1FMVA 1JO8A 1VQ8T 2ED0A 3EG9B 5KYYB 3JCMb 4XU3A 5CKFA 4M7DC 1JJ2P 5IXFA 2WACA 1N5ZA 3M0QA 4AFQC 5GMKi 3GPLA 3OS1A 1XTDA 2O9SA 3EH2A 4CC3A 2DYIA 2MWOA 1M30A 4LN2A 1TTHB 1U5SA 3CMET 2VXFA 3FRNA 2IIMA 5CKDA 3MPUB 1ARKA 3A8LB 3MJXA 2F5TX 4FSXA 1M8MA 2QA4Q 2IPOB 1ZUKA 2AKLA 5HY6A 1NLOC 3I55T 4YTLA 2P0PA 4FYWB 2NWMA 3JCMe 2GFAA 2FZCB 1QP2A 2VASA 4PJOC 3CCMA 1H641 4OGCA 5FROA 2G6FX 3OSSC 4PJLA 1K8AC 3GBQA 5CO7A 4PFZA 1B7TA 3C0CA 4ELZC 1QQJA 1VQ8A 1N8RC 1JJ2A 4RTYA 1RAGB 3A8MB 4ZN3A 2OX7A 1D3BA 2EYXA 1W1FA 2E3HA 3NTIA 3EG3A 2D1XA 5GAMd 4M78C 3HL8A 5D7UA 4RTVA 2GCXA 2W10A 2HQHA 4CC4B 1PRMC 3CCMQ 9ATCB 2WSEE 2E1HA 1D3BB 1M90U 2KRNA 1PKSA 1IGUA 3FC3A 5LJ5f 1GXIE 2DXTA 2LCLA 1VQ8Q 1WDXA 2RMOA 4HA8A 4E47A 3QZ5B 2F5KA 4WTOB 4J9HA 2KVQG 1IHVA 2NUTA 1UE9A 2MI6A 4M75D 5IAYA 2L8DA 1VQ7T 2RJCA 3A5ZB 3GLXA 2DJQA 1IHWA 1TWBA 1LJOA 3CCVA 5J3BA 4JLIA 2HKQB 1D1CA 2KRMA 4JZ4A 1GL5A 5FRMA 1EX4A 2E6NA 1W6XA 2NUTB 4M7DD 1NEGA 4ZGDB 5LJ5e 3CC4T 3CCJT 3JB9D 2KDSA 4E7LA 5AT1B 3OS5A 3JAME 2DA9A 3DKMA 1OQKA 1PM3A 4DA4A 2X35A 4Y91A 3HPWA 3G6ET 4NL2A 3V8KA 1ZQ1A 1SKUB 2D9TA 3OYLA 3CCQA 3CCEA 3OYFA 5LJ3e 2GBQA 4QQ6A 4AMCA 3CCVQ 1KQSS 2RNAA 1KFZA 2E41A 2KT8A 1KHIA 2QQAA 4HKEA 4FCYA 1G3WA
chains in the Genus database with same CATH topology
4GY5A 4M77B 2VGNA 3OS2A 3P8HA 1OYXA 3MCAB 4MMKA 1VQOT 3QIIA 4BB7A 4MDWA 3ZEHA 2A7YA 2DK3A 3LYIA 4MMLA 1ZHIA 2LT4A 4J8OA 4JRKA 2R57A 4MZPA 3OW2A 5KCHA 2RHZA 1V29B 2RM4A 4M7AG 2ZPBB 5IN1A 2DEQA 5CK9A 4E7JA 2K4YA 1PSFA 4F7UB 4PJOE 3MP1A 2EQJA 5GAOl 4X9CA 4XTZA 2XDBA 3VU3C 2LCCA 4N4GA 2M9UA 2JTFA 4A53A 4PJOD 2KSSA 1MHNA 1YIJA 2CZ6B 5D6YA 2E70A 3CPFA 3QJ6A 3JCMV 4LDWA 4XTYA 1QVGS 3MHXA 5FU6B 3J81E 3CCVT 5GANj 4RMOA 4JLGA 1VQPA 2CYZB 2BIVA 1O75A 3RUXA 2LQ8A 5CKEA 2I2LA 4A4EA 3PMTA 4QVCA 1M1KU 1WJRA 2DJZA 5KE3A 1O9SA 1G3SA 2Y4YA 4IUVA 5KE2A 4EMKA 5LJ5d 4HCBA 2DZ9A 4A4GA 1VQNA 4TVRA 2XD0A 1M9SA 2P0QA 2E10A 3CCLT 3CC4A 2RJDA 3AHUA 2DPPB 1U1SA 1HXDA 1UB4A 1FX7A 2XK0A 2ZPIB 3E9FA 3T9NA 4JJNK 4E7IA 1VQKA 2QQ9A 4M78E 3HP9A 3P8DA 3OYKA 3L2QA 1KQ1A 4X9DA 4M7AD 1FXXA 5I2SA 3HRTA 4M78D 5GMKl 4ZGEB 3G6EA 2CZ7B 1YBYA 3NTHA 4X34A 3C95A 4J6WA 2HBPA 3CCQT 3JB9J 2XG8D 1VIEA 2K5LA 4OGEA 4Z02A 4EMKB 1KQSA 3CCET 1VQ9T 1M5Q1 1P92A 3LH0A 4FIBA 1Q7YU 4J83A 3SB2A 3JB9H 4HCZA 2YRVA 4M77E 3RESA 3P8BB 3EAEA 3JRZA 1K73U 3OYYA 1K9MC 2GQVA 4A4FA 3OYDA 3CD6A 3O8VA 3ZFJA 2PUKB 2DAQA 3L2UA 4M77D 3FB9A 4J7FA 3FDRA 2Y4XA 4RCBA 3JB9I 5GAOr 2LT1A 3QO3A 4OP0A 1VQ4T 2CS7A 2VUBA 4PKCC 4XAXB 5KCOA 4XQ3A 3L2VA 4JRQA 4M77C 1JRIA 2RHXA 4OB2B 4F7UE 2DD4A 3E9GA 3RMSA 3QZ9B 2R5AA 2RK1A 4Q5WA 3J80E 5CCAA 2X4YA 1YJNA 1YHQA 2VV5A 2DKGA 2VXEA 3V8JA 1AHJB 2RHUA 3M53A 1OI1A 3L42A 3M9QA 4J6XA 4QW2A 1MGQA 3SWNA 3A8GB 4B9XA 3M56A 1YJWT 3QUIA 5GAN7 5LJ5g 4PJOG 5J26A 2EWNA 1NJIU 3INZA 1EIFA 3OYGA 2K3XA 4JRPA 4EPCA 2G3RA 4RG2A 4C5EA 4C8QA 3ASKA 3H6ZA 1N6AA 4E7HA 4OB0B 3QPHA 4MDXA 1HK9A 1YIJT 5KH6A 2RA2A 4BE1A 2XICA 1Q82C 3TEEA 5I2MA 1R8OB 4A4HA 4JS5A 2EJ9A 5FU6C 3DLLA 3HSBA 3HHTB 4A54A 4C0FA 4BUGA 1VQPT 3OS0A 3CBOA 2JZ2A 4ME7A 3SWNB 3X24B 2IG0A 2CZ0B 4ZTJA 2EIFA 1W4SA 5GMKj 1WGSA 3G71T 4C8QB 1RL2A 3TREA 1VQNT 2E65A 2NLUA 1VIFA 3CCLA 4DQ2A 3URGA 3RKYA 4PL6A 1N9SA 2ZPFB 3HRSA 3MEWA 2FB7A 2RJEA 4M78G 1WQ7A 5GAN3 3J7AF 5CAIA 1KHCA 2RJFA 4LD9K 4C5IA 2OAUA 5GAN6 2V8JA 1IREB 3OY9A 2L5QA 3OYIA 2Y90A 4PLIA 1IZ6A 3OYCA 2M1HA 3OBWA 5GAN8 3CCUA 3HFOA 1QVPA 2P0KA 1VQLA 1UGSB 2EKOA 4J5YA 2X4WA 3BFMA 5LL6S 1VQ9A 1XNIA 2GF7A 3PFSA 3V7CA 5LJ5j 1JB0E 4FM4B 4IUQA 3PIOA 1X75C 4N0AA 1Q82U 2LRQA 3CD6T 3LWHA 2K2VA 5GANf 4M75F 2DTOA 1M1KC 2LQKA 4XU2A 5C6SA 2MF2A 2ZZDA 3LW5E 3C12A 3OQ5A 2HD0A 3VV0A 4BY6B 4RCCA 4GLKA 3RKWA 3QYGB 2LC4A 2XIDA 3OA6A 2D6FA 2QA4A 1RI0A 1Q81C 4UC4A 4BI8B 1LNXA 2MAMA 1YJNT 1YHQT 2QTXA 3E19A 5GANh 4C92F 5LJ3j 3VYGA 5GAMj 2DXBA 5D6XA 4BACA 2JTMA 3G4SA 1YJWA 5FU7C 4XU1A 3JCMf 5J39A 1I8FA 4M75G 4EMHA 4M7DF 4O5VA 3MP6A 3FJPA 3WXMB 1G5VA 4L6V5 5CQXA 3CC7A 3JB9F 2DZCA 4C0DB 4XTWA 1Q7YC 4VUBA 2RI3A 2B8AA 3LLRA 2FL7A 3V7RA 1K73C 4BI3A 2K5FA 1Y71A 2A3LA 4C8QE 4OMFB 3CPWS 3OBYA 1VUBA 2EYQA 3JCMh 3S6WA 3VYHB 4C92G 5GMKm 3V8LA 4C8QD 5GANe 3JCMW 4B9WA 1QVGA 2PUOB 3SWNC 4EDUA 4M7AA 2FYKA 1UEBA 1M1GA 1OZ2A 3HKSA 4WF2A 3OYAA 1KQ2A 4M7DG 4LDYA 2XHCA 1SSFA 1TH7A 2EFIA 2EAYA 3OMCA 3JB9G 3G71A 4C8QC 2RD1A 4IKFA 1YI2T 2PVOB 4ZTFA 2HQXA 4L59A 5I21A 4KT0E 1Q81U 2EJGA 4IUUA 4XU0A 3OYHA 2PVGB 1I4K1 2DVEA 2DXCA 5CKHA 1X6OA 3OYMA 1NJIC 2FVUA 2JN0A 3LX7A 2KK4A 2RI5A 3KBGA 4JRIA 2RHYA 4QQGA 4M7AB 4NL3A 2O01E 3BW1A 3ZBDA 3CCUT 3M55A 1VQLT 3GNFB 3HFNA 1G3YA 3SFMA 2QDYB 4HT9A 2L89A 3VUBA 3OYBA 4IURA 5GAOn 3QYHB 2XI9A 2M0OA 1VQ6A 1NZ9A 3GNGA 1BI3A 3ER0A 5DM7R 2L3RA 2AHJB 2LDMA 4XTXA 4PJOF 4BD3A 3DLMA 2JNGA 3F70A 4ZGJB 4BY6C 2R58A 1WPYA 3R6OA 2LTOA 4KULA 4QVZA 3CEYA 4QVDA 3EFSA 2QA4T 5A0LA 3L2WA 1Y07A 1VQ5A 1Q86U 3S3MA 3DB4A 4XTVA 1UGPB 1BYMA 1KD1U 3X20B 3M58A 4C0GA 3JCMJ 3PGGA 4N0AC 2BKDN 3G4ST 4EMGA 2DIGA 5FU7B 3QDRB 3CCSA 2QQSA 4O6JA 1Y7XA 2YHTA 5GMKh 3CC7T 3WVDB 3CPWA 4C0DC 4DOVA 5GAN4 4ZN1A 2PQWA 1BI2A 5D6WA 3JCMQ 2V8KA 5AYFA 1QW1A 5GANd 5GAOp 4M78F 2KY9A 4BE2A 3CMEA 3CBPA 3PNWC 3A8HB 4KBMB 2O4XA 4JDSA 4LDUA 3QKJA 2F69A 3M4YA 1KG1A 3CC2T 2VYTA 4II1A 2EQMA 5GMKe 4LDXA 3CXCS 5IT9E 4MZMA 1YI2A 4OB3B 3OW2S 3VKIA 2CZ1B 3M5AA 4IUTA 4M77F 2QI2A 3X25B 5DLOA 5GAN2 5L8RE 3L1AA 5HK3A 4HT8A 3JCMd 5LJ5h 1I5LA 3I55A 3MP8A 2VGMA 1OZ3A 2K57A 4RG8A 5A0GA 1BIAA 5LJ3f 5GAMf 4M7AC 2JVVA 3FEOA 2O4XB 4M75C 2OTLA 5CKBA 4FL6A 2MMPA 3X26B 4F7UF 3S3OA 4C0ZA 3UDCA 2RI2A 3Q1JA 4BE0A 3E1SA 3DB3A 2XDPA 3C94A 3M54A 4R56A 4M77G 1Y96A 4MZTA 3NFCA 2ZGWA 5LJ3h 5GAMh 5CR2A 4J6YA 1VQ6T 1ZBXA 2DTIA 1VQ8T 3JSCA 3JCMb 3GF5A 3MO8A 3WVEB 3H8ZA 4XU3A 5CKFA 1M1FA 4M7DC 4LDVA 2IVWA 3QBYA 1M8VA 3META 3CMAT 3PTAA 2P4TA 2RK2A 3G7ZA 4F7UG 3VUZA 2WACA 2K5IA 4IUPA 2X4JA 5GANg 2OTJT 1VQ5T 2JUFA 2KAFA 4C5GA 1JJ2S 5HK0A 3TU4K 5GMKi 2ZCFB 3GPLA 2C06A 1Y96B 2V8IA 3OS1A 1XTDA 4JUVA 5FLXE 1I81A 3V7SA 2R5MA 3CCST 1BI1A 3NTKA 4N4HA 3VJPA 2GFUA 1S72T 1BIBA 3BDLA 4OB1B 2KMTA 2CKKA 2MWOA 3JCMg 2XU8A 2ZPHB 3EFRA 1BKBA 3QJYA 1PSEA 3UPUA 2QXFA 3CMET 5EG2A 4BDYA 2VXFA 2WSCE 3FRNA 4M75A 3CXCA 5CKDA 2BUDA 4L5GA 4HCCA 4QQDA 1H3ZA 3A8LB 3CCRT 1WJSA 2F5TX 3CC2A 1LOJA 1Q86C 1WNLA 2E64A 2QEXA 3I56T 4FSXA 5A2QE 1YJ9T 1KD1C 1U8RA 5HY6A 2CGHA 3FIFA 3QG1A 3I55T 1UGQB 1YITA 1VQ7A 4FT2A 1QP3A 4YTLA 4N4IA 4C92A 2VC8A 2JOYA 2P0PA 2X4XA 3PIPA 3JCMe 2GFAA 3OYNA 1W2BS 1QP2A 1BI0A 3MEVA 4M75B 4M7DA 4ATOA 1KC8U 2OTLT 5FRNA 1UGRB 3CCMA 4PJOC 2E5QA 1H641 5CQYA 4OGCA 1WJQA 5FROA 4Y28E 1M4ZA 3OSSC 1K8AC 5CO7A 1M90C 4XK8E 4BDZA 2DD5A 3RKXA 3SD4A 4C5HA 4PNOA 4CI0C 5C0MA 4FU6A 1DJ7B 4ELZC 3CCJA 4C92B 3L2ZA 1NPPA 4OF1A 1N8RC 2XKOC 5DY9A 1VQ8A 2PU9B 3CBMA 2MWPA 2LX9A 1JJ2A 4M7DB 1XQHA 3M57A 3A8MB 3CMAA 1QVFS 1N9RA 2PVDB 4ZN3A 1D3BA 2OTJA 3MEAA 4LD6A 4C8QF 3NTIA 5LJ3d 2HNIA 3N5BB 4OVAA 5GAMd 1G3TA 4M78C 3RIRA 2M16A 4NS5A 4XTUA 3HL8A 4BI4A 2GCXA 3X28B 2QQBA 2DO3A 4ELYC 2RH2A 2WSFE 4R55A 1S72A 3LGFA 2RB6A 3PT9A 2WSEE 2E1HA 3UT1A 3C4SA 3ME9A 5GAOq 1D3BB 4E7KA 1VQMT 3OSVA 4CRIA 4C8QG 2E6ZA 4DOWA 1K8AU 1M90U 1U1TA 4P5NA 1VQOA 3OYJA 4RKUE 3FC3A 5LJ5f 3KXTA 3LGLA 2DXTA 1GXIE 2LCLA 1XOVA 2RHIA 3L2RA 4PJOA 1N8RU 3CCRA 3OYEA 4HA8A 5M9OA 1NPRA 2ZPGB 4E47A 3QZ5B 2QEXT 2F5KA 3I56A 1YJ9A 4M75E 4M7AE 4J7IA 4KUDK 2KVQG 4FT4A 2H3JA 2MI6A 4M75D 5IAYA 1W2BA 2L8DA 3M4GA 1YITT 2RJCA 1VQ7T 3A5ZB 2DXUA 5CIUA 3OMGA 3GLXA 1LJOA 3CCVA 3TCJA 5J3BA 4JLIA 3RMQA 4C92E 2K3YA 4KUIA 3LWIA 3CCMT 4PJOB 1N27A 4V2SA 1K9MU 2YLCA 3RERA 1B34A 1YCYA 4C92D 5LJ3g 4M7DE 5GAMg 5FRMA 4PLLA 2E6NA 2EQUA 2DIQA 4A4KA 3PMIA 2E12A 1FWZA 3SDZA 1JBMA 2D0QB 4M7DD 3OB9A 4M78A 3GOXA 4ZGDB 5LJ5e 3CC4T 3CCJT 4C92C 3JB9D 1QVFA 3A8OB 2KDSA 4JS4A 4E7LA 3JAME 2LVMA 3OS5A 3UWNA 5GAN5 1VQKT 2HAXA 3QSUA 3DKMA 3JCMX 3M59A 4DA4A 2EJFA 2HQEA 3FLGA 2QQRA 1NE8A 2EQKA 2X35A 4Y91A 2DTHA 3HPWA 1B34B 4NL2A 5CVIA 3V8KA 3MEUA 3G6ET 1ZQ1A 2D9TA 3OYLA 4M77A 3CCQA 2FHDA 3BY7A 3HRUA 4EMKC 3CCEA 3OYFA 3GP8A 5DLQE 4M78B 5LJ3e 3JCMP 5GAMe 1KC8C 4QQ6A 4D6WA 2YLBA 3QHSA 2XDDA 3BDUA 1KQSS 3GIBA 3KUFA 4NOYA 3JCMc 4M7AF 2E41A 2RO0A 5GAOm 1KHIA 4F7UA 2ZPEB 1X01A 2QQAA 3QXEB 4HKEA 5A0DA 5HKCA 1VQ4A 2LNVA 1VQMA 1G3WA 2KQWA 1WQWA 3S3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HK3 A;  5CO7 A;  3VUB A;  5CKE A;  3G7Z A;  3JRZ A;  5CKD A;  1NE8 A;  4ELY C;  3HPW A;  4MDX A;  5HK0 A;  4MZP A;  2C06 A;  4ELZ C;  4OF1 A;  3TCJ A;  2VUB A;  5CKB A;  5CK9 A;  1UB4 A;  4ME7 A;  5CQX A;  4MZT A;  5CKH A;  3NFC A;  5CCA A;  1X75 C;  4VUB A;  2KMT A;  5CR2 A;  5HKC A;  4HKE A;  2MF2 A;  4MZM A;  1VUB A;  3JSC A;  5DLO A;  5CQY A;  5CKF A;  1M1F A; 
#chains in the Genus database with same CATH topology
 1OYX A;  4PK4 A;  4MDW A;  4DBQ A;  2HBW A;  4MML A;  1ZHI A;  2LT4 A;  4J8O A;  2R57 A;  2CSQ A;  2RM4 A;  4M7A G;  2DL7 A;  4N4G A;  3CCQ Q;  4PJO D;  3CCE Q;  2KSS A;  1MHN A;  2E70 A;  3CPF A;  3QJ6 A;  1QVG S;  2J7I A;  3U23 A;  2X3X D;  4RMO A;  1VQP A;  2RN8 A;  1YWP A;  2DJZ A;  1G3S A;  2RQT A;  5KE2 A;  5LJ5 d;  2PNI A;  4A4G A;  1M9S A;  3A98 A;  2E10 A;  3CC4 A;  2RF0 A;  1UB4 A;  1FX7 A;  4JJN K;  2QQ9 A;  3L2Q A;  1MMN A;  4M78 D;  3G6E A;  1YBY A;  3NTH A;  2CP6 A;  4J6W A;  2QAS A;  4Z02 A;  1VQ7 Q;  2CUB A;  1VQ9 T;  3LH0 A;  4J83 A;  2FEI A;  4HCZ A;  4IIO A;  3RES A;  2DFU A;  3EAE A;  3JRZ A;  3D7S B;  3CD6 A;  3ZFJ A;  4M77 D;  1CSK A;  4RCB A;  5GAO r;  1SPK A;  4PKC C;  4XAX B;  5KCO A;  2ROT A;  4JRQ A;  5ECA A;  1JRI A;  2MOX A;  1MNE A;  2R5A A;  3CC4 Q;  4F14 A;  3SEM A;  2DKG A;  2J06 A;  3V8J A;  3SWN A;  4J6X A;  2HKN A;  3M56 A;  1MUZ A;  2FZG B;  2MIO A;  3OYG A;  3G6E Q;  2K3X A;  4EPC A;  4C8Q A;  1LCK A;  1HK9 A;  1YIJ T;  2XIC A;  1Q82 C;  4JS5 A;  3HHT B;  2LMJ A;  2CP0 A;  4ME7 A;  3SWN B;  2HSP A;  2X9H A;  2EIF A;  4C8Q B;  4DQ2 A;  2H8H A;  1WLP B;  1WQ7 A;  2LJ1 A;  2RJF A;  3OY9 A;  1NYF A;  1OUL A;  2DL3 A;  1VQ9 A;  3EG2 A;  5HCK A;  3PFS A;  3PIO A;  2LRQ A;  4HCK A;  2CP3 A;  2DTO A;  2V26 A;  1BB9 A;  3C12 A;  4PFO A;  2FPF A;  4RCC A;  2XID A;  1ZX6 A;  1RI0 A;  4WCI A;  1LNX A;  1XJW B;  2BE7 D;  4C92 F;  3VYG A;  2COW A;  3G4S A;  5J39 A;  3M0T A;  4EMH A;  4O5V A;  1TXQ A;  3FJP A;  3WXM B;  4L6V 5;  2DZC A;  4KGX B;  2W0Z A;  1OX8 A;  2B8A A;  2FL7 A;  1VQ9 Q;  4C8Q E;  3CPW S;  3PE0 A;  2EYQ A;  3JCM h;  5GMK m;  3V8L A;  1VYT A;  2PUO B;  4JPB W;  3SHW A;  2BZY A;  1KQ2 A;  4LDY A;  2YSQ A;  1YI2 T;  2PVO B;  2ATC B;  2HQX A;  4L59 A;  5I21 A;  4KT0 E;  1W2B P;  1I4K 1;  2E3I A;  5CKH A;  3G4S Q;  3LX7 A;  2RI5 A;  4Z88 A;  3ZBD A;  1VQL T;  3HFN A;  1YN8 A;  2DIL A;  2KYB A;  1B07 A;  2L3R A;  2LDM A;  4XTX A;  2HZY A;  2JNG A;  3F70 A;  4BY6 C;  4KUL A;  3EHR A;  3CEY A;  5A0L A;  3CQT A;  3S3M A;  3DB4 A;  4E2F B;  1BYM A;  3X20 B;  3PGG A;  4N0A C;  1Q81 R;  5FU7 B;  3QDR B;  4O6J A;  5GJW B;  4ZN1 A;  3JCM Q;  5AYF A;  3KFV A;  3CBP A;  4KBM B;  4JDS A;  2EYZ A;  3CXC P;  2L3S A;  4ORZ A;  3CC2 T;  4LDX A;  1YI2 A;  4MZM A;  2CZ1 B;  3M5A A;  4IUT A;  3X25 B;  5L8R E;  3L1A A;  5LJ5 h;  2VGM A;  4RG8 A;  4A63 B;  2YXY A;  2OTL A;  2ECZ A;  2MMP A;  3X26 B;  4KGV B;  1GCQ A;  1NM7 A;  3DB3 A;  3C94 A;  3M54 A;  4OMP A;  3REA B;  5LJ3 h;  1UHF A;  1VQ6 T;  3TSZ A;  5KYX A;  1PC0 A;  2JXB A;  3JSC A;  4D8K A;  3GF5 A;  2QAZ A;  1HYO A;  3H8Z A;  1M1F A;  4LDV A;  2L3P A;  3ULR B;  3VUZ A;  1YI2 Q;  1VQ5 T;  3TU4 K;  4DBF A;  4JUV A;  5FLX E;  1I81 A;  3CCS T;  5KYX B;  2SEM A;  3VJP A;  1S72 T;  2OTL Q;  2FPE A;  2XU8 A;  2ZPH B;  1MV0 B;  1RI9 A;  2KBT A;  1PSE A;  6AT1 B;  1WIE A;  1T3L A;  2QXF A;  1V76 A;  2WSC E;  1VA7 A;  3CXC A;  4HCC A;  3CC2 A;  2FG0 A;  1LOJ A;  1WNL A;  3I56 T;  4DEY A;  1RAD B;  3HTR A;  4OML A;  4N4I A;  2QGF B;  2VC8 A;  2X4X A;  1ZSG A;  2EKH A;  4AFS C;  4RUG A;  1W2B S;  1I5O B;  1UGR B;  5IHK A;  1TS9 A;  4XK8 E;  2DD5 A;  4PNO A;  2MK5 A;  2J05 A;  2J6O A;  4FU6 A;  1RAB B;  1X27 A;  1NPP A;  5DY9 A;  2EGE A;  2MWP A;  2LX9 A;  1XQH A;  3CC2 Q;  2KI7 A;  1FYN A;  3MEA A;  4LD6 A;  2HNI A;  1G3T A;  1WX6 A;  4IIM A;  2M16 A;  2JTE A;  5IHI A;  1OEB A;  2HL5 C;  4KRT A;  4AFZ C;  1AZE A;  2DO3 A;  1S72 A;  4R55 A;  5GJV B;  5GAO q;  2JW4 A;  3OSV A;  4C8Q G;  1K8A U;  1UJ0 A;  2E4H A;  3LGL A;  2KEA A;  1N8R U;  1NPR A;  4M7A E;  3I56 A;  4J7I A;  4KUD K;  1AZG B;  4AG2 C;  5FWB A;  4FT4 A;  4R0K A;  1VQ5 Q;  2K3B A;  5KYY A;  1KD1 R;  1RAF B;  4LNP A;  3TCJ A;  4FSS A;  4V2S A;  3CCM T;  1N27 A;  1S72 Q;  1K9M U;  2YLC A;  1YCY A;  4C92 D;  4A4K A;  2EQU A;  2E12 A;  2B86 A;  1JBM A;  2D0Q B;  2YUQ A;  1M90 R;  2KXD A;  2A37 A;  5GAN 5;  1VQK T;  2EVR A;  2EJF A;  2HQE A;  3I56 Q;  5CVI A;  1D0Z A;  1AWO A;  2PZ1 A;  4JJD A;  4EMK C;  1X43 A;  2DF6 A;  3GP8 A;  1H92 A;  1G8X A;  4ZNX A;  1KQS P;  5GAM e;  4D6W A;  5I22 A;  2YLB A;  2XDD A;  3GIB A;  3BDU A;  2DNU A;  3JCM c;  4M7A F;  2RO0 A;  3VS4 A;  1X01 A;  1M2O A;  2KRS A;  1A0N B;  1WQW A;  4GY5 A;  1TUC A;  3OS2 A;  4QKU A;  2LZ6 B;  2NUZ A;  4BB7 A;  1YP5 A;  1U3O A;  2EYY A;  5KCH A;  1UFF A;  5CK9 A;  1NEB A;  4LUE A;  2L2P A;  3VU3 C;  1BCM A;  1QVG P;  4A53 A;  3JCM V;  2KNB B;  5EC7 A;  3J81 E;  3CCV T;  1TUD A;  4JLG A;  2I2L A;  4A4E A;  1M1K U;  1YWO A;  1O9S A;  4TVR A;  2XD0 A;  2M0Y A;  2RJD A;  3RNJ A;  2CT3 A;  2DPP B;  4E7I A;  1VQK A;  2QYZ A;  3HP9 A;  1ABO A;  5I2S A;  4ZGE B;  1T3S A;  2HBP A;  3CCQ T;  1AD5 A;  3CCE T;  2K5L A;  1KQS A;  1UHC A;  3JB9 H;  1P92 A;  1SHG A;  1Q7Y U;  2HSE B;  2YRV A;  1K9M C;  2GQV A;  4A4F A;  3OYD A;  2DMO A;  2GNC A;  2PUK B;  2QK0 A;  2LX7 A;  4OMM A;  3QO3 A;  5FW9 A;  4AG1 C;  1KC8 R;  1JU5 C;  4LUD A;  2CS7 A;  3VS3 A;  3QWY A;  2O2O A;  4M77 C;  3RMS A;  3QZ9 B;  4Q5W A;  5CCA A;  2X4Y A;  1YJN A;  1YHQ A;  2EQI A;  2VXE A;  1VQK Q;  3L42 A;  4B9X A;  4JJC A;  3QUI A;  1UDL A;  4PJO G;  1NJI U;  1QVG A;  4RG2 A;  4C5E A;  3H6Z A;  2HDA A;  1PCX A;  5FU6 C;  3DLL A;  4A54 A;  1VQP T;  1BK2 A;  3CBO A;  3X24 B;  4D8D A;  4F04 B;  2IG0 A;  2CZ0 B;  3NHN A;  1M3A A;  2DRK A;  1BBZ A;  2ENM A;  1WGS A;  3G71 T;  3NMZ C;  2E65 A;  1VIF A;  4PL6 A;  1WXU A;  3MEW A;  1YHQ Q;  4M78 G;  5KYN A;  1Y57 A;  1GFC A;  3J7A F;  2OAU A;  3EGU A;  2L5Q A;  3OYI A;  3CCU A;  2EKO A;  5LL6 S;  1Z9Q A;  3V7C A;  4FM4 B;  1Q82 U;  4N0A A;  3CD6 T;  1RAE B;  3LWH A;  2K2V A;  4ANJ A;  1M1K C;  4J9G A;  1E6G A;  2CUD A;  5C6S A;  3FJ5 A;  2ZZD A;  3OQ5 A;  1D1A A;  2HD0 A;  4BY6 B;  4AFU C;  2J6K A;  4UC4 A;  1ZA2 B;  2F2W A;  3E19 A;  5GAN h;  5D6X A;  2KT1 A;  4XU1 A;  1I8F A;  3MP6 A;  2CRE A;  1G5V A;  1MND A;  3CC7 A;  1Q95 G;  3CCU Q;  1Q7Y C;  3CPW P;  2RI3 A;  4BI3 A;  2F1L A;  4FYV B;  2DRM A;  1OX9 A;  3OBY A;  1VUB A;  1SEM A;  1X6B A;  3HKS A;  4WF2 A;  1TSF A;  3JV3 A;  1ZLM A;  2EAY A;  3G71 A;  1IGQ A;  4ZTF A;  2KR3 A;  3OYH A;  3OYM A;  1NJI C;  2JJ9 A;  3RR6 A;  1VYV A;  2DL8 A;  4NL3 A;  1KSW A;  3CC7 Q;  8ATC B;  2CSI A;  2AT1 B;  2L3Q A;  4HT9 A;  1GFD A;  1TG0 A;  3OYB A;  2GGR A;  5GAO n;  5IHN A;  1KJW A;  1NZ9 A;  3GNG A;  1BI3 A;  3ER0 A;  2K7A A;  1VQP Q;  4J9F A;  1AWW A;  1WI7 A;  1AVZ C;  2CP2 A;  1WPY A;  1NYG A;  2LTO A;  3EFS A;  3G71 Q;  1QKW A;  1Q86 U;  1UUE A;  4XTV A;  4HXJ A;  3NPF A;  3G4S T;  4EMG A;  2DIG A;  1UJY A;  1Y7X A;  2DL5 A;  1E7O A;  2YHT A;  5GMK h;  1C6V X;  3WVD B;  3CPW A;  4DOV A;  1QW1 A;  4J9I A;  1PD0 A;  3CD6 Q;  3A8H B;  1K73 R;  1ZA1 B;  4LDU A;  3QKJ A;  1J3T A;  2F69 A;  2EPD A;  1GBR A;  1SSH A;  2VYT A;  2I0N A;  2EQM A;  5IT9 E;  1WHH A;  1BU1 A;  5GAN 2;  4M7A D;  4HT8 A;  1I5L A;  4FW2 A;  4J9D A;  4AT1 B;  4FL6 A;  4C0Z A;  3UDC A;  2RI2 A;  4BE0 A;  1WHK A;  2F2V A;  3NFC A;  2ZGW A;  2VB6 A;  4EIK A;  4J6Y A;  5CR2 A;  5GAM h;  2ESW A;  3ZL7 C;  3MO8 A;  2IVW A;  3QBY A;  3PTA A;  2P4T A;  2RK2 A;  2K5I A;  2X4J A;  2EBP A;  3I5S A;  2JUF A;  2KAF A;  4C5G A;  1G83 A;  1R0C B;  5HK0 A;  1ZUU A;  2C06 A;  2ZCF B;  2X51 A;  2V8I A;  3RBB B;  2R5M A;  4OB1 B;  2KMT A;  1CKB A;  4DBH A;  1WA7 A;  3JCM g;  1BKB A;  3UPU A;  4OMO A;  1IO6 A;  4BDY A;  4M75 A;  1PKT A;  4QQD A;  1OPK A;  2CT4 A;  1Q86 C;  2QEX A;  1QCN A;  1SF9 A;  1YJ9 T;  1UG1 A;  1U8R A;  3UAT A;  1R0B G;  2CGH A;  3FIF A;  3H0F A;  1OU8 A;  1YIT A;  4FT2 A;  2JOY A;  2RPN A;  3MKD A;  4M75 B;  3MEV A;  4PJM A;  4M7D A;  4ATO A;  2OTL T;  1RAA B;  2E5Q A;  5CQY A;  1WJQ A;  4Y28 E;  1M4Z A;  3QDF A;  1PHT A;  4BDZ A;  3SD4 A;  2OAW A;  4C5H A;  1M2V A;  2MCN A;  2PU9 B;  2VWF A;  2DEU A;  1FMW A;  4M7D B;  2FO0 A;  1QVF S;  1N9R A;  2PVD B;  1WHL A;  4CC7 A;  4C8Q F;  1M2V B;  3N5B B;  3I35 A;  2RQV A;  4XTU A;  2HCK A;  4BI4 A;  2ZAE A;  1C0M A;  2F2X A;  3X28 B;  3LGF A;  3PT9 A;  2O88 A;  3EGX A;  2DM1 A;  4RTT A;  1U1T A;  4P5N A;  8AT1 B;  1VQO A;  3OYJ A;  2RHI A;  4PJO A;  4RTW A;  3OYE A;  1Y0M A;  1YJ9 A;  4M75 E;  1OPL A;  3EGX B;  1SG5 A;  2H3J A;  1K4U S;  2LCS A;  1W2B A;  3M4G A;  2EYW A;  2DXU A;  4PJJ A;  1AWJ A;  1EFN A;  3M0P A;  1MMA A;  3LWI A;  3EFO A;  3RMQ A;  2K3Y A;  4PJO B;  1B34 A;  5LJ3 g;  4M7D E;  2DIQ A;  3PMI A;  1FWZ A;  4M78 A;  1OV3 A;  1K8A R;  4C92 C;  1KIK A;  3I5R A;  2LVM A;  3UWN A;  4GBQ A;  3QSU A;  3BE3 A;  3EFO B;  3M59 A;  3FLG A;  1X69 A;  2FRW A;  1NE8 A;  2EQK A;  1YJ9 Q;  1N8R R;  1B34 B;  5KYW A;  2LJ3 A;  4E6R A;  4M77 A;  3HRU A;  1IXD A;  5I11 A;  4M78 B;  2YRC A;  4F7U A;  2ZPE B;  3QXE B;  4Z8A A;  3EGD A;  5HKC A;  1VQ4 A;  5KYW B;  3A8O B;  3S3N A;  4M77 B;  3P8H A;  3MCA B;  2DK3 A;  3LYI A;  3VS1 A;  4JRK A;  4MZP A;  1SRL A;  3VS2 A;  2RHZ A;  1V29 B;  2ZPB B;  5IN1 A;  2DEQ A;  2K4Y A;  4F7U B;  4PJO E;  3MP1 A;  2EQJ A;  3EGD B;  4X9C A;  5GAO l;  4XTZ A;  2XDB A;  2LCC A;  2M9U A;  2JTF A;  2O31 A;  4RTX A;  5D6Y A;  3MHX A;  5FU6 B;  1JXO A;  2LQ8 A;  1VYU A;  2GTO A;  3PMT A;  4QVC A;  1WJR A;  1VQ4 Q;  4HCB A;  4IUV A;  5IH2 A;  2DZ9 A;  4ESR A;  1VQN A;  3CCL T;  1HXD A;  1MMD A;  2XK0 A;  3E9F A;  2JMA A;  2J6F A;  4M78 E;  1KQ1 A;  5GMK l;  2CZ7 B;  4X34 A;  3C95 A;  3JB9 J;  2XG8 D;  2AIR B;  1M5Q 1;  3SB2 A;  1I07 A;  4M77 E;  2V1R A;  3P8B B;  3OYY A;  3O8V A;  3FB9 A;  3A1P A;  4J7F A;  3JB9 I;  2M02 A;  1CKA A;  2LT1 A;  4OP0 A;  4XQ3 A;  3TQ7 P;  4F7U E;  3VS5 A;  3J80 E;  2VV5 A;  1AHJ B;  3M53 A;  4J9C A;  4KH0 B;  3M9Q A;  4QW2 A;  1MGQ A;  2FRY A;  2QDL A;  2JT4 A;  3O5Z A;  2EWN A;  1UEC A;  3INZ A;  4B6M A;  4JRP A;  1N6A A;  3QPH A;  2RA2 A;  4BE1 A;  1KK7 A;  5I2M A;  4A4H A;  3HSB A;  2K2M A;  2JZ2 A;  4ZTJ A;  3EG1 A;  1RL2 A;  2NLU A;  1D09 B;  3CCL A;  2A28 A;  3RKY A;  1N9S A;  2ZPF B;  4OMN A;  5GAN 3;  4HVW A;  1IRE B;  3VS6 A;  4E7Z A;  2Y90 A;  4PLI A;  3OYC A;  3OBW A;  3R6N A;  5GAN 8;  3H0H A;  3HFO A;  2P0K A;  1V1C A;  2X4W A;  2GF7 A;  2AKK A;  5LJ5 j;  4IUQ A;  1X75 C;  3TVT A;  2MF2 A;  3LW5 E;  1F1B B;  3VV0 A;  2ED1 A;  4GLK A;  4DBR A;  3QYG B;  2LC4 A;  2D6F A;  2LJ0 A;  2QA4 A;  1Q81 C;  3CCL Q;  1YJN T;  1YHQ T;  5LJ3 j;  2DXB A;  4BAC A;  1AWX A;  5FU7 C;  3JCM f;  4M75 G;  1UGV A;  4XTW A;  2FPD A;  4VUB A;  3VS0 A;  3V7R A;  4OMF B;  3VYH B;  3EH1 A;  4C8Q D;  4EDU A;  1UEB A;  1M1G A;  1OZ2 A;  1Q82 R;  1OU9 A;  3OYA A;  4M7D G;  1SSF A;  1TH7 A;  2EFI A;  3JB9 G;  1MMG A;  2RD1 A;  2SRC A;  1NG2 A;  2CH4 A;  2DYB A;  4XU0 A;  1FMK A;  2DVE A;  2DXC A;  2PVG B;  2FVU A;  2O01 E;  3CCU T;  3M55 A;  3PVL A;  1G3Y A;  3SFM A;  2QDY B;  1X2Q A;  3QYH B;  2M0O A;  2AHJ B;  1D0X A;  1K0S A;  2YRD A;  4BD3 A;  2AZS A;  4ZGJ B;  2KE9 A;  3R6O A;  2GQI A;  3H9N A;  1GCQ C;  2COZ A;  1UGP B;  1KD1 U;  2QQS A;  2RQU A;  1H8K A;  1IRX A;  1D0Y A;  3CC7 T;  4C0D C;  4J9E A;  5GAN 4;  2LP5 A;  1BI2 A;  5D6W A;  1U06 A;  1K1Z A;  2DL4 A;  4JJB A;  3CME A;  2EGC A;  3PNW C;  4HVU A;  1B3Q A;  1QKX A;  1TU0 B;  3M4Y A;  4II1 A;  4OB3 B;  2QI2 A;  5HK3 A;  3JCM d;  3I55 A;  1YJN Q;  2LNH B;  1Q86 R;  5A0G A;  1Z9Z A;  4GLM A;  2DE0 X;  1T0H A;  5LJ3 f;  4M7A C;  3FEO A;  3M0S A;  4PJN A;  3S3O A;  3E1S A;  2CP5 A;  4R56 A;  4M77 G;  1Y96 A;  4MZT A;  1QWF A;  3CME Q;  1ZBX A;  2DTI A;  2V1Q A;  2M51 A;  3WVE B;  2A08 A;  2DX1 A;  1M8V A;  3MET A;  3CMA T;  3G7Z A;  1JXM A;  4F7U G;  4IUP A;  5GAN g;  2OTJ T;  1JJ2 S;  1T0J A;  1Y96 B;  2E5K A;  1IB8 A;  3I55 Q;  3PVQ A;  3V7S A;  1BI1 A;  2YUN A;  3NTK A;  2CH4 W;  2K79 A;  1PWT A;  4N4H A;  3I9Q A;  2GFU A;  1BIB A;  3BDL A;  2CKK A;  3EFR A;  3QJY A;  2K9G A;  2YWW A;  5EG2 A;  2CP7 A;  2RQR A;  2BUD A;  4L5G A;  1H3Z A;  3CCR T;  1WJS A;  1WZO A;  2O9V A;  2E64 A;  4JZ3 A;  5A2Q E;  2EW3 A;  1KD1 C;  2K6D A;  2OJ2 A;  1ZSZ C;  3QG1 A;  1VQ7 A;  1QWE A;  1UGQ B;  1QP3 A;  4C92 A;  3PIP A;  1LPL A;  3OYN A;  1BI0 A;  2GTJ A;  4Y92 A;  2CDT A;  2FZK B;  1QCF A;  1KC8 U;  5FRN A;  1X2K A;  2DBK A;  1M90 C;  3RKX A;  4CI0 C;  2JMC A;  5C0M A;  4F16 A;  2LQN A;  1DJ7 B;  1WXT A;  4M4Z A;  3CCJ A;  4C92 B;  1SRM A;  3L2Z A;  4OF1 A;  2XKO C;  3TSW A;  1C1A A;  3CBM A;  1QVF P;  2DLP A;  1ZUY A;  3M57 A;  3CMA A;  3REB B;  1WHJ A;  2XMF A;  2OTJ A;  1NBE B;  1UTI A;  5LJ3 d;  4OVA A;  2COY A;  2BTT A;  1OOT A;  3RIR A;  4NS5 A;  1I0C A;  3EG0 A;  2BE9 B;  2QQB A;  1M3B A;  2RH2 A;  2WSF E;  4ELY C;  2RB6 A;  3UT1 A;  3C4S A;  1AEY A;  3ME9 A;  2X3W D;  4E7K A;  1VQM T;  1GRI A;  4CRI A;  2E6Z A;  4DOW A;  2MYS A;  4RKU E;  3KXT A;  3CCJ Q;  3H41 A;  1XOV A;  3L2R A;  3G1J A;  3CCR A;  5M9O A;  2ZPG B;  1WHG A;  3OW2 P;  3CMA Q;  2QEX T;  2C0I A;  2OTJ Q;  2YT6 A;  1M3C A;  1YIT T;  5CIU A;  3OMG A;  4C92 E;  4KUI A;  3RER A;  2YDL A;  5GAM g;  4PLL A;  3SDZ A;  1TOV A;  3OB9 A;  3GOX A;  1K0X A;  4E7S A;  1QVF A;  4JS4 A;  2HAX A;  3JCM X;  3CCR Q;  5L23 A;  2HMA A;  2QQR A;  2JS0 A;  2DTH A;  1WFW A;  3MEU A;  1RAH B;  3VRY A;  2FHD A;  1JQQ A;  2D0N A;  3BY7 A;  2P84 A;  5DLQ E;  2HL3 A;  2KRO A;  3JCM P;  1KC8 C;  3QHS A;  2JS2 A;  3KUF A;  3IQL A;  4NOY A;  1AT1 B;  5GAO m;  5A0D A;  1HD3 A;  2KYM A;  2LNV A;  1VQM A;  2KQW A;  1RLQ C;  4C0F A;  2VGN A;  1VQO T;  4MMK A;  3QII A;  1SHF A;  3ZEH A;  2A7Y A;  2RQW A;  3OW2 A;  4E7J A;  1PSF A;  1LVK A;  2ABL A;  3VS7 A;  1YIJ A;  2CZ6 B;  2KGT A;  4LDW A;  4XTY A;  5GAN j;  2CYZ B;  2BIV A;  1O75 A;  2BZ8 A;  3RUX A;  5CKE A;  5KE3 A;  2C0O A;  1K9A A;  2Y4Y A;  1VQM Q;  1YFN A;  4EMK A;  2P0Q A;  1PRL C;  3AHU A;  1U1S A;  2ZPI B;  3T9N A;  1K76 A;  3P8D A;  3OYK A;  4X9D A;  1FXX A;  2QEX Q;  3HRT A;  3M0R A;  4EMK B;  1VIE A;  4OGE A;  1BCO A;  1YIT Q;  2DER A;  1YCS B;  4FIB A;  1AOJ A;  1YIJ Q;  2VVK A;  4OMQ A;  1H3H A;  1K73 U;  1JEG A;  2DAQ A;  3L2U A;  3FDR A;  2Y4X A;  1VQ4 T;  2VUB A;  3L2V A;  4OB2 B;  2RHX A;  2DD4 A;  3E9G A;  3QWX X;  2RK1 A;  2NYS A;  2A36 A;  2JM9 A;  2RHU A;  1OI1 A;  3M0U A;  1YJW T;  3A8G B;  2ROL A;  5GAN 7;  5LJ5 g;  5J26 A;  4KGZ B;  4DEX A;  1EIF A;  3OW2 S;  2C0T A;  2G3R A;  4E7H A;  3ASK A;  4OB0 B;  4MDX A;  5KH6 A;  3TEE A;  1R8O B;  2EJ9 A;  4BUG A;  1PG5 B;  3AT1 B;  3OS0 A;  1M27 C;  1QCO A;  3EHQ A;  1W4S A;  5GMK j;  3TRE A;  1VQN T;  3UF4 A;  1VQO Q;  3NGP A;  3URG A;  3HRS A;  2FB7 A;  2RJE A;  3UA6 A;  3UA7 A;  1WHM A;  5CAI A;  1KHC A;  4LD9 K;  4C5I A;  5GAN 6;  2V8J A;  1G2B A;  1E6H A;  4Z89 A;  1IZ6 A;  2M1H A;  1VQL A;  1QVP A;  1UGS B;  4J5Y A;  3BFM A;  4HVV A;  3LH5 A;  1XNI A;  1GCP A;  4X1V A;  1JB0 E;  3H0I A;  2QG9 B;  5GAN f;  4M75 F;  2YUP A;  2LQK A;  4XU2 A;  2PTK A;  1K9M R;  3RKW A;  1PNJ A;  2AZV A;  3OA6 A;  4BI8 B;  4CC2 A;  2MAM A;  1GBQ A;  2QTX A;  2KXC A;  5GAM j;  2JTM A;  1YJW A;  1QLY A;  1WXB A;  4M7D F;  3JB9 F;  5CQX A;  4C0D B;  1RAI B;  4RTZ A;  1VQL Q;  3LLR A;  1K73 C;  2K5F A;  1Y71 A;  2A3L A;  1EZZ B;  3S6W A;  3THK A;  1WYX A;  4C92 G;  5GAN e;  3JCM W;  4B9W A;  3SWN C;  4M7A A;  2A0F B;  2FYK A;  1W70 A;  2XHC A;  5FWC A;  3OMC A;  4C8Q C;  4IKF A;  1VOM A;  1Q81 U;  2EJG A;  4IUU A;  2H3E B;  4LXC A;  1X6O A;  3VRZ A;  2D8H A;  1YJW Q;  4KH1 B;  4JRI A;  4QQG A;  2JN0 A;  1S1N A;  2KK4 A;  3KBG A;  4M7A B;  1NLP C;  2RHY A;  3BW1 A;  2QTV A;  4PFP A;  2MPX C;  3GNF B;  3RDV A;  2JM8 A;  1HJD A;  2L89 A;  3VUB A;  2BZX A;  4FYX B;  4IUR A;  1ABQ A;  2EGA A;  2XI9 A;  1VQ6 A;  1ACM B;  2NUP A;  5DM7 R;  4RTU A;  1MV3 A;  4PJO F;  3DLM A;  2LQW A;  2R58 A;  1TUG B;  4QVZ A;  4QVD A;  2DVJ A;  2QA4 T;  1M1K R;  3L2W A;  1Y07 A;  4F17 A;  1VQ5 A;  1VQN Q;  1R77 A;  2P4R A;  3M58 A;  4C0G A;  3JCM J;  2D8J A;  1QMC A;  2BKD N;  2NUP B;  3CCS A;  4K11 A;  2QGG A;  2L0A A;  1YNZ A;  1HSQ A;  4FW1 A;  2PQW A;  2V8K A;  1ZSZ A;  5GAO p;  5GAN d;  4M78 F;  2KY9 A;  2YUO A;  4BE2 A;  4LE9 A;  1Q7Y R;  1VQ6 Q;  2VKN A;  1ZBJ A;  2O4X A;  4QT7 A;  1KG1 A;  4J9B A;  2OI3 A;  5IXB A;  5GMK e;  7AT1 B;  3CXC S;  2DET A;  3VKI A;  1D1B A;  5DLO A;  4M77 F;  1ZSZ B;  5KYU A;  3E2U A;  3MP8 A;  1OZ3 A;  2K57 A;  1BIA A;  3EG9 A;  1RAC B;  5GAM f;  3CCS Q;  1PD1 A;  2JVV A;  2O4X B;  4M75 C;  2DBM A;  1RUW A;  2AK5 A;  1I1J A;  5CKB A;  4F7U F;  4FYY B;  2HEQ A;  1X6G A;  1NJI R;  3Q1J A;  1RLP C;  2XDP A;  2Z0W A;  5KYU B;  1FMV A;  1JO8 A;  1VQ8 T;  2ED0 A;  3EG9 B;  5KYY B;  3JCM b;  4XU3 A;  5CKF A;  4M7D C;  1JJ2 P;  5IXF A;  2WAC A;  1N5Z A;  3M0Q A;  4AFQ C;  5GMK i;  3GPL A;  3OS1 A;  1XTD A;  2O9S A;  3EH2 A;  4CC3 A;  2DYI A;  2MWO A;  1M30 A;  4LN2 A;  1TTH B;  1U5S A;  3CME T;  2VXF A;  3FRN A;  2IIM A;  5CKD A;  3MPU B;  1ARK A;  3A8L B;  3MJX A;  2F5T X;  4FSX A;  1M8M A;  2QA4 Q;  2IPO B;  1ZUK A;  2AKL A;  5HY6 A;  1NLO C;  3I55 T;  4YTL A;  2P0P A;  4FYW B;  2NWM A;  3JCM e;  2GFA A;  2FZC B;  1QP2 A;  2VAS A;  4PJO C;  3CCM A;  1H64 1;  4OGC A;  5FRO A;  2G6F X;  3OSS C;  4PJL A;  1K8A C;  3GBQ A;  5CO7 A;  4PFZ A;  1B7T A;  3C0C A;  4ELZ C;  1QQJ A;  1VQ8 A;  1N8R C;  1JJ2 A;  4RTY A;  1RAG B;  3A8M B;  4ZN3 A;  2OX7 A;  1D3B A;  2EYX A;  1W1F A;  2E3H A;  3NTI A;  3EG3 A;  2D1X A;  5GAM d;  4M78 C;  3HL8 A;  5D7U A;  4RTV A;  2GCX A;  2W10 A;  2HQH A;  4CC4 B;  1PRM C;  3CCM Q;  9ATC B;  2WSE E;  2E1H A;  1D3B B;  1M90 U;  2KRN A;  1PKS A;  1IGU A;  3FC3 A;  5LJ5 f;  1GXI E;  2DXT A;  2LCL A;  1VQ8 Q;  1WDX A;  2RMO A;  4HA8 A;  4E47 A;  3QZ5 B;  2F5K A;  4WTO B;  4J9H A;  2KVQ G;  1IHV A;  2NUT A;  1UE9 A;  2MI6 A;  4M75 D;  5IAY A;  2L8D A;  1VQ7 T;  2RJC A;  3A5Z B;  3GLX A;  2DJQ A;  1IHW A;  1TWB A;  1LJO A;  3CCV A;  5J3B A;  4JLI A;  2HKQ B;  1D1C A;  2KRM A;  4JZ4 A;  1GL5 A;  5FRM A;  1EX4 A;  2E6N A;  1W6X A;  2NUT B;  4M7D D;  1NEG A;  4ZGD B;  5LJ5 e;  3CC4 T;  3CCJ T;  3JB9 D;  2KDS A;  4E7L A;  5AT1 B;  3OS5 A;  3JAM E;  2DA9 A;  3DKM A;  1OQK A;  1PM3 A;  4DA4 A;  2X35 A;  4Y91 A;  3HPW A;  3G6E T;  4NL2 A;  3V8K A;  1ZQ1 A;  1SKU B;  2D9T A;  3OYL A;  3CCQ A;  3CCE A;  3OYF A;  5LJ3 e;  2GBQ A;  4QQ6 A;  4AMC A;  3CCV Q;  1KQS S;  2RNA A;  1KFZ A;  2E41 A;  2KT8 A;  1KHI A;  2QQA A;  4HKE A;  4FCY A;  1G3W A; 
#chains in the Genus database with same CATH homology
 4GY5 A;  4M77 B;  2VGN A;  3OS2 A;  3P8H A;  1OYX A;  3MCA B;  4MMK A;  1VQO T;  3QII A;  4BB7 A;  4MDW A;  3ZEH A;  2A7Y A;  2DK3 A;  3LYI A;  4MML A;  1ZHI A;  2LT4 A;  4J8O A;  4JRK A;  2R57 A;  4MZP A;  3OW2 A;  5KCH A;  2RHZ A;  1V29 B;  2RM4 A;  4M7A G;  2ZPB B;  5IN1 A;  2DEQ A;  5CK9 A;  4E7J A;  2K4Y A;  1PSF A;  4F7U B;  4PJO E;  3MP1 A;  2EQJ A;  5GAO l;  4X9C A;  4XTZ A;  2XDB A;  3VU3 C;  2LCC A;  4N4G A;  2M9U A;  2JTF A;  4A53 A;  4PJO D;  2KSS A;  1MHN A;  1YIJ A;  2CZ6 B;  5D6Y A;  2E70 A;  3CPF A;  3QJ6 A;  3JCM V;  4LDW A;  4XTY A;  1QVG S;  3MHX A;  5FU6 B;  3J81 E;  3CCV T;  5GAN j;  4RMO A;  4JLG A;  1VQP A;  2CYZ B;  2BIV A;  1O75 A;  3RUX A;  2LQ8 A;  5CKE A;  2I2L A;  4A4E A;  3PMT A;  4QVC A;  1M1K U;  1WJR A;  2DJZ A;  5KE3 A;  1O9S A;  1G3S A;  2Y4Y A;  4IUV A;  5KE2 A;  4EMK A;  5LJ5 d;  4HCB A;  2DZ9 A;  4A4G A;  1VQN A;  4TVR A;  2XD0 A;  1M9S A;  2P0Q A;  2E10 A;  3CCL T;  3CC4 A;  2RJD A;  3AHU A;  2DPP B;  1U1S A;  1HXD A;  1UB4 A;  1FX7 A;  2XK0 A;  2ZPI B;  3E9F A;  3T9N A;  4JJN K;  4E7I A;  1VQK A;  2QQ9 A;  4M78 E;  3HP9 A;  3P8D A;  3OYK A;  3L2Q A;  1KQ1 A;  4X9D A;  4M7A D;  1FXX A;  5I2S A;  3HRT A;  4M78 D;  5GMK l;  4ZGE B;  3G6E A;  2CZ7 B;  1YBY A;  3NTH A;  4X34 A;  3C95 A;  4J6W A;  2HBP A;  3CCQ T;  3JB9 J;  2XG8 D;  1VIE A;  2K5L A;  4OGE A;  4Z02 A;  4EMK B;  1KQS A;  3CCE T;  1VQ9 T;  1M5Q 1;  1P92 A;  3LH0 A;  4FIB A;  1Q7Y U;  4J83 A;  3SB2 A;  3JB9 H;  4HCZ A;  2YRV A;  4M77 E;  3RES A;  3P8B B;  3EAE A;  3JRZ A;  1K73 U;  3OYY A;  1K9M C;  2GQV A;  4A4F A;  3OYD A;  3CD6 A;  3O8V A;  3ZFJ A;  2PUK B;  2DAQ A;  3L2U A;  4M77 D;  3FB9 A;  4J7F A;  3FDR A;  2Y4X A;  4RCB A;  3JB9 I;  5GAO r;  2LT1 A;  3QO3 A;  4OP0 A;  1VQ4 T;  2CS7 A;  2VUB A;  4PKC C;  4XAX B;  5KCO A;  4XQ3 A;  3L2V A;  4JRQ A;  4M77 C;  1JRI A;  2RHX A;  4OB2 B;  4F7U E;  2DD4 A;  3E9G A;  3RMS A;  3QZ9 B;  2R5A A;  2RK1 A;  4Q5W A;  3J80 E;  5CCA A;  2X4Y A;  1YJN A;  1YHQ A;  2VV5 A;  2DKG A;  2VXE A;  3V8J A;  1AHJ B;  2RHU A;  3M53 A;  1OI1 A;  3L42 A;  3M9Q A;  4J6X A;  4QW2 A;  1MGQ A;  3SWN A;  3A8G B;  4B9X A;  3M56 A;  1YJW T;  3QUI A;  5GAN 7;  5LJ5 g;  4PJO G;  5J26 A;  2EWN A;  1NJI U;  3INZ A;  1EIF A;  3OYG A;  2K3X A;  4JRP A;  4EPC A;  2G3R A;  4RG2 A;  4C5E A;  4C8Q A;  3ASK A;  3H6Z A;  1N6A A;  4E7H A;  4OB0 B;  3QPH A;  4MDX A;  1HK9 A;  1YIJ T;  5KH6 A;  2RA2 A;  4BE1 A;  2XIC A;  1Q82 C;  3TEE A;  5I2M A;  1R8O B;  4A4H A;  4JS5 A;  2EJ9 A;  5FU6 C;  3DLL A;  3HSB A;  3HHT B;  4A54 A;  4C0F A;  4BUG A;  1VQP T;  3OS0 A;  3CBO A;  2JZ2 A;  4ME7 A;  3SWN B;  3X24 B;  2IG0 A;  2CZ0 B;  4ZTJ A;  2EIF A;  1W4S A;  5GMK j;  1WGS A;  3G71 T;  4C8Q B;  1RL2 A;  3TRE A;  1VQN T;  2E65 A;  2NLU A;  1VIF A;  3CCL A;  4DQ2 A;  3URG A;  3RKY A;  4PL6 A;  1N9S A;  2ZPF B;  3HRS A;  3MEW A;  2FB7 A;  2RJE A;  4M78 G;  1WQ7 A;  5GAN 3;  3J7A F;  5CAI A;  1KHC A;  2RJF A;  4LD9 K;  4C5I A;  2OAU A;  5GAN 6;  2V8J A;  1IRE B;  3OY9 A;  2L5Q A;  3OYI A;  2Y90 A;  4PLI A;  1IZ6 A;  3OYC A;  2M1H A;  3OBW A;  5GAN 8;  3CCU A;  3HFO A;  1QVP A;  2P0K A;  1VQL A;  1UGS B;  2EKO A;  4J5Y A;  2X4W A;  3BFM A;  5LL6 S;  1VQ9 A;  1XNI A;  2GF7 A;  3PFS A;  3V7C A;  5LJ5 j;  1JB0 E;  4FM4 B;  4IUQ A;  3PIO A;  1X75 C;  4N0A A;  1Q82 U;  2LRQ A;  3CD6 T;  3LWH A;  2K2V A;  5GAN f;  4M75 F;  2DTO A;  1M1K C;  2LQK A;  4XU2 A;  5C6S A;  2MF2 A;  2ZZD A;  3LW5 E;  3C12 A;  3OQ5 A;  2HD0 A;  3VV0 A;  4BY6 B;  4RCC A;  4GLK A;  3RKW A;  3QYG B;  2LC4 A;  2XID A;  3OA6 A;  2D6F A;  2QA4 A;  1RI0 A;  1Q81 C;  4UC4 A;  4BI8 B;  1LNX A;  2MAM A;  1YJN T;  1YHQ T;  2QTX A;  3E19 A;  5GAN h;  4C92 F;  5LJ3 j;  3VYG A;  5GAM j;  2DXB A;  5D6X A;  4BAC A;  2JTM A;  3G4S A;  1YJW A;  5FU7 C;  4XU1 A;  3JCM f;  5J39 A;  1I8F A;  4M75 G;  4EMH A;  4M7D F;  4O5V A;  3MP6 A;  3FJP A;  3WXM B;  1G5V A;  4L6V 5;  5CQX A;  3CC7 A;  3JB9 F;  2DZC A;  4C0D B;  4XTW A;  1Q7Y C;  4VUB A;  2RI3 A;  2B8A A;  3LLR A;  2FL7 A;  3V7R A;  1K73 C;  4BI3 A;  2K5F A;  1Y71 A;  2A3L A;  4C8Q E;  4OMF B;  3CPW S;  3OBY A;  1VUB A;  2EYQ A;  3JCM h;  3S6W A;  3VYH B;  4C92 G;  5GMK m;  3V8L A;  4C8Q D;  5GAN e;  3JCM W;  4B9W A;  1QVG A;  2PUO B;  3SWN C;  4EDU A;  4M7A A;  2FYK A;  1UEB A;  1M1G A;  1OZ2 A;  3HKS A;  4WF2 A;  3OYA A;  1KQ2 A;  4M7D G;  4LDY A;  2XHC A;  1SSF A;  1TH7 A;  2EFI A;  2EAY A;  3OMC A;  3JB9 G;  3G71 A;  4C8Q C;  2RD1 A;  4IKF A;  1YI2 T;  2PVO B;  4ZTF A;  2HQX A;  4L59 A;  5I21 A;  4KT0 E;  1Q81 U;  2EJG A;  4IUU A;  4XU0 A;  3OYH A;  2PVG B;  1I4K 1;  2DVE A;  2DXC A;  5CKH A;  1X6O A;  3OYM A;  1NJI C;  2FVU A;  2JN0 A;  3LX7 A;  2KK4 A;  2RI5 A;  3KBG A;  4JRI A;  2RHY A;  4QQG A;  4M7A B;  4NL3 A;  2O01 E;  3BW1 A;  3ZBD A;  3CCU T;  3M55 A;  1VQL T;  3GNF B;  3HFN A;  1G3Y A;  3SFM A;  2QDY B;  4HT9 A;  2L89 A;  3VUB A;  3OYB A;  4IUR A;  5GAO n;  3QYH B;  2XI9 A;  2M0O A;  1VQ6 A;  1NZ9 A;  3GNG A;  1BI3 A;  3ER0 A;  5DM7 R;  2L3R A;  2AHJ B;  2LDM A;  4XTX A;  4PJO F;  4BD3 A;  3DLM A;  2JNG A;  3F70 A;  4ZGJ B;  4BY6 C;  2R58 A;  1WPY A;  3R6O A;  2LTO A;  4KUL A;  4QVZ A;  3CEY A;  4QVD A;  3EFS A;  2QA4 T;  5A0L A;  3L2W A;  1Y07 A;  1VQ5 A;  1Q86 U;  3S3M A;  3DB4 A;  4XTV A;  1UGP B;  1BYM A;  1KD1 U;  3X20 B;  3M58 A;  4C0G A;  3JCM J;  3PGG A;  4N0A C;  2BKD N;  3G4S T;  4EMG A;  2DIG A;  5FU7 B;  3QDR B;  3CCS A;  2QQS A;  4O6J A;  1Y7X A;  2YHT A;  5GMK h;  3CC7 T;  3WVD B;  3CPW A;  4C0D C;  4DOV A;  5GAN 4;  4ZN1 A;  2PQW A;  1BI2 A;  5D6W A;  3JCM Q;  2V8K A;  5AYF A;  1QW1 A;  5GAN d;  5GAO p;  4M78 F;  2KY9 A;  4BE2 A;  3CME A;  3CBP A;  3PNW C;  3A8H B;  4KBM B;  2O4X A;  4JDS A;  4LDU A;  3QKJ A;  2F69 A;  3M4Y A;  1KG1 A;  3CC2 T;  2VYT A;  4II1 A;  2EQM A;  5GMK e;  4LDX A;  3CXC S;  5IT9 E;  4MZM A;  1YI2 A;  4OB3 B;  3OW2 S;  3VKI A;  2CZ1 B;  3M5A A;  4IUT A;  4M77 F;  2QI2 A;  3X25 B;  5DLO A;  5GAN 2;  5L8R E;  3L1A A;  5HK3 A;  4HT8 A;  3JCM d;  5LJ5 h;  1I5L A;  3I55 A;  3MP8 A;  2VGM A;  1OZ3 A;  2K57 A;  4RG8 A;  5A0G A;  1BIA A;  5LJ3 f;  5GAM f;  4M7A C;  2JVV A;  3FEO A;  2O4X B;  4M75 C;  2OTL A;  5CKB A;  4FL6 A;  2MMP A;  3X26 B;  4F7U F;  3S3O A;  4C0Z A;  3UDC A;  2RI2 A;  3Q1J A;  4BE0 A;  3E1S A;  3DB3 A;  2XDP A;  3C94 A;  3M54 A;  4R56 A;  4M77 G;  1Y96 A;  4MZT A;  3NFC A;  2ZGW A;  5LJ3 h;  5GAM h;  5CR2 A;  4J6Y A;  1VQ6 T;  1ZBX A;  2DTI A;  1VQ8 T;  3JSC A;  3JCM b;  3GF5 A;  3MO8 A;  3WVE B;  3H8Z A;  4XU3 A;  5CKF A;  1M1F A;  4M7D C;  4LDV A;  2IVW A;  3QBY A;  1M8V A;  3MET A;  3CMA T;  3PTA A;  2P4T A;  2RK2 A;  3G7Z A;  4F7U G;  3VUZ A;  2WAC A;  2K5I A;  4IUP A;  2X4J A;  5GAN g;  2OTJ T;  1VQ5 T;  2JUF A;  2KAF A;  4C5G A;  1JJ2 S;  5HK0 A;  3TU4 K;  5GMK i;  2ZCF B;  3GPL A;  2C06 A;  1Y96 B;  2V8I A;  3OS1 A;  1XTD A;  4JUV A;  5FLX E;  1I81 A;  3V7S A;  2R5M A;  3CCS T;  1BI1 A;  3NTK A;  4N4H A;  3VJP A;  2GFU A;  1S72 T;  1BIB A;  3BDL A;  4OB1 B;  2KMT A;  2CKK A;  2MWO A;  3JCM g;  2XU8 A;  2ZPH B;  3EFR A;  1BKB A;  3QJY A;  1PSE A;  3UPU A;  2QXF A;  3CME T;  5EG2 A;  4BDY A;  2VXF A;  2WSC E;  3FRN A;  4M75 A;  3CXC A;  5CKD A;  2BUD A;  4L5G A;  4HCC A;  4QQD A;  1H3Z A;  3A8L B;  3CCR T;  1WJS A;  2F5T X;  3CC2 A;  1LOJ A;  1Q86 C;  1WNL A;  2E64 A;  2QEX A;  3I56 T;  4FSX A;  5A2Q E;  1YJ9 T;  1KD1 C;  1U8R A;  5HY6 A;  2CGH A;  3FIF A;  3QG1 A;  3I55 T;  1UGQ B;  1YIT A;  1VQ7 A;  4FT2 A;  1QP3 A;  4YTL A;  4N4I A;  4C92 A;  2VC8 A;  2JOY A;  2P0P A;  2X4X A;  3PIP A;  3JCM e;  2GFA A;  3OYN A;  1W2B S;  1QP2 A;  1BI0 A;  3MEV A;  4M75 B;  4M7D A;  4ATO A;  1KC8 U;  2OTL T;  5FRN A;  1UGR B;  3CCM A;  4PJO C;  2E5Q A;  1H64 1;  5CQY A;  4OGC A;  1WJQ A;  5FRO A;  4Y28 E;  1M4Z A;  3OSS C;  1K8A C;  5CO7 A;  1M90 C;  4XK8 E;  4BDZ A;  2DD5 A;  3RKX A;  3SD4 A;  4C5H A;  4PNO A;  4CI0 C;  5C0M A;  4FU6 A;  1DJ7 B;  4ELZ C;  3CCJ A;  4C92 B;  3L2Z A;  1NPP A;  4OF1 A;  1N8R C;  2XKO C;  5DY9 A;  1VQ8 A;  2PU9 B;  3CBM A;  2MWP A;  2LX9 A;  1JJ2 A;  4M7D B;  1XQH A;  3M57 A;  3A8M B;  3CMA A;  1QVF S;  1N9R A;  2PVD B;  4ZN3 A;  1D3B A;  2OTJ A;  3MEA A;  4LD6 A;  4C8Q F;  3NTI A;  5LJ3 d;  2HNI A;  3N5B B;  4OVA A;  5GAM d;  1G3T A;  4M78 C;  3RIR A;  2M16 A;  4NS5 A;  4XTU A;  3HL8 A;  4BI4 A;  2GCX A;  3X28 B;  2QQB A;  2DO3 A;  4ELY C;  2RH2 A;  2WSF E;  4R55 A;  1S72 A;  3LGF A;  2RB6 A;  3PT9 A;  2WSE E;  2E1H A;  3UT1 A;  3C4S A;  3ME9 A;  5GAO q;  1D3B B;  4E7K A;  1VQM T;  3OSV A;  4CRI A;  4C8Q G;  2E6Z A;  4DOW A;  1K8A U;  1M90 U;  1U1T A;  4P5N A;  1VQO A;  3OYJ A;  4RKU E;  3FC3 A;  5LJ5 f;  3KXT A;  3LGL A;  2DXT A;  1GXI E;  2LCL A;  1XOV A;  2RHI A;  3L2R A;  4PJO A;  1N8R U;  3CCR A;  3OYE A;  4HA8 A;  5M9O A;  1NPR A;  2ZPG B;  4E47 A;  3QZ5 B;  2QEX T;  2F5K A;  3I56 A;  1YJ9 A;  4M75 E;  4M7A E;  4J7I A;  4KUD K;  2KVQ G;  4FT4 A;  2H3J A;  2MI6 A;  4M75 D;  5IAY A;  1W2B A;  2L8D A;  3M4G A;  1YIT T;  2RJC A;  1VQ7 T;  3A5Z B;  2DXU A;  5CIU A;  3OMG A;  3GLX A;  1LJO A;  3CCV A;  3TCJ A;  5J3B A;  4JLI A;  3RMQ A;  4C92 E;  2K3Y A;  4KUI A;  3LWI A;  3CCM T;  4PJO B;  1N27 A;  4V2S A;  1K9M U;  2YLC A;  3RER A;  1B34 A;  1YCY A;  4C92 D;  5LJ3 g;  4M7D E;  5GAM g;  5FRM A;  4PLL A;  2E6N A;  2EQU A;  2DIQ A;  4A4K A;  3PMI A;  2E12 A;  1FWZ A;  3SDZ A;  1JBM A;  2D0Q B;  4M7D D;  3OB9 A;  4M78 A;  3GOX A;  4ZGD B;  5LJ5 e;  3CC4 T;  3CCJ T;  4C92 C;  3JB9 D;  1QVF A;  3A8O B;  2KDS A;  4JS4 A;  4E7L A;  3JAM E;  2LVM A;  3OS5 A;  3UWN A;  5GAN 5;  1VQK T;  2HAX A;  3QSU A;  3DKM A;  3JCM X;  3M59 A;  4DA4 A;  2EJF A;  2HQE A;  3FLG A;  2QQR A;  1NE8 A;  2EQK A;  2X35 A;  4Y91 A;  2DTH A;  3HPW A;  1B34 B;  4NL2 A;  5CVI A;  3V8K A;  3MEU A;  3G6E T;  1ZQ1 A;  2D9T A;  3OYL A;  4M77 A;  3CCQ A;  2FHD A;  3BY7 A;  3HRU A;  4EMK C;  3CCE A;  3OYF A;  3GP8 A;  5DLQ E;  4M78 B;  5LJ3 e;  3JCM P;  5GAM e;  1KC8 C;  4QQ6 A;  4D6W A;  2YLB A;  3QHS A;  2XDD A;  3BDU A;  1KQS S;  3GIB A;  3KUF A;  4NOY A;  3JCM c;  4M7A F;  2E41 A;  2RO0 A;  5GAO m;  1KHI A;  4F7U A;  2ZPE B;  1X01 A;  2QQA A;  3QXE B;  4HKE A;  5A0D A;  5HKC A;  1VQ4 A;  2LNV A;  1VQM A;  1G3W A;  2KQW A;  1WQW A;  3S3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...