4IIOA

Crystal structure of the second sh3 domain of itsn2 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
GMAQGALLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin-2
publication title Crystal Structure of the Second SH3 Domain of ITSN2 Bound with a Synthetic Peptide
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iioA00
3QWXX 4Z8AA 4LE9A 1UTIA 3VS2A 2W0ZA 4D8DA 2GGRA 2SEMA 4EIKA 4Z89A 1UFFA 2J05A 1QWEA 2LZ6B 2G6FX 4OMMA 4AFUC 2EKHA 2CT3A 2L3SA 4J9HA 1UE9A 1TG0A 2A36A 1KSWA 3U23A 1WX6A 3ZL7C 2FPDA 2QDLA 4RTVA 2ED1A 2FRYA 4IIOA 1FYNA 2ESWA 1K1ZA 2BZXA 2O2OA 2JMCA 2KROA 1E6GA 2M0YA 2LJ0A 2HBWA 2EYYA 1JXOA 1YWPA 1AWOA 1UHFA 1NYGA 1CKAA 1OEBA 1X69A 1K9AA 1AD5A 2AKKA 4JJDA 2B86A 5GJVB 5I22A 2J06A 1BU1A 1JU5C 3NMZC 2JS0A 1GFDA 2AKLA 2YUPA 1WFWA 3JV3A 2EW3A 4GBQA 3RBBB 2DL8A 4CC3A 2JM8A 2EYZA 4JZ3A 4F17A 1I1JA 1SRLA 2RPNA 1J3TA 4OMQA 2DX1A 1NG2A 4J9EA 1HJDA 3M0SA 1PKSA 1SHGA 1WXBA 2J6KA 2RQVA 2EGCA 5EC7A 1K0SA 4HCKA 3VRZA 4DEXA 1ZSGA 4JJBA 1G2BA 5FWBA 5IXFA 1I07A 1XOVA 4KRTA 1YNZA 2F2VA 1H8KA 4RTYA 2BZ8A 2MCNA 2A37A 2DYBA 3REAB 3H0FA 1OOTA 1MUZA 2DBKA 4OMPA 2A08A 2DF6A 2V1QA 2BTTA 3NHNA 3EHRA 1ZLMA 2D8HA 3UA7A 2NWMA 1CKBA 2ABLA 1JO8A 1UECA 2ROTA 1M3AA 1Z9ZA 2PNIA 2VWFA 2LP5A 4IIMA 5IHKA 3EG0A 2EPDA 3H0HA 4J9GA 3I5RA 1SPKA 2O9SA 1GCQC 1TUCA 3RNJA 2J7IA 4A63B 2KXDA 2HEQA 4F14A 2JTEA 1HSQA 2DL4A 2OI3A 2RMOA 2FEIA 3M0PA 2C0TA 1RUWA 1X6GA 2EVRA 1Y0MA 1YP5A 3VRYA 2GTOA 1YWOA 1ZX6A 1OPKA 1SHFA 1UUEA 2P4RA 2RQRA 2JS2A 4LUDA 1UDLA 4R0KA 2KGTA 3EG2A 3FJ5A 1HD3A 1GRIA 1SSHA 2CH4W 1YN8A 1M3CA 3EG1A 5FWCA 2OJ2A 3UATA 1S1NA 1PRLC 2KNBB 1UJYA 2C0IA 1NM7A 1JXMA 2XMFA 1V1CA 4X1VA 1WXTA 3VS4A 2EBPA 4M4ZA 1K4US 2NUZA 2YSQA 1CSKA 2J6OA 1AEYA 1E7OA 4RTWA 1T3LA 3TVTA 2MOXA 1PKTA 1EFNA 3VS5A 1W1FA 2KT8A 4J9CA 3THKA 2KR3A 1X6BA 5IXBA 2BZYA 3ULRB 4RUGA 4CC2A 2LJ1A 1M30A 2GTJA 2F2WA 1H3HA 4HVWA 3M0QA 3H0IA 1JEGA 2KRMA 4LN2A 3IQLA 2GBQA 1B3QA 3I35A 4HVUA 2YDLA 2H8HA 2EGAA 1WI7A 1U5SA 1BBZA 1YCSB 1N5ZA 1OPLA 1GCPA 2CSQA 1AZGB 1UGVA 3A98A 4AG2C 1OV3A 2LCSA 2EYXA 2KRNA 3NPFA 1SRMA 2CH4A 4Z88A 3KFVA 4GLMA 2DMOA 5IHNA 2FPFA 1ZUUA 1T3SA 3VS3A 1VYVA 1NEGA 2YUQA 4RTUA 4ZNXA 1GFCA 2GQIA 4FSSA 1WXUA 3EG3A 1X2KA 2W10A 1JQQA 1GBRA 2PTKA 1Y57A 2DJQA 1M3BA 1GL5A 2X3XD 4HVVA 2YUOA 4E6RA 1BB9A 1UHCA 1WIEA 2GNCA 3CQTA 2ED0A 1LCKA 3I5SA 1U3OA 2AK5A 3GBQA 4K11A 3PVLA 1E6HA 2JMAA 2LNHB 2YUNA 2DRKA 3SEMA 2O9VA 2JW4A 2D1XA 2ENMA 2EYWA 2CT4A 2FRWA 2O31A 1TUDA 4AG1C 1T0JA 1M8MA 2DL5A 2PZ1A 4WCIA 2EGEA 2K2MA 2D8JA 3PE0A 2F2XA 2DL7A 2VKNA 1AVZC 4J9DA 2KE9A 4OMNA 4ESRA 1ARKA 2FPEA 1IO6A 2LQWA 2OAWA 2DNUA 3EHQA 1SEMA 2K3BA 2HCKA 2JT4A 2AZVA 4J9FA 4J9BA 4RTXA 1BK2A 1NYFA 1X43A 4J9IA 2KEAA 1WYXA 3UF4A 1H92A 4RTZA 2DVJA 2DL3A 3LH5A 2CUBA 1QKWA 4AFSC 2MIOA 4CC7A 4ORZA 1MV3A 4OMLA 1NLPC 2KXCA 1I0CA 1PWTA 2M51A 2I0NA 3I9QA 4JZ4A 4CC4B 2O88A 5IHIA 1ABQA 3M0UA 2DM1A 2L0AA 3H41A 1U06A 2A28A 3REBB 1NLOC 1ZBJA 2LMJA 2DBMA 5HCKA 3C0CA 4LNPA 2D0NA 1AWWA 2HDAA 2LX7A 2DA9A 2K9GA 1NEBA 4D8KA 2RQWA 2FO0A 3EGUA 1PRMC 1PNJA 2RF0A 1X2QA 1KIKA 3VS7A 4AFZC 4Y92A 1AWJA 1VA7A 1W70A 1K0XA 5FW9A 1AZEA 2RQUA 2JXBA 1W6XA 1KJWA 3M0TA 2YT6A 4AFQC 1AWXA 1QCFA 3NGPA 1WLPB 4F16A 2FG0A 2IIMA 1GCQA 3PVQA 4LUEA 4OMOA 1VYUA 2LJ3A 2ROLA 4JPBW 1UJ0A 2KBTA 2C0OA 2CREA 1PHTA 1GBQA 1QWFA 3QWYA 3O5ZA 2K7AA 4QT7A 2KT1A 1FMKA 4DEYA 1QLYA 2DRMA 2ECZA 2KYBA 3VS6A 2EQIA 1G83A 1RLQC 2AZSA 2L3PA 2RNAA 3TSZA 3SHWA 2X3WD 3R6NA 2K79A 2CDTA 2SRCA 2KYMA 1ZUYA 1RI9A 2DE0X 1T0HA 3TSWA 5IH2A 2LQNA 2JM9A 5I11A 1VYTA 1AOJA 2KRSA 2RN8A 2K6DA 2J6FA 2L2PA 5ECAA 2DLPA 3UA6A 2VVKA 2V1RA 4RTTA 1ABOA 1QKXA 5GJWB 2CUDA 1B07A 2DILA 1K76A 1WDXA 2CSIA 1ZUKA 3VS0A 2HSPA 3VS1A 1RLPC 1A0NB 2RQTA 1KFZA 2E5KA 2L3QA 4HXJA 1WA7A 1UG1A 1Z9QA 3M0RA 4JJCA 1X27A 5L23A 1M27C 1MV0B
chains in the Genus database with same CATH superfamily
2GGRA 2L8DA 4FYXB 3OMGA 3QZ9B 4EIKA 5CVIA 3T9NA 2OAUA 4HCZA 2LZ6B 3PGGA 4OMMA 1VQKQ 3JCMX 2EKHA 3V8JA 1I4K1 2L3SA 3C12A 5KE2A 3U23A 1TWBA 3ASKA 2FRYA 1W2BP 1NE8A 3OW2A 2FZKB 1FXXA 5GMKe 3M53A 4PJOB 4PJOA 3OYYA 3M5AA 4OB1B 2QQ9A 2LJ0A 4M78G 5LJ3h 2MMPA 5GAMj 1CKAA 1Y7XA 1K9AA 4E2FB 1YITQ 2HL5C 4XTUA 4JJDA 3NMZC 3TCJA 2PQWA 2AKLA 3OYDA 4BD3A 2QQAA 2BUDA 3JV3A 2EW3A 3RBBB 5GAN2 4CC3A 2QEXT 2EYZA 3PIOA 2QG9B 2DX1A 4JRIA 3EGDB 3MCAB 1JJ2S 3EGDA 2RQVA 2QA4Q 2EGCA 1K0SA 4HCKA 2X4JA 4C8QF 2OTJT 4L5GA 4KULA 2R58A 5LJ3j 4JLGA 2P4TA 5IXFA 2BIVA 2RJDA 2A37A 2PVGB 3UPUA 3MPUB 2HD0A 5A0DA 1D1BA 2V1QA 3DB3A 4VUBA 4A4FA 2RI5A 2DD5A 1ZLMA 2D8HA 1CKBA 2P0PA 1WZOA 2ROTA 5CR2A 1ZSZC 5KH6A 2PNIA 4ME7A 3H8ZA 2LP5A 1YJWA 1K8AC 1WHGA 1M9SA 2M9UA 2K3XA 3H0HA 5GANe 1LJOA 2O9SA 3MEUA 1TUCA 3RNJA 2JNGA 2DL4A 1YJ9Q 4M7AE 3EFOB 3QBYA 4QVCA 3EFOA 5I2SA 3A8OB 3M0PA 2XKOC 4XK8E 1AHJB 4IKFA 1RUWA 1KK7A 1YP5A 3VRYA 4BDZA 4DOVA 1MNDA 4PJMA 1ZX6A 3JB9F 1FX7A 1XTDA 2AIRB 2JS2A 3L2QA 1UDLA 3EG2A 3FJ5A 3ZEHA 1GRIA 1SSHA 2DIQA 1KD1U 3DLLA 1YN8A 4PLIA 3MP6A 4ZGEB 4XTXA 1S72A 3CCLA 3CCSQ 2A7YA 3EG1A 4PJNA 2OJ2A 1NZ9A 1ZBXA 5CKHA 3LGFA 1UJYA 2C0IA 2L89A 1BIAA 4O5VA 4PNOA 2PVOB 3CCEQ 4HT8A 5FROA 3OA6A 1WQWA 1PM3A 3SD4A 2YRCA 2NUZA 2YSQA 3E1SA 1E7OA 3GLXA 4RTWA 1T3LA 2JVVA 1TTHB 3E9FA 4JRKA 4WTOB 2DD4A 1QP3A 1QCOA 1X6BA 2KMTA 4MZPA 4M78B 1KQSP 3ME9A 2QTVA 4J6XA 4M78A 4RUGA 4C92D 1M30A 5DLOA 2E5QA 2EYQA 3CXCP 5A2QE 2XD0A 1YJWT 2YDLA 3CC4T 2H8HA 1YCSB 1OPLA 2RK1A 2CSQA 4C8QD 2GF7A 1VQ6Q 3A98A 5GAOm 2EYXA 1M1KC 2KRNA 5CO7A 1SRMA 4KT0E 5CKFA 3CEYA 2FPFA 1ZUUA 1T3SA 3FIFA 1WJRA 4M7AC 4RTUA 4ZNXA 4C92G 4XU3A 3OYBA 3SWNC 2QTXA 1WXUA 3G4SA 1M1GA 4M77E 2QEXQ 1ZA2B 1Q86U 2B8AA 1Y57A 1WJSA 3QDRB 4F04B 2P84A 2X3XD 3CCLT 2RJEA 1Q95G 2GNCA 3CQTA 4EMKC 1M90R 2E65A 5A0LA 2V8IA 2MI6A 4A53A 2JMAA 2OTJQ 5HK0A 1WHJA 1IGUA 2YUNA 3V7RA 2DRKA 3JCMQ 4DBFA 1I8FA 2CT4A 2EJFA 4RKUE 2X4WA 1TUDA 1OI1A 3FEOA 3QG1A 4AG1C 1FWZA 2M0OA 2PZ1A 1VQNQ 4LDYA 2R5AA 3KBGA 3GPLA 2F2XA 2DL7A 5LJ5f 3JCMe 4WF2A 1K73R 2E10A 4ANJA 4PJOE 4OMNA 4RCCA 2DEUA 1IB8A 1VQ7Q 2DNUA 3EHQA 1Q82R 2K3BA 5GAMe 2JT4A 1VUBA 1C6VX 4J9FA 2KSSA 2RA2A 2C06A 4J9BA 4RTXA 1KQ2A 1QVFS 2MAMA 1D0ZA 2DYIA 2MIOA 3CCVQ 4ORZA 3BDLA 5KYYB 1H3ZA 4PFOA 5KYYA 2RD1A 1ABQA 4E7SA 2L0AA 1U06A 1ZBJA 3C95A 4OF1A 4JJNK 3G4ST 2DXBA 3JB9J 4X9CA 1AWWA 2DA9A 1OZ2A 4D8KA 2FO0A 2Y4YA 5LJ3e 4PL6A 3HHTB 1JJ2P 1ZSZB 4C5GA 3GOXA 1ZSZA 2ZPIB 4M75C 3CPWP 3GNFB 3L42A 4RCBA 1KJWA 2EIFA 2KDSA 4AFQC 3OSSC 1IZ6A 1N9SA 3HRSA 3NTHA 1WLPB 4J6YA 2E41A 3CC7A 8ATCB 2HNIA 2AT1B 3PVQA 4LUEA 4OMOA 1OX9A 1VYUA 2ROLA 2K5FA 2EJ9A 1PHTA 3RDVA 4E7IA 3HPWA 1YJWQ 3CCRA 3CC4Q 3VUZA 4BUGA 1RL2A 2PVDB 3QKJA 2VYTA 2WSEE 4PK4A 2KYBA 3VS6A 1YJNA 3Q1JA 5CQYA 3TSZA 2QAZA 5IAYA 1FMWA 4E7KA 4NOYA 3G1JA 2X4XA 2DE0X 1RAAB 1T0HA 2LQNA 4A4GA 3QHSA 2EWNA 1D1AA 1EX4A 3M4YA 1RAHB 1TH7A 2JN0A 2L2PA 3UA6A 1VIEA 3G71T 1PG5B 1QKXA 1N8RR 2CUDA 4JS5A 3OYGA 1WDXA 3VS0A 1HYOA 2EQKA 1A0NB 2L3QA 4HXJA 5KYWB 1WA7A 2H3EB 3OQ5A 5KYWA 2K4YA 4GLKA 2FZGB 2NLUA 4JJCA 1X27A 3D7SB 4M78E 4PKCC 2BKDN 3OYMA 4M75G 4Z8AA 2E4HA 4KH1B 3CPWA 2X51A 1SG5A 1UTIA 2DERA 4M7DC 4N0AC 3X28B 4Z89A 1UFFA 4C0DB 1IRXA 1QVGP 4AFUC 1SSFA 1TU0B 2CT3A 3CCRT 4CRIA 4F7UG 4J9HA 1UE9A 1TG0A 4M7AB 1KSWA 4PFZA 3TEEA 4M7AA 4A4HA 3SWNB 3SWNA 1FYNA 2HQEA 2RK2A 2QASA 2KROA 1E6GA 2HSEB 2M0YA 3VKIA 2DTHA 1VQOT 1X6OA 4EDUA 2FVUA 2BE9B 2L5QA 3JB9H 1AWOA 9ATCB 3C94A 1NYGA 5GAN5 2AKKA 3ER0A 2B86A 3BFMA 5GJVB 5I22A 2J06A 4MMKA 3MP8A 2JS0A 2CP0A 3JCMV 4M7DD 2XIDA 4XTWA 1WFWA 4J7FA 4EPCA 2K3YA 4DOWA 2HMAA 2LNVA 5DLQE 2E1HA 1PD1A 1SRLA 2MPXC 3JCMP 1EZZB 3P8HA 5LJ5j 4PFPA 1RAIB 2A0FB 3HL8A 3N5BB 4J5YA 3J81E 5J39A 1M90C 5D7UA 2Y4XA 1UEBA 5HK3A 1O9SA 3M55A 1ZSGA 2M16A 3JCMb 5I21A 2PUOB 1YNZA 2F2VA 2MCNA 4ZGDB 4M7DG 3CCQA 3H0FA 4NL2A 1DJ7B 2RJCA 3P8BB 1QVGA 3EHRA 1EIFA 1JO8A 1UECA 4QQ6A 2VWFA 1OU8A 4ELYC 2A3LA 4XU2A 3I5RA 1SPKA 2HQHA 1Q82C 1QVFP 3PTAA 3A5ZB 2KXDA 3RMSA 3E9GA 3M4GA 2OI3A 3FC3A 2XHCA 2O01E 1X6GA 3I56A 1Y0MA 4J83A 4M75B 3G71Q 1NPRA 1X01A 4M75A 1SHFA 5CAIA 3QDFA 2WSFE 3ZFJA 1MMNA 3CCJA 3UATA 3QPHA 1PRLC 4JDSA 1LOJA 2R5MA 4DBQA 3NTKA 2COWA 1NM7A 5FRNA 3HTRA 4X1VA 1ACMB 3LGLA 2LT4A 2OTLA 2EAYA 2MOXA 3CCQT 2KT8A 4PJLA 3THKA 3GNGA 4FL6A 5IXBA 2ZPEB 2BZYA 4QQDA 4ATOA 3LWIA 3CCRQ 2GTJA 1H3HA 3M0QA 3M57A 2MK5A 2KRMA 4LN2A 1KD1R 2GBQA 2HQXA 2EGAA 1WI7A 3CBMA 1U5SA 1BBZA 2X4YA 1N5ZA 3F70A 4FT2A 1VQOQ 4AG2C 4DBHA 2E6NA 3DKMA 3VUBA 2NUPB 2NUPA 1D0YA 2DMOA 3I56T 3CMEA 2LQKA 5HY6A 1NEGA 1Y71A 2GQIA 1RAFB 4FSSA 4C0GA 3EG3A 1TXQA 4BI4A 4ZN1A 3CCJT 2LVMA 2DJQA 4N0AA 1GL5A 1BB9A 1UHCA 1WIEA 1KC8U 1N8RC 3OS5A 2ED0A 1OQKA 4DQ2A 5CKEA 3OS2A 5GANd 2AK5A 3GBQA 1G3TA 3CCMA 1Q7YU 1M5Q1 1R0CB 1IGQA 1W2BA 2DK3A 1Q81U 4J7IA 2OTLT 3SEMA 2HZYA 2O9VA 3A8MB 2D1XA 2ENMA 2PU9B 1QVPA 2O31A 5CK9A 1RI0A 3FRNA 3V8KA 2E70A 3FLGA 1M8MA 4E7JA 2DAQA 2DL5A 3MP1A 4BB7A 1OX8A 2CYZB 2GCXA 3EH1A 3RKXA 2EGEA 2K2MA 5CCAA 2VKNA 4C92C 3X20B 1AVZC 2K57A 4JRQA 2FZCB 4V2SA 2YHTA 5AYFA 1Q86R 2LQWA 2OAWA 2JZ2A 1YI2A 2VC8A 3G6EA 5GAN8 4C8QC 1MMDA 2QQBA 1BK2A 1NYFA 1X43A 2FHDA 2KEAA 2DTIA 2DL3A 2CUBA 4FYYB 1O75A 4AFSC 4OMFB 2I0NA 3I9QA 4PLLA 5IHIA 4M7AF 3M0UA 6AT1B 3REBB 1G3SA 1XJWB 4HCCA 1LPLA 5HCKA 3A8GB 4LNPA 3PFSA 4Q5WA 5LJ5e 2RH2A 3QYHB 1M2OA 2IG0A 2RQWA 3OYNA 3EGUA 2RF0A 1KIKA 3OYKA 3VS7A 5LL6S 1G8XA 2RHXA 5J26A 2KI7A 1AWJA 1K0XA 1MNEA 2RQUA 2JXBA 3H9NA 3CCQQ 3M0TA 1BI3A 4OB2B 1NJIU 4F16A 4MDWA 2FG0A 2IIMA 4LDWA 5KYUB 5KYUA 2LJ3A 4HA8A 2CZ6B 3S3NA 3CBOA 1OZ3A 5L8RE 5DM7R 1BI0A 2ATCB 3L2ZA 4DEYA 1YI2T 4A54A 3G6ET 2XICA 3UWNA 1S72T 1G83A 2HKNA 2H3JA 3FB9A 4XTZA 3R6NA 4C8QG 4YTLA 4M75E 1QMCA 1SF9A 2KYMA 3TQ7P 1ZUYA 4OGCA 3OYEA 2DVEA 3S3OA 2IPOB 1D09B 2RN8A 5ECAA 2DLPA 5GANg 3HFOA 2XI9A 3JCMd 3JB9D 2V1RA 3CCJQ 4F7UE 1ABOA 3OW2S 2V8JA 4FW1A 4BY6C 1KQSA 3R6OA 4E7ZA 4X34A 1RLPC 3CCUA 4M77F 1UG1A 4D6WA 3CXCA 3M0RA 2OTLQ 1VQMA 1VQPA 1M27C 3UT1A 3QWXX 1XNIA 5I2MA 3A8HB 3VS2A 2W0ZA 4D8DA 4C0FA 3X26B 1YFNA 3JB9G 1QWEA 2G6FX 3LW5E 3OY9A 1K9MU 3EFSA 2G3RA 4GY5A 4PJOF 2EFIA 2QDLA 1HXDA 4RTVA 2ED1A 3NFCA 4IIOA 4RMOA 2VB6A 2ESWA 1VQ8A 1KD1C 3VJPA 1IXDA 3GP8A 2JMCA 4Z02A 2FB7A 5GMKh 1WGSA 2HBWA 2EYYA 1IREB 5GAOp 1YWPA 4M7DE 2YLCA 1OEBA 1AD5A 4QW2A 4KGVB 4NS5A 2X35A 4A4KA 2Y90A 1VIFA 4J6WA 5GAOq 2LX9A 4HKEA 2JOYA 5KYNA 4Y91A 1WHKA 3CBPA 2QGFB 2CP5A 1U1TA 2DL8A 2ZPGB 3CCUT 2QYZA 3QYGB 3OBYA 4C92B 1G5VA 1I1JA 3CC2A 3EG9B 4OMQA 2JTMA 4C92A 3EG9A 1NG2A 4J9EA 1RACB 3M58A 2QK0A 3RESA 4LDXA 3EH2A 1PKSA 5EC7A 2J6KA 1VQPT 2CZ7B 2XDPA 3H6ZA 4FU6A 4JJBA 1G2BA 3MKDA 5FWBA 2HBPA 3OS0A 2VXEA 1I07A 1F1BB 3OB9A 4C8QB 1YITA 2RI2A 4C8QA 2BZ8A 2DYBA 3REAB 2CP2A 3RMQA 4JS4A 3QXEB 2DBKA 2EQMA 4Y28E 1V76A 4ZTJA 4M77D 5FU6C 3UA7A 2ABLA 1PSFA 2RM4A 2VGNA 1M3AA 3G6EQ 1Z9ZA 1S72Q 3CCLQ 5GAN4 2CP3A 3S6WA 5IHKA 3E2UA 3EG0A 1I5LA 1Q86C 2XK0A 1WHMA 4J9GA 5CIUA 1JBMA 2RHUA 5GANh 3JCMg 4F14A 2FL7A 8AT1B 4LDUA 1JJ2A 4FW2A 3J7AF 1KHCA 2EVRA 2MYSA 2DFUA 2HL3A 2GTOA 1YWOA 2HAXA 3CC7T 3HRUA 1UUEA 4IUTA 2P4RA 4LD6A 2RQRA 4LUDA 1MMGA 4PJOD 1QW1A 2KGTA 2YRVA 1VOMA 1HD3A 4RG8A 1UGRB 2CH4W 2GFUA 4BI8B 2LTOA 4J8OA 3WVDB 5FWCA 3BY7A 3CC2T 4JLIA 4BE1A 2KNBB 3O8VA 3PT9A 1B34B 2XMFA 3PMTA 1B34A 1YJNT 1V1CA 2DZCA 3HKSA 3L2WA 1I81A 4LDVA 1G3YA 1AEYA 4KUDK 1MGQA 3E19A 4M78F 1YITT 3VS5A 4BI3A 4EMKB 1W1FA 4J9CA 4EMKA 3EFRA 3ULRB 5IN1A 1R8OB 3OYIA 2LJ1A 5GAOl 3G4SQ 2D6FA 4MDXA 2F2WA 4C5IA 2D0QB 1RABB 3META 3IQLA 3QUIA 1B3QA 4HVUA 3WVEB 2F5TX 2E64A 4XU1A 2X9HA 4BY6B 2DEQA 3CCEA 2LCSA 1Y07A 3LH0A 3RKYA 1WQ7A 3NPFA 2CH4A 1TS9A 4HT9A 2WSCE 3CPFA 2KQWA 2CZ0B 3VS3A 4EMGA 4BE2A 4E7LA 1BIBA 1MHNA 4XTYA 4C5EA 2DIGA 2JTFA 1GFCA 3SDZA 1RAGB 1K8AU 3OW2P 1GBRA 2NUTB 5CKBA 1VQ4A 2LC4A 2NUTA 3CCUQ 3JCMW 4HCBA 2YXYA 1QQJA 3MJXA 3CD6A 4XQ3A 5M9OA 3I5SA 2P0KA 1UB4A 2NYSA 1VQ6A 4KGZB 4R56A 3OYJA 5EG2A 3HSBA 1P92A 5GAN6 2JW4A 2EYWA 2DTOA 1H641 1BYMA 1T0JA 2DXCA 4ZN3A 4N4IA 1UGPB 4ZGJB 5KCOA 1X75C 4J9DA 5GMKm 1ARKA 3JCMh 4MZMA 1RAEB 2FPEA 2YRDA 5DY9A 4XAXB 2RJFA 1BI2A 4BDYA 1KC8R 1R0BG 2EKOA 2HCKA 3CCET 5GAMh 2OTJA 1Q7YR 1WYXA 4M78D 3UF4A 4F7UB 4F7UA 1Q81R 4IURA 1QKWA 4CC7A 1VQ9A 1MV3A 4OMLA 1NLPC 1PWTA 2M51A 3CC7Q 4CC4B 4JZ4A 1VQNA 2O88A 3RKWA 4C0ZA 3KXTA 2CP7A 1NLOC 4C92E 2LMJA 4E7HA 2DBMA 1VQ4T 4KBMB 2DZ9A 2LX7A 1TSFA 2CZ1B 3QO3A 3CC2Q 1VQ7A 3CD6T 1PRMC 1PNJA 1R77A 1YBYA 1M1KU 1OU9A 3INZA 3MEWA 1YJNQ 4C8QE 3NTIA 1VQ6T 5FU6B 4Y92A 3OYLA 1W70A 2KVQG 2XU8A 5KE3A 5FW9A 1AZEA 4ZTFA 1PD0A 3CCVA 1QCFA 2MF2A 1QVFA 1W4SA 4FYVB 4KGXB 4QVZA 2EJGA 2KBTA 2DXUA 4C92F 1GBQA 1M1FA 1QWFA 3QWYA 4FYWB 2M02A 2K7AA 4QT7A 1QCNA 1BCOA 1FMKA 5KYXB 4M7DB 5KYXA 4M7DA 4OGEA 1QLYA 2DRMA 2ECZA 1BI1A 2EQIA 2GQVA 2LDMA 2L3PA 3CPWS 3HRTA 2X3WD 2JJ9A 2CDTA 2HKQB 4O6JA 2SRCA 1UGQB 1HK9A 3GIBA 2WACA 3M59A 1LVKA 1VQ9T 3TSWA 5IH2A 2JM9A 1VYTA 1VQNT 3UDCA 1OYXA 1NJIR 4FM4B 4X9DA 4RTTA 5FLXE 5CQXA 5GJWB 3S3MA 5FU7C 2DILA 3OYAA 3CC4A 1VQ7T 2ZGWA 2HSPA 3VS1A 3MEVA 3JB9I 1YHQA 2ZPHB 3JRZA 3V7CA 2XDDA 1WJQA 2VUBA 1MV0B 2M1HA 4P5NA 1TUGB 3CCVT 1Y96B 1V29B 4LE9A 4FCYA 2DPPB 1Y96A 5GAN3 2SEMA 1M2VB 1M2VA 2AHJB 2J05A 3CMET 1YIJA 3JSCA 2V26A 1AT1B 3ZBDA 4L59A 5LJ5d 4B9XA 1KQ1A 1I5OB 4FIBA 2KAFA 2A36A 3PNWC 2QXFA 3VV0A 1WHHA 1WX6A 3ZL7C 2FPDA 2EQJA 3BE3A 1K1ZA 5KCHA 4IUQA 2BZXA 4II1A 1B7TA 2O2OA 1IHVA 4B9WA 4LD9K 2CP6A 3CCMT 3MHXA 3M54A 1JXOA 4IUPA 1OULA 2E3HA 1UHFA 1U1SA 3GF5A 3I55A 3CMAA 1MMAA 1X69A 2O4XB 2O4XA 1QVGS 1BU1A 1YCYA 1C1AA 1JU5C 1KHIA 1GFDA 2YUPA 1VQ4Q 2MWPA 1G3WA 4RG2A 2DETA 1C0MA 2RB6A 4OVAA 1JB0E 4GBQA 3L2VA 1VQLA 3CD6Q 1K9MR 2JM8A 1YHQT 4JZ3A 1ZHIA 4F17A 5GANf 1GXIE 2RPNA 1J3TA 2YLBA 1HJDA 3M0SA 4C0DC 1SHGA 1WXBA 3VRZA 4QKUA 4DEXA 5GMKi 2F5KA 1XOVA 4KRTA 2Z0WA 1H8KA 4RTYA 3I56Q 4BE0A 4L6V5 1OOTA 1YIJT 1RADB 1MUZA 2I2LA 4OMPA 3LYIA 2A08A 5AT1B 2DF6A 4KH0B 2BTTA 3NHNA 3RERA 2RHIA 1U8RA 2NWMA 2RI3A 2ZPBB 2QQSA 3QIIA 4OB3B 4IIMA 3P8DA 1JRIA 2EPDA 5GMKl 2XG8D 2E6ZA 5GAMd 3WXMB 1GCQC 1KC8C 2J7IA 1VQ9Q 4A63B 2HEQA 1TOVA 2JTEA 1HSQA 3I55T 5IT9E 3A8LB 1VQ5A 3CMAT 2RHYA 2RMOA 1Q7YC 2FEIA 5D6XA 2FYKA 4M75F 2C0TA 1Q81C 4M7AD 2COZA 5C0MA 3OBWA 5D6WA 2COYA 3X24B 2OX7A 1OPKA 4AMCA 1VQLT 4R0KA 4CI0C 4OB0B 4B6MA 1M3CA 4F7UF 5CKDA 3VYHB 3QZ5B 3PIPA 2LQ8A 1S1NA 2VV5A 5A0GA 2K5LA 3G7ZA 3LWHA 3VYGA 4AT1B 4TVRA 2VXFA 1JXMA 2K5IA 5LJ3d 5GAOn 2RHZA 3RUXA 1ZQ1A 1WXTA 4XU0A 3QJ6A 3VS4A 2DXTA 2EBPA 4M4ZA 1K4US 5LJ5g 1CSKA 2J6OA 3SFMA 1D0XA 3TVTA 1PC0A 1WNLA 1PKTA 2QDYB 7AT1B 1EFNA 2KY9A 3X25B 3OYFA 2LCLA 4M7AG 3BDUA 3CMEQ 2KR3A 3VU3C 4DA4A 1XQHA 3G71A 3EAEA 4IUUA 4CC2A 4MZTA 1M8VA 2CS7A 2VGMA 3EGXB 4E47A 3EGXA 4HVWA 3H0IA 4M77C 1VQKA 3RR6A 1JEGA 3I35A 1M90U 1W2BS 5C6SA 2D9TA 5FU7B 1GCPA 2JUFA 1AZGB 1UGVA 2RO0A 3OS1A 3CCMQ 1OV3A 5J3BA 2YWWA 2K2VA 2EQUA 2DJZA 1VQMT 1UGSB 4ELZC 2CKKA 1VQ5T 4Z88A 3KFVA 4KUIA 4GLMA 5GMKj 4R55A 5IHNA 2LCCA 1WPYA 2DKGA 3L2RA 1N27A 1VYVA 2CGHA 1D3BB 2YUQA 3FJPA 1D3BA 3JCMf 5GAN7 2LRQA 2E3IA 1FMVA 2KK4A 2QI2A 4N4HA 1K73U 4M7DF 3HP9A 1X2KA 2W10A 1NJIC 1JQQA 2PTKA 3AHUA 4PJOC 1YHQQ 1BCMA 1M3BA 4HVVA 2YUOA 4E6RA 2F69A 5GAMf 1Q82U 4OP0A 1LCKA 1YI2Q 1U3OA 4K11A 3PVLA 2MWOA 1E6HA 1VQOA 1VQ8T 2LNHB 2VASA 4M75D 1NPPA 2QA4A 3C4SA 4C5HA 2FRWA 3RIRA 4FSXA 3DLMA 3JAME 2IVWA 1YIJQ 1PSEA 1SKUB 4WCIA 2D8JA 3PE0A 3L2UA 3TREA 4IUVA 2KE9A 1K8AR 3OYHA 5GAMg 4ESRA 4QQGA 1VQKT 3QJYA 4M77G 1IO6A 5HKCA 3JCMc 5LJ3f 3QSUA 1SEMA 3MEAA 2R57A 3OSVA 4N4GA 2AZVA 3V7SA 4J9IA 3I55Q 1H92A 3PMIA 2DO3A 3CMAQ 4RTZA 2DVJA 3LH5A 2QQRA 5GANj 2GFAA 1I0CA 2KXCA 3A1PA 2QGGA 1YJ9A 2DM1A 3H41A 2A28A 2BE7D 1VQLQ 4PJJA 4A4EA 3OYCA 4FT4A 3TU4K 3C0CA 4XTVA 5LJ3g 2D0NA 2HDAA 1QP2A 2K9GA 4PJOG 1NEBA 5LJ5h 5D6YA 3MO8A 3JCMJ 1X2QA 1K9MC 4EMHA 2F1LA 2PUKB 4AFZC 3CCSA 3SB2A 1VA7A 1ZA1B 3AT1B 4UC4A 1M4ZA 1W6XA 4QVDA 2QA4T 4DBRA 3URGA 2YT6A 1AWXA 3M9QA 5GAOr 3NGPA 4JUVA 3FDRA 1GCQA 1PCXA 1KQSS 2ZCFB 4JPBW 1UJ0A 2C0OA 2CREA 1N8RU 3O5ZA 3L1AA 2V8KA 4BACA 3CXCS 2KT1A 3M56A 2LT1A 3DB4A 3J80E 3LX7A 1N6AA 1D1CA 1RLQC 2AZSA 1M1KR 2RNAA 3SHWA 1VQMQ 2K79A 1VQ5Q 1N9RA 4LXCA 4M78C 1VQPQ 4MMLA 1RI9A 3KUFA 2P0QA 1YJ9T 5I11A 1AOJA 2KRSA 3BW1A 3V8LA 2K6DA 2J6FA 1WHLA 2VVKA 2ZPFB 1K73C 5FRMA 1B07A 2E12A 1K76A 2CSIA 1ZUKA 2XDBA 3LLRA 2QEXA 2RQTA 1KFZA 1KG1A 2E5KA 2ZZDA 4JRPA 2L3RA 3CCST 1Z9QA 1LNXA 1VQ8Q 1BKBA 4M77B 1IHWA 4M77A 4NL3A 5L23A 2ZAEA 3HFNA 3OMCA 1NBEB
chains in the Genus database with same CATH topology
3QWXX 4Z8AA 4LE9A 1UTIA 3VS2A 2W0ZA 4D8DA 2GGRA 2SEMA 4EIKA 4Z89A 1UFFA 2J05A 1QWEA 2LZ6B 2G6FX 4OMMA 4AFUC 2EKHA 2CT3A 2L3SA 4J9HA 1UE9A 1TG0A 2A36A 1KSWA 3U23A 1WX6A 3ZL7C 2FPDA 2QDLA 4RTVA 2ED1A 2FRYA 4IIOA 1FYNA 2ESWA 1K1ZA 2BZXA 2O2OA 2JMCA 2KROA 1E6GA 2M0YA 2LJ0A 2HBWA 2EYYA 1JXOA 1YWPA 1AWOA 1UHFA 1NYGA 1CKAA 1OEBA 1X69A 1K9AA 1AD5A 2AKKA 4JJDA 2B86A 5GJVB 5I22A 2J06A 1BU1A 1JU5C 3NMZC 2JS0A 1GFDA 2AKLA 2YUPA 1WFWA 3JV3A 2EW3A 4GBQA 3RBBB 2DL8A 4CC3A 2JM8A 2EYZA 4JZ3A 4F17A 1I1JA 1SRLA 2RPNA 1J3TA 4OMQA 2DX1A 1NG2A 4J9EA 1HJDA 3M0SA 1PKSA 1SHGA 1WXBA 2J6KA 2RQVA 2EGCA 5EC7A 1K0SA 4HCKA 3VRZA 4DEXA 1ZSGA 4JJBA 1G2BA 5FWBA 5IXFA 1I07A 1XOVA 4KRTA 1YNZA 2F2VA 1H8KA 4RTYA 2BZ8A 2MCNA 2A37A 2DYBA 3REAB 3H0FA 1OOTA 1MUZA 2DBKA 4OMPA 2A08A 2DF6A 2V1QA 2BTTA 3NHNA 3EHRA 1ZLMA 2D8HA 3UA7A 2NWMA 1CKBA 2ABLA 1JO8A 1UECA 2ROTA 1M3AA 1Z9ZA 2PNIA 2VWFA 2LP5A 4IIMA 5IHKA 3EG0A 2EPDA 3H0HA 4J9GA 3I5RA 1SPKA 2O9SA 1GCQC 1TUCA 3RNJA 2J7IA 4A63B 2KXDA 2HEQA 4F14A 2JTEA 1HSQA 2DL4A 2OI3A 2RMOA 2FEIA 3M0PA 2C0TA 1RUWA 1X6GA 2EVRA 1Y0MA 1YP5A 3VRYA 2GTOA 1YWOA 1ZX6A 1OPKA 1SHFA 1UUEA 2P4RA 2RQRA 2JS2A 4LUDA 1UDLA 4R0KA 2KGTA 3EG2A 3FJ5A 1HD3A 1GRIA 1SSHA 2CH4W 1YN8A 1M3CA 3EG1A 5FWCA 2OJ2A 3UATA 1S1NA 1PRLC 2KNBB 1UJYA 2C0IA 1NM7A 1JXMA 2XMFA 1V1CA 4X1VA 1WXTA 3VS4A 2EBPA 4M4ZA 1K4US 2NUZA 2YSQA 1CSKA 2J6OA 1AEYA 1E7OA 4RTWA 1T3LA 3TVTA 2MOXA 1PKTA 1EFNA 3VS5A 1W1FA 2KT8A 4J9CA 3THKA 2KR3A 1X6BA 5IXBA 2BZYA 3ULRB 4RUGA 4CC2A 2LJ1A 1M30A 2GTJA 2F2WA 1H3HA 4HVWA 3M0QA 3H0IA 1JEGA 2KRMA 4LN2A 3IQLA 2GBQA 1B3QA 3I35A 4HVUA 2YDLA 2H8HA 2EGAA 1WI7A 1U5SA 1BBZA 1YCSB 1N5ZA 1OPLA 1GCPA 2CSQA 1AZGB 1UGVA 3A98A 4AG2C 1OV3A 2LCSA 2EYXA 2KRNA 3NPFA 1SRMA 2CH4A 4Z88A 3KFVA 4GLMA 2DMOA 5IHNA 2FPFA 1ZUUA 1T3SA 3VS3A 1VYVA 1NEGA 2YUQA 4RTUA 4ZNXA 1GFCA 2GQIA 4FSSA 1WXUA 3EG3A 1X2KA 2W10A 1JQQA 1GBRA 2PTKA 1Y57A 2DJQA 1M3BA 1GL5A 2X3XD 4HVVA 2YUOA 4E6RA 1BB9A 1UHCA 1WIEA 2GNCA 3CQTA 2ED0A 1LCKA 3I5SA 1U3OA 2AK5A 3GBQA 4K11A 3PVLA 1E6HA 2JMAA 2LNHB 2YUNA 2DRKA 3SEMA 2O9VA 2JW4A 2D1XA 2ENMA 2EYWA 2CT4A 2FRWA 2O31A 1TUDA 4AG1C 1T0JA 1M8MA 2DL5A 2PZ1A 4WCIA 2EGEA 2K2MA 2D8JA 3PE0A 2F2XA 2DL7A 2VKNA 1AVZC 4J9DA 2KE9A 4OMNA 4ESRA 1ARKA 2FPEA 1IO6A 2LQWA 2OAWA 2DNUA 3EHQA 1SEMA 2K3BA 2HCKA 2JT4A 2AZVA 4J9FA 4J9BA 4RTXA 1BK2A 1NYFA 1X43A 4J9IA 2KEAA 1WYXA 3UF4A 1H92A 4RTZA 2DVJA 2DL3A 3LH5A 2CUBA 1QKWA 4AFSC 2MIOA 4CC7A 4ORZA 1MV3A 4OMLA 1NLPC 2KXCA 1I0CA 1PWTA 2M51A 2I0NA 3I9QA 4JZ4A 4CC4B 2O88A 5IHIA 1ABQA 3M0UA 2DM1A 2L0AA 3H41A 1U06A 2A28A 3REBB 1NLOC 1ZBJA 2LMJA 2DBMA 5HCKA 3C0CA 4LNPA 2D0NA 1AWWA 2HDAA 2LX7A 2DA9A 2K9GA 1NEBA 4D8KA 2RQWA 2FO0A 3EGUA 1PRMC 1PNJA 2RF0A 1X2QA 1KIKA 3VS7A 4AFZC 4Y92A 1AWJA 1VA7A 1W70A 1K0XA 5FW9A 1AZEA 2RQUA 2JXBA 1W6XA 1KJWA 3M0TA 2YT6A 4AFQC 1AWXA 1QCFA 3NGPA 1WLPB 4F16A 2FG0A 2IIMA 1GCQA 3PVQA 4LUEA 4OMOA 1VYUA 2LJ3A 2ROLA 4JPBW 1UJ0A 2KBTA 2C0OA 2CREA 1PHTA 1GBQA 1QWFA 3QWYA 3O5ZA 2K7AA 4QT7A 2KT1A 1FMKA 4DEYA 1QLYA 2DRMA 2ECZA 2KYBA 3VS6A 2EQIA 1G83A 1RLQC 2AZSA 2L3PA 2RNAA 3TSZA 3SHWA 2X3WD 3R6NA 2K79A 2CDTA 2SRCA 2KYMA 1ZUYA 1RI9A 2DE0X 1T0HA 3TSWA 5IH2A 2LQNA 2JM9A 5I11A 1VYTA 1AOJA 2KRSA 2RN8A 2K6DA 2J6FA 2L2PA 5ECAA 2DLPA 3UA6A 2VVKA 2V1RA 4RTTA 1ABOA 1QKXA 5GJWB 2CUDA 1B07A 2DILA 1K76A 1WDXA 2CSIA 1ZUKA 3VS0A 2HSPA 3VS1A 1RLPC 1A0NB 2RQTA 1KFZA 2E5KA 2L3QA 4HXJA 1WA7A 1UG1A 1Z9QA 3M0RA 4JJCA 1X27A 5L23A 1M27C 1MV0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWX X;  4Z8A A;  4LE9 A;  1UTI A;  3VS2 A;  2W0Z A;  4D8D A;  2GGR A;  2SEM A;  4EIK A;  4Z89 A;  1UFF A;  2J05 A;  1QWE A;  2LZ6 B;  2G6F X;  4OMM A;  4AFU C;  2EKH A;  2CT3 A;  2L3S A;  4J9H A;  1UE9 A;  1TG0 A;  2A36 A;  1KSW A;  3U23 A;  1WX6 A;  3ZL7 C;  2FPD A;  2QDL A;  4RTV A;  2ED1 A;  2FRY A;  4IIO A;  1FYN A;  2ESW A;  1K1Z A;  2BZX A;  2O2O A;  2JMC A;  2KRO A;  1E6G A;  2M0Y A;  2LJ0 A;  2HBW A;  2EYY A;  1JXO A;  1YWP A;  1AWO A;  1UHF A;  1NYG A;  1CKA A;  1OEB A;  1X69 A;  1K9A A;  1AD5 A;  2AKK A;  4JJD A;  2B86 A;  5GJV B;  5I22 A;  2J06 A;  1BU1 A;  1JU5 C;  3NMZ C;  2JS0 A;  1GFD A;  2AKL A;  2YUP A;  1WFW A;  3JV3 A;  2EW3 A;  4GBQ A;  3RBB B;  2DL8 A;  4CC3 A;  2JM8 A;  2EYZ A;  4JZ3 A;  4F17 A;  1I1J A;  1SRL A;  2RPN A;  1J3T A;  4OMQ A;  2DX1 A;  1NG2 A;  4J9E A;  1HJD A;  3M0S A;  1PKS A;  1SHG A;  1WXB A;  2J6K A;  2RQV A;  2EGC A;  5EC7 A;  1K0S A;  4HCK A;  3VRZ A;  4DEX A;  1ZSG A;  4JJB A;  1G2B A;  5FWB A;  5IXF A;  1I07 A;  1XOV A;  4KRT A;  1YNZ A;  2F2V A;  1H8K A;  4RTY A;  2BZ8 A;  2MCN A;  2A37 A;  2DYB A;  3REA B;  3H0F A;  1OOT A;  1MUZ A;  2DBK A;  4OMP A;  2A08 A;  2DF6 A;  2V1Q A;  2BTT A;  3NHN A;  3EHR A;  1ZLM A;  2D8H A;  3UA7 A;  2NWM A;  1CKB A;  2ABL A;  1JO8 A;  1UEC A;  2ROT A;  1M3A A;  1Z9Z A;  2PNI A;  2VWF A;  2LP5 A;  4IIM A;  5IHK A;  3EG0 A;  2EPD A;  3H0H A;  4J9G A;  3I5R A;  1SPK A;  2O9S A;  1GCQ C;  1TUC A;  3RNJ A;  2J7I A;  4A63 B;  2KXD A;  2HEQ A;  4F14 A;  2JTE A;  1HSQ A;  2DL4 A;  2OI3 A;  2RMO A;  2FEI A;  3M0P A;  2C0T A;  1RUW A;  1X6G A;  2EVR A;  1Y0M A;  1YP5 A;  3VRY A;  2GTO A;  1YWO A;  1ZX6 A;  1OPK A;  1SHF A;  1UUE A;  2P4R A;  2RQR A;  2JS2 A;  4LUD A;  1UDL A;  4R0K A;  2KGT A;  3EG2 A;  3FJ5 A;  1HD3 A;  1GRI A;  1SSH A;  2CH4 W;  1YN8 A;  1M3C A;  3EG1 A;  5FWC A;  2OJ2 A;  3UAT A;  1S1N A;  1PRL C;  2KNB B;  1UJY A;  2C0I A;  1NM7 A;  1JXM A;  2XMF A;  1V1C A;  4X1V A;  1WXT A;  3VS4 A;  2EBP A;  4M4Z A;  1K4U S;  2NUZ A;  2YSQ A;  1CSK A;  2J6O A;  1AEY A;  1E7O A;  4RTW A;  1T3L A;  3TVT A;  2MOX A;  1PKT A;  1EFN A;  3VS5 A;  1W1F A;  2KT8 A;  4J9C A;  3THK A;  2KR3 A;  1X6B A;  5IXB A;  2BZY A;  3ULR B;  4RUG A;  4CC2 A;  2LJ1 A;  1M30 A;  2GTJ A;  2F2W A;  1H3H A;  4HVW A;  3M0Q A;  3H0I A;  1JEG A;  2KRM A;  4LN2 A;  3IQL A;  2GBQ A;  1B3Q A;  3I35 A;  4HVU A;  2YDL A;  2H8H A;  2EGA A;  1WI7 A;  1U5S A;  1BBZ A;  1YCS B;  1N5Z A;  1OPL A;  1GCP A;  2CSQ A;  1AZG B;  1UGV A;  3A98 A;  4AG2 C;  1OV3 A;  2LCS A;  2EYX A;  2KRN A;  3NPF A;  1SRM A;  2CH4 A;  4Z88 A;  3KFV A;  4GLM A;  2DMO A;  5IHN A;  2FPF A;  1ZUU A;  1T3S A;  3VS3 A;  1VYV A;  1NEG A;  2YUQ A;  4RTU A;  4ZNX A;  1GFC A;  2GQI A;  4FSS A;  1WXU A;  3EG3 A;  1X2K A;  2W10 A;  1JQQ A;  1GBR A;  2PTK A;  1Y57 A;  2DJQ A;  1M3B A;  1GL5 A;  2X3X D;  4HVV A;  2YUO A;  4E6R A;  1BB9 A;  1UHC A;  1WIE A;  2GNC A;  3CQT A;  2ED0 A;  1LCK A;  3I5S A;  1U3O A;  2AK5 A;  3GBQ A;  4K11 A;  3PVL A;  1E6H A;  2JMA A;  2LNH B;  2YUN A;  2DRK A;  3SEM A;  2O9V A;  2JW4 A;  2D1X A;  2ENM A;  2EYW A;  2CT4 A;  2FRW A;  2O31 A;  1TUD A;  4AG1 C;  1T0J A;  1M8M A;  2DL5 A;  2PZ1 A;  4WCI A;  2EGE A;  2K2M A;  2D8J A;  3PE0 A;  2F2X A;  2DL7 A;  2VKN A;  1AVZ C;  4J9D A;  2KE9 A;  4OMN A;  4ESR A;  1ARK A;  2FPE A;  1IO6 A;  2LQW A;  2OAW A;  2DNU A;  3EHQ A;  1SEM A;  2K3B A;  2HCK A;  2JT4 A;  2AZV A;  4J9F A;  4J9B A;  4RTX A;  1BK2 A;  1NYF A;  1X43 A;  4J9I A;  2KEA A;  1WYX A;  3UF4 A;  1H92 A;  4RTZ A;  2DVJ A;  2DL3 A;  3LH5 A;  2CUB A;  1QKW A;  4AFS C;  2MIO A;  4CC7 A;  4ORZ A;  1MV3 A;  4OML A;  1NLP C;  2KXC A;  1I0C A;  1PWT A;  2M51 A;  2I0N A;  3I9Q A;  4JZ4 A;  4CC4 B;  2O88 A;  5IHI A;  1ABQ A;  3M0U A;  2DM1 A;  2L0A A;  3H41 A;  1U06 A;  2A28 A;  3REB B;  1NLO C;  1ZBJ A;  2LMJ A;  2DBM A;  5HCK A;  3C0C A;  4LNP A;  2D0N A;  1AWW A;  2HDA A;  2LX7 A;  2DA9 A;  2K9G A;  1NEB A;  4D8K A;  2RQW A;  2FO0 A;  3EGU A;  1PRM C;  1PNJ A;  2RF0 A;  1X2Q A;  1KIK A;  3VS7 A;  4AFZ C;  4Y92 A;  1AWJ A;  1VA7 A;  1W70 A;  1K0X A;  5FW9 A;  1AZE A;  2RQU A;  2JXB A;  1W6X A;  1KJW A;  3M0T A;  2YT6 A;  4AFQ C;  1AWX A;  1QCF A;  3NGP A;  1WLP B;  4F16 A;  2FG0 A;  2IIM A;  1GCQ A;  3PVQ A;  4LUE A;  4OMO A;  1VYU A;  2LJ3 A;  2ROL A;  4JPB W;  1UJ0 A;  2KBT A;  2C0O A;  2CRE A;  1PHT A;  1GBQ A;  1QWF A;  3QWY A;  3O5Z A;  2K7A A;  4QT7 A;  2KT1 A;  1FMK A;  4DEY A;  1QLY A;  2DRM A;  2ECZ A;  2KYB A;  3VS6 A;  2EQI A;  1G83 A;  1RLQ C;  2AZS A;  2L3P A;  2RNA A;  3TSZ A;  3SHW A;  2X3W D;  3R6N A;  2K79 A;  2CDT A;  2SRC A;  2KYM A;  1ZUY A;  1RI9 A;  2DE0 X;  1T0H A;  3TSW A;  5IH2 A;  2LQN A;  2JM9 A;  5I11 A;  1VYT A;  1AOJ A;  2KRS A;  2RN8 A;  2K6D A;  2J6F A;  2L2P A;  5ECA A;  2DLP A;  3UA6 A;  2VVK A;  2V1R A;  4RTT A;  1ABO A;  1QKX A;  5GJW B;  2CUD A;  1B07 A;  2DIL A;  1K76 A;  1WDX A;  2CSI A;  1ZUK A;  3VS0 A;  2HSP A;  3VS1 A;  1RLP C;  1A0N B;  2RQT A;  1KFZ A;  2E5K A;  2L3Q A;  4HXJ A;  1WA7 A;  1UG1 A;  1Z9Q A;  3M0R A;  4JJC A;  1X27 A;  5L23 A;  1M27 C;  1MV0 B; 
#chains in the Genus database with same CATH topology
 2GGR A;  2L8D A;  4FYX B;  3OMG A;  3QZ9 B;  4EIK A;  5CVI A;  3T9N A;  2OAU A;  4HCZ A;  2LZ6 B;  3PGG A;  4OMM A;  1VQK Q;  3JCM X;  2EKH A;  3V8J A;  1I4K 1;  2L3S A;  3C12 A;  5KE2 A;  3U23 A;  1TWB A;  3ASK A;  2FRY A;  1W2B P;  1NE8 A;  3OW2 A;  2FZK B;  1FXX A;  5GMK e;  3M53 A;  4PJO B;  4PJO A;  3OYY A;  3M5A A;  4OB1 B;  2QQ9 A;  2LJ0 A;  4M78 G;  5LJ3 h;  2MMP A;  5GAM j;  1CKA A;  1Y7X A;  1K9A A;  4E2F B;  1YIT Q;  2HL5 C;  4XTU A;  4JJD A;  3NMZ C;  3TCJ A;  2PQW A;  2AKL A;  3OYD A;  4BD3 A;  2QQA A;  2BUD A;  3JV3 A;  2EW3 A;  3RBB B;  5GAN 2;  4CC3 A;  2QEX T;  2EYZ A;  3PIO A;  2QG9 B;  2DX1 A;  4JRI A;  3EGD B;  3MCA B;  1JJ2 S;  3EGD A;  2RQV A;  2QA4 Q;  2EGC A;  1K0S A;  4HCK A;  2X4J A;  4C8Q F;  2OTJ T;  4L5G A;  4KUL A;  2R58 A;  5LJ3 j;  4JLG A;  2P4T A;  5IXF A;  2BIV A;  2RJD A;  2A37 A;  2PVG B;  3UPU A;  3MPU B;  2HD0 A;  5A0D A;  1D1B A;  2V1Q A;  3DB3 A;  4VUB A;  4A4F A;  2RI5 A;  2DD5 A;  1ZLM A;  2D8H A;  1CKB A;  2P0P A;  1WZO A;  2ROT A;  5CR2 A;  1ZSZ C;  5KH6 A;  2PNI A;  4ME7 A;  3H8Z A;  2LP5 A;  1YJW A;  1K8A C;  1WHG A;  1M9S A;  2M9U A;  2K3X A;  3H0H A;  5GAN e;  1LJO A;  2O9S A;  3MEU A;  1TUC A;  3RNJ A;  2JNG A;  2DL4 A;  1YJ9 Q;  4M7A E;  3EFO B;  3QBY A;  4QVC A;  3EFO A;  5I2S A;  3A8O B;  3M0P A;  2XKO C;  4XK8 E;  1AHJ B;  4IKF A;  1RUW A;  1KK7 A;  1YP5 A;  3VRY A;  4BDZ A;  4DOV A;  1MND A;  4PJM A;  1ZX6 A;  3JB9 F;  1FX7 A;  1XTD A;  2AIR B;  2JS2 A;  3L2Q A;  1UDL A;  3EG2 A;  3FJ5 A;  3ZEH A;  1GRI A;  1SSH A;  2DIQ A;  1KD1 U;  3DLL A;  1YN8 A;  4PLI A;  3MP6 A;  4ZGE B;  4XTX A;  1S72 A;  3CCL A;  3CCS Q;  2A7Y A;  3EG1 A;  4PJN A;  2OJ2 A;  1NZ9 A;  1ZBX A;  5CKH A;  3LGF A;  1UJY A;  2C0I A;  2L89 A;  1BIA A;  4O5V A;  4PNO A;  2PVO B;  3CCE Q;  4HT8 A;  5FRO A;  3OA6 A;  1WQW A;  1PM3 A;  3SD4 A;  2YRC A;  2NUZ A;  2YSQ A;  3E1S A;  1E7O A;  3GLX A;  4RTW A;  1T3L A;  2JVV A;  1TTH B;  3E9F A;  4JRK A;  4WTO B;  2DD4 A;  1QP3 A;  1QCO A;  1X6B A;  2KMT A;  4MZP A;  4M78 B;  1KQS P;  3ME9 A;  2QTV A;  4J6X A;  4M78 A;  4RUG A;  4C92 D;  1M30 A;  5DLO A;  2E5Q A;  2EYQ A;  3CXC P;  5A2Q E;  2XD0 A;  1YJW T;  2YDL A;  3CC4 T;  2H8H A;  1YCS B;  1OPL A;  2RK1 A;  2CSQ A;  4C8Q D;  2GF7 A;  1VQ6 Q;  3A98 A;  5GAO m;  2EYX A;  1M1K C;  2KRN A;  5CO7 A;  1SRM A;  4KT0 E;  5CKF A;  3CEY A;  2FPF A;  1ZUU A;  1T3S A;  3FIF A;  1WJR A;  4M7A C;  4RTU A;  4ZNX A;  4C92 G;  4XU3 A;  3OYB A;  3SWN C;  2QTX A;  1WXU A;  3G4S A;  1M1G A;  4M77 E;  2QEX Q;  1ZA2 B;  1Q86 U;  2B8A A;  1Y57 A;  1WJS A;  3QDR B;  4F04 B;  2P84 A;  2X3X D;  3CCL T;  2RJE A;  1Q95 G;  2GNC A;  3CQT A;  4EMK C;  1M90 R;  2E65 A;  5A0L A;  2V8I A;  2MI6 A;  4A53 A;  2JMA A;  2OTJ Q;  5HK0 A;  1WHJ A;  1IGU A;  2YUN A;  3V7R A;  2DRK A;  3JCM Q;  4DBF A;  1I8F A;  2CT4 A;  2EJF A;  4RKU E;  2X4W A;  1TUD A;  1OI1 A;  3FEO A;  3QG1 A;  4AG1 C;  1FWZ A;  2M0O A;  2PZ1 A;  1VQN Q;  4LDY A;  2R5A A;  3KBG A;  3GPL A;  2F2X A;  2DL7 A;  5LJ5 f;  3JCM e;  4WF2 A;  1K73 R;  2E10 A;  4ANJ A;  4PJO E;  4OMN A;  4RCC A;  2DEU A;  1IB8 A;  1VQ7 Q;  2DNU A;  3EHQ A;  1Q82 R;  2K3B A;  5GAM e;  2JT4 A;  1VUB A;  1C6V X;  4J9F A;  2KSS A;  2RA2 A;  2C06 A;  4J9B A;  4RTX A;  1KQ2 A;  1QVF S;  2MAM A;  1D0Z A;  2DYI A;  2MIO A;  3CCV Q;  4ORZ A;  3BDL A;  5KYY B;  1H3Z A;  4PFO A;  5KYY A;  2RD1 A;  1ABQ A;  4E7S A;  2L0A A;  1U06 A;  1ZBJ A;  3C95 A;  4OF1 A;  4JJN K;  3G4S T;  2DXB A;  3JB9 J;  4X9C A;  1AWW A;  2DA9 A;  1OZ2 A;  4D8K A;  2FO0 A;  2Y4Y A;  5LJ3 e;  4PL6 A;  3HHT B;  1JJ2 P;  1ZSZ B;  4C5G A;  3GOX A;  1ZSZ A;  2ZPI B;  4M75 C;  3CPW P;  3GNF B;  3L42 A;  4RCB A;  1KJW A;  2EIF A;  2KDS A;  4AFQ C;  3OSS C;  1IZ6 A;  1N9S A;  3HRS A;  3NTH A;  1WLP B;  4J6Y A;  2E41 A;  3CC7 A;  8ATC B;  2HNI A;  2AT1 B;  3PVQ A;  4LUE A;  4OMO A;  1OX9 A;  1VYU A;  2ROL A;  2K5F A;  2EJ9 A;  1PHT A;  3RDV A;  4E7I A;  3HPW A;  1YJW Q;  3CCR A;  3CC4 Q;  3VUZ A;  4BUG A;  1RL2 A;  2PVD B;  3QKJ A;  2VYT A;  2WSE E;  4PK4 A;  2KYB A;  3VS6 A;  1YJN A;  3Q1J A;  5CQY A;  3TSZ A;  2QAZ A;  5IAY A;  1FMW A;  4E7K A;  4NOY A;  3G1J A;  2X4X A;  2DE0 X;  1RAA B;  1T0H A;  2LQN A;  4A4G A;  3QHS A;  2EWN A;  1D1A A;  1EX4 A;  3M4Y A;  1RAH B;  1TH7 A;  2JN0 A;  2L2P A;  3UA6 A;  1VIE A;  3G71 T;  1PG5 B;  1QKX A;  1N8R R;  2CUD A;  4JS5 A;  3OYG A;  1WDX A;  3VS0 A;  1HYO A;  2EQK A;  1A0N B;  2L3Q A;  4HXJ A;  5KYW B;  1WA7 A;  2H3E B;  3OQ5 A;  5KYW A;  2K4Y A;  4GLK A;  2FZG B;  2NLU A;  4JJC A;  1X27 A;  3D7S B;  4M78 E;  4PKC C;  2BKD N;  3OYM A;  4M75 G;  4Z8A A;  2E4H A;  4KH1 B;  3CPW A;  2X51 A;  1SG5 A;  1UTI A;  2DER A;  4M7D C;  4N0A C;  3X28 B;  4Z89 A;  1UFF A;  4C0D B;  1IRX A;  1QVG P;  4AFU C;  1SSF A;  1TU0 B;  2CT3 A;  3CCR T;  4CRI A;  4F7U G;  4J9H A;  1UE9 A;  1TG0 A;  4M7A B;  1KSW A;  4PFZ A;  3TEE A;  4M7A A;  4A4H A;  3SWN B;  3SWN A;  1FYN A;  2HQE A;  2RK2 A;  2QAS A;  2KRO A;  1E6G A;  2HSE B;  2M0Y A;  3VKI A;  2DTH A;  1VQO T;  1X6O A;  4EDU A;  2FVU A;  2BE9 B;  2L5Q A;  3JB9 H;  1AWO A;  9ATC B;  3C94 A;  1NYG A;  5GAN 5;  2AKK A;  3ER0 A;  2B86 A;  3BFM A;  5GJV B;  5I22 A;  2J06 A;  4MMK A;  3MP8 A;  2JS0 A;  2CP0 A;  3JCM V;  4M7D D;  2XID A;  4XTW A;  1WFW A;  4J7F A;  4EPC A;  2K3Y A;  4DOW A;  2HMA A;  2LNV A;  5DLQ E;  2E1H A;  1PD1 A;  1SRL A;  2MPX C;  3JCM P;  1EZZ B;  3P8H A;  5LJ5 j;  4PFP A;  1RAI B;  2A0F B;  3HL8 A;  3N5B B;  4J5Y A;  3J81 E;  5J39 A;  1M90 C;  5D7U A;  2Y4X A;  1UEB A;  5HK3 A;  1O9S A;  3M55 A;  1ZSG A;  2M16 A;  3JCM b;  5I21 A;  2PUO B;  1YNZ A;  2F2V A;  2MCN A;  4ZGD B;  4M7D G;  3CCQ A;  3H0F A;  4NL2 A;  1DJ7 B;  2RJC A;  3P8B B;  1QVG A;  3EHR A;  1EIF A;  1JO8 A;  1UEC A;  4QQ6 A;  2VWF A;  1OU8 A;  4ELY C;  2A3L A;  4XU2 A;  3I5R A;  1SPK A;  2HQH A;  1Q82 C;  1QVF P;  3PTA A;  3A5Z B;  2KXD A;  3RMS A;  3E9G A;  3M4G A;  2OI3 A;  3FC3 A;  2XHC A;  2O01 E;  1X6G A;  3I56 A;  1Y0M A;  4J83 A;  4M75 B;  3G71 Q;  1NPR A;  1X01 A;  4M75 A;  1SHF A;  5CAI A;  3QDF A;  2WSF E;  3ZFJ A;  1MMN A;  3CCJ A;  3UAT A;  3QPH A;  1PRL C;  4JDS A;  1LOJ A;  2R5M A;  4DBQ A;  3NTK A;  2COW A;  1NM7 A;  5FRN A;  3HTR A;  4X1V A;  1ACM B;  3LGL A;  2LT4 A;  2OTL A;  2EAY A;  2MOX A;  3CCQ T;  2KT8 A;  4PJL A;  3THK A;  3GNG A;  4FL6 A;  5IXB A;  2ZPE B;  2BZY A;  4QQD A;  4ATO A;  3LWI A;  3CCR Q;  2GTJ A;  1H3H A;  3M0Q A;  3M57 A;  2MK5 A;  2KRM A;  4LN2 A;  1KD1 R;  2GBQ A;  2HQX A;  2EGA A;  1WI7 A;  3CBM A;  1U5S A;  1BBZ A;  2X4Y A;  1N5Z A;  3F70 A;  4FT2 A;  1VQO Q;  4AG2 C;  4DBH A;  2E6N A;  3DKM A;  3VUB A;  2NUP B;  2NUP A;  1D0Y A;  2DMO A;  3I56 T;  3CME A;  2LQK A;  5HY6 A;  1NEG A;  1Y71 A;  2GQI A;  1RAF B;  4FSS A;  4C0G A;  3EG3 A;  1TXQ A;  4BI4 A;  4ZN1 A;  3CCJ T;  2LVM A;  2DJQ A;  4N0A A;  1GL5 A;  1BB9 A;  1UHC A;  1WIE A;  1KC8 U;  1N8R C;  3OS5 A;  2ED0 A;  1OQK A;  4DQ2 A;  5CKE A;  3OS2 A;  5GAN d;  2AK5 A;  3GBQ A;  1G3T A;  3CCM A;  1Q7Y U;  1M5Q 1;  1R0C B;  1IGQ A;  1W2B A;  2DK3 A;  1Q81 U;  4J7I A;  2OTL T;  3SEM A;  2HZY A;  2O9V A;  3A8M B;  2D1X A;  2ENM A;  2PU9 B;  1QVP A;  2O31 A;  5CK9 A;  1RI0 A;  3FRN A;  3V8K A;  2E70 A;  3FLG A;  1M8M A;  4E7J A;  2DAQ A;  2DL5 A;  3MP1 A;  4BB7 A;  1OX8 A;  2CYZ B;  2GCX A;  3EH1 A;  3RKX A;  2EGE A;  2K2M A;  5CCA A;  2VKN A;  4C92 C;  3X20 B;  1AVZ C;  2K57 A;  4JRQ A;  2FZC B;  4V2S A;  2YHT A;  5AYF A;  1Q86 R;  2LQW A;  2OAW A;  2JZ2 A;  1YI2 A;  2VC8 A;  3G6E A;  5GAN 8;  4C8Q C;  1MMD A;  2QQB A;  1BK2 A;  1NYF A;  1X43 A;  2FHD A;  2KEA A;  2DTI A;  2DL3 A;  2CUB A;  4FYY B;  1O75 A;  4AFS C;  4OMF B;  2I0N A;  3I9Q A;  4PLL A;  5IHI A;  4M7A F;  3M0U A;  6AT1 B;  3REB B;  1G3S A;  1XJW B;  4HCC A;  1LPL A;  5HCK A;  3A8G B;  4LNP A;  3PFS A;  4Q5W A;  5LJ5 e;  2RH2 A;  3QYH B;  1M2O A;  2IG0 A;  2RQW A;  3OYN A;  3EGU A;  2RF0 A;  1KIK A;  3OYK A;  3VS7 A;  5LL6 S;  1G8X A;  2RHX A;  5J26 A;  2KI7 A;  1AWJ A;  1K0X A;  1MNE A;  2RQU A;  2JXB A;  3H9N A;  3CCQ Q;  3M0T A;  1BI3 A;  4OB2 B;  1NJI U;  4F16 A;  4MDW A;  2FG0 A;  2IIM A;  4LDW A;  5KYU B;  5KYU A;  2LJ3 A;  4HA8 A;  2CZ6 B;  3S3N A;  3CBO A;  1OZ3 A;  5L8R E;  5DM7 R;  1BI0 A;  2ATC B;  3L2Z A;  4DEY A;  1YI2 T;  4A54 A;  3G6E T;  2XIC A;  3UWN A;  1S72 T;  1G83 A;  2HKN A;  2H3J A;  3FB9 A;  4XTZ A;  3R6N A;  4C8Q G;  4YTL A;  4M75 E;  1QMC A;  1SF9 A;  2KYM A;  3TQ7 P;  1ZUY A;  4OGC A;  3OYE A;  2DVE A;  3S3O A;  2IPO B;  1D09 B;  2RN8 A;  5ECA A;  2DLP A;  5GAN g;  3HFO A;  2XI9 A;  3JCM d;  3JB9 D;  2V1R A;  3CCJ Q;  4F7U E;  1ABO A;  3OW2 S;  2V8J A;  4FW1 A;  4BY6 C;  1KQS A;  3R6O A;  4E7Z A;  4X34 A;  1RLP C;  3CCU A;  4M77 F;  1UG1 A;  4D6W A;  3CXC A;  3M0R A;  2OTL Q;  1VQM A;  1VQP A;  1M27 C;  3UT1 A;  3QWX X;  1XNI A;  5I2M A;  3A8H B;  3VS2 A;  2W0Z A;  4D8D A;  4C0F A;  3X26 B;  1YFN A;  3JB9 G;  1QWE A;  2G6F X;  3LW5 E;  3OY9 A;  1K9M U;  3EFS A;  2G3R A;  4GY5 A;  4PJO F;  2EFI A;  2QDL A;  1HXD A;  4RTV A;  2ED1 A;  3NFC A;  4IIO A;  4RMO A;  2VB6 A;  2ESW A;  1VQ8 A;  1KD1 C;  3VJP A;  1IXD A;  3GP8 A;  2JMC A;  4Z02 A;  2FB7 A;  5GMK h;  1WGS A;  2HBW A;  2EYY A;  1IRE B;  5GAO p;  1YWP A;  4M7D E;  2YLC A;  1OEB A;  1AD5 A;  4QW2 A;  4KGV B;  4NS5 A;  2X35 A;  4A4K A;  2Y90 A;  1VIF A;  4J6W A;  5GAO q;  2LX9 A;  4HKE A;  2JOY A;  5KYN A;  4Y91 A;  1WHK A;  3CBP A;  2QGF B;  2CP5 A;  1U1T A;  2DL8 A;  2ZPG B;  3CCU T;  2QYZ A;  3QYG B;  3OBY A;  4C92 B;  1G5V A;  1I1J A;  3CC2 A;  3EG9 B;  4OMQ A;  2JTM A;  4C92 A;  3EG9 A;  1NG2 A;  4J9E A;  1RAC B;  3M58 A;  2QK0 A;  3RES A;  4LDX A;  3EH2 A;  1PKS A;  5EC7 A;  2J6K A;  1VQP T;  2CZ7 B;  2XDP A;  3H6Z A;  4FU6 A;  4JJB A;  1G2B A;  3MKD A;  5FWB A;  2HBP A;  3OS0 A;  2VXE A;  1I07 A;  1F1B B;  3OB9 A;  4C8Q B;  1YIT A;  2RI2 A;  4C8Q A;  2BZ8 A;  2DYB A;  3REA B;  2CP2 A;  3RMQ A;  4JS4 A;  3QXE B;  2DBK A;  2EQM A;  4Y28 E;  1V76 A;  4ZTJ A;  4M77 D;  5FU6 C;  3UA7 A;  2ABL A;  1PSF A;  2RM4 A;  2VGN A;  1M3A A;  3G6E Q;  1Z9Z A;  1S72 Q;  3CCL Q;  5GAN 4;  2CP3 A;  3S6W A;  5IHK A;  3E2U A;  3EG0 A;  1I5L A;  1Q86 C;  2XK0 A;  1WHM A;  4J9G A;  5CIU A;  1JBM A;  2RHU A;  5GAN h;  3JCM g;  4F14 A;  2FL7 A;  8AT1 B;  4LDU A;  1JJ2 A;  4FW2 A;  3J7A F;  1KHC A;  2EVR A;  2MYS A;  2DFU A;  2HL3 A;  2GTO A;  1YWO A;  2HAX A;  3CC7 T;  3HRU A;  1UUE A;  4IUT A;  2P4R A;  4LD6 A;  2RQR A;  4LUD A;  1MMG A;  4PJO D;  1QW1 A;  2KGT A;  2YRV A;  1VOM A;  1HD3 A;  4RG8 A;  1UGR B;  2CH4 W;  2GFU A;  4BI8 B;  2LTO A;  4J8O A;  3WVD B;  5FWC A;  3BY7 A;  3CC2 T;  4JLI A;  4BE1 A;  2KNB B;  3O8V A;  3PT9 A;  1B34 B;  2XMF A;  3PMT A;  1B34 A;  1YJN T;  1V1C A;  2DZC A;  3HKS A;  3L2W A;  1I81 A;  4LDV A;  1G3Y A;  1AEY A;  4KUD K;  1MGQ A;  3E19 A;  4M78 F;  1YIT T;  3VS5 A;  4BI3 A;  4EMK B;  1W1F A;  4J9C A;  4EMK A;  3EFR A;  3ULR B;  5IN1 A;  1R8O B;  3OYI A;  2LJ1 A;  5GAO l;  3G4S Q;  2D6F A;  4MDX A;  2F2W A;  4C5I A;  2D0Q B;  1RAB B;  3MET A;  3IQL A;  3QUI A;  1B3Q A;  4HVU A;  3WVE B;  2F5T X;  2E64 A;  4XU1 A;  2X9H A;  4BY6 B;  2DEQ A;  3CCE A;  2LCS A;  1Y07 A;  3LH0 A;  3RKY A;  1WQ7 A;  3NPF A;  2CH4 A;  1TS9 A;  4HT9 A;  2WSC E;  3CPF A;  2KQW A;  2CZ0 B;  3VS3 A;  4EMG A;  4BE2 A;  4E7L A;  1BIB A;  1MHN A;  4XTY A;  4C5E A;  2DIG A;  2JTF A;  1GFC A;  3SDZ A;  1RAG B;  1K8A U;  3OW2 P;  1GBR A;  2NUT B;  5CKB A;  1VQ4 A;  2LC4 A;  2NUT A;  3CCU Q;  3JCM W;  4HCB A;  2YXY A;  1QQJ A;  3MJX A;  3CD6 A;  4XQ3 A;  5M9O A;  3I5S A;  2P0K A;  1UB4 A;  2NYS A;  1VQ6 A;  4KGZ B;  4R56 A;  3OYJ A;  5EG2 A;  3HSB A;  1P92 A;  5GAN 6;  2JW4 A;  2EYW A;  2DTO A;  1H64 1;  1BYM A;  1T0J A;  2DXC A;  4ZN3 A;  4N4I A;  1UGP B;  4ZGJ B;  5KCO A;  1X75 C;  4J9D A;  5GMK m;  1ARK A;  3JCM h;  4MZM A;  1RAE B;  2FPE A;  2YRD A;  5DY9 A;  4XAX B;  2RJF A;  1BI2 A;  4BDY A;  1KC8 R;  1R0B G;  2EKO A;  2HCK A;  3CCE T;  5GAM h;  2OTJ A;  1Q7Y R;  1WYX A;  4M78 D;  3UF4 A;  4F7U B;  4F7U A;  1Q81 R;  4IUR A;  1QKW A;  4CC7 A;  1VQ9 A;  1MV3 A;  4OML A;  1NLP C;  1PWT A;  2M51 A;  3CC7 Q;  4CC4 B;  4JZ4 A;  1VQN A;  2O88 A;  3RKW A;  4C0Z A;  3KXT A;  2CP7 A;  1NLO C;  4C92 E;  2LMJ A;  4E7H A;  2DBM A;  1VQ4 T;  4KBM B;  2DZ9 A;  2LX7 A;  1TSF A;  2CZ1 B;  3QO3 A;  3CC2 Q;  1VQ7 A;  3CD6 T;  1PRM C;  1PNJ A;  1R77 A;  1YBY A;  1M1K U;  1OU9 A;  3INZ A;  3MEW A;  1YJN Q;  4C8Q E;  3NTI A;  1VQ6 T;  5FU6 B;  4Y92 A;  3OYL A;  1W70 A;  2KVQ G;  2XU8 A;  5KE3 A;  5FW9 A;  1AZE A;  4ZTF A;  1PD0 A;  3CCV A;  1QCF A;  2MF2 A;  1QVF A;  1W4S A;  4FYV B;  4KGX B;  4QVZ A;  2EJG A;  2KBT A;  2DXU A;  4C92 F;  1GBQ A;  1M1F A;  1QWF A;  3QWY A;  4FYW B;  2M02 A;  2K7A A;  4QT7 A;  1QCN A;  1BCO A;  1FMK A;  5KYX B;  4M7D B;  5KYX A;  4M7D A;  4OGE A;  1QLY A;  2DRM A;  2ECZ A;  1BI1 A;  2EQI A;  2GQV A;  2LDM A;  2L3P A;  3CPW S;  3HRT A;  2X3W D;  2JJ9 A;  2CDT A;  2HKQ B;  4O6J A;  2SRC A;  1UGQ B;  1HK9 A;  3GIB A;  2WAC A;  3M59 A;  1LVK A;  1VQ9 T;  3TSW A;  5IH2 A;  2JM9 A;  1VYT A;  1VQN T;  3UDC A;  1OYX A;  1NJI R;  4FM4 B;  4X9D A;  4RTT A;  5FLX E;  5CQX A;  5GJW B;  3S3M A;  5FU7 C;  2DIL A;  3OYA A;  3CC4 A;  1VQ7 T;  2ZGW A;  2HSP A;  3VS1 A;  3MEV A;  3JB9 I;  1YHQ A;  2ZPH B;  3JRZ A;  3V7C A;  2XDD A;  1WJQ A;  2VUB A;  1MV0 B;  2M1H A;  4P5N A;  1TUG B;  3CCV T;  1Y96 B;  1V29 B;  4LE9 A;  4FCY A;  2DPP B;  1Y96 A;  5GAN 3;  2SEM A;  1M2V B;  1M2V A;  2AHJ B;  2J05 A;  3CME T;  1YIJ A;  3JSC A;  2V26 A;  1AT1 B;  3ZBD A;  4L59 A;  5LJ5 d;  4B9X A;  1KQ1 A;  1I5O B;  4FIB A;  2KAF A;  2A36 A;  3PNW C;  2QXF A;  3VV0 A;  1WHH A;  1WX6 A;  3ZL7 C;  2FPD A;  2EQJ A;  3BE3 A;  1K1Z A;  5KCH A;  4IUQ A;  2BZX A;  4II1 A;  1B7T A;  2O2O A;  1IHV A;  4B9W A;  4LD9 K;  2CP6 A;  3CCM T;  3MHX A;  3M54 A;  1JXO A;  4IUP A;  1OUL A;  2E3H A;  1UHF A;  1U1S A;  3GF5 A;  3I55 A;  3CMA A;  1MMA A;  1X69 A;  2O4X B;  2O4X A;  1QVG S;  1BU1 A;  1YCY A;  1C1A A;  1JU5 C;  1KHI A;  1GFD A;  2YUP A;  1VQ4 Q;  2MWP A;  1G3W A;  4RG2 A;  2DET A;  1C0M A;  2RB6 A;  4OVA A;  1JB0 E;  4GBQ A;  3L2V A;  1VQL A;  3CD6 Q;  1K9M R;  2JM8 A;  1YHQ T;  4JZ3 A;  1ZHI A;  4F17 A;  5GAN f;  1GXI E;  2RPN A;  1J3T A;  2YLB A;  1HJD A;  3M0S A;  4C0D C;  1SHG A;  1WXB A;  3VRZ A;  4QKU A;  4DEX A;  5GMK i;  2F5K A;  1XOV A;  4KRT A;  2Z0W A;  1H8K A;  4RTY A;  3I56 Q;  4BE0 A;  4L6V 5;  1OOT A;  1YIJ T;  1RAD B;  1MUZ A;  2I2L A;  4OMP A;  3LYI A;  2A08 A;  5AT1 B;  2DF6 A;  4KH0 B;  2BTT A;  3NHN A;  3RER A;  2RHI A;  1U8R A;  2NWM A;  2RI3 A;  2ZPB B;  2QQS A;  3QII A;  4OB3 B;  4IIM A;  3P8D A;  1JRI A;  2EPD A;  5GMK l;  2XG8 D;  2E6Z A;  5GAM d;  3WXM B;  1GCQ C;  1KC8 C;  2J7I A;  1VQ9 Q;  4A63 B;  2HEQ A;  1TOV A;  2JTE A;  1HSQ A;  3I55 T;  5IT9 E;  3A8L B;  1VQ5 A;  3CMA T;  2RHY A;  2RMO A;  1Q7Y C;  2FEI A;  5D6X A;  2FYK A;  4M75 F;  2C0T A;  1Q81 C;  4M7A D;  2COZ A;  5C0M A;  3OBW A;  5D6W A;  2COY A;  3X24 B;  2OX7 A;  1OPK A;  4AMC A;  1VQL T;  4R0K A;  4CI0 C;  4OB0 B;  4B6M A;  1M3C A;  4F7U F;  5CKD A;  3VYH B;  3QZ5 B;  3PIP A;  2LQ8 A;  1S1N A;  2VV5 A;  5A0G A;  2K5L A;  3G7Z A;  3LWH A;  3VYG A;  4AT1 B;  4TVR A;  2VXF A;  1JXM A;  2K5I A;  5LJ3 d;  5GAO n;  2RHZ A;  3RUX A;  1ZQ1 A;  1WXT A;  4XU0 A;  3QJ6 A;  3VS4 A;  2DXT A;  2EBP A;  4M4Z A;  1K4U S;  5LJ5 g;  1CSK A;  2J6O A;  3SFM A;  1D0X A;  3TVT A;  1PC0 A;  1WNL A;  1PKT A;  2QDY B;  7AT1 B;  1EFN A;  2KY9 A;  3X25 B;  3OYF A;  2LCL A;  4M7A G;  3BDU A;  3CME Q;  2KR3 A;  3VU3 C;  4DA4 A;  1XQH A;  3G71 A;  3EAE A;  4IUU A;  4CC2 A;  4MZT A;  1M8V A;  2CS7 A;  2VGM A;  3EGX B;  4E47 A;  3EGX A;  4HVW A;  3H0I A;  4M77 C;  1VQK A;  3RR6 A;  1JEG A;  3I35 A;  1M90 U;  1W2B S;  5C6S A;  2D9T A;  5FU7 B;  1GCP A;  2JUF A;  1AZG B;  1UGV A;  2RO0 A;  3OS1 A;  3CCM Q;  1OV3 A;  5J3B A;  2YWW A;  2K2V A;  2EQU A;  2DJZ A;  1VQM T;  1UGS B;  4ELZ C;  2CKK A;  1VQ5 T;  4Z88 A;  3KFV A;  4KUI A;  4GLM A;  5GMK j;  4R55 A;  5IHN A;  2LCC A;  1WPY A;  2DKG A;  3L2R A;  1N27 A;  1VYV A;  2CGH A;  1D3B B;  2YUQ A;  3FJP A;  1D3B A;  3JCM f;  5GAN 7;  2LRQ A;  2E3I A;  1FMV A;  2KK4 A;  2QI2 A;  4N4H A;  1K73 U;  4M7D F;  3HP9 A;  1X2K A;  2W10 A;  1NJI C;  1JQQ A;  2PTK A;  3AHU A;  4PJO C;  1YHQ Q;  1BCM A;  1M3B A;  4HVV A;  2YUO A;  4E6R A;  2F69 A;  5GAM f;  1Q82 U;  4OP0 A;  1LCK A;  1YI2 Q;  1U3O A;  4K11 A;  3PVL A;  2MWO A;  1E6H A;  1VQO A;  1VQ8 T;  2LNH B;  2VAS A;  4M75 D;  1NPP A;  2QA4 A;  3C4S A;  4C5H A;  2FRW A;  3RIR A;  4FSX A;  3DLM A;  3JAM E;  2IVW A;  1YIJ Q;  1PSE A;  1SKU B;  4WCI A;  2D8J A;  3PE0 A;  3L2U A;  3TRE A;  4IUV A;  2KE9 A;  1K8A R;  3OYH A;  5GAM g;  4ESR A;  4QQG A;  1VQK T;  3QJY A;  4M77 G;  1IO6 A;  5HKC A;  3JCM c;  5LJ3 f;  3QSU A;  1SEM A;  3MEA A;  2R57 A;  3OSV A;  4N4G A;  2AZV A;  3V7S A;  4J9I A;  3I55 Q;  1H92 A;  3PMI A;  2DO3 A;  3CMA Q;  4RTZ A;  2DVJ A;  3LH5 A;  2QQR A;  5GAN j;  2GFA A;  1I0C A;  2KXC A;  3A1P A;  2QGG A;  1YJ9 A;  2DM1 A;  3H41 A;  2A28 A;  2BE7 D;  1VQL Q;  4PJJ A;  4A4E A;  3OYC A;  4FT4 A;  3TU4 K;  3C0C A;  4XTV A;  5LJ3 g;  2D0N A;  2HDA A;  1QP2 A;  2K9G A;  4PJO G;  1NEB A;  5LJ5 h;  5D6Y A;  3MO8 A;  3JCM J;  1X2Q A;  1K9M C;  4EMH A;  2F1L A;  2PUK B;  4AFZ C;  3CCS A;  3SB2 A;  1VA7 A;  1ZA1 B;  3AT1 B;  4UC4 A;  1M4Z A;  1W6X A;  4QVD A;  2QA4 T;  4DBR A;  3URG A;  2YT6 A;  1AWX A;  3M9Q A;  5GAO r;  3NGP A;  4JUV A;  3FDR A;  1GCQ A;  1PCX A;  1KQS S;  2ZCF B;  4JPB W;  1UJ0 A;  2C0O A;  2CRE A;  1N8R U;  3O5Z A;  3L1A A;  2V8K A;  4BAC A;  3CXC S;  2KT1 A;  3M56 A;  2LT1 A;  3DB4 A;  3J80 E;  3LX7 A;  1N6A A;  1D1C A;  1RLQ C;  2AZS A;  1M1K R;  2RNA A;  3SHW A;  1VQM Q;  2K79 A;  1VQ5 Q;  1N9R A;  4LXC A;  4M78 C;  1VQP Q;  4MML A;  1RI9 A;  3KUF A;  2P0Q A;  1YJ9 T;  5I11 A;  1AOJ A;  2KRS A;  3BW1 A;  3V8L A;  2K6D A;  2J6F A;  1WHL A;  2VVK A;  2ZPF B;  1K73 C;  5FRM A;  1B07 A;  2E12 A;  1K76 A;  2CSI A;  1ZUK A;  2XDB A;  3LLR A;  2QEX A;  2RQT A;  1KFZ A;  1KG1 A;  2E5K A;  2ZZD A;  4JRP A;  2L3R A;  3CCS T;  1Z9Q A;  1LNX A;  1VQ8 Q;  1BKB A;  4M77 B;  1IHW A;  4M77 A;  4NL3 A;  5L23 A;  2ZAE A;  3HFN A;  3OMC A;  1NBE B; 
#chains in the Genus database with same CATH homology
 3QWX X;  4Z8A A;  4LE9 A;  1UTI A;  3VS2 A;  2W0Z A;  4D8D A;  2GGR A;  2SEM A;  4EIK A;  4Z89 A;  1UFF A;  2J05 A;  1QWE A;  2LZ6 B;  2G6F X;  4OMM A;  4AFU C;  2EKH A;  2CT3 A;  2L3S A;  4J9H A;  1UE9 A;  1TG0 A;  2A36 A;  1KSW A;  3U23 A;  1WX6 A;  3ZL7 C;  2FPD A;  2QDL A;  4RTV A;  2ED1 A;  2FRY A;  4IIO A;  1FYN A;  2ESW A;  1K1Z A;  2BZX A;  2O2O A;  2JMC A;  2KRO A;  1E6G A;  2M0Y A;  2LJ0 A;  2HBW A;  2EYY A;  1JXO A;  1YWP A;  1AWO A;  1UHF A;  1NYG A;  1CKA A;  1OEB A;  1X69 A;  1K9A A;  1AD5 A;  2AKK A;  4JJD A;  2B86 A;  5GJV B;  5I22 A;  2J06 A;  1BU1 A;  1JU5 C;  3NMZ C;  2JS0 A;  1GFD A;  2AKL A;  2YUP A;  1WFW A;  3JV3 A;  2EW3 A;  4GBQ A;  3RBB B;  2DL8 A;  4CC3 A;  2JM8 A;  2EYZ A;  4JZ3 A;  4F17 A;  1I1J A;  1SRL A;  2RPN A;  1J3T A;  4OMQ A;  2DX1 A;  1NG2 A;  4J9E A;  1HJD A;  3M0S A;  1PKS A;  1SHG A;  1WXB A;  2J6K A;  2RQV A;  2EGC A;  5EC7 A;  1K0S A;  4HCK A;  3VRZ A;  4DEX A;  1ZSG A;  4JJB A;  1G2B A;  5FWB A;  5IXF A;  1I07 A;  1XOV A;  4KRT A;  1YNZ A;  2F2V A;  1H8K A;  4RTY A;  2BZ8 A;  2MCN A;  2A37 A;  2DYB A;  3REA B;  3H0F A;  1OOT A;  1MUZ A;  2DBK A;  4OMP A;  2A08 A;  2DF6 A;  2V1Q A;  2BTT A;  3NHN A;  3EHR A;  1ZLM A;  2D8H A;  3UA7 A;  2NWM A;  1CKB A;  2ABL A;  1JO8 A;  1UEC A;  2ROT A;  1M3A A;  1Z9Z A;  2PNI A;  2VWF A;  2LP5 A;  4IIM A;  5IHK A;  3EG0 A;  2EPD A;  3H0H A;  4J9G A;  3I5R A;  1SPK A;  2O9S A;  1GCQ C;  1TUC A;  3RNJ A;  2J7I A;  4A63 B;  2KXD A;  2HEQ A;  4F14 A;  2JTE A;  1HSQ A;  2DL4 A;  2OI3 A;  2RMO A;  2FEI A;  3M0P A;  2C0T A;  1RUW A;  1X6G A;  2EVR A;  1Y0M A;  1YP5 A;  3VRY A;  2GTO A;  1YWO A;  1ZX6 A;  1OPK A;  1SHF A;  1UUE A;  2P4R A;  2RQR A;  2JS2 A;  4LUD A;  1UDL A;  4R0K A;  2KGT A;  3EG2 A;  3FJ5 A;  1HD3 A;  1GRI A;  1SSH A;  2CH4 W;  1YN8 A;  1M3C A;  3EG1 A;  5FWC A;  2OJ2 A;  3UAT A;  1S1N A;  1PRL C;  2KNB B;  1UJY A;  2C0I A;  1NM7 A;  1JXM A;  2XMF A;  1V1C A;  4X1V A;  1WXT A;  3VS4 A;  2EBP A;  4M4Z A;  1K4U S;  2NUZ A;  2YSQ A;  1CSK A;  2J6O A;  1AEY A;  1E7O A;  4RTW A;  1T3L A;  3TVT A;  2MOX A;  1PKT A;  1EFN A;  3VS5 A;  1W1F A;  2KT8 A;  4J9C A;  3THK A;  2KR3 A;  1X6B A;  5IXB A;  2BZY A;  3ULR B;  4RUG A;  4CC2 A;  2LJ1 A;  1M30 A;  2GTJ A;  2F2W A;  1H3H A;  4HVW A;  3M0Q A;  3H0I A;  1JEG A;  2KRM A;  4LN2 A;  3IQL A;  2GBQ A;  1B3Q A;  3I35 A;  4HVU A;  2YDL A;  2H8H A;  2EGA A;  1WI7 A;  1U5S A;  1BBZ A;  1YCS B;  1N5Z A;  1OPL A;  1GCP A;  2CSQ A;  1AZG B;  1UGV A;  3A98 A;  4AG2 C;  1OV3 A;  2LCS A;  2EYX A;  2KRN A;  3NPF A;  1SRM A;  2CH4 A;  4Z88 A;  3KFV A;  4GLM A;  2DMO A;  5IHN A;  2FPF A;  1ZUU A;  1T3S A;  3VS3 A;  1VYV A;  1NEG A;  2YUQ A;  4RTU A;  4ZNX A;  1GFC A;  2GQI A;  4FSS A;  1WXU A;  3EG3 A;  1X2K A;  2W10 A;  1JQQ A;  1GBR A;  2PTK A;  1Y57 A;  2DJQ A;  1M3B A;  1GL5 A;  2X3X D;  4HVV A;  2YUO A;  4E6R A;  1BB9 A;  1UHC A;  1WIE A;  2GNC A;  3CQT A;  2ED0 A;  1LCK A;  3I5S A;  1U3O A;  2AK5 A;  3GBQ A;  4K11 A;  3PVL A;  1E6H A;  2JMA A;  2LNH B;  2YUN A;  2DRK A;  3SEM A;  2O9V A;  2JW4 A;  2D1X A;  2ENM A;  2EYW A;  2CT4 A;  2FRW A;  2O31 A;  1TUD A;  4AG1 C;  1T0J A;  1M8M A;  2DL5 A;  2PZ1 A;  4WCI A;  2EGE A;  2K2M A;  2D8J A;  3PE0 A;  2F2X A;  2DL7 A;  2VKN A;  1AVZ C;  4J9D A;  2KE9 A;  4OMN A;  4ESR A;  1ARK A;  2FPE A;  1IO6 A;  2LQW A;  2OAW A;  2DNU A;  3EHQ A;  1SEM A;  2K3B A;  2HCK A;  2JT4 A;  2AZV A;  4J9F A;  4J9B A;  4RTX A;  1BK2 A;  1NYF A;  1X43 A;  4J9I A;  2KEA A;  1WYX A;  3UF4 A;  1H92 A;  4RTZ A;  2DVJ A;  2DL3 A;  3LH5 A;  2CUB A;  1QKW A;  4AFS C;  2MIO A;  4CC7 A;  4ORZ A;  1MV3 A;  4OML A;  1NLP C;  2KXC A;  1I0C A;  1PWT A;  2M51 A;  2I0N A;  3I9Q A;  4JZ4 A;  4CC4 B;  2O88 A;  5IHI A;  1ABQ A;  3M0U A;  2DM1 A;  2L0A A;  3H41 A;  1U06 A;  2A28 A;  3REB B;  1NLO C;  1ZBJ A;  2LMJ A;  2DBM A;  5HCK A;  3C0C A;  4LNP A;  2D0N A;  1AWW A;  2HDA A;  2LX7 A;  2DA9 A;  2K9G A;  1NEB A;  4D8K A;  2RQW A;  2FO0 A;  3EGU A;  1PRM C;  1PNJ A;  2RF0 A;  1X2Q A;  1KIK A;  3VS7 A;  4AFZ C;  4Y92 A;  1AWJ A;  1VA7 A;  1W70 A;  1K0X A;  5FW9 A;  1AZE A;  2RQU A;  2JXB A;  1W6X A;  1KJW A;  3M0T A;  2YT6 A;  4AFQ C;  1AWX A;  1QCF A;  3NGP A;  1WLP B;  4F16 A;  2FG0 A;  2IIM A;  1GCQ A;  3PVQ A;  4LUE A;  4OMO A;  1VYU A;  2LJ3 A;  2ROL A;  4JPB W;  1UJ0 A;  2KBT A;  2C0O A;  2CRE A;  1PHT A;  1GBQ A;  1QWF A;  3QWY A;  3O5Z A;  2K7A A;  4QT7 A;  2KT1 A;  1FMK A;  4DEY A;  1QLY A;  2DRM A;  2ECZ A;  2KYB A;  3VS6 A;  2EQI A;  1G83 A;  1RLQ C;  2AZS A;  2L3P A;  2RNA A;  3TSZ A;  3SHW A;  2X3W D;  3R6N A;  2K79 A;  2CDT A;  2SRC A;  2KYM A;  1ZUY A;  1RI9 A;  2DE0 X;  1T0H A;  3TSW A;  5IH2 A;  2LQN A;  2JM9 A;  5I11 A;  1VYT A;  1AOJ A;  2KRS A;  2RN8 A;  2K6D A;  2J6F A;  2L2P A;  5ECA A;  2DLP A;  3UA6 A;  2VVK A;  2V1R A;  4RTT A;  1ABO A;  1QKX A;  5GJW B;  2CUD A;  1B07 A;  2DIL A;  1K76 A;  1WDX A;  2CSI A;  1ZUK A;  3VS0 A;  2HSP A;  3VS1 A;  1RLP C;  1A0N B;  2RQT A;  1KFZ A;  2E5K A;  2L3Q A;  4HXJ A;  1WA7 A;  1UG1 A;  1Z9Q A;  3M0R A;  4JJC A;  1X27 A;  5L23 A;  1M27 C;  1MV0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...