4IIOA

Crystal structure of the second sh3 domain of itsn2 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
GMAQGALLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Second SH3 Domain of ITSN2 Bound with a Synthetic Peptide
rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords Intersectin-2
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iioA00
2K7AA 1UG1A 3JV3A 1Z9ZA 2AZSA 1ZUKA 2DJQA 2AKLA 3H0HA 1QCFA 2GTOA 2LJ1A 4DEYA 4HVUA 5IXBA 1MUZA 4OMLA 5FWBA 1YWOA 1GFCA 1ZLMA 1JQQA 2DL8A 2FPDA 3VS0A 1U5SA 2O2OA 2G6FX 2K3BA 2NWMA 1AWOA 2PTKA 2DM1A 2JW4A 4AFQC 1WDXA 4CC2A 2I0NA 1UHFA 1W6XA 2EYXA 4CC7A 3I9QA 1NLOC 1RI9A 2CREA 2J6OA 2LQNA 1UJYA 2JS2A 2C0OA 1I07A 2F2XA 1NYFA 2JXBA 3EG1A 2CSIA 2CH4A 4HXJA 2DL3A 1Y0MA 1VA7A 2LZ6B 1BBZA 2HSPA 1U06A 3M0QA 3M0PA 2FRWA 2D1XA 1AZGB 1WXTA 2LJ0A 1OEBA 2W0ZA 1FYNA 1SPKA 1GCQA 1UUEA 2EYZA 4K11A 2EGCA 4KRTA 3EG0A 4JJCA 2GBQA 4HVWA 1UTIA 1JU5C 2JM8A 2AZVA 1M30A 3R6NA 2J6FA 4Z89A 2O31A 4RTZA 1JXMA 1RUWA 2K2MA 2IIMA 2RQWA 1H8KA 1I0CA 2LMJA 1YN8A 3FJ5A 2RQUA 1K76A 3VS6A 1UE9A 3M0SA 1X27A 2D0NA 2JTEA 1M8MA 3UA7A 1M3CA 2RPNA 2FRYA 1X6GA 2EGAA 1X43A 1AVZC 3LH5A 4AG1C 4D8KA 2M51A 1KJWA 1T0JA 1UGVA 4RTTA 2KXDA 1X69A 1T3LA 4QT7A 2KYBA 2KROA 4OMOA 2YUNA 2OJ2A 1GCPA 3SHWA 1AZEA 2AKKA 1WIEA 2YT6A 1H3HA 2JM9A 2HBWA 1E7OA 1K1ZA 2DL4A 3EG2A 1FMKA 1NG2A 5FWCA 1Y57A 2LP5A 2XMFA 5I22A 4RTXA 1YCSB 1UDLA 3NPFA 3H0FA 2P4RA 2EYWA 2KRNA 3H41A 4R0KA 4RTUA 3I35A 1SRLA 2A08A 2RQVA 1WLPB 2BTTA 5IXFA 1QKWA 2NUZA 2W10A 3NHNA 3TSWA 2CT4A 3RNJA 2KGTA 3VS5A 1E6HA 3H0IA 4J9GA 1HSQA 4F17A 2YUQA 2YUOA 3O5ZA 4J9IA 3TSZA 3GBQA 2FEIA 3EHRA 4J9FA 2JS0A 1SEMA 1G83A 4RUGA 4J9HA 2ED1A 1MV3A 1ZBJA 1GRIA 1X2QA 2E5KA 4J9DA 4ESRA 1NLPC 2FPFA 2HCKA 2LX7A 2M0YA 2FO0A 2F2WA 2ENMA 2SRCA 2GTJA 1LCKA 1BB9A 4LNPA 3NMZC 1NM7A 1GBQA 2KBTA 1NYGA 4JPBW 4ORZA 2RQRA 1W1FA 1PRMC 1PWTA 1AEYA 1T3SA 2DF6A 2LQWA 2EQIA 2BZ8A 1N5ZA 2C0TA 2FG0A 4AFUC 1PKSA 5GJWB 2PNIA 4J9EA 1UECA 1A0NB 3CQTA 2J7IA 2RF0A 2DA9A 4HVVA 2LNHB 5ECAA 3PVLA 1HJDA 4LUEA 1OPKA 2HEQA 4OMPA 1OOTA 1SSHA 4CC3A 2HDAA 1K4US 1MV0B 1GCQC 1WA7A 2KRMA 2O9SA 5I11A 4AFZC 1VYTA 1SHGA 2RMOA 2QDLA 2J6KA 1M3BA 1QWFA 4Z8AA 1CSKA 2DNUA 1U3OA 2GGRA 5GJVB 4Y92A 2VVKA 3REAB 3RBBB 3M0UA 4X1VA 4OMMA 2AK5A 1IO6A 2K79A 1JEGA 2DE0X 2MCNA 3C0CA 2CUDA 1TUDA 2JT4A 1VYVA 2DBKA 1QLYA 1I1JA 1H92A 3ULRB 2DRKA 4EIKA 1UHCA 3EGUA 2D8HA 3M0RA 3QWXX 4JJDA 2EBPA 1UFFA 3PE0A 1PNJA 2DVJA 5IH2A 2LJ3A 2A37A 4LUDA 2KT8A 3THKA 3A98A 2CH4W 2O88A 2CSQA 1B3QA 1TUCA 2MOXA 3QWYA 1Z9QA 4IIMA 1QWEA 1KSWA 2ROTA 3ZL7C 2FPEA 3M0TA 4J9CA 1VYUA 1KFZA 2J05A 2L2PA 5L23A 1ARKA 2X3WD 3VRZA 2JMCA 1YWPA 4OMNA 5FW9A 4M4ZA 2KE9A 3NGPA 1NEGA 2DL7A 3VS1A 2KNBB 4RTYA 1NEBA 2V1RA 1ABOA 1K0SA 1YP5A 1ABQA 2CUBA 3EHQA 1ZUUA 2RQTA 3UF4A 4A63B 2B86A 2DLPA 3KFVA 2ED0A 5HCKA 1ZX6A 1WXBA 5IHKA 1S1NA 4J9BA 1T0HA 2DX1A 1GBRA 1KIKA 1M3AA 2RN8A 1W70A 2VKNA 2RNAA 2MIOA 3I5RA 1WYXA 3VS7A 1RLQC 4D8DA 2F2VA 2BZXA 1CKBA 4E6RA 1JO8A 2DL5A 1BK2A 1PRLC 1GFDA 2O9VA 1GL5A 2X3XD 1UJ0A 2KXCA 1YNZA 1RLPC 2YSQA 2KYMA 2EW3A 2PZ1A 1WI7A 2DILA 2OI3A 1AWXA 2JMAA 1PHTA 1B07A 2KR3A 2A36A 1M27C 1K9AA 2CDTA 2L3PA 3IQLA 1WXUA 2EPDA 2SEMA 1BU1A 2LCSA 1OV3A 1WFWA 4JJBA 4OMQA 4Z88A 2ESWA 4F14A 2ECZA 4F16A 2EGEA 2L3QA 4LE9A 3VS4A 2H8HA 5IHIA 2DRMA 2KRSA 2DBMA 2DYBA 1SRMA 4GLMA 4LN2A 1X6BA 3VS3A 1E6GA 1TG0A 2OAWA 3UATA 1J3TA 1JXOA 1XOVA 2DMOA 1PKTA 2D8JA 2EYYA 4DEXA 5IHNA 4JZ4A 3SEMA 3TVTA 1HD3A 2ROLA 2GQIA 4HCKA 3I5SA 2EVRA 2J06A 2L3SA 2CT3A 4WCIA 2K6DA 1WX6A 1G2BA 4FSSA 2A28A 1OPLA 1ZSGA 2KEAA 3REBB 1K0XA 2K9GA 2GNCA 2BZYA 1AD5A 1ZUYA 4JZ3A 5EC7A 4RTWA 1AOJA 3EG3A 2YUPA 3VRYA 4AG2C 4ZNXA 3VS2A 4CC4B 4IIOA 4RTVA 1AWWA 2V1QA 2VWFA 3UA6A 3PVQA 1SHFA 3U23A 1CKAA 2C0IA 2KT1A 2ABLA 2L0AA 2EKHA 4AFSC 1EFNA 1V1CA 1QKXA 1AWJA 1X2KA 2YDLA 4GBQA
chains in the Genus database with same CATH superfamily
3CC4Q 2K7AA 2RM4A 3PTAA 1VQPQ 4D6WA 1ZUKA 1KQ2A 2AKLA 3OBWA 5CR2A 5FU7C 5LJ3h 1K9MR 2LJ1A 2MWOA 2RA2A 3VUZA 4RMOA 2DL8A 2RJFA 2V8KA 2H3EB 2QTVA 2DM1A 2BE7D 2JW4A 2YRCA 1WDXA 2RO0A 4CC2A 2XG8D 2EJGA 1W6XA 1NLOC 2CREA 3G7ZA 4XTYA 2LCCA 1YI2Q 3CC2T 5C0MA 5GAN7 4OMFB 4M77A 1KHCA 3FEOA 3CCVT 1OZ3A 2LNVA 3CMAT 3JRZA 2B8AA 4FIBA 2OTJA 2QEXQ 3CD6T 2KMTA 3CCSQ 1BBZA 2XDBA 1U06A 1IHWA 3AT1B 1VQ4A 4DA4A 1WGSA 2Y4XA 3OYGA 1VQ5Q 2ZPIB 1VQ6Q 2HD0A 1C0MA 5J3BA 3MEVA 1FWZA 1UUEA 2EYZA 1VIEA 3EG0A 1PCXA 1UGSB 3PMTA 3MP8A 2JM8A 4C92D 1M30A 3A8MB 3R6NA 3M55A 2O31A 4F7UB 3GP8A 2EJ9A 3RUXA 2YXYA 2FZCB 4B6MA 4OVAA 3E2UA 1OI1A 3FJ5A 1UE9A 2OX7A 1X27A 2D0NA 2IVWA 5D6YA 1X6GA 3LH5A 4PKCC 4QVZA 1PSEA 1KJWA 2K3YA 4PL6A 2KROA 1MMNA 4OP0A 3MPUB 4JS4A 3OYEA 2YT6A 4FW2A 1GXIE 3L2UA 2DKGA 4MDWA 3X28B 2LP5A 5I22A 1YCSB 4FYWB 2EYWA 2CP7A 4RTUA 1G5VA 2QQBA 1WLPB 3J81E 2M02A 1BI1A 4N4HA 1Q81C 1SKUB 3NHNA 3TSWA 4QW2A 3CC2Q 3VS5A 1AT1B 5AYFA 2OTJQ 1HSQA 3TSZA 4PFZA 4RUGA 1QCOA 3G4ST 2XDPA 4XTUA 4C0GA 3EG9B 1VQ9T 1MV3A 4XU3A 1GRIA 2DK3A 3OYNA 4ESRA 1NLPC 1TTHB 1YCYA 2HCKA 2LX7A 4M7DC 4KUDK 1YBYA 1HYOA 4N0AA 1QW1A 4LNPA 1NM7A 3INZA 3VKIA 3CC4T 4E7HA 2F1LA 4C8QG 1P92A 8AT1B 4M7AD 1PWTA 2OTLA 1T3SA 3ER0A 4M77C 2AIRB 4DBHA 2LQWA 1LNXA 2QYZA 3QJYA 1WHJA 3V7RA 4KH1B 4DOWA 1NBEB 1PKSA 5GJWB 4J9EA 1UECA 3CQTA 2RF0A 4M77E 2C06A 1WQ7A 1HJDA 4LUEA 3EFOB 1VQOT 4PJMA 3CCEQ 3BFMA 1U8RA 2LRQA 1KK7A 1VQKQ 1BI3A 1YI2T 3PIPA 5GAN4 3CMET 4M7AB 1SHGA 5CIUA 4PLIA 2NUPA 4RCBA 2EYQA 1M2VA 2A7YA 2CS7A 1YJWA 3CMAQ 2WSFE 3DLMA 4Y92A 5GJVB 1QP2A 3I56Q 3RBBB 2VGMA 1VQ7Q 4FW1A 2PVGB 1B34B 1O9SA 4ME7A 5CQXA 5HY6A 3NFCA 5M9OA 1OYXA 4XAXB 2YRVA 3R6OA 4J7IA 4GY5A 1C6VX 2MAMA 2VASA 1YITT 1H92A 3ULRB 2DRKA 4EIKA 4EMKA 1MGQA 3EGUA 2D8HA 5GMKl 3JCMP 3QWXX 4M75F 3I55Q 1UFFA 1PNJA 4R56A 4KULA 2DVJA 2CGHA 2DZ9A 2LJ3A 3G6EA 2HL3A 2MWPA 3CEYA 2CH4W 1TSFA 3S3NA 3FJPA 3CCUQ 1N8RR 1M90R 5LJ5d 3CCRT 1TUCA 4C0FA 1Z9QA 4IIMA 1KSWA 3EH2A 4VUBA 1OZ2A 1OU9A 2J05A 3OW2A 2HSEB 2K3XA 3VRZA 4JRQA 3BDLA 2M16A 4BDYA 3NGPA 2HAXA 3X26B 2DL7A 4UC4A 1VQ4T 2EJFA 4RTYA 4PNOA 1NEBA 3P8DA 3HHTB 1EX4A 1FMWA 1XTDA 1PG5B 3V8LA 5GAMg 1ZUUA 2COYA 8ATCB 4KBMB 1LVKA 3RKWA 1ZSZC 2WACA 2DJZA 1JB0E 2RN8A 2RNAA 4ZGEB 1IRXA 3JCMW 3JCMg 1OQKA 4E6RA 3G71Q 2JN0A 2KXCA 1RLPC 1WHHA 4IUVA 3CCJQ 3M9QA 3QUIA 2DILA 2OI3A 2E3IA 2V26A 1PHTA 1VIFA 4A4HA 4Q5WA 2CZ0B 3IQLA 1B34A 1M1GA 2GFUA 4HKEA 2EPDA 2SEMA 4M7AC 1MMDA 2VXEA 4OMQA 4MZMA 1OX8A 2RHZA 2X4YA 2ECZA 1ZA2B 2EGEA 5GAN6 5KH6A 3VS4A 5GAOl 2H8HA 5DLOA 4M77G 2AT1B 3FRNA 3SFMA 3GF5A 3JCMc 4KUIA 1I81A 2DRMA 2D6FA 1YI2A 2GQIA 4HCKA 3GPLA 4C8QD 1TU0B 5I21A 2QA4T 4M7DB 5DLQE 3FC3A 3OA6A 4EMHA 1G2BA 2FVUA 3HL8A 5KYNA 3REBB 1QP3A 1V76A 2V8IA 1AD5A 2JUFA 2HQXA 4FYYB 4JZ3A 1KD1R 3EG3A 4AG2C 3PT9A 3VS2A 1R77A 4M75E 3Q1JA 3X25B 2DXUA 2VWFA 3SWNA 3JCMQ 4XU1A 1YFNA 1CKAA 5IN1A 5GMKh 3QG1A 4F7UE 1QMCA 1QKXA 1OX9A 1X2KA 3JAME 4QQGA 4KGZB 5LJ5g 4C92B 1UG1A 4J8OA 2DJQA 4ZN3A 3QPHA 3BE3A 2A0FB 2L5QA 3CCVQ 4KT0E 1QCFA 4FT4A 4LDUA 1D0YA 4DEYA 4ZN1A 1KQSA 1VQMA 3SWNC 2MMPA 1JQQA 1M1FA 1S72Q 1VQ5T 3ZBDA 1ZHIA 2K3BA 2PTKA 1I4K1 3OYLA 1HXDA 4AFQC 2CZ1B 1QVGA 2I0NA 1K73U 2EYXA 3I9QA 2K57A 1RI9A 1LPLA 2VYTA 5FU6B 1UJYA 3CPWS 3JB9J 1X01A 2EQMA 2MI6A 2F69A 4BACA 2COWA 4M75G 2JXBA 3CC7T 1Y0MA 1VA7A 3OW2S 2LZ6B 2X35A 4KGXB 3KUFA 1EZZB 3JB9H 5KYUB 1OEBA 2JVVA 5A2QE 1VOMA 1YJNA 4K11A 2EGCA 4KRTA 2CKKA 3RDVA 3G71T 1IXDA 4AT1B 2R5AA 2ZAEA 1UTIA 2LT4A 3OYAA 2ZCFB 1FXXA 2EQKA 2K2MA 2IIMA 2X4XA 1H8KA 2K5LA 2LMJA 3GLXA 5GMKe 3CXCA 2D0QB 4QQDA 2RQUA 3VS6A 4RG8A 2JTEA 2E1HA 3UA7A 2RPNA 1YJ9A 1X43A 4AG1C 2CYZB 3JCMX 1UGVA 1R0CB 3OQ5A 4A4FA 1X69A 2NYSA 4OMOA 3CCQQ 1I5LA 1N27A 2YUNA 2EWNA 1GCPA 4M77B 4ELYC 1WIEA 1H3HA 1D09B 3MEUA 3OS2A 1E7OA 1K1ZA 2DL4A 5KYXB 3VV0A 4EMKC 1NG2A 2YLBA 4PFPA 3WVDB 2L3RA 1UDLA 2DERA 3H0FA 2P4RA 2HBPA 2KRNA 3H41A 4FU6A 4R0KA 1JJ2S 4DBRA 4RCCA 1SF9A 1SRLA 3GOXA 2L8DA 2VXFA 4MZPA 1Q81U 4Y28E 1YJWQ 4M7AG 2CT4A 4LDWA 2KGTA 5LJ5j 3I56A 4B9WA 1N6AA 4F17A 1WHGA 4M78F 3GBQA 5LL6S 3H9NA 2ED1A 3VUBA 1XJWB 2E5KA 1D1CA 6AT1B 2EFIA 5DM7R 1X75C 3WXMB 2F2WA 1WJRA 1BB9A 1LCKA 2RHXA 1VQKT 2F5KA 1NYGA 4JPBW 4ORZA 1BI0A 3JB9I 2RQRA 2E5QA 1PRMC 3VU3C 4TVRA 1Q95G 2EQIA 2BZ8A 1N5ZA 2K5FA 5KE2A 2C0TA 2FG0A 4AFUC 2PNIA 2J7IA 4HVVA 5ECAA 2LNHB 1LOJA 3NTKA 2HEQA 2XK0A 1OOTA 1SSHA 3FDRA 4ZGJB 3CCQA 1GCQC 4M7DG 2RMOA 5GANd 2QDLA 1YIJQ 5FU7B 1RAEB 3LLRA 1KD1C 1QWFA 4M78D 2QEXA 2DNUA 2GGRA 5AT1B 2VVKA 3M53A 3M0UA 3OYJA 1RADB 2DXBA 2RJCA 3HRTA 1IO6A 5KYWA 3CCUT 1U1SA 2K79A 2JTMA 1SG5A 2XDDA 2JT4A 4FL6A 1K73C 1RABB 4X34A 1M4ZA 4MMKA 4BUGA 2K4YA 3QYGB 2BKDN 1RL2A 4M78A 1UHCA 1ZQ1A 1ZA1B 5GAMd 2CP2A 3C95A 3PE0A 4HT9A 5IH2A 1Q86R 3SD4A 3M58A 2A37A 4JUVA 4LUDA 1M90C 3OYDA 1I5OB 1YJNT 2O88A 1PD1A 3SWNB 1VQ9A 3DLLA 1B3QA 2QTXA 2MOXA 2KY9A 3CCJA 3LH0A 3JCMe 2NUTA 4J9CA 1D1BA 4C0DB 1KFZA 4PJOA 5L23A 4PJOD 4XTWA 5CVIA 4NL2A 4XTVA 1ARKA 2LDMA 5FROA 1YWPA 1BKBA 2L89A 2VB6A 4HT8A 1JBMA 2HL5C 2JZ2A 3UT1A 4BY6B 2CP3A 1H3ZA 1M90U 1NEGA 1WHKA 3EGDB 2PQWA 2VC8A 1YP5A 1JJ2P 1ABQA 1VQOA 3E9GA 2HZYA 4JRPA 2RQTA 4LD6A 2X51A 2DLPA 3CMEA 3KFVA 5HCKA 3V7SA 3G4SQ 1UEBA 2DX1A 2COZA 1GBRA 3KXTA 1KIKA 3OB9A 1M3AA 4QVCA 1IB8A 2VKNA 3JB9D 2FL7A 4PJNA 3P8HA 3CCMQ 3OSVA 5GMKj 1MMAA 2A3LA 3J80E 1ACMB 2M1HA 1CKBA 1KQ1A 2OTLQ 5L8RE 1GFDA 2O9VA 1YJ9T 1W2BP 1UJ0A 5GMKi 1UB4A 2MYSA 3OSSC 2YSQA 4M77D 4E7LA 2DD5A 2XU8A 2PZ1A 3HKSA 3OS5A 2P4TA 5DY9A 1QVGS 1B07A 2KR3A 2DTIA 2A36A 1D1AA 1BCMA 1VQKA 1RAIB 3LGFA 4PFOA 3G6ET 3KBGA 1M9SA 3OS0A 3JCMh 2LCSA 4CRIA 1WFWA 2Y90A 4M75B 3E9FA 3CMAA 4NL3A 1VQMQ 2VV5A 1NE8A 2VGNA 3C12A 5LJ3f 3NTHA 2PU9B 2QQ9A 2PUOB 3F70A 4L6V5 1Y7XA 1VQNT 1QQJA 1D0XA 5IHIA 2KRSA 2QQRA 4X9DA 3CCLT 2DMOA 4BDZA 3SEMA 5LJ3g 1VQ8Q 5GANh 1IREB 1G3YA 3MO8A 2RD1A 2FYKA 2KSSA 1OPLA 3OBYA 1WHLA 1ZSGA 2KEAA 5LJ3j 1K0XA 3GNFB 2K9GA 4LXCA 2X9HA 3L2QA 2CZ6B 4L59A 3CCUA 1Q82C 1TUGB 3CCMA 4EMGA 4BI3A 4CC4B 2LX9A 5CQYA 2YLCA 1YJNQ 2E70A 4RTVA 1AWWA 3UA6A 3QBYA 4PJOE 1SHFA 2I2LA 3V8JA 5CKBA 2E6ZA 3OW2P 4JLIA 2E65A 2PUKB 5LJ5e 4WF2A 3JV3A 2RHYA 3OYFA 4WTOB 1EIFA 1PM3A 2GTOA 5IXBA 3JB9G 4OF1A 1YWOA 1GFCA 1ZLMA 4HCCA 2FPDA 4FT2A 3VYHB 2NWMA 1AWOA 1G3TA 4OB2B 1RAGB 4MMLA 2J6OA 3RMQA 4DOVA 4C8QA 2JS2A 2HQHA 2FHDA 2C0OA 2Y4YA 3MJXA 1G3SA 2RHUA 3C4SA 4YTLA 1KQSP 2CSIA 1WJSA 2CH4A 2KVQG 2EAYA 1VQ6A 2R57A 1MMGA 1VQ8A 2X4WA 3M0PA 2DVEA 3EFOA 1WXTA 3NTIA 1N9SA 2JOYA 2BE9B 2W0ZA 3CCSA 4ZTJA 1Q7YC 1SPKA 1GCQA 2OTLT 1IHVA 1Y96B 4A54A 4PJOB 4HVWA 2JTFA 3S6WA 4C0ZA 5KE3A 1K8AR 1K9MC 3L2WA 2OAUA 2J6FA 4IUUA 3E19A 3CCJT 1JXMA 2CP5A 4M75A 1Y96A 1AHJB 1PSFA 1YHQQ 2LTOA 4IUPA 2XKOC 3OS1A 3PMIA 3M0SA 4QVDA 2YRDA 1M8MA 2ZPHB 1M3CA 2DFUA 3HRSA 2FRYA 3EG9A 5A0GA 5GMKm 1T0JA 4PK4A 5CO7A 3HTRA 4RTTA 1YJWT 2KXDA 4QT7A 2KYBA 1B7TA 1K8AU 2VUBA 2OJ2A 1X6OA 3SHWA 4KH0B 2PVOB 2RB6A 2E64A 4BE0A 1VQNQ 1RAAB 1FMKA 2GQVA 4HA8A 2FZKB 1N9RA 2E6NA 1QCNA 4C8QB 3NPFA 5J26A 2M0OA 2A08A 2RQVA 2QGFB 1W4SA 2DXCA 2BTTA 2DIGA 5IXFA 3OYYA 1QKWA 2NUZA 3LYIA 3SB2A 2RJEA 2E3HA 1E6HA 3H0IA 3MKDA 3OYHA 4BB7A 2YUQA 2YUOA 2KQWA 3EHRA 4M7AA 4J9FA 4P5NA 1SEMA 3CC2A 2QK0A 1RAFB 4J9HA 4EPCA 1VQLQ 5LJ3d 1ZBJA 4J9DA 1MNEA 2RK1A 4RG2A 3CD6A 1ZSZB 2SRCA 5A0DA 2GTJA 1GBQA 4EDUA 1M1KC 4F7UF 3P8BB 1H641 3A8OB 2NUTB 1W1FA 2DF6A 2QQSA 5GAOm 4NOYA 5CAIA 2NLUA 2R5MA 4LD9K 1S72T 3CCEA 2DA9A 4N0AC 4B9XA 4PJLA 3PVLA 1OPKA 4BE1A 4CC3A 1K4US 1MV0B 3QZ5B 4C8QE 3RERA 4HCBA 1Q86U 1D3BA 1R0BG 2O9SA 3MEWA 2CZ7B 1VYTA 5I11A 2DO3A 4C0DC 2J6KA 1M1KU 1M3BA 2IG0A 4M78B 1CSKA 2MF2A 3I55T 3QO3A 7AT1B 3QXEB 4J6YA 5D6XA 2LQKA 2HQEA 4FSXA 4OMMA 3H6ZA 2AK5A 1TS9A 2RHIA 3C94A 4J83A 2DE0X 4BI8B 9ATCB 3AHUA 4L5GA 2CUDA 5GAOq 1VYVA 2DBKA 1QLYA 3OMGA 1I1JA 4PJOG 4M78E 5LJ5h 4C92F 4IUQA 2BIVA 1D0ZA 2YWWA 4JJDA 2EBPA 1NJIC 3EGXB 4LDYA 2E41A 5GAMj 5A0LA 1KG1A 1N8RC 1JJ2A 4A4EA 2QGGA 3M54A 4N4IA 1KC8R 2XI9A 1M8VA 2DXTA 2V8JA 3X20B 3QWYA 4F7UA 3ZL7C 2FPEA 2P0QA 3QIIA 2ZZDA 4LDXA 3OY9A 1VYUA 1BIBA 3LX7A 3CC7Q 1WJQA 3UDCA 3CC4A 3LW5E 2JMCA 4OMNA 3JCMd 3M4GA 3QZ9B 1VQ8T 2R58A 3VS1A 4IURA 2KNBB 1FX7A 4FM4B 2V1RA 1ABOA 3CCQT 5EG2A 4A4KA 3L1AA 3UF4A 4JDSA 4OGCA 3E1SA 2ED0A 2X4JA 3A1PA 4QQ6A 5IHKA 4J9BA 4OB1B 1WQWA 5CCAA 2DTOA 4JS5A 2CP6A 2MIOA 3I5RA 3JSCA 2QAZA 1RLQC 2Z0WA 3O8VA 2F2VA 3V8KA 3L42A 3V7CA 1BK2A 1PRLC 3DB4A 2WSEE 1PC0A 2X3XD 4E2FB 1YNZA 4JJNK 4ANJA 5GAOr 2EW3A 3WVEB 1YITA 2GFAA 1AWXA 2JMAA 4C5IA 2DETA 2RI3A 5IT9E 2GCXA 3QDFA 3CCLQ 3TREA 3TCJA 3CBPA 1WXUA 5FLXE 5KYWB 3FIFA 1YIJA 5GAN8 1BU1A 1F1BB 4M7AE 5I2SA 1OULA 2QI2A 2JNGA 4Z88A 5CKFA 3CC7A 3TQ7P 3QSUA 4F14A 2KAFA 4F16A 2OTJT 3PGGA 1BI2A 4Y91A 4LE9A 4O6JA 3MHXA 5GAOp 5GANf 3ME9A 1D3BB 4OGEA 2DYBA 5HK3A 1X6BA 3GNGA 1J3TA 2OAWA 2EYYA 1PKTA 2D8JA 4DEXA 2G3RA 4PJJA 3BDUA 2EQUA 2DZCA 1SSFA 1NZ9A 2EVRA 2J06A 2L3SA 2CT3A 5FRNA 4WCIA 1NJIR 1QVFA 1W2BA 1WX6A 4FYXB 2A28A 4C5HA 2BZYA 4CI0C 2HNIA 2LQ8A 4C5GA 3JCMf 3CPFA 1AOJA 2YHTA 4ZGDB 2ZPGB 4IIOA 2K2VA 1ZSZA 3OYMA 3PVQA 3U23A 3QKJA 2C0IA 4C5EA 3LGLA 2ABLA 3QYHB 2L0AA 2EKHA 4II1A 4NS5A 1V1CA 1PD0A 1AWJA 2YDLA 3EGXA 4KGVB 1YITQ 3BW1A 5FU6C 1Z9ZA 2AZSA 3MEAA 4C92A 5CKHA 3H0HA 4PJOC 3X24B 3UWNA 2RH2A 4HVUA 1MUZA 4OMLA 5FWBA 3FB9A 2D9TA 2MPXC 4BE2A 2HKNA 3M5AA 3VS0A 1U5SA 2O2OA 2G6FX 5KCOA 5GANj 4F7UG 3N5BB 2EIFA 1UHFA 4CC7A 2LQNA 4BI4A 1O75A 5KYXA 1I07A 3CMEQ 2F2XA 2XICA 3G4SA 1NYFA 3EG1A 3ZFJA 4M7DA 4JRIA 4X9CA 4HXJA 2DL3A 5KYYA 1WPYA 2HSPA 3M0QA 1YHQT 1V29B 2FRWA 2D1XA 2ATCB 1AZGB 3H8ZA 2LJ0A 2XHCA 2QDYB 1FYNA 1VQ7A 1I8FA 3CCRQ 2LCLA 2FZGB 4JJCA 2GBQA 1QVPA 3RKXA 1JU5C 2ZPFB 2AZVA 2IPOB 3A5ZB 4Z89A 3M4YA 3CXCS 4RTZA 3EAEA 2DEUA 1RUWA 2QA4A 3LWHA 2RQWA 3CD6Q 1W2BS 2ZPBB 3CPWP 1I0CA 4HCZA 2HMAA 1YN8A 2E12A 3PFSA 1K76A 4XTZA 4QKUA 3G6EQ 3CCMT 3OYIA 2MK5A 2EGAA 1KQSS 1AVZC 2XD0A 5KYUA 4D8KA 2M51A 4XQ3A 4IUTA 1JRIA 2M9UA 1QVFP 1T3LA 3META 3MP6A 1YJ9Q 1M1KR 3JCMJ 5CKDA 1VQPT 3JCMV 5IAYA 4AMCA 1AZEA 2AHJB 2AKKA 2JM9A 2HBWA 4PJOF 5HKCA 2QG9B 3EG2A 1VQLT 3TEEA 5FWCA 1Y57A 2XMFA 3RESA 4RTXA 3A8HB 4XU0A 1Q7YR 4OB3B 5D6WA 4XK8E 3L2RA 3G1JA 3I35A 1VQ5A 2O4XA 4M7DE 4DBQA 3S3MA 1WZOA 1BCOA 2W10A 4DQ2A 3RNJA 1M2VB 3GIBA 2NUPB 4J9GA 1K8AC 3O5ZA 5KCHA 4J9IA 2FEIA 2JS0A 2FB7A 1G83A 1G8XA 3EGDA 5LJ5f 3M59A 2ZGWA 1NJIU 3CCRA 3TU4K 5GAN5 1X2QA 1M5Q1 4JLGA 2FPFA 1VQ6T 1ZBXA 1IGQA 3JB9F 2M0YA 2FO0A 4MZTA 4OB0B 1QVGP 1BIAA 2ENMA 4M78G 4XTXA 3T9NA 3NMZC 1R8OB 3HP9A 2KBTA 4ZTFA 3HSBA 1M2OA 1YIJT 5C6SA 2QA4Q 2K5IA 3G71A 1AEYA 3HFNA 4M7DF 4J6XA 4M77F 4BY6C 2RJDA 2P0PA 1A0NB 4XU2A 1FMVA 3CBOA 1DJ7B 2P0KA 3M57A 2HKQB 4OMPA 4ELZC 4E7JA 5GANg 2HDAA 3M56A 1NPPA 1WA7A 4IKFA 2KRMA 4AFZC 3RR6A 3OYBA 4Z8AA 3S3OA 3DKMA 4J5YA 3QDRB 4LDVA 1U3OA 4RKUE 4M75C 3REAB 2O4XB 5GAMh 4X1VA 3CXCP 2O01E 1N8RU 1Q7YU 1JEGA 1TH7A 2DTHA 2E4HA 2MCNA 3C0CA 1TUDA 2GF7A 3MP1A 4Z02A 4C8QF 4E7ZA 4C8QC 3CPWA 2F5TX 2QQAA 3PIOA 3M0RA 4M7AF 1YHQA 1Q82U 1VUBA 4E47A 2RI2A 3I56T 2KI7A 1QVFS 2DYIA 1Q81R 3CBMA 1VQ7T 1WHMA 2KT8A 1KC8C 2DEQA 3A98A 3THKA 1VQ9Q 3URGA 1UGRB 2XIDA 4GLKA 1RI0A 4E7SA 2H3JA 2CSQA 4M78C 3OYKA 4O5VA 1UGQB 3OMCA 5HK0A 1QWEA 2ROTA 3QHSA 3M0TA 2WSCE 1VQNA 2KDSA 4ATOA 1RACB 3ASKA 2L2PA 2LC4A 4C92E 3CCLA 2X3WD 5FW9A 4M4ZA 3RIRA 3CCVA 1LJOA 2KE9A 1U1TA 1HK9A 4F04B 2RI5A 5GANe 1KC8U 1Q82R 2DIQA 1VQOQ 1S72A 3RKYA 3CCET 1KD1U 3EFSA 5KYYB 1XNIA 1K0SA 1G3WA 2CUBA 3EHQA 3L2ZA 1VQLA 4BD3A 5GAMe 3L2VA 4A63B 2B86A 5GAOn 3A8LB 2QASA 1ZX6A 2BUDA 1WXBA 5I2MA 4E7KA 1S1NA 3HPWA 1T0HA 2QEXT 4A4GA 4C92C 3I55A 2EKOA 1W70A 2LVMA 1TXQA 5J39A 1WYXA 3VS7A 4D8DA 3FLGA 1IZ6A 2BZXA 3QJ6A 1JO8A 2DL5A 4R55A 1C1AA 1VQMT 1GL5A 4DBFA 1Y71A 2KYMA 3HFOA 2P84A 4JRKA 1XQHA 4EMKB 1WI7A 3JCMb 4M75D 1VQPA 2DD4A 5LJ3e 3DB3A 3MCAB 1TWBA 1RAHB 3SDZA 1K9AA 1M27C 2CDTA 3VYGA 2L3PA 4E7IA 4J7FA 4N4GA 2RK2A 2LT1A 1MNDA 3LWIA 1MHNA 2JJ9A 1OV3A 2CP0A 4JJBA 2ESWA 3EH1A 1Q86C 2L3QA 3PNWC 3VJPA 4C92G 1BYMA 1OU8A 3CCST 4LN2A 2DBMA 4GLMA 1SRMA 1TOVA 3VS3A 5GAMf 1E6GA 1TG0A 3UATA 3J7AF 1JXOA 1XOVA 2E10A 5IHNA 2QXFA 4JZ4A 3TVTA 1HD3A 2ROLA 4J6WA 1VQ4Q 3I5SA 5GAN3 2PVDB 1Y07A 3ZEHA 4V2SA 4MDXA 2DAQA 2ZPEB 2K6DA 3HRUA 4M7DD 4FSSA 3D7SB 4A53A 2GNCA 4PLLA 3A8GB 1WNLA 3EFRA 1K9MU 1ZUYA 5EC7A 1K73R 5GAN2 4RTWA 1UGPB 2YUPA 1NPRA 3VRYA 3UPUA 4ZNXA 2EQJA 4FYVB 5CKEA 3RMSA 2KK4A 1IGUA 2V1QA 1KHIA 2DPPB 5FRMA 3OYCA 5CK9A 2KT1A 3BY7A 4AFSC 4FCYA 1EFNA 5D7UA 4GBQA
chains in the Genus database with same CATH topology
2K7AA 1UG1A 3JV3A 1Z9ZA 2AZSA 1ZUKA 2DJQA 2AKLA 3H0HA 1QCFA 2GTOA 2LJ1A 4DEYA 4HVUA 5IXBA 1MUZA 4OMLA 5FWBA 1YWOA 1GFCA 1ZLMA 1JQQA 2DL8A 2FPDA 3VS0A 1U5SA 2O2OA 2G6FX 2K3BA 2NWMA 1AWOA 2PTKA 2DM1A 2JW4A 4AFQC 1WDXA 4CC2A 2I0NA 1UHFA 1W6XA 2EYXA 4CC7A 3I9QA 1NLOC 1RI9A 2CREA 2J6OA 2LQNA 1UJYA 2JS2A 2C0OA 1I07A 2F2XA 1NYFA 2JXBA 3EG1A 2CSIA 2CH4A 4HXJA 2DL3A 1Y0MA 1VA7A 2LZ6B 1BBZA 2HSPA 1U06A 3M0QA 3M0PA 2FRWA 2D1XA 1AZGB 1WXTA 2LJ0A 1OEBA 2W0ZA 1FYNA 1SPKA 1GCQA 1UUEA 2EYZA 4K11A 2EGCA 4KRTA 3EG0A 4JJCA 2GBQA 4HVWA 1UTIA 1JU5C 2JM8A 2AZVA 1M30A 3R6NA 2J6FA 4Z89A 2O31A 4RTZA 1JXMA 1RUWA 2K2MA 2IIMA 2RQWA 1H8KA 1I0CA 2LMJA 1YN8A 3FJ5A 2RQUA 1K76A 3VS6A 1UE9A 3M0SA 1X27A 2D0NA 2JTEA 1M8MA 3UA7A 1M3CA 2RPNA 2FRYA 1X6GA 2EGAA 1X43A 1AVZC 3LH5A 4AG1C 4D8KA 2M51A 1KJWA 1T0JA 1UGVA 4RTTA 2KXDA 1X69A 1T3LA 4QT7A 2KYBA 2KROA 4OMOA 2YUNA 2OJ2A 1GCPA 3SHWA 1AZEA 2AKKA 1WIEA 2YT6A 1H3HA 2JM9A 2HBWA 1E7OA 1K1ZA 2DL4A 3EG2A 1FMKA 1NG2A 5FWCA 1Y57A 2LP5A 2XMFA 5I22A 4RTXA 1YCSB 1UDLA 3NPFA 3H0FA 2P4RA 2EYWA 2KRNA 3H41A 4R0KA 4RTUA 3I35A 1SRLA 2A08A 2RQVA 1WLPB 2BTTA 5IXFA 1QKWA 2NUZA 2W10A 3NHNA 3TSWA 2CT4A 3RNJA 2KGTA 3VS5A 1E6HA 3H0IA 4J9GA 1HSQA 4F17A 2YUQA 2YUOA 3O5ZA 4J9IA 3TSZA 3GBQA 2FEIA 3EHRA 4J9FA 2JS0A 1SEMA 1G83A 4RUGA 4J9HA 2ED1A 1MV3A 1ZBJA 1GRIA 1X2QA 2E5KA 4J9DA 4ESRA 1NLPC 2FPFA 2HCKA 2LX7A 2M0YA 2FO0A 2F2WA 2ENMA 2SRCA 2GTJA 1LCKA 1BB9A 4LNPA 3NMZC 1NM7A 1GBQA 2KBTA 1NYGA 4JPBW 4ORZA 2RQRA 1W1FA 1PRMC 1PWTA 1AEYA 1T3SA 2DF6A 2LQWA 2EQIA 2BZ8A 1N5ZA 2C0TA 2FG0A 4AFUC 1PKSA 5GJWB 2PNIA 4J9EA 1UECA 1A0NB 3CQTA 2J7IA 2RF0A 2DA9A 4HVVA 2LNHB 5ECAA 3PVLA 1HJDA 4LUEA 1OPKA 2HEQA 4OMPA 1OOTA 1SSHA 4CC3A 2HDAA 1K4US 1MV0B 1GCQC 1WA7A 2KRMA 2O9SA 5I11A 4AFZC 1VYTA 1SHGA 2RMOA 2QDLA 2J6KA 1M3BA 1QWFA 4Z8AA 1CSKA 2DNUA 1U3OA 2GGRA 5GJVB 4Y92A 2VVKA 3REAB 3RBBB 3M0UA 4X1VA 4OMMA 2AK5A 1IO6A 2K79A 1JEGA 2DE0X 2MCNA 3C0CA 2CUDA 1TUDA 2JT4A 1VYVA 2DBKA 1QLYA 1I1JA 1H92A 3ULRB 2DRKA 4EIKA 1UHCA 3EGUA 2D8HA 3M0RA 3QWXX 4JJDA 2EBPA 1UFFA 3PE0A 1PNJA 2DVJA 5IH2A 2LJ3A 2A37A 4LUDA 2KT8A 3THKA 3A98A 2CH4W 2O88A 2CSQA 1B3QA 1TUCA 2MOXA 3QWYA 1Z9QA 4IIMA 1QWEA 1KSWA 2ROTA 3ZL7C 2FPEA 3M0TA 4J9CA 1VYUA 1KFZA 2J05A 2L2PA 5L23A 1ARKA 2X3WD 3VRZA 2JMCA 1YWPA 4OMNA 5FW9A 4M4ZA 2KE9A 3NGPA 1NEGA 2DL7A 3VS1A 2KNBB 4RTYA 1NEBA 2V1RA 1ABOA 1K0SA 1YP5A 1ABQA 2CUBA 3EHQA 1ZUUA 2RQTA 3UF4A 4A63B 2B86A 2DLPA 3KFVA 2ED0A 5HCKA 1ZX6A 1WXBA 5IHKA 1S1NA 4J9BA 1T0HA 2DX1A 1GBRA 1KIKA 1M3AA 2RN8A 1W70A 2VKNA 2RNAA 2MIOA 3I5RA 1WYXA 3VS7A 1RLQC 4D8DA 2F2VA 2BZXA 1CKBA 4E6RA 1JO8A 2DL5A 1BK2A 1PRLC 1GFDA 2O9VA 1GL5A 2X3XD 1UJ0A 2KXCA 1YNZA 1RLPC 2YSQA 2KYMA 2EW3A 2PZ1A 1WI7A 2DILA 2OI3A 1AWXA 2JMAA 1PHTA 1B07A 2KR3A 2A36A 1M27C 1K9AA 2CDTA 2L3PA 3IQLA 1WXUA 2EPDA 2SEMA 1BU1A 2LCSA 1OV3A 1WFWA 4JJBA 4OMQA 4Z88A 2ESWA 4F14A 2ECZA 4F16A 2EGEA 2L3QA 4LE9A 3VS4A 2H8HA 5IHIA 2DRMA 2KRSA 2DBMA 2DYBA 1SRMA 4GLMA 4LN2A 1X6BA 3VS3A 1E6GA 1TG0A 2OAWA 3UATA 1J3TA 1JXOA 1XOVA 2DMOA 1PKTA 2D8JA 2EYYA 4DEXA 5IHNA 4JZ4A 3SEMA 3TVTA 1HD3A 2ROLA 2GQIA 4HCKA 3I5SA 2EVRA 2J06A 2L3SA 2CT3A 4WCIA 2K6DA 1WX6A 1G2BA 4FSSA 2A28A 1OPLA 1ZSGA 2KEAA 3REBB 1K0XA 2K9GA 2GNCA 2BZYA 1AD5A 1ZUYA 4JZ3A 5EC7A 4RTWA 1AOJA 3EG3A 2YUPA 3VRYA 4AG2C 4ZNXA 3VS2A 4CC4B 4IIOA 4RTVA 1AWWA 2V1QA 2VWFA 3UA6A 3PVQA 1SHFA 3U23A 1CKAA 2C0IA 2KT1A 2ABLA 2L0AA 2EKHA 4AFSC 1EFNA 1V1CA 1QKXA 1AWJA 1X2KA 2YDLA 4GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7A A;  1UG1 A;  3JV3 A;  1Z9Z A;  2AZS A;  1ZUK A;  2DJQ A;  2AKL A;  3H0H A;  1QCF A;  2GTO A;  2LJ1 A;  4DEY A;  4HVU A;  5IXB A;  1MUZ A;  4OML A;  5FWB A;  1YWO A;  1GFC A;  1ZLM A;  1JQQ A;  2DL8 A;  2FPD A;  3VS0 A;  1U5S A;  2O2O A;  2G6F X;  2K3B A;  2NWM A;  1AWO A;  2PTK A;  2DM1 A;  2JW4 A;  4AFQ C;  1WDX A;  4CC2 A;  2I0N A;  1UHF A;  1W6X A;  2EYX A;  4CC7 A;  3I9Q A;  1NLO C;  1RI9 A;  2CRE A;  2J6O A;  2LQN A;  1UJY A;  2JS2 A;  2C0O A;  1I07 A;  2F2X A;  1NYF A;  2JXB A;  3EG1 A;  2CSI A;  2CH4 A;  4HXJ A;  2DL3 A;  1Y0M A;  1VA7 A;  2LZ6 B;  1BBZ A;  2HSP A;  1U06 A;  3M0Q A;  3M0P A;  2FRW A;  2D1X A;  1AZG B;  1WXT A;  2LJ0 A;  1OEB A;  2W0Z A;  1FYN A;  1SPK A;  1GCQ A;  1UUE A;  2EYZ A;  4K11 A;  2EGC A;  4KRT A;  3EG0 A;  4JJC A;  2GBQ A;  4HVW A;  1UTI A;  1JU5 C;  2JM8 A;  2AZV A;  1M30 A;  3R6N A;  2J6F A;  4Z89 A;  2O31 A;  4RTZ A;  1JXM A;  1RUW A;  2K2M A;  2IIM A;  2RQW A;  1H8K A;  1I0C A;  2LMJ A;  1YN8 A;  3FJ5 A;  2RQU A;  1K76 A;  3VS6 A;  1UE9 A;  3M0S A;  1X27 A;  2D0N A;  2JTE A;  1M8M A;  3UA7 A;  1M3C A;  2RPN A;  2FRY A;  1X6G A;  2EGA A;  1X43 A;  1AVZ C;  3LH5 A;  4AG1 C;  4D8K A;  2M51 A;  1KJW A;  1T0J A;  1UGV A;  4RTT A;  2KXD A;  1X69 A;  1T3L A;  4QT7 A;  2KYB A;  2KRO A;  4OMO A;  2YUN A;  2OJ2 A;  1GCP A;  3SHW A;  1AZE A;  2AKK A;  1WIE A;  2YT6 A;  1H3H A;  2JM9 A;  2HBW A;  1E7O A;  1K1Z A;  2DL4 A;  3EG2 A;  1FMK A;  1NG2 A;  5FWC A;  1Y57 A;  2LP5 A;  2XMF A;  5I22 A;  4RTX A;  1YCS B;  1UDL A;  3NPF A;  3H0F A;  2P4R A;  2EYW A;  2KRN A;  3H41 A;  4R0K A;  4RTU A;  3I35 A;  1SRL A;  2A08 A;  2RQV A;  1WLP B;  2BTT A;  5IXF A;  1QKW A;  2NUZ A;  2W10 A;  3NHN A;  3TSW A;  2CT4 A;  3RNJ A;  2KGT A;  3VS5 A;  1E6H A;  3H0I A;  4J9G A;  1HSQ A;  4F17 A;  2YUQ A;  2YUO A;  3O5Z A;  4J9I A;  3TSZ A;  3GBQ A;  2FEI A;  3EHR A;  4J9F A;  2JS0 A;  1SEM A;  1G83 A;  4RUG A;  4J9H A;  2ED1 A;  1MV3 A;  1ZBJ A;  1GRI A;  1X2Q A;  2E5K A;  4J9D A;  4ESR A;  1NLP C;  2FPF A;  2HCK A;  2LX7 A;  2M0Y A;  2FO0 A;  2F2W A;  2ENM A;  2SRC A;  2GTJ A;  1LCK A;  1BB9 A;  4LNP A;  3NMZ C;  1NM7 A;  1GBQ A;  2KBT A;  1NYG A;  4JPB W;  4ORZ A;  2RQR A;  1W1F A;  1PRM C;  1PWT A;  1AEY A;  1T3S A;  2DF6 A;  2LQW A;  2EQI A;  2BZ8 A;  1N5Z A;  2C0T A;  2FG0 A;  4AFU C;  1PKS A;  5GJW B;  2PNI A;  4J9E A;  1UEC A;  1A0N B;  3CQT A;  2J7I A;  2RF0 A;  2DA9 A;  4HVV A;  2LNH B;  5ECA A;  3PVL A;  1HJD A;  4LUE A;  1OPK A;  2HEQ A;  4OMP A;  1OOT A;  1SSH A;  4CC3 A;  2HDA A;  1K4U S;  1MV0 B;  1GCQ C;  1WA7 A;  2KRM A;  2O9S A;  5I11 A;  4AFZ C;  1VYT A;  1SHG A;  2RMO A;  2QDL A;  2J6K A;  1M3B A;  1QWF A;  4Z8A A;  1CSK A;  2DNU A;  1U3O A;  2GGR A;  5GJV B;  4Y92 A;  2VVK A;  3REA B;  3RBB B;  3M0U A;  4X1V A;  4OMM A;  2AK5 A;  1IO6 A;  2K79 A;  1JEG A;  2DE0 X;  2MCN A;  3C0C A;  2CUD A;  1TUD A;  2JT4 A;  1VYV A;  2DBK A;  1QLY A;  1I1J A;  1H92 A;  3ULR B;  2DRK A;  4EIK A;  1UHC A;  3EGU A;  2D8H A;  3M0R A;  3QWX X;  4JJD A;  2EBP A;  1UFF A;  3PE0 A;  1PNJ A;  2DVJ A;  5IH2 A;  2LJ3 A;  2A37 A;  4LUD A;  2KT8 A;  3THK A;  3A98 A;  2CH4 W;  2O88 A;  2CSQ A;  1B3Q A;  1TUC A;  2MOX A;  3QWY A;  1Z9Q A;  4IIM A;  1QWE A;  1KSW A;  2ROT A;  3ZL7 C;  2FPE A;  3M0T A;  4J9C A;  1VYU A;  1KFZ A;  2J05 A;  2L2P A;  5L23 A;  1ARK A;  2X3W D;  3VRZ A;  2JMC A;  1YWP A;  4OMN A;  5FW9 A;  4M4Z A;  2KE9 A;  3NGP A;  1NEG A;  2DL7 A;  3VS1 A;  2KNB B;  4RTY A;  1NEB A;  2V1R A;  1ABO A;  1K0S A;  1YP5 A;  1ABQ A;  2CUB A;  3EHQ A;  1ZUU A;  2RQT A;  3UF4 A;  4A63 B;  2B86 A;  2DLP A;  3KFV A;  2ED0 A;  5HCK A;  1ZX6 A;  1WXB A;  5IHK A;  1S1N A;  4J9B A;  1T0H A;  2DX1 A;  1GBR A;  1KIK A;  1M3A A;  2RN8 A;  1W70 A;  2VKN A;  2RNA A;  2MIO A;  3I5R A;  1WYX A;  3VS7 A;  1RLQ C;  4D8D A;  2F2V A;  2BZX A;  1CKB A;  4E6R A;  1JO8 A;  2DL5 A;  1BK2 A;  1PRL C;  1GFD A;  2O9V A;  1GL5 A;  2X3X D;  1UJ0 A;  2KXC A;  1YNZ A;  1RLP C;  2YSQ A;  2KYM A;  2EW3 A;  2PZ1 A;  1WI7 A;  2DIL A;  2OI3 A;  1AWX A;  2JMA A;  1PHT A;  1B07 A;  2KR3 A;  2A36 A;  1M27 C;  1K9A A;  2CDT A;  2L3P A;  3IQL A;  1WXU A;  2EPD A;  2SEM A;  1BU1 A;  2LCS A;  1OV3 A;  1WFW A;  4JJB A;  4OMQ A;  4Z88 A;  2ESW A;  4F14 A;  2ECZ A;  4F16 A;  2EGE A;  2L3Q A;  4LE9 A;  3VS4 A;  2H8H A;  5IHI A;  2DRM A;  2KRS A;  2DBM A;  2DYB A;  1SRM A;  4GLM A;  4LN2 A;  1X6B A;  3VS3 A;  1E6G A;  1TG0 A;  2OAW A;  3UAT A;  1J3T A;  1JXO A;  1XOV A;  2DMO A;  1PKT A;  2D8J A;  2EYY A;  4DEX A;  5IHN A;  4JZ4 A;  3SEM A;  3TVT A;  1HD3 A;  2ROL A;  2GQI A;  4HCK A;  3I5S A;  2EVR A;  2J06 A;  2L3S A;  2CT3 A;  4WCI A;  2K6D A;  1WX6 A;  1G2B A;  4FSS A;  2A28 A;  1OPL A;  1ZSG A;  2KEA A;  3REB B;  1K0X A;  2K9G A;  2GNC A;  2BZY A;  1AD5 A;  1ZUY A;  4JZ3 A;  5EC7 A;  4RTW A;  1AOJ A;  3EG3 A;  2YUP A;  3VRY A;  4AG2 C;  4ZNX A;  3VS2 A;  4CC4 B;  4IIO A;  4RTV A;  1AWW A;  2V1Q A;  2VWF A;  3UA6 A;  3PVQ A;  1SHF A;  3U23 A;  1CKA A;  2C0I A;  2KT1 A;  2ABL A;  2L0A A;  2EKH A;  4AFS C;  1EFN A;  1V1C A;  1QKX A;  1AWJ A;  1X2K A;  2YDL A;  4GBQ A; 
#chains in the Genus database with same CATH topology
 3CC4 Q;  2K7A A;  2RM4 A;  3PTA A;  1VQP Q;  4D6W A;  1ZUK A;  1KQ2 A;  2AKL A;  3OBW A;  5CR2 A;  5FU7 C;  5LJ3 h;  1K9M R;  2LJ1 A;  2MWO A;  2RA2 A;  3VUZ A;  4RMO A;  2DL8 A;  2RJF A;  2V8K A;  2H3E B;  2QTV A;  2DM1 A;  2BE7 D;  2JW4 A;  2YRC A;  1WDX A;  2RO0 A;  4CC2 A;  2XG8 D;  2EJG A;  1W6X A;  1NLO C;  2CRE A;  3G7Z A;  4XTY A;  2LCC A;  1YI2 Q;  3CC2 T;  5C0M A;  5GAN 7;  4OMF B;  4M77 A;  1KHC A;  3FEO A;  3CCV T;  1OZ3 A;  2LNV A;  3CMA T;  3JRZ A;  2B8A A;  4FIB A;  2OTJ A;  2QEX Q;  3CD6 T;  2KMT A;  3CCS Q;  1BBZ A;  2XDB A;  1U06 A;  1IHW A;  3AT1 B;  1VQ4 A;  4DA4 A;  1WGS A;  2Y4X A;  3OYG A;  1VQ5 Q;  2ZPI B;  1VQ6 Q;  2HD0 A;  1C0M A;  5J3B A;  3MEV A;  1FWZ A;  1UUE A;  2EYZ A;  1VIE A;  3EG0 A;  1PCX A;  1UGS B;  3PMT A;  3MP8 A;  2JM8 A;  4C92 D;  1M30 A;  3A8M B;  3R6N A;  3M55 A;  2O31 A;  4F7U B;  3GP8 A;  2EJ9 A;  3RUX A;  2YXY A;  2FZC B;  4B6M A;  4OVA A;  3E2U A;  1OI1 A;  3FJ5 A;  1UE9 A;  2OX7 A;  1X27 A;  2D0N A;  2IVW A;  5D6Y A;  1X6G A;  3LH5 A;  4PKC C;  4QVZ A;  1PSE A;  1KJW A;  2K3Y A;  4PL6 A;  2KRO A;  1MMN A;  4OP0 A;  3MPU B;  4JS4 A;  3OYE A;  2YT6 A;  4FW2 A;  1GXI E;  3L2U A;  2DKG A;  4MDW A;  3X28 B;  2LP5 A;  5I22 A;  1YCS B;  4FYW B;  2EYW A;  2CP7 A;  4RTU A;  1G5V A;  2QQB A;  1WLP B;  3J81 E;  2M02 A;  1BI1 A;  4N4H A;  1Q81 C;  1SKU B;  3NHN A;  3TSW A;  4QW2 A;  3CC2 Q;  3VS5 A;  1AT1 B;  5AYF A;  2OTJ Q;  1HSQ A;  3TSZ A;  4PFZ A;  4RUG A;  1QCO A;  3G4S T;  2XDP A;  4XTU A;  4C0G A;  3EG9 B;  1VQ9 T;  1MV3 A;  4XU3 A;  1GRI A;  2DK3 A;  3OYN A;  4ESR A;  1NLP C;  1TTH B;  1YCY A;  2HCK A;  2LX7 A;  4M7D C;  4KUD K;  1YBY A;  1HYO A;  4N0A A;  1QW1 A;  4LNP A;  1NM7 A;  3INZ A;  3VKI A;  3CC4 T;  4E7H A;  2F1L A;  4C8Q G;  1P92 A;  8AT1 B;  4M7A D;  1PWT A;  2OTL A;  1T3S A;  3ER0 A;  4M77 C;  2AIR B;  4DBH A;  2LQW A;  1LNX A;  2QYZ A;  3QJY A;  1WHJ A;  3V7R A;  4KH1 B;  4DOW A;  1NBE B;  1PKS A;  5GJW B;  4J9E A;  1UEC A;  3CQT A;  2RF0 A;  4M77 E;  2C06 A;  1WQ7 A;  1HJD A;  4LUE A;  3EFO B;  1VQO T;  4PJM A;  3CCE Q;  3BFM A;  1U8R A;  2LRQ A;  1KK7 A;  1VQK Q;  1BI3 A;  1YI2 T;  3PIP A;  5GAN 4;  3CME T;  4M7A B;  1SHG A;  5CIU A;  4PLI A;  2NUP A;  4RCB A;  2EYQ A;  1M2V A;  2A7Y A;  2CS7 A;  1YJW A;  3CMA Q;  2WSF E;  3DLM A;  4Y92 A;  5GJV B;  1QP2 A;  3I56 Q;  3RBB B;  2VGM A;  1VQ7 Q;  4FW1 A;  2PVG B;  1B34 B;  1O9S A;  4ME7 A;  5CQX A;  5HY6 A;  3NFC A;  5M9O A;  1OYX A;  4XAX B;  2YRV A;  3R6O A;  4J7I A;  4GY5 A;  1C6V X;  2MAM A;  2VAS A;  1YIT T;  1H92 A;  3ULR B;  2DRK A;  4EIK A;  4EMK A;  1MGQ A;  3EGU A;  2D8H A;  5GMK l;  3JCM P;  3QWX X;  4M75 F;  3I55 Q;  1UFF A;  1PNJ A;  4R56 A;  4KUL A;  2DVJ A;  2CGH A;  2DZ9 A;  2LJ3 A;  3G6E A;  2HL3 A;  2MWP A;  3CEY A;  2CH4 W;  1TSF A;  3S3N A;  3FJP A;  3CCU Q;  1N8R R;  1M90 R;  5LJ5 d;  3CCR T;  1TUC A;  4C0F A;  1Z9Q A;  4IIM A;  1KSW A;  3EH2 A;  4VUB A;  1OZ2 A;  1OU9 A;  2J05 A;  3OW2 A;  2HSE B;  2K3X A;  3VRZ A;  4JRQ A;  3BDL A;  2M16 A;  4BDY A;  3NGP A;  2HAX A;  3X26 B;  2DL7 A;  4UC4 A;  1VQ4 T;  2EJF A;  4RTY A;  4PNO A;  1NEB A;  3P8D A;  3HHT B;  1EX4 A;  1FMW A;  1XTD A;  1PG5 B;  3V8L A;  5GAM g;  1ZUU A;  2COY A;  8ATC B;  4KBM B;  1LVK A;  3RKW A;  1ZSZ C;  2WAC A;  2DJZ A;  1JB0 E;  2RN8 A;  2RNA A;  4ZGE B;  1IRX A;  3JCM W;  3JCM g;  1OQK A;  4E6R A;  3G71 Q;  2JN0 A;  2KXC A;  1RLP C;  1WHH A;  4IUV A;  3CCJ Q;  3M9Q A;  3QUI A;  2DIL A;  2OI3 A;  2E3I A;  2V26 A;  1PHT A;  1VIF A;  4A4H A;  4Q5W A;  2CZ0 B;  3IQL A;  1B34 A;  1M1G A;  2GFU A;  4HKE A;  2EPD A;  2SEM A;  4M7A C;  1MMD A;  2VXE A;  4OMQ A;  4MZM A;  1OX8 A;  2RHZ A;  2X4Y A;  2ECZ A;  1ZA2 B;  2EGE A;  5GAN 6;  5KH6 A;  3VS4 A;  5GAO l;  2H8H A;  5DLO A;  4M77 G;  2AT1 B;  3FRN A;  3SFM A;  3GF5 A;  3JCM c;  4KUI A;  1I81 A;  2DRM A;  2D6F A;  1YI2 A;  2GQI A;  4HCK A;  3GPL A;  4C8Q D;  1TU0 B;  5I21 A;  2QA4 T;  4M7D B;  5DLQ E;  3FC3 A;  3OA6 A;  4EMH A;  1G2B A;  2FVU A;  3HL8 A;  5KYN A;  3REB B;  1QP3 A;  1V76 A;  2V8I A;  1AD5 A;  2JUF A;  2HQX A;  4FYY B;  4JZ3 A;  1KD1 R;  3EG3 A;  4AG2 C;  3PT9 A;  3VS2 A;  1R77 A;  4M75 E;  3Q1J A;  3X25 B;  2DXU A;  2VWF A;  3SWN A;  3JCM Q;  4XU1 A;  1YFN A;  1CKA A;  5IN1 A;  5GMK h;  3QG1 A;  4F7U E;  1QMC A;  1QKX A;  1OX9 A;  1X2K A;  3JAM E;  4QQG A;  4KGZ B;  5LJ5 g;  4C92 B;  1UG1 A;  4J8O A;  2DJQ A;  4ZN3 A;  3QPH A;  3BE3 A;  2A0F B;  2L5Q A;  3CCV Q;  4KT0 E;  1QCF A;  4FT4 A;  4LDU A;  1D0Y A;  4DEY A;  4ZN1 A;  1KQS A;  1VQM A;  3SWN C;  2MMP A;  1JQQ A;  1M1F A;  1S72 Q;  1VQ5 T;  3ZBD A;  1ZHI A;  2K3B A;  2PTK A;  1I4K 1;  3OYL A;  1HXD A;  4AFQ C;  2CZ1 B;  1QVG A;  2I0N A;  1K73 U;  2EYX A;  3I9Q A;  2K57 A;  1RI9 A;  1LPL A;  2VYT A;  5FU6 B;  1UJY A;  3CPW S;  3JB9 J;  1X01 A;  2EQM A;  2MI6 A;  2F69 A;  4BAC A;  2COW A;  4M75 G;  2JXB A;  3CC7 T;  1Y0M A;  1VA7 A;  3OW2 S;  2LZ6 B;  2X35 A;  4KGX B;  3KUF A;  1EZZ B;  3JB9 H;  5KYU B;  1OEB A;  2JVV A;  5A2Q E;  1VOM A;  1YJN A;  4K11 A;  2EGC A;  4KRT A;  2CKK A;  3RDV A;  3G71 T;  1IXD A;  4AT1 B;  2R5A A;  2ZAE A;  1UTI A;  2LT4 A;  3OYA A;  2ZCF B;  1FXX A;  2EQK A;  2K2M A;  2IIM A;  2X4X A;  1H8K A;  2K5L A;  2LMJ A;  3GLX A;  5GMK e;  3CXC A;  2D0Q B;  4QQD A;  2RQU A;  3VS6 A;  4RG8 A;  2JTE A;  2E1H A;  3UA7 A;  2RPN A;  1YJ9 A;  1X43 A;  4AG1 C;  2CYZ B;  3JCM X;  1UGV A;  1R0C B;  3OQ5 A;  4A4F A;  1X69 A;  2NYS A;  4OMO A;  3CCQ Q;  1I5L A;  1N27 A;  2YUN A;  2EWN A;  1GCP A;  4M77 B;  4ELY C;  1WIE A;  1H3H A;  1D09 B;  3MEU A;  3OS2 A;  1E7O A;  1K1Z A;  2DL4 A;  5KYX B;  3VV0 A;  4EMK C;  1NG2 A;  2YLB A;  4PFP A;  3WVD B;  2L3R A;  1UDL A;  2DER A;  3H0F A;  2P4R A;  2HBP A;  2KRN A;  3H41 A;  4FU6 A;  4R0K A;  1JJ2 S;  4DBR A;  4RCC A;  1SF9 A;  1SRL A;  3GOX A;  2L8D A;  2VXF A;  4MZP A;  1Q81 U;  4Y28 E;  1YJW Q;  4M7A G;  2CT4 A;  4LDW A;  2KGT A;  5LJ5 j;  3I56 A;  4B9W A;  1N6A A;  4F17 A;  1WHG A;  4M78 F;  3GBQ A;  5LL6 S;  3H9N A;  2ED1 A;  3VUB A;  1XJW B;  2E5K A;  1D1C A;  6AT1 B;  2EFI A;  5DM7 R;  1X75 C;  3WXM B;  2F2W A;  1WJR A;  1BB9 A;  1LCK A;  2RHX A;  1VQK T;  2F5K A;  1NYG A;  4JPB W;  4ORZ A;  1BI0 A;  3JB9 I;  2RQR A;  2E5Q A;  1PRM C;  3VU3 C;  4TVR A;  1Q95 G;  2EQI A;  2BZ8 A;  1N5Z A;  2K5F A;  5KE2 A;  2C0T A;  2FG0 A;  4AFU C;  2PNI A;  2J7I A;  4HVV A;  5ECA A;  2LNH B;  1LOJ A;  3NTK A;  2HEQ A;  2XK0 A;  1OOT A;  1SSH A;  3FDR A;  4ZGJ B;  3CCQ A;  1GCQ C;  4M7D G;  2RMO A;  5GAN d;  2QDL A;  1YIJ Q;  5FU7 B;  1RAE B;  3LLR A;  1KD1 C;  1QWF A;  4M78 D;  2QEX A;  2DNU A;  2GGR A;  5AT1 B;  2VVK A;  3M53 A;  3M0U A;  3OYJ A;  1RAD B;  2DXB A;  2RJC A;  3HRT A;  1IO6 A;  5KYW A;  3CCU T;  1U1S A;  2K79 A;  2JTM A;  1SG5 A;  2XDD A;  2JT4 A;  4FL6 A;  1K73 C;  1RAB B;  4X34 A;  1M4Z A;  4MMK A;  4BUG A;  2K4Y A;  3QYG B;  2BKD N;  1RL2 A;  4M78 A;  1UHC A;  1ZQ1 A;  1ZA1 B;  5GAM d;  2CP2 A;  3C95 A;  3PE0 A;  4HT9 A;  5IH2 A;  1Q86 R;  3SD4 A;  3M58 A;  2A37 A;  4JUV A;  4LUD A;  1M90 C;  3OYD A;  1I5O B;  1YJN T;  2O88 A;  1PD1 A;  3SWN B;  1VQ9 A;  3DLL A;  1B3Q A;  2QTX A;  2MOX A;  2KY9 A;  3CCJ A;  3LH0 A;  3JCM e;  2NUT A;  4J9C A;  1D1B A;  4C0D B;  1KFZ A;  4PJO A;  5L23 A;  4PJO D;  4XTW A;  5CVI A;  4NL2 A;  4XTV A;  1ARK A;  2LDM A;  5FRO A;  1YWP A;  1BKB A;  2L89 A;  2VB6 A;  4HT8 A;  1JBM A;  2HL5 C;  2JZ2 A;  3UT1 A;  4BY6 B;  2CP3 A;  1H3Z A;  1M90 U;  1NEG A;  1WHK A;  3EGD B;  2PQW A;  2VC8 A;  1YP5 A;  1JJ2 P;  1ABQ A;  1VQO A;  3E9G A;  2HZY A;  4JRP A;  2RQT A;  4LD6 A;  2X51 A;  2DLP A;  3CME A;  3KFV A;  5HCK A;  3V7S A;  3G4S Q;  1UEB A;  2DX1 A;  2COZ A;  1GBR A;  3KXT A;  1KIK A;  3OB9 A;  1M3A A;  4QVC A;  1IB8 A;  2VKN A;  3JB9 D;  2FL7 A;  4PJN A;  3P8H A;  3CCM Q;  3OSV A;  5GMK j;  1MMA A;  2A3L A;  3J80 E;  1ACM B;  2M1H A;  1CKB A;  1KQ1 A;  2OTL Q;  5L8R E;  1GFD A;  2O9V A;  1YJ9 T;  1W2B P;  1UJ0 A;  5GMK i;  1UB4 A;  2MYS A;  3OSS C;  2YSQ A;  4M77 D;  4E7L A;  2DD5 A;  2XU8 A;  2PZ1 A;  3HKS A;  3OS5 A;  2P4T A;  5DY9 A;  1QVG S;  1B07 A;  2KR3 A;  2DTI A;  2A36 A;  1D1A A;  1BCM A;  1VQK A;  1RAI B;  3LGF A;  4PFO A;  3G6E T;  3KBG A;  1M9S A;  3OS0 A;  3JCM h;  2LCS A;  4CRI A;  1WFW A;  2Y90 A;  4M75 B;  3E9F A;  3CMA A;  4NL3 A;  1VQM Q;  2VV5 A;  1NE8 A;  2VGN A;  3C12 A;  5LJ3 f;  3NTH A;  2PU9 B;  2QQ9 A;  2PUO B;  3F70 A;  4L6V 5;  1Y7X A;  1VQN T;  1QQJ A;  1D0X A;  5IHI A;  2KRS A;  2QQR A;  4X9D A;  3CCL T;  2DMO A;  4BDZ A;  3SEM A;  5LJ3 g;  1VQ8 Q;  5GAN h;  1IRE B;  1G3Y A;  3MO8 A;  2RD1 A;  2FYK A;  2KSS A;  1OPL A;  3OBY A;  1WHL A;  1ZSG A;  2KEA A;  5LJ3 j;  1K0X A;  3GNF B;  2K9G A;  4LXC A;  2X9H A;  3L2Q A;  2CZ6 B;  4L59 A;  3CCU A;  1Q82 C;  1TUG B;  3CCM A;  4EMG A;  4BI3 A;  4CC4 B;  2LX9 A;  5CQY A;  2YLC A;  1YJN Q;  2E70 A;  4RTV A;  1AWW A;  3UA6 A;  3QBY A;  4PJO E;  1SHF A;  2I2L A;  3V8J A;  5CKB A;  2E6Z A;  3OW2 P;  4JLI A;  2E65 A;  2PUK B;  5LJ5 e;  4WF2 A;  3JV3 A;  2RHY A;  3OYF A;  4WTO B;  1EIF A;  1PM3 A;  2GTO A;  5IXB A;  3JB9 G;  4OF1 A;  1YWO A;  1GFC A;  1ZLM A;  4HCC A;  2FPD A;  4FT2 A;  3VYH B;  2NWM A;  1AWO A;  1G3T A;  4OB2 B;  1RAG B;  4MML A;  2J6O A;  3RMQ A;  4DOV A;  4C8Q A;  2JS2 A;  2HQH A;  2FHD A;  2C0O A;  2Y4Y A;  3MJX A;  1G3S A;  2RHU A;  3C4S A;  4YTL A;  1KQS P;  2CSI A;  1WJS A;  2CH4 A;  2KVQ G;  2EAY A;  1VQ6 A;  2R57 A;  1MMG A;  1VQ8 A;  2X4W A;  3M0P A;  2DVE A;  3EFO A;  1WXT A;  3NTI A;  1N9S A;  2JOY A;  2BE9 B;  2W0Z A;  3CCS A;  4ZTJ A;  1Q7Y C;  1SPK A;  1GCQ A;  2OTL T;  1IHV A;  1Y96 B;  4A54 A;  4PJO B;  4HVW A;  2JTF A;  3S6W A;  4C0Z A;  5KE3 A;  1K8A R;  1K9M C;  3L2W A;  2OAU A;  2J6F A;  4IUU A;  3E19 A;  3CCJ T;  1JXM A;  2CP5 A;  4M75 A;  1Y96 A;  1AHJ B;  1PSF A;  1YHQ Q;  2LTO A;  4IUP A;  2XKO C;  3OS1 A;  3PMI A;  3M0S A;  4QVD A;  2YRD A;  1M8M A;  2ZPH B;  1M3C A;  2DFU A;  3HRS A;  2FRY A;  3EG9 A;  5A0G A;  5GMK m;  1T0J A;  4PK4 A;  5CO7 A;  3HTR A;  4RTT A;  1YJW T;  2KXD A;  4QT7 A;  2KYB A;  1B7T A;  1K8A U;  2VUB A;  2OJ2 A;  1X6O A;  3SHW A;  4KH0 B;  2PVO B;  2RB6 A;  2E64 A;  4BE0 A;  1VQN Q;  1RAA B;  1FMK A;  2GQV A;  4HA8 A;  2FZK B;  1N9R A;  2E6N A;  1QCN A;  4C8Q B;  3NPF A;  5J26 A;  2M0O A;  2A08 A;  2RQV A;  2QGF B;  1W4S A;  2DXC A;  2BTT A;  2DIG A;  5IXF A;  3OYY A;  1QKW A;  2NUZ A;  3LYI A;  3SB2 A;  2RJE A;  2E3H A;  1E6H A;  3H0I A;  3MKD A;  3OYH A;  4BB7 A;  2YUQ A;  2YUO A;  2KQW A;  3EHR A;  4M7A A;  4J9F A;  4P5N A;  1SEM A;  3CC2 A;  2QK0 A;  1RAF B;  4J9H A;  4EPC A;  1VQL Q;  5LJ3 d;  1ZBJ A;  4J9D A;  1MNE A;  2RK1 A;  4RG2 A;  3CD6 A;  1ZSZ B;  2SRC A;  5A0D A;  2GTJ A;  1GBQ A;  4EDU A;  1M1K C;  4F7U F;  3P8B B;  1H64 1;  3A8O B;  2NUT B;  1W1F A;  2DF6 A;  2QQS A;  5GAO m;  4NOY A;  5CAI A;  2NLU A;  2R5M A;  4LD9 K;  1S72 T;  3CCE A;  2DA9 A;  4N0A C;  4B9X A;  4PJL A;  3PVL A;  1OPK A;  4BE1 A;  4CC3 A;  1K4U S;  1MV0 B;  3QZ5 B;  4C8Q E;  3RER A;  4HCB A;  1Q86 U;  1D3B A;  1R0B G;  2O9S A;  3MEW A;  2CZ7 B;  1VYT A;  5I11 A;  2DO3 A;  4C0D C;  2J6K A;  1M1K U;  1M3B A;  2IG0 A;  4M78 B;  1CSK A;  2MF2 A;  3I55 T;  3QO3 A;  7AT1 B;  3QXE B;  4J6Y A;  5D6X A;  2LQK A;  2HQE A;  4FSX A;  4OMM A;  3H6Z A;  2AK5 A;  1TS9 A;  2RHI A;  3C94 A;  4J83 A;  2DE0 X;  4BI8 B;  9ATC B;  3AHU A;  4L5G A;  2CUD A;  5GAO q;  1VYV A;  2DBK A;  1QLY A;  3OMG A;  1I1J A;  4PJO G;  4M78 E;  5LJ5 h;  4C92 F;  4IUQ A;  2BIV A;  1D0Z A;  2YWW A;  4JJD A;  2EBP A;  1NJI C;  3EGX B;  4LDY A;  2E41 A;  5GAM j;  5A0L A;  1KG1 A;  1N8R C;  1JJ2 A;  4A4E A;  2QGG A;  3M54 A;  4N4I A;  1KC8 R;  2XI9 A;  1M8V A;  2DXT A;  2V8J A;  3X20 B;  3QWY A;  4F7U A;  3ZL7 C;  2FPE A;  2P0Q A;  3QII A;  2ZZD A;  4LDX A;  3OY9 A;  1VYU A;  1BIB A;  3LX7 A;  3CC7 Q;  1WJQ A;  3UDC A;  3CC4 A;  3LW5 E;  2JMC A;  4OMN A;  3JCM d;  3M4G A;  3QZ9 B;  1VQ8 T;  2R58 A;  3VS1 A;  4IUR A;  2KNB B;  1FX7 A;  4FM4 B;  2V1R A;  1ABO A;  3CCQ T;  5EG2 A;  4A4K A;  3L1A A;  3UF4 A;  4JDS A;  4OGC A;  3E1S A;  2ED0 A;  2X4J A;  3A1P A;  4QQ6 A;  5IHK A;  4J9B A;  4OB1 B;  1WQW A;  5CCA A;  2DTO A;  4JS5 A;  2CP6 A;  2MIO A;  3I5R A;  3JSC A;  2QAZ A;  1RLQ C;  2Z0W A;  3O8V A;  2F2V A;  3V8K A;  3L42 A;  3V7C A;  1BK2 A;  1PRL C;  3DB4 A;  2WSE E;  1PC0 A;  2X3X D;  4E2F B;  1YNZ A;  4JJN K;  4ANJ A;  5GAO r;  2EW3 A;  3WVE B;  1YIT A;  2GFA A;  1AWX A;  2JMA A;  4C5I A;  2DET A;  2RI3 A;  5IT9 E;  2GCX A;  3QDF A;  3CCL Q;  3TRE A;  3TCJ A;  3CBP A;  1WXU A;  5FLX E;  5KYW B;  3FIF A;  1YIJ A;  5GAN 8;  1BU1 A;  1F1B B;  4M7A E;  5I2S A;  1OUL A;  2QI2 A;  2JNG A;  4Z88 A;  5CKF A;  3CC7 A;  3TQ7 P;  3QSU A;  4F14 A;  2KAF A;  4F16 A;  2OTJ T;  3PGG A;  1BI2 A;  4Y91 A;  4LE9 A;  4O6J A;  3MHX A;  5GAO p;  5GAN f;  3ME9 A;  1D3B B;  4OGE A;  2DYB A;  5HK3 A;  1X6B A;  3GNG A;  1J3T A;  2OAW A;  2EYY A;  1PKT A;  2D8J A;  4DEX A;  2G3R A;  4PJJ A;  3BDU A;  2EQU A;  2DZC A;  1SSF A;  1NZ9 A;  2EVR A;  2J06 A;  2L3S A;  2CT3 A;  5FRN A;  4WCI A;  1NJI R;  1QVF A;  1W2B A;  1WX6 A;  4FYX B;  2A28 A;  4C5H A;  2BZY A;  4CI0 C;  2HNI A;  2LQ8 A;  4C5G A;  3JCM f;  3CPF A;  1AOJ A;  2YHT A;  4ZGD B;  2ZPG B;  4IIO A;  2K2V A;  1ZSZ A;  3OYM A;  3PVQ A;  3U23 A;  3QKJ A;  2C0I A;  4C5E A;  3LGL A;  2ABL A;  3QYH B;  2L0A A;  2EKH A;  4II1 A;  4NS5 A;  1V1C A;  1PD0 A;  1AWJ A;  2YDL A;  3EGX A;  4KGV B;  1YIT Q;  3BW1 A;  5FU6 C;  1Z9Z A;  2AZS A;  3MEA A;  4C92 A;  5CKH A;  3H0H A;  4PJO C;  3X24 B;  3UWN A;  2RH2 A;  4HVU A;  1MUZ A;  4OML A;  5FWB A;  3FB9 A;  2D9T A;  2MPX C;  4BE2 A;  2HKN A;  3M5A A;  3VS0 A;  1U5S A;  2O2O A;  2G6F X;  5KCO A;  5GAN j;  4F7U G;  3N5B B;  2EIF A;  1UHF A;  4CC7 A;  2LQN A;  4BI4 A;  1O75 A;  5KYX A;  1I07 A;  3CME Q;  2F2X A;  2XIC A;  3G4S A;  1NYF A;  3EG1 A;  3ZFJ A;  4M7D A;  4JRI A;  4X9C A;  4HXJ A;  2DL3 A;  5KYY A;  1WPY A;  2HSP A;  3M0Q A;  1YHQ T;  1V29 B;  2FRW A;  2D1X A;  2ATC B;  1AZG B;  3H8Z A;  2LJ0 A;  2XHC A;  2QDY B;  1FYN A;  1VQ7 A;  1I8F A;  3CCR Q;  2LCL A;  2FZG B;  4JJC A;  2GBQ A;  1QVP A;  3RKX A;  1JU5 C;  2ZPF B;  2AZV A;  2IPO B;  3A5Z B;  4Z89 A;  3M4Y A;  3CXC S;  4RTZ A;  3EAE A;  2DEU A;  1RUW A;  2QA4 A;  3LWH A;  2RQW A;  3CD6 Q;  1W2B S;  2ZPB B;  3CPW P;  1I0C A;  4HCZ A;  2HMA A;  1YN8 A;  2E12 A;  3PFS A;  1K76 A;  4XTZ A;  4QKU A;  3G6E Q;  3CCM T;  3OYI A;  2MK5 A;  2EGA A;  1KQS S;  1AVZ C;  2XD0 A;  5KYU A;  4D8K A;  2M51 A;  4XQ3 A;  4IUT A;  1JRI A;  2M9U A;  1QVF P;  1T3L A;  3MET A;  3MP6 A;  1YJ9 Q;  1M1K R;  3JCM J;  5CKD A;  1VQP T;  3JCM V;  5IAY A;  4AMC A;  1AZE A;  2AHJ B;  2AKK A;  2JM9 A;  2HBW A;  4PJO F;  5HKC A;  2QG9 B;  3EG2 A;  1VQL T;  3TEE A;  5FWC A;  1Y57 A;  2XMF A;  3RES A;  4RTX A;  3A8H B;  4XU0 A;  1Q7Y R;  4OB3 B;  5D6W A;  4XK8 E;  3L2R A;  3G1J A;  3I35 A;  1VQ5 A;  2O4X A;  4M7D E;  4DBQ A;  3S3M A;  1WZO A;  1BCO A;  2W10 A;  4DQ2 A;  3RNJ A;  1M2V B;  3GIB A;  2NUP B;  4J9G A;  1K8A C;  3O5Z A;  5KCH A;  4J9I A;  2FEI A;  2JS0 A;  2FB7 A;  1G83 A;  1G8X A;  3EGD A;  5LJ5 f;  3M59 A;  2ZGW A;  1NJI U;  3CCR A;  3TU4 K;  5GAN 5;  1X2Q A;  1M5Q 1;  4JLG A;  2FPF A;  1VQ6 T;  1ZBX A;  1IGQ A;  3JB9 F;  2M0Y A;  2FO0 A;  4MZT A;  4OB0 B;  1QVG P;  1BIA A;  2ENM A;  4M78 G;  4XTX A;  3T9N A;  3NMZ C;  1R8O B;  3HP9 A;  2KBT A;  4ZTF A;  3HSB A;  1M2O A;  1YIJ T;  5C6S A;  2QA4 Q;  2K5I A;  3G71 A;  1AEY A;  3HFN A;  4M7D F;  4J6X A;  4M77 F;  4BY6 C;  2RJD A;  2P0P A;  1A0N B;  4XU2 A;  1FMV A;  3CBO A;  1DJ7 B;  2P0K A;  3M57 A;  2HKQ B;  4OMP A;  4ELZ C;  4E7J A;  5GAN g;  2HDA A;  3M56 A;  1NPP A;  1WA7 A;  4IKF A;  2KRM A;  4AFZ C;  3RR6 A;  3OYB A;  4Z8A A;  3S3O A;  3DKM A;  4J5Y A;  3QDR B;  4LDV A;  1U3O A;  4RKU E;  4M75 C;  3REA B;  2O4X B;  5GAM h;  4X1V A;  3CXC P;  2O01 E;  1N8R U;  1Q7Y U;  1JEG A;  1TH7 A;  2DTH A;  2E4H A;  2MCN A;  3C0C A;  1TUD A;  2GF7 A;  3MP1 A;  4Z02 A;  4C8Q F;  4E7Z A;  4C8Q C;  3CPW A;  2F5T X;  2QQA A;  3PIO A;  3M0R A;  4M7A F;  1YHQ A;  1Q82 U;  1VUB A;  4E47 A;  2RI2 A;  3I56 T;  2KI7 A;  1QVF S;  2DYI A;  1Q81 R;  3CBM A;  1VQ7 T;  1WHM A;  2KT8 A;  1KC8 C;  2DEQ A;  3A98 A;  3THK A;  1VQ9 Q;  3URG A;  1UGR B;  2XID A;  4GLK A;  1RI0 A;  4E7S A;  2H3J A;  2CSQ A;  4M78 C;  3OYK A;  4O5V A;  1UGQ B;  3OMC A;  5HK0 A;  1QWE A;  2ROT A;  3QHS A;  3M0T A;  2WSC E;  1VQN A;  2KDS A;  4ATO A;  1RAC B;  3ASK A;  2L2P A;  2LC4 A;  4C92 E;  3CCL A;  2X3W D;  5FW9 A;  4M4Z A;  3RIR A;  3CCV A;  1LJO A;  2KE9 A;  1U1T A;  1HK9 A;  4F04 B;  2RI5 A;  5GAN e;  1KC8 U;  1Q82 R;  2DIQ A;  1VQO Q;  1S72 A;  3RKY A;  3CCE T;  1KD1 U;  3EFS A;  5KYY B;  1XNI A;  1K0S A;  1G3W A;  2CUB A;  3EHQ A;  3L2Z A;  1VQL A;  4BD3 A;  5GAM e;  3L2V A;  4A63 B;  2B86 A;  5GAO n;  3A8L B;  2QAS A;  1ZX6 A;  2BUD A;  1WXB A;  5I2M A;  4E7K A;  1S1N A;  3HPW A;  1T0H A;  2QEX T;  4A4G A;  4C92 C;  3I55 A;  2EKO A;  1W70 A;  2LVM A;  1TXQ A;  5J39 A;  1WYX A;  3VS7 A;  4D8D A;  3FLG A;  1IZ6 A;  2BZX A;  3QJ6 A;  1JO8 A;  2DL5 A;  4R55 A;  1C1A A;  1VQM T;  1GL5 A;  4DBF A;  1Y71 A;  2KYM A;  3HFO A;  2P84 A;  4JRK A;  1XQH A;  4EMK B;  1WI7 A;  3JCM b;  4M75 D;  1VQP A;  2DD4 A;  5LJ3 e;  3DB3 A;  3MCA B;  1TWB A;  1RAH B;  3SDZ A;  1K9A A;  1M27 C;  2CDT A;  3VYG A;  2L3P A;  4E7I A;  4J7F A;  4N4G A;  2RK2 A;  2LT1 A;  1MND A;  3LWI A;  1MHN A;  2JJ9 A;  1OV3 A;  2CP0 A;  4JJB A;  2ESW A;  3EH1 A;  1Q86 C;  2L3Q A;  3PNW C;  3VJP A;  4C92 G;  1BYM A;  1OU8 A;  3CCS T;  4LN2 A;  2DBM A;  4GLM A;  1SRM A;  1TOV A;  3VS3 A;  5GAM f;  1E6G A;  1TG0 A;  3UAT A;  3J7A F;  1JXO A;  1XOV A;  2E10 A;  5IHN A;  2QXF A;  4JZ4 A;  3TVT A;  1HD3 A;  2ROL A;  4J6W A;  1VQ4 Q;  3I5S A;  5GAN 3;  2PVD B;  1Y07 A;  3ZEH A;  4V2S A;  4MDX A;  2DAQ A;  2ZPE B;  2K6D A;  3HRU A;  4M7D D;  4FSS A;  3D7S B;  4A53 A;  2GNC A;  4PLL A;  3A8G B;  1WNL A;  3EFR A;  1K9M U;  1ZUY A;  5EC7 A;  1K73 R;  5GAN 2;  4RTW A;  1UGP B;  2YUP A;  1NPR A;  3VRY A;  3UPU A;  4ZNX A;  2EQJ A;  4FYV B;  5CKE A;  3RMS A;  2KK4 A;  1IGU A;  2V1Q A;  1KHI A;  2DPP B;  5FRM A;  3OYC A;  5CK9 A;  2KT1 A;  3BY7 A;  4AFS C;  4FCY A;  1EFN A;  5D7U A;  4GBQ A; 
#chains in the Genus database with same CATH homology
 2K7A A;  1UG1 A;  3JV3 A;  1Z9Z A;  2AZS A;  1ZUK A;  2DJQ A;  2AKL A;  3H0H A;  1QCF A;  2GTO A;  2LJ1 A;  4DEY A;  4HVU A;  5IXB A;  1MUZ A;  4OML A;  5FWB A;  1YWO A;  1GFC A;  1ZLM A;  1JQQ A;  2DL8 A;  2FPD A;  3VS0 A;  1U5S A;  2O2O A;  2G6F X;  2K3B A;  2NWM A;  1AWO A;  2PTK A;  2DM1 A;  2JW4 A;  4AFQ C;  1WDX A;  4CC2 A;  2I0N A;  1UHF A;  1W6X A;  2EYX A;  4CC7 A;  3I9Q A;  1NLO C;  1RI9 A;  2CRE A;  2J6O A;  2LQN A;  1UJY A;  2JS2 A;  2C0O A;  1I07 A;  2F2X A;  1NYF A;  2JXB A;  3EG1 A;  2CSI A;  2CH4 A;  4HXJ A;  2DL3 A;  1Y0M A;  1VA7 A;  2LZ6 B;  1BBZ A;  2HSP A;  1U06 A;  3M0Q A;  3M0P A;  2FRW A;  2D1X A;  1AZG B;  1WXT A;  2LJ0 A;  1OEB A;  2W0Z A;  1FYN A;  1SPK A;  1GCQ A;  1UUE A;  2EYZ A;  4K11 A;  2EGC A;  4KRT A;  3EG0 A;  4JJC A;  2GBQ A;  4HVW A;  1UTI A;  1JU5 C;  2JM8 A;  2AZV A;  1M30 A;  3R6N A;  2J6F A;  4Z89 A;  2O31 A;  4RTZ A;  1JXM A;  1RUW A;  2K2M A;  2IIM A;  2RQW A;  1H8K A;  1I0C A;  2LMJ A;  1YN8 A;  3FJ5 A;  2RQU A;  1K76 A;  3VS6 A;  1UE9 A;  3M0S A;  1X27 A;  2D0N A;  2JTE A;  1M8M A;  3UA7 A;  1M3C A;  2RPN A;  2FRY A;  1X6G A;  2EGA A;  1X43 A;  1AVZ C;  3LH5 A;  4AG1 C;  4D8K A;  2M51 A;  1KJW A;  1T0J A;  1UGV A;  4RTT A;  2KXD A;  1X69 A;  1T3L A;  4QT7 A;  2KYB A;  2KRO A;  4OMO A;  2YUN A;  2OJ2 A;  1GCP A;  3SHW A;  1AZE A;  2AKK A;  1WIE A;  2YT6 A;  1H3H A;  2JM9 A;  2HBW A;  1E7O A;  1K1Z A;  2DL4 A;  3EG2 A;  1FMK A;  1NG2 A;  5FWC A;  1Y57 A;  2LP5 A;  2XMF A;  5I22 A;  4RTX A;  1YCS B;  1UDL A;  3NPF A;  3H0F A;  2P4R A;  2EYW A;  2KRN A;  3H41 A;  4R0K A;  4RTU A;  3I35 A;  1SRL A;  2A08 A;  2RQV A;  1WLP B;  2BTT A;  5IXF A;  1QKW A;  2NUZ A;  2W10 A;  3NHN A;  3TSW A;  2CT4 A;  3RNJ A;  2KGT A;  3VS5 A;  1E6H A;  3H0I A;  4J9G A;  1HSQ A;  4F17 A;  2YUQ A;  2YUO A;  3O5Z A;  4J9I A;  3TSZ A;  3GBQ A;  2FEI A;  3EHR A;  4J9F A;  2JS0 A;  1SEM A;  1G83 A;  4RUG A;  4J9H A;  2ED1 A;  1MV3 A;  1ZBJ A;  1GRI A;  1X2Q A;  2E5K A;  4J9D A;  4ESR A;  1NLP C;  2FPF A;  2HCK A;  2LX7 A;  2M0Y A;  2FO0 A;  2F2W A;  2ENM A;  2SRC A;  2GTJ A;  1LCK A;  1BB9 A;  4LNP A;  3NMZ C;  1NM7 A;  1GBQ A;  2KBT A;  1NYG A;  4JPB W;  4ORZ A;  2RQR A;  1W1F A;  1PRM C;  1PWT A;  1AEY A;  1T3S A;  2DF6 A;  2LQW A;  2EQI A;  2BZ8 A;  1N5Z A;  2C0T A;  2FG0 A;  4AFU C;  1PKS A;  5GJW B;  2PNI A;  4J9E A;  1UEC A;  1A0N B;  3CQT A;  2J7I A;  2RF0 A;  2DA9 A;  4HVV A;  2LNH B;  5ECA A;  3PVL A;  1HJD A;  4LUE A;  1OPK A;  2HEQ A;  4OMP A;  1OOT A;  1SSH A;  4CC3 A;  2HDA A;  1K4U S;  1MV0 B;  1GCQ C;  1WA7 A;  2KRM A;  2O9S A;  5I11 A;  4AFZ C;  1VYT A;  1SHG A;  2RMO A;  2QDL A;  2J6K A;  1M3B A;  1QWF A;  4Z8A A;  1CSK A;  2DNU A;  1U3O A;  2GGR A;  5GJV B;  4Y92 A;  2VVK A;  3REA B;  3RBB B;  3M0U A;  4X1V A;  4OMM A;  2AK5 A;  1IO6 A;  2K79 A;  1JEG A;  2DE0 X;  2MCN A;  3C0C A;  2CUD A;  1TUD A;  2JT4 A;  1VYV A;  2DBK A;  1QLY A;  1I1J A;  1H92 A;  3ULR B;  2DRK A;  4EIK A;  1UHC A;  3EGU A;  2D8H A;  3M0R A;  3QWX X;  4JJD A;  2EBP A;  1UFF A;  3PE0 A;  1PNJ A;  2DVJ A;  5IH2 A;  2LJ3 A;  2A37 A;  4LUD A;  2KT8 A;  3THK A;  3A98 A;  2CH4 W;  2O88 A;  2CSQ A;  1B3Q A;  1TUC A;  2MOX A;  3QWY A;  1Z9Q A;  4IIM A;  1QWE A;  1KSW A;  2ROT A;  3ZL7 C;  2FPE A;  3M0T A;  4J9C A;  1VYU A;  1KFZ A;  2J05 A;  2L2P A;  5L23 A;  1ARK A;  2X3W D;  3VRZ A;  2JMC A;  1YWP A;  4OMN A;  5FW9 A;  4M4Z A;  2KE9 A;  3NGP A;  1NEG A;  2DL7 A;  3VS1 A;  2KNB B;  4RTY A;  1NEB A;  2V1R A;  1ABO A;  1K0S A;  1YP5 A;  1ABQ A;  2CUB A;  3EHQ A;  1ZUU A;  2RQT A;  3UF4 A;  4A63 B;  2B86 A;  2DLP A;  3KFV A;  2ED0 A;  5HCK A;  1ZX6 A;  1WXB A;  5IHK A;  1S1N A;  4J9B A;  1T0H A;  2DX1 A;  1GBR A;  1KIK A;  1M3A A;  2RN8 A;  1W70 A;  2VKN A;  2RNA A;  2MIO A;  3I5R A;  1WYX A;  3VS7 A;  1RLQ C;  4D8D A;  2F2V A;  2BZX A;  1CKB A;  4E6R A;  1JO8 A;  2DL5 A;  1BK2 A;  1PRL C;  1GFD A;  2O9V A;  1GL5 A;  2X3X D;  1UJ0 A;  2KXC A;  1YNZ A;  1RLP C;  2YSQ A;  2KYM A;  2EW3 A;  2PZ1 A;  1WI7 A;  2DIL A;  2OI3 A;  1AWX A;  2JMA A;  1PHT A;  1B07 A;  2KR3 A;  2A36 A;  1M27 C;  1K9A A;  2CDT A;  2L3P A;  3IQL A;  1WXU A;  2EPD A;  2SEM A;  1BU1 A;  2LCS A;  1OV3 A;  1WFW A;  4JJB A;  4OMQ A;  4Z88 A;  2ESW A;  4F14 A;  2ECZ A;  4F16 A;  2EGE A;  2L3Q A;  4LE9 A;  3VS4 A;  2H8H A;  5IHI A;  2DRM A;  2KRS A;  2DBM A;  2DYB A;  1SRM A;  4GLM A;  4LN2 A;  1X6B A;  3VS3 A;  1E6G A;  1TG0 A;  2OAW A;  3UAT A;  1J3T A;  1JXO A;  1XOV A;  2DMO A;  1PKT A;  2D8J A;  2EYY A;  4DEX A;  5IHN A;  4JZ4 A;  3SEM A;  3TVT A;  1HD3 A;  2ROL A;  2GQI A;  4HCK A;  3I5S A;  2EVR A;  2J06 A;  2L3S A;  2CT3 A;  4WCI A;  2K6D A;  1WX6 A;  1G2B A;  4FSS A;  2A28 A;  1OPL A;  1ZSG A;  2KEA A;  3REB B;  1K0X A;  2K9G A;  2GNC A;  2BZY A;  1AD5 A;  1ZUY A;  4JZ3 A;  5EC7 A;  4RTW A;  1AOJ A;  3EG3 A;  2YUP A;  3VRY A;  4AG2 C;  4ZNX A;  3VS2 A;  4CC4 B;  4IIO A;  4RTV A;  1AWW A;  2V1Q A;  2VWF A;  3UA6 A;  3PVQ A;  1SHF A;  3U23 A;  1CKA A;  2C0I A;  2KT1 A;  2ABL A;  2L0A A;  2EKH A;  4AFS C;  1EFN A;  1V1C A;  1QKX A;  1AWJ A;  1X2K A;  2YDL A;  4GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...