4IIOA

Crystal structure of the second sh3 domain of itsn2 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
b'GMAQGALLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin-2
publication title Crystal Structure of the Second SH3 Domain of ITSN2 Bound with a Synthetic Peptide
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iioA00
1G83A 1UJYA 2F2VA 1UFFA 5IHNA 1BU1A 1GBQA 2BZ8A 2BZXA 1GL5A 4Z88A 5GJWB 2KR3A 5L23A 3EG2A 3VS5A 2ECZA 2VKNA 2W0ZA 2YUQA 3IQLA 4ORZA 1ZUKA 2DL7A 4AFQC 4AG1C 2VWFA 2KT1A 2JW4A 1NLPC 2PNIA 3UATA 1WI7A 1UUEA 3PE0A 2V1QA 2DL8A 1SRLA 2JXBA 4JJCA 5HCKA 1K0SA 1X6BA 4CC2A 2DL4A 4K11A 1UE9A 1B3QA 1ZBJA 2FRWA 2LMJA 1UG1A 2J6FA 2FO0A 3M0UA 1AWJA 2EBPA 2ED0A 1TUDA 1TUCA 1BBZA 1WFWA 4RUGA 1I07A 1ZUUA 1U3OA 1CSKA 2KBTA 4GLMA 3EG3A 1NYFA 1WLPB 2K79A 1YWPA 2DBKA 1SRMA 1AWXA 4FSSA 2RMOA 4X1VA 1M8MA 4OMPA 2JS2A 2CUDA 4ESRA 3TSZA 4F17A 1AWOA 2CH4W 4KRTA 2OJ2A 2QDLA 2L0AA 4AG2C 2ROTA 4LN2A 1K76A 2FPDA 1QWFA 1X27A 1GFDA 1E6HA 1PWTA 2CDTA 1KSWA 2CH4A 2A28A 2GQIA 3TVTA 2CT3A 2RNAA 4M4ZA 1MV3A 1IO6A 4D8DA 2DA9A 4LUDA 1OPLA 1UHCA 1H8KA 2CT4A 2RN8A 3PVQA 3M0SA 1WXTA 2HSPA 1E6GA 1J3TA 2EGAA 5I22A 1WYXA 3LH5A 1NEBA 3GBQA 2ED1A 1AD5A 3M0TA 1MUZA 1ABQA 2DVJA 4OMOA 4CC4B 1GRIA 1AOJA 1JQQA 4RTUA 2O9SA 2EKHA 3RBBB 3H41A 2D0NA 1W70A 4RTWA 2J6OA 1JXMA 2DLPA 4RTYA 1E7OA 2KGTA 2RF0A 4J9BA 2A36A 3RNJA 1T0HA 1W6XA 1XOVA 2X3XD 2KYBA 1H3HA 2JM8A 2RQUA 2YUPA 2ENMA 2FPEA 2JTEA 1GCPA 1RLPC 1X43A 2DF6A 1RI9A 2M51A 1JEGA 2GNCA 2DX1A 2FPFA 2NUZA 2EPDA 1WXBA 2LJ0A 3NGPA 4OMMA 1KJWA 2EYYA 1NLOC 1OV3A 2KE9A 4LNPA 2LP5A 1YN8A 4RTXA 2AKKA 2OAWA 4CC3A 1UTIA 2CSQA 2DL5A 4RTVA 1U06A 4J9DA 1A0NB 2EGCA 1N5ZA 2DJQA 4JZ4A 2LX7A 3M0PA 4RTZA 1K9AA 3M0RA 3NPFA 3H0IA 1KIKA 1Z9QA 2KXCA 2D8JA 2GBQA 5GJVB 2SRCA 3M0QA 2V1RA 2DBMA 4Z8AA 2DRMA 4OMNA 2J06A 1M3CA 2O88A 1K4US 3VS1A 1SEMA 2CSIA 2L2PA 3UA7A 1UHFA 2MCNA 1NYGA 1T3SA 1LCKA 2LJ1A 3VRYA 4DEYA 3H0HA 3SHWA 4QT7A 4JJBA 4Y92A 3I5SA 2FRYA 3VS2A 4JJDA 4OMLA 1EFNA 2EYZA 5IXBA 1NEGA 1GCQA 2A08A 2F2WA 1T3LA 4A63B 3A98A 2DMOA 2E5KA 1WDXA 2YUOA 2JMAA 4AFZC 1BK2A 2DILA 1AZEA 1QLYA 4E6RA 2YSQA 2JS0A 2HDAA 2B86A 2HEQA 2SEMA 1WA7A 2J6KA 3KFVA 3UF4A 2KROA 1M30A 2DRKA 1Y0MA 1PKTA 2OI3A 1CKBA 1KFZA 2C0TA 2JMCA 2YDLA 2FG0A 2ROLA 1FMKA 3VS7A 4OMQA 1YNZA 1SPKA 2C0IA 2GTOA 5FWBA 4RTTA 2J7IA 3ULRB 1JU5C 1MV0B 2RQTA 3SEMA 2K9GA 3CQTA 2MOXA 2KRSA 3VS4A 1SHFA 3PVLA 1OOTA 2A37A 3VS3A 2NWMA 1NG2A 2DM1A 1S1NA 2FEIA 3NHNA 1HSQA 2JT4A 2YUNA 1YP5A 2AKLA 3REAB 2GGRA 2LJ3A 4D8KA 1ZSGA 3QWXX 1PHTA 3FJ5A 2KT8A 5EC7A 2D8HA 2O2OA 1GBRA 4DEXA 3EG0A 2YT6A 5IH2A 1M27C 1UECA 2J05A 1QKXA 5ECAA 2DE0X 1WIEA 1Z9ZA 1PNJA 3QWYA 2EYXA 1X2KA 1B07A 5I11A 4CC7A 1BB9A 4F14A 3THKA 1H92A 3ZL7C 1CKAA 1OEBA 1YWOA 3UA6A 1ZUYA 2BTTA 1ARKA 5FW9A 4HCKA 2EYWA 4IIMA 1SSHA 2KNBB 3I35A 2EW3A 2LNHB 3EHQA 1I1JA 4J9CA 4JPBW 1WX6A 2IIMA 2W10A 1I0CA 3EGUA 3R6NA 2H8HA 1U5SA 2F2XA 1VYTA 3EHRA 4LUEA 2AZSA 1FYNA 1RUWA 2LQWA 2RQVA 1HJDA 2JM9A 2EGEA 4HXJA 2K2MA 1HD3A 2DYBA 4J9HA 2GTJA 4Z89A 2KYMA 1QCFA 4J9FA 1VYVA 2PZ1A 3I5RA 1QWEA 3H0FA 2L3QA 4WCIA 2K7AA 2ESWA 1AWWA 1JO8A 3REBB 2CUBA 4J9EA 2LCSA 1PRMC 1TG0A 1AZGB 3JV3A 2CREA 1SHGA 2DL3A 4EIKA 2KRNA 4HVUA 2AK5A 1X69A 1YCSB 1ZX6A 4JZ3A 2O9VA 2KXDA 1PRLC 3NMZC 1K0XA 4J9GA 4AFSC 2PTKA 2KEAA 2M0YA 1AEYA 4IIOA 2AZVA 2RPNA 3VS0A 5IHIA 5IHKA 4J9IA 2DNUA 1VYUA 4ZNXA 1G2BA 2ABLA 2X3WD 2BZYA 2VVKA 3C0CA 1AVZC 4HVWA 2I0NA 2LQNA 2HBWA 1UGVA 2L3SA 2L3PA 2HCKA 4GBQA 2EQIA 1T0JA 1X2QA 1WXUA 1K1ZA 2XMFA 1OPKA 1Y57A 1QKWA 1V1CA 3EG1A 4AFUC 1X6GA 4R0KA 1UDLA 4LE9A 3I9QA 5FWCA 2O31A 2C0OA 1VA7A 2MIOA 2G6FX 1M3AA 5IXFA 3VRZA 3TSWA 2D1XA 1NM7A 2LZ6B 1ZLMA 1ABOA 3U23A 3O5ZA 1UJ0A 2K3BA 2P4RA 2EVRA 1PKSA 1W1FA 4F16A 4HVVA 1GCQC 2RQRA 2KRMA 1GFCA 2RQWA 2K6DA 1RLQC 3VS6A 1M3BA 1JXOA
chains in the Genus database with same CATH superfamily
3LYIA 4MDXA 2PVOB 2XK0A 3HRUA 1BU1A 5FLXE 3E2UA 1VIEA 1GL5A 3M55A 5GAN7 4PJOE 3PFSA 1ZUKA 2JW4A 5D6YA 4ZTJA 1X6OA 2H3EB 1NJIR 3PE0A 1YFNA 4J6YA 4M75C 2DL8A 4JJCA 1X6BA 2DL4A 1FX7A 1KD1R 5LJ3g 4MMLA 4M78C 1Q82U 1TUGB 3EH1A 3QKJA 3M0UA 5GAN4 3DLLA 1X01A 1QVFS 1BBZA 3QDFA 5FU6B 1WFWA 4RUGA 2LT4A 1I07A 1U3OA 4GLMA 4D6WA 3L2QA 3G6EA 1NYFA 3BFMA 4J5YA 1YI2Q 4HKEA 5M9OA 1AWXA 3FJPA 4C92A 2DIGA 4IUQA 4QW2A 3N5BB 3PTAA 2K3YA 4RG2A 4F17A 2CH4W 3LLRA 4DBHA 4AG2C 1K76A 4PJMA 2FPDA 4PJOB 4C5HA 2A3LA 2FL7A 4JDSA 1YJWQ 2L89A 2QAZA 2HL5C 2YRVA 1PWTA 2GQIA 3TVTA 4E2FB 3JCMV 2NYSA 4BI8B 4PJOD 1M4ZA 1JBMA 4OP0A 4D8DA 4LUDA 4E7JA 5CKFA 1WXTA 2HSPA 2EYQA 1J3TA 2DPPB 2DD5A 1WYXA 1VQ6Q 4N0AC 1H641 4XTXA 2VV5A 4OMOA 6AT1B 3EG9A 2EQKA 1IXDA 1GRIA 2QYZA 4FT2A 2LX9A 3CCUT 3RBBB 2H3JA 2EJFA 3L2WA 3D7SB 4M75E 2J6OA 1E7OA 4A54A 4J9BA 3A8GB 1UEBA 1QVFA 2D0QB 5KCOA 1TOVA 1FMVA 2CP6A 3HTRA 2F5TX 2JTEA 2XKOC 4V2SA 1GCPA 3SD4A 3KBGA 2RJDA 3JB9J 1VQNA 5D6WA 4ELYC 2QA4Q 3JB9G 2KY9A 2OAUA 3X25B 2DX1A 2FPFA 1N8RC 1BI0A 1G3YA 2KE9A 4LNPA 2VGNA 3GOXA 1UTIA 1TS9A 4J9DA 2E1HA 5J26A 2DJQA 4AMCA 1YJWA 4PJOF 5GANj 2RK1A 2RHUA 4RTZA 1QVPA 2FZKB 4ZGJB 4N4HA 5GAN5 3H0IA 1VQ5T 4XU0A 1Z9QA 4C0GA 2KXCA 3JB9H 2AT1B 2QXFA 3DB4A 4WF2A 5CKBA 1R0CB 1V76A 2MPXC 5KYNA 2J06A 2MWOA 4M75B 3L2UA 8AT1B 5KH6A 5D6XA 1K4US 4ZGDB 3E9FA 4B9XA 1SEMA 1KHIA 2CSIA 2L2PA 3OY9A 4M75D 4XK8E 2WSEE 1N8RR 2RJFA 4JJBA 1YBYA 4Y92A 4M78D 2AHJB 2COWA 1ZA1B 3AHUA 3A1PA 3G1JA 1N6AA 3CBPA 3CC4T 5IXBA 3EFOA 3OYNA 2NUTB 2JOYA 4FYVB 1DJ7B 4A63B 5I2SA 5GMKe 3S6WA 1NPRA 1WDXA 1YIJQ 2NLUA 3L2RA 2HQEA 2M16A 3RMQA 4XTVA 4QQGA 1AZEA 2RHYA 3OYBA 2YSQA 3OW2P 1WHKA 4O6JA 4Z02A 3HPWA 3UPUA 2SEMA 4MZPA 1WA7A 1K73C 1TH7A 3UF4A 2KROA 3I55Q 1K8AU 4FCYA 1KQ2A 3PMIA 1PCXA 4QQDA 2WSCE 1KFZA 2C0TA 2JMCA 3DB3A 2R5AA 4R56A 2QTXA 4BB7A 4RTTA 2J7IA 3FEOA 3JB9I 3ULRB 1NPPA 2L5QA 1NJIU 3SEMA 3LGFA 2HSEB 4N4GA 3CQTA 3R6OA 2RM4A 2KRSA 3VS4A 1KD1U 3PVLA 4FYWB 1OOTA 2QTVA 4J83A 3CC7A 3CCEA 2A37A 3VS3A 1KK7A 1YITA 4M75F 4OB3B 2DTIA 2JT4A 1YP5A 2ZPBB 1UGQB 4ZTFA 1EX4A 4C92C 2LCCA 3OMCA 2KAFA 4JRPA 1AHJB 3SWNA 2KT8A 1UGSB 3VUZA 2D8HA 1WZOA 2HL3A 1K73R 4M7DG 4PJLA 5CR2A 1PG5B 5IH2A 1M27C 1UECA 4KT0E 5GAOm 1KQSS 3S3NA 2HNIA 5ECAA 2DE0X 1Z9ZA 5CKHA 4CC7A 3QPHA 3ZL7C 2VXFA 1VQ9Q 1YWOA 2DVEA 1LPLA 2CYZB 3UA6A 5CKDA 1K9MC 2FB7A 3JCMh 2EYWA 3SB2A 2IIMA 2DJZA 3I55A 3EGUA 4ATOA 4QVCA 4LUEA 1FYNA 1W2BA 2X4XA 1S72Q 1HJDA 4HT8A 2JTFA 1D0YA 3T9NA 4PFOA 2RJEA 2DYBA 4PLIA 2GTJA 4M77G 3CCRA 5GMKl 3MPUB 4J9FA 2DXBA 2PZ1A 2FHDA 3I5RA 1QWEA 4WCIA 2I2LA 3A8MB 4J6XA 1OYXA 1JO8A 3REBB 4J9EA 2OTJT 5GMKi 1K9MR 2O01E 1Q86C 4EIKA 1U1TA 2DL3A 2O4XB 1VQ6T 3RMSA 1KQSA 2QASA 4C92E 4HVUA 2MK5A 4JZ3A 2QK0A 2KXDA 1PRLC 3NMZC 4A4EA 5FU7B 4J9GA 1IHVA 4NL3A 3CD6Q 3VS0A 2WSFE 5KYUA 2DEUA 4JUVA 4J7FA 1VQ9A 2E12A 4HT9A 2K4YA 1G2BA 2X3WD 1Q95G 1RAAB 2ATCB 2LRQA 5IT9E 4HVWA 3I56T 2LQNA 3GP8A 1OX8A 4M78A 2QA4T 4R55A 1T0JA 1OPKA 1QP2A 1QKWA 1V1CA 4E7KA 4AFUC 4R0KA 2L3RA 4E47A 5FWCA 5GANg 1Q86R 2DEQA 4M77A 2O31A 3FC3A 3META 1SG5A 1NM7A 5CKEA 2CZ0B 2CZ1B 2BIVA 2K3BA 2RH2A 5LJ5d 1N8RU 3LX7A 2MMPA 4IUVA 1W1FA 4QVDA 2RQRA 4C92B 3CCQA 5GAMe 4RCCA 1I8FA 2K6DA 3VS6A 1VQKT 5CQXA 3HSBA 1UJYA 4C92D 1UFFA 2E70A 2R5MA 2CGHA 2NUPA 2V8IA 2BZ8A 3HKSA 1WQWA 2KR3A 4LD6A 2ECZA 2YUQA 1YJNQ 1Y71A 3IQLA 3OS0A 1I81A 1Y96A 2E3IA 1NLPC 3BE3A 3QXEB 3UATA 2A7YA 1SRLA 2GFAA 3GPLA 3JAME 1UGPB 1B3QA 3WXMB 3KUFA 2LMJA 2RO0A 3DLMA 4C0ZA 3CCLT 2EJGA 4L6V5 2DKGA 2J6FA 2FO0A 2P84A 3EG9B 5LJ3d 1AWJA 4EMGA 4BE0A 3HP9A 1ZUUA 2KBTA 1YWPA 3EFRA 4PJNA 4BY6B 3SWNC 1KC8U 3CCJT 4KH0B 1JB0E 2RI2A 3H9NA 2CUDA 3O8VA 5CAIA 1AWOA 2EFIA 3OYKA 1K73U 2M02A 3E1SA 2ROTA 1QWFA 4HCCA 4C92F 1X27A 2F1LA 3FIFA 1GFDA 1VQOT 1V29B 2A28A 2CT3A 3CCMT 1C0MA 3A8HB 3QZ5B 5HK0A 2DXCA 1OU8A 3M5AA 3OYHA 1UHCA 2RN8A 1B34A 4XQ3A 2RB6A 2E41A 1VQ7T 1NE8A 1VQ4Q 3CMET 1NEBA 1JJ2S 3G6EQ 1AD5A 3M0TA 3RKWA 2PU9B 1G3WA 3UWNA 5CK9A 8ATCB 1WJQA 2BE7D 2WACA 5GAOp 1AOJA 1JQQA 4RTUA 2K5LA 1UGRB 1RAGB 1W70A 4HCBA 5CVIA 4RTWA 3RNJA 1XOVA 3GLXA 3QIIA 5A0GA 3C12A 3LWHA 2FPEA 5J3BA 1Q7YC 1X43A 2DF6A 1YCYA 5J39A 3MKDA 5DY9A 4DOVA 2M51A 4GY5A 4C8QG 2GNCA 3EFOB 1VQPQ 2P0QA 4F7UG 4TVRA 2EQMA 2NUZA 3NGPA 3FDRA 4OMMA 1KJWA 1K9MU 4X9CA 3JB9D 4RTXA 2OAWA 4BACA 4JS4A 2XD0A 1VQ5A 4M7AG 2QQBA 1A0NB 1N5ZA 3L2VA 2LX7A 4BE2A 3M0PA 3EFSA 1BI1A 4LXCA 4FYXB 3M0RA 3TCJA 3V8JA 1WHMA 1KIKA 3CCSQ 3X28B 5IAYA 3A8LB 2LVMA 1M3CA 1Q7YR 1JJ2A 2O88A 1U1SA 1VQNQ 3TQ7P 1OZ3A 1VQ4A 4M77C 3UA7A 1UHFA 2LJ1A 4X9DA 4DEYA 1Q86U 4QT7A 2YLBA 1RABB 3CD6T 3I5SA 1R0BG 1SF9A 3JCMe 3CCVT 1VQLQ 3URGA 2EYZA 3SWNB 3G7ZA 2CP5A 3A98A 1IHWA 2YUOA 2JMAA 1WJRA 1YJ9T 1TWBA 1F1BB 4Q5WA 4KBMB 4C5IA 4E6RA 3JB9F 1VQPA 2JS0A 4M7AA 1ZA2B 5GAN8 4LDVA 3OYCA 1FWZA 4BE1A 1N27A 3JCMW 1FXXA 3MP6A 4QKUA 5A0DA 2DRKA 2OI3A 4MZTA 1CKBA 3PNWC 3OSSC 5GAMj 1FMKA 3VS7A 1YNZA 1SPKA 2GTOA 4IUPA 4KH1B 3VKIA 2RQTA 3INZA 1KHCA 2K9GA 2KI7A 3EGXA 3M54A 3CCSA 1VOMA 2DTOA 3C95A 1QP3A 4M78E 1C6VX 2NWMA 2DM1A 1S1NA 2FEIA 3JCMf 4PFPA 1HSQA 5KYWA 2YUNA 2DERA 2AKLA 2K5IA 2MI6A 2GGRA 2ZPHB 4D8KA 4JRQA 2LC4A 3QWXX 4M77E 1M1KC 3QJ6A 4OB1B 3J7AF 4ME7A 3CC2T 1MNEA 5LJ5f 1PNJA 5D7UA 2EYXA 1X2KA 1B07A 2LDMA 1VQLA 1VQMT 1BKBA 2Z0WA 4AT1B 4EMKC 4C5EA 1PD1A 4N4IA 4ANJA 2CZ6B 2RK2A 5KYUB 2KNBB 2G3RA 3I35A 2EW3A 2LNHB 3FRNA 3CPWS 1M9SA 1I1JA 4JPBW 2QEXA 4JS5A 3NTIA 4FSXA 3CCEQ 3CC7Q 2RI5A 1YITQ 1U5SA 2RD1A 5IN1A 3EHRA 3QYHB 4M78B 2AZSA 1M1KR 4LDUA 2LQWA 1M2VA 2XDPA 4NL2A 1VQ8Q 2JM9A 2EGEA 2E4HA 1HD3A 4PK4A 2XG8D 4M77B 4Z89A 2K3XA 3A5ZB 3OW2S 2K57A 4E7ZA 2KYMA 1QCFA 1VYVA 3H0FA 1WHLA 2ESWA 2DXUA 2ZGWA 4M77D 1TG0A 2VASA 3JV3A 2Y90A 4C5GA 2KRNA 2VB6A 3LH0A 1LJOA 2O9VA 4XTZA 4IURA 1K0XA 2OTLA 4VUBA 4DBQA 1AEYA 4IIOA 2NUPB 2AZVA 2MYSA 2RPNA 1IGUA 3PIPA 1D1AA 2XU8A 3BDLA 1PD0A 4J9IA 3OS5A 2DNUA 4A53A 1VYUA 4ZNXA 2XDBA 2BZYA 2VVKA 1Y96B 2I0NA 2HBWA 2KSSA 3CPWA 2E5QA 2L3PA 2HCKA 2PUKB 2EQIA 3CCRQ 3L42A 1X2QA 1WXUA 1K1ZA 3H8ZA 4ELZC 4BI3A 1GXIE 2X4YA 1X6GA 1YHQQ 3G71Q 1Q7YU 1QW1A 2MIOA 5KYYA 5GAOq 2DK3A 1M3AA 1OQKA 4QQ6A 3VRZA 3OBWA 5GANd 4M78F 3VV0A 4F04B 2D1XA 3G4SQ 4QVZA 2HMAA 1VQ8A 1ABOA 3U23A 3LGLA 3JCMX 3OW2A 1UJ0A 1TSFA 2E3HA 4C8QC 3BY7A 2LT1A 3ZFJA 4DQ2A 2K5FA 4M77F 3HRSA 3QZ9B 5FRMA 1W2BP 1M3BA 2FVUA 2F2VA 5IHNA 3GNFB 4M7AC 1GBQA 3C94A 2BZXA 4KGXB 4Z88A 5L23A 3EG2A 1YI2T 3VS5A 2VKNA 2W0ZA 2ZZDA 4BI4A 2LQKA 4AG1C 2KT1A 5HK3A 1B34B 3RERA 3CCLA 1UUEA 5LJ5h 5GAOr 1MGQA 5HCKA 2HQHA 5GMKm 2XHCA 4CC2A 4K11A 2IPOB 3LW5E 1ZBJA 3LWIA 1UG1A 4E7IA 1YJWT 2QQ9A 4MDWA 2EBPA 2ED0A 1TUDA 3CCQQ 4IKFA 4M7DA 1CSKA 1PSFA 2COYA 5GAMg 3DKMA 3EG3A 3JCMP 1EZZB 1YHQA 2CP0A 4FSSA 1RADB 2HD0A 4XTYA 3G71A 4X1VA 1M8MA 1Q82C 1MMDA 2QGFB 3CXCP 2JS2A 1X75C 1BI2A 3G4SA 4ESRA 4KRTA 4OB0B 2OJ2A 3NTKA 2QDLA 3M53A 3Q1JA 2L0AA 1VQOA 3P8BB 1I5OB 1MHNA 3HRTA 4DA4A 1G3SA 2GFUA 2LTOA 3RESA 2C06A 3VYGA 4LDXA 1MNDA 4JLGA 2D9TA 5LJ3h 1KSWA 2CH4A 3OYAA 4BDZA 3CMAA 1TTHB 2P4TA 4M4ZA 1MV3A 1MMAA 1OPLA 4BD3A 4HCZA 4M7AE 2HQXA 3GBQA 5CO7A 3RKXA 1G3TA 1ABQA 2DVJA 4J8OA 1Q82R 2CP7A 1QVGS 5HY6A 3M57A 2EJ9A 2EKHA 4KUDK 1JXMA 4BDYA 4RTYA 2RF0A 3RKYA 5C0MA 1T0HA 2X3XD 3RDVA 1H3HA 2RQUA 2YUPA 2ENMA 3JSCA 1RLPC 1H3ZA 1RI0A 5CQYA 1RI9A 4DBFA 1VIFA 4YTLA 2CKKA 3CC7T 3CCET 2QG9B 2EPDA 2LJ0A 3ZEHA 1YITT 4XAXB 2EYYA 1NLOC 1OV3A 4C8QD 1IZ6A 1YN8A 2AKKA 2CSQA 3J80E 3CCUQ 4MMKA 4M7AB 4RTVA 1SSFA 1U06A 2IVWA 4JZ4A 2LQ8A 5GMKj 3NPFA 4M7AD 2KVQG 4RMOA 2D8JA 2GBQA 1WHJA 2SRCA 1RACB 1BYMA 2E10A 1YIJT 2V1RA 2DBMA 2FZGB 2DRMA 2DAQA 4OMNA 4II1A 4KULA 2HZYA 4E7LA 1QVGA 2MCNA 3MP8A 1ZSZA 3HL8A 3V7CA 3VRYA 3I55T 2ZCFB 2QQSA 1M2OA 1D3BA 3SHWA 5CCAA 1QCOA 2DYIA 2ZPGB 5KYWB 4X34A 3SDZA 2FRYA 1YJ9A 4OMLA 2CZ7B 1NEGA 3OYIA 2A08A 2F2WA 2P0KA 1T3LA 1VQ5Q 2E6ZA 2X4JA 1OI1A 2DMOA 4OVAA 1QQJA 1BCOA 1BK2A 2YLCA 1D09B 4EMKA 3ZBDA 1M1FA 1PSEA 1QLYA 2DETA 1ACMB 4C8QF 2DZ9A 1BI3A 1UB4A 2B86A 2IG0A 3KFVA 3OSVA 3BW1A 4FM4B 3CCUA 4FW1A 1TXQA 2FG0A 2ROLA 4P5NA 2GF7A 4M7AF 1G8XA 4OMQA 3CC4Q 2C0IA 3EAEA 5FWBA 1JU5C 1MV0B 5AT1B 1K8AC 2PVGB 1VQ9T 2MOXA 1HXDA 4XU1A 1RL2A 4NOYA 3VUBA 1M1GA 1M2VB 2DFUA 4M7DC 1NG2A 3M9QA 3V8KA 1LNXA 1R8OB 3NHNA 1M5Q1 2LJ3A 1ZSGA 1JRIA 3FJ5A 2BKDN 5EC7A 4DEXA 2CP2A 3CEYA 2YT6A 2HBPA 2EIFA 4EDUA 1M90C 2J05A 4Y28E 1JJ2P 1QKXA 2M1HA 3QWYA 1I5LA 3FB9A 5I11A 4MZMA 1S72T 1H92A 3NFCA 3M4YA 3RUXA 3QHSA 3TU4K 1M8VA 2PUOB 4ZN3A 3QSUA 3CCQT 2BTTA 3CPFA 5FW9A 3HFOA 1K8AR 1SSHA 2ZPIB 3OS2A 3EHQA 4ZN1A 4J9CA 4RKUE 3R6NA 2F2XA 1OZ2A 3TREA 2X35A 5EG2A 2RI3A 2BE9B 1RUWA 2RQVA 3EH2A 3GIBA 3OBYA 3CC4A 1M90R 1IRXA 2EQJA 3OYJA 3ME9A 2JNGA 1RAIB 3OYYA 5KYYB 1D0ZA 4C8QA 3FLGA 4OB2B 4F7UA 4JRIA 2L3QA 1D1CA 3CBOA 1AWWA 3V7SA 2LCSA 4M7DE 1PRMC 4EMHA 2F69A 1AZGB 1LVKA 2CREA 2RJCA 5LJ5e 1B7TA 2JJ9A 2QQAA 1QVFP 3V7RA 4XTUA 3M59A 4FL6A 2QEXQ 3KXTA 4AFSC 2M0YA 2P0PA 3EGDA 2VC8A 5IHIA 2HKQB 3MJXA 1PC0A 5KYXA 1IB8A 4FIBA 1AVZC 4E7SA 1UGVA 2YRCA 1RAEB 3TEEA 1NZ9A 4GBQA 2OTJQ 2M9UA 5GAMh 3UDCA 1Y57A 5L8RE 3EG1A 1IGQA 3WVEB 4LE9A 2KMTA 4PJJA 2QI2A 3HFNA 1MMGA 1ZSZC 1PM3A 2PVDB 3UT1A 2G6FX 3QO3A 3TSWA 1YJNT 5LJ3e 4M7DB 1ZLMA 3VU3C 2RHIA 1OULA 2GCXA 2OTLQ 2VUBA 1HYOA 1C1AA 1GFCA 3I56Q 4M7DD 3X26B 3S3OA 4A4FA 4CRIA 5A2QE 2EAYA 1RLQC 4E7HA 1JXOA 1G83A 1YI2A 2R58A 2EKOA 2VYTA 3QYGB 5GJWB 5HKCA 1WHHA 3RIRA 1O75A 2F5KA 2EWNA 4ORZA 2DL7A 4AFQC 5FROA 5GANh 1QCNA 2VWFA 1P92A 2PNIA 4O5VA 1RAHB 1WI7A 2V1QA 2JXBA 3MO8A 1K0SA 1QMCA 5DLQE 1UE9A 3OMGA 1D1BA 2FRWA 2ZPFB 4NS5A 4OGEA 1VQKQ 2CP3A 3MP1A 2X4WA 2OTJA 3OB9A 4IUTA 3CBMA 4RG8A 5LJ3f 1TUCA 4Y91A 1SKUB 3MHXA 4CI0C 2OX7A 1VQ6A 3QUIA 1IREB 2B8AA 1WLPB 2K79A 2DBKA 4KGZB 1SRMA 2K2VA 5GAMd 2RMOA 3CPWP 4OMPA 4XU3A 1MMNA 3L1AA 5C6SA 4KUIA 1VQ4T 1EIFA 2DO3A 3VJPA 3G6ET 3TSZA 4EPCA 3RR6A 4M7DF 2XICA 2DD4A 4LN2A 2DZCA 4HA8A 2HKNA 1O9SA 3ASKA 2XDDA 3M56A 4PJOG 3I56A 3CCLQ 3JCMb 9ATCB 1KC8C 5FU7C 1E6HA 2CDTA 2FYKA 4A4KA 2QA4A 2D6FA 3MEVA 2RNAA 1IO6A 1NBEB 2DA9A 2CT4A 1H8KA 3MEUA 3PVQA 3M0SA 4LDWA 1E6GA 1ZBXA 2EGAA 3X20B 1VQPT 2XI9A 5I22A 1WJSA 3OYGA 3CCJQ 1TU0B 3LH5A 2ED1A 5LL6S 1MUZA 4CC4B 1OX9A 4PLLA 1W2BS 2O9SA 3H41A 2D0NA 1FMWA 3PMTA 3SFMA 3E19A 2DLPA 2KGTA 2A36A 4L59A 1W6XA 1VQOQ 1M90U 4JLIA 2KYBA 2JM8A 1ZSZB 1VQKA 3CCMQ 4B9WA 1D3BB 2V8KA 1Q81C 2VXEA 3QJYA 3CCST 1KC8R 1G5VA 2DIQA 3VYHB 1JEGA 1BIAA 1XNIA 4A4HA 3CMAQ 1VQ7Q 1WXBA 5I2MA 3CMEQ 1OU9A 4PJOA 1VQNT 1XTDA 2LP5A 2DXTA 4EMKB 4CC3A 2DL5A 1WNLA 2COZA 2LNVA 2EGCA 1LOJA 5GAOl 3JCMQ 3ER0A 1YIJA 4PKCC 2L8DA 3MEAA 1KQ1A 1KQSP 1VQLT 1K9AA 5I21A 5DM7R 3PIOA 5LJ5j 5KE3A 5GJVB 5KE2A 3JCMJ 3M0QA 3V8LA 4Z8AA 1VUBA 3CXCS 4BUGA 1BCMA 1Q81R 4M75G 2ZAEA 2JUFA 3VS1A 3PT9A 2E64A 3CCJA 4M78G 2Y4XA 2QEXT 1NYGA 2JZ2A 1T3SA 1LCKA 2V8JA 3H0HA 4JRKA 4KGVB 2EQUA 7AT1B 2QDYB 2XIDA 3A8OB 3S3MA 4BY6C 3E9GA 3VS2A 4JJDA 1EFNA 1GCQA 4C8QE 4IUUA 3OYDA 3CCMA 4F7UE 2E5KA 2MF2A 4AFZC 4DOWA 2YXYA 3HHTB 4UC4A 2DILA 1WGSA 1VQ7A 2HDAA 1N9SA 2HEQA 3CMEA 5LJ3j 2JTMA 2J6KA 3P8HA 1M30A 1HK9A 1Y0MA 1PKTA 4GLKA 5GAN3 4ZGEB 4OF1A 2M0OA 2VGMA 2RHXA 4OMFB 2YDLA 2Y4YA 2OTLT 3CCVQ 2QGGA 4FYYB 4M75A 4C0DC 3OYMA 4LD9K 3JCMc 3OYEA 4JJNK 1M1KU 3CXCA 2PQWA 2YHTA 1YJ9Q 3PGGA 1SHFA 1ZHIA 2GQVA 3JCMd 2BUDA 3MCAB 2V26A 5GAN2 1WHGA 2MAMA 3REAB 1WPYA 4C8QB 4F7UB 2NUTA 1S72A 1PHTA 2O2OA 1GBRA 2JVVA 3EG0A 4A4GA 3X24B 1WIEA 3AT1B 4XU2A 1BB9A 4LDYA 4F14A 5KCHA 3THKA 3JRZA 1QVGP 1VQ8T 2FZCB 1CKAA 3M4GA 2R57A 1OEBA 2MWPA 4PFZA 1D0XA 4J7IA 2A0FB 2DTHA 3M58A 2YWWA 4FU6A 2X51A 3GF5A 1ZUYA 1ARKA 1BIBA 4HCKA 4L5GA 1U8RA 4FW2A 3GNGA 3EGDB 4IIMA 4XTWA 1W4SA 4PL6A 2QQRA 1WX6A 5GMKh 5FRNA 2LCLA 5KYXB 2W10A 1I0CA 2H8HA 3H6ZA 4N0AA 1VYTA 5GAN6 3J81E 1R77A 3CD6A 3CC2Q 3EGXB 1I4K1 3CCVA 5FU6C 2KK4A 1VQMQ 4HXJA 2K2MA 1N9RA 4J9HA 2X9HA 3OS1A 3BDUA 1RAFB 2HAXA 3NTHA 2K7AA 5CIUA 1KG1A 5GANe 2CUBA 3OA6A 3CCRT 4WTOB 5AYFA 3L2ZA 4RCBA 4J6WA 1SHGA 5GAMf 4PJOC 2RHZA 2ZPEB 1YHQT 4F7UF 2AK5A 1X69A 1YCSB 3C4SA 1ZX6A 3G71T 3OYFA 4DBRA 2PTKA 2KEAA 2KDSA 3WVDB 3G4ST 5IHKA 1AT1B 3F70A 3QDRB 2ABLA 1XQHA 3C0CA 3QBYA 2L3SA 2E65A 2RA2A 1Y7XA 2CS7A 3JCMg 4B6MA 3CMAT 2XMFA 5GAOn 4C0DB 5DLOA 3OYLA 1YJNA 1Y07A 2KQWA 3QG1A 2AIRB 1UDLA 1WQ7A 3I9QA 1Q81U 2YRDA 2C0OA 1VA7A 3CC2A 5IXFA 1NJIC 1XJWB 5LJ5g 3OQ5A 2LZ6B 5GANf 4PNOA 1VQMA 1KD1C 3O5ZA 2P4RA 2EVRA 1PKSA 2JN0A 4F16A 4HVVA 1GCQC 2KRMA 3MEWA 4FT4A 1ZQ1A 2O4XA 4C92G 2RQWA 5A0LA 4OGCA 4C0FA 2E6NA 3P8DA
chains in the Genus database with same CATH topology
1G83A 1UJYA 2F2VA 1UFFA 5IHNA 1BU1A 1GBQA 2BZ8A 2BZXA 1GL5A 4Z88A 5GJWB 2KR3A 5L23A 3EG2A 3VS5A 2ECZA 2VKNA 2W0ZA 2YUQA 3IQLA 4ORZA 1ZUKA 2DL7A 4AFQC 4AG1C 2VWFA 2KT1A 2JW4A 1NLPC 2PNIA 3UATA 1WI7A 1UUEA 3PE0A 2V1QA 2DL8A 1SRLA 2JXBA 4JJCA 5HCKA 1K0SA 1X6BA 4CC2A 2DL4A 4K11A 1UE9A 1B3QA 1ZBJA 2FRWA 2LMJA 1UG1A 2J6FA 2FO0A 3M0UA 1AWJA 2EBPA 2ED0A 1TUDA 1TUCA 1BBZA 1WFWA 4RUGA 1I07A 1ZUUA 1U3OA 1CSKA 2KBTA 4GLMA 3EG3A 1NYFA 1WLPB 2K79A 1YWPA 2DBKA 1SRMA 1AWXA 4FSSA 2RMOA 4X1VA 1M8MA 4OMPA 2JS2A 2CUDA 4ESRA 3TSZA 4F17A 1AWOA 2CH4W 4KRTA 2OJ2A 2QDLA 2L0AA 4AG2C 2ROTA 4LN2A 1K76A 2FPDA 1QWFA 1X27A 1GFDA 1E6HA 1PWTA 2CDTA 1KSWA 2CH4A 2A28A 2GQIA 3TVTA 2CT3A 2RNAA 4M4ZA 1MV3A 1IO6A 4D8DA 2DA9A 4LUDA 1OPLA 1UHCA 1H8KA 2CT4A 2RN8A 3PVQA 3M0SA 1WXTA 2HSPA 1E6GA 1J3TA 2EGAA 5I22A 1WYXA 3LH5A 1NEBA 3GBQA 2ED1A 1AD5A 3M0TA 1MUZA 1ABQA 2DVJA 4OMOA 4CC4B 1GRIA 1AOJA 1JQQA 4RTUA 2O9SA 2EKHA 3RBBB 3H41A 2D0NA 1W70A 4RTWA 2J6OA 1JXMA 2DLPA 4RTYA 1E7OA 2KGTA 2RF0A 4J9BA 2A36A 3RNJA 1T0HA 1W6XA 1XOVA 2X3XD 2KYBA 1H3HA 2JM8A 2RQUA 2YUPA 2ENMA 2FPEA 2JTEA 1GCPA 1RLPC 1X43A 2DF6A 1RI9A 2M51A 1JEGA 2GNCA 2DX1A 2FPFA 2NUZA 2EPDA 1WXBA 2LJ0A 3NGPA 4OMMA 1KJWA 2EYYA 1NLOC 1OV3A 2KE9A 4LNPA 2LP5A 1YN8A 4RTXA 2AKKA 2OAWA 4CC3A 1UTIA 2CSQA 2DL5A 4RTVA 1U06A 4J9DA 1A0NB 2EGCA 1N5ZA 2DJQA 4JZ4A 2LX7A 3M0PA 4RTZA 1K9AA 3M0RA 3NPFA 3H0IA 1KIKA 1Z9QA 2KXCA 2D8JA 2GBQA 5GJVB 2SRCA 3M0QA 2V1RA 2DBMA 4Z8AA 2DRMA 4OMNA 2J06A 1M3CA 2O88A 1K4US 3VS1A 1SEMA 2CSIA 2L2PA 3UA7A 1UHFA 2MCNA 1NYGA 1T3SA 1LCKA 2LJ1A 3VRYA 4DEYA 3H0HA 3SHWA 4QT7A 4JJBA 4Y92A 3I5SA 2FRYA 3VS2A 4JJDA 4OMLA 1EFNA 2EYZA 5IXBA 1NEGA 1GCQA 2A08A 2F2WA 1T3LA 4A63B 3A98A 2DMOA 2E5KA 1WDXA 2YUOA 2JMAA 4AFZC 1BK2A 2DILA 1AZEA 1QLYA 4E6RA 2YSQA 2JS0A 2HDAA 2B86A 2HEQA 2SEMA 1WA7A 2J6KA 3KFVA 3UF4A 2KROA 1M30A 2DRKA 1Y0MA 1PKTA 2OI3A 1CKBA 1KFZA 2C0TA 2JMCA 2YDLA 2FG0A 2ROLA 1FMKA 3VS7A 4OMQA 1YNZA 1SPKA 2C0IA 2GTOA 5FWBA 4RTTA 2J7IA 3ULRB 1JU5C 1MV0B 2RQTA 3SEMA 2K9GA 3CQTA 2MOXA 2KRSA 3VS4A 1SHFA 3PVLA 1OOTA 2A37A 3VS3A 2NWMA 1NG2A 2DM1A 1S1NA 2FEIA 3NHNA 1HSQA 2JT4A 2YUNA 1YP5A 2AKLA 3REAB 2GGRA 2LJ3A 4D8KA 1ZSGA 3QWXX 1PHTA 3FJ5A 2KT8A 5EC7A 2D8HA 2O2OA 1GBRA 4DEXA 3EG0A 2YT6A 5IH2A 1M27C 1UECA 2J05A 1QKXA 5ECAA 2DE0X 1WIEA 1Z9ZA 1PNJA 3QWYA 2EYXA 1X2KA 1B07A 5I11A 4CC7A 1BB9A 4F14A 3THKA 1H92A 3ZL7C 1CKAA 1OEBA 1YWOA 3UA6A 1ZUYA 2BTTA 1ARKA 5FW9A 4HCKA 2EYWA 4IIMA 1SSHA 2KNBB 3I35A 2EW3A 2LNHB 3EHQA 1I1JA 4J9CA 4JPBW 1WX6A 2IIMA 2W10A 1I0CA 3EGUA 3R6NA 2H8HA 1U5SA 2F2XA 1VYTA 3EHRA 4LUEA 2AZSA 1FYNA 1RUWA 2LQWA 2RQVA 1HJDA 2JM9A 2EGEA 4HXJA 2K2MA 1HD3A 2DYBA 4J9HA 2GTJA 4Z89A 2KYMA 1QCFA 4J9FA 1VYVA 2PZ1A 3I5RA 1QWEA 3H0FA 2L3QA 4WCIA 2K7AA 2ESWA 1AWWA 1JO8A 3REBB 2CUBA 4J9EA 2LCSA 1PRMC 1TG0A 1AZGB 3JV3A 2CREA 1SHGA 2DL3A 4EIKA 2KRNA 4HVUA 2AK5A 1X69A 1YCSB 1ZX6A 4JZ3A 2O9VA 2KXDA 1PRLC 3NMZC 1K0XA 4J9GA 4AFSC 2PTKA 2KEAA 2M0YA 1AEYA 4IIOA 2AZVA 2RPNA 3VS0A 5IHIA 5IHKA 4J9IA 2DNUA 1VYUA 4ZNXA 1G2BA 2ABLA 2X3WD 2BZYA 2VVKA 3C0CA 1AVZC 4HVWA 2I0NA 2LQNA 2HBWA 1UGVA 2L3SA 2L3PA 2HCKA 4GBQA 2EQIA 1T0JA 1X2QA 1WXUA 1K1ZA 2XMFA 1OPKA 1Y57A 1QKWA 1V1CA 3EG1A 4AFUC 1X6GA 4R0KA 1UDLA 4LE9A 3I9QA 5FWCA 2O31A 2C0OA 1VA7A 2MIOA 2G6FX 1M3AA 5IXFA 3VRZA 3TSWA 2D1XA 1NM7A 2LZ6B 1ZLMA 1ABOA 3U23A 3O5ZA 1UJ0A 2K3BA 2P4RA 2EVRA 1PKSA 1W1FA 4F16A 4HVVA 1GCQC 2RQRA 2KRMA 1GFCA 2RQWA 2K6DA 1RLQC 3VS6A 1M3BA 1JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G83 A;  1UJY A;  2F2V A;  1UFF A;  5IHN A;  1BU1 A;  1GBQ A;  2BZ8 A;  2BZX A;  1GL5 A;  4Z88 A;  5GJW B;  2KR3 A;  5L23 A;  3EG2 A;  3VS5 A;  2ECZ A;  2VKN A;  2W0Z A;  2YUQ A;  3IQL A;  4ORZ A;  1ZUK A;  2DL7 A;  4AFQ C;  4AG1 C;  2VWF A;  2KT1 A;  2JW4 A;  1NLP C;  2PNI A;  3UAT A;  1WI7 A;  1UUE A;  3PE0 A;  2V1Q A;  2DL8 A;  1SRL A;  2JXB A;  4JJC A;  5HCK A;  1K0S A;  1X6B A;  4CC2 A;  2DL4 A;  4K11 A;  1UE9 A;  1B3Q A;  1ZBJ A;  2FRW A;  2LMJ A;  1UG1 A;  2J6F A;  2FO0 A;  3M0U A;  1AWJ A;  2EBP A;  2ED0 A;  1TUD A;  1TUC A;  1BBZ A;  1WFW A;  4RUG A;  1I07 A;  1ZUU A;  1U3O A;  1CSK A;  2KBT A;  4GLM A;  3EG3 A;  1NYF A;  1WLP B;  2K79 A;  1YWP A;  2DBK A;  1SRM A;  1AWX A;  4FSS A;  2RMO A;  4X1V A;  1M8M A;  4OMP A;  2JS2 A;  2CUD A;  4ESR A;  3TSZ A;  4F17 A;  1AWO A;  2CH4 W;  4KRT A;  2OJ2 A;  2QDL A;  2L0A A;  4AG2 C;  2ROT A;  4LN2 A;  1K76 A;  2FPD A;  1QWF A;  1X27 A;  1GFD A;  1E6H A;  1PWT A;  2CDT A;  1KSW A;  2CH4 A;  2A28 A;  2GQI A;  3TVT A;  2CT3 A;  2RNA A;  4M4Z A;  1MV3 A;  1IO6 A;  4D8D A;  2DA9 A;  4LUD A;  1OPL A;  1UHC A;  1H8K A;  2CT4 A;  2RN8 A;  3PVQ A;  3M0S A;  1WXT A;  2HSP A;  1E6G A;  1J3T A;  2EGA A;  5I22 A;  1WYX A;  3LH5 A;  1NEB A;  3GBQ A;  2ED1 A;  1AD5 A;  3M0T A;  1MUZ A;  1ABQ A;  2DVJ A;  4OMO A;  4CC4 B;  1GRI A;  1AOJ A;  1JQQ A;  4RTU A;  2O9S A;  2EKH A;  3RBB B;  3H41 A;  2D0N A;  1W70 A;  4RTW A;  2J6O A;  1JXM A;  2DLP A;  4RTY A;  1E7O A;  2KGT A;  2RF0 A;  4J9B A;  2A36 A;  3RNJ A;  1T0H A;  1W6X A;  1XOV A;  2X3X D;  2KYB A;  1H3H A;  2JM8 A;  2RQU A;  2YUP A;  2ENM A;  2FPE A;  2JTE A;  1GCP A;  1RLP C;  1X43 A;  2DF6 A;  1RI9 A;  2M51 A;  1JEG A;  2GNC A;  2DX1 A;  2FPF A;  2NUZ A;  2EPD A;  1WXB A;  2LJ0 A;  3NGP A;  4OMM A;  1KJW A;  2EYY A;  1NLO C;  1OV3 A;  2KE9 A;  4LNP A;  2LP5 A;  1YN8 A;  4RTX A;  2AKK A;  2OAW A;  4CC3 A;  1UTI A;  2CSQ A;  2DL5 A;  4RTV A;  1U06 A;  4J9D A;  1A0N B;  2EGC A;  1N5Z A;  2DJQ A;  4JZ4 A;  2LX7 A;  3M0P A;  4RTZ A;  1K9A A;  3M0R A;  3NPF A;  3H0I A;  1KIK A;  1Z9Q A;  2KXC A;  2D8J A;  2GBQ A;  5GJV B;  2SRC A;  3M0Q A;  2V1R A;  2DBM A;  4Z8A A;  2DRM A;  4OMN A;  2J06 A;  1M3C A;  2O88 A;  1K4U S;  3VS1 A;  1SEM A;  2CSI A;  2L2P A;  3UA7 A;  1UHF A;  2MCN A;  1NYG A;  1T3S A;  1LCK A;  2LJ1 A;  3VRY A;  4DEY A;  3H0H A;  3SHW A;  4QT7 A;  4JJB A;  4Y92 A;  3I5S A;  2FRY A;  3VS2 A;  4JJD A;  4OML A;  1EFN A;  2EYZ A;  5IXB A;  1NEG A;  1GCQ A;  2A08 A;  2F2W A;  1T3L A;  4A63 B;  3A98 A;  2DMO A;  2E5K A;  1WDX A;  2YUO A;  2JMA A;  4AFZ C;  1BK2 A;  2DIL A;  1AZE A;  1QLY A;  4E6R A;  2YSQ A;  2JS0 A;  2HDA A;  2B86 A;  2HEQ A;  2SEM A;  1WA7 A;  2J6K A;  3KFV A;  3UF4 A;  2KRO A;  1M30 A;  2DRK A;  1Y0M A;  1PKT A;  2OI3 A;  1CKB A;  1KFZ A;  2C0T A;  2JMC A;  2YDL A;  2FG0 A;  2ROL A;  1FMK A;  3VS7 A;  4OMQ A;  1YNZ A;  1SPK A;  2C0I A;  2GTO A;  5FWB A;  4RTT A;  2J7I A;  3ULR B;  1JU5 C;  1MV0 B;  2RQT A;  3SEM A;  2K9G A;  3CQT A;  2MOX A;  2KRS A;  3VS4 A;  1SHF A;  3PVL A;  1OOT A;  2A37 A;  3VS3 A;  2NWM A;  1NG2 A;  2DM1 A;  1S1N A;  2FEI A;  3NHN A;  1HSQ A;  2JT4 A;  2YUN A;  1YP5 A;  2AKL A;  3REA B;  2GGR A;  2LJ3 A;  4D8K A;  1ZSG A;  3QWX X;  1PHT A;  3FJ5 A;  2KT8 A;  5EC7 A;  2D8H A;  2O2O A;  1GBR A;  4DEX A;  3EG0 A;  2YT6 A;  5IH2 A;  1M27 C;  1UEC A;  2J05 A;  1QKX A;  5ECA A;  2DE0 X;  1WIE A;  1Z9Z A;  1PNJ A;  3QWY A;  2EYX A;  1X2K A;  1B07 A;  5I11 A;  4CC7 A;  1BB9 A;  4F14 A;  3THK A;  1H92 A;  3ZL7 C;  1CKA A;  1OEB A;  1YWO A;  3UA6 A;  1ZUY A;  2BTT A;  1ARK A;  5FW9 A;  4HCK A;  2EYW A;  4IIM A;  1SSH A;  2KNB B;  3I35 A;  2EW3 A;  2LNH B;  3EHQ A;  1I1J A;  4J9C A;  4JPB W;  1WX6 A;  2IIM A;  2W10 A;  1I0C A;  3EGU A;  3R6N A;  2H8H A;  1U5S A;  2F2X A;  1VYT A;  3EHR A;  4LUE A;  2AZS A;  1FYN A;  1RUW A;  2LQW A;  2RQV A;  1HJD A;  2JM9 A;  2EGE A;  4HXJ A;  2K2M A;  1HD3 A;  2DYB A;  4J9H A;  2GTJ A;  4Z89 A;  2KYM A;  1QCF A;  4J9F A;  1VYV A;  2PZ1 A;  3I5R A;  1QWE A;  3H0F A;  2L3Q A;  4WCI A;  2K7A A;  2ESW A;  1AWW A;  1JO8 A;  3REB B;  2CUB A;  4J9E A;  2LCS A;  1PRM C;  1TG0 A;  1AZG B;  3JV3 A;  2CRE A;  1SHG A;  2DL3 A;  4EIK A;  2KRN A;  4HVU A;  2AK5 A;  1X69 A;  1YCS B;  1ZX6 A;  4JZ3 A;  2O9V A;  2KXD A;  1PRL C;  3NMZ C;  1K0X A;  4J9G A;  4AFS C;  2PTK A;  2KEA A;  2M0Y A;  1AEY A;  4IIO A;  2AZV A;  2RPN A;  3VS0 A;  5IHI A;  5IHK A;  4J9I A;  2DNU A;  1VYU A;  4ZNX A;  1G2B A;  2ABL A;  2X3W D;  2BZY A;  2VVK A;  3C0C A;  1AVZ C;  4HVW A;  2I0N A;  2LQN A;  2HBW A;  1UGV A;  2L3S A;  2L3P A;  2HCK A;  4GBQ A;  2EQI A;  1T0J A;  1X2Q A;  1WXU A;  1K1Z A;  2XMF A;  1OPK A;  1Y57 A;  1QKW A;  1V1C A;  3EG1 A;  4AFU C;  1X6G A;  4R0K A;  1UDL A;  4LE9 A;  3I9Q A;  5FWC A;  2O31 A;  2C0O A;  1VA7 A;  2MIO A;  2G6F X;  1M3A A;  5IXF A;  3VRZ A;  3TSW A;  2D1X A;  1NM7 A;  2LZ6 B;  1ZLM A;  1ABO A;  3U23 A;  3O5Z A;  1UJ0 A;  2K3B A;  2P4R A;  2EVR A;  1PKS A;  1W1F A;  4F16 A;  4HVV A;  1GCQ C;  2RQR A;  2KRM A;  1GFC A;  2RQW A;  2K6D A;  1RLQ C;  3VS6 A;  1M3B A;  1JXO A; 
#chains in the Genus database with same CATH topology
 3LYI A;  4MDX A;  2PVO B;  2XK0 A;  3HRU A;  1BU1 A;  5FLX E;  3E2U A;  1VIE A;  1GL5 A;  3M55 A;  5GAN 7;  4PJO E;  3PFS A;  1ZUK A;  2JW4 A;  5D6Y A;  4ZTJ A;  1X6O A;  2H3E B;  1NJI R;  3PE0 A;  1YFN A;  4J6Y A;  4M75 C;  2DL8 A;  4JJC A;  1X6B A;  2DL4 A;  1FX7 A;  1KD1 R;  5LJ3 g;  4MML A;  4M78 C;  1Q82 U;  1TUG B;  3EH1 A;  3QKJ A;  3M0U A;  5GAN 4;  3DLL A;  1X01 A;  1QVF S;  1BBZ A;  3QDF A;  5FU6 B;  1WFW A;  4RUG A;  2LT4 A;  1I07 A;  1U3O A;  4GLM A;  4D6W A;  3L2Q A;  3G6E A;  1NYF A;  3BFM A;  4J5Y A;  1YI2 Q;  4HKE A;  5M9O A;  1AWX A;  3FJP A;  4C92 A;  2DIG A;  4IUQ A;  4QW2 A;  3N5B B;  3PTA A;  2K3Y A;  4RG2 A;  4F17 A;  2CH4 W;  3LLR A;  4DBH A;  4AG2 C;  1K76 A;  4PJM A;  2FPD A;  4PJO B;  4C5H A;  2A3L A;  2FL7 A;  4JDS A;  1YJW Q;  2L89 A;  2QAZ A;  2HL5 C;  2YRV A;  1PWT A;  2GQI A;  3TVT A;  4E2F B;  3JCM V;  2NYS A;  4BI8 B;  4PJO D;  1M4Z A;  1JBM A;  4OP0 A;  4D8D A;  4LUD A;  4E7J A;  5CKF A;  1WXT A;  2HSP A;  2EYQ A;  1J3T A;  2DPP B;  2DD5 A;  1WYX A;  1VQ6 Q;  4N0A C;  1H64 1;  4XTX A;  2VV5 A;  4OMO A;  6AT1 B;  3EG9 A;  2EQK A;  1IXD A;  1GRI A;  2QYZ A;  4FT2 A;  2LX9 A;  3CCU T;  3RBB B;  2H3J A;  2EJF A;  3L2W A;  3D7S B;  4M75 E;  2J6O A;  1E7O A;  4A54 A;  4J9B A;  3A8G B;  1UEB A;  1QVF A;  2D0Q B;  5KCO A;  1TOV A;  1FMV A;  2CP6 A;  3HTR A;  2F5T X;  2JTE A;  2XKO C;  4V2S A;  1GCP A;  3SD4 A;  3KBG A;  2RJD A;  3JB9 J;  1VQN A;  5D6W A;  4ELY C;  2QA4 Q;  3JB9 G;  2KY9 A;  2OAU A;  3X25 B;  2DX1 A;  2FPF A;  1N8R C;  1BI0 A;  1G3Y A;  2KE9 A;  4LNP A;  2VGN A;  3GOX A;  1UTI A;  1TS9 A;  4J9D A;  2E1H A;  5J26 A;  2DJQ A;  4AMC A;  1YJW A;  4PJO F;  5GAN j;  2RK1 A;  2RHU A;  4RTZ A;  1QVP A;  2FZK B;  4ZGJ B;  4N4H A;  5GAN 5;  3H0I A;  1VQ5 T;  4XU0 A;  1Z9Q A;  4C0G A;  2KXC A;  3JB9 H;  2AT1 B;  2QXF A;  3DB4 A;  4WF2 A;  5CKB A;  1R0C B;  1V76 A;  2MPX C;  5KYN A;  2J06 A;  2MWO A;  4M75 B;  3L2U A;  8AT1 B;  5KH6 A;  5D6X A;  1K4U S;  4ZGD B;  3E9F A;  4B9X A;  1SEM A;  1KHI A;  2CSI A;  2L2P A;  3OY9 A;  4M75 D;  4XK8 E;  2WSE E;  1N8R R;  2RJF A;  4JJB A;  1YBY A;  4Y92 A;  4M78 D;  2AHJ B;  2COW A;  1ZA1 B;  3AHU A;  3A1P A;  3G1J A;  1N6A A;  3CBP A;  3CC4 T;  5IXB A;  3EFO A;  3OYN A;  2NUT B;  2JOY A;  4FYV B;  1DJ7 B;  4A63 B;  5I2S A;  5GMK e;  3S6W A;  1NPR A;  1WDX A;  1YIJ Q;  2NLU A;  3L2R A;  2HQE A;  2M16 A;  3RMQ A;  4XTV A;  4QQG A;  1AZE A;  2RHY A;  3OYB A;  2YSQ A;  3OW2 P;  1WHK A;  4O6J A;  4Z02 A;  3HPW A;  3UPU A;  2SEM A;  4MZP A;  1WA7 A;  1K73 C;  1TH7 A;  3UF4 A;  2KRO A;  3I55 Q;  1K8A U;  4FCY A;  1KQ2 A;  3PMI A;  1PCX A;  4QQD A;  2WSC E;  1KFZ A;  2C0T A;  2JMC A;  3DB3 A;  2R5A A;  4R56 A;  2QTX A;  4BB7 A;  4RTT A;  2J7I A;  3FEO A;  3JB9 I;  3ULR B;  1NPP A;  2L5Q A;  1NJI U;  3SEM A;  3LGF A;  2HSE B;  4N4G A;  3CQT A;  3R6O A;  2RM4 A;  2KRS A;  3VS4 A;  1KD1 U;  3PVL A;  4FYW B;  1OOT A;  2QTV A;  4J83 A;  3CC7 A;  3CCE A;  2A37 A;  3VS3 A;  1KK7 A;  1YIT A;  4M75 F;  4OB3 B;  2DTI A;  2JT4 A;  1YP5 A;  2ZPB B;  1UGQ B;  4ZTF A;  1EX4 A;  4C92 C;  2LCC A;  3OMC A;  2KAF A;  4JRP A;  1AHJ B;  3SWN A;  2KT8 A;  1UGS B;  3VUZ A;  2D8H A;  1WZO A;  2HL3 A;  1K73 R;  4M7D G;  4PJL A;  5CR2 A;  1PG5 B;  5IH2 A;  1M27 C;  1UEC A;  4KT0 E;  5GAO m;  1KQS S;  3S3N A;  2HNI A;  5ECA A;  2DE0 X;  1Z9Z A;  5CKH A;  4CC7 A;  3QPH A;  3ZL7 C;  2VXF A;  1VQ9 Q;  1YWO A;  2DVE A;  1LPL A;  2CYZ B;  3UA6 A;  5CKD A;  1K9M C;  2FB7 A;  3JCM h;  2EYW A;  3SB2 A;  2IIM A;  2DJZ A;  3I55 A;  3EGU A;  4ATO A;  4QVC A;  4LUE A;  1FYN A;  1W2B A;  2X4X A;  1S72 Q;  1HJD A;  4HT8 A;  2JTF A;  1D0Y A;  3T9N A;  4PFO A;  2RJE A;  2DYB A;  4PLI A;  2GTJ A;  4M77 G;  3CCR A;  5GMK l;  3MPU B;  4J9F A;  2DXB A;  2PZ1 A;  2FHD A;  3I5R A;  1QWE A;  4WCI A;  2I2L A;  3A8M B;  4J6X A;  1OYX A;  1JO8 A;  3REB B;  4J9E A;  2OTJ T;  5GMK i;  1K9M R;  2O01 E;  1Q86 C;  4EIK A;  1U1T A;  2DL3 A;  2O4X B;  1VQ6 T;  3RMS A;  1KQS A;  2QAS A;  4C92 E;  4HVU A;  2MK5 A;  4JZ3 A;  2QK0 A;  2KXD A;  1PRL C;  3NMZ C;  4A4E A;  5FU7 B;  4J9G A;  1IHV A;  4NL3 A;  3CD6 Q;  3VS0 A;  2WSF E;  5KYU A;  2DEU A;  4JUV A;  4J7F A;  1VQ9 A;  2E12 A;  4HT9 A;  2K4Y A;  1G2B A;  2X3W D;  1Q95 G;  1RAA B;  2ATC B;  2LRQ A;  5IT9 E;  4HVW A;  3I56 T;  2LQN A;  3GP8 A;  1OX8 A;  4M78 A;  2QA4 T;  4R55 A;  1T0J A;  1OPK A;  1QP2 A;  1QKW A;  1V1C A;  4E7K A;  4AFU C;  4R0K A;  2L3R A;  4E47 A;  5FWC A;  5GAN g;  1Q86 R;  2DEQ A;  4M77 A;  2O31 A;  3FC3 A;  3MET A;  1SG5 A;  1NM7 A;  5CKE A;  2CZ0 B;  2CZ1 B;  2BIV A;  2K3B A;  2RH2 A;  5LJ5 d;  1N8R U;  3LX7 A;  2MMP A;  4IUV A;  1W1F A;  4QVD A;  2RQR A;  4C92 B;  3CCQ A;  5GAM e;  4RCC A;  1I8F A;  2K6D A;  3VS6 A;  1VQK T;  5CQX A;  3HSB A;  1UJY A;  4C92 D;  1UFF A;  2E70 A;  2R5M A;  2CGH A;  2NUP A;  2V8I A;  2BZ8 A;  3HKS A;  1WQW A;  2KR3 A;  4LD6 A;  2ECZ A;  2YUQ A;  1YJN Q;  1Y71 A;  3IQL A;  3OS0 A;  1I81 A;  1Y96 A;  2E3I A;  1NLP C;  3BE3 A;  3QXE B;  3UAT A;  2A7Y A;  1SRL A;  2GFA A;  3GPL A;  3JAM E;  1UGP B;  1B3Q A;  3WXM B;  3KUF A;  2LMJ A;  2RO0 A;  3DLM A;  4C0Z A;  3CCL T;  2EJG A;  4L6V 5;  2DKG A;  2J6F A;  2FO0 A;  2P84 A;  3EG9 B;  5LJ3 d;  1AWJ A;  4EMG A;  4BE0 A;  3HP9 A;  1ZUU A;  2KBT A;  1YWP A;  3EFR A;  4PJN A;  4BY6 B;  3SWN C;  1KC8 U;  3CCJ T;  4KH0 B;  1JB0 E;  2RI2 A;  3H9N A;  2CUD A;  3O8V A;  5CAI A;  1AWO A;  2EFI A;  3OYK A;  1K73 U;  2M02 A;  3E1S A;  2ROT A;  1QWF A;  4HCC A;  4C92 F;  1X27 A;  2F1L A;  3FIF A;  1GFD A;  1VQO T;  1V29 B;  2A28 A;  2CT3 A;  3CCM T;  1C0M A;  3A8H B;  3QZ5 B;  5HK0 A;  2DXC A;  1OU8 A;  3M5A A;  3OYH A;  1UHC A;  2RN8 A;  1B34 A;  4XQ3 A;  2RB6 A;  2E41 A;  1VQ7 T;  1NE8 A;  1VQ4 Q;  3CME T;  1NEB A;  1JJ2 S;  3G6E Q;  1AD5 A;  3M0T A;  3RKW A;  2PU9 B;  1G3W A;  3UWN A;  5CK9 A;  8ATC B;  1WJQ A;  2BE7 D;  2WAC A;  5GAO p;  1AOJ A;  1JQQ A;  4RTU A;  2K5L A;  1UGR B;  1RAG B;  1W70 A;  4HCB A;  5CVI A;  4RTW A;  3RNJ A;  1XOV A;  3GLX A;  3QII A;  5A0G A;  3C12 A;  3LWH A;  2FPE A;  5J3B A;  1Q7Y C;  1X43 A;  2DF6 A;  1YCY A;  5J39 A;  3MKD A;  5DY9 A;  4DOV A;  2M51 A;  4GY5 A;  4C8Q G;  2GNC A;  3EFO B;  1VQP Q;  2P0Q A;  4F7U G;  4TVR A;  2EQM A;  2NUZ A;  3NGP A;  3FDR A;  4OMM A;  1KJW A;  1K9M U;  4X9C A;  3JB9 D;  4RTX A;  2OAW A;  4BAC A;  4JS4 A;  2XD0 A;  1VQ5 A;  4M7A G;  2QQB A;  1A0N B;  1N5Z A;  3L2V A;  2LX7 A;  4BE2 A;  3M0P A;  3EFS A;  1BI1 A;  4LXC A;  4FYX B;  3M0R A;  3TCJ A;  3V8J A;  1WHM A;  1KIK A;  3CCS Q;  3X28 B;  5IAY A;  3A8L B;  2LVM A;  1M3C A;  1Q7Y R;  1JJ2 A;  2O88 A;  1U1S A;  1VQN Q;  3TQ7 P;  1OZ3 A;  1VQ4 A;  4M77 C;  3UA7 A;  1UHF A;  2LJ1 A;  4X9D A;  4DEY A;  1Q86 U;  4QT7 A;  2YLB A;  1RAB B;  3CD6 T;  3I5S A;  1R0B G;  1SF9 A;  3JCM e;  3CCV T;  1VQL Q;  3URG A;  2EYZ A;  3SWN B;  3G7Z A;  2CP5 A;  3A98 A;  1IHW A;  2YUO A;  2JMA A;  1WJR A;  1YJ9 T;  1TWB A;  1F1B B;  4Q5W A;  4KBM B;  4C5I A;  4E6R A;  3JB9 F;  1VQP A;  2JS0 A;  4M7A A;  1ZA2 B;  5GAN 8;  4LDV A;  3OYC A;  1FWZ A;  4BE1 A;  1N27 A;  3JCM W;  1FXX A;  3MP6 A;  4QKU A;  5A0D A;  2DRK A;  2OI3 A;  4MZT A;  1CKB A;  3PNW C;  3OSS C;  5GAM j;  1FMK A;  3VS7 A;  1YNZ A;  1SPK A;  2GTO A;  4IUP A;  4KH1 B;  3VKI A;  2RQT A;  3INZ A;  1KHC A;  2K9G A;  2KI7 A;  3EGX A;  3M54 A;  3CCS A;  1VOM A;  2DTO A;  3C95 A;  1QP3 A;  4M78 E;  1C6V X;  2NWM A;  2DM1 A;  1S1N A;  2FEI A;  3JCM f;  4PFP A;  1HSQ A;  5KYW A;  2YUN A;  2DER A;  2AKL A;  2K5I A;  2MI6 A;  2GGR A;  2ZPH B;  4D8K A;  4JRQ A;  2LC4 A;  3QWX X;  4M77 E;  1M1K C;  3QJ6 A;  4OB1 B;  3J7A F;  4ME7 A;  3CC2 T;  1MNE A;  5LJ5 f;  1PNJ A;  5D7U A;  2EYX A;  1X2K A;  1B07 A;  2LDM A;  1VQL A;  1VQM T;  1BKB A;  2Z0W A;  4AT1 B;  4EMK C;  4C5E A;  1PD1 A;  4N4I A;  4ANJ A;  2CZ6 B;  2RK2 A;  5KYU B;  2KNB B;  2G3R A;  3I35 A;  2EW3 A;  2LNH B;  3FRN A;  3CPW S;  1M9S A;  1I1J A;  4JPB W;  2QEX A;  4JS5 A;  3NTI A;  4FSX A;  3CCE Q;  3CC7 Q;  2RI5 A;  1YIT Q;  1U5S A;  2RD1 A;  5IN1 A;  3EHR A;  3QYH B;  4M78 B;  2AZS A;  1M1K R;  4LDU A;  2LQW A;  1M2V A;  2XDP A;  4NL2 A;  1VQ8 Q;  2JM9 A;  2EGE A;  2E4H A;  1HD3 A;  4PK4 A;  2XG8 D;  4M77 B;  4Z89 A;  2K3X A;  3A5Z B;  3OW2 S;  2K57 A;  4E7Z A;  2KYM A;  1QCF A;  1VYV A;  3H0F A;  1WHL A;  2ESW A;  2DXU A;  2ZGW A;  4M77 D;  1TG0 A;  2VAS A;  3JV3 A;  2Y90 A;  4C5G A;  2KRN A;  2VB6 A;  3LH0 A;  1LJO A;  2O9V A;  4XTZ A;  4IUR A;  1K0X A;  2OTL A;  4VUB A;  4DBQ A;  1AEY A;  4IIO A;  2NUP B;  2AZV A;  2MYS A;  2RPN A;  1IGU A;  3PIP A;  1D1A A;  2XU8 A;  3BDL A;  1PD0 A;  4J9I A;  3OS5 A;  2DNU A;  4A53 A;  1VYU A;  4ZNX A;  2XDB A;  2BZY A;  2VVK A;  1Y96 B;  2I0N A;  2HBW A;  2KSS A;  3CPW A;  2E5Q A;  2L3P A;  2HCK A;  2PUK B;  2EQI A;  3CCR Q;  3L42 A;  1X2Q A;  1WXU A;  1K1Z A;  3H8Z A;  4ELZ C;  4BI3 A;  1GXI E;  2X4Y A;  1X6G A;  1YHQ Q;  3G71 Q;  1Q7Y U;  1QW1 A;  2MIO A;  5KYY A;  5GAO q;  2DK3 A;  1M3A A;  1OQK A;  4QQ6 A;  3VRZ A;  3OBW A;  5GAN d;  4M78 F;  3VV0 A;  4F04 B;  2D1X A;  3G4S Q;  4QVZ A;  2HMA A;  1VQ8 A;  1ABO A;  3U23 A;  3LGL A;  3JCM X;  3OW2 A;  1UJ0 A;  1TSF A;  2E3H A;  4C8Q C;  3BY7 A;  2LT1 A;  3ZFJ A;  4DQ2 A;  2K5F A;  4M77 F;  3HRS A;  3QZ9 B;  5FRM A;  1W2B P;  1M3B A;  2FVU A;  2F2V A;  5IHN A;  3GNF B;  4M7A C;  1GBQ A;  3C94 A;  2BZX A;  4KGX B;  4Z88 A;  5L23 A;  3EG2 A;  1YI2 T;  3VS5 A;  2VKN A;  2W0Z A;  2ZZD A;  4BI4 A;  2LQK A;  4AG1 C;  2KT1 A;  5HK3 A;  1B34 B;  3RER A;  3CCL A;  1UUE A;  5LJ5 h;  5GAO r;  1MGQ A;  5HCK A;  2HQH A;  5GMK m;  2XHC A;  4CC2 A;  4K11 A;  2IPO B;  3LW5 E;  1ZBJ A;  3LWI A;  1UG1 A;  4E7I A;  1YJW T;  2QQ9 A;  4MDW A;  2EBP A;  2ED0 A;  1TUD A;  3CCQ Q;  4IKF A;  4M7D A;  1CSK A;  1PSF A;  2COY A;  5GAM g;  3DKM A;  3EG3 A;  3JCM P;  1EZZ B;  1YHQ A;  2CP0 A;  4FSS A;  1RAD B;  2HD0 A;  4XTY A;  3G71 A;  4X1V A;  1M8M A;  1Q82 C;  1MMD A;  2QGF B;  3CXC P;  2JS2 A;  1X75 C;  1BI2 A;  3G4S A;  4ESR A;  4KRT A;  4OB0 B;  2OJ2 A;  3NTK A;  2QDL A;  3M53 A;  3Q1J A;  2L0A A;  1VQO A;  3P8B B;  1I5O B;  1MHN A;  3HRT A;  4DA4 A;  1G3S A;  2GFU A;  2LTO A;  3RES A;  2C06 A;  3VYG A;  4LDX A;  1MND A;  4JLG A;  2D9T A;  5LJ3 h;  1KSW A;  2CH4 A;  3OYA A;  4BDZ A;  3CMA A;  1TTH B;  2P4T A;  4M4Z A;  1MV3 A;  1MMA A;  1OPL A;  4BD3 A;  4HCZ A;  4M7A E;  2HQX A;  3GBQ A;  5CO7 A;  3RKX A;  1G3T A;  1ABQ A;  2DVJ A;  4J8O A;  1Q82 R;  2CP7 A;  1QVG S;  5HY6 A;  3M57 A;  2EJ9 A;  2EKH A;  4KUD K;  1JXM A;  4BDY A;  4RTY A;  2RF0 A;  3RKY A;  5C0M A;  1T0H A;  2X3X D;  3RDV A;  1H3H A;  2RQU A;  2YUP A;  2ENM A;  3JSC A;  1RLP C;  1H3Z A;  1RI0 A;  5CQY A;  1RI9 A;  4DBF A;  1VIF A;  4YTL A;  2CKK A;  3CC7 T;  3CCE T;  2QG9 B;  2EPD A;  2LJ0 A;  3ZEH A;  1YIT T;  4XAX B;  2EYY A;  1NLO C;  1OV3 A;  4C8Q D;  1IZ6 A;  1YN8 A;  2AKK A;  2CSQ A;  3J80 E;  3CCU Q;  4MMK A;  4M7A B;  4RTV A;  1SSF A;  1U06 A;  2IVW A;  4JZ4 A;  2LQ8 A;  5GMK j;  3NPF A;  4M7A D;  2KVQ G;  4RMO A;  2D8J A;  2GBQ A;  1WHJ A;  2SRC A;  1RAC B;  1BYM A;  2E10 A;  1YIJ T;  2V1R A;  2DBM A;  2FZG B;  2DRM A;  2DAQ A;  4OMN A;  4II1 A;  4KUL A;  2HZY A;  4E7L A;  1QVG A;  2MCN A;  3MP8 A;  1ZSZ A;  3HL8 A;  3V7C A;  3VRY A;  3I55 T;  2ZCF B;  2QQS A;  1M2O A;  1D3B A;  3SHW A;  5CCA A;  1QCO A;  2DYI A;  2ZPG B;  5KYW B;  4X34 A;  3SDZ A;  2FRY A;  1YJ9 A;  4OML A;  2CZ7 B;  1NEG A;  3OYI A;  2A08 A;  2F2W A;  2P0K A;  1T3L A;  1VQ5 Q;  2E6Z A;  2X4J A;  1OI1 A;  2DMO A;  4OVA A;  1QQJ A;  1BCO A;  1BK2 A;  2YLC A;  1D09 B;  4EMK A;  3ZBD A;  1M1F A;  1PSE A;  1QLY A;  2DET A;  1ACM B;  4C8Q F;  2DZ9 A;  1BI3 A;  1UB4 A;  2B86 A;  2IG0 A;  3KFV A;  3OSV A;  3BW1 A;  4FM4 B;  3CCU A;  4FW1 A;  1TXQ A;  2FG0 A;  2ROL A;  4P5N A;  2GF7 A;  4M7A F;  1G8X A;  4OMQ A;  3CC4 Q;  2C0I A;  3EAE A;  5FWB A;  1JU5 C;  1MV0 B;  5AT1 B;  1K8A C;  2PVG B;  1VQ9 T;  2MOX A;  1HXD A;  4XU1 A;  1RL2 A;  4NOY A;  3VUB A;  1M1G A;  1M2V B;  2DFU A;  4M7D C;  1NG2 A;  3M9Q A;  3V8K A;  1LNX A;  1R8O B;  3NHN A;  1M5Q 1;  2LJ3 A;  1ZSG A;  1JRI A;  3FJ5 A;  2BKD N;  5EC7 A;  4DEX A;  2CP2 A;  3CEY A;  2YT6 A;  2HBP A;  2EIF A;  4EDU A;  1M90 C;  2J05 A;  4Y28 E;  1JJ2 P;  1QKX A;  2M1H A;  3QWY A;  1I5L A;  3FB9 A;  5I11 A;  4MZM A;  1S72 T;  1H92 A;  3NFC A;  3M4Y A;  3RUX A;  3QHS A;  3TU4 K;  1M8V A;  2PUO B;  4ZN3 A;  3QSU A;  3CCQ T;  2BTT A;  3CPF A;  5FW9 A;  3HFO A;  1K8A R;  1SSH A;  2ZPI B;  3OS2 A;  3EHQ A;  4ZN1 A;  4J9C A;  4RKU E;  3R6N A;  2F2X A;  1OZ2 A;  3TRE A;  2X35 A;  5EG2 A;  2RI3 A;  2BE9 B;  1RUW A;  2RQV A;  3EH2 A;  3GIB A;  3OBY A;  3CC4 A;  1M90 R;  1IRX A;  2EQJ A;  3OYJ A;  3ME9 A;  2JNG A;  1RAI B;  3OYY A;  5KYY B;  1D0Z A;  4C8Q A;  3FLG A;  4OB2 B;  4F7U A;  4JRI A;  2L3Q A;  1D1C A;  3CBO A;  1AWW A;  3V7S A;  2LCS A;  4M7D E;  1PRM C;  4EMH A;  2F69 A;  1AZG B;  1LVK A;  2CRE A;  2RJC A;  5LJ5 e;  1B7T A;  2JJ9 A;  2QQA A;  1QVF P;  3V7R A;  4XTU A;  3M59 A;  4FL6 A;  2QEX Q;  3KXT A;  4AFS C;  2M0Y A;  2P0P A;  3EGD A;  2VC8 A;  5IHI A;  2HKQ B;  3MJX A;  1PC0 A;  5KYX A;  1IB8 A;  4FIB A;  1AVZ C;  4E7S A;  1UGV A;  2YRC A;  1RAE B;  3TEE A;  1NZ9 A;  4GBQ A;  2OTJ Q;  2M9U A;  5GAM h;  3UDC A;  1Y57 A;  5L8R E;  3EG1 A;  1IGQ A;  3WVE B;  4LE9 A;  2KMT A;  4PJJ A;  2QI2 A;  3HFN A;  1MMG A;  1ZSZ C;  1PM3 A;  2PVD B;  3UT1 A;  2G6F X;  3QO3 A;  3TSW A;  1YJN T;  5LJ3 e;  4M7D B;  1ZLM A;  3VU3 C;  2RHI A;  1OUL A;  2GCX A;  2OTL Q;  2VUB A;  1HYO A;  1C1A A;  1GFC A;  3I56 Q;  4M7D D;  3X26 B;  3S3O A;  4A4F A;  4CRI A;  5A2Q E;  2EAY A;  1RLQ C;  4E7H A;  1JXO A;  1G83 A;  1YI2 A;  2R58 A;  2EKO A;  2VYT A;  3QYG B;  5GJW B;  5HKC A;  1WHH A;  3RIR A;  1O75 A;  2F5K A;  2EWN A;  4ORZ A;  2DL7 A;  4AFQ C;  5FRO A;  5GAN h;  1QCN A;  2VWF A;  1P92 A;  2PNI A;  4O5V A;  1RAH B;  1WI7 A;  2V1Q A;  2JXB A;  3MO8 A;  1K0S A;  1QMC A;  5DLQ E;  1UE9 A;  3OMG A;  1D1B A;  2FRW A;  2ZPF B;  4NS5 A;  4OGE A;  1VQK Q;  2CP3 A;  3MP1 A;  2X4W A;  2OTJ A;  3OB9 A;  4IUT A;  3CBM A;  4RG8 A;  5LJ3 f;  1TUC A;  4Y91 A;  1SKU B;  3MHX A;  4CI0 C;  2OX7 A;  1VQ6 A;  3QUI A;  1IRE B;  2B8A A;  1WLP B;  2K79 A;  2DBK A;  4KGZ B;  1SRM A;  2K2V A;  5GAM d;  2RMO A;  3CPW P;  4OMP A;  4XU3 A;  1MMN A;  3L1A A;  5C6S A;  4KUI A;  1VQ4 T;  1EIF A;  2DO3 A;  3VJP A;  3G6E T;  3TSZ A;  4EPC A;  3RR6 A;  4M7D F;  2XIC A;  2DD4 A;  4LN2 A;  2DZC A;  4HA8 A;  2HKN A;  1O9S A;  3ASK A;  2XDD A;  3M56 A;  4PJO G;  3I56 A;  3CCL Q;  3JCM b;  9ATC B;  1KC8 C;  5FU7 C;  1E6H A;  2CDT A;  2FYK A;  4A4K A;  2QA4 A;  2D6F A;  3MEV A;  2RNA A;  1IO6 A;  1NBE B;  2DA9 A;  2CT4 A;  1H8K A;  3MEU A;  3PVQ A;  3M0S A;  4LDW A;  1E6G A;  1ZBX A;  2EGA A;  3X20 B;  1VQP T;  2XI9 A;  5I22 A;  1WJS A;  3OYG A;  3CCJ Q;  1TU0 B;  3LH5 A;  2ED1 A;  5LL6 S;  1MUZ A;  4CC4 B;  1OX9 A;  4PLL A;  1W2B S;  2O9S A;  3H41 A;  2D0N A;  1FMW A;  3PMT A;  3SFM A;  3E19 A;  2DLP A;  2KGT A;  2A36 A;  4L59 A;  1W6X A;  1VQO Q;  1M90 U;  4JLI A;  2KYB A;  2JM8 A;  1ZSZ B;  1VQK A;  3CCM Q;  4B9W A;  1D3B B;  2V8K A;  1Q81 C;  2VXE A;  3QJY A;  3CCS T;  1KC8 R;  1G5V A;  2DIQ A;  3VYH B;  1JEG A;  1BIA A;  1XNI A;  4A4H A;  3CMA Q;  1VQ7 Q;  1WXB A;  5I2M A;  3CME Q;  1OU9 A;  4PJO A;  1VQN T;  1XTD A;  2LP5 A;  2DXT A;  4EMK B;  4CC3 A;  2DL5 A;  1WNL A;  2COZ A;  2LNV A;  2EGC A;  1LOJ A;  5GAO l;  3JCM Q;  3ER0 A;  1YIJ A;  4PKC C;  2L8D A;  3MEA A;  1KQ1 A;  1KQS P;  1VQL T;  1K9A A;  5I21 A;  5DM7 R;  3PIO A;  5LJ5 j;  5KE3 A;  5GJV B;  5KE2 A;  3JCM J;  3M0Q A;  3V8L A;  4Z8A A;  1VUB A;  3CXC S;  4BUG A;  1BCM A;  1Q81 R;  4M75 G;  2ZAE A;  2JUF A;  3VS1 A;  3PT9 A;  2E64 A;  3CCJ A;  4M78 G;  2Y4X A;  2QEX T;  1NYG A;  2JZ2 A;  1T3S A;  1LCK A;  2V8J A;  3H0H A;  4JRK A;  4KGV B;  2EQU A;  7AT1 B;  2QDY B;  2XID A;  3A8O B;  3S3M A;  4BY6 C;  3E9G A;  3VS2 A;  4JJD A;  1EFN A;  1GCQ A;  4C8Q E;  4IUU A;  3OYD A;  3CCM A;  4F7U E;  2E5K A;  2MF2 A;  4AFZ C;  4DOW A;  2YXY A;  3HHT B;  4UC4 A;  2DIL A;  1WGS A;  1VQ7 A;  2HDA A;  1N9S A;  2HEQ A;  3CME A;  5LJ3 j;  2JTM A;  2J6K A;  3P8H A;  1M30 A;  1HK9 A;  1Y0M A;  1PKT A;  4GLK A;  5GAN 3;  4ZGE B;  4OF1 A;  2M0O A;  2VGM A;  2RHX A;  4OMF B;  2YDL A;  2Y4Y A;  2OTL T;  3CCV Q;  2QGG A;  4FYY B;  4M75 A;  4C0D C;  3OYM A;  4LD9 K;  3JCM c;  3OYE A;  4JJN K;  1M1K U;  3CXC A;  2PQW A;  2YHT A;  1YJ9 Q;  3PGG A;  1SHF A;  1ZHI A;  2GQV A;  3JCM d;  2BUD A;  3MCA B;  2V26 A;  5GAN 2;  1WHG A;  2MAM A;  3REA B;  1WPY A;  4C8Q B;  4F7U B;  2NUT A;  1S72 A;  1PHT A;  2O2O A;  1GBR A;  2JVV A;  3EG0 A;  4A4G A;  3X24 B;  1WIE A;  3AT1 B;  4XU2 A;  1BB9 A;  4LDY A;  4F14 A;  5KCH A;  3THK A;  3JRZ A;  1QVG P;  1VQ8 T;  2FZC B;  1CKA A;  3M4G A;  2R57 A;  1OEB A;  2MWP A;  4PFZ A;  1D0X A;  4J7I A;  2A0F B;  2DTH A;  3M58 A;  2YWW A;  4FU6 A;  2X51 A;  3GF5 A;  1ZUY A;  1ARK A;  1BIB A;  4HCK A;  4L5G A;  1U8R A;  4FW2 A;  3GNG A;  3EGD B;  4IIM A;  4XTW A;  1W4S A;  4PL6 A;  2QQR A;  1WX6 A;  5GMK h;  5FRN A;  2LCL A;  5KYX B;  2W10 A;  1I0C A;  2H8H A;  3H6Z A;  4N0A A;  1VYT A;  5GAN 6;  3J81 E;  1R77 A;  3CD6 A;  3CC2 Q;  3EGX B;  1I4K 1;  3CCV A;  5FU6 C;  2KK4 A;  1VQM Q;  4HXJ A;  2K2M A;  1N9R A;  4J9H A;  2X9H A;  3OS1 A;  3BDU A;  1RAF B;  2HAX A;  3NTH A;  2K7A A;  5CIU A;  1KG1 A;  5GAN e;  2CUB A;  3OA6 A;  3CCR T;  4WTO B;  5AYF A;  3L2Z A;  4RCB A;  4J6W A;  1SHG A;  5GAM f;  4PJO C;  2RHZ A;  2ZPE B;  1YHQ T;  4F7U F;  2AK5 A;  1X69 A;  1YCS B;  3C4S A;  1ZX6 A;  3G71 T;  3OYF A;  4DBR A;  2PTK A;  2KEA A;  2KDS A;  3WVD B;  3G4S T;  5IHK A;  1AT1 B;  3F70 A;  3QDR B;  2ABL A;  1XQH A;  3C0C A;  3QBY A;  2L3S A;  2E65 A;  2RA2 A;  1Y7X A;  2CS7 A;  3JCM g;  4B6M A;  3CMA T;  2XMF A;  5GAO n;  4C0D B;  5DLO A;  3OYL A;  1YJN A;  1Y07 A;  2KQW A;  3QG1 A;  2AIR B;  1UDL A;  1WQ7 A;  3I9Q A;  1Q81 U;  2YRD A;  2C0O A;  1VA7 A;  3CC2 A;  5IXF A;  1NJI C;  1XJW B;  5LJ5 g;  3OQ5 A;  2LZ6 B;  5GAN f;  4PNO A;  1VQM A;  1KD1 C;  3O5Z A;  2P4R A;  2EVR A;  1PKS A;  2JN0 A;  4F16 A;  4HVV A;  1GCQ C;  2KRM A;  3MEW A;  4FT4 A;  1ZQ1 A;  2O4X A;  4C92 G;  2RQW A;  5A0L A;  4OGC A;  4C0F A;  2E6N A;  3P8D A; 
#chains in the Genus database with same CATH homology
 1G83 A;  1UJY A;  2F2V A;  1UFF A;  5IHN A;  1BU1 A;  1GBQ A;  2BZ8 A;  2BZX A;  1GL5 A;  4Z88 A;  5GJW B;  2KR3 A;  5L23 A;  3EG2 A;  3VS5 A;  2ECZ A;  2VKN A;  2W0Z A;  2YUQ A;  3IQL A;  4ORZ A;  1ZUK A;  2DL7 A;  4AFQ C;  4AG1 C;  2VWF A;  2KT1 A;  2JW4 A;  1NLP C;  2PNI A;  3UAT A;  1WI7 A;  1UUE A;  3PE0 A;  2V1Q A;  2DL8 A;  1SRL A;  2JXB A;  4JJC A;  5HCK A;  1K0S A;  1X6B A;  4CC2 A;  2DL4 A;  4K11 A;  1UE9 A;  1B3Q A;  1ZBJ A;  2FRW A;  2LMJ A;  1UG1 A;  2J6F A;  2FO0 A;  3M0U A;  1AWJ A;  2EBP A;  2ED0 A;  1TUD A;  1TUC A;  1BBZ A;  1WFW A;  4RUG A;  1I07 A;  1ZUU A;  1U3O A;  1CSK A;  2KBT A;  4GLM A;  3EG3 A;  1NYF A;  1WLP B;  2K79 A;  1YWP A;  2DBK A;  1SRM A;  1AWX A;  4FSS A;  2RMO A;  4X1V A;  1M8M A;  4OMP A;  2JS2 A;  2CUD A;  4ESR A;  3TSZ A;  4F17 A;  1AWO A;  2CH4 W;  4KRT A;  2OJ2 A;  2QDL A;  2L0A A;  4AG2 C;  2ROT A;  4LN2 A;  1K76 A;  2FPD A;  1QWF A;  1X27 A;  1GFD A;  1E6H A;  1PWT A;  2CDT A;  1KSW A;  2CH4 A;  2A28 A;  2GQI A;  3TVT A;  2CT3 A;  2RNA A;  4M4Z A;  1MV3 A;  1IO6 A;  4D8D A;  2DA9 A;  4LUD A;  1OPL A;  1UHC A;  1H8K A;  2CT4 A;  2RN8 A;  3PVQ A;  3M0S A;  1WXT A;  2HSP A;  1E6G A;  1J3T A;  2EGA A;  5I22 A;  1WYX A;  3LH5 A;  1NEB A;  3GBQ A;  2ED1 A;  1AD5 A;  3M0T A;  1MUZ A;  1ABQ A;  2DVJ A;  4OMO A;  4CC4 B;  1GRI A;  1AOJ A;  1JQQ A;  4RTU A;  2O9S A;  2EKH A;  3RBB B;  3H41 A;  2D0N A;  1W70 A;  4RTW A;  2J6O A;  1JXM A;  2DLP A;  4RTY A;  1E7O A;  2KGT A;  2RF0 A;  4J9B A;  2A36 A;  3RNJ A;  1T0H A;  1W6X A;  1XOV A;  2X3X D;  2KYB A;  1H3H A;  2JM8 A;  2RQU A;  2YUP A;  2ENM A;  2FPE A;  2JTE A;  1GCP A;  1RLP C;  1X43 A;  2DF6 A;  1RI9 A;  2M51 A;  1JEG A;  2GNC A;  2DX1 A;  2FPF A;  2NUZ A;  2EPD A;  1WXB A;  2LJ0 A;  3NGP A;  4OMM A;  1KJW A;  2EYY A;  1NLO C;  1OV3 A;  2KE9 A;  4LNP A;  2LP5 A;  1YN8 A;  4RTX A;  2AKK A;  2OAW A;  4CC3 A;  1UTI A;  2CSQ A;  2DL5 A;  4RTV A;  1U06 A;  4J9D A;  1A0N B;  2EGC A;  1N5Z A;  2DJQ A;  4JZ4 A;  2LX7 A;  3M0P A;  4RTZ A;  1K9A A;  3M0R A;  3NPF A;  3H0I A;  1KIK A;  1Z9Q A;  2KXC A;  2D8J A;  2GBQ A;  5GJV B;  2SRC A;  3M0Q A;  2V1R A;  2DBM A;  4Z8A A;  2DRM A;  4OMN A;  2J06 A;  1M3C A;  2O88 A;  1K4U S;  3VS1 A;  1SEM A;  2CSI A;  2L2P A;  3UA7 A;  1UHF A;  2MCN A;  1NYG A;  1T3S A;  1LCK A;  2LJ1 A;  3VRY A;  4DEY A;  3H0H A;  3SHW A;  4QT7 A;  4JJB A;  4Y92 A;  3I5S A;  2FRY A;  3VS2 A;  4JJD A;  4OML A;  1EFN A;  2EYZ A;  5IXB A;  1NEG A;  1GCQ A;  2A08 A;  2F2W A;  1T3L A;  4A63 B;  3A98 A;  2DMO A;  2E5K A;  1WDX A;  2YUO A;  2JMA A;  4AFZ C;  1BK2 A;  2DIL A;  1AZE A;  1QLY A;  4E6R A;  2YSQ A;  2JS0 A;  2HDA A;  2B86 A;  2HEQ A;  2SEM A;  1WA7 A;  2J6K A;  3KFV A;  3UF4 A;  2KRO A;  1M30 A;  2DRK A;  1Y0M A;  1PKT A;  2OI3 A;  1CKB A;  1KFZ A;  2C0T A;  2JMC A;  2YDL A;  2FG0 A;  2ROL A;  1FMK A;  3VS7 A;  4OMQ A;  1YNZ A;  1SPK A;  2C0I A;  2GTO A;  5FWB A;  4RTT A;  2J7I A;  3ULR B;  1JU5 C;  1MV0 B;  2RQT A;  3SEM A;  2K9G A;  3CQT A;  2MOX A;  2KRS A;  3VS4 A;  1SHF A;  3PVL A;  1OOT A;  2A37 A;  3VS3 A;  2NWM A;  1NG2 A;  2DM1 A;  1S1N A;  2FEI A;  3NHN A;  1HSQ A;  2JT4 A;  2YUN A;  1YP5 A;  2AKL A;  3REA B;  2GGR A;  2LJ3 A;  4D8K A;  1ZSG A;  3QWX X;  1PHT A;  3FJ5 A;  2KT8 A;  5EC7 A;  2D8H A;  2O2O A;  1GBR A;  4DEX A;  3EG0 A;  2YT6 A;  5IH2 A;  1M27 C;  1UEC A;  2J05 A;  1QKX A;  5ECA A;  2DE0 X;  1WIE A;  1Z9Z A;  1PNJ A;  3QWY A;  2EYX A;  1X2K A;  1B07 A;  5I11 A;  4CC7 A;  1BB9 A;  4F14 A;  3THK A;  1H92 A;  3ZL7 C;  1CKA A;  1OEB A;  1YWO A;  3UA6 A;  1ZUY A;  2BTT A;  1ARK A;  5FW9 A;  4HCK A;  2EYW A;  4IIM A;  1SSH A;  2KNB B;  3I35 A;  2EW3 A;  2LNH B;  3EHQ A;  1I1J A;  4J9C A;  4JPB W;  1WX6 A;  2IIM A;  2W10 A;  1I0C A;  3EGU A;  3R6N A;  2H8H A;  1U5S A;  2F2X A;  1VYT A;  3EHR A;  4LUE A;  2AZS A;  1FYN A;  1RUW A;  2LQW A;  2RQV A;  1HJD A;  2JM9 A;  2EGE A;  4HXJ A;  2K2M A;  1HD3 A;  2DYB A;  4J9H A;  2GTJ A;  4Z89 A;  2KYM A;  1QCF A;  4J9F A;  1VYV A;  2PZ1 A;  3I5R A;  1QWE A;  3H0F A;  2L3Q A;  4WCI A;  2K7A A;  2ESW A;  1AWW A;  1JO8 A;  3REB B;  2CUB A;  4J9E A;  2LCS A;  1PRM C;  1TG0 A;  1AZG B;  3JV3 A;  2CRE A;  1SHG A;  2DL3 A;  4EIK A;  2KRN A;  4HVU A;  2AK5 A;  1X69 A;  1YCS B;  1ZX6 A;  4JZ3 A;  2O9V A;  2KXD A;  1PRL C;  3NMZ C;  1K0X A;  4J9G A;  4AFS C;  2PTK A;  2KEA A;  2M0Y A;  1AEY A;  4IIO A;  2AZV A;  2RPN A;  3VS0 A;  5IHI A;  5IHK A;  4J9I A;  2DNU A;  1VYU A;  4ZNX A;  1G2B A;  2ABL A;  2X3W D;  2BZY A;  2VVK A;  3C0C A;  1AVZ C;  4HVW A;  2I0N A;  2LQN A;  2HBW A;  1UGV A;  2L3S A;  2L3P A;  2HCK A;  4GBQ A;  2EQI A;  1T0J A;  1X2Q A;  1WXU A;  1K1Z A;  2XMF A;  1OPK A;  1Y57 A;  1QKW A;  1V1C A;  3EG1 A;  4AFU C;  1X6G A;  4R0K A;  1UDL A;  4LE9 A;  3I9Q A;  5FWC A;  2O31 A;  2C0O A;  1VA7 A;  2MIO A;  2G6F X;  1M3A A;  5IXF A;  3VRZ A;  3TSW A;  2D1X A;  1NM7 A;  2LZ6 B;  1ZLM A;  1ABO A;  3U23 A;  3O5Z A;  1UJ0 A;  2K3B A;  2P4R A;  2EVR A;  1PKS A;  1W1F A;  4F16 A;  4HVV A;  1GCQ C;  2RQR A;  2KRM A;  1GFC A;  2RQW A;  2K6D A;  1RLQ C;  3VS6 A;  1M3B A;  1JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...