4IIOA

Crystal structure of the second sh3 domain of itsn2 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
b'GMAQGALLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin-2
publication title Crystal Structure of the Second SH3 Domain of ITSN2 Bound with a Synthetic Peptide
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iioA00
2PZ1A 4DEXA 2W10A 1JXMA 1WDXA 1PKTA 2AZVA 2F2XA 1UTIA 4LNPA 3I5SA 1WX6A 4CC3A 3GBQA 2E5KA 2EBPA 4D8DA 1GRIA 1E6HA 1A0NB 4OMQA 4OMPA 2O31A 1K9AA 1X43A 2RQRA 1YWOA 2BZ8A 2L3SA 4RTZA 1UHCA 3KFVA 4WCIA 2KBTA 5IHIA 1WXUA 4KRTA 2K2MA 3EG1A 2D0NA 1PNJA 1ZSGA 4OMOA 5ECAA 2EPDA 1M3CA 3ZL7C 3REAB 2RQWA 1NG2A 2GTOA 1ZUUA 2J05A 2NUZA 1WI7A 4HVVA 4GBQA 2DE0X 4E6RA 2O9SA 2YUPA 1TG0A 1WLPB 1X2KA 4RTUA 3JV3A 1M3AA 1PKSA 1U3OA 3I35A 2DL7A 1FYNA 3EG0A 1TUDA 1K4US 2LJ0A 3I9QA 1AZGB 1CKBA 2FRYA 4AFSC 2V1QA 1GCQA 2JS0A 1SHFA 4OMNA 3NHNA 2H8HA 1YN8A 1SHGA 1GL5A 3VS0A 1NYGA 4EIKA 3EG2A 1AEYA 1B3QA 2A36A 4J9DA 1IO6A 5IXFA 2EGEA 2DL8A 1KIKA 2C0OA 2JW4A 2HBWA 4Z8AA 5EC7A 4AFZC 4ZNXA 3H41A 2PNIA 2KXCA 1OPKA 2BZXA 2L3PA 2J6FA 2BZYA 2X3WD 1U06A 4DEYA 1BB9A 2FPFA 3SEMA 3CQTA 4AG1C 1V1CA 5IHKA 1VYUA 1GBQA 3VRYA 1UG1A 2ESWA 1Z9QA 4D8KA 1VA7A 2LMJA 1BK2A 2MIOA 1NM7A 4JPBW 2VKNA 3C0CA 2D8JA 4QT7A 2LZ6B 4AFQC 1XOVA 4RTTA 3TSZA 1QKWA 2A28A 2HSPA 2YSQA 2JXBA 2L3QA 1ARKA 5IHNA 1QLYA 4J9EA 2DILA 2KT8A 1WA7A 1T0HA 2LQNA 2JM9A 2F2VA 2L2PA 1GFDA 2MOXA 4J9CA 2DVJA 1I07A 4Y92A 2FO0A 4JJCA 3VRZA 1W1FA 2W0ZA 4A63B 2FPEA 5HCKA 1OEBA 4JJDA 1W70A 1UJYA 1QKXA 3NMZC 1AWXA 2XMFA 1GCPA 1M3BA 1T3LA 1GBRA 1GCQC 2DL4A 2LJ3A 5GJVB 3NGPA 1N5ZA 2JT4A 2J6KA 2GQIA 2DX1A 3M0QA 2YUNA 2OJ2A 3TVTA 2K79A 1OV3A 1YNZA 1Y57A 2P4RA 1H92A 1CSKA 2LX7A 2RF0A 3PVLA 1AD5A 1UJ0A 2KRNA 3PE0A 2GBQA 1JU5C 1AOJA 1HD3A 1HSQA 4J9IA 2HCKA 3O5ZA 3UF4A 1AZEA 1QWEA 1LCKA 1EFNA 1MV3A 2DLPA 4LUEA 1QWFA 1S1NA 1KFZA 1WYXA 1ZUYA 2HDAA 1MV0B 5IH2A 5FW9A 2DYBA 2RMOA 2M51A 4CC2A 4FSSA 3M0UA 2CH4A 2CT3A 1KJWA 2DRKA 3VS1A 4JZ4A 2PTKA 1I1JA 2EQIA 1WFWA 4IIOA 1M27C 1VYVA 2ROLA 4RUGA 2FEIA 1ZUKA 1AWWA 4LUDA 2JS2A 2KGTA 2CT4A 2VVKA 2JM8A 3THKA 1J3TA 1Y0MA 2ABLA 2QDLA 4F14A 2AKKA 1E7OA 1H8KA 2ED1A 2FPDA 4M4ZA 2AZSA 2DBKA 2EYZA 2J06A 4AFUC 2B86A 4J9BA 2EW3A 2M0YA 1NEGA 2SEMA 1UGVA 2AK5A 2DL3A 2V1RA 1UFFA 3U23A 4RTWA 3H0IA 2ECZA 1WXTA 2KYMA 1NYFA 1SRMA 2BTTA 3A98A 1G83A 1H3HA 1OOTA 2KNBB 1RLPC 1VYTA 2YDLA 2ROTA 2RQUA 2K6DA 2AKLA 3I5RA 1PRLC 2LJ1A 2EGCA 1NLOC 1X6BA 2RPNA 2EYWA 3EGUA 1T3SA 1UHFA 3FJ5A 4JZ3A 1JO8A 4J9FA 5FWBA 2DNUA 2LP5A 2YUOA 2RQTA 4GLMA 1JQQA 3ULRB 1AWOA 2C0TA 2FG0A 4LN2A 1JXOA 1PRMC 1BU1A 3UATA 2EYXA 1PWTA 1T0JA 2LCSA 2CH4W 1E6GA 2DMOA 2VWFA 3H0FA 2RN8A 2CSIA 3VS5A 2J6OA 1K0SA 4ESRA 3EHRA 5L23A 1SSHA 2KRSA 2MCNA 3IQLA 1UECA 1M8MA 4HVUA 3SHWA 2KEAA 1UDLA 2SRCA 1ABOA 4HVWA 2LQWA 2ED0A 3M0PA 1MUZA 2OI3A 2DM1A 2GTJA 4OMMA 3R6NA 4F17A 1QCFA 1RLQC 1WXBA 2CDTA 1JEGA 2O9VA 2CSQA 2D8HA 1UUEA 2NWMA 2K9GA 4OMLA 3VS3A 2L0AA 3VS2A 4Z89A 2HEQA 3UA7A 2A08A 1K76A 2DJQA 3EG3A 4IIMA 4R0KA 4RTYA 2EKHA 1SEMA 2CUBA 3H0HA 2ENMA 2YUQA 1ABQA 3QWXX 1NLPC 1YWPA 2F2WA 1ZLMA 2IIMA 2CREA 1TUCA 2FRWA 1RI9A 1M30A 1X69A 2A37A 2RNAA 1PHTA 2KROA 4HCKA 1Z9ZA 2OAWA 2CUDA 4J9HA 3RNJA 1BBZA 2RQVA 2X3XD 3M0RA 1B07A 2DBMA 2EVRA 2YT6A 1OPLA 3EHQA 4CC4B 1YCSB 1GFCA 4HXJA 3QWYA 3TSWA 2DF6A 2KT1A 1X6GA 1UE9A 1NEBA 3M0SA 4AG2C 1ZX6A 4J9GA 4CC7A 2LNHB 3REBB 4K11A 5GJWB 1AVZC 2C0IA 1AWJA 2DA9A 3PVQA 1HJDA 5I22A 2KR3A 2EGAA 5FWCA 2KYBA 2KE9A 2KXDA 1FMKA 2K7AA 1X2QA 2JTEA 4JJBA 1YP5A 1SPKA 1ZBJA 2K3BA 3NPFA 2I0NA 4X1VA 3VS7A 2DL5A 2G6FX 2J7IA 3VS6A 1SRLA 3LH5A 4ORZA 1K0XA 1X27A 1WIEA 2D1XA 1G2BA 3VS4A 2JMAA 1W6XA 5IXBA 2O2OA 5I11A 1RUWA 2GGRA 4LE9A 2DRMA 3UA6A 4RTXA 1U5SA 2KRMA 3M0TA 4RTVA 1K1ZA 4Z88A 4F16A 1CKAA 2GNCA 1KSWA 2O88A 2JMCA 1I0CA 2EYYA 3RBBB
chains in the Genus database with same CATH superfamily
2PZ1A 2Y4XA 2W10A 4XAXB 1HYOA 4II1A 1UTIA 5CK9A 3RERA 4QVZA 3I5SA 4P5NA 1IRXA 4TVRA 2EBPA 4E7HA 4D8DA 4E7SA 2XU8A 2OTJQ 2O31A 4F7UG 3OSVA 2BZ8A 1MGQA 2E6NA 2ZPBB 4KGZB 2LX9A 2YWWA 4MZMA 4XTYA 5FRNA 5GAOq 3EG1A 3PNWC 2RD1A 1PNJA 1ZSGA 4C0ZA 3INZA 1YHQT 4FL6A 3REAB 2KMTA 1H641 1ZUUA 2CP7A 1PD1A 4C5EA 3CCJQ 2NUZA 4A4FA 5GAMf 4GBQA 3M53A 2RI5A 1M3AA 3TEEA 2QTXA 1SG5A 4RCBA 4GY5A 3AHUA 1MNEA 1TUDA 2HL3A 4EMKA 5GAN8 1VQ8T 1IXDA 5KCHA 4NOYA 1TH7A 3NHNA 1OZ3A 3FIFA 2H8HA 2K3YA 3M4GA 1GL5A 2MAMA 4JS5A 3WVDB 2KQWA 3EG2A 1XJWB 1B3QA 4M77C 3SDZA 3QXEB 2HBWA 1M8VA 4AFZC 3CC2T 3H41A 3JCMe 2BZXA 3CC7A 2AIRB 2PUKB 1RAHB 3S3OA 3CQTA 3CMAT 5IHKA 1OQKA 1GBQA 3VRYA 4QVCA 3OYJA 2RO0A 1VQ6Q 3N5BB 1MNDA 1BK2A 3LYIA 1M1KR 2V8IA 2D8JA 4QT7A 3ASKA 3CMEQ 1LVKA 2LZ6B 1XOVA 4GLKA 1QKWA 2ZCFB 2A28A 2CS7A 5IAYA 3CCUT 2YSQA 2KAFA 1Y7XA 2OAUA 1VQMA 5FRMA 3M54A 1M4ZA 2KY9A 1BCOA 1T0HA 2P4TA 2JM9A 1ZA1B 3GNFB 2MOXA 5LJ5h 3FC3A 2YRVA 4JRIA 4J9CA 5DLQE 3UPUA 1W1FA 2IPOB 1QQJA 1RAIB 5HCKA 1OEBA 3CCRT 2MMPA 3NMZC 4PLIA 5LJ5d 2EWNA 4OP0A 2LRQA 4ZN3A 2HQHA 2LJ3A 2XHCA 5GJVB 2GQIA 3NTIA 3JCMV 1VQ7Q 4Q5WA 2WACA 3KXTA 4M7DA 2OTLQ 1VQ9Q 2B8AA 2LDMA 2QAZA 1OV3A 5D7UA 4FW1A 4M7AE 2KDSA 1I5OB 2PVDB 1QVFP 1TU0B 3JCMP 4NS5A 1JBMA 2LCLA 1HD3A 1VQNQ 1AZEA 2JZ2A 1KQSP 1EFNA 1LCKA 3PFSA 1S1NA 1MV0B 5IH2A 2COYA 2RMOA 1W2BP 2GCXA 3M0UA 1WHJA 2CH4A 4JZ4A 2PTKA 4E7LA 2EQIA 2FHDA 1LJOA 1WFWA 2ROLA 3O8VA 4M78A 3G1JA 3V7SA 1YJNQ 3BW1A 3CCEQ 2CT4A 2VVKA 1JJ2P 3CCLQ 4OGEA 1K9MC 2QDLA 2DYIA 3RMQA 3E9FA 4M75F 5FU6B 1VQ5T 1G3WA 2MYSA 2P0PA 5LJ3e 2EYZA 1ZSZA 1I5LA 1EX4A 1NEGA 1P92A 1UGVA 1N9SA 2YXYA 2JVVA 1KG1A 2V1RA 2X4WA 4C8QE 3MEWA 1H3ZA 2JJ9A 5GAN6 2R5AA 1RLPC 5HKCA 3QG1A 3QKJA 3HRTA 2X51A 3I5RA 3DLLA 4PNOA 2EGCA 5GANf 3CBOA 1MMGA 1BIBA 1UHFA 2QASA 2M9UA 2PQWA 1QVGA 4J7IA 3DKMA 1M1KU 1M2OA 1JQQA 1XTDA 3OS5A 4QQGA 3CCQQ 1PRMC 3MCAB 2EYXA 3RIRA 2EJ9A 3WXMB 2NUTA 2FB7A 2COWA 3H0FA 4ZGDB 5GAN2 3VS5A 2HMAA 2PVGB 2KI7A 1M1GA 4UC4A 1X75C 4B9XA 1SSHA 2KRSA 1VQ8Q 3IQLA 1QCNA 3SHWA 2KEAA 3PIPA 3M0PA 3R6NA 1OI1A 4OB0B 3OBWA 2DVEA 2E41A 2CDTA 4DBRA 5CKBA 2CSQA 1UUEA 3CC2Q 3VS3A 1RACB 2L0AA 3VS2A 4Z89A 1IGUA 4PFPA 1Y96A 2DJQA 4L59A 2EKHA 4HT8A 3OYAA 2K5FA 3CMAQ 5AT1B 1ABQA 3QWXX 1NLPC 1YWPA 1ZLMA 1VQPA 2HZYA 1ZHIA 2CP6A 4RKUE 2MF2A 2FRWA 4QKUA 1RI9A 1X69A 3QSUA 2RNAA 5CQYA 4M7AA 3TCJA 2DXUA 1YITT 3CCMQ 4PJOF 5J39A 1BBZA 4PFZA 1YJWT 3UDCA 3M0RA 4D6WA 3A8OB 2DBMA 5CVIA 2EVRA 4C92E 2OTJT 2YT6A 3EHQA 3PMTA 2M02A 2RHXA 3CCUQ 1YCSB 1G8XA 1GFCA 2XDPA 2QTVA 4HXJA 1BCMA 2QEXT 3HRUA 3OBYA 2YLBA 1WQWA 5GMKm 3OYBA 4AG2C 1ZX6A 3REBB 2DAQA 4L6V5 2DA9A 5LJ3h 3L42A 3CCJT 5I22A 2KR3A 2EGAA 5DY9A 2KYBA 2O4XB 2KXDA 3CCRQ 1R0CB 5CKEA 1PSFA 2JTEA 1SPKA 3SWNC 1ZBJA 5LJ3d 4OB2B 4X1VA 3VS7A 3VS6A 2LCCA 3I55T 3LH5A 1K0XA 4ZGEB 2D1XA 1G2BA 2P0KA 1EZZB 2YHTA 3P8DA 1B7TA 2P84A 2DK3A 4M7DB 4LDXA 2GGRA 3OYYA 2WSFE 4RTXA 1YHQA 4M77A 2XKOC 3M0TA 4IKFA 4PL6A 4BI8B 1I0CA 2EYYA 2DXCA 3OYMA 1JXMA 1PKTA 2AZVA 2F2XA 4OVAA 1QCOA 2ZPIB 3HPWA 4CC3A 1GRIA 5CR2A 1A0NB 4FT4A 3HSBA 3QHSA 1Q7YC 1X43A 2RQRA 4RTZA 2EKOA 4WCIA 2E1HA 5GMKe 2KBTA 5IHIA 1BI1A 5CKFA 5EG2A 1WJRA 1W4SA 4M78B 2K2MA 3URGA 2A0FB 2DERA 3S3NA 1YI2T 5ECAA 4KGVB 4QW2A 1D1AA 1M3CA 1VQ5Q 1OYXA 3EFOA 3HKSA 4PJMA 4DQ2A 2GTOA 4OGCA 2J05A 2HAXA 1Q7YU 4E6RA 3M55A 1WLPB 4LDWA 4A4EA 2KVQG 1PKSA 1U3OA 1ZSZB 2AT1B 3BE3A 1IZ6A 3OYHA 3QYGB 1Q82C 3RKYA 3J7AF 4F7UA 1FYNA 3EG0A 5GAOp 1OU8A 2DZ9A 2FRYA 2QG9B 2JS0A 2DIQA 4PJLA 1SHFA 2Z0WA 2OTLT 1VQ9T 3VUBA 2L3RA 4C8QG 5LJ3j 5CQXA 1NYGA 3SB2A 5LL6S 1LNXA 1MMDA 2EGEA 4JRQA 2JW4A 5IN1A 5EC7A 1QVFS 2PNIA 2QI2A 4C8QD 2KXCA 4ATOA 1OPKA 2L3PA 2J6FA 5GAOm 3OYKA 1U06A 4DEYA 2XICA 3ER0A 5I2SA 3OYGA 4AG1C 4O5VA 5J3BA 1NBEB 4BY6C 2E65A 3ZBDA 1W2BS 3QPHA 3QBYA 1NM7A 2QA4A 1M2VA 4JPBW 4KH0B 1RI0A 3G4SQ 4AFQC 1YJNT 4RTTA 3D7SB 4RMOA 1VQ4A 3CCET 3JCMW 1ARKA 1D0ZA 2VB6A 3G71A 1S72T 2KT8A 5J26A 3GF5A 1WA7A 3PT9A 4LD9K 5LJ5e 5DLOA 1M1FA 3AT1B 1FMWA 2V8JA 1I07A 4JJCA 1YITQ 1TOVA 3BY7A 1WHGA 3I56Q 1B34A 2W0ZA 2DEQA 1YJWQ 2PU9B 1W70A 1TXQA 1UJYA 1QKXA 3CCSA 2EYQA 4Y28E 3MHXA 1T3LA 4A4HA 1KHIA 2D6FA 4DOWA 4DBFA 1N5ZA 2QEXQ 2J6KA 2LQ8A 4E47A 5GMKh 3CPWA 1WQ7A 2YUNA 2RI2A 3DB4A 3TVTA 4WF2A 3WVEB 3OYNA 1YNZA 1VQOQ 4HKEA 1R0BG 2RHZA 2ZPEB 4E7IA 1X01A 2QYZA 3F70A 4C92G 3LW5E 5GAOn 1ZA2B 4KUIA 2K57A 1JU5C 4OMFB 4BE2A 2LNVA 3CCQT 1HSQA 4J9IA 2IG0A 4C92D 1QWFA 3JCMf 1WHLA 3I55Q 3SD4A 2M51A 4FSSA 4M75E 5D6YA 2DPPB 2D0QB 1I1JA 4FYVB 4C8QC 4CI0C 4IIOA 2E4HA 1M27C 1VYVA 4RUGA 3L2ZA 4LUDA 2XDDA 2XDBA 3TQ7P 2MWPA 3CXCA 3X28B 3BFMA 3LH0A 5GAN5 1RL2A 2JM8A 1K9MR 2ZPFB 3CCVQ 1ZBXA 7AT1B 3OMGA 2ABLA 4F14A 2ATCB 2AKKA 1E7OA 1H8KA 2RJFA 5GAMe 3L1AA 4M77B 4RG2A 2ZPGB 3X20B 5KYXB 4EPCA 3EGDA 2EW3A 3X26B 4X9CA 2SEMA 5FU7C 4F04B 5KYYB 3GPLA 2AK5A 5L8RE 1RAEB 2DL3A 3KUFA 3JCMc 3M5AA 3CCMT 2ECZA 2L5QA 3OYIA 1NYFA 1UEBA 2EQKA 2KNBB 1WHKA 2RQUA 1YI2Q 3HFOA 1PRLC 2QQRA 2FVUA 2VC8A 4MMKA 1OZ2A 1NLOC 1YFNA 4JS4A 2XIDA 1I81A 3FJ5A 3QUIA 3PTAA 2YUOA 5CKHA 2C0TA 5GAN7 2DIGA 2FG0A 3EFOB 1QVGP 4XU0A 1JXOA 3UATA 1PWTA 4HT9A 2LCSA 3FEOA 2VWFA 1AHJB 4WTOB 3HTRA 3TREA 3RKWA 2J6OA 1TS9A 1K0SA 2HD0A 3EHRA 3SWNA 4ESRA 2E64A 3HP9A 3G6EQ 4HVUA 2OTJA 4F7UB 1UDLA 4HVWA 5AYFA 4R56A 4BI4A 2LQWA 2QDYB 3P8BB 1MUZA 4C92C 1QCFA 4PJOE 3GNGA 1RLQC 1JEGA 1PM3A 3JCMQ 2JNGA 2D8HA 3FRNA 4LDYA 3OW2A 3JB9F 1R77A 2HEQA 1KC8R 4ME7A 1G5VA 4M7DF 1KQ1A 2IIMA 1TUCA 3CCJA 5A2QE 3OYFA 2L89A 2FZCB 3FB9A 5FLXE 2CZ6B 4LDUA 1PHTA 1Z9ZA 2NLUA 2RQVA 4ELYC 1B07A 1PD0A 4HA8A 5KYUA 3UWNA 4N0AC 1OPLA 3GIBA 2E6ZA 1BYMA 3RESA 3TU4K 4BE1A 3HRSA 2DTHA 2AHJB 1S72Q 1X6GA 2KK4A 4C5IA 1GXIE 4J9GA 1D3BB 2LNHB 3M9QA 4M78F 3VYHB 5GAMh 1AVZC 2HQXA 1AWJA 2X4YA 2YRDA 4FYYB 2CZ0B 1FMKA 2K7AA 4FYWB 3C95A 3LWHA 5GAMd 3QDFA 1UGPB 1F1BB 1K9MU 1KD1R 3NPFA 1B34B 1VQ6A 1G3SA 4Y91A 2RB6A 3OYLA 1SF9A 2DL5A 5GAOr 3OQ5A 4RG8A 2YLCA 2QQSA 4OF1A 3CMEA 5LJ5j 3HHTB 3VS4A 3A5ZB 5DM7R 1Q95G 2E12A 2JTMA 3L2WA 5I11A 3A1PA 4C0GA 3JB9G 5C0MA 2DRMA 3UA6A 4AMCA 3L2VA 1N27A 5CIUA 1K1ZA 4J5YA 1CKAA 4HCZA 3JB9D 2O88A 2WSEE 1UB4A 2BKDN 1C1AA 3VKIA 3EH2A 2LC4A 4FW2A 3MO8A 4DEXA 3OY9A 4XU2A 1QW1A 4LNPA 1UGRB 4ELZC 1YIJQ 1FWZA 3JCMg 1Q7YR 2E5KA 2LT4A 1E6HA 4EMKB 2L8DA 4OMQA 4OMPA 1K9AA 2ZPHB 3G4ST 1UHCA 3LGFA 3EGXA 1VQ7A 2RJCA 2X4JA 3VU3C 5GANe 2RA2A 2OTLA 1VQ9A 1I8FA 1VOMA 4M75G 2EPDA 2CP0A 4MDXA 1VIFA 4A53A 1DJ7B 2RHYA 1KC8C 3ZL7C 3J81E 1TSFA 1FX7A 1NG2A 3GOXA 3E19A 4M75D 1VQNA 1WI7A 4PKCC 1O9SA 4HVVA 4NL2A 2DE0X 4LXCA 3I56T 1X2KA 3JV3A 1Q82R 2EAYA 3DB3A 2DTIA 3CC4Q 1RAGB 2CP2A 1YJ9Q 4JLIA 1N8RR 3QZ9B 1K4US 2LJ0A 1KC8U 1AZGB 1N6AA 1CKBA 4AFSC 4B9WA 3MP1A 2V1QA 4E7JA 4KULA 1YJNA 2OX7A 4OMNA 2LTOA 3CCEA 3CBMA 5HK0A 2VASA 1VQOT 4EIKA 5A0DA 1AEYA 5GMKl 2A36A 4J9DA 2R5MA 3CCLA 1IO6A 4JRKA 5IXFA 1KIKA 4Z8AA 4ZNXA 4FU6A 3JAME 1BIAA 4CRIA 1D1BA 2BZYA 4PJNA 2X3WD 2FPFA 3FLGA 3M4YA 5GAN3 3PMIA 1V1CA 3QJYA 1KD1C 1M5Q1 8ATCB 2ESWA 3EFSA 1VA7A 2RJDA 2LMJA 4EMHA 2EQUA 2JN0A 2VKNA 3C0CA 1M90C 3SWNB 2KSSA 1Q81C 4OB1B 3TSZA 4C8QA 2VXEA 2CP3A 4BUGA 1BKBA 1WJQA 3CD6Q 3VYGA 3CCVT 2CZ1B 5IHNA 1QLYA 4J9EA 1KD1U 2VGMA 2DILA 5C6SA 1JB0E 2RK2A 4HCCA 2LQNA 2L2PA 1GFDA 3CCQA 1M90U 4PJOG 3VRZA 4Y92A 4KT0E 2FPEA 3L2UA 2XI9A 4M77F 4FCYA 1G3TA 5I2MA 4PJOD 1U8RA 4IUUA 5D6XA 4J6YA 2CZ7B 1VQ8A 5A0LA 5LJ3g 1GCQC 2DXTA 3C94A 3NGPA 3GP8A 4ANJA 2GFAA 5KH6A 4M75C 5GANh 2CGHA 2DX1A 3M0QA 3JCMX 5KYUB 4ZTFA 2OJ2A 2RJEA 3X24B 2EQJA 5M9OA 4A4KA 2X9HA 3RDVA 4DBHA 3CPWP 1Y57A 2DD5A 3OMCA 4XK8E 2YRCA 5KYWA 1CSKA 2LX7A 2RF0A 3PVLA 1UJ0A 2KRNA 3G7ZA 3CC2A 5GANd 3PE0A 1WPYA 4YTLA 2GBQA 1D1CA 1AOJA 4XTUA 3EFRA 2BIVA 2DZCA 2HCKA 3O5ZA 3UF4A 2QK0A 3CBPA 3CMAA 3NFCA 1MV3A 2E3IA 1QVGS 2DLPA 4LUEA 1KFZA 1IHWA 1WYXA 1ZUYA 3J80E 1R8OB 2DYBA 5IT9E 4CC2A 3G6ET 3CCMA 1N8RC 1SKUB 1KJWA 3VS1A 2O01E 3R6OA 2E10A 2MWOA 1RADB 2FEIA 3FJPA 1AWWA 2JS2A 3CCUA 3OA6A 4XTWA 2H3JA 4C0DC 4C92A 4F7UF 1Q82U 2ZGWA 1J3TA 3CXCP 1Y0MA 3OSSC 3LGLA 4C0FA 2HBPA 3QDRB 3OYDA 2FPDA 4ZTJA 1N8RU 4JDSA 4IUTA 4XTVA 5GAOl 1D0XA 4ZN1A 5HK3A 2AZSA 2DBKA 4AFUC 2RHIA 3Q1JA 4BI3A 2M0YA 2NUTB 3A8GB 3CCRA 3JCMJ 5LJ5f 3E2UA 1UFFA 3U23A 2E3HA 1WXTA 2KYMA 1SRMA 4XU3A 2QQ9A 2XK0A 1VYTA 4L5GA 4N0AA 4BY6B 2ROTA 1VQLT 1MMNA 2CKKA 4JLGA 2P0QA 2LJ1A 3EGXB 3KBGA 3MP6A 1VQMQ 1X6BA 2D9TA 3ZFJA 5CKDA 2RI3A 3JB9H 4PJOC 4JZ3A 1JO8A 3H9NA 4J9FA 1Y96B 5FWBA 2VUBA 3ULRB 1NPRA 1AWOA 3BDLA 4LN2A 2A3LA 1ZQ1A 2DMOA 4M7AB 2RN8A 1K73C 4BB7A 4M7DE 2MK5A 2XD0A 4RCCA 1UECA 1I4K1 3OS0A 3JCMb 4VUBA 2SRCA 4KGXB 1ABOA 1BI3A 2M0OA 2GTJA 4OMMA 4F17A 3ME9A 1WXBA 1PSEA 3GLXA 3P8HA 2K9GA 1N9RA 4OMLA 1VIEA 1K73U 2V26A 1K76A 1VQ5A 3EG3A 4IIMA 1SEMA 2R58A 2CUBA 3H0HA 3OW2P 4E7KA 2F2WA 2BE9B 2A7YA 1M30A 3RMSA 2KROA 4M78E 2EFIA 2CUDA 4J9HA 4X34A 1YIJT 1Q86R 3PIOA 2K3XA 4OB3B 5KE3A 2DKGA 3CPFA 3MEVA 4N4IA 4MMLA 4CC4B 4BDZA 3FDRA 3E9GA 2KT1A 1VQKT 4C8QB 4R55A 1NEBA 2JUFA 2FZGB 3LX7A 3MPUB 4CC7A 4K11A 4XTZA 1IHVA 5FWCA 2KE9A 2ZAEA 2FZKB 4N4HA 2E5QA 4B6MA 1KK7A 1YP5A 3MEUA 3CC4T 1YJ9T 2G6FX 2J7IA 5FU7B 2QGFB 1OU9A 2LT1A 1X27A 3NTHA 1WIEA 3G4SA 3HL8A 1IGQA 2JMAA 2FL7A 2O2OA 4FYXB 3HFNA 5CAIA 2R57A 4LE9A 3LLRA 4AT1B 2KRMA 1WZOA 4KH1B 5KYWB 1AT1B 3T9NA 3M57A 2GNCA 1KSWA 1NPPA 1UGSB 2COZA 2CP5A 5GMKj 3RBBB 2O4XA 1YITA 1K8AR 1NZ9A 1WDXA 3I56A 2E70A 1YJWA 3E1SA 2K2VA 1WX6A 4LD6A 3GBQA 5GAN4 2HKNA 5CO7A 1YWOA 4IUQA 1TUGB 4PFOA 2QA4T 2L3SA 2QEXA 3KFVA 2DO3A 2JOYA 4QVDA 1WXUA 4KRTA 1VQ4T 1JRIA 2D0NA 3CD6T 2MPXC 4OMOA 1VQOA 2DETA 2K5IA 2ZZDA 4C5HA 2DFUA 4BACA 4C92B 2RQWA 3G71T 1OX8A 3SFMA 1VQPQ 4KUDK 4DOVA 2EIFA 1Y71A 4Z02A 2O9SA 2YUPA 1TG0A 2FYKA 4EMGA 2QXFA 4RTUA 5LJ3f 1KQ2A 2BUDA 1BI2A 3I35A 2RHUA 2DL7A 4A4GA 1Q86C 5LJ5g 2XG8D 3I55A 3QJ6A 6AT1B 1M2VB 1VQLQ 3I9QA 3CCST 1ACMB 2X4XA 1GCQA 4XTXA 3V7RA 4M75A 1YN8A 3ZEHA 1SHGA 2DXBA 3VS0A 2H3EB 1BI0A 2QQAA 3CPWS 5FU6C 3CCVA 2DL8A 2C0OA 3OS1A 1Q86U 1OX9A 5FROA 2QQBA 3V8KA 1U1TA 4ZGJB 1PCXA 4JJNK 5KE2A 3JCMh 3EAEA 1BB9A 1FMVA 3SEMA 3RKXA 1VYUA 3C4SA 1UG1A 1Z9QA 2PUOB 4D8KA 3H6ZA 3S6WA 1M90R 3JCMd 2MIOA 2NUPA 1Q81R 3BDUA 3M56A 4O6JA 4PK4A 1M1KC 3EG9A 1C6VX 2EJGA 4J7FA 4M77E 4MDWA 1PG5B 1YI2A 1WHMA 2HSPA 2JXBA 2L3QA 4M7DG 2DTOA 4BD3A 1YHQQ 3CXCS 2M16A 2RK1A 3OYEA 3NTKA 3CC7T 2F2VA 3OYCA 4M7DD 2DVJA 2FO0A 1K8AC 2GFUA 2F1LA 4A63B 4JJDA 4QQDA 3EH1A 8AT1B 2GF7A 1AWXA 2XMFA 4EMKC 5GAMg 3G6EA 1WGSA 1WNLA 1GCPA 1M3BA 1MHNA 3A8LB 3S3MA 1GBRA 1D09B 2BE7D 3JB9I 2DL4A 2JT4A 4EDUA 1VQKQ 1FXXA 4JUVA 4M78G 2K79A 1QVFA 5KYNA 1K8AU 1VQMT 1TTHB 1H92A 2P4RA 2HNIA 1AD5A 1YBYA 1KQSA 2G3RA 4M78D 4NL3A 4PJOA 4X9DA 1RAAB 2NYSA 3VJPA 1HK9A 4F7UE 2DEUA 1QWEA 3EGDB 5GMKi 1W2BA 2HDAA 3MKDA 3OS2A 2LVMA 2WSCE 5FW9A 1NJIR 3RR6A 1M9SA 2CT3A 2DRKA 4M7AF 4XU1A 3OB9A 5GAMj 1O75A 2HKQB 1JJ2A 4N4GA 1NE8A 1ZUKA 1VQLA 2KGTA 3META 5CCAA 5A0GA 4J6XA 3MEAA 1IREB 1S72A 9ATCB 2HQEA 3THKA 4PLLA 2K4YA 3CEYA 3L2RA 3JB9J 4MZTA 2ED1A 3LWIA 4M4ZA 3OW2S 3QIIA 2J06A 2B86A 4J9BA 4JRPA 1QVPA 3H8ZA 4J6WA 4FIBA 4RTWA 1KHCA 3H0IA 1G3YA 2QA4Q 1YCYA 2BTTA 3A98A 1G83A 1WJSA 1H3HA 1OOTA 2Y90A 4LDVA 3M58A 2C06A 2YDLA 4M7DC 1VQ4Q 1X6OA 4V2SA 2K6DA 2AKLA 1XNIA 2RPNA 2EYWA 1WHHA 3EGUA 3X25B 1T3SA 3G71Q 4XQ3A 2K5LA 5HY6A 2GQVA 3QYHB 1QP3A 3V7CA 4C8QF 3MJXA 2DNUA 2LP5A 2RQTA 3PGGA 4GLMA 3UT1A 1Q81U 4BE0A 5KYXA 1BU1A 1T0JA 2CH4W 1UGQB 1K73R 1E6GA 5KYYA 2CSIA 4DBQA 2F69A 4M7AG 2F5TX 2VV5A 5L23A 3CCSQ 1YIJA 4J83A 2MCNA 2MI6A 4M78C 4E7ZA 1M8MA 1VQ6T 1V29B 1LPLA 2ED0A 4M7AD 2OI3A 2DM1A 4C5GA 3CMET 1SSFA 2PVOB 4A54A 1VQKA 2O9VA 2NWMA 4M75B 2EJFA 3UA7A 2A08A 4MZPA 2M1HA 4R0KA 4RTYA 2DJZA 1ZSZC 2ENMA 2YUQA 2CREA 2DD4A 1HXDA 2X35A 2A37A 4IURA 1NJIC 4HCKA 2OAWA 1Y07A 3RNJA 2EQMA 2X3XD 3CC4A 1VUBA 2LQKA 1YJ9A 4KBMB 1D0YA 3C12A 1QP2A 2NUPB 3VV0A 2VYTA 5D6WA 3QWYA 3TSWA 2DF6A 3A8HB 2IVWA 3EG9B 1VQ7T 1UE9A 3M0SA 3CC7Q 1NJIU 5I21A 3QZ5B 4FM4B 4DA4A 2HSEB 4C0DB 2VGNA 5GJWB 4HCBA 3V8JA 1RAFB 2C0IA 3PVQA 5GANg 4M77G 1VQPT 1HJDA 1V76A 2F5KA 1TWBA 4C92F 5KCOA 1VQNT 1IB8A 4J8OA 1X2QA 2V8KA 4JJBA 1QMCA 1KQSS 2HL5C 4M77D 3DLMA 3MP8A 2K3BA 2I0NA 2CYZB 3A8MB 1EIFA 2I2LA 1SRLA 2VXFA 3VUZA 3L2QA 4ORZA 1C0MA 3RUXA 4FT2A 2RH2A 2JTFA 4BDYA 2QGGA 1MMAA 4E2FB 1W6XA 5IXBA 3M59A 4IUVA 1RUWA 3CD6A 1JJ2S 1OULA 1D3BA 1RABB 1U5SA 3JRZA 4QQ6A 3V8LA 3CCLT 3QO3A 4RTVA 1PC0A 4PJJA 2RM4A 1XQHA 1U1SA 1LOJA 4Z88A 4F16A 3JSCA 2JMCA 2Y4YA 4PJOB 4FSXA 5GANj 4M7AC 4IUPA
chains in the Genus database with same CATH topology
2PZ1A 4DEXA 2W10A 1JXMA 1WDXA 1PKTA 2AZVA 2F2XA 1UTIA 4LNPA 3I5SA 1WX6A 4CC3A 3GBQA 2E5KA 2EBPA 4D8DA 1GRIA 1E6HA 1A0NB 4OMQA 4OMPA 2O31A 1K9AA 1X43A 2RQRA 1YWOA 2BZ8A 2L3SA 4RTZA 1UHCA 3KFVA 4WCIA 2KBTA 5IHIA 1WXUA 4KRTA 2K2MA 3EG1A 2D0NA 1PNJA 1ZSGA 4OMOA 5ECAA 2EPDA 1M3CA 3ZL7C 3REAB 2RQWA 1NG2A 2GTOA 1ZUUA 2J05A 2NUZA 1WI7A 4HVVA 4GBQA 2DE0X 4E6RA 2O9SA 2YUPA 1TG0A 1WLPB 1X2KA 4RTUA 3JV3A 1M3AA 1PKSA 1U3OA 3I35A 2DL7A 1FYNA 3EG0A 1TUDA 1K4US 2LJ0A 3I9QA 1AZGB 1CKBA 2FRYA 4AFSC 2V1QA 1GCQA 2JS0A 1SHFA 4OMNA 3NHNA 2H8HA 1YN8A 1SHGA 1GL5A 3VS0A 1NYGA 4EIKA 3EG2A 1AEYA 1B3QA 2A36A 4J9DA 1IO6A 5IXFA 2EGEA 2DL8A 1KIKA 2C0OA 2JW4A 2HBWA 4Z8AA 5EC7A 4AFZC 4ZNXA 3H41A 2PNIA 2KXCA 1OPKA 2BZXA 2L3PA 2J6FA 2BZYA 2X3WD 1U06A 4DEYA 1BB9A 2FPFA 3SEMA 3CQTA 4AG1C 1V1CA 5IHKA 1VYUA 1GBQA 3VRYA 1UG1A 2ESWA 1Z9QA 4D8KA 1VA7A 2LMJA 1BK2A 2MIOA 1NM7A 4JPBW 2VKNA 3C0CA 2D8JA 4QT7A 2LZ6B 4AFQC 1XOVA 4RTTA 3TSZA 1QKWA 2A28A 2HSPA 2YSQA 2JXBA 2L3QA 1ARKA 5IHNA 1QLYA 4J9EA 2DILA 2KT8A 1WA7A 1T0HA 2LQNA 2JM9A 2F2VA 2L2PA 1GFDA 2MOXA 4J9CA 2DVJA 1I07A 4Y92A 2FO0A 4JJCA 3VRZA 1W1FA 2W0ZA 4A63B 2FPEA 5HCKA 1OEBA 4JJDA 1W70A 1UJYA 1QKXA 3NMZC 1AWXA 2XMFA 1GCPA 1M3BA 1T3LA 1GBRA 1GCQC 2DL4A 2LJ3A 5GJVB 3NGPA 1N5ZA 2JT4A 2J6KA 2GQIA 2DX1A 3M0QA 2YUNA 2OJ2A 3TVTA 2K79A 1OV3A 1YNZA 1Y57A 2P4RA 1H92A 1CSKA 2LX7A 2RF0A 3PVLA 1AD5A 1UJ0A 2KRNA 3PE0A 2GBQA 1JU5C 1AOJA 1HD3A 1HSQA 4J9IA 2HCKA 3O5ZA 3UF4A 1AZEA 1QWEA 1LCKA 1EFNA 1MV3A 2DLPA 4LUEA 1QWFA 1S1NA 1KFZA 1WYXA 1ZUYA 2HDAA 1MV0B 5IH2A 5FW9A 2DYBA 2RMOA 2M51A 4CC2A 4FSSA 3M0UA 2CH4A 2CT3A 1KJWA 2DRKA 3VS1A 4JZ4A 2PTKA 1I1JA 2EQIA 1WFWA 4IIOA 1M27C 1VYVA 2ROLA 4RUGA 2FEIA 1ZUKA 1AWWA 4LUDA 2JS2A 2KGTA 2CT4A 2VVKA 2JM8A 3THKA 1J3TA 1Y0MA 2ABLA 2QDLA 4F14A 2AKKA 1E7OA 1H8KA 2ED1A 2FPDA 4M4ZA 2AZSA 2DBKA 2EYZA 2J06A 4AFUC 2B86A 4J9BA 2EW3A 2M0YA 1NEGA 2SEMA 1UGVA 2AK5A 2DL3A 2V1RA 1UFFA 3U23A 4RTWA 3H0IA 2ECZA 1WXTA 2KYMA 1NYFA 1SRMA 2BTTA 3A98A 1G83A 1H3HA 1OOTA 2KNBB 1RLPC 1VYTA 2YDLA 2ROTA 2RQUA 2K6DA 2AKLA 3I5RA 1PRLC 2LJ1A 2EGCA 1NLOC 1X6BA 2RPNA 2EYWA 3EGUA 1T3SA 1UHFA 3FJ5A 4JZ3A 1JO8A 4J9FA 5FWBA 2DNUA 2LP5A 2YUOA 2RQTA 4GLMA 1JQQA 3ULRB 1AWOA 2C0TA 2FG0A 4LN2A 1JXOA 1PRMC 1BU1A 3UATA 2EYXA 1PWTA 1T0JA 2LCSA 2CH4W 1E6GA 2DMOA 2VWFA 3H0FA 2RN8A 2CSIA 3VS5A 2J6OA 1K0SA 4ESRA 3EHRA 5L23A 1SSHA 2KRSA 2MCNA 3IQLA 1UECA 1M8MA 4HVUA 3SHWA 2KEAA 1UDLA 2SRCA 1ABOA 4HVWA 2LQWA 2ED0A 3M0PA 1MUZA 2OI3A 2DM1A 2GTJA 4OMMA 3R6NA 4F17A 1QCFA 1RLQC 1WXBA 2CDTA 1JEGA 2O9VA 2CSQA 2D8HA 1UUEA 2NWMA 2K9GA 4OMLA 3VS3A 2L0AA 3VS2A 4Z89A 2HEQA 3UA7A 2A08A 1K76A 2DJQA 3EG3A 4IIMA 4R0KA 4RTYA 2EKHA 1SEMA 2CUBA 3H0HA 2ENMA 2YUQA 1ABQA 3QWXX 1NLPC 1YWPA 2F2WA 1ZLMA 2IIMA 2CREA 1TUCA 2FRWA 1RI9A 1M30A 1X69A 2A37A 2RNAA 1PHTA 2KROA 4HCKA 1Z9ZA 2OAWA 2CUDA 4J9HA 3RNJA 1BBZA 2RQVA 2X3XD 3M0RA 1B07A 2DBMA 2EVRA 2YT6A 1OPLA 3EHQA 4CC4B 1YCSB 1GFCA 4HXJA 3QWYA 3TSWA 2DF6A 2KT1A 1X6GA 1UE9A 1NEBA 3M0SA 4AG2C 1ZX6A 4J9GA 4CC7A 2LNHB 3REBB 4K11A 5GJWB 1AVZC 2C0IA 1AWJA 2DA9A 3PVQA 1HJDA 5I22A 2KR3A 2EGAA 5FWCA 2KYBA 2KE9A 2KXDA 1FMKA 2K7AA 1X2QA 2JTEA 4JJBA 1YP5A 1SPKA 1ZBJA 2K3BA 3NPFA 2I0NA 4X1VA 3VS7A 2DL5A 2G6FX 2J7IA 3VS6A 1SRLA 3LH5A 4ORZA 1K0XA 1X27A 1WIEA 2D1XA 1G2BA 3VS4A 2JMAA 1W6XA 5IXBA 2O2OA 5I11A 1RUWA 2GGRA 4LE9A 2DRMA 3UA6A 4RTXA 1U5SA 2KRMA 3M0TA 4RTVA 1K1ZA 4Z88A 4F16A 1CKAA 2GNCA 1KSWA 2O88A 2JMCA 1I0CA 2EYYA 3RBBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  4DEX A;  2W10 A;  1JXM A;  1WDX A;  1PKT A;  2AZV A;  2F2X A;  1UTI A;  4LNP A;  3I5S A;  1WX6 A;  4CC3 A;  3GBQ A;  2E5K A;  2EBP A;  4D8D A;  1GRI A;  1E6H A;  1A0N B;  4OMQ A;  4OMP A;  2O31 A;  1K9A A;  1X43 A;  2RQR A;  1YWO A;  2BZ8 A;  2L3S A;  4RTZ A;  1UHC A;  3KFV A;  4WCI A;  2KBT A;  5IHI A;  1WXU A;  4KRT A;  2K2M A;  3EG1 A;  2D0N A;  1PNJ A;  1ZSG A;  4OMO A;  5ECA A;  2EPD A;  1M3C A;  3ZL7 C;  3REA B;  2RQW A;  1NG2 A;  2GTO A;  1ZUU A;  2J05 A;  2NUZ A;  1WI7 A;  4HVV A;  4GBQ A;  2DE0 X;  4E6R A;  2O9S A;  2YUP A;  1TG0 A;  1WLP B;  1X2K A;  4RTU A;  3JV3 A;  1M3A A;  1PKS A;  1U3O A;  3I35 A;  2DL7 A;  1FYN A;  3EG0 A;  1TUD A;  1K4U S;  2LJ0 A;  3I9Q A;  1AZG B;  1CKB A;  2FRY A;  4AFS C;  2V1Q A;  1GCQ A;  2JS0 A;  1SHF A;  4OMN A;  3NHN A;  2H8H A;  1YN8 A;  1SHG A;  1GL5 A;  3VS0 A;  1NYG A;  4EIK A;  3EG2 A;  1AEY A;  1B3Q A;  2A36 A;  4J9D A;  1IO6 A;  5IXF A;  2EGE A;  2DL8 A;  1KIK A;  2C0O A;  2JW4 A;  2HBW A;  4Z8A A;  5EC7 A;  4AFZ C;  4ZNX A;  3H41 A;  2PNI A;  2KXC A;  1OPK A;  2BZX A;  2L3P A;  2J6F A;  2BZY A;  2X3W D;  1U06 A;  4DEY A;  1BB9 A;  2FPF A;  3SEM A;  3CQT A;  4AG1 C;  1V1C A;  5IHK A;  1VYU A;  1GBQ A;  3VRY A;  1UG1 A;  2ESW A;  1Z9Q A;  4D8K A;  1VA7 A;  2LMJ A;  1BK2 A;  2MIO A;  1NM7 A;  4JPB W;  2VKN A;  3C0C A;  2D8J A;  4QT7 A;  2LZ6 B;  4AFQ C;  1XOV A;  4RTT A;  3TSZ A;  1QKW A;  2A28 A;  2HSP A;  2YSQ A;  2JXB A;  2L3Q A;  1ARK A;  5IHN A;  1QLY A;  4J9E A;  2DIL A;  2KT8 A;  1WA7 A;  1T0H A;  2LQN A;  2JM9 A;  2F2V A;  2L2P A;  1GFD A;  2MOX A;  4J9C A;  2DVJ A;  1I07 A;  4Y92 A;  2FO0 A;  4JJC A;  3VRZ A;  1W1F A;  2W0Z A;  4A63 B;  2FPE A;  5HCK A;  1OEB A;  4JJD A;  1W70 A;  1UJY A;  1QKX A;  3NMZ C;  1AWX A;  2XMF A;  1GCP A;  1M3B A;  1T3L A;  1GBR A;  1GCQ C;  2DL4 A;  2LJ3 A;  5GJV B;  3NGP A;  1N5Z A;  2JT4 A;  2J6K A;  2GQI A;  2DX1 A;  3M0Q A;  2YUN A;  2OJ2 A;  3TVT A;  2K79 A;  1OV3 A;  1YNZ A;  1Y57 A;  2P4R A;  1H92 A;  1CSK A;  2LX7 A;  2RF0 A;  3PVL A;  1AD5 A;  1UJ0 A;  2KRN A;  3PE0 A;  2GBQ A;  1JU5 C;  1AOJ A;  1HD3 A;  1HSQ A;  4J9I A;  2HCK A;  3O5Z A;  3UF4 A;  1AZE A;  1QWE A;  1LCK A;  1EFN A;  1MV3 A;  2DLP A;  4LUE A;  1QWF A;  1S1N A;  1KFZ A;  1WYX A;  1ZUY A;  2HDA A;  1MV0 B;  5IH2 A;  5FW9 A;  2DYB A;  2RMO A;  2M51 A;  4CC2 A;  4FSS A;  3M0U A;  2CH4 A;  2CT3 A;  1KJW A;  2DRK A;  3VS1 A;  4JZ4 A;  2PTK A;  1I1J A;  2EQI A;  1WFW A;  4IIO A;  1M27 C;  1VYV A;  2ROL A;  4RUG A;  2FEI A;  1ZUK A;  1AWW A;  4LUD A;  2JS2 A;  2KGT A;  2CT4 A;  2VVK A;  2JM8 A;  3THK A;  1J3T A;  1Y0M A;  2ABL A;  2QDL A;  4F14 A;  2AKK A;  1E7O A;  1H8K A;  2ED1 A;  2FPD A;  4M4Z A;  2AZS A;  2DBK A;  2EYZ A;  2J06 A;  4AFU C;  2B86 A;  4J9B A;  2EW3 A;  2M0Y A;  1NEG A;  2SEM A;  1UGV A;  2AK5 A;  2DL3 A;  2V1R A;  1UFF A;  3U23 A;  4RTW A;  3H0I A;  2ECZ A;  1WXT A;  2KYM A;  1NYF A;  1SRM A;  2BTT A;  3A98 A;  1G83 A;  1H3H A;  1OOT A;  2KNB B;  1RLP C;  1VYT A;  2YDL A;  2ROT A;  2RQU A;  2K6D A;  2AKL A;  3I5R A;  1PRL C;  2LJ1 A;  2EGC A;  1NLO C;  1X6B A;  2RPN A;  2EYW A;  3EGU A;  1T3S A;  1UHF A;  3FJ5 A;  4JZ3 A;  1JO8 A;  4J9F A;  5FWB A;  2DNU A;  2LP5 A;  2YUO A;  2RQT A;  4GLM A;  1JQQ A;  3ULR B;  1AWO A;  2C0T A;  2FG0 A;  4LN2 A;  1JXO A;  1PRM C;  1BU1 A;  3UAT A;  2EYX A;  1PWT A;  1T0J A;  2LCS A;  2CH4 W;  1E6G A;  2DMO A;  2VWF A;  3H0F A;  2RN8 A;  2CSI A;  3VS5 A;  2J6O A;  1K0S A;  4ESR A;  3EHR A;  5L23 A;  1SSH A;  2KRS A;  2MCN A;  3IQL A;  1UEC A;  1M8M A;  4HVU A;  3SHW A;  2KEA A;  1UDL A;  2SRC A;  1ABO A;  4HVW A;  2LQW A;  2ED0 A;  3M0P A;  1MUZ A;  2OI3 A;  2DM1 A;  2GTJ A;  4OMM A;  3R6N A;  4F17 A;  1QCF A;  1RLQ C;  1WXB A;  2CDT A;  1JEG A;  2O9V A;  2CSQ A;  2D8H A;  1UUE A;  2NWM A;  2K9G A;  4OML A;  3VS3 A;  2L0A A;  3VS2 A;  4Z89 A;  2HEQ A;  3UA7 A;  2A08 A;  1K76 A;  2DJQ A;  3EG3 A;  4IIM A;  4R0K A;  4RTY A;  2EKH A;  1SEM A;  2CUB A;  3H0H A;  2ENM A;  2YUQ A;  1ABQ A;  3QWX X;  1NLP C;  1YWP A;  2F2W A;  1ZLM A;  2IIM A;  2CRE A;  1TUC A;  2FRW A;  1RI9 A;  1M30 A;  1X69 A;  2A37 A;  2RNA A;  1PHT A;  2KRO A;  4HCK A;  1Z9Z A;  2OAW A;  2CUD A;  4J9H A;  3RNJ A;  1BBZ A;  2RQV A;  2X3X D;  3M0R A;  1B07 A;  2DBM A;  2EVR A;  2YT6 A;  1OPL A;  3EHQ A;  4CC4 B;  1YCS B;  1GFC A;  4HXJ A;  3QWY A;  3TSW A;  2DF6 A;  2KT1 A;  1X6G A;  1UE9 A;  1NEB A;  3M0S A;  4AG2 C;  1ZX6 A;  4J9G A;  4CC7 A;  2LNH B;  3REB B;  4K11 A;  5GJW B;  1AVZ C;  2C0I A;  1AWJ A;  2DA9 A;  3PVQ A;  1HJD A;  5I22 A;  2KR3 A;  2EGA A;  5FWC A;  2KYB A;  2KE9 A;  2KXD A;  1FMK A;  2K7A A;  1X2Q A;  2JTE A;  4JJB A;  1YP5 A;  1SPK A;  1ZBJ A;  2K3B A;  3NPF A;  2I0N A;  4X1V A;  3VS7 A;  2DL5 A;  2G6F X;  2J7I A;  3VS6 A;  1SRL A;  3LH5 A;  4ORZ A;  1K0X A;  1X27 A;  1WIE A;  2D1X A;  1G2B A;  3VS4 A;  2JMA A;  1W6X A;  5IXB A;  2O2O A;  5I11 A;  1RUW A;  2GGR A;  4LE9 A;  2DRM A;  3UA6 A;  4RTX A;  1U5S A;  2KRM A;  3M0T A;  4RTV A;  1K1Z A;  4Z88 A;  4F16 A;  1CKA A;  2GNC A;  1KSW A;  2O88 A;  2JMC A;  1I0C A;  2EYY A;  3RBB B; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  2Y4X A;  2W10 A;  4XAX B;  1HYO A;  4II1 A;  1UTI A;  5CK9 A;  3RER A;  4QVZ A;  3I5S A;  4P5N A;  1IRX A;  4TVR A;  2EBP A;  4E7H A;  4D8D A;  4E7S A;  2XU8 A;  2OTJ Q;  2O31 A;  4F7U G;  3OSV A;  2BZ8 A;  1MGQ A;  2E6N A;  2ZPB B;  4KGZ B;  2LX9 A;  2YWW A;  4MZM A;  4XTY A;  5FRN A;  5GAO q;  3EG1 A;  3PNW C;  2RD1 A;  1PNJ A;  1ZSG A;  4C0Z A;  3INZ A;  1YHQ T;  4FL6 A;  3REA B;  2KMT A;  1H64 1;  1ZUU A;  2CP7 A;  1PD1 A;  4C5E A;  3CCJ Q;  2NUZ A;  4A4F A;  5GAM f;  4GBQ A;  3M53 A;  2RI5 A;  1M3A A;  3TEE A;  2QTX A;  1SG5 A;  4RCB A;  4GY5 A;  3AHU A;  1MNE A;  1TUD A;  2HL3 A;  4EMK A;  5GAN 8;  1VQ8 T;  1IXD A;  5KCH A;  4NOY A;  1TH7 A;  3NHN A;  1OZ3 A;  3FIF A;  2H8H A;  2K3Y A;  3M4G A;  1GL5 A;  2MAM A;  4JS5 A;  3WVD B;  2KQW A;  3EG2 A;  1XJW B;  1B3Q A;  4M77 C;  3SDZ A;  3QXE B;  2HBW A;  1M8V A;  4AFZ C;  3CC2 T;  3H41 A;  3JCM e;  2BZX A;  3CC7 A;  2AIR B;  2PUK B;  1RAH B;  3S3O A;  3CQT A;  3CMA T;  5IHK A;  1OQK A;  1GBQ A;  3VRY A;  4QVC A;  3OYJ A;  2RO0 A;  1VQ6 Q;  3N5B B;  1MND A;  1BK2 A;  3LYI A;  1M1K R;  2V8I A;  2D8J A;  4QT7 A;  3ASK A;  3CME Q;  1LVK A;  2LZ6 B;  1XOV A;  4GLK A;  1QKW A;  2ZCF B;  2A28 A;  2CS7 A;  5IAY A;  3CCU T;  2YSQ A;  2KAF A;  1Y7X A;  2OAU A;  1VQM A;  5FRM A;  3M54 A;  1M4Z A;  2KY9 A;  1BCO A;  1T0H A;  2P4T A;  2JM9 A;  1ZA1 B;  3GNF B;  2MOX A;  5LJ5 h;  3FC3 A;  2YRV A;  4JRI A;  4J9C A;  5DLQ E;  3UPU A;  1W1F A;  2IPO B;  1QQJ A;  1RAI B;  5HCK A;  1OEB A;  3CCR T;  2MMP A;  3NMZ C;  4PLI A;  5LJ5 d;  2EWN A;  4OP0 A;  2LRQ A;  4ZN3 A;  2HQH A;  2LJ3 A;  2XHC A;  5GJV B;  2GQI A;  3NTI A;  3JCM V;  1VQ7 Q;  4Q5W A;  2WAC A;  3KXT A;  4M7D A;  2OTL Q;  1VQ9 Q;  2B8A A;  2LDM A;  2QAZ A;  1OV3 A;  5D7U A;  4FW1 A;  4M7A E;  2KDS A;  1I5O B;  2PVD B;  1QVF P;  1TU0 B;  3JCM P;  4NS5 A;  1JBM A;  2LCL A;  1HD3 A;  1VQN Q;  1AZE A;  2JZ2 A;  1KQS P;  1EFN A;  1LCK A;  3PFS A;  1S1N A;  1MV0 B;  5IH2 A;  2COY A;  2RMO A;  1W2B P;  2GCX A;  3M0U A;  1WHJ A;  2CH4 A;  4JZ4 A;  2PTK A;  4E7L A;  2EQI A;  2FHD A;  1LJO A;  1WFW A;  2ROL A;  3O8V A;  4M78 A;  3G1J A;  3V7S A;  1YJN Q;  3BW1 A;  3CCE Q;  2CT4 A;  2VVK A;  1JJ2 P;  3CCL Q;  4OGE A;  1K9M C;  2QDL A;  2DYI A;  3RMQ A;  3E9F A;  4M75 F;  5FU6 B;  1VQ5 T;  1G3W A;  2MYS A;  2P0P A;  5LJ3 e;  2EYZ A;  1ZSZ A;  1I5L A;  1EX4 A;  1NEG A;  1P92 A;  1UGV A;  1N9S A;  2YXY A;  2JVV A;  1KG1 A;  2V1R A;  2X4W A;  4C8Q E;  3MEW A;  1H3Z A;  2JJ9 A;  5GAN 6;  2R5A A;  1RLP C;  5HKC A;  3QG1 A;  3QKJ A;  3HRT A;  2X51 A;  3I5R A;  3DLL A;  4PNO A;  2EGC A;  5GAN f;  3CBO A;  1MMG A;  1BIB A;  1UHF A;  2QAS A;  2M9U A;  2PQW A;  1QVG A;  4J7I A;  3DKM A;  1M1K U;  1M2O A;  1JQQ A;  1XTD A;  3OS5 A;  4QQG A;  3CCQ Q;  1PRM C;  3MCA B;  2EYX A;  3RIR A;  2EJ9 A;  3WXM B;  2NUT A;  2FB7 A;  2COW A;  3H0F A;  4ZGD B;  5GAN 2;  3VS5 A;  2HMA A;  2PVG B;  2KI7 A;  1M1G A;  4UC4 A;  1X75 C;  4B9X A;  1SSH A;  2KRS A;  1VQ8 Q;  3IQL A;  1QCN A;  3SHW A;  2KEA A;  3PIP A;  3M0P A;  3R6N A;  1OI1 A;  4OB0 B;  3OBW A;  2DVE A;  2E41 A;  2CDT A;  4DBR A;  5CKB A;  2CSQ A;  1UUE A;  3CC2 Q;  3VS3 A;  1RAC B;  2L0A A;  3VS2 A;  4Z89 A;  1IGU A;  4PFP A;  1Y96 A;  2DJQ A;  4L59 A;  2EKH A;  4HT8 A;  3OYA A;  2K5F A;  3CMA Q;  5AT1 B;  1ABQ A;  3QWX X;  1NLP C;  1YWP A;  1ZLM A;  1VQP A;  2HZY A;  1ZHI A;  2CP6 A;  4RKU E;  2MF2 A;  2FRW A;  4QKU A;  1RI9 A;  1X69 A;  3QSU A;  2RNA A;  5CQY A;  4M7A A;  3TCJ A;  2DXU A;  1YIT T;  3CCM Q;  4PJO F;  5J39 A;  1BBZ A;  4PFZ A;  1YJW T;  3UDC A;  3M0R A;  4D6W A;  3A8O B;  2DBM A;  5CVI A;  2EVR A;  4C92 E;  2OTJ T;  2YT6 A;  3EHQ A;  3PMT A;  2M02 A;  2RHX A;  3CCU Q;  1YCS B;  1G8X A;  1GFC A;  2XDP A;  2QTV A;  4HXJ A;  1BCM A;  2QEX T;  3HRU A;  3OBY A;  2YLB A;  1WQW A;  5GMK m;  3OYB A;  4AG2 C;  1ZX6 A;  3REB B;  2DAQ A;  4L6V 5;  2DA9 A;  5LJ3 h;  3L42 A;  3CCJ T;  5I22 A;  2KR3 A;  2EGA A;  5DY9 A;  2KYB A;  2O4X B;  2KXD A;  3CCR Q;  1R0C B;  5CKE A;  1PSF A;  2JTE A;  1SPK A;  3SWN C;  1ZBJ A;  5LJ3 d;  4OB2 B;  4X1V A;  3VS7 A;  3VS6 A;  2LCC A;  3I55 T;  3LH5 A;  1K0X A;  4ZGE B;  2D1X A;  1G2B A;  2P0K A;  1EZZ B;  2YHT A;  3P8D A;  1B7T A;  2P84 A;  2DK3 A;  4M7D B;  4LDX A;  2GGR A;  3OYY A;  2WSF E;  4RTX A;  1YHQ A;  4M77 A;  2XKO C;  3M0T A;  4IKF A;  4PL6 A;  4BI8 B;  1I0C A;  2EYY A;  2DXC A;  3OYM A;  1JXM A;  1PKT A;  2AZV A;  2F2X A;  4OVA A;  1QCO A;  2ZPI B;  3HPW A;  4CC3 A;  1GRI A;  5CR2 A;  1A0N B;  4FT4 A;  3HSB A;  3QHS A;  1Q7Y C;  1X43 A;  2RQR A;  4RTZ A;  2EKO A;  4WCI A;  2E1H A;  5GMK e;  2KBT A;  5IHI A;  1BI1 A;  5CKF A;  5EG2 A;  1WJR A;  1W4S A;  4M78 B;  2K2M A;  3URG A;  2A0F B;  2DER A;  3S3N A;  1YI2 T;  5ECA A;  4KGV B;  4QW2 A;  1D1A A;  1M3C A;  1VQ5 Q;  1OYX A;  3EFO A;  3HKS A;  4PJM A;  4DQ2 A;  2GTO A;  4OGC A;  2J05 A;  2HAX A;  1Q7Y U;  4E6R A;  3M55 A;  1WLP B;  4LDW A;  4A4E A;  2KVQ G;  1PKS A;  1U3O A;  1ZSZ B;  2AT1 B;  3BE3 A;  1IZ6 A;  3OYH A;  3QYG B;  1Q82 C;  3RKY A;  3J7A F;  4F7U A;  1FYN A;  3EG0 A;  5GAO p;  1OU8 A;  2DZ9 A;  2FRY A;  2QG9 B;  2JS0 A;  2DIQ A;  4PJL A;  1SHF A;  2Z0W A;  2OTL T;  1VQ9 T;  3VUB A;  2L3R A;  4C8Q G;  5LJ3 j;  5CQX A;  1NYG A;  3SB2 A;  5LL6 S;  1LNX A;  1MMD A;  2EGE A;  4JRQ A;  2JW4 A;  5IN1 A;  5EC7 A;  1QVF S;  2PNI A;  2QI2 A;  4C8Q D;  2KXC A;  4ATO A;  1OPK A;  2L3P A;  2J6F A;  5GAO m;  3OYK A;  1U06 A;  4DEY A;  2XIC A;  3ER0 A;  5I2S A;  3OYG A;  4AG1 C;  4O5V A;  5J3B A;  1NBE B;  4BY6 C;  2E65 A;  3ZBD A;  1W2B S;  3QPH A;  3QBY A;  1NM7 A;  2QA4 A;  1M2V A;  4JPB W;  4KH0 B;  1RI0 A;  3G4S Q;  4AFQ C;  1YJN T;  4RTT A;  3D7S B;  4RMO A;  1VQ4 A;  3CCE T;  3JCM W;  1ARK A;  1D0Z A;  2VB6 A;  3G71 A;  1S72 T;  2KT8 A;  5J26 A;  3GF5 A;  1WA7 A;  3PT9 A;  4LD9 K;  5LJ5 e;  5DLO A;  1M1F A;  3AT1 B;  1FMW A;  2V8J A;  1I07 A;  4JJC A;  1YIT Q;  1TOV A;  3BY7 A;  1WHG A;  3I56 Q;  1B34 A;  2W0Z A;  2DEQ A;  1YJW Q;  2PU9 B;  1W70 A;  1TXQ A;  1UJY A;  1QKX A;  3CCS A;  2EYQ A;  4Y28 E;  3MHX A;  1T3L A;  4A4H A;  1KHI A;  2D6F A;  4DOW A;  4DBF A;  1N5Z A;  2QEX Q;  2J6K A;  2LQ8 A;  4E47 A;  5GMK h;  3CPW A;  1WQ7 A;  2YUN A;  2RI2 A;  3DB4 A;  3TVT A;  4WF2 A;  3WVE B;  3OYN A;  1YNZ A;  1VQO Q;  4HKE A;  1R0B G;  2RHZ A;  2ZPE B;  4E7I A;  1X01 A;  2QYZ A;  3F70 A;  4C92 G;  3LW5 E;  5GAO n;  1ZA2 B;  4KUI A;  2K57 A;  1JU5 C;  4OMF B;  4BE2 A;  2LNV A;  3CCQ T;  1HSQ A;  4J9I A;  2IG0 A;  4C92 D;  1QWF A;  3JCM f;  1WHL A;  3I55 Q;  3SD4 A;  2M51 A;  4FSS A;  4M75 E;  5D6Y A;  2DPP B;  2D0Q B;  1I1J A;  4FYV B;  4C8Q C;  4CI0 C;  4IIO A;  2E4H A;  1M27 C;  1VYV A;  4RUG A;  3L2Z A;  4LUD A;  2XDD A;  2XDB A;  3TQ7 P;  2MWP A;  3CXC A;  3X28 B;  3BFM A;  3LH0 A;  5GAN 5;  1RL2 A;  2JM8 A;  1K9M R;  2ZPF B;  3CCV Q;  1ZBX A;  7AT1 B;  3OMG A;  2ABL A;  4F14 A;  2ATC B;  2AKK A;  1E7O A;  1H8K A;  2RJF A;  5GAM e;  3L1A A;  4M77 B;  4RG2 A;  2ZPG B;  3X20 B;  5KYX B;  4EPC A;  3EGD A;  2EW3 A;  3X26 B;  4X9C A;  2SEM A;  5FU7 C;  4F04 B;  5KYY B;  3GPL A;  2AK5 A;  5L8R E;  1RAE B;  2DL3 A;  3KUF A;  3JCM c;  3M5A A;  3CCM T;  2ECZ A;  2L5Q A;  3OYI A;  1NYF A;  1UEB A;  2EQK A;  2KNB B;  1WHK A;  2RQU A;  1YI2 Q;  3HFO A;  1PRL C;  2QQR A;  2FVU A;  2VC8 A;  4MMK A;  1OZ2 A;  1NLO C;  1YFN A;  4JS4 A;  2XID A;  1I81 A;  3FJ5 A;  3QUI A;  3PTA A;  2YUO A;  5CKH A;  2C0T A;  5GAN 7;  2DIG A;  2FG0 A;  3EFO B;  1QVG P;  4XU0 A;  1JXO A;  3UAT A;  1PWT A;  4HT9 A;  2LCS A;  3FEO A;  2VWF A;  1AHJ B;  4WTO B;  3HTR A;  3TRE A;  3RKW A;  2J6O A;  1TS9 A;  1K0S A;  2HD0 A;  3EHR A;  3SWN A;  4ESR A;  2E64 A;  3HP9 A;  3G6E Q;  4HVU A;  2OTJ A;  4F7U B;  1UDL A;  4HVW A;  5AYF A;  4R56 A;  4BI4 A;  2LQW A;  2QDY B;  3P8B B;  1MUZ A;  4C92 C;  1QCF A;  4PJO E;  3GNG A;  1RLQ C;  1JEG A;  1PM3 A;  3JCM Q;  2JNG A;  2D8H A;  3FRN A;  4LDY A;  3OW2 A;  3JB9 F;  1R77 A;  2HEQ A;  1KC8 R;  4ME7 A;  1G5V A;  4M7D F;  1KQ1 A;  2IIM A;  1TUC A;  3CCJ A;  5A2Q E;  3OYF A;  2L89 A;  2FZC B;  3FB9 A;  5FLX E;  2CZ6 B;  4LDU A;  1PHT A;  1Z9Z A;  2NLU A;  2RQV A;  4ELY C;  1B07 A;  1PD0 A;  4HA8 A;  5KYU A;  3UWN A;  4N0A C;  1OPL A;  3GIB A;  2E6Z A;  1BYM A;  3RES A;  3TU4 K;  4BE1 A;  3HRS A;  2DTH A;  2AHJ B;  1S72 Q;  1X6G A;  2KK4 A;  4C5I A;  1GXI E;  4J9G A;  1D3B B;  2LNH B;  3M9Q A;  4M78 F;  3VYH B;  5GAM h;  1AVZ C;  2HQX A;  1AWJ A;  2X4Y A;  2YRD A;  4FYY B;  2CZ0 B;  1FMK A;  2K7A A;  4FYW B;  3C95 A;  3LWH A;  5GAM d;  3QDF A;  1UGP B;  1F1B B;  1K9M U;  1KD1 R;  3NPF A;  1B34 B;  1VQ6 A;  1G3S A;  4Y91 A;  2RB6 A;  3OYL A;  1SF9 A;  2DL5 A;  5GAO r;  3OQ5 A;  4RG8 A;  2YLC A;  2QQS A;  4OF1 A;  3CME A;  5LJ5 j;  3HHT B;  3VS4 A;  3A5Z B;  5DM7 R;  1Q95 G;  2E12 A;  2JTM A;  3L2W A;  5I11 A;  3A1P A;  4C0G A;  3JB9 G;  5C0M A;  2DRM A;  3UA6 A;  4AMC A;  3L2V A;  1N27 A;  5CIU A;  1K1Z A;  4J5Y A;  1CKA A;  4HCZ A;  3JB9 D;  2O88 A;  2WSE E;  1UB4 A;  2BKD N;  1C1A A;  3VKI A;  3EH2 A;  2LC4 A;  4FW2 A;  3MO8 A;  4DEX A;  3OY9 A;  4XU2 A;  1QW1 A;  4LNP A;  1UGR B;  4ELZ C;  1YIJ Q;  1FWZ A;  3JCM g;  1Q7Y R;  2E5K A;  2LT4 A;  1E6H A;  4EMK B;  2L8D A;  4OMQ A;  4OMP A;  1K9A A;  2ZPH B;  3G4S T;  1UHC A;  3LGF A;  3EGX A;  1VQ7 A;  2RJC A;  2X4J A;  3VU3 C;  5GAN e;  2RA2 A;  2OTL A;  1VQ9 A;  1I8F A;  1VOM A;  4M75 G;  2EPD A;  2CP0 A;  4MDX A;  1VIF A;  4A53 A;  1DJ7 B;  2RHY A;  1KC8 C;  3ZL7 C;  3J81 E;  1TSF A;  1FX7 A;  1NG2 A;  3GOX A;  3E19 A;  4M75 D;  1VQN A;  1WI7 A;  4PKC C;  1O9S A;  4HVV A;  4NL2 A;  2DE0 X;  4LXC A;  3I56 T;  1X2K A;  3JV3 A;  1Q82 R;  2EAY A;  3DB3 A;  2DTI A;  3CC4 Q;  1RAG B;  2CP2 A;  1YJ9 Q;  4JLI A;  1N8R R;  3QZ9 B;  1K4U S;  2LJ0 A;  1KC8 U;  1AZG B;  1N6A A;  1CKB A;  4AFS C;  4B9W A;  3MP1 A;  2V1Q A;  4E7J A;  4KUL A;  1YJN A;  2OX7 A;  4OMN A;  2LTO A;  3CCE A;  3CBM A;  5HK0 A;  2VAS A;  1VQO T;  4EIK A;  5A0D A;  1AEY A;  5GMK l;  2A36 A;  4J9D A;  2R5M A;  3CCL A;  1IO6 A;  4JRK A;  5IXF A;  1KIK A;  4Z8A A;  4ZNX A;  4FU6 A;  3JAM E;  1BIA A;  4CRI A;  1D1B A;  2BZY A;  4PJN A;  2X3W D;  2FPF A;  3FLG A;  3M4Y A;  5GAN 3;  3PMI A;  1V1C A;  3QJY A;  1KD1 C;  1M5Q 1;  8ATC B;  2ESW A;  3EFS A;  1VA7 A;  2RJD A;  2LMJ A;  4EMH A;  2EQU A;  2JN0 A;  2VKN A;  3C0C A;  1M90 C;  3SWN B;  2KSS A;  1Q81 C;  4OB1 B;  3TSZ A;  4C8Q A;  2VXE A;  2CP3 A;  4BUG A;  1BKB A;  1WJQ A;  3CD6 Q;  3VYG A;  3CCV T;  2CZ1 B;  5IHN A;  1QLY A;  4J9E A;  1KD1 U;  2VGM A;  2DIL A;  5C6S A;  1JB0 E;  2RK2 A;  4HCC A;  2LQN A;  2L2P A;  1GFD A;  3CCQ A;  1M90 U;  4PJO G;  3VRZ A;  4Y92 A;  4KT0 E;  2FPE A;  3L2U A;  2XI9 A;  4M77 F;  4FCY A;  1G3T A;  5I2M A;  4PJO D;  1U8R A;  4IUU A;  5D6X A;  4J6Y A;  2CZ7 B;  1VQ8 A;  5A0L A;  5LJ3 g;  1GCQ C;  2DXT A;  3C94 A;  3NGP A;  3GP8 A;  4ANJ A;  2GFA A;  5KH6 A;  4M75 C;  5GAN h;  2CGH A;  2DX1 A;  3M0Q A;  3JCM X;  5KYU B;  4ZTF A;  2OJ2 A;  2RJE A;  3X24 B;  2EQJ A;  5M9O A;  4A4K A;  2X9H A;  3RDV A;  4DBH A;  3CPW P;  1Y57 A;  2DD5 A;  3OMC A;  4XK8 E;  2YRC A;  5KYW A;  1CSK A;  2LX7 A;  2RF0 A;  3PVL A;  1UJ0 A;  2KRN A;  3G7Z A;  3CC2 A;  5GAN d;  3PE0 A;  1WPY A;  4YTL A;  2GBQ A;  1D1C A;  1AOJ A;  4XTU A;  3EFR A;  2BIV A;  2DZC A;  2HCK A;  3O5Z A;  3UF4 A;  2QK0 A;  3CBP A;  3CMA A;  3NFC A;  1MV3 A;  2E3I A;  1QVG S;  2DLP A;  4LUE A;  1KFZ A;  1IHW A;  1WYX A;  1ZUY A;  3J80 E;  1R8O B;  2DYB A;  5IT9 E;  4CC2 A;  3G6E T;  3CCM A;  1N8R C;  1SKU B;  1KJW A;  3VS1 A;  2O01 E;  3R6O A;  2E10 A;  2MWO A;  1RAD B;  2FEI A;  3FJP A;  1AWW A;  2JS2 A;  3CCU A;  3OA6 A;  4XTW A;  2H3J A;  4C0D C;  4C92 A;  4F7U F;  1Q82 U;  2ZGW A;  1J3T A;  3CXC P;  1Y0M A;  3OSS C;  3LGL A;  4C0F A;  2HBP A;  3QDR B;  3OYD A;  2FPD A;  4ZTJ A;  1N8R U;  4JDS A;  4IUT A;  4XTV A;  5GAO l;  1D0X A;  4ZN1 A;  5HK3 A;  2AZS A;  2DBK A;  4AFU C;  2RHI A;  3Q1J A;  4BI3 A;  2M0Y A;  2NUT B;  3A8G B;  3CCR A;  3JCM J;  5LJ5 f;  3E2U A;  1UFF A;  3U23 A;  2E3H A;  1WXT A;  2KYM A;  1SRM A;  4XU3 A;  2QQ9 A;  2XK0 A;  1VYT A;  4L5G A;  4N0A A;  4BY6 B;  2ROT A;  1VQL T;  1MMN A;  2CKK A;  4JLG A;  2P0Q A;  2LJ1 A;  3EGX B;  3KBG A;  3MP6 A;  1VQM Q;  1X6B A;  2D9T A;  3ZFJ A;  5CKD A;  2RI3 A;  3JB9 H;  4PJO C;  4JZ3 A;  1JO8 A;  3H9N A;  4J9F A;  1Y96 B;  5FWB A;  2VUB A;  3ULR B;  1NPR A;  1AWO A;  3BDL A;  4LN2 A;  2A3L A;  1ZQ1 A;  2DMO A;  4M7A B;  2RN8 A;  1K73 C;  4BB7 A;  4M7D E;  2MK5 A;  2XD0 A;  4RCC A;  1UEC A;  1I4K 1;  3OS0 A;  3JCM b;  4VUB A;  2SRC A;  4KGX B;  1ABO A;  1BI3 A;  2M0O A;  2GTJ A;  4OMM A;  4F17 A;  3ME9 A;  1WXB A;  1PSE A;  3GLX A;  3P8H A;  2K9G A;  1N9R A;  4OML A;  1VIE A;  1K73 U;  2V26 A;  1K76 A;  1VQ5 A;  3EG3 A;  4IIM A;  1SEM A;  2R58 A;  2CUB A;  3H0H A;  3OW2 P;  4E7K A;  2F2W A;  2BE9 B;  2A7Y A;  1M30 A;  3RMS A;  2KRO A;  4M78 E;  2EFI A;  2CUD A;  4J9H A;  4X34 A;  1YIJ T;  1Q86 R;  3PIO A;  2K3X A;  4OB3 B;  5KE3 A;  2DKG A;  3CPF A;  3MEV A;  4N4I A;  4MML A;  4CC4 B;  4BDZ A;  3FDR A;  3E9G A;  2KT1 A;  1VQK T;  4C8Q B;  4R55 A;  1NEB A;  2JUF A;  2FZG B;  3LX7 A;  3MPU B;  4CC7 A;  4K11 A;  4XTZ A;  1IHV A;  5FWC A;  2KE9 A;  2ZAE A;  2FZK B;  4N4H A;  2E5Q A;  4B6M A;  1KK7 A;  1YP5 A;  3MEU A;  3CC4 T;  1YJ9 T;  2G6F X;  2J7I A;  5FU7 B;  2QGF B;  1OU9 A;  2LT1 A;  1X27 A;  3NTH A;  1WIE A;  3G4S A;  3HL8 A;  1IGQ A;  2JMA A;  2FL7 A;  2O2O A;  4FYX B;  3HFN A;  5CAI A;  2R57 A;  4LE9 A;  3LLR A;  4AT1 B;  2KRM A;  1WZO A;  4KH1 B;  5KYW B;  1AT1 B;  3T9N A;  3M57 A;  2GNC A;  1KSW A;  1NPP A;  1UGS B;  2COZ A;  2CP5 A;  5GMK j;  3RBB B;  2O4X A;  1YIT A;  1K8A R;  1NZ9 A;  1WDX A;  3I56 A;  2E70 A;  1YJW A;  3E1S A;  2K2V A;  1WX6 A;  4LD6 A;  3GBQ A;  5GAN 4;  2HKN A;  5CO7 A;  1YWO A;  4IUQ A;  1TUG B;  4PFO A;  2QA4 T;  2L3S A;  2QEX A;  3KFV A;  2DO3 A;  2JOY A;  4QVD A;  1WXU A;  4KRT A;  1VQ4 T;  1JRI A;  2D0N A;  3CD6 T;  2MPX C;  4OMO A;  1VQO A;  2DET A;  2K5I A;  2ZZD A;  4C5H A;  2DFU A;  4BAC A;  4C92 B;  2RQW A;  3G71 T;  1OX8 A;  3SFM A;  1VQP Q;  4KUD K;  4DOV A;  2EIF A;  1Y71 A;  4Z02 A;  2O9S A;  2YUP A;  1TG0 A;  2FYK A;  4EMG A;  2QXF A;  4RTU A;  5LJ3 f;  1KQ2 A;  2BUD A;  1BI2 A;  3I35 A;  2RHU A;  2DL7 A;  4A4G A;  1Q86 C;  5LJ5 g;  2XG8 D;  3I55 A;  3QJ6 A;  6AT1 B;  1M2V B;  1VQL Q;  3I9Q A;  3CCS T;  1ACM B;  2X4X A;  1GCQ A;  4XTX A;  3V7R A;  4M75 A;  1YN8 A;  3ZEH A;  1SHG A;  2DXB A;  3VS0 A;  2H3E B;  1BI0 A;  2QQA A;  3CPW S;  5FU6 C;  3CCV A;  2DL8 A;  2C0O A;  3OS1 A;  1Q86 U;  1OX9 A;  5FRO A;  2QQB A;  3V8K A;  1U1T A;  4ZGJ B;  1PCX A;  4JJN K;  5KE2 A;  3JCM h;  3EAE A;  1BB9 A;  1FMV A;  3SEM A;  3RKX A;  1VYU A;  3C4S A;  1UG1 A;  1Z9Q A;  2PUO B;  4D8K A;  3H6Z A;  3S6W A;  1M90 R;  3JCM d;  2MIO A;  2NUP A;  1Q81 R;  3BDU A;  3M56 A;  4O6J A;  4PK4 A;  1M1K C;  3EG9 A;  1C6V X;  2EJG A;  4J7F A;  4M77 E;  4MDW A;  1PG5 B;  1YI2 A;  1WHM A;  2HSP A;  2JXB A;  2L3Q A;  4M7D G;  2DTO A;  4BD3 A;  1YHQ Q;  3CXC S;  2M16 A;  2RK1 A;  3OYE A;  3NTK A;  3CC7 T;  2F2V A;  3OYC A;  4M7D D;  2DVJ A;  2FO0 A;  1K8A C;  2GFU A;  2F1L A;  4A63 B;  4JJD A;  4QQD A;  3EH1 A;  8AT1 B;  2GF7 A;  1AWX A;  2XMF A;  4EMK C;  5GAM g;  3G6E A;  1WGS A;  1WNL A;  1GCP A;  1M3B A;  1MHN A;  3A8L B;  3S3M A;  1GBR A;  1D09 B;  2BE7 D;  3JB9 I;  2DL4 A;  2JT4 A;  4EDU A;  1VQK Q;  1FXX A;  4JUV A;  4M78 G;  2K79 A;  1QVF A;  5KYN A;  1K8A U;  1VQM T;  1TTH B;  1H92 A;  2P4R A;  2HNI A;  1AD5 A;  1YBY A;  1KQS A;  2G3R A;  4M78 D;  4NL3 A;  4PJO A;  4X9D A;  1RAA B;  2NYS A;  3VJP A;  1HK9 A;  4F7U E;  2DEU A;  1QWE A;  3EGD B;  5GMK i;  1W2B A;  2HDA A;  3MKD A;  3OS2 A;  2LVM A;  2WSC E;  5FW9 A;  1NJI R;  3RR6 A;  1M9S A;  2CT3 A;  2DRK A;  4M7A F;  4XU1 A;  3OB9 A;  5GAM j;  1O75 A;  2HKQ B;  1JJ2 A;  4N4G A;  1NE8 A;  1ZUK A;  1VQL A;  2KGT A;  3MET A;  5CCA A;  5A0G A;  4J6X A;  3MEA A;  1IRE B;  1S72 A;  9ATC B;  2HQE A;  3THK A;  4PLL A;  2K4Y A;  3CEY A;  3L2R A;  3JB9 J;  4MZT A;  2ED1 A;  3LWI A;  4M4Z A;  3OW2 S;  3QII A;  2J06 A;  2B86 A;  4J9B A;  4JRP A;  1QVP A;  3H8Z A;  4J6W A;  4FIB A;  4RTW A;  1KHC A;  3H0I A;  1G3Y A;  2QA4 Q;  1YCY A;  2BTT A;  3A98 A;  1G83 A;  1WJS A;  1H3H A;  1OOT A;  2Y90 A;  4LDV A;  3M58 A;  2C06 A;  2YDL A;  4M7D C;  1VQ4 Q;  1X6O A;  4V2S A;  2K6D A;  2AKL A;  1XNI A;  2RPN A;  2EYW A;  1WHH A;  3EGU A;  3X25 B;  1T3S A;  3G71 Q;  4XQ3 A;  2K5L A;  5HY6 A;  2GQV A;  3QYH B;  1QP3 A;  3V7C A;  4C8Q F;  3MJX A;  2DNU A;  2LP5 A;  2RQT A;  3PGG A;  4GLM A;  3UT1 A;  1Q81 U;  4BE0 A;  5KYX A;  1BU1 A;  1T0J A;  2CH4 W;  1UGQ B;  1K73 R;  1E6G A;  5KYY A;  2CSI A;  4DBQ A;  2F69 A;  4M7A G;  2F5T X;  2VV5 A;  5L23 A;  3CCS Q;  1YIJ A;  4J83 A;  2MCN A;  2MI6 A;  4M78 C;  4E7Z A;  1M8M A;  1VQ6 T;  1V29 B;  1LPL A;  2ED0 A;  4M7A D;  2OI3 A;  2DM1 A;  4C5G A;  3CME T;  1SSF A;  2PVO B;  4A54 A;  1VQK A;  2O9V A;  2NWM A;  4M75 B;  2EJF A;  3UA7 A;  2A08 A;  4MZP A;  2M1H A;  4R0K A;  4RTY A;  2DJZ A;  1ZSZ C;  2ENM A;  2YUQ A;  2CRE A;  2DD4 A;  1HXD A;  2X35 A;  2A37 A;  4IUR A;  1NJI C;  4HCK A;  2OAW A;  1Y07 A;  3RNJ A;  2EQM A;  2X3X D;  3CC4 A;  1VUB A;  2LQK A;  1YJ9 A;  4KBM B;  1D0Y A;  3C12 A;  1QP2 A;  2NUP B;  3VV0 A;  2VYT A;  5D6W A;  3QWY A;  3TSW A;  2DF6 A;  3A8H B;  2IVW A;  3EG9 B;  1VQ7 T;  1UE9 A;  3M0S A;  3CC7 Q;  1NJI U;  5I21 A;  3QZ5 B;  4FM4 B;  4DA4 A;  2HSE B;  4C0D B;  2VGN A;  5GJW B;  4HCB A;  3V8J A;  1RAF B;  2C0I A;  3PVQ A;  5GAN g;  4M77 G;  1VQP T;  1HJD A;  1V76 A;  2F5K A;  1TWB A;  4C92 F;  5KCO A;  1VQN T;  1IB8 A;  4J8O A;  1X2Q A;  2V8K A;  4JJB A;  1QMC A;  1KQS S;  2HL5 C;  4M77 D;  3DLM A;  3MP8 A;  2K3B A;  2I0N A;  2CYZ B;  3A8M B;  1EIF A;  2I2L A;  1SRL A;  2VXF A;  3VUZ A;  3L2Q A;  4ORZ A;  1C0M A;  3RUX A;  4FT2 A;  2RH2 A;  2JTF A;  4BDY A;  2QGG A;  1MMA A;  4E2F B;  1W6X A;  5IXB A;  3M59 A;  4IUV A;  1RUW A;  3CD6 A;  1JJ2 S;  1OUL A;  1D3B A;  1RAB B;  1U5S A;  3JRZ A;  4QQ6 A;  3V8L A;  3CCL T;  3QO3 A;  4RTV A;  1PC0 A;  4PJJ A;  2RM4 A;  1XQH A;  1U1S A;  1LOJ A;  4Z88 A;  4F16 A;  3JSC A;  2JMC A;  2Y4Y A;  4PJO B;  4FSX A;  5GAN j;  4M7A C;  4IUP A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  4DEX A;  2W10 A;  1JXM A;  1WDX A;  1PKT A;  2AZV A;  2F2X A;  1UTI A;  4LNP A;  3I5S A;  1WX6 A;  4CC3 A;  3GBQ A;  2E5K A;  2EBP A;  4D8D A;  1GRI A;  1E6H A;  1A0N B;  4OMQ A;  4OMP A;  2O31 A;  1K9A A;  1X43 A;  2RQR A;  1YWO A;  2BZ8 A;  2L3S A;  4RTZ A;  1UHC A;  3KFV A;  4WCI A;  2KBT A;  5IHI A;  1WXU A;  4KRT A;  2K2M A;  3EG1 A;  2D0N A;  1PNJ A;  1ZSG A;  4OMO A;  5ECA A;  2EPD A;  1M3C A;  3ZL7 C;  3REA B;  2RQW A;  1NG2 A;  2GTO A;  1ZUU A;  2J05 A;  2NUZ A;  1WI7 A;  4HVV A;  4GBQ A;  2DE0 X;  4E6R A;  2O9S A;  2YUP A;  1TG0 A;  1WLP B;  1X2K A;  4RTU A;  3JV3 A;  1M3A A;  1PKS A;  1U3O A;  3I35 A;  2DL7 A;  1FYN A;  3EG0 A;  1TUD A;  1K4U S;  2LJ0 A;  3I9Q A;  1AZG B;  1CKB A;  2FRY A;  4AFS C;  2V1Q A;  1GCQ A;  2JS0 A;  1SHF A;  4OMN A;  3NHN A;  2H8H A;  1YN8 A;  1SHG A;  1GL5 A;  3VS0 A;  1NYG A;  4EIK A;  3EG2 A;  1AEY A;  1B3Q A;  2A36 A;  4J9D A;  1IO6 A;  5IXF A;  2EGE A;  2DL8 A;  1KIK A;  2C0O A;  2JW4 A;  2HBW A;  4Z8A A;  5EC7 A;  4AFZ C;  4ZNX A;  3H41 A;  2PNI A;  2KXC A;  1OPK A;  2BZX A;  2L3P A;  2J6F A;  2BZY A;  2X3W D;  1U06 A;  4DEY A;  1BB9 A;  2FPF A;  3SEM A;  3CQT A;  4AG1 C;  1V1C A;  5IHK A;  1VYU A;  1GBQ A;  3VRY A;  1UG1 A;  2ESW A;  1Z9Q A;  4D8K A;  1VA7 A;  2LMJ A;  1BK2 A;  2MIO A;  1NM7 A;  4JPB W;  2VKN A;  3C0C A;  2D8J A;  4QT7 A;  2LZ6 B;  4AFQ C;  1XOV A;  4RTT A;  3TSZ A;  1QKW A;  2A28 A;  2HSP A;  2YSQ A;  2JXB A;  2L3Q A;  1ARK A;  5IHN A;  1QLY A;  4J9E A;  2DIL A;  2KT8 A;  1WA7 A;  1T0H A;  2LQN A;  2JM9 A;  2F2V A;  2L2P A;  1GFD A;  2MOX A;  4J9C A;  2DVJ A;  1I07 A;  4Y92 A;  2FO0 A;  4JJC A;  3VRZ A;  1W1F A;  2W0Z A;  4A63 B;  2FPE A;  5HCK A;  1OEB A;  4JJD A;  1W70 A;  1UJY A;  1QKX A;  3NMZ C;  1AWX A;  2XMF A;  1GCP A;  1M3B A;  1T3L A;  1GBR A;  1GCQ C;  2DL4 A;  2LJ3 A;  5GJV B;  3NGP A;  1N5Z A;  2JT4 A;  2J6K A;  2GQI A;  2DX1 A;  3M0Q A;  2YUN A;  2OJ2 A;  3TVT A;  2K79 A;  1OV3 A;  1YNZ A;  1Y57 A;  2P4R A;  1H92 A;  1CSK A;  2LX7 A;  2RF0 A;  3PVL A;  1AD5 A;  1UJ0 A;  2KRN A;  3PE0 A;  2GBQ A;  1JU5 C;  1AOJ A;  1HD3 A;  1HSQ A;  4J9I A;  2HCK A;  3O5Z A;  3UF4 A;  1AZE A;  1QWE A;  1LCK A;  1EFN A;  1MV3 A;  2DLP A;  4LUE A;  1QWF A;  1S1N A;  1KFZ A;  1WYX A;  1ZUY A;  2HDA A;  1MV0 B;  5IH2 A;  5FW9 A;  2DYB A;  2RMO A;  2M51 A;  4CC2 A;  4FSS A;  3M0U A;  2CH4 A;  2CT3 A;  1KJW A;  2DRK A;  3VS1 A;  4JZ4 A;  2PTK A;  1I1J A;  2EQI A;  1WFW A;  4IIO A;  1M27 C;  1VYV A;  2ROL A;  4RUG A;  2FEI A;  1ZUK A;  1AWW A;  4LUD A;  2JS2 A;  2KGT A;  2CT4 A;  2VVK A;  2JM8 A;  3THK A;  1J3T A;  1Y0M A;  2ABL A;  2QDL A;  4F14 A;  2AKK A;  1E7O A;  1H8K A;  2ED1 A;  2FPD A;  4M4Z A;  2AZS A;  2DBK A;  2EYZ A;  2J06 A;  4AFU C;  2B86 A;  4J9B A;  2EW3 A;  2M0Y A;  1NEG A;  2SEM A;  1UGV A;  2AK5 A;  2DL3 A;  2V1R A;  1UFF A;  3U23 A;  4RTW A;  3H0I A;  2ECZ A;  1WXT A;  2KYM A;  1NYF A;  1SRM A;  2BTT A;  3A98 A;  1G83 A;  1H3H A;  1OOT A;  2KNB B;  1RLP C;  1VYT A;  2YDL A;  2ROT A;  2RQU A;  2K6D A;  2AKL A;  3I5R A;  1PRL C;  2LJ1 A;  2EGC A;  1NLO C;  1X6B A;  2RPN A;  2EYW A;  3EGU A;  1T3S A;  1UHF A;  3FJ5 A;  4JZ3 A;  1JO8 A;  4J9F A;  5FWB A;  2DNU A;  2LP5 A;  2YUO A;  2RQT A;  4GLM A;  1JQQ A;  3ULR B;  1AWO A;  2C0T A;  2FG0 A;  4LN2 A;  1JXO A;  1PRM C;  1BU1 A;  3UAT A;  2EYX A;  1PWT A;  1T0J A;  2LCS A;  2CH4 W;  1E6G A;  2DMO A;  2VWF A;  3H0F A;  2RN8 A;  2CSI A;  3VS5 A;  2J6O A;  1K0S A;  4ESR A;  3EHR A;  5L23 A;  1SSH A;  2KRS A;  2MCN A;  3IQL A;  1UEC A;  1M8M A;  4HVU A;  3SHW A;  2KEA A;  1UDL A;  2SRC A;  1ABO A;  4HVW A;  2LQW A;  2ED0 A;  3M0P A;  1MUZ A;  2OI3 A;  2DM1 A;  2GTJ A;  4OMM A;  3R6N A;  4F17 A;  1QCF A;  1RLQ C;  1WXB A;  2CDT A;  1JEG A;  2O9V A;  2CSQ A;  2D8H A;  1UUE A;  2NWM A;  2K9G A;  4OML A;  3VS3 A;  2L0A A;  3VS2 A;  4Z89 A;  2HEQ A;  3UA7 A;  2A08 A;  1K76 A;  2DJQ A;  3EG3 A;  4IIM A;  4R0K A;  4RTY A;  2EKH A;  1SEM A;  2CUB A;  3H0H A;  2ENM A;  2YUQ A;  1ABQ A;  3QWX X;  1NLP C;  1YWP A;  2F2W A;  1ZLM A;  2IIM A;  2CRE A;  1TUC A;  2FRW A;  1RI9 A;  1M30 A;  1X69 A;  2A37 A;  2RNA A;  1PHT A;  2KRO A;  4HCK A;  1Z9Z A;  2OAW A;  2CUD A;  4J9H A;  3RNJ A;  1BBZ A;  2RQV A;  2X3X D;  3M0R A;  1B07 A;  2DBM A;  2EVR A;  2YT6 A;  1OPL A;  3EHQ A;  4CC4 B;  1YCS B;  1GFC A;  4HXJ A;  3QWY A;  3TSW A;  2DF6 A;  2KT1 A;  1X6G A;  1UE9 A;  1NEB A;  3M0S A;  4AG2 C;  1ZX6 A;  4J9G A;  4CC7 A;  2LNH B;  3REB B;  4K11 A;  5GJW B;  1AVZ C;  2C0I A;  1AWJ A;  2DA9 A;  3PVQ A;  1HJD A;  5I22 A;  2KR3 A;  2EGA A;  5FWC A;  2KYB A;  2KE9 A;  2KXD A;  1FMK A;  2K7A A;  1X2Q A;  2JTE A;  4JJB A;  1YP5 A;  1SPK A;  1ZBJ A;  2K3B A;  3NPF A;  2I0N A;  4X1V A;  3VS7 A;  2DL5 A;  2G6F X;  2J7I A;  3VS6 A;  1SRL A;  3LH5 A;  4ORZ A;  1K0X A;  1X27 A;  1WIE A;  2D1X A;  1G2B A;  3VS4 A;  2JMA A;  1W6X A;  5IXB A;  2O2O A;  5I11 A;  1RUW A;  2GGR A;  4LE9 A;  2DRM A;  3UA6 A;  4RTX A;  1U5S A;  2KRM A;  3M0T A;  4RTV A;  1K1Z A;  4Z88 A;  4F16 A;  1CKA A;  2GNC A;  1KSW A;  2O88 A;  2JMC A;  1I0C A;  2EYY A;  3RBB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...