4IIOA

Crystal structure of the second sh3 domain of itsn2 bound with a synthetic peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
GMAQGALLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords Intersectin-2
publication title Crystal Structure of the Second SH3 Domain of ITSN2 Bound with a Synthetic Peptide
rcsb
source organism Homo sapiens
total genus 13
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4iioA00
1ARKA 2O9SA 2W10A 3REAB 1T0HA 2YUOA 3REBB 2IIMA 1TUCA 4RTVA 1W70A 5GJWB 2FO0A 2LZ6B 1UJYA 2CUBA 2XMFA 2VWFA 4GBQA 2J05A 1K4US 1K9AA 3EHQA 1OOTA 2J6OA 3NMZC 2DLPA 4CC3A 4Z8AA 3M0UA 1M27C 1ZBJA 3GBQA 2O31A 4HVWA 3NGPA 1X69A 4J9EA 4JJCA 1I07A 1PKTA 2DF6A 3EG3A 1GBQA 4LUEA 1U06A 2O9VA 1GCQC 1JQQA 2CDTA 3NPFA 2HSPA 2DYBA 2LJ1A 1MV0B 3UF4A 4KRTA 2KYBA 4AFZC 1H92A 1TUDA 1UHCA 1RUWA 1GL5A 1GFCA 4ESRA 1UUEA 3SEMA 2P4RA 1ZX6A 1YWPA 2J06A 4RTWA 2DL7A 3EG0A 5ECAA 2O88A 2RNAA 1Y0MA 2KEAA 3SHWA 1K0XA 2EKHA 2FEIA 2KBTA 1M3CA 1OV3A 4IIMA 3H0HA 2KXDA 4CC4B 5IH2A 2KGTA 2ECZA 3VRZA 1WDXA 2K9GA 4DEYA 2YDLA 3M0PA 4RTYA 1GFDA 2DBKA 4R0KA 1PNJA 4F16A 1YN8A 1NEGA 1H3HA 2L2PA 2LCSA 1FMKA 1N5ZA 2C0IA 2DL8A 3TVTA 2LJ3A 1AWWA 4M4ZA 1VYTA 2CUDA 1JO8A 4AG2C 1SEMA 3PVLA 1BBZA 2O2OA 5HCKA 1AOJA 3QWYA 2HBWA 2A08A 2JW4A 1BK2A 1GCPA 2DILA 2AKLA 1W6XA 4WCIA 1JEGA 1RLQC 1UG1A 1NG2A 2YT6A 2EYZA 2CH4W 4GLMA 1X2KA 1CKBA 2D0NA 3UATA 2HEQA 1MV3A 2FPDA 1UE9A 3H41A 4J9IA 2KRSA 4HVVA 2K6DA 5IHKA 1ABQA 3ZL7C 1UTIA 2G6FX 2JXBA 1WI7A 2K2MA 2AZSA 3VS5A 4J9HA 2L0AA 1PHTA 5GJVB 1S1NA 2FRYA 4X1VA 3M0RA 2DMOA 4K11A 2KE9A 2RF0A 1T0JA 3RBBB 4D8DA 1KJWA 2DJQA 2FG0A 1KFZA 1CSKA 1I0CA 3I35A 1WFWA 1B3QA 2E5KA 2JS0A 1X6GA 1T3SA 2YUPA 1HJDA 1QWEA 1QCFA 1NEBA 2LJ0A 1NYGA 1SHFA 2K79A 5IHNA 2M51A 1J3TA 2CSQA 5FWCA 2AZVA 2NWMA 2W0ZA 1AWOA 1ABOA 2M0YA 4JZ3A 3I9QA 2SEMA 1WIEA 5IXBA 5I11A 3I5RA 3VS6A 2L3PA 4RTZA 1WX6A 3CQTA 4OMMA 1SPKA 3FJ5A 1AWJA 2CT4A 2MCNA 2RQVA 1M3BA 3KFVA 4JJBA 1KSWA 1SRLA 4LE9A 1OPLA 2RPNA 2PTKA 1WLPB 2YUQA 1M3AA 3M0TA 2RQTA 2CH4A 4JZ4A 2C0TA 2GBQA 1E7OA 3THKA 1NLOC 1U3OA 2EBPA 4OMQA 3VS0A 1W1FA 2H8HA 4Y92A 1T3LA 2ROTA 2AKKA 1WA7A 1PRLC 3A98A 4HCKA 4LNPA 2NUZA 1NLPC 2LNHB 1SRMA 4DEXA 2EGEA 1AZEA 3UA6A 1K1ZA 3VS7A 1TG0A 2DL4A 2KYMA 2KRMA 1ZLMA 2X3WD 1OPKA 2EQIA 4ORZA 1AZGB 1GCQA 1PKSA 2QDLA 3U23A 2J6FA 2KT8A 2BZ8A 2DBMA 3RNJA 1YNZA 2DL3A 2DVJA 5IHIA 1K0SA 5I22A 5IXFA 2A37A 2JS2A 1Z9ZA 3VS3A 2I0NA 4LN2A 2DM1A 1AVZC 4FSSA 1B07A 2LMJA 1VYVA 2L3SA 2K3BA 2EW3A 1UJ0A 1UDLA 2CREA 1Y57A 1HD3A 1QKXA 2JMCA 2A36A 2DRKA 2KROA 2DRMA 2EYXA 1NM7A 4RTXA 5FWBA 1IO6A 1LCKA 2MIOA 1AWXA 2JM8A 2JM9A 2K7AA 2F2VA 3TSWA 3VS1A 2DNUA 1SHGA 1H8KA 1A0NB 1ZUUA 1BU1A 2GGRA 4Z88A 2L3QA 3EG2A 1ZSGA 3PVQA 1ZUKA 1CKAA 1QWFA 1X6BA 3H0IA 4Z89A 3I5SA 5L23A 2J7IA 3ULRB 2VVKA 5EC7A 3EHRA 2D8HA 1ZUYA 2EYYA 3PE0A 4JJDA 1WYXA 2VKNA 2RQRA 2OJ2A 1UFFA 2GNCA 1QKWA 2HDAA 3TSZA 4QT7A 4F14A 2RQUA 1OEBA 2ENMA 2RQWA 4A63B 2D1XA 4D8KA 1MUZA 1U5SA 1XOVA 4LUDA 1I1JA 2YUNA 2B86A 4RUGA 2FPEA 3NHNA 2EPDA 3IQLA 2LQNA 4E6RA 4HVUA 2J6KA 2KRNA 1BB9A 2F2XA 1JXOA 5FW9A 1RLPC 2HCKA 2V1RA 1JXMA 2EVRA 2FRWA 2BZYA 2V1QA 4J9FA 1G83A 1WXTA 4HXJA 2PZ1A 3M0QA 3EGUA 2KXCA 2YSQA 2F2WA 3QWXX 2ED1A 4OMNA 1AEYA 1E6HA 2BTTA 1EFNA 1PRMC 2SRCA 1GBRA 3LH5A 3UA7A 3R6NA 4AFSC 4OMOA 1YP5A 1NYFA 2CT3A 4ZNXA 2LP5A 1UHFA 4CC7A 1KIKA 2EYWA 1VA7A 2ESWA 2KT1A 1JU5C 1E6GA 2ABLA 1UGVA 1AD5A 1M30A 2DA9A 2X3XD 1M8MA 1HSQA 2KNBB 2JTEA 3VS4A 2FPFA 1YCSB 2DX1A 4F17A 3VS2A 3M0SA 4J9CA 2PNIA 3EG1A 2OI3A 4JPBW 2EGAA 2CSIA 4OMLA 1G2BA 2DL5A 2GTJA 3O5ZA 4J9BA 4AFQC 2EGCA 1WXUA 1X2QA 1Z9QA 1QLYA 2GTOA 2MOXA 2RMOA 4IIOA 2JT4A 2D8JA 2LX7A 4OMPA 2OAWA 1GRIA 4J9DA 4AG1C 3JV3A 1FYNA 1K76A 2RN8A 1RI9A 2BZXA 4J9GA 2ROLA 2JMAA 2ED0A 4RTUA 2AK5A 2DE0X 4RTTA 1YWOA 1VYUA 1WXBA 2A28A 2C0OA 4EIKA 4CC2A 1UECA 4AFUC 1V1CA 1X27A 2LQWA 3H0FA 3C0CA 1SSHA 1PWTA 2GQIA 1X43A 2KR3A 3VRYA
chains in the Genus database with same CATH superfamily
2W10A 3OQ5A 3REAB 4RG8A 5HK0A 1TUCA 2QASA 2LQKA 1HXDA 2LZ6B 4Q5WA 3CEYA 5KYXA 1Q86R 3JB9J 2J05A 4C0ZA 2CP2A 1OOTA 2J6OA 1WJRA 3NMZC 2Y4XA 4ELZC 3CC2Q 1ZQ1A 4Y91A 2EKOA 4JRIA 2LRQA 1LOJA 4EMHA 5GANf 3EG3A 1W2BA 2K5FA 3OYDA 1OZ3A 4M7AG 3CC2T 1JQQA 2CDTA 3NPFA 2X4XA 1Q82U 1UEBA 3JCMV 2QTVA 2RHZA 4X9CA 3UF4A 1QVGA 2COZA 3HFOA 1H92A 1QMCA 3PFSA 2CP3A 2K5IA 1RUWA 3SEMA 2P4RA 1ZX6A 3OS0A 3HHTB 4ZTFA 3JCMb 5CVIA 1K0XA 2DPPB 2FEIA 4XTVA 4JRQA 1YITQ 1QW1A 2KXDA 4CC4B 3CC7Q 5GAOp 2NUTB 4RTYA 3AT1B 3NFCA 1YITT 2M16A 4F16A 1H3HA 3CC7T 2L2PA 3SWNB 2DL8A 1BCOA 1U1TA 1OU9A 2LJ3A 4PFPA 2EQMA 4RCCA 1SEMA 1R0BG 5D6XA 4M7AB 3CCQQ 3OYFA 4RG2A 2NUTA 1OU8A 2QG9B 2EJGA 2B8AA 1TU0B 2A08A 2QEXA 2FZCB 1BK2A 3CCQT 4JRPA 3SWNA 2DERA 4E2FB 1B34B 2WSEE 3OBYA 2RHXA 1TUGB 2LDMA 3OBWA 1RLQC 1N9RA 2YT6A 4M7AA 2CGHA 3DLMA 4DOWA 1IGUA 3MEUA 4GLMA 1X2KA 1X75C 4N4HA 1Q81U 3PIOA 4XK8E 1CKBA 3UATA 2NLUA 2IPOB 1SKUB 5CK9A 2HKNA 3JB9I 3H41A 4J9IA 4MMKA 1B34A 3SB2A 2BE7D 1G5VA 2EQJA 2KMTA 5FRMA 1D1AA 3JRZA 1WI7A 2COWA 3L2RA 2K2MA 4QVZA 4E7IA 2HD0A 2L0AA 3MP6A 1S1NA 2DYIA 2FRYA 4X1VA 2DMOA 2A7YA 4FYWB 4FM4B 1KQSP 4RMOA 1KFZA 4C0DC 1B3QA 3CCJA 2E5KA 1BI2A 3RKYA 4PJOF 4GY5A 3CPWP 1QWEA 3RIRA 3G71Q 1NEBA 2CZ7B 2COYA 2PU9B 1D0ZA 5IHNA 1J3TA 4NL2A 4FW1A 2AZVA 2NWMA 3M59A 1ABOA 3OYAA 1OX8A 3HKSA 3G71T 4C8QC 4LDWA 2L8DA 2H3JA 2RD1A 4XU0A 3CCLA 4J8OA 1KQSS 4PL6A 3CCUA 2CT4A 1JJ2A 2CP7A 4LE9A 5LJ3g 4C92C 3CPWS 3E19A 4X9DA 2RK1A 4IUUA 1M3AA 2RI2A 3OY9A 3THKA 3CCSA 4OMQA 4QW2A 4HCBA 4Y92A 1VQNA 3A8GB 4JS4A 4CI0C 3EGXB 3A98A 4HCKA 4Y28E 3CCEQ 2NUZA 2LNHB 4DEXA 1PD0A 1UGSB 3VS7A 2ZPFB 1N27A 2KYMA 1WPYA 1ZLMA 3CCRA 2MYSA 3CCET 4PJOD 2C06A 1PKSA 2RI3A 1NBEB 3QYGB 3U23A 4ZGJB 2J6FA 2HAXA 1BKBA 4UC4A 1YNZA 1SG5A 4PJNA 1VQ8Q 3EGXA 3S3OA 4XU1A 2P0KA 4LDYA 2RB6A 3V7CA 5FROA 4LN2A 4F04B 3A5ZB 1OZ2A 2X35A 1VQ8T 4O5VA 2LMJA 2L3SA 4KGVB 2EW3A 2CREA 3QDFA 2DO3A 2DRMA 4DBFA 1NM7A 1U8RA 4BI4A 5FWBA 4LDUA 3HRSA 1VQPA 5LJ3d 2JM8A 3QO3A 1YJ9A 5LJ5h 4LDXA 3VS1A 4M75D 1VQ6A 3PMTA 5GAN2 1K73U 3CBPA 4Z88A 2L3QA 3G4SQ 4JLIA 2E6NA 4Z89A 2HL5C 5L23A 3BW1A 1V29B 5GAN5 1TXQA 1M5Q1 5AYFA 4TVRA 3G4ST 1RACB 3OMGA 3I55A 3PE0A 2R58A 2VKNA 2VGMA 1YJNA 2GNCA 5GANg 4F14A 2XDDA 2EIFA 3JCMh 4JJNK 4Z02A 3PTAA 3D7SB 1MUZA 4ZGDB 2FL7A 2B86A 4RUGA 2LQNA 3RERA 4VUBA 1QVFS 3CCMA 2KRNA 4M77G 4JLGA 5FW9A 2YLCA 1VIFA 4BE2A 4KULA 3NTKA 1JB0E 1M90U 2PZ1A 4F7UG 1WHMA 5J39A 3EGUA 2QXFA 4M78D 4QKUA 5KYUB 4RKUE 2VXEA 1M2OA 3OYYA 2ED1A 1VQ4A 2XDPA 2CP0A 2DIQA 1EFNA 3JB9H 1BIAA 1FXXA 1PRMC 2F69A 1K9MU 1NPRA 2YRCA 3GLXA 2E1HA 3PT9A 4ZNXA 2P4TA 4PK4A 4CC7A 2EYWA 2A3LA 2ESWA 5KYUA 2QI2A 1VUBA 2ZPGB 1UGVA 2DD5A 3FDRA 2VV5A 2DA9A 5CKFA 2X3XD 3VU3C 1M8MA 1HSQA 3X28B 4JRKA 3OMCA 1QCOA 4E7JA 2DX1A 2MI6A 2CZ6B 4M77B 3CCVQ 3HFNA 5LJ5e 4J9CA 3J80E 1GXIE 2OI3A 4FSXA 4JPBW 2PUKB 2HZYA 1XJWB 3O5ZA 4XTZA 3CCVT 4F7UB 1Z9QA 4RCBA 1JRIA 2MOXA 2BKDN 2LX7A 3KBGA 4OF1A 3V7SA 5LJ5f 4AG1C 3JV3A 3UDCA 4A53A 1RI9A 2BZXA 3OW2S 2DKGA 2JMAA 2ED0A 4C8QF 4F7UA 3GNFB 1YWOA 4BI3A 3BE3A 3C94A 1V1CA 1QVPA 3JCMe 1OULA 2LQ8A 1ARKA 2O9SA 4EMGA 1VQMQ 1T0HA 3REBB 4C5HA 1KC8C 4QVDA 4C92F 3DKMA 2RA2A 4R56A 1UJYA 2XMFA 3JCMf 1VQMT 3V8KA 1PG5B 4C0FA 2L3RA 2CS7A 1VQ9A 2DLPA 2KK4A 3EG9B 4Z8AA 3M0UA 4EMKB 4OVAA 1M27C 3JCMQ 3L2QA 3MPUB 3NGPA 1S72Q 1X69A 4J9EA 3CC7A 4JJCA 1I07A 1PKTA 3SD4A 5GANh 4N4GA 4J83A 2WSFE 1YJWQ 1RABB 3CPFA 1S72T 5IT9E 1PSFA 3MKDA 4KRTA 3EG9A 2KDSA 1KD1U 4EMKA 1TUDA 1YJWT 1UHCA 3V7RA 1GFCA 4ESRA 1M1KU 3M57A 2YXYA 2DTIA 4E7SA 2EJ9A 1Y0MA 2JUFA 4PJOC 4ZGEB 2RK2A 1PD1A 2KEAA 4BY6C 3HPWA 1IGQA 1Q86U 1OV3A 4IIMA 3H0HA 4KBMB 3L42A 2KGTA 2K9GA 1ZA2B 2JTMA 2E4HA 1P92A 1Q82C 3TU4K 4PJMA 4M7AD 3OS2A 4QQ6A 1IHWA 1BI3A 3TVTA 4N0AC 3GNGA 1JO8A 4AG2C 4BACA 3CMEQ 3EH2A 4KT0E 3TEEA 3LGFA 1V76A 2E70A 4M75C 5GMKh 3CMET 1FMVA 1JEGA 3RKWA 4ATOA 3CBOA 3J81E 3QIIA 2CH4W 3FJPA 3UWNA 2JTFA 4HCCA 3AHUA 5L8RE 3QPHA 1UE9A 2KRSA 1NE8A 5CIUA 1VIEA 3ZL7C 2G6FX 1KHIA 4XTWA 2AZSA 3P8BB 2WACA 1WNLA 2E10A 2HKQB 1PHTA 3L2VA 2KE9A 5GANe 2RF0A 3N5BB 1ACMB 1UGQB 4IUVA 3CC4Q 1KJWA 2OTJQ 1I0CA 3I35A 1WFWA 4D6WA 1AHJB 5DY9A 2JS0A 1X6GA 1T3SA 5FU7B 2CP5A 3CC4T 1Q81C 2OTJT 4NS5A 1NYGA 1SHFA 2M51A 4M78C 2E12A 2JJ9A 2R57A 2W0ZA 3QXEB 1AWOA 1PSEA 3I9QA 2SEMA 3EFSA 4A4GA 2OAUA 2LVMA 5I11A 2XDBA 3I56Q 1R77A 3RDVA 3VS6A 1VQ7Q 2O01E 4FYXB 3A8HB 2X9HA 3LLRA 3CQTA 5DLOA 3I56T 2MCNA 1VQ8A 3VUBA 3ER0A 1M3BA 1VQ7T 2PVOB 1OPLA 2OTLQ 1Y7XA 5CKDA 2PTKA 3URGA 1WHGA 1WQ7A 2HL3A 1N8RU 3M0TA 2C0TA 2R5MA 2GBQA 2OTLT 1W1FA 2ROTA 2GFAA 5I2SA 1NJIR 5GMKe 1NLPC 3M9QA 4C5GA 1SRMA 4KGZB 3WVEB 4JS5A 4KH1B 2EGEA 2KRMA 2D6FA 5A0DA 2EQIA 2K4YA 1GCQA 3H6ZA 7AT1B 2DBMA 5A0LA 5IHIA 1K0SA 2DXCA 5CQXA 4ZN1A 5LJ5g 2XHCA 2ZZDA 3VS3A 2I0NA 4B9WA 1O9SA 1R0CB 4BD3A 2EAYA 1M9SA 3SDZA 2DK3A 5HKCA 2FYKA 3X26B 1VQKQ 1UJ0A 1UDLA 2RHYA 1Y57A 1H3ZA 2HBPA 2A36A 3FLGA 4BE1A 5KYWB 2PQWA 2EYXA 1YI2Q 2EJFA 1VQKT 1LCKA 1KQ1A 3ZFJA 4LDVA 2RJDA 3L1AA 3TSWA 4PJJA 3JCMP 2EYQA 1YI2T 2MPXC 1Q82R 4LXCA 1ZUUA 1A0NB 1BU1A 4IUPA 1Y07A 3OSVA 4PLLA 3PVQA 3JCMg 2GCXA 4XTUA 3VYGA 4M7DG 1VQOQ 4JDSA 1AT1B 1C0MA 2M1HA 2XI9A 4L5GA 2Z0WA 2MAMA 3SFMA 3ZBDA 5GAN6 1KQ2A 1WYXA 4YTLA 1KG1A 1M1FA 3MEAA 2RQRA 2QQRA 1RAFB 1VQOT 5CR2A 2CZ0B 3ASKA 2HDAA 1ZHIA 2QQBA 4ZN3A 4C5IA 1OEBA 2QAZA 3OYCA 1OYXA 4DBQA 2XK0A 1RAGB 5LJ5d 3CD6Q 4LUDA 2FHDA 1K73C 1YCYA 3RMSA 4DBHA 2DZCA 3CMAQ 2VGNA 2ZGWA 3CD6T 2F2XA 1WHHA 3HL8A 3ME9A 3JCMc 4OP0A 1RLPC 2O4XB 2FRWA 3CMAT 1G83A 2NYSA 4HXJA 1Y71A 3SWNC 1ZSZB 4M75F 2YSQA 2DD4A 4M7DB 2ZCFB 3G7ZA 5KH6A 1PM3A 4M7AC 2BTTA 4MDWA 3JCMd 8AT1B 3KXTA 4BDYA 3LH5A 3UA7A 3R6NA 2RH2A 2V8JA 3M53A 1YP5A 1NYFA 2CT3A 2LP5A 3RR6A 1IRXA 1ZSZA 2BE9B 2QA4Q 5GAN7 4A4EA 5FLXE 4M7DA 2ABLA 5GAMj 2YWWA 1D1BA 4EPCA 4M77E 2QA4T 2K3XA 1YHQA 1F1BB 1O75A 3JB9F 2FPFA 1M90C 1YCSB 4F7UE 4F17A 3HSBA 2QYZA 2LTOA 5D6WA 3M0SA 4PNOA 1FMWA 2PNIA 2EGAA 4N4IA 2CSIA 4NOYA 4OMLA 3OYKA 1G2BA 2EGCA 1X2QA 1QLYA 3LH0A 3OYLA 1K9MC 2JT4A 3P8HA 3UPUA 4B9XA 5A0GA 1Q7YU 3M58A 2OAWA 4M78F 4J6YA 1YBYA 5KCHA 2KAFA 2QK0A 1MNEA 4OB1B 4CC2A 1UECA 4E7HA 1X27A 1G3YA 1QVFP 2F1LA 2QGFB 4FT2A 4CRIA 1D0XA 1WHLA 2KR3A 1KQSA 2HQEA 3OS5A 2YUOA 3UT1A 2IIMA 4RTVA 4WTOB 2FO0A 3V8LA 3CPWA 1EZZB 2CUBA 2EQUA 5D6YA 2QEXQ 4GBQA 3CXCP 1K4US 4AMCA 3EHQA 3JB9D 5CQYA 3DLLA 2RHUA 3RMQA 4CC3A 2QEXT 1M2VB 1ZBJA 2O31A 3QKJA 3MJXA 3JCMW 2DF6A 5FRNA 4LUEA 1U06A 2DAQA 2HSPA 1BCMA 2XICA 1MV0B 3X24B 3E2UA 4X34A 2QGGA 4PJOG 1MMAA 3CXCS 4AT1B 1GL5A 1UUEA 2DL7A 3EG0A 2O88A 4J7FA 3VUZA 5GMKi 4BI8B 2FB7A 3SHWA 2M02A 1IXDA 3CCJQ 1SF9A 1M3CA 1PC0A 2JNGA 2JN0A 3QG1A 3G6EQ 2ECZA 2X4YA 1WDXA 4DEYA 5GANd 2YDLA 1GFDA 3CCJT 4KUDK 3OW2P 4R0KA 1PNJA 3QHSA 1NEGA 3JCMJ 6AT1B 2LCSA 3G6ET 1FMKA 1UB4A 5EG2A 1DJ7B 1KD1C 2M9UA 1AWWA 3T9NA 1Q95G 1VYTA 2CUDA 3H9NA 5GMKl 1K8AC 1BBZA 3H8ZA 3CCLQ 2O2OA 1M1KC 1G8XA 3CCUQ 5HCKA 3QWYA 2JW4A 1GCPA 1D0YA 2DILA 3CCLT 2AKLA 1W6XA 4M77A 3CCUT 2OTJA 5HY6A 1UG1A 4KH0B 1WHJA 3CC2A 2VXFA 3EH1A 3CCSQ 5FU6B 3HP9A 1VQNQ 2D0NA 2AHJB 2XU8A 1MV3A 1XQHA 1IB8A 3CCST 4HVVA 5CKEA 1QVFA 2K6DA 1ABQA 3VKIA 1VQNT 2ZPIB 9ATCB 2RJEA 2JXBA 4LD6A 3CCRQ 3R6OA 3VS5A 2CYZB 3RKXA 2V8IA 2V26A 1QP2A 5GJVB 3M0RA 3VYHB 5CCAA 3CCRT 1OX9A 2LCCA 4M7AF 1FWZA 2ZAEA 2DJQA 1CSKA 3OYIA 1YITA 2EWNA 2YUPA 2ZPHB 4A54A 3MEWA 1QCFA 2LJ0A 3LW5E 1TSFA 2IVWA 1FX7A 1VQPQ 4JZ3A 3PNWC 4A4HA 1YJ9Q 1VQ6Q 1YIJQ 3S3NA 3LWHA 3CCQA 4RTZA 1VQPT 1W2BP 2JOYA 1YJ9T 1MMGA 1VQ6T 1YIJT 4OMMA 2CP6A 1SPKA 3FJ5A 2HSEB 4J5YA 4JJBA 1KSWA 1SRLA 5CAIA 1QVGP 3I55Q 3Q1JA 1WLPB 4FT4A 5KE2A 2CH4A 4FYYB 2LNVA 4C8QE 4V2SA 3I55T 1NLOC 1U3OA 5C6SA 2EBPA 2DEUA 3VS0A 3FC3A 2DZ9A 3E9FA 4IKFA 2NUPB 1T3LA 2AKKA 3ZEHA 1WA7A 4A4FA 1YI2A 4XTYA 3MEVA 3OYBA 1PRLC 1W2BS 1AZEA 1K1ZA 2GFUA 2X3WD 4OB0B 2KQWA 1OPKA 4ORZA 1R8OB 3CCMQ 3GP8A 2QDLA 1QVGS 4FW2A 3BDLA 5J26A 1D3BB 2DVJA 5I22A 4PFOA 3QZ5B 1HYOA 4GLKA 2JS2A 1Z9ZA 3L2UA 3CCMT 3EGDB 2G3RA 2DM1A 5AT1B 1N8RC 1WZOA 1EX4A 1RAAB 3NTIA 2K3BA 3BFMA 1VQ4Q 3M55A 1D3BA 3G71A 2RI5A 2JMCA 2DRKA 2KROA 4DA4A 3BDUA 4R55A 1H641 3EGDA 4J6WA 3S3MA 1IO6A 2MIOA 4DBRA 1AWXA 3META 5IAYA 1VQ4T 1I8FA 4DQ2A 2DTHA 5A2QE 3FEOA 2F2VA 4MMLA 2DNUA 1LVKA 1H8KA 4OGCA 4MZPA 2GGRA 1BI1A 4EMKC 3EG2A 1KHCA 1ZSGA 1ZUKA 1CKAA 5KE3A 4BUGA 1NJIU 5GAMh 1K8AR 2J7IA 3ULRB 2VVKA 2DXUA 3OYEA 5EC7A 1ZUYA 1W4SA 2HNIA 5I2MA 3OYJA 1UFFA 3HRUA 1QKWA 4PJLA 4C8QG 5HK3A 3A8LB 4QT7A 2M0OA 3M5AA 4HCZA 5DLQE 5LJ3j 2K2VA 2KY9A 1ZBXA 1VQ5Q 3CCEA 2D1XA 4D8KA 1U5SA 1HK9A 1BI0A 1XOVA 5GMKm 4B6MA 2YUNA 2QA4A 4C92G 3NHNA 2A0FB 3IQLA 4E6RA 1VQ5T 4HVUA 4HT8A 2DEQA 1BB9A 1XNIA 1JXOA 2GQVA 1WHKA 4E47A 4M7DE 2V1RA 1KC8R 2EVRA 4M7DD 2V1QA 2F5KA 4II1A 3VJPA 4C0DB 3M0QA 1Y96B 3F70A 2GF7A 5CKHA 2VC8A 1AEYA 1E6HA 2DVEA 1JJ2P 2DXBA 3A8MB 2SRCA 2YHTA 4AFSC 1VQLQ 4OMOA 4C8QB 1TS9A 1Y96A 2E64A 1UHFA 1VQ9Q 3LGLA 3OB9A 2RJFA 2LX9A 3FRNA 3MP1A 2AIRB 1JU5C 4DOVA 4FCYA 1VQLT 1AD5A 2VUBA 1M30A 3EFOB 1MGQA 3HTRA 3G4SA 2F5TX 1VQ9T 2I2LA 1X6OA 4XU3A 4HT9A 2KNBB 2JTEA 4C8QA 4C92B 1MMNA 3VS4A 2LCLA 1JJ2S 3VS2A 1RAHB 3EFOA 2EQKA 2HQHA 4XTXA 4MDXA 4J9BA 2DL5A 2K5LA 4AFQC 2GTOA 4C92A 1BIBA 5GAMe 2D8JA 3MO8A 2BIVA 4XAXB 3E1SA 1VOMA 4OMPA 5I21A 1G3TA 4MZMA 3QZ9B 1GRIA 4J9DA 4HA8A 1N9SA 1FYNA 1PCXA 5GANj 4J9GA 2DIGA 1M8VA 4RTTA 3NTHA 1VYUA 5FU7C 5KYWA 3A1PA 1WXBA 5GAMf 4KGXB 5GAN4 4AFUC 5GAN3 3H0FA 4NL3A 2QQAA 3C0CA 2HQXA 5M9OA 2GQIA 3VRYA 2PVGB 1LNXA 1TTHB 3TREA 4QQDA 5GAOl 4C0GA 1M1GA 1W70A 5GJWB 3DB3A 1N8RR 1RI0A 1LJOA 2VWFA 4M77F 5GAOr 1K9AA 3J7AF 2OX7A 1Q7YC 3JCMX 2RHIA 2VB6A 4F7UF 4J7IA 3GBQA 3O8VA 4HVWA 2WSCE 3CBMA 3QYHB 3G6EA 3OA6A 2X4WA 5J3BA 1QCNA 3DB4A 1GBQA 2QQ9A 3LX7A 3OYGA 2O9VA 1GCQC 3OYNA 2D0QB 3M4GA 3VV0A 2DYBA 1IHVA 2LJ1A 2KYBA 4AFZC 3CCVA 2QDYB 4QVCA 1KK7A 4BDZA 2JVVA 5GMKj 1C1AA 3WXMB 1YWPA 3FIFA 2J06A 2O4XA 4RTWA 5ECAA 2RNAA 3PIPA 1Q81R 2VASA 3LYIA 2EKHA 2KBTA 1LPLA 3E9GA 5IH2A 3VRZA 3OSSC 3M0PA 4WF2A 2DBKA 1I5LA 1TOVA 4E7KA 3X20B 4M77D 2PUOB 1YN8A 2LC4A 2C0IA 1N5ZA 2XKOC 1N6AA 4M4ZA 4PJOE 1QP3A 4FU6A 1VQMA 3PVLA 2RJCA 1C6VX 4E7LA 1YFNA 1AOJA 2HBWA 2P84A 5CO7A 2K3YA 4WCIA 1RL2A 4OMFB 5IN1A 4JUVA 2LT1A 4L59A 2MK5A 2KI7A 1NG2A 2EYZA 1S72A 3PGGA 2HEQA 2FPDA 2DTOA 1YJWA 4P5NA 4M75E 5IHKA 1UGRB 2XIDA 2P0QA 1UTIA 1YIJA 2XD0A 2MF2A 3TQ7P 4J9HA 5GAOq 1I4K1 2L89A 2QTXA 4K11A 1T0JA 3RBBB 1UGPB 4D8DA 3TCJA 2FG0A 3MCAB 3QBYA 1D09B 4XQ3A 3P8DA 3GOXA 4KUIA 1G3SA 3OS1A 1ZSZC 1HJDA 4M7DC 2RM4A 2MWOA 4A4KA 2K79A 1TH7A 1WJQA 5C0MA 2CSQA 5FWCA 2PVDB 2E5QA 2H3EB 2M0YA 2DFUA 1WIEA 1EIFA 5IXBA 3I5RA 1M2VA 3GF5A 4FIBA 1D1CA 2V8KA 3C12A 2L3PA 2HMAA 1WX6A 3M4YA 3CMEA 4XU2A 2ZPBB 5D7UA 2FVUA 2MWPA 3KUFA 1AWJA 2RQVA 3KFVA 2RPNA 2JZ2A 2YUQA 4M78E 4ELYC 4HKEA 2RQTA 3L2ZA 4JZ4A 5KCOA 3C95A 1E7OA 1Q7YR 1BYMA 2E3HA 2RO0A 2LT4A 4MZTA 2H8HA 1XTDA 1K73R 1QQJA 4O6JA 3GPLA 2Y4YA 4LNPA 2Y90A 2EFIA 4M75G 3OYHA 5LJ3h 4QQGA 3UA6A 5GAOm 1TG0A 4L6V5 2DL4A 3X25B 1AZGB 2ATCB 5LL6S 2KT8A 2BZ8A 3RNJA 3QSUA 2DL3A 3QDRB 1X01A 5IXFA 4PJOB 2A37A 2P0PA 4BY6B 1OQKA 2X4JA 3M56A 3LWIA 3CC4A 1AVZC 4FSSA 1B07A 4EDUA 1Q86C 1VYVA 5GAMg 4BE0A 4J6XA 2YRVA 1HD3A 1QKXA 3JB9G 4PJOA 2K57A 4IURA 4RTXA 1VQ5A 2YRDA 2KSSA 2JM9A 2K7AA 2KVQG 4ZTJA 5KYNA 1SHGA 3FB9A 3I56A 3S6WA 1WGSA 1VQ7A 3EFRA 1G3WA 1M90R 4C5EA 2X51A 3C4SA 1QWFA 4M75B 1X6BA 2MMPA 3H0IA 2YLBA 3I5SA 1YHQQ 1I5OB 4LD9K 4BB7A 3CXCA 3EHRA 2D8HA 4N0AA 4M78G 2EYYA 2OTLA 4JJDA 8ATCB 1WJSA 2E6ZA 2DJZA 2OJ2A 1YHQT 1K9MR 2IG0A 1TWBA 3TSZA 4M75A 2DXTA 3L2WA 4IUQA 4ME7A 2RQUA 4OB2B 3WVDB 2BUDA 2VYTA 3JAME 1VQLA 2ENMA 2RQWA 4A63B 4OGEA 3INZA 1U1SA 3A8OB 3EAEA 1I1JA 2CKKA 1ZA1B 2FPEA 2EPDA 1SSFA 2DETA 4PLIA 2J6KA 2E3IA 1NPPA 1NJIC 5GAMd 3OYMA 3RUXA 1MMDA 2XG8D 2HCKA 5CKBA 1JXMA 2AT1B 2BZYA 4J9FA 1WXTA 1IREB 4FYVB 2L5QA 2KXCA 1YJNQ 2F2WA 5LJ3e 1K8AU 4M77C 1MHNA 3QWXX 2ZPEB 4C8QD 4OMNA 1VQKA 3M54A 4M78B 1YJNT 1RAIB 1JBMA 3RESA 3GIBA 5LJ5j 1GBRA 4FL6A 5DM7R 3OW2A 1B7TA 1M4ZA 1NZ9A 1RADB 1KIKA 2FZGB 5LJ3f 1VA7A 2KT1A 4PKCC 2E65A 1E6GA 4C92E 4E7ZA 1OI1A 4C92D 4M78A 3QUIA 1I81A 5FU6C 2NUPA 3QJYA 3HRTA 4M7AE 1VQOA 3QJ6A 1IZ6A 2QQSA 3BY7A 4OB3B 3EG1A 1KC8U 2GTJA 2R5AA 1WXUA 1MNDA 5KYYB 2CZ1B 2RMOA 4IIOA 4IUTA 5GAOn 4M7DF 4ANJA 3PMIA 3CD6A 3G1JA 2D9TA 1K76A 2RN8A 3MP8A 2ROLA 3CMAA 4RTUA 2AK5A 2DE0X 1RAEB 1KD1R 5KYYA 1WQWA 2A28A 2C0OA 4EIKA 3MHXA 5KYXB 2FZKB 3JSCA 2LQWA 3V8JA 4PFZA 1SSHA 1PWTA 1M1KR 1X43A 2E41A 5GAN8
chains in the Genus database with same CATH topology
1ARKA 2O9SA 2W10A 3REAB 1T0HA 2YUOA 3REBB 2IIMA 1TUCA 4RTVA 1W70A 5GJWB 2FO0A 2LZ6B 1UJYA 2CUBA 2XMFA 2VWFA 4GBQA 2J05A 1K4US 1K9AA 3EHQA 1OOTA 2J6OA 3NMZC 2DLPA 4CC3A 4Z8AA 3M0UA 1M27C 1ZBJA 3GBQA 2O31A 4HVWA 3NGPA 1X69A 4J9EA 4JJCA 1I07A 1PKTA 2DF6A 3EG3A 1GBQA 4LUEA 1U06A 2O9VA 1GCQC 1JQQA 2CDTA 3NPFA 2HSPA 2DYBA 2LJ1A 1MV0B 3UF4A 4KRTA 2KYBA 4AFZC 1H92A 1TUDA 1UHCA 1RUWA 1GL5A 1GFCA 4ESRA 1UUEA 3SEMA 2P4RA 1ZX6A 1YWPA 2J06A 4RTWA 2DL7A 3EG0A 5ECAA 2O88A 2RNAA 1Y0MA 2KEAA 3SHWA 1K0XA 2EKHA 2FEIA 2KBTA 1M3CA 1OV3A 4IIMA 3H0HA 2KXDA 4CC4B 5IH2A 2KGTA 2ECZA 3VRZA 1WDXA 2K9GA 4DEYA 2YDLA 3M0PA 4RTYA 1GFDA 2DBKA 4R0KA 1PNJA 4F16A 1YN8A 1NEGA 1H3HA 2L2PA 2LCSA 1FMKA 1N5ZA 2C0IA 2DL8A 3TVTA 2LJ3A 1AWWA 4M4ZA 1VYTA 2CUDA 1JO8A 4AG2C 1SEMA 3PVLA 1BBZA 2O2OA 5HCKA 1AOJA 3QWYA 2HBWA 2A08A 2JW4A 1BK2A 1GCPA 2DILA 2AKLA 1W6XA 4WCIA 1JEGA 1RLQC 1UG1A 1NG2A 2YT6A 2EYZA 2CH4W 4GLMA 1X2KA 1CKBA 2D0NA 3UATA 2HEQA 1MV3A 2FPDA 1UE9A 3H41A 4J9IA 2KRSA 4HVVA 2K6DA 5IHKA 1ABQA 3ZL7C 1UTIA 2G6FX 2JXBA 1WI7A 2K2MA 2AZSA 3VS5A 4J9HA 2L0AA 1PHTA 5GJVB 1S1NA 2FRYA 4X1VA 3M0RA 2DMOA 4K11A 2KE9A 2RF0A 1T0JA 3RBBB 4D8DA 1KJWA 2DJQA 2FG0A 1KFZA 1CSKA 1I0CA 3I35A 1WFWA 1B3QA 2E5KA 2JS0A 1X6GA 1T3SA 2YUPA 1HJDA 1QWEA 1QCFA 1NEBA 2LJ0A 1NYGA 1SHFA 2K79A 5IHNA 2M51A 1J3TA 2CSQA 5FWCA 2AZVA 2NWMA 2W0ZA 1AWOA 1ABOA 2M0YA 4JZ3A 3I9QA 2SEMA 1WIEA 5IXBA 5I11A 3I5RA 3VS6A 2L3PA 4RTZA 1WX6A 3CQTA 4OMMA 1SPKA 3FJ5A 1AWJA 2CT4A 2MCNA 2RQVA 1M3BA 3KFVA 4JJBA 1KSWA 1SRLA 4LE9A 1OPLA 2RPNA 2PTKA 1WLPB 2YUQA 1M3AA 3M0TA 2RQTA 2CH4A 4JZ4A 2C0TA 2GBQA 1E7OA 3THKA 1NLOC 1U3OA 2EBPA 4OMQA 3VS0A 1W1FA 2H8HA 4Y92A 1T3LA 2ROTA 2AKKA 1WA7A 1PRLC 3A98A 4HCKA 4LNPA 2NUZA 1NLPC 2LNHB 1SRMA 4DEXA 2EGEA 1AZEA 3UA6A 1K1ZA 3VS7A 1TG0A 2DL4A 2KYMA 2KRMA 1ZLMA 2X3WD 1OPKA 2EQIA 4ORZA 1AZGB 1GCQA 1PKSA 2QDLA 3U23A 2J6FA 2KT8A 2BZ8A 2DBMA 3RNJA 1YNZA 2DL3A 2DVJA 5IHIA 1K0SA 5I22A 5IXFA 2A37A 2JS2A 1Z9ZA 3VS3A 2I0NA 4LN2A 2DM1A 1AVZC 4FSSA 1B07A 2LMJA 1VYVA 2L3SA 2K3BA 2EW3A 1UJ0A 1UDLA 2CREA 1Y57A 1HD3A 1QKXA 2JMCA 2A36A 2DRKA 2KROA 2DRMA 2EYXA 1NM7A 4RTXA 5FWBA 1IO6A 1LCKA 2MIOA 1AWXA 2JM8A 2JM9A 2K7AA 2F2VA 3TSWA 3VS1A 2DNUA 1SHGA 1H8KA 1A0NB 1ZUUA 1BU1A 2GGRA 4Z88A 2L3QA 3EG2A 1ZSGA 3PVQA 1ZUKA 1CKAA 1QWFA 1X6BA 3H0IA 4Z89A 3I5SA 5L23A 2J7IA 3ULRB 2VVKA 5EC7A 3EHRA 2D8HA 1ZUYA 2EYYA 3PE0A 4JJDA 1WYXA 2VKNA 2RQRA 2OJ2A 1UFFA 2GNCA 1QKWA 2HDAA 3TSZA 4QT7A 4F14A 2RQUA 1OEBA 2ENMA 2RQWA 4A63B 2D1XA 4D8KA 1MUZA 1U5SA 1XOVA 4LUDA 1I1JA 2YUNA 2B86A 4RUGA 2FPEA 3NHNA 2EPDA 3IQLA 2LQNA 4E6RA 4HVUA 2J6KA 2KRNA 1BB9A 2F2XA 1JXOA 5FW9A 1RLPC 2HCKA 2V1RA 1JXMA 2EVRA 2FRWA 2BZYA 2V1QA 4J9FA 1G83A 1WXTA 4HXJA 2PZ1A 3M0QA 3EGUA 2KXCA 2YSQA 2F2WA 3QWXX 2ED1A 4OMNA 1AEYA 1E6HA 2BTTA 1EFNA 1PRMC 2SRCA 1GBRA 3LH5A 3UA7A 3R6NA 4AFSC 4OMOA 1YP5A 1NYFA 2CT3A 4ZNXA 2LP5A 1UHFA 4CC7A 1KIKA 2EYWA 1VA7A 2ESWA 2KT1A 1JU5C 1E6GA 2ABLA 1UGVA 1AD5A 1M30A 2DA9A 2X3XD 1M8MA 1HSQA 2KNBB 2JTEA 3VS4A 2FPFA 1YCSB 2DX1A 4F17A 3VS2A 3M0SA 4J9CA 2PNIA 3EG1A 2OI3A 4JPBW 2EGAA 2CSIA 4OMLA 1G2BA 2DL5A 2GTJA 3O5ZA 4J9BA 4AFQC 2EGCA 1WXUA 1X2QA 1Z9QA 1QLYA 2GTOA 2MOXA 2RMOA 4IIOA 2JT4A 2D8JA 2LX7A 4OMPA 2OAWA 1GRIA 4J9DA 4AG1C 3JV3A 1FYNA 1K76A 2RN8A 1RI9A 2BZXA 4J9GA 2ROLA 2JMAA 2ED0A 4RTUA 2AK5A 2DE0X 4RTTA 1YWOA 1VYUA 1WXBA 2A28A 2C0OA 4EIKA 4CC2A 1UECA 4AFUC 1V1CA 1X27A 2LQWA 3H0FA 3C0CA 1SSHA 1PWTA 2GQIA 1X43A 2KR3A 3VRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARK A;  2O9S A;  2W10 A;  3REA B;  1T0H A;  2YUO A;  3REB B;  2IIM A;  1TUC A;  4RTV A;  1W70 A;  5GJW B;  2FO0 A;  2LZ6 B;  1UJY A;  2CUB A;  2XMF A;  2VWF A;  4GBQ A;  2J05 A;  1K4U S;  1K9A A;  3EHQ A;  1OOT A;  2J6O A;  3NMZ C;  2DLP A;  4CC3 A;  4Z8A A;  3M0U A;  1M27 C;  1ZBJ A;  3GBQ A;  2O31 A;  4HVW A;  3NGP A;  1X69 A;  4J9E A;  4JJC A;  1I07 A;  1PKT A;  2DF6 A;  3EG3 A;  1GBQ A;  4LUE A;  1U06 A;  2O9V A;  1GCQ C;  1JQQ A;  2CDT A;  3NPF A;  2HSP A;  2DYB A;  2LJ1 A;  1MV0 B;  3UF4 A;  4KRT A;  2KYB A;  4AFZ C;  1H92 A;  1TUD A;  1UHC A;  1RUW A;  1GL5 A;  1GFC A;  4ESR A;  1UUE A;  3SEM A;  2P4R A;  1ZX6 A;  1YWP A;  2J06 A;  4RTW A;  2DL7 A;  3EG0 A;  5ECA A;  2O88 A;  2RNA A;  1Y0M A;  2KEA A;  3SHW A;  1K0X A;  2EKH A;  2FEI A;  2KBT A;  1M3C A;  1OV3 A;  4IIM A;  3H0H A;  2KXD A;  4CC4 B;  5IH2 A;  2KGT A;  2ECZ A;  3VRZ A;  1WDX A;  2K9G A;  4DEY A;  2YDL A;  3M0P A;  4RTY A;  1GFD A;  2DBK A;  4R0K A;  1PNJ A;  4F16 A;  1YN8 A;  1NEG A;  1H3H A;  2L2P A;  2LCS A;  1FMK A;  1N5Z A;  2C0I A;  2DL8 A;  3TVT A;  2LJ3 A;  1AWW A;  4M4Z A;  1VYT A;  2CUD A;  1JO8 A;  4AG2 C;  1SEM A;  3PVL A;  1BBZ A;  2O2O A;  5HCK A;  1AOJ A;  3QWY A;  2HBW A;  2A08 A;  2JW4 A;  1BK2 A;  1GCP A;  2DIL A;  2AKL A;  1W6X A;  4WCI A;  1JEG A;  1RLQ C;  1UG1 A;  1NG2 A;  2YT6 A;  2EYZ A;  2CH4 W;  4GLM A;  1X2K A;  1CKB A;  2D0N A;  3UAT A;  2HEQ A;  1MV3 A;  2FPD A;  1UE9 A;  3H41 A;  4J9I A;  2KRS A;  4HVV A;  2K6D A;  5IHK A;  1ABQ A;  3ZL7 C;  1UTI A;  2G6F X;  2JXB A;  1WI7 A;  2K2M A;  2AZS A;  3VS5 A;  4J9H A;  2L0A A;  1PHT A;  5GJV B;  1S1N A;  2FRY A;  4X1V A;  3M0R A;  2DMO A;  4K11 A;  2KE9 A;  2RF0 A;  1T0J A;  3RBB B;  4D8D A;  1KJW A;  2DJQ A;  2FG0 A;  1KFZ A;  1CSK A;  1I0C A;  3I35 A;  1WFW A;  1B3Q A;  2E5K A;  2JS0 A;  1X6G A;  1T3S A;  2YUP A;  1HJD A;  1QWE A;  1QCF A;  1NEB A;  2LJ0 A;  1NYG A;  1SHF A;  2K79 A;  5IHN A;  2M51 A;  1J3T A;  2CSQ A;  5FWC A;  2AZV A;  2NWM A;  2W0Z A;  1AWO A;  1ABO A;  2M0Y A;  4JZ3 A;  3I9Q A;  2SEM A;  1WIE A;  5IXB A;  5I11 A;  3I5R A;  3VS6 A;  2L3P A;  4RTZ A;  1WX6 A;  3CQT A;  4OMM A;  1SPK A;  3FJ5 A;  1AWJ A;  2CT4 A;  2MCN A;  2RQV A;  1M3B A;  3KFV A;  4JJB A;  1KSW A;  1SRL A;  4LE9 A;  1OPL A;  2RPN A;  2PTK A;  1WLP B;  2YUQ A;  1M3A A;  3M0T A;  2RQT A;  2CH4 A;  4JZ4 A;  2C0T A;  2GBQ A;  1E7O A;  3THK A;  1NLO C;  1U3O A;  2EBP A;  4OMQ A;  3VS0 A;  1W1F A;  2H8H A;  4Y92 A;  1T3L A;  2ROT A;  2AKK A;  1WA7 A;  1PRL C;  3A98 A;  4HCK A;  4LNP A;  2NUZ A;  1NLP C;  2LNH B;  1SRM A;  4DEX A;  2EGE A;  1AZE A;  3UA6 A;  1K1Z A;  3VS7 A;  1TG0 A;  2DL4 A;  2KYM A;  2KRM A;  1ZLM A;  2X3W D;  1OPK A;  2EQI A;  4ORZ A;  1AZG B;  1GCQ A;  1PKS A;  2QDL A;  3U23 A;  2J6F A;  2KT8 A;  2BZ8 A;  2DBM A;  3RNJ A;  1YNZ A;  2DL3 A;  2DVJ A;  5IHI A;  1K0S A;  5I22 A;  5IXF A;  2A37 A;  2JS2 A;  1Z9Z A;  3VS3 A;  2I0N A;  4LN2 A;  2DM1 A;  1AVZ C;  4FSS A;  1B07 A;  2LMJ A;  1VYV A;  2L3S A;  2K3B A;  2EW3 A;  1UJ0 A;  1UDL A;  2CRE A;  1Y57 A;  1HD3 A;  1QKX A;  2JMC A;  2A36 A;  2DRK A;  2KRO A;  2DRM A;  2EYX A;  1NM7 A;  4RTX A;  5FWB A;  1IO6 A;  1LCK A;  2MIO A;  1AWX A;  2JM8 A;  2JM9 A;  2K7A A;  2F2V A;  3TSW A;  3VS1 A;  2DNU A;  1SHG A;  1H8K A;  1A0N B;  1ZUU A;  1BU1 A;  2GGR A;  4Z88 A;  2L3Q A;  3EG2 A;  1ZSG A;  3PVQ A;  1ZUK A;  1CKA A;  1QWF A;  1X6B A;  3H0I A;  4Z89 A;  3I5S A;  5L23 A;  2J7I A;  3ULR B;  2VVK A;  5EC7 A;  3EHR A;  2D8H A;  1ZUY A;  2EYY A;  3PE0 A;  4JJD A;  1WYX A;  2VKN A;  2RQR A;  2OJ2 A;  1UFF A;  2GNC A;  1QKW A;  2HDA A;  3TSZ A;  4QT7 A;  4F14 A;  2RQU A;  1OEB A;  2ENM A;  2RQW A;  4A63 B;  2D1X A;  4D8K A;  1MUZ A;  1U5S A;  1XOV A;  4LUD A;  1I1J A;  2YUN A;  2B86 A;  4RUG A;  2FPE A;  3NHN A;  2EPD A;  3IQL A;  2LQN A;  4E6R A;  4HVU A;  2J6K A;  2KRN A;  1BB9 A;  2F2X A;  1JXO A;  5FW9 A;  1RLP C;  2HCK A;  2V1R A;  1JXM A;  2EVR A;  2FRW A;  2BZY A;  2V1Q A;  4J9F A;  1G83 A;  1WXT A;  4HXJ A;  2PZ1 A;  3M0Q A;  3EGU A;  2KXC A;  2YSQ A;  2F2W A;  3QWX X;  2ED1 A;  4OMN A;  1AEY A;  1E6H A;  2BTT A;  1EFN A;  1PRM C;  2SRC A;  1GBR A;  3LH5 A;  3UA7 A;  3R6N A;  4AFS C;  4OMO A;  1YP5 A;  1NYF A;  2CT3 A;  4ZNX A;  2LP5 A;  1UHF A;  4CC7 A;  1KIK A;  2EYW A;  1VA7 A;  2ESW A;  2KT1 A;  1JU5 C;  1E6G A;  2ABL A;  1UGV A;  1AD5 A;  1M30 A;  2DA9 A;  2X3X D;  1M8M A;  1HSQ A;  2KNB B;  2JTE A;  3VS4 A;  2FPF A;  1YCS B;  2DX1 A;  4F17 A;  3VS2 A;  3M0S A;  4J9C A;  2PNI A;  3EG1 A;  2OI3 A;  4JPB W;  2EGA A;  2CSI A;  4OML A;  1G2B A;  2DL5 A;  2GTJ A;  3O5Z A;  4J9B A;  4AFQ C;  2EGC A;  1WXU A;  1X2Q A;  1Z9Q A;  1QLY A;  2GTO A;  2MOX A;  2RMO A;  4IIO A;  2JT4 A;  2D8J A;  2LX7 A;  4OMP A;  2OAW A;  1GRI A;  4J9D A;  4AG1 C;  3JV3 A;  1FYN A;  1K76 A;  2RN8 A;  1RI9 A;  2BZX A;  4J9G A;  2ROL A;  2JMA A;  2ED0 A;  4RTU A;  2AK5 A;  2DE0 X;  4RTT A;  1YWO A;  1VYU A;  1WXB A;  2A28 A;  2C0O A;  4EIK A;  4CC2 A;  1UEC A;  4AFU C;  1V1C A;  1X27 A;  2LQW A;  3H0F A;  3C0C A;  1SSH A;  1PWT A;  2GQI A;  1X43 A;  2KR3 A;  3VRY A; 
#chains in the Genus database with same CATH topology
 2W10 A;  3OQ5 A;  3REA B;  4RG8 A;  5HK0 A;  1TUC A;  2QAS A;  2LQK A;  1HXD A;  2LZ6 B;  4Q5W A;  3CEY A;  5KYX A;  1Q86 R;  3JB9 J;  2J05 A;  4C0Z A;  2CP2 A;  1OOT A;  2J6O A;  1WJR A;  3NMZ C;  2Y4X A;  4ELZ C;  3CC2 Q;  1ZQ1 A;  4Y91 A;  2EKO A;  4JRI A;  2LRQ A;  1LOJ A;  4EMH A;  5GAN f;  3EG3 A;  1W2B A;  2K5F A;  3OYD A;  1OZ3 A;  4M7A G;  3CC2 T;  1JQQ A;  2CDT A;  3NPF A;  2X4X A;  1Q82 U;  1UEB A;  3JCM V;  2QTV A;  2RHZ A;  4X9C A;  3UF4 A;  1QVG A;  2COZ A;  3HFO A;  1H92 A;  1QMC A;  3PFS A;  2CP3 A;  2K5I A;  1RUW A;  3SEM A;  2P4R A;  1ZX6 A;  3OS0 A;  3HHT B;  4ZTF A;  3JCM b;  5CVI A;  1K0X A;  2DPP B;  2FEI A;  4XTV A;  4JRQ A;  1YIT Q;  1QW1 A;  2KXD A;  4CC4 B;  3CC7 Q;  5GAO p;  2NUT B;  4RTY A;  3AT1 B;  3NFC A;  1YIT T;  2M16 A;  4F16 A;  1H3H A;  3CC7 T;  2L2P A;  3SWN B;  2DL8 A;  1BCO A;  1U1T A;  1OU9 A;  2LJ3 A;  4PFP A;  2EQM A;  4RCC A;  1SEM A;  1R0B G;  5D6X A;  4M7A B;  3CCQ Q;  3OYF A;  4RG2 A;  2NUT A;  1OU8 A;  2QG9 B;  2EJG A;  2B8A A;  1TU0 B;  2A08 A;  2QEX A;  2FZC B;  1BK2 A;  3CCQ T;  4JRP A;  3SWN A;  2DER A;  4E2F B;  1B34 B;  2WSE E;  3OBY A;  2RHX A;  1TUG B;  2LDM A;  3OBW A;  1RLQ C;  1N9R A;  2YT6 A;  4M7A A;  2CGH A;  3DLM A;  4DOW A;  1IGU A;  3MEU A;  4GLM A;  1X2K A;  1X75 C;  4N4H A;  1Q81 U;  3PIO A;  4XK8 E;  1CKB A;  3UAT A;  2NLU A;  2IPO B;  1SKU B;  5CK9 A;  2HKN A;  3JB9 I;  3H41 A;  4J9I A;  4MMK A;  1B34 A;  3SB2 A;  2BE7 D;  1G5V A;  2EQJ A;  2KMT A;  5FRM A;  1D1A A;  3JRZ A;  1WI7 A;  2COW A;  3L2R A;  2K2M A;  4QVZ A;  4E7I A;  2HD0 A;  2L0A A;  3MP6 A;  1S1N A;  2DYI A;  2FRY A;  4X1V A;  2DMO A;  2A7Y A;  4FYW B;  4FM4 B;  1KQS P;  4RMO A;  1KFZ A;  4C0D C;  1B3Q A;  3CCJ A;  2E5K A;  1BI2 A;  3RKY A;  4PJO F;  4GY5 A;  3CPW P;  1QWE A;  3RIR A;  3G71 Q;  1NEB A;  2CZ7 B;  2COY A;  2PU9 B;  1D0Z A;  5IHN A;  1J3T A;  4NL2 A;  4FW1 A;  2AZV A;  2NWM A;  3M59 A;  1ABO A;  3OYA A;  1OX8 A;  3HKS A;  3G71 T;  4C8Q C;  4LDW A;  2L8D A;  2H3J A;  2RD1 A;  4XU0 A;  3CCL A;  4J8O A;  1KQS S;  4PL6 A;  3CCU A;  2CT4 A;  1JJ2 A;  2CP7 A;  4LE9 A;  5LJ3 g;  4C92 C;  3CPW S;  3E19 A;  4X9D A;  2RK1 A;  4IUU A;  1M3A A;  2RI2 A;  3OY9 A;  3THK A;  3CCS A;  4OMQ A;  4QW2 A;  4HCB A;  4Y92 A;  1VQN A;  3A8G B;  4JS4 A;  4CI0 C;  3EGX B;  3A98 A;  4HCK A;  4Y28 E;  3CCE Q;  2NUZ A;  2LNH B;  4DEX A;  1PD0 A;  1UGS B;  3VS7 A;  2ZPF B;  1N27 A;  2KYM A;  1WPY A;  1ZLM A;  3CCR A;  2MYS A;  3CCE T;  4PJO D;  2C06 A;  1PKS A;  2RI3 A;  1NBE B;  3QYG B;  3U23 A;  4ZGJ B;  2J6F A;  2HAX A;  1BKB A;  4UC4 A;  1YNZ A;  1SG5 A;  4PJN A;  1VQ8 Q;  3EGX A;  3S3O A;  4XU1 A;  2P0K A;  4LDY A;  2RB6 A;  3V7C A;  5FRO A;  4LN2 A;  4F04 B;  3A5Z B;  1OZ2 A;  2X35 A;  1VQ8 T;  4O5V A;  2LMJ A;  2L3S A;  4KGV B;  2EW3 A;  2CRE A;  3QDF A;  2DO3 A;  2DRM A;  4DBF A;  1NM7 A;  1U8R A;  4BI4 A;  5FWB A;  4LDU A;  3HRS A;  1VQP A;  5LJ3 d;  2JM8 A;  3QO3 A;  1YJ9 A;  5LJ5 h;  4LDX A;  3VS1 A;  4M75 D;  1VQ6 A;  3PMT A;  5GAN 2;  1K73 U;  3CBP A;  4Z88 A;  2L3Q A;  3G4S Q;  4JLI A;  2E6N A;  4Z89 A;  2HL5 C;  5L23 A;  3BW1 A;  1V29 B;  5GAN 5;  1TXQ A;  1M5Q 1;  5AYF A;  4TVR A;  3G4S T;  1RAC B;  3OMG A;  3I55 A;  3PE0 A;  2R58 A;  2VKN A;  2VGM A;  1YJN A;  2GNC A;  5GAN g;  4F14 A;  2XDD A;  2EIF A;  3JCM h;  4JJN K;  4Z02 A;  3PTA A;  3D7S B;  1MUZ A;  4ZGD B;  2FL7 A;  2B86 A;  4RUG A;  2LQN A;  3RER A;  4VUB A;  1QVF S;  3CCM A;  2KRN A;  4M77 G;  4JLG A;  5FW9 A;  2YLC A;  1VIF A;  4BE2 A;  4KUL A;  3NTK A;  1JB0 E;  1M90 U;  2PZ1 A;  4F7U G;  1WHM A;  5J39 A;  3EGU A;  2QXF A;  4M78 D;  4QKU A;  5KYU B;  4RKU E;  2VXE A;  1M2O A;  3OYY A;  2ED1 A;  1VQ4 A;  2XDP A;  2CP0 A;  2DIQ A;  1EFN A;  3JB9 H;  1BIA A;  1FXX A;  1PRM C;  2F69 A;  1K9M U;  1NPR A;  2YRC A;  3GLX A;  2E1H A;  3PT9 A;  4ZNX A;  2P4T A;  4PK4 A;  4CC7 A;  2EYW A;  2A3L A;  2ESW A;  5KYU A;  2QI2 A;  1VUB A;  2ZPG B;  1UGV A;  2DD5 A;  3FDR A;  2VV5 A;  2DA9 A;  5CKF A;  2X3X D;  3VU3 C;  1M8M A;  1HSQ A;  3X28 B;  4JRK A;  3OMC A;  1QCO A;  4E7J A;  2DX1 A;  2MI6 A;  2CZ6 B;  4M77 B;  3CCV Q;  3HFN A;  5LJ5 e;  4J9C A;  3J80 E;  1GXI E;  2OI3 A;  4FSX A;  4JPB W;  2PUK B;  2HZY A;  1XJW B;  3O5Z A;  4XTZ A;  3CCV T;  4F7U B;  1Z9Q A;  4RCB A;  1JRI A;  2MOX A;  2BKD N;  2LX7 A;  3KBG A;  4OF1 A;  3V7S A;  5LJ5 f;  4AG1 C;  3JV3 A;  3UDC A;  4A53 A;  1RI9 A;  2BZX A;  3OW2 S;  2DKG A;  2JMA A;  2ED0 A;  4C8Q F;  4F7U A;  3GNF B;  1YWO A;  4BI3 A;  3BE3 A;  3C94 A;  1V1C A;  1QVP A;  3JCM e;  1OUL A;  2LQ8 A;  1ARK A;  2O9S A;  4EMG A;  1VQM Q;  1T0H A;  3REB B;  4C5H A;  1KC8 C;  4QVD A;  4C92 F;  3DKM A;  2RA2 A;  4R56 A;  1UJY A;  2XMF A;  3JCM f;  1VQM T;  3V8K A;  1PG5 B;  4C0F A;  2L3R A;  2CS7 A;  1VQ9 A;  2DLP A;  2KK4 A;  3EG9 B;  4Z8A A;  3M0U A;  4EMK B;  4OVA A;  1M27 C;  3JCM Q;  3L2Q A;  3MPU B;  3NGP A;  1S72 Q;  1X69 A;  4J9E A;  3CC7 A;  4JJC A;  1I07 A;  1PKT A;  3SD4 A;  5GAN h;  4N4G A;  4J83 A;  2WSF E;  1YJW Q;  1RAB B;  3CPF A;  1S72 T;  5IT9 E;  1PSF A;  3MKD A;  4KRT A;  3EG9 A;  2KDS A;  1KD1 U;  4EMK A;  1TUD A;  1YJW T;  1UHC A;  3V7R A;  1GFC A;  4ESR A;  1M1K U;  3M57 A;  2YXY A;  2DTI A;  4E7S A;  2EJ9 A;  1Y0M A;  2JUF A;  4PJO C;  4ZGE B;  2RK2 A;  1PD1 A;  2KEA A;  4BY6 C;  3HPW A;  1IGQ A;  1Q86 U;  1OV3 A;  4IIM A;  3H0H A;  4KBM B;  3L42 A;  2KGT A;  2K9G A;  1ZA2 B;  2JTM A;  2E4H A;  1P92 A;  1Q82 C;  3TU4 K;  4PJM A;  4M7A D;  3OS2 A;  4QQ6 A;  1IHW A;  1BI3 A;  3TVT A;  4N0A C;  3GNG A;  1JO8 A;  4AG2 C;  4BAC A;  3CME Q;  3EH2 A;  4KT0 E;  3TEE A;  3LGF A;  1V76 A;  2E70 A;  4M75 C;  5GMK h;  3CME T;  1FMV A;  1JEG A;  3RKW A;  4ATO A;  3CBO A;  3J81 E;  3QII A;  2CH4 W;  3FJP A;  3UWN A;  2JTF A;  4HCC A;  3AHU A;  5L8R E;  3QPH A;  1UE9 A;  2KRS A;  1NE8 A;  5CIU A;  1VIE A;  3ZL7 C;  2G6F X;  1KHI A;  4XTW A;  2AZS A;  3P8B B;  2WAC A;  1WNL A;  2E10 A;  2HKQ B;  1PHT A;  3L2V A;  2KE9 A;  5GAN e;  2RF0 A;  3N5B B;  1ACM B;  1UGQ B;  4IUV A;  3CC4 Q;  1KJW A;  2OTJ Q;  1I0C A;  3I35 A;  1WFW A;  4D6W A;  1AHJ B;  5DY9 A;  2JS0 A;  1X6G A;  1T3S A;  5FU7 B;  2CP5 A;  3CC4 T;  1Q81 C;  2OTJ T;  4NS5 A;  1NYG A;  1SHF A;  2M51 A;  4M78 C;  2E12 A;  2JJ9 A;  2R57 A;  2W0Z A;  3QXE B;  1AWO A;  1PSE A;  3I9Q A;  2SEM A;  3EFS A;  4A4G A;  2OAU A;  2LVM A;  5I11 A;  2XDB A;  3I56 Q;  1R77 A;  3RDV A;  3VS6 A;  1VQ7 Q;  2O01 E;  4FYX B;  3A8H B;  2X9H A;  3LLR A;  3CQT A;  5DLO A;  3I56 T;  2MCN A;  1VQ8 A;  3VUB A;  3ER0 A;  1M3B A;  1VQ7 T;  2PVO B;  1OPL A;  2OTL Q;  1Y7X A;  5CKD A;  2PTK A;  3URG A;  1WHG A;  1WQ7 A;  2HL3 A;  1N8R U;  3M0T A;  2C0T A;  2R5M A;  2GBQ A;  2OTL T;  1W1F A;  2ROT A;  2GFA A;  5I2S A;  1NJI R;  5GMK e;  1NLP C;  3M9Q A;  4C5G A;  1SRM A;  4KGZ B;  3WVE B;  4JS5 A;  4KH1 B;  2EGE A;  2KRM A;  2D6F A;  5A0D A;  2EQI A;  2K4Y A;  1GCQ A;  3H6Z A;  7AT1 B;  2DBM A;  5A0L A;  5IHI A;  1K0S A;  2DXC A;  5CQX A;  4ZN1 A;  5LJ5 g;  2XHC A;  2ZZD A;  3VS3 A;  2I0N A;  4B9W A;  1O9S A;  1R0C B;  4BD3 A;  2EAY A;  1M9S A;  3SDZ A;  2DK3 A;  5HKC A;  2FYK A;  3X26 B;  1VQK Q;  1UJ0 A;  1UDL A;  2RHY A;  1Y57 A;  1H3Z A;  2HBP A;  2A36 A;  3FLG A;  4BE1 A;  5KYW B;  2PQW A;  2EYX A;  1YI2 Q;  2EJF A;  1VQK T;  1LCK A;  1KQ1 A;  3ZFJ A;  4LDV A;  2RJD A;  3L1A A;  3TSW A;  4PJJ A;  3JCM P;  2EYQ A;  1YI2 T;  2MPX C;  1Q82 R;  4LXC A;  1ZUU A;  1A0N B;  1BU1 A;  4IUP A;  1Y07 A;  3OSV A;  4PLL A;  3PVQ A;  3JCM g;  2GCX A;  4XTU A;  3VYG A;  4M7D G;  1VQO Q;  4JDS A;  1AT1 B;  1C0M A;  2M1H A;  2XI9 A;  4L5G A;  2Z0W A;  2MAM A;  3SFM A;  3ZBD A;  5GAN 6;  1KQ2 A;  1WYX A;  4YTL A;  1KG1 A;  1M1F A;  3MEA A;  2RQR A;  2QQR A;  1RAF B;  1VQO T;  5CR2 A;  2CZ0 B;  3ASK A;  2HDA A;  1ZHI A;  2QQB A;  4ZN3 A;  4C5I A;  1OEB A;  2QAZ A;  3OYC A;  1OYX A;  4DBQ A;  2XK0 A;  1RAG B;  5LJ5 d;  3CD6 Q;  4LUD A;  2FHD A;  1K73 C;  1YCY A;  3RMS A;  4DBH A;  2DZC A;  3CMA Q;  2VGN A;  2ZGW A;  3CD6 T;  2F2X A;  1WHH A;  3HL8 A;  3ME9 A;  3JCM c;  4OP0 A;  1RLP C;  2O4X B;  2FRW A;  3CMA T;  1G83 A;  2NYS A;  4HXJ A;  1Y71 A;  3SWN C;  1ZSZ B;  4M75 F;  2YSQ A;  2DD4 A;  4M7D B;  2ZCF B;  3G7Z A;  5KH6 A;  1PM3 A;  4M7A C;  2BTT A;  4MDW A;  3JCM d;  8AT1 B;  3KXT A;  4BDY A;  3LH5 A;  3UA7 A;  3R6N A;  2RH2 A;  2V8J A;  3M53 A;  1YP5 A;  1NYF A;  2CT3 A;  2LP5 A;  3RR6 A;  1IRX A;  1ZSZ A;  2BE9 B;  2QA4 Q;  5GAN 7;  4A4E A;  5FLX E;  4M7D A;  2ABL A;  5GAM j;  2YWW A;  1D1B A;  4EPC A;  4M77 E;  2QA4 T;  2K3X A;  1YHQ A;  1F1B B;  1O75 A;  3JB9 F;  2FPF A;  1M90 C;  1YCS B;  4F7U E;  4F17 A;  3HSB A;  2QYZ A;  2LTO A;  5D6W A;  3M0S A;  4PNO A;  1FMW A;  2PNI A;  2EGA A;  4N4I A;  2CSI A;  4NOY A;  4OML A;  3OYK A;  1G2B A;  2EGC A;  1X2Q A;  1QLY A;  3LH0 A;  3OYL A;  1K9M C;  2JT4 A;  3P8H A;  3UPU A;  4B9X A;  5A0G A;  1Q7Y U;  3M58 A;  2OAW A;  4M78 F;  4J6Y A;  1YBY A;  5KCH A;  2KAF A;  2QK0 A;  1MNE A;  4OB1 B;  4CC2 A;  1UEC A;  4E7H A;  1X27 A;  1G3Y A;  1QVF P;  2F1L A;  2QGF B;  4FT2 A;  4CRI A;  1D0X A;  1WHL A;  2KR3 A;  1KQS A;  2HQE A;  3OS5 A;  2YUO A;  3UT1 A;  2IIM A;  4RTV A;  4WTO B;  2FO0 A;  3V8L A;  3CPW A;  1EZZ B;  2CUB A;  2EQU A;  5D6Y A;  2QEX Q;  4GBQ A;  3CXC P;  1K4U S;  4AMC A;  3EHQ A;  3JB9 D;  5CQY A;  3DLL A;  2RHU A;  3RMQ A;  4CC3 A;  2QEX T;  1M2V B;  1ZBJ A;  2O31 A;  3QKJ A;  3MJX A;  3JCM W;  2DF6 A;  5FRN A;  4LUE A;  1U06 A;  2DAQ A;  2HSP A;  1BCM A;  2XIC A;  1MV0 B;  3X24 B;  3E2U A;  4X34 A;  2QGG A;  4PJO G;  1MMA A;  3CXC S;  4AT1 B;  1GL5 A;  1UUE A;  2DL7 A;  3EG0 A;  2O88 A;  4J7F A;  3VUZ A;  5GMK i;  4BI8 B;  2FB7 A;  3SHW A;  2M02 A;  1IXD A;  3CCJ Q;  1SF9 A;  1M3C A;  1PC0 A;  2JNG A;  2JN0 A;  3QG1 A;  3G6E Q;  2ECZ A;  2X4Y A;  1WDX A;  4DEY A;  5GAN d;  2YDL A;  1GFD A;  3CCJ T;  4KUD K;  3OW2 P;  4R0K A;  1PNJ A;  3QHS A;  1NEG A;  3JCM J;  6AT1 B;  2LCS A;  3G6E T;  1FMK A;  1UB4 A;  5EG2 A;  1DJ7 B;  1KD1 C;  2M9U A;  1AWW A;  3T9N A;  1Q95 G;  1VYT A;  2CUD A;  3H9N A;  5GMK l;  1K8A C;  1BBZ A;  3H8Z A;  3CCL Q;  2O2O A;  1M1K C;  1G8X A;  3CCU Q;  5HCK A;  3QWY A;  2JW4 A;  1GCP A;  1D0Y A;  2DIL A;  3CCL T;  2AKL A;  1W6X A;  4M77 A;  3CCU T;  2OTJ A;  5HY6 A;  1UG1 A;  4KH0 B;  1WHJ A;  3CC2 A;  2VXF A;  3EH1 A;  3CCS Q;  5FU6 B;  3HP9 A;  1VQN Q;  2D0N A;  2AHJ B;  2XU8 A;  1MV3 A;  1XQH A;  1IB8 A;  3CCS T;  4HVV A;  5CKE A;  1QVF A;  2K6D A;  1ABQ A;  3VKI A;  1VQN T;  2ZPI B;  9ATC B;  2RJE A;  2JXB A;  4LD6 A;  3CCR Q;  3R6O A;  3VS5 A;  2CYZ B;  3RKX A;  2V8I A;  2V26 A;  1QP2 A;  5GJV B;  3M0R A;  3VYH B;  5CCA A;  3CCR T;  1OX9 A;  2LCC A;  4M7A F;  1FWZ A;  2ZAE A;  2DJQ A;  1CSK A;  3OYI A;  1YIT A;  2EWN A;  2YUP A;  2ZPH B;  4A54 A;  3MEW A;  1QCF A;  2LJ0 A;  3LW5 E;  1TSF A;  2IVW A;  1FX7 A;  1VQP Q;  4JZ3 A;  3PNW C;  4A4H A;  1YJ9 Q;  1VQ6 Q;  1YIJ Q;  3S3N A;  3LWH A;  3CCQ A;  4RTZ A;  1VQP T;  1W2B P;  2JOY A;  1YJ9 T;  1MMG A;  1VQ6 T;  1YIJ T;  4OMM A;  2CP6 A;  1SPK A;  3FJ5 A;  2HSE B;  4J5Y A;  4JJB A;  1KSW A;  1SRL A;  5CAI A;  1QVG P;  3I55 Q;  3Q1J A;  1WLP B;  4FT4 A;  5KE2 A;  2CH4 A;  4FYY B;  2LNV A;  4C8Q E;  4V2S A;  3I55 T;  1NLO C;  1U3O A;  5C6S A;  2EBP A;  2DEU A;  3VS0 A;  3FC3 A;  2DZ9 A;  3E9F A;  4IKF A;  2NUP B;  1T3L A;  2AKK A;  3ZEH A;  1WA7 A;  4A4F A;  1YI2 A;  4XTY A;  3MEV A;  3OYB A;  1PRL C;  1W2B S;  1AZE A;  1K1Z A;  2GFU A;  2X3W D;  4OB0 B;  2KQW A;  1OPK A;  4ORZ A;  1R8O B;  3CCM Q;  3GP8 A;  2QDL A;  1QVG S;  4FW2 A;  3BDL A;  5J26 A;  1D3B B;  2DVJ A;  5I22 A;  4PFO A;  3QZ5 B;  1HYO A;  4GLK A;  2JS2 A;  1Z9Z A;  3L2U A;  3CCM T;  3EGD B;  2G3R A;  2DM1 A;  5AT1 B;  1N8R C;  1WZO A;  1EX4 A;  1RAA B;  3NTI A;  2K3B A;  3BFM A;  1VQ4 Q;  3M55 A;  1D3B A;  3G71 A;  2RI5 A;  2JMC A;  2DRK A;  2KRO A;  4DA4 A;  3BDU A;  4R55 A;  1H64 1;  3EGD A;  4J6W A;  3S3M A;  1IO6 A;  2MIO A;  4DBR A;  1AWX A;  3MET A;  5IAY A;  1VQ4 T;  1I8F A;  4DQ2 A;  2DTH A;  5A2Q E;  3FEO A;  2F2V A;  4MML A;  2DNU A;  1LVK A;  1H8K A;  4OGC A;  4MZP A;  2GGR A;  1BI1 A;  4EMK C;  3EG2 A;  1KHC A;  1ZSG A;  1ZUK A;  1CKA A;  5KE3 A;  4BUG A;  1NJI U;  5GAM h;  1K8A R;  2J7I A;  3ULR B;  2VVK A;  2DXU A;  3OYE A;  5EC7 A;  1ZUY A;  1W4S A;  2HNI A;  5I2M A;  3OYJ A;  1UFF A;  3HRU A;  1QKW A;  4PJL A;  4C8Q G;  5HK3 A;  3A8L B;  4QT7 A;  2M0O A;  3M5A A;  4HCZ A;  5DLQ E;  5LJ3 j;  2K2V A;  2KY9 A;  1ZBX A;  1VQ5 Q;  3CCE A;  2D1X A;  4D8K A;  1U5S A;  1HK9 A;  1BI0 A;  1XOV A;  5GMK m;  4B6M A;  2YUN A;  2QA4 A;  4C92 G;  3NHN A;  2A0F B;  3IQL A;  4E6R A;  1VQ5 T;  4HVU A;  4HT8 A;  2DEQ A;  1BB9 A;  1XNI A;  1JXO A;  2GQV A;  1WHK A;  4E47 A;  4M7D E;  2V1R A;  1KC8 R;  2EVR A;  4M7D D;  2V1Q A;  2F5K A;  4II1 A;  3VJP A;  4C0D B;  3M0Q A;  1Y96 B;  3F70 A;  2GF7 A;  5CKH A;  2VC8 A;  1AEY A;  1E6H A;  2DVE A;  1JJ2 P;  2DXB A;  3A8M B;  2SRC A;  2YHT A;  4AFS C;  1VQL Q;  4OMO A;  4C8Q B;  1TS9 A;  1Y96 A;  2E64 A;  1UHF A;  1VQ9 Q;  3LGL A;  3OB9 A;  2RJF A;  2LX9 A;  3FRN A;  3MP1 A;  2AIR B;  1JU5 C;  4DOV A;  4FCY A;  1VQL T;  1AD5 A;  2VUB A;  1M30 A;  3EFO B;  1MGQ A;  3HTR A;  3G4S A;  2F5T X;  1VQ9 T;  2I2L A;  1X6O A;  4XU3 A;  4HT9 A;  2KNB B;  2JTE A;  4C8Q A;  4C92 B;  1MMN A;  3VS4 A;  2LCL A;  1JJ2 S;  3VS2 A;  1RAH B;  3EFO A;  2EQK A;  2HQH A;  4XTX A;  4MDX A;  4J9B A;  2DL5 A;  2K5L A;  4AFQ C;  2GTO A;  4C92 A;  1BIB A;  5GAM e;  2D8J A;  3MO8 A;  2BIV A;  4XAX B;  3E1S A;  1VOM A;  4OMP A;  5I21 A;  1G3T A;  4MZM A;  3QZ9 B;  1GRI A;  4J9D A;  4HA8 A;  1N9S A;  1FYN A;  1PCX A;  5GAN j;  4J9G A;  2DIG A;  1M8V A;  4RTT A;  3NTH A;  1VYU A;  5FU7 C;  5KYW A;  3A1P A;  1WXB A;  5GAM f;  4KGX B;  5GAN 4;  4AFU C;  5GAN 3;  3H0F A;  4NL3 A;  2QQA A;  3C0C A;  2HQX A;  5M9O A;  2GQI A;  3VRY A;  2PVG B;  1LNX A;  1TTH B;  3TRE A;  4QQD A;  5GAO l;  4C0G A;  1M1G A;  1W70 A;  5GJW B;  3DB3 A;  1N8R R;  1RI0 A;  1LJO A;  2VWF A;  4M77 F;  5GAO r;  1K9A A;  3J7A F;  2OX7 A;  1Q7Y C;  3JCM X;  2RHI A;  2VB6 A;  4F7U F;  4J7I A;  3GBQ A;  3O8V A;  4HVW A;  2WSC E;  3CBM A;  3QYH B;  3G6E A;  3OA6 A;  2X4W A;  5J3B A;  1QCN A;  3DB4 A;  1GBQ A;  2QQ9 A;  3LX7 A;  3OYG A;  2O9V A;  1GCQ C;  3OYN A;  2D0Q B;  3M4G A;  3VV0 A;  2DYB A;  1IHV A;  2LJ1 A;  2KYB A;  4AFZ C;  3CCV A;  2QDY B;  4QVC A;  1KK7 A;  4BDZ A;  2JVV A;  5GMK j;  1C1A A;  3WXM B;  1YWP A;  3FIF A;  2J06 A;  2O4X A;  4RTW A;  5ECA A;  2RNA A;  3PIP A;  1Q81 R;  2VAS A;  3LYI A;  2EKH A;  2KBT A;  1LPL A;  3E9G A;  5IH2 A;  3VRZ A;  3OSS C;  3M0P A;  4WF2 A;  2DBK A;  1I5L A;  1TOV A;  4E7K A;  3X20 B;  4M77 D;  2PUO B;  1YN8 A;  2LC4 A;  2C0I A;  1N5Z A;  2XKO C;  1N6A A;  4M4Z A;  4PJO E;  1QP3 A;  4FU6 A;  1VQM A;  3PVL A;  2RJC A;  1C6V X;  4E7L A;  1YFN A;  1AOJ A;  2HBW A;  2P84 A;  5CO7 A;  2K3Y A;  4WCI A;  1RL2 A;  4OMF B;  5IN1 A;  4JUV A;  2LT1 A;  4L59 A;  2MK5 A;  2KI7 A;  1NG2 A;  2EYZ A;  1S72 A;  3PGG A;  2HEQ A;  2FPD A;  2DTO A;  1YJW A;  4P5N A;  4M75 E;  5IHK A;  1UGR B;  2XID A;  2P0Q A;  1UTI A;  1YIJ A;  2XD0 A;  2MF2 A;  3TQ7 P;  4J9H A;  5GAO q;  1I4K 1;  2L89 A;  2QTX A;  4K11 A;  1T0J A;  3RBB B;  1UGP B;  4D8D A;  3TCJ A;  2FG0 A;  3MCA B;  3QBY A;  1D09 B;  4XQ3 A;  3P8D A;  3GOX A;  4KUI A;  1G3S A;  3OS1 A;  1ZSZ C;  1HJD A;  4M7D C;  2RM4 A;  2MWO A;  4A4K A;  2K79 A;  1TH7 A;  1WJQ A;  5C0M A;  2CSQ A;  5FWC A;  2PVD B;  2E5Q A;  2H3E B;  2M0Y A;  2DFU A;  1WIE A;  1EIF A;  5IXB A;  3I5R A;  1M2V A;  3GF5 A;  4FIB A;  1D1C A;  2V8K A;  3C12 A;  2L3P A;  2HMA A;  1WX6 A;  3M4Y A;  3CME A;  4XU2 A;  2ZPB B;  5D7U A;  2FVU A;  2MWP A;  3KUF A;  1AWJ A;  2RQV A;  3KFV A;  2RPN A;  2JZ2 A;  2YUQ A;  4M78 E;  4ELY C;  4HKE A;  2RQT A;  3L2Z A;  4JZ4 A;  5KCO A;  3C95 A;  1E7O A;  1Q7Y R;  1BYM A;  2E3H A;  2RO0 A;  2LT4 A;  4MZT A;  2H8H A;  1XTD A;  1K73 R;  1QQJ A;  4O6J A;  3GPL A;  2Y4Y A;  4LNP A;  2Y90 A;  2EFI A;  4M75 G;  3OYH A;  5LJ3 h;  4QQG A;  3UA6 A;  5GAO m;  1TG0 A;  4L6V 5;  2DL4 A;  3X25 B;  1AZG B;  2ATC B;  5LL6 S;  2KT8 A;  2BZ8 A;  3RNJ A;  3QSU A;  2DL3 A;  3QDR B;  1X01 A;  5IXF A;  4PJO B;  2A37 A;  2P0P A;  4BY6 B;  1OQK A;  2X4J A;  3M56 A;  3LWI A;  3CC4 A;  1AVZ C;  4FSS A;  1B07 A;  4EDU A;  1Q86 C;  1VYV A;  5GAM g;  4BE0 A;  4J6X A;  2YRV A;  1HD3 A;  1QKX A;  3JB9 G;  4PJO A;  2K57 A;  4IUR A;  4RTX A;  1VQ5 A;  2YRD A;  2KSS A;  2JM9 A;  2K7A A;  2KVQ G;  4ZTJ A;  5KYN A;  1SHG A;  3FB9 A;  3I56 A;  3S6W A;  1WGS A;  1VQ7 A;  3EFR A;  1G3W A;  1M90 R;  4C5E A;  2X51 A;  3C4S A;  1QWF A;  4M75 B;  1X6B A;  2MMP A;  3H0I A;  2YLB A;  3I5S A;  1YHQ Q;  1I5O B;  4LD9 K;  4BB7 A;  3CXC A;  3EHR A;  2D8H A;  4N0A A;  4M78 G;  2EYY A;  2OTL A;  4JJD A;  8ATC B;  1WJS A;  2E6Z A;  2DJZ A;  2OJ2 A;  1YHQ T;  1K9M R;  2IG0 A;  1TWB A;  3TSZ A;  4M75 A;  2DXT A;  3L2W A;  4IUQ A;  4ME7 A;  2RQU A;  4OB2 B;  3WVD B;  2BUD A;  2VYT A;  3JAM E;  1VQL A;  2ENM A;  2RQW A;  4A63 B;  4OGE A;  3INZ A;  1U1S A;  3A8O B;  3EAE A;  1I1J A;  2CKK A;  1ZA1 B;  2FPE A;  2EPD A;  1SSF A;  2DET A;  4PLI A;  2J6K A;  2E3I A;  1NPP A;  1NJI C;  5GAM d;  3OYM A;  3RUX A;  1MMD A;  2XG8 D;  2HCK A;  5CKB A;  1JXM A;  2AT1 B;  2BZY A;  4J9F A;  1WXT A;  1IRE B;  4FYV B;  2L5Q A;  2KXC A;  1YJN Q;  2F2W A;  5LJ3 e;  1K8A U;  4M77 C;  1MHN A;  3QWX X;  2ZPE B;  4C8Q D;  4OMN A;  1VQK A;  3M54 A;  4M78 B;  1YJN T;  1RAI B;  1JBM A;  3RES A;  3GIB A;  5LJ5 j;  1GBR A;  4FL6 A;  5DM7 R;  3OW2 A;  1B7T A;  1M4Z A;  1NZ9 A;  1RAD B;  1KIK A;  2FZG B;  5LJ3 f;  1VA7 A;  2KT1 A;  4PKC C;  2E65 A;  1E6G A;  4C92 E;  4E7Z A;  1OI1 A;  4C92 D;  4M78 A;  3QUI A;  1I81 A;  5FU6 C;  2NUP A;  3QJY A;  3HRT A;  4M7A E;  1VQO A;  3QJ6 A;  1IZ6 A;  2QQS A;  3BY7 A;  4OB3 B;  3EG1 A;  1KC8 U;  2GTJ A;  2R5A A;  1WXU A;  1MND A;  5KYY B;  2CZ1 B;  2RMO A;  4IIO A;  4IUT A;  5GAO n;  4M7D F;  4ANJ A;  3PMI A;  3CD6 A;  3G1J A;  2D9T A;  1K76 A;  2RN8 A;  3MP8 A;  2ROL A;  3CMA A;  4RTU A;  2AK5 A;  2DE0 X;  1RAE B;  1KD1 R;  5KYY A;  1WQW A;  2A28 A;  2C0O A;  4EIK A;  3MHX A;  5KYX B;  2FZK B;  3JSC A;  2LQW A;  3V8J A;  4PFZ A;  1SSH A;  1PWT A;  1M1K R;  1X43 A;  2E41 A;  5GAN 8; 
#chains in the Genus database with same CATH homology
 1ARK A;  2O9S A;  2W10 A;  3REA B;  1T0H A;  2YUO A;  3REB B;  2IIM A;  1TUC A;  4RTV A;  1W70 A;  5GJW B;  2FO0 A;  2LZ6 B;  1UJY A;  2CUB A;  2XMF A;  2VWF A;  4GBQ A;  2J05 A;  1K4U S;  1K9A A;  3EHQ A;  1OOT A;  2J6O A;  3NMZ C;  2DLP A;  4CC3 A;  4Z8A A;  3M0U A;  1M27 C;  1ZBJ A;  3GBQ A;  2O31 A;  4HVW A;  3NGP A;  1X69 A;  4J9E A;  4JJC A;  1I07 A;  1PKT A;  2DF6 A;  3EG3 A;  1GBQ A;  4LUE A;  1U06 A;  2O9V A;  1GCQ C;  1JQQ A;  2CDT A;  3NPF A;  2HSP A;  2DYB A;  2LJ1 A;  1MV0 B;  3UF4 A;  4KRT A;  2KYB A;  4AFZ C;  1H92 A;  1TUD A;  1UHC A;  1RUW A;  1GL5 A;  1GFC A;  4ESR A;  1UUE A;  3SEM A;  2P4R A;  1ZX6 A;  1YWP A;  2J06 A;  4RTW A;  2DL7 A;  3EG0 A;  5ECA A;  2O88 A;  2RNA A;  1Y0M A;  2KEA A;  3SHW A;  1K0X A;  2EKH A;  2FEI A;  2KBT A;  1M3C A;  1OV3 A;  4IIM A;  3H0H A;  2KXD A;  4CC4 B;  5IH2 A;  2KGT A;  2ECZ A;  3VRZ A;  1WDX A;  2K9G A;  4DEY A;  2YDL A;  3M0P A;  4RTY A;  1GFD A;  2DBK A;  4R0K A;  1PNJ A;  4F16 A;  1YN8 A;  1NEG A;  1H3H A;  2L2P A;  2LCS A;  1FMK A;  1N5Z A;  2C0I A;  2DL8 A;  3TVT A;  2LJ3 A;  1AWW A;  4M4Z A;  1VYT A;  2CUD A;  1JO8 A;  4AG2 C;  1SEM A;  3PVL A;  1BBZ A;  2O2O A;  5HCK A;  1AOJ A;  3QWY A;  2HBW A;  2A08 A;  2JW4 A;  1BK2 A;  1GCP A;  2DIL A;  2AKL A;  1W6X A;  4WCI A;  1JEG A;  1RLQ C;  1UG1 A;  1NG2 A;  2YT6 A;  2EYZ A;  2CH4 W;  4GLM A;  1X2K A;  1CKB A;  2D0N A;  3UAT A;  2HEQ A;  1MV3 A;  2FPD A;  1UE9 A;  3H41 A;  4J9I A;  2KRS A;  4HVV A;  2K6D A;  5IHK A;  1ABQ A;  3ZL7 C;  1UTI A;  2G6F X;  2JXB A;  1WI7 A;  2K2M A;  2AZS A;  3VS5 A;  4J9H A;  2L0A A;  1PHT A;  5GJV B;  1S1N A;  2FRY A;  4X1V A;  3M0R A;  2DMO A;  4K11 A;  2KE9 A;  2RF0 A;  1T0J A;  3RBB B;  4D8D A;  1KJW A;  2DJQ A;  2FG0 A;  1KFZ A;  1CSK A;  1I0C A;  3I35 A;  1WFW A;  1B3Q A;  2E5K A;  2JS0 A;  1X6G A;  1T3S A;  2YUP A;  1HJD A;  1QWE A;  1QCF A;  1NEB A;  2LJ0 A;  1NYG A;  1SHF A;  2K79 A;  5IHN A;  2M51 A;  1J3T A;  2CSQ A;  5FWC A;  2AZV A;  2NWM A;  2W0Z A;  1AWO A;  1ABO A;  2M0Y A;  4JZ3 A;  3I9Q A;  2SEM A;  1WIE A;  5IXB A;  5I11 A;  3I5R A;  3VS6 A;  2L3P A;  4RTZ A;  1WX6 A;  3CQT A;  4OMM A;  1SPK A;  3FJ5 A;  1AWJ A;  2CT4 A;  2MCN A;  2RQV A;  1M3B A;  3KFV A;  4JJB A;  1KSW A;  1SRL A;  4LE9 A;  1OPL A;  2RPN A;  2PTK A;  1WLP B;  2YUQ A;  1M3A A;  3M0T A;  2RQT A;  2CH4 A;  4JZ4 A;  2C0T A;  2GBQ A;  1E7O A;  3THK A;  1NLO C;  1U3O A;  2EBP A;  4OMQ A;  3VS0 A;  1W1F A;  2H8H A;  4Y92 A;  1T3L A;  2ROT A;  2AKK A;  1WA7 A;  1PRL C;  3A98 A;  4HCK A;  4LNP A;  2NUZ A;  1NLP C;  2LNH B;  1SRM A;  4DEX A;  2EGE A;  1AZE A;  3UA6 A;  1K1Z A;  3VS7 A;  1TG0 A;  2DL4 A;  2KYM A;  2KRM A;  1ZLM A;  2X3W D;  1OPK A;  2EQI A;  4ORZ A;  1AZG B;  1GCQ A;  1PKS A;  2QDL A;  3U23 A;  2J6F A;  2KT8 A;  2BZ8 A;  2DBM A;  3RNJ A;  1YNZ A;  2DL3 A;  2DVJ A;  5IHI A;  1K0S A;  5I22 A;  5IXF A;  2A37 A;  2JS2 A;  1Z9Z A;  3VS3 A;  2I0N A;  4LN2 A;  2DM1 A;  1AVZ C;  4FSS A;  1B07 A;  2LMJ A;  1VYV A;  2L3S A;  2K3B A;  2EW3 A;  1UJ0 A;  1UDL A;  2CRE A;  1Y57 A;  1HD3 A;  1QKX A;  2JMC A;  2A36 A;  2DRK A;  2KRO A;  2DRM A;  2EYX A;  1NM7 A;  4RTX A;  5FWB A;  1IO6 A;  1LCK A;  2MIO A;  1AWX A;  2JM8 A;  2JM9 A;  2K7A A;  2F2V A;  3TSW A;  3VS1 A;  2DNU A;  1SHG A;  1H8K A;  1A0N B;  1ZUU A;  1BU1 A;  2GGR A;  4Z88 A;  2L3Q A;  3EG2 A;  1ZSG A;  3PVQ A;  1ZUK A;  1CKA A;  1QWF A;  1X6B A;  3H0I A;  4Z89 A;  3I5S A;  5L23 A;  2J7I A;  3ULR B;  2VVK A;  5EC7 A;  3EHR A;  2D8H A;  1ZUY A;  2EYY A;  3PE0 A;  4JJD A;  1WYX A;  2VKN A;  2RQR A;  2OJ2 A;  1UFF A;  2GNC A;  1QKW A;  2HDA A;  3TSZ A;  4QT7 A;  4F14 A;  2RQU A;  1OEB A;  2ENM A;  2RQW A;  4A63 B;  2D1X A;  4D8K A;  1MUZ A;  1U5S A;  1XOV A;  4LUD A;  1I1J A;  2YUN A;  2B86 A;  4RUG A;  2FPE A;  3NHN A;  2EPD A;  3IQL A;  2LQN A;  4E6R A;  4HVU A;  2J6K A;  2KRN A;  1BB9 A;  2F2X A;  1JXO A;  5FW9 A;  1RLP C;  2HCK A;  2V1R A;  1JXM A;  2EVR A;  2FRW A;  2BZY A;  2V1Q A;  4J9F A;  1G83 A;  1WXT A;  4HXJ A;  2PZ1 A;  3M0Q A;  3EGU A;  2KXC A;  2YSQ A;  2F2W A;  3QWX X;  2ED1 A;  4OMN A;  1AEY A;  1E6H A;  2BTT A;  1EFN A;  1PRM C;  2SRC A;  1GBR A;  3LH5 A;  3UA7 A;  3R6N A;  4AFS C;  4OMO A;  1YP5 A;  1NYF A;  2CT3 A;  4ZNX A;  2LP5 A;  1UHF A;  4CC7 A;  1KIK A;  2EYW A;  1VA7 A;  2ESW A;  2KT1 A;  1JU5 C;  1E6G A;  2ABL A;  1UGV A;  1AD5 A;  1M30 A;  2DA9 A;  2X3X D;  1M8M A;  1HSQ A;  2KNB B;  2JTE A;  3VS4 A;  2FPF A;  1YCS B;  2DX1 A;  4F17 A;  3VS2 A;  3M0S A;  4J9C A;  2PNI A;  3EG1 A;  2OI3 A;  4JPB W;  2EGA A;  2CSI A;  4OML A;  1G2B A;  2DL5 A;  2GTJ A;  3O5Z A;  4J9B A;  4AFQ C;  2EGC A;  1WXU A;  1X2Q A;  1Z9Q A;  1QLY A;  2GTO A;  2MOX A;  2RMO A;  4IIO A;  2JT4 A;  2D8J A;  2LX7 A;  4OMP A;  2OAW A;  1GRI A;  4J9D A;  4AG1 C;  3JV3 A;  1FYN A;  1K76 A;  2RN8 A;  1RI9 A;  2BZX A;  4J9G A;  2ROL A;  2JMA A;  2ED0 A;  4RTU A;  2AK5 A;  2DE0 X;  4RTT A;  1YWO A;  1VYU A;  1WXB A;  2A28 A;  2C0O A;  4EIK A;  4CC2 A;  1UEC A;  4AFU C;  1V1C A;  1X27 A;  2LQW A;  3H0F A;  3C0C A;  1SSH A;  1PWT A;  2GQI A;  1X43 A;  2KR3 A;  3VRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...