4C92D

Crystal structure of the yeast lsm1-7 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 19
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92D00
1MGQA 4M77D 4HA8A 4PJOD 2FYKA 4M7AF 4M77F 5GAMf 2VXEA 4M77E 4PJOF 4C8QG 4HT8A 4PJOE 5LJ3e 4JRKA 3SWNA 4PNOA 3JB9H 4Y91A 3RIRA 2VC8A 1B34A 2RA2A 4XTZA 3AHUA 1WPYA 1LOJA 2ZGWA 4F7UA 3RKYA 2VXFA 5GAN6 5GMKh 5GAN2 3VU3C 5GAOn 5GMKl 5GAN7 2DXTA 4M78D 5LJ5e 5GAMg 2EWNA 5GAMj 4M75E 4MMLA 4N0AA 1X01A 3HFOA 4M78F 4M78E 5GAOl 1I5LA 1M5Q1 5LJ3h 2DZCA 4M7AA 4XTXA 3RKXA 5GANj 4J6XA 3V7SA 1LJOA 5GAMd 4M7AG 3V7RA 1WQWA 4MMKA 4NL3A 3FIFA 3JB9G 2YLBA 4M7AC 4XU0A 3JCMQ 1D3BA 4C8QE 3RESA 3SWNB 4M7DA 5GANd 2E64A 1N9SA 4OP0A 4M7DG 1B34B 4RCCA 4XQ3A 3RUXA 4M7DC 2RD1A 4C92A 5LJ5h 1JBMA 4A53A 5GMKm 5GANf 4F7UB 3JCMf 4C92G 1HK9A 2YHTA 3PGGA 4X9DA 3SWNC 4C92C 2HNIA 5GAMe 1TH7A 1H641 3FJPA 4XU2A 3BFMA 4EMKA 5GAN3 2E10A 4M75D 3V8LA 4F7UG 3JB9I 3QUIA 3JCMX 3GIBA 4QVDA 3INZA 4M75F 3V7CA 3BY7A 4M7AB 4EMKC 3L2ZA 4PJOB 2CGHA 3V8JA 2DTOA 2DTIA 2Y90A 5GANg 4X9CA 2FB7A 3JCMg 1D3BB 1HXDA 4M77A 4N0AC 4NL2A 2E65A 4C8QD 4M7DB 4PJOA 4EMHA 4M77G 1JRIA 4PJOG 1U1TA 4C8QF 5CAIA 4M77C 5LJ5f 4C92B 5GAMh 3QHSA 2EJFA 5GAOp 1LNXA 4PJOC 3JCMd 3BDUA 5GAN4 1KQ2A 5LJ3j 4XU3A 2I2LA 3QSUA 2E41A 2DVEA 4EMKB 1I8FA 4RCBA 3JCMJ 3L1AA 1BIBA 2DXUA 4XTUA 2RB6A 1Y96B 2K57A 5LJ3d 4EMGA 4M75A 5GAOm 4JRIA 1WQ7A 4F7UE 4HT9A 4V2SA 4M78A 2EJGA 3JCMV 1Y96A 2DKGA 1U1SA 5LJ3f 4M78G 4M75C 5GANe 4XTWA 2QTXA 5LJ5g 5LJ5j 3JCMW 5GAOr 4M78C 1KQ1A 3JCMc 4J5YA 4M77B 3JB9D 1I4K1 5GAN8 5GAN5 4C8QA 5GMKi 4M7AE 2EAYA 3JB9F 5GMKj 5LJ5d 4JUVA 4XTVA 3JCMb 4M7DD 2RM4A 2DZ9A 4XTYA 5I21A 4XU1A 3SB2A 3M4GA 4C8QC 4M7DF 3EFSA 2E1HA 5DY9A 4M7DE 3RERA 4C92D 5LJ3g 1WNLA 2EJ9A 2DTHA 4WF2A 4C92F 2JN0A 4QVCA 4C92E 3JB9J 2DJZA 5GANh 3JCMP 4M75B 3JCMh 1N9RA 2DEQA 3HFNA 4M78B 4DQ2A 4A54A 4NOYA 3QO3A 4F7UF 1I81A 3HSBA 4J6YA 3EFRA 4J6WA 2YLCA 3BW1A 4M75G 5GAOq 1M8VA 1BIAA 4JLIA 5GMKe 3FB9A 4C8QB 3JCMe 4M7AD 1YCYA 3V8KA 3RKWA
chains in the Genus database with same CATH superfamily
1XNIA 4OGCA 1D1CA 1B7TA 2X4WA 1VQ7A 2ZPFB 2EGEA 4LDUA 2YUNA 5KYXA 1Q82U 3CCLQ 1WA7A 5CKFA 4JRQA 2LVMA 2DRKA 4JDSA 3SDZA 3A8HB 3QXEB 2KRNA 3VU3C 4AFUC 4F14A 1E7OA 3HFOA 1QWEA 3CBPA 2CP5A 5HKCA 1VQMA 4QW2A 5GJWB 1YI2Q 4NL3A 2HL3A 2KR3A 3VS6A 2DNUA 4F17A 3CCVA 4AFQC 1YWOA 5GANf 2K6DA 1HK9A 1VQPA 3NMZC 1H641 1QP3A 3VRYA 6AT1B 3CCSA 2X3XD 3X24B 4RTTA 2FHDA 2R5AA 1NPRA 1SHGA 2X9HA 2KT8A 1MUZA 3EGUA 4PL6A 2FPDA 5CAIA 2J6FA 2EJFA 2ZAEA 2DYBA 3H0HA 3VS4A 1RLPC 3DLLA 4M4ZA 1JU5C 5HK3A 3G71A 1VQKT 2KQWA 4ME7A 3JSCA 1WYXA 1B3QA 1WGSA 1VQ8Q 3SD4A 4L5GA 1I4K1 1M1GA 2RK2A 3EG9A 1G5VA 2QAZA 1AWXA 5DM7R 3CCLA 3GOXA 3LWIA 1NPPA 4MZPA 2R58A 2OX7A 1JB0E 5GJVB 1M3AA 2DEQA 4J9BA 3QO3A 4MDXA 3M58A 2QDYB 1M8VA 2V1RA 4JLIA 5IHKA 5GMKe 2RO0A 2ZPIB 1YI2A 1UG1A 5AYFA 1MGQA 4M77D 3X28B 3OYJA 1K0SA 2VXEA 1K1ZA 4ATOA 4BY6B 1YHQA 3OQ5A 2AIRB 4Z89A 1WX6A 4XTZA 4JRPA 1KQSA 2C0IA 3AHUA 2RF0A 1GBQA 1WFWA 5GAN2 1E6HA 1D09B 5GAN7 2DXTA 4M78D 2LT4A 2B8AA 4VUBA 2DL7A 4J9DA 1V76A 5EC7A 4WTOB 2DBMA 1WQWA 4RG2A 2E70A 4Y92A 1YIJQ 1N27A 2KGTA 1SHFA 1YJ9Q 2FZCB 1B34B 2P84A 1C0MA 4C92G 3CCVT 1V1CA 2L0AA 1KD1U 3UATA 1VQ6T 2CT4A 4L6V5 3GIBA 1VQNQ 1VQ8A 1ZSGA 3BY7A 1IHVA 2CSQA 1OZ3A 1CKAA 3PIOA 1PG5B 4E7LA 3QDRB 2L3PA 4EMHA 4LD6A 2OTJT 2LX7A 3OYCA 2KNBB 1OYXA 2M51A 3HP9A 2BE9B 4FYXB 3OYHA 3OYYA 3SFMA 5M9OA 1BCMA 4FYVB 2DBKA 1VQ9Q 1VQOA 3MO8A 1RABB 4CC4B 2KXDA 5LJ3g 2WSFE 2GGRA 1MMAA 4M75B 1N9RA 2JTEA 3OMGA 2CYZB 2GCXA 1KHCA 3UF4A 4FCYA 3FRNA 3QZ9B 1I81A 1Q81C 4J6WA 3BW1A 2F69A 4BI8B 1O9SA 4IKFA 1VUBA 4DOVA 1QWFA 1KC8U 1YCYA 2KROA 3N5BB 3QJ6A 3QG1A 5D6WA 3TEEA 1YIJA 4BUGA 3X20B 4M77F 4OB0B 8AT1B 1B34A 2K7AA 2RPNA 3M55A 2FEIA 4C5EA 1VQNA 1G3TA 2P0KA 2I0NA 4M78F 4ZGDB 2QEXQ 3RNJA 3PIPA 4J9FA 2DZCA 4PLIA 4LDWA 2COYA 3S3OA 2JW4A 3OYLA 3UWNA 2L5QA 2LCSA 3M56A 1G3SA 4ZNXA 1PRLC 2QASA 1IGUA 4QQDA 4HCCA 4FM4B 1FYNA 2HBWA 3M54A 4RCCA 2NUTB 3CPWP 2DL5A 5LL6S 4QQ6A 4DBQA 1Y71A 2RI2A 4J9CA 2RQUA 1VQ9A 2HD0A 4OMNA 3QWXX 4DEYA 5GANg 4JS5A 3QPHA 1JRIA 1NEBA 1SG5A 1U1TA 2OJ2A 3TCJA 1GXIE 1GCQA 3M57A 2BUDA 1UGVA 3CPWS 1MV3A 4M75A 1P92A 1WQ7A 1BI1A 4J8OA 2EJGA 2QQAA 2DERA 3META 2DFUA 5A0LA 3PNWC 1XJWB 2PUOB 4IURA 2BE7D 2LRQA 2LP5A 2JNGA 2J6OA 4C92D 2WSEE 3REBB 4BACA 2JOYA 3G4SQ 2X4JA 3JCMh 1N8RC 4J9HA 2ZPGB 1I07A 5CQXA 3CCUT 2QEXA 2K5IA 1KD1R 2LCLA 2E3HA 4JZ4A 2V8JA 4M75G 2O2OA 4IUPA 4GBQA 1KQSP 2ZPEB 1IB8A 1TUGB 3G7ZA 2FRYA 1NG2A 2PZ1A 1S72T 3GLXA 1WIEA 2DXCA 3JB9H 1SKUB 4Y91A 2PVGB 4FW2A 2NUTA 5A2QE 1K8AU 1T0JA 3CC2T 4J83A 1PD1A 4CRIA 1VYVA 2BIVA 5IXBA 3LYIA 2XDPA 3OYEA 2K4YA 1NM7A 2GFUA 1KQSS 3OYFA 2YLBA 5I2SA 1W4SA 4IIMA 2ESWA 2DIGA 1LPLA 4KRTA 2M0OA 2XDDA 2GFAA 2ED0A 4LN2A 2RD1A 3S3NA 3PGGA 4JJBA 4KGZB 4KH0B 1U5SA 1OV3A 2PTKA 4D8DA 3E1SA 2RH2A 2GQVA 2GTJA 4PJOB 3SHWA 3I55T 1KC8R 4ZTFA 3KUFA 2MWPA 2EQIA 3DB3A 3G4SA 4OMOA 1RACB 4PFPA 1QVPA 1TWBA 1VQLT 2KK4A 3M0SA 3G6EQ 2LNVA 1ABOA 1Y96A 1UFFA 3M5AA 2RHXA 4M77B 4E7SA 1JJ2A 1K4US 1IREB 3JCMb 2VKNA 1IXDA 3LGFA 5IT9E 5DLQE 1RI0A 1M1FA 4C92F 1PKSA 4J9EA 1WXBA 4M78B 1RAEB 5L23A 2P0PA 4A4HA 4J6YA 3EFRA 5KE3A 5IAYA 2DM1A 1N6AA 1OX9A 2VWFA 1YNZA 3M4YA 3CCJQ 1JO8A 2YSQA 3PVLA 2AHJB 1Z9ZA 4CC3A 5CKBA 2EWNA 2DD5A 1M5Q1 4E7KA 2G3RA 3V7RA 5D6XA 2A28A 2CUBA 1RAHB 3SWNB 1VIEA 2X35A 2OTLQ 2PVDB 3RUXA 5CKHA 3UT1A 3I56Q 3CC4A 1TG0A 2RHYA 3CQTA 4RTUA 3G6EA 2HNIA 1NEGA 4OB2B 4Z88A 2HQEA 2VVKA 4M75D 3CCQQ 3H9NA 2FL7A 3JCMX 2CKKA 3L2VA 1BKBA 2JZ2A 4E47A 1YJNA 2DTIA 2X4YA 1A0NB 1D3BB 4M77A 4N0AC 1ZQ1A 1KG1A 4D8KA 4PJOG 1BBZA 1FXXA 5GAN4 1M1KC 1W1FA 1XOVA 1I8FA 1NLPC 2DXUA 4D6WA 4V2SA 2R5MA 4M78A 1M8MA 4LUEA 1KJWA 5LJ5j 3OY9A 3VS3A 3L2QA 3CBOA 5GAN5 1AT1B 1KK7A 3PFSA 2O01E 3UA7A 3CCJA 3AT1B 4XU1A 3OS5A 1X75C 3EFSA 3OYNA 4JPBW 2X4XA 1TU0B 2L89A 4LUDA 4BI3A 5CCAA 2EKHA 4BY6C 3GBQA 4ANJA 3OYDA 1UEBA 2DVJA 4E2FB 3LH5A 2ED1A 2F2VA 4RTVA 1HJDA 2OTLA 3IQLA 1YITQ 2LJ1A 2ZZDA 1W2BA 3I56A 3SWNA 2ROTA 4CC7A 2VGNA 1PC0A 1NZ9A 3RKYA 2VXFA 3CCQA 2XG8D 2KE9A 2MWOA 2RJEA 3CC7T 3OB9A 4M75E 2L3SA 3JAME 5KCOA 3CD6T 1M27C 5A0DA 1Q7YC 3EH2A 1WHLA 3VJPA 1D3BA 1N9SA 2JT4A 3A8LB 3OS2A 1K9MU 1RL2A 1YJWT 3LLRA 3CC4T 4RTXA 3QUIA 1FX7A 4M75F 4C0FA 1FMWA 4KGVB 4LD9K 2H8HA 4X9CA 1FMVA 1MMNA 4C92B 5GAMh 5KE2A 1N5ZA 1GCPA 4DEXA 2CP3A 1GCQC 1JJ2P 3L1AA 3PE0A 3VYGA 1QVFA 5D6YA 2FPFA 3NPFA 4RG8A 2DKGA 5DLOA 4M75C 2FZGB 1Q86U 3JCMc 1W6XA 1YITA 1V29B 5LJ5d 4RUGA 1MMGA 3CCMT 3L42A 2HCKA 1LVKA 2YUOA 2NYSA 3RERA 1YBYA 3C4SA 1BI3A 2DJZA 1M90U 2HZYA 1KC8C 2QA4T 1JJ2S 2DMOA 2XKOC 2RQWA 3QKJA 5FWBA 3RMSA 2YLCA 2E4HA 1ZHIA 1BIAA 2Y4XA 1WLPB 3I9QA 1GFCA 3HRSA 4HA8A 4PJOD 2PQWA 2GQIA 3C95A 3MKDA 3CMAQ 3UPUA 5I2MA 4FYYB 1UTIA 1FWZA 2JM9A 2JUFA 1ZUKA 5GAOn 2COZA 3CCEQ 4AFZC 2X3WD 4XK8E 2KEAA 4MMLA 2PU9B 4QT7A 3LW5E 4J6XA 1G8XA 3JB9G 1R8OB 1ZLMA 2QGFB 4MZTA 1RADB 1LCKA 2O4XB 4M7DG 1ZUYA 1VQ7T 3OYGA 4C92A 4FT2A 5KYNA 2LTOA 4QVZA 2L3RA 1QKXA 1TH7A 1OX8A 2SRCA 1OQKA 3FJPA 2QQRA 2K3BA 1VQ4Q 4E7JA 3VUBA 3V8JA 1VQ5Q 1HXDA 1X6GA 1TOVA 2M02A 2NLUA 2RJCA 2MCNA 1VQMT 1PD0A 3QHSA 3JCMd 4LDVA 4GY5A 5FLXE 4J7FA 3OBYA 4JRIA 1D1BA 4B6MA 1NJIR 1VQPT 2D1XA 1M2VB 4KT0E 4BE1A 3FC3A 3CCST 2RM4A 3CMAA 4CI0C 1DJ7B 3FEOA 4C5GA 1SPKA 3CMEQ 3TVTA 1Q82R 3CCEA 2E6NA 1I1JA 1K9MR 4F16A 1MV0B 2AKLA 5IN1A 1W2BP 4JJNK 4AT1B 2YUQA 3G71T 3EAEA 3MJXA 1U8RA 2EQKA 4X1VA 4C8QB 4KUIA 3HTRA 4M77E 4PJOF 5FU6C 5FU7C 2ECZA 2O4XA 4R0KA 3CCLT 2YRVA 4HVUA 3CXCA 1I5OB 1BYMA 3J80E 3JRZA 4XAXB 3TSWA 1VQ4A 2QDLA 2LDMA 2L2PA 1W2BS 4M78E 1VQ5A 1S1NA 4B9XA 2YRDA 5CKEA 1OPLA 4M7AG 2CP2A 2JTFA 1Q86R 4JLGA 4HKEA 3OSVA 1YI2T 2NWMA 1YJ9A 4OP0A 1AWOA 3M53A 3HPWA 5KYYB 5LJ5h 2L3QA 4KUDK 4A63B 4E7ZA 4ZGEB 1YHQT 1RLQC 1XQHA 3V8LA 1WDXA 5HCKA 1AHJB 1XTDA 3H0IA 1G3YA 1QVFP 1QVGA 5LJ5f 4M77C 3CMEA 1AWJA 5LJ3j 4XU3A 2P4TA 2XMFA 4P5NA 1GL5A 2QYZA 1G2BA 3OYBA 3OW2A 3JCMW 5J39A 4XTWA 3BE3A 4M78C 2XIDA 2X51A 3JB9D 4LNPA 1VQ8T 4C8QA 4OMLA 3OSSC 4M7DD 4XTYA 2W10A 2DYIA 1D0ZA 3MP1A 2RQVA 1O75A 2JN0A 1JXOA 1PKTA 3HFNA 4A54A 3TU4K 4A4EA 4E7HA 3VS2A 2JMCA 1JQQA 1WHMA 4RTZA 3FB9A 2KI7A 3CCRQ 4C8QG 4A4KA 1VQOT 1U06A 5J3BA 3G1JA 2CUDA 3M0PA 2RA2A 3EG1A 2LT1A 2QG9B 3OS0A 4BI4A 2E3IA 4C5HA 5GAMj 2HSEB 1PSEA 1YWPA 1UDLA 3D7SB 1SRLA 3RKXA 5GANj 1UB4A 1LJOA 3M0TA 5CR2A 1R77A 2VYTA 3CPFA 2CH4W 2JJ9A 2HMAA 3L2RA 1YIJT 4N4GA 4BE0A 5GMKm 2V26A 4F7UB 1ZSZB 3JCMf 3MCAB 3GF5A 1WHJA 4OF1A 1Z9QA 3DB4A 2RN8A 3JB9I 3V7CA 1KIKA 3VS1A 1VQNT 2ZPHB 2CGHA 2FVUA 2EPDA 2MI6A 1M4ZA 4WCIA 4EIKA 2GTOA 1QCNA 4AG2C 3ME9A 3QSUA 2DVEA 3I5SA 5IH2A 2KRSA 2K3YA 1MMDA 2D6FA 2CP7A 1AD5A 5LJ3d 1TS9A 1WJRA 3RDVA 3CCRA 4KBMB 3PVQA 1IZ6A 1SRMA 2DPPB 2QQ9A 4J5YA 2DD4A 4ZN1A 1Q81U 3JB9F 1VQ9T 4M7DF 3LWHA 2VASA 3A8MB 2QQBA 4HVWA 4RTWA 2EVRA 4C92E 2RHIA 1PM3A 4B9WA 3CD6Q 3MP6A 3GPLA 1EZZB 1C6VX 1QW1A 1WHGA 1KHIA 4C0DB 2FYKA 3M9QA 1UGPB 3CXCP 1AOJA 1NJIC 1M9SA 2EGCA 2MK5A 2QTVA 2LQNA 3EG3A 8ATCB 1RAIB 1EIFA 4OMFB 1D0XA 4F7UA 1ZSZA 2F5TX 3WXMB 2QK0A 3VS5A 4PJJA 4E7IA 2BTTA 3ZEHA 1TUDA 1UHFA 2FO0A 2QEXT 2JMAA 1Q82C 3EH1A 3OA6A 5GAMd 3PT9A 1K9MC 1Q95G 4MMKA 3FIFA 2DJQA 4XU0A 2K2MA 4II1A 5GANd 3CXCS 2P0QA 1JBMA 2PUKB 3H6ZA 3ASKA 2DL8A 2YHTA 3A5ZB 4C92C 5GAMe 3L2UA 1WHHA 2K3XA 2E10A 3HKSA 1QVGP 1G3WA 4F7UG 2DK3A 1PNJA 1BI2A 2D8HA 4J9GA 2DL3A 2MOXA 3HHTB 4ZN3A 1ZX6A 2LNHB 2YUPA 4C8QD 4PJOA 2ROLA 3QWYA 3LX7A 3OMCA 2E12A 3C94A 1OI1A 4FL6A 2A36A 2KT1A 3OW2P 3J81E 2CZ7B 1R0BG 2KAFA 1VQKQ 1W70A 1Q86C 2DXBA 2DA9A 1YN8A 2LZ6B 4EMGA 1GFDA 4HT9A 4IIOA 2O88A 1Y57A 3JCMV 5D7UA 5LJ5g 1N8RU 4PLLA 4A4GA 1KQ1A 4EDUA 1AZEA 1IHWA 4BDYA 1PSFA 3E19A 1IRXA 4JUVA 3E9GA 1VA7A 1UGSB 2FRWA 5I21A 2IG0A 2Z0WA 2HDAA 3M0UA 4FYWB 3ZL7C 5KYWB 2HKQB 3OW2S 4DOWA 3J7AF 3VKIA 2DRMA 3MEVA 4ZGJB 2DO3A 3G4ST 1RAFB 2KDSA 1RUWA 4JS4A 3MEWA 1K8AR 2BZXA 1QCOA 2KBTA 1MHNA 2VV5A 1OZ2A 4BD3A 2EYYA 2LC4A 3M0QA 2KSSA 4R56A 3SEMA 1SF9A 2QI2A 5GAN6 3TQ7P 2BZYA 2IPOB 2EQMA 4BE2A 5GMKl 3DLMA 3GNGA 2A37A 4EPCA 4ESRA 1QMCA 1RAGB 5LJ3h 2CDTA 2QGGA 2LJ0A 2F2WA 1IGQA 2LQWA 3VYHB 3VS0A 4C8QE 2RHZA 2LQ8A 4FSXA 3CCVQ 1QQJA 1VQKA 2NUZA 1VQ6Q 4F04B 3BFMA 1GBRA 4KH1B 3INZA 4O5VA 4OVAA 4L59A 4QQGA 1OOTA 1C1AA 2OTJQ 2FB7A 3JCMg 4M7DB 2WACA 1X43A 4FIBA 4C8QF 2RQTA 1KD1C 5CVIA 4RTYA 1PHTA 3S6WA 1K76A 3A8GB 2JTMA 1T3LA 2RI3A 2JS0A 4EMKB 5KYWA 3RMQA 3G6ET 4OMMA 5GAOr 4HCBA 1MNEA 3OYIA 2D9TA 1QCFA 4IUQA 2LX9A 2G6FX 1YJNT 2XK0A 4C8QC 3M4GA 3QDFA 2RMOA 1OPKA 2LMJA 3EGDB 2PVOB 3PTAA 2DTHA 1D1AA 5GANh 4YTLA 7AT1B 4JJCA 2EGAA 2HBPA 2ATCB 4C5IA 1UECA 2RK1A 2LJ3A 3UA6A 1TUCA 3S3MA 1QLYA 1UE9A 2XD0A 5GAMf 2SEMA 3CEYA 3L2WA 4HT8A 4N4IA 3GP8A 2DF6A 3CCJT 1VQ6A 3EG2A 1YHQQ 1OU9A 2ZGWA 4OB3B 5FW9A 2Y4YA 5CO7A 2RHUA 4ORZA 1K9AA 5LJ5e 1ABQA 1WI7A 2P4RA 3NTKA 5CQYA 3CPWA 5FWCA 4OMPA 2OTJA 4OB1B 3O5ZA 1N8RR 2M1HA 1AWWA 3JCMQ 3H8ZA 4PKCC 5CKDA 4M7DA 3C12A 3R6OA 4MZMA 2KMTA 3GNFB 2W0ZA 1K73U 2KRMA 3URGA 1X2QA 2OTLT 3QYGB 3I56T 2R57A 2C0OA 4EMKA 2CZ1B 1M1KU 3QZ5B 2O31A 4M7AB 2JS2A 3CCQT 2J7IA 9ATCB 4PFOA 4NL2A 2JXBA 4AMCA 3ER0A 3PMIA 2A3LA 2KVQG 1H3HA 4A4FA 2C0TA 2I2LA 4UC4A 3EGDA 1EX4A 2MF2A 4XTUA 2F5KA 3NTIA 2K57A 4F7UE 3E2UA 2K5FA 4DA4A 2HEQA 4PK4A 3A98A 1TTHB 2EFIA 3KBGA 4DBHA 1HD3A 2B86A 1QKWA 1VQOQ 1NYFA 2EAYA 4XTVA 1OEBA 5DY9A 3MPUB 4CC2A 1B07A 2XICA 3JB9J 3EHRA 3CCUQ 4OMQA 4F7UF 2D0QB 2OAWA 3EG0A 3JCMe 3HRTA 4BDZA 4DBFA 1S72Q 1HSQA 2MAMA 3PMTA 4PJOE 4FSSA 4JRKA 1YITT 1VIFA 1Q7YU 3CC2Q 2C06A 1TSFA 2QXFA 2VUBA 1ZA2B 1ZSZC 1WZOA 4N0AA 5GAOl 2CSIA 2HQXA 4M7AA 4XTXA 5EG2A 2EYQA 1OU8A 1QP2A 1YCSB 2DIQA 5HY6A 1GRIA 1WJSA 1K8AC 3OYMA 1YFNA 2MPXC 2HSPA 2DE0X 2BZ8A 2IVWA 5HK0A 2F1LA 3RBBB 1CKBA 1M3BA 2M16A 2EYXA 1JEGA 2DEUA 1SSFA 2DTOA 3I55Q 2E65A 3FDRA 4DBRA 1SSHA 2E5QA 3KFVA 4GLKA 4PJOC 1MNDA 2CH4A 3C0CA 3CCUA 3DKMA 1VQLQ 2E5KA 4RCBA 3JCMJ 1H8KA 2ZCFB 1H92A 1M90R 2K5LA 3EGXB 1S72A 3E9FA 1M2VA 1KFZA 2K79A 3KXTA 4RMOA 2EKOA 2J6KA 1X6BA 1M2OA 1AVZC 3CC2A 4C0DC 3UDCA 1WNLA 4QVCA 2LCCA 1K73R 2MYSA 1NBEB 1BK2A 2MMPA 4HXJA 3Q1JA 3QYHB 2EQUA 2D8JA 1JXMA 2JVVA 1M1KR 1ZA1B 2DLPA 5I22A 2M0YA 1BU1A 2JM8A 3MHXA 1M3CA 5L8RE 2CS7A 1QVFS 1PCXA 1U3OA 3WVEB 3M0RA 3CMAT 5AT1B 2RNAA 2XI9A 1WPYA 1VYTA 3I35A 1X6OA 5GMKh 2O9SA 2XHCA 1BCOA 3F70A 5GAMg 2O9VA 3QIIA 3CCET 1X27A 1X01A 1ARKA 3I55A 2V8KA 4HCZA 3VS7A 2CZ0B 4PFZA 5KYUB 3P8BB 3RESA 2DILA 2KYBA 2E64A 4NS5A 1VQLA 4XQ3A 4MDWA 2YRCA 3SWNC 5KYYA 4XU2A 1UUEA 3FJ5A 3QJYA 2CP0A 2EBPA 3L2ZA 5FRMA 4TVRA 2FZKB 3EGXA 1VQ4T 2E6ZA 1VQ5T 2IIMA 1Y0MA 2HKNA 1RAAB 1LNXA 1X69A 1KQ2A 2DX1A 1YJ9T 2GNCA 1Q7YR 5FROA 2J05A 1Y96B 2CT3A 1K0XA 1U1SA 2YT6A 2QTXA 3NHNA 2YDLA 1ACMB 2GBQA 1UHCA 4FT4A 4IUTA 1OULA 2AZSA 3QBYA 4M7DE 2F2XA 4PJLA 5C6SA 4IUUA 4AG1C 1Y07A 3CMET 2FPEA 3JCMP 1J3TA 1WHKA 2VB6A 4NOYA 1UGQB 1YP5A 5GAOq 2EW3A 1AEYA 3NFCA 5FU6B 5FU7B 5KH6A 4M7AD 1EFNA 3RKWA 3EHQA 1Y7XA 1TXQA 3H0FA 3OYKA 1M30A 2EIFA 1ZBJA 5KYUA 5LJ3e 4PNOA 3TSZA 1NLOC 1UJYA 3RIRA 4KGXB 2YWWA 1IO6A 4HVVA 1LOJA 1FMKA 4BB7A 3CC7Q 2EYWA 1VOMA 1T0HA 2YXYA 1R0CB 2KXCA 4LDYA 3OS1A 3V7SA 4QKUA 2DL4A 3HL8A 1ZBXA 2HQHA 2PNIA 4K11A 4M7DC 4HCKA 4A53A 1YJWQ 3OBWA 1PWTA 3CC4Q 5ECAA 4X9DA 1HYOA 3WVDB 2AZVA 3BDLA 3P8DA 2K2VA 2COWA 4EMKC 4QVDA 4N4HA 1ZUUA 3FLGA 4PJNA 1WXTA 2H3JA 3U23A 3HRUA 5KCHA 1YJNQ 3MEAA 2MIOA 4C0GA 5IHNA 2D0NA 5J26A 3TREA 3R6NA 3THKA 1NYGA 3BDUA 1BB9A 4X34A 1UGRB 5CK9A 2E41A 3NTHA 2J06A 2RB6A 2HL5C 1BI0A 4GLMA 1G83A 1WJQA 4C0ZA 4IUVA 5GANe 2EYZA 4O6JA 3ZBDA 4KULA 4Y28E 1D0YA 4Z8AA 1SEMA 4FW1A 1E6GA 5GMKi 3CCMQ 4M7AE 4ZTJA 2DZ9A 3X25B 2A7YA 3ULRB 2KYMA 2EJ9A 2QA4Q 3CC7A 3H41A 3CD6A 2AK5A 3EFOB 4DQ2A 2XU8A 2AKKA 4OGEA 1QVGS 1H3ZA 3NGPA 2QQSA 3P8HA 3OYAA 2DETA 1I0CA 3CCRT 4M7AF 3VV0A 2V8IA 2AT1B 1CSKA 2H3EB 1M90C 1YJWA 2A08A 2VC8A 3MEUA 2OI3A 1UJ0A 2RQRA 2RJDA 3M59A 2NUPB 4LE9A 3JV3A 4JZ3A 5IHIA 2RI5A 1X2KA 3A8OB 4E6RA 1I5LA 1K73C 1T3SA 5KYXB 4M7AC 1VQ7Q 4J7IA 4RKUE 2EQJA 3ZFJA 3VRZA 2M9UA 2LQKA 5I11A 2CP6A 2KY9A 5GAN3 2FG0A 1AZGB 2ENMA 1KSWA 1NE8A 1PRMC 3A1PA 3I5RA 1RI9A 4Z02A 3CCMA 2Y90A 5A0GA 2K9GA 4ELYC 1VQMQ 2OAUA 4M77G 3LH0A 2V1QA 4Q5WA 5GAOp 1Q81R 2WSCE 5CIUA 4ELZC 2QA4A 2GF7A 3RR6A 3X26B 4J9IA 1BIBA 5GAOm 4R55A 1VQPQ 4FU6A 3EFOA 3REAB 2CREA 5LJ3f 4M78G 3VUZA 3CCSQ 5C0MA 3O8VA 5IXFA 2DAQA 4PJMA 5GAN8 1WXUA 3LGLA 4LXCA 5GMKj 2L8DA 3T9NA 2ABLA 4AFSC 3SB2A 2E1HA 2A0FB 2ZPBB 4WF2A 4LDXA 1NJIU 2HAXA 3MP8A 2XDBA 2CZ6B 4JJDA 1F1BB 5FRNA 2NUPA 3HSBA 3G71Q 3CBMA 2BKDN 3EG9B 1VYUA 2VGMA 2RJFA 3V8KA
chains in the Genus database with same CATH topology
1XNIA 4OGCA 4BDZA 1VQ7A 2X4WA 2MAMA 2ZPFB 4LDUA 3PMTA 4C8QG 3M4YA 4A4KA 4PJOE 1VQOT 4JRKA 1Q82U 1YITT 1VIFA 5J3BA 1Q7YU 5CKFA 4JRQA 2RA2A 2AHJB 2LVMA 2C06A 4JDSA 3SDZA 2LT1A 3OS0A 3A8HB 2QXFA 3QXEB 3VU3C 2VUBA 5CKBA 4BI4A 2EWNA 5GAMj 4C5HA 4N0AA 3HFOA 1PSEA 2DD5A 3JCMW 5GAOl 1M5Q1 2HQXA 3CBPA 5HKCA 4E7KA 4XTXA 5EG2A 3RKXA 5GANj 2G3RA 1UB4A 2EYQA 4QW2A 1LJOA 1VQMA 4PJOD 3V7RA 5CR2A 4NL3A 1QP2A 2DIQA 2VYTA 3CPFA 5D6XA 5HY6A 3SWNB 1VIEA 3L2RA 1WJSA 2X35A 3CCVA 1K8AC 3OYMA 2PVDB 3RUXA 1YIJT 4N4GA 5CKHA 3UT1A 4BE0A 5GMKm 3CC4A 2RHYA 5GANf 4F7UB 3JCMf 2IVWA 3MCAB 1HK9A 3GF5A 1VQPA 4OF1A 5HK0A 3G6EA 2HNIA 1H641 4OB2B 3DB4A 1QP3A 2HQEA 4M75D 3JB9I 3CCSA 2FL7A 3JCMX 2M16A 3X24B 3V7CA 2CKKA 3L2VA 1BKBA 2FHDA 1VQNT 2R5AA 2JZ2A 2CGHA 2ZPHB 4E47A 1SSFA 1YJNA 2DTOA 2DTIA 2FVUA 1NPRA 2X4YA 2MI6A 1D3BB 4M77A 4N0AC 1ZQ1A 2E65A 3FDRA 1M4ZA 1KG1A 2E5QA 4GLKA 4PJOG 4PL6A 5CAIA 2EJFA 4PJOC 1FXXA 5GAN4 3CCUA 3DKMA 1M1KC 3ME9A 1XOVA 3QSUA 2DVEA 1I8FA 4RCBA 3JCMJ 3DLLA 2K3YA 2DXUA 2D6FA 2ZCFB 4D6WA 5HK3A 3G71A 5LJ3d 4V2SA 1VQKT 1WJRA 2KQWA 2R5MA 4ME7A 4M78A 3JSCA 2K5LA 3CCRA 4KBMB 5LJ5j 1IZ6A 1WGSA 3OY9A 3SD4A 3L2QA 3CBOA 2DPPB 2QQ9A 4J5YA 4L5GA 1I4K1 3E9FA 1S72A 5GAN5 2DD4A 1M1GA 4ZN1A 1Q81U 3PFSA 2RK2A 3JB9F 1G5VA 1VQ9T 3KXTA 2O01E 5DM7R 3CCJA 4RMOA 3CCLA 2EKOA 3GOXA 4XU1A 3OS5A 3LWIA 1X75C 4M7DF 3EFSA 3OYNA 3LWHA 2X4XA 3CC2A 3A8MB 2QQBA 4C0DC 1NPPA 4MZPA 2R58A 3UDCA 1WNLA 4QVCA 2L89A 4C92E 4BI3A 2RHIA 1JB0E 2LCCA 4B9WA 2DEQA 5CCAA 2MMPA 4BY6C 3QO3A 3MP6A 3Q1JA 4MDXA 3QYHB 3GPLA 3M58A 2EQUA 2QDYB 1M8VA 4JLIA 2JVVA 3OYDA 5GMKe 2RO0A 2ZPIB 1YI2A 1UEBA 5AYFA 1MGQA 1QW1A 4M77D 3X28B 3OYJA 1KHIA 4C0DB 2FYKA 2OTLA 2VXEA 1UGPB 3M9QA 3MHXA 1NJIC 1M9SA 5L8RE 2ZZDA 1W2BA 2CS7A 4ATOA 3I56A 1QVFS 3SWNA 4BY6B 1YHQA 3WVEB 3OQ5A 1EIFA 4XTZA 4JRPA 4OMFB 3CMAT 2VGNA 1KQSA 1NZ9A 2XI9A 1WPYA 3AHUA 4F7UA 3RKYA 2VXFA 1X6OA 5GMKh 3CCQA 2XG8D 2XHCA 2F5TX 5GAN2 2MWOA 3WXMB 5GAN7 2DXTA 2RJEA 3F70A 4M78D 5GAMg 4E7IA 2LT4A 2B8AA 3QIIA 3ZEHA 3OB9A 4M75E 3JAME 3CC7T 1X01A 4VUBA 5KCOA 3CCET 3CD6T 3I55A 2V8KA 4HCZA 2QEXT 1Q82C 5A0DA 5GAMd 3PT9A 2CZ0B 3OA6A 1Q7YC 1K9MC 1WQWA 4MMKA 3FIFA 3VJPA 4RG2A 2E70A 3P8BB 4XU0A 1D3BA 3RESA 1N27A 4II1A 2E64A 1N9SA 5GANd 4NS5A 3CXCS 3A8LB 1VQLA 1B34B 4XQ3A 3OS2A 2P0QA 4MDWA 1JBMA 1K9MU 2PUKB 3H6ZA 4C92G 3CCVT 3ASKA 2YHTA 3A5ZB 1RL2A 3SWNC 1YJWT 4C92C 3LLRA 1KD1U 5GAMe 3L2UA 3CC4T 4XU2A 2K3XA 2E10A 3HKSA 1VQ6T 1G3WA 4F7UG 2DK3A 3QUIA 4L6V5 3GIBA 1BI2A 3QJYA 1VQ8A 1FX7A 4M75F 4C0FA 3BY7A 3L2ZA 5FRMA 1OZ3A 4LD9K 3PIOA 4TVRA 3HHTB 4E7LA 4ZN3A 4X9CA 3QDRB 1VQ4T 2E6ZA 4C8QD 4PJOA 4EMHA 4LD6A 1VQ5T 2OTJT 3LX7A 3OMCA 4C92B 2E12A 3C94A 5GAMh 3OYCA 1LNXA 5KE2A 1OI1A 4FL6A 1KQ2A 3J81E 2CZ7B 1OYXA 1YJ9T 2KAFA 3L1AA 5FROA 1Q86C 2DXBA 3HP9A 3VYGA 1QVFA 1Y96B 4EMGA 4HT9A 5D6YA 3OYHA 3OYYA 3SFMA 5M9OA 4RG8A 3JCMV 2DKGA 1U1SA 5DLOA 5LJ5g 4M75C 2QTXA 1N8RU 1Q86U 4PLLA 3JCMc 1KQ1A 4A4GA 4EDUA 1VQOA 4BDYA 1YITA 1PSFA 1V29B 4FT4A 4IUTA 5LJ5d 3E19A 3MO8A 4JUVA 3E9GA 1UGSB 3CCMT 3L42A 5I21A 3QBYA 2IG0A 4M7DE 3RERA 1YBYA 5LJ3g 5C6SA 4IUUA 3OW2S 4DOWA 3J7AF 3C4SA 3VKIA 4ZGJB 1Y07A 1BI3A 2DJZA 2WSFE 3MEVA 3CMET 4M75B 3JCMP 1N9RA 1M90U 1KC8C 2DO3A 3OMGA 2CYZB 2KDSA 2GCXA 1KHCA 3G4ST 2QA4T 1JJ2S 4NOYA 3FRNA 2XKOC 3QKJA 1I81A 3QZ9B 1Q81C 4JS4A 1UGQB 3MEWA 3RMSA 4J6WA 2YLCA 3BW1A 2F69A 5GAOq 1ZHIA 4BI8B 1BIAA 2Y4XA 1MHNA 1O9SA 1VUBA 3NFCA 5FU6B 5FU7B 4DOVA 1YCYA 5KH6A 1KC8U 3RKWA 2VV5A 4M7AD 1OZ2A 3HRSA 3N5BB 3QJ6A 3QG1A 4HA8A 5D6WA 3TEEA 4BD3A 1Y7XA 4BUGA 2PQWA 1YIJA 3X20B 4M77F 3C95A 4OB0B 2LC4A 3OYKA 2EIFA 5LJ3e 2KSSA 4PNOA 3UPUA 3RIRA 5I2MA 4R56A 1B34A 1FWZA 2JUFA 3M55A 1LOJA 2QI2A 5GAN6 4BB7A 2EQMA 4C5EA 5GAOn 1VQNA 4BE2A 1G3TA 5GMKl 2P0KA 3DLMA 4XK8E 4MMLA 2PU9B 3GNGA 4M78F 4EPCA 4ZGDB 4LDYA 3PIPA 5LJ3h 3OS1A 2DZCA 3LW5E 4J6XA 4LDWA 4PLIA 3V7SA 3S3OA 3OYLA 3UWNA 2L5QA 3JB9G 1R8OB 3M56A 3VYHB 4MZTA 4C8QE 1G3SA 2O4XB 4HCCA 4QQDA 3HL8A 4M7DG 4FM4B 1ZBXA 4RCCA 2RHZA 2LQ8A 3M54A 4FSXA 1VQ7T 3OYGA 4M7DC 4C92A 4FT2A 4A53A 1VQKA 3OBWA 2LTOA 4QVZA 5LL6S 4X9DA 2L3RA 4QQ6A 1Y71A 1TH7A 2RI2A 3FJPA 3BFMA 3WVDB 3BDLA 3P8DA 2QQRA 2K2VA 4QVDA 3INZA 4EMKC 4N4HA 2HD0A 4O5VA 4OVAA 1VQ9A 4L59A 3FLGA 4QQGA 3VUBA 3V8JA 2H3JA 5KCHA 3HRUA 4E7JA 3MEAA 5GANg 4JS5A 2FB7A 3JCMg 1HXDA 4M7DB 2WACA 4C0GA 4FIBA 2NLUA 3QPHA 1JRIA 2RJCA 4C8QF 1U1TA 3TCJA 1VQMT 5J26A 5CVIA 3QHSA 3TREA 1KD1C 1GXIE 3JCMd 3BDUA 3S6WA 3M57A 2BUDA 4X34A 3A8GB 1UGRB 5CK9A 2JTMA 2RI3A 2E41A 3NTHA 4LDVA 3CPWS 4EMKB 4GY5A 5FLXE 4J7FA 2RB6A 3OBYA 1P92A 4M75A 1BI0A 1WQ7A 1BI1A 4JRIA 3RMQA 1WJQA 4J8OA 4IUVA 2EJGA 4C0ZA 1VQPT 3G6ET 2QQAA 5GANe 3META 5GAOr 4HCBA 4KT0E 4BE1A 3FC3A 4O6JA 3ZBDA 4KULA 4Y28E 3OYIA 2D9TA 3CCST 5A0LA 3PNWC 5GMKi 4M7AE 4IUQA 4ZTJA 2LX9A 2PUOB 2DZ9A 2RM4A 4IURA 1YJNT 3X25B 2A7YA 2XK0A 2LRQA 4C8QC 3M4GA 4CI0C 3CMAA 1DJ7B 4M7DA 2JNGA 3FEOA 4C5GA 4C92D 2WSEE 2PVOB 3PTAA 2EJ9A 2DTHA 2JOYA 4BACA 3CC7A 2X4JA 5GANh 3CCEA 3JCMh 1N8RC 2E6NA 3CD6A 4YTLA 2ZPGB 5CQXA 3CCUT 4DQ2A 2XU8A 2QEXA 5IN1A 2K5IA 2HBPA 2LCLA 4JJNK 4OGEA 2V8JA 4M75G 1QVGS 1H3ZA 2QQSA 3P8HA 3OYAA 3EAEA 3G71T 1U8RA 4IKFA 2EQKA 4IUPA 4C5IA 4C8QB 2RK1A 2ZPEB 4KUIA 3CCRT 3S3MA 4M7AF 3VV0A 3G7ZA 2XD0A 5GAMf 2V8IA 4M77E 4PJOF 3L2WA 3CEYA 4HT8A 1S72T 1M90C 4M7AA 4N4IA 3GLXA 5FU6C 1YJWA 5FU7C 3GP8A 2DXCA 2O4XA 3JB9H 4Y91A 2PVGB 2VC8A 3CCJT 3CCLT 3MEUA 1VQ6A 2ZGWA 4OB3B 5A2QE 1K8AU 2RJDA 3M59A 3CC2T 2YRVA 4J83A 2Y4YA 3CXCA 5CO7A 2RHUA 1BYMA 3J80E 4CRIA 5LJ5e 3JRZA 4XAXB 2RI5A 1VQ4A 3NTKA 5CQYA 2BIVA 2LDMA 1W2BS 3A8OB 3CPWA 4M78E 1VQ5A 1I5LA 3LYIA 2OTJA 4B9XA 2XDPA 4OB1B 5CKEA 1K73C 3OYEA 2K4YA 4M7AG 2GFUA 2JTFA 1KQSS 2M1HA 2YLBA 4JLGA 3OYFA 4M7AC 4HKEA 3H8ZA 3OSVA 4PKCC 1W4SA 5CKDA 5I2SA 2DIGA 3JCMQ 2XDDA 2M0OA 1YI2T 4OP0A 4J7IA 2GFAA 3M53A 1YJ9A 3C12A 3HPWA 3R6OA 4MZMA 2KMTA 3GNFB 2RD1A 1K73U 4RKUE 3URGA 5LJ5h 3S3NA 2OTLT 2EQJA 3QYGB 3ZFJA 4KUDK 3PGGA 3I56T 2M9UA 2LQKA 2R57A 4EMKA 2KY9A 4ZGEB 1YHQT 1XQHA 5GAN3 3V8LA 2CZ1B 1M1KU 3QZ5B 3E1SA 1NE8A 2RH2A 4M7AB 3CCQT 2GQVA 3CCMA 4Z02A 4PJOB 2Y90A 5A0GA 4NL2A 1AHJB 1XTDA 4ELYC 1G3YA 3I55T 2OAUA 4M77G 1QVGA 3LH0A 4ZTFA 4Q5WA 4M77C 5LJ5f 5GAOp 3CMEA 2WSCE 5CIUA 3ER0A 2MWPA 3KUFA 3DB3A 2A3LA 3PMIA 4ELZC 3G4SA 2KVQG 2QA4A 5LJ3j 4XU3A 4A4FA 2I2LA 2P4TA 4UC4A 1QVPA 2GF7A 3X26B 1VQLT 1BIBA 2KK4A 2MF2A 2F5KA 4P5NA 3NTIA 4XTUA 2K57A 5GAOm 4R55A 4F7UE 4FU6A 2K5FA 3OYBA 2LNVA 4DA4A 1Y96A 5LJ3f 2EFIA 4M78G 3VUZA 5J39A 3M5AA 4XTWA 3KBGA 3O8VA 5C0MA 2RHXA 3OW2A 4M78C 2XIDA 2DAQA 4M77B 3JB9D 5GAN8 3LGLA 1JJ2A 1VQ8T 4C8QA 2EAYA 5GMKj 2L8DA 1IREB 4XTVA 3T9NA 3OSSC 3JCMb 4M7DD 4XTYA 3LGFA 3MP1A 3SB2A 5IT9E 5DLQE 2E1HA 5DY9A 1O75A 2ZPBB 1RI0A 1M1FA 4WF2A 2JN0A 2XICA 4C92F 3JB9J 1NJIU 2HAXA 3MP8A 4LDXA 2XDBA 2CZ6B 3HFNA 4M78B 4A54A 3TU4K 2P0PA 4F7UF 4A4EA 5FRNA 2D0QB 4A4HA 4E7HA 4J6YA 3HSBA 3EFRA 5KE3A 3CBMA 5IAYA 1N6AA 3FB9A 2BKDN 3JCMe 3HRTA 2VGMA 2RJFA 3V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGQ A;  4M77 D;  4HA8 A;  4PJO D;  2FYK A;  4M7A F;  4M77 F;  5GAM f;  2VXE A;  4M77 E;  4PJO F;  4C8Q G;  4HT8 A;  4PJO E;  5LJ3 e;  4JRK A;  3SWN A;  4PNO A;  3JB9 H;  4Y91 A;  3RIR A;  2VC8 A;  1B34 A;  2RA2 A;  4XTZ A;  3AHU A;  1WPY A;  1LOJ A;  2ZGW A;  4F7U A;  3RKY A;  2VXF A;  5GAN 6;  5GMK h;  5GAN 2;  3VU3 C;  5GAO n;  5GMK l;  5GAN 7;  2DXT A;  4M78 D;  5LJ5 e;  5GAM g;  2EWN A;  5GAM j;  4M75 E;  4MML A;  4N0A A;  1X01 A;  3HFO A;  4M78 F;  4M78 E;  5GAO l;  1I5L A;  1M5Q 1;  5LJ3 h;  2DZC A;  4M7A A;  4XTX A;  3RKX A;  5GAN j;  4J6X A;  3V7S A;  1LJO A;  5GAM d;  4M7A G;  3V7R A;  1WQW A;  4MMK A;  4NL3 A;  3FIF A;  3JB9 G;  2YLB A;  4M7A C;  4XU0 A;  3JCM Q;  1D3B A;  4C8Q E;  3RES A;  3SWN B;  4M7D A;  5GAN d;  2E64 A;  1N9S A;  4OP0 A;  4M7D G;  1B34 B;  4RCC A;  4XQ3 A;  3RUX A;  4M7D C;  2RD1 A;  4C92 A;  5LJ5 h;  1JBM A;  4A53 A;  5GMK m;  5GAN f;  4F7U B;  3JCM f;  4C92 G;  1HK9 A;  2YHT A;  3PGG A;  4X9D A;  3SWN C;  4C92 C;  2HNI A;  5GAM e;  1TH7 A;  1H64 1;  3FJP A;  4XU2 A;  3BFM A;  4EMK A;  5GAN 3;  2E10 A;  4M75 D;  3V8L A;  4F7U G;  3JB9 I;  3QUI A;  3JCM X;  3GIB A;  4QVD A;  3INZ A;  4M75 F;  3V7C A;  3BY7 A;  4M7A B;  4EMK C;  3L2Z A;  4PJO B;  2CGH A;  3V8J A;  2DTO A;  2DTI A;  2Y90 A;  5GAN g;  4X9C A;  2FB7 A;  3JCM g;  1D3B B;  1HXD A;  4M77 A;  4N0A C;  4NL2 A;  2E65 A;  4C8Q D;  4M7D B;  4PJO A;  4EMH A;  4M77 G;  1JRI A;  4PJO G;  1U1T A;  4C8Q F;  5CAI A;  4M77 C;  5LJ5 f;  4C92 B;  5GAM h;  3QHS A;  2EJF A;  5GAO p;  1LNX A;  4PJO C;  3JCM d;  3BDU A;  5GAN 4;  1KQ2 A;  5LJ3 j;  4XU3 A;  2I2L A;  3QSU A;  2E41 A;  2DVE A;  4EMK B;  1I8F A;  4RCB A;  3JCM J;  3L1A A;  1BIB A;  2DXU A;  4XTU A;  2RB6 A;  1Y96 B;  2K57 A;  5LJ3 d;  4EMG A;  4M75 A;  5GAO m;  4JRI A;  1WQ7 A;  4F7U E;  4HT9 A;  4V2S A;  4M78 A;  2EJG A;  3JCM V;  1Y96 A;  2DKG A;  1U1S A;  5LJ3 f;  4M78 G;  4M75 C;  5GAN e;  4XTW A;  2QTX A;  5LJ5 g;  5LJ5 j;  3JCM W;  5GAO r;  4M78 C;  1KQ1 A;  3JCM c;  4J5Y A;  4M77 B;  3JB9 D;  1I4K 1;  5GAN 8;  5GAN 5;  4C8Q A;  5GMK i;  4M7A E;  2EAY A;  3JB9 F;  5GMK j;  5LJ5 d;  4JUV A;  4XTV A;  3JCM b;  4M7D D;  2RM4 A;  2DZ9 A;  4XTY A;  5I21 A;  4XU1 A;  3SB2 A;  3M4G A;  4C8Q C;  4M7D F;  3EFS A;  2E1H A;  5DY9 A;  4M7D E;  3RER A;  4C92 D;  5LJ3 g;  1WNL A;  2EJ9 A;  2DTH A;  4WF2 A;  4C92 F;  2JN0 A;  4QVC A;  4C92 E;  3JB9 J;  2DJZ A;  5GAN h;  3JCM P;  4M75 B;  3JCM h;  1N9R A;  2DEQ A;  3HFN A;  4M78 B;  4DQ2 A;  4A54 A;  4NOY A;  3QO3 A;  4F7U F;  1I81 A;  3HSB A;  4J6Y A;  3EFR A;  4J6W A;  2YLC A;  3BW1 A;  4M75 G;  5GAO q;  1M8V A;  1BIA A;  4JLI A;  5GMK e;  3FB9 A;  4C8Q B;  3JCM e;  4M7A D;  1YCY A;  3V8K A;  3RKW A; 
#chains in the Genus database with same CATH topology
 1XNI A;  4OGC A;  1D1C A;  1B7T A;  2X4W A;  1VQ7 A;  2ZPF B;  2EGE A;  4LDU A;  2YUN A;  5KYX A;  1Q82 U;  3CCL Q;  1WA7 A;  5CKF A;  4JRQ A;  2LVM A;  2DRK A;  4JDS A;  3SDZ A;  3A8H B;  3QXE B;  2KRN A;  3VU3 C;  4AFU C;  4F14 A;  1E7O A;  3HFO A;  1QWE A;  3CBP A;  2CP5 A;  5HKC A;  1VQM A;  4QW2 A;  5GJW B;  1YI2 Q;  4NL3 A;  2HL3 A;  2KR3 A;  3VS6 A;  2DNU A;  4F17 A;  3CCV A;  4AFQ C;  1YWO A;  5GAN f;  2K6D A;  1HK9 A;  1VQP A;  3NMZ C;  1H64 1;  1QP3 A;  3VRY A;  6AT1 B;  3CCS A;  2X3X D;  3X24 B;  4RTT A;  2FHD A;  2R5A A;  1NPR A;  1SHG A;  2X9H A;  2KT8 A;  1MUZ A;  3EGU A;  4PL6 A;  2FPD A;  5CAI A;  2J6F A;  2EJF A;  2ZAE A;  2DYB A;  3H0H A;  3VS4 A;  1RLP C;  3DLL A;  4M4Z A;  1JU5 C;  5HK3 A;  3G71 A;  1VQK T;  2KQW A;  4ME7 A;  3JSC A;  1WYX A;  1B3Q A;  1WGS A;  1VQ8 Q;  3SD4 A;  4L5G A;  1I4K 1;  1M1G A;  2RK2 A;  3EG9 A;  1G5V A;  2QAZ A;  1AWX A;  5DM7 R;  3CCL A;  3GOX A;  3LWI A;  1NPP A;  4MZP A;  2R58 A;  2OX7 A;  1JB0 E;  5GJV B;  1M3A A;  2DEQ A;  4J9B A;  3QO3 A;  4MDX A;  3M58 A;  2QDY B;  1M8V A;  2V1R A;  4JLI A;  5IHK A;  5GMK e;  2RO0 A;  2ZPI B;  1YI2 A;  1UG1 A;  5AYF A;  1MGQ A;  4M77 D;  3X28 B;  3OYJ A;  1K0S A;  2VXE A;  1K1Z A;  4ATO A;  4BY6 B;  1YHQ A;  3OQ5 A;  2AIR B;  4Z89 A;  1WX6 A;  4XTZ A;  4JRP A;  1KQS A;  2C0I A;  3AHU A;  2RF0 A;  1GBQ A;  1WFW A;  5GAN 2;  1E6H A;  1D09 B;  5GAN 7;  2DXT A;  4M78 D;  2LT4 A;  2B8A A;  4VUB A;  2DL7 A;  4J9D A;  1V76 A;  5EC7 A;  4WTO B;  2DBM A;  1WQW A;  4RG2 A;  2E70 A;  4Y92 A;  1YIJ Q;  1N27 A;  2KGT A;  1SHF A;  1YJ9 Q;  2FZC B;  1B34 B;  2P84 A;  1C0M A;  4C92 G;  3CCV T;  1V1C A;  2L0A A;  1KD1 U;  3UAT A;  1VQ6 T;  2CT4 A;  4L6V 5;  3GIB A;  1VQN Q;  1VQ8 A;  1ZSG A;  3BY7 A;  1IHV A;  2CSQ A;  1OZ3 A;  1CKA A;  3PIO A;  1PG5 B;  4E7L A;  3QDR B;  2L3P A;  4EMH A;  4LD6 A;  2OTJ T;  2LX7 A;  3OYC A;  2KNB B;  1OYX A;  2M51 A;  3HP9 A;  2BE9 B;  4FYX B;  3OYH A;  3OYY A;  3SFM A;  5M9O A;  1BCM A;  4FYV B;  2DBK A;  1VQ9 Q;  1VQO A;  3MO8 A;  1RAB B;  4CC4 B;  2KXD A;  5LJ3 g;  2WSF E;  2GGR A;  1MMA A;  4M75 B;  1N9R A;  2JTE A;  3OMG A;  2CYZ B;  2GCX A;  1KHC A;  3UF4 A;  4FCY A;  3FRN A;  3QZ9 B;  1I81 A;  1Q81 C;  4J6W A;  3BW1 A;  2F69 A;  4BI8 B;  1O9S A;  4IKF A;  1VUB A;  4DOV A;  1QWF A;  1KC8 U;  1YCY A;  2KRO A;  3N5B B;  3QJ6 A;  3QG1 A;  5D6W A;  3TEE A;  1YIJ A;  4BUG A;  3X20 B;  4M77 F;  4OB0 B;  8AT1 B;  1B34 A;  2K7A A;  2RPN A;  3M55 A;  2FEI A;  4C5E A;  1VQN A;  1G3T A;  2P0K A;  2I0N A;  4M78 F;  4ZGD B;  2QEX Q;  3RNJ A;  3PIP A;  4J9F A;  2DZC A;  4PLI A;  4LDW A;  2COY A;  3S3O A;  2JW4 A;  3OYL A;  3UWN A;  2L5Q A;  2LCS A;  3M56 A;  1G3S A;  4ZNX A;  1PRL C;  2QAS A;  1IGU A;  4QQD A;  4HCC A;  4FM4 B;  1FYN A;  2HBW A;  3M54 A;  4RCC A;  2NUT B;  3CPW P;  2DL5 A;  5LL6 S;  4QQ6 A;  4DBQ A;  1Y71 A;  2RI2 A;  4J9C A;  2RQU A;  1VQ9 A;  2HD0 A;  4OMN A;  3QWX X;  4DEY A;  5GAN g;  4JS5 A;  3QPH A;  1JRI A;  1NEB A;  1SG5 A;  1U1T A;  2OJ2 A;  3TCJ A;  1GXI E;  1GCQ A;  3M57 A;  2BUD A;  1UGV A;  3CPW S;  1MV3 A;  4M75 A;  1P92 A;  1WQ7 A;  1BI1 A;  4J8O A;  2EJG A;  2QQA A;  2DER A;  3MET A;  2DFU A;  5A0L A;  3PNW C;  1XJW B;  2PUO B;  4IUR A;  2BE7 D;  2LRQ A;  2LP5 A;  2JNG A;  2J6O A;  4C92 D;  2WSE E;  3REB B;  4BAC A;  2JOY A;  3G4S Q;  2X4J A;  3JCM h;  1N8R C;  4J9H A;  2ZPG B;  1I07 A;  5CQX A;  3CCU T;  2QEX A;  2K5I A;  1KD1 R;  2LCL A;  2E3H A;  4JZ4 A;  2V8J A;  4M75 G;  2O2O A;  4IUP A;  4GBQ A;  1KQS P;  2ZPE B;  1IB8 A;  1TUG B;  3G7Z A;  2FRY A;  1NG2 A;  2PZ1 A;  1S72 T;  3GLX A;  1WIE A;  2DXC A;  3JB9 H;  1SKU B;  4Y91 A;  2PVG B;  4FW2 A;  2NUT A;  5A2Q E;  1K8A U;  1T0J A;  3CC2 T;  4J83 A;  1PD1 A;  4CRI A;  1VYV A;  2BIV A;  5IXB A;  3LYI A;  2XDP A;  3OYE A;  2K4Y A;  1NM7 A;  2GFU A;  1KQS S;  3OYF A;  2YLB A;  5I2S A;  1W4S A;  4IIM A;  2ESW A;  2DIG A;  1LPL A;  4KRT A;  2M0O A;  2XDD A;  2GFA A;  2ED0 A;  4LN2 A;  2RD1 A;  3S3N A;  3PGG A;  4JJB A;  4KGZ B;  4KH0 B;  1U5S A;  1OV3 A;  2PTK A;  4D8D A;  3E1S A;  2RH2 A;  2GQV A;  2GTJ A;  4PJO B;  3SHW A;  3I55 T;  1KC8 R;  4ZTF A;  3KUF A;  2MWP A;  2EQI A;  3DB3 A;  3G4S A;  4OMO A;  1RAC B;  4PFP A;  1QVP A;  1TWB A;  1VQL T;  2KK4 A;  3M0S A;  3G6E Q;  2LNV A;  1ABO A;  1Y96 A;  1UFF A;  3M5A A;  2RHX A;  4M77 B;  4E7S A;  1JJ2 A;  1K4U S;  1IRE B;  3JCM b;  2VKN A;  1IXD A;  3LGF A;  5IT9 E;  5DLQ E;  1RI0 A;  1M1F A;  4C92 F;  1PKS A;  4J9E A;  1WXB A;  4M78 B;  1RAE B;  5L23 A;  2P0P A;  4A4H A;  4J6Y A;  3EFR A;  5KE3 A;  5IAY A;  2DM1 A;  1N6A A;  1OX9 A;  2VWF A;  1YNZ A;  3M4Y A;  3CCJ Q;  1JO8 A;  2YSQ A;  3PVL A;  2AHJ B;  1Z9Z A;  4CC3 A;  5CKB A;  2EWN A;  2DD5 A;  1M5Q 1;  4E7K A;  2G3R A;  3V7R A;  5D6X A;  2A28 A;  2CUB A;  1RAH B;  3SWN B;  1VIE A;  2X35 A;  2OTL Q;  2PVD B;  3RUX A;  5CKH A;  3UT1 A;  3I56 Q;  3CC4 A;  1TG0 A;  2RHY A;  3CQT A;  4RTU A;  3G6E A;  2HNI A;  1NEG A;  4OB2 B;  4Z88 A;  2HQE A;  2VVK A;  4M75 D;  3CCQ Q;  3H9N A;  2FL7 A;  3JCM X;  2CKK A;  3L2V A;  1BKB A;  2JZ2 A;  4E47 A;  1YJN A;  2DTI A;  2X4Y A;  1A0N B;  1D3B B;  4M77 A;  4N0A C;  1ZQ1 A;  1KG1 A;  4D8K A;  4PJO G;  1BBZ A;  1FXX A;  5GAN 4;  1M1K C;  1W1F A;  1XOV A;  1I8F A;  1NLP C;  2DXU A;  4D6W A;  4V2S A;  2R5M A;  4M78 A;  1M8M A;  4LUE A;  1KJW A;  5LJ5 j;  3OY9 A;  3VS3 A;  3L2Q A;  3CBO A;  5GAN 5;  1AT1 B;  1KK7 A;  3PFS A;  2O01 E;  3UA7 A;  3CCJ A;  3AT1 B;  4XU1 A;  3OS5 A;  1X75 C;  3EFS A;  3OYN A;  4JPB W;  2X4X A;  1TU0 B;  2L89 A;  4LUD A;  4BI3 A;  5CCA A;  2EKH A;  4BY6 C;  3GBQ A;  4ANJ A;  3OYD A;  1UEB A;  2DVJ A;  4E2F B;  3LH5 A;  2ED1 A;  2F2V A;  4RTV A;  1HJD A;  2OTL A;  3IQL A;  1YIT Q;  2LJ1 A;  2ZZD A;  1W2B A;  3I56 A;  3SWN A;  2ROT A;  4CC7 A;  2VGN A;  1PC0 A;  1NZ9 A;  3RKY A;  2VXF A;  3CCQ A;  2XG8 D;  2KE9 A;  2MWO A;  2RJE A;  3CC7 T;  3OB9 A;  4M75 E;  2L3S A;  3JAM E;  5KCO A;  3CD6 T;  1M27 C;  5A0D A;  1Q7Y C;  3EH2 A;  1WHL A;  3VJP A;  1D3B A;  1N9S A;  2JT4 A;  3A8L B;  3OS2 A;  1K9M U;  1RL2 A;  1YJW T;  3LLR A;  3CC4 T;  4RTX A;  3QUI A;  1FX7 A;  4M75 F;  4C0F A;  1FMW A;  4KGV B;  4LD9 K;  2H8H A;  4X9C A;  1FMV A;  1MMN A;  4C92 B;  5GAM h;  5KE2 A;  1N5Z A;  1GCP A;  4DEX A;  2CP3 A;  1GCQ C;  1JJ2 P;  3L1A A;  3PE0 A;  3VYG A;  1QVF A;  5D6Y A;  2FPF A;  3NPF A;  4RG8 A;  2DKG A;  5DLO A;  4M75 C;  2FZG B;  1Q86 U;  3JCM c;  1W6X A;  1YIT A;  1V29 B;  5LJ5 d;  4RUG A;  1MMG A;  3CCM T;  3L42 A;  2HCK A;  1LVK A;  2YUO A;  2NYS A;  3RER A;  1YBY A;  3C4S A;  1BI3 A;  2DJZ A;  1M90 U;  2HZY A;  1KC8 C;  2QA4 T;  1JJ2 S;  2DMO A;  2XKO C;  2RQW A;  3QKJ A;  5FWB A;  3RMS A;  2YLC A;  2E4H A;  1ZHI A;  1BIA A;  2Y4X A;  1WLP B;  3I9Q A;  1GFC A;  3HRS A;  4HA8 A;  4PJO D;  2PQW A;  2GQI A;  3C95 A;  3MKD A;  3CMA Q;  3UPU A;  5I2M A;  4FYY B;  1UTI A;  1FWZ A;  2JM9 A;  2JUF A;  1ZUK A;  5GAO n;  2COZ A;  3CCE Q;  4AFZ C;  2X3W D;  4XK8 E;  2KEA A;  4MML A;  2PU9 B;  4QT7 A;  3LW5 E;  4J6X A;  1G8X A;  3JB9 G;  1R8O B;  1ZLM A;  2QGF B;  4MZT A;  1RAD B;  1LCK A;  2O4X B;  4M7D G;  1ZUY A;  1VQ7 T;  3OYG A;  4C92 A;  4FT2 A;  5KYN A;  2LTO A;  4QVZ A;  2L3R A;  1QKX A;  1TH7 A;  1OX8 A;  2SRC A;  1OQK A;  3FJP A;  2QQR A;  2K3B A;  1VQ4 Q;  4E7J A;  3VUB A;  3V8J A;  1VQ5 Q;  1HXD A;  1X6G A;  1TOV A;  2M02 A;  2NLU A;  2RJC A;  2MCN A;  1VQM T;  1PD0 A;  3QHS A;  3JCM d;  4LDV A;  4GY5 A;  5FLX E;  4J7F A;  3OBY A;  4JRI A;  1D1B A;  4B6M A;  1NJI R;  1VQP T;  2D1X A;  1M2V B;  4KT0 E;  4BE1 A;  3FC3 A;  3CCS T;  2RM4 A;  3CMA A;  4CI0 C;  1DJ7 B;  3FEO A;  4C5G A;  1SPK A;  3CME Q;  3TVT A;  1Q82 R;  3CCE A;  2E6N A;  1I1J A;  1K9M R;  4F16 A;  1MV0 B;  2AKL A;  5IN1 A;  1W2B P;  4JJN K;  4AT1 B;  2YUQ A;  3G71 T;  3EAE A;  3MJX A;  1U8R A;  2EQK A;  4X1V A;  4C8Q B;  4KUI A;  3HTR A;  4M77 E;  4PJO F;  5FU6 C;  5FU7 C;  2ECZ A;  2O4X A;  4R0K A;  3CCL T;  2YRV A;  4HVU A;  3CXC A;  1I5O B;  1BYM A;  3J80 E;  3JRZ A;  4XAX B;  3TSW A;  1VQ4 A;  2QDL A;  2LDM A;  2L2P A;  1W2B S;  4M78 E;  1VQ5 A;  1S1N A;  4B9X A;  2YRD A;  5CKE A;  1OPL A;  4M7A G;  2CP2 A;  2JTF A;  1Q86 R;  4JLG A;  4HKE A;  3OSV A;  1YI2 T;  2NWM A;  1YJ9 A;  4OP0 A;  1AWO A;  3M53 A;  3HPW A;  5KYY B;  5LJ5 h;  2L3Q A;  4KUD K;  4A63 B;  4E7Z A;  4ZGE B;  1YHQ T;  1RLQ C;  1XQH A;  3V8L A;  1WDX A;  5HCK A;  1AHJ B;  1XTD A;  3H0I A;  1G3Y A;  1QVF P;  1QVG A;  5LJ5 f;  4M77 C;  3CME A;  1AWJ A;  5LJ3 j;  4XU3 A;  2P4T A;  2XMF A;  4P5N A;  1GL5 A;  2QYZ A;  1G2B A;  3OYB A;  3OW2 A;  3JCM W;  5J39 A;  4XTW A;  3BE3 A;  4M78 C;  2XID A;  2X51 A;  3JB9 D;  4LNP A;  1VQ8 T;  4C8Q A;  4OML A;  3OSS C;  4M7D D;  4XTY A;  2W10 A;  2DYI A;  1D0Z A;  3MP1 A;  2RQV A;  1O75 A;  2JN0 A;  1JXO A;  1PKT A;  3HFN A;  4A54 A;  3TU4 K;  4A4E A;  4E7H A;  3VS2 A;  2JMC A;  1JQQ A;  1WHM A;  4RTZ A;  3FB9 A;  2KI7 A;  3CCR Q;  4C8Q G;  4A4K A;  1VQO T;  1U06 A;  5J3B A;  3G1J A;  2CUD A;  3M0P A;  2RA2 A;  3EG1 A;  2LT1 A;  2QG9 B;  3OS0 A;  4BI4 A;  2E3I A;  4C5H A;  5GAM j;  2HSE B;  1PSE A;  1YWP A;  1UDL A;  3D7S B;  1SRL A;  3RKX A;  5GAN j;  1UB4 A;  1LJO A;  3M0T A;  5CR2 A;  1R77 A;  2VYT A;  3CPF A;  2CH4 W;  2JJ9 A;  2HMA A;  3L2R A;  1YIJ T;  4N4G A;  4BE0 A;  5GMK m;  2V26 A;  4F7U B;  1ZSZ B;  3JCM f;  3MCA B;  3GF5 A;  1WHJ A;  4OF1 A;  1Z9Q A;  3DB4 A;  2RN8 A;  3JB9 I;  3V7C A;  1KIK A;  3VS1 A;  1VQN T;  2ZPH B;  2CGH A;  2FVU A;  2EPD A;  2MI6 A;  1M4Z A;  4WCI A;  4EIK A;  2GTO A;  1QCN A;  4AG2 C;  3ME9 A;  3QSU A;  2DVE A;  3I5S A;  5IH2 A;  2KRS A;  2K3Y A;  1MMD A;  2D6F A;  2CP7 A;  1AD5 A;  5LJ3 d;  1TS9 A;  1WJR A;  3RDV A;  3CCR A;  4KBM B;  3PVQ A;  1IZ6 A;  1SRM A;  2DPP B;  2QQ9 A;  4J5Y A;  2DD4 A;  4ZN1 A;  1Q81 U;  3JB9 F;  1VQ9 T;  4M7D F;  3LWH A;  2VAS A;  3A8M B;  2QQB A;  4HVW A;  4RTW A;  2EVR A;  4C92 E;  2RHI A;  1PM3 A;  4B9W A;  3CD6 Q;  3MP6 A;  3GPL A;  1EZZ B;  1C6V X;  1QW1 A;  1WHG A;  1KHI A;  4C0D B;  2FYK A;  3M9Q A;  1UGP B;  3CXC P;  1AOJ A;  1NJI C;  1M9S A;  2EGC A;  2MK5 A;  2QTV A;  2LQN A;  3EG3 A;  8ATC B;  1RAI B;  1EIF A;  4OMF B;  1D0X A;  4F7U A;  1ZSZ A;  2F5T X;  3WXM B;  2QK0 A;  3VS5 A;  4PJJ A;  4E7I A;  2BTT A;  3ZEH A;  1TUD A;  1UHF A;  2FO0 A;  2QEX T;  2JMA A;  1Q82 C;  3EH1 A;  3OA6 A;  5GAM d;  3PT9 A;  1K9M C;  1Q95 G;  4MMK A;  3FIF A;  2DJQ A;  4XU0 A;  2K2M A;  4II1 A;  5GAN d;  3CXC S;  2P0Q A;  1JBM A;  2PUK B;  3H6Z A;  3ASK A;  2DL8 A;  2YHT A;  3A5Z B;  4C92 C;  5GAM e;  3L2U A;  1WHH A;  2K3X A;  2E10 A;  3HKS A;  1QVG P;  1G3W A;  4F7U G;  2DK3 A;  1PNJ A;  1BI2 A;  2D8H A;  4J9G A;  2DL3 A;  2MOX A;  3HHT B;  4ZN3 A;  1ZX6 A;  2LNH B;  2YUP A;  4C8Q D;  4PJO A;  2ROL A;  3QWY A;  3LX7 A;  3OMC A;  2E12 A;  3C94 A;  1OI1 A;  4FL6 A;  2A36 A;  2KT1 A;  3OW2 P;  3J81 E;  2CZ7 B;  1R0B G;  2KAF A;  1VQK Q;  1W70 A;  1Q86 C;  2DXB A;  2DA9 A;  1YN8 A;  2LZ6 B;  4EMG A;  1GFD A;  4HT9 A;  4IIO A;  2O88 A;  1Y57 A;  3JCM V;  5D7U A;  5LJ5 g;  1N8R U;  4PLL A;  4A4G A;  1KQ1 A;  4EDU A;  1AZE A;  1IHW A;  4BDY A;  1PSF A;  3E19 A;  1IRX A;  4JUV A;  3E9G A;  1VA7 A;  1UGS B;  2FRW A;  5I21 A;  2IG0 A;  2Z0W A;  2HDA A;  3M0U A;  4FYW B;  3ZL7 C;  5KYW B;  2HKQ B;  3OW2 S;  4DOW A;  3J7A F;  3VKI A;  2DRM A;  3MEV A;  4ZGJ B;  2DO3 A;  3G4S T;  1RAF B;  2KDS A;  1RUW A;  4JS4 A;  3MEW A;  1K8A R;  2BZX A;  1QCO A;  2KBT A;  1MHN A;  2VV5 A;  1OZ2 A;  4BD3 A;  2EYY A;  2LC4 A;  3M0Q A;  2KSS A;  4R56 A;  3SEM A;  1SF9 A;  2QI2 A;  5GAN 6;  3TQ7 P;  2BZY A;  2IPO B;  2EQM A;  4BE2 A;  5GMK l;  3DLM A;  3GNG A;  2A37 A;  4EPC A;  4ESR A;  1QMC A;  1RAG B;  5LJ3 h;  2CDT A;  2QGG A;  2LJ0 A;  2F2W A;  1IGQ A;  2LQW A;  3VYH B;  3VS0 A;  4C8Q E;  2RHZ A;  2LQ8 A;  4FSX A;  3CCV Q;  1QQJ A;  1VQK A;  2NUZ A;  1VQ6 Q;  4F04 B;  3BFM A;  1GBR A;  4KH1 B;  3INZ A;  4O5V A;  4OVA A;  4L59 A;  4QQG A;  1OOT A;  1C1A A;  2OTJ Q;  2FB7 A;  3JCM g;  4M7D B;  2WAC A;  1X43 A;  4FIB A;  4C8Q F;  2RQT A;  1KD1 C;  5CVI A;  4RTY A;  1PHT A;  3S6W A;  1K76 A;  3A8G B;  2JTM A;  1T3L A;  2RI3 A;  2JS0 A;  4EMK B;  5KYW A;  3RMQ A;  3G6E T;  4OMM A;  5GAO r;  4HCB A;  1MNE A;  3OYI A;  2D9T A;  1QCF A;  4IUQ A;  2LX9 A;  2G6F X;  1YJN T;  2XK0 A;  4C8Q C;  3M4G A;  3QDF A;  2RMO A;  1OPK A;  2LMJ A;  3EGD B;  2PVO B;  3PTA A;  2DTH A;  1D1A A;  5GAN h;  4YTL A;  7AT1 B;  4JJC A;  2EGA A;  2HBP A;  2ATC B;  4C5I A;  1UEC A;  2RK1 A;  2LJ3 A;  3UA6 A;  1TUC A;  3S3M A;  1QLY A;  1UE9 A;  2XD0 A;  5GAM f;  2SEM A;  3CEY A;  3L2W A;  4HT8 A;  4N4I A;  3GP8 A;  2DF6 A;  3CCJ T;  1VQ6 A;  3EG2 A;  1YHQ Q;  1OU9 A;  2ZGW A;  4OB3 B;  5FW9 A;  2Y4Y A;  5CO7 A;  2RHU A;  4ORZ A;  1K9A A;  5LJ5 e;  1ABQ A;  1WI7 A;  2P4R A;  3NTK A;  5CQY A;  3CPW A;  5FWC A;  4OMP A;  2OTJ A;  4OB1 B;  3O5Z A;  1N8R R;  2M1H A;  1AWW A;  3JCM Q;  3H8Z A;  4PKC C;  5CKD A;  4M7D A;  3C12 A;  3R6O A;  4MZM A;  2KMT A;  3GNF B;  2W0Z A;  1K73 U;  2KRM A;  3URG A;  1X2Q A;  2OTL T;  3QYG B;  3I56 T;  2R57 A;  2C0O A;  4EMK A;  2CZ1 B;  1M1K U;  3QZ5 B;  2O31 A;  4M7A B;  2JS2 A;  3CCQ T;  2J7I A;  9ATC B;  4PFO A;  4NL2 A;  2JXB A;  4AMC A;  3ER0 A;  3PMI A;  2A3L A;  2KVQ G;  1H3H A;  4A4F A;  2C0T A;  2I2L A;  4UC4 A;  3EGD A;  1EX4 A;  2MF2 A;  4XTU A;  2F5K A;  3NTI A;  2K57 A;  4F7U E;  3E2U A;  2K5F A;  4DA4 A;  2HEQ A;  4PK4 A;  3A98 A;  1TTH B;  2EFI A;  3KBG A;  4DBH A;  1HD3 A;  2B86 A;  1QKW A;  1VQO Q;  1NYF A;  2EAY A;  4XTV A;  1OEB A;  5DY9 A;  3MPU B;  4CC2 A;  1B07 A;  2XIC A;  3JB9 J;  3EHR A;  3CCU Q;  4OMQ A;  4F7U F;  2D0Q B;  2OAW A;  3EG0 A;  3JCM e;  3HRT A;  4BDZ A;  4DBF A;  1S72 Q;  1HSQ A;  2MAM A;  3PMT A;  4PJO E;  4FSS A;  4JRK A;  1YIT T;  1VIF A;  1Q7Y U;  3CC2 Q;  2C06 A;  1TSF A;  2QXF A;  2VUB A;  1ZA2 B;  1ZSZ C;  1WZO A;  4N0A A;  5GAO l;  2CSI A;  2HQX A;  4M7A A;  4XTX A;  5EG2 A;  2EYQ A;  1OU8 A;  1QP2 A;  1YCS B;  2DIQ A;  5HY6 A;  1GRI A;  1WJS A;  1K8A C;  3OYM A;  1YFN A;  2MPX C;  2HSP A;  2DE0 X;  2BZ8 A;  2IVW A;  5HK0 A;  2F1L A;  3RBB B;  1CKB A;  1M3B A;  2M16 A;  2EYX A;  1JEG A;  2DEU A;  1SSF A;  2DTO A;  3I55 Q;  2E65 A;  3FDR A;  4DBR A;  1SSH A;  2E5Q A;  3KFV A;  4GLK A;  4PJO C;  1MND A;  2CH4 A;  3C0C A;  3CCU A;  3DKM A;  1VQL Q;  2E5K A;  4RCB A;  3JCM J;  1H8K A;  2ZCF B;  1H92 A;  1M90 R;  2K5L A;  3EGX B;  1S72 A;  3E9F A;  1M2V A;  1KFZ A;  2K79 A;  3KXT A;  4RMO A;  2EKO A;  2J6K A;  1X6B A;  1M2O A;  1AVZ C;  3CC2 A;  4C0D C;  3UDC A;  1WNL A;  4QVC A;  2LCC A;  1K73 R;  2MYS A;  1NBE B;  1BK2 A;  2MMP A;  4HXJ A;  3Q1J A;  3QYH B;  2EQU A;  2D8J A;  1JXM A;  2JVV A;  1M1K R;  1ZA1 B;  2DLP A;  5I22 A;  2M0Y A;  1BU1 A;  2JM8 A;  3MHX A;  1M3C A;  5L8R E;  2CS7 A;  1QVF S;  1PCX A;  1U3O A;  3WVE B;  3M0R A;  3CMA T;  5AT1 B;  2RNA A;  2XI9 A;  1WPY A;  1VYT A;  3I35 A;  1X6O A;  5GMK h;  2O9S A;  2XHC A;  1BCO A;  3F70 A;  5GAM g;  2O9V A;  3QII A;  3CCE T;  1X27 A;  1X01 A;  1ARK A;  3I55 A;  2V8K A;  4HCZ A;  3VS7 A;  2CZ0 B;  4PFZ A;  5KYU B;  3P8B B;  3RES A;  2DIL A;  2KYB A;  2E64 A;  4NS5 A;  1VQL A;  4XQ3 A;  4MDW A;  2YRC A;  3SWN C;  5KYY A;  4XU2 A;  1UUE A;  3FJ5 A;  3QJY A;  2CP0 A;  2EBP A;  3L2Z A;  5FRM A;  4TVR A;  2FZK B;  3EGX A;  1VQ4 T;  2E6Z A;  1VQ5 T;  2IIM A;  1Y0M A;  2HKN A;  1RAA B;  1LNX A;  1X69 A;  1KQ2 A;  2DX1 A;  1YJ9 T;  2GNC A;  1Q7Y R;  5FRO A;  2J05 A;  1Y96 B;  2CT3 A;  1K0X A;  1U1S A;  2YT6 A;  2QTX A;  3NHN A;  2YDL A;  1ACM B;  2GBQ A;  1UHC A;  4FT4 A;  4IUT A;  1OUL A;  2AZS A;  3QBY A;  4M7D E;  2F2X A;  4PJL A;  5C6S A;  4IUU A;  4AG1 C;  1Y07 A;  3CME T;  2FPE A;  3JCM P;  1J3T A;  1WHK A;  2VB6 A;  4NOY A;  1UGQ B;  1YP5 A;  5GAO q;  2EW3 A;  1AEY A;  3NFC A;  5FU6 B;  5FU7 B;  5KH6 A;  4M7A D;  1EFN A;  3RKW A;  3EHQ A;  1Y7X A;  1TXQ A;  3H0F A;  3OYK A;  1M30 A;  2EIF A;  1ZBJ A;  5KYU A;  5LJ3 e;  4PNO A;  3TSZ A;  1NLO C;  1UJY A;  3RIR A;  4KGX B;  2YWW A;  1IO6 A;  4HVV A;  1LOJ A;  1FMK A;  4BB7 A;  3CC7 Q;  2EYW A;  1VOM A;  1T0H A;  2YXY A;  1R0C B;  2KXC A;  4LDY A;  3OS1 A;  3V7S A;  4QKU A;  2DL4 A;  3HL8 A;  1ZBX A;  2HQH A;  2PNI A;  4K11 A;  4M7D C;  4HCK A;  4A53 A;  1YJW Q;  3OBW A;  1PWT A;  3CC4 Q;  5ECA A;  4X9D A;  1HYO A;  3WVD B;  2AZV A;  3BDL A;  3P8D A;  2K2V A;  2COW A;  4EMK C;  4QVD A;  4N4H A;  1ZUU A;  3FLG A;  4PJN A;  1WXT A;  2H3J A;  3U23 A;  3HRU A;  5KCH A;  1YJN Q;  3MEA A;  2MIO A;  4C0G A;  5IHN A;  2D0N A;  5J26 A;  3TRE A;  3R6N A;  3THK A;  1NYG A;  3BDU A;  1BB9 A;  4X34 A;  1UGR B;  5CK9 A;  2E41 A;  3NTH A;  2J06 A;  2RB6 A;  2HL5 C;  1BI0 A;  4GLM A;  1G83 A;  1WJQ A;  4C0Z A;  4IUV A;  5GAN e;  2EYZ A;  4O6J A;  3ZBD A;  4KUL A;  4Y28 E;  1D0Y A;  4Z8A A;  1SEM A;  4FW1 A;  1E6G A;  5GMK i;  3CCM Q;  4M7A E;  4ZTJ A;  2DZ9 A;  3X25 B;  2A7Y A;  3ULR B;  2KYM A;  2EJ9 A;  2QA4 Q;  3CC7 A;  3H41 A;  3CD6 A;  2AK5 A;  3EFO B;  4DQ2 A;  2XU8 A;  2AKK A;  4OGE A;  1QVG S;  1H3Z A;  3NGP A;  2QQS A;  3P8H A;  3OYA A;  2DET A;  1I0C A;  3CCR T;  4M7A F;  3VV0 A;  2V8I A;  2AT1 B;  1CSK A;  2H3E B;  1M90 C;  1YJW A;  2A08 A;  2VC8 A;  3MEU A;  2OI3 A;  1UJ0 A;  2RQR A;  2RJD A;  3M59 A;  2NUP B;  4LE9 A;  3JV3 A;  4JZ3 A;  5IHI A;  2RI5 A;  1X2K A;  3A8O B;  4E6R A;  1I5L A;  1K73 C;  1T3S A;  5KYX B;  4M7A C;  1VQ7 Q;  4J7I A;  4RKU E;  2EQJ A;  3ZFJ A;  3VRZ A;  2M9U A;  2LQK A;  5I11 A;  2CP6 A;  2KY9 A;  5GAN 3;  2FG0 A;  1AZG B;  2ENM A;  1KSW A;  1NE8 A;  1PRM C;  3A1P A;  3I5R A;  1RI9 A;  4Z02 A;  3CCM A;  2Y90 A;  5A0G A;  2K9G A;  4ELY C;  1VQM Q;  2OAU A;  4M77 G;  3LH0 A;  2V1Q A;  4Q5W A;  5GAO p;  1Q81 R;  2WSC E;  5CIU A;  4ELZ C;  2QA4 A;  2GF7 A;  3RR6 A;  3X26 B;  4J9I A;  1BIB A;  5GAO m;  4R55 A;  1VQP Q;  4FU6 A;  3EFO A;  3REA B;  2CRE A;  5LJ3 f;  4M78 G;  3VUZ A;  3CCS Q;  5C0M A;  3O8V A;  5IXF A;  2DAQ A;  4PJM A;  5GAN 8;  1WXU A;  3LGL A;  4LXC A;  5GMK j;  2L8D A;  3T9N A;  2ABL A;  4AFS C;  3SB2 A;  2E1H A;  2A0F B;  2ZPB B;  4WF2 A;  4LDX A;  1NJI U;  2HAX A;  3MP8 A;  2XDB A;  2CZ6 B;  4JJD A;  1F1B B;  5FRN A;  2NUP A;  3HSB A;  3G71 Q;  3CBM A;  2BKD N;  3EG9 B;  1VYU A;  2VGM A;  2RJF A;  3V8K A; 
#chains in the Genus database with same CATH homology
 1XNI A;  4OGC A;  4BDZ A;  1VQ7 A;  2X4W A;  2MAM A;  2ZPF B;  4LDU A;  3PMT A;  4C8Q G;  3M4Y A;  4A4K A;  4PJO E;  1VQO T;  4JRK A;  1Q82 U;  1YIT T;  1VIF A;  5J3B A;  1Q7Y U;  5CKF A;  4JRQ A;  2RA2 A;  2AHJ B;  2LVM A;  2C06 A;  4JDS A;  3SDZ A;  2LT1 A;  3OS0 A;  3A8H B;  2QXF A;  3QXE B;  3VU3 C;  2VUB A;  5CKB A;  4BI4 A;  2EWN A;  5GAM j;  4C5H A;  4N0A A;  3HFO A;  1PSE A;  2DD5 A;  3JCM W;  5GAO l;  1M5Q 1;  2HQX A;  3CBP A;  5HKC A;  4E7K A;  4XTX A;  5EG2 A;  3RKX A;  5GAN j;  2G3R A;  1UB4 A;  2EYQ A;  4QW2 A;  1LJO A;  1VQM A;  4PJO D;  3V7R A;  5CR2 A;  4NL3 A;  1QP2 A;  2DIQ A;  2VYT A;  3CPF A;  5D6X A;  5HY6 A;  3SWN B;  1VIE A;  3L2R A;  1WJS A;  2X35 A;  3CCV A;  1K8A C;  3OYM A;  2PVD B;  3RUX A;  1YIJ T;  4N4G A;  5CKH A;  3UT1 A;  4BE0 A;  5GMK m;  3CC4 A;  2RHY A;  5GAN f;  4F7U B;  3JCM f;  2IVW A;  3MCA B;  1HK9 A;  3GF5 A;  1VQP A;  4OF1 A;  5HK0 A;  3G6E A;  2HNI A;  1H64 1;  4OB2 B;  3DB4 A;  1QP3 A;  2HQE A;  4M75 D;  3JB9 I;  3CCS A;  2FL7 A;  3JCM X;  2M16 A;  3X24 B;  3V7C A;  2CKK A;  3L2V A;  1BKB A;  2FHD A;  1VQN T;  2R5A A;  2JZ2 A;  2CGH A;  2ZPH B;  4E47 A;  1SSF A;  1YJN A;  2DTO A;  2DTI A;  2FVU A;  1NPR A;  2X4Y A;  2MI6 A;  1D3B B;  4M77 A;  4N0A C;  1ZQ1 A;  2E65 A;  3FDR A;  1M4Z A;  1KG1 A;  2E5Q A;  4GLK A;  4PJO G;  4PL6 A;  5CAI A;  2EJF A;  4PJO C;  1FXX A;  5GAN 4;  3CCU A;  3DKM A;  1M1K C;  3ME9 A;  1XOV A;  3QSU A;  2DVE A;  1I8F A;  4RCB A;  3JCM J;  3DLL A;  2K3Y A;  2DXU A;  2D6F A;  2ZCF B;  4D6W A;  5HK3 A;  3G71 A;  5LJ3 d;  4V2S A;  1VQK T;  1WJR A;  2KQW A;  2R5M A;  4ME7 A;  4M78 A;  3JSC A;  2K5L A;  3CCR A;  4KBM B;  5LJ5 j;  1IZ6 A;  1WGS A;  3OY9 A;  3SD4 A;  3L2Q A;  3CBO A;  2DPP B;  2QQ9 A;  4J5Y A;  4L5G A;  1I4K 1;  3E9F A;  1S72 A;  5GAN 5;  2DD4 A;  1M1G A;  4ZN1 A;  1Q81 U;  3PFS A;  2RK2 A;  3JB9 F;  1G5V A;  1VQ9 T;  3KXT A;  2O01 E;  5DM7 R;  3CCJ A;  4RMO A;  3CCL A;  2EKO A;  3GOX A;  4XU1 A;  3OS5 A;  3LWI A;  1X75 C;  4M7D F;  3EFS A;  3OYN A;  3LWH A;  2X4X A;  3CC2 A;  3A8M B;  2QQB A;  4C0D C;  1NPP A;  4MZP A;  2R58 A;  3UDC A;  1WNL A;  4QVC A;  2L89 A;  4C92 E;  4BI3 A;  2RHI A;  1JB0 E;  2LCC A;  4B9W A;  2DEQ A;  5CCA A;  2MMP A;  4BY6 C;  3QO3 A;  3MP6 A;  3Q1J A;  4MDX A;  3QYH B;  3GPL A;  3M58 A;  2EQU A;  2QDY B;  1M8V A;  4JLI A;  2JVV A;  3OYD A;  5GMK e;  2RO0 A;  2ZPI B;  1YI2 A;  1UEB A;  5AYF A;  1MGQ A;  1QW1 A;  4M77 D;  3X28 B;  3OYJ A;  1KHI A;  4C0D B;  2FYK A;  2OTL A;  2VXE A;  1UGP B;  3M9Q A;  3MHX A;  1NJI C;  1M9S A;  5L8R E;  2ZZD A;  1W2B A;  2CS7 A;  4ATO A;  3I56 A;  1QVF S;  3SWN A;  4BY6 B;  1YHQ A;  3WVE B;  3OQ5 A;  1EIF A;  4XTZ A;  4JRP A;  4OMF B;  3CMA T;  2VGN A;  1KQS A;  1NZ9 A;  2XI9 A;  1WPY A;  3AHU A;  4F7U A;  3RKY A;  2VXF A;  1X6O A;  5GMK h;  3CCQ A;  2XG8 D;  2XHC A;  2F5T X;  5GAN 2;  2MWO A;  3WXM B;  5GAN 7;  2DXT A;  2RJE A;  3F70 A;  4M78 D;  5GAM g;  4E7I A;  2LT4 A;  2B8A A;  3QII A;  3ZEH A;  3OB9 A;  4M75 E;  3JAM E;  3CC7 T;  1X01 A;  4VUB A;  5KCO A;  3CCE T;  3CD6 T;  3I55 A;  2V8K A;  4HCZ A;  2QEX T;  1Q82 C;  5A0D A;  5GAM d;  3PT9 A;  2CZ0 B;  3OA6 A;  1Q7Y C;  1K9M C;  1WQW A;  4MMK A;  3FIF A;  3VJP A;  4RG2 A;  2E70 A;  3P8B B;  4XU0 A;  1D3B A;  3RES A;  1N27 A;  4II1 A;  2E64 A;  1N9S A;  5GAN d;  4NS5 A;  3CXC S;  3A8L B;  1VQL A;  1B34 B;  4XQ3 A;  3OS2 A;  2P0Q A;  4MDW A;  1JBM A;  1K9M U;  2PUK B;  3H6Z A;  4C92 G;  3CCV T;  3ASK A;  2YHT A;  3A5Z B;  1RL2 A;  3SWN C;  1YJW T;  4C92 C;  3LLR A;  1KD1 U;  5GAM e;  3L2U A;  3CC4 T;  4XU2 A;  2K3X A;  2E10 A;  3HKS A;  1VQ6 T;  1G3W A;  4F7U G;  2DK3 A;  3QUI A;  4L6V 5;  3GIB A;  1BI2 A;  3QJY A;  1VQ8 A;  1FX7 A;  4M75 F;  4C0F A;  3BY7 A;  3L2Z A;  5FRM A;  1OZ3 A;  4LD9 K;  3PIO A;  4TVR A;  3HHT B;  4E7L A;  4ZN3 A;  4X9C A;  3QDR B;  1VQ4 T;  2E6Z A;  4C8Q D;  4PJO A;  4EMH A;  4LD6 A;  1VQ5 T;  2OTJ T;  3LX7 A;  3OMC A;  4C92 B;  2E12 A;  3C94 A;  5GAM h;  3OYC A;  1LNX A;  5KE2 A;  1OI1 A;  4FL6 A;  1KQ2 A;  3J81 E;  2CZ7 B;  1OYX A;  1YJ9 T;  2KAF A;  3L1A A;  5FRO A;  1Q86 C;  2DXB A;  3HP9 A;  3VYG A;  1QVF A;  1Y96 B;  4EMG A;  4HT9 A;  5D6Y A;  3OYH A;  3OYY A;  3SFM A;  5M9O A;  4RG8 A;  3JCM V;  2DKG A;  1U1S A;  5DLO A;  5LJ5 g;  4M75 C;  2QTX A;  1N8R U;  1Q86 U;  4PLL A;  3JCM c;  1KQ1 A;  4A4G A;  4EDU A;  1VQO A;  4BDY A;  1YIT A;  1PSF A;  1V29 B;  4FT4 A;  4IUT A;  5LJ5 d;  3E19 A;  3MO8 A;  4JUV A;  3E9G A;  1UGS B;  3CCM T;  3L42 A;  5I21 A;  3QBY A;  2IG0 A;  4M7D E;  3RER A;  1YBY A;  5LJ3 g;  5C6S A;  4IUU A;  3OW2 S;  4DOW A;  3J7A F;  3C4S A;  3VKI A;  4ZGJ B;  1Y07 A;  1BI3 A;  2DJZ A;  2WSF E;  3MEV A;  3CME T;  4M75 B;  3JCM P;  1N9R A;  1M90 U;  1KC8 C;  2DO3 A;  3OMG A;  2CYZ B;  2KDS A;  2GCX A;  1KHC A;  3G4S T;  2QA4 T;  1JJ2 S;  4NOY A;  3FRN A;  2XKO C;  3QKJ A;  1I81 A;  3QZ9 B;  1Q81 C;  4JS4 A;  1UGQ B;  3MEW A;  3RMS A;  4J6W A;  2YLC A;  3BW1 A;  2F69 A;  5GAO q;  1ZHI A;  4BI8 B;  1BIA A;  2Y4X A;  1MHN A;  1O9S A;  1VUB A;  3NFC A;  5FU6 B;  5FU7 B;  4DOV A;  1YCY A;  5KH6 A;  1KC8 U;  3RKW A;  2VV5 A;  4M7A D;  1OZ2 A;  3HRS A;  3N5B B;  3QJ6 A;  3QG1 A;  4HA8 A;  5D6W A;  3TEE A;  4BD3 A;  1Y7X A;  4BUG A;  2PQW A;  1YIJ A;  3X20 B;  4M77 F;  3C95 A;  4OB0 B;  2LC4 A;  3OYK A;  2EIF A;  5LJ3 e;  2KSS A;  4PNO A;  3UPU A;  3RIR A;  5I2M A;  4R56 A;  1B34 A;  1FWZ A;  2JUF A;  3M55 A;  1LOJ A;  2QI2 A;  5GAN 6;  4BB7 A;  2EQM A;  4C5E A;  5GAO n;  1VQN A;  4BE2 A;  1G3T A;  5GMK l;  2P0K A;  3DLM A;  4XK8 E;  4MML A;  2PU9 B;  3GNG A;  4M78 F;  4EPC A;  4ZGD B;  4LDY A;  3PIP A;  5LJ3 h;  3OS1 A;  2DZC A;  3LW5 E;  4J6X A;  4LDW A;  4PLI A;  3V7S A;  3S3O A;  3OYL A;  3UWN A;  2L5Q A;  3JB9 G;  1R8O B;  3M56 A;  3VYH B;  4MZT A;  4C8Q E;  1G3S A;  2O4X B;  4HCC A;  4QQD A;  3HL8 A;  4M7D G;  4FM4 B;  1ZBX A;  4RCC A;  2RHZ A;  2LQ8 A;  3M54 A;  4FSX A;  1VQ7 T;  3OYG A;  4M7D C;  4C92 A;  4FT2 A;  4A53 A;  1VQK A;  3OBW A;  2LTO A;  4QVZ A;  5LL6 S;  4X9D A;  2L3R A;  4QQ6 A;  1Y71 A;  1TH7 A;  2RI2 A;  3FJP A;  3BFM A;  3WVD B;  3BDL A;  3P8D A;  2QQR A;  2K2V A;  4QVD A;  3INZ A;  4EMK C;  4N4H A;  2HD0 A;  4O5V A;  4OVA A;  1VQ9 A;  4L59 A;  3FLG A;  4QQG A;  3VUB A;  3V8J A;  2H3J A;  5KCH A;  3HRU A;  4E7J A;  3MEA A;  5GAN g;  4JS5 A;  2FB7 A;  3JCM g;  1HXD A;  4M7D B;  2WAC A;  4C0G A;  4FIB A;  2NLU A;  3QPH A;  1JRI A;  2RJC A;  4C8Q F;  1U1T A;  3TCJ A;  1VQM T;  5J26 A;  5CVI A;  3QHS A;  3TRE A;  1KD1 C;  1GXI E;  3JCM d;  3BDU A;  3S6W A;  3M57 A;  2BUD A;  4X34 A;  3A8G B;  1UGR B;  5CK9 A;  2JTM A;  2RI3 A;  2E41 A;  3NTH A;  4LDV A;  3CPW S;  4EMK B;  4GY5 A;  5FLX E;  4J7F A;  2RB6 A;  3OBY A;  1P92 A;  4M75 A;  1BI0 A;  1WQ7 A;  1BI1 A;  4JRI A;  3RMQ A;  1WJQ A;  4J8O A;  4IUV A;  2EJG A;  4C0Z A;  1VQP T;  3G6E T;  2QQA A;  5GAN e;  3MET A;  5GAO r;  4HCB A;  4KT0 E;  4BE1 A;  3FC3 A;  4O6J A;  3ZBD A;  4KUL A;  4Y28 E;  3OYI A;  2D9T A;  3CCS T;  5A0L A;  3PNW C;  5GMK i;  4M7A E;  4IUQ A;  4ZTJ A;  2LX9 A;  2PUO B;  2DZ9 A;  2RM4 A;  4IUR A;  1YJN T;  3X25 B;  2A7Y A;  2XK0 A;  2LRQ A;  4C8Q C;  3M4G A;  4CI0 C;  3CMA A;  1DJ7 B;  4M7D A;  2JNG A;  3FEO A;  4C5G A;  4C92 D;  2WSE E;  2PVO B;  3PTA A;  2EJ9 A;  2DTH A;  2JOY A;  4BAC A;  3CC7 A;  2X4J A;  5GAN h;  3CCE A;  3JCM h;  1N8R C;  2E6N A;  3CD6 A;  4YTL A;  2ZPG B;  5CQX A;  3CCU T;  4DQ2 A;  2XU8 A;  2QEX A;  5IN1 A;  2K5I A;  2HBP A;  2LCL A;  4JJN K;  4OGE A;  2V8J A;  4M75 G;  1QVG S;  1H3Z A;  2QQS A;  3P8H A;  3OYA A;  3EAE A;  3G71 T;  1U8R A;  4IKF A;  2EQK A;  4IUP A;  4C5I A;  4C8Q B;  2RK1 A;  2ZPE B;  4KUI A;  3CCR T;  3S3M A;  4M7A F;  3VV0 A;  3G7Z A;  2XD0 A;  5GAM f;  2V8I A;  4M77 E;  4PJO F;  3L2W A;  3CEY A;  4HT8 A;  1S72 T;  1M90 C;  4M7A A;  4N4I A;  3GLX A;  5FU6 C;  1YJW A;  5FU7 C;  3GP8 A;  2DXC A;  2O4X A;  3JB9 H;  4Y91 A;  2PVG B;  2VC8 A;  3CCJ T;  3CCL T;  3MEU A;  1VQ6 A;  2ZGW A;  4OB3 B;  5A2Q E;  1K8A U;  2RJD A;  3M59 A;  3CC2 T;  2YRV A;  4J83 A;  2Y4Y A;  3CXC A;  5CO7 A;  2RHU A;  1BYM A;  3J80 E;  4CRI A;  5LJ5 e;  3JRZ A;  4XAX B;  2RI5 A;  1VQ4 A;  3NTK A;  5CQY A;  2BIV A;  2LDM A;  1W2B S;  3A8O B;  3CPW A;  4M78 E;  1VQ5 A;  1I5L A;  3LYI A;  2OTJ A;  4B9X A;  2XDP A;  4OB1 B;  5CKE A;  1K73 C;  3OYE A;  2K4Y A;  4M7A G;  2GFU A;  2JTF A;  1KQS S;  2M1H A;  2YLB A;  4JLG A;  3OYF A;  4M7A C;  4HKE A;  3H8Z A;  3OSV A;  4PKC C;  1W4S A;  5CKD A;  5I2S A;  2DIG A;  3JCM Q;  2XDD A;  2M0O A;  1YI2 T;  4OP0 A;  4J7I A;  2GFA A;  3M53 A;  1YJ9 A;  3C12 A;  3HPW A;  3R6O A;  4MZM A;  2KMT A;  3GNF B;  2RD1 A;  1K73 U;  4RKU E;  3URG A;  5LJ5 h;  3S3N A;  2OTL T;  2EQJ A;  3QYG B;  3ZFJ A;  4KUD K;  3PGG A;  3I56 T;  2M9U A;  2LQK A;  2R57 A;  4EMK A;  2KY9 A;  4ZGE B;  1YHQ T;  1XQH A;  5GAN 3;  3V8L A;  2CZ1 B;  1M1K U;  3QZ5 B;  3E1S A;  1NE8 A;  2RH2 A;  4M7A B;  3CCQ T;  2GQV A;  3CCM A;  4Z02 A;  4PJO B;  2Y90 A;  5A0G A;  4NL2 A;  1AHJ B;  1XTD A;  4ELY C;  1G3Y A;  3I55 T;  2OAU A;  4M77 G;  1QVG A;  3LH0 A;  4ZTF A;  4Q5W A;  4M77 C;  5LJ5 f;  5GAO p;  3CME A;  2WSC E;  5CIU A;  3ER0 A;  2MWP A;  3KUF A;  3DB3 A;  2A3L A;  3PMI A;  4ELZ C;  3G4S A;  2KVQ G;  2QA4 A;  5LJ3 j;  4XU3 A;  4A4F A;  2I2L A;  2P4T A;  4UC4 A;  1QVP A;  2GF7 A;  3X26 B;  1VQL T;  1BIB A;  2KK4 A;  2MF2 A;  2F5K A;  4P5N A;  3NTI A;  4XTU A;  2K57 A;  5GAO m;  4R55 A;  4F7U E;  4FU6 A;  2K5F A;  3OYB A;  2LNV A;  4DA4 A;  1Y96 A;  5LJ3 f;  2EFI A;  4M78 G;  3VUZ A;  5J39 A;  3M5A A;  4XTW A;  3KBG A;  3O8V A;  5C0M A;  2RHX A;  3OW2 A;  4M78 C;  2XID A;  2DAQ A;  4M77 B;  3JB9 D;  5GAN 8;  3LGL A;  1JJ2 A;  1VQ8 T;  4C8Q A;  2EAY A;  5GMK j;  2L8D A;  1IRE B;  4XTV A;  3T9N A;  3OSS C;  3JCM b;  4M7D D;  4XTY A;  3LGF A;  3MP1 A;  3SB2 A;  5IT9 E;  5DLQ E;  2E1H A;  5DY9 A;  1O75 A;  2ZPB B;  1RI0 A;  1M1F A;  4WF2 A;  2JN0 A;  2XIC A;  4C92 F;  3JB9 J;  1NJI U;  2HAX A;  3MP8 A;  4LDX A;  2XDB A;  2CZ6 B;  3HFN A;  4M78 B;  4A54 A;  3TU4 K;  2P0P A;  4F7U F;  4A4E A;  5FRN A;  2D0Q B;  4A4H A;  4E7H A;  4J6Y A;  3HSB A;  3EFR A;  5KE3 A;  3CBM A;  5IAY A;  1N6A A;  3FB9 A;  2BKD N;  3JCM e;  3HRT A;  2VGM A;  2RJF A;  3V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...