4C92D

Crystal structure of the yeast lsm1-7 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92D00
5GAN8 4XU1A 4X9CA 4XU3A 4F7UA 2DXTA 4M7DA 5LJ5d 3JB9H 4M75G 5DY9A 5GANh 3JB9I 4M78G 2K57A 4C92D 5GANf 3HSBA 1TH7A 1B34B 3JCMc 5GAMh 2EJFA 5GAMf 4M7DG 5GANj 4C92E 4C92A 3JCMe 3V7RA 4PJOD 1I8FA 4F7UG 3SWNB 4XTXA 5GAMj 3AHUA 4HA8A 3EFSA 5LJ3d 4PJOB 3JB9F 3QUIA 5GAN6 3SWNC 2E1HA 4PJOA 4Y91A 2DEQA 4M77F 4PJOE 4M77B 5GAMd 1Y96B 4RCBA 5LJ3e 1N9SA 4M77C 1N9RA 3V8KA 1B34A 4JRIA 3BDUA 5LJ5e 3JCMQ 2YHTA 3INZA 4J6XA 3JB9D 4M7AF 1M5Q1 4M7AB 3V7CA 2E10A 4EMKC 3SWNA 4XU2A 1LNXA 4M77D 5GAOq 2E65A 1D3BB 4C8QC 1I5LA 4M7AC 3HFNA 3L2ZA 1U1TA 4MMLA 2EJGA 2DZCA 2RD1A 2FYKA 3FB9A 4XTVA 4M77E 4M77A 5GMKj 3JCMb 4QVCA 5GANg 3RERA 4XTWA 1BIBA 3QO3A 5GAMg 1Y96A 2DTIA 4RCCA 3JCMX 3JCMJ 5GAOr 4V2SA 3GIBA 4M7AD 2Y90A 1I81A 5GANd 4C8QE 4J6WA 4JLIA 2I2LA 4X9DA 4M78F 3JCMh 1X01A 1WPYA 2VXEA 4M78B 3JCMf 4C8QA 1JRIA 4C92G 4M7AA 4M7AE 5GAN7 1M8VA 1D3BA 4M75C 2JN0A 4XQ3A 4MMKA 1WQ7A 4M78C 4EMKB 5CAIA 3BY7A 1KQ2A 2DXUA 4PJOG 1H641 4C8QF 3QSUA 4C8QB 5GAN2 4HT8A 2CGHA 4J5YA 4M7DC 2YLCA 3BW1A 2HNIA 4XTYA 5GMKh 3PGGA 2EJ9A 4J6YA 4JUVA 5LJ3f 5GAN5 4XU0A 4M78D 4XTUA 3M4GA 4QVDA 3V8JA 3JCMd 5GMKm 5GAN4 5GAOn 4WF2A 3RUXA 3SB2A 4EMHA 4M75E 4M78E 1HXDA 2RA2A 4M78A 4N0AC 5GANe 5I21A 4C8QD 5GMKi 4NL2A 4C92C 3JCMP 3RKXA 5GAMe 2E64A 3QHSA 2DVEA 3BFMA 4EMKA 3JB9G 2EWNA 4PNOA 4M7DE 4M75F 3V8LA 1LOJA 2E41A 4EMGA 4M75B 3JCMW 4M77G 4F7UE 5GAOm 2VXFA 2DTHA 2YLBA 4XTZA 4PJOC 2DZ9A 5GAN3 4M7DF 3L1AA 3RKWA 3FJPA 3RESA 2DJZA 3JCMg 5GAOp 4M7DB 4JRKA 4N0AA 4NOYA 4F7UF 3HFOA 4F7UB 5GMKl 3JB9J 4NL3A 3RKYA 4C8QG 1HK9A 4HT9A 5LJ3h 1WQWA 2DTOA 2RB6A 4M7AG 2EAYA 4M75D 3EFRA 1U1SA 3VU3C 1YCYA 3JCMV 1MGQA 2RM4A 1KQ1A 2DKGA 2FB7A 2ZGWA 4A54A 5LJ5h 5LJ5f 4C92F 5LJ3j 5LJ3g 4C92B 4M7DD 4M75A 1WNLA 2QTXA 3FIFA 5GMKe 1I4K1 4DQ2A 2VC8A 5LJ5j 5LJ5g 3V7SA 1BIAA 4A53A 5GAOl 1JBMA 1LJOA 3RIRA 4PJOF 4OP0A
chains in the Genus database with same CATH superfamily
1GBRA 2EQUA 2RN8A 4OMOA 1RABB 2K57A 2QQSA 5A2QE 1R77A 1B7TA 2LNVA 5KE2A 4JRPA 5GANj 2CKKA 6AT1B 1TUCA 3AT1B 2CDTA 1IZ6A 3CCLA 3I5RA 1IGUA 1W6XA 3ME9A 3VS0A 4LDYA 4FYXB 4Z8AA 3CCRT 4TVRA 2BZXA 2O31A 1YJWA 1MV3A 3LWIA 4QT7A 1ZSZA 1M2VB 3IQLA 3HL8A 2IPOB 4OMQA 3ZEHA 2K3YA 2E10A 4M77D 5KYYB 5GAOq 5ECAA 3DLMA 1WXTA 1WHGA 3OYFA 4QQGA 3A8LB 3EHRA 1VYVA 1MV0B 2LC4A 2L8DA 4FSXA 4KGVB 5IXBA 1H641 2F2VA 1AVZC 2YUNA 4RMOA 4E2FB 3L2QA 1VQ7Q 4WF2A 3RUXA 4JS4A 1PWTA 2JJ9A 2LP5A 1LCKA 1XNIA 4PJJA 1ZQ1A 1YBYA 3VJPA 1ZLMA 1KC8U 2YLBA 1BCMA 1UGQB 4IIMA 1K76A 1PRLC 1K0XA 4F7UF 1KD1R 2BE7D 1KHCA 4A4GA 2ECZA 3EFRA 3QWYA 1U3OA 2F2WA 2HSEB 2BZ8A 3H6ZA 3X26B 2NUPA 1QCOA 3OYJA 2OTJA 4B9WA 4PLIA 4WTOB 2AK5A 2VC8A 1RAGB 4X9CA 3NHNA 3JB9I 5GANf 1D1AA 2DYIA 4FSSA 2QQ9A 2ZPGB 2HMAA 1K8AU 1ZUYA 3HTRA 2DETA 3SWNC 2KQWA 3E1SA 4JJCA 1AWJA 2EBPA 5LJ3e 2E5KA 4BI4A 4JRIA 5CKBA 5AYFA 3FLGA 1Y7XA 4PJMA 1UUEA 1PKSA 3JSCA 3UPUA 2QI2A 1G3TA 2NWMA 1YN8A 2E65A 3HFNA 3G71T 3UT1A 5GMKj 4FT4A 1VQKT 2P84A 4XTWA 5GAOr 2ZPIB 2KGTA 4M7AD 3FDRA 3CEYA 1H8KA 1M2VA 3PVLA 3NTIA 1S72T 4C8QE 2VXEA 3X20B 5D6WA 3UA6A 1NJIR 5KYYA 1XQHA 3FC3A 1GL5A 2NLUA 3N5BB 2K3BA 4C8QB 2GFUA 1OU8A 3A1PA 1VQ5T 3OW2S 4JUVA 2EQKA 1W2BP 3QYGB 2HEQA 2E70A 2R58A 2WSFE 3PFSA 3SB2A 2YRDA 4CC7A 1WGSA 2KK4A 1WHKA 3JCMP 4M7DE 1BBZA 4QVZA 4E6RA 3LLRA 2VXFA 2XHCA 4XTZA 2QDYB 3EG0A 4LE9A 5GAN3 4D8DA 2EGEA 4M7DB 3CCLQ 4JRKA 4N0AA 1NYGA 5DLQE 2K7AA 3P8BB 4DOVA 2VVKA 2CP5A 2CS7A 1HK9A 2DTOA 3CC2T 2EAYA 3VU3C 1M1KR 1YJNT 2F1LA 2JOYA 3RIRA 2J05A 2A08A 4OP0A 3C94A 2ZZDA 1M2OA 4KH0B 2DXTA 4IUUA 3GOXA 1JXMA 2CZ6B 3HSBA 2FVUA 4A4EA 4AFSC 1N8RC 4IURA 1WZOA 2I0NA 4D6WA 2RK1A 3OW2A 2HBWA 4ZGEB 2OX7A 4M77B 1TSFA 2PQWA 1B3QA 4DBQA 3DLLA 1PCXA 2COZA 1VIEA 1BKBA 1Q95G 1FMKA 2PUKB 3HRSA 2L5QA 4C5EA 2QTVA 2J6KA 2OAUA 1K9MU 4C8QC 3CBOA 2FYKA 3CCET 3JCMX 4FYVB 2CH4W 1RI9A 3S3OA 1Z9ZA 3VS4A 4XQ3A 2FPEA 3LH5A 3VS1A 2OTJQ 2RJEA 4QW2A 1X6GA 3L2RA 1GFDA 2K5IA 4M7DC 1GFCA 5GMKh 3O8VA 1NLOC 3CXCA 2BKDN 2V26A 2EYZA 3CCVT 5GAOn 3MP8A 2CT4A 1N6AA 1VQKA 2BZYA 2JM8A 3LX7A 1X69A 3RDVA 4M77G 1QW1A 1S72A 2D8HA 2ZPBB 1VQ8T 1ABOA 3JCMg 2E6ZA 2LQNA 2XMFA 4R0KA 4LDWA 1RAAB 4LUDA 3META 5AT1B 3CCQA 4DEXA 3JAME 3R6NA 1WNLA 2AZVA 2DVJA 4DQ2A 2ROLA 1LJOA 2VGMA 4M7DA 4AG2C 2LCLA 3EFOB 1YFNA 5KH6A 9ATCB 1BCOA 2A28A 2VUBA 4J7FA 5EC7A 3THKA 2YUQA 1IRXA 2ENMA 3ULRB 1M9SA 5C0MA 4PJOD 3VS6A 1WXUA 4AFZC 1D1BA 3CCRQ 1H3HA 3CC2A 3JB9F 1AT1B 3EG2A 3MKDA 1R0CB 4OB0B 1TTHB 4J9CA 2DRKA 2M16A 4IKFA 4RCBA 4J9HA 5I2SA 2K4YA 1VQ9T 3MJXA 3NPFA 2C0OA 2K2VA 3GLXA 3INZA 3A8GB 2LX7A 2DILA 4M7AB 3OYMA 4KT0E 3J80E 1TUDA 4CI0C 2QYZA 1UGVA 1RLPC 2H8HA 3T9NA 4M77A 1KC8C 2DLPA 1BK2A 4L6V5 2EVRA 1SHFA 1VQMT 3PMTA 4BE2A 1KQSS 2FEIA 3MPUB 1U8RA 3FEOA 4ZGDB 4JLGA 2CGHA 1OPLA 4BY6C 5HKCA 3NGPA 3CBMA 1JEGA 1H92A 3OYGA 2ZAEA 4N4GA 5IN1A 1K8AC 1Q82C 2OI3A 1HYOA 1G3YA 2RQWA 1BI2A 5A0GA 1SSFA 1BYMA 1Y57A 2GCXA 4MDWA 2YUOA 2X35A 1NEBA 4M7AG 2C0IA 4OF1A 4FW2A 5CKFA 2DKGA 2ZGWA 2V8JA 5HY6A 2QTXA 5LJ5j 4JZ3A 1VQOT 3NTHA 5FU6C 3L42A 2LRQA 3OQ5A 3HPWA 1TH7A 3LH0A 4JJNK 1V76A 1AWOA 3CC4T 1T0JA 3V7RA 4HA8A 3EFSA 1M1KU 1SRLA 3F70A 3EFOA 4R56A 1IGQA 1UHCA 2L0AA 1X2KA 3EHQA 2RHIA 2RO0A 5CCAA 1VQKQ 3CCUA 4MMLA 3L2UA 3OBWA 4XTVA 1S72Q 3JCMb 2LJ3A 3GNGA 4RCCA 4LNPA 4KULA 2KBTA 2GFAA 4X9DA 1TG0A 2EKHA 3JCMf 1VQ5Q 4M7AA 1M8MA 3I56T 1VQNT 2YRCA 1VQ9A 3VS5A 1G83A 1RUWA 4J6YA 3WVEB 4ZGJB 3G6ET 1OX8A 4PL6A 2DL7A 4PNOA 3V8LA 4EMGA 3JV3A 2DL3A 4D8KA 4E7KA 1VQMA 4XK8E 2RI2A 3CC2Q 3C0CA 2KR3A 2DZ9A 1YJNQ 2WSEE 1ZA2B 2V1RA 3RKYA 2AIRB 4NS5A 1VOMA 5LJ5f 3CCJT 5FU7B 4J7IA 2HQHA 2MK5A 3CCST 4A4HA 3VS3A 5LJ3d 4PJOB 2DBKA 4QKUA 4M75G 1B34B 1NPPA 3JCMc 5GAMh 1SHGA 2EJFA 2RNAA 1I8FA 2EYQA 1KG1A 1M3BA 4GBQA 4Y91A 3PIOA 4N4HA 2A37A 1UJ0A 5IAYA 4C0DB 1MMNA 1YI2T 2DYBA 5LJ5e 2B86A 1VQOA 1M5Q1 2HD0A 4ME7A 1K9MR 2CREA 1TWBA 4HKEA 1ACMB 3EH1A 2EJGA 8AT1B 4RTYA 5D6YA 4PJNA 5CQXA 4RTWA 2YDLA 2QEXT 4KGXB 2XDBA 1BU1A 3S3MA 2HKNA 1C6VX 3EGUA 3PNWC 4A4KA 2V8KA 3OS1A 1WQ7A 4A63B 3A5ZB 5CAIA 1VQ6T 2WSCE 2P4RA 2XI9A 4PJOG 2MCNA 4C8QF 3CCVQ 4HT8A 3PMIA 1QKXA 4M78D 2ED1A 4E7IA 1UTIA 2X4WA 4OVAA 2FZKB 3QJ6A 1SKUB 1I07A 2V8IA 2ZPEB 5GMKi 1VQ8Q 1AZGB 2HAXA 5FU7C 1KD1C 5KCHA 3GP8A 2LT1A 2DMOA 4PJOC 3TEEA 4M7DF 1ZBJA 1UDLA 1VQNA 3M53A 2EQMA 1QKWA 3JB9J 4FCYA 4HT9A 1OULA 3JCMV 2IVWA 1EZZB 1QVGP 3REAB 2RJDA 1UGSB 2FO0A 1SG5A 4II1A 3CCUQ 1UGPB 3X25B 5GAN8 4RUGA 3ER0A 3JB9H 1FMWA 3SDZA 5CKDA 4RG2A 1TUGB 3LW5E 4ZTJA 2XDDA 5CO7A 4ZNXA 3HP9A 1VQ9Q 1RAEB 4PJOA 2DEQA 4M77F 3HRTA 1K1ZA 2LNHB 5FRNA 2RI3A 1B34A 2LQ8A 3M0UA 5KYUB 1UG1A 2LQKA 3CC7T 4X1VA 4KUIA 3V7CA 1QQJA 3OYLA 4OMLA 2D8JA 1VQMQ 2M51A 1NJIC 5DM7R 3OMCA 3JCMJ 2KYMA 1ZUUA 3M55A 2K5LA 2OTLT 1D0XA 1OZ2A 1AEYA 1EX4A 2I2LA 4JDSA 1IREB 1NPRA 2RHUA 1WPYA 2A36A 2W10A 2K79A 2D1XA 1YI2A 2PNIA 1I0CA 2DK3A 2HNIA 3HKSA 4KBMB 4XTYA 3GPLA 2HZYA 3A8HB 1S1NA 2JZ2A 1WI7A 2JW4A 4RTUA 2QAZA 3BE3A 4N0AC 5GANe 4KH1B 2H3EB 3CD6T 2QEXA 2CP0A 4C0FA 3M5AA 1YIJT 4E47A 2FPFA 1V1CA 1M1KC 3E9GA 2QA4T 3CCRA 1V29B 4CRIA 3NTKA 1WHJA 2MWOA 3Q1JA 1VQ6A 4KGZB 2E6NA 2RB6A 2A0FB 3RMQA 2X51A 1VQOQ 5J26A 1XJWB 1QVPA 3FIFA 2VYTA 1NLPC 4AT1B 1PKTA 2HBPA 2G3RA 3I55T 1IO6A 4C92D 2E3HA 2YUPA 2QK0A 3LGLA 1YNZA 1VQLT 3ZBDA 2MIOA 4XTXA 2A3LA 2M9UA 3QUIA 2E12A 3L2VA 1Y96B 1PG5B 4OMFB 1WHHA 1X2QA 4M7AF 3VKIA 4XU2A 1OU9A 2ED0A 1VQ4T 1GCPA 3VRYA 3C12A 1I5LA 4MDXA 1X6BA 2DZCA 1PNJA 4M77E 1BIBA 4IIOA 5KCOA 1ZHIA 4CC3A 2EGAA 3I56Q 1X6OA 1VQNQ 2DE0X 3G7ZA 3HHTB 4X34A 5KYUA 2ROTA 1UHFA 2CP2A 2KI7A 4M78B 1K0SA 2XICA 4RG8A 1M30A 3G6EQ 1HD3A 1UE9A 2HKQB 1T3SA 3PGGA 1Y71A 5GAN5 4XU0A 2DF6A 1VA7A 3DKMA 3KBGA 2R5AA 3RKXA 1TXQA 3BFMA 4BI8B 3OSSC 2M0YA 3JCMW 2EGCA 1LVKA 1YWPA 2ZPFB 2DTHA 1ABQA 3FRNA 1TS9A 5GAOp 2DJZA 5L23A 3EH2A 1X43A 5GMKl 4L5GA 4C0ZA 1RADB 1WX6A 3PT9A 4M75D 3CCSQ 2CZ1B 2SRCA 4AG1C 3G71A 2JMAA 5GMKe 1FMVA 5DLOA 1VQPT 1JBMA 2L2PA 4BE1A 3PIPA 4HCZA 5I2MA 2X9HA 1YIJA 2J7IA 4RTZA 1WJRA 4M78G 2IG0A 2P4TA 2H3JA 2LX9A 3OB9A 1MMDA 1MUZA 2LCCA 2HCKA 1AHJB 1AOJA 2GNCA 3M59A 4F7UG 2KYBA 1VQ5A 5D6XA 1YCSB 3OW2P 1YI2Q 4OMPA 3MEVA 4M77C 2KT1A 2E3IA 3LGFA 3M0TA 5M9OA 2K9GA 3I55A 4ZTFA 2QEXQ 2PVOB 1Q86R 2L3PA 2DIGA 2FPDA 4RTVA 3CMET 5GAMg 1WDXA 1Y96A 1YJNA 3M57A 1VQ6Q 1UJYA 2CP6A 2DM1A 2JS2A 4J6WA 4M7AE 4QQDA 3A8OB 4HCCA 2EQJA 1QVFS 2KNBB 3BW1A 4PFPA 4ATOA 1KJWA 3JCMd 4LDVA 1ZX6A 1VQ4A 4A4FA 1O9SA 2KDSA 5GAN4 4Y92A 4O6JA 3CXCP 1OZ3A 3CQTA 4M78A 1NZ9A 4BI3A 2KE9A 4E7HA 1A0NB 2JM9A 2CP3A 2J06A 2RHYA 2XU8A 3CPWS 5CK9A 2BTTA 3P8DA 3PTAA 2VKNA 3UA7A 1YP5A 2DD4A 1EFNA 1T0HA 1UFFA 1MNDA 4PFOA 2X4YA 1RAIB 1U1SA 3BDLA 4DBRA 5KE3A 3CCEA 4C92B 3GF5A 2LCSA 3UWNA 1FYNA 2V1QA 4A53A 3I5SA 1PD0A 1I1JA 2OJ2A 4PJOF 4XU3A 2EYXA 3VYHB 2VWFA 3M9QA 1IXDA 1T3LA 5LJ5d 1UEBA 4PJLA 4KUDK 3OYHA 1QVFA 5CQYA 3KUFA 5GAMj 4IUTA 1K4US 4ELZC 1HJDA 1NYFA 3CCVA 3CC7Q 1K73U 4J8OA 1N9SA 2ESWA 3UDCA 1N9RA 3OYNA 1OEBA 1VQPA 1G2BA 3QBYA 1KQSA 3RBBB 3G4ST 2FHDA 5HK0A 4C0GA 1VQ8A 2BE9B 4M7AC 2OTLQ 4GY5A 1FXXA 2RD1A 3RERA 1NBEB 1SSHA 2X4JA 2J6FA 1WHLA 2EQIA 1JJ2S 2DTIA 1NE8A 2CT3A 1BI0A 4HVVA 3URGA 1I81A 3EAEA 1Y0MA 4RKUE 4C92G 7AT1B 2JN0A 3G71Q 3OS0A 3TQ7P 3VRZA 3ZL7C 2PZ1A 4F16A 4AFUC 1N5ZA 2O2OA 4J9EA 3V8JA 4FW1A 1YIJQ 3CCLT 1M1GA 4M75E 3C4SA 1R8OB 5I21A 3J81E 4NL2A 4C92C 1YJWT 1G3WA 4M75B 4DBFA 4DBHA 2O9VA 1G8XA 3KXTA 2JTEA 3HFOA 2KY9A 3ZFJA 1HSQA 1TOVA 1WQWA 5A0DA 3OYIA 1M27C 1X27A 5KYXB 5LJ3g 1JJ2A 2O9SA 3I55Q 1AWWA 3OBYA 4R55A 4ZN3A 2QGGA 2P0KA 2NUTA 4AFQC 3D7SB 2JXBA 4BDYA 2JTFA 1VQLQ 1M90U 4BUGA 1IHWA 1KQSP 1QCNA 2DO3A 5GJWB 5GAMf 5IHIA 1XOVA 1LPLA 4KRTA 2KRMA 4C92A 3JCMe 1D0ZA 3QG1A 4P5NA 3AHUA 1CSKA 2DBMA 2RHXA 4C5IA 4PJOE 2ATCB 3QWXX 4IUQA 1YITT 1K9MC 1ARKA 1VQ4Q 5I11A 1Q81R 2X3WD 1BI3A 3VS7A 3MHXA 2RHZA 4J6XA 2ZPHB 2FRYA 2J6OA 2RK2A 3L2ZA 2DNUA 1U1TA 2KXCA 5IHKA 2DJQA 2KXDA 2FZGB 3OS2A 3CCMT 4V2SA 2W0ZA 5KYWB 2LZ6B 5GANd 3PE0A 4ANJA 4EDUA 4BB7A 1X01A 3H0FA 2BUDA 1M8VA 2EKOA 4M75C 4MMKA 4OB3B 2CUDA 3CCEQ 2AHJB 3SD4A 5CR2A 3OYEA 1IB8A 3G4SA 2EJ9A 1VIFA 4OGCA 4FYWB 4E7LA 5C6SA 1Q86U 5GMKm 4EMHA 2LJ0A 3RMSA 1QP3A 3CC4A 1P92A 2L89A 3VV0A 2E64A 3NFCA 3H9NA 1LOJA 3MCAB 3EG9B 1ZBXA 3H8ZA 1JQQA 5L8RE 3VS2A 4XAXB 1SRMA 2VGNA 1VQPQ 2B8AA 2D6FA 2RM4A 2CP7A 2DXBA 3MO8A 1PD1A 2MYSA 1PRMC 2RF0A 3E2UA 1KK7A 4M75A 2DIQA 1YJ9T 1BIAA 1W1FA 2FZCB 2HSPA 4BACA 2EIFA 4XU1A 2RPNA 5DY9A 1W2BS 4DOWA 2JMCA 3I56A 1MNEA 5KYXA 1KSWA 4K11A 1Q7YR 2C06A 2M1HA 4JPBW 3SWNB 2M0OA 2EFIA 3QDRB 2MOXA 3G6EA 1U06A 3QIIA 5IH2A 2D0NA 2AKLA 1JB0E 1UECA 1QLYA 4IUPA 2DD5A 3QDFA 2YT6A 1O75A 2F69A 2KMTA 2YHTA 4C0DC 3CMEQ 3J7AF 3M0SA 4J9BA 1KFZA 4AMCA 4ESRA 3TU4K 2AKKA 3M4YA 3NMZC 4OGEA 4Q5WA 3FB9A 8ATCB 5A0LA 1G5VA 4OMMA 1VYTA 1XTDA 3QPHA 2COWA 2GQVA 2IIMA 4M78F 3CCJA 3I35A 1YITA 4GLKA 1M3CA 1VYUA 3CCSA 5HCKA 3HRUA 3OYCA 4PKCC 2SEMA 2O4XB 1W2BA 3UATA 2GBQA 2XG8D 2CH4A 4LD9K 5LJ3f 5KYWA 3QXEB 4QVDA 2CYZB 2EYWA 4CC2A 2DL8A 3I9QA 3CCMA 5CVIA 2DVEA 1RAFB 2E41A 3REBB 2FG0A 2F2XA 3LYIA 2F5KA 1MHNA 3L1AA 3FJPA 4FU6A 2G6FX 2HL3A 2KROA 1AZEA 1K73C 2LQWA 2RQVA 3X24B 5LJ3h 3JRZA 1PHTA 1Q82U 1GXIE 4LUEA 2RI5A 5J39A 2L3RA 1F1BB 3EG9A 2GTJA 2CSQA 2O01E 1CKBA 1N27A 3OYAA 3MEUA 4L59A 3EGDB 3CMAT 5EG2A 4FM4B 5GANh 2RJCA 4CC4B 4HCBA 4LN2A 1JO8A 1JXOA 4DEYA 1QMCA 2NUZA 4PFZA 1PM3A 2E1HA 3OMGA 1U5SA 1NEGA 1K73R 2LT4A 3G4SQ 1RI0A 1WLPB 2KRSA 4J83A 1KHIA 4HVWA 1YJ9A 3PVQA 3A98A 4B9XA 1RLQC 2COYA 3BDUA 1ZUKA 4VUBA 3CC4Q 3TVTA 3SWNA 1MMGA 3SFMA 3CCQT 1D3BB 2QXFA 3E19A 2VB6A 2LJ1A 4FIBA 3UF4A 3H0IA 1BI1A 3GIBA 2CZ0B 1W70A 4Y28E 4ORZA 1MMAA 1GRIA 4JLIA 4MZMA 2K3XA 5I22A 1G3SA 3E9FA 1Q81U 1D0YA 5GAN2 1AD5A 4EPCA 2YRVA 1YJWQ 1M90C 2E5QA 4M78E 4J9GA 2L3QA 1M3AA 3QZ9B 1D09B 2O4XA 5IHNA 4F7UE 4RTXA 1YHQT 2P0PA 3RKWA 4RTTA 1OOTA 3OYKA 3CXCS 4F7UB 3CC7A 2DA9A 1OPKA 4C8QG 1C1AA 3OYBA 2D9TA 1YCYA 4C5HA 2NYSA 1ZSGA 4C92F 1WA7A 4F04B 4JJBA 2KT8A 5GAOl 1QWFA 1PSFA 4GLMA 1WYXA 2VASA 2OTLA 2MWPA 4ZN1A 1M90R 1D1CA 4E7ZA 3MEWA 2WACA 4OB2B 3RR6A 4JJDA 4M7DG 3CCJQ 1YITQ 4ELYC 2QQBA 3GNFB 1M1FA 5HK3A 3O5ZA 3M58A 3EGDA 1N8RR 1C0MA 3VYGA 4BE0A 4BDZA 2KAFA 3TSZA 1KIKA 3WXMB 1Q86C 2AT1B 4M4ZA 3CD6A 2KSSA 3H41A 3JCMQ 3CMAA 3JB9D 2CZ7B 3CCMQ 2QA4A 2LVMA 3OYYA 1Q7YU 3X28B 2X4XA 4C8QA 3A8MB 1JRIA 3S6WA 2F5TX 1I5OB 2PVGB 1D3BA 5D7UA 3OSVA 4M78C 2QG9B 4EMKB 2MMPA 3BY7A 3MP1A 4BY6B 1NG2A 2JNGA 3TCJA 2D0QB 3M4GA 1GCQC 3QKJA 2KRNA 1VQLA 1WJSA 1OYXA 2GQIA 1FWZA 2DX1A 5FRMA 3CPFA 2L3SA 3QHSA 3M0QA 2PTKA 1VQ7T 4M75F 2YXYA 5FWBA 1WFWA 1Y07A 3CCUT 4B6MA 3RESA 1UB4A 5FWCA 4NOYA 2DL4A 1WIEA 3U23A 2JTMA 1KD1U 1PSEA 5CKEA 1YJ9Q 2EPDA 1MGQA 4MZPA 2FB7A 4A54A 4QQ6A 1K9AA 2HQEA 2GTOA 5LJ5g 2RJFA 5FU6B 2BIVA 2DFUA 4F7UA 2XKOC 1GCQA 5LL6S 2QQRA 4F14A 1FX7A 2NUTB 1YHQA 4FYYB 5GJVB 4PK4A 4C92E 3QZ5B 1NM7A 4Z89A 2DL5A 5GAN6 4E7JA 2QGFB 3LWHA 2RQTA 5GAMd 3TREA 2MF2A 2MPXC 5J3BA 4LXCA 2XDPA 1J3TA 1OQKA 1B07A 4LDUA 1W4SA 1OI1A 2K6DA 2A7YA 4JS5A 2AZSA 2P0QA 3M54A 4EMKC 3QJYA 4HXJA 1LNXA 1SF9A 3EG1A 3KFVA 1H3ZA 3M0PA 2R57A 3VUZA 1JU5C 2JS0A 4J9DA 3QO3A 1BB9A 1TU0B 3M56A 3G1JA 2Y90A 5FLXE 2JT4A 1PC0A 2DRMA 3FJ5A 3OYDA 4LDXA 1KC8R 3EGXB 4MZTA 2R5MA 1NJIU 4O5VA 3CPWA 1IHVA 3QSUA 3L2WA 2XK0A 4J5YA 2YLCA 4HCKA 1X75C 1R0BG 3VUBA 4XTUA 1Z9QA 5IT9E 1CKAA 1HXDA 2RA2A 2RQUA 2RMOA 2LTOA 4E7SA 2OAWA 4EMKA 2EWNA 2C0TA 2KEAA 1UGRB 2QQAA 3OA6A 1RL2A 2MI6A 2DPPB 1OX9A 4NL3A 1K8AR 1Q82R 2Y4XA 3CD6Q 4YTLA 3OS5A 4EIKA 3ASKA 1KQ1A 1WHMA 1QCFA 3CMAQ 2RQRA 4FT2A 2PU9B 5CIUA 2HDAA 2KVQG 3CMEA 2QA4Q 1I4K1 3V7SA 1GBQA 1SEMA 2CUBA 2GF7A 1RAHB 2ZCFB 2ABLA 2RH2A 2GGRA 2LMJA 3SHWA 1VQ7A 1EIFA 3EG3A 4OB1B 2YWWA 3P8HA 4IUVA 2K5FA 3R6OA 1ZSZB 2VV5A 1QP2A 2JUFA 3TSWA 1Q81C 1QVFP 2X3XD 2EW3A 4FL6A 3CCQQ 3V8KA 4Z02A 2M02A 1OV3A 4F17A 5IXFA 3M0RA 3OY9A 1SPKA 3CPWP 1QVGS 1DJ7B 3RNJA 1E6GA 1M4ZA 2YSQA 5GANg 5FW9A 4DA4A 4PLLA 4QVCA 2MAMA 2DERA 2Y4YA 2FRWA 4UC4A 4N4IA 1AWXA 2K2MA 5FROA 2QDLA 1N8RU 3GBQA 3DB4A 4JZ4A 3JCMh 1E6HA 2E4HA 3MP6A 5GAN7 1RACB 4Z88A 1QWEA 2PVDB 1KQ2A 3C95A 2DXUA 4WCIA 2CSIA 4OMNA 2XIDA 2FL7A 4J9FA 2OTJT 1E7OA 2HQXA 4BD3A 3EGXA 4JRQA 4C8QD 1VUBA 1YHQQ 5GAMe 3JB9G 2O88A 2XD0A 2NUPB 5KYNA 5GAOm 1WJQA 1ZA1B 3MEAA 2DEUA 2EYYA 3H0HA 3SEMA 2LDMA 1YWOA 2Z0WA 2PUOB 4J9IA 2QASA 1QVGA 3S3NA 1ZSZC 4C5GA 2DAQA 5CKHA 3WVDB 1WXBA 5LJ5h 3QYHB 5LJ3j 4M7DD 2JVVA 2HL5C 2DXCA 3DB3A 4LD6A 1JJ2P 4HVUA 3CBPA 1Q7YC
chains in the Genus database with same CATH topology
4HCZA 5I2MA 3CMAT 1VQOT 1YIJA 3NTHA 5FU6C 2EQUA 3L42A 2LRQA 5EG2A 4FM4B 3OQ5A 5GANh 1WJRA 4M78G 2IG0A 2K57A 2QQSA 2RJCA 3HPWA 5A2QE 4HCBA 1TH7A 2P4TA 2H3JA 2LX9A 3LH0A 3OB9A 4JJNK 2LNVA 2LCCA 5KE2A 4JRPA 5GANj 3CC4T 1AHJB 2CKKA 3V7RA 3M59A 4F7UG 1VQ5A 4HA8A 3EFSA 5D6XA 1M1KU 3F70A 2E1HA 1IZ6A 3OMGA 3CCLA 3MEVA 4R56A 2LT4A 3ME9A 1RI0A 4LDYA 4J83A 4M77C 1KHIA 3CCRT 4TVRA 1YJ9A 1YJWA 4B9XA 2RHIA 3BDUA 3LWIA 2RO0A 3LGFA 3ZEHA 4VUBA 3HL8A 5CCAA 2K3YA 5M9OA 2E10A 3SWNA 3SFMA 4M77D 3I55A 5GAOq 4ZTFA 3CCQT 1D3BB 2PVOB 2QXFA 3CCUA 3DLMA 4MMLA 3E19A 3OBWA 3L2UA 2DIGA 4XTVA 3JCMb 3CMET 4FIBA 5GAMg 1Y96A 3GNGA 4RCCA 1BI1A 3OYFA 4QQGA 3GIBA 1YJNA 4KULA 2CZ0B 3M57A 4Y28E 3A8LB 4J6WA 4JLIA 4MZMA 2K3XA 2GFAA 2LC4A 4X9DA 1G3SA 2L8DA 4M7AE 4M7AA 3JCMf 3E9FA 4QQDA 1Q81U 4FSXA 3I56T 1VQNT 3A8OB 1VQ9A 4HCCA 1H641 2EQJA 1QVFS 5GAN2 4EPCA 3BW1A 4J6YA 4RMOA 4ATOA 2YRVA 3JCMd 4LDVA 1VQ4A 4A4FA 1O9SA 2KDSA 3L2QA 3WVEB 5GAN4 4ZGJB 3G6ET 4WF2A 4O6JA 3RUXA 4JS4A 1M90C 2E5QA 1OZ3A 4M78E 4M78A 4PL6A 1NZ9A 1XNIA 4BI3A 1ZQ1A 4E7HA 3QZ9B 4PNOA 3V8LA 1YBYA 2RHYA 4EMGA 2O4XA 4F7UE 2XU8A 3CPWS 3VJPA 4E7KA 4XK8E 5CK9A 1VQMA 2RI2A 2YLBA 3P8DA 1KC8U 1UGQB 2DZ9A 3PTAA 1YHQT 2P0PA 3RKWA 2WSEE 4F7UF 2DD4A 3OYKA 3CXCS 4F7UB 3CC7A 1KHCA 3RKYA 2X4YA 4A4GA 4C8QG 3OYBA 3EFRA 1U1SA 2D9TA 3BDLA 1YCYA 4NS5A 4C5HA 3H6ZA 3X26B 5LJ5f 4C92F 5KE3A 3CCEA 4C92B 3OYJA 3GF5A 3CCJT 2OTJA 4B9WA 3L2RA 4PLIA 3UWNA 5FU7B 4J7IA 2VC8A 5GAOl 3CCST 4A53A 1PSFA 4PJOF 4A4HA 5LJ3d 2OTLA 4PJOB 2MWPA 4ZN1A 4X9CA 4XU3A 3VYHB 3M9QA 5LJ5d 4M75G 3JB9I 1UEBA 5GANf 4KUDK 3OYHA 1B34B 1NPPA 2WACA 3MEWA 4OB2B 3JCMc 5GAMh 2EJFA 1QVFA 5CQYA 2QQ9A 4M7DG 2ZPGB 1K8AU 1I8FA 3KUFA 4ELYC 2EYQA 4IUTA 5GAMj 1KG1A 2QQBA 3GNFB 1M1FA 4ELZC 5HK3A 3SWNC 3M58A 2KQWA 4Y91A 3PIOA 3E1SA 4N4HA 3CCVA 3VYGA 4BE0A 4BDZA 1K73U 2KAFA 4J8OA 3WXMB 1N9SA 3UDCA 5IAYA 5LJ3e 1Q86C 1N9RA 3OYNA 4C0DB 4BI4A 4JRIA 1VQPA 3CD6A 5CKBA 2KSSA 3QBYA 5AYFA 1YI2T 3FLGA 1Y7XA 5LJ5e 3JCMQ 1KQSA 3CMAA 3JB9D 1VQOA 3JSCA 1M5Q1 2HD0A 3G4ST 4ME7A 2QI2A 1G3TA 2CZ7B 2FHDA 2QA4A 5HK0A 3UPUA 2E65A 4C0GA 1VQ8A 4M7AC 3HFNA 4HKEA 3G71T 4GY5A 1FXXA 2EJGA 2RD1A 3UT1A 3RERA 2LVMA 3OYYA 5GMKj 4FT4A 1Q7YU 3X28B 2X4JA 4XTWA 1VQKT 5D6YA 1JJ2S 5CQXA 5GAOr 2DTIA 1NE8A 1BI0A 2ZPIB 2QEXT 4M7AD 3URGA 3FDRA 2XDBA 1I81A 2X4XA 3CEYA 3S3MA 3EAEA 1S72T 3NTIA 4RKUE 4C8QE 4C8QA 3A8MB 4C92G 4M7DC 2VXEA 3X20B 5D6WA 1JRIA 3S6WA 3PNWC 2F5TX 4A4KA 1XQHA 3FC3A 2PVGB 2V8KA 1D3BA 3OS1A 2JN0A 2NLUA 3OSVA 1WQ7A 4M78C 4EMKB 3A5ZB 2MMPA 3BY7A 3N5BB 2WSCE 5CAIA 3OS0A 2XI9A 4PJOG 4C8QF 3MP1A 2GFUA 4BY6B 3PMIA 4C8QB 4HT8A 1VQ5T 3OW2S 2JNGA 4JUVA 3TCJA 4M78D 2D0QB 3M4GA 2EQKA 3V8JA 3QKJA 3QYGB 4E7IA 2X4WA 4OVAA 2E70A 2R58A 2WSFE 3PFSA 3CCLT 3SB2A 1M1GA 4M75E 3C4SA 3PIPA 1R8OB 1WJSA 1OYXA 1WGSA 2KK4A 1FWZA 3QJ6A 5I21A 1VQLA 5FRMA 2V8IA 2ZPEB 4NL2A 3CPFA 4C92C 5GMKi 3J81E 3JCMP 1YJWT 1G3WA 3QHSA 2HAXA 4M7DE 5FU7C 1KD1C 5KCHA 1VQ7T 4QVZA 4M75F 4M75B 3GP8A 3LLRA 2LT1A 2VXFA 2XHCA 4XTZA 2QDYB 4PJOC 1Y07A 3TEEA 5GAN3 4M7DF 3CCUT 4M7DB 3RESA 1UB4A 4JRKA 4N0AA 3M53A 4NOYA 3KXTA 1VQNA 2EQMA 3HFOA 2KY9A 5DLQE 3JB9J 2JTMA 3P8BB 4DOVA 1PSEA 3ZFJA 1KD1U 2CS7A 1HK9A 4HT9A 1WQWA 2DTOA 5CKEA 5A0DA 3OYIA 3CC2T 2EAYA 3VU3C 1VQ6T 1YJNT 3JCMV 2IVWA 1MGQA 4MZPA 2FB7A 4A54A 4QQ6A 2RJDA 5LJ3g 1UGSB 1JJ2A 2JOYA 2HQEA 3OBYA 4II1A 5LJ5g 2RJFA 3RIRA 1UGPB 5FU6B 4R55A 2BIVA 3X25B 4ZN3A 2P0KA 4OP0A 3C94A 2ZZDA 5GAN8 4F7UA 2DXTA 2XKOC 4IUUA 3GOXA 2JTFA 3ER0A 4BDYA 1M90U 4BUGA 3JB9H 2CZ6B 3SDZA 5LL6S 5CKDA 2FVUA 2QQRA 3HSBA 2DO3A 1FX7A 4A4EA 1YHQA 5GAMf 1N8RC 4RG2A 4IURA 1XOVA 4D6WA 4C92E 4C92A 2RK1A 3LW5E 3QZ5B 3JCMe 3OW2A 3QG1A 4P5NA 4ZGEB 4ZTJA 3AHUA 2XDDA 5CO7A 5GAN6 4E7JA 3HP9A 2RHXA 4C5IA 4PJOA 4PJOE 2DEQA 4M77F 3LWHA 4M77B 3HRTA 2PQWA 4IUQA 5GAMd 1YITT 1K9MC 5FRNA 3DLLA 3TREA 2MF2A 2RI3A 5J3BA 1VIEA 1B34A 2XDPA 1BI3A 2LQ8A 1BKBA 4LDUA 1W4SA 3MHXA 2RHZA 2LQKA 2PUKB 1OI1A 3HRSA 4J6XA 2L5QA 4C5EA 2A7YA 4KUIA 4JS5A 3CC7T 2P0QA 3M54A 3V7CA 3QJYA 4EMKC 2ZPHB 1LNXA 2OAUA 2RK2A 1K9MU 3OYLA 4C8QC 1H3ZA 3L2ZA 1U1TA 3CBOA 2FYKA 2R57A 3CCET 3VUZA 3OS2A 1NJIC 3QO3A 5DM7R 3OMCA 3JCMX 3CCMT 3JCMJ 4V2SA 3M55A 3M56A 2K5LA 2Y90A 5FLXE 5GANd 2OTLT 1OZ2A 4EDUA 4BB7A 3S3OA 2I2LA 4JDSA 1IREB 1NPRA 2RHUA 1WPYA 1X01A 3OYDA 4LDXA 2BUDA 4MZTA 1M8VA 2EKOA 2R5MA 1NJIU 4O5VA 4M75C 4XQ3A 4MMKA 4OB3B 3CPWA 1YI2A 3QSUA 2RJEA 4QW2A 3L2WA 2AHJB 2XK0A 4J5YA 2K5IA 3SD4A 2YLCA 2DK3A 2HNIA 3HKSA 4KBMB 1X75C 4XTYA 2EJ9A 5GMKh 1VIFA 3O8VA 3OYEA 3A8HB 3G4SA 4OGCA 3GPLA 3VUBA 4E7LA 4XTUA 5C6SA 3CXCA 1Q86U 2BKDN 2JZ2A 5GMKm 5IT9E 3CCVT 5GAOn 3MP8A 4EMHA 3CC4A 3RMSA 1QP3A 1N6AA 1HXDA 2RA2A 4N0AC 5GANe 1VQKA 5CR2A 1P92A 2L89A 2LTOA 3VV0A 2QEXA 2E64A 3LX7A 3CD6T 4C0FA 4EMKA 3NFCA 2EWNA 3M5AA 1YIJT 4E47A 1LOJA 3MCAB 4M77G 1QW1A 1ZBXA 1S72A 1UGRB 3H8ZA 1M1KC 3E9GA 2QA4T 2QQAA 2ZPBB 5L8RE 3OA6A 1VQ8T 3CCRA 1V29B 4CRIA 3NTKA 1RL2A 2MI6A 3JCMg 2DPPB 2MWOA 3Q1JA 2E6ZA 4XAXB 1VQ6A 4LDWA 4NL3A 2E6NA 2RB6A 2Y4XA 3META 2VGNA 2B8AA 3RMQA 3CCQA 4YTLA 3OS5A 2D6FA 2RM4A 3ASKA 1KQ1A 2DXBA 3MO8A 3JAME 4FT2A 2PU9B 5CIUA 4M75A 2KVQG 1WNLA 5J26A 3CMEA 3FIFA 1QVPA 1I4K1 2DIQA 4DQ2A 1YJ9T 2VYTA 1BIAA 3V7SA 1LJOA 2VGMA 4M7DA 2LCLA 2GF7A 4BACA 2ZCFB 2HBPA 2RH2A 2EIFA 2G3RA 4XU1A 1VQ7A 5KH6A 1EIFA 3I55T 2VUBA 4OB1B 4J7FA 5DY9A 1W2BS 4C92D 4DOWA 3LGLA 3I56A 3P8HA 4IUVA 2K5FA 3R6OA 1M9SA 2VV5A 1QP2A 2JUFA 2C06A 2M1HA 5C0MA 3ZBDA 1VQLT 1Q81C 4PJOD 3SWNB 4XTXA 2A3LA 2M9UA 3CC2A 2M0OA 3JB9F 3QUIA 2E12A 2EFIA 3QDRB 4OB0B 3L2VA 4IKFA 2M16A 4FL6A 3G6EA 3QIIA 1Y96B 4RCBA 1JB0E 4OMFB 3V8KA 4IUPA 2DD5A 2K4YA 5I2SA 1VQ9T 1O75A 4Z02A 2F69A 2KMTA 2YHTA 2K2VA 3GLXA 3INZA 4C0DC 3A8GB 4M7AF 3VKIA 3OY9A 4M7AB 3J7AF 4XU2A 3OYMA 3TU4K 4KT0E 3J80E 1VQ4T 1QVGS 3C12A 3M4YA 1I5LA 1DJ7B 4OGEA 4CI0C 4MDXA 4Q5WA 1M4ZA 2DZCA 3FB9A 5GANg 3T9NA 4M77E 4M77A 4PLLA 4DA4A 4QVCA 1KC8C 2MAMA 1BIBA 1G5VA 5A0LA 2Y4YA 5KCOA 4UC4A 4L6V5 1ZHIA 1X6OA 4N4IA 3G7ZA 3HHTB 4X34A 1XTDA 5FROA 3QPHA 1N8RU 2GQVA 3DB4A 1VQMT 3PMTA 4BE2A 4M78F 3JCMh 3CCJA 1KQSS 4M78B 1YITA 4GLKA 3MP6A 5GAN7 2XICA 3CCSA 1U8RA 2PVDB 3FEOA 3HRUA 4RG8A 3OYCA 4PKCC 4ZGDB 1KQ2A 3C95A 2DXUA 4JLGA 2O4XB 2CGHA 1W2BA 3PGGA 1Y71A 2XG8D 4LD9K 2XIDA 4BY6C 5LJ3f 2FL7A 5GAN5 4XU0A 5HKCA 3QXEB 4QVDA 2CYZB 3CBMA 3DKMA 3KBGA 2OTJT 2R5AA 2HQXA 4BD3A 4JRQA 4C8QD 3CCMA 3OYGA 5CVIA 1VUBA 3RKXA 4N4GA 5GAMe 2DVEA 3BFMA 4BI8B 3JB9G 5IN1A 2XD0A 3OSSC 1K8AC 3JCMW 2E41A 1Q82C 5GAOm 2ZPFB 1WJQA 2DTHA 3MEAA 3FRNA 1G3YA 3LYIA 2F5KA 1MHNA 2LDMA 3L1AA 3FJPA 1BI2A 2DJZA 4FU6A 5A0GA 5GAOp 1SSFA 1BYMA 2GCXA 4MDWA 2PUOB 1K73C 5GMKl 2X35A 4L5GA 4C0ZA 3X24B 5LJ3h 1QVGA 3JRZA 4M7AG 3S3NA 4C5GA 3PT9A 4M75D 1Q82U 2CZ1B 2DAQA 4OF1A 5CKHA 3WVDB 1GXIE 5CKFA 2DKGA 5LJ5h 2RI5A 2ZGWA 3G71A 5J39A 2L3RA 3QYHB 5LJ3j 4M7DD 2V8JA 2JVVA 5HY6A 2QTXA 2O01E 5GMKe 1N27A 5DLOA 2DXCA 3DB3A 4LD6A 5LJ5j 1VQPT 1JBMA 3OYAA 4BE1A 3MEUA 4L59A 3CBPA 1Q7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 8;  4XU1 A;  4X9C A;  4XU3 A;  4F7U A;  2DXT A;  4M7D A;  5LJ5 d;  3JB9 H;  4M75 G;  5DY9 A;  5GAN h;  3JB9 I;  4M78 G;  2K57 A;  4C92 D;  5GAN f;  3HSB A;  1TH7 A;  1B34 B;  3JCM c;  5GAM h;  2EJF A;  5GAM f;  4M7D G;  5GAN j;  4C92 E;  4C92 A;  3JCM e;  3V7R A;  4PJO D;  1I8F A;  4F7U G;  3SWN B;  4XTX A;  5GAM j;  3AHU A;  4HA8 A;  3EFS A;  5LJ3 d;  4PJO B;  3JB9 F;  3QUI A;  5GAN 6;  3SWN C;  2E1H A;  4PJO A;  4Y91 A;  2DEQ A;  4M77 F;  4PJO E;  4M77 B;  5GAM d;  1Y96 B;  4RCB A;  5LJ3 e;  1N9S A;  4M77 C;  1N9R A;  3V8K A;  1B34 A;  4JRI A;  3BDU A;  5LJ5 e;  3JCM Q;  2YHT A;  3INZ A;  4J6X A;  3JB9 D;  4M7A F;  1M5Q 1;  4M7A B;  3V7C A;  2E10 A;  4EMK C;  3SWN A;  4XU2 A;  1LNX A;  4M77 D;  5GAO q;  2E65 A;  1D3B B;  4C8Q C;  1I5L A;  4M7A C;  3HFN A;  3L2Z A;  1U1T A;  4MML A;  2EJG A;  2DZC A;  2RD1 A;  2FYK A;  3FB9 A;  4XTV A;  4M77 E;  4M77 A;  5GMK j;  3JCM b;  4QVC A;  5GAN g;  3RER A;  4XTW A;  1BIB A;  3QO3 A;  5GAM g;  1Y96 A;  2DTI A;  4RCC A;  3JCM X;  3JCM J;  5GAO r;  4V2S A;  3GIB A;  4M7A D;  2Y90 A;  1I81 A;  5GAN d;  4C8Q E;  4J6W A;  4JLI A;  2I2L A;  4X9D A;  4M78 F;  3JCM h;  1X01 A;  1WPY A;  2VXE A;  4M78 B;  3JCM f;  4C8Q A;  1JRI A;  4C92 G;  4M7A A;  4M7A E;  5GAN 7;  1M8V A;  1D3B A;  4M75 C;  2JN0 A;  4XQ3 A;  4MMK A;  1WQ7 A;  4M78 C;  4EMK B;  5CAI A;  3BY7 A;  1KQ2 A;  2DXU A;  4PJO G;  1H64 1;  4C8Q F;  3QSU A;  4C8Q B;  5GAN 2;  4HT8 A;  2CGH A;  4J5Y A;  4M7D C;  2YLC A;  3BW1 A;  2HNI A;  4XTY A;  5GMK h;  3PGG A;  2EJ9 A;  4J6Y A;  4JUV A;  5LJ3 f;  5GAN 5;  4XU0 A;  4M78 D;  4XTU A;  3M4G A;  4QVD A;  3V8J A;  3JCM d;  5GMK m;  5GAN 4;  5GAO n;  4WF2 A;  3RUX A;  3SB2 A;  4EMH A;  4M75 E;  4M78 E;  1HXD A;  2RA2 A;  4M78 A;  4N0A C;  5GAN e;  5I21 A;  4C8Q D;  5GMK i;  4NL2 A;  4C92 C;  3JCM P;  3RKX A;  5GAM e;  2E64 A;  3QHS A;  2DVE A;  3BFM A;  4EMK A;  3JB9 G;  2EWN A;  4PNO A;  4M7D E;  4M75 F;  3V8L A;  1LOJ A;  2E41 A;  4EMG A;  4M75 B;  3JCM W;  4M77 G;  4F7U E;  5GAO m;  2VXF A;  2DTH A;  2YLB A;  4XTZ A;  4PJO C;  2DZ9 A;  5GAN 3;  4M7D F;  3L1A A;  3RKW A;  3FJP A;  3RES A;  2DJZ A;  3JCM g;  5GAO p;  4M7D B;  4JRK A;  4N0A A;  4NOY A;  4F7U F;  3HFO A;  4F7U B;  5GMK l;  3JB9 J;  4NL3 A;  3RKY A;  4C8Q G;  1HK9 A;  4HT9 A;  5LJ3 h;  1WQW A;  2DTO A;  2RB6 A;  4M7A G;  2EAY A;  4M75 D;  3EFR A;  1U1S A;  3VU3 C;  1YCY A;  3JCM V;  1MGQ A;  2RM4 A;  1KQ1 A;  2DKG A;  2FB7 A;  2ZGW A;  4A54 A;  5LJ5 h;  5LJ5 f;  4C92 F;  5LJ3 j;  5LJ3 g;  4C92 B;  4M7D D;  4M75 A;  1WNL A;  2QTX A;  3FIF A;  5GMK e;  1I4K 1;  4DQ2 A;  2VC8 A;  5LJ5 j;  5LJ5 g;  3V7S A;  1BIA A;  4A53 A;  5GAO l;  1JBM A;  1LJO A;  3RIR A;  4PJO F;  4OP0 A; 
#chains in the Genus database with same CATH topology
 1GBR A;  2EQU A;  2RN8 A;  4OMO A;  1RAB B;  2K57 A;  2QQS A;  5A2Q E;  1R77 A;  1B7T A;  2LNV A;  5KE2 A;  4JRP A;  5GAN j;  2CKK A;  6AT1 B;  1TUC A;  3AT1 B;  2CDT A;  1IZ6 A;  3CCL A;  3I5R A;  1IGU A;  1W6X A;  3ME9 A;  3VS0 A;  4LDY A;  4FYX B;  4Z8A A;  3CCR T;  4TVR A;  2BZX A;  2O31 A;  1YJW A;  1MV3 A;  3LWI A;  4QT7 A;  1ZSZ A;  1M2V B;  3IQL A;  3HL8 A;  2IPO B;  4OMQ A;  3ZEH A;  2K3Y A;  2E10 A;  4M77 D;  5KYY B;  5GAO q;  5ECA A;  3DLM A;  1WXT A;  1WHG A;  3OYF A;  4QQG A;  3A8L B;  3EHR A;  1VYV A;  1MV0 B;  2LC4 A;  2L8D A;  4FSX A;  4KGV B;  5IXB A;  1H64 1;  2F2V A;  1AVZ C;  2YUN A;  4RMO A;  4E2F B;  3L2Q A;  1VQ7 Q;  4WF2 A;  3RUX A;  4JS4 A;  1PWT A;  2JJ9 A;  2LP5 A;  1LCK A;  1XNI A;  4PJJ A;  1ZQ1 A;  1YBY A;  3VJP A;  1ZLM A;  1KC8 U;  2YLB A;  1BCM A;  1UGQ B;  4IIM A;  1K76 A;  1PRL C;  1K0X A;  4F7U F;  1KD1 R;  2BE7 D;  1KHC A;  4A4G A;  2ECZ A;  3EFR A;  3QWY A;  1U3O A;  2F2W A;  2HSE B;  2BZ8 A;  3H6Z A;  3X26 B;  2NUP A;  1QCO A;  3OYJ A;  2OTJ A;  4B9W A;  4PLI A;  4WTO B;  2AK5 A;  2VC8 A;  1RAG B;  4X9C A;  3NHN A;  3JB9 I;  5GAN f;  1D1A A;  2DYI A;  4FSS A;  2QQ9 A;  2ZPG B;  2HMA A;  1K8A U;  1ZUY A;  3HTR A;  2DET A;  3SWN C;  2KQW A;  3E1S A;  4JJC A;  1AWJ A;  2EBP A;  5LJ3 e;  2E5K A;  4BI4 A;  4JRI A;  5CKB A;  5AYF A;  3FLG A;  1Y7X A;  4PJM A;  1UUE A;  1PKS A;  3JSC A;  3UPU A;  2QI2 A;  1G3T A;  2NWM A;  1YN8 A;  2E65 A;  3HFN A;  3G71 T;  3UT1 A;  5GMK j;  4FT4 A;  1VQK T;  2P84 A;  4XTW A;  5GAO r;  2ZPI B;  2KGT A;  4M7A D;  3FDR A;  3CEY A;  1H8K A;  1M2V A;  3PVL A;  3NTI A;  1S72 T;  4C8Q E;  2VXE A;  3X20 B;  5D6W A;  3UA6 A;  1NJI R;  5KYY A;  1XQH A;  3FC3 A;  1GL5 A;  2NLU A;  3N5B B;  2K3B A;  4C8Q B;  2GFU A;  1OU8 A;  3A1P A;  1VQ5 T;  3OW2 S;  4JUV A;  2EQK A;  1W2B P;  3QYG B;  2HEQ A;  2E70 A;  2R58 A;  2WSF E;  3PFS A;  3SB2 A;  2YRD A;  4CC7 A;  1WGS A;  2KK4 A;  1WHK A;  3JCM P;  4M7D E;  1BBZ A;  4QVZ A;  4E6R A;  3LLR A;  2VXF A;  2XHC A;  4XTZ A;  2QDY B;  3EG0 A;  4LE9 A;  5GAN 3;  4D8D A;  2EGE A;  4M7D B;  3CCL Q;  4JRK A;  4N0A A;  1NYG A;  5DLQ E;  2K7A A;  3P8B B;  4DOV A;  2VVK A;  2CP5 A;  2CS7 A;  1HK9 A;  2DTO A;  3CC2 T;  2EAY A;  3VU3 C;  1M1K R;  1YJN T;  2F1L A;  2JOY A;  3RIR A;  2J05 A;  2A08 A;  4OP0 A;  3C94 A;  2ZZD A;  1M2O A;  4KH0 B;  2DXT A;  4IUU A;  3GOX A;  1JXM A;  2CZ6 B;  3HSB A;  2FVU A;  4A4E A;  4AFS C;  1N8R C;  4IUR A;  1WZO A;  2I0N A;  4D6W A;  2RK1 A;  3OW2 A;  2HBW A;  4ZGE B;  2OX7 A;  4M77 B;  1TSF A;  2PQW A;  1B3Q A;  4DBQ A;  3DLL A;  1PCX A;  2COZ A;  1VIE A;  1BKB A;  1Q95 G;  1FMK A;  2PUK B;  3HRS A;  2L5Q A;  4C5E A;  2QTV A;  2J6K A;  2OAU A;  1K9M U;  4C8Q C;  3CBO A;  2FYK A;  3CCE T;  3JCM X;  4FYV B;  2CH4 W;  1RI9 A;  3S3O A;  1Z9Z A;  3VS4 A;  4XQ3 A;  2FPE A;  3LH5 A;  3VS1 A;  2OTJ Q;  2RJE A;  4QW2 A;  1X6G A;  3L2R A;  1GFD A;  2K5I A;  4M7D C;  1GFC A;  5GMK h;  3O8V A;  1NLO C;  3CXC A;  2BKD N;  2V26 A;  2EYZ A;  3CCV T;  5GAO n;  3MP8 A;  2CT4 A;  1N6A A;  1VQK A;  2BZY A;  2JM8 A;  3LX7 A;  1X69 A;  3RDV A;  4M77 G;  1QW1 A;  1S72 A;  2D8H A;  2ZPB B;  1VQ8 T;  1ABO A;  3JCM g;  2E6Z A;  2LQN A;  2XMF A;  4R0K A;  4LDW A;  1RAA B;  4LUD A;  3MET A;  5AT1 B;  3CCQ A;  4DEX A;  3JAM E;  3R6N A;  1WNL A;  2AZV A;  2DVJ A;  4DQ2 A;  2ROL A;  1LJO A;  2VGM A;  4M7D A;  4AG2 C;  2LCL A;  3EFO B;  1YFN A;  5KH6 A;  9ATC B;  1BCO A;  2A28 A;  2VUB A;  4J7F A;  5EC7 A;  3THK A;  2YUQ A;  1IRX A;  2ENM A;  3ULR B;  1M9S A;  5C0M A;  4PJO D;  3VS6 A;  1WXU A;  4AFZ C;  1D1B A;  3CCR Q;  1H3H A;  3CC2 A;  3JB9 F;  1AT1 B;  3EG2 A;  3MKD A;  1R0C B;  4OB0 B;  1TTH B;  4J9C A;  2DRK A;  2M16 A;  4IKF A;  4RCB A;  4J9H A;  5I2S A;  2K4Y A;  1VQ9 T;  3MJX A;  3NPF A;  2C0O A;  2K2V A;  3GLX A;  3INZ A;  3A8G B;  2LX7 A;  2DIL A;  4M7A B;  3OYM A;  4KT0 E;  3J80 E;  1TUD A;  4CI0 C;  2QYZ A;  1UGV A;  1RLP C;  2H8H A;  3T9N A;  4M77 A;  1KC8 C;  2DLP A;  1BK2 A;  4L6V 5;  2EVR A;  1SHF A;  1VQM T;  3PMT A;  4BE2 A;  1KQS S;  2FEI A;  3MPU B;  1U8R A;  3FEO A;  4ZGD B;  4JLG A;  2CGH A;  1OPL A;  4BY6 C;  5HKC A;  3NGP A;  3CBM A;  1JEG A;  1H92 A;  3OYG A;  2ZAE A;  4N4G A;  5IN1 A;  1K8A C;  1Q82 C;  2OI3 A;  1HYO A;  1G3Y A;  2RQW A;  1BI2 A;  5A0G A;  1SSF A;  1BYM A;  1Y57 A;  2GCX A;  4MDW A;  2YUO A;  2X35 A;  1NEB A;  4M7A G;  2C0I A;  4OF1 A;  4FW2 A;  5CKF A;  2DKG A;  2ZGW A;  2V8J A;  5HY6 A;  2QTX A;  5LJ5 j;  4JZ3 A;  1VQO T;  3NTH A;  5FU6 C;  3L42 A;  2LRQ A;  3OQ5 A;  3HPW A;  1TH7 A;  3LH0 A;  4JJN K;  1V76 A;  1AWO A;  3CC4 T;  1T0J A;  3V7R A;  4HA8 A;  3EFS A;  1M1K U;  1SRL A;  3F70 A;  3EFO A;  4R56 A;  1IGQ A;  1UHC A;  2L0A A;  1X2K A;  3EHQ A;  2RHI A;  2RO0 A;  5CCA A;  1VQK Q;  3CCU A;  4MML A;  3L2U A;  3OBW A;  4XTV A;  1S72 Q;  3JCM b;  2LJ3 A;  3GNG A;  4RCC A;  4LNP A;  4KUL A;  2KBT A;  2GFA A;  4X9D A;  1TG0 A;  2EKH A;  3JCM f;  1VQ5 Q;  4M7A A;  1M8M A;  3I56 T;  1VQN T;  2YRC A;  1VQ9 A;  3VS5 A;  1G83 A;  1RUW A;  4J6Y A;  3WVE B;  4ZGJ B;  3G6E T;  1OX8 A;  4PL6 A;  2DL7 A;  4PNO A;  3V8L A;  4EMG A;  3JV3 A;  2DL3 A;  4D8K A;  4E7K A;  1VQM A;  4XK8 E;  2RI2 A;  3CC2 Q;  3C0C A;  2KR3 A;  2DZ9 A;  1YJN Q;  2WSE E;  1ZA2 B;  2V1R A;  3RKY A;  2AIR B;  4NS5 A;  1VOM A;  5LJ5 f;  3CCJ T;  5FU7 B;  4J7I A;  2HQH A;  2MK5 A;  3CCS T;  4A4H A;  3VS3 A;  5LJ3 d;  4PJO B;  2DBK A;  4QKU A;  4M75 G;  1B34 B;  1NPP A;  3JCM c;  5GAM h;  1SHG A;  2EJF A;  2RNA A;  1I8F A;  2EYQ A;  1KG1 A;  1M3B A;  4GBQ A;  4Y91 A;  3PIO A;  4N4H A;  2A37 A;  1UJ0 A;  5IAY A;  4C0D B;  1MMN A;  1YI2 T;  2DYB A;  5LJ5 e;  2B86 A;  1VQO A;  1M5Q 1;  2HD0 A;  4ME7 A;  1K9M R;  2CRE A;  1TWB A;  4HKE A;  1ACM B;  3EH1 A;  2EJG A;  8AT1 B;  4RTY A;  5D6Y A;  4PJN A;  5CQX A;  4RTW A;  2YDL A;  2QEX T;  4KGX B;  2XDB A;  1BU1 A;  3S3M A;  2HKN A;  1C6V X;  3EGU A;  3PNW C;  4A4K A;  2V8K A;  3OS1 A;  1WQ7 A;  4A63 B;  3A5Z B;  5CAI A;  1VQ6 T;  2WSC E;  2P4R A;  2XI9 A;  4PJO G;  2MCN A;  4C8Q F;  3CCV Q;  4HT8 A;  3PMI A;  1QKX A;  4M78 D;  2ED1 A;  4E7I A;  1UTI A;  2X4W A;  4OVA A;  2FZK B;  3QJ6 A;  1SKU B;  1I07 A;  2V8I A;  2ZPE B;  5GMK i;  1VQ8 Q;  1AZG B;  2HAX A;  5FU7 C;  1KD1 C;  5KCH A;  3GP8 A;  2LT1 A;  2DMO A;  4PJO C;  3TEE A;  4M7D F;  1ZBJ A;  1UDL A;  1VQN A;  3M53 A;  2EQM A;  1QKW A;  3JB9 J;  4FCY A;  4HT9 A;  1OUL A;  3JCM V;  2IVW A;  1EZZ B;  1QVG P;  3REA B;  2RJD A;  1UGS B;  2FO0 A;  1SG5 A;  4II1 A;  3CCU Q;  1UGP B;  3X25 B;  5GAN 8;  4RUG A;  3ER0 A;  3JB9 H;  1FMW A;  3SDZ A;  5CKD A;  4RG2 A;  1TUG B;  3LW5 E;  4ZTJ A;  2XDD A;  5CO7 A;  4ZNX A;  3HP9 A;  1VQ9 Q;  1RAE B;  4PJO A;  2DEQ A;  4M77 F;  3HRT A;  1K1Z A;  2LNH B;  5FRN A;  2RI3 A;  1B34 A;  2LQ8 A;  3M0U A;  5KYU B;  1UG1 A;  2LQK A;  3CC7 T;  4X1V A;  4KUI A;  3V7C A;  1QQJ A;  3OYL A;  4OML A;  2D8J A;  1VQM Q;  2M51 A;  1NJI C;  5DM7 R;  3OMC A;  3JCM J;  2KYM A;  1ZUU A;  3M55 A;  2K5L A;  2OTL T;  1D0X A;  1OZ2 A;  1AEY A;  1EX4 A;  2I2L A;  4JDS A;  1IRE B;  1NPR A;  2RHU A;  1WPY A;  2A36 A;  2W10 A;  2K79 A;  2D1X A;  1YI2 A;  2PNI A;  1I0C A;  2DK3 A;  2HNI A;  3HKS A;  4KBM B;  4XTY A;  3GPL A;  2HZY A;  3A8H B;  1S1N A;  2JZ2 A;  1WI7 A;  2JW4 A;  4RTU A;  2QAZ A;  3BE3 A;  4N0A C;  5GAN e;  4KH1 B;  2H3E B;  3CD6 T;  2QEX A;  2CP0 A;  4C0F A;  3M5A A;  1YIJ T;  4E47 A;  2FPF A;  1V1C A;  1M1K C;  3E9G A;  2QA4 T;  3CCR A;  1V29 B;  4CRI A;  3NTK A;  1WHJ A;  2MWO A;  3Q1J A;  1VQ6 A;  4KGZ B;  2E6N A;  2RB6 A;  2A0F B;  3RMQ A;  2X51 A;  1VQO Q;  5J26 A;  1XJW B;  1QVP A;  3FIF A;  2VYT A;  1NLP C;  4AT1 B;  1PKT A;  2HBP A;  2G3R A;  3I55 T;  1IO6 A;  4C92 D;  2E3H A;  2YUP A;  2QK0 A;  3LGL A;  1YNZ A;  1VQL T;  3ZBD A;  2MIO A;  4XTX A;  2A3L A;  2M9U A;  3QUI A;  2E12 A;  3L2V A;  1Y96 B;  1PG5 B;  4OMF B;  1WHH A;  1X2Q A;  4M7A F;  3VKI A;  4XU2 A;  1OU9 A;  2ED0 A;  1VQ4 T;  1GCP A;  3VRY A;  3C12 A;  1I5L A;  4MDX A;  1X6B A;  2DZC A;  1PNJ A;  4M77 E;  1BIB A;  4IIO A;  5KCO A;  1ZHI A;  4CC3 A;  2EGA A;  3I56 Q;  1X6O A;  1VQN Q;  2DE0 X;  3G7Z A;  3HHT B;  4X34 A;  5KYU A;  2ROT A;  1UHF A;  2CP2 A;  2KI7 A;  4M78 B;  1K0S A;  2XIC A;  4RG8 A;  1M30 A;  3G6E Q;  1HD3 A;  1UE9 A;  2HKQ B;  1T3S A;  3PGG A;  1Y71 A;  5GAN 5;  4XU0 A;  2DF6 A;  1VA7 A;  3DKM A;  3KBG A;  2R5A A;  3RKX A;  1TXQ A;  3BFM A;  4BI8 B;  3OSS C;  2M0Y A;  3JCM W;  2EGC A;  1LVK A;  1YWP A;  2ZPF B;  2DTH A;  1ABQ A;  3FRN A;  1TS9 A;  5GAO p;  2DJZ A;  5L23 A;  3EH2 A;  1X43 A;  5GMK l;  4L5G A;  4C0Z A;  1RAD B;  1WX6 A;  3PT9 A;  4M75 D;  3CCS Q;  2CZ1 B;  2SRC A;  4AG1 C;  3G71 A;  2JMA A;  5GMK e;  1FMV A;  5DLO A;  1VQP T;  1JBM A;  2L2P A;  4BE1 A;  3PIP A;  4HCZ A;  5I2M A;  2X9H A;  1YIJ A;  2J7I A;  4RTZ A;  1WJR A;  4M78 G;  2IG0 A;  2P4T A;  2H3J A;  2LX9 A;  3OB9 A;  1MMD A;  1MUZ A;  2LCC A;  2HCK A;  1AHJ B;  1AOJ A;  2GNC A;  3M59 A;  4F7U G;  2KYB A;  1VQ5 A;  5D6X A;  1YCS B;  3OW2 P;  1YI2 Q;  4OMP A;  3MEV A;  4M77 C;  2KT1 A;  2E3I A;  3LGF A;  3M0T A;  5M9O A;  2K9G A;  3I55 A;  4ZTF A;  2QEX Q;  2PVO B;  1Q86 R;  2L3P A;  2DIG A;  2FPD A;  4RTV A;  3CME T;  5GAM g;  1WDX A;  1Y96 A;  1YJN A;  3M57 A;  1VQ6 Q;  1UJY A;  2CP6 A;  2DM1 A;  2JS2 A;  4J6W A;  4M7A E;  4QQD A;  3A8O B;  4HCC A;  2EQJ A;  1QVF S;  2KNB B;  3BW1 A;  4PFP A;  4ATO A;  1KJW A;  3JCM d;  4LDV A;  1ZX6 A;  1VQ4 A;  4A4F A;  1O9S A;  2KDS A;  5GAN 4;  4Y92 A;  4O6J A;  3CXC P;  1OZ3 A;  3CQT A;  4M78 A;  1NZ9 A;  4BI3 A;  2KE9 A;  4E7H A;  1A0N B;  2JM9 A;  2CP3 A;  2J06 A;  2RHY A;  2XU8 A;  3CPW S;  5CK9 A;  2BTT A;  3P8D A;  3PTA A;  2VKN A;  3UA7 A;  1YP5 A;  2DD4 A;  1EFN A;  1T0H A;  1UFF A;  1MND A;  4PFO A;  2X4Y A;  1RAI B;  1U1S A;  3BDL A;  4DBR A;  5KE3 A;  3CCE A;  4C92 B;  3GF5 A;  2LCS A;  3UWN A;  1FYN A;  2V1Q A;  4A53 A;  3I5S A;  1PD0 A;  1I1J A;  2OJ2 A;  4PJO F;  4XU3 A;  2EYX A;  3VYH B;  2VWF A;  3M9Q A;  1IXD A;  1T3L A;  5LJ5 d;  1UEB A;  4PJL A;  4KUD K;  3OYH A;  1QVF A;  5CQY A;  3KUF A;  5GAM j;  4IUT A;  1K4U S;  4ELZ C;  1HJD A;  1NYF A;  3CCV A;  3CC7 Q;  1K73 U;  4J8O A;  1N9S A;  2ESW A;  3UDC A;  1N9R A;  3OYN A;  1OEB A;  1VQP A;  1G2B A;  3QBY A;  1KQS A;  3RBB B;  3G4S T;  2FHD A;  5HK0 A;  4C0G A;  1VQ8 A;  2BE9 B;  4M7A C;  2OTL Q;  4GY5 A;  1FXX A;  2RD1 A;  3RER A;  1NBE B;  1SSH A;  2X4J A;  2J6F A;  1WHL A;  2EQI A;  1JJ2 S;  2DTI A;  1NE8 A;  2CT3 A;  1BI0 A;  4HVV A;  3URG A;  1I81 A;  3EAE A;  1Y0M A;  4RKU E;  4C92 G;  7AT1 B;  2JN0 A;  3G71 Q;  3OS0 A;  3TQ7 P;  3VRZ A;  3ZL7 C;  2PZ1 A;  4F16 A;  4AFU C;  1N5Z A;  2O2O A;  4J9E A;  3V8J A;  4FW1 A;  1YIJ Q;  3CCL T;  1M1G A;  4M75 E;  3C4S A;  1R8O B;  5I21 A;  3J81 E;  4NL2 A;  4C92 C;  1YJW T;  1G3W A;  4M75 B;  4DBF A;  4DBH A;  2O9V A;  1G8X A;  3KXT A;  2JTE A;  3HFO A;  2KY9 A;  3ZFJ A;  1HSQ A;  1TOV A;  1WQW A;  5A0D A;  3OYI A;  1M27 C;  1X27 A;  5KYX B;  5LJ3 g;  1JJ2 A;  2O9S A;  3I55 Q;  1AWW A;  3OBY A;  4R55 A;  4ZN3 A;  2QGG A;  2P0K A;  2NUT A;  4AFQ C;  3D7S B;  2JXB A;  4BDY A;  2JTF A;  1VQL Q;  1M90 U;  4BUG A;  1IHW A;  1KQS P;  1QCN A;  2DO3 A;  5GJW B;  5GAM f;  5IHI A;  1XOV A;  1LPL A;  4KRT A;  2KRM A;  4C92 A;  3JCM e;  1D0Z A;  3QG1 A;  4P5N A;  3AHU A;  1CSK A;  2DBM A;  2RHX A;  4C5I A;  4PJO E;  2ATC B;  3QWX X;  4IUQ A;  1YIT T;  1K9M C;  1ARK A;  1VQ4 Q;  5I11 A;  1Q81 R;  2X3W D;  1BI3 A;  3VS7 A;  3MHX A;  2RHZ A;  4J6X A;  2ZPH B;  2FRY A;  2J6O A;  2RK2 A;  3L2Z A;  2DNU A;  1U1T A;  2KXC A;  5IHK A;  2DJQ A;  2KXD A;  2FZG B;  3OS2 A;  3CCM T;  4V2S A;  2W0Z A;  5KYW B;  2LZ6 B;  5GAN d;  3PE0 A;  4ANJ A;  4EDU A;  4BB7 A;  1X01 A;  3H0F A;  2BUD A;  1M8V A;  2EKO A;  4M75 C;  4MMK A;  4OB3 B;  2CUD A;  3CCE Q;  2AHJ B;  3SD4 A;  5CR2 A;  3OYE A;  1IB8 A;  3G4S A;  2EJ9 A;  1VIF A;  4OGC A;  4FYW B;  4E7L A;  5C6S A;  1Q86 U;  5GMK m;  4EMH A;  2LJ0 A;  3RMS A;  1QP3 A;  3CC4 A;  1P92 A;  2L89 A;  3VV0 A;  2E64 A;  3NFC A;  3H9N A;  1LOJ A;  3MCA B;  3EG9 B;  1ZBX A;  3H8Z A;  1JQQ A;  5L8R E;  3VS2 A;  4XAX B;  1SRM A;  2VGN A;  1VQP Q;  2B8A A;  2D6F A;  2RM4 A;  2CP7 A;  2DXB A;  3MO8 A;  1PD1 A;  2MYS A;  1PRM C;  2RF0 A;  3E2U A;  1KK7 A;  4M75 A;  2DIQ A;  1YJ9 T;  1BIA A;  1W1F A;  2FZC B;  2HSP A;  4BAC A;  2EIF A;  4XU1 A;  2RPN A;  5DY9 A;  1W2B S;  4DOW A;  2JMC A;  3I56 A;  1MNE A;  5KYX A;  1KSW A;  4K11 A;  1Q7Y R;  2C06 A;  2M1H A;  4JPB W;  3SWN B;  2M0O A;  2EFI A;  3QDR B;  2MOX A;  3G6E A;  1U06 A;  3QII A;  5IH2 A;  2D0N A;  2AKL A;  1JB0 E;  1UEC A;  1QLY A;  4IUP A;  2DD5 A;  3QDF A;  2YT6 A;  1O75 A;  2F69 A;  2KMT A;  2YHT A;  4C0D C;  3CME Q;  3J7A F;  3M0S A;  4J9B A;  1KFZ A;  4AMC A;  4ESR A;  3TU4 K;  2AKK A;  3M4Y A;  3NMZ C;  4OGE A;  4Q5W A;  3FB9 A;  8ATC B;  5A0L A;  1G5V A;  4OMM A;  1VYT A;  1XTD A;  3QPH A;  2COW A;  2GQV A;  2IIM A;  4M78 F;  3CCJ A;  3I35 A;  1YIT A;  4GLK A;  1M3C A;  1VYU A;  3CCS A;  5HCK A;  3HRU A;  3OYC A;  4PKC C;  2SEM A;  2O4X B;  1W2B A;  3UAT A;  2GBQ A;  2XG8 D;  2CH4 A;  4LD9 K;  5LJ3 f;  5KYW A;  3QXE B;  4QVD A;  2CYZ B;  2EYW A;  4CC2 A;  2DL8 A;  3I9Q A;  3CCM A;  5CVI A;  2DVE A;  1RAF B;  2E41 A;  3REB B;  2FG0 A;  2F2X A;  3LYI A;  2F5K A;  1MHN A;  3L1A A;  3FJP A;  4FU6 A;  2G6F X;  2HL3 A;  2KRO A;  1AZE A;  1K73 C;  2LQW A;  2RQV A;  3X24 B;  5LJ3 h;  3JRZ A;  1PHT A;  1Q82 U;  1GXI E;  4LUE A;  2RI5 A;  5J39 A;  2L3R A;  1F1B B;  3EG9 A;  2GTJ A;  2CSQ A;  2O01 E;  1CKB A;  1N27 A;  3OYA A;  3MEU A;  4L59 A;  3EGD B;  3CMA T;  5EG2 A;  4FM4 B;  5GAN h;  2RJC A;  4CC4 B;  4HCB A;  4LN2 A;  1JO8 A;  1JXO A;  4DEY A;  1QMC A;  2NUZ A;  4PFZ A;  1PM3 A;  2E1H A;  3OMG A;  1U5S A;  1NEG A;  1K73 R;  2LT4 A;  3G4S Q;  1RI0 A;  1WLP B;  2KRS A;  4J83 A;  1KHI A;  4HVW A;  1YJ9 A;  3PVQ A;  3A98 A;  4B9X A;  1RLQ C;  2COY A;  3BDU A;  1ZUK A;  4VUB A;  3CC4 Q;  3TVT A;  3SWN A;  1MMG A;  3SFM A;  3CCQ T;  1D3B B;  2QXF A;  3E19 A;  2VB6 A;  2LJ1 A;  4FIB A;  3UF4 A;  3H0I A;  1BI1 A;  3GIB A;  2CZ0 B;  1W70 A;  4Y28 E;  4ORZ A;  1MMA A;  1GRI A;  4JLI A;  4MZM A;  2K3X A;  5I22 A;  1G3S A;  3E9F A;  1Q81 U;  1D0Y A;  5GAN 2;  1AD5 A;  4EPC A;  2YRV A;  1YJW Q;  1M90 C;  2E5Q A;  4M78 E;  4J9G A;  2L3Q A;  1M3A A;  3QZ9 B;  1D09 B;  2O4X A;  5IHN A;  4F7U E;  4RTX A;  1YHQ T;  2P0P A;  3RKW A;  4RTT A;  1OOT A;  3OYK A;  3CXC S;  4F7U B;  3CC7 A;  2DA9 A;  1OPK A;  4C8Q G;  1C1A A;  3OYB A;  2D9T A;  1YCY A;  4C5H A;  2NYS A;  1ZSG A;  4C92 F;  1WA7 A;  4F04 B;  4JJB A;  2KT8 A;  5GAO l;  1QWF A;  1PSF A;  4GLM A;  1WYX A;  2VAS A;  2OTL A;  2MWP A;  4ZN1 A;  1M90 R;  1D1C A;  4E7Z A;  3MEW A;  2WAC A;  4OB2 B;  3RR6 A;  4JJD A;  4M7D G;  3CCJ Q;  1YIT Q;  4ELY C;  2QQB A;  3GNF B;  1M1F A;  5HK3 A;  3O5Z A;  3M58 A;  3EGD A;  1N8R R;  1C0M A;  3VYG A;  4BE0 A;  4BDZ A;  2KAF A;  3TSZ A;  1KIK A;  3WXM B;  1Q86 C;  2AT1 B;  4M4Z A;  3CD6 A;  2KSS A;  3H41 A;  3JCM Q;  3CMA A;  3JB9 D;  2CZ7 B;  3CCM Q;  2QA4 A;  2LVM A;  3OYY A;  1Q7Y U;  3X28 B;  2X4X A;  4C8Q A;  3A8M B;  1JRI A;  3S6W A;  2F5T X;  1I5O B;  2PVG B;  1D3B A;  5D7U A;  3OSV A;  4M78 C;  2QG9 B;  4EMK B;  2MMP A;  3BY7 A;  3MP1 A;  4BY6 B;  1NG2 A;  2JNG A;  3TCJ A;  2D0Q B;  3M4G A;  1GCQ C;  3QKJ A;  2KRN A;  1VQL A;  1WJS A;  1OYX A;  2GQI A;  1FWZ A;  2DX1 A;  5FRM A;  3CPF A;  2L3S A;  3QHS A;  3M0Q A;  2PTK A;  1VQ7 T;  4M75 F;  2YXY A;  5FWB A;  1WFW A;  1Y07 A;  3CCU T;  4B6M A;  3RES A;  1UB4 A;  5FWC A;  4NOY A;  2DL4 A;  1WIE A;  3U23 A;  2JTM A;  1KD1 U;  1PSE A;  5CKE A;  1YJ9 Q;  2EPD A;  1MGQ A;  4MZP A;  2FB7 A;  4A54 A;  4QQ6 A;  1K9A A;  2HQE A;  2GTO A;  5LJ5 g;  2RJF A;  5FU6 B;  2BIV A;  2DFU A;  4F7U A;  2XKO C;  1GCQ A;  5LL6 S;  2QQR A;  4F14 A;  1FX7 A;  2NUT B;  1YHQ A;  4FYY B;  5GJV B;  4PK4 A;  4C92 E;  3QZ5 B;  1NM7 A;  4Z89 A;  2DL5 A;  5GAN 6;  4E7J A;  2QGF B;  3LWH A;  2RQT A;  5GAM d;  3TRE A;  2MF2 A;  2MPX C;  5J3B A;  4LXC A;  2XDP A;  1J3T A;  1OQK A;  1B07 A;  4LDU A;  1W4S A;  1OI1 A;  2K6D A;  2A7Y A;  4JS5 A;  2AZS A;  2P0Q A;  3M54 A;  4EMK C;  3QJY A;  4HXJ A;  1LNX A;  1SF9 A;  3EG1 A;  3KFV A;  1H3Z A;  3M0P A;  2R57 A;  3VUZ A;  1JU5 C;  2JS0 A;  4J9D A;  3QO3 A;  1BB9 A;  1TU0 B;  3M56 A;  3G1J A;  2Y90 A;  5FLX E;  2JT4 A;  1PC0 A;  2DRM A;  3FJ5 A;  3OYD A;  4LDX A;  1KC8 R;  3EGX B;  4MZT A;  2R5M A;  1NJI U;  4O5V A;  3CPW A;  1IHV A;  3QSU A;  3L2W A;  2XK0 A;  4J5Y A;  2YLC A;  4HCK A;  1X75 C;  1R0B G;  3VUB A;  4XTU A;  1Z9Q A;  5IT9 E;  1CKA A;  1HXD A;  2RA2 A;  2RQU A;  2RMO A;  2LTO A;  4E7S A;  2OAW A;  4EMK A;  2EWN A;  2C0T A;  2KEA A;  1UGR B;  2QQA A;  3OA6 A;  1RL2 A;  2MI6 A;  2DPP B;  1OX9 A;  4NL3 A;  1K8A R;  1Q82 R;  2Y4X A;  3CD6 Q;  4YTL A;  3OS5 A;  4EIK A;  3ASK A;  1KQ1 A;  1WHM A;  1QCF A;  3CMA Q;  2RQR A;  4FT2 A;  2PU9 B;  5CIU A;  2HDA A;  2KVQ G;  3CME A;  2QA4 Q;  1I4K 1;  3V7S A;  1GBQ A;  1SEM A;  2CUB A;  2GF7 A;  1RAH B;  2ZCF B;  2ABL A;  2RH2 A;  2GGR A;  2LMJ A;  3SHW A;  1VQ7 A;  1EIF A;  3EG3 A;  4OB1 B;  2YWW A;  3P8H A;  4IUV A;  2K5F A;  3R6O A;  1ZSZ B;  2VV5 A;  1QP2 A;  2JUF A;  3TSW A;  1Q81 C;  1QVF P;  2X3X D;  2EW3 A;  4FL6 A;  3CCQ Q;  3V8K A;  4Z02 A;  2M02 A;  1OV3 A;  4F17 A;  5IXF A;  3M0R A;  3OY9 A;  1SPK A;  3CPW P;  1QVG S;  1DJ7 B;  3RNJ A;  1E6G A;  1M4Z A;  2YSQ A;  5GAN g;  5FW9 A;  4DA4 A;  4PLL A;  4QVC A;  2MAM A;  2DER A;  2Y4Y A;  2FRW A;  4UC4 A;  4N4I A;  1AWX A;  2K2M A;  5FRO A;  2QDL A;  1N8R U;  3GBQ A;  3DB4 A;  4JZ4 A;  3JCM h;  1E6H A;  2E4H A;  3MP6 A;  5GAN 7;  1RAC B;  4Z88 A;  1QWE A;  2PVD B;  1KQ2 A;  3C95 A;  2DXU A;  4WCI A;  2CSI A;  4OMN A;  2XID A;  2FL7 A;  4J9F A;  2OTJ T;  1E7O A;  2HQX A;  4BD3 A;  3EGX A;  4JRQ A;  4C8Q D;  1VUB A;  1YHQ Q;  5GAM e;  3JB9 G;  2O88 A;  2XD0 A;  2NUP B;  5KYN A;  5GAO m;  1WJQ A;  1ZA1 B;  3MEA A;  2DEU A;  2EYY A;  3H0H A;  3SEM A;  2LDM A;  1YWO A;  2Z0W A;  2PUO B;  4J9I A;  2QAS A;  1QVG A;  3S3N A;  1ZSZ C;  4C5G A;  2DAQ A;  5CKH A;  3WVD B;  1WXB A;  5LJ5 h;  3QYH B;  5LJ3 j;  4M7D D;  2JVV A;  2HL5 C;  2DXC A;  3DB3 A;  4LD6 A;  1JJ2 P;  4HVU A;  3CBP A;  1Q7Y C; 
#chains in the Genus database with same CATH homology
 4HCZ A;  5I2M A;  3CMA T;  1VQO T;  1YIJ A;  3NTH A;  5FU6 C;  2EQU A;  3L42 A;  2LRQ A;  5EG2 A;  4FM4 B;  3OQ5 A;  5GAN h;  1WJR A;  4M78 G;  2IG0 A;  2K57 A;  2QQS A;  2RJC A;  3HPW A;  5A2Q E;  4HCB A;  1TH7 A;  2P4T A;  2H3J A;  2LX9 A;  3LH0 A;  3OB9 A;  4JJN K;  2LNV A;  2LCC A;  5KE2 A;  4JRP A;  5GAN j;  3CC4 T;  1AHJ B;  2CKK A;  3V7R A;  3M59 A;  4F7U G;  1VQ5 A;  4HA8 A;  3EFS A;  5D6X A;  1M1K U;  3F70 A;  2E1H A;  1IZ6 A;  3OMG A;  3CCL A;  3MEV A;  4R56 A;  2LT4 A;  3ME9 A;  1RI0 A;  4LDY A;  4J83 A;  4M77 C;  1KHI A;  3CCR T;  4TVR A;  1YJ9 A;  1YJW A;  4B9X A;  2RHI A;  3BDU A;  3LWI A;  2RO0 A;  3LGF A;  3ZEH A;  4VUB A;  3HL8 A;  5CCA A;  2K3Y A;  5M9O A;  2E10 A;  3SWN A;  3SFM A;  4M77 D;  3I55 A;  5GAO q;  4ZTF A;  3CCQ T;  1D3B B;  2PVO B;  2QXF A;  3CCU A;  3DLM A;  4MML A;  3E19 A;  3OBW A;  3L2U A;  2DIG A;  4XTV A;  3JCM b;  3CME T;  4FIB A;  5GAM g;  1Y96 A;  3GNG A;  4RCC A;  1BI1 A;  3OYF A;  4QQG A;  3GIB A;  1YJN A;  4KUL A;  2CZ0 B;  3M57 A;  4Y28 E;  3A8L B;  4J6W A;  4JLI A;  4MZM A;  2K3X A;  2GFA A;  2LC4 A;  4X9D A;  1G3S A;  2L8D A;  4M7A E;  4M7A A;  3JCM f;  3E9F A;  4QQD A;  1Q81 U;  4FSX A;  3I56 T;  1VQN T;  3A8O B;  1VQ9 A;  4HCC A;  1H64 1;  2EQJ A;  1QVF S;  5GAN 2;  4EPC A;  3BW1 A;  4J6Y A;  4RMO A;  4ATO A;  2YRV A;  3JCM d;  4LDV A;  1VQ4 A;  4A4F A;  1O9S A;  2KDS A;  3L2Q A;  3WVE B;  5GAN 4;  4ZGJ B;  3G6E T;  4WF2 A;  4O6J A;  3RUX A;  4JS4 A;  1M90 C;  2E5Q A;  1OZ3 A;  4M78 E;  4M78 A;  4PL6 A;  1NZ9 A;  1XNI A;  4BI3 A;  1ZQ1 A;  4E7H A;  3QZ9 B;  4PNO A;  3V8L A;  1YBY A;  2RHY A;  4EMG A;  2O4X A;  4F7U E;  2XU8 A;  3CPW S;  3VJP A;  4E7K A;  4XK8 E;  5CK9 A;  1VQM A;  2RI2 A;  2YLB A;  3P8D A;  1KC8 U;  1UGQ B;  2DZ9 A;  3PTA A;  1YHQ T;  2P0P A;  3RKW A;  2WSE E;  4F7U F;  2DD4 A;  3OYK A;  3CXC S;  4F7U B;  3CC7 A;  1KHC A;  3RKY A;  2X4Y A;  4A4G A;  4C8Q G;  3OYB A;  3EFR A;  1U1S A;  2D9T A;  3BDL A;  1YCY A;  4NS5 A;  4C5H A;  3H6Z A;  3X26 B;  5LJ5 f;  4C92 F;  5KE3 A;  3CCE A;  4C92 B;  3OYJ A;  3GF5 A;  3CCJ T;  2OTJ A;  4B9W A;  3L2R A;  4PLI A;  3UWN A;  5FU7 B;  4J7I A;  2VC8 A;  5GAO l;  3CCS T;  4A53 A;  1PSF A;  4PJO F;  4A4H A;  5LJ3 d;  2OTL A;  4PJO B;  2MWP A;  4ZN1 A;  4X9C A;  4XU3 A;  3VYH B;  3M9Q A;  5LJ5 d;  4M75 G;  3JB9 I;  1UEB A;  5GAN f;  4KUD K;  3OYH A;  1B34 B;  1NPP A;  2WAC A;  3MEW A;  4OB2 B;  3JCM c;  5GAM h;  2EJF A;  1QVF A;  5CQY A;  2QQ9 A;  4M7D G;  2ZPG B;  1K8A U;  1I8F A;  3KUF A;  4ELY C;  2EYQ A;  4IUT A;  5GAM j;  1KG1 A;  2QQB A;  3GNF B;  1M1F A;  4ELZ C;  5HK3 A;  3SWN C;  3M58 A;  2KQW A;  4Y91 A;  3PIO A;  3E1S A;  4N4H A;  3CCV A;  3VYG A;  4BE0 A;  4BDZ A;  1K73 U;  2KAF A;  4J8O A;  3WXM B;  1N9S A;  3UDC A;  5IAY A;  5LJ3 e;  1Q86 C;  1N9R A;  3OYN A;  4C0D B;  4BI4 A;  4JRI A;  1VQP A;  3CD6 A;  5CKB A;  2KSS A;  3QBY A;  5AYF A;  1YI2 T;  3FLG A;  1Y7X A;  5LJ5 e;  3JCM Q;  1KQS A;  3CMA A;  3JB9 D;  1VQO A;  3JSC A;  1M5Q 1;  2HD0 A;  3G4S T;  4ME7 A;  2QI2 A;  1G3T A;  2CZ7 B;  2FHD A;  2QA4 A;  5HK0 A;  3UPU A;  2E65 A;  4C0G A;  1VQ8 A;  4M7A C;  3HFN A;  4HKE A;  3G71 T;  4GY5 A;  1FXX A;  2EJG A;  2RD1 A;  3UT1 A;  3RER A;  2LVM A;  3OYY A;  5GMK j;  4FT4 A;  1Q7Y U;  3X28 B;  2X4J A;  4XTW A;  1VQK T;  5D6Y A;  1JJ2 S;  5CQX A;  5GAO r;  2DTI A;  1NE8 A;  1BI0 A;  2ZPI B;  2QEX T;  4M7A D;  3URG A;  3FDR A;  2XDB A;  1I81 A;  2X4X A;  3CEY A;  3S3M A;  3EAE A;  1S72 T;  3NTI A;  4RKU E;  4C8Q E;  4C8Q A;  3A8M B;  4C92 G;  4M7D C;  2VXE A;  3X20 B;  5D6W A;  1JRI A;  3S6W A;  3PNW C;  2F5T X;  4A4K A;  1XQH A;  3FC3 A;  2PVG B;  2V8K A;  1D3B A;  3OS1 A;  2JN0 A;  2NLU A;  3OSV A;  1WQ7 A;  4M78 C;  4EMK B;  3A5Z B;  2MMP A;  3BY7 A;  3N5B B;  2WSC E;  5CAI A;  3OS0 A;  2XI9 A;  4PJO G;  4C8Q F;  3MP1 A;  2GFU A;  4BY6 B;  3PMI A;  4C8Q B;  4HT8 A;  1VQ5 T;  3OW2 S;  2JNG A;  4JUV A;  3TCJ A;  4M78 D;  2D0Q B;  3M4G A;  2EQK A;  3V8J A;  3QKJ A;  3QYG B;  4E7I A;  2X4W A;  4OVA A;  2E70 A;  2R58 A;  2WSF E;  3PFS A;  3CCL T;  3SB2 A;  1M1G A;  4M75 E;  3C4S A;  3PIP A;  1R8O B;  1WJS A;  1OYX A;  1WGS A;  2KK4 A;  1FWZ A;  3QJ6 A;  5I21 A;  1VQL A;  5FRM A;  2V8I A;  2ZPE B;  4NL2 A;  3CPF A;  4C92 C;  5GMK i;  3J81 E;  3JCM P;  1YJW T;  1G3W A;  3QHS A;  2HAX A;  4M7D E;  5FU7 C;  1KD1 C;  5KCH A;  1VQ7 T;  4QVZ A;  4M75 F;  4M75 B;  3GP8 A;  3LLR A;  2LT1 A;  2VXF A;  2XHC A;  4XTZ A;  2QDY B;  4PJO C;  1Y07 A;  3TEE A;  5GAN 3;  4M7D F;  3CCU T;  4M7D B;  3RES A;  1UB4 A;  4JRK A;  4N0A A;  3M53 A;  4NOY A;  3KXT A;  1VQN A;  2EQM A;  3HFO A;  2KY9 A;  5DLQ E;  3JB9 J;  2JTM A;  3P8B B;  4DOV A;  1PSE A;  3ZFJ A;  1KD1 U;  2CS7 A;  1HK9 A;  4HT9 A;  1WQW A;  2DTO A;  5CKE A;  5A0D A;  3OYI A;  3CC2 T;  2EAY A;  3VU3 C;  1VQ6 T;  1YJN T;  3JCM V;  2IVW A;  1MGQ A;  4MZP A;  2FB7 A;  4A54 A;  4QQ6 A;  2RJD A;  5LJ3 g;  1UGS B;  1JJ2 A;  2JOY A;  2HQE A;  3OBY A;  4II1 A;  5LJ5 g;  2RJF A;  3RIR A;  1UGP B;  5FU6 B;  4R55 A;  2BIV A;  3X25 B;  4ZN3 A;  2P0K A;  4OP0 A;  3C94 A;  2ZZD A;  5GAN 8;  4F7U A;  2DXT A;  2XKO C;  4IUU A;  3GOX A;  2JTF A;  3ER0 A;  4BDY A;  1M90 U;  4BUG A;  3JB9 H;  2CZ6 B;  3SDZ A;  5LL6 S;  5CKD A;  2FVU A;  2QQR A;  3HSB A;  2DO3 A;  1FX7 A;  4A4E A;  1YHQ A;  5GAM f;  1N8R C;  4RG2 A;  4IUR A;  1XOV A;  4D6W A;  4C92 E;  4C92 A;  2RK1 A;  3LW5 E;  3QZ5 B;  3JCM e;  3OW2 A;  3QG1 A;  4P5N A;  4ZGE B;  4ZTJ A;  3AHU A;  2XDD A;  5CO7 A;  5GAN 6;  4E7J A;  3HP9 A;  2RHX A;  4C5I A;  4PJO A;  4PJO E;  2DEQ A;  4M77 F;  3LWH A;  4M77 B;  3HRT A;  2PQW A;  4IUQ A;  5GAM d;  1YIT T;  1K9M C;  5FRN A;  3DLL A;  3TRE A;  2MF2 A;  2RI3 A;  5J3B A;  1VIE A;  1B34 A;  2XDP A;  1BI3 A;  2LQ8 A;  1BKB A;  4LDU A;  1W4S A;  3MHX A;  2RHZ A;  2LQK A;  2PUK B;  1OI1 A;  3HRS A;  4J6X A;  2L5Q A;  4C5E A;  2A7Y A;  4KUI A;  4JS5 A;  3CC7 T;  2P0Q A;  3M54 A;  3V7C A;  3QJY A;  4EMK C;  2ZPH B;  1LNX A;  2OAU A;  2RK2 A;  1K9M U;  3OYL A;  4C8Q C;  1H3Z A;  3L2Z A;  1U1T A;  3CBO A;  2FYK A;  2R57 A;  3CCE T;  3VUZ A;  3OS2 A;  1NJI C;  3QO3 A;  5DM7 R;  3OMC A;  3JCM X;  3CCM T;  3JCM J;  4V2S A;  3M55 A;  3M56 A;  2K5L A;  2Y90 A;  5FLX E;  5GAN d;  2OTL T;  1OZ2 A;  4EDU A;  4BB7 A;  3S3O A;  2I2L A;  4JDS A;  1IRE B;  1NPR A;  2RHU A;  1WPY A;  1X01 A;  3OYD A;  4LDX A;  2BUD A;  4MZT A;  1M8V A;  2EKO A;  2R5M A;  1NJI U;  4O5V A;  4M75 C;  4XQ3 A;  4MMK A;  4OB3 B;  3CPW A;  1YI2 A;  3QSU A;  2RJE A;  4QW2 A;  3L2W A;  2AHJ B;  2XK0 A;  4J5Y A;  2K5I A;  3SD4 A;  2YLC A;  2DK3 A;  2HNI A;  3HKS A;  4KBM B;  1X75 C;  4XTY A;  2EJ9 A;  5GMK h;  1VIF A;  3O8V A;  3OYE A;  3A8H B;  3G4S A;  4OGC A;  3GPL A;  3VUB A;  4E7L A;  4XTU A;  5C6S A;  3CXC A;  1Q86 U;  2BKD N;  2JZ2 A;  5GMK m;  5IT9 E;  3CCV T;  5GAO n;  3MP8 A;  4EMH A;  3CC4 A;  3RMS A;  1QP3 A;  1N6A A;  1HXD A;  2RA2 A;  4N0A C;  5GAN e;  1VQK A;  5CR2 A;  1P92 A;  2L89 A;  2LTO A;  3VV0 A;  2QEX A;  2E64 A;  3LX7 A;  3CD6 T;  4C0F A;  4EMK A;  3NFC A;  2EWN A;  3M5A A;  1YIJ T;  4E47 A;  1LOJ A;  3MCA B;  4M77 G;  1QW1 A;  1ZBX A;  1S72 A;  1UGR B;  3H8Z A;  1M1K C;  3E9G A;  2QA4 T;  2QQA A;  2ZPB B;  5L8R E;  3OA6 A;  1VQ8 T;  3CCR A;  1V29 B;  4CRI A;  3NTK A;  1RL2 A;  2MI6 A;  3JCM g;  2DPP B;  2MWO A;  3Q1J A;  2E6Z A;  4XAX B;  1VQ6 A;  4LDW A;  4NL3 A;  2E6N A;  2RB6 A;  2Y4X A;  3MET A;  2VGN A;  2B8A A;  3RMQ A;  3CCQ A;  4YTL A;  3OS5 A;  2D6F A;  2RM4 A;  3ASK A;  1KQ1 A;  2DXB A;  3MO8 A;  3JAM E;  4FT2 A;  2PU9 B;  5CIU A;  4M75 A;  2KVQ G;  1WNL A;  5J26 A;  3CME A;  3FIF A;  1QVP A;  1I4K 1;  2DIQ A;  4DQ2 A;  1YJ9 T;  2VYT A;  1BIA A;  3V7S A;  1LJO A;  2VGM A;  4M7D A;  2LCL A;  2GF7 A;  4BAC A;  2ZCF B;  2HBP A;  2RH2 A;  2EIF A;  2G3R A;  4XU1 A;  1VQ7 A;  5KH6 A;  1EIF A;  3I55 T;  2VUB A;  4OB1 B;  4J7F A;  5DY9 A;  1W2B S;  4C92 D;  4DOW A;  3LGL A;  3I56 A;  3P8H A;  4IUV A;  2K5F A;  3R6O A;  1M9S A;  2VV5 A;  1QP2 A;  2JUF A;  2C06 A;  2M1H A;  5C0M A;  3ZBD A;  1VQL T;  1Q81 C;  4PJO D;  3SWN B;  4XTX A;  2A3L A;  2M9U A;  3CC2 A;  2M0O A;  3JB9 F;  3QUI A;  2E12 A;  2EFI A;  3QDR B;  4OB0 B;  3L2V A;  4IKF A;  2M16 A;  4FL6 A;  3G6E A;  3QII A;  1Y96 B;  4RCB A;  1JB0 E;  4OMF B;  3V8K A;  4IUP A;  2DD5 A;  2K4Y A;  5I2S A;  1VQ9 T;  1O75 A;  4Z02 A;  2F69 A;  2KMT A;  2YHT A;  2K2V A;  3GLX A;  3INZ A;  4C0D C;  3A8G B;  4M7A F;  3VKI A;  3OY9 A;  4M7A B;  3J7A F;  4XU2 A;  3OYM A;  3TU4 K;  4KT0 E;  3J80 E;  1VQ4 T;  1QVG S;  3C12 A;  3M4Y A;  1I5L A;  1DJ7 B;  4OGE A;  4CI0 C;  4MDX A;  4Q5W A;  1M4Z A;  2DZC A;  3FB9 A;  5GAN g;  3T9N A;  4M77 E;  4M77 A;  4PLL A;  4DA4 A;  4QVC A;  1KC8 C;  2MAM A;  1BIB A;  1G5V A;  5A0L A;  2Y4Y A;  5KCO A;  4UC4 A;  4L6V 5;  1ZHI A;  1X6O A;  4N4I A;  3G7Z A;  3HHT B;  4X34 A;  1XTD A;  5FRO A;  3QPH A;  1N8R U;  2GQV A;  3DB4 A;  1VQM T;  3PMT A;  4BE2 A;  4M78 F;  3JCM h;  3CCJ A;  1KQS S;  4M78 B;  1YIT A;  4GLK A;  3MP6 A;  5GAN 7;  2XIC A;  3CCS A;  1U8R A;  2PVD B;  3FEO A;  3HRU A;  4RG8 A;  3OYC A;  4PKC C;  4ZGD B;  1KQ2 A;  3C95 A;  2DXU A;  4JLG A;  2O4X B;  2CGH A;  1W2B A;  3PGG A;  1Y71 A;  2XG8 D;  4LD9 K;  2XID A;  4BY6 C;  5LJ3 f;  2FL7 A;  5GAN 5;  4XU0 A;  5HKC A;  3QXE B;  4QVD A;  2CYZ B;  3CBM A;  3DKM A;  3KBG A;  2OTJ T;  2R5A A;  2HQX A;  4BD3 A;  4JRQ A;  4C8Q D;  3CCM A;  3OYG A;  5CVI A;  1VUB A;  3RKX A;  4N4G A;  5GAM e;  2DVE A;  3BFM A;  4BI8 B;  3JB9 G;  5IN1 A;  2XD0 A;  3OSS C;  1K8A C;  3JCM W;  2E41 A;  1Q82 C;  5GAO m;  2ZPF B;  1WJQ A;  2DTH A;  3MEA A;  3FRN A;  1G3Y A;  3LYI A;  2F5K A;  1MHN A;  2LDM A;  3L1A A;  3FJP A;  1BI2 A;  2DJZ A;  4FU6 A;  5A0G A;  5GAO p;  1SSF A;  1BYM A;  2GCX A;  4MDW A;  2PUO B;  1K73 C;  5GMK l;  2X35 A;  4L5G A;  4C0Z A;  3X24 B;  5LJ3 h;  1QVG A;  3JRZ A;  4M7A G;  3S3N A;  4C5G A;  3PT9 A;  4M75 D;  1Q82 U;  2CZ1 B;  2DAQ A;  4OF1 A;  5CKH A;  3WVD B;  1GXI E;  5CKF A;  2DKG A;  5LJ5 h;  2RI5 A;  2ZGW A;  3G71 A;  5J39 A;  2L3R A;  3QYH B;  5LJ3 j;  4M7D D;  2V8J A;  2JVV A;  5HY6 A;  2QTX A;  2O01 E;  5GMK e;  1N27 A;  5DLO A;  2DXC A;  3DB3 A;  4LD6 A;  5LJ5 j;  1VQP T;  1JBM A;  3OYA A;  4BE1 A;  3MEU A;  4L59 A;  3CBP A;  1Q7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...