4C92D

Crystal structure of the yeast lsm1-7 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 19
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92D00
5GAMd 1I8FA 2VXFA 5GMKi 2ZGWA 3QSUA 1KQ2A 5GAMj 4MMKA 4N0AC 4M77F 4C8QA 4C92D 5GMKe 4F7UF 3HFNA 4X9DA 3BFMA 4M77D 2DTOA 1D3BB 5LJ3d 5LJ3h 4M7AA 2DTHA 2E10A 4M78G 3SWNC 3JB9I 5GMKh 5LJ3j 4M7DF 4PJOE 4PJOC 3V7CA 4PNOA 3V7RA 4C92C 4C92E 5GAN5 2RB6A 4M7DD 5GMKj 3V7SA 4M7AB 4M7DG 4M7DC 3EFSA 4F7UE 1U1TA 3V8JA 4V2SA 5GMKm 3RERA 5LJ3g 4A53A 3JCMX 3JCMQ 3AHUA 4J6YA 1I5LA 1B34A 3RKWA 1WNLA 4EMKC 2YHTA 4JRKA 5GAOq 2E41A 4JLIA 3JCMe 5GAN3 4HT8A 5LJ5f 4C8QD 1MGQA 2DXTA 4PJOF 1M8VA 5GAOn 3JCMh 1D3BA 4C92F 5LJ3e 3VU3C 3JCMd 1U1SA 5GAN8 5GAOr 4PJOD 4XU0A 4PJOG 5GAOp 4C92G 5GAMf 5GAOm 4C8QE 2DZCA 3RKYA 2DTIA 4XQ3A 4C8QC 4M7DE 4M75A 3RIRA 2VXEA 4M77G 4F7UG 1HXDA 3JCMc 4M7AE 4M7AC 2I2LA 4QVDA 2E65A 3L1AA 3JCMg 4HA8A 4M75B 3BY7A 5GAN7 4JRIA 1Y96B 2FB7A 4M78B 3SB2A 1I81A 1WQWA 4MMLA 1M5Q1 2Y90A 5GANg 2DJZA 4HT9A 5DY9A 3JB9F 2JN0A 1BIAA 2CGHA 5GAN4 4J5YA 4C8QF 1N9SA 2VC8A 3JB9D 3JB9H 2EAYA 1LJOA 3JB9J 4C8QG 4M7AF 4QVCA 2FYKA 1YCYA 4EMHA 3JCMJ 3FIFA 4M7AD 5GANe 2QTXA 4OP0A 4NL2A 4JUVA 5GAN2 3RESA 2DKGA 3JCMP 3HFOA 3JCMf 3JCMW 5GANh 5GANd 4M75E 3SWNB 4M75C 4NOYA 1Y96A 4M78A 4XTZA 5GMKl 2DZ9A 2EJFA 3QUIA 4C92B 5GANj 3HSBA 5LJ3f 1BIBA 1HK9A 5I21A 1KQ1A 4M7DA 4M77B 5LJ5h 3GIBA 2DVEA 3FB9A 4F7UB 3FJPA 1LNXA 1LOJA 4XTWA 4M7DB 2EWNA 1TH7A 1WQ7A 5GAN6 4XU1A 2E1HA 3QO3A 5GAMh 2EJGA 1I4K1 1WPYA 3JB9G 4N0AA 3JCMV 5LJ5g 2RM4A 4XU2A 4M75F 3RUXA 3V8LA 4XTYA 5GAOl 3EFRA 1H641 1X01A 3QHSA 5CAIA 4M78F 4M75D 2RA2A 4M75G 2YLBA 3INZA 3SWNA 3L2ZA 3RKXA 4M7AG 4M78D 4PJOA 2K57A 1N9RA 4RCCA 4C8QB 4C92A 3BDUA 5GAMg 4J6XA 2DXUA 4XTXA 3M4GA 4M77A 5LJ5e 2E64A 4J6WA 4M77E 4F7UA 2EJ9A 3BW1A 4M77C 4PJOB 4M78E 4M78C 4EMGA 2DEQA 5GANf 2RD1A 3PGGA 4Y91A 4EMKA 4X9CA 1JRIA 4RCBA 5LJ5d 5GAMe 4WF2A 2HNIA 3V8KA 4A54A 4XU3A 5LJ5j 1JBMA 4NL3A 4XTVA 4DQ2A 3JCMb 4XTUA 2YLCA 4EMKB 1B34B
chains in the Genus database with same CATH superfamily
2HSPA 1X43A 5GMKi 1KC8R 3I55Q 5GAMj 2VVKA 5FWBA 4C8QA 3CD6Q 1YBYA 1D3BB 3VRYA 1U06A 3G6EA 3S3NA 1VQ5Q 2ZPBB 2EGEA 1OOTA 2DD5A 4PJOC 3THKA 3JAME 3MP6A 3RERA 1NM7A 4BB7A 1RI0A 4FT4A 1VQ4Q 4HKEA 4EMKC 1RL2A 4C8QD 2DA9A 2OI3A 1D1BA 5GAOr 3PMIA 3HP9A 1E6HA 2KQWA 2D1XA 3CCQA 2PU9B 2EQIA 5FRNA 1G3YA 2KNBB 3QWYA 4C5IA 3BY7A 2A36A 1I81A 4FW1A 5CKEA 3CC7A 2R57A 4LUDA 3OW2P 2EGAA 3MO8A 3QXEB 1N9SA 3UDCA 4IIOA 2LQKA 4B6MA 3QIIA 1YJ9A 2F5KA 1QWEA 1T3SA 3SWNB 4ESRA 4HCCA 2OTJQ 4PLLA 1NYFA 4XU1A 2QQ9A 3QO3A 2VV5A 4R55A 3ULRB 2RA2A 5FU6C 1O75A 1VYTA 1BI3A 4CC4B 5GAMg 3EG2A 1KK7A 1H3HA 4J6XA 3H8ZA 1T0JA 3CMET 4OF1A 4J6WA 2P4TA 2HCKA 3OYNA 1XTDA 5LJ5d 4RMOA 4A54A 2ABLA 2GF7A 1OEBA 1BYMA 4FCYA 3REBB 3FDRA 1MHNA 3HRTA 4Z88A 1JXOA 2O2OA 3GOXA 4PJLA 1NPPA 3DKMA 3BFMA 4E7IA 3CBPA 4M7AA 1VQ8T 3JB9I 3SWNC 5GMKh 3C0CA 2OAUA 5IHKA 4C92E 1NYGA 1KQSS 5FU7B 2EBPA 1RLPC 2DX1A 2L89A 1PSEA 2YHTA 1NJIU 4F04B 3CCET 2CP6A 2BZXA 4ZTJA 4C5GA 2QEXA 1B07A 1M2VA 1UE9A 3M55A 5HKCA 2Z0WA 4PFOA 4M77G 1J3TA 2ZPGB 3CXCS 2EW3A 3LX7A 3S3MA 4FYWB 1QKWA 4FW2A 4ZTFA 2JMAA 3G6ET 3JB9F 4OGEA 3CC2A 2CGHA 4J5YA 1MNEA 3UATA 2C06A 4PFPA 2K5IA 2L0AA 1M8MA 4JJCA 2KEAA 2RNAA 3EG9B 2NUPA 4ELYC 1AZGB 3PFSA 3PNWC 4JRPA 3JCMP 4L5GA 1PD1A 1M3BA 3M4YA 1Y96A 3QKJA 3UF4A 3QUIA 2RH2A 3RMQA 5LJ5h 2PVDB 3H6ZA 3FRNA 4HCBA 3CCQT 1VQOA 2JUFA 2BTTA 3UT1A 1W1FA 2EWNA 3AT1B 5KYUA 1WQ7A 3MCAB 3OYLA 4KUDK 1OPLA 4JJBA 4PKCC 3OBWA 3JCMV 1RABB 4XU2A 3PT9A 2CP0A 3INZA 2O88A 2GGRA 2DERA 1T3LA 4C8QB 1SF9A 2MIOA 1QVFS 3CMAA 1X6GA 2VASA 1WLPB 1D0YA 1FMVA 2LQ8A 1OV3A 3I56T 1SHFA 1YJ9T 3CPWS 2DJQA 1ZLMA 3JCMb 2JM8A 4RTTA 2P0KA 1I8FA 3DLLA 2EFIA 2CZ6B 3HFNA 5LJ3h 2KK4A 1BCMA 3X24B 4C0DB 3CCMT 3VRZA 1VYVA 1FYNA 4M7DD 2P84A 5KYYA 3G7ZA 1ZSZA 2J06A 1M1FA 3M0PA 5LJ5f 1KG1A 1RAFB 1EFNA 2QYZA 4AT1B 5C0MA 3VS2A 2PUKB 2KSSA 3S6WA 5GAOm 3P8HA 5EC7A 1QWFA 4C8QC 2BIVA 2EYZA 5CQXA 4RTYA 1E7OA 2YUQA 5I11A 3CMEQ 1WXBA 3I35A 3OYFA 4VUBA 4AFZC 3VS7A 1ARKA 5GAN7 3I55A 1MMGA 4CC7A 3A8MB 1RACB 1BBZA 3JCMJ 2QTXA 3PE0A 4JUVA 3G71A 1GCPA 1N27A 1VQ8Q 1VQ4A 5CR2A 3WVEB 2M16A 1UGRB 3HPWA 1UHFA 3RBBB 3VS0A 4A4GA 2VWFA 3NMZC 5LJ3f 2K5LA 2QEXT 1SPKA 1TUCA 2DPPB 2ED0A 1MMDA 3CCEQ 3H9NA 5L8RE 4RKUE 4M75D 1Y57A 3OBYA 3TEEA 1UJYA 3CC2T 2XDBA 3KBGA 2DAQA 3GBQA 5DLOA 1E6GA 2RJCA 4BUGA 2ECZA 4N4GA 3CCUT 3EFOA 4WF2A 3HRUA 3G6EQ 5LJ5j 3RDVA 2AT1B 4FYVB 1JXMA 1O9SA 2CUDA 2RI5A 1AHJB 1BCOA 1UUEA 2DIQA 4M77F 2RJEA 1NEBA 1M4ZA 1RAIB 1CSKA 1VQOT 3QG1A 1M2VB 1GBQA 2JNGA 3PMTA 4QT7A 3V7SA 4M7DG 2XU8A 2DBKA 2E5QA 2AZSA 4OMQA 5GMKm 4JLGA 3CCQQ 3X28B 2MI6A 3I5RA 1NLPC 5HY6A 3J7AF 5KH6A 4L6V5 3CMAT 3DB4A 3JCMd 1VQPT 4PJOD 3CC7Q 1K8AU 3SHWA 4F7UG 1HXDA 4QQDA 4M7AC 3ZFJA 2X4JA 2W0ZA 1Y07A 1PD0A 3EGDA 3D7SB 5IT9E 1Y96B 4E6RA 2P0PA 3I56Q 4JZ4A 4KH0B 4KULA 1YJ9Q 2ZPEB 2EYXA 1BB9A 4F14A 2RQTA 3KXTA 4QVCA 5KYUB 2FVUA 1S72A 2AKKA 3PIOA 4BI8B 1PSFA 1UJ0A 1SRMA 2D0QB 2KXDA 3EHRA 1ACMB 3PVLA 4N4IA 1HK9A 1JO8A 2KVQG 2XDPA 4E7KA 4M7DB 1K8AR 1H92A 2HBPA 2KXCA 5KCHA 2HKQB 5LJ5g 5GAOl 4J9EA 4M75G 1R8OB 3EGUA 1SHGA 3OYJA 2LTOA 1K73C 1AEYA 1X2QA 2EJ9A 4X1VA 3GPLA 2ROTA 1UECA 1D1CA 5KYYB 3G71T 1YP5A 2GFUA 2QQRA 2X4WA 1ZSZB 4XTUA 1Q86C 2KT8A 2YLCA 4JRQA 4DBQA 1K76A 3EG3A 3E9GA 2CT3A 4E7JA 1TWBA 3C12A 4FIBA 1KD1R 2NYSA 4ZN3A 2RB6A 2E3HA 2QEXQ 3CPFA 3EFSA 4J9DA 5LJ3g 1WJSA 2HAXA 4J9FA 2K3YA 1WNLA 3OYYA 5KYWA 3TSWA 2FO0A 2DXCA 3MEWA 1F1BB 3CBOA 4PJOG 1KD1C 1EIFA 1Y71A 3VJPA 3L42A 5EG2A 3CC2Q 5LL6S 3OSVA 3CCJA 2RHYA 3O8VA 2K3XA 3BE3A 4M75B 1U8RA 4C5HA 2AHJB 3CCUQ 2LCLA 1ZSZC 4K11A 1YJWT 2XD0A 3QDRB 2K3BA 2VC8A 4J7FA 4R56A 2JS0A 1WFWA 1HYOA 4LDXA 1VQMT 1YCYA 2YWWA 3REAB 2LMJA 4F16A 3M57A 2DYBA 1VQOQ 2DD4A 2HQHA 2LZ6B 3JCMf 1M90U 4M78A 4JPBW 5GMKl 2FZGB 2IIMA 2CSIA 2EIFA 3LWIA 3LGLA 1VIFA 1QCNA 3QZ5B 5CQYA 3ZEHA 1I4K1 2HQXA 3M56A 2DBMA 2M9UA 2LP5A 3CMAQ 1VQPQ 4E7ZA 1SSHA 4M78D 4RTVA 1HSQA 2SEMA 2M02A 1KFZA 2HD0A 4C0ZA 4PJOB 3P8DA 2F2XA 1S72T 2RD1A 4BD3A 3E2UA 4M7DE 4RCBA 2EPDA 5FROA 3E9FA 1JJ2P 1WDXA 2QAZA 2EQJA 4EMKB 2EGCA 1M90R 1W2BP 3FJ5A 1UTIA 4WCIA 5FLXE 5GMKe 3FLGA 4F7UF 5CKHA 4J83A 2DTOA 3M9QA 2DIGA 3SEMA 3G4ST 1ZUYA 3CCEA 2QA4A 2RPNA 3EG0A 1VQ6A 4F7UE 1YHQA 2KR3A 3JCMQ 4RTXA 3PIPA 1SG5A 4JLIA 2BUDA 2X51A 4HVVA 1G5VA 5GAOn 1NEGA 4OMFB 3QJ6A 4PJMA 3OW2S 1WHHA 1D1AA 1TS9A 3RIRA 2KY9A 3LYIA 4BE2A 2E6NA 2I2LA 2HBWA 4BY6C 1IHVA 1RADB 4PLIA 2E65A 4FSXA 2CSQA 2P0QA 1PNJA 2YT6A 1N8RU 3G71Q 4DOWA 1KC8C 2F5TX 3OYHA 4A4EA 1MMNA 2LJ1A 1G2BA 2A28A 1YIJA 5FU6B 4JS5A 3HFOA 4OMMA 5GANd 4M75E 2O31A 2JTEA 3GIBA 4WTOB 1OU8A 2DVEA 1VQNA 1JJ2A 2GNCA 3M54A 2OTLT 1W2BA 1Q7YU 4YTLA 5FRMA 5IXBA 3CCJT 4MDXA 1QMCA 4CC3A 2M0YA 2OX7A 2YUNA 3V8LA 2XK0A 3VS1A 1N8RR 3I56A 2AZVA 2HEQA 2K57A 1X27A 2XICA 1MNDA 2FRYA 1X75C 2CP3A 3ME9A 4LN2A 1R0BG 2QASA 2G3RA 3MPUB 1JRIA 2L3PA 1JBMA 4DQ2A 2CZ0B 3CCMA 4FM4B 2WSEE 1VQ9T 1PG5B 1BK2A 2ZGWA 3MP8A 5KYWB 2DLPA 3TQ7P 2M0OA 4ELZC 2JTMA 3A8HB 1WX6A 3KFVA 3CCVA 2LVMA 4PJOE 2BE7D 1Q7YR 3V7CA 4PNOA 1GCQA 1NLOC 1QLYA 5ECAA 3CCRA 2DMOA 4J6YA 1OZ2A 2VGMA 2RQRA 1UB4A 1RAHB 4C92F 1S1NA 2DXBA 2X9HA 3RKYA 2NWMA 3R6NA 2VXEA 4DEXA 3M0TA 4CI0C 5CKFA 1S72Q 4M78B 1H3ZA 3QJYA 1ZUKA 4BE0A 1WZOA 3VUZA 2E70A 3OYEA 2JN0A 1VQ7A 1NPRA 2M1HA 2QA4T 1LJOA 4C8QG 1VQ6T 1YHQT 4M7AD 3LH5A 3ZBDA 5GAN2 1Q82U 3G4SQ 4NOYA 2P4RA 1RUWA 4ME7A 2IG0A 4M4ZA 2C0OA 2GTOA 2DL8A 1WHKA 4OVAA 2D8HA 2QK0A 1HD3A 2CDTA 8ATCB 4KGVB 3URGA 2X3XD 2EJGA 3CCLA 1G3WA 1FMKA 1WXUA 3EFRA 4N4HA 4TVRA 5GJWB 3CCUA 2NUTA 4AFSC 1JB0E 2ATCB 3GP8A 1NJIR 2FPFA 1GL5A 4RTZA 4M78C 5GANf 4A63B 1YIJT 1Q82R 1VIEA 2DL5A 4LXCA 2XI9A 2R5AA 1ZA2B 2B86A 2K6DA 3VYGA 2DK3A 3A1PA 1VQNT 1AD5A 2AKLA 2XDDA 1NJIC 2E10A 4FT2A 2QI2A 1M30A 4C0FA 4MZPA 3WVDB 4QW2A 1XJWB 2PQWA 2DRKA 1VQPA 2MK5A 4JRKA 2OTLQ 2LQNA 3CCJQ 4PFZA 3VUBA 2DRMA 2RK1A 1I1JA 1XOVA 4ORZA 2Y4XA 2DL4A 4DBHA 4QVDA 2BE9B 2QQAA 2R58A 2YRVA 4DEYA 4J9IA 2C0TA 1AWJA 3NFCA 1ZBJA 4IKFA 1KJWA 3CCVT 4JDSA 1Q81U 1AWWA 1NZ9A 1VQ9Q 3QZ9B 2MWOA 1IB8A 3CCRT 1WXTA 2RJFA 5IAYA 4NL2A 3X26B 5A2QE 1UGSB 2AIRB 3OQ5A 5GANj 4AFUC 1AWOA 1ZA1B 5CCAA 2QGFB 3HKSA 2RHXA 4A4FA 2AK5A 2LCSA 2ENMA 4KGZB 1LPLA 1GRIA 3H0IA 4OB3B 3CC4A 1I07A 2IPOB 1AWXA 2DVJA 1H641 2LX9A 3QHSA 2DO3A 1H8KA 2DILA 2COYA 1X69A 1VQ7T 3CQTA 3CPWP 1OU9A 4M77C 1Q81R 4XAXB 1K1ZA 4OMLA 4JZ3A 5GAMe 5HK0A 1YITT 2JM9A 1WHMA 5FWCA 3NGPA 3OS1A 4ZGJB 2QA4Q 2LNVA 2MCNA 4ANJA 1UEBA 1VQ6Q 1YHQQ 3GNGA 4RG8A 3OB9A 5GAN5 3V7RA 2EVRA 4DBFA 3CCLT 4M7AB 1KIKA 1FX7A 3OS2A 1Z9QA 4LE9A 3RKWA 4A4KA 2O01E 2RHIA 2YSQA 2M51A 5D6XA 3TU4K 5CIUA 4C8QE 3NTHA 4XQ3A 2RI2A 2DFUA 1SRLA 2J7IA 1YJWA 1K9AA 4B9XA 1KSWA 1RAEB 3OYDA 3M0QA 1VQMA 1GCQC 2V8IA 4ZGEB 2LRQA 4MMLA 2PVOB 5GANg 2L3SA 1VQLT 1YIJQ 1BU1A 2VUBA 2G6FX 4R0KA 2E6ZA 1MUZA 2KRNA 1QVFA 2RF0A 2WSFE 4UC4A 1K9MU 1ZX6A 3FIFA 5D7UA 5KE3A 1C0MA 1VQNQ 3CPWA 4OMOA 3RMSA 3M0RA 1WGSA 2NUPB 3JCMW 3NTIA 2NUTB 3VKIA 1IHWA 1JU5C 3CCSA 1BIBA 4E7LA 2CZ1B 2FL7A 3OYMA 1CKAA 2OAWA 4HCKA 1IO6A 1TH7A 1QVGS 3RUXA 4XTYA 3DB3A 2J05A 3QYGB 2RMOA 4AG2C 4BDZA 4RCCA 1ABOA 3EGXA 4C92A 2BZYA 2NUZA 3M4GA 1TSFA 2KMTA 3CCMQ 3I9QA 2DEUA 4LD9K 4LDVA 4CRIA 1C1AA 3M5AA 4C0GA 3PGGA 2K79A 2CP7A 2HNIA 1FXXA 3CCVQ 3G4SA 2QQSA 2D8JA 1K0XA 4DOVA 1KQ2A 1X6BA 5A0GA 4AG1C 3CCRQ 4C92D 1W70A 2V1QA 2L3QA 1RAAB 2KRMA 2O9SA 3CC4T 2E4HA 1MMAA 4JJNK 2JS2A 1M2OA 4D6WA 1K8AC 1I5LA 4D8KA 4MZTA 4GY5A 2ESWA 1NE8A 3JCMh 2V26A 4Z8AA 1IGQA 1W4SA 2DTIA 7AT1B 3OY9A 1VQ7Q 4M7AE 3OSSC 2MPXC 2X3WD 3L1AA 1NG2A 2D0NA 1PRLC 1YNZA 4KH1B 2ZPHB 4OB2B 1OULA 2Y90A 2A0FB 1YITQ 4II1A 1U5SA 1Z9ZA 3JB9D 2GQVA 3JB9J 2ZPIB 2FYKA 2HL5C 2JJ9A 2L5QA 2H8HA 4FYXB 2OTLA 2PUOB 3CCLQ 2YDLA 3X20B 2BKDN 1V29B 2ZCFB 1KQ1A 2RJDA 5KYXA 4ZN1A 4L59A 2QTVA 5KE2A 2DF6A 1AZEA 1R77A 4J7IA 3M59A 2DE0X 4N0AA 4ATOA 1Q95G 1MV3A 2W10A 2J6KA 3L2ZA 3RKXA 1JJ2S 4GLMA 5J3BA 2H3JA 1D0XA 4XTXA 1W2BS 2PZ1A 3TSZA 4A4HA 2HKNA 2JTFA 3BW1A 1VQ9A 2OTJT 4Y92A 1P92A 3TVTA 4O5VA 3LLRA 3QDFA 2X35A 3Q1JA 3V8KA 4C5EA 4MZMA 1PRMC 2JXBA 3EFOB 5CAIA 1UFFA 2B8AA 3JV3A 3CCST 1YWOA 5CKDA 2HDAA 1M1KU 4PK4A 1WHJA 3HTRA 2JW4A 4M7DF 2E5KA 4FL6A 1MV0B 1QP3A 2FZKB 4BI4A 3F70A 4BY6B 1QVPA 3V8JA 4V2SA 4MDWA 4J9BA 2FPEA 1OZ3A 1XNIA 3JCMX 2JOYA 5GAOq 1X2KA 1BI2A 4HT8A 5GJVB 4J8OA 1JQQA 2DXTA 3OYBA 5GAN8 4XU0A 1M1GA 1LVKA 3HRSA 1UG1A 2MAMA 1I5OB 1GBRA 3QBYA 2PNIA 4Z02A 1GFCA 3P8BB 2HZYA 4JRIA 3SB2A 3L2WA 1W6XA 3X25B 3EGDB 1M1KR 2J6FA 1M90C 5GAN4 3UWNA 2CH4A 4Q5WA 1D09B 3ER0A 2CZ7B 2F2WA 3RNJA 2YRDA 2FHDA 3KUFA 2L8DA 4LDUA 3DLMA 1YWPA 3LW5E 3E19A 1DJ7B 4RG2A 4PL6A 3EGXB 4C92B 3CC4Q 1QW1A 5CVIA 4O6JA 1R0CB 2O4XA 2KBTA 3JRZA 2JMCA 1UHCA 4BACA 3C4SA 5KCOA 5L23A 1FMWA 2K5FA 4IIMA 4M75F 2RHUA 3GNFB 2VKNA 2V8JA 2KRSA 4LD6A 4QQGA 1RAGB 2KI7A 2LT1A 2WSCE 4EDUA 4FSSA 2FPDA 2GCXA 4M77A 5LJ5e 2E64A 5M9OA 4X34A 1YFNA 3L2VA 3M0SA 2RK2A 1NBEB 1JEGA 2I0NA 1EX4A 4FU6A 2CYZB 1V1CA 2KT1A 2F2VA 4X9DA 4E7SA 4M77D 4F17A 3VS4A 1A0NB 4M78G 1OX8A 2EYYA 4C92C 4BE1A 1OYXA 3MP1A 3VS6A 1U1TA 3LGFA 1X6OA 2LC4A 2QG9B 3WXMB 1SKUB 1QCFA 1YJWQ 4OMPA 5A0DA 5CKBA 2JVVA 3VV0A 2K7AA 4PJOF 1M8VA 1N8RC 5LJ3e 1VQMQ 1OI1A 1PM3A 5DM7R 3VS5A 2R5MA 2A08A 2A3LA 2HMAA 3JCMg 2PVGB 3LH0A 4BI3A 4RTWA 5DY9A 1WYXA 5KYXB 1AT1B 1VQKT 3FEOA 3JSCA 1PHTA 4LDWA 3CCSQ 5C6SA 2ED1A 2CH4W 3UA6A 1YJNA 2YUPA 2ZAEA 3RESA 1Q7YC 2RQUA 3LWHA 1VUBA 5GANh 2XKOC 3A5ZB 1ZSGA 4PJJA 4J9CA 3H0FA 4E2FB 2C0IA 3L2UA 3FJPA 1LNXA 1RI9A 2RO0A 2LJ3A 3EAEA 1C6VX 2SRCA 2LNHB 2RM4A 3MEVA 1X01A 3BDLA 3MKDA 3OMGA 3J80E 1N9RA 1YITA 3BDUA 2CT4A 2F1LA 3OW2A 3SDZA 2MF2A 2DEQA 4KT0E 2GFAA 4XU3A 4NS5A 4XTVA 1SEMA 3TCJA 5I22A 1IGUA 1N6AA 3HHTB 1WIEA 4OB1B 1N5ZA 4N0AC 4AMCA 2QGGA 2KAFA 5LJ3d 1G3TA 1XQHA 2K2MA 5D6YA 4GBQA 2L3RA 2V8KA 4OB0B 3A98A 4A53A 1KHIA 2COZA 2DM1A 1MGQA 2KDSA 3A8LB 9ATCB 1KQSP 5AT1B 1UGVA 2XMFA 2EQKA 4QKUA 1TOVA 1VQLA 2QXFA 1UDLA 3JCMc 3RR6A 5FU7C 3I5SA 3OYCA 3C95A 1TG0A 1Q82C 1ZQ1A 4AFQC 1IZ6A 3M58A 2FEIA 1BIAA 2O4XB 2J6OA 2D6FA 2XG8D 4IURA 1UGPB 3CXCP 3H0HA 4OP0A 3CC7T 1LCKA 2FRWA 3A8GB 3SD4A 4EIKA 4EPCA 4XTZA 2DZ9A 5IHNA 4DBRA 2QQBA 2DETA 4M7DA 4M77B 3L2RA 4JS4A 1UGQB 3VS3A 3G1JA 2E1HA 1OQKA 2DNUA 1Y7XA 3MJXA 5J26A 1K4US 3OYGA 2DYIA 2HQEA 2MOXA 4M78F 4M7AG 1GXIE 3QWXX 2DXUA 2KROA 3GLXA 4F7UA 4M78E 1WA7A 1AOJA 1YJNT 2D9TA 3CEYA 4QQ6A 1VQKQ 1KQSA 3EHQA 2KGTA 2VXFA 1KHCA 1YI2A 3FC3A 1QVFP 2MWPA 3MEUA 4D8DA 2YUOA 1M3AA 4LDYA 2LJ0A 3N5BB 5GMKj 2GBQA 1M27C 3EH2A 2X4XA 4Y28E 1G3SA 3AHUA 1I0CA 3CD6A 1VQ5A 4FYYB 5AYFA 3JCMe 4P5NA 5GAN3 3QPHA 3CXCA 3VU3C 1U1SA 1M3CA 2LCCA 4C0DC 4M75A 2V1RA 2KYMA 1Q81C 4HCZA 2EKHA 1U3OA 5CK9A 4XK8E 5FW9A 1QP2A 2K9GA 1QQJA 1K0SA 3E1SA 4C8QF 5IH2A 2EAYA 2LQWA 3O5ZA 4LUEA 2GQIA 1BI0A 2CP5A 2DL3A 2DKGA 1RLQC 1PC0A 4ZNXA 2EJFA 3H41A 2LDMA 1IRXA 1WHLA 1YCSB 3NTKA 3OYKA 4HXJA 3VYHB 5HK3A 1SSFA 2L2PA 3SFMA 4XTWA 5I2MA 5GAN6 4BDYA 1WPYA 1PWTA 4ZGDB 4IUTA 2OTJA 3OYAA 4DA4A 1PKTA 4PJOA 1WI7A 2VYTA 1WJQA 1ZUUA 4J9GA 4M77E 4KUIA 4EMKA 1HJDA 1QKXA 1PKSA 4NL3A 1B7TA 5J39A 2QDLA 3IQLA 2IVWA 5GAMd 3HL8A 1K73U 2XHCA 2O9VA 4MMKA 3OYIA 2WACA 3ZL7C 2DTHA 5LJ3j 5IN1A 1Q86U 2JZ2A 2HL3A 2Y4YA 1EZZB 3PTAA 4J9HA 3EG1A 4RTUA 5DLQE 1K9MR 5D6WA 4LNPA 1B34A 2K4YA 1OX9A 4QVZA 4KRTA 2A7YA 4HVUA 2F69A 3T9NA 1D3BA 3M53A 3META 4PJNA 5GAOp 2DZCA 3EH1A 2K2VA 1TUDA 1K9MC 3QYHB 2XIDA 1YI2T 1K73R 1PCXA 1WQWA 1FWZA 1YJNQ 1M5Q1 2MMPA 1KD1U 2DL7A 2RQVA 3A8OB 1D0ZA 1G8XA 3JB9H 3UA7A 1AVZC 1Q86R 5HCKA 2CUBA 4M7AF 4EMHA 3I55T 1QCOA 3CD6T 5KYNA 2X4YA 1VQ5T 3NPFA 3U23A 1VYUA 4IUQA 3ASKA 2LX7A 1QVGP 2NLUA 1ZBXA 3HSBA 2EYWA 3OA6A 5I21A 4F7UB 2CP2A 2EQUA 4IUPA 2E3IA 1VQ4T 1LOJA 5GAMh 3M0UA 4KBMB 3NHNA 2EQMA 2YLBA 3SWNA 3MHXA 1TXQA 3TREA 1TUGB 2KE9A 5IHIA 1CKBA 3UPUA 4EMGA 1VA7A 1Y0MA 3S3OA 2GTJA 2LT4A 3OMCA 3PVQA 2RHZA 2CREA 4X9CA 4M7DC 1WJRA 3OS0A 2CKKA 4IUVA 2A37A 2ROLA 3QSUA 4CC2A 4E47A 4IUUA 4Z89A 1IREB 2RI3A 3GF5A 3R6OA 2RQWA 5CO7A 1ZHIA 2QDYB 1VQLQ 2E41A 2VB6A 1GFDA 4B9WA 4OGCA 3C94A 2FZCB 4JJDA 6AT1B 2H3EB 4C92G 5GAMf 1QVGA 1OPKA 1VQKA 4HA8A 1T0HA 4OMNA 2FB7A 2FG0A 3OS5A 2KYBA 1VOMA 2DJZA 4HT9A 2YRCA 1WHGA 1TTHB 3CMEA 3CBMA 1ABQA 3L2QA 4KGXB 2ZPFB 5A0LA 1BI1A 5GANe 2ZZDA 1M9SA 1TU0B 4RUGA 4M75C 5I2SA 1KC8U 1V76A 2RN8A 3FB9A 1VQ8A 1YN8A 4HVWA 4GLKA 3MEAA 2HSEB 3EG9A 5IXFA 2OJ2A 3JB9G 2YXYA 2BZ8A 2CS7A 2VGNA 8AT1B 3J81E 4E7HA 2EKOA 1IXDA 1B3QA 1YI2Q 2EYQA 2MYSA 1M1KC 4Y91A 2PTKA 2COWA 2E12A 1G83A 2JT4A 1BKBA 1B34B
chains in the Genus database with same CATH topology
2LNVA 3TCJA 5GMKi 1UEBA 1N6AA 3HHTB 5GAMj 4OB1B 3GNGA 4N0AC 4C8QA 1VQNA 3E9GA 2KAFA 4RG8A 1YBYA 4E7JA 3C12A 1D3BB 5LJ3d 3G6EA 1G3TA 3OB9A 3S3NA 2ZPBB 4FIBA 1Q82U 2DD5A 4PJOC 4ZN3A 5GAN5 3V7RA 1XQHA 2RB6A 3CCLT 4M7AB 3JAME 3MP6A 3CPFA 3EFSA 5D6YA 2L3RA 2V8KA 3RERA 4OB0B 1FX7A 5LJ3g 4A53A 1KHIA 1RI0A 4BB7A 1WJSA 3OS2A 2HAXA 4FT4A 3RKWA 2K3YA 1WNLA 4HKEA 4A4KA 4EMKC 2O01E 2RHIA 3OYYA 1RL2A 5D6XA 4C8QD 2DXCA 1MGQA 2KDSA 3A8LB 3TU4K 3MEWA 5GAOr 3CBOA 3PMIA 3HP9A 2KQWA 4PJOG 3CCQA 1KD1C 1EIFA 5CIUA 2EQKA 3NTHA 4C8QE 1Y71A 2RI2A 4XQ3A 3L42A 5EG2A 3VJPA 1VQLA 2PU9B 2QXFA 1YJWA 3JCMc 5LL6S 5FRNA 1G3YA 3OSVA 5FU7C 2RHYA 3CCJA 4B9XA 3O8VA 2K3XA 4C5IA 3OYDA 4M75B 3OYCA 3BY7A 1VQMA 1U8RA 2V8IA 4C5HA 3C95A 4ZGEB 1I81A 2AHJB 2LRQA 4MMLA 2LCLA 5CKEA 2PVOB 3CC7A 2R57A 5GANg 1Q82C 1ZQ1A 1VQLT 3MO8A 1IZ6A 2VUBA 3M58A 3QXEB 1YJWT 1BIAA 2XD0A 2E6ZA 3QDRB 1QVFA 1N9SA 2VC8A 2O4XB 3UDCA 4J7FA 2D6FA 4R56A 2XG8D 4IURA 2WSFE 1UGPB 4UC4A 4LDXA 2LQKA 1VQMT 1YCYA 1K9MU 3QIIA 3FIFA 4OP0A 3CC7T 5KE3A 3CPWA 3M57A 1YJ9A 2DD4A 3RMSA 3A8GB 3SD4A 1WGSA 2F5KA 3JCMf 3NTIA 4EPCA 3JCMW 1M90U 3SWNB 3VKIA 4M78A 4XTZA 5GMKl 2DZ9A 3CCSA 4HCCA 1BIBA 2QQBA 4M7DA 4M77B 4PLLA 4E7LA 3L2RA 2CZ1B 2EIFA 2FL7A 3OYMA 3LWIA 3LGLA 1VIFA 4JS4A 1UGQB 1TH7A 3QZ5B 1QVGS 4XU1A 2E1HA 2QQ9A 3QO3A 5CQYA 1I4K1 2HQXA 3M56A 3ZEHA 2M9UA 2VV5A 3RUXA 1Y7XA 4XTYA 4R55A 5J26A 3DB3A 3OYGA 2HQEA 4M78F 2RA2A 5FU6C 4M7AG 1O75A 3QYGB 1BI3A 4M78D 4BDZA 4RCCA 1GXIE 4C92A 5GAMg 4J6XA 2DXUA 3H8ZA 3CMET 3GLXA 3M4GA 2KMTA 2HD0A 4OF1A 4LD9K 4J6WA 4C0ZA 4F7UA 4PJOB 2P4TA 3P8DA 4LDVA 4M78E 4CRIA 1S72T 3M5AA 2RD1A 4C0GA 4BD3A 3OYNA 1YJNT 1XTDA 2D9TA 3PGGA 5LJ5d 4RMOA 4RCBA 4M7DE 4A54A 2HNIA 3E9FA 1FXXA 3CEYA 2GF7A 5FROA 1BYMA 4QQ6A 3G4SA 2EQJA 4EMKB 2QQSA 1KQSA 3FDRA 2VXFA 4DOVA 1KHCA 1MHNA 1YI2A 3FC3A 3HRTA 5A0GA 1KQ2A 2MWPA 3MEUA 4C92D 5FLXE 5GMKe 3FLGA 4F7UF 3GOXA 1NPPA 3DKMA 5CKHA 3BFMA 4J83A 2DTOA 3CBPA 3M9QA 4E7IA 2DIGA 1VQ8T 4M7AA 3JB9I 3SWNC 5GMKh 3G4ST 4LDYA 2OAUA 4C92E 3N5BB 3CCEA 2QA4A 5GMKj 1KQSS 3CC4T 1VQ6A 5FU7B 4F7UE 1YHQA 2X4XA 4JJNK 3JCMQ 4Y28E 1G3SA 4D6WA 3AHUA 2L89A 3CD6A 3PIPA 1K8AC 1VQ5A 1I5LA 1PSEA 2YHTA 5AYFA 4JLIA 4MZTA 3JCMe 1NJIU 2BUDA 4P5NA 5GAN3 3QPHA 3CCET 4GY5A 3CXCA 1G5VA 4ZTJA 4C5GA 2QEXA 1NE8A 3JCMh 5GAOn 4OMFB 3VU3C 3QJ6A 1U1SA 3OW2S 3M55A 5HKCA 2LCCA 4C0DC 1W4SA 2DTIA 3OY9A 4M75A 3RIRA 2KY9A 4M77G 3LYIA 4BE2A 4M7AE 3OSSC 1Q81C 2E6NA 2I2LA 2ZPGB 4BY6C 4PLIA 2E65A 3L1AA 4HCZA 3CXCS 3LX7A 4FSXA 3S3MA 5CK9A 4XK8E 2P0QA 1N8RU 1QP2A 2ZPHB 4OB2B 2Y90A 4ZTFA 3G6ET 4DOWA 3JB9F 4II1A 4OGEA 3CC2A 2CGHA 3E1SA 4J5YA 4C8QF 3JB9D 1KC8C 2EAYA 2F5TX 2GQVA 3OYHA 2C06A 3JB9J 2K5IA 2ZPIB 4A4EA 2FYKA 2L5QA 4ELYC 1BI0A 3PFSA 2DKGA 3PNWC 1YIJA 5FU6B 4JS5A 4JRPA 3HFOA 3JCMP 4L5GA 2OTLA 5GANd 4M75E 3M4YA 2PUOB 1Y96A 3QKJA 2EJFA 3QUIA 2RH2A 2LDMA 2BKDN 1V29B 3X20B 2ZCFB 1KQ1A 3RMQA 5LJ5h 2PVDB 2RJDA 2DVEA 3H6ZA 3FRNA 3NTKA 4ZN1A 3OYKA 1JJ2A 3VYHB 5HK3A 4L59A 1SSFA 3CCQT 4HCBA 3M54A 1VQOA 2JUFA 5KE2A 3SFMA 4XTWA 3UT1A 2OTLT 4J7IA 1W2BA 2EWNA 4YTLA 5I2MA 1Q7YU 1WQ7A 3MCAB 5GAN6 3OYLA 4BDYA 4KUDK 5FRMA 3M59A 1WPYA 3CCJT 4MDXA 4PKCC 3OBWA 4N0AA 4IUTA 3JCMV 4XU2A 4ZGDB 2OTJA 3V8LA 2XK0A 3OYAA 4ATOA 3PT9A 3INZA 3I56A 3L2ZA 3RKXA 1JJ2S 4DA4A 4PJOA 2K57A 5J3BA 4C8QB 2H3JA 2XICA 2VYTA 1WJQA 4XTXA 1W2BS 1X75C 4A4HA 4M77E 2JTFA 1QVFS 3BW1A 3ME9A 1VQ9A 3CMAA 2OTJT 1P92A 4O5VA 3LLRA 4KUIA 3I56T 4EMKA 2LQ8A 2G3RA 1JRIA 2X35A 3Q1JA 4NL3A 3V8KA 1YJ9T 1JBMA 5J39A 4C5EA 3CPWS 3JCMb 4DQ2A 4MZMA 2CZ0B 3CCMA 4FM4B 2WSEE 2P0KA 2IVWA 5CAIA 1VQ9T 5GAMd 1I8FA 2B8AA 3HL8A 2EFIA 2ZGWA 3DLLA 3MP8A 2XHCA 3CCST 1K73U 2CZ6B 4MMKA 5CKDA 2WACA 2M0OA 4ELZC 3OYIA 3HFNA 5LJ3h 1M1KU 2JTMA 3A8HB 2DTHA 2KK4A 3X24B 4C0DB 3CCVA 2LVMA 5LJ3j 4M7DF 3CCMT 5IN1A 4PJOE 1Q86U 2JZ2A 2Y4YA 4PNOA 3V7CA 4FL6A 4BI4A 1QP3A 4M7DD 3PTAA 3F70A 4BY6B 1QVPA 3V8JA 4V2SA 4MDWA 3CCRA 3G7ZA 1OZ3A 1XNIA 5DLQE 5D6WA 3JCMX 1M8VA 4J6YA 1OZ2A 2VGMA 1B34A 2JOYA 1M1FA 5GAOq 1BI2A 2K4YA 4HT8A 1UB4A 5LJ5f 4QVZA 1KG1A 4J8OA 2DXTA 2A7YA 3OYBA 2F69A 3T9NA 1D3BA 3M53A 4C92F 3META 5C0MA 5GAN8 2DXBA 2PUKB 4XU0A 5GAOp 2KSSA 1M1GA 3S6WA 5GAOm 3HRSA 3P8HA 2DZCA 3RKYA 4C8QC 2K2VA 2BIVA 2MAMA 5CQXA 2VXEA 3OYFA 3QBYA 4VUBA 4Z02A 4CI0C 1K9MC 5CKFA 3P8BB 3QYHB 2XIDA 4JRIA 5GAN7 3SB2A 4M78B 3I55A 3L2WA 1WQWA 3QJYA 1YI2T 1FWZA 1H3ZA 1M5Q1 2MMPA 4BE0A 3X25B 1KD1U 3VUZA 2E70A 3OYEA 2JN0A 1M90C 1VQ7A 3A8OB 5GAN4 1NPRA 3JB9H 3UWNA 2M1HA 3A8MB 2QA4T 1LJOA 4Q5WA 3GIBA 4C8QG 4M7AF 4EMHA 3JCMJ 3I55T 1VQ6T 1YHQT 4M7AD 3ZBDA 2QTXA 3ER0A 4JUVA 5GAN2 3G71A 2CZ7B 2X4YA 3CD6T 1VQ5T 1N27A 2FHDA 3KUFA 2L8DA 4IUQA 4LDUA 3ASKA 3DLMA 5CR2A 3WVEB 1VQ4A 2M16A 1UGRB 3HPWA 3LW5E 4NOYA 3E19A 2NLUA 1DJ7B 1ZBXA 4RG2A 4PL6A 4A4GA 3HSBA 4ME7A 4C92B 1QW1A 2QEXT 5LJ3f 2K5LA 2IG0A 5I21A 3OA6A 5CVIA 4F7UB 2DPPB 4O6JA 2EQUA 4IUPA 4OVAA 2O4XA 1VQ4T 1LOJA 3JRZA 3URGA 5GAMh 4BACA 2EJGA 3CCLA 3C4SA 5KCOA 4KBMB 2K5FA 4M75F 2RHUA 1G3WA 3GNFB 3EFRA 4N4HA 4TVRA 5L8RE 4RKUE 2EQMA 2V8JA 4M75D 3CCUA 2YLBA 3OBYA 3SWNA 4LD6A 3TEEA 3MHXA 4QQGA 1JB0E 3TREA 3GP8A 3CC2T 2LT1A 2WSCE 4EDUA 2XDBA 3KBGA 2DAQA 4M77A 2GCXA 5DLOA 5LJ5e 2E64A 2RJCA 4BUGA 5M9OA 4M78C 3UPUA 4EMGA 3S3OA 4X34A 5GANf 2LT4A 3OMCA 4N4GA 3CCUT 2RHZA 4X9CA 4M7DC 1WJRA 4WF2A 3OS0A 2CKKA 3HRUA 4IUVA 5LJ5j 3L2VA 1YIJT 2RK2A 1VIEA 2XI9A 2R5AA 3QSUA 4FU6A 2CYZB 1O9SA 2DK3A 1AHJB 2RI5A 3VYGA 2DIQA 4M77F 4E47A 2RJEA 1VQNT 1M4ZA 4X9DA 2XDDA 4M77D 4IUUA 1VQOT 3QG1A 1NJIC 2E10A 2JNGA 4FT2A 4M78G 3PMTA 1IREB 2QI2A 2RI3A 3GF5A 3R6OA 4C92C 4C0FA 4MZPA 3WVDB 3V7SA 4BE1A 1OYXA 2XU8A 4QW2A 3MP1A 4M7DG 1U1TA 2E5QA 3LGFA 2PQWA 5GMKm 4JLGA 1VQPA 1X6OA 2LC4A 5CO7A 1ZHIA 3WXMB 2QDYB 4JRKA 3X28B 2E41A 2MI6A 5A0DA 5CKBA 2JVVA 5HY6A 4B9WA 4OGCA 3VV0A 3J7AF 4PJOF 3VUBA 4L6V5 5KH6A 3C94A 3DB4A 5LJ3e 1N8RC 3CMAT 3JCMd 2RK1A 1VQPT 4PJOD 1OI1A 4C92G 5GAMf 5DM7R 1QVGA 1XOVA 1K8AU 2R5MA 2A3LA 1HXDA 2Y4XA 4QQDA 4F7UG 3ZFJA 1VQKA 2X4JA 4QVDA 4M7AC 1Y07A 2QQAA 2YRVA 2R58A 3JCMg 4HA8A 5IT9E 1Y96B 2FB7A 2PVGB 3NFCA 3LH0A 2P0PA 4BI3A 3OS5A 2DJZA 4HT9A 4KULA 5DY9A 4IKFA 2ZPEB 3CCVT 3CMEA 4JDSA 1VQKT 3CBMA 1Q81U 3FEOA 1NZ9A 3JSCA 3L2QA 4LDWA 3KXTA 3QZ9B 4QVCA 2MWOA 2FVUA 2ZPFB 5C6SA 1S72A 5A0LA 3CCRT 1BI1A 5GANe 1YJNA 3PIOA 2RJFA 4BI8B 5IAYA 4NL2A 2ZZDA 3RESA 1PSFA 1M9SA 1Q7YC 3X26B 5A2QE 1VUBA 3LWHA 2D0QB 5GANh 4M75C 1UGSB 2XKOC 5I2SA 3OQ5A 1KC8U 5GANj 3A5ZB 4N4IA 1HK9A 3L2UA 3FB9A 2KVQG 2XDPA 5CCAA 3HKSA 4E7KA 3FJPA 2RHXA 1LNXA 2RO0A 4A4FA 1VQ8A 4GLKA 4M7DB 3MEAA 3EAEA 2HBPA 5KCHA 3JB9G 4OB3B 3CC4A 5LJ5g 2RM4A 3MEVA 5GAOl 1H641 1X01A 2LX9A 3QHSA 2CS7A 3BDLA 4M75G 1R8OB 2DO3A 2VGNA 3OMGA 3J80E 1N9RA 1YITA 3BDUA 1VQ7T 3J81E 3OYJA 4E7HA 2LTOA 2EKOA 1K73C 2EJ9A 4M77C 3OW2A 3SDZA 4XAXB 2MF2A 2DEQA 4KT0E 3GPLA 2EYQA 1M1KC 2GFAA 4Y91A 5GAMe 2E12A 5HK0A 3G71T 4XU3A 1YITT 2GFUA 2QQRA 1BKBA 2X4WA 4NS5A 4XTVA 4XTUA 1Q86C 3OS1A 2YLCA 4JRQA 4ZGJB 1B34B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM d;  1I8F A;  2VXF A;  5GMK i;  2ZGW A;  3QSU A;  1KQ2 A;  5GAM j;  4MMK A;  4N0A C;  4M77 F;  4C8Q A;  4C92 D;  5GMK e;  4F7U F;  3HFN A;  4X9D A;  3BFM A;  4M77 D;  2DTO A;  1D3B B;  5LJ3 d;  5LJ3 h;  4M7A A;  2DTH A;  2E10 A;  4M78 G;  3SWN C;  3JB9 I;  5GMK h;  5LJ3 j;  4M7D F;  4PJO E;  4PJO C;  3V7C A;  4PNO A;  3V7R A;  4C92 C;  4C92 E;  5GAN 5;  2RB6 A;  4M7D D;  5GMK j;  3V7S A;  4M7A B;  4M7D G;  4M7D C;  3EFS A;  4F7U E;  1U1T A;  3V8J A;  4V2S A;  5GMK m;  3RER A;  5LJ3 g;  4A53 A;  3JCM X;  3JCM Q;  3AHU A;  4J6Y A;  1I5L A;  1B34 A;  3RKW A;  1WNL A;  4EMK C;  2YHT A;  4JRK A;  5GAO q;  2E41 A;  4JLI A;  3JCM e;  5GAN 3;  4HT8 A;  5LJ5 f;  4C8Q D;  1MGQ A;  2DXT A;  4PJO F;  1M8V A;  5GAO n;  3JCM h;  1D3B A;  4C92 F;  5LJ3 e;  3VU3 C;  3JCM d;  1U1S A;  5GAN 8;  5GAO r;  4PJO D;  4XU0 A;  4PJO G;  5GAO p;  4C92 G;  5GAM f;  5GAO m;  4C8Q E;  2DZC A;  3RKY A;  2DTI A;  4XQ3 A;  4C8Q C;  4M7D E;  4M75 A;  3RIR A;  2VXE A;  4M77 G;  4F7U G;  1HXD A;  3JCM c;  4M7A E;  4M7A C;  2I2L A;  4QVD A;  2E65 A;  3L1A A;  3JCM g;  4HA8 A;  4M75 B;  3BY7 A;  5GAN 7;  4JRI A;  1Y96 B;  2FB7 A;  4M78 B;  3SB2 A;  1I81 A;  1WQW A;  4MML A;  1M5Q 1;  2Y90 A;  5GAN g;  2DJZ A;  4HT9 A;  5DY9 A;  3JB9 F;  2JN0 A;  1BIA A;  2CGH A;  5GAN 4;  4J5Y A;  4C8Q F;  1N9S A;  2VC8 A;  3JB9 D;  3JB9 H;  2EAY A;  1LJO A;  3JB9 J;  4C8Q G;  4M7A F;  4QVC A;  2FYK A;  1YCY A;  4EMH A;  3JCM J;  3FIF A;  4M7A D;  5GAN e;  2QTX A;  4OP0 A;  4NL2 A;  4JUV A;  5GAN 2;  3RES A;  2DKG A;  3JCM P;  3HFO A;  3JCM f;  3JCM W;  5GAN h;  5GAN d;  4M75 E;  3SWN B;  4M75 C;  4NOY A;  1Y96 A;  4M78 A;  4XTZ A;  5GMK l;  2DZ9 A;  2EJF A;  3QUI A;  4C92 B;  5GAN j;  3HSB A;  5LJ3 f;  1BIB A;  1HK9 A;  5I21 A;  1KQ1 A;  4M7D A;  4M77 B;  5LJ5 h;  3GIB A;  2DVE A;  3FB9 A;  4F7U B;  3FJP A;  1LNX A;  1LOJ A;  4XTW A;  4M7D B;  2EWN A;  1TH7 A;  1WQ7 A;  5GAN 6;  4XU1 A;  2E1H A;  3QO3 A;  5GAM h;  2EJG A;  1I4K 1;  1WPY A;  3JB9 G;  4N0A A;  3JCM V;  5LJ5 g;  2RM4 A;  4XU2 A;  4M75 F;  3RUX A;  3V8L A;  4XTY A;  5GAO l;  3EFR A;  1H64 1;  1X01 A;  3QHS A;  5CAI A;  4M78 F;  4M75 D;  2RA2 A;  4M75 G;  2YLB A;  3INZ A;  3SWN A;  3L2Z A;  3RKX A;  4M7A G;  4M78 D;  4PJO A;  2K57 A;  1N9R A;  4RCC A;  4C8Q B;  4C92 A;  3BDU A;  5GAM g;  4J6X A;  2DXU A;  4XTX A;  3M4G A;  4M77 A;  5LJ5 e;  2E64 A;  4J6W A;  4M77 E;  4F7U A;  2EJ9 A;  3BW1 A;  4M77 C;  4PJO B;  4M78 E;  4M78 C;  4EMG A;  2DEQ A;  5GAN f;  2RD1 A;  3PGG A;  4Y91 A;  4EMK A;  4X9C A;  1JRI A;  4RCB A;  5LJ5 d;  5GAM e;  4WF2 A;  2HNI A;  3V8K A;  4A54 A;  4XU3 A;  5LJ5 j;  1JBM A;  4NL3 A;  4XTV A;  4DQ2 A;  3JCM b;  4XTU A;  2YLC A;  4EMK B;  1B34 B; 
#chains in the Genus database with same CATH topology
 2HSP A;  1X43 A;  5GMK i;  1KC8 R;  3I55 Q;  5GAM j;  2VVK A;  5FWB A;  4C8Q A;  3CD6 Q;  1YBY A;  1D3B B;  3VRY A;  1U06 A;  3G6E A;  3S3N A;  1VQ5 Q;  2ZPB B;  2EGE A;  1OOT A;  2DD5 A;  4PJO C;  3THK A;  3JAM E;  3MP6 A;  3RER A;  1NM7 A;  4BB7 A;  1RI0 A;  4FT4 A;  1VQ4 Q;  4HKE A;  4EMK C;  1RL2 A;  4C8Q D;  2DA9 A;  2OI3 A;  1D1B A;  5GAO r;  3PMI A;  3HP9 A;  1E6H A;  2KQW A;  2D1X A;  3CCQ A;  2PU9 B;  2EQI A;  5FRN A;  1G3Y A;  2KNB B;  3QWY A;  4C5I A;  3BY7 A;  2A36 A;  1I81 A;  4FW1 A;  5CKE A;  3CC7 A;  2R57 A;  4LUD A;  3OW2 P;  2EGA A;  3MO8 A;  3QXE B;  1N9S A;  3UDC A;  4IIO A;  2LQK A;  4B6M A;  3QII A;  1YJ9 A;  2F5K A;  1QWE A;  1T3S A;  3SWN B;  4ESR A;  4HCC A;  2OTJ Q;  4PLL A;  1NYF A;  4XU1 A;  2QQ9 A;  3QO3 A;  2VV5 A;  4R55 A;  3ULR B;  2RA2 A;  5FU6 C;  1O75 A;  1VYT A;  1BI3 A;  4CC4 B;  5GAM g;  3EG2 A;  1KK7 A;  1H3H A;  4J6X A;  3H8Z A;  1T0J A;  3CME T;  4OF1 A;  4J6W A;  2P4T A;  2HCK A;  3OYN A;  1XTD A;  5LJ5 d;  4RMO A;  4A54 A;  2ABL A;  2GF7 A;  1OEB A;  1BYM A;  4FCY A;  3REB B;  3FDR A;  1MHN A;  3HRT A;  4Z88 A;  1JXO A;  2O2O A;  3GOX A;  4PJL A;  1NPP A;  3DKM A;  3BFM A;  4E7I A;  3CBP A;  4M7A A;  1VQ8 T;  3JB9 I;  3SWN C;  5GMK h;  3C0C A;  2OAU A;  5IHK A;  4C92 E;  1NYG A;  1KQS S;  5FU7 B;  2EBP A;  1RLP C;  2DX1 A;  2L89 A;  1PSE A;  2YHT A;  1NJI U;  4F04 B;  3CCE T;  2CP6 A;  2BZX A;  4ZTJ A;  4C5G A;  2QEX A;  1B07 A;  1M2V A;  1UE9 A;  3M55 A;  5HKC A;  2Z0W A;  4PFO A;  4M77 G;  1J3T A;  2ZPG B;  3CXC S;  2EW3 A;  3LX7 A;  3S3M A;  4FYW B;  1QKW A;  4FW2 A;  4ZTF A;  2JMA A;  3G6E T;  3JB9 F;  4OGE A;  3CC2 A;  2CGH A;  4J5Y A;  1MNE A;  3UAT A;  2C06 A;  4PFP A;  2K5I A;  2L0A A;  1M8M A;  4JJC A;  2KEA A;  2RNA A;  3EG9 B;  2NUP A;  4ELY C;  1AZG B;  3PFS A;  3PNW C;  4JRP A;  3JCM P;  4L5G A;  1PD1 A;  1M3B A;  3M4Y A;  1Y96 A;  3QKJ A;  3UF4 A;  3QUI A;  2RH2 A;  3RMQ A;  5LJ5 h;  2PVD B;  3H6Z A;  3FRN A;  4HCB A;  3CCQ T;  1VQO A;  2JUF A;  2BTT A;  3UT1 A;  1W1F A;  2EWN A;  3AT1 B;  5KYU A;  1WQ7 A;  3MCA B;  3OYL A;  4KUD K;  1OPL A;  4JJB A;  4PKC C;  3OBW A;  3JCM V;  1RAB B;  4XU2 A;  3PT9 A;  2CP0 A;  3INZ A;  2O88 A;  2GGR A;  2DER A;  1T3L A;  4C8Q B;  1SF9 A;  2MIO A;  1QVF S;  3CMA A;  1X6G A;  2VAS A;  1WLP B;  1D0Y A;  1FMV A;  2LQ8 A;  1OV3 A;  3I56 T;  1SHF A;  1YJ9 T;  3CPW S;  2DJQ A;  1ZLM A;  3JCM b;  2JM8 A;  4RTT A;  2P0K A;  1I8F A;  3DLL A;  2EFI A;  2CZ6 B;  3HFN A;  5LJ3 h;  2KK4 A;  1BCM A;  3X24 B;  4C0D B;  3CCM T;  3VRZ A;  1VYV A;  1FYN A;  4M7D D;  2P84 A;  5KYY A;  3G7Z A;  1ZSZ A;  2J06 A;  1M1F A;  3M0P A;  5LJ5 f;  1KG1 A;  1RAF B;  1EFN A;  2QYZ A;  4AT1 B;  5C0M A;  3VS2 A;  2PUK B;  2KSS A;  3S6W A;  5GAO m;  3P8H A;  5EC7 A;  1QWF A;  4C8Q C;  2BIV A;  2EYZ A;  5CQX A;  4RTY A;  1E7O A;  2YUQ A;  5I11 A;  3CME Q;  1WXB A;  3I35 A;  3OYF A;  4VUB A;  4AFZ C;  3VS7 A;  1ARK A;  5GAN 7;  3I55 A;  1MMG A;  4CC7 A;  3A8M B;  1RAC B;  1BBZ A;  3JCM J;  2QTX A;  3PE0 A;  4JUV A;  3G71 A;  1GCP A;  1N27 A;  1VQ8 Q;  1VQ4 A;  5CR2 A;  3WVE B;  2M16 A;  1UGR B;  3HPW A;  1UHF A;  3RBB B;  3VS0 A;  4A4G A;  2VWF A;  3NMZ C;  5LJ3 f;  2K5L A;  2QEX T;  1SPK A;  1TUC A;  2DPP B;  2ED0 A;  1MMD A;  3CCE Q;  3H9N A;  5L8R E;  4RKU E;  4M75 D;  1Y57 A;  3OBY A;  3TEE A;  1UJY A;  3CC2 T;  2XDB A;  3KBG A;  2DAQ A;  3GBQ A;  5DLO A;  1E6G A;  2RJC A;  4BUG A;  2ECZ A;  4N4G A;  3CCU T;  3EFO A;  4WF2 A;  3HRU A;  3G6E Q;  5LJ5 j;  3RDV A;  2AT1 B;  4FYV B;  1JXM A;  1O9S A;  2CUD A;  2RI5 A;  1AHJ B;  1BCO A;  1UUE A;  2DIQ A;  4M77 F;  2RJE A;  1NEB A;  1M4Z A;  1RAI B;  1CSK A;  1VQO T;  3QG1 A;  1M2V B;  1GBQ A;  2JNG A;  3PMT A;  4QT7 A;  3V7S A;  4M7D G;  2XU8 A;  2DBK A;  2E5Q A;  2AZS A;  4OMQ A;  5GMK m;  4JLG A;  3CCQ Q;  3X28 B;  2MI6 A;  3I5R A;  1NLP C;  5HY6 A;  3J7A F;  5KH6 A;  4L6V 5;  3CMA T;  3DB4 A;  3JCM d;  1VQP T;  4PJO D;  3CC7 Q;  1K8A U;  3SHW A;  4F7U G;  1HXD A;  4QQD A;  4M7A C;  3ZFJ A;  2X4J A;  2W0Z A;  1Y07 A;  1PD0 A;  3EGD A;  3D7S B;  5IT9 E;  1Y96 B;  4E6R A;  2P0P A;  3I56 Q;  4JZ4 A;  4KH0 B;  4KUL A;  1YJ9 Q;  2ZPE B;  2EYX A;  1BB9 A;  4F14 A;  2RQT A;  3KXT A;  4QVC A;  5KYU B;  2FVU A;  1S72 A;  2AKK A;  3PIO A;  4BI8 B;  1PSF A;  1UJ0 A;  1SRM A;  2D0Q B;  2KXD A;  3EHR A;  1ACM B;  3PVL A;  4N4I A;  1HK9 A;  1JO8 A;  2KVQ G;  2XDP A;  4E7K A;  4M7D B;  1K8A R;  1H92 A;  2HBP A;  2KXC A;  5KCH A;  2HKQ B;  5LJ5 g;  5GAO l;  4J9E A;  4M75 G;  1R8O B;  3EGU A;  1SHG A;  3OYJ A;  2LTO A;  1K73 C;  1AEY A;  1X2Q A;  2EJ9 A;  4X1V A;  3GPL A;  2ROT A;  1UEC A;  1D1C A;  5KYY B;  3G71 T;  1YP5 A;  2GFU A;  2QQR A;  2X4W A;  1ZSZ B;  4XTU A;  1Q86 C;  2KT8 A;  2YLC A;  4JRQ A;  4DBQ A;  1K76 A;  3EG3 A;  3E9G A;  2CT3 A;  4E7J A;  1TWB A;  3C12 A;  4FIB A;  1KD1 R;  2NYS A;  4ZN3 A;  2RB6 A;  2E3H A;  2QEX Q;  3CPF A;  3EFS A;  4J9D A;  5LJ3 g;  1WJS A;  2HAX A;  4J9F A;  2K3Y A;  1WNL A;  3OYY A;  5KYW A;  3TSW A;  2FO0 A;  2DXC A;  3MEW A;  1F1B B;  3CBO A;  4PJO G;  1KD1 C;  1EIF A;  1Y71 A;  3VJP A;  3L42 A;  5EG2 A;  3CC2 Q;  5LL6 S;  3OSV A;  3CCJ A;  2RHY A;  3O8V A;  2K3X A;  3BE3 A;  4M75 B;  1U8R A;  4C5H A;  2AHJ B;  3CCU Q;  2LCL A;  1ZSZ C;  4K11 A;  1YJW T;  2XD0 A;  3QDR B;  2K3B A;  2VC8 A;  4J7F A;  4R56 A;  2JS0 A;  1WFW A;  1HYO A;  4LDX A;  1VQM T;  1YCY A;  2YWW A;  3REA B;  2LMJ A;  4F16 A;  3M57 A;  2DYB A;  1VQO Q;  2DD4 A;  2HQH A;  2LZ6 B;  3JCM f;  1M90 U;  4M78 A;  4JPB W;  5GMK l;  2FZG B;  2IIM A;  2CSI A;  2EIF A;  3LWI A;  3LGL A;  1VIF A;  1QCN A;  3QZ5 B;  5CQY A;  3ZEH A;  1I4K 1;  2HQX A;  3M56 A;  2DBM A;  2M9U A;  2LP5 A;  3CMA Q;  1VQP Q;  4E7Z A;  1SSH A;  4M78 D;  4RTV A;  1HSQ A;  2SEM A;  2M02 A;  1KFZ A;  2HD0 A;  4C0Z A;  4PJO B;  3P8D A;  2F2X A;  1S72 T;  2RD1 A;  4BD3 A;  3E2U A;  4M7D E;  4RCB A;  2EPD A;  5FRO A;  3E9F A;  1JJ2 P;  1WDX A;  2QAZ A;  2EQJ A;  4EMK B;  2EGC A;  1M90 R;  1W2B P;  3FJ5 A;  1UTI A;  4WCI A;  5FLX E;  5GMK e;  3FLG A;  4F7U F;  5CKH A;  4J83 A;  2DTO A;  3M9Q A;  2DIG A;  3SEM A;  3G4S T;  1ZUY A;  3CCE A;  2QA4 A;  2RPN A;  3EG0 A;  1VQ6 A;  4F7U E;  1YHQ A;  2KR3 A;  3JCM Q;  4RTX A;  3PIP A;  1SG5 A;  4JLI A;  2BUD A;  2X51 A;  4HVV A;  1G5V A;  5GAO n;  1NEG A;  4OMF B;  3QJ6 A;  4PJM A;  3OW2 S;  1WHH A;  1D1A A;  1TS9 A;  3RIR A;  2KY9 A;  3LYI A;  4BE2 A;  2E6N A;  2I2L A;  2HBW A;  4BY6 C;  1IHV A;  1RAD B;  4PLI A;  2E65 A;  4FSX A;  2CSQ A;  2P0Q A;  1PNJ A;  2YT6 A;  1N8R U;  3G71 Q;  4DOW A;  1KC8 C;  2F5T X;  3OYH A;  4A4E A;  1MMN A;  2LJ1 A;  1G2B A;  2A28 A;  1YIJ A;  5FU6 B;  4JS5 A;  3HFO A;  4OMM A;  5GAN d;  4M75 E;  2O31 A;  2JTE A;  3GIB A;  4WTO B;  1OU8 A;  2DVE A;  1VQN A;  1JJ2 A;  2GNC A;  3M54 A;  2OTL T;  1W2B A;  1Q7Y U;  4YTL A;  5FRM A;  5IXB A;  3CCJ T;  4MDX A;  1QMC A;  4CC3 A;  2M0Y A;  2OX7 A;  2YUN A;  3V8L A;  2XK0 A;  3VS1 A;  1N8R R;  3I56 A;  2AZV A;  2HEQ A;  2K57 A;  1X27 A;  2XIC A;  1MND A;  2FRY A;  1X75 C;  2CP3 A;  3ME9 A;  4LN2 A;  1R0B G;  2QAS A;  2G3R A;  3MPU B;  1JRI A;  2L3P A;  1JBM A;  4DQ2 A;  2CZ0 B;  3CCM A;  4FM4 B;  2WSE E;  1VQ9 T;  1PG5 B;  1BK2 A;  2ZGW A;  3MP8 A;  5KYW B;  2DLP A;  3TQ7 P;  2M0O A;  4ELZ C;  2JTM A;  3A8H B;  1WX6 A;  3KFV A;  3CCV A;  2LVM A;  4PJO E;  2BE7 D;  1Q7Y R;  3V7C A;  4PNO A;  1GCQ A;  1NLO C;  1QLY A;  5ECA A;  3CCR A;  2DMO A;  4J6Y A;  1OZ2 A;  2VGM A;  2RQR A;  1UB4 A;  1RAH B;  4C92 F;  1S1N A;  2DXB A;  2X9H A;  3RKY A;  2NWM A;  3R6N A;  2VXE A;  4DEX A;  3M0T A;  4CI0 C;  5CKF A;  1S72 Q;  4M78 B;  1H3Z A;  3QJY A;  1ZUK A;  4BE0 A;  1WZO A;  3VUZ A;  2E70 A;  3OYE A;  2JN0 A;  1VQ7 A;  1NPR A;  2M1H A;  2QA4 T;  1LJO A;  4C8Q G;  1VQ6 T;  1YHQ T;  4M7A D;  3LH5 A;  3ZBD A;  5GAN 2;  1Q82 U;  3G4S Q;  4NOY A;  2P4R A;  1RUW A;  4ME7 A;  2IG0 A;  4M4Z A;  2C0O A;  2GTO A;  2DL8 A;  1WHK A;  4OVA A;  2D8H A;  2QK0 A;  1HD3 A;  2CDT A;  8ATC B;  4KGV B;  3URG A;  2X3X D;  2EJG A;  3CCL A;  1G3W A;  1FMK A;  1WXU A;  3EFR A;  4N4H A;  4TVR A;  5GJW B;  3CCU A;  2NUT A;  4AFS C;  1JB0 E;  2ATC B;  3GP8 A;  1NJI R;  2FPF A;  1GL5 A;  4RTZ A;  4M78 C;  5GAN f;  4A63 B;  1YIJ T;  1Q82 R;  1VIE A;  2DL5 A;  4LXC A;  2XI9 A;  2R5A A;  1ZA2 B;  2B86 A;  2K6D A;  3VYG A;  2DK3 A;  3A1P A;  1VQN T;  1AD5 A;  2AKL A;  2XDD A;  1NJI C;  2E10 A;  4FT2 A;  2QI2 A;  1M30 A;  4C0F A;  4MZP A;  3WVD B;  4QW2 A;  1XJW B;  2PQW A;  2DRK A;  1VQP A;  2MK5 A;  4JRK A;  2OTL Q;  2LQN A;  3CCJ Q;  4PFZ A;  3VUB A;  2DRM A;  2RK1 A;  1I1J A;  1XOV A;  4ORZ A;  2Y4X A;  2DL4 A;  4DBH A;  4QVD A;  2BE9 B;  2QQA A;  2R58 A;  2YRV A;  4DEY A;  4J9I A;  2C0T A;  1AWJ A;  3NFC A;  1ZBJ A;  4IKF A;  1KJW A;  3CCV T;  4JDS A;  1Q81 U;  1AWW A;  1NZ9 A;  1VQ9 Q;  3QZ9 B;  2MWO A;  1IB8 A;  3CCR T;  1WXT A;  2RJF A;  5IAY A;  4NL2 A;  3X26 B;  5A2Q E;  1UGS B;  2AIR B;  3OQ5 A;  5GAN j;  4AFU C;  1AWO A;  1ZA1 B;  5CCA A;  2QGF B;  3HKS A;  2RHX A;  4A4F A;  2AK5 A;  2LCS A;  2ENM A;  4KGZ B;  1LPL A;  1GRI A;  3H0I A;  4OB3 B;  3CC4 A;  1I07 A;  2IPO B;  1AWX A;  2DVJ A;  1H64 1;  2LX9 A;  3QHS A;  2DO3 A;  1H8K A;  2DIL A;  2COY A;  1X69 A;  1VQ7 T;  3CQT A;  3CPW P;  1OU9 A;  4M77 C;  1Q81 R;  4XAX B;  1K1Z A;  4OML A;  4JZ3 A;  5GAM e;  5HK0 A;  1YIT T;  2JM9 A;  1WHM A;  5FWC A;  3NGP A;  3OS1 A;  4ZGJ B;  2QA4 Q;  2LNV A;  2MCN A;  4ANJ A;  1UEB A;  1VQ6 Q;  1YHQ Q;  3GNG A;  4RG8 A;  3OB9 A;  5GAN 5;  3V7R A;  2EVR A;  4DBF A;  3CCL T;  4M7A B;  1KIK A;  1FX7 A;  3OS2 A;  1Z9Q A;  4LE9 A;  3RKW A;  4A4K A;  2O01 E;  2RHI A;  2YSQ A;  2M51 A;  5D6X A;  3TU4 K;  5CIU A;  4C8Q E;  3NTH A;  4XQ3 A;  2RI2 A;  2DFU A;  1SRL A;  2J7I A;  1YJW A;  1K9A A;  4B9X A;  1KSW A;  1RAE B;  3OYD A;  3M0Q A;  1VQM A;  1GCQ C;  2V8I A;  4ZGE B;  2LRQ A;  4MML A;  2PVO B;  5GAN g;  2L3S A;  1VQL T;  1YIJ Q;  1BU1 A;  2VUB A;  2G6F X;  4R0K A;  2E6Z A;  1MUZ A;  2KRN A;  1QVF A;  2RF0 A;  2WSF E;  4UC4 A;  1K9M U;  1ZX6 A;  3FIF A;  5D7U A;  5KE3 A;  1C0M A;  1VQN Q;  3CPW A;  4OMO A;  3RMS A;  3M0R A;  1WGS A;  2NUP B;  3JCM W;  3NTI A;  2NUT B;  3VKI A;  1IHW A;  1JU5 C;  3CCS A;  1BIB A;  4E7L A;  2CZ1 B;  2FL7 A;  3OYM A;  1CKA A;  2OAW A;  4HCK A;  1IO6 A;  1TH7 A;  1QVG S;  3RUX A;  4XTY A;  3DB3 A;  2J05 A;  3QYG B;  2RMO A;  4AG2 C;  4BDZ A;  4RCC A;  1ABO A;  3EGX A;  4C92 A;  2BZY A;  2NUZ A;  3M4G A;  1TSF A;  2KMT A;  3CCM Q;  3I9Q A;  2DEU A;  4LD9 K;  4LDV A;  4CRI A;  1C1A A;  3M5A A;  4C0G A;  3PGG A;  2K79 A;  2CP7 A;  2HNI A;  1FXX A;  3CCV Q;  3G4S A;  2QQS A;  2D8J A;  1K0X A;  4DOV A;  1KQ2 A;  1X6B A;  5A0G A;  4AG1 C;  3CCR Q;  4C92 D;  1W70 A;  2V1Q A;  2L3Q A;  1RAA B;  2KRM A;  2O9S A;  3CC4 T;  2E4H A;  1MMA A;  4JJN K;  2JS2 A;  1M2O A;  4D6W A;  1K8A C;  1I5L A;  4D8K A;  4MZT A;  4GY5 A;  2ESW A;  1NE8 A;  3JCM h;  2V26 A;  4Z8A A;  1IGQ A;  1W4S A;  2DTI A;  7AT1 B;  3OY9 A;  1VQ7 Q;  4M7A E;  3OSS C;  2MPX C;  2X3W D;  3L1A A;  1NG2 A;  2D0N A;  1PRL C;  1YNZ A;  4KH1 B;  2ZPH B;  4OB2 B;  1OUL A;  2Y90 A;  2A0F B;  1YIT Q;  4II1 A;  1U5S A;  1Z9Z A;  3JB9 D;  2GQV A;  3JB9 J;  2ZPI B;  2FYK A;  2HL5 C;  2JJ9 A;  2L5Q A;  2H8H A;  4FYX B;  2OTL A;  2PUO B;  3CCL Q;  2YDL A;  3X20 B;  2BKD N;  1V29 B;  2ZCF B;  1KQ1 A;  2RJD A;  5KYX A;  4ZN1 A;  4L59 A;  2QTV A;  5KE2 A;  2DF6 A;  1AZE A;  1R77 A;  4J7I A;  3M59 A;  2DE0 X;  4N0A A;  4ATO A;  1Q95 G;  1MV3 A;  2W10 A;  2J6K A;  3L2Z A;  3RKX A;  1JJ2 S;  4GLM A;  5J3B A;  2H3J A;  1D0X A;  4XTX A;  1W2B S;  2PZ1 A;  3TSZ A;  4A4H A;  2HKN A;  2JTF A;  3BW1 A;  1VQ9 A;  2OTJ T;  4Y92 A;  1P92 A;  3TVT A;  4O5V A;  3LLR A;  3QDF A;  2X35 A;  3Q1J A;  3V8K A;  4C5E A;  4MZM A;  1PRM C;  2JXB A;  3EFO B;  5CAI A;  1UFF A;  2B8A A;  3JV3 A;  3CCS T;  1YWO A;  5CKD A;  2HDA A;  1M1K U;  4PK4 A;  1WHJ A;  3HTR A;  2JW4 A;  4M7D F;  2E5K A;  4FL6 A;  1MV0 B;  1QP3 A;  2FZK B;  4BI4 A;  3F70 A;  4BY6 B;  1QVP A;  3V8J A;  4V2S A;  4MDW A;  4J9B A;  2FPE A;  1OZ3 A;  1XNI A;  3JCM X;  2JOY A;  5GAO q;  1X2K A;  1BI2 A;  4HT8 A;  5GJV B;  4J8O A;  1JQQ A;  2DXT A;  3OYB A;  5GAN 8;  4XU0 A;  1M1G A;  1LVK A;  3HRS A;  1UG1 A;  2MAM A;  1I5O B;  1GBR A;  3QBY A;  2PNI A;  4Z02 A;  1GFC A;  3P8B B;  2HZY A;  4JRI A;  3SB2 A;  3L2W A;  1W6X A;  3X25 B;  3EGD B;  1M1K R;  2J6F A;  1M90 C;  5GAN 4;  3UWN A;  2CH4 A;  4Q5W A;  1D09 B;  3ER0 A;  2CZ7 B;  2F2W A;  3RNJ A;  2YRD A;  2FHD A;  3KUF A;  2L8D A;  4LDU A;  3DLM A;  1YWP A;  3LW5 E;  3E19 A;  1DJ7 B;  4RG2 A;  4PL6 A;  3EGX B;  4C92 B;  3CC4 Q;  1QW1 A;  5CVI A;  4O6J A;  1R0C B;  2O4X A;  2KBT A;  3JRZ A;  2JMC A;  1UHC A;  4BAC A;  3C4S A;  5KCO A;  5L23 A;  1FMW A;  2K5F A;  4IIM A;  4M75 F;  2RHU A;  3GNF B;  2VKN A;  2V8J A;  2KRS A;  4LD6 A;  4QQG A;  1RAG B;  2KI7 A;  2LT1 A;  2WSC E;  4EDU A;  4FSS A;  2FPD A;  2GCX A;  4M77 A;  5LJ5 e;  2E64 A;  5M9O A;  4X34 A;  1YFN A;  3L2V A;  3M0S A;  2RK2 A;  1NBE B;  1JEG A;  2I0N A;  1EX4 A;  4FU6 A;  2CYZ B;  1V1C A;  2KT1 A;  2F2V A;  4X9D A;  4E7S A;  4M77 D;  4F17 A;  3VS4 A;  1A0N B;  4M78 G;  1OX8 A;  2EYY A;  4C92 C;  4BE1 A;  1OYX A;  3MP1 A;  3VS6 A;  1U1T A;  3LGF A;  1X6O A;  2LC4 A;  2QG9 B;  3WXM B;  1SKU B;  1QCF A;  1YJW Q;  4OMP A;  5A0D A;  5CKB A;  2JVV A;  3VV0 A;  2K7A A;  4PJO F;  1M8V A;  1N8R C;  5LJ3 e;  1VQM Q;  1OI1 A;  1PM3 A;  5DM7 R;  3VS5 A;  2R5M A;  2A08 A;  2A3L A;  2HMA A;  3JCM g;  2PVG B;  3LH0 A;  4BI3 A;  4RTW A;  5DY9 A;  1WYX A;  5KYX B;  1AT1 B;  1VQK T;  3FEO A;  3JSC A;  1PHT A;  4LDW A;  3CCS Q;  5C6S A;  2ED1 A;  2CH4 W;  3UA6 A;  1YJN A;  2YUP A;  2ZAE A;  3RES A;  1Q7Y C;  2RQU A;  3LWH A;  1VUB A;  5GAN h;  2XKO C;  3A5Z B;  1ZSG A;  4PJJ A;  4J9C A;  3H0F A;  4E2F B;  2C0I A;  3L2U A;  3FJP A;  1LNX A;  1RI9 A;  2RO0 A;  2LJ3 A;  3EAE A;  1C6V X;  2SRC A;  2LNH B;  2RM4 A;  3MEV A;  1X01 A;  3BDL A;  3MKD A;  3OMG A;  3J80 E;  1N9R A;  1YIT A;  3BDU A;  2CT4 A;  2F1L A;  3OW2 A;  3SDZ A;  2MF2 A;  2DEQ A;  4KT0 E;  2GFA A;  4XU3 A;  4NS5 A;  4XTV A;  1SEM A;  3TCJ A;  5I22 A;  1IGU A;  1N6A A;  3HHT B;  1WIE A;  4OB1 B;  1N5Z A;  4N0A C;  4AMC A;  2QGG A;  2KAF A;  5LJ3 d;  1G3T A;  1XQH A;  2K2M A;  5D6Y A;  4GBQ A;  2L3R A;  2V8K A;  4OB0 B;  3A98 A;  4A53 A;  1KHI A;  2COZ A;  2DM1 A;  1MGQ A;  2KDS A;  3A8L B;  9ATC B;  1KQS P;  5AT1 B;  1UGV A;  2XMF A;  2EQK A;  4QKU A;  1TOV A;  1VQL A;  2QXF A;  1UDL A;  3JCM c;  3RR6 A;  5FU7 C;  3I5S A;  3OYC A;  3C95 A;  1TG0 A;  1Q82 C;  1ZQ1 A;  4AFQ C;  1IZ6 A;  3M58 A;  2FEI A;  1BIA A;  2O4X B;  2J6O A;  2D6F A;  2XG8 D;  4IUR A;  1UGP B;  3CXC P;  3H0H A;  4OP0 A;  3CC7 T;  1LCK A;  2FRW A;  3A8G B;  3SD4 A;  4EIK A;  4EPC A;  4XTZ A;  2DZ9 A;  5IHN A;  4DBR A;  2QQB A;  2DET A;  4M7D A;  4M77 B;  3L2R A;  4JS4 A;  1UGQ B;  3VS3 A;  3G1J A;  2E1H A;  1OQK A;  2DNU A;  1Y7X A;  3MJX A;  5J26 A;  1K4U S;  3OYG A;  2DYI A;  2HQE A;  2MOX A;  4M78 F;  4M7A G;  1GXI E;  3QWX X;  2DXU A;  2KRO A;  3GLX A;  4F7U A;  4M78 E;  1WA7 A;  1AOJ A;  1YJN T;  2D9T A;  3CEY A;  4QQ6 A;  1VQK Q;  1KQS A;  3EHQ A;  2KGT A;  2VXF A;  1KHC A;  1YI2 A;  3FC3 A;  1QVF P;  2MWP A;  3MEU A;  4D8D A;  2YUO A;  1M3A A;  4LDY A;  2LJ0 A;  3N5B B;  5GMK j;  2GBQ A;  1M27 C;  3EH2 A;  2X4X A;  4Y28 E;  1G3S A;  3AHU A;  1I0C A;  3CD6 A;  1VQ5 A;  4FYY B;  5AYF A;  3JCM e;  4P5N A;  5GAN 3;  3QPH A;  3CXC A;  3VU3 C;  1U1S A;  1M3C A;  2LCC A;  4C0D C;  4M75 A;  2V1R A;  2KYM A;  1Q81 C;  4HCZ A;  2EKH A;  1U3O A;  5CK9 A;  4XK8 E;  5FW9 A;  1QP2 A;  2K9G A;  1QQJ A;  1K0S A;  3E1S A;  4C8Q F;  5IH2 A;  2EAY A;  2LQW A;  3O5Z A;  4LUE A;  2GQI A;  1BI0 A;  2CP5 A;  2DL3 A;  2DKG A;  1RLQ C;  1PC0 A;  4ZNX A;  2EJF A;  3H41 A;  2LDM A;  1IRX A;  1WHL A;  1YCS B;  3NTK A;  3OYK A;  4HXJ A;  3VYH B;  5HK3 A;  1SSF A;  2L2P A;  3SFM A;  4XTW A;  5I2M A;  5GAN 6;  4BDY A;  1WPY A;  1PWT A;  4ZGD B;  4IUT A;  2OTJ A;  3OYA A;  4DA4 A;  1PKT A;  4PJO A;  1WI7 A;  2VYT A;  1WJQ A;  1ZUU A;  4J9G A;  4M77 E;  4KUI A;  4EMK A;  1HJD A;  1QKX A;  1PKS A;  4NL3 A;  1B7T A;  5J39 A;  2QDL A;  3IQL A;  2IVW A;  5GAM d;  3HL8 A;  1K73 U;  2XHC A;  2O9V A;  4MMK A;  3OYI A;  2WAC A;  3ZL7 C;  2DTH A;  5LJ3 j;  5IN1 A;  1Q86 U;  2JZ2 A;  2HL3 A;  2Y4Y A;  1EZZ B;  3PTA A;  4J9H A;  3EG1 A;  4RTU A;  5DLQ E;  1K9M R;  5D6W A;  4LNP A;  1B34 A;  2K4Y A;  1OX9 A;  4QVZ A;  4KRT A;  2A7Y A;  4HVU A;  2F69 A;  3T9N A;  1D3B A;  3M53 A;  3MET A;  4PJN A;  5GAO p;  2DZC A;  3EH1 A;  2K2V A;  1TUD A;  1K9M C;  3QYH B;  2XID A;  1YI2 T;  1K73 R;  1PCX A;  1WQW A;  1FWZ A;  1YJN Q;  1M5Q 1;  2MMP A;  1KD1 U;  2DL7 A;  2RQV A;  3A8O B;  1D0Z A;  1G8X A;  3JB9 H;  3UA7 A;  1AVZ C;  1Q86 R;  5HCK A;  2CUB A;  4M7A F;  4EMH A;  3I55 T;  1QCO A;  3CD6 T;  5KYN A;  2X4Y A;  1VQ5 T;  3NPF A;  3U23 A;  1VYU A;  4IUQ A;  3ASK A;  2LX7 A;  1QVG P;  2NLU A;  1ZBX A;  3HSB A;  2EYW A;  3OA6 A;  5I21 A;  4F7U B;  2CP2 A;  2EQU A;  4IUP A;  2E3I A;  1VQ4 T;  1LOJ A;  5GAM h;  3M0U A;  4KBM B;  3NHN A;  2EQM A;  2YLB A;  3SWN A;  3MHX A;  1TXQ A;  3TRE A;  1TUG B;  2KE9 A;  5IHI A;  1CKB A;  3UPU A;  4EMG A;  1VA7 A;  1Y0M A;  3S3O A;  2GTJ A;  2LT4 A;  3OMC A;  3PVQ A;  2RHZ A;  2CRE A;  4X9C A;  4M7D C;  1WJR A;  3OS0 A;  2CKK A;  4IUV A;  2A37 A;  2ROL A;  3QSU A;  4CC2 A;  4E47 A;  4IUU A;  4Z89 A;  1IRE B;  2RI3 A;  3GF5 A;  3R6O A;  2RQW A;  5CO7 A;  1ZHI A;  2QDY B;  1VQL Q;  2E41 A;  2VB6 A;  1GFD A;  4B9W A;  4OGC A;  3C94 A;  2FZC B;  4JJD A;  6AT1 B;  2H3E B;  4C92 G;  5GAM f;  1QVG A;  1OPK A;  1VQK A;  4HA8 A;  1T0H A;  4OMN A;  2FB7 A;  2FG0 A;  3OS5 A;  2KYB A;  1VOM A;  2DJZ A;  4HT9 A;  2YRC A;  1WHG A;  1TTH B;  3CME A;  3CBM A;  1ABQ A;  3L2Q A;  4KGX B;  2ZPF B;  5A0L A;  1BI1 A;  5GAN e;  2ZZD A;  1M9S A;  1TU0 B;  4RUG A;  4M75 C;  5I2S A;  1KC8 U;  1V76 A;  2RN8 A;  3FB9 A;  1VQ8 A;  1YN8 A;  4HVW A;  4GLK A;  3MEA A;  2HSE B;  3EG9 A;  5IXF A;  2OJ2 A;  3JB9 G;  2YXY A;  2BZ8 A;  2CS7 A;  2VGN A;  8AT1 B;  3J81 E;  4E7H A;  2EKO A;  1IXD A;  1B3Q A;  1YI2 Q;  2EYQ A;  2MYS A;  1M1K C;  4Y91 A;  2PTK A;  2COW A;  2E12 A;  1G83 A;  2JT4 A;  1BKB A;  1B34 B; 
#chains in the Genus database with same CATH homology
 2LNV A;  3TCJ A;  5GMK i;  1UEB A;  1N6A A;  3HHT B;  5GAM j;  4OB1 B;  3GNG A;  4N0A C;  4C8Q A;  1VQN A;  3E9G A;  2KAF A;  4RG8 A;  1YBY A;  4E7J A;  3C12 A;  1D3B B;  5LJ3 d;  3G6E A;  1G3T A;  3OB9 A;  3S3N A;  2ZPB B;  4FIB A;  1Q82 U;  2DD5 A;  4PJO C;  4ZN3 A;  5GAN 5;  3V7R A;  1XQH A;  2RB6 A;  3CCL T;  4M7A B;  3JAM E;  3MP6 A;  3CPF A;  3EFS A;  5D6Y A;  2L3R A;  2V8K A;  3RER A;  4OB0 B;  1FX7 A;  5LJ3 g;  4A53 A;  1KHI A;  1RI0 A;  4BB7 A;  1WJS A;  3OS2 A;  2HAX A;  4FT4 A;  3RKW A;  2K3Y A;  1WNL A;  4HKE A;  4A4K A;  4EMK C;  2O01 E;  2RHI A;  3OYY A;  1RL2 A;  5D6X A;  4C8Q D;  2DXC A;  1MGQ A;  2KDS A;  3A8L B;  3TU4 K;  3MEW A;  5GAO r;  3CBO A;  3PMI A;  3HP9 A;  2KQW A;  4PJO G;  3CCQ A;  1KD1 C;  1EIF A;  5CIU A;  2EQK A;  3NTH A;  4C8Q E;  1Y71 A;  2RI2 A;  4XQ3 A;  3L42 A;  5EG2 A;  3VJP A;  1VQL A;  2PU9 B;  2QXF A;  1YJW A;  3JCM c;  5LL6 S;  5FRN A;  1G3Y A;  3OSV A;  5FU7 C;  2RHY A;  3CCJ A;  4B9X A;  3O8V A;  2K3X A;  4C5I A;  3OYD A;  4M75 B;  3OYC A;  3BY7 A;  1VQM A;  1U8R A;  2V8I A;  4C5H A;  3C95 A;  4ZGE B;  1I81 A;  2AHJ B;  2LRQ A;  4MML A;  2LCL A;  5CKE A;  2PVO B;  3CC7 A;  2R57 A;  5GAN g;  1Q82 C;  1ZQ1 A;  1VQL T;  3MO8 A;  1IZ6 A;  2VUB A;  3M58 A;  3QXE B;  1YJW T;  1BIA A;  2XD0 A;  2E6Z A;  3QDR B;  1QVF A;  1N9S A;  2VC8 A;  2O4X B;  3UDC A;  4J7F A;  2D6F A;  4R56 A;  2XG8 D;  4IUR A;  2WSF E;  1UGP B;  4UC4 A;  4LDX A;  2LQK A;  1VQM T;  1YCY A;  1K9M U;  3QII A;  3FIF A;  4OP0 A;  3CC7 T;  5KE3 A;  3CPW A;  3M57 A;  1YJ9 A;  2DD4 A;  3RMS A;  3A8G B;  3SD4 A;  1WGS A;  2F5K A;  3JCM f;  3NTI A;  4EPC A;  3JCM W;  1M90 U;  3SWN B;  3VKI A;  4M78 A;  4XTZ A;  5GMK l;  2DZ9 A;  3CCS A;  4HCC A;  1BIB A;  2QQB A;  4M7D A;  4M77 B;  4PLL A;  4E7L A;  3L2R A;  2CZ1 B;  2EIF A;  2FL7 A;  3OYM A;  3LWI A;  3LGL A;  1VIF A;  4JS4 A;  1UGQ B;  1TH7 A;  3QZ5 B;  1QVG S;  4XU1 A;  2E1H A;  2QQ9 A;  3QO3 A;  5CQY A;  1I4K 1;  2HQX A;  3M56 A;  3ZEH A;  2M9U A;  2VV5 A;  3RUX A;  1Y7X A;  4XTY A;  4R55 A;  5J26 A;  3DB3 A;  3OYG A;  2HQE A;  4M78 F;  2RA2 A;  5FU6 C;  4M7A G;  1O75 A;  3QYG B;  1BI3 A;  4M78 D;  4BDZ A;  4RCC A;  1GXI E;  4C92 A;  5GAM g;  4J6X A;  2DXU A;  3H8Z A;  3CME T;  3GLX A;  3M4G A;  2KMT A;  2HD0 A;  4OF1 A;  4LD9 K;  4J6W A;  4C0Z A;  4F7U A;  4PJO B;  2P4T A;  3P8D A;  4LDV A;  4M78 E;  4CRI A;  1S72 T;  3M5A A;  2RD1 A;  4C0G A;  4BD3 A;  3OYN A;  1YJN T;  1XTD A;  2D9T A;  3PGG A;  5LJ5 d;  4RMO A;  4RCB A;  4M7D E;  4A54 A;  2HNI A;  3E9F A;  1FXX A;  3CEY A;  2GF7 A;  5FRO A;  1BYM A;  4QQ6 A;  3G4S A;  2EQJ A;  4EMK B;  2QQS A;  1KQS A;  3FDR A;  2VXF A;  4DOV A;  1KHC A;  1MHN A;  1YI2 A;  3FC3 A;  3HRT A;  5A0G A;  1KQ2 A;  2MWP A;  3MEU A;  4C92 D;  5FLX E;  5GMK e;  3FLG A;  4F7U F;  3GOX A;  1NPP A;  3DKM A;  5CKH A;  3BFM A;  4J83 A;  2DTO A;  3CBP A;  3M9Q A;  4E7I A;  2DIG A;  1VQ8 T;  4M7A A;  3JB9 I;  3SWN C;  5GMK h;  3G4S T;  4LDY A;  2OAU A;  4C92 E;  3N5B B;  3CCE A;  2QA4 A;  5GMK j;  1KQS S;  3CC4 T;  1VQ6 A;  5FU7 B;  4F7U E;  1YHQ A;  2X4X A;  4JJN K;  3JCM Q;  4Y28 E;  1G3S A;  4D6W A;  3AHU A;  2L89 A;  3CD6 A;  3PIP A;  1K8A C;  1VQ5 A;  1I5L A;  1PSE A;  2YHT A;  5AYF A;  4JLI A;  4MZT A;  3JCM e;  1NJI U;  2BUD A;  4P5N A;  5GAN 3;  3QPH A;  3CCE T;  4GY5 A;  3CXC A;  1G5V A;  4ZTJ A;  4C5G A;  2QEX A;  1NE8 A;  3JCM h;  5GAO n;  4OMF B;  3VU3 C;  3QJ6 A;  1U1S A;  3OW2 S;  3M55 A;  5HKC A;  2LCC A;  4C0D C;  1W4S A;  2DTI A;  3OY9 A;  4M75 A;  3RIR A;  2KY9 A;  4M77 G;  3LYI A;  4BE2 A;  4M7A E;  3OSS C;  1Q81 C;  2E6N A;  2I2L A;  2ZPG B;  4BY6 C;  4PLI A;  2E65 A;  3L1A A;  4HCZ A;  3CXC S;  3LX7 A;  4FSX A;  3S3M A;  5CK9 A;  4XK8 E;  2P0Q A;  1N8R U;  1QP2 A;  2ZPH B;  4OB2 B;  2Y90 A;  4ZTF A;  3G6E T;  4DOW A;  3JB9 F;  4II1 A;  4OGE A;  3CC2 A;  2CGH A;  3E1S A;  4J5Y A;  4C8Q F;  3JB9 D;  1KC8 C;  2EAY A;  2F5T X;  2GQV A;  3OYH A;  2C06 A;  3JB9 J;  2K5I A;  2ZPI B;  4A4E A;  2FYK A;  2L5Q A;  4ELY C;  1BI0 A;  3PFS A;  2DKG A;  3PNW C;  1YIJ A;  5FU6 B;  4JS5 A;  4JRP A;  3HFO A;  3JCM P;  4L5G A;  2OTL A;  5GAN d;  4M75 E;  3M4Y A;  2PUO B;  1Y96 A;  3QKJ A;  2EJF A;  3QUI A;  2RH2 A;  2LDM A;  2BKD N;  1V29 B;  3X20 B;  2ZCF B;  1KQ1 A;  3RMQ A;  5LJ5 h;  2PVD B;  2RJD A;  2DVE A;  3H6Z A;  3FRN A;  3NTK A;  4ZN1 A;  3OYK A;  1JJ2 A;  3VYH B;  5HK3 A;  4L59 A;  1SSF A;  3CCQ T;  4HCB A;  3M54 A;  1VQO A;  2JUF A;  5KE2 A;  3SFM A;  4XTW A;  3UT1 A;  2OTL T;  4J7I A;  1W2B A;  2EWN A;  4YTL A;  5I2M A;  1Q7Y U;  1WQ7 A;  3MCA B;  5GAN 6;  3OYL A;  4BDY A;  4KUD K;  5FRM A;  3M59 A;  1WPY A;  3CCJ T;  4MDX A;  4PKC C;  3OBW A;  4N0A A;  4IUT A;  3JCM V;  4XU2 A;  4ZGD B;  2OTJ A;  3V8L A;  2XK0 A;  3OYA A;  4ATO A;  3PT9 A;  3INZ A;  3I56 A;  3L2Z A;  3RKX A;  1JJ2 S;  4DA4 A;  4PJO A;  2K57 A;  5J3B A;  4C8Q B;  2H3J A;  2XIC A;  2VYT A;  1WJQ A;  4XTX A;  1W2B S;  1X75 C;  4A4H A;  4M77 E;  2JTF A;  1QVF S;  3BW1 A;  3ME9 A;  1VQ9 A;  3CMA A;  2OTJ T;  1P92 A;  4O5V A;  3LLR A;  4KUI A;  3I56 T;  4EMK A;  2LQ8 A;  2G3R A;  1JRI A;  2X35 A;  3Q1J A;  4NL3 A;  3V8K A;  1YJ9 T;  1JBM A;  5J39 A;  4C5E A;  3CPW S;  3JCM b;  4DQ2 A;  4MZM A;  2CZ0 B;  3CCM A;  4FM4 B;  2WSE E;  2P0K A;  2IVW A;  5CAI A;  1VQ9 T;  5GAM d;  1I8F A;  2B8A A;  3HL8 A;  2EFI A;  2ZGW A;  3DLL A;  3MP8 A;  2XHC A;  3CCS T;  1K73 U;  2CZ6 B;  4MMK A;  5CKD A;  2WAC A;  2M0O A;  4ELZ C;  3OYI A;  3HFN A;  5LJ3 h;  1M1K U;  2JTM A;  3A8H B;  2DTH A;  2KK4 A;  3X24 B;  4C0D B;  3CCV A;  2LVM A;  5LJ3 j;  4M7D F;  3CCM T;  5IN1 A;  4PJO E;  1Q86 U;  2JZ2 A;  2Y4Y A;  4PNO A;  3V7C A;  4FL6 A;  4BI4 A;  1QP3 A;  4M7D D;  3PTA A;  3F70 A;  4BY6 B;  1QVP A;  3V8J A;  4V2S A;  4MDW A;  3CCR A;  3G7Z A;  1OZ3 A;  1XNI A;  5DLQ E;  5D6W A;  3JCM X;  1M8V A;  4J6Y A;  1OZ2 A;  2VGM A;  1B34 A;  2JOY A;  1M1F A;  5GAO q;  1BI2 A;  2K4Y A;  4HT8 A;  1UB4 A;  5LJ5 f;  4QVZ A;  1KG1 A;  4J8O A;  2DXT A;  2A7Y A;  3OYB A;  2F69 A;  3T9N A;  1D3B A;  3M53 A;  4C92 F;  3MET A;  5C0M A;  5GAN 8;  2DXB A;  2PUK B;  4XU0 A;  5GAO p;  2KSS A;  1M1G A;  3S6W A;  5GAO m;  3HRS A;  3P8H A;  2DZC A;  3RKY A;  4C8Q C;  2K2V A;  2BIV A;  2MAM A;  5CQX A;  2VXE A;  3OYF A;  3QBY A;  4VUB A;  4Z02 A;  4CI0 C;  1K9M C;  5CKF A;  3P8B B;  3QYH B;  2XID A;  4JRI A;  5GAN 7;  3SB2 A;  4M78 B;  3I55 A;  3L2W A;  1WQW A;  3QJY A;  1YI2 T;  1FWZ A;  1H3Z A;  1M5Q 1;  2MMP A;  4BE0 A;  3X25 B;  1KD1 U;  3VUZ A;  2E70 A;  3OYE A;  2JN0 A;  1M90 C;  1VQ7 A;  3A8O B;  5GAN 4;  1NPR A;  3JB9 H;  3UWN A;  2M1H A;  3A8M B;  2QA4 T;  1LJO A;  4Q5W A;  3GIB A;  4C8Q G;  4M7A F;  4EMH A;  3JCM J;  3I55 T;  1VQ6 T;  1YHQ T;  4M7A D;  3ZBD A;  2QTX A;  3ER0 A;  4JUV A;  5GAN 2;  3G71 A;  2CZ7 B;  2X4Y A;  3CD6 T;  1VQ5 T;  1N27 A;  2FHD A;  3KUF A;  2L8D A;  4IUQ A;  4LDU A;  3ASK A;  3DLM A;  5CR2 A;  3WVE B;  1VQ4 A;  2M16 A;  1UGR B;  3HPW A;  3LW5 E;  4NOY A;  3E19 A;  2NLU A;  1DJ7 B;  1ZBX A;  4RG2 A;  4PL6 A;  4A4G A;  3HSB A;  4ME7 A;  4C92 B;  1QW1 A;  2QEX T;  5LJ3 f;  2K5L A;  2IG0 A;  5I21 A;  3OA6 A;  5CVI A;  4F7U B;  2DPP B;  4O6J A;  2EQU A;  4IUP A;  4OVA A;  2O4X A;  1VQ4 T;  1LOJ A;  3JRZ A;  3URG A;  5GAM h;  4BAC A;  2EJG A;  3CCL A;  3C4S A;  5KCO A;  4KBM B;  2K5F A;  4M75 F;  2RHU A;  1G3W A;  3GNF B;  3EFR A;  4N4H A;  4TVR A;  5L8R E;  4RKU E;  2EQM A;  2V8J A;  4M75 D;  3CCU A;  2YLB A;  3OBY A;  3SWN A;  4LD6 A;  3TEE A;  3MHX A;  4QQG A;  1JB0 E;  3TRE A;  3GP8 A;  3CC2 T;  2LT1 A;  2WSC E;  4EDU A;  2XDB A;  3KBG A;  2DAQ A;  4M77 A;  2GCX A;  5DLO A;  5LJ5 e;  2E64 A;  2RJC A;  4BUG A;  5M9O A;  4M78 C;  3UPU A;  4EMG A;  3S3O A;  4X34 A;  5GAN f;  2LT4 A;  3OMC A;  4N4G A;  3CCU T;  2RHZ A;  4X9C A;  4M7D C;  1WJR A;  4WF2 A;  3OS0 A;  2CKK A;  3HRU A;  4IUV A;  5LJ5 j;  3L2V A;  1YIJ T;  2RK2 A;  1VIE A;  2XI9 A;  2R5A A;  3QSU A;  4FU6 A;  2CYZ B;  1O9S A;  2DK3 A;  1AHJ B;  2RI5 A;  3VYG A;  2DIQ A;  4M77 F;  4E47 A;  2RJE A;  1VQN T;  1M4Z A;  4X9D A;  2XDD A;  4M77 D;  4IUU A;  1VQO T;  3QG1 A;  1NJI C;  2E10 A;  2JNG A;  4FT2 A;  4M78 G;  3PMT A;  1IRE B;  2QI2 A;  2RI3 A;  3GF5 A;  3R6O A;  4C92 C;  4C0F A;  4MZP A;  3WVD B;  3V7S A;  4BE1 A;  1OYX A;  2XU8 A;  4QW2 A;  3MP1 A;  4M7D G;  1U1T A;  2E5Q A;  3LGF A;  2PQW A;  5GMK m;  4JLG A;  1VQP A;  1X6O A;  2LC4 A;  5CO7 A;  1ZHI A;  3WXM B;  2QDY B;  4JRK A;  3X28 B;  2E41 A;  2MI6 A;  5A0D A;  5CKB A;  2JVV A;  5HY6 A;  4B9W A;  4OGC A;  3VV0 A;  3J7A F;  4PJO F;  3VUB A;  4L6V 5;  5KH6 A;  3C94 A;  3DB4 A;  5LJ3 e;  1N8R C;  3CMA T;  3JCM d;  2RK1 A;  1VQP T;  4PJO D;  1OI1 A;  4C92 G;  5GAM f;  5DM7 R;  1QVG A;  1XOV A;  1K8A U;  2R5M A;  2A3L A;  1HXD A;  2Y4X A;  4QQD A;  4F7U G;  3ZFJ A;  1VQK A;  2X4J A;  4QVD A;  4M7A C;  1Y07 A;  2QQA A;  2YRV A;  2R58 A;  3JCM g;  4HA8 A;  5IT9 E;  1Y96 B;  2FB7 A;  2PVG B;  3NFC A;  3LH0 A;  2P0P A;  4BI3 A;  3OS5 A;  2DJZ A;  4HT9 A;  4KUL A;  5DY9 A;  4IKF A;  2ZPE B;  3CCV T;  3CME A;  4JDS A;  1VQK T;  3CBM A;  1Q81 U;  3FEO A;  1NZ9 A;  3JSC A;  3L2Q A;  4LDW A;  3KXT A;  3QZ9 B;  4QVC A;  2MWO A;  2FVU A;  2ZPF B;  5C6S A;  1S72 A;  5A0L A;  3CCR T;  1BI1 A;  5GAN e;  1YJN A;  3PIO A;  2RJF A;  4BI8 B;  5IAY A;  4NL2 A;  2ZZD A;  3RES A;  1PSF A;  1M9S A;  1Q7Y C;  3X26 B;  5A2Q E;  1VUB A;  3LWH A;  2D0Q B;  5GAN h;  4M75 C;  1UGS B;  2XKO C;  5I2S A;  3OQ5 A;  1KC8 U;  5GAN j;  3A5Z B;  4N4I A;  1HK9 A;  3L2U A;  3FB9 A;  2KVQ G;  2XDP A;  5CCA A;  3HKS A;  4E7K A;  3FJP A;  2RHX A;  1LNX A;  2RO0 A;  4A4F A;  1VQ8 A;  4GLK A;  4M7D B;  3MEA A;  3EAE A;  2HBP A;  5KCH A;  3JB9 G;  4OB3 B;  3CC4 A;  5LJ5 g;  2RM4 A;  3MEV A;  5GAO l;  1H64 1;  1X01 A;  2LX9 A;  3QHS A;  2CS7 A;  3BDL A;  4M75 G;  1R8O B;  2DO3 A;  2VGN A;  3OMG A;  3J80 E;  1N9R A;  1YIT A;  3BDU A;  1VQ7 T;  3J81 E;  3OYJ A;  4E7H A;  2LTO A;  2EKO A;  1K73 C;  2EJ9 A;  4M77 C;  3OW2 A;  3SDZ A;  4XAX B;  2MF2 A;  2DEQ A;  4KT0 E;  3GPL A;  2EYQ A;  1M1K C;  2GFA A;  4Y91 A;  5GAM e;  2E12 A;  5HK0 A;  3G71 T;  4XU3 A;  1YIT T;  2GFU A;  2QQR A;  1BKB A;  2X4W A;  4NS5 A;  4XTV A;  4XTU A;  1Q86 C;  3OS1 A;  2YLC A;  4JRQ A;  4ZGJ B;  1B34 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...