4C92D

Crystal structure of the yeast lsm1-7 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
b'MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
total genus 19
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92D00
4C92F 5GAMd 4PJOB 2DVEA 4JRIA 5GAOq 3JCMJ 3L1AA 4M75G 3RKXA 1I8FA 1Y96A 5GAOm 4RCBA 1BIAA 4M75F 5GANf 4J6WA 1M5Q1 4C8QG 4M77D 3VU3C 2RB6A 4F7UE 5GAN6 5LJ5g 4M78D 4M7AB 4MMKA 5LJ5h 1D3BB 4J6XA 4XU0A 4PJOE 3EFRA 2EJFA 2DZCA 4N0AA 1N9SA 4XTXA 5GAOn 4M7DB 1JBMA 3BFMA 4M7DC 4PJOD 2E10A 1JRIA 2E64A 2RD1A 3EFSA 4NL2A 5GAMe 3FB9A 2RA2A 3BDUA 3JCMX 4JUVA 4PNOA 2E1HA 3JCMd 4HA8A 3SWNC 5LJ5f 5DY9A 5GMKl 4M7AA 4C92B 4XU1A 5GMKj 4QVDA 3JCMW 2EWNA 4DQ2A 1I5LA 5GANj 2ZGWA 4M7DE 4V2SA 5GAMh 4C8QD 3JCMQ 2DJZA 4M7DD 3QHSA 4M78G 5GAMj 4M77G 5LJ3g 5GANd 4F7UG 5GAN2 2JN0A 4C8QE 4OP0A 1KQ2A 1I4K1 4EMKC 3JCMV 3V8LA 2E41A 1LOJA 2EAYA 2YLBA 4M75D 3V8KA 1LNXA 2DTHA 4XTZA 3PGGA 4EMHA 4QVCA 3HSBA 4HT9A 2Y90A 2DXUA 2EJGA 2RM4A 5GMKi 1YCYA 2DKGA 5LJ3h 4XTYA 4M77A 4WF2A 4C8QB 5I21A 4M7DF 1LJOA 5GAN4 3JCMh 3JB9J 3JB9F 4XU2A 5LJ5d 4C92A 3GIBA 4M7AC 2DTOA 5GAOl 1KQ1A 5GAN8 5LJ3e 2DZ9A 4HT8A 3QSUA 1B34A 1I81A 5GAOr 4XTVA 3SWNA 1Y96B 2DXTA 4M7AE 1U1SA 1B34B 2E65A 4JLIA 3V7CA 3JCMe 5GANh 3JB9H 3BY7A 4M77B 4C8QF 1HK9A 1M8VA 4X9CA 2CGHA 4M78B 3AHUA 4M7AD 3HFOA 4A53A 2EJ9A 1WQWA 2DEQA 2HNIA 3FIFA 2VXEA 4MMLA 2K57A 4EMGA 2I2LA 3FJPA 4XTUA 3INZA 5CAIA 2FYKA 3M4GA 4RCCA 4EMKA 5GANe 4C92C 3QUIA 2VXFA 4F7UB 4C8QC 3RERA 4M78A 3L2ZA 4XQ3A 5LJ3d 4M77E 2YLCA 5GMKm 3V8JA 4M78E 3JCMc 1WPYA 4JRKA 4XU3A 1HXDA 4C8QA 4C92G 4M78C 3V7SA 5GAN7 3RESA 4M7DG 3RKYA 4M77C 3JCMg 4PJOA 4EMKB 3JB9D 1WQ7A 2FB7A 2QTXA 5GAMf 3JB9I 5GMKe 5LJ3j 4PJOC 1MGQA 4F7UF 4A54A 3V7RA 4M77F 3JB9G 4M78F 1H641 3JCMP 3BW1A 4Y91A 5GANg 4M75B 5GAN3 4N0AC 4J5YA 4PJOG 3SWNB 4M7DA 2YHTA 4M7AG 1N9RA 4M7AF 4C92E 4PJOF 4X9DA 3RIRA 5GAN5 5LJ5e 3HFNA 4XTWA 4C92D 1WNLA 4M75A 4NOYA 5LJ3f 5GAOp 3RKWA 4M75E 4F7UA 3RUXA 3QO3A 1X01A 2VC8A 5GMKh 4J6YA 4NL3A 3JCMf 3JCMb 4M75C 1U1TA 1D3BA 1BIBA 3SB2A 2DTIA 5GAMg 5LJ5j 1TH7A
chains in the Genus database with same CATH superfamily
1IREB 2P0KA 3EH1A 1AWJA 2M16A 5FROA 1GRIA 3J80E 3C95A 3QKJA 1VIEA 3DLLA 2EVRA 1S72Q 2L8DA 3VU3C 4FYVB 1Q86U 1GFDA 1VQMQ 3OYAA 1ZBJA 1M9SA 2E6NA 3CBMA 5GAOn 1QVFS 3CCMA 1M1FA 2E64A 4RUGA 4AG2C 2X3WD 3OYEA 2E6ZA 4FT2A 1N6AA 4M7AA 5GMKj 1Q81C 1YJNT 3EH2A 4OGCA 4M78G 2A37A 3OA6A 2DE0X 2L2PA 3V8LA 3EG9B 3JCMX 2YLBA 4XTZA 3RNJA 2RMOA 5I21A 4M77A 3RR6A 1RAIB 1ZA2B 1BI0A 5FU7B 5GAOl 3CPWA 1WHGA 3NPFA 1H3HA 2FZCB 1TTHB 2CGHA 4M7AD 1SG5A 3VRZA 4IIOA 5GANe 1D09B 3VRYA 2XDBA 1S1NA 4LNPA 2EYZA 1X6BA 3TSZA 1VYVA 3LH0A 4GLMA 1YI2Q 3OS5A 3OYNA 3RKYA 3CXCS 2FB7A 5D6WA 3JB9I 4E7JA 5GMKe 3G4SQ 4F7UF 4Z89A 3MCAB 3OYCA 1W1FA 1ABOA 1SSFA 2YHTA 5IH2A 4L5GA 4BY6B 3MO8A 2CP2A 1G5VA 4GY5A 2HEQA 2RI3A 1KK7A 5GAOp 2LDMA 1TG0A 1VQ9T 4F7UA 4OMMA 2SEMA 2EQIA 1VQ5T 4PFOA 1Q7YU 2EYXA 3HRUA 5LJ5j 4QQDA 4DEXA 4Z88A 2RHIA 2O01E 1YBYA 1I07A 3EHQA 4F7UE 2RB6A 2C0OA 2KRSA 3UPUA 1DJ7B 1Q81R 1WX6A 1N8RR 2EIFA 3E2UA 4MDXA 3X20B 3BDUA 1BKBA 2RQWA 2CREA 4EIKA 4CC2A 4ANJA 1K4US 1VQ7T 3QXEB 1XOVA 3TU4K 3NTHA 2DNUA 2JN0A 3VKIA 1LNXA 2YUOA 2ZZDA 1YJNQ 2RM4A 2NWMA 5KE2A 4JJBA 1GXIE 1R8OB 3OY9A 1M1KC 4E2FB 1B34A 1M90C 3MEAA 3V7CA 2D9TA 1UTIA 4ZTJA 3ZL7C 4BE2A 3P8HA 4HXJA 3BDLA 5HKCA 2R57A 3H8ZA 4HCCA 3INZA 1X2KA 4C92C 5HK0A 2J05A 1G3YA 3L2ZA 2XICA 1VQ4Q 2MPXC 3QZ9B 2JOYA 2RQRA 4KH0B 2JT4A 1W2BP 1ZSZB 4EMKB 1SRLA 1OPKA 2ATCB 4CC7A 2D8JA 2IG0A 3VS6A 3CCRQ 1YITA 2DILA 5LJ3j 5J26A 3QIIA 2V8IA 3NTIA 2COWA 1M3CA 2X4XA 2EQUA 1XTDA 2EBPA 4DEYA 5AYFA 2K4YA 2KGTA 4J83A 4A4FA 3RMQA 3RKWA 3I9QA 3JCMf 2JM8A 1NEBA 2BZXA 2J06A 4C0GA 1MMDA 3C0CA 3DB4A 3WXMB 1Q82C 2P0QA 4KUIA 4OMNA 3JCMJ 4M75G 4BACA 5GAOm 1RABB 3I35A 1KQSA 3GF5A 1M5Q1 4J6WA 5C0MA 5GAN6 2OTJA 3NGPA 3ULRB 4HVVA 3CMAA 1VQ4T 3SHWA 3X28B 3S6WA 1KJWA 3JCMd 5DY9A 8AT1B 3QDFA 4C5IA 1PRLC 1ZSZA 2DL7A 2WSCE 5GAMh 3G71A 1F1BB 2LX7A 2DL4A 3CCUQ 1K0SA 1OZ2A 2DRMA 4RTZA 3J7AF 4AFZC 4DBHA 1M1KR 2DL5A 1VQ8A 3UATA 2DYIA 2K6DA 2LC4A 4Y28E 3F70A 3PVQA 2OTLT 2GTJA 1VIFA 4J7IA 4XTVA 1VQ8T 1S72A 4QKUA 4KULA 3M0UA 2KR3A 2DEQA 4PFZA 3FIFA 3RMSA 3HRSA 2JJ9A 3JCMc 2EKOA 2D0QB 4XU3A 4BY6C 1NE8A 3UT1A 2K79A 3RBBB 3V7SA 5GAN7 2DBMA 2RHZA 5KH6A 2OTJQ 3JB9D 3OQ5A 1V1CA 1VQPQ 2ROLA 3P8DA 3NMZC 3JB9G 1QQJA 2EGAA 2K2VA 3CQTA 4J9FA 1Q82R 3CXCP 3M56A 4FIBA 2X3XD 2CT3A 1YHQA 4J9IA 1EFNA 3G4SA 4LXCA 3QG1A 4C92F 2HD0A 2JTMA 2RF0A 2RO0A 4DOVA 4D8DA 1WHLA 1IRXA 1FMKA 4MMKA 1AZGB 2MYSA 4PJOD 1JU5C 2Y4XA 5KYUA 2F2WA 1Z9ZA 3CCUA 3UF4A 2OTJT 3TSWA 5FRMA 1O9SA 3QHSA 4IIMA 2FVUA 2RNAA 1YJ9T 5GANd 1OQKA 1VQKT 1KQ2A 1D0ZA 2Z0WA 2DBKA 4C0DB 3THKA 2XI9A 3E19A 2QDYB 1KD1R 2KRMA 5IXFA 1YIJT 2LT4A 3KFVA 3I55Q 3JB9J 1TSFA 4JLGA 2CP7A 3X24B 3OYDA 1GFCA 5CKHA 1TOVA 1SHGA 2CSIA 3EG3A 2CS7A 1Y71A 3A8OB 1N27A 1WQWA 2YSQA 3I56Q 3N5BB 4PJJA 3M4GA 3M0TA 4EMKA 5L8RE 4F7UB 3ASKA 2RH2A 1E7OA 2KMTA 2V1RA 1WLPB 3TQ7P 2V8KA 4C92G 1RADB 3ME9A 1RAGB 2B8AA 4D6WA 2QTXA 4RTUA 2VGMA 4J7FA 2G3RA 5I2SA 1D0YA 5GAN3 1N9RA 3CCVQ 1OU8A 3CD6A 1XNIA 4O6JA 2DXBA 5C6SA 2FRYA 3AT1B 5CKBA 1I5OB 1M4ZA 1NPRA 4RTWA 1B34B 3E9FA 1QKXA 2ZPFB 1VQ6Q 3O5ZA 2DVEA 2CZ1B 2QG9B 3VS5A 4NS5A 4OMOA 1V76A 4C8QG 3LWIA 2NUZA 1E6GA 2VV5A 2O2OA 5LJ5h 3CD6T 2HL5C 4XU0A 2COZA 1JBMA 1YP5A 4PJLA 2FL7A 3UA7A 5FW9A 4JUVA 5D7UA 2E1HA 1NZ9A 1X6GA 3I56A 2CUDA 1WJRA 3JCMW 3M58A 5CIUA 4D8KA 6AT1B 2XDPA 2NUPA 2CYZB 1SPKA 1QP3A 2Y4YA 3HSBA 3VS1A 2F1LA 1K8AC 3H0IA 4RTVA 1UGQB 1AT1B 3UDCA 2CZ6B 2JMAA 4QVZA 5CQYA 4LDXA 2PUOB 3GIBA 2EGCA 4A4EA 4AFQC 1UB4A 3OMCA 5CK9A 2CH4A 3EG2A 2P4RA 1TU0B 1UFFA 4IKFA 4BDYA 4KRTA 1M2OA 3O8VA 3E9GA 3QUIA 4HCZA 2O4XA 3V8JA 1B7TA 2J6KA 3QPHA 4PJOA 1MV3A 1ZSZC 2RK1A 3OW2A 1HJDA 2BKDN 3CCQA 3JSCA 1S72T 4N0AC 3A8MB 3WVDB 1ZUYA 4L6V5 2RJCA 1M3BA 5GJWB 3KXTA 4PJOF 2PNIA 2M0YA 2XMFA 2LP5A 2LMJA 3HFNA 3I5RA 2CT4A 1RI9A 2KSSA 1X01A 2VASA 2DEUA 5CO7A 1BIBA 2M1HA 3TREA 3VS0A 1UEBA 5ECAA 3L1AA 1JEGA 2DERA 2ABLA 1BIAA 1MMAA 4M77D 3PT9A 1M1KU 4C0FA 3MP1A 4K11A 4OMLA 1K0XA 1WZOA 2CSQA 2F2XA 4PNOA 3PIOA 5LJ5f 4KGXB 1K9MU 1B07A 5I22A 4A4GA 5IHKA 4DQ2A 2LJ0A 4V2SA 2L3QA 3M5AA 3JCMQ 2FO0A 2D6FA 1FXXA 1QVGS 1G83A 1VQLQ 5FU6C 4LDYA 4M75D 1IGQA 1ZUKA 1NLOC 1VQ5Q 4PLIA 2KROA 4JRPA 4CRIA 1NLPC 3R6OA 4C5GA 4C8QB 1WYXA 2RJDA 2A36A 1KC8U 5KYWB 3CCRA 1YITQ 3OS0A 4M7AC 1BU1A 1ZA1B 1GBQA 4JJDA 2L0AA 5GAOr 3CCST 2OX7A 4LN2A 1QVGA 1IB8A 2AZSA 5IN1A 1EX4A 1YITT 2YUQA 1OZ3A 3JAME 2FYKA 1D0XA 1T0JA 1V29B 4KBMB 3RERA 1VQ9Q 2K5FA 4JRKA 1Q86C 3CCQQ 1UGSB 2PU9B 2EGEA 4C5HA 2WSFE 4HCKA 2FG0A 2H3EB 1K76A 1MGQA 1T0HA 3A8HB 2LVMA 3V7RA 5A0LA 1HYOA 5GANg 2VYTA 4M7AG 1AVZC 4RTYA 4XTWA 4C92D 1WNLA 1SRMA 2A7YA 2LCCA 2QQBA 1K73U 2CDTA 2GNCA 2F69A 4WTOB 1TH7A 1RAFB 2RD1A 4YTLA 1FMWA 4A63B 2QA4A 2E3HA 2QGGA 3CPWP 1MV0B 3CCVA 4OGEA 3C4SA 5A2QE 2QQ9A 4M7AB 1KG1A 4PJOE 1WXBA 1D1CA 1YN8A 2XU8A 2AKKA 2GF7A 3LYIA 3SWNC 4E7KA 1LPLA 4XU1A 3CCJT 4C8QD 1SF9A 1TWBA 4BUGA 1YNZA 4JJNK 4IUVA 4N4GA 1I4K1 4FSSA 2E41A 2FEIA 4X1VA 1BCOA 5KYYA 3VS2A 4JDSA 3H0FA 1QW1A 4FT4A 3CPWS 1KQSS 1OULA 1RLQC 2DPPB 2HL3A 2P0PA 4BD3A 9ATCB 2RQUA 5LJ5d 3OYYA 1ACMB 1I81A 1VQ6A 2D1XA 2JW4A 2OAWA 2QQSA 3CC2T 1P92A 1QVFP 2DFUA 1WXUA 3VJPA 2PTKA 2XIDA 2I2LA 4JZ4A 1ZSGA 3VV0A 2RK2A 5GMKm 3QZ5B 1BI3A 1KQSP 1VQ7A 4Q5WA 2CKKA 2LT1A 2DO3A 3GNFB 4A54A 3MKDA 3CCET 3OSVA 1H641 4J9HA 4CC3A 2ZPBB 4M7AF 2JTFA 1KD1U 2LTOA 3HTRA 4KUDK 1N8RU 1QVGP 1VQPT 3OBYA 4A4HA 2RQVA 3VUZA 1K9MR 4XK8E 4OB2B 1TS9A 2BE9B 3HKSA 4QQ6A 4RCBA 1QLYA 3ZBDA 2F5TX 4PJMA 3EGDA 1PSFA 3QJYA 1X43A 4LDVA 2KQWA 4N0AA 1N9SA 4M7DC 2O4XB 2E10A 4NL2A 1KSWA 2DMOA 2P84A 5D6YA 4AT1B 3CXCA 2AZVA 1SKUB 3REBB 4LDUA 3EG1A 1X75C 5DLQE 1M2VB 2QA4T 3G7ZA 4EMHA 2ZPGB 4LDWA 3MEVA 3CCJQ 2L5QA 5LJ3h 1AWOA 1AWXA 2QASA 1NBEB 4XU2A 3CMEA 3PMIA 2DTOA 1VQ5A 5GAN8 4KGVB 2HKQB 5CQXA 4M7AE 3JV3A 1WI7A 1K8AU 4M77B 1QMCA 2QI2A 4RG8A 2DD4A 4R0KA 1M27C 1OI1A 1UGVA 2QDLA 2JUFA 2R58A 3OW2P 2R5AA 1QCFA 1UGPB 5KCOA 3M54A 1Y7XA 2C0TA 4M7DG 2RHXA 1H3ZA 3EGXA 1UHCA 1M2VA 1GCQA 1VYTA 3CC4T 4XAXB 2KK4A 1ZLMA 1VQLA 2RHUA 1OV3A 4PJOG 2JVVA 3L2WA 1RAHB 4LUDA 2CP5A 2LX9A 1ABQA 2HSPA 3L2UA 2RPNA 1VQKQ 2CZ0B 2F2VA 1M3AA 4ELZC 3M55A 2O9VA 5GAMg 3A98A 3WVEB 4LD9K 3CCLT 2OI3A 2LRQA 3EFOA 3OBWA 1VQOQ 2V8JA 1ZHIA 4XTXA 1JRIA 2QEXA 2VB6A 3CCLQ 4II1A 1YJNA 1TUGB 2R5MA 2YRVA 3M4YA 1QP2A 1HSQA 1TUCA 7AT1B 4BI3A 2L3PA 1MUZA 2W0ZA 1GBRA 4F7UG 2KYMA 1KIKA 4ZGDB 1YCYA 3A5ZB 2DXCA 4RMOA 2J7IA 1LJOA 1YFNA 2K3BA 2KXCA 1NYGA 4OB0B 1YI2T 1A0NB 3MP6A 5LJ3e 2K5LA 4OB3B 1M8MA 4JLIA 3EFOB 1WA7A 5GJVB 5GANh 4A4KA 4M78B 4Z8AA 2E5QA 2YWWA 3M53A 1I1JA 2X4YA 4N4IA 5FWCA 4XTUA 4HVWA 4OVAA 3QBYA 3PMTA 1G3TA 1B3QA 4M78E 4MZTA 4ME7A 2PVDB 3FJ5A 4JPBW 1VQ4A 1KC8R 1QVPA 4M77C 4AG1C 4ATOA 3NTKA 3MHXA 2E70A 2L89A 4FYWB 3CC2A 2VVKA 2JNGA 4R55A 1Q86R 3FC3A 1Q82U 2XD0A 2HKNA 3DLMA 2IIMA 3M0SA 4C92E 5IHIA 2LCLA 1NG2A 2IVWA 2YUPA 5GMKh 1PD1A 4NL3A 2AHJB 3JCMb 1D1AA 1D3BA 2KE9A 1QCNA 1UJ0A 1U8RA 1LVKA 3H9NA 1UHFA 1H8KA 3RKXA 4JZ3A 2LCSA 4J8OA 4EDUA 2JM9A 4Z02A 2X9HA 1JXOA 1VUBA 4M7DB 2NUTA 3QDRB 3MPUB 2GFUA 3EFSA 3CCQT 2PZ1A 4HA8A 3G6EA 2I0NA 3LLRA 3VYHB 1VQOT 5GANj 1G3SA 2CH4W 4M77G 5LJ3g 5GAN2 4J9BA 1E6HA 1M1GA 1YWOA 2D8HA 2NYSA 1JJ2A 2DK3A 4C92A 1IZ6A 2GGRA 2A08A 1BB9A 3CC2Q 1EZZB 2GQIA 2O88A 3SEMA 1RUWA 4BE1A 4R56A 3OS2A 5FWBA 1FX7A 2G6FX 4LE9A 5HCKA 4JJCA 3QSUA 2LJ1A 1IO6A 1NM7A 2O31A 5KYWA 4J9CA 4EMGA 2FPDA 3FJPA 1AD5A 3DB3A 3Q1JA 3CCEA 2X4WA 5LJ3d 4ZN1A 1RL2A 2LQWA 1X27A 3CCUT 2HMAA 2ZPIB 3RESA 3LX7A 2MWOA 3FDRA 3OYKA 1WXTA 2JZ2A 1I0CA 4M77F 2YUNA 4PFPA 3BW1A 4M75B 3GBQA 3OYHA 3BE3A 1OX8A 1FWZA 1RI0A 3M9QA 3CEYA 3MEUA 4JRQA 1C1AA 4NOYA 2KT8A 2QAZA 1U3OA 4M75C 4OMQA 4RTTA 1YHQQ 4F17A 1K9MC 1N8RC 3REAB 4ZNXA 4DOWA 4J9EA 1D3BB 3C94A 1RACB 4DBRA 3VS4A 3JRZA 3NHNA 2GCXA 4FSXA 1WJQA 3QYHB 2HSEB 3FB9A 3CCJA 2DL8A 1W70A 4FM4B 3MP8A 1D1BA 2W10A 1VA7A 2ED0A 1I5LA 2ZGWA 4PKCC 2M0OA 1KC8C 3CCMT 4M7DD 1Z9QA 3CCSQ 2CUBA 4OMFB 4E47A 3D7SB 1CKAA 3X26B 3CCVT 2EJGA 3CCLA 2OTLA 2DKGA 1OX9A 2M9UA 3L2RA 2RHYA 5KCHA 1RAEB 1KD1C 4UC4A 1ZQ1A 2DZ9A 3LW5E 1J3TA 4ZN3A 1PRMC 2J6OA 1VYUA 2EQKA 1Y96B 1U1SA 2FRWA 4BI8B 3JB9H 5KYNA 1PHTA 3CCEQ 2XKOC 3G71Q 3ER0A 2EJ9A 3CPFA 2HNIA 4FW1A 2IPOB 2A28A 4M78A 1PKSA 5CKDA 1GCPA 1YJ9A 1BI1A 2JS0A 4HKEA 1WHMA 1SSHA 1FYNA 4OB1B 3L2QA 4M78F 5KE3A 1JXMA 1PCXA 2DLPA 1C6VX 1OYXA 1PKTA 2HAXA 2VUBA 5LJ3f 3OYGA 5IHNA 3CCSA 2JXBA 3G1JA 3QWYA 4L59A 4BE0A 1NJIR 2DD5A 2F5KA 2MCNA 2AIRB 1IGUA 2OAUA 2QK0A 1I8FA 5FRNA 4IURA 3OYLA 2K9GA 3PIPA 2ECZA 2L3RA 1ZX6A 3G71T 1BCMA 2HQHA 4J6XA 3CC4A 2BTTA 1WHJA 1OEBA 4F16A 3BFMA 5M9OA 1WIEA 1PNJA 1EIFA 5A0GA 2H3JA 1BK2A 2ZAEA 2BUDA 4C92B 3KBGA 2DETA 2EWNA 8ATCB 2K2MA 1OOTA 1YCSB 3OYBA 3DKMA 4ELYC 5FU7C 1MNEA 5CCAA 2HCKA 1R77A 3PTAA 4EMKC 2DVJA 3V8KA 3CMAQ 3PGGA 2YT6A 1BI2A 4DA4A 1OU9A 4QW2A 2XDDA 3HP9A 5GMKi 3QYGB 4TVRA 4BB7A 3CMET 5GAN4 3GPLA 4HT8A 2PQWA 3ZFJA 2VGNA 2E65A 2LQ8A 3BY7A 1O75A 3EG0A 4O5VA 4ORZA 4J9DA 1VQNQ 1Q95G 2VXEA 2MWPA 1YJWQ 2NUTB 2X4JA 3SDZA 2HBPA 4FL6A 4HVUA 4M77E 2GTOA 2KT1A 1WPYA 2J6FA 3OW2S 3SFMA 2C06A 4C0ZA 4PL6A 2YXYA 3C12A 3CBPA 2KDSA 2AT1B 3I55A 3SD4A 4QQGA 2FPFA 2MK5A 2JTEA 4OF1A 4Y91A 2LQNA 3CC7A 2KY9A 2RQTA 1R0CB 2BZYA 1C0MA 2ENMA 2LQKA 1W4SA 2P4TA 1SEMA 4PJNA 5KYUB 4ZGEB 4P5NA 1N5ZA 1K73R 4M75E 4E7ZA 1FMVA 2EKHA 3QO3A 4F04B 2VC8A 1NEGA 2RJEA 4C5EA 2ED1A 1VQPA 2WACA 4E7HA 5EC7A 1X6OA 2BIVA 4B9XA 3G6EQ 4PJOB 3M0PA 5L23A 4B6MA 1AHJB 2EYQA 1KFZA 4FYXB 1RAAB 4IUQA 2JMCA 2LNHB 1VQOA 4GBQA 2EFIA 1OPLA 2B86A 1VQMA 2EJFA 3OYIA 1WJSA 3G6ET 4ZTFA 1G2BA 2MI6A 2O9SA 1SHFA 2KNBB 3I56T 3FRNA 2QYZA 3EG9A 1NJIU 4HCBA 2X51A 2V1QA 2KVQG 1PSEA 1Y0MA 2AKLA 2DYBA 3U23A 1VQMT 3R6NA 1WHHA 3OYJA 1UJYA 2RI2A 5HY6A 4RKUE 4EPCA 4CI0C 1KHCA 5FLXE 5CR2A 1VQ6T 2NUPB 5CVIA 1YI2A 4B9WA 1Y57A 2D0NA 3VUBA 3CD6Q 1W2BS 1UECA 3OB9A 1G3WA 3SWNA 3VS3A 1MMGA 5A0DA 2YRCA 4C8QF 1M90R 2HBWA 3HFOA 1U06A 2DL3A 2RN8A 2M51A 3CC7T 2DM1A 2KYBA 4E7IA 2L3SA 2ZCFB 1PM3A 2QXFA 4C8QA 2YRDA 2QQAA 1GCQC 2QEXT 3JCMg 2DA9A 3UWNA 3CC7Q 2LNVA 2MF2A 3JCMP 1K73C 4QT7A 5D6XA 4J5YA 3SWNB 3UA6A 3EGXB 3PNWC 3HL8A 2EYWA 1Q7YR 3A8LB 4C0DC 5AT1B 1NPPA 2XK0A 1WGSA 2PUKB 2DTIA 3FLGA 3CCRT 4MDWA 3G4ST 4VUBA 4KT0E 3T9NA 3TVTA 4OMPA 3FEOA 4BDZA 4WCIA 2BE7D 1VQ9A 1VQLT 2YDLA 1AOJA 2EYYA 4E6RA 1QWFA 5KYXB 1JO8A 5DM7R 3CBOA 2GQVA 5GMKl 3L2VA 1NYFA 4M7DE 1CKBA 1PG5B 1ARKA 4GLKA 4IUTA 4F14A 3HHTB 4OP0A 3S3NA 1LOJA 4QVCA 2Y90A 3GP8A 3H41A 2DXUA 3J81E 3LGLA 2DIQA 1IHWA 3E1SA 1NJIC 4AFUC 1MHNA 2DF6A 2VWFA 2EW3A 1IXDA 1YHQT 4AFSC 3L42A 2DXTA 3VS7A 2MOXA 2K3YA 4A53A 3META 1QWEA 2K57A 5CAIA 1M8VA 5I2MA 4AMCA 4C8QC 3S3OA 4PLLA 2YLCA 2WSEE 2MIOA 4PK4A 4KGZB 2A0FB 3EGUA 2HQEA 4MZMA 1WQ7A 3H0HA 3URGA 5GAMf 2QTVA 1VQ7Q 3NFCA 2KEAA 1LCKA 1Q7YC 2K7AA 2BZ8A 3CMAT 2E5KA 3OYFA 1Q81U 1TXQA 2DX1A 1UDLA 2K5IA 4DBQA 1G8XA 2COYA 2GFAA 2KBTA 1Y07A 4J6YA 2JS2A 2V26A 4XTYA 3OS1A 1VQNA 2E4HA 5GAMd 2DRKA 2CP0A 2EPDA 5GAOq 1Y96A 3CCMQ 2ROTA 1JJ2S 5KYXA 3HRTA 5LJ5g 4DBFA 4M78D 2OTLQ 3M59A 1ZBXA 2K3XA 2DZCA 2KAFA 1MMNA 4E7SA 1UG1A 3I5SA 5I11A 2LZ6B 2H8HA 1WFWA 4X34A 4FU6A 4ESRA 1T3LA 3LH5A 4M4ZA 2FZKB 5KYYB 1K1ZA 1JB0E 2LJ3A 3OSSC 5GAMj 3CMEQ 1U5SA 1QVFA 3QWXX 4FW2A 3PE0A 4ZGJB 5IXBA 2DIGA 3TEEA 2DTHA 2M02A 4HT9A 1W2BA 1VQ8Q 1X69A 1PC0A 1UGRB 4N4HA 3M0QA 3P8BB 5J39A 3IQLA 1KQ1A 2HZYA 4IUPA 4FCYA 4J9GA 4CC4B 2DAQA 4KH1B 1HK9A 1M30A 3AHUA 3PVLA 4Y92A 1VOMA 1KHIA 1T3SA 2X35A 2VXFA 1HD3A 3OYMA 1PD0A 3I55T 1YJ9Q 1HXDA 1XQHA 3KUFA 1QCOA 3M57A 5EG2A 2FPEA 5IAYA 2SRCA 4FYYB 1K8AR 3A1PA 4M7DA 1X2QA 4X9DA 1CSKA 5LJ5e 2OJ2A 4M75A 2QA4Q 1IHVA 5DLOA 1U1TA 4M7DF 5CKEA 4JRIA 1YIJA 4BI4A 2FHDA 4M75F 5GANf 2RJFA 3A8GB 3EHRA 4JS5A 3EFRA 1M90U 2QQRA 1AZEA 1ZUUA 1UE9A 2RI5A 1QKWA 4RG2A 5GAMe 2VKNA 5CKFA 2RA2A 3PFSA 2XHCA 1BBZA 3LGFA 2KRNA 4QVDA 1UUEA 2MAMA 2DJZA 4JS4A 3VYGA 3S3MA 3MJXA 3TCJA 4C8QE 3H6ZA 5J3BA 4LUEA 2ESWA 5IT9E 1W6XA 3GNGA 3JCMV 2EAYA 2XG8D 1VQNT 3HPWA 1GL5A 3CC4Q 1R0BG 1RLPC 4WF2A 2E3IA 1PWTA 2HDAA 2KI7A 2CP6A 3JCMh 2FZGB 3JB9F 2QGFB 2EQJA 1YWPA 2PVOB 1WDXA 3MEWA 2HQXA 4E7LA 1AWWA 2MMPA 2PVGB 3JCMe 5FU6B 3ZEHA 4RTXA 1JQQA 4X9CA 2A3LA 2E12A 2QEXQ 3RDVA 1BYMA 3X25B 1YJWA 1VQKA 4MMLA 4RCCA 1TUDA 4XQ3A 1JJ2P 4MZPA 3EAEA 2C0IA 2NLUA 2ZPHB 3M0RA 2CP3A 4M78C 1WHKA 4LD6A 2AK5A 2EQMA 1YJWT 4IUUA 3LWHA 4PJOC 3QJ6A 2GBQA 2ZPEB 1H92A 3RIRA 5GAN5 1K9AA 2DJQA 3GLXA 2CZ7B 5HK3A 5LL6S 1MNDA 3OMGA 3RUXA 1YIJQ 1XJWB 2KXDA 1AEYA 3EGDB 3GOXA 3SB2A
chains in the Genus database with same CATH topology
4B9XA 1IREB 2ZPFB 4PJOB 3WVEB 2P0KA 2DVEA 2CZ1B 2M16A 5FROA 3J80E 4LD9K 3C95A 3QKJA 1VIEA 1AHJB 3DLLA 3CCLT 4NS5A 2LRQA 2EYQA 2L8DA 4C8QG 3VU3C 3LWIA 1Q86U 4IUQA 2VV5A 5LJ5h 3OBWA 1VQOA 3CD6T 2EFIA 4XU0A 2V8JA 3OYAA 1ZHIA 1VQMA 2EJFA 3OYIA 1M9SA 1WJSA 2E6NA 3CBMA 4XTXA 5GAOn 3G6ET 4ZTFA 1JBMA 1QVFS 1JRIA 1M1FA 2E64A 2FL7A 2MI6A 3CCMA 2QEXA 4II1A 4JUVA 1YJNA 2E1HA 1NZ9A 3I56T 2R5MA 3OYEA 2E6ZA 3FRNA 4FT2A 1N6AA 2YRVA 3M4YA 3I56A 1WJRA 5GMKj 1Q81C 3JCMW 1QP2A 1YJNT 1NJIU 3M58A 5CIUA 4HCBA 4BI3A 4OGCA 4M78G 2KVQG 2XDPA 3OA6A 4F7UG 1PSEA 2CYZB 1QP3A 3V8LA 3JCMX 1VQMT 2Y4YA 2YLBA 3HSBA 4XTZA 3OYJA 2RI2A 5HY6A 4RKUE 1K8AC 4EPCA 4CI0C 1KHCA 5FLXE 5CR2A 1VQ6T 4ZGDB 1UGQB 1YCYA 3A5ZB 5I21A 4M77A 2DXCA 5CVIA 1YI2A 4RMOA 3UDCA 2CZ6B 1LJOA 4QVZA 4B9WA 5CQYA 4LDXA 4OB0B 2PUOB 1BI0A 5FU7B 1YI2T 3MP6A 3VUBA 5GAOl 3CPWA 3GIBA 5LJ3e 2K5LA 1W2BS 3OB9A 4A4EA 4OB3B 1UB4A 1G3WA 3SWNA 3OMCA 5A0DA 5CK9A 4JLIA 5GANh 4C8QF 4A4KA 2CGHA 4M78B 4M7AD 3HFOA 2E5QA 4IKFA 3M53A 4BDYA 3CC7T 2X4YA 4N4IA 4XTUA 5GANe 4E7IA 3O8VA 3QUIA 3E9GA 4HCZA 4OVAA 2XDBA 2ZCFB 3PMTA 3QBYA 2O4XA 3V8JA 1G3TA 4M78E 4MZTA 4ME7A 2PVDB 1K9MC 2QXFA 3LH0A 4C8QA 3QPHA 1VQ4A 1N8RC 3OS5A 5GAMg 1QVPA 3OYNA 2QQAA 2QEXT 3RKYA 4M77C 3JCMg 4PJOA 3UWNA 3CXCS 2RK1A 2FB7A 5D6WA 4ATOA 2LNVA 3MHXA 3NTKA 3JB9I 4E7JA 3OW2A 5GMKe 2E70A 4F7UF 2L89A 2MF2A 4EMKA 2BKDN 3CC2A 3CCQA 3MCAB 3JCMP 1K73C 3JSCA 2JNGA 4R55A 3OYCA 3FC3A 1S72T 1Q82U 2XD0A 4N0AC 3A8MB 3DLMA 5D6XA 3WVDB 4J5YA 4L6V5 2RJCA 3SWNB 1SSFA 2YHTA 3PNWC 4L5GA 4BY6B 3MO8A 4PJOF 4C92E 3KXTA 1G5VA 4GY5A 3HFNA 2LCLA 3HL8A 2RI3A 5GAOp 2LDMA 2IVWA 1VQ9T 4F7UA 3A8LB 2KSSA 1X01A 4C0DC 5GMKh 4NL3A 2AHJB 1NPPA 2XK0A 3JCMb 1WGSA 5CO7A 1D3BA 1VQ5T 2PUKB 1Q7YU 1BIBA 2M1HA 2DTIA 3FLGA 3HRUA 4MDWA 3TREA 5LJ5j 3CCRT 1UEBA 1U8RA 4QQDA 3G4ST 4VUBA 4KT0E 3L1AA 3T9NA 3RKXA 2RHIA 4J8OA 1BIAA 3FEOA 2O01E 1YBYA 4BDZA 1VQ9A 4M77D 3PT9A 2RB6A 4F7UE 1M1KU 4EDUA 1VQLT 4C0FA 3UPUA 3MP1A 1DJ7B 4Z02A 1VUBA 4M7DB 2EIFA 4MDXA 3QDRB 3X20B 2GFUA 3EFSA 3BDUA 1BKBA 5DM7R 3CCQT 4PNOA 3PIOA 4HA8A 3G6EA 5LJ5f 3CBOA 2GQVA 5GMKl 3L2VA 1K9MU 3LLRA 3VYHB 4M7DE 4A4GA 4DQ2A 1VQOT 5GANj 1VQ7T 4V2SA 1G3SA 3QXEB 3M5AA 1XOVA 3TU4K 3NTHA 3JCMQ 2D6FA 4GLKA 1FXXA 4IUTA 4M77G 5LJ3g 5GAN2 1M1GA 2JN0A 3HHTB 4OP0A 1JJ2A 1QVGS 2DK3A 3S3NA 5FU6C 3VKIA 1LOJA 1IZ6A 4LDYA 4M75D 4C92A 1LNXA 2ZZDA 4QVCA 2Y90A 3GP8A 4PLIA 2DXUA 3J81E 3LGLA 2DIQA 4JRPA 3E1SA 2RM4A 4CRIA 1NJIC 4C5GA 3R6OA 4C8QB 2RJDA 1MHNA 5KE2A 1KC8U 4BE1A 4R56A 3OS2A 1GXIE 1FX7A 1R8OB 3OY9A 3CCRA 3OS0A 1M1KC 4M7AC 3QSUA 1B34A 5GAOr 1M90C 3MEAA 1YHQT 3L42A 3CCST 2DXTA 3V7CA 2D9TA 1QVGA 4ZTJA 2K3YA 4BE2A 5IN1A 3P8HA 4A53A 3META 1YITT 3BDLA 5HKCA 1VQKT 1OZ3A 2K57A 2R57A 3H8ZA 4EMGA 3FJPA 5CAIA 3INZA 3JAME 2FYKA 4HCCA 1M8VA 3DB3A 5I2MA 4C92C 3Q1JA 1V29B 4KBMB 2X4WA 1G3YA 4C8QC 5HK0A 3CCEA 3L2ZA 5LJ3d 1RL2A 4PLLA 2YLCA 4ZN1A 2WSEE 2XICA 3QZ9B 3CCUT 2K5FA 2JOYA 4JRKA 1Q86C 1UGSB 2PU9B 2ZPIB 3LX7A 3RESA 4C5HA 2HQEA 4EMKB 2MWOA 3FDRA 4MZMA 3OYKA 2WSFE 1WQ7A 2JZ2A 2IG0A 5GAMf 3URGA 1YITA 5LJ3j 1MGQA 3A8HB 5J26A 3NFCA 2LVMA 3V7RA 4M77F 5A0LA 3QIIA 2V8IA 2X4XA 3NTIA 3BW1A 1Q7YC 2EQUA 4M75B 5GANg 3CMAT 2VYTA 1XTDA 3OYHA 3OYFA 4M7AG 1Q81U 5AYFA 2K4YA 1FWZA 1RI0A 4J83A 3M9QA 3CEYA 3MEUA 2K5IA 4XTWA 4A4FA 1WNLA 3RMQA 4NOYA 4C92D 4JRQA 3RKWA 3RERA 2GFAA 2A7YA 2LCCA 1Y07A 2QQBA 4J6YA 3JCMf 4M75C 1K73U 4C0GA 3DB4A 3WXMB 1Q82C 2F69A 2P0QA 2RD1A 1TH7A 4XTYA 3OS1A 1VQNA 4KUIA 5GAMd 4YTLA 5GAOq 3JCMJ 4M75G 2QA4A 4BACA 1Y96A 5GAOm 1JJ2S 1KQSA 3GF5A 1M5Q1 3HRTA 4J6WA 5LJ5g 5C0MA 4OGEA 3C4SA 4DOWA 5GAN6 2QQ9A 4M78D 4M7AB 5A2QE 1KG1A 1D3BB 3C94A 2OTJA 4PJOE 3M59A 1ZBXA 2K3XA 2DZCA 3JRZA 2KAFA 2GCXA 4FSXA 3CMAA 1WJQA 2XU8A 3QYHB 3FB9A 3CCJA 1VQ4T 2GF7A 3LYIA 3X28B 3S6WA 3JCMd 4X34A 3SWNC 4FM4B 4FU6A 5DY9A 3MP8A 4E7KA 4XU1A 4C5IA 1I5LA 2ZGWA 4PKCC 2WSCE 5GAMh 3G71A 2M0OA 1JB0E 4C8QD 3CCJT 4BUGA 3CCMT 4JJNK 3OSSC 5GAMj 1KC8C 4M7DD 4IUVA 4OMFB 4E47A 1OZ2A 1QVFA 4N4GA 1I4K1 4ZGJB 2DIGA 3J7AF 2E41A 3X26B 3TEEA 2DTHA 4HT9A 3CCVT 4JDSA 1VQ8A 1W2BA 2EJGA 3CCLA 4FT4A 1QW1A 3CPWS 1KQSS 2OTLA 1UGRB 4N4HA 2DKGA 2DPPB 2P0PA 4BD3A 2LC4A 2M9UA 3L2RA 2RHYA 3P8BB 5KCHA 5J39A 5LJ5d 3OYYA 4Y28E 1KD1C 1KQ1A 1ZQ1A 3F70A 2DZ9A 4UC4A 4IUPA 1I81A 2OTLT 1VQ6A 3LW5E 1VIFA 4ZN3A 4J7IA 4XTVA 2EQKA 1VQ8T 1Y96B 1U1SA 2DAQA 1S72A 4BI8B 3JB9H 2QQSA 3CC2T 1P92A 1HK9A 4KULA 3VJPA 3AHUA 2XKOC 3ER0A 2EJ9A 2DEQA 2HNIA 3CPFA 3FIFA 1KHIA 2XIDA 2I2LA 2X35A 2VXFA 3RMSA 2RK2A 3VV0A 3HRSA 4M78A 5CKDA 5GMKm 3OYMA 3QZ5B 3S3OA 3JCMc 2EKOA 3I55T 2D0QB 1BI3A 1YJ9A 4XU3A 4BY6C 1HXDA 1NE8A 1XQHA 3KUFA 3UT1A 3V7SA 5GAN7 2RHZA 1BI1A 3M57A 5KH6A 5EG2A 1VQ7A 3JB9D 4HKEA 4Q5WA 2CKKA 2LT1A 3OQ5A 5IAYA 2DO3A 4OB1B 3GNFB 4A54A 3L2QA 3P8DA 3CCET 3JB9G 3OSVA 1H641 4M78F 5KE3A 2K2VA 4M7DA 2ZPBB 4M7AF 2JTFA 4X9DA 1KD1U 2LTOA 3M56A 5LJ5e 4KUDK 4FIBA 1OYXA 2HAXA 2VUBA 4M75A 5LJ3f 3OYGA 3CCSA 1N8RU 1VQPT 1YHQA 5DLOA 3OBYA 4L59A 1U1TA 4BE0A 2DD5A 3G4SA 2F5KA 4A4HA 4M7DF 3VUZA 3QG1A 5CKEA 4C92F 2OAUA 4JRIA 4XK8E 4OB2B 4BI4A 1YIJA 2HD0A 1I8FA 3HKSA 4QQ6A 5FRNA 2JTMA 4IURA 2FHDA 2RO0A 4M75F 4RCBA 4DOVA 5GANf 3ZBDA 3PIPA 3OYLA 2F5TX 2L3RA 2RJFA 3G71T 3CCVA 3A8GB 4MMKA 4JS5A 4J6XA 3CC4A 1PSFA 3EFRA 2QQRA 3QJYA 1M90U 4LDVA 2KQWA 4N0AA 1N9SA 3BFMA 4M7DC 2O4XB 5M9OA 4PJOD 2RI5A 2E10A 4NL2A 2Y4XA 4RG2A 1EIFA 5GAMe 5CKFA 2RA2A 5A0GA 3PFSA 2XHCA 2H3JA 3LGFA 3CCUA 5D6YA 3CXCA 2BUDA 4C92B 3KBGA 4QVDA 2OTJT 2EWNA 2MAMA 5FRMA 4LDUA 1O9SA 2DJZA 4JS4A 3QHSA 3VYGA 3OYBA 3S3MA 1X75C 5DLQE 2FVUA 1YJ9T 3DKMA 3TCJA 4ELYC 5GANd 5FU7C 4C8QE 3H6ZA 5J3BA 5CCAA 3PTAA 2QA4T 5IT9E 3GNGA 4EMKC 3JCMV 2EAYA 3G7ZA 3V8KA 4C0DB 2XG8D 3PGGA 4EMHA 1VQNT 2ZPGB 1BI2A 2XI9A 3HPWA 3E19A 4DA4A 2QDYB 4LDWA 3MEVA 4QW2A 2XDDA 3HP9A 5GMKi 3QYGB 2L5QA 4TVRA 5LJ3h 4WF2A 4BB7A 1YIJT 3CMET 2LT4A 5GAN4 3JCMh 3JB9J 3JB9F 4XU2A 3GPLA 3CMEA 3PMIA 2DTOA 1VQ5A 5GAN8 4HT8A 2EQJA 2PQWA 3ZFJA 2PVOB 3MEWA 2VGNA 2HQXA 4E7LA 5CQXA 4M7AE 2MMPA 2PVGB 3JCMe 2E65A 4JLGA 5FU6B 2LQ8A 3ZEHA 3X24B 3OYDA 1K8AU 3BY7A 1O75A 4M77B 5CKHA 2A3LA 4X9CA 2QI2A 4O5VA 2E12A 2DD4A 4RG8A 2CS7A 1Y71A 3A8OB 1N27A 1WQWA 3X25B 2VXEA 2MWPA 1OI1A 1YJWA 4MMLA 1VQKA 3N5BB 1KQ2A 2JUFA 2X4JA 2R58A 3M4GA 4RCCA 2HBPA 5L8RE 4FL6A 3SDZA 3ASKA 2R5AA 4F7UB 2RH2A 4XQ3A 4M7AA 4M77E 1UGPB 4MZPA 3EAEA 2KMTA 2NLUA 2ZPHB 5KCOA 1WPYA 3M54A 2V8KA 1Y7XA 3OW2S 3SFMA 4C92G 4M78C 2C06A 4C0ZA 4PL6A 4M7DG 3ME9A 4LD6A 2RHXA 3C12A 2B8AA 2EQMA 2KDSA 3CBPA 2QTXA 4D6WA 1YJWT 1H3ZA 3I55A 2VGMA 3SD4A 4IUUA 3LWHA 4PJOC 4J7FA 3CC4T 4QQGA 4XAXB 2KK4A 2G3RA 3QJ6A 5I2SA 1VQLA 4OF1A 4Y91A 5GAN3 2RHUA 2ZPEB 3CC7A 4PJOG 2JVVA 2KY9A 2LQKA 3L2WA 1N9RA 1W4SA 2P4TA 2LX9A 3RIRA 5GAN5 3CD6A 1XNIA 4O6JA 3GLXA 2CZ7B 4P5NA 2DXBA 4ZGEB 5C6SA 5HK3A 5LL6S 3L2UA 2CZ0B 3OMGA 4M75E 5CKBA 3RUXA 3QO3A 2VC8A 2RJEA 1M4ZA 1NPRA 4C5EA 4ELZC 1BYMA 3M55A 3GOXA 2WACA 4E7HA 1VQPA 1B34B 3SB2A 3E9FA 1X6OA 2BIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 F;  5GAM d;  4PJO B;  2DVE A;  4JRI A;  5GAO q;  3JCM J;  3L1A A;  4M75 G;  3RKX A;  1I8F A;  1Y96 A;  5GAO m;  4RCB A;  1BIA A;  4M75 F;  5GAN f;  4J6W A;  1M5Q 1;  4C8Q G;  4M77 D;  3VU3 C;  2RB6 A;  4F7U E;  5GAN 6;  5LJ5 g;  4M78 D;  4M7A B;  4MMK A;  5LJ5 h;  1D3B B;  4J6X A;  4XU0 A;  4PJO E;  3EFR A;  2EJF A;  2DZC A;  4N0A A;  1N9S A;  4XTX A;  5GAO n;  4M7D B;  1JBM A;  3BFM A;  4M7D C;  4PJO D;  2E10 A;  1JRI A;  2E64 A;  2RD1 A;  3EFS A;  4NL2 A;  5GAM e;  3FB9 A;  2RA2 A;  3BDU A;  3JCM X;  4JUV A;  4PNO A;  2E1H A;  3JCM d;  4HA8 A;  3SWN C;  5LJ5 f;  5DY9 A;  5GMK l;  4M7A A;  4C92 B;  4XU1 A;  5GMK j;  4QVD A;  3JCM W;  2EWN A;  4DQ2 A;  1I5L A;  5GAN j;  2ZGW A;  4M7D E;  4V2S A;  5GAM h;  4C8Q D;  3JCM Q;  2DJZ A;  4M7D D;  3QHS A;  4M78 G;  5GAM j;  4M77 G;  5LJ3 g;  5GAN d;  4F7U G;  5GAN 2;  2JN0 A;  4C8Q E;  4OP0 A;  1KQ2 A;  1I4K 1;  4EMK C;  3JCM V;  3V8L A;  2E41 A;  1LOJ A;  2EAY A;  2YLB A;  4M75 D;  3V8K A;  1LNX A;  2DTH A;  4XTZ A;  3PGG A;  4EMH A;  4QVC A;  3HSB A;  4HT9 A;  2Y90 A;  2DXU A;  2EJG A;  2RM4 A;  5GMK i;  1YCY A;  2DKG A;  5LJ3 h;  4XTY A;  4M77 A;  4WF2 A;  4C8Q B;  5I21 A;  4M7D F;  1LJO A;  5GAN 4;  3JCM h;  3JB9 J;  3JB9 F;  4XU2 A;  5LJ5 d;  4C92 A;  3GIB A;  4M7A C;  2DTO A;  5GAO l;  1KQ1 A;  5GAN 8;  5LJ3 e;  2DZ9 A;  4HT8 A;  3QSU A;  1B34 A;  1I81 A;  5GAO r;  4XTV A;  3SWN A;  1Y96 B;  2DXT A;  4M7A E;  1U1S A;  1B34 B;  2E65 A;  4JLI A;  3V7C A;  3JCM e;  5GAN h;  3JB9 H;  3BY7 A;  4M77 B;  4C8Q F;  1HK9 A;  1M8V A;  4X9C A;  2CGH A;  4M78 B;  3AHU A;  4M7A D;  3HFO A;  4A53 A;  2EJ9 A;  1WQW A;  2DEQ A;  2HNI A;  3FIF A;  2VXE A;  4MML A;  2K57 A;  4EMG A;  2I2L A;  3FJP A;  4XTU A;  3INZ A;  5CAI A;  2FYK A;  3M4G A;  4RCC A;  4EMK A;  5GAN e;  4C92 C;  3QUI A;  2VXF A;  4F7U B;  4C8Q C;  3RER A;  4M78 A;  3L2Z A;  4XQ3 A;  5LJ3 d;  4M77 E;  2YLC A;  5GMK m;  3V8J A;  4M78 E;  3JCM c;  1WPY A;  4JRK A;  4XU3 A;  1HXD A;  4C8Q A;  4C92 G;  4M78 C;  3V7S A;  5GAN 7;  3RES A;  4M7D G;  3RKY A;  4M77 C;  3JCM g;  4PJO A;  4EMK B;  3JB9 D;  1WQ7 A;  2FB7 A;  2QTX A;  5GAM f;  3JB9 I;  5GMK e;  5LJ3 j;  4PJO C;  1MGQ A;  4F7U F;  4A54 A;  3V7R A;  4M77 F;  3JB9 G;  4M78 F;  1H64 1;  3JCM P;  3BW1 A;  4Y91 A;  5GAN g;  4M75 B;  5GAN 3;  4N0A C;  4J5Y A;  4PJO G;  3SWN B;  4M7D A;  2YHT A;  4M7A G;  1N9R A;  4M7A F;  4C92 E;  4PJO F;  4X9D A;  3RIR A;  5GAN 5;  5LJ5 e;  3HFN A;  4XTW A;  4C92 D;  1WNL A;  4M75 A;  4NOY A;  5LJ3 f;  5GAO p;  3RKW A;  4M75 E;  4F7U A;  3RUX A;  3QO3 A;  1X01 A;  2VC8 A;  5GMK h;  4J6Y A;  4NL3 A;  3JCM f;  3JCM b;  4M75 C;  1U1T A;  1D3B A;  1BIB A;  3SB2 A;  2DTI A;  5GAM g;  5LJ5 j;  1TH7 A; 
#chains in the Genus database with same CATH topology
 1IRE B;  2P0K A;  3EH1 A;  1AWJ A;  2M16 A;  5FRO A;  1GRI A;  3J80 E;  3C95 A;  3QKJ A;  1VIE A;  3DLL A;  2EVR A;  1S72 Q;  2L8D A;  3VU3 C;  4FYV B;  1Q86 U;  1GFD A;  1VQM Q;  3OYA A;  1ZBJ A;  1M9S A;  2E6N A;  3CBM A;  5GAO n;  1QVF S;  3CCM A;  1M1F A;  2E64 A;  4RUG A;  4AG2 C;  2X3W D;  3OYE A;  2E6Z A;  4FT2 A;  1N6A A;  4M7A A;  5GMK j;  1Q81 C;  1YJN T;  3EH2 A;  4OGC A;  4M78 G;  2A37 A;  3OA6 A;  2DE0 X;  2L2P A;  3V8L A;  3EG9 B;  3JCM X;  2YLB A;  4XTZ A;  3RNJ A;  2RMO A;  5I21 A;  4M77 A;  3RR6 A;  1RAI B;  1ZA2 B;  1BI0 A;  5FU7 B;  5GAO l;  3CPW A;  1WHG A;  3NPF A;  1H3H A;  2FZC B;  1TTH B;  2CGH A;  4M7A D;  1SG5 A;  3VRZ A;  4IIO A;  5GAN e;  1D09 B;  3VRY A;  2XDB A;  1S1N A;  4LNP A;  2EYZ A;  1X6B A;  3TSZ A;  1VYV A;  3LH0 A;  4GLM A;  1YI2 Q;  3OS5 A;  3OYN A;  3RKY A;  3CXC S;  2FB7 A;  5D6W A;  3JB9 I;  4E7J A;  5GMK e;  3G4S Q;  4F7U F;  4Z89 A;  3MCA B;  3OYC A;  1W1F A;  1ABO A;  1SSF A;  2YHT A;  5IH2 A;  4L5G A;  4BY6 B;  3MO8 A;  2CP2 A;  1G5V A;  4GY5 A;  2HEQ A;  2RI3 A;  1KK7 A;  5GAO p;  2LDM A;  1TG0 A;  1VQ9 T;  4F7U A;  4OMM A;  2SEM A;  2EQI A;  1VQ5 T;  4PFO A;  1Q7Y U;  2EYX A;  3HRU A;  5LJ5 j;  4QQD A;  4DEX A;  4Z88 A;  2RHI A;  2O01 E;  1YBY A;  1I07 A;  3EHQ A;  4F7U E;  2RB6 A;  2C0O A;  2KRS A;  3UPU A;  1DJ7 B;  1Q81 R;  1WX6 A;  1N8R R;  2EIF A;  3E2U A;  4MDX A;  3X20 B;  3BDU A;  1BKB A;  2RQW A;  2CRE A;  4EIK A;  4CC2 A;  4ANJ A;  1K4U S;  1VQ7 T;  3QXE B;  1XOV A;  3TU4 K;  3NTH A;  2DNU A;  2JN0 A;  3VKI A;  1LNX A;  2YUO A;  2ZZD A;  1YJN Q;  2RM4 A;  2NWM A;  5KE2 A;  4JJB A;  1GXI E;  1R8O B;  3OY9 A;  1M1K C;  4E2F B;  1B34 A;  1M90 C;  3MEA A;  3V7C A;  2D9T A;  1UTI A;  4ZTJ A;  3ZL7 C;  4BE2 A;  3P8H A;  4HXJ A;  3BDL A;  5HKC A;  2R57 A;  3H8Z A;  4HCC A;  3INZ A;  1X2K A;  4C92 C;  5HK0 A;  2J05 A;  1G3Y A;  3L2Z A;  2XIC A;  1VQ4 Q;  2MPX C;  3QZ9 B;  2JOY A;  2RQR A;  4KH0 B;  2JT4 A;  1W2B P;  1ZSZ B;  4EMK B;  1SRL A;  1OPK A;  2ATC B;  4CC7 A;  2D8J A;  2IG0 A;  3VS6 A;  3CCR Q;  1YIT A;  2DIL A;  5LJ3 j;  5J26 A;  3QII A;  2V8I A;  3NTI A;  2COW A;  1M3C A;  2X4X A;  2EQU A;  1XTD A;  2EBP A;  4DEY A;  5AYF A;  2K4Y A;  2KGT A;  4J83 A;  4A4F A;  3RMQ A;  3RKW A;  3I9Q A;  3JCM f;  2JM8 A;  1NEB A;  2BZX A;  2J06 A;  4C0G A;  1MMD A;  3C0C A;  3DB4 A;  3WXM B;  1Q82 C;  2P0Q A;  4KUI A;  4OMN A;  3JCM J;  4M75 G;  4BAC A;  5GAO m;  1RAB B;  3I35 A;  1KQS A;  3GF5 A;  1M5Q 1;  4J6W A;  5C0M A;  5GAN 6;  2OTJ A;  3NGP A;  3ULR B;  4HVV A;  3CMA A;  1VQ4 T;  3SHW A;  3X28 B;  3S6W A;  1KJW A;  3JCM d;  5DY9 A;  8AT1 B;  3QDF A;  4C5I A;  1PRL C;  1ZSZ A;  2DL7 A;  2WSC E;  5GAM h;  3G71 A;  1F1B B;  2LX7 A;  2DL4 A;  3CCU Q;  1K0S A;  1OZ2 A;  2DRM A;  4RTZ A;  3J7A F;  4AFZ C;  4DBH A;  1M1K R;  2DL5 A;  1VQ8 A;  3UAT A;  2DYI A;  2K6D A;  2LC4 A;  4Y28 E;  3F70 A;  3PVQ A;  2OTL T;  2GTJ A;  1VIF A;  4J7I A;  4XTV A;  1VQ8 T;  1S72 A;  4QKU A;  4KUL A;  3M0U A;  2KR3 A;  2DEQ A;  4PFZ A;  3FIF A;  3RMS A;  3HRS A;  2JJ9 A;  3JCM c;  2EKO A;  2D0Q B;  4XU3 A;  4BY6 C;  1NE8 A;  3UT1 A;  2K79 A;  3RBB B;  3V7S A;  5GAN 7;  2DBM A;  2RHZ A;  5KH6 A;  2OTJ Q;  3JB9 D;  3OQ5 A;  1V1C A;  1VQP Q;  2ROL A;  3P8D A;  3NMZ C;  3JB9 G;  1QQJ A;  2EGA A;  2K2V A;  3CQT A;  4J9F A;  1Q82 R;  3CXC P;  3M56 A;  4FIB A;  2X3X D;  2CT3 A;  1YHQ A;  4J9I A;  1EFN A;  3G4S A;  4LXC A;  3QG1 A;  4C92 F;  2HD0 A;  2JTM A;  2RF0 A;  2RO0 A;  4DOV A;  4D8D A;  1WHL A;  1IRX A;  1FMK A;  4MMK A;  1AZG B;  2MYS A;  4PJO D;  1JU5 C;  2Y4X A;  5KYU A;  2F2W A;  1Z9Z A;  3CCU A;  3UF4 A;  2OTJ T;  3TSW A;  5FRM A;  1O9S A;  3QHS A;  4IIM A;  2FVU A;  2RNA A;  1YJ9 T;  5GAN d;  1OQK A;  1VQK T;  1KQ2 A;  1D0Z A;  2Z0W A;  2DBK A;  4C0D B;  3THK A;  2XI9 A;  3E19 A;  2QDY B;  1KD1 R;  2KRM A;  5IXF A;  1YIJ T;  2LT4 A;  3KFV A;  3I55 Q;  3JB9 J;  1TSF A;  4JLG A;  2CP7 A;  3X24 B;  3OYD A;  1GFC A;  5CKH A;  1TOV A;  1SHG A;  2CSI A;  3EG3 A;  2CS7 A;  1Y71 A;  3A8O B;  1N27 A;  1WQW A;  2YSQ A;  3I56 Q;  3N5B B;  4PJJ A;  3M4G A;  3M0T A;  4EMK A;  5L8R E;  4F7U B;  3ASK A;  2RH2 A;  1E7O A;  2KMT A;  2V1R A;  1WLP B;  3TQ7 P;  2V8K A;  4C92 G;  1RAD B;  3ME9 A;  1RAG B;  2B8A A;  4D6W A;  2QTX A;  4RTU A;  2VGM A;  4J7F A;  2G3R A;  5I2S A;  1D0Y A;  5GAN 3;  1N9R A;  3CCV Q;  1OU8 A;  3CD6 A;  1XNI A;  4O6J A;  2DXB A;  5C6S A;  2FRY A;  3AT1 B;  5CKB A;  1I5O B;  1M4Z A;  1NPR A;  4RTW A;  1B34 B;  3E9F A;  1QKX A;  2ZPF B;  1VQ6 Q;  3O5Z A;  2DVE A;  2CZ1 B;  2QG9 B;  3VS5 A;  4NS5 A;  4OMO A;  1V76 A;  4C8Q G;  3LWI A;  2NUZ A;  1E6G A;  2VV5 A;  2O2O A;  5LJ5 h;  3CD6 T;  2HL5 C;  4XU0 A;  2COZ A;  1JBM A;  1YP5 A;  4PJL A;  2FL7 A;  3UA7 A;  5FW9 A;  4JUV A;  5D7U A;  2E1H A;  1NZ9 A;  1X6G A;  3I56 A;  2CUD A;  1WJR A;  3JCM W;  3M58 A;  5CIU A;  4D8K A;  6AT1 B;  2XDP A;  2NUP A;  2CYZ B;  1SPK A;  1QP3 A;  2Y4Y A;  3HSB A;  3VS1 A;  2F1L A;  1K8A C;  3H0I A;  4RTV A;  1UGQ B;  1AT1 B;  3UDC A;  2CZ6 B;  2JMA A;  4QVZ A;  5CQY A;  4LDX A;  2PUO B;  3GIB A;  2EGC A;  4A4E A;  4AFQ C;  1UB4 A;  3OMC A;  5CK9 A;  2CH4 A;  3EG2 A;  2P4R A;  1TU0 B;  1UFF A;  4IKF A;  4BDY A;  4KRT A;  1M2O A;  3O8V A;  3E9G A;  3QUI A;  4HCZ A;  2O4X A;  3V8J A;  1B7T A;  2J6K A;  3QPH A;  4PJO A;  1MV3 A;  1ZSZ C;  2RK1 A;  3OW2 A;  1HJD A;  2BKD N;  3CCQ A;  3JSC A;  1S72 T;  4N0A C;  3A8M B;  3WVD B;  1ZUY A;  4L6V 5;  2RJC A;  1M3B A;  5GJW B;  3KXT A;  4PJO F;  2PNI A;  2M0Y A;  2XMF A;  2LP5 A;  2LMJ A;  3HFN A;  3I5R A;  2CT4 A;  1RI9 A;  2KSS A;  1X01 A;  2VAS A;  2DEU A;  5CO7 A;  1BIB A;  2M1H A;  3TRE A;  3VS0 A;  1UEB A;  5ECA A;  3L1A A;  1JEG A;  2DER A;  2ABL A;  1BIA A;  1MMA A;  4M77 D;  3PT9 A;  1M1K U;  4C0F A;  3MP1 A;  4K11 A;  4OML A;  1K0X A;  1WZO A;  2CSQ A;  2F2X A;  4PNO A;  3PIO A;  5LJ5 f;  4KGX B;  1K9M U;  1B07 A;  5I22 A;  4A4G A;  5IHK A;  4DQ2 A;  2LJ0 A;  4V2S A;  2L3Q A;  3M5A A;  3JCM Q;  2FO0 A;  2D6F A;  1FXX A;  1QVG S;  1G83 A;  1VQL Q;  5FU6 C;  4LDY A;  4M75 D;  1IGQ A;  1ZUK A;  1NLO C;  1VQ5 Q;  4PLI A;  2KRO A;  4JRP A;  4CRI A;  1NLP C;  3R6O A;  4C5G A;  4C8Q B;  1WYX A;  2RJD A;  2A36 A;  1KC8 U;  5KYW B;  3CCR A;  1YIT Q;  3OS0 A;  4M7A C;  1BU1 A;  1ZA1 B;  1GBQ A;  4JJD A;  2L0A A;  5GAO r;  3CCS T;  2OX7 A;  4LN2 A;  1QVG A;  1IB8 A;  2AZS A;  5IN1 A;  1EX4 A;  1YIT T;  2YUQ A;  1OZ3 A;  3JAM E;  2FYK A;  1D0X A;  1T0J A;  1V29 B;  4KBM B;  3RER A;  1VQ9 Q;  2K5F A;  4JRK A;  1Q86 C;  3CCQ Q;  1UGS B;  2PU9 B;  2EGE A;  4C5H A;  2WSF E;  4HCK A;  2FG0 A;  2H3E B;  1K76 A;  1MGQ A;  1T0H A;  3A8H B;  2LVM A;  3V7R A;  5A0L A;  1HYO A;  5GAN g;  2VYT A;  4M7A G;  1AVZ C;  4RTY A;  4XTW A;  4C92 D;  1WNL A;  1SRM A;  2A7Y A;  2LCC A;  2QQB A;  1K73 U;  2CDT A;  2GNC A;  2F69 A;  4WTO B;  1TH7 A;  1RAF B;  2RD1 A;  4YTL A;  1FMW A;  4A63 B;  2QA4 A;  2E3H A;  2QGG A;  3CPW P;  1MV0 B;  3CCV A;  4OGE A;  3C4S A;  5A2Q E;  2QQ9 A;  4M7A B;  1KG1 A;  4PJO E;  1WXB A;  1D1C A;  1YN8 A;  2XU8 A;  2AKK A;  2GF7 A;  3LYI A;  3SWN C;  4E7K A;  1LPL A;  4XU1 A;  3CCJ T;  4C8Q D;  1SF9 A;  1TWB A;  4BUG A;  1YNZ A;  4JJN K;  4IUV A;  4N4G A;  1I4K 1;  4FSS A;  2E41 A;  2FEI A;  4X1V A;  1BCO A;  5KYY A;  3VS2 A;  4JDS A;  3H0F A;  1QW1 A;  4FT4 A;  3CPW S;  1KQS S;  1OUL A;  1RLQ C;  2DPP B;  2HL3 A;  2P0P A;  4BD3 A;  9ATC B;  2RQU A;  5LJ5 d;  3OYY A;  1ACM B;  1I81 A;  1VQ6 A;  2D1X A;  2JW4 A;  2OAW A;  2QQS A;  3CC2 T;  1P92 A;  1QVF P;  2DFU A;  1WXU A;  3VJP A;  2PTK A;  2XID A;  2I2L A;  4JZ4 A;  1ZSG A;  3VV0 A;  2RK2 A;  5GMK m;  3QZ5 B;  1BI3 A;  1KQS P;  1VQ7 A;  4Q5W A;  2CKK A;  2LT1 A;  2DO3 A;  3GNF B;  4A54 A;  3MKD A;  3CCE T;  3OSV A;  1H64 1;  4J9H A;  4CC3 A;  2ZPB B;  4M7A F;  2JTF A;  1KD1 U;  2LTO A;  3HTR A;  4KUD K;  1N8R U;  1QVG P;  1VQP T;  3OBY A;  4A4H A;  2RQV A;  3VUZ A;  1K9M R;  4XK8 E;  4OB2 B;  1TS9 A;  2BE9 B;  3HKS A;  4QQ6 A;  4RCB A;  1QLY A;  3ZBD A;  2F5T X;  4PJM A;  3EGD A;  1PSF A;  3QJY A;  1X43 A;  4LDV A;  2KQW A;  4N0A A;  1N9S A;  4M7D C;  2O4X B;  2E10 A;  4NL2 A;  1KSW A;  2DMO A;  2P84 A;  5D6Y A;  4AT1 B;  3CXC A;  2AZV A;  1SKU B;  3REB B;  4LDU A;  3EG1 A;  1X75 C;  5DLQ E;  1M2V B;  2QA4 T;  3G7Z A;  4EMH A;  2ZPG B;  4LDW A;  3MEV A;  3CCJ Q;  2L5Q A;  5LJ3 h;  1AWO A;  1AWX A;  2QAS A;  1NBE B;  4XU2 A;  3CME A;  3PMI A;  2DTO A;  1VQ5 A;  5GAN 8;  4KGV B;  2HKQ B;  5CQX A;  4M7A E;  3JV3 A;  1WI7 A;  1K8A U;  4M77 B;  1QMC A;  2QI2 A;  4RG8 A;  2DD4 A;  4R0K A;  1M27 C;  1OI1 A;  1UGV A;  2QDL A;  2JUF A;  2R58 A;  3OW2 P;  2R5A A;  1QCF A;  1UGP B;  5KCO A;  3M54 A;  1Y7X A;  2C0T A;  4M7D G;  2RHX A;  1H3Z A;  3EGX A;  1UHC A;  1M2V A;  1GCQ A;  1VYT A;  3CC4 T;  4XAX B;  2KK4 A;  1ZLM A;  1VQL A;  2RHU A;  1OV3 A;  4PJO G;  2JVV A;  3L2W A;  1RAH B;  4LUD A;  2CP5 A;  2LX9 A;  1ABQ A;  2HSP A;  3L2U A;  2RPN A;  1VQK Q;  2CZ0 B;  2F2V A;  1M3A A;  4ELZ C;  3M55 A;  2O9V A;  5GAM g;  3A98 A;  3WVE B;  4LD9 K;  3CCL T;  2OI3 A;  2LRQ A;  3EFO A;  3OBW A;  1VQO Q;  2V8J A;  1ZHI A;  4XTX A;  1JRI A;  2QEX A;  2VB6 A;  3CCL Q;  4II1 A;  1YJN A;  1TUG B;  2R5M A;  2YRV A;  3M4Y A;  1QP2 A;  1HSQ A;  1TUC A;  7AT1 B;  4BI3 A;  2L3P A;  1MUZ A;  2W0Z A;  1GBR A;  4F7U G;  2KYM A;  1KIK A;  4ZGD B;  1YCY A;  3A5Z B;  2DXC A;  4RMO A;  2J7I A;  1LJO A;  1YFN A;  2K3B A;  2KXC A;  1NYG A;  4OB0 B;  1YI2 T;  1A0N B;  3MP6 A;  5LJ3 e;  2K5L A;  4OB3 B;  1M8M A;  4JLI A;  3EFO B;  1WA7 A;  5GJV B;  5GAN h;  4A4K A;  4M78 B;  4Z8A A;  2E5Q A;  2YWW A;  3M53 A;  1I1J A;  2X4Y A;  4N4I A;  5FWC A;  4XTU A;  4HVW A;  4OVA A;  3QBY A;  3PMT A;  1G3T A;  1B3Q A;  4M78 E;  4MZT A;  4ME7 A;  2PVD B;  3FJ5 A;  4JPB W;  1VQ4 A;  1KC8 R;  1QVP A;  4M77 C;  4AG1 C;  4ATO A;  3NTK A;  3MHX A;  2E70 A;  2L89 A;  4FYW B;  3CC2 A;  2VVK A;  2JNG A;  4R55 A;  1Q86 R;  3FC3 A;  1Q82 U;  2XD0 A;  2HKN A;  3DLM A;  2IIM A;  3M0S A;  4C92 E;  5IHI A;  2LCL A;  1NG2 A;  2IVW A;  2YUP A;  5GMK h;  1PD1 A;  4NL3 A;  2AHJ B;  3JCM b;  1D1A A;  1D3B A;  2KE9 A;  1QCN A;  1UJ0 A;  1U8R A;  1LVK A;  3H9N A;  1UHF A;  1H8K A;  3RKX A;  4JZ3 A;  2LCS A;  4J8O A;  4EDU A;  2JM9 A;  4Z02 A;  2X9H A;  1JXO A;  1VUB A;  4M7D B;  2NUT A;  3QDR B;  3MPU B;  2GFU A;  3EFS A;  3CCQ T;  2PZ1 A;  4HA8 A;  3G6E A;  2I0N A;  3LLR A;  3VYH B;  1VQO T;  5GAN j;  1G3S A;  2CH4 W;  4M77 G;  5LJ3 g;  5GAN 2;  4J9B A;  1E6H A;  1M1G A;  1YWO A;  2D8H A;  2NYS A;  1JJ2 A;  2DK3 A;  4C92 A;  1IZ6 A;  2GGR A;  2A08 A;  1BB9 A;  3CC2 Q;  1EZZ B;  2GQI A;  2O88 A;  3SEM A;  1RUW A;  4BE1 A;  4R56 A;  3OS2 A;  5FWB A;  1FX7 A;  2G6F X;  4LE9 A;  5HCK A;  4JJC A;  3QSU A;  2LJ1 A;  1IO6 A;  1NM7 A;  2O31 A;  5KYW A;  4J9C A;  4EMG A;  2FPD A;  3FJP A;  1AD5 A;  3DB3 A;  3Q1J A;  3CCE A;  2X4W A;  5LJ3 d;  4ZN1 A;  1RL2 A;  2LQW A;  1X27 A;  3CCU T;  2HMA A;  2ZPI B;  3RES A;  3LX7 A;  2MWO A;  3FDR A;  3OYK A;  1WXT A;  2JZ2 A;  1I0C A;  4M77 F;  2YUN A;  4PFP A;  3BW1 A;  4M75 B;  3GBQ A;  3OYH A;  3BE3 A;  1OX8 A;  1FWZ A;  1RI0 A;  3M9Q A;  3CEY A;  3MEU A;  4JRQ A;  1C1A A;  4NOY A;  2KT8 A;  2QAZ A;  1U3O A;  4M75 C;  4OMQ A;  4RTT A;  1YHQ Q;  4F17 A;  1K9M C;  1N8R C;  3REA B;  4ZNX A;  4DOW A;  4J9E A;  1D3B B;  3C94 A;  1RAC B;  4DBR A;  3VS4 A;  3JRZ A;  3NHN A;  2GCX A;  4FSX A;  1WJQ A;  3QYH B;  2HSE B;  3FB9 A;  3CCJ A;  2DL8 A;  1W70 A;  4FM4 B;  3MP8 A;  1D1B A;  2W10 A;  1VA7 A;  2ED0 A;  1I5L A;  2ZGW A;  4PKC C;  2M0O A;  1KC8 C;  3CCM T;  4M7D D;  1Z9Q A;  3CCS Q;  2CUB A;  4OMF B;  4E47 A;  3D7S B;  1CKA A;  3X26 B;  3CCV T;  2EJG A;  3CCL A;  2OTL A;  2DKG A;  1OX9 A;  2M9U A;  3L2R A;  2RHY A;  5KCH A;  1RAE B;  1KD1 C;  4UC4 A;  1ZQ1 A;  2DZ9 A;  3LW5 E;  1J3T A;  4ZN3 A;  1PRM C;  2J6O A;  1VYU A;  2EQK A;  1Y96 B;  1U1S A;  2FRW A;  4BI8 B;  3JB9 H;  5KYN A;  1PHT A;  3CCE Q;  2XKO C;  3G71 Q;  3ER0 A;  2EJ9 A;  3CPF A;  2HNI A;  4FW1 A;  2IPO B;  2A28 A;  4M78 A;  1PKS A;  5CKD A;  1GCP A;  1YJ9 A;  1BI1 A;  2JS0 A;  4HKE A;  1WHM A;  1SSH A;  1FYN A;  4OB1 B;  3L2Q A;  4M78 F;  5KE3 A;  1JXM A;  1PCX A;  2DLP A;  1C6V X;  1OYX A;  1PKT A;  2HAX A;  2VUB A;  5LJ3 f;  3OYG A;  5IHN A;  3CCS A;  2JXB A;  3G1J A;  3QWY A;  4L59 A;  4BE0 A;  1NJI R;  2DD5 A;  2F5K A;  2MCN A;  2AIR B;  1IGU A;  2OAU A;  2QK0 A;  1I8F A;  5FRN A;  4IUR A;  3OYL A;  2K9G A;  3PIP A;  2ECZ A;  2L3R A;  1ZX6 A;  3G71 T;  1BCM A;  2HQH A;  4J6X A;  3CC4 A;  2BTT A;  1WHJ A;  1OEB A;  4F16 A;  3BFM A;  5M9O A;  1WIE A;  1PNJ A;  1EIF A;  5A0G A;  2H3J A;  1BK2 A;  2ZAE A;  2BUD A;  4C92 B;  3KBG A;  2DET A;  2EWN A;  8ATC B;  2K2M A;  1OOT A;  1YCS B;  3OYB A;  3DKM A;  4ELY C;  5FU7 C;  1MNE A;  5CCA A;  2HCK A;  1R77 A;  3PTA A;  4EMK C;  2DVJ A;  3V8K A;  3CMA Q;  3PGG A;  2YT6 A;  1BI2 A;  4DA4 A;  1OU9 A;  4QW2 A;  2XDD A;  3HP9 A;  5GMK i;  3QYG B;  4TVR A;  4BB7 A;  3CME T;  5GAN 4;  3GPL A;  4HT8 A;  2PQW A;  3ZFJ A;  2VGN A;  2E65 A;  2LQ8 A;  3BY7 A;  1O75 A;  3EG0 A;  4O5V A;  4ORZ A;  4J9D A;  1VQN Q;  1Q95 G;  2VXE A;  2MWP A;  1YJW Q;  2NUT B;  2X4J A;  3SDZ A;  2HBP A;  4FL6 A;  4HVU A;  4M77 E;  2GTO A;  2KT1 A;  1WPY A;  2J6F A;  3OW2 S;  3SFM A;  2C06 A;  4C0Z A;  4PL6 A;  2YXY A;  3C12 A;  3CBP A;  2KDS A;  2AT1 B;  3I55 A;  3SD4 A;  4QQG A;  2FPF A;  2MK5 A;  2JTE A;  4OF1 A;  4Y91 A;  2LQN A;  3CC7 A;  2KY9 A;  2RQT A;  1R0C B;  2BZY A;  1C0M A;  2ENM A;  2LQK A;  1W4S A;  2P4T A;  1SEM A;  4PJN A;  5KYU B;  4ZGE B;  4P5N A;  1N5Z A;  1K73 R;  4M75 E;  4E7Z A;  1FMV A;  2EKH A;  3QO3 A;  4F04 B;  2VC8 A;  1NEG A;  2RJE A;  4C5E A;  2ED1 A;  1VQP A;  2WAC A;  4E7H A;  5EC7 A;  1X6O A;  2BIV A;  4B9X A;  3G6E Q;  4PJO B;  3M0P A;  5L23 A;  4B6M A;  1AHJ B;  2EYQ A;  1KFZ A;  4FYX B;  1RAA B;  4IUQ A;  2JMC A;  2LNH B;  1VQO A;  4GBQ A;  2EFI A;  1OPL A;  2B86 A;  1VQM A;  2EJF A;  3OYI A;  1WJS A;  3G6E T;  4ZTF A;  1G2B A;  2MI6 A;  2O9S A;  1SHF A;  2KNB B;  3I56 T;  3FRN A;  2QYZ A;  3EG9 A;  1NJI U;  4HCB A;  2X51 A;  2V1Q A;  2KVQ G;  1PSE A;  1Y0M A;  2AKL A;  2DYB A;  3U23 A;  1VQM T;  3R6N A;  1WHH A;  3OYJ A;  1UJY A;  2RI2 A;  5HY6 A;  4RKU E;  4EPC A;  4CI0 C;  1KHC A;  5FLX E;  5CR2 A;  1VQ6 T;  2NUP B;  5CVI A;  1YI2 A;  4B9W A;  1Y57 A;  2D0N A;  3VUB A;  3CD6 Q;  1W2B S;  1UEC A;  3OB9 A;  1G3W A;  3SWN A;  3VS3 A;  1MMG A;  5A0D A;  2YRC A;  4C8Q F;  1M90 R;  2HBW A;  3HFO A;  1U06 A;  2DL3 A;  2RN8 A;  2M51 A;  3CC7 T;  2DM1 A;  2KYB A;  4E7I A;  2L3S A;  2ZCF B;  1PM3 A;  2QXF A;  4C8Q A;  2YRD A;  2QQA A;  1GCQ C;  2QEX T;  3JCM g;  2DA9 A;  3UWN A;  3CC7 Q;  2LNV A;  2MF2 A;  3JCM P;  1K73 C;  4QT7 A;  5D6X A;  4J5Y A;  3SWN B;  3UA6 A;  3EGX B;  3PNW C;  3HL8 A;  2EYW A;  1Q7Y R;  3A8L B;  4C0D C;  5AT1 B;  1NPP A;  2XK0 A;  1WGS A;  2PUK B;  2DTI A;  3FLG A;  3CCR T;  4MDW A;  3G4S T;  4VUB A;  4KT0 E;  3T9N A;  3TVT A;  4OMP A;  3FEO A;  4BDZ A;  4WCI A;  2BE7 D;  1VQ9 A;  1VQL T;  2YDL A;  1AOJ A;  2EYY A;  4E6R A;  1QWF A;  5KYX B;  1JO8 A;  5DM7 R;  3CBO A;  2GQV A;  5GMK l;  3L2V A;  1NYF A;  4M7D E;  1CKB A;  1PG5 B;  1ARK A;  4GLK A;  4IUT A;  4F14 A;  3HHT B;  4OP0 A;  3S3N A;  1LOJ A;  4QVC A;  2Y90 A;  3GP8 A;  3H41 A;  2DXU A;  3J81 E;  3LGL A;  2DIQ A;  1IHW A;  3E1S A;  1NJI C;  4AFU C;  1MHN A;  2DF6 A;  2VWF A;  2EW3 A;  1IXD A;  1YHQ T;  4AFS C;  3L42 A;  2DXT A;  3VS7 A;  2MOX A;  2K3Y A;  4A53 A;  3MET A;  1QWE A;  2K57 A;  5CAI A;  1M8V A;  5I2M A;  4AMC A;  4C8Q C;  3S3O A;  4PLL A;  2YLC A;  2WSE E;  2MIO A;  4PK4 A;  4KGZ B;  2A0F B;  3EGU A;  2HQE A;  4MZM A;  1WQ7 A;  3H0H A;  3URG A;  5GAM f;  2QTV A;  1VQ7 Q;  3NFC A;  2KEA A;  1LCK A;  1Q7Y C;  2K7A A;  2BZ8 A;  3CMA T;  2E5K A;  3OYF A;  1Q81 U;  1TXQ A;  2DX1 A;  1UDL A;  2K5I A;  4DBQ A;  1G8X A;  2COY A;  2GFA A;  2KBT A;  1Y07 A;  4J6Y A;  2JS2 A;  2V26 A;  4XTY A;  3OS1 A;  1VQN A;  2E4H A;  5GAM d;  2DRK A;  2CP0 A;  2EPD A;  5GAO q;  1Y96 A;  3CCM Q;  2ROT A;  1JJ2 S;  5KYX A;  3HRT A;  5LJ5 g;  4DBF A;  4M78 D;  2OTL Q;  3M59 A;  1ZBX A;  2K3X A;  2DZC A;  2KAF A;  1MMN A;  4E7S A;  1UG1 A;  3I5S A;  5I11 A;  2LZ6 B;  2H8H A;  1WFW A;  4X34 A;  4FU6 A;  4ESR A;  1T3L A;  3LH5 A;  4M4Z A;  2FZK B;  5KYY B;  1K1Z A;  1JB0 E;  2LJ3 A;  3OSS C;  5GAM j;  3CME Q;  1U5S A;  1QVF A;  3QWX X;  4FW2 A;  3PE0 A;  4ZGJ B;  5IXB A;  2DIG A;  3TEE A;  2DTH A;  2M02 A;  4HT9 A;  1W2B A;  1VQ8 Q;  1X69 A;  1PC0 A;  1UGR B;  4N4H A;  3M0Q A;  3P8B B;  5J39 A;  3IQL A;  1KQ1 A;  2HZY A;  4IUP A;  4FCY A;  4J9G A;  4CC4 B;  2DAQ A;  4KH1 B;  1HK9 A;  1M30 A;  3AHU A;  3PVL A;  4Y92 A;  1VOM A;  1KHI A;  1T3S A;  2X35 A;  2VXF A;  1HD3 A;  3OYM A;  1PD0 A;  3I55 T;  1YJ9 Q;  1HXD A;  1XQH A;  3KUF A;  1QCO A;  3M57 A;  5EG2 A;  2FPE A;  5IAY A;  2SRC A;  4FYY B;  1K8A R;  3A1P A;  4M7D A;  1X2Q A;  4X9D A;  1CSK A;  5LJ5 e;  2OJ2 A;  4M75 A;  2QA4 Q;  1IHV A;  5DLO A;  1U1T A;  4M7D F;  5CKE A;  4JRI A;  1YIJ A;  4BI4 A;  2FHD A;  4M75 F;  5GAN f;  2RJF A;  3A8G B;  3EHR A;  4JS5 A;  3EFR A;  1M90 U;  2QQR A;  1AZE A;  1ZUU A;  1UE9 A;  2RI5 A;  1QKW A;  4RG2 A;  5GAM e;  2VKN A;  5CKF A;  2RA2 A;  3PFS A;  2XHC A;  1BBZ A;  3LGF A;  2KRN A;  4QVD A;  1UUE A;  2MAM A;  2DJZ A;  4JS4 A;  3VYG A;  3S3M A;  3MJX A;  3TCJ A;  4C8Q E;  3H6Z A;  5J3B A;  4LUE A;  2ESW A;  5IT9 E;  1W6X A;  3GNG A;  3JCM V;  2EAY A;  2XG8 D;  1VQN T;  3HPW A;  1GL5 A;  3CC4 Q;  1R0B G;  1RLP C;  4WF2 A;  2E3I A;  1PWT A;  2HDA A;  2KI7 A;  2CP6 A;  3JCM h;  2FZG B;  3JB9 F;  2QGF B;  2EQJ A;  1YWP A;  2PVO B;  1WDX A;  3MEW A;  2HQX A;  4E7L A;  1AWW A;  2MMP A;  2PVG B;  3JCM e;  5FU6 B;  3ZEH A;  4RTX A;  1JQQ A;  4X9C A;  2A3L A;  2E12 A;  2QEX Q;  3RDV A;  1BYM A;  3X25 B;  1YJW A;  1VQK A;  4MML A;  4RCC A;  1TUD A;  4XQ3 A;  1JJ2 P;  4MZP A;  3EAE A;  2C0I A;  2NLU A;  2ZPH B;  3M0R A;  2CP3 A;  4M78 C;  1WHK A;  4LD6 A;  2AK5 A;  2EQM A;  1YJW T;  4IUU A;  3LWH A;  4PJO C;  3QJ6 A;  2GBQ A;  2ZPE B;  1H92 A;  3RIR A;  5GAN 5;  1K9A A;  2DJQ A;  3GLX A;  2CZ7 B;  5HK3 A;  5LL6 S;  1MND A;  3OMG A;  3RUX A;  1YIJ Q;  1XJW B;  2KXD A;  1AEY A;  3EGD B;  3GOX A;  3SB2 A; 
#chains in the Genus database with same CATH homology
 4B9X A;  1IRE B;  2ZPF B;  4PJO B;  3WVE B;  2P0K A;  2DVE A;  2CZ1 B;  2M16 A;  5FRO A;  3J80 E;  4LD9 K;  3C95 A;  3QKJ A;  1VIE A;  1AHJ B;  3DLL A;  3CCL T;  4NS5 A;  2LRQ A;  2EYQ A;  2L8D A;  4C8Q G;  3VU3 C;  3LWI A;  1Q86 U;  4IUQ A;  2VV5 A;  5LJ5 h;  3OBW A;  1VQO A;  3CD6 T;  2EFI A;  4XU0 A;  2V8J A;  3OYA A;  1ZHI A;  1VQM A;  2EJF A;  3OYI A;  1M9S A;  1WJS A;  2E6N A;  3CBM A;  4XTX A;  5GAO n;  3G6E T;  4ZTF A;  1JBM A;  1QVF S;  1JRI A;  1M1F A;  2E64 A;  2FL7 A;  2MI6 A;  3CCM A;  2QEX A;  4II1 A;  4JUV A;  1YJN A;  2E1H A;  1NZ9 A;  3I56 T;  2R5M A;  3OYE A;  2E6Z A;  3FRN A;  4FT2 A;  1N6A A;  2YRV A;  3M4Y A;  3I56 A;  1WJR A;  5GMK j;  1Q81 C;  3JCM W;  1QP2 A;  1YJN T;  1NJI U;  3M58 A;  5CIU A;  4HCB A;  4BI3 A;  4OGC A;  4M78 G;  2KVQ G;  2XDP A;  3OA6 A;  4F7U G;  1PSE A;  2CYZ B;  1QP3 A;  3V8L A;  3JCM X;  1VQM T;  2Y4Y A;  2YLB A;  3HSB A;  4XTZ A;  3OYJ A;  2RI2 A;  5HY6 A;  4RKU E;  1K8A C;  4EPC A;  4CI0 C;  1KHC A;  5FLX E;  5CR2 A;  1VQ6 T;  4ZGD B;  1UGQ B;  1YCY A;  3A5Z B;  5I21 A;  4M77 A;  2DXC A;  5CVI A;  1YI2 A;  4RMO A;  3UDC A;  2CZ6 B;  1LJO A;  4QVZ A;  4B9W A;  5CQY A;  4LDX A;  4OB0 B;  2PUO B;  1BI0 A;  5FU7 B;  1YI2 T;  3MP6 A;  3VUB A;  5GAO l;  3CPW A;  3GIB A;  5LJ3 e;  2K5L A;  1W2B S;  3OB9 A;  4A4E A;  4OB3 B;  1UB4 A;  1G3W A;  3SWN A;  3OMC A;  5A0D A;  5CK9 A;  4JLI A;  5GAN h;  4C8Q F;  4A4K A;  2CGH A;  4M78 B;  4M7A D;  3HFO A;  2E5Q A;  4IKF A;  3M53 A;  4BDY A;  3CC7 T;  2X4Y A;  4N4I A;  4XTU A;  5GAN e;  4E7I A;  3O8V A;  3QUI A;  3E9G A;  4HCZ A;  4OVA A;  2XDB A;  2ZCF B;  3PMT A;  3QBY A;  2O4X A;  3V8J A;  1G3T A;  4M78 E;  4MZT A;  4ME7 A;  2PVD B;  1K9M C;  2QXF A;  3LH0 A;  4C8Q A;  3QPH A;  1VQ4 A;  1N8R C;  3OS5 A;  5GAM g;  1QVP A;  3OYN A;  2QQA A;  2QEX T;  3RKY A;  4M77 C;  3JCM g;  4PJO A;  3UWN A;  3CXC S;  2RK1 A;  2FB7 A;  5D6W A;  4ATO A;  2LNV A;  3MHX A;  3NTK A;  3JB9 I;  4E7J A;  3OW2 A;  5GMK e;  2E70 A;  4F7U F;  2L89 A;  2MF2 A;  4EMK A;  2BKD N;  3CC2 A;  3CCQ A;  3MCA B;  3JCM P;  1K73 C;  3JSC A;  2JNG A;  4R55 A;  3OYC A;  3FC3 A;  1S72 T;  1Q82 U;  2XD0 A;  4N0A C;  3A8M B;  3DLM A;  5D6X A;  3WVD B;  4J5Y A;  4L6V 5;  2RJC A;  3SWN B;  1SSF A;  2YHT A;  3PNW C;  4L5G A;  4BY6 B;  3MO8 A;  4PJO F;  4C92 E;  3KXT A;  1G5V A;  4GY5 A;  3HFN A;  2LCL A;  3HL8 A;  2RI3 A;  5GAO p;  2LDM A;  2IVW A;  1VQ9 T;  4F7U A;  3A8L B;  2KSS A;  1X01 A;  4C0D C;  5GMK h;  4NL3 A;  2AHJ B;  1NPP A;  2XK0 A;  3JCM b;  1WGS A;  5CO7 A;  1D3B A;  1VQ5 T;  2PUK B;  1Q7Y U;  1BIB A;  2M1H A;  2DTI A;  3FLG A;  3HRU A;  4MDW A;  3TRE A;  5LJ5 j;  3CCR T;  1UEB A;  1U8R A;  4QQD A;  3G4S T;  4VUB A;  4KT0 E;  3L1A A;  3T9N A;  3RKX A;  2RHI A;  4J8O A;  1BIA A;  3FEO A;  2O01 E;  1YBY A;  4BDZ A;  1VQ9 A;  4M77 D;  3PT9 A;  2RB6 A;  4F7U E;  1M1K U;  4EDU A;  1VQL T;  4C0F A;  3UPU A;  3MP1 A;  1DJ7 B;  4Z02 A;  1VUB A;  4M7D B;  2EIF A;  4MDX A;  3QDR B;  3X20 B;  2GFU A;  3EFS A;  3BDU A;  1BKB A;  5DM7 R;  3CCQ T;  4PNO A;  3PIO A;  4HA8 A;  3G6E A;  5LJ5 f;  3CBO A;  2GQV A;  5GMK l;  3L2V A;  1K9M U;  3LLR A;  3VYH B;  4M7D E;  4A4G A;  4DQ2 A;  1VQO T;  5GAN j;  1VQ7 T;  4V2S A;  1G3S A;  3QXE B;  3M5A A;  1XOV A;  3TU4 K;  3NTH A;  3JCM Q;  2D6F A;  4GLK A;  1FXX A;  4IUT A;  4M77 G;  5LJ3 g;  5GAN 2;  1M1G A;  2JN0 A;  3HHT B;  4OP0 A;  1JJ2 A;  1QVG S;  2DK3 A;  3S3N A;  5FU6 C;  3VKI A;  1LOJ A;  1IZ6 A;  4LDY A;  4M75 D;  4C92 A;  1LNX A;  2ZZD A;  4QVC A;  2Y90 A;  3GP8 A;  4PLI A;  2DXU A;  3J81 E;  3LGL A;  2DIQ A;  4JRP A;  3E1S A;  2RM4 A;  4CRI A;  1NJI C;  4C5G A;  3R6O A;  4C8Q B;  2RJD A;  1MHN A;  5KE2 A;  1KC8 U;  4BE1 A;  4R56 A;  3OS2 A;  1GXI E;  1FX7 A;  1R8O B;  3OY9 A;  3CCR A;  3OS0 A;  1M1K C;  4M7A C;  3QSU A;  1B34 A;  5GAO r;  1M90 C;  3MEA A;  1YHQ T;  3L42 A;  3CCS T;  2DXT A;  3V7C A;  2D9T A;  1QVG A;  4ZTJ A;  2K3Y A;  4BE2 A;  5IN1 A;  3P8H A;  4A53 A;  3MET A;  1YIT T;  3BDL A;  5HKC A;  1VQK T;  1OZ3 A;  2K57 A;  2R57 A;  3H8Z A;  4EMG A;  3FJP A;  5CAI A;  3INZ A;  3JAM E;  2FYK A;  4HCC A;  1M8V A;  3DB3 A;  5I2M A;  4C92 C;  3Q1J A;  1V29 B;  4KBM B;  2X4W A;  1G3Y A;  4C8Q C;  5HK0 A;  3CCE A;  3L2Z A;  5LJ3 d;  1RL2 A;  4PLL A;  2YLC A;  4ZN1 A;  2WSE E;  2XIC A;  3QZ9 B;  3CCU T;  2K5F A;  2JOY A;  4JRK A;  1Q86 C;  1UGS B;  2PU9 B;  2ZPI B;  3LX7 A;  3RES A;  4C5H A;  2HQE A;  4EMK B;  2MWO A;  3FDR A;  4MZM A;  3OYK A;  2WSF E;  1WQ7 A;  2JZ2 A;  2IG0 A;  5GAM f;  3URG A;  1YIT A;  5LJ3 j;  1MGQ A;  3A8H B;  5J26 A;  3NFC A;  2LVM A;  3V7R A;  4M77 F;  5A0L A;  3QII A;  2V8I A;  2X4X A;  3NTI A;  3BW1 A;  1Q7Y C;  2EQU A;  4M75 B;  5GAN g;  3CMA T;  2VYT A;  1XTD A;  3OYH A;  3OYF A;  4M7A G;  1Q81 U;  5AYF A;  2K4Y A;  1FWZ A;  1RI0 A;  4J83 A;  3M9Q A;  3CEY A;  3MEU A;  2K5I A;  4XTW A;  4A4F A;  1WNL A;  3RMQ A;  4NOY A;  4C92 D;  4JRQ A;  3RKW A;  3RER A;  2GFA A;  2A7Y A;  2LCC A;  1Y07 A;  2QQB A;  4J6Y A;  3JCM f;  4M75 C;  1K73 U;  4C0G A;  3DB4 A;  3WXM B;  1Q82 C;  2F69 A;  2P0Q A;  2RD1 A;  1TH7 A;  4XTY A;  3OS1 A;  1VQN A;  4KUI A;  5GAM d;  4YTL A;  5GAO q;  3JCM J;  4M75 G;  2QA4 A;  4BAC A;  1Y96 A;  5GAO m;  1JJ2 S;  1KQS A;  3GF5 A;  1M5Q 1;  3HRT A;  4J6W A;  5LJ5 g;  5C0M A;  4OGE A;  3C4S A;  4DOW A;  5GAN 6;  2QQ9 A;  4M78 D;  4M7A B;  5A2Q E;  1KG1 A;  1D3B B;  3C94 A;  2OTJ A;  4PJO E;  3M59 A;  1ZBX A;  2K3X A;  2DZC A;  3JRZ A;  2KAF A;  2GCX A;  4FSX A;  3CMA A;  1WJQ A;  2XU8 A;  3QYH B;  3FB9 A;  3CCJ A;  1VQ4 T;  2GF7 A;  3LYI A;  3X28 B;  3S6W A;  3JCM d;  4X34 A;  3SWN C;  4FM4 B;  4FU6 A;  5DY9 A;  3MP8 A;  4E7K A;  4XU1 A;  4C5I A;  1I5L A;  2ZGW A;  4PKC C;  2WSC E;  5GAM h;  3G71 A;  2M0O A;  1JB0 E;  4C8Q D;  3CCJ T;  4BUG A;  3CCM T;  4JJN K;  3OSS C;  5GAM j;  1KC8 C;  4M7D D;  4IUV A;  4OMF B;  4E47 A;  1OZ2 A;  1QVF A;  4N4G A;  1I4K 1;  4ZGJ B;  2DIG A;  3J7A F;  2E41 A;  3X26 B;  3TEE A;  2DTH A;  4HT9 A;  3CCV T;  4JDS A;  1VQ8 A;  1W2B A;  2EJG A;  3CCL A;  4FT4 A;  1QW1 A;  3CPW S;  1KQS S;  2OTL A;  1UGR B;  4N4H A;  2DKG A;  2DPP B;  2P0P A;  4BD3 A;  2LC4 A;  2M9U A;  3L2R A;  2RHY A;  3P8B B;  5KCH A;  5J39 A;  5LJ5 d;  3OYY A;  4Y28 E;  1KD1 C;  1KQ1 A;  1ZQ1 A;  3F70 A;  2DZ9 A;  4UC4 A;  4IUP A;  1I81 A;  2OTL T;  1VQ6 A;  3LW5 E;  1VIF A;  4ZN3 A;  4J7I A;  4XTV A;  2EQK A;  1VQ8 T;  1Y96 B;  1U1S A;  2DAQ A;  1S72 A;  4BI8 B;  3JB9 H;  2QQS A;  3CC2 T;  1P92 A;  1HK9 A;  4KUL A;  3VJP A;  3AHU A;  2XKO C;  3ER0 A;  2EJ9 A;  2DEQ A;  2HNI A;  3CPF A;  3FIF A;  1KHI A;  2XID A;  2I2L A;  2X35 A;  2VXF A;  3RMS A;  2RK2 A;  3VV0 A;  3HRS A;  4M78 A;  5CKD A;  5GMK m;  3OYM A;  3QZ5 B;  3S3O A;  3JCM c;  2EKO A;  3I55 T;  2D0Q B;  1BI3 A;  1YJ9 A;  4XU3 A;  4BY6 C;  1HXD A;  1NE8 A;  1XQH A;  3KUF A;  3UT1 A;  3V7S A;  5GAN 7;  2RHZ A;  1BI1 A;  3M57 A;  5KH6 A;  5EG2 A;  1VQ7 A;  3JB9 D;  4HKE A;  4Q5W A;  2CKK A;  2LT1 A;  3OQ5 A;  5IAY A;  2DO3 A;  4OB1 B;  3GNF B;  4A54 A;  3L2Q A;  3P8D A;  3CCE T;  3JB9 G;  3OSV A;  1H64 1;  4M78 F;  5KE3 A;  2K2V A;  4M7D A;  2ZPB B;  4M7A F;  2JTF A;  4X9D A;  1KD1 U;  2LTO A;  3M56 A;  5LJ5 e;  4KUD K;  4FIB A;  1OYX A;  2HAX A;  2VUB A;  4M75 A;  5LJ3 f;  3OYG A;  3CCS A;  1N8R U;  1VQP T;  1YHQ A;  5DLO A;  3OBY A;  4L59 A;  1U1T A;  4BE0 A;  2DD5 A;  3G4S A;  2F5K A;  4A4H A;  4M7D F;  3VUZ A;  3QG1 A;  5CKE A;  4C92 F;  2OAU A;  4JRI A;  4XK8 E;  4OB2 B;  4BI4 A;  1YIJ A;  2HD0 A;  1I8F A;  3HKS A;  4QQ6 A;  5FRN A;  2JTM A;  4IUR A;  2FHD A;  2RO0 A;  4M75 F;  4RCB A;  4DOV A;  5GAN f;  3ZBD A;  3PIP A;  3OYL A;  2F5T X;  2L3R A;  2RJF A;  3G71 T;  3CCV A;  3A8G B;  4MMK A;  4JS5 A;  4J6X A;  3CC4 A;  1PSF A;  3EFR A;  2QQR A;  3QJY A;  1M90 U;  4LDV A;  2KQW A;  4N0A A;  1N9S A;  3BFM A;  4M7D C;  2O4X B;  5M9O A;  4PJO D;  2RI5 A;  2E10 A;  4NL2 A;  2Y4X A;  4RG2 A;  1EIF A;  5GAM e;  5CKF A;  2RA2 A;  5A0G A;  3PFS A;  2XHC A;  2H3J A;  3LGF A;  3CCU A;  5D6Y A;  3CXC A;  2BUD A;  4C92 B;  3KBG A;  4QVD A;  2OTJ T;  2EWN A;  2MAM A;  5FRM A;  4LDU A;  1O9S A;  2DJZ A;  4JS4 A;  3QHS A;  3VYG A;  3OYB A;  3S3M A;  1X75 C;  5DLQ E;  2FVU A;  1YJ9 T;  3DKM A;  3TCJ A;  4ELY C;  5GAN d;  5FU7 C;  4C8Q E;  3H6Z A;  5J3B A;  5CCA A;  3PTA A;  2QA4 T;  5IT9 E;  3GNG A;  4EMK C;  3JCM V;  2EAY A;  3G7Z A;  3V8K A;  4C0D B;  2XG8 D;  3PGG A;  4EMH A;  1VQN T;  2ZPG B;  1BI2 A;  2XI9 A;  3HPW A;  3E19 A;  4DA4 A;  2QDY B;  4LDW A;  3MEV A;  4QW2 A;  2XDD A;  3HP9 A;  5GMK i;  3QYG B;  2L5Q A;  4TVR A;  5LJ3 h;  4WF2 A;  4BB7 A;  1YIJ T;  3CME T;  2LT4 A;  5GAN 4;  3JCM h;  3JB9 J;  3JB9 F;  4XU2 A;  3GPL A;  3CME A;  3PMI A;  2DTO A;  1VQ5 A;  5GAN 8;  4HT8 A;  2EQJ A;  2PQW A;  3ZFJ A;  2PVO B;  3MEW A;  2VGN A;  2HQX A;  4E7L A;  5CQX A;  4M7A E;  2MMP A;  2PVG B;  3JCM e;  2E65 A;  4JLG A;  5FU6 B;  2LQ8 A;  3ZEH A;  3X24 B;  3OYD A;  1K8A U;  3BY7 A;  1O75 A;  4M77 B;  5CKH A;  2A3L A;  4X9C A;  2QI2 A;  4O5V A;  2E12 A;  2DD4 A;  4RG8 A;  2CS7 A;  1Y71 A;  3A8O B;  1N27 A;  1WQW A;  3X25 B;  2VXE A;  2MWP A;  1OI1 A;  1YJW A;  4MML A;  1VQK A;  3N5B B;  1KQ2 A;  2JUF A;  2X4J A;  2R58 A;  3M4G A;  4RCC A;  2HBP A;  5L8R E;  4FL6 A;  3SDZ A;  3ASK A;  2R5A A;  4F7U B;  2RH2 A;  4XQ3 A;  4M7A A;  4M77 E;  1UGP B;  4MZP A;  3EAE A;  2KMT A;  2NLU A;  2ZPH B;  5KCO A;  1WPY A;  3M54 A;  2V8K A;  1Y7X A;  3OW2 S;  3SFM A;  4C92 G;  4M78 C;  2C06 A;  4C0Z A;  4PL6 A;  4M7D G;  3ME9 A;  4LD6 A;  2RHX A;  3C12 A;  2B8A A;  2EQM A;  2KDS A;  3CBP A;  2QTX A;  4D6W A;  1YJW T;  1H3Z A;  3I55 A;  2VGM A;  3SD4 A;  4IUU A;  3LWH A;  4PJO C;  4J7F A;  3CC4 T;  4QQG A;  4XAX B;  2KK4 A;  2G3R A;  3QJ6 A;  5I2S A;  1VQL A;  4OF1 A;  4Y91 A;  5GAN 3;  2RHU A;  2ZPE B;  3CC7 A;  4PJO G;  2JVV A;  2KY9 A;  2LQK A;  3L2W A;  1N9R A;  1W4S A;  2P4T A;  2LX9 A;  3RIR A;  5GAN 5;  3CD6 A;  1XNI A;  4O6J A;  3GLX A;  2CZ7 B;  4P5N A;  2DXB A;  4ZGE B;  5C6S A;  5HK3 A;  5LL6 S;  3L2U A;  2CZ0 B;  3OMG A;  4M75 E;  5CKB A;  3RUX A;  3QO3 A;  2VC8 A;  2RJE A;  1M4Z A;  1NPR A;  4C5E A;  4ELZ C;  1BYM A;  3M55 A;  3GOX A;  2WAC A;  4E7H A;  1VQP A;  1B34 B;  3SB2 A;  3E9F A;  1X6O A;  2BIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...