5CKEA

E.coli mazf e24a form iia
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
101
Chain Sequence
VSRYVPDMGDLIWVDFHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 27
structure length 101
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckeA00
2MF2A 4ME7A 5CQYA 3G7ZA 3HPWA 2VUBA 5CKEA 5CO7A 4OF1A 3TCJA 4ELYC 5CR2A 3JRZA 5HK3A 1M1FA 1NE8A 5HK0A 5CCAA 4HKEA 5DLOA 5CKHA 5CKDA 1UB4A 4ELZC 3VUBA 2KMTA 4VUBA 4MZMA 5CK9A 5CQXA 1VUBA 4MZPA 4MDXA 5HKCA 4MZTA 5CKFA 2C06A 1X75C 5CKBA 3JSCA 3NFCA
chains in the Genus database with same CATH superfamily
3VYGA 3PFSA 1M90U 4BY6C 1N6AA 5FU7C 2DRKA 2O9VA 1JRIA 4FYWB 3V7SA 2CT4A 2E65A 4DBQA 2XICA 2RJDA 4M7AA 4KBMB 2MCNA 4QVCA 3VS0A 3OYMA 3EH1A 3CXCP 1JQQA 4JDSA 1PD0A 4O5VA 1QP2A 4KGXB 3OB9A 1SEMA 4OB0B 3OS2A 3L2RA 1RAFB 2A37A 4E7SA 3F70A 5IHIA 2DTOA 2RHIA 2RHZA 2L89A 1B07A 2YLBA 4N0AC 3OSVA 3A8OB 3JB9D 4E6RA 1FX7A 1M30A 1NJIU 4GLKA 1WA7A 4BI4A 3I56T 4J9EA 3JCMd 4RTWA 3REAB 3D7SB 3CCSA 4PJOA 2QGGA 3I5SA 4BUGA 1QVGA 4BD3A 5FRMA 1W70A 3LH5A 4LDXA 2K79A 3LH0A 4BE1A 5I11A 4EPCA 4FYYB 1QKWA 3ZFJA 3NGPA 1W2BS 4RUGA 1ZLMA 3PTAA 2RJFA 1JB0E 3QWYA 5CCAA 3BE3A 2YSQA 1LNXA 1ARKA 1IREB 2JTEA 2XMFA 2LC4A 2MK5A 4M7AG 3UPUA 1Q7YC 4M78F 4C5IA 1WHHA 2D8HA 5LJ5g 3NMZC 3H41A 3DLLA 2KDSA 4XU3A 5DLQE 2CP2A 1GBQA 2O4XB 3CMET 4E2FB 1K4US 5GMKj 2C0OA 1VQOQ 4DOWA 3I5RA 1O9SA 2JMAA 2Y90A 2O01E 3RKWA 3EG3A 3CCLA 3CPFA 1GCPA 2DO3A 1U06A 4EMGA 2KR3A 4E7LA 1VOMA 4KH0B 4AFUC 2IIMA 2K5LA 1KJWA 3OYBA 2QA4Q 1K73C 2DL8A 4ZGEB 2DZ9A 1X6BA 1YCYA 2DFUA 2PVGB 4PJOG 2OTLQ 1M90R 2ESWA 4J9FA 1I8FA 8AT1B 5GAMh 2KMTA 4MZPA 4LE9A 4QT7A 4E7HA 4OMOA 3SD4A 3CC7T 2DBMA 5GMKi 2DPPB 3CCMA 3LWHA 2DD4A 4Q5WA 3J7AF 3CD6A 3L2WA 1D09B 3EG9A 2AZVA 2COZA 1H641 4M78D 5J26A 1UUEA 2JMCA 2X4XA 1PRMC 2DK3A 1BB9A 1SKUB 1R0CB 1VQ5A 2JT4A 1B34A 2DXUA 1GL5A 3JCMJ 4E47A 3OMCA 1Q81C 2VVKA 1ABQA 1VQ6T 2LX7A 3I9QA 1NYFA 1X2QA 1ZUKA 1AWXA 2EJ9A 1YNZA 1TUCA 1K9MC 4BI3A 1UB4A 1NJIR 5GMKe 4JRQA 3G71Q 4AG2C 3RERA 4KGZB 4KT0E 1FMVA 3G4SQ 2EYZA 3RUXA 2EGAA 3MPUB 2JM8A 3FJPA 1OZ3A 2YUQA 3OY9A 5FW9A 2A28A 4AFSC 2OJ2A 4M7AC 2QGFB 2J6KA 1JO8A 1YITA 3MP1A 3V8JA 2CZ6B 2YUPA 1SPKA 2JN0A 4XU0A 5IXFA 2HQHA 4XTZA 3DLMA 1P92A 3S6WA 1BK2A 2FRWA 2NLUA 5CQXA 3CC4T 2PUKB 4M77F 1PKSA 3QJ6A 1VQLA 1I4K1 3A5ZB 5FU6B 3G7ZA 1Y57A 5HY6A 4LN2A 2HAXA 1QLYA 2LQWA 2QYZA 1BCMA 4L5GA 2DM1A 3VRYA 1VQPQ 2CUBA 2EW3A 1QCFA 3EGXB 1KD1C 5J39A 3EHRA 3JCMQ 2E1HA 2RQTA 4C92A 4PJOC 1BYMA 3EFRA 2MIOA 5A0GA 1YJWT 4DBRA 4OF1A 5CAIA 3SWNC 2R5MA 1CKBA 1R77A 5J3BA 3SDZA 3L2UA 1FMWA 2DF6A 4Y28E 3UATA 3VS5A 1M4ZA 4HA8A 3MO8A 2H3EB 2JS2A 4NS5A 3OYEA 5KYWA 4M78E 3KFVA 1M2OA 3CCRA 1X69A 5GANg 3CCQQ 4RG2A 3CC2Q 4PKCC 5LJ3j 4LNPA 3G6ET 2JS0A 3CCLT 3OYDA 3EG2A 1KC8R 1MUZA 1NYGA 4J9BA 4C0GA 4OP0A 1YN8A 3VKIA 4OMMA 2IG0A 4ZN3A 1AT1B 3MP6A 1HD3A 3NTKA 2HDAA 1U3OA 3EHQA 4QVZA 2ED0A 1U5SA 4QQDA 2QTXA 4J9CA 3HHTB 4JRIA 3CD6T 1UGRB 4EMHA 2ZGWA 4KH1B 1ZSZA 3QZ5B 1X01A 2DJZA 3JAME 2GFAA 2L3SA 2C06A 2EKHA 1VQ9T 2JZ2A 1X43A 1SRLA 1YHQQ 2KGTA 2NUTA 5FWBA 1VQ5T 4FCYA 4IIMA 1NPPA 3LGLA 3M0PA 2OI3A 4C92G 4OGEA 2XK0A 2HMAA 3OS1A 3GLXA 5LJ5f 1X6OA 2CSQA 2EAYA 2MWOA 1NG2A 1VQNQ 4MZMA 5KYXA 1YJ9Q 4FU6A 2KEAA 1Q7YU 1N27A 3A8GB 4M75A 1RL2A 2EPDA 1OX8A 5CIUA 1GRIA 2FO0A 4MMKA 4PJOF 2JNGA 4M78B 3QJYA 4RKUE 3MEAA 1S1NA 3BDUA 1OULA 4BY6B 5A2QE 5FU7B 1QMCA 1WHMA 2PU9B 3OS0A 4M7AD 2ZPHB 4D8DA 5KYXB 1JJ2A 3GNGA 1BI1A 4N0AA 2I2LA 2KT1A 3QDRB 1Q82C 1NLOC 4FSXA 1K73U 1IO6A 2CP7A 4GLMA 4WTOB 3OYJA 3M5AA 2EGEA 2VXFA 3OW2A 2NUPA 3GF5A 4KRTA 1RI9A 1WI7A 2M02A 1K9AA 1A0NB 2HQEA 3M57A 1C1AA 5GMKh 4PJNA 3V8LA 1VQ8A 1HK9A 2E6NA 1QVFP 3RMQA 1KG1A 2XIDA 4KULA 1GCQC 1T3SA 1MGQA 2QI2A 2Z0WA 4F17A 4PJOD 2YLCA 3LGFA 1PSFA 3C95A 1RUWA 3CCJQ 2EQIA 4F7UG 1OU8A 2W10A 3E19A 4JUVA 3BDLA 1Q81U 4IKFA 1AOJA 1IGUA 4J9IA 2RF0A 4Z89A 1QCOA 2YRCA 4M75G 2LRQA 3QO3A 2R57A 3CCRT 2CSIA 3SEMA 1K8AU 3TU4K 2D1XA 3CPWA 2G6FX 1M27C 3QUIA 1TWBA 1SHGA 2ZPGB 1K9MU 4PJLA 1PNJA 1KC8C 4PLIA 2M51A 4C92C 1VQMT 2ZAEA 4C0FA 4Y91A 6AT1B 2RMOA 1OZ2A 3SHWA 3QWXX 4DEXA 1TUDA 1N5ZA 1W6XA 4OMPA 4DOVA 3TCJA 5GMKl 3C94A 5HK3A 4M7DG 1QCNA 2DA9A 5GMKm 1NE8A 4LD9K 1YIJA 2PNIA 2K2MA 4OMQA 5A0LA 3A1PA 2OTJA 2LNVA 4J83A 1VYVA 1NEBA 4GBQA 2IPOB 1UEBA 2BUDA 5LL6S 2QASA 2GBQA 4QW2A 3HKSA 4ESRA 3I55Q 1AZEA 4M7AE 4C8QG 2DEUA 1MMDA 3G1JA 4A53A 1JU5C 3WVEB 2RHYA 3JCMb 1M1KR 3M0QA 1KD1U 2OTLA 1SSFA 1VQ4Q 4XTXA 2K9GA 3OYGA 4WF2A 3X26B 3CCUA 3NTIA 1M2VA 1UGVA 3EFOA 5GANf 2E4HA 1ZSZC 1FWZA 4XAXB 1N8RU 4XTYA 3CCVQ 1HYOA 3JB9F 3VRZA 4JPBW 1YI2A 1QVGP 1IHWA 2XI9A 5GAOn 2VGMA 2P4RA 2JOYA 4XQ3A 5IXBA 1YJNQ 4JJDA 3KUFA 4PJOE 2XHCA 2KK4A 4O6JA 2D0QB 2J05A 2FVUA 1XOVA 1EZZB 2A08A 2JM9A 3CMAQ 2HZYA 2BZYA 1Y07A 3RIRA 1AVZC 2VYTA 2QXFA 3EFOB 1KQ1A 5FRNA 4M75C 3ASKA 4WCIA 2FEIA 1DJ7B 2LQNA 2J7IA 2EYXA 2E64A 4C92F 2RQUA 2A0FB 2L3PA 3H0FA 3FJ5A 4B6MA 4L59A 2K6DA 2QQSA 2COWA 2ENMA 5LJ5e 3G4SA 1XNIA 3VJPA 1VQ8T 4J5YA 5HK0A 1XTDA 1D3BA 5LJ3h 1ZX6A 2LTOA 3OYCA 1BI0A 1RLPC 4M7DC 1B3QA 3PIOA 1OX9A 2BE9B 2ED1A 1KK7A 1UGQB 1WHJA 2FZGB 2QQBA 1W2BA 4M7AB 3H8ZA 1I1JA 2YXYA 2KT8A 1PG5B 5FWCA 3J81E 3SWNA 2M9UA 3UDCA 4FW1A 4MDXA 3PE0A 3VU3C 2YUOA 2I0NA 2GQVA 4KUDK 1D3BB 4C8QC 1ZHIA 1VQKA 1Z9QA 1VQPA 4HXJA 2M1HA 5KYUA 2AKKA 2DNUA 3JCMW 2QEXA 4II1A 4C92D 4Y92A 3I56Q 2DIGA 1QWEA 2HD0A 5C6SA 2CYZB 2DZCA 3AT1B 4PJOB 1EIFA 4PJMA 1I5OB 2DXTA 2GGRA 1HSQA 2EYYA 3SWNB 1G2BA 5I21A 1VQ7A 2VASA 1YIJT 2K3YA 3QYHB 5CKEA 1TH7A 4HCKA 4NL2A 3E9GA 5GAN6 2OTJT 3CC2A 3OA6A 2MYSA 1MHNA 3JCMh 5KYUB 3IQLA 4CRIA 2L3QA 1WFWA 2QQ9A 2KRMA 4X9CA 1ZQ1A 2P0PA 4F04B 2P84A 3M0SA 3FEOA 1ZA1B 1FXXA 1I0CA 2E5KA 2VC8A 4F14A 3CCUT 2Y4XA 2LQKA 3CMEQ 1ZBJA 4J9HA 4E7IA 2A36A 1T0HA 3FB9A 2CS7A 4D6WA 1M3BA 3CXCS 2X4YA 3CCET 3HTRA 3RKXA 3PIPA 2W0ZA 4Z02A 1Q86U 2KYBA 1YI2T 4IUVA 2QTVA 1G8XA 1UG1A 3NTHA 2P4TA 2YDLA 1YHQA 3L2VA 2ZZDA 1M1FA 1S72A 4XTUA 3VS4A 1K76A 2L5QA 3GOXA 5KH6A 3MHXA 2K7AA 4C5EA 4BDYA 4HVVA 1WJSA 1G3TA 2MMPA 2FL7A 1PCXA 5CKBA 2HNIA 4EMKA 3NFCA 1D1CA 4CC4B 1IHVA 4LUEA 2CP5A 1YJ9A 3CC7Q 3QXEB 4M75D 1Z9ZA 1OPKA 3UT1A 3A98A 5LJ5d 3QZ9B 1WGSA 2ZPEB 3VYHB 2F69A 3UF4A 1N9RA 3LLRA 4LXCA 4OGCA 5GAOl 1SSHA 4FYXB 3EG9B 1X2KA 2E6ZA 4C92E 4J7FA 5DLOA 4K11A 2X4JA 5GAN8 1EX4A 4XTVA 2DL4A 3V7RA 1TS9A 2KY9A 1B34B 4ELYC 5GANe 2ZPIB 2EQKA 1K1ZA 2HBWA 1VQ6Q 3OYKA 2GTJA 1RACB 4M7DD 3RR6A 3M0TA 2QDLA 4CC3A 3VUBA 1H8KA 1GCQA 3CCST 2V1QA 3QG1A 1WXTA 2MF2A 2DL7A 2FZCB 3H9NA 3TSZA 1NLPC 3CBMA 1VYUA 4L6V5 1VQKT 3M0RA 5IHKA 1VQPT 3A8LB 3L1AA 4J9GA 4C8QD 2QEXT 2VWFA 1UFFA 3LW5E 4VUBA 4Z88A 3RDVA 1G3SA 2F5KA 1BU1A 4QKUA 3LYIA 2DL5A 3ME9A 3CC4Q 2DTIA 1YFNA 2JUFA 4J9DA 1RAAB 2DXBA 1BIAA 2RB6A 3EGDA 1WLPB 2EQMA 4DEYA 1VQ7T 1D0YA 4FT2A 3L2ZA 1JBMA 4NOYA 2RH2A 2HL3A 4JLGA 3MEWA 3L2QA 3REBB 4KGVB 2CGHA 3CC2T 2D0NA 3OSSC 2E41A 2NUZA 1WHKA 2EFIA 5CKFA 1PSEA 2QAZA 1U8RA 1Q95G 3TEEA 2O88A 3S3OA 2F2XA 1PWTA 2V8JA 1TXQA 1QVPA 3JCMX 2ABLA 1YJWQ 4A63B 2HSEB 4C92B 1KFZA 3WXMB 1O75A 2QQAA 2RNAA 4C0DC 4M75E 4JRKA 1VUBA 1R0BG 3PNWC 1M90C 4ZTJA 2EQUA 1NM7A 1HXDA 4RCCA 2O9SA 5GAOq 1W1FA 2KRSA 3VV0A 2ROTA 5KYWB 3INZA 2J06A 3A8MB 3BY7A 2CZ1B 4YTLA 1VIFA 4PL6A 3ULRB 1I07A 3CCMT 1LPLA 1JJ2P 3G6EQ 4PFZA 1M3AA 3CCLQ 2K3BA 2RHUA 1Y0MA 1BI3A 3E2UA 4M7AF 3EG0A 1S72T 5GAN3 4E7JA 2RJEA 3OW2P 4M7DE 2BZXA 4AG1C 1WNLA 4R56A 1T0JA 1WXBA 3URGA 5GAOp 4ATOA 1VQ4A 1WJRA 3JB9J 3X25B 2ATCB 3EG1A 2RI2A 4IUQA 1MMGA 1YP5A 3X28B 4F7UA 3CD6Q 2E5QA 1M9SA 4N4IA 1UE9A 4FT4A 1M3CA 2M0OA 5ECAA 1NJIC 1UJ0A 2D8JA 1WPYA 1ZSZB 2GTOA 3GIBA 4HT9A 2R5AA 1VQ9Q 3VS2A 2DKGA 2DTHA 1VQ5Q 1RLQC 2RI5A 1TU0B 5GANd 2AZSA 2NUTB 2KXDA 1OQKA 1YJNA 4M4ZA 2JTMA 3DB3A 2X51A 2KROA 4EMKC 3CPWP 4OVAA 1MMAA 5EC7A 3JB9H 4MZTA 1YITT 5AT1B 5IH2A 3HPWA 3VS7A 1PKTA 2RJCA 4DBFA 4M7DA 2F2VA 2DEQA 1F1BB 3CEYA 3NHNA 4M75B 1VQLT 2X3WD 1LCKA 2QDYB 4IURA 4BE2A 1VYTA 1PHTA 1PM3A 3BFMA 3R6NA 3CBPA 4A4KA 2FB7A 2ZPBB 1QW1A 1TSFA 2P0QA 1C6VX 1UECA 3T9NA 4B9XA 4N4HA 3N5BB 3VUZA 2VB6A 2RK2A 3P8DA 2HBPA 3OYNA 1D0ZA 4C8QA 3S3MA 1UGPB 4M7DB 3O8VA 2JXBA 3QDFA 1BKBA 2PTKA 3MEUA 2V1RA 4BB7A 2D9TA 4MDWA 5GAN5 3TSWA 2K2VA 2NUPB 3VS3A 2PVOB 2YRDA 2F2WA 5KCOA 2KAFA 1QQJA 1ZSGA 1AHJB 2DBKA 3PVQA 5DY9A 3PMIA 3E1SA 4C8QB 1YWPA 2RK1A 1TOVA 4N4GA 2KYMA 3I56A 2DERA 3C0CA 1KHCA 5LJ3g 1OYXA 3JSCA 7AT1B 3R6OA 2EJGA 2KXCA 1PD1A 2ECZA 3M59A 2LCSA 2QQRA 1MMNA 4IIOA 2DMOA 3FRNA 4QVDA 1KIKA 3CCRQ 3PGGA 3P8HA 5CKDA 2DETA 2EYWA 2LP5A 2PZ1A 1H92A 2CH4W 2V8KA 1MV3A 2RQVA 1GFDA 1UGSB 4AMCA 4KUIA 2RHXA 1BBZA 3GP8A 1VQOA 4JJCA 1VQMQ 2BZ8A 4BE0A 2KNBB 1WDXA 2LJ3A 1ZBXA 5LJ5j 4XK8E 3UA7A 1UTIA 5IN1A 3H6ZA 1XQHA 1W4SA 1TTHB 5GAN4 3I35A 2D6FA 3VS1A 3UA6A 1Q7YR 2LVMA 1VQ4T 2OX7A 2OAWA 2QA4A 1U1SA 2KRNA 2O2OA 4A4GA 2YWWA 3PT9A 3CMEA 2MWPA 4ZGJB 5GJWB 2J6FA 3QSUA 1NEGA 5L8RE 1WQ7A 1W2BP 1V29B 4PLLA 3M58A 3V7CA 3M9QA 3M56A 2DL3A 4HKEA 5D6WA 2A3LA 3ZL7C 2PUOB 3JCMg 4AT1B 4XTWA 2WSEE 2DILA 1JXMA 4PFPA 2MAMA 5GAOr 1K73R 3JV3A 2CREA 2AK5A 3MEVA 4J8OA 3SFMA 2XG8D 4CC7A 2LZ6B 2MI6A 1IB8A 2SEMA 2JW4A 1WXUA 3JCMP 1GFCA 1M2VB 4AFZC 1OV3A 4OMNA 3META 2EQJA 4BI8B 1X75C 2AHJB 1I5LA 5GAMg 2GCXA 2EJFA 4M77G 4JS5A 3HP9A 2YUNA 3GPLA 3G71A 2ZPFB 1TUGB 4ZN1A 2YT6A 1Q81R 1VQ6A 1WIEA 2K4YA 4X1VA 2FYKA 1K8AR 5KE3A 5HCKA 4QQGA 2E12A 2EIFA 1K9MR 1FMKA 2WSFE 4NL3A 2LT4A 3OQ5A 3M4YA 4RTTA 1QKXA 4ORZA 4PJJA 5GAN7 1T3LA 1M1GA 1ABOA 3C12A 2RPNA 1VQ8Q 1M8VA 3HRSA 3EH2A 1IRXA 2B86A 3TQ7P 4CI0C 5CQYA 3QBYA 1NZ9A 2HKQB 2X4WA 2AT1B 2C0IA 4FW2A 3FC3A 4R55A 4J7IA 2LT1A 1X6GA 1KQSA 4PK4A 1GXIE 3THKA 3CC4A 2KBTA 2LJ1A 4ZNXA 3S3NA 2QG9B 4B9WA 1WJQA 2COYA 2CKKA 1SRMA 2E70A 3MP8A 1B7TA 4DA4A 3KBGA 2O4XA 4LDUA 2XDDA 1Y7XA 2H8HA 4IUUA 1Y71A 2FG0A 3RESA 3EGUA 1UHCA 2CDTA 1VQOT 2JVVA 3CCQA 5GAMd 2G3RA 1N9SA 1Q82U 1KD1R 4TVRA 2RQWA 4F7UF 2O31A 3CXCA 5KYYA 4HCBA 4HT8A 1IGQA 1YJWA 1KQSS 2V8IA 3M0UA 4X9DA 2OAUA 1G3WA 2X3XD 1WZOA 1QVGS 4V2SA 2YHTA 1PRLC 2P0KA 2F5TX 4M75F 2DXCA 2QA4T 1M1KC 5GANj 3HFOA 1N8RR 4DBHA 2AIRB 2GF7A 4F16A 1YIJQ 2OTLT 4C0DB 2KI7A 3HSBA 3UWNA 1SHFA 2C0TA 2OTJQ 2EBPA 1WHLA 4C0ZA 3TVTA 5DM7R 4M77C 3RKYA 1AZGB 4OMFB 3AHUA 1YWOA 3H0IA 2DAQA 4PFOA 4RG8A 3G6EA 5KYYB 1JEGA 2K5FA 4PNOA 4HCCA 2DE0X 3KXTA 4M7DF 2DVJA 3WVDB 1MV0B 3BW1A 3QKJA 2E3IA 2XKOC 1AWWA 4OB1B 4OB3B 5LJ3f 2EVRA 3OYYA 3HRTA 4P5NA 4JRPA 4LUDA 3OMGA 3QHSA 1KC8U 3CCUQ 1TG0A 5HKCA 4JZ4A 3RBBB 4FSSA 3M53A 2PVDB 2K5IA 3OYFA 2K3XA 1LVKA 1YBYA 2DYBA 1VQNA 3CCEQ 1E6GA 4C8QF 3X20B 3A8HB 1YI2Q 1PC0A 4DQ2A 1VQ9A 4RTVA 5CKHA 3G71T 1RAGB 2F1LA 3M54A 5GAOm 1AD5A 3GBQA 3G4ST 3X24B 1C0MA 4IUPA 2NYSA 3SB2A 1OPLA 3NPFA 4EIKA 4FL6A 2DIQA 5FLXE 1K8AC 4EMKB 1H3ZA 2HKNA 2L3RA 3QYGB 2HCKA 2KSSA 2VKNA 2LCLA 3ZEHA 4RTUA 3JCMf 2AKLA 1GBRA 1KHIA 4RTXA 5D7UA 5I2MA 2XDBA 3LX7A 3RNJA 1K0XA 3EGXA 2VXEA 1MNDA 3DKMA 3MCAB 5LJ5h 2FPEA 3MJXA 1AWOA 5KCHA 2BE7D 1X27A 4A4HA 3CCSQ 2B8AA 1Q82R 2XD0A 4HVWA 3CCJA 1AEYA 2M16A 1WQWA 1E6HA 2NWMA 3GNFB 5CR2A 4X34A 5KYNA 1WHGA 5GAMf 1BI2A 1G83A 2R58A 3L42A 3OYLA 1VQKQ 2LX9A 2L8DA 3CCQT 4BACA 1ZA2B 1K0SA 2QEXQ 2IVWA 1MNEA 1RADB 2EGCA 3OYHA 2LQ8A 2KQWA 5M9OA 3V8KA 2K57A 2LNHB 2X35A 3QIIA 1CKAA 1OEBA 2EYQA 1VA7A 4F7UE 1N8RC 1Y96A 1VQ7Q 3EGDB 9ATCB 1Q86R 2WACA 2DLPA 4C5GA 3OYAA 5IAYA 2DYIA 2FPFA 2HEQA 3HRUA 2DX1A 4M77D 4FIBA 4CC2A 4LDYA 3Q1JA 1D0XA 2DVEA 1VQMA 4HCZA 4MMLA 1SF9A 3DB4A 1EFNA 3QPHA 1YHQT 3MKDA 3I55A 1Y96B 3FDRA 3JCMc 2KVQG 3JB9G 4OMLA 4JJNK 2CUDA 1IZ6A 1AWJA 4E7ZA 1M5Q1 2FRYA 2GQIA 3O5ZA 1WYXA 2JTFA 1BIBA 4LD6A 1SG5A 1VQNT 3ER0A 1YJ9T 5EG2A 1IXDA 2DRMA 1D1BA 3CCMQ 2BKDN 2FZKB 1ZUUA 2DD5A 4M78A 1S72Q 1BCOA 5GAN2 2BTTA 4Z8AA 3CCVA 4LDVA 4C8QE 1D1AA 5L23A 2L2PA 2HL5C 2GNCA 1OI1A 4RCBA 3CBOA 2EKOA 1YCSB 2PQWA 1UHFA 2RI3A 1ZUYA 4ZTFA 4RMOA 5GJVB 2LMJA 1KQ2A 4ELZC 3FLGA 3PVLA 4ZGDB 3CMAA 4J6WA 5IT9E 3C4SA 2EWNA 1XJWB 1RABB 1RAIB 4F7UB 1HJDA 1KSWA 2Y4YA 2HQXA 1M1KU 3M55A 4LDWA 5LJ3e 5IHNA 1WX6A 1ACMB 8ATCB 1V1CA 2VGNA 2WSCE 1OOTA 3OYIA 4QQ6A 2V26A 3JCMV 2YRVA 4JJBA 3HFNA 1G5VA 4HVUA 1YITQ 4JZ3A 5GAMj 5D6XA 1OU9A 3OBWA 2VV5A 2LCCA 2HSPA 1VIEA 3JRZA 5FU6C 5CVIA 2CZ0B 3CCJT 2RM4A 1VQLQ 5GANh 4M77E 4XU1A 4IUTA 1UJYA 2J6OA 4A4EA 4J6YA 1FYNA 2X9HA 4R0KA 5C0MA 1RAHB 3VS6A 2FHDA 4A54A 4J6XA 2LDMA 4M78G 3M4GA 2RA2A 1JJ2S 4EDUA 1RI0A 4OB2B 1J3TA 1JXOA 4RTZA 2MOXA 5I22A 4FYVB 1UDLA 3FIFA 2LJ0A 4FM4B 3OW2S 4ME7A 2CZ7B 1Q86C 3JCMe 3OBYA 2KE9A 3EAEA 3ZBDA 2RQRA 2XDPA 2E3HA 3EFSA 5FROA 4D8KA 4A4FA 2CP0A 4GY5A 3OS5A 2M0YA 3E9FA 5I2SA 2CH4A 4E7KA 1QP3A 4M77A 2CP6A 3I55T 3H0HA 4ANJA 1R8OB 2RO0A 2GFUA 5GAMe 2DJQA 2RD1A 3HL8A 5A0DA 4RTYA 2JJ9A 2A7YA 2FPDA 4C5HA 4JLIA 3CPWS 2BIVA 2MPXC 1QVFA 1LJOA 1CSKA 3J80E 2VUBA 2L0AA 3CQTA 4UC4A 1LOJA 1NPRA 3TREA 5AYFA 3U23A 4M77B 1U1TA 3CCVT 2ZCFB 2CP3A 2H3JA 1V76A 4AFQC 3P8BB 1RAEB 1YJNT 1NBEB 2SRCA 2RN8A 2XU8A 3PMTA 1E7OA 5CO7A 1I81A 5D6YA 3CMAT 1QVFS 5LJ3d 4XU2A 5KE2A 2QK0A 3LWIA 2ROLA 1H3HA 3CCEA 2E10A 3CC7A 1KQSP 1M8MA 1G3YA 4JS4A 2CT3A 4M78C 1QWFA 4BDZA 3RMSA 5CK9A 3JB9I
chains in the Genus database with same CATH topology
3TEEA 3PFSA 3VYGA 4PNOA 4BY6C 5GMKh 3S3OA 1M90U 1N6AA 4HCCA 5FU7C 3KXTA 3V8LA 4M7DF 2V8JA 1VQ8A 1HK9A 2E6NA 3WVDB 3BW1A 1QVPA 3QKJA 3JCMX 2XKOC 4OB1B 4OB3B 5LJ3f 3RMQA 1KG1A 1JRIA 2XIDA 4KULA 3V7SA 3OYYA 4C92B 3HRTA 4P5NA 1MGQA 2QI2A 4JRPA 3WXMB 2E65A 1O75A 3OMGA 2XICA 4PJOD 2QQAA 2RJDA 2YLCA 3LGFA 4M7AA 3QHSA 4C0DC 1KC8U 4KBMB 4QVCA 1PSFA 3C95A 4M75E 4JRKA 1VUBA 3OYMA 5HKCA 4F7UG 3PNWC 4JDSA 3E19A 4JUVA 1M90C 4ZTJA 3M53A 2EQUA 1HXDA 2PVDB 1QP2A 2K5IA 3BDLA 4O5VA 2K3XA 4RCCA 3VV0A 3OB9A 5GAOq 3OYFA 1YBYA 1VQNA 3INZA 3A8MB 3BY7A 4M75G 2CZ1B 2LRQA 3QO3A 1VIFA 2R57A 4YTLA 3X20B 4OB0B 4PL6A 4C8QF 3OS2A 3CCRT 3A8HB 3L2RA 1K8AU 3TU4K 3CCMT 3CPWA 3QUIA 4DQ2A 1VQ9A 2RHUA 2ZPGB 5CKHA 1K9MU 1KC8C 1BI3A 3G71T 4M7AF 3F70A 4PLIA 2DTOA 2RHIA 3M54A 2RHZA 4C92C 5GAN3 5GAOm 1VQMT 2L89A 4C0FA 4E7JA 1S72T 3G4ST 4Y91A 2YLBA 3X24B 4N0AC 4IUPA 1OZ2A 2RJEA 3SB2A 3OSVA 4M7DE 3A8OB 3JB9D 1WNLA 4R56A 1FX7A 1NJIU 4GLKA 4BI4A 3I56T 3JCMd 4FL6A 2DIQA 4DOVA 3TCJA 3URGA 5FLXE 5GAOp 4ATOA 5GMKl 1VQ4A 1WJRA 3CCSA 3C94A 3JB9J 4EMKB 1K8AC 3X25B 4PJOA 5HK3A 1H3ZA 4M7DG 2L3RA 5GMKm 1NE8A 3QYGB 4BUGA 1QVGA 2RI2A 4LD9K 4IUQA 4BD3A 3X28B 4F7UA 1YIJA 2E5QA 2KSSA 5FRMA 2LCLA 1M9SA 4N4IA 5A0LA 4FT4A 2OTJA 2LNVA 4J83A 2M0OA 4LDXA 3ZEHA 1NJIC 3LH0A 4BE1A 1WPYA 3JCMf 1UEBA 3GIBA 4HT9A 2R5AA 2BUDA 2DKGA 1KHIA 5LL6S 4EPCA 2DTHA 3ZFJA 1W2BS 5I2MA 2XDBA 2RI5A 3LX7A 4QW2A 3HKSA 5GANd 3PTAA 1YJNA 4M7AE 2JTMA 2VXEA 2RJFA 4C8QG 3DB3A 1JB0E 5CCAA 3DKMA 1LNXA 4A53A 1IREB 4EMKC 3WVEB 3MCAB 2RHYA 4OVAA 5LJ5h 3JCMb 1Q81U 3JB9H 2LC4A 4MZTA 1YITT 1KD1U 3UPUA 1Q7YC 4M78F 1SSFA 4C5IA 4A4HA 5KCHA 2OTLA 5LJ5g 2B8AA 2XD0A 4XTXA 3DLLA 2KDSA 4XU3A 5DLQE 3OYGA 3HPWA 4WF2A 3X26B 3CCUA 3CCJA 2RJCA 2M16A 1WQWA 3NTIA 4M7DA 2DEQA 3CEYA 3GNFB 2O4XB 5CR2A 5GANf 4M75B 3CMET 4X34A 1VQLT 5GAMf 1BI2A 5GMKj 1FWZA 2QDYB 4IURA 4XAXB 4BE2A 1N8RU 2R58A 4DOWA 3L42A 4XTYA 3OYLA 2LX9A 1O9SA 2Y90A 3JB9F 2O01E 3RKWA 2L8DA 3CCQT 3BFMA 3CBPA 4A4KA 4BACA 1YI2A 2XI9A 5GAOn 2VGMA 2FB7A 2ZPBB 2IVWA 1QW1A 3CCLA 2P0QA 2JOYA 3CPFA 3T9NA 4XQ3A 4B9XA 3OYHA 2DO3A 2LQ8A 2KQWA 5M9OA 3KUFA 4N4HA 3V8KA 4EMGA 2XHCA 3N5BB 2KK4A 4O6JA 3VUZA 4PJOE 2D0QB 2K57A 2RK2A 2FVUA 2HBPA 3P8DA 1XOVA 3OYNA 2X35A 4E7LA 2K5LA 3QIIA 4C8QA 3OYBA 1K73C 4ZGEB 2DZ9A 2EYQA 4F7UE 3CC2T 1YCYA 2PVGB 1N8RC 3S3MA 1Y96A 4PJOG 1UGPB 1Y07A 4M7DB 4M7AG 3RIRA 1I8FA 2VYTA 2QXFA 3O8VA 1KQ1A 5FRNA 4M75C 2KMTA 5GAMh 2WACA 3ASKA 4IKFA 4C5GA 1BKBA 3MEUA 4MZPA 3OYAA 1DJ7B 4BB7A 4E7HA 2D9TA 3SD4A 4MDWA 2E64A 5IAYA 4C92F 5GAN5 3CC7T 5GMKi 2DPPB 3CCMA 2K2VA 3LWHA 2DD4A 4Q5WA 3J7AF 2PVOB 3CD6A 3L2WA 3HRUA 4M77D 4FIBA 4L59A 4LDYA 1H641 3Q1JA 2QQSA 4M78D 2DVEA 5LJ5e 5J26A 5KCOA 2KAFA 1VQMA 2X4XA 4HCZA 3G4SA 1XNIA 4MMLA 3VJPA 2DK3A 1VQ8T 4J5YA 3DB4A 1AHJB 1XTDA 5HK0A 5DY9A 1D3BA 3PMIA 3E1SA 5LJ3h 4C8QB 2RK1A 4N4GA 3I56A 1VQ5A 3QPHA 1YHQT 2LTOA 1KHCA 3I55A 1B34A 1Y96B 2DXUA 5LJ3g 3FDRA 1BI0A 3OYCA 3JCMc 2KVQG 1OYXA 3JSCA 3JB9G 3R6OA 3JCMJ 4M7DC 4E47A 2EJGA 3OMCA 3PIOA 1UGQB 2QQBA 4JJNK 1W2BA 1Q81C 4M7AB 3H8ZA 3M59A 1VQ6T 1IZ6A 2QQRA 1M5Q1 2JTFA 3FRNA 1BIBA 2EJ9A 4LD6A 4QVDA 1VQNT 3ER0A 3J81E 3PGGA 2M9UA 3SWNA 3P8HA 1K9MC 4BI3A 5EG2A 5CKDA 1YJ9T 1UB4A 5GMKe 2BKDN 3UDCA 4JRQA 2V8KA 4MDXA 3VU3C 1UGSB 4KUIA 2RHXA 3GP8A 1VQOA 2GQVA 4KUDK 1D3BB 2DD5A 3RERA 4M78A 4C8QC 1ZHIA 4KT0E 1VQKA 5GAN2 3CCVA 4BE0A 4LDVA 4C8QE 1VQPA 3RUXA 1ZBXA 2M1HA 4XK8E 5LJ5j 3JCMW 1OI1A 3FJPA 4RCBA 3CBOA 2EKOA 4II1A 3H6ZA 5IN1A 1OZ3A 2QEXA 1XQHA 4C92D 3OY9A 1W4SA 5GAN4 2DIGA 2PQWA 4M7AC 2RI3A 1YITA 3MP1A 2D6FA 3V8JA 4ZTFA 2CZ6B 4RMOA 2HD0A 5C6SA 2CYZB 2JN0A 4XU0A 2DZCA 2LVMA 4XTZA 4ELZC 1VQ4T 1KQ2A 3DLMA 3FLGA 4PJOB 1EIFA 1P92A 2QA4A 1U1SA 2DXTA 3S6WA 5CQXA 2NLUA 4ZGDB 3CC4T 2PUKB 3SWNB 3CMAA 4M77F 4A4GA 4J6WA 5IT9E 3PT9A 3C4SA 2EWNA 3QJ6A 3CMEA 1VQLA 1I4K1 2MWPA 4ZGJB 5I21A 1VQ7A 3A5ZB 5FU6B 1YIJT 2K3YA 3G7ZA 4F7UB 3QYHB 5HY6A 1M1KU 2Y4YA 2HQXA 5CKEA 3QSUA 1TH7A 3M55A 4LDWA 4NL2A 5L8RE 3E9GA 5GAN6 5LJ3e 2OTJT 1WQ7A 2HAXA 1V29B 4PLLA 3CC2A 3OA6A 3M58A 3V7CA 3M9QA 1MHNA 3JCMh 3M56A 2VGNA 4CRIA 2WSCE 4L5GA 4HKEA 3OYIA 4QQ6A 2QQ9A 5D6WA 2A3LA 2PUOB 3JCMg 4X9CA 4XTWA 2WSEE 1ZQ1A 2P0PA 1KD1C 5J39A 3JCMV 2YRVA 5GAOr 2MAMA 3JCMQ 2E1HA 3FEOA 3HFNA 4C92A 4PJOC 1G5VA 1BYMA 3EFRA 5A0GA 1YJWT 1FXXA 5GAMj 5D6XA 4OF1A 3OBWA 5CAIA 2VV5A 2LCCA 2R5MA 3SWNC 5J3BA 3SDZA 1VIEA 3MEVA 4J8OA 3SFMA 3L2UA 2XG8D 3JRZA 5FU6C 2VC8A 5CVIA 2CZ0B 3CCUT 2Y4XA 4Y28E 2MI6A 3CCJT 2LQKA 3JCMP 1M4ZA 2RM4A 4HA8A 4E7IA 3MO8A 5GANh 3FB9A 4M77E 4NS5A 2CS7A 4IUTA 4XU1A 4D6WA 3OYEA 4M78E 4A4EA 4J6YA 3META 2EQJA 4BI8B 3CXCS 1X75C 2X4YA 3CCRA 3CCET 5GANg 2AHJB 3RKXA 1I5LA 1VQKT 4RG2A 5C0MA 5GAMg 3PIPA 2GCXA 4PKCC 4Z02A 5LJ3j 2FHDA 1Q86U 1YI2T 4IUVA 4J6XA 2EJFA 4A54A 2LDMA 4M77G 4JS5A 4M78G 3G6ET 3HP9A 3M4GA 3GPLA 3CCLT 3G71A 3OYDA 3NTHA 2P4TA 1YHQA 2ZPFB 3L2VA 2ZZDA 1M1FA 1S72A 4XTUA 2RA2A 1JJ2S 4C0GA 4OP0A 4ZN1A 2L5QA 3GOXA 5KH6A 3MHXA 3VKIA 4EDUA 1RI0A 4C5EA 4OB2B 4BDYA 2IG0A 4ZN3A 1VQ6A 1WJSA 1G3TA 2MMPA 2FL7A 3MP6A 3FIFA 5CKBA 2K4YA 2HNIA 4FM4B 4EMKA 3NFCA 3OW2S 2FYKA 4ME7A 2CZ7B 1Q86C 3NTKA 5KE3A 3JCMe 3OBYA 4QQGA 2E12A 2EIFA 1YJ9A 2WSFE 3EAEA 3QXEB 4QVZA 4NL3A 2LT4A 4M75D 3ZBDA 3UT1A 3OQ5A 4QQDA 3M4YA 2QTXA 2XDPA 5LJ5d 3QZ9B 3EFSA 1WGSA 2ZPEB 3HHTB 3VYHB 2F69A 4JRIA 3CD6T 1UGRB 1N9RA 3LLRA 4OGCA 5FROA 5GAN7 4EMHA 2ZGWA 1M1GA 4A4FA 5GAOl 3C12A 3QZ5B 1X01A 2E6ZA 1M8VA 3HRSA 2DJZA 4GY5A 2GFAA 3OS5A 4C92E 3JAME 3E9FA 2C06A 4J7FA 5DLOA 1VQ9T 2JZ2A 5I2SA 4E7KA 1QP3A 4M77A 4CI0C 5CQYA 2X4JA 1VQ5T 3QBYA 1NZ9A 2X4WA 5GAN8 3FC3A 4R55A 4J7IA 4XTVA 3I55T 3V7RA 1NPPA 3LGLA 2KY9A 1B34B 4ELYC 4C92G 2LT1A 4OGEA 2XK0A 1R8OB 2RO0A 5GANe 2GFUA 3GLXA 2ZPIB 3OS1A 2EQKA 5GAMe 5LJ5f 2RD1A 3OYKA 1KQSA 1GXIE 3HL8A 5A0DA 3CC4A 1X6OA 4M7DD 2EAYA 3S3NA 4B9WA 2A7YA 4C5HA 2MWOA 1WJQA 3VUBA 4JLIA 3CPWS 2CKKA 3CCST 2E70A 3MP8A 4MZMA 2BIVA 4DA4A 3KBGA 4FU6A 3QG1A 1Q7YU 1QVFA 1N27A 2O4XA 3A8GB 4LDUA 2MF2A 4M75A 2XDDA 1LJOA 1RL2A 3J80E 1Y7XA 2VUBA 1Y71A 4IUUA 4UC4A 1LOJA 3RESA 1NPRA 5CIUA 3TREA 5AYFA 3CBMA 4MMKA 4PJOF 1VQOT 2JNGA 4M77B 2JVVA 3CCQA 1U1TA 4L6V5 2G3RA 4M78B 5GAMd 1N9SA 3QJYA 4RKUE 3CCVT 1Q82U 3MEAA 2ZCFB 3A8LB 3L1AA 1VQPT 2H3JA 4C8QD 4TVRA 4F7UF 2QEXT 3CXCA 3BDUA 4HCBA 4BY6B 1YJWA 1KQSS 4HT8A 2V8IA 3LW5E 5A2QE 4X9DA 2OAUA 4VUBA 1G3WA 3P8BB 5FU7B 1QVGS 4V2SA 1G3SA 2F5KA 2PU9B 2YHTA 3OS0A 1YJNT 2P0KA 2F5TX 3LYIA 4M75F 4M7AD 2XU8A 2DXCA 3ME9A 2ZPHB 2DTIA 3PMTA 2QA4T 3HFOA 2JUFA 5CO7A 5GANj 1M1KC 1JJ2A 3GNGA 1BI1A 1I81A 2GF7A 4N0AA 2I2LA 5D6YA 2DXBA 1BIAA 2RB6A 3CMAT 1QVFS 2EQMA 3QDRB 5LJ3d 2OTLT 4XU2A 4C0DB 5KE2A 3LWIA 1Q82C 1K73U 4FSXA 1VQ7T 4FT2A 3L2ZA 3HSBA 1JBMA 3UWNA 4NOYA 2RH2A 4JLGA 3CCEA 2E10A 3MEWA 3L2QA 3CC7A 4C0ZA 5DM7R 1G3YA 4M77C 2CGHA 3M5AA 2VXFA 3RKYA 3OYJA 4JS4A 3OW2A 4M78C 2E41A 3GF5A 3OSSC 4OMFB 3RMSA 5CK9A 2DAQA 4BDZA 3AHUA 4RG8A 3G6EA 2EFIA 5CKFA 1PSEA 3JB9I 2HQEA 1U8RA 3M57A 2K5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF2 A;  4ME7 A;  5CQY A;  3G7Z A;  3HPW A;  2VUB A;  5CKE A;  5CO7 A;  4OF1 A;  3TCJ A;  4ELY C;  5CR2 A;  3JRZ A;  5HK3 A;  1M1F A;  1NE8 A;  5HK0 A;  5CCA A;  4HKE A;  5DLO A;  5CKH A;  5CKD A;  1UB4 A;  4ELZ C;  3VUB A;  2KMT A;  4VUB A;  4MZM A;  5CK9 A;  5CQX A;  1VUB A;  4MZP A;  4MDX A;  5HKC A;  4MZT A;  5CKF A;  2C06 A;  1X75 C;  5CKB A;  3JSC A;  3NFC A; 
#chains in the Genus database with same CATH topology
 3VYG A;  3PFS A;  1M90 U;  4BY6 C;  1N6A A;  5FU7 C;  2DRK A;  2O9V A;  1JRI A;  4FYW B;  3V7S A;  2CT4 A;  2E65 A;  4DBQ A;  2XIC A;  2RJD A;  4M7A A;  4KBM B;  2MCN A;  4QVC A;  3VS0 A;  3OYM A;  3EH1 A;  3CXC P;  1JQQ A;  4JDS A;  1PD0 A;  4O5V A;  1QP2 A;  4KGX B;  3OB9 A;  1SEM A;  4OB0 B;  3OS2 A;  3L2R A;  1RAF B;  2A37 A;  4E7S A;  3F70 A;  5IHI A;  2DTO A;  2RHI A;  2RHZ A;  2L89 A;  1B07 A;  2YLB A;  4N0A C;  3OSV A;  3A8O B;  3JB9 D;  4E6R A;  1FX7 A;  1M30 A;  1NJI U;  4GLK A;  1WA7 A;  4BI4 A;  3I56 T;  4J9E A;  3JCM d;  4RTW A;  3REA B;  3D7S B;  3CCS A;  4PJO A;  2QGG A;  3I5S A;  4BUG A;  1QVG A;  4BD3 A;  5FRM A;  1W70 A;  3LH5 A;  4LDX A;  2K79 A;  3LH0 A;  4BE1 A;  5I11 A;  4EPC A;  4FYY B;  1QKW A;  3ZFJ A;  3NGP A;  1W2B S;  4RUG A;  1ZLM A;  3PTA A;  2RJF A;  1JB0 E;  3QWY A;  5CCA A;  3BE3 A;  2YSQ A;  1LNX A;  1ARK A;  1IRE B;  2JTE A;  2XMF A;  2LC4 A;  2MK5 A;  4M7A G;  3UPU A;  1Q7Y C;  4M78 F;  4C5I A;  1WHH A;  2D8H A;  5LJ5 g;  3NMZ C;  3H41 A;  3DLL A;  2KDS A;  4XU3 A;  5DLQ E;  2CP2 A;  1GBQ A;  2O4X B;  3CME T;  4E2F B;  1K4U S;  5GMK j;  2C0O A;  1VQO Q;  4DOW A;  3I5R A;  1O9S A;  2JMA A;  2Y90 A;  2O01 E;  3RKW A;  3EG3 A;  3CCL A;  3CPF A;  1GCP A;  2DO3 A;  1U06 A;  4EMG A;  2KR3 A;  4E7L A;  1VOM A;  4KH0 B;  4AFU C;  2IIM A;  2K5L A;  1KJW A;  3OYB A;  2QA4 Q;  1K73 C;  2DL8 A;  4ZGE B;  2DZ9 A;  1X6B A;  1YCY A;  2DFU A;  2PVG B;  4PJO G;  2OTL Q;  1M90 R;  2ESW A;  4J9F A;  1I8F A;  8AT1 B;  5GAM h;  2KMT A;  4MZP A;  4LE9 A;  4QT7 A;  4E7H A;  4OMO A;  3SD4 A;  3CC7 T;  2DBM A;  5GMK i;  2DPP B;  3CCM A;  3LWH A;  2DD4 A;  4Q5W A;  3J7A F;  3CD6 A;  3L2W A;  1D09 B;  3EG9 A;  2AZV A;  2COZ A;  1H64 1;  4M78 D;  5J26 A;  1UUE A;  2JMC A;  2X4X A;  1PRM C;  2DK3 A;  1BB9 A;  1SKU B;  1R0C B;  1VQ5 A;  2JT4 A;  1B34 A;  2DXU A;  1GL5 A;  3JCM J;  4E47 A;  3OMC A;  1Q81 C;  2VVK A;  1ABQ A;  1VQ6 T;  2LX7 A;  3I9Q A;  1NYF A;  1X2Q A;  1ZUK A;  1AWX A;  2EJ9 A;  1YNZ A;  1TUC A;  1K9M C;  4BI3 A;  1UB4 A;  1NJI R;  5GMK e;  4JRQ A;  3G71 Q;  4AG2 C;  3RER A;  4KGZ B;  4KT0 E;  1FMV A;  3G4S Q;  2EYZ A;  3RUX A;  2EGA A;  3MPU B;  2JM8 A;  3FJP A;  1OZ3 A;  2YUQ A;  3OY9 A;  5FW9 A;  2A28 A;  4AFS C;  2OJ2 A;  4M7A C;  2QGF B;  2J6K A;  1JO8 A;  1YIT A;  3MP1 A;  3V8J A;  2CZ6 B;  2YUP A;  1SPK A;  2JN0 A;  4XU0 A;  5IXF A;  2HQH A;  4XTZ A;  3DLM A;  1P92 A;  3S6W A;  1BK2 A;  2FRW A;  2NLU A;  5CQX A;  3CC4 T;  2PUK B;  4M77 F;  1PKS A;  3QJ6 A;  1VQL A;  1I4K 1;  3A5Z B;  5FU6 B;  3G7Z A;  1Y57 A;  5HY6 A;  4LN2 A;  2HAX A;  1QLY A;  2LQW A;  2QYZ A;  1BCM A;  4L5G A;  2DM1 A;  3VRY A;  1VQP Q;  2CUB A;  2EW3 A;  1QCF A;  3EGX B;  1KD1 C;  5J39 A;  3EHR A;  3JCM Q;  2E1H A;  2RQT A;  4C92 A;  4PJO C;  1BYM A;  3EFR A;  2MIO A;  5A0G A;  1YJW T;  4DBR A;  4OF1 A;  5CAI A;  3SWN C;  2R5M A;  1CKB A;  1R77 A;  5J3B A;  3SDZ A;  3L2U A;  1FMW A;  2DF6 A;  4Y28 E;  3UAT A;  3VS5 A;  1M4Z A;  4HA8 A;  3MO8 A;  2H3E B;  2JS2 A;  4NS5 A;  3OYE A;  5KYW A;  4M78 E;  3KFV A;  1M2O A;  3CCR A;  1X69 A;  5GAN g;  3CCQ Q;  4RG2 A;  3CC2 Q;  4PKC C;  5LJ3 j;  4LNP A;  3G6E T;  2JS0 A;  3CCL T;  3OYD A;  3EG2 A;  1KC8 R;  1MUZ A;  1NYG A;  4J9B A;  4C0G A;  4OP0 A;  1YN8 A;  3VKI A;  4OMM A;  2IG0 A;  4ZN3 A;  1AT1 B;  3MP6 A;  1HD3 A;  3NTK A;  2HDA A;  1U3O A;  3EHQ A;  4QVZ A;  2ED0 A;  1U5S A;  4QQD A;  2QTX A;  4J9C A;  3HHT B;  4JRI A;  3CD6 T;  1UGR B;  4EMH A;  2ZGW A;  4KH1 B;  1ZSZ A;  3QZ5 B;  1X01 A;  2DJZ A;  3JAM E;  2GFA A;  2L3S A;  2C06 A;  2EKH A;  1VQ9 T;  2JZ2 A;  1X43 A;  1SRL A;  1YHQ Q;  2KGT A;  2NUT A;  5FWB A;  1VQ5 T;  4FCY A;  4IIM A;  1NPP A;  3LGL A;  3M0P A;  2OI3 A;  4C92 G;  4OGE A;  2XK0 A;  2HMA A;  3OS1 A;  3GLX A;  5LJ5 f;  1X6O A;  2CSQ A;  2EAY A;  2MWO A;  1NG2 A;  1VQN Q;  4MZM A;  5KYX A;  1YJ9 Q;  4FU6 A;  2KEA A;  1Q7Y U;  1N27 A;  3A8G B;  4M75 A;  1RL2 A;  2EPD A;  1OX8 A;  5CIU A;  1GRI A;  2FO0 A;  4MMK A;  4PJO F;  2JNG A;  4M78 B;  3QJY A;  4RKU E;  3MEA A;  1S1N A;  3BDU A;  1OUL A;  4BY6 B;  5A2Q E;  5FU7 B;  1QMC A;  1WHM A;  2PU9 B;  3OS0 A;  4M7A D;  2ZPH B;  4D8D A;  5KYX B;  1JJ2 A;  3GNG A;  1BI1 A;  4N0A A;  2I2L A;  2KT1 A;  3QDR B;  1Q82 C;  1NLO C;  4FSX A;  1K73 U;  1IO6 A;  2CP7 A;  4GLM A;  4WTO B;  3OYJ A;  3M5A A;  2EGE A;  2VXF A;  3OW2 A;  2NUP A;  3GF5 A;  4KRT A;  1RI9 A;  1WI7 A;  2M02 A;  1K9A A;  1A0N B;  2HQE A;  3M57 A;  1C1A A;  5GMK h;  4PJN A;  3V8L A;  1VQ8 A;  1HK9 A;  2E6N A;  1QVF P;  3RMQ A;  1KG1 A;  2XID A;  4KUL A;  1GCQ C;  1T3S A;  1MGQ A;  2QI2 A;  2Z0W A;  4F17 A;  4PJO D;  2YLC A;  3LGF A;  1PSF A;  3C95 A;  1RUW A;  3CCJ Q;  2EQI A;  4F7U G;  1OU8 A;  2W10 A;  3E19 A;  4JUV A;  3BDL A;  1Q81 U;  4IKF A;  1AOJ A;  1IGU A;  4J9I A;  2RF0 A;  4Z89 A;  1QCO A;  2YRC A;  4M75 G;  2LRQ A;  3QO3 A;  2R57 A;  3CCR T;  2CSI A;  3SEM A;  1K8A U;  3TU4 K;  2D1X A;  3CPW A;  2G6F X;  1M27 C;  3QUI A;  1TWB A;  1SHG A;  2ZPG B;  1K9M U;  4PJL A;  1PNJ A;  1KC8 C;  4PLI A;  2M51 A;  4C92 C;  1VQM T;  2ZAE A;  4C0F A;  4Y91 A;  6AT1 B;  2RMO A;  1OZ2 A;  3SHW A;  3QWX X;  4DEX A;  1TUD A;  1N5Z A;  1W6X A;  4OMP A;  4DOV A;  3TCJ A;  5GMK l;  3C94 A;  5HK3 A;  4M7D G;  1QCN A;  2DA9 A;  5GMK m;  1NE8 A;  4LD9 K;  1YIJ A;  2PNI A;  2K2M A;  4OMQ A;  5A0L A;  3A1P A;  2OTJ A;  2LNV A;  4J83 A;  1VYV A;  1NEB A;  4GBQ A;  2IPO B;  1UEB A;  2BUD A;  5LL6 S;  2QAS A;  2GBQ A;  4QW2 A;  3HKS A;  4ESR A;  3I55 Q;  1AZE A;  4M7A E;  4C8Q G;  2DEU A;  1MMD A;  3G1J A;  4A53 A;  1JU5 C;  3WVE B;  2RHY A;  3JCM b;  1M1K R;  3M0Q A;  1KD1 U;  2OTL A;  1SSF A;  1VQ4 Q;  4XTX A;  2K9G A;  3OYG A;  4WF2 A;  3X26 B;  3CCU A;  3NTI A;  1M2V A;  1UGV A;  3EFO A;  5GAN f;  2E4H A;  1ZSZ C;  1FWZ A;  4XAX B;  1N8R U;  4XTY A;  3CCV Q;  1HYO A;  3JB9 F;  3VRZ A;  4JPB W;  1YI2 A;  1QVG P;  1IHW A;  2XI9 A;  5GAO n;  2VGM A;  2P4R A;  2JOY A;  4XQ3 A;  5IXB A;  1YJN Q;  4JJD A;  3KUF A;  4PJO E;  2XHC A;  2KK4 A;  4O6J A;  2D0Q B;  2J05 A;  2FVU A;  1XOV A;  1EZZ B;  2A08 A;  2JM9 A;  3CMA Q;  2HZY A;  2BZY A;  1Y07 A;  3RIR A;  1AVZ C;  2VYT A;  2QXF A;  3EFO B;  1KQ1 A;  5FRN A;  4M75 C;  3ASK A;  4WCI A;  2FEI A;  1DJ7 B;  2LQN A;  2J7I A;  2EYX A;  2E64 A;  4C92 F;  2RQU A;  2A0F B;  2L3P A;  3H0F A;  3FJ5 A;  4B6M A;  4L59 A;  2K6D A;  2QQS A;  2COW A;  2ENM A;  5LJ5 e;  3G4S A;  1XNI A;  3VJP A;  1VQ8 T;  4J5Y A;  5HK0 A;  1XTD A;  1D3B A;  5LJ3 h;  1ZX6 A;  2LTO A;  3OYC A;  1BI0 A;  1RLP C;  4M7D C;  1B3Q A;  3PIO A;  1OX9 A;  2BE9 B;  2ED1 A;  1KK7 A;  1UGQ B;  1WHJ A;  2FZG B;  2QQB A;  1W2B A;  4M7A B;  3H8Z A;  1I1J A;  2YXY A;  2KT8 A;  1PG5 B;  5FWC A;  3J81 E;  3SWN A;  2M9U A;  3UDC A;  4FW1 A;  4MDX A;  3PE0 A;  3VU3 C;  2YUO A;  2I0N A;  2GQV A;  4KUD K;  1D3B B;  4C8Q C;  1ZHI A;  1VQK A;  1Z9Q A;  1VQP A;  4HXJ A;  2M1H A;  5KYU A;  2AKK A;  2DNU A;  3JCM W;  2QEX A;  4II1 A;  4C92 D;  4Y92 A;  3I56 Q;  2DIG A;  1QWE A;  2HD0 A;  5C6S A;  2CYZ B;  2DZC A;  3AT1 B;  4PJO B;  1EIF A;  4PJM A;  1I5O B;  2DXT A;  2GGR A;  1HSQ A;  2EYY A;  3SWN B;  1G2B A;  5I21 A;  1VQ7 A;  2VAS A;  1YIJ T;  2K3Y A;  3QYH B;  5CKE A;  1TH7 A;  4HCK A;  4NL2 A;  3E9G A;  5GAN 6;  2OTJ T;  3CC2 A;  3OA6 A;  2MYS A;  1MHN A;  3JCM h;  5KYU B;  3IQL A;  4CRI A;  2L3Q A;  1WFW A;  2QQ9 A;  2KRM A;  4X9C A;  1ZQ1 A;  2P0P A;  4F04 B;  2P84 A;  3M0S A;  3FEO A;  1ZA1 B;  1FXX A;  1I0C A;  2E5K A;  2VC8 A;  4F14 A;  3CCU T;  2Y4X A;  2LQK A;  3CME Q;  1ZBJ A;  4J9H A;  4E7I A;  2A36 A;  1T0H A;  3FB9 A;  2CS7 A;  4D6W A;  1M3B A;  3CXC S;  2X4Y A;  3CCE T;  3HTR A;  3RKX A;  3PIP A;  2W0Z A;  4Z02 A;  1Q86 U;  2KYB A;  1YI2 T;  4IUV A;  2QTV A;  1G8X A;  1UG1 A;  3NTH A;  2P4T A;  2YDL A;  1YHQ A;  3L2V A;  2ZZD A;  1M1F A;  1S72 A;  4XTU A;  3VS4 A;  1K76 A;  2L5Q A;  3GOX A;  5KH6 A;  3MHX A;  2K7A A;  4C5E A;  4BDY A;  4HVV A;  1WJS A;  1G3T A;  2MMP A;  2FL7 A;  1PCX A;  5CKB A;  2HNI A;  4EMK A;  3NFC A;  1D1C A;  4CC4 B;  1IHV A;  4LUE A;  2CP5 A;  1YJ9 A;  3CC7 Q;  3QXE B;  4M75 D;  1Z9Z A;  1OPK A;  3UT1 A;  3A98 A;  5LJ5 d;  3QZ9 B;  1WGS A;  2ZPE B;  3VYH B;  2F69 A;  3UF4 A;  1N9R A;  3LLR A;  4LXC A;  4OGC A;  5GAO l;  1SSH A;  4FYX B;  3EG9 B;  1X2K A;  2E6Z A;  4C92 E;  4J7F A;  5DLO A;  4K11 A;  2X4J A;  5GAN 8;  1EX4 A;  4XTV A;  2DL4 A;  3V7R A;  1TS9 A;  2KY9 A;  1B34 B;  4ELY C;  5GAN e;  2ZPI B;  2EQK A;  1K1Z A;  2HBW A;  1VQ6 Q;  3OYK A;  2GTJ A;  1RAC B;  4M7D D;  3RR6 A;  3M0T A;  2QDL A;  4CC3 A;  3VUB A;  1H8K A;  1GCQ A;  3CCS T;  2V1Q A;  3QG1 A;  1WXT A;  2MF2 A;  2DL7 A;  2FZC B;  3H9N A;  3TSZ A;  1NLP C;  3CBM A;  1VYU A;  4L6V 5;  1VQK T;  3M0R A;  5IHK A;  1VQP T;  3A8L B;  3L1A A;  4J9G A;  4C8Q D;  2QEX T;  2VWF A;  1UFF A;  3LW5 E;  4VUB A;  4Z88 A;  3RDV A;  1G3S A;  2F5K A;  1BU1 A;  4QKU A;  3LYI A;  2DL5 A;  3ME9 A;  3CC4 Q;  2DTI A;  1YFN A;  2JUF A;  4J9D A;  1RAA B;  2DXB A;  1BIA A;  2RB6 A;  3EGD A;  1WLP B;  2EQM A;  4DEY A;  1VQ7 T;  1D0Y A;  4FT2 A;  3L2Z A;  1JBM A;  4NOY A;  2RH2 A;  2HL3 A;  4JLG A;  3MEW A;  3L2Q A;  3REB B;  4KGV B;  2CGH A;  3CC2 T;  2D0N A;  3OSS C;  2E41 A;  2NUZ A;  1WHK A;  2EFI A;  5CKF A;  1PSE A;  2QAZ A;  1U8R A;  1Q95 G;  3TEE A;  2O88 A;  3S3O A;  2F2X A;  1PWT A;  2V8J A;  1TXQ A;  1QVP A;  3JCM X;  2ABL A;  1YJW Q;  4A63 B;  2HSE B;  4C92 B;  1KFZ A;  3WXM B;  1O75 A;  2QQA A;  2RNA A;  4C0D C;  4M75 E;  4JRK A;  1VUB A;  1R0B G;  3PNW C;  1M90 C;  4ZTJ A;  2EQU A;  1NM7 A;  1HXD A;  4RCC A;  2O9S A;  5GAO q;  1W1F A;  2KRS A;  3VV0 A;  2ROT A;  5KYW B;  3INZ A;  2J06 A;  3A8M B;  3BY7 A;  2CZ1 B;  4YTL A;  1VIF A;  4PL6 A;  3ULR B;  1I07 A;  3CCM T;  1LPL A;  1JJ2 P;  3G6E Q;  4PFZ A;  1M3A A;  3CCL Q;  2K3B A;  2RHU A;  1Y0M A;  1BI3 A;  3E2U A;  4M7A F;  3EG0 A;  1S72 T;  5GAN 3;  4E7J A;  2RJE A;  3OW2 P;  4M7D E;  2BZX A;  4AG1 C;  1WNL A;  4R56 A;  1T0J A;  1WXB A;  3URG A;  5GAO p;  4ATO A;  1VQ4 A;  1WJR A;  3JB9 J;  3X25 B;  2ATC B;  3EG1 A;  2RI2 A;  4IUQ A;  1MMG A;  1YP5 A;  3X28 B;  4F7U A;  3CD6 Q;  2E5Q A;  1M9S A;  4N4I A;  1UE9 A;  4FT4 A;  1M3C A;  2M0O A;  5ECA A;  1NJI C;  1UJ0 A;  2D8J A;  1WPY A;  1ZSZ B;  2GTO A;  3GIB A;  4HT9 A;  2R5A A;  1VQ9 Q;  3VS2 A;  2DKG A;  2DTH A;  1VQ5 Q;  1RLQ C;  2RI5 A;  1TU0 B;  5GAN d;  2AZS A;  2NUT B;  2KXD A;  1OQK A;  1YJN A;  4M4Z A;  2JTM A;  3DB3 A;  2X51 A;  2KRO A;  4EMK C;  3CPW P;  4OVA A;  1MMA A;  5EC7 A;  3JB9 H;  4MZT A;  1YIT T;  5AT1 B;  5IH2 A;  3HPW A;  3VS7 A;  1PKT A;  2RJC A;  4DBF A;  4M7D A;  2F2V A;  2DEQ A;  1F1B B;  3CEY A;  3NHN A;  4M75 B;  1VQL T;  2X3W D;  1LCK A;  2QDY B;  4IUR A;  4BE2 A;  1VYT A;  1PHT A;  1PM3 A;  3BFM A;  3R6N A;  3CBP A;  4A4K A;  2FB7 A;  2ZPB B;  1QW1 A;  1TSF A;  2P0Q A;  1C6V X;  1UEC A;  3T9N A;  4B9X A;  4N4H A;  3N5B B;  3VUZ A;  2VB6 A;  2RK2 A;  3P8D A;  2HBP A;  3OYN A;  1D0Z A;  4C8Q A;  3S3M A;  1UGP B;  4M7D B;  3O8V A;  2JXB A;  3QDF A;  1BKB A;  2PTK A;  3MEU A;  2V1R A;  4BB7 A;  2D9T A;  4MDW A;  5GAN 5;  3TSW A;  2K2V A;  2NUP B;  3VS3 A;  2PVO B;  2YRD A;  2F2W A;  5KCO A;  2KAF A;  1QQJ A;  1ZSG A;  1AHJ B;  2DBK A;  3PVQ A;  5DY9 A;  3PMI A;  3E1S A;  4C8Q B;  1YWP A;  2RK1 A;  1TOV A;  4N4G A;  2KYM A;  3I56 A;  2DER A;  3C0C A;  1KHC A;  5LJ3 g;  1OYX A;  3JSC A;  7AT1 B;  3R6O A;  2EJG A;  2KXC A;  1PD1 A;  2ECZ A;  3M59 A;  2LCS A;  2QQR A;  1MMN A;  4IIO A;  2DMO A;  3FRN A;  4QVD A;  1KIK A;  3CCR Q;  3PGG A;  3P8H A;  5CKD A;  2DET A;  2EYW A;  2LP5 A;  2PZ1 A;  1H92 A;  2CH4 W;  2V8K A;  1MV3 A;  2RQV A;  1GFD A;  1UGS B;  4AMC A;  4KUI A;  2RHX A;  1BBZ A;  3GP8 A;  1VQO A;  4JJC A;  1VQM Q;  2BZ8 A;  4BE0 A;  2KNB B;  1WDX A;  2LJ3 A;  1ZBX A;  5LJ5 j;  4XK8 E;  3UA7 A;  1UTI A;  5IN1 A;  3H6Z A;  1XQH A;  1W4S A;  1TTH B;  5GAN 4;  3I35 A;  2D6F A;  3VS1 A;  3UA6 A;  1Q7Y R;  2LVM A;  1VQ4 T;  2OX7 A;  2OAW A;  2QA4 A;  1U1S A;  2KRN A;  2O2O A;  4A4G A;  2YWW A;  3PT9 A;  3CME A;  2MWP A;  4ZGJ B;  5GJW B;  2J6F A;  3QSU A;  1NEG A;  5L8R E;  1WQ7 A;  1W2B P;  1V29 B;  4PLL A;  3M58 A;  3V7C A;  3M9Q A;  3M56 A;  2DL3 A;  4HKE A;  5D6W A;  2A3L A;  3ZL7 C;  2PUO B;  3JCM g;  4AT1 B;  4XTW A;  2WSE E;  2DIL A;  1JXM A;  4PFP A;  2MAM A;  5GAO r;  1K73 R;  3JV3 A;  2CRE A;  2AK5 A;  3MEV A;  4J8O A;  3SFM A;  2XG8 D;  4CC7 A;  2LZ6 B;  2MI6 A;  1IB8 A;  2SEM A;  2JW4 A;  1WXU A;  3JCM P;  1GFC A;  1M2V B;  4AFZ C;  1OV3 A;  4OMN A;  3MET A;  2EQJ A;  4BI8 B;  1X75 C;  2AHJ B;  1I5L A;  5GAM g;  2GCX A;  2EJF A;  4M77 G;  4JS5 A;  3HP9 A;  2YUN A;  3GPL A;  3G71 A;  2ZPF B;  1TUG B;  4ZN1 A;  2YT6 A;  1Q81 R;  1VQ6 A;  1WIE A;  2K4Y A;  4X1V A;  2FYK A;  1K8A R;  5KE3 A;  5HCK A;  4QQG A;  2E12 A;  2EIF A;  1K9M R;  1FMK A;  2WSF E;  4NL3 A;  2LT4 A;  3OQ5 A;  3M4Y A;  4RTT A;  1QKX A;  4ORZ A;  4PJJ A;  5GAN 7;  1T3L A;  1M1G A;  1ABO A;  3C12 A;  2RPN A;  1VQ8 Q;  1M8V A;  3HRS A;  3EH2 A;  1IRX A;  2B86 A;  3TQ7 P;  4CI0 C;  5CQY A;  3QBY A;  1NZ9 A;  2HKQ B;  2X4W A;  2AT1 B;  2C0I A;  4FW2 A;  3FC3 A;  4R55 A;  4J7I A;  2LT1 A;  1X6G A;  1KQS A;  4PK4 A;  1GXI E;  3THK A;  3CC4 A;  2KBT A;  2LJ1 A;  4ZNX A;  3S3N A;  2QG9 B;  4B9W A;  1WJQ A;  2COY A;  2CKK A;  1SRM A;  2E70 A;  3MP8 A;  1B7T A;  4DA4 A;  3KBG A;  2O4X A;  4LDU A;  2XDD A;  1Y7X A;  2H8H A;  4IUU A;  1Y71 A;  2FG0 A;  3RES A;  3EGU A;  1UHC A;  2CDT A;  1VQO T;  2JVV A;  3CCQ A;  5GAM d;  2G3R A;  1N9S A;  1Q82 U;  1KD1 R;  4TVR A;  2RQW A;  4F7U F;  2O31 A;  3CXC A;  5KYY A;  4HCB A;  4HT8 A;  1IGQ A;  1YJW A;  1KQS S;  2V8I A;  3M0U A;  4X9D A;  2OAU A;  1G3W A;  2X3X D;  1WZO A;  1QVG S;  4V2S A;  2YHT A;  1PRL C;  2P0K A;  2F5T X;  4M75 F;  2DXC A;  2QA4 T;  1M1K C;  5GAN j;  3HFO A;  1N8R R;  4DBH A;  2AIR B;  2GF7 A;  4F16 A;  1YIJ Q;  2OTL T;  4C0D B;  2KI7 A;  3HSB A;  3UWN A;  1SHF A;  2C0T A;  2OTJ Q;  2EBP A;  1WHL A;  4C0Z A;  3TVT A;  5DM7 R;  4M77 C;  3RKY A;  1AZG B;  4OMF B;  3AHU A;  1YWO A;  3H0I A;  2DAQ A;  4PFO A;  4RG8 A;  3G6E A;  5KYY B;  1JEG A;  2K5F A;  4PNO A;  4HCC A;  2DE0 X;  3KXT A;  4M7D F;  2DVJ A;  3WVD B;  1MV0 B;  3BW1 A;  3QKJ A;  2E3I A;  2XKO C;  1AWW A;  4OB1 B;  4OB3 B;  5LJ3 f;  2EVR A;  3OYY A;  3HRT A;  4P5N A;  4JRP A;  4LUD A;  3OMG A;  3QHS A;  1KC8 U;  3CCU Q;  1TG0 A;  5HKC A;  4JZ4 A;  3RBB B;  4FSS A;  3M53 A;  2PVD B;  2K5I A;  3OYF A;  2K3X A;  1LVK A;  1YBY A;  2DYB A;  1VQN A;  3CCE Q;  1E6G A;  4C8Q F;  3X20 B;  3A8H B;  1YI2 Q;  1PC0 A;  4DQ2 A;  1VQ9 A;  4RTV A;  5CKH A;  3G71 T;  1RAG B;  2F1L A;  3M54 A;  5GAO m;  1AD5 A;  3GBQ A;  3G4S T;  3X24 B;  1C0M A;  4IUP A;  2NYS A;  3SB2 A;  1OPL A;  3NPF A;  4EIK A;  4FL6 A;  2DIQ A;  5FLX E;  1K8A C;  4EMK B;  1H3Z A;  2HKN A;  2L3R A;  3QYG B;  2HCK A;  2KSS A;  2VKN A;  2LCL A;  3ZEH A;  4RTU A;  3JCM f;  2AKL A;  1GBR A;  1KHI A;  4RTX A;  5D7U A;  5I2M A;  2XDB A;  3LX7 A;  3RNJ A;  1K0X A;  3EGX A;  2VXE A;  1MND A;  3DKM A;  3MCA B;  5LJ5 h;  2FPE A;  3MJX A;  1AWO A;  5KCH A;  2BE7 D;  1X27 A;  4A4H A;  3CCS Q;  2B8A A;  1Q82 R;  2XD0 A;  4HVW A;  3CCJ A;  1AEY A;  2M16 A;  1WQW A;  1E6H A;  2NWM A;  3GNF B;  5CR2 A;  4X34 A;  5KYN A;  1WHG A;  5GAM f;  1BI2 A;  1G83 A;  2R58 A;  3L42 A;  3OYL A;  1VQK Q;  2LX9 A;  2L8D A;  3CCQ T;  4BAC A;  1ZA2 B;  1K0S A;  2QEX Q;  2IVW A;  1MNE A;  1RAD B;  2EGC A;  3OYH A;  2LQ8 A;  2KQW A;  5M9O A;  3V8K A;  2K57 A;  2LNH B;  2X35 A;  3QII A;  1CKA A;  1OEB A;  2EYQ A;  1VA7 A;  4F7U E;  1N8R C;  1Y96 A;  1VQ7 Q;  3EGD B;  9ATC B;  1Q86 R;  2WAC A;  2DLP A;  4C5G A;  3OYA A;  5IAY A;  2DYI A;  2FPF A;  2HEQ A;  3HRU A;  2DX1 A;  4M77 D;  4FIB A;  4CC2 A;  4LDY A;  3Q1J A;  1D0X A;  2DVE A;  1VQM A;  4HCZ A;  4MML A;  1SF9 A;  3DB4 A;  1EFN A;  3QPH A;  1YHQ T;  3MKD A;  3I55 A;  1Y96 B;  3FDR A;  3JCM c;  2KVQ G;  3JB9 G;  4OML A;  4JJN K;  2CUD A;  1IZ6 A;  1AWJ A;  4E7Z A;  1M5Q 1;  2FRY A;  2GQI A;  3O5Z A;  1WYX A;  2JTF A;  1BIB A;  4LD6 A;  1SG5 A;  1VQN T;  3ER0 A;  1YJ9 T;  5EG2 A;  1IXD A;  2DRM A;  1D1B A;  3CCM Q;  2BKD N;  2FZK B;  1ZUU A;  2DD5 A;  4M78 A;  1S72 Q;  1BCO A;  5GAN 2;  2BTT A;  4Z8A A;  3CCV A;  4LDV A;  4C8Q E;  1D1A A;  5L23 A;  2L2P A;  2HL5 C;  2GNC A;  1OI1 A;  4RCB A;  3CBO A;  2EKO A;  1YCS B;  2PQW A;  1UHF A;  2RI3 A;  1ZUY A;  4ZTF A;  4RMO A;  5GJV B;  2LMJ A;  1KQ2 A;  4ELZ C;  3FLG A;  3PVL A;  4ZGD B;  3CMA A;  4J6W A;  5IT9 E;  3C4S A;  2EWN A;  1XJW B;  1RAB B;  1RAI B;  4F7U B;  1HJD A;  1KSW A;  2Y4Y A;  2HQX A;  1M1K U;  3M55 A;  4LDW A;  5LJ3 e;  5IHN A;  1WX6 A;  1ACM B;  8ATC B;  1V1C A;  2VGN A;  2WSC E;  1OOT A;  3OYI A;  4QQ6 A;  2V26 A;  3JCM V;  2YRV A;  4JJB A;  3HFN A;  1G5V A;  4HVU A;  1YIT Q;  4JZ3 A;  5GAM j;  5D6X A;  1OU9 A;  3OBW A;  2VV5 A;  2LCC A;  2HSP A;  1VIE A;  3JRZ A;  5FU6 C;  5CVI A;  2CZ0 B;  3CCJ T;  2RM4 A;  1VQL Q;  5GAN h;  4M77 E;  4XU1 A;  4IUT A;  1UJY A;  2J6O A;  4A4E A;  4J6Y A;  1FYN A;  2X9H A;  4R0K A;  5C0M A;  1RAH B;  3VS6 A;  2FHD A;  4A54 A;  4J6X A;  2LDM A;  4M78 G;  3M4G A;  2RA2 A;  1JJ2 S;  4EDU A;  1RI0 A;  4OB2 B;  1J3T A;  1JXO A;  4RTZ A;  2MOX A;  5I22 A;  4FYV B;  1UDL A;  3FIF A;  2LJ0 A;  4FM4 B;  3OW2 S;  4ME7 A;  2CZ7 B;  1Q86 C;  3JCM e;  3OBY A;  2KE9 A;  3EAE A;  3ZBD A;  2RQR A;  2XDP A;  2E3H A;  3EFS A;  5FRO A;  4D8K A;  4A4F A;  2CP0 A;  4GY5 A;  3OS5 A;  2M0Y A;  3E9F A;  5I2S A;  2CH4 A;  4E7K A;  1QP3 A;  4M77 A;  2CP6 A;  3I55 T;  3H0H A;  4ANJ A;  1R8O B;  2RO0 A;  2GFU A;  5GAM e;  2DJQ A;  2RD1 A;  3HL8 A;  5A0D A;  4RTY A;  2JJ9 A;  2A7Y A;  2FPD A;  4C5H A;  4JLI A;  3CPW S;  2BIV A;  2MPX C;  1QVF A;  1LJO A;  1CSK A;  3J80 E;  2VUB A;  2L0A A;  3CQT A;  4UC4 A;  1LOJ A;  1NPR A;  3TRE A;  5AYF A;  3U23 A;  4M77 B;  1U1T A;  3CCV T;  2ZCF B;  2CP3 A;  2H3J A;  1V76 A;  4AFQ C;  3P8B B;  1RAE B;  1YJN T;  1NBE B;  2SRC A;  2RN8 A;  2XU8 A;  3PMT A;  1E7O A;  5CO7 A;  1I81 A;  5D6Y A;  3CMA T;  1QVF S;  5LJ3 d;  4XU2 A;  5KE2 A;  2QK0 A;  3LWI A;  2ROL A;  1H3H A;  3CCE A;  2E10 A;  3CC7 A;  1KQS P;  1M8M A;  1G3Y A;  4JS4 A;  2CT3 A;  4M78 C;  1QWF A;  4BDZ A;  3RMS A;  5CK9 A;  3JB9 I; 
#chains in the Genus database with same CATH homology
 3TEE A;  3PFS A;  3VYG A;  4PNO A;  4BY6 C;  5GMK h;  3S3O A;  1M90 U;  1N6A A;  4HCC A;  5FU7 C;  3KXT A;  3V8L A;  4M7D F;  2V8J A;  1VQ8 A;  1HK9 A;  2E6N A;  3WVD B;  3BW1 A;  1QVP A;  3QKJ A;  3JCM X;  2XKO C;  4OB1 B;  4OB3 B;  5LJ3 f;  3RMQ A;  1KG1 A;  1JRI A;  2XID A;  4KUL A;  3V7S A;  3OYY A;  4C92 B;  3HRT A;  4P5N A;  1MGQ A;  2QI2 A;  4JRP A;  3WXM B;  2E65 A;  1O75 A;  3OMG A;  2XIC A;  4PJO D;  2QQA A;  2RJD A;  2YLC A;  3LGF A;  4M7A A;  3QHS A;  4C0D C;  1KC8 U;  4KBM B;  4QVC A;  1PSF A;  3C95 A;  4M75 E;  4JRK A;  1VUB A;  3OYM A;  5HKC A;  4F7U G;  3PNW C;  4JDS A;  3E19 A;  4JUV A;  1M90 C;  4ZTJ A;  3M53 A;  2EQU A;  1HXD A;  2PVD B;  1QP2 A;  2K5I A;  3BDL A;  4O5V A;  2K3X A;  4RCC A;  3VV0 A;  3OB9 A;  5GAO q;  3OYF A;  1YBY A;  1VQN A;  3INZ A;  3A8M B;  3BY7 A;  4M75 G;  2CZ1 B;  2LRQ A;  3QO3 A;  1VIF A;  2R57 A;  4YTL A;  3X20 B;  4OB0 B;  4PL6 A;  4C8Q F;  3OS2 A;  3CCR T;  3A8H B;  3L2R A;  1K8A U;  3TU4 K;  3CCM T;  3CPW A;  3QUI A;  4DQ2 A;  1VQ9 A;  2RHU A;  2ZPG B;  5CKH A;  1K9M U;  1KC8 C;  1BI3 A;  3G71 T;  4M7A F;  3F70 A;  4PLI A;  2DTO A;  2RHI A;  3M54 A;  2RHZ A;  4C92 C;  5GAN 3;  5GAO m;  1VQM T;  2L89 A;  4C0F A;  4E7J A;  1S72 T;  3G4S T;  4Y91 A;  2YLB A;  3X24 B;  4N0A C;  4IUP A;  1OZ2 A;  2RJE A;  3SB2 A;  3OSV A;  4M7D E;  3A8O B;  3JB9 D;  1WNL A;  4R56 A;  1FX7 A;  1NJI U;  4GLK A;  4BI4 A;  3I56 T;  3JCM d;  4FL6 A;  2DIQ A;  4DOV A;  3TCJ A;  3URG A;  5FLX E;  5GAO p;  4ATO A;  5GMK l;  1VQ4 A;  1WJR A;  3CCS A;  3C94 A;  3JB9 J;  4EMK B;  1K8A C;  3X25 B;  4PJO A;  5HK3 A;  1H3Z A;  4M7D G;  2L3R A;  5GMK m;  1NE8 A;  3QYG B;  4BUG A;  1QVG A;  2RI2 A;  4LD9 K;  4IUQ A;  4BD3 A;  3X28 B;  4F7U A;  1YIJ A;  2E5Q A;  2KSS A;  5FRM A;  2LCL A;  1M9S A;  4N4I A;  5A0L A;  4FT4 A;  2OTJ A;  2LNV A;  4J83 A;  2M0O A;  4LDX A;  3ZEH A;  1NJI C;  3LH0 A;  4BE1 A;  1WPY A;  3JCM f;  1UEB A;  3GIB A;  4HT9 A;  2R5A A;  2BUD A;  2DKG A;  1KHI A;  5LL6 S;  4EPC A;  2DTH A;  3ZFJ A;  1W2B S;  5I2M A;  2XDB A;  2RI5 A;  3LX7 A;  4QW2 A;  3HKS A;  5GAN d;  3PTA A;  1YJN A;  4M7A E;  2JTM A;  2VXE A;  2RJF A;  4C8Q G;  3DB3 A;  1JB0 E;  5CCA A;  3DKM A;  1LNX A;  4A53 A;  1IRE B;  4EMK C;  3WVE B;  3MCA B;  2RHY A;  4OVA A;  5LJ5 h;  3JCM b;  1Q81 U;  3JB9 H;  2LC4 A;  4MZT A;  1YIT T;  1KD1 U;  3UPU A;  1Q7Y C;  4M78 F;  1SSF A;  4C5I A;  4A4H A;  5KCH A;  2OTL A;  5LJ5 g;  2B8A A;  2XD0 A;  4XTX A;  3DLL A;  2KDS A;  4XU3 A;  5DLQ E;  3OYG A;  3HPW A;  4WF2 A;  3X26 B;  3CCU A;  3CCJ A;  2RJC A;  2M16 A;  1WQW A;  3NTI A;  4M7D A;  2DEQ A;  3CEY A;  3GNF B;  2O4X B;  5CR2 A;  5GAN f;  4M75 B;  3CME T;  4X34 A;  1VQL T;  5GAM f;  1BI2 A;  5GMK j;  1FWZ A;  2QDY B;  4IUR A;  4XAX B;  4BE2 A;  1N8R U;  2R58 A;  4DOW A;  3L42 A;  4XTY A;  3OYL A;  2LX9 A;  1O9S A;  2Y90 A;  3JB9 F;  2O01 E;  3RKW A;  2L8D A;  3CCQ T;  3BFM A;  3CBP A;  4A4K A;  4BAC A;  1YI2 A;  2XI9 A;  5GAO n;  2VGM A;  2FB7 A;  2ZPB B;  2IVW A;  1QW1 A;  3CCL A;  2P0Q A;  2JOY A;  3CPF A;  3T9N A;  4XQ3 A;  4B9X A;  3OYH A;  2DO3 A;  2LQ8 A;  2KQW A;  5M9O A;  3KUF A;  4N4H A;  3V8K A;  4EMG A;  2XHC A;  3N5B B;  2KK4 A;  4O6J A;  3VUZ A;  4PJO E;  2D0Q B;  2K57 A;  2RK2 A;  2FVU A;  2HBP A;  3P8D A;  1XOV A;  3OYN A;  2X35 A;  4E7L A;  2K5L A;  3QII A;  4C8Q A;  3OYB A;  1K73 C;  4ZGE B;  2DZ9 A;  2EYQ A;  4F7U E;  3CC2 T;  1YCY A;  2PVG B;  1N8R C;  3S3M A;  1Y96 A;  4PJO G;  1UGP B;  1Y07 A;  4M7D B;  4M7A G;  3RIR A;  1I8F A;  2VYT A;  2QXF A;  3O8V A;  1KQ1 A;  5FRN A;  4M75 C;  2KMT A;  5GAM h;  2WAC A;  3ASK A;  4IKF A;  4C5G A;  1BKB A;  3MEU A;  4MZP A;  3OYA A;  1DJ7 B;  4BB7 A;  4E7H A;  2D9T A;  3SD4 A;  4MDW A;  2E64 A;  5IAY A;  4C92 F;  5GAN 5;  3CC7 T;  5GMK i;  2DPP B;  3CCM A;  2K2V A;  3LWH A;  2DD4 A;  4Q5W A;  3J7A F;  2PVO B;  3CD6 A;  3L2W A;  3HRU A;  4M77 D;  4FIB A;  4L59 A;  4LDY A;  1H64 1;  3Q1J A;  2QQS A;  4M78 D;  2DVE A;  5LJ5 e;  5J26 A;  5KCO A;  2KAF A;  1VQM A;  2X4X A;  4HCZ A;  3G4S A;  1XNI A;  4MML A;  3VJP A;  2DK3 A;  1VQ8 T;  4J5Y A;  3DB4 A;  1AHJ B;  1XTD A;  5HK0 A;  5DY9 A;  1D3B A;  3PMI A;  3E1S A;  5LJ3 h;  4C8Q B;  2RK1 A;  4N4G A;  3I56 A;  1VQ5 A;  3QPH A;  1YHQ T;  2LTO A;  1KHC A;  3I55 A;  1B34 A;  1Y96 B;  2DXU A;  5LJ3 g;  3FDR A;  1BI0 A;  3OYC A;  3JCM c;  2KVQ G;  1OYX A;  3JSC A;  3JB9 G;  3R6O A;  3JCM J;  4M7D C;  4E47 A;  2EJG A;  3OMC A;  3PIO A;  1UGQ B;  2QQB A;  4JJN K;  1W2B A;  1Q81 C;  4M7A B;  3H8Z A;  3M59 A;  1VQ6 T;  1IZ6 A;  2QQR A;  1M5Q 1;  2JTF A;  3FRN A;  1BIB A;  2EJ9 A;  4LD6 A;  4QVD A;  1VQN T;  3ER0 A;  3J81 E;  3PGG A;  2M9U A;  3SWN A;  3P8H A;  1K9M C;  4BI3 A;  5EG2 A;  5CKD A;  1YJ9 T;  1UB4 A;  5GMK e;  2BKD N;  3UDC A;  4JRQ A;  2V8K A;  4MDX A;  3VU3 C;  1UGS B;  4KUI A;  2RHX A;  3GP8 A;  1VQO A;  2GQV A;  4KUD K;  1D3B B;  2DD5 A;  3RER A;  4M78 A;  4C8Q C;  1ZHI A;  4KT0 E;  1VQK A;  5GAN 2;  3CCV A;  4BE0 A;  4LDV A;  4C8Q E;  1VQP A;  3RUX A;  1ZBX A;  2M1H A;  4XK8 E;  5LJ5 j;  3JCM W;  1OI1 A;  3FJP A;  4RCB A;  3CBO A;  2EKO A;  4II1 A;  3H6Z A;  5IN1 A;  1OZ3 A;  2QEX A;  1XQH A;  4C92 D;  3OY9 A;  1W4S A;  5GAN 4;  2DIG A;  2PQW A;  4M7A C;  2RI3 A;  1YIT A;  3MP1 A;  2D6F A;  3V8J A;  4ZTF A;  2CZ6 B;  4RMO A;  2HD0 A;  5C6S A;  2CYZ B;  2JN0 A;  4XU0 A;  2DZC A;  2LVM A;  4XTZ A;  4ELZ C;  1VQ4 T;  1KQ2 A;  3DLM A;  3FLG A;  4PJO B;  1EIF A;  1P92 A;  2QA4 A;  1U1S A;  2DXT A;  3S6W A;  5CQX A;  2NLU A;  4ZGD B;  3CC4 T;  2PUK B;  3SWN B;  3CMA A;  4M77 F;  4A4G A;  4J6W A;  5IT9 E;  3PT9 A;  3C4S A;  2EWN A;  3QJ6 A;  3CME A;  1VQL A;  1I4K 1;  2MWP A;  4ZGJ B;  5I21 A;  1VQ7 A;  3A5Z B;  5FU6 B;  1YIJ T;  2K3Y A;  3G7Z A;  4F7U B;  3QYH B;  5HY6 A;  1M1K U;  2Y4Y A;  2HQX A;  5CKE A;  3QSU A;  1TH7 A;  3M55 A;  4LDW A;  4NL2 A;  5L8R E;  3E9G A;  5GAN 6;  5LJ3 e;  2OTJ T;  1WQ7 A;  2HAX A;  1V29 B;  4PLL A;  3CC2 A;  3OA6 A;  3M58 A;  3V7C A;  3M9Q A;  1MHN A;  3JCM h;  3M56 A;  2VGN A;  4CRI A;  2WSC E;  4L5G A;  4HKE A;  3OYI A;  4QQ6 A;  2QQ9 A;  5D6W A;  2A3L A;  2PUO B;  3JCM g;  4X9C A;  4XTW A;  2WSE E;  1ZQ1 A;  2P0P A;  1KD1 C;  5J39 A;  3JCM V;  2YRV A;  5GAO r;  2MAM A;  3JCM Q;  2E1H A;  3FEO A;  3HFN A;  4C92 A;  4PJO C;  1G5V A;  1BYM A;  3EFR A;  5A0G A;  1YJW T;  1FXX A;  5GAM j;  5D6X A;  4OF1 A;  3OBW A;  5CAI A;  2VV5 A;  2LCC A;  2R5M A;  3SWN C;  5J3B A;  3SDZ A;  1VIE A;  3MEV A;  4J8O A;  3SFM A;  3L2U A;  2XG8 D;  3JRZ A;  5FU6 C;  2VC8 A;  5CVI A;  2CZ0 B;  3CCU T;  2Y4X A;  4Y28 E;  2MI6 A;  3CCJ T;  2LQK A;  3JCM P;  1M4Z A;  2RM4 A;  4HA8 A;  4E7I A;  3MO8 A;  5GAN h;  3FB9 A;  4M77 E;  4NS5 A;  2CS7 A;  4IUT A;  4XU1 A;  4D6W A;  3OYE A;  4M78 E;  4A4E A;  4J6Y A;  3MET A;  2EQJ A;  4BI8 B;  3CXC S;  1X75 C;  2X4Y A;  3CCR A;  3CCE T;  5GAN g;  2AHJ B;  3RKX A;  1I5L A;  1VQK T;  4RG2 A;  5C0M A;  5GAM g;  3PIP A;  2GCX A;  4PKC C;  4Z02 A;  5LJ3 j;  2FHD A;  1Q86 U;  1YI2 T;  4IUV A;  4J6X A;  2EJF A;  4A54 A;  2LDM A;  4M77 G;  4JS5 A;  4M78 G;  3G6E T;  3HP9 A;  3M4G A;  3GPL A;  3CCL T;  3G71 A;  3OYD A;  3NTH A;  2P4T A;  1YHQ A;  2ZPF B;  3L2V A;  2ZZD A;  1M1F A;  1S72 A;  4XTU A;  2RA2 A;  1JJ2 S;  4C0G A;  4OP0 A;  4ZN1 A;  2L5Q A;  3GOX A;  5KH6 A;  3MHX A;  3VKI A;  4EDU A;  1RI0 A;  4C5E A;  4OB2 B;  4BDY A;  2IG0 A;  4ZN3 A;  1VQ6 A;  1WJS A;  1G3T A;  2MMP A;  2FL7 A;  3MP6 A;  3FIF A;  5CKB A;  2K4Y A;  2HNI A;  4FM4 B;  4EMK A;  3NFC A;  3OW2 S;  2FYK A;  4ME7 A;  2CZ7 B;  1Q86 C;  3NTK A;  5KE3 A;  3JCM e;  3OBY A;  4QQG A;  2E12 A;  2EIF A;  1YJ9 A;  2WSF E;  3EAE A;  3QXE B;  4QVZ A;  4NL3 A;  2LT4 A;  4M75 D;  3ZBD A;  3UT1 A;  3OQ5 A;  4QQD A;  3M4Y A;  2QTX A;  2XDP A;  5LJ5 d;  3QZ9 B;  3EFS A;  1WGS A;  2ZPE B;  3HHT B;  3VYH B;  2F69 A;  4JRI A;  3CD6 T;  1UGR B;  1N9R A;  3LLR A;  4OGC A;  5FRO A;  5GAN 7;  4EMH A;  2ZGW A;  1M1G A;  4A4F A;  5GAO l;  3C12 A;  3QZ5 B;  1X01 A;  2E6Z A;  1M8V A;  3HRS A;  2DJZ A;  4GY5 A;  2GFA A;  3OS5 A;  4C92 E;  3JAM E;  3E9F A;  2C06 A;  4J7F A;  5DLO A;  1VQ9 T;  2JZ2 A;  5I2S A;  4E7K A;  1QP3 A;  4M77 A;  4CI0 C;  5CQY A;  2X4J A;  1VQ5 T;  3QBY A;  1NZ9 A;  2X4W A;  5GAN 8;  3FC3 A;  4R55 A;  4J7I A;  4XTV A;  3I55 T;  3V7R A;  1NPP A;  3LGL A;  2KY9 A;  1B34 B;  4ELY C;  4C92 G;  2LT1 A;  4OGE A;  2XK0 A;  1R8O B;  2RO0 A;  5GAN e;  2GFU A;  3GLX A;  2ZPI B;  3OS1 A;  2EQK A;  5GAM e;  5LJ5 f;  2RD1 A;  3OYK A;  1KQS A;  1GXI E;  3HL8 A;  5A0D A;  3CC4 A;  1X6O A;  4M7D D;  2EAY A;  3S3N A;  4B9W A;  2A7Y A;  4C5H A;  2MWO A;  1WJQ A;  3VUB A;  4JLI A;  3CPW S;  2CKK A;  3CCS T;  2E70 A;  3MP8 A;  4MZM A;  2BIV A;  4DA4 A;  3KBG A;  4FU6 A;  3QG1 A;  1Q7Y U;  1QVF A;  1N27 A;  2O4X A;  3A8G B;  4LDU A;  2MF2 A;  4M75 A;  2XDD A;  1LJO A;  1RL2 A;  3J80 E;  1Y7X A;  2VUB A;  1Y71 A;  4IUU A;  4UC4 A;  1LOJ A;  3RES A;  1NPR A;  5CIU A;  3TRE A;  5AYF A;  3CBM A;  4MMK A;  4PJO F;  1VQO T;  2JNG A;  4M77 B;  2JVV A;  3CCQ A;  1U1T A;  4L6V 5;  2G3R A;  4M78 B;  5GAM d;  1N9S A;  3QJY A;  4RKU E;  3CCV T;  1Q82 U;  3MEA A;  2ZCF B;  3A8L B;  3L1A A;  1VQP T;  2H3J A;  4C8Q D;  4TVR A;  4F7U F;  2QEX T;  3CXC A;  3BDU A;  4HCB A;  4BY6 B;  1YJW A;  1KQS S;  4HT8 A;  2V8I A;  3LW5 E;  5A2Q E;  4X9D A;  2OAU A;  4VUB A;  1G3W A;  3P8B B;  5FU7 B;  1QVG S;  4V2S A;  1G3S A;  2F5K A;  2PU9 B;  2YHT A;  3OS0 A;  1YJN T;  2P0K A;  2F5T X;  3LYI A;  4M75 F;  4M7A D;  2XU8 A;  2DXC A;  3ME9 A;  2ZPH B;  2DTI A;  3PMT A;  2QA4 T;  3HFO A;  2JUF A;  5CO7 A;  5GAN j;  1M1K C;  1JJ2 A;  3GNG A;  1BI1 A;  1I81 A;  2GF7 A;  4N0A A;  2I2L A;  5D6Y A;  2DXB A;  1BIA A;  2RB6 A;  3CMA T;  1QVF S;  2EQM A;  3QDR B;  5LJ3 d;  2OTL T;  4XU2 A;  4C0D B;  5KE2 A;  3LWI A;  1Q82 C;  1K73 U;  4FSX A;  1VQ7 T;  4FT2 A;  3L2Z A;  3HSB A;  1JBM A;  3UWN A;  4NOY A;  2RH2 A;  4JLG A;  3CCE A;  2E10 A;  3MEW A;  3L2Q A;  3CC7 A;  4C0Z A;  5DM7 R;  1G3Y A;  4M77 C;  2CGH A;  3M5A A;  2VXF A;  3RKY A;  3OYJ A;  4JS4 A;  3OW2 A;  4M78 C;  2E41 A;  3GF5 A;  3OSS C;  4OMF B;  3RMS A;  5CK9 A;  2DAQ A;  4BDZ A;  3AHU A;  4RG8 A;  3G6E A;  2EFI A;  5CKF A;  1PSE A;  3JB9 I;  2HQE A;  1U8R A;  3M57 A;  2K5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...