5CKEA

E.coli mazf e24a form iia
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
101
Chain Sequence
VSRYVPDMGDLIWVDFHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 27
structure length 101
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckeA00
1M1FA 1VUBA 2MF2A 4ME7A 5CKBA 4ELZC 5HK0A 3JRZA 1X75C 4MZTA 5CQYA 5CK9A 5HK3A 3G7ZA 4OF1A 1UB4A 1NE8A 5CR2A 2KMTA 4MZPA 5HKCA 3HPWA 4VUBA 4MDXA 5CKEA 3TCJA 4HKEA 4MZMA 5CCAA 5CKDA 3NFCA 4ELYC 5CO7A 5CKFA 2C06A 5CKHA 5DLOA 3JSCA 5CQXA 2VUBA 3VUBA
chains in the Genus database with same CATH superfamily
1ZHIA 4OMLA 2J6FA 1Y96B 2VVKA 1PHTA 1N5ZA 2YSQA 1WQWA 2M1HA 3GIBA 4D8DA 1NPPA 2DF6A 3RESA 2WACA 2RQWA 3HFOA 1ZUKA 3OYEA 4ATOA 5LJ3f 2CH4A 2JVVA 2E4HA 4QW2A 2RNAA 1GCPA 2O4XA 1H641 3T9NA 1VUBA 3SFMA 4JZ3A 1YITQ 3JAME 2OAUA 2XDBA 1KIKA 2EAYA 1T3SA 1PKTA 3MPUB 4M78G 1QW1A 3M56A 1PC0A 4M4ZA 4J7IA 2A0FB 2DVJA 4ZGDB 5GAOl 3CCQQ 1IZ6A 2FZKB 5KYXB 1K9MU 2QQSA 2RQVA 2X3WD 4E47A 3OYIA 3C94A 2YT6A 3QKJA 2HBPA 5KE2A 1WYXA 2C0IA 2V26A 2DILA 2J7IA 4IKFA 3TSWA 1VQ9T 2H3JA 2VYTA 1K73U 1RI9A 2ZAEA 1ZSZB 3LWIA 1GRIA 2BE7D 5CKDA 2RQUA 4LUDA 2O31A 2ZPBB 1YJ9Q 3JCMh 2PQWA 1N27A 2VXEA 1UG1A 2V8JA 4OB0B 1BI2A 1YI2Q 2RI5A 1YJWT 1BI0A 2DERA 3M55A 2J6OA 2A08A 2RH2A 3EG3A 4M77F 1Q81R 1T3LA 1VQ5Q 2HAXA 3ULRB 3CD6A 1GFDA 4DOVA 2RF0A 5IHIA 1S72Q 4CC2A 5IN1A 2KROA 2RQTA 2YLCA 3CCUT 1Q86R 2R57A 3CMAA 1O75A 4XTZA 1I5OB 5GAN5 2SRCA 3G4ST 4JRIA 1OZ2A 2OAWA 3MHXA 3L2WA 3EFOB 4QVZA 3A8HB 1MV0B 1M3CA 5KYYA 3META 3CMEQ 2F69A 1G3TA 1PSFA 2YUQA 2QI2A 2FHDA 2JZ2A 1RACB 1B3QA 4KBMB 1D1BA 2AIRB 1TUGB 2QXFA 1KQ2A 2VGNA 4KH0B 2CP5A 2CH4W 2DL7A 3E9FA 1KD1U 2OTLT 1W1FA 4F7UF 1K0XA 1LCKA 1BB9A 3OS5A 3LWHA 1MNEA 1B07A 4EDUA 1WA7A 2CDTA 5GJWB 4BDZA 1G5VA 5FWCA 3SD4A 1Q82R 1SSHA 3S6WA 4J9GA 2O2OA 1W2BA 3L1AA 3M4YA 1E7OA 2OJ2A 2KE9A 3OW2P 1EZZB 1AWJA 3UA6A 1SEMA 4M77E 3VJPA 5GAN7 5I21A 3EFRA 2K79A 2C0TA 4M7AE 2LCCA 3CQTA 2F2WA 2OI3A 2HEQA 1VQKT 2VB6A 4J9DA 4QQGA 1W2BS 4DEYA 2FG0A 3ASKA 3HRTA 4PK4A 1PRMC 5J3BA 4LE9A 2FPEA 1HSQA 1QP3A 3HFNA 1D3BB 2QAZA 3V8LA 1YJNA 1NJIC 1VQPT 1VQLT 1YNZA 4EMGA 1N8RR 4BE0A 4RCBA 1UECA 3GNGA 1IGQA 2ZGWA 1HD3A 3FEOA 2O4XB 2EGEA 3JCMg 3CC7Q 3S3MA 1NE8A 3JV3A 1ARKA 3BFMA 2M0YA 1Y07A 3REAB 5C6SA 2EJ9A 4OVAA 2L5QA 1X01A 3ME9A 1WDXA 2ZPIB 3MCAB 4N4GA 2YUPA 2AZVA 3E1SA 3RIRA 2X9HA 3L2UA 2BKDN 2L3RA 5GAMf 2LNHB 4E7KA 5IXFA 2XG8D 3JCMJ 2YLBA 4BY6C 3OA6A 1X27A 4M75F 1N9SA 1QLYA 3REBB 2EGAA 4A63B 2QK0A 1QMCA 2NUZA 2I0NA 2DKGA 3MP8A 1KC8U 4L6V5 1QKXA 2LQ8A 2M9UA 3CXCP 1X75C 1YCSB 2P0QA 3F70A 4BACA 1OI1A 2LC4A 2KI7A 2JJ9A 2DBKA 2V8KA 4J6XA 3TQ7P 3JCMe 4RTXA 4L5GA 2JMCA 4KT0E 3OMCA 2HNIA 2QTXA 3OYNA 3G6EQ 3VS7A 5GAN4 1H92A 1PG5B 2BUDA 3CCEA 4QVDA 1MMGA 3VRYA 1M1KU 2NUTA 1IRXA 2K2VA 3CCMA 1FX7A 1Y71A 3EFSA 5D7UA 1TXQA 1ZBJA 3CCRQ 4IURA 3JCMP 2DD4A 1IGUA 2FO0A 2HD0A 2XDPA 4FYWB 4NL2A 2KK4A 5EC7A 3EH1A 1UGRB 3PTAA 1HXDA 4AFZC 1K9AA 2QGFB 5KYYB 2F5TX 3CD6T 1SRLA 1VQ8Q 3VS5A 4N0AA 2LP5A 5AT1B 3KUFA 4M7DE 2DYBA 2C0OA 4C8QF 3OYKA 3E9GA 3G7ZA 3WVDB 4XU2A 4M75E 1LVKA 3CMAT 1GL5A 1WJSA 3RMQA 3CC2A 4MDXA 2K7AA 3CBMA 3JCMQ 2DZCA 2L3QA 1BCMA 2OX7A 3E19A 4JLIA 3S3OA 4RG2A 2QDYB 1Z9QA 1JQQA 3EGDA 1MHNA 1LOJA 2LDMA 3IQLA 3OB9A 3OBWA 4BD3A 3M0UA 1KHIA 3BY7A 4C92A 2DXBA 2AHJB 4N4HA 4XTXA 4HKEA 2X3XD 4C92C 3M4GA 2EKOA 4J83A 1H3ZA 4RTZA 3L2RA 4XU1A 2X35A 4N4IA 2PU9B 4JUVA 4PKCC 3ER0A 1Y96A 2RB6A 2GTJA 1JJ2A 2G3RA 2NLUA 4PFZA 1KC8C 1YIJA 2RHUA 4MZPA 2KY9A 5I11A 2KYMA 1Z9ZA 5FRNA 1AOJA 4XTWA 2O9VA 4IIOA 2JMAA 5LJ5h 2KSSA 3GP8A 5HCKA 2VUBA 3VUBA 2ED0A 3OYDA 4OMPA 5GANf 2DL5A 2HBWA 4C8QE 4C92D 4BE1A 1Q81C 3I56Q 1JJ2S 3JB9F 3PFSA 1M90U 2CZ0B 1M1KC 1R77A 2SEMA 1QVFA 4GBQA 3MEAA 2IPOB 4C5HA 1YJNT 1QCOA 2KGTA 4C0GA 4XAXB 5CAIA 2RJCA 5I2MA 1VQ6A 4AG2C 4EMKA 1LPLA 3BE3A 1HK9A 3M54A 1M3BA 5CK9A 1LNXA 3G71Q 1OU9A 1U06A 2K4YA 1M4ZA 2RJEA 4EMKC 4BY6B 3UWNA 5A2QE 1QVFS 4NOYA 3UA7A 3MEWA 2RMOA 1RAGB 2RHXA 3HKSA 2COYA 2KXDA 1KQSP 2K6DA 4J9CA 3X20B 3UDCA 3G4SQ 2CP2A 1AWWA 1FMWA 3P8HA 4O6JA 2EYXA 4DOWA 3P8DA 4PJOF 2EWNA 1Q82C 4CC4B 3OS2A 2EYWA 4C0DC 1BK2A 3OYBA 3LGFA 3OYCA 2COZA 3KFVA 4QT7A 2NUTB 2QEXQ 4QVCA 4GY5A 3SB2A 4LD9K 3OSVA 5I22A 5LL6S 3FDRA 3C4SA 2FRYA 4XU0A 3EFOA 3SDZA 3S3NA 2FPDA 2YRCA 1IHWA 1D09B 3DLLA 1YBYA 2FZGB 3QBYA 4OP0A 5LJ3d 1I07A 4PJMA 1D0XA 3FB9A 3PVQA 3J7AF 1OEBA 2M0OA 3CCET 3EGUA 1KG1A 3CCMT 2JTMA 4DBQA 3JCMV 1NM7A 3M0PA 1JXMA 2A37A 4GLMA 3VS2A 2DJZA 1OPLA 1UB4A 2HKQB 1N8RC 3QJYA 2LTOA 2E12A 1RLQC 1YN8A 4PLIA 1VQKQ 1ZQ1A 2RHYA 3QZ5B 4HCKA 1YWOA 2P84A 2P4RA 4RKUE 2MMPA 4E7JA 2BZ8A 4Y92A 3EG9B 3GF5A 3I55Q 2MWPA 4M75C 5GAOp 2KR3A 3EGDB 5LJ5g 4ZN3A 3M53A 1FYNA 3OYYA 5GAN6 1T0HA 2XIDA 2KDSA 4JRPA 3CC2T 3O8VA 2K2MA 2VWFA 1QP2A 1K8AR 4J9IA 1KK7A 2OTJA 1O9SA 2WSFE 1VYTA 3QDRB 4FW1A 4M77B 4J7FA 1PRLC 2B8AA 1WHHA 4JDSA 3BDLA 2LVMA 2E65A 3RDVA 1D1AA 1WX6A 4JLGA 2MIOA 1SHFA 1D3BA 3RUXA 1W70A 1TU0B 3N5BB 4LUEA 1BU1A 1OQKA 3VV0A 4DBFA 4YTLA 3H0HA 1M2OA 2CKKA 1J3TA 3CBOA 3GPLA 2CSIA 2YRVA 1I8FA 2XD0A 2MF2A 5GAOr 1VQ7A 2DL4A 1UFFA 4OGEA 2YUOA 3A8OB 2CP7A 1YIJT 1QWEA 2RA2A 5LJ3g 3OYJA 5LJ5e 2J05A 1JRIA 4Z02A 5GAOn 4PFOA 1ABOA 3L42A 2DE0X 2QQ9A 2AKKA 1VOMA 3EGXA 5GAN3 4EMKB 1YITA 2LX9A 1UHCA 2EYQA 2BTTA 4F7UB 5FU6C 4FYYB 5CR2A 2HCKA 2QA4Q 4E7LA 2LT4A 5CIUA 1OOTA 2RPNA 2QTVA 2EIFA 2K57A 2QDLA 2ZZDA 1TH7A 1VQ6T 1M1FA 2RJDA 1WPYA 4M78E 2QQBA 1VQNA 2GQVA 2COWA 1UGSB 1NJIU 4E6RA 1KHCA 3PMTA 3DLMA 2EFIA 5AYFA 3CD6Q 5C0MA 3QYHB 4C0DB 2B86A 4M7AF 4MMLA 5IHNA 4HT8A 3FRNA 3JCMb 5IXBA 3CCVA 2DLPA 4BI4A 3CMAQ 2CP0A 2X4WA 3I9QA 4QQ6A 1TWBA 4JS5A 1PD1A 5GAMh 2AZSA 1SKUB 1TG0A 4PLLA 1WHLA 5FW9A 1VQ5A 1S1NA 2K5FA 2F2VA 4OMMA 1VQMQ 4LN2A 1AZGB 3CCJQ 4MZTA 2Z0WA 4C5IA 4C92G 1VQOQ 3AT1B 1XQHA 2DTOA 4NL3A 4JJBA 1QVGP 2EKHA 4J9HA 1WXTA 4FM4B 2HMAA 1DJ7B 3CMEA 2KYBA 4M75B 3TU4K 2QGGA 1AEYA 1N9RA 1WI7A 2L2PA 2PUOB 1D1CA 2DYIA 5GAMd 4JJCA 1Q7YR 4X9CA 1G83A 4A4HA 1K76A 1QCNA 1TOVA 2DO3A 5D6YA 3JB9D 2K3XA 3H9NA 4AT1B 5LJ5j 4ANJA 1F1BB 3CPWP 1GBRA 2RO0A 3QSUA 4LDYA 3NTHA 3X24B 2DTHA 3OYAA 4PJOA 3EG0A 1H8KA 2JS2A 4PJOC 3TREA 4KH1B 2RK1A 4XTYA 4O5VA 4DBHA 3OYHA 3NFCA 4Z8AA 4J9EA 2DIQA 2K3YA 4RMOA 5DLOA 4QKUA 2Y4XA 4F7UG 3FIFA 3QWXX 2OTJT 3H0IA 1H3HA 2LZ6B 5KYNA 1I4K1 1IHVA 3MKDA 1E6HA 3VS6A 2KT8A 4KGZB 3JCMf 3KBGA 1Y0MA 3ZFJA 2YRDA 4EPCA 5CCAA 4X34A 2H8HA 3OW2A 4Z88A 4C8QB 2PZ1A 1OU8A 4PJOD 5KCHA 2EW3A 4HVUA 2MK5A 4L59A 3QHSA 1HYOA 4Y28E 3EGXB 5FU6B 4M7DF 2CT4A 3CC7A 3JB9H 1VQ7T 4BDYA 4RUGA 2PUKB 1Y7XA 1LJOA 2DM1A 1WGSA 4KUIA 4ZN1A 3OW2S 1Y57A 2EGCA 1M27C 2KRSA 3CCLA 4A54A 4BI3A 5GAMg 3WVEB 3CPFA 3UF4A 2RHZA 3CBPA 1UJ0A 2HQHA 1X2KA 1YITT 4LDWA 1VYUA 1NLPC 3DB3A 4EIKA 2ROTA 1WNLA 3VKIA 5GANh 4MZMA 1NEBA 2Y4YA 4AMCA 1CKAA 4BE2A 2G6FX 3RBBB 1Q81U 3CCEQ 2V1RA 4B9WA 4E7ZA 2YXYA 3CCMQ 5CKBA 3C0CA 1FXXA 1WJRA 4CI0C 4RG8A 1YFNA 3CCSA 1VQNT 2MI6A 2EJFA 3G1JA 2RI3A 2F1LA 1K8AC 1M9SA 1Q86U 4HVVA 1ZLMA 5A0LA 3OYLA 3UT1A 2I2LA 3MO8A 4HXJA 3VS3A 1WQ7A 2JTEA 2X4XA 3G6EA 5KH6A 4LXCA 4JJDA 1FMKA 4JRKA 2K5IA 2ATCB 3CCVT 1VYVA 5GANd 5CVIA 1CSKA 3CC2Q 4WF2A 3CCRA 3H41A 3CXCA 1UUEA 4FSSA 4ZTJA 3I5RA 3R6OA 5GAN8 2NWMA 2DVEA 1UDLA 3C12A 4F16A 4FYVB 2LT1A 1TS9A 1VQ5T 3EG9A 1OYXA 3A8LB 3L2QA 5J39A 4IUVA 1Q82U 2ABLA 1GBQA 2HSEB 3CXCS 2AK5A 1X6BA 2D8HA 5HY6A 2KEAA 2EYZA 3EG1A 3CC4A 3U23A 2K5LA 3VUZA 1WHKA 3CMET 4M77A 1YHQA 2GGRA 2DAQA 4PJOB 3PE0A 2PTKA 1I0CA 3VS1A 1FMVA 1YIJQ 2A28A 5KYWA 4M7AA 2QASA 2CSQA 4M77C 1PM3A 1KQ1A 1HJDA 3UPUA 4OMFB 4R0KA 4M7AC 4PJJA 2PVOB 2CZ7B 1GXIE 3OMGA 1AT1B 3LLRA 4OMOA 1N8RU 3JRZA 2Y90A 4KGVB 1VQ9Q 2MCNA 1WXUA 2DEQA 2LQNA 3V8JA 2KBTA 2BZXA 2BIVA 3CEYA 2VC8A 1RL2A 2K3BA 1WHMA 4HT9A 2A36A 2GFUA 1VQ6Q 3THKA 1D0ZA 5GANg 1Q86C 4M77D 5FWBA 1W4SA 1YJWQ 2JT4A 4LDVA 4F7UA 4M7AD 3QXEB 2O01E 2DRMA 1FWZA 3I56A 1I81A 4XK8E 4AFSC 1PCXA 1MUZA 5GAN2 1W6XA 1K9MR 2CUBA 4K11A 2E6NA 4DBRA 2JUFA 1AHJB 1VQ4A 1BKBA 5L8RE 2V1QA 1TUDA 1G3SA 2BZYA 3CCUQ 1K73R 1P92A 2K9GA 5LJ3h 2DIGA 4EMHA 2DL3A 3G71A 2ZPEB 3VS0A 4D8KA 5GAMj 3CC7T 3EHQA 2L89A 1NLOC 3JB9G 3PVLA 2MOXA 2LX7A 1JU5C 4FW2A 2D0QB 3LW5E 2FEIA 4BI8B 2CT3A 4WCIA 3HTRA 1Q7YC 1M30A 3VYGA 3CCLT 1ZUYA 3J81E 1AWOA 2DNUA 2EQJA 3ZL7C 4C0ZA 1TSFA 4A4GA 1XJWB 2E5QA 3QPHA 4P5NA 1YP5A 3SWNC 5CKEA 2OTLQ 1PKSA 2KAFA 2PVGB 2ECZA 2LQWA 2M16A 1BBZA 5CO7A 1OV3A 2ED1A 4C5EA 2GNCA 4JZ4A 4NS5A 3MJXA 1NPRA 2HL3A 2E1HA 1WHJA 3CCST 2QEXA 3L2ZA 1PNJA 1EIFA 1QKWA 2YHTA 1T0JA 2RM4A 3SHWA 4OGCA 1KQSA 5GMKi 1RAEB 4VUBA 2HDAA 3OBYA 1RAHB 1SG5A 4M7DA 1D0YA 3NPFA 1R0CB 3V7SA 4C0FA 4PJOG 4M75A 4M7DC 2JNGA 3G6ET 3A98A 2KT1A 1PSEA 2RN8A 3PIPA 2JTFA 2NYSA 2LQKA 3MP1A 2LCSA 5D6WA 1WFWA 2D6FA 2R58A 2W0ZA 1KQSS 1IB8A 3CCRT 1KD1R 1VQPQ 1VQLQ 1BI1A 4QQDA 1JEGA 5FLXE 2MYSA 2AT1B 3Q1JA 2C06A 2OTJQ 3M59A 3HSBA 2PVDB 5HK0A 3WXMB 5CQYA 2VASA 4M78F 1NEGA 3I55A 1ACMB 5DY9A 2FZCB 3NTKA 3FLGA 1U1TA 5KYWB 4M7AB 1NYGA 4CC7A 4M7DD 2RK2A 3NMZC 1WZOA 2X4YA 4KUDK 1G3WA 4M75D 3MEVA 2EBPA 3INZA 4IUPA 1M1GA 3CC4T 2RI2A 1N6AA 1XTDA 1VQ7Q 3LH5A 3R6NA 1VIEA 4IUUA 1YHQT 3JB9J 2D9TA 4IIMA 4OF1A 4CRIA 2V8IA 1M2VA 4C8QA 2LMJA 2DPPB 2E6ZA 5FROA 3QJ6A 3V7RA 4C8QC 1TUCA 3I35A 4E7SA 3V7CA 1C0MA 2CGHA 1ZBXA 3X28B 2QYZA 2EQUA 4FT2A 4JPBW 5GANj 4FL6A 1RAIB 3GNFB 4AG1C 2E41A 4X9DA 3RKYA 4A4EA 1RLPC 1KJWA 1WLPB 2DA9A 5ECAA 2J06A 5CKHA 4J5YA 1RADB 3LH0A 3CCQA 1VQNQ 3QZ9B 2ZPGB 4KGXB 4F14A 2RHIA 4CC3A 1SHGA 1PD0A 3PT9A 1U1SA 3I56T 1JO8A 2NUPA 2WSCE 3A5ZB 4C8QD 2D8JA 1M8VA 2QA4A 1X2QA 5FU7C 2O9SA 3M0QA 1KC8R 1KFZA 4C92F 2EQKA 3CCVQ 2E3HA 2EYYA 2GTOA 3LGLA 1VQ4T 1YJ9A 2XU8A 1OULA 5LJ3e 2MAMA 3PGGA 1WHGA 1EX4A 1YI2A 2CREA 3G71T 3SWNB 3QDFA 4HA8A 3OQ5A 4FYXB 2L3PA 1I5LA 1UTIA 4ELYC 1GCQA 3VU3C 1C1AA 5GAOq 1M1KR 1W2BP 2GFAA 3QYGB 4LNPA 1GCQC 3GOXA 1M8MA 4D6WA 1S72A 1MMNA 2EQMA 3NGPA 1I1JA 2AKLA 1AVZC 2ENMA 3JCMd 4R55A 2P0PA 1BCOA 1R0BG 4C5GA 3UATA 3PIOA 2ZPFB 4XTVA 1X69A 4OB3B 4M7DB 4RTTA 6AT1B 4Z89A 4M77G 5IH2A 3JCMc 5GJVB 1VQMA 5L23A 3CCJA 4B9XA 4M7AG 3O5ZA 1VQOA 3M0TA 3H0FA 4J6YA 1B34A 2QEXT 3MP6A 3MEUA 1EFNA 2IIMA 1RAAB 3PNWC 2LCLA 1MGQA 3HP9A 2PNIA 4FT4A 3TSZA 4XTUA 2GQIA 2FPFA 4J8OA 4ZGJB 1UE9A 4C92E 3BW1A 2P4TA 1QCFA 2HZYA 1QQJA 2CUDA 1UEBA 1K8AU 5I2SA 3M9QA 1K9MC 2KRNA 2GF7A 5D6XA 3JB9I 1CKBA 3FJ5A 2DETA 4J9FA 1YJNQ 4F17A 3OS1A 1SF9A 1IXDA 1QVPA 1K73C 1QVGA 2X4JA 3VYHB 1XOVA 1ZA2B 1BIAA 2DTIA 4XU3A 2VXFA 2FVUA 2XMFA 2EQIA 2CP3A 3M0RA 3EG2A 3QWYA 5EG2A 3V8KA 3I55T 5FRMA 2YUNA 1VIFA 2DXCA 3HRUA 5KYUA 4IUQA 3OYFA 2F5KA 2RD1A 4OMQA 2DK3A 2A7YA 1QVGS 1M2VB 4ZGEB 1NG2A 4ZNXA 3RR6A 1SPKA 1NYFA 5LJ3j 2LJ3A 3CPWA 2RJFA 1M90R 5GMKh 3M0SA 4R56A 5IT9E 1V1CA 2L8DA 2JS0A 2DJQA 2E10A 2VV5A 1YCYA 1K1ZA 2XHCA 4F7UE 1WJQA 8ATCB 1ZA1B 4DQ2A 1G3YA 3CCLQ 3E2UA 1YWPA 1OX8A 2O88A 1WXBA 3RMSA 3CPWS 2XI9A 8AT1B 2ZPHB 4DEXA 3AHUA 5HK3A 3GLXA 4A4FA 3FJPA 2JN0A 2P0KA 1U5SA 4HCZA 2JW4A 2MWOA 5FU7B 5IAYA 4M78A 1UGVA 4RTWA 2JM9A 2ESWA 2NUPB 5J26A 1X43A 2VGMA 4M78C 3JSCA 3OS0A 2KXCA 3CCQT 1KD1C 3CCSQ 2X51A 1MMDA 3EHRA 3SEMA 4KRTA 4MMKA 2JM8A 3ZBDA 2E5KA 3OY9A 2DXTA 3I5SA 4M7DG 2CYZB 4BB7A 1M5Q1 2EPDA 2QA4T 4UC4A 4M75G 1K0SA 2QQAA 4AFUC 2ZCFB 4BUGA 5A0GA 1YJ9T 3OSSC 1ZSGA 1RUWA 2FRWA 3HL8A 1YI2T 2HL5C 5GAMe 5M9OA 3HHTB 2JXBA 3NTIA 4M78D 3EH2A 1PWTA 2HKNA 1C6VX 3A8GB 1MNDA 3ZEHA 5GMKm 1ZX6A 3X26B 1JJ2P 1U3OA 1UGPB 3C95A 1VQ8A 2VKNA 2LJ0A 1S72T 4N0AC 3GBQA 1OPKA 4PL6A 2A3LA 1Q7YU 4ZTFA 1B34B 1XNIA 3CC4Q 1YHQQ 2FB7A 1RI0A 3DKMA 4RTYA 1IO6A 1VQMT 3URGA 1QVFP 4GLKA 3CCJT 1M3AA 1ZUUA 1VA7A 4OB2B 4TVRA 3OYGA 1VQOT 2M02A 3HPWA 4C8QG 1RABB 2DMOA 1SSFA 2CZ6B 4LDXA 1AWXA 1NZ9A 4ESRA 4DA4A 4RCCA 1BYMA 2XKOC 1G8XA 3A1PA 1MV3A 1JB0E 4E2FB 4E7HA 2DRKA 4FSXA 2D0NA 3QIIA 4JJNK 3PMIA 1IREB 1SRMA 4A4KA 4Q5WA 2XDDA 1B7TA 2HSPA 3LX7A 5GMKl 2DD5A 2ROLA 5KYUB 2DEUA 4FU6A 4Y91A 4XQ3A 2KQWA 4HCCA 1X6OA 3QG1A 2W10A 3VRZA 4LD6A 1V76A 3NHNA 2RQRA 4WTOB 1VQ9A 1NBEB 3TEEA 2IG0A 5A0DA 2L3SA 2DZ9A 4X1VA 3M58A 1QWFA 2E64A 5KYXA 3RKXA 5DLQE 1VQ4Q 1BI3A 3JCMX 5GMKe 3RNJA 3M5AA 3J80E 2LJ1A 2CZ1B 1YJWA 2XK0A 2XICA 5KE3A 4OB1B 4JRQA 2KNBB 1ZSZA 4KULA 4B6MA 4FCYA 5HKCA 5LJ5d 4PJNA 3TCJA 3P8BB 3KXTA 1OX9A 1V29B 1ZSZC 2CP6A 3RKWA 3DB4A 2KVQG 4M78B 3BDUA 1RAFB 2F2XA 2YWWA 1G2BA 3HRSA 2QQRA 4J9BA 3TVTA 2R5MA 4V2SA 3H8ZA 2H3EB 2DFUA 2LNVA 1NJIR 1AD5A 4II1A 2CS7A 3SWNA 2QG9B 3CCUA 1MMAA 5GANe 1K4US 3EAEA 3G4SA 4PFPA 5DM7R 1X6GA 2D1XA 2DXUA 3JCMW 1E6GA 1GFCA 2YDLA 1ABQA 1UHFA 3L2VA 5IHKA 5CKFA 1UGQB 4FIBA 3D7SB 4PJLA 3QO3A 2MPXC 4F04B 1TTHB 4JS4A 7AT1B 2WSEE 1AZEA 4HCBA 2OTLA 1Q95G 2DL8A 1U8RA 2FYKA 2E70A 3X25B 2E3IA 5CQXA 3M57A 3QUIA 4PNOA 4ELZC 5KCOA 2DBMA 1R8OB 3OYMA 3H6ZA 4ORZA 2KRMA 2M51A 4RTVA 5LJ5f 2IVWA 4E7IA 3LYIA 2GBQA 1M90C 4OMNA 2GCXA 2EVRA 2J6KA 2HQEA 4HVWA 3A8MB 4AFQC 1JBMA 2LRQA 4LDUA 1VQKA 3FC3A 5GAOm 4IUTA 4ME7A 4RTUA 2EJGA 4J6WA 2R5AA 1KSWA 3RERA 1VQ8T 4MDWA 2JOYA 2HQXA 1UJYA 1BIBA 1JXOA 2KMTA 4C92B 4PJOE 2DX1A 9ATCB 1VQPA 1VQLA 1A0NB 3VS4A 1WIEA 2L0AA 1OZ3A 4A53A 2BE9B 2FL7A 5GMKj
chains in the Genus database with same CATH topology
3JCMc 1HK9A 1ZHIA 5CKBA 1VQMA 3M54A 3CCJA 4B9XA 5CK9A 1FXXA 1WJRA 4CI0C 1LNXA 2K4YA 4RG8A 3CCSA 4M7AG 1M4ZA 1Y96B 2RJEA 1VQNT 2MI6A 4EMKC 1VQOA 2EJFA 4BY6B 2RI3A 4J6YA 3UWNA 1B34A 5A2QE 1WQWA 2QEXT 2M1HA 1QVFS 1K8AC 4NOYA 3GIBA 1M9SA 1NPPA 3MP6A 3MEWA 3MEUA 1Q86U 3RESA 2WACA 3PNWC 2LCLA 1MGQA 3HP9A 5A0LA 4FT4A 4XTUA 3OYLA 3UT1A 3HFOA 2I2LA 4J8OA 2RHXA 3MO8A 3OYEA 4ZGJB 4ATOA 5LJ3f 1WQ7A 4C92E 3HKSA 2JVVA 3BW1A 4QW2A 2X4XA 3G6EA 2P4TA 5KH6A 2O4XA 1H641 3T9NA 1VUBA 3SFMA 1UEBA 4JRKA 1K8AU 2K5IA 3JAME 5I2SA 2OAUA 3CCVT 2XDBA 3M9QA 1K9MC 5GANd 2GF7A 5D6XA 5CVIA 3X20B 2EAYA 3UDCA 3JB9I 3P8HA 4WF2A 3CCRA 4M78G 4O6JA 3CXCA 1QW1A 3M56A 4DOWA 4ZTJA 3R6OA 3P8DA 5GAN8 3OS1A 4PJOF 2EWNA 4J7IA 2DVEA 1Q82C 3C12A 4ZGDB 1QVPA 1K73C 1QVGA 2X4JA 3VYHB 1XOVA 1BIAA 2DTIA 4XU3A 5GAOl 1IZ6A 1K9MU 2LT1A 3OS2A 2QQSA 1VQ5T 2VXFA 4E47A 4C0DC 2FVUA 3OYBA 3LGFA 3OYIA 3C94A 1OYXA 3OYCA 3A8LB 3QKJA 2HBPA 3L2QA 5KE2A 5J39A 4IUVA 4QVCA 4GY5A 3SB2A 4LD9K 5EG2A 3OSVA 3V8KA 1Q82U 3I55T 4IKFA 5FRMA 1VQ9T 3CXCS 2H3JA 2VYTA 1K73U 5LL6S 1VIFA 2DXCA 3HRUA 3FDRA 3C4SA 4XU0A 3SDZA 4IUQA 3OYFA 3LWIA 3S3NA 2F5KA 2RD1A 5HY6A 5CKDA 2DK3A 2A7YA 1QVGS 2ZPBB 3DLLA 1YBYA 3QBYA 3JCMh 2PQWA 4ZGEB 4OP0A 1N27A 2VXEA 5LJ3d 3CC4A 2K5LA 3VUZA 3FB9A 2V8JA 3CMET 5LJ3j 3CPWA 4OB0B 1BI2A 2M0OA 4M77A 3CCET 1YHQA 3J7AF 2RJFA 2DAQA 2RI5A 5GMKh 4PJOB 1KG1A 3CCMT 2JTMA 4R56A 1YJWT 1BI0A 3JCMV 5IT9E 2L8DA 3M55A 4M7AA 2DJZA 1UB4A 1N8RC 4M77C 2E10A 3QJYA 1KQ1A 3UPUA 2VV5A 4OMFB 2LTOA 1YCYA 2RH2A 2E12A 2XHCA 4F7UE 1WJQA 4M77F 4M7AC 2PVOB 2CZ7B 1GXIE 3OMGA 4PLIA 4DQ2A 1G3YA 3LLRA 2HAXA 1ZQ1A 3CD6A 2RHYA 3QZ5B 3RMSA 3CPWS 4RKUE 4DOVA 2MMPA 4E7JA 1N8RU 2XI9A 2ZPHB 3JRZA 3AHUA 3GF5A 2Y90A 5HK3A 3GLXA 2MWPA 4M75C 5GAOp 5IN1A 5LJ5g 4A4FA 3FJPA 4ZN3A 2JN0A 2P0KA 2YLCA 3M53A 3CCUT 2DEQA 4HCZA 2R57A 3V8JA 3CMAA 1O75A 4XTZA 3OYYA 5GAN5 5GAN6 3G4ST 4JRIA 2MWOA 2XIDA 5FU7B 1VQKA 2BIVA 1OZ2A 2KDSA 1RL2A 2VC8A 3CEYA 3MHXA 4M78A 5IAYA 3O8VA 3L2WA 4JRPA 3CC2T 4HT9A 4QVZA 3A8HB 2GFUA 5J26A 3META 1QP2A 2VGMA 4M78C 5GANg 3JSCA 3OS0A 1Q86C 2F69A 4M77D 1G3TA 1PSFA 2OTJA 3CCQT 1O9SA 2WSFE 1KD1C 1W4SA 2QI2A 2FHDA 4LDVA 4F7UA 3QDRB 4JDSA 4J7FA 2B8AA 4M77B 4M7AD 2JZ2A 3QXEB 3BDLA 2O01E 4KBMB 1FWZA 3I56A 1I81A 2E65A 2LVMA 4MMKA 4XK8E 4JLGA 3ZBDA 2QXFA 1D3BA 2DXTA 3OY9A 1KQ2A 3RUXA 4M7DG 2VGNA 3N5BB 5GAN2 2CYZB 3E9FA 1M5Q1 4BB7A 2QA4T 4UC4A 1KD1U 2OTLT 3VV0A 2E6NA 4YTLA 4F7UF 4M75G 2CKKA 2JUFA 3OS5A 1AHJB 3LWHA 2QQAA 4EDUA 1VQ4A 3CBOA 3GPLA 1BKBA 2ZCFB 2YRVA 5L8RE 4BUGA 1I8FA 5A0GA 4BDZA 1YJ9T 2XD0A 2MF2A 3OSSC 1G5VA 1G3SA 3SD4A 5GAOr 3S6WA 1W2BA 3HL8A 1P92A 5LJ3h 2DIGA 3L1AA 3M4YA 4EMHA 3G71A 1YI2T 1VQ7A 2ZPEB 4OGEA 5GAMj 3CC7T 3A8OB 5GAMe 5M9OA 3HHTB 3NTIA 4M78D 1YIJT 2L89A 3JB9G 2RA2A 5LJ3g 4M77E 3OYJA 2D0QB 3LW5E 3VJPA 5LJ5e 5GAN7 3A8GB 4BI8B 5I21A 3EFRA 3ZEHA 5GMKm 1JRIA 4Z02A 5GAOn 4M7AE 2LCCA 1Q7YC 3VYGA 3L42A 3X26B 1VQKT 3CCLT 2QQ9A 5GAN3 1UGPB 4QQGA 3C95A 1W2BS 4EMKB 1YITA 2LX9A 1VQ8A 3ASKA 3J81E 2EYQA 2EQJA 1S72T 3HRTA 4F7UB 4C0ZA 4N0AC 4A4GA 5J3BA 5FU6C 5CR2A 2E5QA 2A3LA 3QPHA 4P5NA 4PL6A 3SWNC 1Q7YU 1M8VA 4E7LA 2LT4A 5CKEA 1B34B 1QP3A 5CIUA 2KAFA 2PVGB 3HFNA 4ZTFA 1D3BB 3V8LA 1YJNA 1NJIC 1XNIA 1VQPT 1VQLT 2M16A 2EIFA 5CO7A 2K57A 2ZZDA 4C5EA 4EMGA 4BE0A 1TH7A 4RCBA 4NS5A 1VQ6T 3GNGA 2FB7A 1RI0A 1M1FA 3DKMA 2RJDA 1NPRA 1WPYA 4M78E 2QQBA 2ZGWA 1VQMT 3URGA 3FEOA 1VQNA 2E1HA 2GQVA 2O4XB 4GLKA 3JCMg 3CCJT 3S3MA 3CCST 1UGSB 1NJIU 2QEXA 1KHCA 3PMTA 3L2ZA 4OB2B 4TVRA 3OYGA 1NE8A 1VQOT 1EIFA 2YHTA 2RM4A 3BFMA 1Y07A 4OGCA 1KQSA 3HPWA 5GMKi 4VUBA 4C8QG 3DLMA 2EFIA 3OBYA 5AYFA 4M7DA 1SSFA 2CZ6B 4LDXA 1NZ9A 5C6SA 4DA4A 1BYMA 4RCCA 2EJ9A 3V7SA 4OVAA 4C0FA 5C0MA 3QYHB 4PJOG 2XKOC 2L5QA 4C0DB 1X01A 3ME9A 4M75A 2ZPIB 4N4GA 3MCAB 2JNGA 4MMLA 4M7DC 3G6ET 4HT8A 4M7AF 3FRNA 3JCMb 1JB0E 3CCVA 3E1SA 3RIRA 1PSEA 4E7HA 4FSXA 3L2UA 2BKDN 3PIPA 2JTFA 2L3RA 3QIIA 4JJNK 3PMIA 5GAMf 4BI4A 2LQKA 3MP1A 1IREB 5D6WA 4E7KA 2X4WA 2XG8D 3JCMJ 2D6FA 4A4KA 2R58A 4Q5WA 2YLBA 2XDDA 1KQSS 4QQ6A 4BY6C 3OA6A 4M75F 3CCRT 3LX7A 1N9SA 4JS5A 1BI1A 5GMKl 4QQDA 5GAMh 2DD5A 5FLXE 4FU6A 4Y91A 3Q1JA 4PLLA 4XQ3A 2C06A 2DKGA 3M59A 1VQ5A 2K5FA 3HSBA 3MP8A 2KQWA 4HCCA 2PVDB 1KC8U 1X6OA 4L6V5 2LQ8A 2M9UA 3QG1A 5HK0A 1X75C 4MZTA 5CQYA 3WXMB 4C5IA 2P0QA 4LD6A 4M78F 3F70A 4C92G 1XQHA 2DTOA 4NL3A 3I55A 4BACA 1VQ9A 1OI1A 3TEEA 2LC4A 5DY9A 3NTKA 3FLGA 1U1TA 2IG0A 5A0DA 2DZ9A 2V8KA 4M7AB 4M7DD 4FM4B 2RK2A 4J6XA 3M58A 3JCMe 2X4YA 2E64A 3RKXA 4L5GA 4KT0E 5DLQE 3OMCA 4KUDK 1BI3A 1G3WA 2HNIA 2QTXA 3OYNA 4M75D 3JCMX 1DJ7B 3MEVA 5GAN4 4IUPA 3INZA 5GMKe 1M1GA 2BUDA 3CMEA 3CC4T 3M5AA 2RI2A 3J80E 3CCEA 4QVDA 1M1KU 4M75B 3TU4K 2K2VA 1N6AA 2CZ1B 1N9RA 2PUOB 1XTDA 3CCMA 1VIEA 4IUUA 1YHQT 1YJWA 1FX7A 1Y71A 2XK0A 2XICA 5KE3A 3EFSA 4OB1B 5GAMd 4JRQA 3JB9J 2D9TA 4OF1A 4IURA 4X9CA 4CRIA 3JCMP 4KULA 4A4HA 2V8IA 5HKCA 5LJ5d 2DD4A 2DO3A 5D6YA 3JB9D 2K3XA 3TCJA 3P8BB 2HD0A 2XDPA 5LJ5j 3KXTA 1V29B 4C8QA 3RKWA 3DB4A 4NL2A 2KK4A 2KVQG 4M78B 2DPPB 2RO0A 3BDUA 2E6ZA 5FROA 3QSUA 4LDYA 1UGRB 3NTHA 1HXDA 3QJ6A 3X24B 2DTHA 3PTAA 3HRSA 4V2SA 3OYAA 2QQRA 2F5TX 2R5MA 3CD6T 3V7RA 4C8QC 3H8ZA 4PJOA 2LNVA 4N0AA 3KUFA 3V7CA 4M7DE 2CGHA 1ZBXA 4II1A 2CS7A 3SWNA 3X28B 4C8QF 3E9GA 3G7ZA 3OYKA 2EQUA 3CCUA 4FT2A 3WVDB 4PJOC 5GANj 4FL6A 4XU2A 5GANe 3EAEA 3TREA 3G4SA 4M75E 5DM7R 3CMAT 3JCMW 2DXUA 2RK1A 1WJSA 3GNFB 4O5VA 4XTYA 3RMQA 3CC2A 4MDXA 2E41A 3CBMA 3JCMQ 2DZCA 3OYHA 4X9DA 3RKYA 3NFCA 4A4EA 3E19A 2DIQA 3L2VA 2K3YA 4JLIA 4RMOA 3S3OA 5CKHA 5DLOA 4J5YA 4RG2A 3LH0A 3CCQA 2QDYB 5CKFA 2Y4XA 4F7UG 1UGQB 3FIFA 4FIBA 3QZ9B 2ZPGB 2OTJT 1MHNA 2RHIA 1I4K1 1LOJA 2LDMA 3OB9A 4BD3A 3OBWA 3QO3A 3PT9A 1KHIA 3BY7A 4C92A 2DXBA 1U1SA 3I56T 3JCMf 2AHJB 4N4HA 4JS4A 3KBGA 2WSCE 3A5ZB 4C8QD 3ZFJA 4XTXA 2WSEE 4HKEA 4EPCA 2QA4A 5CCAA 4HCBA 4C92C 2OTLA 5FU7C 3M4GA 4X34A 2EKOA 3OW2A 1U8RA 4J83A 4C8QB 1H3ZA 3L2RA 4PJOD 2FYKA 4XU1A 4C92F 2E70A 2EQKA 2X35A 4N4IA 3X25B 3LGLA 5CQXA 5KCHA 1VQ4T 2PU9B 2XU8A 3M57A 3QUIA 4JUVA 2MAMA 4PKCC 4PNOA 4ELZC 3ER0A 5LJ3e 5KCOA 3PGGA 1Y96A 2RB6A 4L59A 1R8OB 3QHSA 4Y28E 3OYMA 1YI2A 5FU6B 4M7DF 1JJ2A 3CC7A 3H6ZA 2G3RA 2NLUA 3SWNB 3G71T 4BDYA 1VQ7T 1KC8C 3JB9H 1YIJA 4HA8A 2RHUA 4MZPA 5LJ5f 2PUKB 1Y7XA 1LJOA 3OQ5A 1WGSA 2IVWA 2KY9A 4KUIA 4E7IA 1I5LA 3LYIA 4ZN1A 3OW2S 5FRNA 1M90C 4XTWA 4ELYC 2GCXA 3VU3C 5GAOq 2HQEA 3A8MB 2GFAA 1JBMA 2KSSA 2LRQA 3QYGB 4LDUA 5LJ5h 3FC3A 3GP8A 4A54A 4BI3A 5GAMg 2VUBA 3VUBA 3WVEB 3CPFA 5GAOm 3CCLA 4IUTA 3OYDA 4ME7A 2RHZA 2EJGA 3GOXA 1YJ9A 4J6WA 2R5AA 3CBPA 5GANf 4C8QE 4D6WA 1Q81C 4C92D 4BE1A 1YITT 1S72A 1VQ8T 4LDWA 4MDWA 1JJ2S 3RERA 2EQMA 3JB9F 3PFSA 1M90U 2JOYA 3DB3A 2CZ0B 2HQXA 1BIBA 2KMTA 1M1KC 4C92B 3JCMd 4R55A 2P0PA 1QVFA 4PJOE 1WNLA 3MEAA 3VKIA 5GANh 4C5GA 4MZMA 4C5HA 1VQPA 1VQLA 3PIOA 2Y4YA 2ZPFB 4XTVA 1YJNT 4BE2A 4OB3B 1OZ3A 4C0GA 4XAXB 4M7DB 1Q81U 5CAIA 2RJCA 5I2MA 4A53A 1VQ6A 2FL7A 4B9WA 5GMKj 4M77G 4EMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1F A;  1VUB A;  2MF2 A;  4ME7 A;  5CKB A;  4ELZ C;  5HK0 A;  3JRZ A;  1X75 C;  4MZT A;  5CQY A;  5CK9 A;  5HK3 A;  3G7Z A;  4OF1 A;  1UB4 A;  1NE8 A;  5CR2 A;  2KMT A;  4MZP A;  5HKC A;  3HPW A;  4VUB A;  4MDX A;  5CKE A;  3TCJ A;  4HKE A;  4MZM A;  5CCA A;  5CKD A;  3NFC A;  4ELY C;  5CO7 A;  5CKF A;  2C06 A;  5CKH A;  5DLO A;  3JSC A;  5CQX A;  2VUB A;  3VUB A; 
#chains in the Genus database with same CATH topology
 1ZHI A;  4OML A;  2J6F A;  1Y96 B;  2VVK A;  1PHT A;  1N5Z A;  2YSQ A;  1WQW A;  2M1H A;  3GIB A;  4D8D A;  1NPP A;  2DF6 A;  3RES A;  2WAC A;  2RQW A;  3HFO A;  1ZUK A;  3OYE A;  4ATO A;  5LJ3 f;  2CH4 A;  2JVV A;  2E4H A;  4QW2 A;  2RNA A;  1GCP A;  2O4X A;  1H64 1;  3T9N A;  1VUB A;  3SFM A;  4JZ3 A;  1YIT Q;  3JAM E;  2OAU A;  2XDB A;  1KIK A;  2EAY A;  1T3S A;  1PKT A;  3MPU B;  4M78 G;  1QW1 A;  3M56 A;  1PC0 A;  4M4Z A;  4J7I A;  2A0F B;  2DVJ A;  4ZGD B;  5GAO l;  3CCQ Q;  1IZ6 A;  2FZK B;  5KYX B;  1K9M U;  2QQS A;  2RQV A;  2X3W D;  4E47 A;  3OYI A;  3C94 A;  2YT6 A;  3QKJ A;  2HBP A;  5KE2 A;  1WYX A;  2C0I A;  2V26 A;  2DIL A;  2J7I A;  4IKF A;  3TSW A;  1VQ9 T;  2H3J A;  2VYT A;  1K73 U;  1RI9 A;  2ZAE A;  1ZSZ B;  3LWI A;  1GRI A;  2BE7 D;  5CKD A;  2RQU A;  4LUD A;  2O31 A;  2ZPB B;  1YJ9 Q;  3JCM h;  2PQW A;  1N27 A;  2VXE A;  1UG1 A;  2V8J A;  4OB0 B;  1BI2 A;  1YI2 Q;  2RI5 A;  1YJW T;  1BI0 A;  2DER A;  3M55 A;  2J6O A;  2A08 A;  2RH2 A;  3EG3 A;  4M77 F;  1Q81 R;  1T3L A;  1VQ5 Q;  2HAX A;  3ULR B;  3CD6 A;  1GFD A;  4DOV A;  2RF0 A;  5IHI A;  1S72 Q;  4CC2 A;  5IN1 A;  2KRO A;  2RQT A;  2YLC A;  3CCU T;  1Q86 R;  2R57 A;  3CMA A;  1O75 A;  4XTZ A;  1I5O B;  5GAN 5;  2SRC A;  3G4S T;  4JRI A;  1OZ2 A;  2OAW A;  3MHX A;  3L2W A;  3EFO B;  4QVZ A;  3A8H B;  1MV0 B;  1M3C A;  5KYY A;  3MET A;  3CME Q;  2F69 A;  1G3T A;  1PSF A;  2YUQ A;  2QI2 A;  2FHD A;  2JZ2 A;  1RAC B;  1B3Q A;  4KBM B;  1D1B A;  2AIR B;  1TUG B;  2QXF A;  1KQ2 A;  2VGN A;  4KH0 B;  2CP5 A;  2CH4 W;  2DL7 A;  3E9F A;  1KD1 U;  2OTL T;  1W1F A;  4F7U F;  1K0X A;  1LCK A;  1BB9 A;  3OS5 A;  3LWH A;  1MNE A;  1B07 A;  4EDU A;  1WA7 A;  2CDT A;  5GJW B;  4BDZ A;  1G5V A;  5FWC A;  3SD4 A;  1Q82 R;  1SSH A;  3S6W A;  4J9G A;  2O2O A;  1W2B A;  3L1A A;  3M4Y A;  1E7O A;  2OJ2 A;  2KE9 A;  3OW2 P;  1EZZ B;  1AWJ A;  3UA6 A;  1SEM A;  4M77 E;  3VJP A;  5GAN 7;  5I21 A;  3EFR A;  2K79 A;  2C0T A;  4M7A E;  2LCC A;  3CQT A;  2F2W A;  2OI3 A;  2HEQ A;  1VQK T;  2VB6 A;  4J9D A;  4QQG A;  1W2B S;  4DEY A;  2FG0 A;  3ASK A;  3HRT A;  4PK4 A;  1PRM C;  5J3B A;  4LE9 A;  2FPE A;  1HSQ A;  1QP3 A;  3HFN A;  1D3B B;  2QAZ A;  3V8L A;  1YJN A;  1NJI C;  1VQP T;  1VQL T;  1YNZ A;  4EMG A;  1N8R R;  4BE0 A;  4RCB A;  1UEC A;  3GNG A;  1IGQ A;  2ZGW A;  1HD3 A;  3FEO A;  2O4X B;  2EGE A;  3JCM g;  3CC7 Q;  3S3M A;  1NE8 A;  3JV3 A;  1ARK A;  3BFM A;  2M0Y A;  1Y07 A;  3REA B;  5C6S A;  2EJ9 A;  4OVA A;  2L5Q A;  1X01 A;  3ME9 A;  1WDX A;  2ZPI B;  3MCA B;  4N4G A;  2YUP A;  2AZV A;  3E1S A;  3RIR A;  2X9H A;  3L2U A;  2BKD N;  2L3R A;  5GAM f;  2LNH B;  4E7K A;  5IXF A;  2XG8 D;  3JCM J;  2YLB A;  4BY6 C;  3OA6 A;  1X27 A;  4M75 F;  1N9S A;  1QLY A;  3REB B;  2EGA A;  4A63 B;  2QK0 A;  1QMC A;  2NUZ A;  2I0N A;  2DKG A;  3MP8 A;  1KC8 U;  4L6V 5;  1QKX A;  2LQ8 A;  2M9U A;  3CXC P;  1X75 C;  1YCS B;  2P0Q A;  3F70 A;  4BAC A;  1OI1 A;  2LC4 A;  2KI7 A;  2JJ9 A;  2DBK A;  2V8K A;  4J6X A;  3TQ7 P;  3JCM e;  4RTX A;  4L5G A;  2JMC A;  4KT0 E;  3OMC A;  2HNI A;  2QTX A;  3OYN A;  3G6E Q;  3VS7 A;  5GAN 4;  1H92 A;  1PG5 B;  2BUD A;  3CCE A;  4QVD A;  1MMG A;  3VRY A;  1M1K U;  2NUT A;  1IRX A;  2K2V A;  3CCM A;  1FX7 A;  1Y71 A;  3EFS A;  5D7U A;  1TXQ A;  1ZBJ A;  3CCR Q;  4IUR A;  3JCM P;  2DD4 A;  1IGU A;  2FO0 A;  2HD0 A;  2XDP A;  4FYW B;  4NL2 A;  2KK4 A;  5EC7 A;  3EH1 A;  1UGR B;  3PTA A;  1HXD A;  4AFZ C;  1K9A A;  2QGF B;  5KYY B;  2F5T X;  3CD6 T;  1SRL A;  1VQ8 Q;  3VS5 A;  4N0A A;  2LP5 A;  5AT1 B;  3KUF A;  4M7D E;  2DYB A;  2C0O A;  4C8Q F;  3OYK A;  3E9G A;  3G7Z A;  3WVD B;  4XU2 A;  4M75 E;  1LVK A;  3CMA T;  1GL5 A;  1WJS A;  3RMQ A;  3CC2 A;  4MDX A;  2K7A A;  3CBM A;  3JCM Q;  2DZC A;  2L3Q A;  1BCM A;  2OX7 A;  3E19 A;  4JLI A;  3S3O A;  4RG2 A;  2QDY B;  1Z9Q A;  1JQQ A;  3EGD A;  1MHN A;  1LOJ A;  2LDM A;  3IQL A;  3OB9 A;  3OBW A;  4BD3 A;  3M0U A;  1KHI A;  3BY7 A;  4C92 A;  2DXB A;  2AHJ B;  4N4H A;  4XTX A;  4HKE A;  2X3X D;  4C92 C;  3M4G A;  2EKO A;  4J83 A;  1H3Z A;  4RTZ A;  3L2R A;  4XU1 A;  2X35 A;  4N4I A;  2PU9 B;  4JUV A;  4PKC C;  3ER0 A;  1Y96 A;  2RB6 A;  2GTJ A;  1JJ2 A;  2G3R A;  2NLU A;  4PFZ A;  1KC8 C;  1YIJ A;  2RHU A;  4MZP A;  2KY9 A;  5I11 A;  2KYM A;  1Z9Z A;  5FRN A;  1AOJ A;  4XTW A;  2O9V A;  4IIO A;  2JMA A;  5LJ5 h;  2KSS A;  3GP8 A;  5HCK A;  2VUB A;  3VUB A;  2ED0 A;  3OYD A;  4OMP A;  5GAN f;  2DL5 A;  2HBW A;  4C8Q E;  4C92 D;  4BE1 A;  1Q81 C;  3I56 Q;  1JJ2 S;  3JB9 F;  3PFS A;  1M90 U;  2CZ0 B;  1M1K C;  1R77 A;  2SEM A;  1QVF A;  4GBQ A;  3MEA A;  2IPO B;  4C5H A;  1YJN T;  1QCO A;  2KGT A;  4C0G A;  4XAX B;  5CAI A;  2RJC A;  5I2M A;  1VQ6 A;  4AG2 C;  4EMK A;  1LPL A;  3BE3 A;  1HK9 A;  3M54 A;  1M3B A;  5CK9 A;  1LNX A;  3G71 Q;  1OU9 A;  1U06 A;  2K4Y A;  1M4Z A;  2RJE A;  4EMK C;  4BY6 B;  3UWN A;  5A2Q E;  1QVF S;  4NOY A;  3UA7 A;  3MEW A;  2RMO A;  1RAG B;  2RHX A;  3HKS A;  2COY A;  2KXD A;  1KQS P;  2K6D A;  4J9C A;  3X20 B;  3UDC A;  3G4S Q;  2CP2 A;  1AWW A;  1FMW A;  3P8H A;  4O6J A;  2EYX A;  4DOW A;  3P8D A;  4PJO F;  2EWN A;  1Q82 C;  4CC4 B;  3OS2 A;  2EYW A;  4C0D C;  1BK2 A;  3OYB A;  3LGF A;  3OYC A;  2COZ A;  3KFV A;  4QT7 A;  2NUT B;  2QEX Q;  4QVC A;  4GY5 A;  3SB2 A;  4LD9 K;  3OSV A;  5I22 A;  5LL6 S;  3FDR A;  3C4S A;  2FRY A;  4XU0 A;  3EFO A;  3SDZ A;  3S3N A;  2FPD A;  2YRC A;  1IHW A;  1D09 B;  3DLL A;  1YBY A;  2FZG B;  3QBY A;  4OP0 A;  5LJ3 d;  1I07 A;  4PJM A;  1D0X A;  3FB9 A;  3PVQ A;  3J7A F;  1OEB A;  2M0O A;  3CCE T;  3EGU A;  1KG1 A;  3CCM T;  2JTM A;  4DBQ A;  3JCM V;  1NM7 A;  3M0P A;  1JXM A;  2A37 A;  4GLM A;  3VS2 A;  2DJZ A;  1OPL A;  1UB4 A;  2HKQ B;  1N8R C;  3QJY A;  2LTO A;  2E12 A;  1RLQ C;  1YN8 A;  4PLI A;  1VQK Q;  1ZQ1 A;  2RHY A;  3QZ5 B;  4HCK A;  1YWO A;  2P84 A;  2P4R A;  4RKU E;  2MMP A;  4E7J A;  2BZ8 A;  4Y92 A;  3EG9 B;  3GF5 A;  3I55 Q;  2MWP A;  4M75 C;  5GAO p;  2KR3 A;  3EGD B;  5LJ5 g;  4ZN3 A;  3M53 A;  1FYN A;  3OYY A;  5GAN 6;  1T0H A;  2XID A;  2KDS A;  4JRP A;  3CC2 T;  3O8V A;  2K2M A;  2VWF A;  1QP2 A;  1K8A R;  4J9I A;  1KK7 A;  2OTJ A;  1O9S A;  2WSF E;  1VYT A;  3QDR B;  4FW1 A;  4M77 B;  4J7F A;  1PRL C;  2B8A A;  1WHH A;  4JDS A;  3BDL A;  2LVM A;  2E65 A;  3RDV A;  1D1A A;  1WX6 A;  4JLG A;  2MIO A;  1SHF A;  1D3B A;  3RUX A;  1W70 A;  1TU0 B;  3N5B B;  4LUE A;  1BU1 A;  1OQK A;  3VV0 A;  4DBF A;  4YTL A;  3H0H A;  1M2O A;  2CKK A;  1J3T A;  3CBO A;  3GPL A;  2CSI A;  2YRV A;  1I8F A;  2XD0 A;  2MF2 A;  5GAO r;  1VQ7 A;  2DL4 A;  1UFF A;  4OGE A;  2YUO A;  3A8O B;  2CP7 A;  1YIJ T;  1QWE A;  2RA2 A;  5LJ3 g;  3OYJ A;  5LJ5 e;  2J05 A;  1JRI A;  4Z02 A;  5GAO n;  4PFO A;  1ABO A;  3L42 A;  2DE0 X;  2QQ9 A;  2AKK A;  1VOM A;  3EGX A;  5GAN 3;  4EMK B;  1YIT A;  2LX9 A;  1UHC A;  2EYQ A;  2BTT A;  4F7U B;  5FU6 C;  4FYY B;  5CR2 A;  2HCK A;  2QA4 Q;  4E7L A;  2LT4 A;  5CIU A;  1OOT A;  2RPN A;  2QTV A;  2EIF A;  2K57 A;  2QDL A;  2ZZD A;  1TH7 A;  1VQ6 T;  1M1F A;  2RJD A;  1WPY A;  4M78 E;  2QQB A;  1VQN A;  2GQV A;  2COW A;  1UGS B;  1NJI U;  4E6R A;  1KHC A;  3PMT A;  3DLM A;  2EFI A;  5AYF A;  3CD6 Q;  5C0M A;  3QYH B;  4C0D B;  2B86 A;  4M7A F;  4MML A;  5IHN A;  4HT8 A;  3FRN A;  3JCM b;  5IXB A;  3CCV A;  2DLP A;  4BI4 A;  3CMA Q;  2CP0 A;  2X4W A;  3I9Q A;  4QQ6 A;  1TWB A;  4JS5 A;  1PD1 A;  5GAM h;  2AZS A;  1SKU B;  1TG0 A;  4PLL A;  1WHL A;  5FW9 A;  1VQ5 A;  1S1N A;  2K5F A;  2F2V A;  4OMM A;  1VQM Q;  4LN2 A;  1AZG B;  3CCJ Q;  4MZT A;  2Z0W A;  4C5I A;  4C92 G;  1VQO Q;  3AT1 B;  1XQH A;  2DTO A;  4NL3 A;  4JJB A;  1QVG P;  2EKH A;  4J9H A;  1WXT A;  4FM4 B;  2HMA A;  1DJ7 B;  3CME A;  2KYB A;  4M75 B;  3TU4 K;  2QGG A;  1AEY A;  1N9R A;  1WI7 A;  2L2P A;  2PUO B;  1D1C A;  2DYI A;  5GAM d;  4JJC A;  1Q7Y R;  4X9C A;  1G83 A;  4A4H A;  1K76 A;  1QCN A;  1TOV A;  2DO3 A;  5D6Y A;  3JB9 D;  2K3X A;  3H9N A;  4AT1 B;  5LJ5 j;  4ANJ A;  1F1B B;  3CPW P;  1GBR A;  2RO0 A;  3QSU A;  4LDY A;  3NTH A;  3X24 B;  2DTH A;  3OYA A;  4PJO A;  3EG0 A;  1H8K A;  2JS2 A;  4PJO C;  3TRE A;  4KH1 B;  2RK1 A;  4XTY A;  4O5V A;  4DBH A;  3OYH A;  3NFC A;  4Z8A A;  4J9E A;  2DIQ A;  2K3Y A;  4RMO A;  5DLO A;  4QKU A;  2Y4X A;  4F7U G;  3FIF A;  3QWX X;  2OTJ T;  3H0I A;  1H3H A;  2LZ6 B;  5KYN A;  1I4K 1;  1IHV A;  3MKD A;  1E6H A;  3VS6 A;  2KT8 A;  4KGZ B;  3JCM f;  3KBG A;  1Y0M A;  3ZFJ A;  2YRD A;  4EPC A;  5CCA A;  4X34 A;  2H8H A;  3OW2 A;  4Z88 A;  4C8Q B;  2PZ1 A;  1OU8 A;  4PJO D;  5KCH A;  2EW3 A;  4HVU A;  2MK5 A;  4L59 A;  3QHS A;  1HYO A;  4Y28 E;  3EGX B;  5FU6 B;  4M7D F;  2CT4 A;  3CC7 A;  3JB9 H;  1VQ7 T;  4BDY A;  4RUG A;  2PUK B;  1Y7X A;  1LJO A;  2DM1 A;  1WGS A;  4KUI A;  4ZN1 A;  3OW2 S;  1Y57 A;  2EGC A;  1M27 C;  2KRS A;  3CCL A;  4A54 A;  4BI3 A;  5GAM g;  3WVE B;  3CPF A;  3UF4 A;  2RHZ A;  3CBP A;  1UJ0 A;  2HQH A;  1X2K A;  1YIT T;  4LDW A;  1VYU A;  1NLP C;  3DB3 A;  4EIK A;  2ROT A;  1WNL A;  3VKI A;  5GAN h;  4MZM A;  1NEB A;  2Y4Y A;  4AMC A;  1CKA A;  4BE2 A;  2G6F X;  3RBB B;  1Q81 U;  3CCE Q;  2V1R A;  4B9W A;  4E7Z A;  2YXY A;  3CCM Q;  5CKB A;  3C0C A;  1FXX A;  1WJR A;  4CI0 C;  4RG8 A;  1YFN A;  3CCS A;  1VQN T;  2MI6 A;  2EJF A;  3G1J A;  2RI3 A;  2F1L A;  1K8A C;  1M9S A;  1Q86 U;  4HVV A;  1ZLM A;  5A0L A;  3OYL A;  3UT1 A;  2I2L A;  3MO8 A;  4HXJ A;  3VS3 A;  1WQ7 A;  2JTE A;  2X4X A;  3G6E A;  5KH6 A;  4LXC A;  4JJD A;  1FMK A;  4JRK A;  2K5I A;  2ATC B;  3CCV T;  1VYV A;  5GAN d;  5CVI A;  1CSK A;  3CC2 Q;  4WF2 A;  3CCR A;  3H41 A;  3CXC A;  1UUE A;  4FSS A;  4ZTJ A;  3I5R A;  3R6O A;  5GAN 8;  2NWM A;  2DVE A;  1UDL A;  3C12 A;  4F16 A;  4FYV B;  2LT1 A;  1TS9 A;  1VQ5 T;  3EG9 A;  1OYX A;  3A8L B;  3L2Q A;  5J39 A;  4IUV A;  1Q82 U;  2ABL A;  1GBQ A;  2HSE B;  3CXC S;  2AK5 A;  1X6B A;  2D8H A;  5HY6 A;  2KEA A;  2EYZ A;  3EG1 A;  3CC4 A;  3U23 A;  2K5L A;  3VUZ A;  1WHK A;  3CME T;  4M77 A;  1YHQ A;  2GGR A;  2DAQ A;  4PJO B;  3PE0 A;  2PTK A;  1I0C A;  3VS1 A;  1FMV A;  1YIJ Q;  2A28 A;  5KYW A;  4M7A A;  2QAS A;  2CSQ A;  4M77 C;  1PM3 A;  1KQ1 A;  1HJD A;  3UPU A;  4OMF B;  4R0K A;  4M7A C;  4PJJ A;  2PVO B;  2CZ7 B;  1GXI E;  3OMG A;  1AT1 B;  3LLR A;  4OMO A;  1N8R U;  3JRZ A;  2Y90 A;  4KGV B;  1VQ9 Q;  2MCN A;  1WXU A;  2DEQ A;  2LQN A;  3V8J A;  2KBT A;  2BZX A;  2BIV A;  3CEY A;  2VC8 A;  1RL2 A;  2K3B A;  1WHM A;  4HT9 A;  2A36 A;  2GFU A;  1VQ6 Q;  3THK A;  1D0Z A;  5GAN g;  1Q86 C;  4M77 D;  5FWB A;  1W4S A;  1YJW Q;  2JT4 A;  4LDV A;  4F7U A;  4M7A D;  3QXE B;  2O01 E;  2DRM A;  1FWZ A;  3I56 A;  1I81 A;  4XK8 E;  4AFS C;  1PCX A;  1MUZ A;  5GAN 2;  1W6X A;  1K9M R;  2CUB A;  4K11 A;  2E6N A;  4DBR A;  2JUF A;  1AHJ B;  1VQ4 A;  1BKB A;  5L8R E;  2V1Q A;  1TUD A;  1G3S A;  2BZY A;  3CCU Q;  1K73 R;  1P92 A;  2K9G A;  5LJ3 h;  2DIG A;  4EMH A;  2DL3 A;  3G71 A;  2ZPE B;  3VS0 A;  4D8K A;  5GAM j;  3CC7 T;  3EHQ A;  2L89 A;  1NLO C;  3JB9 G;  3PVL A;  2MOX A;  2LX7 A;  1JU5 C;  4FW2 A;  2D0Q B;  3LW5 E;  2FEI A;  4BI8 B;  2CT3 A;  4WCI A;  3HTR A;  1Q7Y C;  1M30 A;  3VYG A;  3CCL T;  1ZUY A;  3J81 E;  1AWO A;  2DNU A;  2EQJ A;  3ZL7 C;  4C0Z A;  1TSF A;  4A4G A;  1XJW B;  2E5Q A;  3QPH A;  4P5N A;  1YP5 A;  3SWN C;  5CKE A;  2OTL Q;  1PKS A;  2KAF A;  2PVG B;  2ECZ A;  2LQW A;  2M16 A;  1BBZ A;  5CO7 A;  1OV3 A;  2ED1 A;  4C5E A;  2GNC A;  4JZ4 A;  4NS5 A;  3MJX A;  1NPR A;  2HL3 A;  2E1H A;  1WHJ A;  3CCS T;  2QEX A;  3L2Z A;  1PNJ A;  1EIF A;  1QKW A;  2YHT A;  1T0J A;  2RM4 A;  3SHW A;  4OGC A;  1KQS A;  5GMK i;  1RAE B;  4VUB A;  2HDA A;  3OBY A;  1RAH B;  1SG5 A;  4M7D A;  1D0Y A;  3NPF A;  1R0C B;  3V7S A;  4C0F A;  4PJO G;  4M75 A;  4M7D C;  2JNG A;  3G6E T;  3A98 A;  2KT1 A;  1PSE A;  2RN8 A;  3PIP A;  2JTF A;  2NYS A;  2LQK A;  3MP1 A;  2LCS A;  5D6W A;  1WFW A;  2D6F A;  2R58 A;  2W0Z A;  1KQS S;  1IB8 A;  3CCR T;  1KD1 R;  1VQP Q;  1VQL Q;  1BI1 A;  4QQD A;  1JEG A;  5FLX E;  2MYS A;  2AT1 B;  3Q1J A;  2C06 A;  2OTJ Q;  3M59 A;  3HSB A;  2PVD B;  5HK0 A;  3WXM B;  5CQY A;  2VAS A;  4M78 F;  1NEG A;  3I55 A;  1ACM B;  5DY9 A;  2FZC B;  3NTK A;  3FLG A;  1U1T A;  5KYW B;  4M7A B;  1NYG A;  4CC7 A;  4M7D D;  2RK2 A;  3NMZ C;  1WZO A;  2X4Y A;  4KUD K;  1G3W A;  4M75 D;  3MEV A;  2EBP A;  3INZ A;  4IUP A;  1M1G A;  3CC4 T;  2RI2 A;  1N6A A;  1XTD A;  1VQ7 Q;  3LH5 A;  3R6N A;  1VIE A;  4IUU A;  1YHQ T;  3JB9 J;  2D9T A;  4IIM A;  4OF1 A;  4CRI A;  2V8I A;  1M2V A;  4C8Q A;  2LMJ A;  2DPP B;  2E6Z A;  5FRO A;  3QJ6 A;  3V7R A;  4C8Q C;  1TUC A;  3I35 A;  4E7S A;  3V7C A;  1C0M A;  2CGH A;  1ZBX A;  3X28 B;  2QYZ A;  2EQU A;  4FT2 A;  4JPB W;  5GAN j;  4FL6 A;  1RAI B;  3GNF B;  4AG1 C;  2E41 A;  4X9D A;  3RKY A;  4A4E A;  1RLP C;  1KJW A;  1WLP B;  2DA9 A;  5ECA A;  2J06 A;  5CKH A;  4J5Y A;  1RAD B;  3LH0 A;  3CCQ A;  1VQN Q;  3QZ9 B;  2ZPG B;  4KGX B;  4F14 A;  2RHI A;  4CC3 A;  1SHG A;  1PD0 A;  3PT9 A;  1U1S A;  3I56 T;  1JO8 A;  2NUP A;  2WSC E;  3A5Z B;  4C8Q D;  2D8J A;  1M8V A;  2QA4 A;  1X2Q A;  5FU7 C;  2O9S A;  3M0Q A;  1KC8 R;  1KFZ A;  4C92 F;  2EQK A;  3CCV Q;  2E3H A;  2EYY A;  2GTO A;  3LGL A;  1VQ4 T;  1YJ9 A;  2XU8 A;  1OUL A;  5LJ3 e;  2MAM A;  3PGG A;  1WHG A;  1EX4 A;  1YI2 A;  2CRE A;  3G71 T;  3SWN B;  3QDF A;  4HA8 A;  3OQ5 A;  4FYX B;  2L3P A;  1I5L A;  1UTI A;  4ELY C;  1GCQ A;  3VU3 C;  1C1A A;  5GAO q;  1M1K R;  1W2B P;  2GFA A;  3QYG B;  4LNP A;  1GCQ C;  3GOX A;  1M8M A;  4D6W A;  1S72 A;  1MMN A;  2EQM A;  3NGP A;  1I1J A;  2AKL A;  1AVZ C;  2ENM A;  3JCM d;  4R55 A;  2P0P A;  1BCO A;  1R0B G;  4C5G A;  3UAT A;  3PIO A;  2ZPF B;  4XTV A;  1X69 A;  4OB3 B;  4M7D B;  4RTT A;  6AT1 B;  4Z89 A;  4M77 G;  5IH2 A;  3JCM c;  5GJV B;  1VQM A;  5L23 A;  3CCJ A;  4B9X A;  4M7A G;  3O5Z A;  1VQO A;  3M0T A;  3H0F A;  4J6Y A;  1B34 A;  2QEX T;  3MP6 A;  3MEU A;  1EFN A;  2IIM A;  1RAA B;  3PNW C;  2LCL A;  1MGQ A;  3HP9 A;  2PNI A;  4FT4 A;  3TSZ A;  4XTU A;  2GQI A;  2FPF A;  4J8O A;  4ZGJ B;  1UE9 A;  4C92 E;  3BW1 A;  2P4T A;  1QCF A;  2HZY A;  1QQJ A;  2CUD A;  1UEB A;  1K8A U;  5I2S A;  3M9Q A;  1K9M C;  2KRN A;  2GF7 A;  5D6X A;  3JB9 I;  1CKB A;  3FJ5 A;  2DET A;  4J9F A;  1YJN Q;  4F17 A;  3OS1 A;  1SF9 A;  1IXD A;  1QVP A;  1K73 C;  1QVG A;  2X4J A;  3VYH B;  1XOV A;  1ZA2 B;  1BIA A;  2DTI A;  4XU3 A;  2VXF A;  2FVU A;  2XMF A;  2EQI A;  2CP3 A;  3M0R A;  3EG2 A;  3QWY A;  5EG2 A;  3V8K A;  3I55 T;  5FRM A;  2YUN A;  1VIF A;  2DXC A;  3HRU A;  5KYU A;  4IUQ A;  3OYF A;  2F5K A;  2RD1 A;  4OMQ A;  2DK3 A;  2A7Y A;  1QVG S;  1M2V B;  4ZGE B;  1NG2 A;  4ZNX A;  3RR6 A;  1SPK A;  1NYF A;  5LJ3 j;  2LJ3 A;  3CPW A;  2RJF A;  1M90 R;  5GMK h;  3M0S A;  4R56 A;  5IT9 E;  1V1C A;  2L8D A;  2JS0 A;  2DJQ A;  2E10 A;  2VV5 A;  1YCY A;  1K1Z A;  2XHC A;  4F7U E;  1WJQ A;  8ATC B;  1ZA1 B;  4DQ2 A;  1G3Y A;  3CCL Q;  3E2U A;  1YWP A;  1OX8 A;  2O88 A;  1WXB A;  3RMS A;  3CPW S;  2XI9 A;  8AT1 B;  2ZPH B;  4DEX A;  3AHU A;  5HK3 A;  3GLX A;  4A4F A;  3FJP A;  2JN0 A;  2P0K A;  1U5S A;  4HCZ A;  2JW4 A;  2MWO A;  5FU7 B;  5IAY A;  4M78 A;  1UGV A;  4RTW A;  2JM9 A;  2ESW A;  2NUP B;  5J26 A;  1X43 A;  2VGM A;  4M78 C;  3JSC A;  3OS0 A;  2KXC A;  3CCQ T;  1KD1 C;  3CCS Q;  2X51 A;  1MMD A;  3EHR A;  3SEM A;  4KRT A;  4MMK A;  2JM8 A;  3ZBD A;  2E5K A;  3OY9 A;  2DXT A;  3I5S A;  4M7D G;  2CYZ B;  4BB7 A;  1M5Q 1;  2EPD A;  2QA4 T;  4UC4 A;  4M75 G;  1K0S A;  2QQA A;  4AFU C;  2ZCF B;  4BUG A;  5A0G A;  1YJ9 T;  3OSS C;  1ZSG A;  1RUW A;  2FRW A;  3HL8 A;  1YI2 T;  2HL5 C;  5GAM e;  5M9O A;  3HHT B;  2JXB A;  3NTI A;  4M78 D;  3EH2 A;  1PWT A;  2HKN A;  1C6V X;  3A8G B;  1MND A;  3ZEH A;  5GMK m;  1ZX6 A;  3X26 B;  1JJ2 P;  1U3O A;  1UGP B;  3C95 A;  1VQ8 A;  2VKN A;  2LJ0 A;  1S72 T;  4N0A C;  3GBQ A;  1OPK A;  4PL6 A;  2A3L A;  1Q7Y U;  4ZTF A;  1B34 B;  1XNI A;  3CC4 Q;  1YHQ Q;  2FB7 A;  1RI0 A;  3DKM A;  4RTY A;  1IO6 A;  1VQM T;  3URG A;  1QVF P;  4GLK A;  3CCJ T;  1M3A A;  1ZUU A;  1VA7 A;  4OB2 B;  4TVR A;  3OYG A;  1VQO T;  2M02 A;  3HPW A;  4C8Q G;  1RAB B;  2DMO A;  1SSF A;  2CZ6 B;  4LDX A;  1AWX A;  1NZ9 A;  4ESR A;  4DA4 A;  4RCC A;  1BYM A;  2XKO C;  1G8X A;  3A1P A;  1MV3 A;  1JB0 E;  4E2F B;  4E7H A;  2DRK A;  4FSX A;  2D0N A;  3QII A;  4JJN K;  3PMI A;  1IRE B;  1SRM A;  4A4K A;  4Q5W A;  2XDD A;  1B7T A;  2HSP A;  3LX7 A;  5GMK l;  2DD5 A;  2ROL A;  5KYU B;  2DEU A;  4FU6 A;  4Y91 A;  4XQ3 A;  2KQW A;  4HCC A;  1X6O A;  3QG1 A;  2W10 A;  3VRZ A;  4LD6 A;  1V76 A;  3NHN A;  2RQR A;  4WTO B;  1VQ9 A;  1NBE B;  3TEE A;  2IG0 A;  5A0D A;  2L3S A;  2DZ9 A;  4X1V A;  3M58 A;  1QWF A;  2E64 A;  5KYX A;  3RKX A;  5DLQ E;  1VQ4 Q;  1BI3 A;  3JCM X;  5GMK e;  3RNJ A;  3M5A A;  3J80 E;  2LJ1 A;  2CZ1 B;  1YJW A;  2XK0 A;  2XIC A;  5KE3 A;  4OB1 B;  4JRQ A;  2KNB B;  1ZSZ A;  4KUL A;  4B6M A;  4FCY A;  5HKC A;  5LJ5 d;  4PJN A;  3TCJ A;  3P8B B;  3KXT A;  1OX9 A;  1V29 B;  1ZSZ C;  2CP6 A;  3RKW A;  3DB4 A;  2KVQ G;  4M78 B;  3BDU A;  1RAF B;  2F2X A;  2YWW A;  1G2B A;  3HRS A;  2QQR A;  4J9B A;  3TVT A;  2R5M A;  4V2S A;  3H8Z A;  2H3E B;  2DFU A;  2LNV A;  1NJI R;  1AD5 A;  4II1 A;  2CS7 A;  3SWN A;  2QG9 B;  3CCU A;  1MMA A;  5GAN e;  1K4U S;  3EAE A;  3G4S A;  4PFP A;  5DM7 R;  1X6G A;  2D1X A;  2DXU A;  3JCM W;  1E6G A;  1GFC A;  2YDL A;  1ABQ A;  1UHF A;  3L2V A;  5IHK A;  5CKF A;  1UGQ B;  4FIB A;  3D7S B;  4PJL A;  3QO3 A;  2MPX C;  4F04 B;  1TTH B;  4JS4 A;  7AT1 B;  2WSE E;  1AZE A;  4HCB A;  2OTL A;  1Q95 G;  2DL8 A;  1U8R A;  2FYK A;  2E70 A;  3X25 B;  2E3I A;  5CQX A;  3M57 A;  3QUI A;  4PNO A;  4ELZ C;  5KCO A;  2DBM A;  1R8O B;  3OYM A;  3H6Z A;  4ORZ A;  2KRM A;  2M51 A;  4RTV A;  5LJ5 f;  2IVW A;  4E7I A;  3LYI A;  2GBQ A;  1M90 C;  4OMN A;  2GCX A;  2EVR A;  2J6K A;  2HQE A;  4HVW A;  3A8M B;  4AFQ C;  1JBM A;  2LRQ A;  4LDU A;  1VQK A;  3FC3 A;  5GAO m;  4IUT A;  4ME7 A;  4RTU A;  2EJG A;  4J6W A;  2R5A A;  1KSW A;  3RER A;  1VQ8 T;  4MDW A;  2JOY A;  2HQX A;  1UJY A;  1BIB A;  1JXO A;  2KMT A;  4C92 B;  4PJO E;  2DX1 A;  9ATC B;  1VQP A;  1VQL A;  1A0N B;  3VS4 A;  1WIE A;  2L0A A;  1OZ3 A;  4A53 A;  2BE9 B;  2FL7 A;  5GMK j; 
#chains in the Genus database with same CATH homology
 3JCM c;  1HK9 A;  1ZHI A;  5CKB A;  1VQM A;  3M54 A;  3CCJ A;  4B9X A;  5CK9 A;  1FXX A;  1WJR A;  4CI0 C;  1LNX A;  2K4Y A;  4RG8 A;  3CCS A;  4M7A G;  1M4Z A;  1Y96 B;  2RJE A;  1VQN T;  2MI6 A;  4EMK C;  1VQO A;  2EJF A;  4BY6 B;  2RI3 A;  4J6Y A;  3UWN A;  1B34 A;  5A2Q E;  1WQW A;  2QEX T;  2M1H A;  1QVF S;  1K8A C;  4NOY A;  3GIB A;  1M9S A;  1NPP A;  3MP6 A;  3MEW A;  3MEU A;  1Q86 U;  3RES A;  2WAC A;  3PNW C;  2LCL A;  1MGQ A;  3HP9 A;  5A0L A;  4FT4 A;  4XTU A;  3OYL A;  3UT1 A;  3HFO A;  2I2L A;  4J8O A;  2RHX A;  3MO8 A;  3OYE A;  4ZGJ B;  4ATO A;  5LJ3 f;  1WQ7 A;  4C92 E;  3HKS A;  2JVV A;  3BW1 A;  4QW2 A;  2X4X A;  3G6E A;  2P4T A;  5KH6 A;  2O4X A;  1H64 1;  3T9N A;  1VUB A;  3SFM A;  1UEB A;  4JRK A;  1K8A U;  2K5I A;  3JAM E;  5I2S A;  2OAU A;  3CCV T;  2XDB A;  3M9Q A;  1K9M C;  5GAN d;  2GF7 A;  5D6X A;  5CVI A;  3X20 B;  2EAY A;  3UDC A;  3JB9 I;  3P8H A;  4WF2 A;  3CCR A;  4M78 G;  4O6J A;  3CXC A;  1QW1 A;  3M56 A;  4DOW A;  4ZTJ A;  3R6O A;  3P8D A;  5GAN 8;  3OS1 A;  4PJO F;  2EWN A;  4J7I A;  2DVE A;  1Q82 C;  3C12 A;  4ZGD B;  1QVP A;  1K73 C;  1QVG A;  2X4J A;  3VYH B;  1XOV A;  1BIA A;  2DTI A;  4XU3 A;  5GAO l;  1IZ6 A;  1K9M U;  2LT1 A;  3OS2 A;  2QQS A;  1VQ5 T;  2VXF A;  4E47 A;  4C0D C;  2FVU A;  3OYB A;  3LGF A;  3OYI A;  3C94 A;  1OYX A;  3OYC A;  3A8L B;  3QKJ A;  2HBP A;  3L2Q A;  5KE2 A;  5J39 A;  4IUV A;  4QVC A;  4GY5 A;  3SB2 A;  4LD9 K;  5EG2 A;  3OSV A;  3V8K A;  1Q82 U;  3I55 T;  4IKF A;  5FRM A;  1VQ9 T;  3CXC S;  2H3J A;  2VYT A;  1K73 U;  5LL6 S;  1VIF A;  2DXC A;  3HRU A;  3FDR A;  3C4S A;  4XU0 A;  3SDZ A;  4IUQ A;  3OYF A;  3LWI A;  3S3N A;  2F5K A;  2RD1 A;  5HY6 A;  5CKD A;  2DK3 A;  2A7Y A;  1QVG S;  2ZPB B;  3DLL A;  1YBY A;  3QBY A;  3JCM h;  2PQW A;  4ZGE B;  4OP0 A;  1N27 A;  2VXE A;  5LJ3 d;  3CC4 A;  2K5L A;  3VUZ A;  3FB9 A;  2V8J A;  3CME T;  5LJ3 j;  3CPW A;  4OB0 B;  1BI2 A;  2M0O A;  4M77 A;  3CCE T;  1YHQ A;  3J7A F;  2RJF A;  2DAQ A;  2RI5 A;  5GMK h;  4PJO B;  1KG1 A;  3CCM T;  2JTM A;  4R56 A;  1YJW T;  1BI0 A;  3JCM V;  5IT9 E;  2L8D A;  3M55 A;  4M7A A;  2DJZ A;  1UB4 A;  1N8R C;  4M77 C;  2E10 A;  3QJY A;  1KQ1 A;  3UPU A;  2VV5 A;  4OMF B;  2LTO A;  1YCY A;  2RH2 A;  2E12 A;  2XHC A;  4F7U E;  1WJQ A;  4M77 F;  4M7A C;  2PVO B;  2CZ7 B;  1GXI E;  3OMG A;  4PLI A;  4DQ2 A;  1G3Y A;  3LLR A;  2HAX A;  1ZQ1 A;  3CD6 A;  2RHY A;  3QZ5 B;  3RMS A;  3CPW S;  4RKU E;  4DOV A;  2MMP A;  4E7J A;  1N8R U;  2XI9 A;  2ZPH B;  3JRZ A;  3AHU A;  3GF5 A;  2Y90 A;  5HK3 A;  3GLX A;  2MWP A;  4M75 C;  5GAO p;  5IN1 A;  5LJ5 g;  4A4F A;  3FJP A;  4ZN3 A;  2JN0 A;  2P0K A;  2YLC A;  3M53 A;  3CCU T;  2DEQ A;  4HCZ A;  2R57 A;  3V8J A;  3CMA A;  1O75 A;  4XTZ A;  3OYY A;  5GAN 5;  5GAN 6;  3G4S T;  4JRI A;  2MWO A;  2XID A;  5FU7 B;  1VQK A;  2BIV A;  1OZ2 A;  2KDS A;  1RL2 A;  2VC8 A;  3CEY A;  3MHX A;  4M78 A;  5IAY A;  3O8V A;  3L2W A;  4JRP A;  3CC2 T;  4HT9 A;  4QVZ A;  3A8H B;  2GFU A;  5J26 A;  3MET A;  1QP2 A;  2VGM A;  4M78 C;  5GAN g;  3JSC A;  3OS0 A;  1Q86 C;  2F69 A;  4M77 D;  1G3T A;  1PSF A;  2OTJ A;  3CCQ T;  1O9S A;  2WSF E;  1KD1 C;  1W4S A;  2QI2 A;  2FHD A;  4LDV A;  4F7U A;  3QDR B;  4JDS A;  4J7F A;  2B8A A;  4M77 B;  4M7A D;  2JZ2 A;  3QXE B;  3BDL A;  2O01 E;  4KBM B;  1FWZ A;  3I56 A;  1I81 A;  2E65 A;  2LVM A;  4MMK A;  4XK8 E;  4JLG A;  3ZBD A;  2QXF A;  1D3B A;  2DXT A;  3OY9 A;  1KQ2 A;  3RUX A;  4M7D G;  2VGN A;  3N5B B;  5GAN 2;  2CYZ B;  3E9F A;  1M5Q 1;  4BB7 A;  2QA4 T;  4UC4 A;  1KD1 U;  2OTL T;  3VV0 A;  2E6N A;  4YTL A;  4F7U F;  4M75 G;  2CKK A;  2JUF A;  3OS5 A;  1AHJ B;  3LWH A;  2QQA A;  4EDU A;  1VQ4 A;  3CBO A;  3GPL A;  1BKB A;  2ZCF B;  2YRV A;  5L8R E;  4BUG A;  1I8F A;  5A0G A;  4BDZ A;  1YJ9 T;  2XD0 A;  2MF2 A;  3OSS C;  1G5V A;  1G3S A;  3SD4 A;  5GAO r;  3S6W A;  1W2B A;  3HL8 A;  1P92 A;  5LJ3 h;  2DIG A;  3L1A A;  3M4Y A;  4EMH A;  3G71 A;  1YI2 T;  1VQ7 A;  2ZPE B;  4OGE A;  5GAM j;  3CC7 T;  3A8O B;  5GAM e;  5M9O A;  3HHT B;  3NTI A;  4M78 D;  1YIJ T;  2L89 A;  3JB9 G;  2RA2 A;  5LJ3 g;  4M77 E;  3OYJ A;  2D0Q B;  3LW5 E;  3VJP A;  5LJ5 e;  5GAN 7;  3A8G B;  4BI8 B;  5I21 A;  3EFR A;  3ZEH A;  5GMK m;  1JRI A;  4Z02 A;  5GAO n;  4M7A E;  2LCC A;  1Q7Y C;  3VYG A;  3L42 A;  3X26 B;  1VQK T;  3CCL T;  2QQ9 A;  5GAN 3;  1UGP B;  4QQG A;  3C95 A;  1W2B S;  4EMK B;  1YIT A;  2LX9 A;  1VQ8 A;  3ASK A;  3J81 E;  2EYQ A;  2EQJ A;  1S72 T;  3HRT A;  4F7U B;  4C0Z A;  4N0A C;  4A4G A;  5J3B A;  5FU6 C;  5CR2 A;  2E5Q A;  2A3L A;  3QPH A;  4P5N A;  4PL6 A;  3SWN C;  1Q7Y U;  1M8V A;  4E7L A;  2LT4 A;  5CKE A;  1B34 B;  1QP3 A;  5CIU A;  2KAF A;  2PVG B;  3HFN A;  4ZTF A;  1D3B B;  3V8L A;  1YJN A;  1NJI C;  1XNI A;  1VQP T;  1VQL T;  2M16 A;  2EIF A;  5CO7 A;  2K57 A;  2ZZD A;  4C5E A;  4EMG A;  4BE0 A;  1TH7 A;  4RCB A;  4NS5 A;  1VQ6 T;  3GNG A;  2FB7 A;  1RI0 A;  1M1F A;  3DKM A;  2RJD A;  1NPR A;  1WPY A;  4M78 E;  2QQB A;  2ZGW A;  1VQM T;  3URG A;  3FEO A;  1VQN A;  2E1H A;  2GQV A;  2O4X B;  4GLK A;  3JCM g;  3CCJ T;  3S3M A;  3CCS T;  1UGS B;  1NJI U;  2QEX A;  1KHC A;  3PMT A;  3L2Z A;  4OB2 B;  4TVR A;  3OYG A;  1NE8 A;  1VQO T;  1EIF A;  2YHT A;  2RM4 A;  3BFM A;  1Y07 A;  4OGC A;  1KQS A;  3HPW A;  5GMK i;  4VUB A;  4C8Q G;  3DLM A;  2EFI A;  3OBY A;  5AYF A;  4M7D A;  1SSF A;  2CZ6 B;  4LDX A;  1NZ9 A;  5C6S A;  4DA4 A;  1BYM A;  4RCC A;  2EJ9 A;  3V7S A;  4OVA A;  4C0F A;  5C0M A;  3QYH B;  4PJO G;  2XKO C;  2L5Q A;  4C0D B;  1X01 A;  3ME9 A;  4M75 A;  2ZPI B;  4N4G A;  3MCA B;  2JNG A;  4MML A;  4M7D C;  3G6E T;  4HT8 A;  4M7A F;  3FRN A;  3JCM b;  1JB0 E;  3CCV A;  3E1S A;  3RIR A;  1PSE A;  4E7H A;  4FSX A;  3L2U A;  2BKD N;  3PIP A;  2JTF A;  2L3R A;  3QII A;  4JJN K;  3PMI A;  5GAM f;  4BI4 A;  2LQK A;  3MP1 A;  1IRE B;  5D6W A;  4E7K A;  2X4W A;  2XG8 D;  3JCM J;  2D6F A;  4A4K A;  2R58 A;  4Q5W A;  2YLB A;  2XDD A;  1KQS S;  4QQ6 A;  4BY6 C;  3OA6 A;  4M75 F;  3CCR T;  3LX7 A;  1N9S A;  4JS5 A;  1BI1 A;  5GMK l;  4QQD A;  5GAM h;  2DD5 A;  5FLX E;  4FU6 A;  4Y91 A;  3Q1J A;  4PLL A;  4XQ3 A;  2C06 A;  2DKG A;  3M59 A;  1VQ5 A;  2K5F A;  3HSB A;  3MP8 A;  2KQW A;  4HCC A;  2PVD B;  1KC8 U;  1X6O A;  4L6V 5;  2LQ8 A;  2M9U A;  3QG1 A;  5HK0 A;  1X75 C;  4MZT A;  5CQY A;  3WXM B;  4C5I A;  2P0Q A;  4LD6 A;  4M78 F;  3F70 A;  4C92 G;  1XQH A;  2DTO A;  4NL3 A;  3I55 A;  4BAC A;  1VQ9 A;  1OI1 A;  3TEE A;  2LC4 A;  5DY9 A;  3NTK A;  3FLG A;  1U1T A;  2IG0 A;  5A0D A;  2DZ9 A;  2V8K A;  4M7A B;  4M7D D;  4FM4 B;  2RK2 A;  4J6X A;  3M58 A;  3JCM e;  2X4Y A;  2E64 A;  3RKX A;  4L5G A;  4KT0 E;  5DLQ E;  3OMC A;  4KUD K;  1BI3 A;  1G3W A;  2HNI A;  2QTX A;  3OYN A;  4M75 D;  3JCM X;  1DJ7 B;  3MEV A;  5GAN 4;  4IUP A;  3INZ A;  5GMK e;  1M1G A;  2BUD A;  3CME A;  3CC4 T;  3M5A A;  2RI2 A;  3J80 E;  3CCE A;  4QVD A;  1M1K U;  4M75 B;  3TU4 K;  2K2V A;  1N6A A;  2CZ1 B;  1N9R A;  2PUO B;  1XTD A;  3CCM A;  1VIE A;  4IUU A;  1YHQ T;  1YJW A;  1FX7 A;  1Y71 A;  2XK0 A;  2XIC A;  5KE3 A;  3EFS A;  4OB1 B;  5GAM d;  4JRQ A;  3JB9 J;  2D9T A;  4OF1 A;  4IUR A;  4X9C A;  4CRI A;  3JCM P;  4KUL A;  4A4H A;  2V8I A;  5HKC A;  5LJ5 d;  2DD4 A;  2DO3 A;  5D6Y A;  3JB9 D;  2K3X A;  3TCJ A;  3P8B B;  2HD0 A;  2XDP A;  5LJ5 j;  3KXT A;  1V29 B;  4C8Q A;  3RKW A;  3DB4 A;  4NL2 A;  2KK4 A;  2KVQ G;  4M78 B;  2DPP B;  2RO0 A;  3BDU A;  2E6Z A;  5FRO A;  3QSU A;  4LDY A;  1UGR B;  3NTH A;  1HXD A;  3QJ6 A;  3X24 B;  2DTH A;  3PTA A;  3HRS A;  4V2S A;  3OYA A;  2QQR A;  2F5T X;  2R5M A;  3CD6 T;  3V7R A;  4C8Q C;  3H8Z A;  4PJO A;  2LNV A;  4N0A A;  3KUF A;  3V7C A;  4M7D E;  2CGH A;  1ZBX A;  4II1 A;  2CS7 A;  3SWN A;  3X28 B;  4C8Q F;  3E9G A;  3G7Z A;  3OYK A;  2EQU A;  3CCU A;  4FT2 A;  3WVD B;  4PJO C;  5GAN j;  4FL6 A;  4XU2 A;  5GAN e;  3EAE A;  3TRE A;  3G4S A;  4M75 E;  5DM7 R;  3CMA T;  3JCM W;  2DXU A;  2RK1 A;  1WJS A;  3GNF B;  4O5V A;  4XTY A;  3RMQ A;  3CC2 A;  4MDX A;  2E41 A;  3CBM A;  3JCM Q;  2DZC A;  3OYH A;  4X9D A;  3RKY A;  3NFC A;  4A4E A;  3E19 A;  2DIQ A;  3L2V A;  2K3Y A;  4JLI A;  4RMO A;  3S3O A;  5CKH A;  5DLO A;  4J5Y A;  4RG2 A;  3LH0 A;  3CCQ A;  2QDY B;  5CKF A;  2Y4X A;  4F7U G;  1UGQ B;  3FIF A;  4FIB A;  3QZ9 B;  2ZPG B;  2OTJ T;  1MHN A;  2RHI A;  1I4K 1;  1LOJ A;  2LDM A;  3OB9 A;  4BD3 A;  3OBW A;  3QO3 A;  3PT9 A;  1KHI A;  3BY7 A;  4C92 A;  2DXB A;  1U1S A;  3I56 T;  3JCM f;  2AHJ B;  4N4H A;  4JS4 A;  3KBG A;  2WSC E;  3A5Z B;  4C8Q D;  3ZFJ A;  4XTX A;  2WSE E;  4HKE A;  4EPC A;  2QA4 A;  5CCA A;  4HCB A;  4C92 C;  2OTL A;  5FU7 C;  3M4G A;  4X34 A;  2EKO A;  3OW2 A;  1U8R A;  4J83 A;  4C8Q B;  1H3Z A;  3L2R A;  4PJO D;  2FYK A;  4XU1 A;  4C92 F;  2E70 A;  2EQK A;  2X35 A;  4N4I A;  3X25 B;  3LGL A;  5CQX A;  5KCH A;  1VQ4 T;  2PU9 B;  2XU8 A;  3M57 A;  3QUI A;  4JUV A;  2MAM A;  4PKC C;  4PNO A;  4ELZ C;  3ER0 A;  5LJ3 e;  5KCO A;  3PGG A;  1Y96 A;  2RB6 A;  4L59 A;  1R8O B;  3QHS A;  4Y28 E;  3OYM A;  1YI2 A;  5FU6 B;  4M7D F;  1JJ2 A;  3CC7 A;  3H6Z A;  2G3R A;  2NLU A;  3SWN B;  3G71 T;  4BDY A;  1VQ7 T;  1KC8 C;  3JB9 H;  1YIJ A;  4HA8 A;  2RHU A;  4MZP A;  5LJ5 f;  2PUK B;  1Y7X A;  1LJO A;  3OQ5 A;  1WGS A;  2IVW A;  2KY9 A;  4KUI A;  4E7I A;  1I5L A;  3LYI A;  4ZN1 A;  3OW2 S;  5FRN A;  1M90 C;  4XTW A;  4ELY C;  2GCX A;  3VU3 C;  5GAO q;  2HQE A;  3A8M B;  2GFA A;  1JBM A;  2KSS A;  2LRQ A;  3QYG B;  4LDU A;  5LJ5 h;  3FC3 A;  3GP8 A;  4A54 A;  4BI3 A;  5GAM g;  2VUB A;  3VUB A;  3WVE B;  3CPF A;  5GAO m;  3CCL A;  4IUT A;  3OYD A;  4ME7 A;  2RHZ A;  2EJG A;  3GOX A;  1YJ9 A;  4J6W A;  2R5A A;  3CBP A;  5GAN f;  4C8Q E;  4D6W A;  1Q81 C;  4C92 D;  4BE1 A;  1YIT T;  1S72 A;  1VQ8 T;  4LDW A;  4MDW A;  1JJ2 S;  3RER A;  2EQM A;  3JB9 F;  3PFS A;  1M90 U;  2JOY A;  3DB3 A;  2CZ0 B;  2HQX A;  1BIB A;  2KMT A;  1M1K C;  4C92 B;  3JCM d;  4R55 A;  2P0P A;  1QVF A;  4PJO E;  1WNL A;  3MEA A;  3VKI A;  5GAN h;  4C5G A;  4MZM A;  4C5H A;  1VQP A;  1VQL A;  3PIO A;  2Y4Y A;  2ZPF B;  4XTV A;  1YJN T;  4BE2 A;  4OB3 B;  1OZ3 A;  4C0G A;  4XAX B;  4M7D B;  1Q81 U;  5CAI A;  2RJC A;  5I2M A;  4A53 A;  1VQ6 A;  2FL7 A;  4B9W A;  5GMK j;  4M77 G;  4EMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...