3PMTA

Crystal structure of the tudor domain of human tudor domain-containing protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
KMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Tudor domain-containing protein 3
publication title Crystal Structure of TDRD3 and Methyl-Arginine Binding Characterization of TDRD3, SMN and SPF30.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pmtA00
2L8DA 3H8ZA 3LGLA 3ME9A 2FHDA 4QQGA 2DAQA 4PL6A 5C6SA 3OA6A 2GF7A 3OMCA 2RHYA 2RHXA 1SSFA 3MEAA 4A4HA 3OYMA 3QIIA 5J39A 3CEYA 5D6YA 3NTIA 5D6XA 2X35A 5J26A 2EFIA 3FEOA 3MEVA 3P8HA 4NS5A 2MWPA 2R57A 4C5GA 4BE0A 1WJRA 3OQ5A 3OYKA 4A4EA 5C0MA 3OYJA 4BDYA 2HQXA 3OY9A 3QKJA 3OYNA 3MEWA 4Q5WA 3E9FA 4QQDA 3C4SA 4N4HA 2IG0A 5CIUA 3FDRA 3OS2A 4E7IA 1G5VA 2P0KA 2RJCA 4FU6A 5KE3A 4BACA 3OMGA 2RHUA 4QW2A 3L2QA 3O8VA 1MHNA 2RJDA 3MO8A 4UC4A 4B9XA 3SD4A 4CRIA 2XK0A 4IURA 2JTFA 4PLIA 3P8DA 1H3ZA 4QQ6A 2X4WA 1WGSA 3LH0A 4II1A 4C5HA 3OYEA 5KCOA 4B9WA 4FL6A 2O4XA 3LGFA 5KE2A 4BE2A 3OYFA 4N4IA 5IAYA 4IUPA 2YRVA 2O4XB 5FRMA 3L2WA 5KCHA 3S3NA 2EQJA 2RHIA 2EQUA 4ZTJA 2RHZA 2VYTA 3L42A 4ZTFA 3PMTA 2D9TA 4HCZA 3OYLA 3QBYA 4L59A 2RI3A 1KHCA 3LLRA 4C5EA 2G3RA 2PQWA 2K3YA 3UWNA 3F70A 2X4YA 2E6NA 4X34A 3NTKA 3OB9A 4N4GA 3GOXA 2M0OA 3ASKA 4PLLA 3MP8A 2L89A 4E7LA 4LD6A 4Z02A 2DIQA 1OI1A 2F5KA 2GFAA 2LCCA 4GY5A 4E7HA 4E7JA 3NTHA 2B8AA 2WACA 2RI5A 3L2RA 2RJEA 4OVAA 2M1HA 1N27A 1OYXA 1WJQA 4A4FA 3H6ZA 3S6WA 3OS1A 3MP6A 2E5QA 3Q1JA 2L3RA 4C5IA 5D6WA 2BIVA 2R5MA 2EKOA 3EAEA 3L2UA 3OYGA 2LRQA 3PNWC 3FC3A 3DB4A 4E7KA 5FROA 3MP1A 4IKFA 4RG2A 2R58A 3DLMA 2NLUA 4BDZA 3OYIA 1OZ2A 4IUTA 3META 1RI0A 2MWOA 4A4GA 3UT1A 2QQRA 2M16A 2CKKA 3KUFA 3LYIA 3OS0A 3OYCA 3OYAA 3ZEHA 2EQMA 2XDPA 4QVZA 5M9OA 3FLGA 3L2VA 2HQEA 4EDUA 3OYHA 4BD3A 2BUDA 2K3XA 5FRNA 5KH6A 2GFUA 2RJFA 1WJSA 4IUUA 3QJ6A 2JZ2A 2QQSA 3PMIA 3S3OA 2LDMA 2RI2A 2RO0A 3S3MA 2EQKA 1OZ3A 3MEUA 3E9GA 4IUQA 3LX7A 3M9QA 3OYBA 4BE1A 3DB3A 3OYDA 2BKDN 2LVMA 2X4XA 3BDLA 1XNIA 5IN1A 3PFSA 2LTOA 4IUVA 2DIGA 2R5AA
chains in the Genus database with same CATH superfamily
2ZPEB 3L2ZA 1MGQA 2DZ9A 1Q82R 1WLPB 4QVCA 3EG0A 4JZ3A 2LQKA 2GF7A 2RQRA 1VQ8A 1EX4A 1ZUYA 2QEXQ 4BE0A 3OYKA 3HRTA 1UJ0A 3RESA 3C4SA 3OS2A 3JCMJ 1K9MR 3OW2P 3O8VA 4XTYA 2ATCB 2EYWA 1WNLA 1H3ZA 1VQ5T 2A3LA 4M77F 1M3AA 1D3BA 2DXTA 2MOXA 3CCQA 3PIPA 2KDSA 4LXCA 4X9CA 3EFOA 3X24B 5FU7C 1FMKA 2PVDB 1YITA 5I11A 1QW1A 1M90R 4PLLA 1BBZA 3SWNC 2NUTB 3H0HA 2RA2A 5GMKj 3MJXA 2DEQA 2RPNA 3NTHA 2RI5A 2COYA 4A4FA 2E5QA 2DTIA 3CPWP 2J06A 2EIFA 4XU1A 1JBMA 1UE9A 1BI2A 5GAOm 4A63B 2EYYA 2OTLA 3PTAA 3L2VA 1PG5B 1RAAB 3O5ZA 3EGUA 2J6KA 3PE0A 5A2QE 1QCOA 2XKOC 5GMKm 5CKEA 3QJ6A 1K0SA 3VS4A 5GAN3 3S3MA 1K76A 4M7DD 5LJ5g 1LJOA 3CMAT 3TVTA 2VGNA 1VQMQ 1ZSZC 2JOYA 1RUWA 3KBGA 2PZ1A 4PFOA 3H8ZA 3GF5A 1R0BG 1YJWT 5GMKe 1WIEA 2ZGWA 2F69A 1S72A 4AFSC 4R55A 2EFIA 3G6ET 3V7RA 5KYXA 2ZPGB 4AG1C 4A4EA 1VQPA 3CD6Q 4XTZA 3EGXA 5GAN5 4Q5WA 4KUDK 1AOJA 3JCMQ 1D0ZA 1Q82C 1KC8U 1QMCA 2RD1A 1G5VA 2O9VA 2QTXA 3OMGA 4ZGJB 4RTXA 1GFCA 2JTFA 1SHFA 2QA4T 2H8HA 3HPWA 2RNAA 1OX8A 5HK0A 4DEXA 4PJOF 2ZZDA 2V26A 5A0DA 1RAIB 4C8QA 1K9MC 2C0IA 3VUBA 2LT4A 4OGCA 4J9CA 4DBHA 3GOXA 4HCCA 3T9NA 3KFVA 4LD6A 1RACB 4XU3A 1GXIE 3VS3A 2JTMA 2VV5A 3E19A 2E6ZA 4PFPA 1V29B 3OS1A 3MKDA 2L3RA 1KQSA 2RF0A 3L2UA 2YUQA 1YJ9T 1Y57A 2YUNA 1IO6A 3CCVQ 4BDZA 2L3PA 1RLQC 3EFSA 5GAN8 4JUVA 2VXFA 3LYIA 2CKKA 3QJYA 3HP9A 2HQEA 1M5Q1 1OV3A 3I56Q 4IIMA 3M0UA 1PSEA 1Y0MA 2KT1A 3C0CA 3CCUA 3SEMA 4JS5A 2ED1A 2RO0A 2AIRB 3OYBA 2QI2A 5GAMf 4EIKA 1W4SA 2VWFA 2BZYA 2DVJA 3CQTA 3HFNA 5GAN4 4J8OA 2DF6A 1BKBA 1RI9A 4J6WA 2OX7A 2MPXC 1SSFA 1YFNA 1G3SA 2X35A 1BYMA 2E4HA 1KD1R 3CCMT 3G4ST 1MMAA 5LJ5j 3RDVA 3QKJA 2SEMA 3URGA 2E65A 4AFUC 4F7UF 3FDRA 3G7ZA 2LX9A 4FT2A 1M2OA 3L2QA 4UC4A 1QVFS 1KIKA 1VYTA 4OGEA 5A0LA 1JB0E 1ARKA 1RADB 2JM8A 3LGFA 2KE9A 3OYFA 1Y96A 1JXMA 1V1CA 3QZ5B 4FT4A 2MIOA 1UECA 4HCZA 3GPLA 3JCMV 3UWNA 1R77A 2X4YA 5GANf 5I22A 3M58A 2VB6A 4A4KA 3OBYA 4B6MA 3CMET 3VS0A 1X6OA 5GAOr 2LCCA 3CBPA 1SF9A 3M0TA 2PVGB 2EYZA 1PKTA 4L6V5 2X9HA 2NYSA 2E10A 2DNUA 3G71T 5LJ5e 2KMTA 3META 3ZFJA 4DQ2A 2XDDA 1WZOA 3CC4T 1VQ6Q 2DJQA 5GANh 2HKNA 1M1KR 4KGZB 1Z9QA 2DL7A 4KRTA 1ZX6A 2JZ2A 3FB9A 4EMKC 1N5ZA 4MDWA 2YHTA 1H92A 5GJWB 1YI2A 3OYDA 1AHJB 3H41A 1XNIA 4JRIA 2LJ3A 2LJ1A 4M75B 3CC2Q 2R5AA 2NUPB 1MUZA 2YRCA 2ECZA 2X51A 1VOMA 5CO7A 1TUDA 4OMFB 3VS6A 3EG9B 3CXCA 2YUOA 1Z9ZA 3OSSC 1VQ5A 3OYJA 3G1JA 1YJNQ 2OTLT 5KYNA 2FL7A 1GCPA 4J6YA 2E3IA 1KC8C 4FU6A 5IXBA 2RHUA 4P5NA 1JU5C 2MYSA 4CRIA 4J7FA 1YJWQ 3E1SA 4II1A 1YCSB 3TU4K 1VQ7T 2MCNA 4J9BA 5IAYA 1Y07A 5FRMA 5KCHA 1PNJA 4C92A 3G6EQ 3S3NA 2DA9A 1A0NB 4MMKA 2D9TA 2VVKA 1QCFA 2K3BA 2YUPA 2KYBA 2KRSA 1JO8A 2CS7A 2DXCA 3CC7Q 1T3SA 5FU6B 3EGDB 5KYYA 1VQOT 3I5SA 2CP2A 5HCKA 2H3EB 1M30A 2P84A 3AHUA 2AKKA 5CVIA 3H0FA 3S6WA 4C5IA 1K8AR 1ZUUA 1CSKA 2HZYA 2E1HA 2QAZA 3JCMW 3GNFB 3EAEA 1FXXA 2QYZA 1OZ2A 1X6BA 3VJPA 1AWWA 4Z88A 2KYMA 2W0ZA 5J3BA 2E41A 4PFZA 1Q86R 1NE8A 1TUGB 3FLGA 1VQ4Q 2JM9A 3CMAA 3VKIA 4M75G 1GBRA 5A0GA 3I35A 5CR2A 4OMNA 1I81A 1ZQ1A 4DEYA 3V7CA 1YJ9Q 1YJWA 4KT0E 3M9QA 3OW2A 3DB3A 2BKDN 2FO0A 5KYWB 2PTKA 3VS7A 2BIVA 2F5TX 3G6EA 1NM7A 5GAMg 2PUOB 4OB3B 1GL5A 1DJ7B 4E7ZA 1SRMA 4M75C 1GCQC 2FYKA 2ZPBB 2DD4A 4C8QE 5KYUB 2YRDA 4HCKA 5J26A 4M78B 4C5GA 4DBFA 2QA4A 2XU8A 4M77A 3A5ZB 1IB8A 4E7IA 1WHHA 2YLCA 2FPFA 1N9SA 5CKHA 3LWIA 1I5OB 5KCOA 3HRSA 1W6XA 2QASA 2XHCA 4F17A 1BK2A 2HSEB 2COZA 3M0SA 2VC8A 3CPWA 1K1ZA 3CCMQ 4BB7A 2KXCA 1M2VA 3THKA 5LJ3f 8AT1B 3LH5A 2HL3A 3NTKA 1ZBXA 3A8LB 5IH2A 3RNJA 2D0QB 2L89A 1M8MA 3UA6A 1YJ9A 2M02A 3H0IA 5FU6C 2OTJQ 2YT6A 1D0XA 1I8FA 3E2UA 3M55A 5EC7A 1K9MU 2Y4XA 4FYYB 3FC3A 4M7AA 2HBPA 2K57A 2YXYA 1KHIA 1V76A 4A4GA 3UA7A 1YWOA 3UPUA 1QP3A 4ZGDB 1IHVA 4BD3A 2CZ1B 2DXBA 4FSXA 3EH2A 2K9GA 2RI2A 1M90U 3G71Q 4ANJA 4BUGA 2QQBA 1M3BA 3QXEB 4M78G 5IN1A 4AG2C 5DLOA 3CCQQ 3RKWA 1G3YA 3CCMA 2EJ9A 3ME9A 2D8JA 3G4SA 1OOTA 2XD0A 3NFCA 1YP5A 3OMCA 1M1GA 1YITQ 3RUXA 1WJRA 1ZSZB 2E12A 4BI3A 5C0MA 4M78C 4PJOA 4MZMA 2XDBA 4M75D 4JJCA 4LDVA 2RQUA 1TU0B 5LJ5d 1BIAA 1Q95G 1VQ9T 5GAMj 2DO3A 3QWXX 1C6VX 2FEIA 2FRYA 1YI2T 2DYBA 1N8RR 2O4XB 2CP0A 1AZEA 4PJJA 5CQXA 4XTXA 3ZBDA 4ZTJA 2RHZA 3CMEA 1WQ7A 1QVGA 4BY6B 2OTLQ 3RERA 1VYVA 4ME7A 1HYOA 4ZN1A 2MK5A 2RH2A 1ZA1B 2DILA 2X3WD 1OI1A 2KI7A 3CCRT 3G71A 5CAIA 2I2LA 2B8AA 1GRIA 2COWA 2RJEA 2FVUA 4HA8A 1OYXA 1M4ZA 3Q1JA 3CC4A 1BI0A 5L23A 1WYXA 1S72Q 2LNHB 3HL8A 4A53A 3JB9J 2D1XA 2DYIA 2X3XD 3JCMd 1NEBA 1XTDA 1VQOQ 4MDXA 2CSQA 4LUEA 1VQPQ 5GAMe 1MMDA 2BUDA 2ROTA 3JB9I 2PNIA 4ZN3A 4JS4A 4C0ZA 2XI9A 1SRLA 1WDXA 2YWWA 2V8IA 1PRLC 5IHNA 2CH4W 4FYVB 4CC7A 2LTOA 1X2KA 3MCAB 1UGVA 1YIJT 4R56A 1QVFP 2JMAA 4OMQA 4C92E 3OA6A 2EYQA 4F7UA 1YN8A 2A7YA 1ZLMA 3PVQA 4WCIA 1Q81R 2M51A 1VQ7A 3EFRA 4HVWA 4B9XA 1MHNA 1RABB 3N5BB 1HD3A 1HSQA 4RUGA 1JJ2P 3TCJA 1WGSA 3LH0A 4C5HA 1X6GA 3A8GB 4N4IA 1PM3A 1BB9A 1XJWB 4M78D 4IUPA 1PKSA 2EQJA 1ZHIA 4RG8A 1KQ2A 3QBYA 1YWPA 1VQOA 1KHCA 3OSVA 3BW1A 3F70A 1N9RA 1W2BP 4RTVA 2K79A 4F14A 1H8KA 4BY6C 2M0OA 1UEBA 1WHMA 3CCUQ 4Y92A 1N8RC 3M5AA 3EG1A 3QO3A 1KD1U 4NOYA 3GLXA 2PVOB 4ATOA 4MZPA 2K7AA 4M7DA 4PKCC 3REAB 2H3JA 3JCMg 4E7KA 5FROA 1PD0A 3R6OA 1MNDA 1R8OB 1N6AA 4X9DA 2RQTA 3CCET 2LP5A 1H3HA 2M16A 2KSSA 2DM1A 1VQNT 3A1PA 2HNIA 2JXBA 1FX7A 1OPKA 2LNVA 2RJFA 4M77E 1WJSA 1BCOA 4FSSA 3PMIA 4FM4B 2FZGB 3PVLA 1M90C 1VQLT 3J81E 2DFUA 1W70A 2J6FA 4J9IA 2RMOA 2ZCFB 2E64A 2KNBB 2D6FA 3CCJT 4M75F 4EMKB 2OI3A 5D7UA 1PRMC 2RM4A 3NTIA 4PJNA 1MV0B 2JN0A 2BTTA 4NS5A 3OQ5A 1S1NA 1C0MA 4E6RA 2XG8D 1U3OA 2GQVA 1KQ1A 1M1KU 1TWBA 4E2FB 4RCBA 1VYUA 5KE2A 2AKLA 1X69A 2DL8A 4M7AE 3I55T 3A98A 2DX1A 1JEGA 4XQ3A 3HHTB 3JCMb 3SWNA 2F2WA 4C5EA 5GAOp 2HBWA 3H9NA 2GTJA 2CP5A 3GBQA 3X26B 2K2VA 2A28A 1AWXA 4HXJA 2DL5A 3NMZC 2HDAA 2DIQA 1UGQB 1YI2Q 1LOJA 3L1AA 4JPBW 3A8OB 2EGCA 2EAYA 1EZZB 3OYGA 2EGEA 3JSCA 1YBYA 2NLUA 2AK5A 4FW2A 4GLKA 2JUFA 1IGQA 1VQ5Q 1JJ2S 2ED0A 4J83A 3TQ7P 2IVWA 1B7TA 2K3XA 4KBMB 5IXFA 2C06A 2CP6A 1NZ9A 3VYGA 3GIBA 4PJOE 2AHJB 3CPFA 4J5YA 1UG1A 1W2BS 2LVMA 3FIFA 3V8JA 4E7SA 4IUVA 1U06A 1OQKA 2LJ0A 1M8VA 2GQIA 1K8AU 2J05A 5C6SA 2LMJA 3VS2A 3M59A 3D7SB 3OYMA 5DLQE 4PJLA 2AT1B 5D6YA 4E47A 3NHNA 2MWPA 2LT1A 1VQ9A 3M0QA 2EYXA 4AFQC 3MEWA 2DTOA 2K6DA 4C0DB 2QGGA 4N4HA 1Q86U 1QP2A 2CUBA 4M78F 1YIJQ 1K4US 1H641 2RJDA 4WF2A 3RKYA 1WHLA 5LJ3e 2E3HA 5GMKh 3QSUA 4J7IA 3HTRA 1JRIA 3M4GA 1K73R 4BE2A 1NBEB 3A8HB 5CQYA 3CCLT 3FRNA 1D3BB 1D1BA 5GAMd 4JRQA 1YHQT 4IIOA 3JCMe 3CCRA 3CMAQ 1WXTA 4FCYA 1VQKT 2BZXA 2NUTA 2V8JA 3EFOB 1LNXA 2BZ8A 4N0AC 4HT8A 2MI6A 5I2SA 4AMCA 1KD1C 1WJQA 4JLIA 4PJMA 3H6ZA 5IHKA 2F2VA 3M0PA 3J80E 1AD5A 2FB7A 2QEXT 1KQSP 4AT1B 3I9QA 1QVGS 3EG2A 3MP1A 4BI4A 3DLMA 1QVPA 2MWOA 1UFFA 4JDSA 4F7UE 1C1AA 4C0GA 2YSQA 1NJIR 2RN8A 1CKAA 2DD5A 2QA4Q 3QYGB 5FLXE 1KK7A 1O9SA 3UF4A 2DK3A 3FJ5A 3JB9H 3JCMP 1YIJA 3TREA 4FW1A 5ECAA 1AZGB 4JJBA 4TVRA 3CCST 3LX7A 5DY9A 2ZAEA 2WSCE 2O2OA 2DXUA 3V8KA 2A36A 3ER0A 4XTVA 1VQNQ 2GBQA 2K4YA 4Y91A 3X25B 1HJDA 2HEQA 2HMAA 3CEYA 2RK2A 4ELYC 2LX7A 3MEVA 3P8HA 3BE3A 4PNOA 2HQXA 5L8RE 1XOVA 5KYXB 3EGXB 4BACA 1RAHB 1QKXA 3MO8A 1M1KC 2XK0A 4C0DC 2QDYB 2ESWA 4QQ6A 3OYEA 1G2BA 4M7DE 1SG5A 2A0FB 3QWYA 3CBMA 1Q7YR 2RHIA 2AZVA 4D8KA 2HKQB 3OBWA 3M57A 1MMNA 5AT1B 4C8QB 1PD1A 4BI8B 5GAN2 5CKDA 3NGPA 4ELZC 1VQMT 5CCAA 1WHKA 2RQWA 3MP8A 4ZGEB 2DE0X 4E7LA 1NG2A 2EW3A 2VUBA 2FG0A 3BDUA 1ACMB 4E7JA 2DETA 3IQLA 3CCEA 1TOVA 3VS5A 3I55Q 2MAMA 4DA4A 3G4SQ 3CD6T 1VQNA 5I2MA 4O6JA 3AT1B 3OYIA 1QVFA 1X2QA 1NYFA 2EQIA 4OB0B 1SKUB 1N8RU 3OYCA 3OYAA 2EQMA 5GANg 1VQLA 2Y4YA 4QKUA 4KULA 2YLBA 2O88A 5KH6A 2ZPIB 4Z8AA 7AT1B 4HCBA 3MHXA 4MZTA 1OU8A 1OZ3A 2KY9A 3MEUA 5LJ5h 1NJIC 2VXEA 2KR3A 4FYXB 3CCJA 1BI1A 4LE9A 8ATCB 1T0HA 1ABOA 1EFNA 1AEYA 2OJ2A 3CMEQ 4D6WA 2CP3A 2DAQA 1K8AC 5FW9A 1HK9A 2GCXA 2RHXA 3VS1A 1J3TA 2MF2A 3QIIA 3QG1A 2F1LA 1WFWA 3RBBB 2R57A 1KQSS 3A8MB 4BDYA 2KRNA 4J9FA 4J6XA 5CIUA 3CCVT 2IG0A 2PU9B 2WSFE 4EMHA 1Q86C 5KE3A 1U8RA 3I55A 4C92F 2X4JA 3CC4Q 4IURA 1I1JA 1QCNA 4C8QG 3NPFA 2CREA 9ATCB 1WHJA 1UTIA 1VUBA 2VKNA 3I56T 4QT7A 2B86A 1WI7A 1Y96B 4FIBA 3OYLA 4L59A 3LLRA 1I4K1 1P92A 2JNGA 3OB9A 3PT9A 4M7DC 4C8QC 1HXDA 4E7HA 1Q81U 3V7SA 5GAN6 3RKXA 3M0RA 3LW5E 5GAOn 4RTYA 4OMMA 2LRQA 2EJFA 4RG2A 4OMLA 5GJVB 1D09B 3TSWA 4V2SA 1ABQA 1FYNA 1NLOC 2CZ6B 2HL5C 3VV0A 2HCKA 4F04B 4J9HA 4NL2A 1VQ7Q 4ORZA 3C12A 4RTWA 3RIRA 2LQWA 1SEMA 5LJ3d 4HT9A 4IUUA 1R0CB 2K2MA 3S3OA 1ZA2B 2EQKA 2JJ9A 5CK9A 4M75A 1GCQA 2LQNA 3JB9G 2NUPA 1X01A 1NEGA 2L8DA 2K5LA 3J7AF 3EG9A 5DM7R 4XTWA 3R6NA 5GANj 2FZCB 2CZ0B 3UDCA 4OMOA 2RHYA 3EHRA 1MMGA 2HQHA 2WSEE 1WHGA 2ROLA 5J39A 3QHSA 1FWZA 2O9SA 3FEOA 2C0OA 3CCSQ 3SHWA 3OYNA 3U23A 3VRZA 5HKCA 2HAXA 2FZKB 4A54A 4CI0C 4JJNK 1NPRA 3CCLA 4PLIA 1UGPB 1VQ6T 2XMFA 2C0TA 2X4WA 1YHQA 4FL6A 2VASA 1PC0A 1AT1B 2L2PA 2A08A 1VQKA 2E5KA 2IPOB 2I0NA 1PCXA 3L42A 2EBPA 4C92B 1VA7A 1TH7A 1WPYA 2QG9B 1OU9A 2E6NA 2NUZA 2CDTA 3JRZA 3EGDA 3CC2T 2RK1A 1SSHA 2QEXA 1UHCA 4Z02A 1TTHB 4M7AF 4R0KA 2F5KA 4O5VA 3QPHA 4LUDA 5GANe 1U1SA 2E70A 4LDXA 5KYYB 2M1HA 1N27A 2CSIA 2KEAA 5EG2A 3CXCS 4C8QD 3EH1A 4DBRA 3JAME 4JRKA 3DB4A 3WVEB 1YJNT 2MMPA 1WA7A 1E7OA 3RMQA 2QGFB 4HVUA 2KQWA 4LD9K 1RI0A 3UT1A 2F2XA 3WXMB 3M54A 5LJ3g 1D1AA 3ZEHA 2KROA 3CCSA 1NPPA 2DBKA 4OF1A 4RTUA 3REBB 2BE7D 4QVDA 1M9SA 4EDUA 4FYWB 3OYHA 4OP0A 5FWCA 1T3LA 4DOVA 2KRMA 1T0JA 2V8KA 1GBQA 2EPDA 2LDMA 1O75A 1AWOA 3M4YA 5KYWA 4JLGA 5GAOl 2LC4A 2J6OA 3I5RA 3CC7T 5KYUA 4YTLA 2FHDA 5GMKl 2CYZB 4M78A 3MEAA 4RMOA 2FRWA 3QYHB 2EJGA 4CC2A 3M56A 4XU2A 3VYHB 1K9AA 2K5IA 3E9FA 1KG1A 4QQDA 2LQ8A 5CKFA 2DERA 3TEEA 1VIEA 4M77B 1LCKA 1M27C 4QW2A 2HSPA 1OULA 1QQJA 4C92G 1IZ6A 3P8DA 1OPLA 5LL6S 1UJYA 1VQ4T 1Y7XA 2QQAA 2JS2A 4X1VA 1VQMA 3JB9D 1U5SA 3SFMA 1IXDA 4XK8E 4ZTFA 2PUKB 3UATA 2SRCA 1OX9A 1QVGP 1M2VB 4PK4A 2FPEA 4N4GA 3OW2S 2CUDA 1KJWA 4C92C 2CGHA 4GBQA 2JS0A 1B07A 4DOWA 3DKMA 2CZ7B 4D8DA 3CD6A 3EHQA 4KGVB 2WACA 1Q81C 1E6HA 3INZA 1OEBA 1G83A 1RL2A 1TSFA 1UGRB 4J9GA 2EKOA 3VU3C 4OB1B 4J9EA 2DLPA 2JMCA 4M7AB 1K73U 3QDRB 1B3QA 1LVKA 1KC8R 1VQ9Q 1B34A 5M9OA 2L3QA 1TUCA 2KGTA 2QDLA 4KGXB 3QZ9B 3CPWS 3RR6A 2OAUA 2QXFA 4BE1A 2CT4A 2DTHA 2DIGA 5LJ3j 1NYGA 4Y28E 5GAMh 2LCLA 4QQGA 3CCRQ 1TXQA 4M77G 4CC4B 5IT9E 2O31A 4XAXB 3HKSA 3CCVA 2OTJT 5D6XA 1ZSZA 2A37A 4NL3A 4EMGA 2M9UA 2D0NA 3P8BB 1NJIU 5HK3A 3HSBA 3M53A 3I56A 1VQ8T 1D0YA 1F1BB 1I0CA 3SD4A 4PJOB 4M77C 1X43A 2XIDA 4LDWA 2O4XA 2P0PA 4JRPA 1X27A 2K5FA 3L2WA 3ULRB 1RAFB 4LDYA 1G3WA 3JV3A 1CKBA 1RAGB 2QTVA 2G3RA 3JCMc 1PHTA 2QK0A 2EGAA 1TS9A 2ZPHB 4M7DF 4C8QF 1UGSB 3CCQT 4GY5A 4M7AG 2CT3A 3HRUA 2LZ6B 2QQ9A 3HFOA 1YITT 2V1RA 2GGRA 2L3SA 5D6WA 4M75E 4C92D 4HKEA 2Z0WA 3PNWC 1RLPC 1RAEB 3TSZA 3PIOA 4IUTA 2Y90A 1MNEA 4CC3A 4HVVA 2W10A 2P0QA 2QQRA 3GNGA 4M7AC 5GAOq 2DZCA 2VGMA 1Q7YU 1FMWA 1QKWA 4RTTA 5FRNA 4LN2A 2DL3A 4RKUE 1NLPC 2DBMA 2KVQG 4IUQA 2YDLA 4XU0A 1SHGA 3GP8A 2LCSA 3X28B 1JQQA 1UB4A 2X4XA 3FJPA 1IREB 1K0XA 2JT4A 3LGLA 3VRYA 2G6FX 1BI3A 2IIMA 3QUIA 2EWNA 1IGUA 4LNPA 4PJOG 2DEUA 1X75C 4F7UB 1UUEA 5GANd 1VQ6A 4C0FA 3OYYA 1G8XA 1U1TA 1S72T 3SDZA 2FPDA 3CCEQ 2P0KA 3WVDB 3JB9F 1JXOA 2EVRA 5I21A 4GLMA 2XICA 2JVVA 1VQPT 4PJOC 2O01E 1M1FA 1SPKA 2YRVA 2EQUA 3CC2A 4XTUA 2VYTA 2DL4A 2RI3A 1VQLQ 1GFDA 2JW4A 2PQWA 2K3YA 4M77D 4VUBA 4X34A 1UHFA 3ASKA 4Z89A 3QDFA 3DLLA 4ZNXA 1YJNA 3CCJQ 3L2RA 5IHIA 4KUIA 4AFZC 1D1CA 2CP7A 2HD0A 2GTOA 1EIFA 2ENMA 1KFZA 4M7DB 4IKFA 2R58A 1PSFA 5FWBA 2EKHA 5CKBA 1K73C 2RB6A 3KUFA 4M78E 1QWFA 1QLYA 1ZBJA 2XDPA 4QVZA 2P4TA 5LJ5f 2DPPB 2GFUA 1ZUKA 2ABLA 4L5GA 2KXDA 5GAN7 2AZSA 2GNCA 2CH4A 3OS5A 3CC7A 3X20B 5GMKi 2DJZA 4M7AD 4F7UG 6AT1B 3BDLA 3CBOA 3VUZA 3PFSA 3CCUT 1WXBA 1IRXA 4JZ4A 2BE9B 4EMKA 4RTZA 2DRKA 4PL6A 3ZL7C 4MMLA 2V1QA 4A4HA 1AWJA 4OMPA 4DBQA 2KBTA 4WTOB 1M3CA 3C95A 4M4ZA 1YCYA 3OY9A 2DRMA 1VQ4A 1G3TA 1Q82U 2KAFA 2RJCA 1UDLA 2ZPFB 1JJ2A 3PGGA 1LPLA 1BCMA 3SB2A 2RQVA 1XQHA 2L0AA 4B9WA 1Y71A 3JCMf 4JJDA 1AVZC 1E6GA 2OAWA 2DMOA 4EPCA 5AYFA 1FMVA 1BIBA 3CXCP 4N0AA 3PMTA 5FU7B 4KH0B 3KXTA 1MV3A 3V8LA 1W2BA 1WX6A 3SWNB 1YNZA 1VQ8Q 1I5LA 1IHWA 4PJOD 5LJ3h 4M7DG 2GFAA 4OB2B 4RCCA 1W1FA 1B34B 2DVEA 4OVAA 1WXUA 3MP6A 2L5QA 2NWMA 2R5MA 3C94A 1TG0A 3JCMh 2D8HA 1ZSGA 3MPUB 3BY7A 2P4RA 1I07A 4KH1B 2KK4A 3EG3A 2DKGA 4F16A 2J7IA 3OS0A 2M0YA 1Q7YC 3LWHA 4ESRA 1PWTA 3CCLQ 3RMSA 1QWEA 5HY6A 4K11A 2QQSA 2KT8A 2JTEA 3E9GA 4LDUA 1BU1A 1YHQQ 1VIFA 4J9DA 1KSWA 1VQKQ 1WQWA 3BFMA 3JCMX 2OTJA
chains in the Genus database with same CATH topology
2ZPEB 2F5TX 1MGQA 3L2ZA 3G6EA 3CC7T 1M8VA 2DZ9A 4YTLA 5GAMg 2PUOB 2FHDA 4OB3B 4QVCA 1K8AU 1DJ7B 5C6SA 5GMKl 3M59A 2LQKA 2CYZB 2FYKA 2GF7A 2DD4A 2ZPBB 4M75C 4C8QE 4M78A 3MEAA 4RMOA 3QYHB 2EJGA 5DLQE 3OYMA 1VQ8A 5D6YA 4E47A 5J26A 3M56A 4M78B 4XU2A 3VYHB 4BE0A 2MWPA 4C5GA 2QA4A 2LT1A 2K5IA 2XU8A 3OYKA 1VQ9A 3HRTA 4M77A 3RESA 3MEWA 2DTOA 3A5ZB 3E9FA 1KG1A 4QQDA 3C4SA 4N4HA 2LQ8A 5CKFA 4C0DB 3OS2A 4E7IA 1QP2A 4M78F 3TEEA 1VIEA 4M77B 3JCMJ 1Q86U 4QW2A 2YLCA 1H641 3O8VA 2RJDA 1N9SA 4XTYA 5CKHA 4WF2A 4C92G 3RKYA 1IZ6A 1WNLA 5GMKh 3P8DA 5LJ3e 4J7IA 3LWIA 1VQ5T 3QSUA 1H3ZA 2A3LA 1JRIA 3M4GA 5LL6S 5KCOA 3HRSA 4M77F 1VQ4T 1Y7XA 2QQAA 2XHCA 4BE2A 1D3BA 3A8HB 5CQYA 1VQMA 2VC8A 3CCLT 3JB9D 3FRNA 3CPWA 1D3BB 3SFMA 5GAMd 2DXTA 4BB7A 4XK8E 3CCQA 4ZTFA 3PIPA 4JRQA 2KDSA 2PUKB 5LJ3f 4X9CA 1YHQT 3JCMe 3CCRA 3NTKA 3X24B 1VQKT 4N4GA 2PVDB 1ZBXA 5FU7C 2V8JA 3A8LB 1LNXA 3OW2S 1QW1A 4C92C 4PLLA 1YITA 2CGHA 2D0QB 4N0AC 2L89A 3SWNC 4DOWA 2RA2A 5GMKj 4HT8A 3DKMA 2CZ7B 1YJ9A 2MI6A 3CD6A 5I2SA 2DEQA 3NTHA 2WACA 2RI5A 1Q81C 1KD1C 5FU6C 3INZA 1WJQA 4JLIA 4A4FA 3H6ZA 1I8FA 1RL2A 2E5QA 3J80E 1UGRB 3M55A 2FB7A 2QEXT 1K9MU 2Y4XA 2EKOA 2DTIA 3VU3C 3FC3A 4M7AA 2EIFA 4OB1B 2HBPA 2K57A 1QVGS 3MP1A 4BI4A 4XU1A 1KHIA 3DLMA 1JBMA 4M7AB 1QVPA 1K73U 3QDRB 2MWOA 4A4GA 4JDSA 1BI2A 3UPUA 4F7UE 1QP3A 4C0GA 5GAOm 2DD5A 3QYGB 1B34A 5FLXE 2OTLA 5M9OA 4ZGDB 3PTAA 3L2VA 1O9SA 4BD3A 2DK3A 2CZ1B 5A2QE 2DXBA 2XKOC 5GMKm 4FSXA 3JB9H 3JCMP 5CKEA 3TREA 3QJ6A 3QZ9B 1YIJA 5GAN3 2RI2A 3CPWS 3S3MA 1M90U 4M7DD 5LJ5g 4TVRA 2OAUA 3CCST 4BUGA 1LJOA 2QXFA 3LX7A 2QQBA 4BE1A 3CMAT 5DY9A 2VGNA 3QXEB 4M78G 2WSCE 2JOYA 5IN1A 2DXUA 5DLOA 3V8KA 3KBGA 2DTHA 2DIGA 3H8ZA 3GF5A 3RKWA 5LJ3j 1G3YA 3ER0A 4Y28E 3CCMA 2EJ9A 3ME9A 2LCLA 4QQGA 4XTVA 5GMKe 5GAMh 3G4SA 1YJWT 2XD0A 2ZGWA 2F69A 3NFCA 4M77G 1S72A 5IT9E 2K4YA 3OMCA 4R55A 4XAXB 3HKSA 3CCVA 4Y91A 3X25B 2OTJT 1M1GA 3CEYA 2RK2A 5D6XA 4NL3A 4ELYC 2EFIA 4EMGA 2M9UA 3G6ET 3MEVA 3RUXA 3P8HA 3V7RA 2ZPGB 1WJRA 1VQPA 4PNOA 2E12A 4A4EA 4BI3A 3P8BB 2HQXA 4XTZA 5C0MA 1NJIU 5HK3A 5L8RE 4Q5WA 5GAN5 4KUDK 4M78C 3JCMQ 1XOVA 1Q82C 3HSBA 3M53A 1KC8U 4PJOA 4MZMA 2RD1A 3I56A 2XDBA 4M75D 1VQ8T 1G5VA 4BACA 2QTXA 3OMGA 4LDVA 3MO8A 4ZGJB 3SD4A 5LJ5d 1BIAA 2XK0A 2JTFA 4C0DC 1M1KC 2QDYB 4PJOB 4QQ6A 2QA4T 4M77C 1VQ9T 5GAMj 2DO3A 3OYEA 2XIDA 4LDWA 2O4XA 2P0PA 3HPWA 4M7DE 1YI2T 4JRPA 5HK0A 4PJOF 2ZZDA 2O4XB 3CBMA 2K5FA 5A0DA 3L2WA 4LDYA 5CQXA 1G3WA 4XTXA 2RHIA 3ZBDA 4C8QA 4ZTJA 1K9MC 2RHZA 3OBWA 3M57A 3CMEA 1WQ7A 1QVGA 4BY6B 3VUBA 2G3RA 4C8QB 4BI8B 5GAN2 5CKDA 3RERA 3JCMc 2LT4A 4OGCA 4ELZC 1VQMT 3GOXA 4ME7A 5CCAA 4HCCA 4ZN1A 3MP8A 2ZPHB 2RH2A 4ZGEB 4M7DF 4E7LA 3T9NA 1UGSB 4C8QF 3CCQT 4LD6A 4XU3A 2VUBA 1GXIE 1OI1A 3BDUA 3CCRT 2JTMA 4GY5A 4M7AG 3G71A 5CAIA 2I2LA 2VV5A 4E7JA 2B8AA 3HRUA 2QQ9A 2RJEA 3HFOA 2FVUA 3E19A 4HA8A 3GPLA 3CCEA 1OYXA 2E6ZA 1YITT 1M4ZA 1V29B 3OS1A 3Q1JA 2L3RA 2MAMA 5D6WA 1KQSA 3CC4A 1BI0A 4M75E 4C92D 4DA4A 3L2UA 4HKEA 1YJ9T 3PNWC 3CD6T 1VQNA 5I2MA 3HL8A 3PIOA 4O6JA 3OYIA 4IUTA 2Y90A 4A53A 4BDZA 1QVFA 3JB9J 3EFSA 5GAN8 3JCMd 1XTDA 4JUVA 4OB0B 2VXFA 2P0QA 2QQRA 3LYIA 2CKKA 1N8RU 3OYCA 3OYAA 4MDXA 3GNGA 4M7AC 2EQMA 5GAOq 2DZCA 2VGMA 1Q7YU 5GANg 3QJYA 1VQLA 5GAMe 3HP9A 2Y4YA 2HQEA 1M5Q1 4KULA 2YLBA 2BUDA 5FRNA 3JB9I 5KH6A 1PSEA 2ZPIB 4ZN3A 4HCBA 3MHXA 4JS4A 4RKUE 4C0ZA 2XI9A 3CCUA 4MZTA 4JS5A 2RO0A 2KVQG 1OZ3A 2KY9A 3MEUA 4IUQA 5LJ5h 2V8IA 4XU0A 2VXEA 1NJIC 3OYBA 3GP8A 3CCJA 2QI2A 1BI1A 3X28B 5GAMf 1UB4A 2X4XA 1W4SA 3FJPA 1IREB 2LTOA 3MCAB 1YIJT 4R56A 3LGLA 4D6WA 3HFNA 5GAN4 1BI3A 4J8OA 2DAQA 1K8AC 1BKBA 3QUIA 4C92E 2EYQA 4F7UA 4J6WA 3OA6A 1HK9A 2EWNA 2GCXA 2RHXA 1SSFA 4PJOG 2MF2A 3QIIA 3QG1A 1X75C 2A7YA 4F7UB 1G3SA 2X35A 1BYMA 5GANd 1VQ6A 4C0FA 2R57A 3CCMT 1KQSS 3A8MB 3G4ST 5LJ5j 4BDYA 3OYYA 3QKJA 1U1TA 3URGA 1S72T 2E65A 1VQ7A 4J6XA 3SDZA 5CIUA 4F7UF 2IG0A 3CCVT 3FDRA 3EFRA 2PU9B 3G7ZA 2WSFE 2LX9A 2P0KA 4FT2A 3WVDB 4EMHA 5KE3A 1Q86C 3JB9F 1U8RA 5I21A 3I55A 4B9XA 1MHNA 2XICA 2X4JA 3N5BB 4UC4A 4C92F 3L2QA 1QVFS 4IURA 4C8QG 4OGEA 5A0LA 3TCJA 1JB0E 2JVVA 1VQPT 1WGSA 3LH0A 4C5HA 3LGFA 4PJOC 2O01E 3A8GB 1M1FA 4N4IA 1VUBA 1Y96A 3OYFA 3I56T 4M78D 4IUPA 2YRVA 2EQJA 2EQUA 3CC2A 1Y96B 4XTUA 2VYTA 1ZHIA 3QZ5B 4FIBA 4FT4A 4RG8A 1KQ2A 4HCZA 3OYLA 3QBYA 4L59A 2RI3A 1KHCA 3LLRA 1I4K1 3OSVA 2PQWA 3JCMV 1VQOA 2K3YA 3UWNA 3BW1A 3F70A 1N9RA 1P92A 2X4YA 4M77D 4VUBA 4X34A 5GANf 2JNGA 3OB9A 3PT9A 3M58A 4BY6C 2M0OA 3ASKA 4M7DC 1UEBA 4A4KA 4C8QC 3OBYA 1HXDA 1N8RC 3M5AA 3CMET 3QO3A 1X6OA 3DLLA 5GAOr 2LCCA 3CBPA 4E7HA 1YJNA 1Q81U 3V7SA 5GAN6 3L2RA 1KD1U 4NOYA 3GLXA 4KUIA 3RKXA 2PVOB 3LW5E 2PVGB 5GAOn 4ATOA 2HD0A 1EIFA 4MZPA 4L6V5 4M7DA 4PKCC 2E10A 2H3JA 3JCMg 2LRQA 2EJFA 4E7KA 5FROA 3G71T 3R6OA 1R8OB 5LJ5e 4IKFA 4RG2A 4M7DB 1N6AA 2R58A 1PSFA 4X9DA 2KMTA 3CCET 3META 5CKBA 3ZFJA 1K73C 4DQ2A 2XDDA 2RB6A 3CC4T 4V2SA 2M16A 2CZ6B 3KUFA 3VV0A 4M78E 2KSSA 4NL2A 2XDPA 4QVZA 5GANh 1VQNT 3C12A 2HNIA 2P4TA 3RIRA 5LJ5f 1FX7A 2DPPB 5LJ3d 4HT9A 2GFUA 2LNVA 2RJFA 4M77E 4L5GA 1WJSA 4IUUA 2JZ2A 3FB9A 5GAN7 4EMKC 3PMIA 3S3OA 4FM4B 3OS5A 3CC7A 2EQKA 3X20B 5CK9A 1M90C 5GMKi 1VQLT 2DJZA 4MDWA 2YHTA 4M7AD 1YI2A 3OYDA 3J81E 4M75A 4F7UG 1AHJB 3BDLA 3CBOA 1XNIA 4JRIA 3VUZA 3JB9G 1X01A 3PFSA 3CCUT 4M75B 2R5AA 2ZCFB 2L8DA 2E64A 2K5LA 3J7AF 4EMKA 5DM7R 4XTWA 5GANj 4PL6A 2D6FA 3CCJT 5CO7A 2CZ0B 4MMLA 4OMFB 3UDCA 2RHYA 3CXCA 4M75F 4A4HA 4EMKB 2WSEE 5J39A 3QHSA 2RM4A 1FWZA 3NTIA 3OSSC 3FEOA 2JN0A 4NS5A 3C95A 1VQ5A 3OYJA 3OQ5A 3OYNA 1YCYA 3OY9A 2OTLT 2FL7A 1VQ4A 1G3TA 5HKCA 1Q82U 2HAXA 2XG8D 4J6YA 4A54A 1KC8C 2KAFA 2RJCA 4FU6A 4CI0C 2GQVA 4JJNK 1NPRA 1KQ1A 2RHUA 4P5NA 3CCLA 2ZPFB 1M1KU 1JJ2A 4CRIA 4PLIA 3PGGA 4J7FA 1UGPB 1VQ6T 4RCBA 3SB2A 3E1SA 2X4WA 4II1A 1XQHA 1YHQA 3TU4K 4B9WA 4FL6A 5KE2A 1VQ7T 1Y71A 3JCMf 5IAYA 1VQKA 4EPCA 1Y07A 4M7AE 3I55T 5FRMA 5AYFA 5KCHA 4C92A 3S3NA 1BIBA 4XQ3A 3HHTB 4N0AA 3L42A 3JCMb 4MMKA 3PMTA 3SWNA 2D9TA 5FU7B 3KXTA 4C5EA 4C92B 5GAOp 3V8LA 1W2BA 1TH7A 1WPYA 3SWNB 2E6NA 1I5LA 3JRZA 3X26B 4PJOD 2K2VA 2CS7A 5LJ3h 2DXCA 3CC2T 2RK1A 2QEXA 4M7DG 4Z02A 5FU6B 4M7AF 1VQOT 2DIQA 2F5KA 2GFAA 4O5VA 3QPHA 1UGQB 4OB2B 4RCCA 5GANe 1LOJA 1B34B 1U1SA 2E70A 2DVEA 4OVAA 4LDXA 3AHUA 2M1HA 1N27A 5CVIA 3L1AA 3S6WA 3MP6A 5EG2A 3A8OB 4C5IA 2L5QA 3CXCS 2E1HA 2R5MA 3JCMW 2EAYA 3C94A 3EAEA 3GNFB 4C8QD 3OYGA 3JCMh 3JAME 4JRKA 1FXXA 3DB4A 3JSCA 3BY7A 3WVEB 1YJNT 2MMPA 1YBYA 2NLUA 2KK4A 1OZ2A 3RMQA 2KQWA 3VJPA 1RI0A 4LD9K 3UT1A 4GLKA 3WXMB 2DKGA 2JUFA 3M54A 5LJ3g 3OS0A 5J3BA 3ZEHA 1JJ2S 2E41A 3CCSA 1NPPA 4J83A 1NE8A 3FLGA 1Q7YC 4OF1A 4QVDA 2IVWA 3CMAA 1M9SA 4EDUA 3OYHA 3LWHA 2K3XA 4OP0A 3VKIA 4M75G 4KBMB 5A0GA 4DOVA 5CR2A 3RMSA 5HY6A 1I81A 2V8KA 1ZQ1A 2QQSA 2C06A 1NZ9A 2LDMA 3V7CA 3VYGA 3GIBA 1O75A 4PJOE 2AHJB 3CPFA 3E9GA 3M4YA 4J5YA 4LDUA 1YJWA 4KT0E 1VIFA 3M9QA 3OW2A 3DB3A 4JLGA 2BKDN 5GAOl 1WQWA 2LVMA 3BFMA 3JCMX 3FIFA 1W2BS 2OTJA 3V8JA 2LC4A 4IUVA 2BIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8D A;  3H8Z A;  3LGL A;  3ME9 A;  2FHD A;  4QQG A;  2DAQ A;  4PL6 A;  5C6S A;  3OA6 A;  2GF7 A;  3OMC A;  2RHY A;  2RHX A;  1SSF A;  3MEA A;  4A4H A;  3OYM A;  3QII A;  5J39 A;  3CEY A;  5D6Y A;  3NTI A;  5D6X A;  2X35 A;  5J26 A;  2EFI A;  3FEO A;  3MEV A;  3P8H A;  4NS5 A;  2MWP A;  2R57 A;  4C5G A;  4BE0 A;  1WJR A;  3OQ5 A;  3OYK A;  4A4E A;  5C0M A;  3OYJ A;  4BDY A;  2HQX A;  3OY9 A;  3QKJ A;  3OYN A;  3MEW A;  4Q5W A;  3E9F A;  4QQD A;  3C4S A;  4N4H A;  2IG0 A;  5CIU A;  3FDR A;  3OS2 A;  4E7I A;  1G5V A;  2P0K A;  2RJC A;  4FU6 A;  5KE3 A;  4BAC A;  3OMG A;  2RHU A;  4QW2 A;  3L2Q A;  3O8V A;  1MHN A;  2RJD A;  3MO8 A;  4UC4 A;  4B9X A;  3SD4 A;  4CRI A;  2XK0 A;  4IUR A;  2JTF A;  4PLI A;  3P8D A;  1H3Z A;  4QQ6 A;  2X4W A;  1WGS A;  3LH0 A;  4II1 A;  4C5H A;  3OYE A;  5KCO A;  4B9W A;  4FL6 A;  2O4X A;  3LGF A;  5KE2 A;  4BE2 A;  3OYF A;  4N4I A;  5IAY A;  4IUP A;  2YRV A;  2O4X B;  5FRM A;  3L2W A;  5KCH A;  3S3N A;  2EQJ A;  2RHI A;  2EQU A;  4ZTJ A;  2RHZ A;  2VYT A;  3L42 A;  4ZTF A;  3PMT A;  2D9T A;  4HCZ A;  3OYL A;  3QBY A;  4L59 A;  2RI3 A;  1KHC A;  3LLR A;  4C5E A;  2G3R A;  2PQW A;  2K3Y A;  3UWN A;  3F70 A;  2X4Y A;  2E6N A;  4X34 A;  3NTK A;  3OB9 A;  4N4G A;  3GOX A;  2M0O A;  3ASK A;  4PLL A;  3MP8 A;  2L89 A;  4E7L A;  4LD6 A;  4Z02 A;  2DIQ A;  1OI1 A;  2F5K A;  2GFA A;  2LCC A;  4GY5 A;  4E7H A;  4E7J A;  3NTH A;  2B8A A;  2WAC A;  2RI5 A;  3L2R A;  2RJE A;  4OVA A;  2M1H A;  1N27 A;  1OYX A;  1WJQ A;  4A4F A;  3H6Z A;  3S6W A;  3OS1 A;  3MP6 A;  2E5Q A;  3Q1J A;  2L3R A;  4C5I A;  5D6W A;  2BIV A;  2R5M A;  2EKO A;  3EAE A;  3L2U A;  3OYG A;  2LRQ A;  3PNW C;  3FC3 A;  3DB4 A;  4E7K A;  5FRO A;  3MP1 A;  4IKF A;  4RG2 A;  2R58 A;  3DLM A;  2NLU A;  4BDZ A;  3OYI A;  1OZ2 A;  4IUT A;  3MET A;  1RI0 A;  2MWO A;  4A4G A;  3UT1 A;  2QQR A;  2M16 A;  2CKK A;  3KUF A;  3LYI A;  3OS0 A;  3OYC A;  3OYA A;  3ZEH A;  2EQM A;  2XDP A;  4QVZ A;  5M9O A;  3FLG A;  3L2V A;  2HQE A;  4EDU A;  3OYH A;  4BD3 A;  2BUD A;  2K3X A;  5FRN A;  5KH6 A;  2GFU A;  2RJF A;  1WJS A;  4IUU A;  3QJ6 A;  2JZ2 A;  2QQS A;  3PMI A;  3S3O A;  2LDM A;  2RI2 A;  2RO0 A;  3S3M A;  2EQK A;  1OZ3 A;  3MEU A;  3E9G A;  4IUQ A;  3LX7 A;  3M9Q A;  3OYB A;  4BE1 A;  3DB3 A;  3OYD A;  2BKD N;  2LVM A;  2X4X A;  3BDL A;  1XNI A;  5IN1 A;  3PFS A;  2LTO A;  4IUV A;  2DIG A;  2R5A A; 
#chains in the Genus database with same CATH topology
 2ZPE B;  3L2Z A;  1MGQ A;  2DZ9 A;  1Q82 R;  1WLP B;  4QVC A;  3EG0 A;  4JZ3 A;  2LQK A;  2GF7 A;  2RQR A;  1VQ8 A;  1EX4 A;  1ZUY A;  2QEX Q;  4BE0 A;  3OYK A;  3HRT A;  1UJ0 A;  3RES A;  3C4S A;  3OS2 A;  3JCM J;  1K9M R;  3OW2 P;  3O8V A;  4XTY A;  2ATC B;  2EYW A;  1WNL A;  1H3Z A;  1VQ5 T;  2A3L A;  4M77 F;  1M3A A;  1D3B A;  2DXT A;  2MOX A;  3CCQ A;  3PIP A;  2KDS A;  4LXC A;  4X9C A;  3EFO A;  3X24 B;  5FU7 C;  1FMK A;  2PVD B;  1YIT A;  5I11 A;  1QW1 A;  1M90 R;  4PLL A;  1BBZ A;  3SWN C;  2NUT B;  3H0H A;  2RA2 A;  5GMK j;  3MJX A;  2DEQ A;  2RPN A;  3NTH A;  2RI5 A;  2COY A;  4A4F A;  2E5Q A;  2DTI A;  3CPW P;  2J06 A;  2EIF A;  4XU1 A;  1JBM A;  1UE9 A;  1BI2 A;  5GAO m;  4A63 B;  2EYY A;  2OTL A;  3PTA A;  3L2V A;  1PG5 B;  1RAA B;  3O5Z A;  3EGU A;  2J6K A;  3PE0 A;  5A2Q E;  1QCO A;  2XKO C;  5GMK m;  5CKE A;  3QJ6 A;  1K0S A;  3VS4 A;  5GAN 3;  3S3M A;  1K76 A;  4M7D D;  5LJ5 g;  1LJO A;  3CMA T;  3TVT A;  2VGN A;  1VQM Q;  1ZSZ C;  2JOY A;  1RUW A;  3KBG A;  2PZ1 A;  4PFO A;  3H8Z A;  3GF5 A;  1R0B G;  1YJW T;  5GMK e;  1WIE A;  2ZGW A;  2F69 A;  1S72 A;  4AFS C;  4R55 A;  2EFI A;  3G6E T;  3V7R A;  5KYX A;  2ZPG B;  4AG1 C;  4A4E A;  1VQP A;  3CD6 Q;  4XTZ A;  3EGX A;  5GAN 5;  4Q5W A;  4KUD K;  1AOJ A;  3JCM Q;  1D0Z A;  1Q82 C;  1KC8 U;  1QMC A;  2RD1 A;  1G5V A;  2O9V A;  2QTX A;  3OMG A;  4ZGJ B;  4RTX A;  1GFC A;  2JTF A;  1SHF A;  2QA4 T;  2H8H A;  3HPW A;  2RNA A;  1OX8 A;  5HK0 A;  4DEX A;  4PJO F;  2ZZD A;  2V26 A;  5A0D A;  1RAI B;  4C8Q A;  1K9M C;  2C0I A;  3VUB A;  2LT4 A;  4OGC A;  4J9C A;  4DBH A;  3GOX A;  4HCC A;  3T9N A;  3KFV A;  4LD6 A;  1RAC B;  4XU3 A;  1GXI E;  3VS3 A;  2JTM A;  2VV5 A;  3E19 A;  2E6Z A;  4PFP A;  1V29 B;  3OS1 A;  3MKD A;  2L3R A;  1KQS A;  2RF0 A;  3L2U A;  2YUQ A;  1YJ9 T;  1Y57 A;  2YUN A;  1IO6 A;  3CCV Q;  4BDZ A;  2L3P A;  1RLQ C;  3EFS A;  5GAN 8;  4JUV A;  2VXF A;  3LYI A;  2CKK A;  3QJY A;  3HP9 A;  2HQE A;  1M5Q 1;  1OV3 A;  3I56 Q;  4IIM A;  3M0U A;  1PSE A;  1Y0M A;  2KT1 A;  3C0C A;  3CCU A;  3SEM A;  4JS5 A;  2ED1 A;  2RO0 A;  2AIR B;  3OYB A;  2QI2 A;  5GAM f;  4EIK A;  1W4S A;  2VWF A;  2BZY A;  2DVJ A;  3CQT A;  3HFN A;  5GAN 4;  4J8O A;  2DF6 A;  1BKB A;  1RI9 A;  4J6W A;  2OX7 A;  2MPX C;  1SSF A;  1YFN A;  1G3S A;  2X35 A;  1BYM A;  2E4H A;  1KD1 R;  3CCM T;  3G4S T;  1MMA A;  5LJ5 j;  3RDV A;  3QKJ A;  2SEM A;  3URG A;  2E65 A;  4AFU C;  4F7U F;  3FDR A;  3G7Z A;  2LX9 A;  4FT2 A;  1M2O A;  3L2Q A;  4UC4 A;  1QVF S;  1KIK A;  1VYT A;  4OGE A;  5A0L A;  1JB0 E;  1ARK A;  1RAD B;  2JM8 A;  3LGF A;  2KE9 A;  3OYF A;  1Y96 A;  1JXM A;  1V1C A;  3QZ5 B;  4FT4 A;  2MIO A;  1UEC A;  4HCZ A;  3GPL A;  3JCM V;  3UWN A;  1R77 A;  2X4Y A;  5GAN f;  5I22 A;  3M58 A;  2VB6 A;  4A4K A;  3OBY A;  4B6M A;  3CME T;  3VS0 A;  1X6O A;  5GAO r;  2LCC A;  3CBP A;  1SF9 A;  3M0T A;  2PVG B;  2EYZ A;  1PKT A;  4L6V 5;  2X9H A;  2NYS A;  2E10 A;  2DNU A;  3G71 T;  5LJ5 e;  2KMT A;  3MET A;  3ZFJ A;  4DQ2 A;  2XDD A;  1WZO A;  3CC4 T;  1VQ6 Q;  2DJQ A;  5GAN h;  2HKN A;  1M1K R;  4KGZ B;  1Z9Q A;  2DL7 A;  4KRT A;  1ZX6 A;  2JZ2 A;  3FB9 A;  4EMK C;  1N5Z A;  4MDW A;  2YHT A;  1H92 A;  5GJW B;  1YI2 A;  3OYD A;  1AHJ B;  3H41 A;  1XNI A;  4JRI A;  2LJ3 A;  2LJ1 A;  4M75 B;  3CC2 Q;  2R5A A;  2NUP B;  1MUZ A;  2YRC A;  2ECZ A;  2X51 A;  1VOM A;  5CO7 A;  1TUD A;  4OMF B;  3VS6 A;  3EG9 B;  3CXC A;  2YUO A;  1Z9Z A;  3OSS C;  1VQ5 A;  3OYJ A;  3G1J A;  1YJN Q;  2OTL T;  5KYN A;  2FL7 A;  1GCP A;  4J6Y A;  2E3I A;  1KC8 C;  4FU6 A;  5IXB A;  2RHU A;  4P5N A;  1JU5 C;  2MYS A;  4CRI A;  4J7F A;  1YJW Q;  3E1S A;  4II1 A;  1YCS B;  3TU4 K;  1VQ7 T;  2MCN A;  4J9B A;  5IAY A;  1Y07 A;  5FRM A;  5KCH A;  1PNJ A;  4C92 A;  3G6E Q;  3S3N A;  2DA9 A;  1A0N B;  4MMK A;  2D9T A;  2VVK A;  1QCF A;  2K3B A;  2YUP A;  2KYB A;  2KRS A;  1JO8 A;  2CS7 A;  2DXC A;  3CC7 Q;  1T3S A;  5FU6 B;  3EGD B;  5KYY A;  1VQO T;  3I5S A;  2CP2 A;  5HCK A;  2H3E B;  1M30 A;  2P84 A;  3AHU A;  2AKK A;  5CVI A;  3H0F A;  3S6W A;  4C5I A;  1K8A R;  1ZUU A;  1CSK A;  2HZY A;  2E1H A;  2QAZ A;  3JCM W;  3GNF B;  3EAE A;  1FXX A;  2QYZ A;  1OZ2 A;  1X6B A;  3VJP A;  1AWW A;  4Z88 A;  2KYM A;  2W0Z A;  5J3B A;  2E41 A;  4PFZ A;  1Q86 R;  1NE8 A;  1TUG B;  3FLG A;  1VQ4 Q;  2JM9 A;  3CMA A;  3VKI A;  4M75 G;  1GBR A;  5A0G A;  3I35 A;  5CR2 A;  4OMN A;  1I81 A;  1ZQ1 A;  4DEY A;  3V7C A;  1YJ9 Q;  1YJW A;  4KT0 E;  3M9Q A;  3OW2 A;  3DB3 A;  2BKD N;  2FO0 A;  5KYW B;  2PTK A;  3VS7 A;  2BIV A;  2F5T X;  3G6E A;  1NM7 A;  5GAM g;  2PUO B;  4OB3 B;  1GL5 A;  1DJ7 B;  4E7Z A;  1SRM A;  4M75 C;  1GCQ C;  2FYK A;  2ZPB B;  2DD4 A;  4C8Q E;  5KYU B;  2YRD A;  4HCK A;  5J26 A;  4M78 B;  4C5G A;  4DBF A;  2QA4 A;  2XU8 A;  4M77 A;  3A5Z B;  1IB8 A;  4E7I A;  1WHH A;  2YLC A;  2FPF A;  1N9S A;  5CKH A;  3LWI A;  1I5O B;  5KCO A;  3HRS A;  1W6X A;  2QAS A;  2XHC A;  4F17 A;  1BK2 A;  2HSE B;  2COZ A;  3M0S A;  2VC8 A;  3CPW A;  1K1Z A;  3CCM Q;  4BB7 A;  2KXC A;  1M2V A;  3THK A;  5LJ3 f;  8AT1 B;  3LH5 A;  2HL3 A;  3NTK A;  1ZBX A;  3A8L B;  5IH2 A;  3RNJ A;  2D0Q B;  2L89 A;  1M8M A;  3UA6 A;  1YJ9 A;  2M02 A;  3H0I A;  5FU6 C;  2OTJ Q;  2YT6 A;  1D0X A;  1I8F A;  3E2U A;  3M55 A;  5EC7 A;  1K9M U;  2Y4X A;  4FYY B;  3FC3 A;  4M7A A;  2HBP A;  2K57 A;  2YXY A;  1KHI A;  1V76 A;  4A4G A;  3UA7 A;  1YWO A;  3UPU A;  1QP3 A;  4ZGD B;  1IHV A;  4BD3 A;  2CZ1 B;  2DXB A;  4FSX A;  3EH2 A;  2K9G A;  2RI2 A;  1M90 U;  3G71 Q;  4ANJ A;  4BUG A;  2QQB A;  1M3B A;  3QXE B;  4M78 G;  5IN1 A;  4AG2 C;  5DLO A;  3CCQ Q;  3RKW A;  1G3Y A;  3CCM A;  2EJ9 A;  3ME9 A;  2D8J A;  3G4S A;  1OOT A;  2XD0 A;  3NFC A;  1YP5 A;  3OMC A;  1M1G A;  1YIT Q;  3RUX A;  1WJR A;  1ZSZ B;  2E12 A;  4BI3 A;  5C0M A;  4M78 C;  4PJO A;  4MZM A;  2XDB A;  4M75 D;  4JJC A;  4LDV A;  2RQU A;  1TU0 B;  5LJ5 d;  1BIA A;  1Q95 G;  1VQ9 T;  5GAM j;  2DO3 A;  3QWX X;  1C6V X;  2FEI A;  2FRY A;  1YI2 T;  2DYB A;  1N8R R;  2O4X B;  2CP0 A;  1AZE A;  4PJJ A;  5CQX A;  4XTX A;  3ZBD A;  4ZTJ A;  2RHZ A;  3CME A;  1WQ7 A;  1QVG A;  4BY6 B;  2OTL Q;  3RER A;  1VYV A;  4ME7 A;  1HYO A;  4ZN1 A;  2MK5 A;  2RH2 A;  1ZA1 B;  2DIL A;  2X3W D;  1OI1 A;  2KI7 A;  3CCR T;  3G71 A;  5CAI A;  2I2L A;  2B8A A;  1GRI A;  2COW A;  2RJE A;  2FVU A;  4HA8 A;  1OYX A;  1M4Z A;  3Q1J A;  3CC4 A;  1BI0 A;  5L23 A;  1WYX A;  1S72 Q;  2LNH B;  3HL8 A;  4A53 A;  3JB9 J;  2D1X A;  2DYI A;  2X3X D;  3JCM d;  1NEB A;  1XTD A;  1VQO Q;  4MDX A;  2CSQ A;  4LUE A;  1VQP Q;  5GAM e;  1MMD A;  2BUD A;  2ROT A;  3JB9 I;  2PNI A;  4ZN3 A;  4JS4 A;  4C0Z A;  2XI9 A;  1SRL A;  1WDX A;  2YWW A;  2V8I A;  1PRL C;  5IHN A;  2CH4 W;  4FYV B;  4CC7 A;  2LTO A;  1X2K A;  3MCA B;  1UGV A;  1YIJ T;  4R56 A;  1QVF P;  2JMA A;  4OMQ A;  4C92 E;  3OA6 A;  2EYQ A;  4F7U A;  1YN8 A;  2A7Y A;  1ZLM A;  3PVQ A;  4WCI A;  1Q81 R;  2M51 A;  1VQ7 A;  3EFR A;  4HVW A;  4B9X A;  1MHN A;  1RAB B;  3N5B B;  1HD3 A;  1HSQ A;  4RUG A;  1JJ2 P;  3TCJ A;  1WGS A;  3LH0 A;  4C5H A;  1X6G A;  3A8G B;  4N4I A;  1PM3 A;  1BB9 A;  1XJW B;  4M78 D;  4IUP A;  1PKS A;  2EQJ A;  1ZHI A;  4RG8 A;  1KQ2 A;  3QBY A;  1YWP A;  1VQO A;  1KHC A;  3OSV A;  3BW1 A;  3F70 A;  1N9R A;  1W2B P;  4RTV A;  2K79 A;  4F14 A;  1H8K A;  4BY6 C;  2M0O A;  1UEB A;  1WHM A;  3CCU Q;  4Y92 A;  1N8R C;  3M5A A;  3EG1 A;  3QO3 A;  1KD1 U;  4NOY A;  3GLX A;  2PVO B;  4ATO A;  4MZP A;  2K7A A;  4M7D A;  4PKC C;  3REA B;  2H3J A;  3JCM g;  4E7K A;  5FRO A;  1PD0 A;  3R6O A;  1MND A;  1R8O B;  1N6A A;  4X9D A;  2RQT A;  3CCE T;  2LP5 A;  1H3H A;  2M16 A;  2KSS A;  2DM1 A;  1VQN T;  3A1P A;  2HNI A;  2JXB A;  1FX7 A;  1OPK A;  2LNV A;  2RJF A;  4M77 E;  1WJS A;  1BCO A;  4FSS A;  3PMI A;  4FM4 B;  2FZG B;  3PVL A;  1M90 C;  1VQL T;  3J81 E;  2DFU A;  1W70 A;  2J6F A;  4J9I A;  2RMO A;  2ZCF B;  2E64 A;  2KNB B;  2D6F A;  3CCJ T;  4M75 F;  4EMK B;  2OI3 A;  5D7U A;  1PRM C;  2RM4 A;  3NTI A;  4PJN A;  1MV0 B;  2JN0 A;  2BTT A;  4NS5 A;  3OQ5 A;  1S1N A;  1C0M A;  4E6R A;  2XG8 D;  1U3O A;  2GQV A;  1KQ1 A;  1M1K U;  1TWB A;  4E2F B;  4RCB A;  1VYU A;  5KE2 A;  2AKL A;  1X69 A;  2DL8 A;  4M7A E;  3I55 T;  3A98 A;  2DX1 A;  1JEG A;  4XQ3 A;  3HHT B;  3JCM b;  3SWN A;  2F2W A;  4C5E A;  5GAO p;  2HBW A;  3H9N A;  2GTJ A;  2CP5 A;  3GBQ A;  3X26 B;  2K2V A;  2A28 A;  1AWX A;  4HXJ A;  2DL5 A;  3NMZ C;  2HDA A;  2DIQ A;  1UGQ B;  1YI2 Q;  1LOJ A;  3L1A A;  4JPB W;  3A8O B;  2EGC A;  2EAY A;  1EZZ B;  3OYG A;  2EGE A;  3JSC A;  1YBY A;  2NLU A;  2AK5 A;  4FW2 A;  4GLK A;  2JUF A;  1IGQ A;  1VQ5 Q;  1JJ2 S;  2ED0 A;  4J83 A;  3TQ7 P;  2IVW A;  1B7T A;  2K3X A;  4KBM B;  5IXF A;  2C06 A;  2CP6 A;  1NZ9 A;  3VYG A;  3GIB A;  4PJO E;  2AHJ B;  3CPF A;  4J5Y A;  1UG1 A;  1W2B S;  2LVM A;  3FIF A;  3V8J A;  4E7S A;  4IUV A;  1U06 A;  1OQK A;  2LJ0 A;  1M8V A;  2GQI A;  1K8A U;  2J05 A;  5C6S A;  2LMJ A;  3VS2 A;  3M59 A;  3D7S B;  3OYM A;  5DLQ E;  4PJL A;  2AT1 B;  5D6Y A;  4E47 A;  3NHN A;  2MWP A;  2LT1 A;  1VQ9 A;  3M0Q A;  2EYX A;  4AFQ C;  3MEW A;  2DTO A;  2K6D A;  4C0D B;  2QGG A;  4N4H A;  1Q86 U;  1QP2 A;  2CUB A;  4M78 F;  1YIJ Q;  1K4U S;  1H64 1;  2RJD A;  4WF2 A;  3RKY A;  1WHL A;  5LJ3 e;  2E3H A;  5GMK h;  3QSU A;  4J7I A;  3HTR A;  1JRI A;  3M4G A;  1K73 R;  4BE2 A;  1NBE B;  3A8H B;  5CQY A;  3CCL T;  3FRN A;  1D3B B;  1D1B A;  5GAM d;  4JRQ A;  1YHQ T;  4IIO A;  3JCM e;  3CCR A;  3CMA Q;  1WXT A;  4FCY A;  1VQK T;  2BZX A;  2NUT A;  2V8J A;  3EFO B;  1LNX A;  2BZ8 A;  4N0A C;  4HT8 A;  2MI6 A;  5I2S A;  4AMC A;  1KD1 C;  1WJQ A;  4JLI A;  4PJM A;  3H6Z A;  5IHK A;  2F2V A;  3M0P A;  3J80 E;  1AD5 A;  2FB7 A;  2QEX T;  1KQS P;  4AT1 B;  3I9Q A;  1QVG S;  3EG2 A;  3MP1 A;  4BI4 A;  3DLM A;  1QVP A;  2MWO A;  1UFF A;  4JDS A;  4F7U E;  1C1A A;  4C0G A;  2YSQ A;  1NJI R;  2RN8 A;  1CKA A;  2DD5 A;  2QA4 Q;  3QYG B;  5FLX E;  1KK7 A;  1O9S A;  3UF4 A;  2DK3 A;  3FJ5 A;  3JB9 H;  3JCM P;  1YIJ A;  3TRE A;  4FW1 A;  5ECA A;  1AZG B;  4JJB A;  4TVR A;  3CCS T;  3LX7 A;  5DY9 A;  2ZAE A;  2WSC E;  2O2O A;  2DXU A;  3V8K A;  2A36 A;  3ER0 A;  4XTV A;  1VQN Q;  2GBQ A;  2K4Y A;  4Y91 A;  3X25 B;  1HJD A;  2HEQ A;  2HMA A;  3CEY A;  2RK2 A;  4ELY C;  2LX7 A;  3MEV A;  3P8H A;  3BE3 A;  4PNO A;  2HQX A;  5L8R E;  1XOV A;  5KYX B;  3EGX B;  4BAC A;  1RAH B;  1QKX A;  3MO8 A;  1M1K C;  2XK0 A;  4C0D C;  2QDY B;  2ESW A;  4QQ6 A;  3OYE A;  1G2B A;  4M7D E;  1SG5 A;  2A0F B;  3QWY A;  3CBM A;  1Q7Y R;  2RHI A;  2AZV A;  4D8K A;  2HKQ B;  3OBW A;  3M57 A;  1MMN A;  5AT1 B;  4C8Q B;  1PD1 A;  4BI8 B;  5GAN 2;  5CKD A;  3NGP A;  4ELZ C;  1VQM T;  5CCA A;  1WHK A;  2RQW A;  3MP8 A;  4ZGE B;  2DE0 X;  4E7L A;  1NG2 A;  2EW3 A;  2VUB A;  2FG0 A;  3BDU A;  1ACM B;  4E7J A;  2DET A;  3IQL A;  3CCE A;  1TOV A;  3VS5 A;  3I55 Q;  2MAM A;  4DA4 A;  3G4S Q;  3CD6 T;  1VQN A;  5I2M A;  4O6J A;  3AT1 B;  3OYI A;  1QVF A;  1X2Q A;  1NYF A;  2EQI A;  4OB0 B;  1SKU B;  1N8R U;  3OYC A;  3OYA A;  2EQM A;  5GAN g;  1VQL A;  2Y4Y A;  4QKU A;  4KUL A;  2YLB A;  2O88 A;  5KH6 A;  2ZPI B;  4Z8A A;  7AT1 B;  4HCB A;  3MHX A;  4MZT A;  1OU8 A;  1OZ3 A;  2KY9 A;  3MEU A;  5LJ5 h;  1NJI C;  2VXE A;  2KR3 A;  4FYX B;  3CCJ A;  1BI1 A;  4LE9 A;  8ATC B;  1T0H A;  1ABO A;  1EFN A;  1AEY A;  2OJ2 A;  3CME Q;  4D6W A;  2CP3 A;  2DAQ A;  1K8A C;  5FW9 A;  1HK9 A;  2GCX A;  2RHX A;  3VS1 A;  1J3T A;  2MF2 A;  3QII A;  3QG1 A;  2F1L A;  1WFW A;  3RBB B;  2R57 A;  1KQS S;  3A8M B;  4BDY A;  2KRN A;  4J9F A;  4J6X A;  5CIU A;  3CCV T;  2IG0 A;  2PU9 B;  2WSF E;  4EMH A;  1Q86 C;  5KE3 A;  1U8R A;  3I55 A;  4C92 F;  2X4J A;  3CC4 Q;  4IUR A;  1I1J A;  1QCN A;  4C8Q G;  3NPF A;  2CRE A;  9ATC B;  1WHJ A;  1UTI A;  1VUB A;  2VKN A;  3I56 T;  4QT7 A;  2B86 A;  1WI7 A;  1Y96 B;  4FIB A;  3OYL A;  4L59 A;  3LLR A;  1I4K 1;  1P92 A;  2JNG A;  3OB9 A;  3PT9 A;  4M7D C;  4C8Q C;  1HXD A;  4E7H A;  1Q81 U;  3V7S A;  5GAN 6;  3RKX A;  3M0R A;  3LW5 E;  5GAO n;  4RTY A;  4OMM A;  2LRQ A;  2EJF A;  4RG2 A;  4OML A;  5GJV B;  1D09 B;  3TSW A;  4V2S A;  1ABQ A;  1FYN A;  1NLO C;  2CZ6 B;  2HL5 C;  3VV0 A;  2HCK A;  4F04 B;  4J9H A;  4NL2 A;  1VQ7 Q;  4ORZ A;  3C12 A;  4RTW A;  3RIR A;  2LQW A;  1SEM A;  5LJ3 d;  4HT9 A;  4IUU A;  1R0C B;  2K2M A;  3S3O A;  1ZA2 B;  2EQK A;  2JJ9 A;  5CK9 A;  4M75 A;  1GCQ A;  2LQN A;  3JB9 G;  2NUP A;  1X01 A;  1NEG A;  2L8D A;  2K5L A;  3J7A F;  3EG9 A;  5DM7 R;  4XTW A;  3R6N A;  5GAN j;  2FZC B;  2CZ0 B;  3UDC A;  4OMO A;  2RHY A;  3EHR A;  1MMG A;  2HQH A;  2WSE E;  1WHG A;  2ROL A;  5J39 A;  3QHS A;  1FWZ A;  2O9S A;  3FEO A;  2C0O A;  3CCS Q;  3SHW A;  3OYN A;  3U23 A;  3VRZ A;  5HKC A;  2HAX A;  2FZK B;  4A54 A;  4CI0 C;  4JJN K;  1NPR A;  3CCL A;  4PLI A;  1UGP B;  1VQ6 T;  2XMF A;  2C0T A;  2X4W A;  1YHQ A;  4FL6 A;  2VAS A;  1PC0 A;  1AT1 B;  2L2P A;  2A08 A;  1VQK A;  2E5K A;  2IPO B;  2I0N A;  1PCX A;  3L42 A;  2EBP A;  4C92 B;  1VA7 A;  1TH7 A;  1WPY A;  2QG9 B;  1OU9 A;  2E6N A;  2NUZ A;  2CDT A;  3JRZ A;  3EGD A;  3CC2 T;  2RK1 A;  1SSH A;  2QEX A;  1UHC A;  4Z02 A;  1TTH B;  4M7A F;  4R0K A;  2F5K A;  4O5V A;  3QPH A;  4LUD A;  5GAN e;  1U1S A;  2E70 A;  4LDX A;  5KYY B;  2M1H A;  1N27 A;  2CSI A;  2KEA A;  5EG2 A;  3CXC S;  4C8Q D;  3EH1 A;  4DBR A;  3JAM E;  4JRK A;  3DB4 A;  3WVE B;  1YJN T;  2MMP A;  1WA7 A;  1E7O A;  3RMQ A;  2QGF B;  4HVU A;  2KQW A;  4LD9 K;  1RI0 A;  3UT1 A;  2F2X A;  3WXM B;  3M54 A;  5LJ3 g;  1D1A A;  3ZEH A;  2KRO A;  3CCS A;  1NPP A;  2DBK A;  4OF1 A;  4RTU A;  3REB B;  2BE7 D;  4QVD A;  1M9S A;  4EDU A;  4FYW B;  3OYH A;  4OP0 A;  5FWC A;  1T3L A;  4DOV A;  2KRM A;  1T0J A;  2V8K A;  1GBQ A;  2EPD A;  2LDM A;  1O75 A;  1AWO A;  3M4Y A;  5KYW A;  4JLG A;  5GAO l;  2LC4 A;  2J6O A;  3I5R A;  3CC7 T;  5KYU A;  4YTL A;  2FHD A;  5GMK l;  2CYZ B;  4M78 A;  3MEA A;  4RMO A;  2FRW A;  3QYH B;  2EJG A;  4CC2 A;  3M56 A;  4XU2 A;  3VYH B;  1K9A A;  2K5I A;  3E9F A;  1KG1 A;  4QQD A;  2LQ8 A;  5CKF A;  2DER A;  3TEE A;  1VIE A;  4M77 B;  1LCK A;  1M27 C;  4QW2 A;  2HSP A;  1OUL A;  1QQJ A;  4C92 G;  1IZ6 A;  3P8D A;  1OPL A;  5LL6 S;  1UJY A;  1VQ4 T;  1Y7X A;  2QQA A;  2JS2 A;  4X1V A;  1VQM A;  3JB9 D;  1U5S A;  3SFM A;  1IXD A;  4XK8 E;  4ZTF A;  2PUK B;  3UAT A;  2SRC A;  1OX9 A;  1QVG P;  1M2V B;  4PK4 A;  2FPE A;  4N4G A;  3OW2 S;  2CUD A;  1KJW A;  4C92 C;  2CGH A;  4GBQ A;  2JS0 A;  1B07 A;  4DOW A;  3DKM A;  2CZ7 B;  4D8D A;  3CD6 A;  3EHQ A;  4KGV B;  2WAC A;  1Q81 C;  1E6H A;  3INZ A;  1OEB A;  1G83 A;  1RL2 A;  1TSF A;  1UGR B;  4J9G A;  2EKO A;  3VU3 C;  4OB1 B;  4J9E A;  2DLP A;  2JMC A;  4M7A B;  1K73 U;  3QDR B;  1B3Q A;  1LVK A;  1KC8 R;  1VQ9 Q;  1B34 A;  5M9O A;  2L3Q A;  1TUC A;  2KGT A;  2QDL A;  4KGX B;  3QZ9 B;  3CPW S;  3RR6 A;  2OAU A;  2QXF A;  4BE1 A;  2CT4 A;  2DTH A;  2DIG A;  5LJ3 j;  1NYG A;  4Y28 E;  5GAM h;  2LCL A;  4QQG A;  3CCR Q;  1TXQ A;  4M77 G;  4CC4 B;  5IT9 E;  2O31 A;  4XAX B;  3HKS A;  3CCV A;  2OTJ T;  5D6X A;  1ZSZ A;  2A37 A;  4NL3 A;  4EMG A;  2M9U A;  2D0N A;  3P8B B;  1NJI U;  5HK3 A;  3HSB A;  3M53 A;  3I56 A;  1VQ8 T;  1D0Y A;  1F1B B;  1I0C A;  3SD4 A;  4PJO B;  4M77 C;  1X43 A;  2XID A;  4LDW A;  2O4X A;  2P0P A;  4JRP A;  1X27 A;  2K5F A;  3L2W A;  3ULR B;  1RAF B;  4LDY A;  1G3W A;  3JV3 A;  1CKB A;  1RAG B;  2QTV A;  2G3R A;  3JCM c;  1PHT A;  2QK0 A;  2EGA A;  1TS9 A;  2ZPH B;  4M7D F;  4C8Q F;  1UGS B;  3CCQ T;  4GY5 A;  4M7A G;  2CT3 A;  3HRU A;  2LZ6 B;  2QQ9 A;  3HFO A;  1YIT T;  2V1R A;  2GGR A;  2L3S A;  5D6W A;  4M75 E;  4C92 D;  4HKE A;  2Z0W A;  3PNW C;  1RLP C;  1RAE B;  3TSZ A;  3PIO A;  4IUT A;  2Y90 A;  1MNE A;  4CC3 A;  4HVV A;  2W10 A;  2P0Q A;  2QQR A;  3GNG A;  4M7A C;  5GAO q;  2DZC A;  2VGM A;  1Q7Y U;  1FMW A;  1QKW A;  4RTT A;  5FRN A;  4LN2 A;  2DL3 A;  4RKU E;  1NLP C;  2DBM A;  2KVQ G;  4IUQ A;  2YDL A;  4XU0 A;  1SHG A;  3GP8 A;  2LCS A;  3X28 B;  1JQQ A;  1UB4 A;  2X4X A;  3FJP A;  1IRE B;  1K0X A;  2JT4 A;  3LGL A;  3VRY A;  2G6F X;  1BI3 A;  2IIM A;  3QUI A;  2EWN A;  1IGU A;  4LNP A;  4PJO G;  2DEU A;  1X75 C;  4F7U B;  1UUE A;  5GAN d;  1VQ6 A;  4C0F A;  3OYY A;  1G8X A;  1U1T A;  1S72 T;  3SDZ A;  2FPD A;  3CCE Q;  2P0K A;  3WVD B;  3JB9 F;  1JXO A;  2EVR A;  5I21 A;  4GLM A;  2XIC A;  2JVV A;  1VQP T;  4PJO C;  2O01 E;  1M1F A;  1SPK A;  2YRV A;  2EQU A;  3CC2 A;  4XTU A;  2VYT A;  2DL4 A;  2RI3 A;  1VQL Q;  1GFD A;  2JW4 A;  2PQW A;  2K3Y A;  4M77 D;  4VUB A;  4X34 A;  1UHF A;  3ASK A;  4Z89 A;  3QDF A;  3DLL A;  4ZNX A;  1YJN A;  3CCJ Q;  3L2R A;  5IHI A;  4KUI A;  4AFZ C;  1D1C A;  2CP7 A;  2HD0 A;  2GTO A;  1EIF A;  2ENM A;  1KFZ A;  4M7D B;  4IKF A;  2R58 A;  1PSF A;  5FWB A;  2EKH A;  5CKB A;  1K73 C;  2RB6 A;  3KUF A;  4M78 E;  1QWF A;  1QLY A;  1ZBJ A;  2XDP A;  4QVZ A;  2P4T A;  5LJ5 f;  2DPP B;  2GFU A;  1ZUK A;  2ABL A;  4L5G A;  2KXD A;  5GAN 7;  2AZS A;  2GNC A;  2CH4 A;  3OS5 A;  3CC7 A;  3X20 B;  5GMK i;  2DJZ A;  4M7A D;  4F7U G;  6AT1 B;  3BDL A;  3CBO A;  3VUZ A;  3PFS A;  3CCU T;  1WXB A;  1IRX A;  4JZ4 A;  2BE9 B;  4EMK A;  4RTZ A;  2DRK A;  4PL6 A;  3ZL7 C;  4MML A;  2V1Q A;  4A4H A;  1AWJ A;  4OMP A;  4DBQ A;  2KBT A;  4WTO B;  1M3C A;  3C95 A;  4M4Z A;  1YCY A;  3OY9 A;  2DRM A;  1VQ4 A;  1G3T A;  1Q82 U;  2KAF A;  2RJC A;  1UDL A;  2ZPF B;  1JJ2 A;  3PGG A;  1LPL A;  1BCM A;  3SB2 A;  2RQV A;  1XQH A;  2L0A A;  4B9W A;  1Y71 A;  3JCM f;  4JJD A;  1AVZ C;  1E6G A;  2OAW A;  2DMO A;  4EPC A;  5AYF A;  1FMV A;  1BIB A;  3CXC P;  4N0A A;  3PMT A;  5FU7 B;  4KH0 B;  3KXT A;  1MV3 A;  3V8L A;  1W2B A;  1WX6 A;  3SWN B;  1YNZ A;  1VQ8 Q;  1I5L A;  1IHW A;  4PJO D;  5LJ3 h;  4M7D G;  2GFA A;  4OB2 B;  4RCC A;  1W1F A;  1B34 B;  2DVE A;  4OVA A;  1WXU A;  3MP6 A;  2L5Q A;  2NWM A;  2R5M A;  3C94 A;  1TG0 A;  3JCM h;  2D8H A;  1ZSG A;  3MPU B;  3BY7 A;  2P4R A;  1I07 A;  4KH1 B;  2KK4 A;  3EG3 A;  2DKG A;  4F16 A;  2J7I A;  3OS0 A;  2M0Y A;  1Q7Y C;  3LWH A;  4ESR A;  1PWT A;  3CCL Q;  3RMS A;  1QWE A;  5HY6 A;  4K11 A;  2QQS A;  2KT8 A;  2JTE A;  3E9G A;  4LDU A;  1BU1 A;  1YHQ Q;  1VIF A;  4J9D A;  1KSW A;  1VQK Q;  1WQW A;  3BFM A;  3JCM X;  2OTJ A; 
#chains in the Genus database with same CATH homology
 2ZPE B;  2F5T X;  1MGQ A;  3L2Z A;  3G6E A;  3CC7 T;  1M8V A;  2DZ9 A;  4YTL A;  5GAM g;  2PUO B;  2FHD A;  4OB3 B;  4QVC A;  1K8A U;  1DJ7 B;  5C6S A;  5GMK l;  3M59 A;  2LQK A;  2CYZ B;  2FYK A;  2GF7 A;  2DD4 A;  2ZPB B;  4M75 C;  4C8Q E;  4M78 A;  3MEA A;  4RMO A;  3QYH B;  2EJG A;  5DLQ E;  3OYM A;  1VQ8 A;  5D6Y A;  4E47 A;  5J26 A;  3M56 A;  4M78 B;  4XU2 A;  3VYH B;  4BE0 A;  2MWP A;  4C5G A;  2QA4 A;  2LT1 A;  2K5I A;  2XU8 A;  3OYK A;  1VQ9 A;  3HRT A;  4M77 A;  3RES A;  3MEW A;  2DTO A;  3A5Z B;  3E9F A;  1KG1 A;  4QQD A;  3C4S A;  4N4H A;  2LQ8 A;  5CKF A;  4C0D B;  3OS2 A;  4E7I A;  1QP2 A;  4M78 F;  3TEE A;  1VIE A;  4M77 B;  3JCM J;  1Q86 U;  4QW2 A;  2YLC A;  1H64 1;  3O8V A;  2RJD A;  1N9S A;  4XTY A;  5CKH A;  4WF2 A;  4C92 G;  3RKY A;  1IZ6 A;  1WNL A;  5GMK h;  3P8D A;  5LJ3 e;  4J7I A;  3LWI A;  1VQ5 T;  3QSU A;  1H3Z A;  2A3L A;  1JRI A;  3M4G A;  5LL6 S;  5KCO A;  3HRS A;  4M77 F;  1VQ4 T;  1Y7X A;  2QQA A;  2XHC A;  4BE2 A;  1D3B A;  3A8H B;  5CQY A;  1VQM A;  2VC8 A;  3CCL T;  3JB9 D;  3FRN A;  3CPW A;  1D3B B;  3SFM A;  5GAM d;  2DXT A;  4BB7 A;  4XK8 E;  3CCQ A;  4ZTF A;  3PIP A;  4JRQ A;  2KDS A;  2PUK B;  5LJ3 f;  4X9C A;  1YHQ T;  3JCM e;  3CCR A;  3NTK A;  3X24 B;  1VQK T;  4N4G A;  2PVD B;  1ZBX A;  5FU7 C;  2V8J A;  3A8L B;  1LNX A;  3OW2 S;  1QW1 A;  4C92 C;  4PLL A;  1YIT A;  2CGH A;  2D0Q B;  4N0A C;  2L89 A;  3SWN C;  4DOW A;  2RA2 A;  5GMK j;  4HT8 A;  3DKM A;  2CZ7 B;  1YJ9 A;  2MI6 A;  3CD6 A;  5I2S A;  2DEQ A;  3NTH A;  2WAC A;  2RI5 A;  1Q81 C;  1KD1 C;  5FU6 C;  3INZ A;  1WJQ A;  4JLI A;  4A4F A;  3H6Z A;  1I8F A;  1RL2 A;  2E5Q A;  3J80 E;  1UGR B;  3M55 A;  2FB7 A;  2QEX T;  1K9M U;  2Y4X A;  2EKO A;  2DTI A;  3VU3 C;  3FC3 A;  4M7A A;  2EIF A;  4OB1 B;  2HBP A;  2K57 A;  1QVG S;  3MP1 A;  4BI4 A;  4XU1 A;  1KHI A;  3DLM A;  1JBM A;  4M7A B;  1QVP A;  1K73 U;  3QDR B;  2MWO A;  4A4G A;  4JDS A;  1BI2 A;  3UPU A;  4F7U E;  1QP3 A;  4C0G A;  5GAO m;  2DD5 A;  3QYG B;  1B34 A;  5FLX E;  2OTL A;  5M9O A;  4ZGD B;  3PTA A;  3L2V A;  1O9S A;  4BD3 A;  2DK3 A;  2CZ1 B;  5A2Q E;  2DXB A;  2XKO C;  5GMK m;  4FSX A;  3JB9 H;  3JCM P;  5CKE A;  3TRE A;  3QJ6 A;  3QZ9 B;  1YIJ A;  5GAN 3;  2RI2 A;  3CPW S;  3S3M A;  1M90 U;  4M7D D;  5LJ5 g;  4TVR A;  2OAU A;  3CCS T;  4BUG A;  1LJO A;  2QXF A;  3LX7 A;  2QQB A;  4BE1 A;  3CMA T;  5DY9 A;  2VGN A;  3QXE B;  4M78 G;  2WSC E;  2JOY A;  5IN1 A;  2DXU A;  5DLO A;  3V8K A;  3KBG A;  2DTH A;  2DIG A;  3H8Z A;  3GF5 A;  3RKW A;  5LJ3 j;  1G3Y A;  3ER0 A;  4Y28 E;  3CCM A;  2EJ9 A;  3ME9 A;  2LCL A;  4QQG A;  4XTV A;  5GMK e;  5GAM h;  3G4S A;  1YJW T;  2XD0 A;  2ZGW A;  2F69 A;  3NFC A;  4M77 G;  1S72 A;  5IT9 E;  2K4Y A;  3OMC A;  4R55 A;  4XAX B;  3HKS A;  3CCV A;  4Y91 A;  3X25 B;  2OTJ T;  1M1G A;  3CEY A;  2RK2 A;  5D6X A;  4NL3 A;  4ELY C;  2EFI A;  4EMG A;  2M9U A;  3G6E T;  3MEV A;  3RUX A;  3P8H A;  3V7R A;  2ZPG B;  1WJR A;  1VQP A;  4PNO A;  2E12 A;  4A4E A;  4BI3 A;  3P8B B;  2HQX A;  4XTZ A;  5C0M A;  1NJI U;  5HK3 A;  5L8R E;  4Q5W A;  5GAN 5;  4KUD K;  4M78 C;  3JCM Q;  1XOV A;  1Q82 C;  3HSB A;  3M53 A;  1KC8 U;  4PJO A;  4MZM A;  2RD1 A;  3I56 A;  2XDB A;  4M75 D;  1VQ8 T;  1G5V A;  4BAC A;  2QTX A;  3OMG A;  4LDV A;  3MO8 A;  4ZGJ B;  3SD4 A;  5LJ5 d;  1BIA A;  2XK0 A;  2JTF A;  4C0D C;  1M1K C;  2QDY B;  4PJO B;  4QQ6 A;  2QA4 T;  4M77 C;  1VQ9 T;  5GAM j;  2DO3 A;  3OYE A;  2XID A;  4LDW A;  2O4X A;  2P0P A;  3HPW A;  4M7D E;  1YI2 T;  4JRP A;  5HK0 A;  4PJO F;  2ZZD A;  2O4X B;  3CBM A;  2K5F A;  5A0D A;  3L2W A;  4LDY A;  5CQX A;  1G3W A;  4XTX A;  2RHI A;  3ZBD A;  4C8Q A;  4ZTJ A;  1K9M C;  2RHZ A;  3OBW A;  3M57 A;  3CME A;  1WQ7 A;  1QVG A;  4BY6 B;  3VUB A;  2G3R A;  4C8Q B;  4BI8 B;  5GAN 2;  5CKD A;  3RER A;  3JCM c;  2LT4 A;  4OGC A;  4ELZ C;  1VQM T;  3GOX A;  4ME7 A;  5CCA A;  4HCC A;  4ZN1 A;  3MP8 A;  2ZPH B;  2RH2 A;  4ZGE B;  4M7D F;  4E7L A;  3T9N A;  1UGS B;  4C8Q F;  3CCQ T;  4LD6 A;  4XU3 A;  2VUB A;  1GXI E;  1OI1 A;  3BDU A;  3CCR T;  2JTM A;  4GY5 A;  4M7A G;  3G71 A;  5CAI A;  2I2L A;  2VV5 A;  4E7J A;  2B8A A;  3HRU A;  2QQ9 A;  2RJE A;  3HFO A;  2FVU A;  3E19 A;  4HA8 A;  3GPL A;  3CCE A;  1OYX A;  2E6Z A;  1YIT T;  1M4Z A;  1V29 B;  3OS1 A;  3Q1J A;  2L3R A;  2MAM A;  5D6W A;  1KQS A;  3CC4 A;  1BI0 A;  4M75 E;  4C92 D;  4DA4 A;  3L2U A;  4HKE A;  1YJ9 T;  3PNW C;  3CD6 T;  1VQN A;  5I2M A;  3HL8 A;  3PIO A;  4O6J A;  3OYI A;  4IUT A;  2Y90 A;  4A53 A;  4BDZ A;  1QVF A;  3JB9 J;  3EFS A;  5GAN 8;  3JCM d;  1XTD A;  4JUV A;  4OB0 B;  2VXF A;  2P0Q A;  2QQR A;  3LYI A;  2CKK A;  1N8R U;  3OYC A;  3OYA A;  4MDX A;  3GNG A;  4M7A C;  2EQM A;  5GAO q;  2DZC A;  2VGM A;  1Q7Y U;  5GAN g;  3QJY A;  1VQL A;  5GAM e;  3HP9 A;  2Y4Y A;  2HQE A;  1M5Q 1;  4KUL A;  2YLB A;  2BUD A;  5FRN A;  3JB9 I;  5KH6 A;  1PSE A;  2ZPI B;  4ZN3 A;  4HCB A;  3MHX A;  4JS4 A;  4RKU E;  4C0Z A;  2XI9 A;  3CCU A;  4MZT A;  4JS5 A;  2RO0 A;  2KVQ G;  1OZ3 A;  2KY9 A;  3MEU A;  4IUQ A;  5LJ5 h;  2V8I A;  4XU0 A;  2VXE A;  1NJI C;  3OYB A;  3GP8 A;  3CCJ A;  2QI2 A;  1BI1 A;  3X28 B;  5GAM f;  1UB4 A;  2X4X A;  1W4S A;  3FJP A;  1IRE B;  2LTO A;  3MCA B;  1YIJ T;  4R56 A;  3LGL A;  4D6W A;  3HFN A;  5GAN 4;  1BI3 A;  4J8O A;  2DAQ A;  1K8A C;  1BKB A;  3QUI A;  4C92 E;  2EYQ A;  4F7U A;  4J6W A;  3OA6 A;  1HK9 A;  2EWN A;  2GCX A;  2RHX A;  1SSF A;  4PJO G;  2MF2 A;  3QII A;  3QG1 A;  1X75 C;  2A7Y A;  4F7U B;  1G3S A;  2X35 A;  1BYM A;  5GAN d;  1VQ6 A;  4C0F A;  2R57 A;  3CCM T;  1KQS S;  3A8M B;  3G4S T;  5LJ5 j;  4BDY A;  3OYY A;  3QKJ A;  1U1T A;  3URG A;  1S72 T;  2E65 A;  1VQ7 A;  4J6X A;  3SDZ A;  5CIU A;  4F7U F;  2IG0 A;  3CCV T;  3FDR A;  3EFR A;  2PU9 B;  3G7Z A;  2WSF E;  2LX9 A;  2P0K A;  4FT2 A;  3WVD B;  4EMH A;  5KE3 A;  1Q86 C;  3JB9 F;  1U8R A;  5I21 A;  3I55 A;  4B9X A;  1MHN A;  2XIC A;  2X4J A;  3N5B B;  4UC4 A;  4C92 F;  3L2Q A;  1QVF S;  4IUR A;  4C8Q G;  4OGE A;  5A0L A;  3TCJ A;  1JB0 E;  2JVV A;  1VQP T;  1WGS A;  3LH0 A;  4C5H A;  3LGF A;  4PJO C;  2O01 E;  3A8G B;  1M1F A;  4N4I A;  1VUB A;  1Y96 A;  3OYF A;  3I56 T;  4M78 D;  4IUP A;  2YRV A;  2EQJ A;  2EQU A;  3CC2 A;  1Y96 B;  4XTU A;  2VYT A;  1ZHI A;  3QZ5 B;  4FIB A;  4FT4 A;  4RG8 A;  1KQ2 A;  4HCZ A;  3OYL A;  3QBY A;  4L59 A;  2RI3 A;  1KHC A;  3LLR A;  1I4K 1;  3OSV A;  2PQW A;  3JCM V;  1VQO A;  2K3Y A;  3UWN A;  3BW1 A;  3F70 A;  1N9R A;  1P92 A;  2X4Y A;  4M77 D;  4VUB A;  4X34 A;  5GAN f;  2JNG A;  3OB9 A;  3PT9 A;  3M58 A;  4BY6 C;  2M0O A;  3ASK A;  4M7D C;  1UEB A;  4A4K A;  4C8Q C;  3OBY A;  1HXD A;  1N8R C;  3M5A A;  3CME T;  3QO3 A;  1X6O A;  3DLL A;  5GAO r;  2LCC A;  3CBP A;  4E7H A;  1YJN A;  1Q81 U;  3V7S A;  5GAN 6;  3L2R A;  1KD1 U;  4NOY A;  3GLX A;  4KUI A;  3RKX A;  2PVO B;  3LW5 E;  2PVG B;  5GAO n;  4ATO A;  2HD0 A;  1EIF A;  4MZP A;  4L6V 5;  4M7D A;  4PKC C;  2E10 A;  2H3J A;  3JCM g;  2LRQ A;  2EJF A;  4E7K A;  5FRO A;  3G71 T;  3R6O A;  1R8O B;  5LJ5 e;  4IKF A;  4RG2 A;  4M7D B;  1N6A A;  2R58 A;  1PSF A;  4X9D A;  2KMT A;  3CCE T;  3MET A;  5CKB A;  3ZFJ A;  1K73 C;  4DQ2 A;  2XDD A;  2RB6 A;  3CC4 T;  4V2S A;  2M16 A;  2CZ6 B;  3KUF A;  3VV0 A;  4M78 E;  2KSS A;  4NL2 A;  2XDP A;  4QVZ A;  5GAN h;  1VQN T;  3C12 A;  2HNI A;  2P4T A;  3RIR A;  5LJ5 f;  1FX7 A;  2DPP B;  5LJ3 d;  4HT9 A;  2GFU A;  2LNV A;  2RJF A;  4M77 E;  4L5G A;  1WJS A;  4IUU A;  2JZ2 A;  3FB9 A;  5GAN 7;  4EMK C;  3PMI A;  3S3O A;  4FM4 B;  3OS5 A;  3CC7 A;  2EQK A;  3X20 B;  5CK9 A;  1M90 C;  5GMK i;  1VQL T;  2DJZ A;  4MDW A;  2YHT A;  4M7A D;  1YI2 A;  3OYD A;  3J81 E;  4M75 A;  4F7U G;  1AHJ B;  3BDL A;  3CBO A;  1XNI A;  4JRI A;  3VUZ A;  3JB9 G;  1X01 A;  3PFS A;  3CCU T;  4M75 B;  2R5A A;  2ZCF B;  2L8D A;  2E64 A;  2K5L A;  3J7A F;  4EMK A;  5DM7 R;  4XTW A;  5GAN j;  4PL6 A;  2D6F A;  3CCJ T;  5CO7 A;  2CZ0 B;  4MML A;  4OMF B;  3UDC A;  2RHY A;  3CXC A;  4M75 F;  4A4H A;  4EMK B;  2WSE E;  5J39 A;  3QHS A;  2RM4 A;  1FWZ A;  3NTI A;  3OSS C;  3FEO A;  2JN0 A;  4NS5 A;  3C95 A;  1VQ5 A;  3OYJ A;  3OQ5 A;  3OYN A;  1YCY A;  3OY9 A;  2OTL T;  2FL7 A;  1VQ4 A;  1G3T A;  5HKC A;  1Q82 U;  2HAX A;  2XG8 D;  4J6Y A;  4A54 A;  1KC8 C;  2KAF A;  2RJC A;  4FU6 A;  4CI0 C;  2GQV A;  4JJN K;  1NPR A;  1KQ1 A;  2RHU A;  4P5N A;  3CCL A;  2ZPF B;  1M1K U;  1JJ2 A;  4CRI A;  4PLI A;  3PGG A;  4J7F A;  1UGP B;  1VQ6 T;  4RCB A;  3SB2 A;  3E1S A;  2X4W A;  4II1 A;  1XQH A;  1YHQ A;  3TU4 K;  4B9W A;  4FL6 A;  5KE2 A;  1VQ7 T;  1Y71 A;  3JCM f;  5IAY A;  1VQK A;  4EPC A;  1Y07 A;  4M7A E;  3I55 T;  5FRM A;  5AYF A;  5KCH A;  4C92 A;  3S3N A;  1BIB A;  4XQ3 A;  3HHT B;  4N0A A;  3L42 A;  3JCM b;  4MMK A;  3PMT A;  3SWN A;  2D9T A;  5FU7 B;  3KXT A;  4C5E A;  4C92 B;  5GAO p;  3V8L A;  1W2B A;  1TH7 A;  1WPY A;  3SWN B;  2E6N A;  1I5L A;  3JRZ A;  3X26 B;  4PJO D;  2K2V A;  2CS7 A;  5LJ3 h;  2DXC A;  3CC2 T;  2RK1 A;  2QEX A;  4M7D G;  4Z02 A;  5FU6 B;  4M7A F;  1VQO T;  2DIQ A;  2F5K A;  2GFA A;  4O5V A;  3QPH A;  1UGQ B;  4OB2 B;  4RCC A;  5GAN e;  1LOJ A;  1B34 B;  1U1S A;  2E70 A;  2DVE A;  4OVA A;  4LDX A;  3AHU A;  2M1H A;  1N27 A;  5CVI A;  3L1A A;  3S6W A;  3MP6 A;  5EG2 A;  3A8O B;  4C5I A;  2L5Q A;  3CXC S;  2E1H A;  2R5M A;  3JCM W;  2EAY A;  3C94 A;  3EAE A;  3GNF B;  4C8Q D;  3OYG A;  3JCM h;  3JAM E;  4JRK A;  1FXX A;  3DB4 A;  3JSC A;  3BY7 A;  3WVE B;  1YJN T;  2MMP A;  1YBY A;  2NLU A;  2KK4 A;  1OZ2 A;  3RMQ A;  2KQW A;  3VJP A;  1RI0 A;  4LD9 K;  3UT1 A;  4GLK A;  3WXM B;  2DKG A;  2JUF A;  3M54 A;  5LJ3 g;  3OS0 A;  5J3B A;  3ZEH A;  1JJ2 S;  2E41 A;  3CCS A;  1NPP A;  4J83 A;  1NE8 A;  3FLG A;  1Q7Y C;  4OF1 A;  4QVD A;  2IVW A;  3CMA A;  1M9S A;  4EDU A;  3OYH A;  3LWH A;  2K3X A;  4OP0 A;  3VKI A;  4M75 G;  4KBM B;  5A0G A;  4DOV A;  5CR2 A;  3RMS A;  5HY6 A;  1I81 A;  2V8K A;  1ZQ1 A;  2QQS A;  2C06 A;  1NZ9 A;  2LDM A;  3V7C A;  3VYG A;  3GIB A;  1O75 A;  4PJO E;  2AHJ B;  3CPF A;  3E9G A;  3M4Y A;  4J5Y A;  4LDU A;  1YJW A;  4KT0 E;  1VIF A;  3M9Q A;  3OW2 A;  3DB3 A;  4JLG A;  2BKD N;  5GAO l;  1WQW A;  2LVM A;  3BFM A;  3JCM X;  3FIF A;  1W2B S;  2OTJ A;  3V8J A;  2LC4 A;  4IUV A;  2BIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...