3PMTA

Crystal structure of the tudor domain of human tudor domain-containing protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
KMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor domain-containing protein 3
publication title Crystal Structure of TDRD3 and Methyl-Arginine Binding Characterization of TDRD3, SMN and SPF30.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pmtA00
3MEWA 5J26A 3OYNA 4ZTFA 3OYHA 3FC3A 3MP6A 3L2VA 3GOXA 5D6YA 2QQSA 5KCOA 3L2RA 2LRQA 2RHXA 2XK0A 2RHUA 2MWPA 4PLIA 2R57A 2K3XA 3FEOA 3LLRA 3O8VA 3S6WA 3CEYA 4QQDA 3L2WA 4BE1A 1SSFA 3NTKA 2X4XA 3OYAA 3L42A 2LTOA 3FDRA 3H6ZA 3OB9A 4LD6A 3MEVA 4QW2A 3OYFA 2E5QA 2GFAA 3OQ5A 4FU6A 4E7JA 2RJCA 3ZEHA 2FHDA 4A4GA 3OA6A 3DB4A 3PFSA 4BD3A 3F70A 5IN1A 3NTIA 2RI2A 3SD4A 2R5MA 4HCZA 4C5HA 4BDZA 2EQMA 4E7IA 4ZTJA 4CRIA 1WJRA 2DAQA 2L8DA 4N4IA 5J39A 2WACA 3META 4C5GA 1XNIA 1MHNA 4FL6A 3UWNA 5KH6A 2HQEA 3OYDA 5FRNA 4UC4A 3OYMA 2G3RA 2RJFA 2P0KA 3DLMA 5IAYA 3L2QA 2QQRA 3S3OA 3S3NA 4PL6A 5C0MA 3P8DA 3H8ZA 3NTHA 4N4HA 1OYXA 3OYLA 5KE3A 1OI1A 1RI0A 2EQJA 2IG0A 2MWOA 3OYIA 3E9GA 3MEUA 1OZ3A 5D6WA 3Q1JA 1WJQA 3OYGA 4OVAA 2BKDN 2PQWA 3PNWC 4E7HA 3OYCA 2RI3A 3EAEA 2RHYA 4C5IA 5C6SA 2RHZA 4BACA 2R58A 4RG2A 2F5KA 3MEAA 4NS5A 3OS1A 4PLLA 4E7LA 1WJSA 4IUQA 4QQGA 4IUVA 4BDYA 2L3RA 2EQUA 2LCCA 2RO0A 3OMGA 3QJ6A 4QQ6A 3UT1A 2CKKA 2X4YA 3LYIA 4Q5WA 2O4XA 4Z02A 2DIQA 4BE0A 2RI5A 5KE2A 1N27A 2K3YA 3MP8A 5KCHA 3MO8A 3M9QA 3FLGA 2LVMA 5FRMA 4IUUA 2XDPA 2GF7A 3L2UA 2E6NA 2JTFA 4II1A 4GY5A 2O4XB 4X34A 3LGFA 3KUFA 4A4EA 3OYKA 3OYEA 3LGLA 2B8AA 3OYJA 5CIUA 2VYTA 4IUPA 3QKJA 2X4WA 3DB3A 4L59A 4C5EA 2RJEA 2YRVA 3QBYA 3OMCA 2L89A 4N4GA 3P8HA 2RJDA 4IKFA 1OZ2A 3E9FA 4BE2A 3C4SA 4B9XA 4A4FA 2EQKA 4IURA 3ASKA 5FROA 3LH0A 2D9TA 2GFUA 2X35A 3OY9A 1G5VA 2R5AA 2JZ2A 3OYBA 2NLUA 2RHIA 4IUTA 2EKOA 2M16A 1H3ZA 3LX7A 2HQXA 2DIGA 5M9OA 3BDLA 3ME9A 1WGSA 4B9WA 2M1HA 3PMTA 3PMIA 3MP1A 4A4HA 2BIVA 2M0OA 2EFIA 2BUDA 4EDUA 3S3MA 5D6XA 3OS2A 4E7KA 1KHCA 3OS0A 4QVZA 3QIIA 2LDMA
chains in the Genus database with same CATH superfamily
3EH2A 1V29B 1WXTA 3ZFJA 3VS7A 2J05A 4Y91A 3V7CA 1LPLA 4Y92A 1PSFA 2DXTA 2OAWA 4LUDA 2HCKA 2MWPA 2OTLQ 1M90C 2QDLA 2OTJA 3FDRA 4QW2A 2F2XA 5GAOn 1W2BS 1Y0MA 1QCFA 4IIOA 1Q7YU 5FU6B 1UGRB 2OTLT 3CD6A 2KE9A 3T9NA 3GF5A 4FCYA 3BY7A 4HCBA 4HCKA 2V8KA 3G7ZA 1VA7A 1AOJA 2PVOB 3TU4K 2G3RA 1RAGB 2E3HA 2ZPEB 1KD1U 2QTVA 1W2BA 3SEMA 1K9MC 1UEBA 1VQ4A 5KE3A 3INZA 3CCSQ 2A0FB 4PJMA 1Y07A 3RMSA 4PJNA 1M1KR 4HVWA 5LJ3h 4PJLA 1VYUA 1H92A 1UE9A 2R58A 1W4SA 2OX7A 3EGUA 2LCCA 1K8AR 1QMCA 1K0SA 2Z0WA 4MMLA 1YCYA 2CZ0B 4A4EA 2VYTA 1M2VA 2FO0A 5LJ3f 4M7AF 4LDVA 4PJOB 3RIRA 4ZNXA 2KEAA 2L0AA 2CP0A 3CPWS 1HK9A 2VXFA 2W0ZA 4Z88A 3VYGA 4J83A 2OTLA 3ZBDA 1PG5B 3X26B 4M7DF 5GAOl 3QYHB 5GAN2 2E4HA 1I8FA 1KHCA 1FMKA 4FYVB 2ROLA 1VQ8T 2DBKA 3OYNA 2MCNA 3G4SQ 2KSSA 2K3XA 2CZ1B 5HY6A 2GBQA 2DEUA 2HKNA 3OB9A 3MHXA 1K9AA 2IVWA 4LDUA 1SF9A 5GANh 2J6FA 3PE0A 3HPWA 2W10A 4OMPA 1UFFA 1H8KA 2LQWA 1KQSS 4ZTJA 3PTAA 3CCSA 2F2VA 2XICA 1Z9QA 2Y4XA 3HTRA 3PIPA 1IB8A 1Q82C 5IAYA 3EFOA 5IXFA 1M3BA 4M7AG 4LN2A 5LJ5d 2D0NA 1W6XA 3G71T 2EJ9A 3LH5A 1WJQA 4A53A 1ZHIA 4OMFB 3PNWC 4KUDK 2H3JA 4WF2A 4RG2A 4M7DG 2EGAA 2NUZA 3SFMA 2JT4A 3JSCA 3UT1A 1ZSZA 1BI3A 2X4YA 5A0GA 1YJ9T 1BIBA 3X24B 2DF6A 3OYYA 1OX8A 4J9HA 4IUUA 2XDPA 4DBHA 2JTFA 4M75F 3M58A 2L3PA 5GAMe 1BYMA 4X34A 4JS4A 1QP2A 3QYGB 3JCMW 1SRMA 1VYVA 4M77E 3VYHB 5L23A 2X4WA 4FSSA 4L59A 1F1BB 1JXOA 2DETA 4N4GA 4IKFA 2LMJA 2CP2A 1S72Q 5FLXE 1OEBA 2HSEB 2O9SA 1PSEA 1ZSZC 1G5VA 2H3EB 1QKWA 2K9GA 3G4SA 4C0FA 2FYKA 3PMIA 1RLPC 2MMPA 2EFIA 2O01E 2DTIA 1SRLA 2XD0A 1ARKA 4M7AA 2RHXA 2SRCA 4PLIA 3FEOA 1RACB 1GXIE 1WYXA 1B7TA 4LE9A 1SKUB 4FU6A 1ZQ1A 1QWFA 1RUWA 2DPPB 1UJYA 3PFSA 4M7DA 3BFMA 4AG1C 5IHKA 2K57A 1EIFA 4N4IA 3RKXA 3I55T 4PNOA 4M75G 4M7AC 1G3TA 2CP3A 3OYDA 4AFUC 2RQRA 3M4GA 5GAOp 4PFZA 4LXCA 2EQIA 2WSFE 2O31A 4J9CA 5LJ5g 2DZCA 4CC4B 2FZGB 1UTIA 5KYXB 4M7DC 3JCMe 1FMVA 4J6XA 1D09B 5LL6S 4OB0B 3M0UA 1BCMA 3VJPA 3KXTA 1UG1A 3EGDA 2F69A 5GAOm 1Q81C 4ELZC 2EWNA 4X1VA 4JS5A 1AWJA 2CKKA 4Q5WA 2ZAEA 2VC8A 4XU3A 3CBOA 2MIOA 1N8RU 5FRMA 2GF7A 3L2UA 1ZSZB 3EFRA 3UF4A 3PVLA 3LGFA 3A1PA 4FYXB 2X9HA 1WX6A 2B8AA 1XTDA 3L2ZA 4MMKA 4AFZC 1KQ1A 4KGVB 2RJEA 3MKDA 4M75D 2C0TA 3NMZC 3M5AA 1YWOA 4IURA 2JUFA 2D9TA 2ZPBB 1WDXA 3CCMQ 1B07A 1TU0B 1FWZA 3VS2A 1NE8A 2E41A 4J9IA 2MAMA 2BUDA 3I55A 5A0LA 1LCKA 4M75A 2DERA 3OS5A 3MPUB 4R56A 2RNAA 3GOXA 2DVEA 1Y57A 4K11A 3NTKA 1WHKA 2AZSA 5KYUA 1HJDA 4RTZA 3H6ZA 2DXUA 1WZOA 1TTHB 5IT9E 2DK3A 1W2BP 3OQ5A 4J7IA 1BIAA 4KT0E 4M75C 2NYSA 5IN1A 2DRKA 3VS6A 1LNXA 2EKHA 2JTMA 3N5BB 4FIBA 2DVJA 2DAQA 5J39A 1XNIA 2PNIA 4N0AA 4ZN3A 2HEQA 2LC4A 2DL5A 1IRXA 3S3NA 1B3QA 1ZLMA 4R0KA 5CKFA 4RTYA 1YJWQ 2OAUA 3NHNA 3E9GA 3OBYA 4E7HA 2DYBA 3L1AA 2RN8A 4LNPA 3M4YA 2JM9A 4N0AC 3QJ6A 1WHHA 1LJOA 2KQWA 4OMOA 5CKBA 4RTUA 3THKA 4Z02A 3I35A 3CC4Q 2NWMA 1QVGA 3MP8A 5GANg 3HSBA 3CCMA 1BI1A 4GY5A 3VRYA 1Q7YR 1NYFA 3LGLA 1VQ6Q 2RMOA 2SEMA 2YT6A 3C4SA 4A4FA 1VIEA 8ATCB 2IIMA 2OI3A 2LJ1A 2X35A 4XTZA 1KD1R 1B34A 2QI2A 5GMKj 2ZPIB 4KGXB 3A8LB 3CPFA 2OJ2A 4DQ2A 3OW2S 4FW2A 4EDUA 1VQ9Q 4BI8B 4ZTFA 6AT1B 4D8DA 2BE7D 1ZA1B 3NFCA 3OYHA 2AK5A 5KCOA 3FIFA 2LCLA 3JB9I 2YUPA 1CKBA 1YI2Q 3URGA 1VQOQ 2RK1A 5CK9A 4O5VA 4RG8A 2HZYA 3CXCS 2RJCA 4J8OA 5KYUB 2QEXQ 3I9QA 1IXDA 2CZ7B 2RI2A 3GNFB 1YJWA 2R5MA 5LJ3j 4CRIA 4FM4B 4JZ4A 4J6YA 3H41A 1MMGA 3CCUT 5KH6A 2RJFA 2K2MA 3VS1A 1RAHB 2QYZA 3EG0A 2HL3A 2E12A 4HVVA 3UA7A 2KGTA 2MPXC 4PL6A 2JM8A 1YP5A 3CC2Q 5GAMd 1YFNA 4HT8A 3NTHA 4EMHA 3CC4A 1QLYA 1BBZA 1X6BA 2LX7A 4BI3A 3Q1JA 2D8JA 4JDSA 2X3WD 3WXMB 1AWWA 2BZ8A 1ZA2B 1TS9A 2PU9B 3M0TA 5C6SA 3CC2T 2VGNA 4ZGDB 2CUDA 4J9EA 1VQ6A 4QQGA 2H8HA 2EVRA 2J7IA 3OMGA 1UGPB 2DLPA 4KGZB 3V7SA 4KRTA 1M1FA 4BE0A 4CI0C 2LVMA 5KYWA 3TEEA 1ZUYA 1PCXA 4HKEA 2DTHA 3CCJQ 1BCOA 2OTJT 1KK7A 4JJCA 1R0CB 3QZ9B 2JMCA 3OMCA 3CD6T 4RUGA 3D7SB 1T0HA 4RTTA 3CCJT 4MDXA 2EKOA 4QT7A 1K0XA 5GANj 1NEBA 3PMTA 2CP7A 1YI2A 1TWBA 2M0OA 1B34B 1VQOA 3CCQQ 1M90U 1QQJA 1PRMC 2DFUA 1VQ4T 4QVZA 2HBPA 3RNJA 4M78B 1PD0A 1SPKA 4A4KA 4C0DC 2VV5A 3I56Q 5D6YA 4ESRA 2QQSA 3CCQT 1VQMQ 1EX4A 4LDWA 3OYAA 4NL2A 3M54A 2WSEE 3REAB 1ACMB 4ZGEB 1QWEA 3LW5E 1D0XA 3JCMd 2HBWA 3CC2A 5LJ5h 5GAN7 3H0IA 2LT1A 1U06A 5GAN8 4ZN1A 2L8DA 1K9MU 1TSFA 5I2SA 2HD0A 1IHVA 1VQNT 1OV3A 2P84A 4O6JA 4KBMB 1OPLA 1I4K1 2P0KA 2YLCA 3PIOA 2EAYA 2F5TX 1YWPA 1HD3A 1YHQQ 1G8XA 1OULA 1SSHA 5IHNA 1A0NB 4X9DA 2PVGB 1K73C 5GMKh 2E5KA 1ZUKA 2EW3A 1VYTA 5GAMg 2IG0A 5CKDA 5LJ5f 2LNVA 4F7UG 5KYNA 2Y4YA 3CCJA 3EAEA 1AT1B 3KBGA 4JLIA 1JJ2S 3QWYA 3C94A 2V1QA 3M53A 2LQNA 3VS4A 1N27A 2ABLA 1RAFB 4JJDA 2DM1A 3R6NA 2KBTA 3RKWA 3SWNA 3CMAQ 2LZ6B 2M51A 3U23A 3TQ7P 1AHJB 1JJ2A 5KYWB 1JU5C 2A3LA 3VS0A 5CVIA 3CCQA 4RTWA 1OZ2A 4EIKA 2QGFB 2AKLA 3I56A 3UDCA 3CCST 4M77F 4OGEA 1PD1A 1V1CA 1WPYA 3SWNC 3JB9J 3I5RA 1VQMA 2RPNA 2RQWA 4NOYA 2EYYA 4F7UE 5DLOA 3TVTA 1VQNA 3OS0A 1QVPA 4F14A 2VB6A 1UHFA 2PUKB 2BZXA 2ATCB 1KC8C 1YBYA 4MDWA 3LLRA 3X28B 1M9SA 4PFOA 1Q95G 4D6WA 1KIKA 2KT8A 1D0YA 1N8RR 2E5QA 2PUOB 9ATCB 1N9SA 2ENMA 3A5ZB 4CC7A 4E7JA 4XTXA 3ZEHA 1YHQA 2DBMA 4BD3A 4P5NA 3RMQA 5FU7C 1Q82U 2DA9A 4C5HA 1N5ZA 2RB6A 4MZPA 4DEYA 3CPWA 1GBRA 5FRNA 3BW1A 5CQXA 3S3OA 1RLQC 3RR6A 2DILA 2DL3A 2MF2A 1QVGP 1ZBJA 1TUGB 5GAN3 1RI0A 3E2UA 1OZ3A 3QWXX 3G4ST 4M77G 1G3WA 2KK4A 3CMAA 1TUCA 1J3TA 2YWWA 2HNIA 3HRTA 4XU1A 2COYA 1ABQA 2CP6A 1QKXA 2ROTA 2L5QA 4PFPA 2GTJA 5KCHA 1IZ6A 3MO8A 5DLQE 2ED1A 2E6NA 2FVUA 3RDVA 5GANf 2RQVA 4C8QF 1KQSA 5CIUA 1WLPB 1VQ7Q 2YRVA 2CSQA 1Q86C 1YNZA 1G83A 1K4US 3OY9A 1OU9A 3VRZA 2O88A 1GRIA 1UHCA 3TSZA 3ME9A 1D1AA 2FPDA 3QO3A 2VGMA 4XU2A 5GAN4 2BIVA 1GFCA 3CCRQ 4M77D 2KAFA 5AYFA 3MJXA 5I11A 1QVFS 3J81E 4ELYC 1VQPQ 2ZPHB 1GCPA 3G1JA 5FU7B 1M2VB 1AWXA 4BE1A 2QASA 2V26A 2HKQB 4M7AD 3OYFA 1VQPT 4M77A 1S1NA 1QVFA 1WI7A 1S72T 3DB4A 1PKSA 2KXCA 3SD4A 4HCZA 3QSUA 4EPCA 4J9DA 4M7DD 1OPKA 4C8QG 3EH1A 4OGCA 2EYXA 3L2QA 2QQRA 4BB7A 2QAZA 2FPFA 3LWIA 3UA6A 3QUIA 1T0JA 4M77C 3H8ZA 3CCVQ 1Q81U 1OI1A 1N9RA 3QJYA 4OVAA 2PQWA 1YIJQ 2B86A 1EFNA 1VQ7A 2DX1A 4RTVA 1D3BA 2K3YA 1UGQB 3FRNA 2M02A 3VUBA 2VUBA 3A8HB 1NPPA 2E1HA 4MZTA 2A08A 2K2VA 1Y71A 3QDRB 3EFOB 3HL8A 4DEXA 1VQLQ 1OU8A 2DL8A 4VUBA 3BE3A 1X75C 3JB9G 1TUDA 3CCRA 1O9SA 2CS7A 3JV3A 4C8QE 1M3AA 2JTEA 1VQPA 3OYBA 2RHIA 1H3ZA 1Z9ZA 3LX7A 2HQXA 2JOYA 1S72A 1NYGA 3FJPA 4EMGA 1VIFA 2DRMA 4A4HA 3J80E 3S3MA 4C0ZA 1KQ2A 2D8HA 2IPOB 2MYSA 2VASA 1WXUA 1C0MA 1H3HA 1QCOA 3JAME 2J6OA 2CP5A 3I5SA 1JXMA 2YLBA 2X4XA 1JEGA 1M1KC 4A54A 3CBPA 2QK0A 5CAIA 3RERA 3VKIA 2K5LA 1U8RA 1K8AC 3F70A 4QVDA 3CCVA 3FB9A 3CCMT 5GAMh 2EQMA 4OF1A 3G6EQ 2WACA 3META 5GJWB 1MHNA 2X51A 1YIJA 4AFQC 2DL4A 2ZPGB 2ZPFB 4M7AB 5D7UA 4B6MA 2CGHA 3QG1A 1AZGB 1M90R 3VUZA 5GAMf 1QP3A 1N8RC 3OYCA 1JJ2P 1VQLA 1IREB 3OS1A 4NS5A 2LNHB 5IH2A 4IUVA 4M7DB 2O2OA 5KYYA 2E65A 2KRSA 1JO8A 1TOVA 2O4XA 1ZX6A 3PT9A 3GBQA 1Y7XA 2YRCA 1JQQA 1O75A 5CQYA 4HXJA 3JCMX 1U5SA 2BZYA 4Y28E 3ZL7C 1BK2A 3E9FA 1XQHA 4KH1B 3CCEQ 3GP8A 2I0NA 2KR3A 1YJWT 2FZKB 1AD5A 1WQWA 1GCQA 1KG1A 2X4JA 3EGDB 2RD1A 4JRIA 2E6ZA 3CCET 1MMDA 2JMAA 4C92G 4JRPA 5LJ5j 3OS2A 3CC4T 3MEWA 3JCMh 3RKYA 5EG2A 5HKCA 3L2RA 1C1AA 2LRQA 2CSIA 3G6EA 4QQDA 1GCQC 3CPWP 1VQ6T 2C06A 1MMAA 1Y96A 2JN0A 4M78E 4Z89A 1M5Q1 2FRYA 1M27C 4A63B 1GL5A 2KDSA 3RUXA 4HT9A 3SHWA 2RM4A 4RTXA 2X3XD 2XU8A 4M75B 3VS3A 5DM7R 1X6GA 1VQ9T 2F1LA 3OW2A 1OYXA 2ZZDA 4C92E 4DBRA 5A0DA 3JCMJ 2BKDN 2RI3A 1KQSP 1YI2T 1NM7A 1DJ7B 2A7YA 1VQOT 4PLLA 4IUQA 1NJIU 4XK8E 4QQ6A 2QEXT 5GMKe 2I2LA 1X2QA 3CCEA 4J9BA 4JUVA 3CXCA 4J6WA 1IGQA 1YN8A 4YTLA 2LP5A 5KYYB 1V76A 2BTTA 2O4XB 5I22A 1HYOA 3OYJA 3HP9A 1Q82R 1MUZA 2E70A 4PJOG 5HCKA 2HL5C 2YXYA 4JJBA 3TSWA 2GQIA 1WQ7A 4ATOA 5GMKl 4R55A 2LT4A 1RL2A 2M16A 3MCAB 5M9OA 2CDTA 1XJWB 1WGSA 5GAN5 2M1HA 4EMKA 2JS2A 5CCAA 4RCBA 1PRLC 4DOVA 5LJ3e 2KY9A 5HK3A 3A8OB 4OMQA 1QVFP 3MP6A 4TVRA 1VQ9A 1WHLA 1NLOC 2XDDA 2KI7A 2DJZA 5DY9A 3SDZA 4F7UF 4RKUE 1U3OA 3V7RA 4EMKC 2K5FA 2Y90A 1RADB 1CSKA 1C6VX 2EJFA 2CZ6B 2D6FA 3M0QA 1OX9A 1Y96B 4PJOE 1VQ5Q 2QEXA 1FXXA 2QQAA 3QHSA 2P4RA 1K73U 2CT3A 4FL6A 2XI9A 4OMMA 4RMOA 3EFSA 4UC4A 3DLMA 1VQ5T 4FYWB 1R0BG 1RI9A 3JCMV 1YJNQ 1PM3A 3I56T 3OYLA 1G3SA 5J3BA 4BY6C 1E7OA 2D1XA 3EG3A 3R6OA 1VQMT 3WVDB 5EC7A 2QA4Q 2CH4A 2DE0X 3GLXA 3GPLA 5CKEA 2YDLA 5GANe 5KE2A 2A28A 4C0GA 4E2FB 2J06A 2QA4T 4XTWA 3CC7Q 4LDYA 3M0RA 3QKJA 3CMEQ 3C12A 1YHQT 1KJWA 4GLMA 1UGSB 1M1GA 3JCMb 3QPHA 2EQKA 3ASKA 3LH0A 3JB9H 2K4YA 3CC7T 4D8KA 1VOMA 3CMET 3BDLA 4HCCA 2GQVA 1BB9A 2LCSA 1KC8U 1YITQ 2L2PA 2GGRA 1Q81R 2CH4W 4DA4A 1WHGA 1HSQA 2JS0A 1R8OB 2DO3A 1PHTA 4EMKB 1PNJA 2DJQA 4MZMA 3VS5A 4XTYA 3FC3A 2P0PA 4J5YA 1G2BA 4WCIA 1VQ5A 1YITT 1VQKQ 2RHUA 1R77A 4L6V5 3CMAT 3CEYA 4J7FA 3L42A 4C0DB 2KYBA 3MEVA 3GNGA 4JRKA 2EGEA 2DL7A 1UB4A 2KVQG 2RQTA 1VQKT 3JCMQ 1YJNA 1D1CA 2ZGWA 2EYQA 1BI2A 4KH0B 2YUNA 1I81A 1WJRA 4BY6B 2JW4A 2KYMA 1Q7YC 2QA4A 4KUIA 2C0OA 4OB1B 2J6KA 4F7UA 4F17A 2AZVA 2MWOA 5GMKm 1NZ9A 1IGUA 1KD1C 3JCMg 2VKNA 2YUOA 2E64A 3CC7A 2RHYA 4OB2B 1UJ0A 3EGXA 4E7LA 1WIEA 4ME7A 3CMEA 2XHCA 2D0QB 2EQUA 2RO0A 3SB2A 1M3CA 1VQ8Q 1AZEA 2XIDA 3V8LA 2AIRB 1Q86U 2YUQA 2P0QA 2FRWA 3OYKA 2C0IA 1YITA 3DB3A 2DXBA 2FB7A 2ZCFB 2A36A 2L89A 2GNCA 5FROA 1TG0A 2KROA 2VVKA 4BUGA 1WXBA 1VQKA 2E10A 1W70A 2RK2A 2YSQA 5CO7A 3JCMc 3EHRA 2NUTA 1SG5A 5GAMj 4RCCA 5IHIA 3SWNB 3G71Q 4JJNK 4JLGA 3A8MB 2XK0A 3HRUA 2R57A 3GIBA 1XOVA 5KYXA 2ECZA 5GMKi 1N6AA 4AFSC 1RAEB 3M56A 1VQ7T 3OSSC 4XQ3A 3KFVA 3OW2P 1YJ9Q 1FYNA 3EG9A 4FYYB 2EYZA 5HK0A 2EJGA 1QCNA 1AEYA 1LOJA 4XU0A 1JRIA 2AT1B 1X43A 3CCLQ 4C5GA 3O5ZA 3C95A 1RAAB 3CCRT 1U1TA 2A37A 2DMOA 3JB9F 3CCLT 3EG1A 1VQ8A 3CXCP 1X01A 2EQJA 5GJVB 3REBB 1NLPC 5D6WA 2EPDA 2ED0A 1MV0B 1H641 4E7ZA 4F7UB 3A8GB 4C5IA 1LVKA 1T3SA 3HRSA 2MOXA 2RH2A 4J9FA 1K1ZA 2EYWA 3LYIA 4M7AE 2KNBB 3EGXB 4XTVA 3UATA 4X9CA 4DBFA 5LJ3d 2XKOC 3KUFA 1AWOA 1UGVA 4ORZA 2V1RA 1I5OB 1W1FA 3H0HA 4M7DE 3RESA 1M30A 3UPUA 3CCVT 2O9VA 3G71A 2R5AA 2NLUA 2XDBA 4DOWA 1KFZA 3I55Q 1KSWA 4B9WA 1YIJT 3M57A 1UDLA 4J9GA 3JRZA 3X25B 3V8KA 2P4TA 2K79A 4NL3A 5FW9A 1M1KU 1OQKA 1YJ9A 4QKUA 2NUTB 2WSCE 3L2VA 1FMWA 4FSXA 4XTUA 4JRQA 2PVDB 1NJIR 4GLKA 3FJ5A 1X69A 1SHFA 2KXDA 4C8QD 1K8AU 3L2WA 4CC3A 3CCLA 1VQLT 2LTOA 4LD6A 3AT1B 1GBQA 3HFOA 4E6RA 2RA2A 1PWTA 4HVUA 3HHTB 2XMFA 1KHIA 4FW1A 2HQHA 3QDFA 2EGCA 1MNDA 4C8QA 1AVZC 2HDAA 3EG9B 4IIMA 3P8BB 2HQEA 4L5GA 1WFWA 2QQBA 1JB0E 5GANd 2M0YA 4M78F 5A2QE 2GTOA 2JVVA 2K7AA 2FEIA 5C0MA 3P8DA 3NPFA 4N4HA 3QZ5B 2EBPA 2QDYB 1NEGA 4GBQA 1TH7A 3NGPA 2MK5A 4M75E 4M77B 4C8QC 3JB9D 5I2MA 4OMNA 2L3RA 1CKAA 3E19A 1M2OA 1T3LA 3ULRB 3LWHA 4C92F 2DD5A 1E6HA 5CKHA 3IQLA 1PC0A 3FLGA 3G6ET 4II1A 3X20B 4FT2A 1ZSGA 5LJ3g 3OBWA 2LQ8A 4C5EA 2QXFA 5FWCA 1BKBA 4BE2A 1K73R 1PKTA 4B9XA 2YHTA 5ECAA 2DXCA 2LX9A 2HAXA 1X6OA 3M0PA 2DNUA 1WHJA 2LJ0A 2DYIA 1SHGA 2HMAA 2NUPA 2PZ1A 1VUBA 1I07A 2RF0A 3EG2A 3AHUA 1ZUUA 4OP0A 3HFNA 5GAOq 1K76A 1D3BB 2KRNA 3OSVA 4ZGJB 4M78G 2CYZB 2HSPA 3QIIA 2LDMA 1D1BA 1ABOA 1MNEA 4AMCA 3DKMA 4CC2A 1K9MR 1M8VA 1P92A 2ESWA 2KMTA 3S6WA 1NG2A 1I0CA 3M59A 4OB3B 2XG8D 2JNGA 4OMLA 3PVQA 4JZ3A 2GFAA 1QVGS 3M55A 1WA7A 2FHDA 2GCXA 3VV0A 2RQUA 4FT4A 3NTIA 4BDZA 2DTOA 2LQKA 2V8IA 3UWNA 1D0ZA 4C8QB 3C0CA 4PK4A 1I1JA 4PJOF 2DEQA 3H9NA 2L3SA 1KC8R 5L8RE 3OYIA 3E1SA 1MMNA 4M78D 2FG0A 4PJJA 1M8MA 2LJ3A 2VXEA 4WTOB 3JCMf 2AHJB 2KRMA 4F04B 1MV3A 4BDYA 2QGGA 5CR2A 2V8JA 2RI5A 3M9QA 3EHQA 3ER0A 4M78A 5LJ5e 4XAXB 1MGQA 3BDUA 1SEMA 4C92D 3OYEA 4IUPA 2FPEA 1WNLA 4DBQA 3QBYA 2COZA 3WVEB 1U1SA 3JCMP 4V2SA 1ZBXA 4IUTA 2CUBA 2DIGA 4C92A 4M78C 3CQTA 4ANJA 3CCUQ 4M4ZA 1BI0A 2DKGA 3MP1A 1HXDA 2QTXA 2NUPB 1RAIB 3J7AF 2G6FX 5J26A 2QG9B 3A98A 3TREA 2K3BA 3O8VA 2VWFA 4E47A 2JJ9A 1SSFA 1YCSB 1G3YA 2QQ9A 2CT4A 4C92C 4LD9K 1FX7A 4A4GA 4LDXA 1Q86R 3OA6A 2AKKA 8AT1B 4E7IA 1EZZB 2MI6A 3CBMA 2BE9B 4PKCC 4F16A 1OOTA 2JXBA 2OTJQ 3OYMA 4HA8A 1GFDA 2FZCB 1M4ZA 1BU1A 4LUEA 5FU6C 5AT1B 5IXBA 1NJIC 1IO6A 3CD6Q 2M9UA 1TXQA 7AT1B 3H0FA 3VU3C 3MEUA 2EIFA 2K5IA 3OYGA 2KT1A 4PJOD 2DZ9A 1E6GA 2YRDA 2DD4A 5I21A 2RHZA 4BACA 1RABB 4E7SA 2F5KA 3MEAA 1UUEA 1WJSA 3V8JA 2F2WA 3HKSA 4AG2C 3TCJA 1VQ4Q 1NBEB 2DIQA 2E3IA 4JPBW 2L3QA 2CREA 4KULA 4QVCA 4Z8AA 4PJOA 4BI4A 1JBMA 1UECA 1WHMA 2K6DA 3RBBB 3CCUA 1I5LA 2PTKA 1X2KA 1X27A 3P8HA 2RJDA 1YJNT 5FWBA 1IHWA 1QW1A 3DLLA 2GFUA 3QXEB 5GAOr 2JZ2A 5GAN6 1VQNQ 4AT1B 4PJOC 3M0SA 2FL7A 3PGGA 5D6XA 4C92B 1NPRA 4E7KA 2COWA
chains in the Genus database with same CATH topology
4BI8B 1V29B 3SWNB 3ZFJA 4ZTFA 3OYHA 3NFCA 4Y91A 3V7CA 4JJNK 4JLGA 5KCOA 1PSFA 3A8MB 2DXTA 2XK0A 3HRUA 2MWPA 2R57A 3FIFA 2LCLA 3JAME 3JB9I 1M90C 3GIBA 1XOVA 2YLBA 2X4XA 2OTJA 3FDRA 1N6AA 3URGA 4QW2A 5GMKi 1M1KC 5GAOn 3M56A 4A54A 3CBPA 1VQ7T 2RK1A 5CK9A 1W2BS 4O5VA 4RG8A 3CXCS 5CAIA 2RJCA 4J8OA 3VKIA 3RERA 2K5LA 3OSSC 4XQ3A 1U8RA 1Q7YU 5FU6B 1UGRB 2OTLT 1K8AC 2CZ7B 3F70A 5HK0A 4QVDA 2RI2A 2EJGA 3GNFB 3CD6A 1YJWA 2R5MA 3FB9A 3T9NA 3CCVA 3GF5A 5LJ3j 5GAMh 3CCMT 1LOJA 4XU0A 2EQMA 4OF1A 4CRIA 1JRIA 3BY7A 4FM4B 4HCBA 2WACA 3META 2V8KA 3G7ZA 4C5GA 4J6YA 1MHNA 2PVOB 3CCUT 5KH6A 3C95A 3TU4K 2G3RA 2RJFA 1YIJA 2ZPEB 1KD1U 3CCRT 1W2BA 1U1TA 2E12A 2ZPGB 4PL6A 2ZPFB 1K9MC 1UEBA 5GAMd 4M7AB 1VQ4A 3JB9F 4HT8A 3NTHA 3CCLT 4EMHA 5KE3A 1VQ8A 3CC4A 1X01A 3INZA 2EQJA 2CGHA 3QG1A 4BI3A 5D6WA 1Y07A 3Q1JA 3RMSA 3VUZA 5GAMf 1QP3A 1H641 4JDSA 3WXMB 1N8RC 3OYCA 4F7UB 5LJ3h 3A8GB 2PU9B 4C5IA 5C6SA 3CC2T 2R58A 2VGNA 1IREB 1W4SA 3HRSA 4NS5A 4ZGDB 3OS1A 1VQLA 1VQ6A 2RH2A 4QQGA 4IUVA 4M7DB 2LCCA 3OMGA 2E65A 1UGPB 3LYIA 4M7AE 2O4XA 3V7SA 1M1FA 4BE0A 4XTVA 4CI0C 3PT9A 1Y7XA 4MMLA 2LVMA 4X9CA 1YCYA 5LJ3d 3TEEA 2XKOC 1O75A 2CZ0B 4HKEA 2DTHA 5CQYA 3KUFA 4A4EA 3JCMX 2OTJT 3QZ9B 2VYTA 4Y28E 5LJ3f 4M7DE 3RESA 4M7AF 4LDVA 3OMCA 4PJOB 3RIRA 3E9FA 1XQHA 3GP8A 3CD6T 3UPUA 1YJWT 3CCVT 3CCJT 3G71A 3CPWS 1HK9A 1WQWA 2R5AA 4MDXA 2NLUA 2VXFA 4DOWA 2EKOA 2X4JA 2XDBA 3VYGA 1KG1A 4J83A 2OTLA 3ZBDA 3X26B 2RD1A 4JRIA 4B9WA 5GANj 3PMTA 2E6ZA 1YIJT 4M7DF 3M57A 5GAOl 1YI2A 3CCET 2M0OA 3QYHB 1B34B 4C92G 4JRPA 5LJ5j 1VQOA 3JRZA 3X25B 3V8KA 2P4TA 5GAN2 1I8FA 1KHCA 3OS2A 1M90U 1VQ4T 4QVZA 2HBPA 4A4KA 4M78B 4NL3A 3CC4T 1M1KU 3MEWA 1VQ8T 1YJ9A 3OYNA 4C0DC 2VV5A 2WSCE 3JCMh 3L2VA 3RKYA 5EG2A 5HKCA 4FSXA 4XTUA 2QQSA 5D6YA 3L2RA 2LRQA 4JRQA 2PVDB 4GLKA 3G6EA 4C8QD 2KSSA 2K3XA 2CZ1B 1K8AU 4QQDA 5HY6A 3CCQT 3L2WA 3CCLA 4LDWA 3OYAA 4NL2A 1VQLT 2LTOA 4LD6A 3M54A 3OB9A 1VQ6T 2C06A 3MHXA 2WSEE 3HFOA 1Y96A 2IVWA 4LDUA 4ZGEB 2RA2A 3LW5E 3JCMd 5GANh 2JN0A 4M78E 1M5Q1 3HPWA 3CC2A 3HHTB 1KHIA 5LJ5h 5GAN7 2LT1A 5GAN8 4ZN1A 1KQSS 4ZTJA 3PTAA 2KDSA 4C8QA 2L8DA 3RUXA 3CCSA 1K9MU 4HT9A 5I2SA 2HD0A 2RM4A 1VQNT 2XICA 2Y4XA 4O6JA 3P8BB 2XU8A 4KBMB 4M75B 2HQEA 1I4K1 5DM7R 4L5GA 2P0KA 2QQBA 1JB0E 2YLCA 5GANd 3PIOA 2EAYA 3PIPA 2F5TX 1Q82C 5IAYA 4M78F 1VQ9T 5A2QE 4M7AG 5LJ5d 2JVVA 5C0MA 3OW2A 3P8DA 4X9DA 2PVGB 1K73C 4N4HA 1OYXA 2ZZDA 3G71T 5GMKh 3QZ5B 4C92E 2EJ9A 5GAMg 2IG0A 2QDYB 5CKDA 5LJ5f 4A53A 1TH7A 1WJQA 2LNVA 4F7UG 1ZHIA 5A0DA 3JCMJ 4OMFB 2BKDN 3PNWC 2Y4YA 4KUDK 2H3JA 2RI3A 3EAEA 4M75E 4M77B 4C8QC 3CCJA 3JB9D 1YI2T 1DJ7B 2A7YA 5I2MA 3KBGA 4JLIA 4RG2A 4WF2A 1VQOT 1JJ2S 4M7DG 4PLLA 4IUQA 1NJIU 3C94A 2L3RA 4XK8E 3SFMA 3JSCA 3E19A 4QQ6A 3UT1A 3M53A 2X4YA 1BI3A 4C92F 2DD5A 5A0GA 3LWHA 5GMKe 1BIBA 2I2LA 2QEXT 1YJ9T 3X24B 3CCEA 3OYYA 1N27A 4JUVA 5CKHA 3CXCA 4J6WA 3FLGA 4YTLA 3G6ET 4IUUA 2XDPA 3SWNA 2JTFA 4II1A 4M75F 3RKWA 1QVFA 3M58A 3X20B 4FT2A 5GAMe 2O4XB 4X34A 4JS4A 1QP2A 3QYGB 1BYMA 3JCMW 4M77E 3VYHB 5LJ3g 3OYJA 3OBWA 1AHJB 1JJ2A 3HP9A 2X4WA 2LQ8A 4L59A 2E70A 4C5EA 2QXFA 4PJOG 2A3LA 1BKBA 5CVIA 3CCQA 4N4GA 4IKFA 1OZ2A 4BE2A 4B9XA 2YHTA 5FLXE 1PSEA 2DXCA 2LX9A 1WQ7A 4ATOA 5GMKl 3I56A 4R55A 1X6OA 2HAXA 2LT4A 1G5VA 3UDCA 1RL2A 3CCST 4M77F 2M16A 4OGEA 3MCAB 5M9OA 3G4SA 1VUBA 1WGSA 5GAN5 1WPYA 3SWNC 3JB9J 3AHUA 2M1HA 4C0FA 4EMKA 1VQMA 2FYKA 3PMIA 5CCAA 4OP0A 3HFNA 2MMPA 2EFIA 4RCBA 4DOVA 5GAOq 5LJ3e 1D3BB 2KY9A 3OSVA 4NOYA 4F7UE 3A8OB 4ZGJB 5HK3A 5DLOA 2O01E 2CYZB 4M78G 1VQNA 3OS0A 1QVPA 3QIIA 2LDMA 2DTIA 2XD0A 3MP6A 4TVRA 2PUKB 1VQ9A 1KC8C 3DKMA 1M8VA 1YBYA 4M7AA 2XDDA 2RHXA 1P92A 4PLIA 4MDWA 3LLRA 2KMTA 1M9SA 3FEOA 3S6WA 3X28B 3M59A 4OB3B 2DJZA 4D6WA 1GXIE 5DY9A 2XG8D 3SDZA 4F7UF 4RKUE 2JNGA 3V7RA 2E5QA 2GFAA 2PUOB 1N9SA 3A5ZB 4EMKC 1QVGS 3M55A 2K5FA 4FU6A 4E7JA 1ZQ1A 2Y90A 4XTXA 3ZEHA 1YHQA 2FHDA 2EJFA 2CZ6B 2GCXA 2DPPB 3PFSA 3VV0A 2D6FA 4BD3A 4M7DA 4FT4A 3NTIA 4P5NA 3RMQA 5FU7C 1Q82U 1Y96B 4C5HA 3BFMA 4PJOE 2K57A 4BDZA 2QEXA 1EIFA 1FXXA 2DTOA 2LQKA 4N4IA 3RKXA 3I55T 2QQAA 3QHSA 2RB6A 4M75G 4MZPA 4PNOA 1K73U 2V8IA 3CPWA 1G3TA 4FL6A 2XI9A 3UWNA 4M7AC 3OYDA 4RMOA 5FRNA 3EFSA 4UC4A 3BW1A 4C8QB 3DLMA 5CQXA 3M4GA 5GAOp 3S3OA 1VQ5T 2WSFE 4PJOF 2DEQA 2MF2A 3JCMV 3I56T 3OYLA 5LJ5g 2DZCA 1G3SA 5J3BA 5L8RE 1RI0A 4BY6C 5GAN3 3OYIA 4M7DC 3E1SA 3JCMe 1OZ3A 4M78D 3G4ST 3R6OA 4J6XA 4M77G 1G3WA 5LL6S 4OB0B 1VQMT 3WVDB 2KK4A 3CMAA 2VXEA 3VJPA 3KXTA 2HNIA 3HRTA 4XU1A 3JCMf 2AHJB 2F69A 5GAOm 3GLXA 4BDYA 1Q81C 4ELZC 3GPLA 2EWNA 4JS5A 5CKEA 2CKKA 2L5QA 4Q5WA 5CR2A 2VC8A 4XU3A 2V8JA 5GANe 2RI5A 5KE2A 3CBOA 5KCHA 1N8RU 1IZ6A 3M9QA 3MO8A 5DLQE 4C0GA 5FRMA 3ER0A 4M78A 2QA4T 2GF7A 4XTWA 2E6NA 2FVUA 3EFRA 5LJ5e 4XAXB 3L2UA 1MGQA 5GANf 3LGFA 3BDUA 4C92D 4C8QF 3OYEA 4LDYA 1KQSA 2B8AA 1XTDA 3L2ZA 4MMKA 4IUPA 3QKJA 1KQ1A 5CIUA 3C12A 2RJEA 1WNLA 2YRVA 1YHQT 3QBYA 4M75D 1UGSB 1M1GA 3JCMb 3QPHA 2EQKA 3M5AA 3ASKA 4IURA 3WVEB 1U1SA 3JCMP 1Q86C 2JUFA 2D9TA 3LH0A 4V2SA 1ZBXA 2K4YA 2ZPBB 3OY9A 3CC7T 3JB9H 4IUTA 2DIGA 1FWZA 3CMET 3BDLA 3ME9A 4C92A 4HCCA 2GQVA 4M78C 1NE8A 3QO3A 2VGMA 4XU2A 5GAN4 1BI0A 1KC8U 2DKGA 2E41A 3MP1A 1HXDA 2BIVA 2QTXA 2MAMA 2BUDA 3I55A 5A0LA 4DA4A 4M75A 4M77D 2KAFA 1R8OB 2DO3A 3OS5A 5AYFA 3J7AF 4EMKB 4R56A 1QVFS 3J81E 5J26A 4ELYC 4MZMA 3FC3A 4XTYA 2ZPHB 2DVEA 2P0PA 4J5YA 3GOXA 3TREA 1VQ5A 1YITT 2RHUA 5FU7B 3O8VA 4L6V5 4E47A 3CMAT 3CEYA 4BE1A 1SSFA 3NTKA 4J7FA 1G3YA 3L42A 2QQ9A 2DXUA 3H6ZA 4C0DB 3MEVA 4C92C 3GNGA 5IT9E 4LD9K 4M7AD 4JRKA 3OYFA 2DK3A 1VQPT 4M77A 1FX7A 3OQ5A 4J7IA 1UB4A 1BIAA 2KVQG 4KT0E 4A4GA 3OA6A 1S72T 3DB4A 1VQKT 4LDXA 4M75C 3JCMQ 5IN1A 1YJNA 1LNXA 2ZGWA 2EYQA 3SD4A 4HCZA 1BI2A 2JTMA 3QSUA 3N5BB 4FIBA 4E7IA 1I81A 1WJRA 2DAQA 4EPCA 5J39A 4BY6B 2MI6A 3CBMA 4M7DD 1XNIA 4PKCC 1Q7YC 4N0AA 4ZN3A 4C8QG 3OYMA 4HA8A 2QA4A 1M4ZA 4KUIA 2LC4A 4OGCA 5FU6C 2QQRA 4BB7A 3L2QA 3S3NA 4OB1B 3LWIA 3QUIA 4M77C 5CKFA 3H8ZA 1NJIC 2M9UA 4F7UA 1Q81U 1OI1A 2MWOA 2OAUA 3VU3C 3E9GA 3MEUA 5GMKm 1NZ9A 1N9RA 3QJYA 1KD1C 2EIFA 3JCMg 2K5IA 3OYGA 4OVAA 3OBYA 2PQWA 4E7HA 4PJOD 2DZ9A 2E64A 3CC7A 2DD4A 2RHYA 5I21A 2RHZA 4BACA 4OB2B 2F5KA 3L1AA 3MEAA 4E7LA 1WJSA 4ME7A 3V8JA 2XHCA 2D0QB 3M4YA 2EQUA 2RO0A 4N0AC 3CMEA 1VQ7A 3QJ6A 1LJOA 3HKSA 2KQWA 5CKBA 3TCJA 3SB2A 4Z02A 1D3BA 1QVGA 2DIQA 3MP8A 2K3YA 1UGQB 3FRNA 2XIDA 3V8LA 3VUBA 5GANg 2VUBA 3HSBA 3CCMA 3A8HB 1BI1A 1NPPA 2E1HA 4GY5A 4KULA 4MZTA 1Q86U 2K2VA 2P0QA 1Y71A 3QDRB 4QVCA 3OYKA 4PJOA 4BI4A 3HL8A 1JBMA 3LGLA 3CCUA 1I5LA 1YITA 3DB3A 4VUBA 2DXBA 2FB7A 2ZCFB 1X75C 3JB9G 2L89A 3CCRA 1O9SA 3P8HA 2RJDA 3C4SA 1YJNT 4A4FA 2CS7A 1QW1A 5FROA 1VIEA 4C8QE 3DLLA 2GFUA 3QXEB 2X35A 1VQPA 4XTZA 5GAOr 2JZ2A 4BUGA 3OYBA 2RHIA 5GAN6 1H3ZA 1B34A 3LX7A 2HQXA 2JOYA 1VQKA 1S72A 2E10A 2QI2A 3FJPA 5GMKj 2ZPIB 4EMGA 2RK2A 3A8LB 5CO7A 1VIFA 3CPFA 3JCMc 4A4HA 4PJOC 4DQ2A 3OW2S 3J80E 4EDUA 2FL7A 3S3MA 3PGGA 5D6XA 4RCCA 1NPRA 4C92B 4C0ZA 5GAMj 4E7KA 1KQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEW A;  5J26 A;  3OYN A;  4ZTF A;  3OYH A;  3FC3 A;  3MP6 A;  3L2V A;  3GOX A;  5D6Y A;  2QQS A;  5KCO A;  3L2R A;  2LRQ A;  2RHX A;  2XK0 A;  2RHU A;  2MWP A;  4PLI A;  2R57 A;  2K3X A;  3FEO A;  3LLR A;  3O8V A;  3S6W A;  3CEY A;  4QQD A;  3L2W A;  4BE1 A;  1SSF A;  3NTK A;  2X4X A;  3OYA A;  3L42 A;  2LTO A;  3FDR A;  3H6Z A;  3OB9 A;  4LD6 A;  3MEV A;  4QW2 A;  3OYF A;  2E5Q A;  2GFA A;  3OQ5 A;  4FU6 A;  4E7J A;  2RJC A;  3ZEH A;  2FHD A;  4A4G A;  3OA6 A;  3DB4 A;  3PFS A;  4BD3 A;  3F70 A;  5IN1 A;  3NTI A;  2RI2 A;  3SD4 A;  2R5M A;  4HCZ A;  4C5H A;  4BDZ A;  2EQM A;  4E7I A;  4ZTJ A;  4CRI A;  1WJR A;  2DAQ A;  2L8D A;  4N4I A;  5J39 A;  2WAC A;  3MET A;  4C5G A;  1XNI A;  1MHN A;  4FL6 A;  3UWN A;  5KH6 A;  2HQE A;  3OYD A;  5FRN A;  4UC4 A;  3OYM A;  2G3R A;  2RJF A;  2P0K A;  3DLM A;  5IAY A;  3L2Q A;  2QQR A;  3S3O A;  3S3N A;  4PL6 A;  5C0M A;  3P8D A;  3H8Z A;  3NTH A;  4N4H A;  1OYX A;  3OYL A;  5KE3 A;  1OI1 A;  1RI0 A;  2EQJ A;  2IG0 A;  2MWO A;  3OYI A;  3E9G A;  3MEU A;  1OZ3 A;  5D6W A;  3Q1J A;  1WJQ A;  3OYG A;  4OVA A;  2BKD N;  2PQW A;  3PNW C;  4E7H A;  3OYC A;  2RI3 A;  3EAE A;  2RHY A;  4C5I A;  5C6S A;  2RHZ A;  4BAC A;  2R58 A;  4RG2 A;  2F5K A;  3MEA A;  4NS5 A;  3OS1 A;  4PLL A;  4E7L A;  1WJS A;  4IUQ A;  4QQG A;  4IUV A;  4BDY A;  2L3R A;  2EQU A;  2LCC A;  2RO0 A;  3OMG A;  3QJ6 A;  4QQ6 A;  3UT1 A;  2CKK A;  2X4Y A;  3LYI A;  4Q5W A;  2O4X A;  4Z02 A;  2DIQ A;  4BE0 A;  2RI5 A;  5KE2 A;  1N27 A;  2K3Y A;  3MP8 A;  5KCH A;  3MO8 A;  3M9Q A;  3FLG A;  2LVM A;  5FRM A;  4IUU A;  2XDP A;  2GF7 A;  3L2U A;  2E6N A;  2JTF A;  4II1 A;  4GY5 A;  2O4X B;  4X34 A;  3LGF A;  3KUF A;  4A4E A;  3OYK A;  3OYE A;  3LGL A;  2B8A A;  3OYJ A;  5CIU A;  2VYT A;  4IUP A;  3QKJ A;  2X4W A;  3DB3 A;  4L59 A;  4C5E A;  2RJE A;  2YRV A;  3QBY A;  3OMC A;  2L89 A;  4N4G A;  3P8H A;  2RJD A;  4IKF A;  1OZ2 A;  3E9F A;  4BE2 A;  3C4S A;  4B9X A;  4A4F A;  2EQK A;  4IUR A;  3ASK A;  5FRO A;  3LH0 A;  2D9T A;  2GFU A;  2X35 A;  3OY9 A;  1G5V A;  2R5A A;  2JZ2 A;  3OYB A;  2NLU A;  2RHI A;  4IUT A;  2EKO A;  2M16 A;  1H3Z A;  3LX7 A;  2HQX A;  2DIG A;  5M9O A;  3BDL A;  3ME9 A;  1WGS A;  4B9W A;  2M1H A;  3PMT A;  3PMI A;  3MP1 A;  4A4H A;  2BIV A;  2M0O A;  2EFI A;  2BUD A;  4EDU A;  3S3M A;  5D6X A;  3OS2 A;  4E7K A;  1KHC A;  3OS0 A;  4QVZ A;  3QII A;  2LDM A; 
#chains in the Genus database with same CATH topology
 3EH2 A;  1V29 B;  1WXT A;  3ZFJ A;  3VS7 A;  2J05 A;  4Y91 A;  3V7C A;  1LPL A;  4Y92 A;  1PSF A;  2DXT A;  2OAW A;  4LUD A;  2HCK A;  2MWP A;  2OTL Q;  1M90 C;  2QDL A;  2OTJ A;  3FDR A;  4QW2 A;  2F2X A;  5GAO n;  1W2B S;  1Y0M A;  1QCF A;  4IIO A;  1Q7Y U;  5FU6 B;  1UGR B;  2OTL T;  3CD6 A;  2KE9 A;  3T9N A;  3GF5 A;  4FCY A;  3BY7 A;  4HCB A;  4HCK A;  2V8K A;  3G7Z A;  1VA7 A;  1AOJ A;  2PVO B;  3TU4 K;  2G3R A;  1RAG B;  2E3H A;  2ZPE B;  1KD1 U;  2QTV A;  1W2B A;  3SEM A;  1K9M C;  1UEB A;  1VQ4 A;  5KE3 A;  3INZ A;  3CCS Q;  2A0F B;  4PJM A;  1Y07 A;  3RMS A;  4PJN A;  1M1K R;  4HVW A;  5LJ3 h;  4PJL A;  1VYU A;  1H92 A;  1UE9 A;  2R58 A;  1W4S A;  2OX7 A;  3EGU A;  2LCC A;  1K8A R;  1QMC A;  1K0S A;  2Z0W A;  4MML A;  1YCY A;  2CZ0 B;  4A4E A;  2VYT A;  1M2V A;  2FO0 A;  5LJ3 f;  4M7A F;  4LDV A;  4PJO B;  3RIR A;  4ZNX A;  2KEA A;  2L0A A;  2CP0 A;  3CPW S;  1HK9 A;  2VXF A;  2W0Z A;  4Z88 A;  3VYG A;  4J83 A;  2OTL A;  3ZBD A;  1PG5 B;  3X26 B;  4M7D F;  5GAO l;  3QYH B;  5GAN 2;  2E4H A;  1I8F A;  1KHC A;  1FMK A;  4FYV B;  2ROL A;  1VQ8 T;  2DBK A;  3OYN A;  2MCN A;  3G4S Q;  2KSS A;  2K3X A;  2CZ1 B;  5HY6 A;  2GBQ A;  2DEU A;  2HKN A;  3OB9 A;  3MHX A;  1K9A A;  2IVW A;  4LDU A;  1SF9 A;  5GAN h;  2J6F A;  3PE0 A;  3HPW A;  2W10 A;  4OMP A;  1UFF A;  1H8K A;  2LQW A;  1KQS S;  4ZTJ A;  3PTA A;  3CCS A;  2F2V A;  2XIC A;  1Z9Q A;  2Y4X A;  3HTR A;  3PIP A;  1IB8 A;  1Q82 C;  5IAY A;  3EFO A;  5IXF A;  1M3B A;  4M7A G;  4LN2 A;  5LJ5 d;  2D0N A;  1W6X A;  3G71 T;  2EJ9 A;  3LH5 A;  1WJQ A;  4A53 A;  1ZHI A;  4OMF B;  3PNW C;  4KUD K;  2H3J A;  4WF2 A;  4RG2 A;  4M7D G;  2EGA A;  2NUZ A;  3SFM A;  2JT4 A;  3JSC A;  3UT1 A;  1ZSZ A;  1BI3 A;  2X4Y A;  5A0G A;  1YJ9 T;  1BIB A;  3X24 B;  2DF6 A;  3OYY A;  1OX8 A;  4J9H A;  4IUU A;  2XDP A;  4DBH A;  2JTF A;  4M75 F;  3M58 A;  2L3P A;  5GAM e;  1BYM A;  4X34 A;  4JS4 A;  1QP2 A;  3QYG B;  3JCM W;  1SRM A;  1VYV A;  4M77 E;  3VYH B;  5L23 A;  2X4W A;  4FSS A;  4L59 A;  1F1B B;  1JXO A;  2DET A;  4N4G A;  4IKF A;  2LMJ A;  2CP2 A;  1S72 Q;  5FLX E;  1OEB A;  2HSE B;  2O9S A;  1PSE A;  1ZSZ C;  1G5V A;  2H3E B;  1QKW A;  2K9G A;  3G4S A;  4C0F A;  2FYK A;  3PMI A;  1RLP C;  2MMP A;  2EFI A;  2O01 E;  2DTI A;  1SRL A;  2XD0 A;  1ARK A;  4M7A A;  2RHX A;  2SRC A;  4PLI A;  3FEO A;  1RAC B;  1GXI E;  1WYX A;  1B7T A;  4LE9 A;  1SKU B;  4FU6 A;  1ZQ1 A;  1QWF A;  1RUW A;  2DPP B;  1UJY A;  3PFS A;  4M7D A;  3BFM A;  4AG1 C;  5IHK A;  2K57 A;  1EIF A;  4N4I A;  3RKX A;  3I55 T;  4PNO A;  4M75 G;  4M7A C;  1G3T A;  2CP3 A;  3OYD A;  4AFU C;  2RQR A;  3M4G A;  5GAO p;  4PFZ A;  4LXC A;  2EQI A;  2WSF E;  2O31 A;  4J9C A;  5LJ5 g;  2DZC A;  4CC4 B;  2FZG B;  1UTI A;  5KYX B;  4M7D C;  3JCM e;  1FMV A;  4J6X A;  1D09 B;  5LL6 S;  4OB0 B;  3M0U A;  1BCM A;  3VJP A;  3KXT A;  1UG1 A;  3EGD A;  2F69 A;  5GAO m;  1Q81 C;  4ELZ C;  2EWN A;  4X1V A;  4JS5 A;  1AWJ A;  2CKK A;  4Q5W A;  2ZAE A;  2VC8 A;  4XU3 A;  3CBO A;  2MIO A;  1N8R U;  5FRM A;  2GF7 A;  3L2U A;  1ZSZ B;  3EFR A;  3UF4 A;  3PVL A;  3LGF A;  3A1P A;  4FYX B;  2X9H A;  1WX6 A;  2B8A A;  1XTD A;  3L2Z A;  4MMK A;  4AFZ C;  1KQ1 A;  4KGV B;  2RJE A;  3MKD A;  4M75 D;  2C0T A;  3NMZ C;  3M5A A;  1YWO A;  4IUR A;  2JUF A;  2D9T A;  2ZPB B;  1WDX A;  3CCM Q;  1B07 A;  1TU0 B;  1FWZ A;  3VS2 A;  1NE8 A;  2E41 A;  4J9I A;  2MAM A;  2BUD A;  3I55 A;  5A0L A;  1LCK A;  4M75 A;  2DER A;  3OS5 A;  3MPU B;  4R56 A;  2RNA A;  3GOX A;  2DVE A;  1Y57 A;  4K11 A;  3NTK A;  1WHK A;  2AZS A;  5KYU A;  1HJD A;  4RTZ A;  3H6Z A;  2DXU A;  1WZO A;  1TTH B;  5IT9 E;  2DK3 A;  1W2B P;  3OQ5 A;  4J7I A;  1BIA A;  4KT0 E;  4M75 C;  2NYS A;  5IN1 A;  2DRK A;  3VS6 A;  1LNX A;  2EKH A;  2JTM A;  3N5B B;  4FIB A;  2DVJ A;  2DAQ A;  5J39 A;  1XNI A;  2PNI A;  4N0A A;  4ZN3 A;  2HEQ A;  2LC4 A;  2DL5 A;  1IRX A;  3S3N A;  1B3Q A;  1ZLM A;  4R0K A;  5CKF A;  4RTY A;  1YJW Q;  2OAU A;  3NHN A;  3E9G A;  3OBY A;  4E7H A;  2DYB A;  3L1A A;  2RN8 A;  4LNP A;  3M4Y A;  2JM9 A;  4N0A C;  3QJ6 A;  1WHH A;  1LJO A;  2KQW A;  4OMO A;  5CKB A;  4RTU A;  3THK A;  4Z02 A;  3I35 A;  3CC4 Q;  2NWM A;  1QVG A;  3MP8 A;  5GAN g;  3HSB A;  3CCM A;  1BI1 A;  4GY5 A;  3VRY A;  1Q7Y R;  1NYF A;  3LGL A;  1VQ6 Q;  2RMO A;  2SEM A;  2YT6 A;  3C4S A;  4A4F A;  1VIE A;  8ATC B;  2IIM A;  2OI3 A;  2LJ1 A;  2X35 A;  4XTZ A;  1KD1 R;  1B34 A;  2QI2 A;  5GMK j;  2ZPI B;  4KGX B;  3A8L B;  3CPF A;  2OJ2 A;  4DQ2 A;  3OW2 S;  4FW2 A;  4EDU A;  1VQ9 Q;  4BI8 B;  4ZTF A;  6AT1 B;  4D8D A;  2BE7 D;  1ZA1 B;  3NFC A;  3OYH A;  2AK5 A;  5KCO A;  3FIF A;  2LCL A;  3JB9 I;  2YUP A;  1CKB A;  1YI2 Q;  3URG A;  1VQO Q;  2RK1 A;  5CK9 A;  4O5V A;  4RG8 A;  2HZY A;  3CXC S;  2RJC A;  4J8O A;  5KYU B;  2QEX Q;  3I9Q A;  1IXD A;  2CZ7 B;  2RI2 A;  3GNF B;  1YJW A;  2R5M A;  5LJ3 j;  4CRI A;  4FM4 B;  4JZ4 A;  4J6Y A;  3H41 A;  1MMG A;  3CCU T;  5KH6 A;  2RJF A;  2K2M A;  3VS1 A;  1RAH B;  2QYZ A;  3EG0 A;  2HL3 A;  2E12 A;  4HVV A;  3UA7 A;  2KGT A;  2MPX C;  4PL6 A;  2JM8 A;  1YP5 A;  3CC2 Q;  5GAM d;  1YFN A;  4HT8 A;  3NTH A;  4EMH A;  3CC4 A;  1QLY A;  1BBZ A;  1X6B A;  2LX7 A;  4BI3 A;  3Q1J A;  2D8J A;  4JDS A;  2X3W D;  3WXM B;  1AWW A;  2BZ8 A;  1ZA2 B;  1TS9 A;  2PU9 B;  3M0T A;  5C6S A;  3CC2 T;  2VGN A;  4ZGD B;  2CUD A;  4J9E A;  1VQ6 A;  4QQG A;  2H8H A;  2EVR A;  2J7I A;  3OMG A;  1UGP B;  2DLP A;  4KGZ B;  3V7S A;  4KRT A;  1M1F A;  4BE0 A;  4CI0 C;  2LVM A;  5KYW A;  3TEE A;  1ZUY A;  1PCX A;  4HKE A;  2DTH A;  3CCJ Q;  1BCO A;  2OTJ T;  1KK7 A;  4JJC A;  1R0C B;  3QZ9 B;  2JMC A;  3OMC A;  3CD6 T;  4RUG A;  3D7S B;  1T0H A;  4RTT A;  3CCJ T;  4MDX A;  2EKO A;  4QT7 A;  1K0X A;  5GAN j;  1NEB A;  3PMT A;  2CP7 A;  1YI2 A;  1TWB A;  2M0O A;  1B34 B;  1VQO A;  3CCQ Q;  1M90 U;  1QQJ A;  1PRM C;  2DFU A;  1VQ4 T;  4QVZ A;  2HBP A;  3RNJ A;  4M78 B;  1PD0 A;  1SPK A;  4A4K A;  4C0D C;  2VV5 A;  3I56 Q;  5D6Y A;  4ESR A;  2QQS A;  3CCQ T;  1VQM Q;  1EX4 A;  4LDW A;  3OYA A;  4NL2 A;  3M54 A;  2WSE E;  3REA B;  1ACM B;  4ZGE B;  1QWE A;  3LW5 E;  1D0X A;  3JCM d;  2HBW A;  3CC2 A;  5LJ5 h;  5GAN 7;  3H0I A;  2LT1 A;  1U06 A;  5GAN 8;  4ZN1 A;  2L8D A;  1K9M U;  1TSF A;  5I2S A;  2HD0 A;  1IHV A;  1VQN T;  1OV3 A;  2P84 A;  4O6J A;  4KBM B;  1OPL A;  1I4K 1;  2P0K A;  2YLC A;  3PIO A;  2EAY A;  2F5T X;  1YWP A;  1HD3 A;  1YHQ Q;  1G8X A;  1OUL A;  1SSH A;  5IHN A;  1A0N B;  4X9D A;  2PVG B;  1K73 C;  5GMK h;  2E5K A;  1ZUK A;  2EW3 A;  1VYT A;  5GAM g;  2IG0 A;  5CKD A;  5LJ5 f;  2LNV A;  4F7U G;  5KYN A;  2Y4Y A;  3CCJ A;  3EAE A;  1AT1 B;  3KBG A;  4JLI A;  1JJ2 S;  3QWY A;  3C94 A;  2V1Q A;  3M53 A;  2LQN A;  3VS4 A;  1N27 A;  2ABL A;  1RAF B;  4JJD A;  2DM1 A;  3R6N A;  2KBT A;  3RKW A;  3SWN A;  3CMA Q;  2LZ6 B;  2M51 A;  3U23 A;  3TQ7 P;  1AHJ B;  1JJ2 A;  5KYW B;  1JU5 C;  2A3L A;  3VS0 A;  5CVI A;  3CCQ A;  4RTW A;  1OZ2 A;  4EIK A;  2QGF B;  2AKL A;  3I56 A;  3UDC A;  3CCS T;  4M77 F;  4OGE A;  1PD1 A;  1V1C A;  1WPY A;  3SWN C;  3JB9 J;  3I5R A;  1VQM A;  2RPN A;  2RQW A;  4NOY A;  2EYY A;  4F7U E;  5DLO A;  3TVT A;  1VQN A;  3OS0 A;  1QVP A;  4F14 A;  2VB6 A;  1UHF A;  2PUK B;  2BZX A;  2ATC B;  1KC8 C;  1YBY A;  4MDW A;  3LLR A;  3X28 B;  1M9S A;  4PFO A;  1Q95 G;  4D6W A;  1KIK A;  2KT8 A;  1D0Y A;  1N8R R;  2E5Q A;  2PUO B;  9ATC B;  1N9S A;  2ENM A;  3A5Z B;  4CC7 A;  4E7J A;  4XTX A;  3ZEH A;  1YHQ A;  2DBM A;  4BD3 A;  4P5N A;  3RMQ A;  5FU7 C;  1Q82 U;  2DA9 A;  4C5H A;  1N5Z A;  2RB6 A;  4MZP A;  4DEY A;  3CPW A;  1GBR A;  5FRN A;  3BW1 A;  5CQX A;  3S3O A;  1RLQ C;  3RR6 A;  2DIL A;  2DL3 A;  2MF2 A;  1QVG P;  1ZBJ A;  1TUG B;  5GAN 3;  1RI0 A;  3E2U A;  1OZ3 A;  3QWX X;  3G4S T;  4M77 G;  1G3W A;  2KK4 A;  3CMA A;  1TUC A;  1J3T A;  2YWW A;  2HNI A;  3HRT A;  4XU1 A;  2COY A;  1ABQ A;  2CP6 A;  1QKX A;  2ROT A;  2L5Q A;  4PFP A;  2GTJ A;  5KCH A;  1IZ6 A;  3MO8 A;  5DLQ E;  2ED1 A;  2E6N A;  2FVU A;  3RDV A;  5GAN f;  2RQV A;  4C8Q F;  1KQS A;  5CIU A;  1WLP B;  1VQ7 Q;  2YRV A;  2CSQ A;  1Q86 C;  1YNZ A;  1G83 A;  1K4U S;  3OY9 A;  1OU9 A;  3VRZ A;  2O88 A;  1GRI A;  1UHC A;  3TSZ A;  3ME9 A;  1D1A A;  2FPD A;  3QO3 A;  2VGM A;  4XU2 A;  5GAN 4;  2BIV A;  1GFC A;  3CCR Q;  4M77 D;  2KAF A;  5AYF A;  3MJX A;  5I11 A;  1QVF S;  3J81 E;  4ELY C;  1VQP Q;  2ZPH B;  1GCP A;  3G1J A;  5FU7 B;  1M2V B;  1AWX A;  4BE1 A;  2QAS A;  2V26 A;  2HKQ B;  4M7A D;  3OYF A;  1VQP T;  4M77 A;  1S1N A;  1QVF A;  1WI7 A;  1S72 T;  3DB4 A;  1PKS A;  2KXC A;  3SD4 A;  4HCZ A;  3QSU A;  4EPC A;  4J9D A;  4M7D D;  1OPK A;  4C8Q G;  3EH1 A;  4OGC A;  2EYX A;  3L2Q A;  2QQR A;  4BB7 A;  2QAZ A;  2FPF A;  3LWI A;  3UA6 A;  3QUI A;  1T0J A;  4M77 C;  3H8Z A;  3CCV Q;  1Q81 U;  1OI1 A;  1N9R A;  3QJY A;  4OVA A;  2PQW A;  1YIJ Q;  2B86 A;  1EFN A;  1VQ7 A;  2DX1 A;  4RTV A;  1D3B A;  2K3Y A;  1UGQ B;  3FRN A;  2M02 A;  3VUB A;  2VUB A;  3A8H B;  1NPP A;  2E1H A;  4MZT A;  2A08 A;  2K2V A;  1Y71 A;  3QDR B;  3EFO B;  3HL8 A;  4DEX A;  1VQL Q;  1OU8 A;  2DL8 A;  4VUB A;  3BE3 A;  1X75 C;  3JB9 G;  1TUD A;  3CCR A;  1O9S A;  2CS7 A;  3JV3 A;  4C8Q E;  1M3A A;  2JTE A;  1VQP A;  3OYB A;  2RHI A;  1H3Z A;  1Z9Z A;  3LX7 A;  2HQX A;  2JOY A;  1S72 A;  1NYG A;  3FJP A;  4EMG A;  1VIF A;  2DRM A;  4A4H A;  3J80 E;  3S3M A;  4C0Z A;  1KQ2 A;  2D8H A;  2IPO B;  2MYS A;  2VAS A;  1WXU A;  1C0M A;  1H3H A;  1QCO A;  3JAM E;  2J6O A;  2CP5 A;  3I5S A;  1JXM A;  2YLB A;  2X4X A;  1JEG A;  1M1K C;  4A54 A;  3CBP A;  2QK0 A;  5CAI A;  3RER A;  3VKI A;  2K5L A;  1U8R A;  1K8A C;  3F70 A;  4QVD A;  3CCV A;  3FB9 A;  3CCM T;  5GAM h;  2EQM A;  4OF1 A;  3G6E Q;  2WAC A;  3MET A;  5GJW B;  1MHN A;  2X51 A;  1YIJ A;  4AFQ C;  2DL4 A;  2ZPG B;  2ZPF B;  4M7A B;  5D7U A;  4B6M A;  2CGH A;  3QG1 A;  1AZG B;  1M90 R;  3VUZ A;  5GAM f;  1QP3 A;  1N8R C;  3OYC A;  1JJ2 P;  1VQL A;  1IRE B;  3OS1 A;  4NS5 A;  2LNH B;  5IH2 A;  4IUV A;  4M7D B;  2O2O A;  5KYY A;  2E65 A;  2KRS A;  1JO8 A;  1TOV A;  2O4X A;  1ZX6 A;  3PT9 A;  3GBQ A;  1Y7X A;  2YRC A;  1JQQ A;  1O75 A;  5CQY A;  4HXJ A;  3JCM X;  1U5S A;  2BZY A;  4Y28 E;  3ZL7 C;  1BK2 A;  3E9F A;  1XQH A;  4KH1 B;  3CCE Q;  3GP8 A;  2I0N A;  2KR3 A;  1YJW T;  2FZK B;  1AD5 A;  1WQW A;  1GCQ A;  1KG1 A;  2X4J A;  3EGD B;  2RD1 A;  4JRI A;  2E6Z A;  3CCE T;  1MMD A;  2JMA A;  4C92 G;  4JRP A;  5LJ5 j;  3OS2 A;  3CC4 T;  3MEW A;  3JCM h;  3RKY A;  5EG2 A;  5HKC A;  3L2R A;  1C1A A;  2LRQ A;  2CSI A;  3G6E A;  4QQD A;  1GCQ C;  3CPW P;  1VQ6 T;  2C06 A;  1MMA A;  1Y96 A;  2JN0 A;  4M78 E;  4Z89 A;  1M5Q 1;  2FRY A;  1M27 C;  4A63 B;  1GL5 A;  2KDS A;  3RUX A;  4HT9 A;  3SHW A;  2RM4 A;  4RTX A;  2X3X D;  2XU8 A;  4M75 B;  3VS3 A;  5DM7 R;  1X6G A;  1VQ9 T;  2F1L A;  3OW2 A;  1OYX A;  2ZZD A;  4C92 E;  4DBR A;  5A0D A;  3JCM J;  2BKD N;  2RI3 A;  1KQS P;  1YI2 T;  1NM7 A;  1DJ7 B;  2A7Y A;  1VQO T;  4PLL A;  4IUQ A;  1NJI U;  4XK8 E;  4QQ6 A;  2QEX T;  5GMK e;  2I2L A;  1X2Q A;  3CCE A;  4J9B A;  4JUV A;  3CXC A;  4J6W A;  1IGQ A;  1YN8 A;  4YTL A;  2LP5 A;  5KYY B;  1V76 A;  2BTT A;  2O4X B;  5I22 A;  1HYO A;  3OYJ A;  3HP9 A;  1Q82 R;  1MUZ A;  2E70 A;  4PJO G;  5HCK A;  2HL5 C;  2YXY A;  4JJB A;  3TSW A;  2GQI A;  1WQ7 A;  4ATO A;  5GMK l;  4R55 A;  2LT4 A;  1RL2 A;  2M16 A;  3MCA B;  5M9O A;  2CDT A;  1XJW B;  1WGS A;  5GAN 5;  2M1H A;  4EMK A;  2JS2 A;  5CCA A;  4RCB A;  1PRL C;  4DOV A;  5LJ3 e;  2KY9 A;  5HK3 A;  3A8O B;  4OMQ A;  1QVF P;  3MP6 A;  4TVR A;  1VQ9 A;  1WHL A;  1NLO C;  2XDD A;  2KI7 A;  2DJZ A;  5DY9 A;  3SDZ A;  4F7U F;  4RKU E;  1U3O A;  3V7R A;  4EMK C;  2K5F A;  2Y90 A;  1RAD B;  1CSK A;  1C6V X;  2EJF A;  2CZ6 B;  2D6F A;  3M0Q A;  1OX9 A;  1Y96 B;  4PJO E;  1VQ5 Q;  2QEX A;  1FXX A;  2QQA A;  3QHS A;  2P4R A;  1K73 U;  2CT3 A;  4FL6 A;  2XI9 A;  4OMM A;  4RMO A;  3EFS A;  4UC4 A;  3DLM A;  1VQ5 T;  4FYW B;  1R0B G;  1RI9 A;  3JCM V;  1YJN Q;  1PM3 A;  3I56 T;  3OYL A;  1G3S A;  5J3B A;  4BY6 C;  1E7O A;  2D1X A;  3EG3 A;  3R6O A;  1VQM T;  3WVD B;  5EC7 A;  2QA4 Q;  2CH4 A;  2DE0 X;  3GLX A;  3GPL A;  5CKE A;  2YDL A;  5GAN e;  5KE2 A;  2A28 A;  4C0G A;  4E2F B;  2J06 A;  2QA4 T;  4XTW A;  3CC7 Q;  4LDY A;  3M0R A;  3QKJ A;  3CME Q;  3C12 A;  1YHQ T;  1KJW A;  4GLM A;  1UGS B;  1M1G A;  3JCM b;  3QPH A;  2EQK A;  3ASK A;  3LH0 A;  3JB9 H;  2K4Y A;  3CC7 T;  4D8K A;  1VOM A;  3CME T;  3BDL A;  4HCC A;  2GQV A;  1BB9 A;  2LCS A;  1KC8 U;  1YIT Q;  2L2P A;  2GGR A;  1Q81 R;  2CH4 W;  4DA4 A;  1WHG A;  1HSQ A;  2JS0 A;  1R8O B;  2DO3 A;  1PHT A;  4EMK B;  1PNJ A;  2DJQ A;  4MZM A;  3VS5 A;  4XTY A;  3FC3 A;  2P0P A;  4J5Y A;  1G2B A;  4WCI A;  1VQ5 A;  1YIT T;  1VQK Q;  2RHU A;  1R77 A;  4L6V 5;  3CMA T;  3CEY A;  4J7F A;  3L42 A;  4C0D B;  2KYB A;  3MEV A;  3GNG A;  4JRK A;  2EGE A;  2DL7 A;  1UB4 A;  2KVQ G;  2RQT A;  1VQK T;  3JCM Q;  1YJN A;  1D1C A;  2ZGW A;  2EYQ A;  1BI2 A;  4KH0 B;  2YUN A;  1I81 A;  1WJR A;  4BY6 B;  2JW4 A;  2KYM A;  1Q7Y C;  2QA4 A;  4KUI A;  2C0O A;  4OB1 B;  2J6K A;  4F7U A;  4F17 A;  2AZV A;  2MWO A;  5GMK m;  1NZ9 A;  1IGU A;  1KD1 C;  3JCM g;  2VKN A;  2YUO A;  2E64 A;  3CC7 A;  2RHY A;  4OB2 B;  1UJ0 A;  3EGX A;  4E7L A;  1WIE A;  4ME7 A;  3CME A;  2XHC A;  2D0Q B;  2EQU A;  2RO0 A;  3SB2 A;  1M3C A;  1VQ8 Q;  1AZE A;  2XID A;  3V8L A;  2AIR B;  1Q86 U;  2YUQ A;  2P0Q A;  2FRW A;  3OYK A;  2C0I A;  1YIT A;  3DB3 A;  2DXB A;  2FB7 A;  2ZCF B;  2A36 A;  2L89 A;  2GNC A;  5FRO A;  1TG0 A;  2KRO A;  2VVK A;  4BUG A;  1WXB A;  1VQK A;  2E10 A;  1W70 A;  2RK2 A;  2YSQ A;  5CO7 A;  3JCM c;  3EHR A;  2NUT A;  1SG5 A;  5GAM j;  4RCC A;  5IHI A;  3SWN B;  3G71 Q;  4JJN K;  4JLG A;  3A8M B;  2XK0 A;  3HRU A;  2R57 A;  3GIB A;  1XOV A;  5KYX A;  2ECZ A;  5GMK i;  1N6A A;  4AFS C;  1RAE B;  3M56 A;  1VQ7 T;  3OSS C;  4XQ3 A;  3KFV A;  3OW2 P;  1YJ9 Q;  1FYN A;  3EG9 A;  4FYY B;  2EYZ A;  5HK0 A;  2EJG A;  1QCN A;  1AEY A;  1LOJ A;  4XU0 A;  1JRI A;  2AT1 B;  1X43 A;  3CCL Q;  4C5G A;  3O5Z A;  3C95 A;  1RAA B;  3CCR T;  1U1T A;  2A37 A;  2DMO A;  3JB9 F;  3CCL T;  3EG1 A;  1VQ8 A;  3CXC P;  1X01 A;  2EQJ A;  5GJV B;  3REB B;  1NLP C;  5D6W A;  2EPD A;  2ED0 A;  1MV0 B;  1H64 1;  4E7Z A;  4F7U B;  3A8G B;  4C5I A;  1LVK A;  1T3S A;  3HRS A;  2MOX A;  2RH2 A;  4J9F A;  1K1Z A;  2EYW A;  3LYI A;  4M7A E;  2KNB B;  3EGX B;  4XTV A;  3UAT A;  4X9C A;  4DBF A;  5LJ3 d;  2XKO C;  3KUF A;  1AWO A;  1UGV A;  4ORZ A;  2V1R A;  1I5O B;  1W1F A;  3H0H A;  4M7D E;  3RES A;  1M30 A;  3UPU A;  3CCV T;  2O9V A;  3G71 A;  2R5A A;  2NLU A;  2XDB A;  4DOW A;  1KFZ A;  3I55 Q;  1KSW A;  4B9W A;  1YIJ T;  3M57 A;  1UDL A;  4J9G A;  3JRZ A;  3X25 B;  3V8K A;  2P4T A;  2K79 A;  4NL3 A;  5FW9 A;  1M1K U;  1OQK A;  1YJ9 A;  4QKU A;  2NUT B;  2WSC E;  3L2V A;  1FMW A;  4FSX A;  4XTU A;  4JRQ A;  2PVD B;  1NJI R;  4GLK A;  3FJ5 A;  1X69 A;  1SHF A;  2KXD A;  4C8Q D;  1K8A U;  3L2W A;  4CC3 A;  3CCL A;  1VQL T;  2LTO A;  4LD6 A;  3AT1 B;  1GBQ A;  3HFO A;  4E6R A;  2RA2 A;  1PWT A;  4HVU A;  3HHT B;  2XMF A;  1KHI A;  4FW1 A;  2HQH A;  3QDF A;  2EGC A;  1MND A;  4C8Q A;  1AVZ C;  2HDA A;  3EG9 B;  4IIM A;  3P8B B;  2HQE A;  4L5G A;  1WFW A;  2QQB A;  1JB0 E;  5GAN d;  2M0Y A;  4M78 F;  5A2Q E;  2GTO A;  2JVV A;  2K7A A;  2FEI A;  5C0M A;  3P8D A;  3NPF A;  4N4H A;  3QZ5 B;  2EBP A;  2QDY B;  1NEG A;  4GBQ A;  1TH7 A;  3NGP A;  2MK5 A;  4M75 E;  4M77 B;  4C8Q C;  3JB9 D;  5I2M A;  4OMN A;  2L3R A;  1CKA A;  3E19 A;  1M2O A;  1T3L A;  3ULR B;  3LWH A;  4C92 F;  2DD5 A;  1E6H A;  5CKH A;  3IQL A;  1PC0 A;  3FLG A;  3G6E T;  4II1 A;  3X20 B;  4FT2 A;  1ZSG A;  5LJ3 g;  3OBW A;  2LQ8 A;  4C5E A;  2QXF A;  5FWC A;  1BKB A;  4BE2 A;  1K73 R;  1PKT A;  4B9X A;  2YHT A;  5ECA A;  2DXC A;  2LX9 A;  2HAX A;  1X6O A;  3M0P A;  2DNU A;  1WHJ A;  2LJ0 A;  2DYI A;  1SHG A;  2HMA A;  2NUP A;  2PZ1 A;  1VUB A;  1I07 A;  2RF0 A;  3EG2 A;  3AHU A;  1ZUU A;  4OP0 A;  3HFN A;  5GAO q;  1K76 A;  1D3B B;  2KRN A;  3OSV A;  4ZGJ B;  4M78 G;  2CYZ B;  2HSP A;  3QII A;  2LDM A;  1D1B A;  1ABO A;  1MNE A;  4AMC A;  3DKM A;  4CC2 A;  1K9M R;  1M8V A;  1P92 A;  2ESW A;  2KMT A;  3S6W A;  1NG2 A;  1I0C A;  3M59 A;  4OB3 B;  2XG8 D;  2JNG A;  4OML A;  3PVQ A;  4JZ3 A;  2GFA A;  1QVG S;  3M55 A;  1WA7 A;  2FHD A;  2GCX A;  3VV0 A;  2RQU A;  4FT4 A;  3NTI A;  4BDZ A;  2DTO A;  2LQK A;  2V8I A;  3UWN A;  1D0Z A;  4C8Q B;  3C0C A;  4PK4 A;  1I1J A;  4PJO F;  2DEQ A;  3H9N A;  2L3S A;  1KC8 R;  5L8R E;  3OYI A;  3E1S A;  1MMN A;  4M78 D;  2FG0 A;  4PJJ A;  1M8M A;  2LJ3 A;  2VXE A;  4WTO B;  3JCM f;  2AHJ B;  2KRM A;  4F04 B;  1MV3 A;  4BDY A;  2QGG A;  5CR2 A;  2V8J A;  2RI5 A;  3M9Q A;  3EHQ A;  3ER0 A;  4M78 A;  5LJ5 e;  4XAX B;  1MGQ A;  3BDU A;  1SEM A;  4C92 D;  3OYE A;  4IUP A;  2FPE A;  1WNL A;  4DBQ A;  3QBY A;  2COZ A;  3WVE B;  1U1S A;  3JCM P;  4V2S A;  1ZBX A;  4IUT A;  2CUB A;  2DIG A;  4C92 A;  4M78 C;  3CQT A;  4ANJ A;  3CCU Q;  4M4Z A;  1BI0 A;  2DKG A;  3MP1 A;  1HXD A;  2QTX A;  2NUP B;  1RAI B;  3J7A F;  2G6F X;  5J26 A;  2QG9 B;  3A98 A;  3TRE A;  2K3B A;  3O8V A;  2VWF A;  4E47 A;  2JJ9 A;  1SSF A;  1YCS B;  1G3Y A;  2QQ9 A;  2CT4 A;  4C92 C;  4LD9 K;  1FX7 A;  4A4G A;  4LDX A;  1Q86 R;  3OA6 A;  2AKK A;  8AT1 B;  4E7I A;  1EZZ B;  2MI6 A;  3CBM A;  2BE9 B;  4PKC C;  4F16 A;  1OOT A;  2JXB A;  2OTJ Q;  3OYM A;  4HA8 A;  1GFD A;  2FZC B;  1M4Z A;  1BU1 A;  4LUE A;  5FU6 C;  5AT1 B;  5IXB A;  1NJI C;  1IO6 A;  3CD6 Q;  2M9U A;  1TXQ A;  7AT1 B;  3H0F A;  3VU3 C;  3MEU A;  2EIF A;  2K5I A;  3OYG A;  2KT1 A;  4PJO D;  2DZ9 A;  1E6G A;  2YRD A;  2DD4 A;  5I21 A;  2RHZ A;  4BAC A;  1RAB B;  4E7S A;  2F5K A;  3MEA A;  1UUE A;  1WJS A;  3V8J A;  2F2W A;  3HKS A;  4AG2 C;  3TCJ A;  1VQ4 Q;  1NBE B;  2DIQ A;  2E3I A;  4JPB W;  2L3Q A;  2CRE A;  4KUL A;  4QVC A;  4Z8A A;  4PJO A;  4BI4 A;  1JBM A;  1UEC A;  1WHM A;  2K6D A;  3RBB B;  3CCU A;  1I5L A;  2PTK A;  1X2K A;  1X27 A;  3P8H A;  2RJD A;  1YJN T;  5FWB A;  1IHW A;  1QW1 A;  3DLL A;  2GFU A;  3QXE B;  5GAO r;  2JZ2 A;  5GAN 6;  1VQN Q;  4AT1 B;  4PJO C;  3M0S A;  2FL7 A;  3PGG A;  5D6X A;  4C92 B;  1NPR A;  4E7K A;  2COW A; 
#chains in the Genus database with same CATH homology
 4BI8 B;  1V29 B;  3SWN B;  3ZFJ A;  4ZTF A;  3OYH A;  3NFC A;  4Y91 A;  3V7C A;  4JJN K;  4JLG A;  5KCO A;  1PSF A;  3A8M B;  2DXT A;  2XK0 A;  3HRU A;  2MWP A;  2R57 A;  3FIF A;  2LCL A;  3JAM E;  3JB9 I;  1M90 C;  3GIB A;  1XOV A;  2YLB A;  2X4X A;  2OTJ A;  3FDR A;  1N6A A;  3URG A;  4QW2 A;  5GMK i;  1M1K C;  5GAO n;  3M56 A;  4A54 A;  3CBP A;  1VQ7 T;  2RK1 A;  5CK9 A;  1W2B S;  4O5V A;  4RG8 A;  3CXC S;  5CAI A;  2RJC A;  4J8O A;  3VKI A;  3RER A;  2K5L A;  3OSS C;  4XQ3 A;  1U8R A;  1Q7Y U;  5FU6 B;  1UGR B;  2OTL T;  1K8A C;  2CZ7 B;  3F70 A;  5HK0 A;  4QVD A;  2RI2 A;  2EJG A;  3GNF B;  3CD6 A;  1YJW A;  2R5M A;  3FB9 A;  3T9N A;  3CCV A;  3GF5 A;  5LJ3 j;  5GAM h;  3CCM T;  1LOJ A;  4XU0 A;  2EQM A;  4OF1 A;  4CRI A;  1JRI A;  3BY7 A;  4FM4 B;  4HCB A;  2WAC A;  3MET A;  2V8K A;  3G7Z A;  4C5G A;  4J6Y A;  1MHN A;  2PVO B;  3CCU T;  5KH6 A;  3C95 A;  3TU4 K;  2G3R A;  2RJF A;  1YIJ A;  2ZPE B;  1KD1 U;  3CCR T;  1W2B A;  1U1T A;  2E12 A;  2ZPG B;  4PL6 A;  2ZPF B;  1K9M C;  1UEB A;  5GAM d;  4M7A B;  1VQ4 A;  3JB9 F;  4HT8 A;  3NTH A;  3CCL T;  4EMH A;  5KE3 A;  1VQ8 A;  3CC4 A;  1X01 A;  3INZ A;  2EQJ A;  2CGH A;  3QG1 A;  4BI3 A;  5D6W A;  1Y07 A;  3Q1J A;  3RMS A;  3VUZ A;  5GAM f;  1QP3 A;  1H64 1;  4JDS A;  3WXM B;  1N8R C;  3OYC A;  4F7U B;  5LJ3 h;  3A8G B;  2PU9 B;  4C5I A;  5C6S A;  3CC2 T;  2R58 A;  2VGN A;  1IRE B;  1W4S A;  3HRS A;  4NS5 A;  4ZGD B;  3OS1 A;  1VQL A;  1VQ6 A;  2RH2 A;  4QQG A;  4IUV A;  4M7D B;  2LCC A;  3OMG A;  2E65 A;  1UGP B;  3LYI A;  4M7A E;  2O4X A;  3V7S A;  1M1F A;  4BE0 A;  4XTV A;  4CI0 C;  3PT9 A;  1Y7X A;  4MML A;  2LVM A;  4X9C A;  1YCY A;  5LJ3 d;  3TEE A;  2XKO C;  1O75 A;  2CZ0 B;  4HKE A;  2DTH A;  5CQY A;  3KUF A;  4A4E A;  3JCM X;  2OTJ T;  3QZ9 B;  2VYT A;  4Y28 E;  5LJ3 f;  4M7D E;  3RES A;  4M7A F;  4LDV A;  3OMC A;  4PJO B;  3RIR A;  3E9F A;  1XQH A;  3GP8 A;  3CD6 T;  3UPU A;  1YJW T;  3CCV T;  3CCJ T;  3G71 A;  3CPW S;  1HK9 A;  1WQW A;  2R5A A;  4MDX A;  2NLU A;  2VXF A;  4DOW A;  2EKO A;  2X4J A;  2XDB A;  3VYG A;  1KG1 A;  4J83 A;  2OTL A;  3ZBD A;  3X26 B;  2RD1 A;  4JRI A;  4B9W A;  5GAN j;  3PMT A;  2E6Z A;  1YIJ T;  4M7D F;  3M57 A;  5GAO l;  1YI2 A;  3CCE T;  2M0O A;  3QYH B;  1B34 B;  4C92 G;  4JRP A;  5LJ5 j;  1VQO A;  3JRZ A;  3X25 B;  3V8K A;  2P4T A;  5GAN 2;  1I8F A;  1KHC A;  3OS2 A;  1M90 U;  1VQ4 T;  4QVZ A;  2HBP A;  4A4K A;  4M78 B;  4NL3 A;  3CC4 T;  1M1K U;  3MEW A;  1VQ8 T;  1YJ9 A;  3OYN A;  4C0D C;  2VV5 A;  2WSC E;  3JCM h;  3L2V A;  3RKY A;  5EG2 A;  5HKC A;  4FSX A;  4XTU A;  2QQS A;  5D6Y A;  3L2R A;  2LRQ A;  4JRQ A;  2PVD B;  4GLK A;  3G6E A;  4C8Q D;  2KSS A;  2K3X A;  2CZ1 B;  1K8A U;  4QQD A;  5HY6 A;  3CCQ T;  3L2W A;  3CCL A;  4LDW A;  3OYA A;  4NL2 A;  1VQL T;  2LTO A;  4LD6 A;  3M54 A;  3OB9 A;  1VQ6 T;  2C06 A;  3MHX A;  2WSE E;  3HFO A;  1Y96 A;  2IVW A;  4LDU A;  4ZGE B;  2RA2 A;  3LW5 E;  3JCM d;  5GAN h;  2JN0 A;  4M78 E;  1M5Q 1;  3HPW A;  3CC2 A;  3HHT B;  1KHI A;  5LJ5 h;  5GAN 7;  2LT1 A;  5GAN 8;  4ZN1 A;  1KQS S;  4ZTJ A;  3PTA A;  2KDS A;  4C8Q A;  2L8D A;  3RUX A;  3CCS A;  1K9M U;  4HT9 A;  5I2S A;  2HD0 A;  2RM4 A;  1VQN T;  2XIC A;  2Y4X A;  4O6J A;  3P8B B;  2XU8 A;  4KBM B;  4M75 B;  2HQE A;  1I4K 1;  5DM7 R;  4L5G A;  2P0K A;  2QQB A;  1JB0 E;  2YLC A;  5GAN d;  3PIO A;  2EAY A;  3PIP A;  2F5T X;  1Q82 C;  5IAY A;  4M78 F;  1VQ9 T;  5A2Q E;  4M7A G;  5LJ5 d;  2JVV A;  5C0M A;  3OW2 A;  3P8D A;  4X9D A;  2PVG B;  1K73 C;  4N4H A;  1OYX A;  2ZZD A;  3G71 T;  5GMK h;  3QZ5 B;  4C92 E;  2EJ9 A;  5GAM g;  2IG0 A;  2QDY B;  5CKD A;  5LJ5 f;  4A53 A;  1TH7 A;  1WJQ A;  2LNV A;  4F7U G;  1ZHI A;  5A0D A;  3JCM J;  4OMF B;  2BKD N;  3PNW C;  2Y4Y A;  4KUD K;  2H3J A;  2RI3 A;  3EAE A;  4M75 E;  4M77 B;  4C8Q C;  3CCJ A;  3JB9 D;  1YI2 T;  1DJ7 B;  2A7Y A;  5I2M A;  3KBG A;  4JLI A;  4RG2 A;  4WF2 A;  1VQO T;  1JJ2 S;  4M7D G;  4PLL A;  4IUQ A;  1NJI U;  3C94 A;  2L3R A;  4XK8 E;  3SFM A;  3JSC A;  3E19 A;  4QQ6 A;  3UT1 A;  3M53 A;  2X4Y A;  1BI3 A;  4C92 F;  2DD5 A;  5A0G A;  3LWH A;  5GMK e;  1BIB A;  2I2L A;  2QEX T;  1YJ9 T;  3X24 B;  3CCE A;  3OYY A;  1N27 A;  4JUV A;  5CKH A;  3CXC A;  4J6W A;  3FLG A;  4YTL A;  3G6E T;  4IUU A;  2XDP A;  3SWN A;  2JTF A;  4II1 A;  4M75 F;  3RKW A;  1QVF A;  3M58 A;  3X20 B;  4FT2 A;  5GAM e;  2O4X B;  4X34 A;  4JS4 A;  1QP2 A;  3QYG B;  1BYM A;  3JCM W;  4M77 E;  3VYH B;  5LJ3 g;  3OYJ A;  3OBW A;  1AHJ B;  1JJ2 A;  3HP9 A;  2X4W A;  2LQ8 A;  4L59 A;  2E70 A;  4C5E A;  2QXF A;  4PJO G;  2A3L A;  1BKB A;  5CVI A;  3CCQ A;  4N4G A;  4IKF A;  1OZ2 A;  4BE2 A;  4B9X A;  2YHT A;  5FLX E;  1PSE A;  2DXC A;  2LX9 A;  1WQ7 A;  4ATO A;  5GMK l;  3I56 A;  4R55 A;  1X6O A;  2HAX A;  2LT4 A;  1G5V A;  3UDC A;  1RL2 A;  3CCS T;  4M77 F;  2M16 A;  4OGE A;  3MCA B;  5M9O A;  3G4S A;  1VUB A;  1WGS A;  5GAN 5;  1WPY A;  3SWN C;  3JB9 J;  3AHU A;  2M1H A;  4C0F A;  4EMK A;  1VQM A;  2FYK A;  3PMI A;  5CCA A;  4OP0 A;  3HFN A;  2MMP A;  2EFI A;  4RCB A;  4DOV A;  5GAO q;  5LJ3 e;  1D3B B;  2KY9 A;  3OSV A;  4NOY A;  4F7U E;  3A8O B;  4ZGJ B;  5HK3 A;  5DLO A;  2O01 E;  2CYZ B;  4M78 G;  1VQN A;  3OS0 A;  1QVP A;  3QII A;  2LDM A;  2DTI A;  2XD0 A;  3MP6 A;  4TVR A;  2PUK B;  1VQ9 A;  1KC8 C;  3DKM A;  1M8V A;  1YBY A;  4M7A A;  2XDD A;  2RHX A;  1P92 A;  4PLI A;  4MDW A;  3LLR A;  2KMT A;  1M9S A;  3FEO A;  3S6W A;  3X28 B;  3M59 A;  4OB3 B;  2DJZ A;  4D6W A;  1GXI E;  5DY9 A;  2XG8 D;  3SDZ A;  4F7U F;  4RKU E;  2JNG A;  3V7R A;  2E5Q A;  2GFA A;  2PUO B;  1N9S A;  3A5Z B;  4EMK C;  1QVG S;  3M55 A;  2K5F A;  4FU6 A;  4E7J A;  1ZQ1 A;  2Y90 A;  4XTX A;  3ZEH A;  1YHQ A;  2FHD A;  2EJF A;  2CZ6 B;  2GCX A;  2DPP B;  3PFS A;  3VV0 A;  2D6F A;  4BD3 A;  4M7D A;  4FT4 A;  3NTI A;  4P5N A;  3RMQ A;  5FU7 C;  1Q82 U;  1Y96 B;  4C5H A;  3BFM A;  4PJO E;  2K57 A;  4BDZ A;  2QEX A;  1EIF A;  1FXX A;  2DTO A;  2LQK A;  4N4I A;  3RKX A;  3I55 T;  2QQA A;  3QHS A;  2RB6 A;  4M75 G;  4MZP A;  4PNO A;  1K73 U;  2V8I A;  3CPW A;  1G3T A;  4FL6 A;  2XI9 A;  3UWN A;  4M7A C;  3OYD A;  4RMO A;  5FRN A;  3EFS A;  4UC4 A;  3BW1 A;  4C8Q B;  3DLM A;  5CQX A;  3M4G A;  5GAO p;  3S3O A;  1VQ5 T;  2WSF E;  4PJO F;  2DEQ A;  2MF2 A;  3JCM V;  3I56 T;  3OYL A;  5LJ5 g;  2DZC A;  1G3S A;  5J3B A;  5L8R E;  1RI0 A;  4BY6 C;  5GAN 3;  3OYI A;  4M7D C;  3E1S A;  3JCM e;  1OZ3 A;  4M78 D;  3G4S T;  3R6O A;  4J6X A;  4M77 G;  1G3W A;  5LL6 S;  4OB0 B;  1VQM T;  3WVD B;  2KK4 A;  3CMA A;  2VXE A;  3VJP A;  3KXT A;  2HNI A;  3HRT A;  4XU1 A;  3JCM f;  2AHJ B;  2F69 A;  5GAO m;  3GLX A;  4BDY A;  1Q81 C;  4ELZ C;  3GPL A;  2EWN A;  4JS5 A;  5CKE A;  2CKK A;  2L5Q A;  4Q5W A;  5CR2 A;  2VC8 A;  4XU3 A;  2V8J A;  5GAN e;  2RI5 A;  5KE2 A;  3CBO A;  5KCH A;  1N8R U;  1IZ6 A;  3M9Q A;  3MO8 A;  5DLQ E;  4C0G A;  5FRM A;  3ER0 A;  4M78 A;  2QA4 T;  2GF7 A;  4XTW A;  2E6N A;  2FVU A;  3EFR A;  5LJ5 e;  4XAX B;  3L2U A;  1MGQ A;  5GAN f;  3LGF A;  3BDU A;  4C92 D;  4C8Q F;  3OYE A;  4LDY A;  1KQS A;  2B8A A;  1XTD A;  3L2Z A;  4MMK A;  4IUP A;  3QKJ A;  1KQ1 A;  5CIU A;  3C12 A;  2RJE A;  1WNL A;  2YRV A;  1YHQ T;  3QBY A;  4M75 D;  1UGS B;  1M1G A;  3JCM b;  3QPH A;  2EQK A;  3M5A A;  3ASK A;  4IUR A;  3WVE B;  1U1S A;  3JCM P;  1Q86 C;  2JUF A;  2D9T A;  3LH0 A;  4V2S A;  1ZBX A;  2K4Y A;  2ZPB B;  3OY9 A;  3CC7 T;  3JB9 H;  4IUT A;  2DIG A;  1FWZ A;  3CME T;  3BDL A;  3ME9 A;  4C92 A;  4HCC A;  2GQV A;  4M78 C;  1NE8 A;  3QO3 A;  2VGM A;  4XU2 A;  5GAN 4;  1BI0 A;  1KC8 U;  2DKG A;  2E41 A;  3MP1 A;  1HXD A;  2BIV A;  2QTX A;  2MAM A;  2BUD A;  3I55 A;  5A0L A;  4DA4 A;  4M75 A;  4M77 D;  2KAF A;  1R8O B;  2DO3 A;  3OS5 A;  5AYF A;  3J7A F;  4EMK B;  4R56 A;  1QVF S;  3J81 E;  5J26 A;  4ELY C;  4MZM A;  3FC3 A;  4XTY A;  2ZPH B;  2DVE A;  2P0P A;  4J5Y A;  3GOX A;  3TRE A;  1VQ5 A;  1YIT T;  2RHU A;  5FU7 B;  3O8V A;  4L6V 5;  4E47 A;  3CMA T;  3CEY A;  4BE1 A;  1SSF A;  3NTK A;  4J7F A;  1G3Y A;  3L42 A;  2QQ9 A;  2DXU A;  3H6Z A;  4C0D B;  3MEV A;  4C92 C;  3GNG A;  5IT9 E;  4LD9 K;  4M7A D;  4JRK A;  3OYF A;  2DK3 A;  1VQP T;  4M77 A;  1FX7 A;  3OQ5 A;  4J7I A;  1UB4 A;  1BIA A;  2KVQ G;  4KT0 E;  4A4G A;  3OA6 A;  1S72 T;  3DB4 A;  1VQK T;  4LDX A;  4M75 C;  3JCM Q;  5IN1 A;  1YJN A;  1LNX A;  2ZGW A;  2EYQ A;  3SD4 A;  4HCZ A;  1BI2 A;  2JTM A;  3QSU A;  3N5B B;  4FIB A;  4E7I A;  1I81 A;  1WJR A;  2DAQ A;  4EPC A;  5J39 A;  4BY6 B;  2MI6 A;  3CBM A;  4M7D D;  1XNI A;  4PKC C;  1Q7Y C;  4N0A A;  4ZN3 A;  4C8Q G;  3OYM A;  4HA8 A;  2QA4 A;  1M4Z A;  4KUI A;  2LC4 A;  4OGC A;  5FU6 C;  2QQR A;  4BB7 A;  3L2Q A;  3S3N A;  4OB1 B;  3LWI A;  3QUI A;  4M77 C;  5CKF A;  3H8Z A;  1NJI C;  2M9U A;  4F7U A;  1Q81 U;  1OI1 A;  2MWO A;  2OAU A;  3VU3 C;  3E9G A;  3MEU A;  5GMK m;  1NZ9 A;  1N9R A;  3QJY A;  1KD1 C;  2EIF A;  3JCM g;  2K5I A;  3OYG A;  4OVA A;  3OBY A;  2PQW A;  4E7H A;  4PJO D;  2DZ9 A;  2E64 A;  3CC7 A;  2DD4 A;  2RHY A;  5I21 A;  2RHZ A;  4BAC A;  4OB2 B;  2F5K A;  3L1A A;  3MEA A;  4E7L A;  1WJS A;  4ME7 A;  3V8J A;  2XHC A;  2D0Q B;  3M4Y A;  2EQU A;  2RO0 A;  4N0A C;  3CME A;  1VQ7 A;  3QJ6 A;  1LJO A;  3HKS A;  2KQW A;  5CKB A;  3TCJ A;  3SB2 A;  4Z02 A;  1D3B A;  1QVG A;  2DIQ A;  3MP8 A;  2K3Y A;  1UGQ B;  3FRN A;  2XID A;  3V8L A;  3VUB A;  5GAN g;  2VUB A;  3HSB A;  3CCM A;  3A8H B;  1BI1 A;  1NPP A;  2E1H A;  4GY5 A;  4KUL A;  4MZT A;  1Q86 U;  2K2V A;  2P0Q A;  1Y71 A;  3QDR B;  4QVC A;  3OYK A;  4PJO A;  4BI4 A;  3HL8 A;  1JBM A;  3LGL A;  3CCU A;  1I5L A;  1YIT A;  3DB3 A;  4VUB A;  2DXB A;  2FB7 A;  2ZCF B;  1X75 C;  3JB9 G;  2L89 A;  3CCR A;  1O9S A;  3P8H A;  2RJD A;  3C4S A;  1YJN T;  4A4F A;  2CS7 A;  1QW1 A;  5FRO A;  1VIE A;  4C8Q E;  3DLL A;  2GFU A;  3QXE B;  2X35 A;  1VQP A;  4XTZ A;  5GAO r;  2JZ2 A;  4BUG A;  3OYB A;  2RHI A;  5GAN 6;  1H3Z A;  1B34 A;  3LX7 A;  2HQX A;  2JOY A;  1VQK A;  1S72 A;  2E10 A;  2QI2 A;  3FJP A;  5GMK j;  2ZPI B;  4EMG A;  2RK2 A;  3A8L B;  5CO7 A;  1VIF A;  3CPF A;  3JCM c;  4A4H A;  4PJO C;  4DQ2 A;  3OW2 S;  3J80 E;  4EDU A;  2FL7 A;  3S3M A;  3PGG A;  5D6X A;  4RCC A;  1NPR A;  4C92 B;  4C0Z A;  5GAM j;  4E7K A;  1KQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...