3PMTA

Crystal structure of the tudor domain of human tudor domain-containing protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
KMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor domain-containing protein 3
publication title Crystal Structure of TDRD3 and Methyl-Arginine Binding Characterization of TDRD3, SMN and SPF30.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pmtA00
3H6ZA 4QQDA 3H8ZA 3NTKA 2BUDA 3DB4A 4C5IA 3L42A 3OYCA 2RHXA 2LVMA 4BD3A 4E7JA 2WACA 2GFUA 2EQKA 3MEAA 2K3XA 2X4WA 2LTOA 3PNWC 5FROA 5FRMA 1WJRA 2EKOA 4QVZA 2LDMA 2R58A 4A4HA 5KCOA 3OYEA 2EQJA 3L2WA 2QQSA 3EAEA 5KH6A 2L3RA 3QIIA 3OS1A 3MP1A 3NTIA 3OY9A 3NTHA 2EQMA 3L2UA 3O8VA 4GY5A 5C0MA 2RJDA 4IUUA 4A4FA 3ZEHA 3OYAA 3L2VA 4QQGA 4B9WA 2NLUA 4II1A 2R5AA 3FC3A 2X4YA 2LRQA 2PQWA 1H3ZA 2EQUA 3LGLA 5D6YA 1OZ3A 3E9FA 4IUTA 4BDYA 4C5EA 2GF7A 4NS5A 2JZ2A 3OYNA 2M16A 1XNIA 3SD4A 2XDPA 2FHDA 3UT1A 4IKFA 1WJSA 2RI5A 2X35A 3DB3A 4C5HA 3OYGA 2G3RA 2M0OA 1OYXA 2YRVA 1KHCA 2E5QA 4Q5WA 4IUVA 4UC4A 3C4SA 2RI3A 3MEVA 2VYTA 5IN1A 3OYFA 4X34A 2E6NA 4E7HA 5C6SA 3QBYA 1G5VA 3MEUA 3OYLA 2EFIA 2M1HA 3MP6A 5J39A 1N27A 2L89A 5FRNA 3M9QA 3S3OA 3MEWA 3UWNA 3OYBA 3L2RA 2RHYA 3PMIA 4BACA 3DLMA 1WJQA 3META 3MP8A 4IUQA 3S6WA 3BDLA 2RJFA 4B9XA 2DAQA 2RJEA 4FU6A 2DIGA 4QQ6A 3LH0A 2RHUA 2RJCA 2RHIA 4A4GA 4L59A 3MO8A 1OI1A 5D6WA 3P8HA 3P8DA 4A4EA 3OYJA 3OS2A 4ZTFA 3OMCA 3LGFA 5IAYA 5D6XA 4C5GA 2BIVA 3S3MA 3PMTA 4N4HA 2XK0A 3GOXA 2GFAA 4BE0A 2JTFA 3L2QA 5KE2A 3OMGA 2RI2A 4E7IA 2CKKA 2F5KA 3FLGA 2D9TA 2QQRA 4PLLA 3CEYA 4IURA 2DIQA 2P0KA 3OQ5A 3S3NA 4N4IA 3KUFA 2LCCA 3LLRA 4HCZA 2X4XA 3F70A 1WGSA 5M9OA 2O4XB 3FDRA 3QJ6A 4PL6A 3OYHA 3OYDA 3OA6A 3QKJA 5J26A 3OS0A 2IG0A 3LX7A 3OYKA 3E9GA 4IUPA 4LD6A 4Z02A 5KE3A 4E7LA 2L8DA 3FEOA 4BE1A 3Q1JA 4PLIA 4N4GA 3OYIA 4E7KA 4EDUA 3LYIA 4RG2A 2HQXA 4OVAA 5KCHA 2RO0A 2RHZA 2B8AA 3OYMA 2MWOA 4CRIA 3PFSA 1SSFA 4FL6A 2BKDN 1MHNA 3ME9A 4ZTJA 3OB9A 4BDZA 4QW2A 2K3YA 5CIUA 1RI0A 2R5MA 4BE2A 2R57A 2O4XA 1OZ2A 3ASKA 2HQEA 2MWPA
chains in the Genus database with same CATH superfamily
1WQWA 3H6ZA 4JLIA 2A08A 1W2BP 4M78A 3OW2S 4FCYA 2KYBA 1KC8U 4LE9A 4F16A 3EAEA 3SWNB 1UB4A 1MGQA 3MJXA 2RJDA 1MMAA 2PNIA 3BDUA 4C8QF 2DD4A 4AFZC 5LJ5e 2QA4A 3VKIA 2LJ3A 1Y0MA 1T0JA 5J3BA 3SEMA 4BDYA 2FRWA 2VWFA 4M4ZA 1NG2A 5GAOm 1FMVA 1ZSGA 1TSFA 4LD9K 2KBTA 3H9NA 1IREB 2MCNA 3NPFA 1VQOT 2KGTA 2V8KA 5IN1A 1M2OA 4FYWB 3VUZA 1UFFA 4ANJA 3QXEB 5DY9A 4M78G 4HCBA 2LJ1A 2CZ6B 2NUPB 4PK4A 1VQ9Q 4XAXB 4X9CA 1M90U 3REBB 4C92A 1NPPA 3BE3A 4IUQA 2DAQA 1U8RA 2O31A 1ZSZA 4Y92A 4RCCA 4A4GA 4EMKC 3P8DA 5LJ3d 2YUOA 2LQKA 4C5GA 2YSQA 2OTJQ 1TU0B 2X51A 3VS2A 3EGXA 4J9FA 2QGGA 2O4XB 3FIFA 3SWNC 1K9AA 3SDZA 1TXQA 1UGQB 2K4YA 5A0LA 4M78B 4MZPA 1RI9A 1Y07A 2D1XA 4PJMA 4RTVA 1KD1C 1ZQ1A 1YJ9T 4C92G 4JDSA 3OYMA 1K8AR 3OW2P 1QCFA 1U1TA 1M30A 1I5LA 5LJ5j 4HCCA 2JMCA 2VASA 1M1FA 4Z8AA 4KT0E 4M78F 2CP7A 3JCMg 1YBYA 1V29B 4J9CA 1IB8A 2L3RA 3VS7A 4PJLA 1Q82R 1VQ9A 5GAMg 3THKA 3WXMB 1VQ8Q 3G71Q 1VQ4T 4II1A 2R5AA 3MKDA 4J6WA 2HD0A 1VQLQ 1NE8A 2JZ2A 4C92B 2CUDA 1X6BA 2KRNA 1ZSZB 3DB3A 4FIBA 2OTJA 2A28A 2AKKA 2K9GA 2QAZA 4CC4B 5FW9A 2IIMA 3CMAT 3V7SA 1UG1A 1S72T 4CC3A 2JN0A 4J9GA 2EYQA 3FB9A 4JJDA 2QDYB 1R8OB 4J9EA 3UF4A 1VA7A 4M78C 2PUKB 3L2RA 1BCOA 3EGXB 2Y4YA 2ZPFB 2FO0A 5LJ3h 3CCUQ 1PM3A 1KHIA 4YTLA 2RJCA 5GANg 5GMKe 5D6WA 1X6GA 3OYJA 5GJWB 3MPUB 5GAN2 1YI2T 2NUZA 3C0CA 2FZCB 2V8JA 2KRMA 2CP6A 2EIFA 1G3SA 1OX9A 4PLLA 1WHGA 4ZNXA 2QYZA 4RG8A 1ACMB 3LLRA 3CMEQ 3E1SA 2LCLA 3OYHA 4XU1A 3EFRA 1D3BA 4FYVB 5CKFA 2FPDA 1VQ8A 3G71A 4BE1A 3H0HA 1I8FA 1Q81C 1WI7A 1ZUUA 4LUDA 1D1AA 4WTOB 1VQLA 4C92C 4JUVA 2XHCA 3VS4A 3CC7Q 1UDLA 1ZSZC 4J7FA 1QVGA 3M56A 2R57A 4K11A 2MWPA 2KSSA 2F1LA 2P0PA 4M7DE 1W6XA 3PT9A 3CPWA 2EQKA 1EX4A 5IHIA 5FRMA 3CCRQ 2XKOC 1ZUYA 1JO8A 2R58A 5GJVB 2X9HA 3L2WA 2RN8A 2SEMA 1K1ZA 3OY9A 1SHFA 3SHWA 2VXEA 1W4SA 2DMOA 2ECZA 3CCUA 1TOVA 4J7IA 3TSZA 1QKWA 1KJWA 4A4KA 1K73R 1H8KA 1VYVA 4R0KA 4C5HA 2COWA 5GMKj 3CPFA 2E5QA 4UC4A 4XTUA 2CSQA 3VRYA 1VQNQ 1NYFA 2HKNA 3CMEA 3OYLA 5FRNA 2HMAA 4M7DD 1Q7YC 3M0UA 3GBQA 2SRCA 4BACA 3EH2A 1BI0A 1NPRA 2EAYA 3S6WA 3A8GB 1BI3A 3BDLA 3LW5E 1B7TA 1M1GA 4QQ6A 1QVGS 1RLQC 3QO3A 9ATCB 3CC7A 1D3BB 3LGFA 3QSUA 5D6XA 4PJOE 3CPWS 2JTFA 1D0ZA 3RBBB 3L2QA 2HEQA 2M02A 1PHTA 3A8HB 1E7OA 1PKSA 2DIQA 2P0KA 5KYYA 2QI2A 3CCRA 3R6NA 4FSXA 3CCMQ 4ATOA 2JUFA 1HJDA 2DEUA 5GMKl 4E7LA 3Q1JA 3PIPA 1UHFA 1WLPB 4RG2A 1NEBA 2XDDA 4J9IA 4KH1B 1FWZA 4CRIA 3HP9A 5HCKA 2K3YA 4ME7A 3ASKA 2VGNA 3PIOA 3L42A 1SG5A 2MPXC 1C6VX 1VQNA 4PJOD 2GTOA 1LCKA 3JCMX 4MMKA 1VQ9T 3OYEA 2DJZA 2QQSA 1OPKA 2K57A 1KD1R 2ED0A 2MI6A 4LN2A 1UJ0A 1QW1A 2B86A 3VS1A 2QQBA 2HCKA 1WPYA 4E7ZA 3E19A 2DFUA 4XTZA 4NS5A 3OYNA 3JCMW 2M0YA 1YCYA 3JCMV 2FEIA 2RI3A 4KUIA 2NUTA 2YUPA 1QVGP 2YRDA 2EWNA 5C6SA 2XG8D 1ZA2B 4JLGA 3JCMb 1G5VA 4LDWA 4XU2A 4HT9A 1N27A 1IO6A 2L89A 3H0IA 1K8AU 1W1FA 3CPWP 3CCMA 1FXXA 4BUGA 2L3QA 1AWWA 3V8JA 5I2SA 5KYUB 5KYYB 3TSWA 5I22A 1IHWA 2DEQA 2YDLA 1VQPQ 3X26B 4AG2C 1GFCA 1U1SA 3NFCA 5CKHA 2PTKA 3JRZA 2OJ2A 2K7AA 2CKKA 1EFNA 2O9SA 3G6EQ 1OU8A 1WXUA 3S3NA 2CREA 2KXCA 1MV0B 1MV3A 1KQ2A 3QJ6A 4PL6A 1G83A 1VQ8T 3G71T 2P84A 1JRIA 1IXDA 5LL6S 1VQLT 1VQ7Q 5GAN6 1G3YA 3EFOA 1WFWA 3EG0A 2K79A 3CXCS 4R56A 1WNLA 3R6OA 4J6YA 1AD5A 1X6OA 3QWYA 2Z0WA 2HSPA 3CCQQ 2FB7A 2YLCA 3MEAA 1M1KC 1H92A 1MNEA 4OB0B 4V2SA 2DRKA 6AT1B 2EYWA 3KFVA 2DD5A 3WVDB 4BI3A 5HY6A 2LNVA 5HK0A 4RTTA 2NUTB 2F2XA 1Z9ZA 4Y91A 2H8HA 2RB6A 3CCEQ 2D0QB 1A0NB 1JXOA 1VQPA 2V8IA 1YITQ 2FHDA 4E47A 2JVVA 1IGQA 2HAXA 1QP3A 4Q5WA 2RNAA 3CMET 3HSBA 3G6EA 3M4GA 1K76A 1VIEA 5J39A 4DBHA 1LVKA 3S3OA 4F7UE 2EBPA 2KI7A 1SKUB 4J83A 3DLMA 4OMLA 1VQ7A 2BE9B 3V7CA 3CC7T 1AEYA 2FYKA 1OI1A 1JBMA 2HNIA 1C1AA 2F2WA 5GAOq 4A4EA 1JEGA 3CC2Q 1LPLA 4FYYB 2XICA 2BE7D 3CCQA 2L0AA 7AT1B 3CCRT 3EFOB 4KGVB 4FYXB 4JRIA 5LJ5d 3HHTB 2LCSA 2EGEA 4MZTA 1K73U 4BI4A 4DEYA 1I81A 4RKUE 3LX7A 2EYZA 4D8KA 1PC0A 1G3WA 4IUPA 5FU7B 1M2VA 2L8DA 4OF1A 3CCEA 3LYIA 2YUQA 2GQVA 2RO0A 1M9SA 1XTDA 1YIJT 2ZPBB 1SSFA 4ESRA 1YITA 3FRNA 1QVFS 4QW2A 1SPKA 4ZGEB 1V76A 4OMNA 3CCLQ 1VQNT 3QWXX 2MMPA 5GAN5 1QVPA 1WHLA 2WACA 2COZA 2K5IA 3PNWC 4GLKA 2LQNA 2YWWA 5EG2A 1M3BA 3QIIA 2DTIA 1M3CA 2Y90A 1PWTA 1TWBA 2JXBA 4B9WA 1IZ6A 1G2BA 1ZHIA 5CVIA 4A54A 3CQTA 3UATA 5DM7R 1ARKA 2GF7A 5KYNA 1XNIA 2XDPA 2KMTA 3CCJQ 3CC2A 4M7DA 1UECA 2JNGA 1PG5B 1FMWA 2CGHA 4AT1B 4KUDK 2DF6A 2HBWA 2EFIA 3MP6A 3CCMT 1N8RC 1J3TA 1X69A 1Y7XA 4DBFA 5FU7C 2DL8A 3VS6A 2L3PA 3EGDB 2ROTA 1WIEA 2DBKA 1OV3A 2K3BA 1K4US 1QWEA 4AG1C 5GAN7 5HK3A 2AT1B 5KYXA 3CCLA 2E64A 5LJ5h 2EYYA 3BW1A 1KD1U 3FLGA 3VS3A 1PSEA 1BK2A 3CEYA 4M7DG 4EPCA 3GF5A 1U5SA 3TVTA 1YFNA 1QVFP 2AZVA 2DRMA 1OEBA 2Y4XA 3PTAA 3IQLA 4LD6A 5CK9A 3AT1B 2C06A 4E7KA 2EQIA 2QG9B 1TUCA 3G4SQ 5KCHA 4ZN1A 2MYSA 2RHZA 3JCMf 1M8MA 2KR3A 1UTIA 3NMZC 4PJOA 3M0TA 2MF2A 1N9SA 5GAMf 1PD1A 3CCJA 3RESA 3H41A 1H3HA 2OTLQ 4XK8E 2EVRA 4C0DB 1K0SA 4BD3A 2YRCA 3QZ5B 4PNOA 4LUEA 1AWXA 1LJOA 2EKOA 2RQVA 2A7YA 1M3AA 5KH6A 2WSEE 3O8VA 2KROA 1GL5A 4A4FA 2MK5A 1VQPT 4NL2A 4M77E 4JRPA 4E2FB 2RM4A 1WZOA 2EQUA 3VJPA 2DJQA 5L23A 1KQSS 3GIBA 4PJOG 3G6ET 2DA9A 2M0OA 1M1KR 2K5LA 4X34A 5GAOp 5GANf 1N6AA 3OBYA 2CP5A 4B6MA 5KYXB 5GAOn 4NOYA 4BB7A 1GBQA 3URGA 4M7AE 1VQ7T 3MEWA 3OYBA 1YP5A 1WJQA 5I2MA 2DERA 3G4SA 5LJ3g 4A53A 3CBPA 3ZL7C 3JCMe 2HSEB 1U3OA 2X3WD 4M77D 5IAYA 3CCQT 1N5ZA 4C8QE 1WXTA 1NLPC 4C0DC 2OTLA 1Q86C 1VQ5Q 1PCXA 1Q81U 3GNFB 1BI2A 4IURA 1YJNT 4C92F 1KIKA 4M7DC 5M9OA 3O5ZA 1ZLMA 4P5NA 3CCET 1M8VA 1VUBA 2DXCA 3X24B 4JZ4A 2QEXQ 3KBGA 1YITT 2EKHA 4M7AD 3FJPA 5A0GA 1K9MC 3PVQA 3JB9J 2ENMA 3OB9A 1DJ7B 1X75C 3M0RA 4QQDA 2E3IA 1TH7A 3OYCA 2VC8A 3RMQA 5GMKh 1BU1A 4C8QD 2P4TA 4JPBW 4A4HA 2LJ0A 4DBRA 3OS1A 1KQSP 4QVDA 2BTTA 3CCVQ 2FZGB 3UDCA 4J9BA 2OX7A 4MDXA 3UPUA 1HD3A 4J9HA 3CC2T 1G8XA 1RAGB 2V1RA 2QQAA 4L6V5 5DLQE 1Q7YU 4RTZA 3OSVA 2RI5A 1UUEA 1VQ5A 4PJOC 2OAUA 2VYTA 1FX7A 2E6NA 4E7HA 5GAMj 3MEUA 2J05A 2QA4T 3JB9G 1BYMA 5ECAA 3PVLA 3U23A 4LDYA 1SRLA 8AT1B 1WHKA 2QEXA 2ZZDA 4QT7A 3MP8A 4B9XA 1RAHB 3PGGA 5KYWA 2JW4A 3RKYA 4CC2A 2LQWA 5CAIA 1ZUKA 2CT4A 4JJCA 3M59A 5A2QE 3CCLT 1P92A 1CKAA 4FW1A 3GNGA 5DLOA 2XK0A 1LOJA 1RLPC 5GAN8 2RI2A 1CSKA 1N8RR 3A98A 1RAIB 1VQ6Q 2C0TA 4F7UA 4OMMA 4FSSA 1TUGB 1N9RA 4ZN3A 5CKDA 5GANj 1WDXA 3CCVA 2DXUA 1RL2A 2A37A 4KULA 4M78D 3CBOA 3PFSA 4O5VA 2BKDN 4J8OA 2KYMA 1QCOA 2QDLA 2E6ZA 1HYOA 2D6FA 1R0BG 4MZMA 4WCIA 3NTKA 3JB9F 1ZX6A 2BUDA 3DB4A 2QTVA 5GMKm 5IT9E 2PVOB 2DBMA 2GFUA 3NHNA 3JCMP 2LNHB 4OMFB 1NBEB 2D8HA 1QMCA 1T0HA 4F7UG 3V7RA 4JRQA 2ZGWA 2YXYA 1MMDA 2QXFA 2PQWA 2ZPHB 5EC7A 1D0XA 4C5EA 2DZ9A 3X20B 1T3LA 2JM9A 1YWOA 1PSFA 2DE0X 5KYWB 2PU9B 2BZXA 2YRVA 1PRMC 1KHCA 2YT6A 1YWPA 2DTOA 3EG1A 4RMOA 2D0NA 3EFSA 4OGCA 5A0DA 4XTYA 2FVUA 1NZ9A 3OS5A 1OOTA 2FL7A 3QBYA 4ZGDB 1VQ6A 4AMCA 2M1HA 3VS0A 5CCAA 1TUDA 2G6FX 2OI3A 3L1AA 2FZKB 4E7SA 3G4ST 1RAFB 4C0ZA 2M51A 2CZ7B 1PRLC 2OTJT 4F7UB 1X2QA 4L59A 3RR6A 3GPLA 2LT1A 2GGRA 3OMCA 2O2OA 3NGPA 2VXFA 1KSWA 3CXCA 2HL3A 2VV5A 2OTLT 2BIVA 3PMTA 3EHQA 4E7IA 3SB2A 3EG3A 2RQUA 3V8LA 2JS0A 3KUFA 3EG9A 1QWFA 4HCZA 3HFOA 4F7UF 1WGSA 3LWHA 4KBMB 4GLMA 3UA7A 3HRSA 1PNJA 3OYIA 2PVGB 1AT1B 1M1KU 1BKBA 2DVEA 2K5FA 5IHNA 1UGVA 1WHMA 3VRZA 2DYIA 1MHNA 2J6FA 1RI0A 1Q86R 3E2UA 2I2LA 5IHKA 4CI0C 2CP0A 1YJ9Q 3I5RA 3A8MB 3ER0A 2JM8A 5FROA 2X3XD 1WJRA 3MHXA 1KG1A 2DVJA 4FW2A 2RK2A 3HL8A 4TVRA 4JS5A 1YHQQ 3I35A 1TTHB 1PKTA 4QQGA 4X1VA 1K9MR 2J06A 2E4HA 2DM1A 2QQ9A 4Y28E 1F1BB 1D0YA 3SD4A 2E41A 1VQ5T 1ZA1B 2E1HA 3TREA 3QZ9B 1SEMA 3OYYA 1QP2A 1Q81R 3CCUT 5CR2A 1R77A 2QEXT 1WYXA 3CMAQ 2PUOB 2CUBA 4M77A 3EG9B 1MMNA 2RJFA 3I55Q 3GP8A 2GQIA 5FU6C 2J6KA 2RQTA 4MMLA 1UGPB 1YN8A 1Q82C 2HZYA 1MMGA 3OS2A 1OX8A 1G3TA 2O01E 1QVFA 3REAB 2YUNA 4N4HA 4OMPA 3GOXA 2GBQA 4FT4A 1YJ9A 4F14A 3A5ZB 2K2MA 1I4K1 2X4XA 4QVCA 4HA8A 2AKLA 4M7AA 2XDBA 3CCVT 1RACB 2FRYA 2JTEA 1YHQA 3OS0A 1AOJA 4BI8B 3I9QA 4XTVA 2X4JA 5CKBA 1OPLA 4M77G 2I0NA 4EMKA 2V1QA 4FL6A 2LMJA 5HKCA 4C8QA 2K6DA 1H641 5CIUA 2R5MA 1W70A 1JQQA 4OGEA 1Q7YR 3H8ZA 4RTUA 2FPFA 3CXCP 4C0FA 1GXIE 4LXCA 1VQKQ 4QVZA 3CMAA 3L2UA 1E6GA 3NTHA 4GY5A 4M7AG 2HQHA 3I55A 2ATCB 3OYAA 1SSHA 2KVQG 2NLUA 1AZEA 2F2VA 5D6YA 1OZ3A 2WSFE 1N8RU 2EPDA 4M77B 4PFPA 1X01A 2BZYA 3UT1A 2VUBA 2J7IA 3RIRA 4C8QG 2DL4A 3RDVA 1RADB 1VQ6T 3J80E 4OB1B 2KT8A 1BBZA 3QJYA 3C95A 5CQYA 4M75E 2XD0A 4HT8A 2JMAA 3PMIA 1WA7A 1RUWA 2ZPIB 2DETA 3H0FA 4M7AB 4LDUA 2JS2A 1RABB 3QYHB 2CYZB 3MO8A 2CZ1B 3QHSA 1WHJA 4ZTFA 2LX7A 4X9DA 3TCJA 2GCXA 1M5Q1 5FWCA 4HVVA 2ESWA 2EJ9A 2KAFA 1OU9A 1UHCA 5LJ5g 2GTJA 1GCQA 4C8QB 1YJWQ 4PJNA 4M7AF 1VQKA 2CH4W 2L5QA 2ZCFB 5CQXA 3JSCA 5GAN3 3QYGB 4N0AA 5IH2A 2IG0A 1X43A 4QKUA 4FT2A 1FYNA 4C0GA 4M75D 3V8KA 3VV0A 1M2VB 2B8AA 2DL5A 2RPNA 1GFDA 1Y71A 4M77C 2XIDA 3CC4Q 2PZ1A 1KQSA 2ZPGB 1NJIC 4AFQC 1M4ZA 3QDFA 2VGMA 3TQ7P 1VYUA 4E7JA 2RD1A 1ZBXA 5GAOl 2LZ6B 5I21A 2P4RA 2DNUA 1WX6A 2DL3A 3JV3A 3JCMd 3A1PA 2EQMA 2AIRB 5C0MA 2EYXA 3AHUA 4RTWA 1AWOA 2XMFA 4M7AC 5GAMd 1JU5C 2KXDA 4IUTA 1CKBA 1KC8C 4HKEA 3JCMQ 1GCPA 3M57A 1MNDA 1R0CB 2X35A 2G3RA 2KDSA 3M5AA 4PFOA 3HFNA 4ELZC 3C4SA 5FLXE 4C8QC 1O75A 3FJ5A 3RKXA 3TU4K 5LJ3f 4M7DB 3I56Q 2DXBA 1YJWA 2EGCA 3M53A 3PE0A 1M27C 3M4YA 2E5KA 2COYA 4RCBA 4Z89A 4OB2B 1QKXA 4WF2A 5I11A 3M0QA 2V26A 5CO7A 1Q86U 1XOVA 2W10A 5GAN4 1BIBA 3RNJA 4M7DF 4ZGJB 2CP2A 1JJ2A 3CC4A 1UEBA 5GANd 4BE0A 1M90C 2RMOA 3LH5A 3T9NA 1UGRB 4GBQA 4AFSC 2E70A 1E6HA 1Y57A 3A8OB 1K9MU 2IPOB 3M58A 1ABQA 3INZA 1YHQT 4JRKA 2C0IA 3P8BB 1KK7A 1MUZA 2AHJB 3OYKA 3JCMJ 2DZCA 1JXMA 3JB9H 3M54A 4J5YA 2C0OA 1IHVA 1VQMQ 5GAMe 4NL3A 4ZTJA 2CZ0B 2XI9A 3M0SA 3LWIA 2YLBA 4J9DA 4BE2A 4PJOB 4DOVA 3JCMh 1B3QA 5LJ3e 3I56A 2VKNA 4EIKA 2RA2A 1EZZB 2JT4A 2LDMA 5GAMh 5D7UA 2YHTA 3I55T 1GCQC 2DO3A 4L5GA 4PJOF 1RAAB 1JJ2S 2X4YA 4N0AC 2LRQA 4BY6B 3ZBDA 1H3ZA 3LGLA 1Y96A 2ZAEA 4MDWA 2DYBA 2M16A 1WJSA 2A3LA 3G7ZA 1GRIA 5GANe 1D1BA 4KRTA 4HCKA 3MEVA 2LT4A 2KEAA 1EIFA 2JJ9A 2ED1A 3HPWA 3JB9I 3HRUA 2HKQB 1KQ1A 1B34A 3UWNA 2DILA 1FMKA 2ROLA 3META 4BDZA 1QLYA 5GANh 2JTMA 1VQMA 2KE9A 4PJJA 4JJNK 1YCSB 3C12A 2GFAA 1OQKA 3VUBA 4A63B 1VQKT 5GMKi 4M78E 2FPEA 3FDRA 5LJ3j 4DQ2A 2FG0A 3E9GA 5KE3A 3FEOA 1XJWB 1NEGA 4LDXA 4XTXA 1PD0A 4BY6C 3QPHA 1Q95G 2E10A 2MWOA 4PKCC 1OULA 5IXFA 1NYGA 5AT1B 5FWBA 1I0CA 2P0QA 2MIOA 2HQEA 2AK5A 3EHRA 1Y96B 1YIJQ 1JJ2P 3CCSQ 2LVMA 2J6OA 2K3XA 4OP0A 3RMSA 2LTOA 3I5SA 2RH2A 5KCOA 2XU8A 2E3HA 2EQJA 3VYHB 2RQRA 3NTIA 1NLOC 3BY7A 3CD6Q 2KY9A 3CCJT 3M55A 3L2VA 4OB3B 4C92E 1JB0E 3RUXA 1S1NA 3FC3A 1IGUA 4EMGA 4DEXA 3VS5A 1NJIR 1B34B 2IVWA 4IKFA 2EJFA 3BFMA 3OYGA 1YJWT 2A36A 4IUVA 3OYFA 2QK0A 1WHHA 4F04B 3L2ZA 2QTXA 1I07A 2NWMA 3ZFJA 1QCNA 1HXDA 1O9SA 1UE9A 1VOMA 5KYUA 1RAEB 3RERA 1I5OB 2E12A 2RJEA 3SFMA 2DIGA 1KC8R 3EGUA 4D6WA 4D8DA 3G1JA 3EH1A 3OSSC 2CDTA 2DLPA 3QG1A 4JJBA 4O6JA 3CC4T 2L2PA 3P8HA 3JCMc 4C92D 1AZGB 2KT1A 4E6RA 2O9VA 1TS9A 1C0MA 2K2VA 5KE2A 2F5KA 1YIJA 3CCSA 2QQRA 3OQ5A 3WVEB 4N4IA 2NYSA 2LCCA 3F70A 1VQOQ 3ULRB 3C94A 4M75A 3OYDA 1ZBJA 3TEEA 4JS4A 3OA6A 3QKJA 3CD6A 4Z02A 4FM4B 4EDUA 1IRXA 2LC4A 1M90R 2DXTA 5IXBA 1OZ2A 4ELYC 3I56T 4C5IA 3KXTA 2RHXA 2DX1A 1SF9A 1ABOA 3D7SB 3X28B 1HSQA 2CH4A 3A8LB 4DBQA 4M75G 2VB6A 4IUUA 5FU6B 4KH0B 3J81E 2E65A 2HBPA 4DA4A 2CP3A 8ATCB 2F69A 2KNBB 1T3SA 3JAME 2GNCA 1Z9QA 2EGAA 1SRMA 1VQOA 1Q82U 4LNPA 2MAMA 2LX9A 4XU3A 2O88A 4RTYA 3UA6A 2RHYA 3QUIA 5AYFA 2EJGA 1AWJA 4XTWA 4XQ3A 1VIFA 1VQMT 4LDVA 3LH0A 4M75B 2A0FB 2RHIA 1VQ4Q 3VYGA 1GBRA 2QASA 4KGZB 1W2BA 1K8AC 2DPPB 2AZSA 2JOYA 2CT3A 1TG0A 4VUBA 2CS7A 1YNZA 1K0XA 4M75F 2DKGA 4JZ3A 1S72Q 2HDAA 4R55A 2PVDB 5J26A 2H3JA 2KRSA 1AVZC 1YJNQ 4PFZA 2ABLA 4PLIA 4N4GA 2KQWA 4RUGA 2HQXA 4OVAA 3N5BB 3JB9D 3M0PA 3J7AF 1UGSB 2DK3A 3QDRB 2HL5C 3DLLA 1YI2Q 1X2KA 2X4WA 2OAWA 3HKSA 1X27A 1QQJA 2BZ8A 3MP1A 2MOXA 2L3SA 2F5TX 2DL7A 3ZEHA 4M75C 3GLXA 1W2BS 1D1CA 4HXJA 1VQ4A 4DOWA 3E9FA 2D8JA 2M9UA 2RK1A 4CC7A 2LQ8A 1BI1A 2CSIA 1UJYA 1OYXA 3HTRA 1U06A 3SWNA 1KFZA 4Z88A 3HRTA 3EG2A 1S72A 5CKEA 3VU3C 3M9QA 4OMOA 1LNXA 4IIMA 3EGDA 3OW2A 1BCMA 1AHJB 2DTHA 2VVKA 3DKMA 1YJNA 4FU6A 5LJ5f 2RF0A 2QA4Q 2RHUA 1WXBA 4AFUC 3RKWA 2ZPEB 4HVUA 4KGXB 1V1CA 1WQ7A 1SHGA 2W0ZA 4F17A 1I1JA 1D09B 1BIAA 3S3MA 2LP5A 3CCST 2KK4A 4J6XA 4EMHA 3OMGA 1YI2A 2NUPA 2H3EB 2D9TA 1HK9A 2EW3A 4M77F 2RQWA 1NM7A 1XQHA 4HVWA 3CD6T 1NJIU 4XU0A 5L8RE 3X25B 5GAOr 4IIOA 2QGFB 4RTXA 2WSCE 1B07A 1BB9A 4ORZA 3ME9A 3OBWA 4EMKB 1VYTA 1K73C 4OMQA 3MCAB 3CBMA 2O4XA
chains in the Genus database with same CATH topology
1WQWA 3H6ZA 4MZMA 3NTKA 3JB9F 2BUDA 3DB4A 4DOVA 5GMKm 5IT9E 4JLIA 2FB7A 2PVOB 2YLCA 4M78A 3JCMh 2GFUA 5LJ3e 3I56A 3MEAA 1M1KC 2RA2A 3OW2S 4OB0B 4V2SA 3JCMP 1KC8U 2LDMA 4OMFB 2DD5A 3WVDB 5GAMh 3EAEA 3SWNB 5HY6A 1UB4A 2LNVA 2YHTA 1MGQA 4BI3A 5HK0A 3I55T 2DO3A 4F7UG 4L5GA 2RJDA 4Y91A 4PJOF 3V7RA 4JRQA 2RB6A 3BDUA 4C8QF 2DD4A 2ZGWA 5LJ5e 2QA4A 2D0QB 1JJ2S 3VKIA 2X4YA 4N0AC 2LRQA 2QXFA 4BY6B 3ZBDA 2PQWA 2ZPHB 1VQPA 3LGLA 1Y96A 1H3ZA 5J3BA 2V8IA 4BDYA 4MDWA 4C5EA 2DZ9A 3X20B 5GAOm 2M16A 1PSFA 2FHDA 4E47A 2JVVA 4LD9K 1WJSA 1IREB 2A3LA 2PU9B 3G7ZA 2HAXA 5GANe 2YRVA 1KHCA 1QP3A 4Q5WA 2DTOA 3CMET 3HSBA 3G6EA 1VQOT 3MEVA 4RMOA 2V8KA 3EFSA 5IN1A 3M4GA 4OGCA 3VUZA 2LT4A 4XTYA 5A0DA 2FVUA 1NZ9A 3OS5A 2FL7A 3QBYA 3QXEB 1VIEA 4ZGDB 1VQ6A 1EIFA 2M1HA 3HPWA 5DY9A 5J39A 5CCAA 4M78G 4IKFA 3JB9I 4HCBA 3HRUA 3S3OA 2CZ6B 4F7UE 3L1AA 1KQ1A 1B34A 4J83A 4X9CA 4XAXB 3UWNA 3G4ST 3DLMA 1M90U 4C0ZA 4C92A 1NPPA 3META 4IUQA 4BDZA 2DAQA 1U8RA 1VQ7A 2CZ7B 2OTJT 4RCCA 4F7UB 5GANh 3V7CA 3CC7T 2JTMA 4L59A 4A4GA 2FYKA 1OI1A 1VQMA 3GPLA 1JBMA 2HNIA 2LT1A 4EMKC 5GAOq 3P8DA 4A4EA 5LJ3d 4JJNK 3OMCA 2VXFA 2LQKA 4C5GA 3CXCA 2VV5A 2OTLT 3C12A 2BIVA 3PMTA 2GFAA 2XICA 3VUBA 4E7IA 3CCQA 3SB2A 3CCRT 1VQKT 3V8LA 5GMKi 3KUFA 4HCZA 3HFOA 4JRIA 4F7UF 4M78E 5LJ5d 1WGSA 2O4XB 3FIFA 3HHTB 3SWNC 3FDRA 3SDZA 4MZTA 3LWHA 1K73U 1UGQB 4BI4A 1I81A 5LJ3j 2K4YA 4KBMB 4RKUE 3LX7A 5A0LA 4M78B 3E9GA 4IUPA 1G3WA 4MZPA 5FU7B 1Y07A 4DQ2A 5KE3A 2L8DA 3FEOA 4OF1A 3CCEA 1KD1C 4LDXA 3HRSA 4XTXA 1ZQ1A 3OYIA 3LYIA 4BY6C 2PVGB 3QPHA 1YJ9T 2GQVA 4JDSA 2RO0A 4C92G 1M9SA 1M1KU 1BKBA 1XTDA 2DVEA 2E10A 2K5FA 3OYMA 1YIJT 2MWOA 2ZPBB 1SSFA 1MHNA 1YITA 4PKCC 1U1TA 3FRNA 1QVFS 4QW2A 1I5LA 5LJ5j 4ZGEB 4HCCA 1RI0A 2I2LA 2P0QA 4CI0C 2HQEA 1VQNT 1M1FA 2MMPA 4KT0E 5GAN5 1QVPA 1Y96B 4M78F 3A8MB 2LVMA 3ER0A 2WACA 2K3XA 2K5IA 4OP0A 1YBYA 3RMSA 3JCMg 2LTOA 3PNWC 5FROA 1V29B 4GLKA 1WJRA 2RH2A 3MHXA 5KCOA 2XU8A 1KG1A 2RK2A 2EQJA 3HL8A 5EG2A 3VYHB 2L3RA 3QIIA 4TVRA 3NTIA 5GAMg 2DTIA 4JS5A 1VQ9A 2Y90A 3BY7A 2KY9A 3WXMB 3CCJT 3M55A 4QQGA 4OB3B 4B9WA 3L2VA 1VQ4T 4C92E 4II1A 1IZ6A 1JB0E 1ZHIA 2R5AA 4J6WA 5CVIA 3RUXA 3FC3A 2HD0A 4A54A 5DM7R 4EMGA 1B34B 2QQ9A 4Y28E 2GF7A 1NE8A 2JZ2A 4C92B 1XNIA 3SD4A 2XDPA 2E41A 1VQ5T 2IVWA 2E1HA 2KMTA 3TREA 3QZ9B 2EJFA 3BFMA 3OYGA 3CC2A 3DB3A 4FIBA 2OTJA 4M7DA 3CMAT 3OYYA 2JNGA 1YJWT 4IUVA 3OYFA 2CGHA 3V7SA 1S72T 1QP2A 2JN0A 4KUDK 2EYQA 3FB9A 3L2ZA 2EFIA 3MP6A 3CCMT 3CCUT 1N8RC 2QTXA 5CR2A 2QDYB 2QEXT 3ZFJA 1R8OB 1Y7XA 1HXDA 1O9SA 2PUOB 4M78C 2PUKB 5FU7C 3L2RA 3RERA 4M77A 2Y4YA 2ZPFB 2RJFA 2E12A 2RJEA 3SFMA 2DIGA 3GP8A 5LJ3h 1KHIA 4YTLA 2RJCA 5FU6C 4D6WA 5GANg 3OSSC 3QG1A 3CC4T 4MMLA 1UGPB 5GMKe 4O6JA 1Q82C 5D6WA 3P8HA 3OYJA 3OS2A 2O01E 1G3TA 3JCMc 4C92D 1QVFA 5GAN2 5GAN7 5HK3A 1YI2T 4N4HA 3GOXA 3CCLA 4FT4A 2E64A 2V8JA 2K2VA 5KE2A 1YJ9A 5LJ5h 2F5KA 3BW1A 2EIFA 3FLGA 1YIJA 1KD1U 1G3SA 3CCSA 1PSEA 2QQRA 4PLLA 3A5ZB 3CEYA 4M7DG 3OQ5A 4RG8A 3WVEB 4N4IA 2LCCA 3LLRA 1I4K1 2X4XA 3F70A 3C94A 3E1SA 4M75A 4EPCA 4QVCA 3GF5A 4HA8A 4M7AA 2LCLA 2XDBA 3OYHA 3OYDA 3CCVT 4XU1A 3TEEA 4JS4A 2Y4XA 3OA6A 3QKJA 3EFRA 3OS0A 3PTAA 1D3BA 4BI8B 1YHQA 5CKFA 4LD6A 4Z02A 3CD6A 5CK9A 1VQ8A 3G71A 4BE1A 1I8FA 1Q81C 2C06A 4FM4B 4XTVA 2X4JA 4EDUA 4E7KA 5CKBA 5KCHA 4M77G 4ZN1A 2RHZA 3JCMf 2LC4A 4EMKA 1VQLA 4FL6A 4C92C 4JUVA 2XHCA 4PJOA 5HKCA 4C8QA 2DXTA 2MF2A 4J7FA 1H641 1N9SA 5CIUA 2R5MA 1QVGA 3M56A 5GAMf 3CCJA 3RESA 2R57A 1OZ2A 4ELYC 2MWPA 4OGEA 3H8ZA 3I56T 2KSSA 4XK8E 4C5IA 4C0DB 3KXTA 2RHXA 2P0PA 4M7DE 3PT9A 4BD3A 3QZ5B 3CPWA 4C0FA 1GXIE 2EQKA 4PNOA 3X28B 5FRMA 2XKOC 1LJOA 2EKOA 4QVZA 2A7YA 2R58A 3L2WA 3CMAA 5KH6A 3A8LB 3L2UA 3OY9A 2WSEE 3NTHA 4M75G 3O8VA 4GY5A 4M7AG 4IUUA 4A4FA 2VXEA 5FU6B 3I55A 3OYAA 3J81E 1W4SA 1VQPT 2KVQG 2NLUA 4NL2A 3CCUA 2E65A 4M77E 4JRPA 4J7IA 2RM4A 4A4KA 2EQUA 5D6YA 1OZ3A 2HBPA 2WSFE 1N8RU 3VJPA 4DA4A 4M77B 1X01A 1KQSS 3GIBA 3UT1A 2VUBA 4PJOG 3G6ET 4C5HA 3RIRA 2F69A 4C8QG 2M0OA 5GMKj 3CPFA 2E5QA 3JAME 4UC4A 2K5LA 1VQ6T 4XTUA 4X34A 3J80E 4OB1B 5GANf 5GAOp 1N6AA 3OBYA 3CMEA 3OYLA 5GAOn 3QJYA 1VQOA 1Q82U 4NOYA 2MAMA 4BB7A 3C95A 2LX9A 4XU3A 5FRNA 5CQYA 4M7DD 4M75E 1Q7YC 2XD0A 4HT8A 3URGA 4M7AE 1VQ7T 3MEWA 3OYBA 2RHYA 3PMIA 3QUIA 4BACA 5AYFA 1WJQA 1BI0A 2EJGA 1NPRA 2EAYA 3S6WA 4XTWA 3A8GB 1BI3A 3BDLA 3LW5E 2ZPIB 1VIFA 4XQ3A 5I2MA 1M1GA 1VQMT 4QQ6A 3R6OA 3LH0A 4LDVA 4M75B 3G4SA 5LJ3g 4A53A 4M7AB 2RHIA 4LDUA 1QVGS 3CBPA 3QYHB 2CYZB 3MO8A 3JCMe 3QO3A 2CZ1B 3QHSA 3VYGA 3CC7A 1D3BB 4ZTFA 4X9DA 3TCJA 3LGFA 4M77D 5IAYA 1W2BA 3QSUA 1K8AC 5D6XA 4PJOE 3CPWS 3CCQT 2GCXA 1M5Q1 2DPPB 4C8QE 2JTFA 4C0DC 3L2QA 2JOYA 2EJ9A 2OTLA 1Q86C 1Q81U 2KAFA 5LJ5g 4VUBA 2CS7A 3GNFB 1BI2A 3A8HB 4IURA 2DIQA 2P0KA 4C8QB 1YJNT 4M75F 2QI2A 4C92F 2DKGA 3CCRA 4M7AF 1VQKA 4M7DC 5M9OA 2L5QA 4P5NA 2ZCFB 5CQXA 3JSCA 5GAN3 3QYGB 4FSXA 4N0AA 4R55A 4ATOA 3CCET 1M8VA 2JUFA 1VUBA 2DXCA 2PVDB 2H3JA 2IG0A 5J26A 3X24B 4FT2A 5GMKl 4E7LA 4C0GA 3Q1JA 4PLIA 4N4GA 2KQWA 3PIPA 3KBGA 4M75D 3V8KA 3VV0A 4RG2A 2HQXA 4OVAA 1YITT 3N5BB 2XDDA 3JB9D 4M7AD 2B8AA 3FJPA 1FWZA 1Y71A 4CRIA 5A0GA 1K9MC 4M77C 3JB9J 3OB9A 2XIDA 3HP9A 2K3YA 3J7AF 1KQSA 1DJ7B 2ZPGB 1NJIC 4ME7A 3ASKA 1UGSB 2VGNA 1X75C 2DK3A 3QDRB 4QQDA 1M4ZA 3DLLA 1TH7A 2VGMA 3PIOA 3L42A 3OYCA 2VC8A 3RMQA 4E7JA 1VQNA 4PJOD 2RD1A 5GMKh 1ZBXA 4C8QD 2X4WA 2P4TA 3JCMX 3HKSA 4MMKA 5GAOl 1VQ9T 4A4HA 5I21A 3OYEA 2DJZA 2QQSA 3JCMd 3OS1A 2K57A 3MP1A 2MI6A 2EQMA 5C0MA 2F5TX 4QVDA 3AHUA 1QW1A 3ZEHA 4M75C 3GLXA 4M7AC 5GAMd 3UDCA 1W2BS 4MDXA 2QQBA 1VQ4A 1WPYA 3UPUA 4DOWA 3E19A 3E9FA 4XTZA 4IUTA 2M9UA 2RK1A 4NS5A 4HKEA 3JCMQ 1KC8C 3CC2T 3OYNA 2LQ8A 2QQAA 3M57A 1BI1A 4L6V5 5DLQE 1Q7YU 3JCMW 3OSVA 2RI5A 2X35A 2G3RA 1OYXA 1YCYA 2KDSA 3M5AA 3HFNA 3SWNA 3JCMV 4ELZC 1VQ5A 4PJOC 3C4SA 5FLXE 2RI3A 4KUIA 1O75A 2OAUA 2VYTA 1FX7A 3RKXA 5LJ3f 4C8QC 2E6NA 3TU4K 4M7DB 3JCMb 2DXBA 2EWNA 2XG8D 4JLGA 5C6SA 5GAMj 3MEUA 3HRTA 4E7HA 1YJWA 1G5VA 2QA4T 3M53A 3JB9G 4LDWA 1BYMA 4RCBA 3M4YA 4XU2A 1S72A 1N27A 2L89A 4HT9A 5CKEA 4LDYA 3M9QA 3VU3C 1K8AU 4OB2B 1LNXA 3CCMA 1FXXA 4WF2A 4BUGA 3OW2A 2QEXA 2ZZDA 1AHJB 2DTHA 3DKMA 3MP8A 5CO7A 3V8JA 4B9XA 5I2SA 1YJNA 1Q86U 4FU6A 5LJ5f 3PGGA 1XOVA 5GAN4 3RKYA 2RHUA 2DEQA 1BIBA 3RKWA 2ZPEB 3X26B 5CAIA 4M7DF 4ZGJB 1U1SA 3NFCA 3M59A 5CKHA 5A2QE 1WQ7A 3CCLT 1P92A 1JJ2A 1UEBA 3JRZA 5GANd 3CC4A 1BIAA 3GNGA 5DLOA 3S3MA 2XK0A 1LOJA 5GAN8 3CCST 4BE0A 1M90C 2KK4A 4J6XA 4EMHA 3OMGA 1YI2A 2RI2A 3T9NA 2CKKA 1UGRB 2D9TA 2E70A 1HK9A 3A8OB 3S3NA 4M77F 1KQ2A 1K9MU 3M58A 4F7UA 3INZA 1XQHA 1YHQT 3CD6T 4JRKA 3QJ6A 3P8BB 4PL6A 1N9RA 4ZN3A 5CKDA 1VQ8T 3G71T 1NJIU 2AHJB 4XU0A 5L8RE 5GANj 3X25B 3OYKA 1JRIA 3JCMJ 3CCVA 5GAOr 2DZCA 5LL6S 3JB9H 3M54A 4J5YA 1VQLT 5GAN6 2DXUA 1RL2A 4KULA 2WSCE 1G3YA 4M78D 5GAMe 3CBOA 3PFSA 4NL3A 4O5VA 2BKDN 4J8OA 3ME9A 4ZTJA 2E6ZA 3OBWA 2CZ0B 4EMKB 2XI9A 3CXCS 3LWIA 2YLBA 4R56A 1K73C 3MCAB 2D6FA 3CBMA 4BE2A 1WNLA 4PJOB 2O4XA 4J6YA 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6Z A;  4QQD A;  3H8Z A;  3NTK A;  2BUD A;  3DB4 A;  4C5I A;  3L42 A;  3OYC A;  2RHX A;  2LVM A;  4BD3 A;  4E7J A;  2WAC A;  2GFU A;  2EQK A;  3MEA A;  2K3X A;  2X4W A;  2LTO A;  3PNW C;  5FRO A;  5FRM A;  1WJR A;  2EKO A;  4QVZ A;  2LDM A;  2R58 A;  4A4H A;  5KCO A;  3OYE A;  2EQJ A;  3L2W A;  2QQS A;  3EAE A;  5KH6 A;  2L3R A;  3QII A;  3OS1 A;  3MP1 A;  3NTI A;  3OY9 A;  3NTH A;  2EQM A;  3L2U A;  3O8V A;  4GY5 A;  5C0M A;  2RJD A;  4IUU A;  4A4F A;  3ZEH A;  3OYA A;  3L2V A;  4QQG A;  4B9W A;  2NLU A;  4II1 A;  2R5A A;  3FC3 A;  2X4Y A;  2LRQ A;  2PQW A;  1H3Z A;  2EQU A;  3LGL A;  5D6Y A;  1OZ3 A;  3E9F A;  4IUT A;  4BDY A;  4C5E A;  2GF7 A;  4NS5 A;  2JZ2 A;  3OYN A;  2M16 A;  1XNI A;  3SD4 A;  2XDP A;  2FHD A;  3UT1 A;  4IKF A;  1WJS A;  2RI5 A;  2X35 A;  3DB3 A;  4C5H A;  3OYG A;  2G3R A;  2M0O A;  1OYX A;  2YRV A;  1KHC A;  2E5Q A;  4Q5W A;  4IUV A;  4UC4 A;  3C4S A;  2RI3 A;  3MEV A;  2VYT A;  5IN1 A;  3OYF A;  4X34 A;  2E6N A;  4E7H A;  5C6S A;  3QBY A;  1G5V A;  3MEU A;  3OYL A;  2EFI A;  2M1H A;  3MP6 A;  5J39 A;  1N27 A;  2L89 A;  5FRN A;  3M9Q A;  3S3O A;  3MEW A;  3UWN A;  3OYB A;  3L2R A;  2RHY A;  3PMI A;  4BAC A;  3DLM A;  1WJQ A;  3MET A;  3MP8 A;  4IUQ A;  3S6W A;  3BDL A;  2RJF A;  4B9X A;  2DAQ A;  2RJE A;  4FU6 A;  2DIG A;  4QQ6 A;  3LH0 A;  2RHU A;  2RJC A;  2RHI A;  4A4G A;  4L59 A;  3MO8 A;  1OI1 A;  5D6W A;  3P8H A;  3P8D A;  4A4E A;  3OYJ A;  3OS2 A;  4ZTF A;  3OMC A;  3LGF A;  5IAY A;  5D6X A;  4C5G A;  2BIV A;  3S3M A;  3PMT A;  4N4H A;  2XK0 A;  3GOX A;  2GFA A;  4BE0 A;  2JTF A;  3L2Q A;  5KE2 A;  3OMG A;  2RI2 A;  4E7I A;  2CKK A;  2F5K A;  3FLG A;  2D9T A;  2QQR A;  4PLL A;  3CEY A;  4IUR A;  2DIQ A;  2P0K A;  3OQ5 A;  3S3N A;  4N4I A;  3KUF A;  2LCC A;  3LLR A;  4HCZ A;  2X4X A;  3F70 A;  1WGS A;  5M9O A;  2O4X B;  3FDR A;  3QJ6 A;  4PL6 A;  3OYH A;  3OYD A;  3OA6 A;  3QKJ A;  5J26 A;  3OS0 A;  2IG0 A;  3LX7 A;  3OYK A;  3E9G A;  4IUP A;  4LD6 A;  4Z02 A;  5KE3 A;  4E7L A;  2L8D A;  3FEO A;  4BE1 A;  3Q1J A;  4PLI A;  4N4G A;  3OYI A;  4E7K A;  4EDU A;  3LYI A;  4RG2 A;  2HQX A;  4OVA A;  5KCH A;  2RO0 A;  2RHZ A;  2B8A A;  3OYM A;  2MWO A;  4CRI A;  3PFS A;  1SSF A;  4FL6 A;  2BKD N;  1MHN A;  3ME9 A;  4ZTJ A;  3OB9 A;  4BDZ A;  4QW2 A;  2K3Y A;  5CIU A;  1RI0 A;  2R5M A;  4BE2 A;  2R57 A;  2O4X A;  1OZ2 A;  3ASK A;  2HQE A;  2MWP A; 
#chains in the Genus database with same CATH topology
 1WQW A;  3H6Z A;  4JLI A;  2A08 A;  1W2B P;  4M78 A;  3OW2 S;  4FCY A;  2KYB A;  1KC8 U;  4LE9 A;  4F16 A;  3EAE A;  3SWN B;  1UB4 A;  1MGQ A;  3MJX A;  2RJD A;  1MMA A;  2PNI A;  3BDU A;  4C8Q F;  2DD4 A;  4AFZ C;  5LJ5 e;  2QA4 A;  3VKI A;  2LJ3 A;  1Y0M A;  1T0J A;  5J3B A;  3SEM A;  4BDY A;  2FRW A;  2VWF A;  4M4Z A;  1NG2 A;  5GAO m;  1FMV A;  1ZSG A;  1TSF A;  4LD9 K;  2KBT A;  3H9N A;  1IRE B;  2MCN A;  3NPF A;  1VQO T;  2KGT A;  2V8K A;  5IN1 A;  1M2O A;  4FYW B;  3VUZ A;  1UFF A;  4ANJ A;  3QXE B;  5DY9 A;  4M78 G;  4HCB A;  2LJ1 A;  2CZ6 B;  2NUP B;  4PK4 A;  1VQ9 Q;  4XAX B;  4X9C A;  1M90 U;  3REB B;  4C92 A;  1NPP A;  3BE3 A;  4IUQ A;  2DAQ A;  1U8R A;  2O31 A;  1ZSZ A;  4Y92 A;  4RCC A;  4A4G A;  4EMK C;  3P8D A;  5LJ3 d;  2YUO A;  2LQK A;  4C5G A;  2YSQ A;  2OTJ Q;  1TU0 B;  2X51 A;  3VS2 A;  3EGX A;  4J9F A;  2QGG A;  2O4X B;  3FIF A;  3SWN C;  1K9A A;  3SDZ A;  1TXQ A;  1UGQ B;  2K4Y A;  5A0L A;  4M78 B;  4MZP A;  1RI9 A;  1Y07 A;  2D1X A;  4PJM A;  4RTV A;  1KD1 C;  1ZQ1 A;  1YJ9 T;  4C92 G;  4JDS A;  3OYM A;  1K8A R;  3OW2 P;  1QCF A;  1U1T A;  1M30 A;  1I5L A;  5LJ5 j;  4HCC A;  2JMC A;  2VAS A;  1M1F A;  4Z8A A;  4KT0 E;  4M78 F;  2CP7 A;  3JCM g;  1YBY A;  1V29 B;  4J9C A;  1IB8 A;  2L3R A;  3VS7 A;  4PJL A;  1Q82 R;  1VQ9 A;  5GAM g;  3THK A;  3WXM B;  1VQ8 Q;  3G71 Q;  1VQ4 T;  4II1 A;  2R5A A;  3MKD A;  4J6W A;  2HD0 A;  1VQL Q;  1NE8 A;  2JZ2 A;  4C92 B;  2CUD A;  1X6B A;  2KRN A;  1ZSZ B;  3DB3 A;  4FIB A;  2OTJ A;  2A28 A;  2AKK A;  2K9G A;  2QAZ A;  4CC4 B;  5FW9 A;  2IIM A;  3CMA T;  3V7S A;  1UG1 A;  1S72 T;  4CC3 A;  2JN0 A;  4J9G A;  2EYQ A;  3FB9 A;  4JJD A;  2QDY B;  1R8O B;  4J9E A;  3UF4 A;  1VA7 A;  4M78 C;  2PUK B;  3L2R A;  1BCO A;  3EGX B;  2Y4Y A;  2ZPF B;  2FO0 A;  5LJ3 h;  3CCU Q;  1PM3 A;  1KHI A;  4YTL A;  2RJC A;  5GAN g;  5GMK e;  5D6W A;  1X6G A;  3OYJ A;  5GJW B;  3MPU B;  5GAN 2;  1YI2 T;  2NUZ A;  3C0C A;  2FZC B;  2V8J A;  2KRM A;  2CP6 A;  2EIF A;  1G3S A;  1OX9 A;  4PLL A;  1WHG A;  4ZNX A;  2QYZ A;  4RG8 A;  1ACM B;  3LLR A;  3CME Q;  3E1S A;  2LCL A;  3OYH A;  4XU1 A;  3EFR A;  1D3B A;  4FYV B;  5CKF A;  2FPD A;  1VQ8 A;  3G71 A;  4BE1 A;  3H0H A;  1I8F A;  1Q81 C;  1WI7 A;  1ZUU A;  4LUD A;  1D1A A;  4WTO B;  1VQL A;  4C92 C;  4JUV A;  2XHC A;  3VS4 A;  3CC7 Q;  1UDL A;  1ZSZ C;  4J7F A;  1QVG A;  3M56 A;  2R57 A;  4K11 A;  2MWP A;  2KSS A;  2F1L A;  2P0P A;  4M7D E;  1W6X A;  3PT9 A;  3CPW A;  2EQK A;  1EX4 A;  5IHI A;  5FRM A;  3CCR Q;  2XKO C;  1ZUY A;  1JO8 A;  2R58 A;  5GJV B;  2X9H A;  3L2W A;  2RN8 A;  2SEM A;  1K1Z A;  3OY9 A;  1SHF A;  3SHW A;  2VXE A;  1W4S A;  2DMO A;  2ECZ A;  3CCU A;  1TOV A;  4J7I A;  3TSZ A;  1QKW A;  1KJW A;  4A4K A;  1K73 R;  1H8K A;  1VYV A;  4R0K A;  4C5H A;  2COW A;  5GMK j;  3CPF A;  2E5Q A;  4UC4 A;  4XTU A;  2CSQ A;  3VRY A;  1VQN Q;  1NYF A;  2HKN A;  3CME A;  3OYL A;  5FRN A;  2HMA A;  4M7D D;  1Q7Y C;  3M0U A;  3GBQ A;  2SRC A;  4BAC A;  3EH2 A;  1BI0 A;  1NPR A;  2EAY A;  3S6W A;  3A8G B;  1BI3 A;  3BDL A;  3LW5 E;  1B7T A;  1M1G A;  4QQ6 A;  1QVG S;  1RLQ C;  3QO3 A;  9ATC B;  3CC7 A;  1D3B B;  3LGF A;  3QSU A;  5D6X A;  4PJO E;  3CPW S;  2JTF A;  1D0Z A;  3RBB B;  3L2Q A;  2HEQ A;  2M02 A;  1PHT A;  3A8H B;  1E7O A;  1PKS A;  2DIQ A;  2P0K A;  5KYY A;  2QI2 A;  3CCR A;  3R6N A;  4FSX A;  3CCM Q;  4ATO A;  2JUF A;  1HJD A;  2DEU A;  5GMK l;  4E7L A;  3Q1J A;  3PIP A;  1UHF A;  1WLP B;  4RG2 A;  1NEB A;  2XDD A;  4J9I A;  4KH1 B;  1FWZ A;  4CRI A;  3HP9 A;  5HCK A;  2K3Y A;  4ME7 A;  3ASK A;  2VGN A;  3PIO A;  3L42 A;  1SG5 A;  2MPX C;  1C6V X;  1VQN A;  4PJO D;  2GTO A;  1LCK A;  3JCM X;  4MMK A;  1VQ9 T;  3OYE A;  2DJZ A;  2QQS A;  1OPK A;  2K57 A;  1KD1 R;  2ED0 A;  2MI6 A;  4LN2 A;  1UJ0 A;  1QW1 A;  2B86 A;  3VS1 A;  2QQB A;  2HCK A;  1WPY A;  4E7Z A;  3E19 A;  2DFU A;  4XTZ A;  4NS5 A;  3OYN A;  3JCM W;  2M0Y A;  1YCY A;  3JCM V;  2FEI A;  2RI3 A;  4KUI A;  2NUT A;  2YUP A;  1QVG P;  2YRD A;  2EWN A;  5C6S A;  2XG8 D;  1ZA2 B;  4JLG A;  3JCM b;  1G5V A;  4LDW A;  4XU2 A;  4HT9 A;  1N27 A;  1IO6 A;  2L89 A;  3H0I A;  1K8A U;  1W1F A;  3CPW P;  3CCM A;  1FXX A;  4BUG A;  2L3Q A;  1AWW A;  3V8J A;  5I2S A;  5KYU B;  5KYY B;  3TSW A;  5I22 A;  1IHW A;  2DEQ A;  2YDL A;  1VQP Q;  3X26 B;  4AG2 C;  1GFC A;  1U1S A;  3NFC A;  5CKH A;  2PTK A;  3JRZ A;  2OJ2 A;  2K7A A;  2CKK A;  1EFN A;  2O9S A;  3G6E Q;  1OU8 A;  1WXU A;  3S3N A;  2CRE A;  2KXC A;  1MV0 B;  1MV3 A;  1KQ2 A;  3QJ6 A;  4PL6 A;  1G83 A;  1VQ8 T;  3G71 T;  2P84 A;  1JRI A;  1IXD A;  5LL6 S;  1VQL T;  1VQ7 Q;  5GAN 6;  1G3Y A;  3EFO A;  1WFW A;  3EG0 A;  2K79 A;  3CXC S;  4R56 A;  1WNL A;  3R6O A;  4J6Y A;  1AD5 A;  1X6O A;  3QWY A;  2Z0W A;  2HSP A;  3CCQ Q;  2FB7 A;  2YLC A;  3MEA A;  1M1K C;  1H92 A;  1MNE A;  4OB0 B;  4V2S A;  2DRK A;  6AT1 B;  2EYW A;  3KFV A;  2DD5 A;  3WVD B;  4BI3 A;  5HY6 A;  2LNV A;  5HK0 A;  4RTT A;  2NUT B;  2F2X A;  1Z9Z A;  4Y91 A;  2H8H A;  2RB6 A;  3CCE Q;  2D0Q B;  1A0N B;  1JXO A;  1VQP A;  2V8I A;  1YIT Q;  2FHD A;  4E47 A;  2JVV A;  1IGQ A;  2HAX A;  1QP3 A;  4Q5W A;  2RNA A;  3CME T;  3HSB A;  3G6E A;  3M4G A;  1K76 A;  1VIE A;  5J39 A;  4DBH A;  1LVK A;  3S3O A;  4F7U E;  2EBP A;  2KI7 A;  1SKU B;  4J83 A;  3DLM A;  4OML A;  1VQ7 A;  2BE9 B;  3V7C A;  3CC7 T;  1AEY A;  2FYK A;  1OI1 A;  1JBM A;  2HNI A;  1C1A A;  2F2W A;  5GAO q;  4A4E A;  1JEG A;  3CC2 Q;  1LPL A;  4FYY B;  2XIC A;  2BE7 D;  3CCQ A;  2L0A A;  7AT1 B;  3CCR T;  3EFO B;  4KGV B;  4FYX B;  4JRI A;  5LJ5 d;  3HHT B;  2LCS A;  2EGE A;  4MZT A;  1K73 U;  4BI4 A;  4DEY A;  1I81 A;  4RKU E;  3LX7 A;  2EYZ A;  4D8K A;  1PC0 A;  1G3W A;  4IUP A;  5FU7 B;  1M2V A;  2L8D A;  4OF1 A;  3CCE A;  3LYI A;  2YUQ A;  2GQV A;  2RO0 A;  1M9S A;  1XTD A;  1YIJ T;  2ZPB B;  1SSF A;  4ESR A;  1YIT A;  3FRN A;  1QVF S;  4QW2 A;  1SPK A;  4ZGE B;  1V76 A;  4OMN A;  3CCL Q;  1VQN T;  3QWX X;  2MMP A;  5GAN 5;  1QVP A;  1WHL A;  2WAC A;  2COZ A;  2K5I A;  3PNW C;  4GLK A;  2LQN A;  2YWW A;  5EG2 A;  1M3B A;  3QII A;  2DTI A;  1M3C A;  2Y90 A;  1PWT A;  1TWB A;  2JXB A;  4B9W A;  1IZ6 A;  1G2B A;  1ZHI A;  5CVI A;  4A54 A;  3CQT A;  3UAT A;  5DM7 R;  1ARK A;  2GF7 A;  5KYN A;  1XNI A;  2XDP A;  2KMT A;  3CCJ Q;  3CC2 A;  4M7D A;  1UEC A;  2JNG A;  1PG5 B;  1FMW A;  2CGH A;  4AT1 B;  4KUD K;  2DF6 A;  2HBW A;  2EFI A;  3MP6 A;  3CCM T;  1N8R C;  1J3T A;  1X69 A;  1Y7X A;  4DBF A;  5FU7 C;  2DL8 A;  3VS6 A;  2L3P A;  3EGD B;  2ROT A;  1WIE A;  2DBK A;  1OV3 A;  2K3B A;  1K4U S;  1QWE A;  4AG1 C;  5GAN 7;  5HK3 A;  2AT1 B;  5KYX A;  3CCL A;  2E64 A;  5LJ5 h;  2EYY A;  3BW1 A;  1KD1 U;  3FLG A;  3VS3 A;  1PSE A;  1BK2 A;  3CEY A;  4M7D G;  4EPC A;  3GF5 A;  1U5S A;  3TVT A;  1YFN A;  1QVF P;  2AZV A;  2DRM A;  1OEB A;  2Y4X A;  3PTA A;  3IQL A;  4LD6 A;  5CK9 A;  3AT1 B;  2C06 A;  4E7K A;  2EQI A;  2QG9 B;  1TUC A;  3G4S Q;  5KCH A;  4ZN1 A;  2MYS A;  2RHZ A;  3JCM f;  1M8M A;  2KR3 A;  1UTI A;  3NMZ C;  4PJO A;  3M0T A;  2MF2 A;  1N9S A;  5GAM f;  1PD1 A;  3CCJ A;  3RES A;  3H41 A;  1H3H A;  2OTL Q;  4XK8 E;  2EVR A;  4C0D B;  1K0S A;  4BD3 A;  2YRC A;  3QZ5 B;  4PNO A;  4LUE A;  1AWX A;  1LJO A;  2EKO A;  2RQV A;  2A7Y A;  1M3A A;  5KH6 A;  2WSE E;  3O8V A;  2KRO A;  1GL5 A;  4A4F A;  2MK5 A;  1VQP T;  4NL2 A;  4M77 E;  4JRP A;  4E2F B;  2RM4 A;  1WZO A;  2EQU A;  3VJP A;  2DJQ A;  5L23 A;  1KQS S;  3GIB A;  4PJO G;  3G6E T;  2DA9 A;  2M0O A;  1M1K R;  2K5L A;  4X34 A;  5GAO p;  5GAN f;  1N6A A;  3OBY A;  2CP5 A;  4B6M A;  5KYX B;  5GAO n;  4NOY A;  4BB7 A;  1GBQ A;  3URG A;  4M7A E;  1VQ7 T;  3MEW A;  3OYB A;  1YP5 A;  1WJQ A;  5I2M A;  2DER A;  3G4S A;  5LJ3 g;  4A53 A;  3CBP A;  3ZL7 C;  3JCM e;  2HSE B;  1U3O A;  2X3W D;  4M77 D;  5IAY A;  3CCQ T;  1N5Z A;  4C8Q E;  1WXT A;  1NLP C;  4C0D C;  2OTL A;  1Q86 C;  1VQ5 Q;  1PCX A;  1Q81 U;  3GNF B;  1BI2 A;  4IUR A;  1YJN T;  4C92 F;  1KIK A;  4M7D C;  5M9O A;  3O5Z A;  1ZLM A;  4P5N A;  3CCE T;  1M8V A;  1VUB A;  2DXC A;  3X24 B;  4JZ4 A;  2QEX Q;  3KBG A;  1YIT T;  2EKH A;  4M7A D;  3FJP A;  5A0G A;  1K9M C;  3PVQ A;  3JB9 J;  2ENM A;  3OB9 A;  1DJ7 B;  1X75 C;  3M0R A;  4QQD A;  2E3I A;  1TH7 A;  3OYC A;  2VC8 A;  3RMQ A;  5GMK h;  1BU1 A;  4C8Q D;  2P4T A;  4JPB W;  4A4H A;  2LJ0 A;  4DBR A;  3OS1 A;  1KQS P;  4QVD A;  2BTT A;  3CCV Q;  2FZG B;  3UDC A;  4J9B A;  2OX7 A;  4MDX A;  3UPU A;  1HD3 A;  4J9H A;  3CC2 T;  1G8X A;  1RAG B;  2V1R A;  2QQA A;  4L6V 5;  5DLQ E;  1Q7Y U;  4RTZ A;  3OSV A;  2RI5 A;  1UUE A;  1VQ5 A;  4PJO C;  2OAU A;  2VYT A;  1FX7 A;  2E6N A;  4E7H A;  5GAM j;  3MEU A;  2J05 A;  2QA4 T;  3JB9 G;  1BYM A;  5ECA A;  3PVL A;  3U23 A;  4LDY A;  1SRL A;  8AT1 B;  1WHK A;  2QEX A;  2ZZD A;  4QT7 A;  3MP8 A;  4B9X A;  1RAH B;  3PGG A;  5KYW A;  2JW4 A;  3RKY A;  4CC2 A;  2LQW A;  5CAI A;  1ZUK A;  2CT4 A;  4JJC A;  3M59 A;  5A2Q E;  3CCL T;  1P92 A;  1CKA A;  4FW1 A;  3GNG A;  5DLO A;  2XK0 A;  1LOJ A;  1RLP C;  5GAN 8;  2RI2 A;  1CSK A;  1N8R R;  3A98 A;  1RAI B;  1VQ6 Q;  2C0T A;  4F7U A;  4OMM A;  4FSS A;  1TUG B;  1N9R A;  4ZN3 A;  5CKD A;  5GAN j;  1WDX A;  3CCV A;  2DXU A;  1RL2 A;  2A37 A;  4KUL A;  4M78 D;  3CBO A;  3PFS A;  4O5V A;  2BKD N;  4J8O A;  2KYM A;  1QCO A;  2QDL A;  2E6Z A;  1HYO A;  2D6F A;  1R0B G;  4MZM A;  4WCI A;  3NTK A;  3JB9 F;  1ZX6 A;  2BUD A;  3DB4 A;  2QTV A;  5GMK m;  5IT9 E;  2PVO B;  2DBM A;  2GFU A;  3NHN A;  3JCM P;  2LNH B;  4OMF B;  1NBE B;  2D8H A;  1QMC A;  1T0H A;  4F7U G;  3V7R A;  4JRQ A;  2ZGW A;  2YXY A;  1MMD A;  2QXF A;  2PQW A;  2ZPH B;  5EC7 A;  1D0X A;  4C5E A;  2DZ9 A;  3X20 B;  1T3L A;  2JM9 A;  1YWO A;  1PSF A;  2DE0 X;  5KYW B;  2PU9 B;  2BZX A;  2YRV A;  1PRM C;  1KHC A;  2YT6 A;  1YWP A;  2DTO A;  3EG1 A;  4RMO A;  2D0N A;  3EFS A;  4OGC A;  5A0D A;  4XTY A;  2FVU A;  1NZ9 A;  3OS5 A;  1OOT A;  2FL7 A;  3QBY A;  4ZGD B;  1VQ6 A;  4AMC A;  2M1H A;  3VS0 A;  5CCA A;  1TUD A;  2G6F X;  2OI3 A;  3L1A A;  2FZK B;  4E7S A;  3G4S T;  1RAF B;  4C0Z A;  2M51 A;  2CZ7 B;  1PRL C;  2OTJ T;  4F7U B;  1X2Q A;  4L59 A;  3RR6 A;  3GPL A;  2LT1 A;  2GGR A;  3OMC A;  2O2O A;  3NGP A;  2VXF A;  1KSW A;  3CXC A;  2HL3 A;  2VV5 A;  2OTL T;  2BIV A;  3PMT A;  3EHQ A;  4E7I A;  3SB2 A;  3EG3 A;  2RQU A;  3V8L A;  2JS0 A;  3KUF A;  3EG9 A;  1QWF A;  4HCZ A;  3HFO A;  4F7U F;  1WGS A;  3LWH A;  4KBM B;  4GLM A;  3UA7 A;  3HRS A;  1PNJ A;  3OYI A;  2PVG B;  1AT1 B;  1M1K U;  1BKB A;  2DVE A;  2K5F A;  5IHN A;  1UGV A;  1WHM A;  3VRZ A;  2DYI A;  1MHN A;  2J6F A;  1RI0 A;  1Q86 R;  3E2U A;  2I2L A;  5IHK A;  4CI0 C;  2CP0 A;  1YJ9 Q;  3I5R A;  3A8M B;  3ER0 A;  2JM8 A;  5FRO A;  2X3X D;  1WJR A;  3MHX A;  1KG1 A;  2DVJ A;  4FW2 A;  2RK2 A;  3HL8 A;  4TVR A;  4JS5 A;  1YHQ Q;  3I35 A;  1TTH B;  1PKT A;  4QQG A;  4X1V A;  1K9M R;  2J06 A;  2E4H A;  2DM1 A;  2QQ9 A;  4Y28 E;  1F1B B;  1D0Y A;  3SD4 A;  2E41 A;  1VQ5 T;  1ZA1 B;  2E1H A;  3TRE A;  3QZ9 B;  1SEM A;  3OYY A;  1QP2 A;  1Q81 R;  3CCU T;  5CR2 A;  1R77 A;  2QEX T;  1WYX A;  3CMA Q;  2PUO B;  2CUB A;  4M77 A;  3EG9 B;  1MMN A;  2RJF A;  3I55 Q;  3GP8 A;  2GQI A;  5FU6 C;  2J6K A;  2RQT A;  4MML A;  1UGP B;  1YN8 A;  1Q82 C;  2HZY A;  1MMG A;  3OS2 A;  1OX8 A;  1G3T A;  2O01 E;  1QVF A;  3REA B;  2YUN A;  4N4H A;  4OMP A;  3GOX A;  2GBQ A;  4FT4 A;  1YJ9 A;  4F14 A;  3A5Z B;  2K2M A;  1I4K 1;  2X4X A;  4QVC A;  4HA8 A;  2AKL A;  4M7A A;  2XDB A;  3CCV T;  1RAC B;  2FRY A;  2JTE A;  1YHQ A;  3OS0 A;  1AOJ A;  4BI8 B;  3I9Q A;  4XTV A;  2X4J A;  5CKB A;  1OPL A;  4M77 G;  2I0N A;  4EMK A;  2V1Q A;  4FL6 A;  2LMJ A;  5HKC A;  4C8Q A;  2K6D A;  1H64 1;  5CIU A;  2R5M A;  1W70 A;  1JQQ A;  4OGE A;  1Q7Y R;  3H8Z A;  4RTU A;  2FPF A;  3CXC P;  4C0F A;  1GXI E;  4LXC A;  1VQK Q;  4QVZ A;  3CMA A;  3L2U A;  1E6G A;  3NTH A;  4GY5 A;  4M7A G;  2HQH A;  3I55 A;  2ATC B;  3OYA A;  1SSH A;  2KVQ G;  2NLU A;  1AZE A;  2F2V A;  5D6Y A;  1OZ3 A;  2WSF E;  1N8R U;  2EPD A;  4M77 B;  4PFP A;  1X01 A;  2BZY A;  3UT1 A;  2VUB A;  2J7I A;  3RIR A;  4C8Q G;  2DL4 A;  3RDV A;  1RAD B;  1VQ6 T;  3J80 E;  4OB1 B;  2KT8 A;  1BBZ A;  3QJY A;  3C95 A;  5CQY A;  4M75 E;  2XD0 A;  4HT8 A;  2JMA A;  3PMI A;  1WA7 A;  1RUW A;  2ZPI B;  2DET A;  3H0F A;  4M7A B;  4LDU A;  2JS2 A;  1RAB B;  3QYH B;  2CYZ B;  3MO8 A;  2CZ1 B;  3QHS A;  1WHJ A;  4ZTF A;  2LX7 A;  4X9D A;  3TCJ A;  2GCX A;  1M5Q 1;  5FWC A;  4HVV A;  2ESW A;  2EJ9 A;  2KAF A;  1OU9 A;  1UHC A;  5LJ5 g;  2GTJ A;  1GCQ A;  4C8Q B;  1YJW Q;  4PJN A;  4M7A F;  1VQK A;  2CH4 W;  2L5Q A;  2ZCF B;  5CQX A;  3JSC A;  5GAN 3;  3QYG B;  4N0A A;  5IH2 A;  2IG0 A;  1X43 A;  4QKU A;  4FT2 A;  1FYN A;  4C0G A;  4M75 D;  3V8K A;  3VV0 A;  1M2V B;  2B8A A;  2DL5 A;  2RPN A;  1GFD A;  1Y71 A;  4M77 C;  2XID A;  3CC4 Q;  2PZ1 A;  1KQS A;  2ZPG B;  1NJI C;  4AFQ C;  1M4Z A;  3QDF A;  2VGM A;  3TQ7 P;  1VYU A;  4E7J A;  2RD1 A;  1ZBX A;  5GAO l;  2LZ6 B;  5I21 A;  2P4R A;  2DNU A;  1WX6 A;  2DL3 A;  3JV3 A;  3JCM d;  3A1P A;  2EQM A;  2AIR B;  5C0M A;  2EYX A;  3AHU A;  4RTW A;  1AWO A;  2XMF A;  4M7A C;  5GAM d;  1JU5 C;  2KXD A;  4IUT A;  1CKB A;  1KC8 C;  4HKE A;  3JCM Q;  1GCP A;  3M57 A;  1MND A;  1R0C B;  2X35 A;  2G3R A;  2KDS A;  3M5A A;  4PFO A;  3HFN A;  4ELZ C;  3C4S A;  5FLX E;  4C8Q C;  1O75 A;  3FJ5 A;  3RKX A;  3TU4 K;  5LJ3 f;  4M7D B;  3I56 Q;  2DXB A;  1YJW A;  2EGC A;  3M53 A;  3PE0 A;  1M27 C;  3M4Y A;  2E5K A;  2COY A;  4RCB A;  4Z89 A;  4OB2 B;  1QKX A;  4WF2 A;  5I11 A;  3M0Q A;  2V26 A;  5CO7 A;  1Q86 U;  1XOV A;  2W10 A;  5GAN 4;  1BIB A;  3RNJ A;  4M7D F;  4ZGJ B;  2CP2 A;  1JJ2 A;  3CC4 A;  1UEB A;  5GAN d;  4BE0 A;  1M90 C;  2RMO A;  3LH5 A;  3T9N A;  1UGR B;  4GBQ A;  4AFS C;  2E70 A;  1E6H A;  1Y57 A;  3A8O B;  1K9M U;  2IPO B;  3M58 A;  1ABQ A;  3INZ A;  1YHQ T;  4JRK A;  2C0I A;  3P8B B;  1KK7 A;  1MUZ A;  2AHJ B;  3OYK A;  3JCM J;  2DZC A;  1JXM A;  3JB9 H;  3M54 A;  4J5Y A;  2C0O A;  1IHV A;  1VQM Q;  5GAM e;  4NL3 A;  4ZTJ A;  2CZ0 B;  2XI9 A;  3M0S A;  3LWI A;  2YLB A;  4J9D A;  4BE2 A;  4PJO B;  4DOV A;  3JCM h;  1B3Q A;  5LJ3 e;  3I56 A;  2VKN A;  4EIK A;  2RA2 A;  1EZZ B;  2JT4 A;  2LDM A;  5GAM h;  5D7U A;  2YHT A;  3I55 T;  1GCQ C;  2DO3 A;  4L5G A;  4PJO F;  1RAA B;  1JJ2 S;  2X4Y A;  4N0A C;  2LRQ A;  4BY6 B;  3ZBD A;  1H3Z A;  3LGL A;  1Y96 A;  2ZAE A;  4MDW A;  2DYB A;  2M16 A;  1WJS A;  2A3L A;  3G7Z A;  1GRI A;  5GAN e;  1D1B A;  4KRT A;  4HCK A;  3MEV A;  2LT4 A;  2KEA A;  1EIF A;  2JJ9 A;  2ED1 A;  3HPW A;  3JB9 I;  3HRU A;  2HKQ B;  1KQ1 A;  1B34 A;  3UWN A;  2DIL A;  1FMK A;  2ROL A;  3MET A;  4BDZ A;  1QLY A;  5GAN h;  2JTM A;  1VQM A;  2KE9 A;  4PJJ A;  4JJN K;  1YCS B;  3C12 A;  2GFA A;  1OQK A;  3VUB A;  4A63 B;  1VQK T;  5GMK i;  4M78 E;  2FPE A;  3FDR A;  5LJ3 j;  4DQ2 A;  2FG0 A;  3E9G A;  5KE3 A;  3FEO A;  1XJW B;  1NEG A;  4LDX A;  4XTX A;  1PD0 A;  4BY6 C;  3QPH A;  1Q95 G;  2E10 A;  2MWO A;  4PKC C;  1OUL A;  5IXF A;  1NYG A;  5AT1 B;  5FWB A;  1I0C A;  2P0Q A;  2MIO A;  2HQE A;  2AK5 A;  3EHR A;  1Y96 B;  1YIJ Q;  1JJ2 P;  3CCS Q;  2LVM A;  2J6O A;  2K3X A;  4OP0 A;  3RMS A;  2LTO A;  3I5S A;  2RH2 A;  5KCO A;  2XU8 A;  2E3H A;  2EQJ A;  3VYH B;  2RQR A;  3NTI A;  1NLO C;  3BY7 A;  3CD6 Q;  2KY9 A;  3CCJ T;  3M55 A;  3L2V A;  4OB3 B;  4C92 E;  1JB0 E;  3RUX A;  1S1N A;  3FC3 A;  1IGU A;  4EMG A;  4DEX A;  3VS5 A;  1NJI R;  1B34 B;  2IVW A;  4IKF A;  2EJF A;  3BFM A;  3OYG A;  1YJW T;  2A36 A;  4IUV A;  3OYF A;  2QK0 A;  1WHH A;  4F04 B;  3L2Z A;  2QTX A;  1I07 A;  2NWM A;  3ZFJ A;  1QCN A;  1HXD A;  1O9S A;  1UE9 A;  1VOM A;  5KYU A;  1RAE B;  3RER A;  1I5O B;  2E12 A;  2RJE A;  3SFM A;  2DIG A;  1KC8 R;  3EGU A;  4D6W A;  4D8D A;  3G1J A;  3EH1 A;  3OSS C;  2CDT A;  2DLP A;  3QG1 A;  4JJB A;  4O6J A;  3CC4 T;  2L2P A;  3P8H A;  3JCM c;  4C92 D;  1AZG B;  2KT1 A;  4E6R A;  2O9V A;  1TS9 A;  1C0M A;  2K2V A;  5KE2 A;  2F5K A;  1YIJ A;  3CCS A;  2QQR A;  3OQ5 A;  3WVE B;  4N4I A;  2NYS A;  2LCC A;  3F70 A;  1VQO Q;  3ULR B;  3C94 A;  4M75 A;  3OYD A;  1ZBJ A;  3TEE A;  4JS4 A;  3OA6 A;  3QKJ A;  3CD6 A;  4Z02 A;  4FM4 B;  4EDU A;  1IRX A;  2LC4 A;  1M90 R;  2DXT A;  5IXB A;  1OZ2 A;  4ELY C;  3I56 T;  4C5I A;  3KXT A;  2RHX A;  2DX1 A;  1SF9 A;  1ABO A;  3D7S B;  3X28 B;  1HSQ A;  2CH4 A;  3A8L B;  4DBQ A;  4M75 G;  2VB6 A;  4IUU A;  5FU6 B;  4KH0 B;  3J81 E;  2E65 A;  2HBP A;  4DA4 A;  2CP3 A;  8ATC B;  2F69 A;  2KNB B;  1T3S A;  3JAM E;  2GNC A;  1Z9Q A;  2EGA A;  1SRM A;  1VQO A;  1Q82 U;  4LNP A;  2MAM A;  2LX9 A;  4XU3 A;  2O88 A;  4RTY A;  3UA6 A;  2RHY A;  3QUI A;  5AYF A;  2EJG A;  1AWJ A;  4XTW A;  4XQ3 A;  1VIF A;  1VQM T;  4LDV A;  3LH0 A;  4M75 B;  2A0F B;  2RHI A;  1VQ4 Q;  3VYG A;  1GBR A;  2QAS A;  4KGZ B;  1W2B A;  1K8A C;  2DPP B;  2AZS A;  2JOY A;  2CT3 A;  1TG0 A;  4VUB A;  2CS7 A;  1YNZ A;  1K0X A;  4M75 F;  2DKG A;  4JZ3 A;  1S72 Q;  2HDA A;  4R55 A;  2PVD B;  5J26 A;  2H3J A;  2KRS A;  1AVZ C;  1YJN Q;  4PFZ A;  2ABL A;  4PLI A;  4N4G A;  2KQW A;  4RUG A;  2HQX A;  4OVA A;  3N5B B;  3JB9 D;  3M0P A;  3J7A F;  1UGS B;  2DK3 A;  3QDR B;  2HL5 C;  3DLL A;  1YI2 Q;  1X2K A;  2X4W A;  2OAW A;  3HKS A;  1X27 A;  1QQJ A;  2BZ8 A;  3MP1 A;  2MOX A;  2L3S A;  2F5T X;  2DL7 A;  3ZEH A;  4M75 C;  3GLX A;  1W2B S;  1D1C A;  4HXJ A;  1VQ4 A;  4DOW A;  3E9F A;  2D8J A;  2M9U A;  2RK1 A;  4CC7 A;  2LQ8 A;  1BI1 A;  2CSI A;  1UJY A;  1OYX A;  3HTR A;  1U06 A;  3SWN A;  1KFZ A;  4Z88 A;  3HRT A;  3EG2 A;  1S72 A;  5CKE A;  3VU3 C;  3M9Q A;  4OMO A;  1LNX A;  4IIM A;  3EGD A;  3OW2 A;  1BCM A;  1AHJ B;  2DTH A;  2VVK A;  3DKM A;  1YJN A;  4FU6 A;  5LJ5 f;  2RF0 A;  2QA4 Q;  2RHU A;  1WXB A;  4AFU C;  3RKW A;  2ZPE B;  4HVU A;  4KGX B;  1V1C A;  1WQ7 A;  1SHG A;  2W0Z A;  4F17 A;  1I1J A;  1D09 B;  1BIA A;  3S3M A;  2LP5 A;  3CCS T;  2KK4 A;  4J6X A;  4EMH A;  3OMG A;  1YI2 A;  2NUP A;  2H3E B;  2D9T A;  1HK9 A;  2EW3 A;  4M77 F;  2RQW A;  1NM7 A;  1XQH A;  4HVW A;  3CD6 T;  1NJI U;  4XU0 A;  5L8R E;  3X25 B;  5GAO r;  4IIO A;  2QGF B;  4RTX A;  2WSC E;  1B07 A;  1BB9 A;  4ORZ A;  3ME9 A;  3OBW A;  4EMK B;  1VYT A;  1K73 C;  4OMQ A;  3MCA B;  3CBM A;  2O4X A; 
#chains in the Genus database with same CATH homology
 1WQW A;  3H6Z A;  4MZM A;  3NTK A;  3JB9 F;  2BUD A;  3DB4 A;  4DOV A;  5GMK m;  5IT9 E;  4JLI A;  2FB7 A;  2PVO B;  2YLC A;  4M78 A;  3JCM h;  2GFU A;  5LJ3 e;  3I56 A;  3MEA A;  1M1K C;  2RA2 A;  3OW2 S;  4OB0 B;  4V2S A;  3JCM P;  1KC8 U;  2LDM A;  4OMF B;  2DD5 A;  3WVD B;  5GAM h;  3EAE A;  3SWN B;  5HY6 A;  1UB4 A;  2LNV A;  2YHT A;  1MGQ A;  4BI3 A;  5HK0 A;  3I55 T;  2DO3 A;  4F7U G;  4L5G A;  2RJD A;  4Y91 A;  4PJO F;  3V7R A;  4JRQ A;  2RB6 A;  3BDU A;  4C8Q F;  2DD4 A;  2ZGW A;  5LJ5 e;  2QA4 A;  2D0Q B;  1JJ2 S;  3VKI A;  2X4Y A;  4N0A C;  2LRQ A;  2QXF A;  4BY6 B;  3ZBD A;  2PQW A;  2ZPH B;  1VQP A;  3LGL A;  1Y96 A;  1H3Z A;  5J3B A;  2V8I A;  4BDY A;  4MDW A;  4C5E A;  2DZ9 A;  3X20 B;  5GAO m;  2M16 A;  1PSF A;  2FHD A;  4E47 A;  2JVV A;  4LD9 K;  1WJS A;  1IRE B;  2A3L A;  2PU9 B;  3G7Z A;  2HAX A;  5GAN e;  2YRV A;  1KHC A;  1QP3 A;  4Q5W A;  2DTO A;  3CME T;  3HSB A;  3G6E A;  1VQO T;  3MEV A;  4RMO A;  2V8K A;  3EFS A;  5IN1 A;  3M4G A;  4OGC A;  3VUZ A;  2LT4 A;  4XTY A;  5A0D A;  2FVU A;  1NZ9 A;  3OS5 A;  2FL7 A;  3QBY A;  3QXE B;  1VIE A;  4ZGD B;  1VQ6 A;  1EIF A;  2M1H A;  3HPW A;  5DY9 A;  5J39 A;  5CCA A;  4M78 G;  4IKF A;  3JB9 I;  4HCB A;  3HRU A;  3S3O A;  2CZ6 B;  4F7U E;  3L1A A;  1KQ1 A;  1B34 A;  4J83 A;  4X9C A;  4XAX B;  3UWN A;  3G4S T;  3DLM A;  1M90 U;  4C0Z A;  4C92 A;  1NPP A;  3MET A;  4IUQ A;  4BDZ A;  2DAQ A;  1U8R A;  1VQ7 A;  2CZ7 B;  2OTJ T;  4RCC A;  4F7U B;  5GAN h;  3V7C A;  3CC7 T;  2JTM A;  4L59 A;  4A4G A;  2FYK A;  1OI1 A;  1VQM A;  3GPL A;  1JBM A;  2HNI A;  2LT1 A;  4EMK C;  5GAO q;  3P8D A;  4A4E A;  5LJ3 d;  4JJN K;  3OMC A;  2VXF A;  2LQK A;  4C5G A;  3CXC A;  2VV5 A;  2OTL T;  3C12 A;  2BIV A;  3PMT A;  2GFA A;  2XIC A;  3VUB A;  4E7I A;  3CCQ A;  3SB2 A;  3CCR T;  1VQK T;  3V8L A;  5GMK i;  3KUF A;  4HCZ A;  3HFO A;  4JRI A;  4F7U F;  4M78 E;  5LJ5 d;  1WGS A;  2O4X B;  3FIF A;  3HHT B;  3SWN C;  3FDR A;  3SDZ A;  4MZT A;  3LWH A;  1K73 U;  1UGQ B;  4BI4 A;  1I81 A;  5LJ3 j;  2K4Y A;  4KBM B;  4RKU E;  3LX7 A;  5A0L A;  4M78 B;  3E9G A;  4IUP A;  1G3W A;  4MZP A;  5FU7 B;  1Y07 A;  4DQ2 A;  5KE3 A;  2L8D A;  3FEO A;  4OF1 A;  3CCE A;  1KD1 C;  4LDX A;  3HRS A;  4XTX A;  1ZQ1 A;  3OYI A;  3LYI A;  4BY6 C;  2PVG B;  3QPH A;  1YJ9 T;  2GQV A;  4JDS A;  2RO0 A;  4C92 G;  1M9S A;  1M1K U;  1BKB A;  1XTD A;  2DVE A;  2E10 A;  2K5F A;  3OYM A;  1YIJ T;  2MWO A;  2ZPB B;  1SSF A;  1MHN A;  1YIT A;  4PKC C;  1U1T A;  3FRN A;  1QVF S;  4QW2 A;  1I5L A;  5LJ5 j;  4ZGE B;  4HCC A;  1RI0 A;  2I2L A;  2P0Q A;  4CI0 C;  2HQE A;  1VQN T;  1M1F A;  2MMP A;  4KT0 E;  5GAN 5;  1QVP A;  1Y96 B;  4M78 F;  3A8M B;  2LVM A;  3ER0 A;  2WAC A;  2K3X A;  2K5I A;  4OP0 A;  1YBY A;  3RMS A;  3JCM g;  2LTO A;  3PNW C;  5FRO A;  1V29 B;  4GLK A;  1WJR A;  2RH2 A;  3MHX A;  5KCO A;  2XU8 A;  1KG1 A;  2RK2 A;  2EQJ A;  3HL8 A;  5EG2 A;  3VYH B;  2L3R A;  3QII A;  4TVR A;  3NTI A;  5GAM g;  2DTI A;  4JS5 A;  1VQ9 A;  2Y90 A;  3BY7 A;  2KY9 A;  3WXM B;  3CCJ T;  3M55 A;  4QQG A;  4OB3 B;  4B9W A;  3L2V A;  1VQ4 T;  4C92 E;  4II1 A;  1IZ6 A;  1JB0 E;  1ZHI A;  2R5A A;  4J6W A;  5CVI A;  3RUX A;  3FC3 A;  2HD0 A;  4A54 A;  5DM7 R;  4EMG A;  1B34 B;  2QQ9 A;  4Y28 E;  2GF7 A;  1NE8 A;  2JZ2 A;  4C92 B;  1XNI A;  3SD4 A;  2XDP A;  2E41 A;  1VQ5 T;  2IVW A;  2E1H A;  2KMT A;  3TRE A;  3QZ9 B;  2EJF A;  3BFM A;  3OYG A;  3CC2 A;  3DB3 A;  4FIB A;  2OTJ A;  4M7D A;  3CMA T;  3OYY A;  2JNG A;  1YJW T;  4IUV A;  3OYF A;  2CGH A;  3V7S A;  1S72 T;  1QP2 A;  2JN0 A;  4KUD K;  2EYQ A;  3FB9 A;  3L2Z A;  2EFI A;  3MP6 A;  3CCM T;  3CCU T;  1N8R C;  2QTX A;  5CR2 A;  2QDY B;  2QEX T;  3ZFJ A;  1R8O B;  1Y7X A;  1HXD A;  1O9S A;  2PUO B;  4M78 C;  2PUK B;  5FU7 C;  3L2R A;  3RER A;  4M77 A;  2Y4Y A;  2ZPF B;  2RJF A;  2E12 A;  2RJE A;  3SFM A;  2DIG A;  3GP8 A;  5LJ3 h;  1KHI A;  4YTL A;  2RJC A;  5FU6 C;  4D6W A;  5GAN g;  3OSS C;  3QG1 A;  3CC4 T;  4MML A;  1UGP B;  5GMK e;  4O6J A;  1Q82 C;  5D6W A;  3P8H A;  3OYJ A;  3OS2 A;  2O01 E;  1G3T A;  3JCM c;  4C92 D;  1QVF A;  5GAN 2;  5GAN 7;  5HK3 A;  1YI2 T;  4N4H A;  3GOX A;  3CCL A;  4FT4 A;  2E64 A;  2V8J A;  2K2V A;  5KE2 A;  1YJ9 A;  5LJ5 h;  2F5K A;  3BW1 A;  2EIF A;  3FLG A;  1YIJ A;  1KD1 U;  1G3S A;  3CCS A;  1PSE A;  2QQR A;  4PLL A;  3A5Z B;  3CEY A;  4M7D G;  3OQ5 A;  4RG8 A;  3WVE B;  4N4I A;  2LCC A;  3LLR A;  1I4K 1;  2X4X A;  3F70 A;  3C94 A;  3E1S A;  4M75 A;  4EPC A;  4QVC A;  3GF5 A;  4HA8 A;  4M7A A;  2LCL A;  2XDB A;  3OYH A;  3OYD A;  3CCV T;  4XU1 A;  3TEE A;  4JS4 A;  2Y4X A;  3OA6 A;  3QKJ A;  3EFR A;  3OS0 A;  3PTA A;  1D3B A;  4BI8 B;  1YHQ A;  5CKF A;  4LD6 A;  4Z02 A;  3CD6 A;  5CK9 A;  1VQ8 A;  3G71 A;  4BE1 A;  1I8F A;  1Q81 C;  2C06 A;  4FM4 B;  4XTV A;  2X4J A;  4EDU A;  4E7K A;  5CKB A;  5KCH A;  4M77 G;  4ZN1 A;  2RHZ A;  3JCM f;  2LC4 A;  4EMK A;  1VQL A;  4FL6 A;  4C92 C;  4JUV A;  2XHC A;  4PJO A;  5HKC A;  4C8Q A;  2DXT A;  2MF2 A;  4J7F A;  1H64 1;  1N9S A;  5CIU A;  2R5M A;  1QVG A;  3M56 A;  5GAM f;  3CCJ A;  3RES A;  2R57 A;  1OZ2 A;  4ELY C;  2MWP A;  4OGE A;  3H8Z A;  3I56 T;  2KSS A;  4XK8 E;  4C5I A;  4C0D B;  3KXT A;  2RHX A;  2P0P A;  4M7D E;  3PT9 A;  4BD3 A;  3QZ5 B;  3CPW A;  4C0F A;  1GXI E;  2EQK A;  4PNO A;  3X28 B;  5FRM A;  2XKO C;  1LJO A;  2EKO A;  4QVZ A;  2A7Y A;  2R58 A;  3L2W A;  3CMA A;  5KH6 A;  3A8L B;  3L2U A;  3OY9 A;  2WSE E;  3NTH A;  4M75 G;  3O8V A;  4GY5 A;  4M7A G;  4IUU A;  4A4F A;  2VXE A;  5FU6 B;  3I55 A;  3OYA A;  3J81 E;  1W4S A;  1VQP T;  2KVQ G;  2NLU A;  4NL2 A;  3CCU A;  2E65 A;  4M77 E;  4JRP A;  4J7I A;  2RM4 A;  4A4K A;  2EQU A;  5D6Y A;  1OZ3 A;  2HBP A;  2WSF E;  1N8R U;  3VJP A;  4DA4 A;  4M77 B;  1X01 A;  1KQS S;  3GIB A;  3UT1 A;  2VUB A;  4PJO G;  3G6E T;  4C5H A;  3RIR A;  2F69 A;  4C8Q G;  2M0O A;  5GMK j;  3CPF A;  2E5Q A;  3JAM E;  4UC4 A;  2K5L A;  1VQ6 T;  4XTU A;  4X34 A;  3J80 E;  4OB1 B;  5GAN f;  5GAO p;  1N6A A;  3OBY A;  3CME A;  3OYL A;  5GAO n;  3QJY A;  1VQO A;  1Q82 U;  4NOY A;  2MAM A;  4BB7 A;  3C95 A;  2LX9 A;  4XU3 A;  5FRN A;  5CQY A;  4M7D D;  4M75 E;  1Q7Y C;  2XD0 A;  4HT8 A;  3URG A;  4M7A E;  1VQ7 T;  3MEW A;  3OYB A;  2RHY A;  3PMI A;  3QUI A;  4BAC A;  5AYF A;  1WJQ A;  1BI0 A;  2EJG A;  1NPR A;  2EAY A;  3S6W A;  4XTW A;  3A8G B;  1BI3 A;  3BDL A;  3LW5 E;  2ZPI B;  1VIF A;  4XQ3 A;  5I2M A;  1M1G A;  1VQM T;  4QQ6 A;  3R6O A;  3LH0 A;  4LDV A;  4M75 B;  3G4S A;  5LJ3 g;  4A53 A;  4M7A B;  2RHI A;  4LDU A;  1QVG S;  3CBP A;  3QYH B;  2CYZ B;  3MO8 A;  3JCM e;  3QO3 A;  2CZ1 B;  3QHS A;  3VYG A;  3CC7 A;  1D3B B;  4ZTF A;  4X9D A;  3TCJ A;  3LGF A;  4M77 D;  5IAY A;  1W2B A;  3QSU A;  1K8A C;  5D6X A;  4PJO E;  3CPW S;  3CCQ T;  2GCX A;  1M5Q 1;  2DPP B;  4C8Q E;  2JTF A;  4C0D C;  3L2Q A;  2JOY A;  2EJ9 A;  2OTL A;  1Q86 C;  1Q81 U;  2KAF A;  5LJ5 g;  4VUB A;  2CS7 A;  3GNF B;  1BI2 A;  3A8H B;  4IUR A;  2DIQ A;  2P0K A;  4C8Q B;  1YJN T;  4M75 F;  2QI2 A;  4C92 F;  2DKG A;  3CCR A;  4M7A F;  1VQK A;  4M7D C;  5M9O A;  2L5Q A;  4P5N A;  2ZCF B;  5CQX A;  3JSC A;  5GAN 3;  3QYG B;  4FSX A;  4N0A A;  4R55 A;  4ATO A;  3CCE T;  1M8V A;  2JUF A;  1VUB A;  2DXC A;  2PVD B;  2H3J A;  2IG0 A;  5J26 A;  3X24 B;  4FT2 A;  5GMK l;  4E7L A;  4C0G A;  3Q1J A;  4PLI A;  4N4G A;  2KQW A;  3PIP A;  3KBG A;  4M75 D;  3V8K A;  3VV0 A;  4RG2 A;  2HQX A;  4OVA A;  1YIT T;  3N5B B;  2XDD A;  3JB9 D;  4M7A D;  2B8A A;  3FJP A;  1FWZ A;  1Y71 A;  4CRI A;  5A0G A;  1K9M C;  4M77 C;  3JB9 J;  3OB9 A;  2XID A;  3HP9 A;  2K3Y A;  3J7A F;  1KQS A;  1DJ7 B;  2ZPG B;  1NJI C;  4ME7 A;  3ASK A;  1UGS B;  2VGN A;  1X75 C;  2DK3 A;  3QDR B;  4QQD A;  1M4Z A;  3DLL A;  1TH7 A;  2VGM A;  3PIO A;  3L42 A;  3OYC A;  2VC8 A;  3RMQ A;  4E7J A;  1VQN A;  4PJO D;  2RD1 A;  5GMK h;  1ZBX A;  4C8Q D;  2X4W A;  2P4T A;  3JCM X;  3HKS A;  4MMK A;  5GAO l;  1VQ9 T;  4A4H A;  5I21 A;  3OYE A;  2DJZ A;  2QQS A;  3JCM d;  3OS1 A;  2K57 A;  3MP1 A;  2MI6 A;  2EQM A;  5C0M A;  2F5T X;  4QVD A;  3AHU A;  1QW1 A;  3ZEH A;  4M75 C;  3GLX A;  4M7A C;  5GAM d;  3UDC A;  1W2B S;  4MDX A;  2QQB A;  1VQ4 A;  1WPY A;  3UPU A;  4DOW A;  3E19 A;  3E9F A;  4XTZ A;  4IUT A;  2M9U A;  2RK1 A;  4NS5 A;  4HKE A;  3JCM Q;  1KC8 C;  3CC2 T;  3OYN A;  2LQ8 A;  2QQA A;  3M57 A;  1BI1 A;  4L6V 5;  5DLQ E;  1Q7Y U;  3JCM W;  3OSV A;  2RI5 A;  2X35 A;  2G3R A;  1OYX A;  1YCY A;  2KDS A;  3M5A A;  3HFN A;  3SWN A;  3JCM V;  4ELZ C;  1VQ5 A;  4PJO C;  3C4S A;  5FLX E;  2RI3 A;  4KUI A;  1O75 A;  2OAU A;  2VYT A;  1FX7 A;  3RKX A;  5LJ3 f;  4C8Q C;  2E6N A;  3TU4 K;  4M7D B;  3JCM b;  2DXB A;  2EWN A;  2XG8 D;  4JLG A;  5C6S A;  5GAM j;  3MEU A;  3HRT A;  4E7H A;  1YJW A;  1G5V A;  2QA4 T;  3M53 A;  3JB9 G;  4LDW A;  1BYM A;  4RCB A;  3M4Y A;  4XU2 A;  1S72 A;  1N27 A;  2L89 A;  4HT9 A;  5CKE A;  4LDY A;  3M9Q A;  3VU3 C;  1K8A U;  4OB2 B;  1LNX A;  3CCM A;  1FXX A;  4WF2 A;  4BUG A;  3OW2 A;  2QEX A;  2ZZD A;  1AHJ B;  2DTH A;  3DKM A;  3MP8 A;  5CO7 A;  3V8J A;  4B9X A;  5I2S A;  1YJN A;  1Q86 U;  4FU6 A;  5LJ5 f;  3PGG A;  1XOV A;  5GAN 4;  3RKY A;  2RHU A;  2DEQ A;  1BIB A;  3RKW A;  2ZPE B;  3X26 B;  5CAI A;  4M7D F;  4ZGJ B;  1U1S A;  3NFC A;  3M59 A;  5CKH A;  5A2Q E;  1WQ7 A;  3CCL T;  1P92 A;  1JJ2 A;  1UEB A;  3JRZ A;  5GAN d;  3CC4 A;  1BIA A;  3GNG A;  5DLO A;  3S3M A;  2XK0 A;  1LOJ A;  5GAN 8;  3CCS T;  4BE0 A;  1M90 C;  2KK4 A;  4J6X A;  4EMH A;  3OMG A;  1YI2 A;  2RI2 A;  3T9N A;  2CKK A;  1UGR B;  2D9T A;  2E70 A;  1HK9 A;  3A8O B;  3S3N A;  4M77 F;  1KQ2 A;  1K9M U;  3M58 A;  4F7U A;  3INZ A;  1XQH A;  1YHQ T;  3CD6 T;  4JRK A;  3QJ6 A;  3P8B B;  4PL6 A;  1N9R A;  4ZN3 A;  5CKD A;  1VQ8 T;  3G71 T;  1NJI U;  2AHJ B;  4XU0 A;  5L8R E;  5GAN j;  3X25 B;  3OYK A;  1JRI A;  3JCM J;  3CCV A;  5GAO r;  2DZC A;  5LL6 S;  3JB9 H;  3M54 A;  4J5Y A;  1VQL T;  5GAN 6;  2DXU A;  1RL2 A;  4KUL A;  2WSC E;  1G3Y A;  4M78 D;  5GAM e;  3CBO A;  3PFS A;  4NL3 A;  4O5V A;  2BKD N;  4J8O A;  3ME9 A;  4ZTJ A;  2E6Z A;  3OBW A;  2CZ0 B;  4EMK B;  2XI9 A;  3CXC S;  3LWI A;  2YLB A;  4R56 A;  1K73 C;  3MCA B;  2D6F A;  3CBM A;  4BE2 A;  1WNL A;  4PJO B;  2O4X A;  4J6Y A;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...