2DXBA

Recombinant thiocyanate hydrolase comprising partially-modified cobalt centers
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
VWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Catalytic Activation of Thiocyanate Hydrolase Involving Metal-Ligated Cysteine Modification
pubmed doi rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
molecule keywords Thiocyanate hydrolase subunit alpha
total genus 28
structure length 118
sequence length 118
chains with identical sequence D, G, J, M, P, S, V
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxbA00
2ZPBB 2ZPIB 4ZGJB 4OB3B 2O01E 2PVGB 3VYHB 2WSEE 1PSEA 1PSFA 3A8HB 4OB0B 2DD4A 1QP2A 1IREB 2PVDB 3QYHB 2ZPFB 1GXIE 4KT0E 2ZZDA 3A8MB 1DJ7B 2PVOB 2CZ1B 4XK8E 2D0QB 3X28B 2CZ7B 3X24B 3LW5E 2DXBA 4OB1B 5L8RE 4ZGEB 3QZ9B 3X20B 1AHJB 2CZ6B 2PU9B 2ZCFB 3QYGB 2CYZB 4RKUE 2DD5A 2ZPEB 3VYGA 2DXCA 4Y28E 2QDYB 3X26B 1UGPB 2WSFE 3A8OB 2DPPB 2ZPGB 3A8GB 3HHTB 4FM4B 2AHJB 2PUKB 3A8LB 1JB0E 2WSCE 4ZGDB 1UGRB 4L6V5 2ZPHB 4OB2B 3WVEB 3X25B 2CZ0B 2PUOB 1UGSB 3QXEB 1V29B 1UGQB 3QZ5B 3WVDB 1QP3A
chains in the Genus database with same CATH superfamily
5GANg 4LUDA 4MZMA 1BIAA 3LH0A 3CXCS 5EC7A 1DJ7B 1K73C 2RN8A 2BTTA 1RAAB 1PKTA 4QVZA 4C5GA 3OYLA 1YITA 1YITT 3NHNA 3V8LA 2FHDA 2EJ9A 1E6HA 1NE8A 3MEAA 3GNFB 1R8OB 2KROA 2NYSA 4E7SA 3OS0A 3JCMb 5LJ5d 2CS7A 3M0QA 2EGAA 4E7JA 5GAN7 2K2MA 3X28B 3CCVQ 1GCQC 3IQLA 3MO8A 4JDSA 3CC2Q 2VC8A 1UGPB 2E3IA 2ED1A 2FRYA 2EJGA 3VS7A 5KYWA 2G6FX 4RG8A 1RLPC 3OQ5A 1X69A 3UPUA 2XMFA 4M77G 1M1FA 4DEYA 3JB9I 5FLXE 3CBPA 2NUTA 2QA4T 2IIMA 5IH2A 3NFCA 3EFSA 2FVUA 3PFSA 1ZHIA 3FIFA 1X6GA 5HKCA 1YJNT 3OYMA 1XOVA 1KQSP 1OPLA 1WHJA 2PTKA 2K5IA 2EYQA 2DRKA 3H0FA 3JCMe 3KUFA 1VQ5T 2O4XA 3S6WA 3X24B 3JAME 1NBEB 1WJQA 1SSFA 4Z89A 4HVWA 1RADB 4M75B 1ZBXA 1YFNA 2O9SA 5HK0A 3WVEB 1H92A 1JQQA 2PUOB 3RDVA 3JV3A 3INZA 1T0HA 1K8AU 4HKEA 2X3XD 5GAMe 4C8QB 1CKAA 1VQ5Q 4PK4A 2FB7A 4A4HA 5GAN3 3FC3A 1IREB 3CC7T 5GAMh 4Z88A 2OX7A 3LWHA 4FCYA 1ZSZA 1ACMB 1X6OA 4PJOC 1ZUKA 1VQMT 5KYNA 3MKDA 1TUDA 4OMOA 4JRPA 1NEBA 3C4SA 2LQKA 1IGQA 1Q82C 2MCNA 2E70A 4JZ3A 3H0IA 4ZN3A 1VOMA 5A2QE 3I55A 2BZXA 2DMOA 2GQVA 1WQWA 1YWOA 3CC4T 1YJWT 2DEQA 2DX1A 2P0PA 5KH6A 2LT1A 1WIEA 2DVEA 3V7CA 1Q82U 4QT7A 4M7DB 3DB3A 2JT4A 3CCEA 3ULRB 2WSFE 3JB9D 3VS3A 2KI7A 4AT1B 4FYYB 2P0QA 1NYGA 3M0RA 2RHIA 4J9IA 1YWPA 3KFVA 7AT1B 3N5BB 2ROLA 2LJ0A 4F14A 2P4RA 3PE0A 4C8QG 1D1AA 4M78E 1O75A 4C0GA 1Q86C 1VQKA 1VA7A 3D7SB 1RAFB 3UWNA 5LJ5h 3E1SA 4IIOA 2L8DA 2DTIA 2QEXQ 3PTAA 2B8AA 1LCKA 1VQKQ 1Z9ZA 1H8KA 1WXUA 3M9QA 1EX4A 3X26B 2O88A 3ME9A 1KD1U 2DBMA 5GAN8 2J05A 2E5QA 1EFNA 3OBYA 3JCMf 2ECZA 4C92C 3CCQT 1JJ2A 3CPWA 4IUTA 1E6GA 4RTTA 3CCEQ 1W70A 1RAHB 3CCSA 2RJCA 1I81A 1M30A 2DK3A 2EQMA 2KT1A 3S3NA 2CT4A 3QWYA 1KHIA 1QW1A 3BFMA 2LX7A 4HVUA 4M75C 2AIRB 3RUXA 2GCXA 3HPWA 2IG0A 3OMCA 4DA4A 2RI3A 4C8QA 1N8RR 4WCIA 1VQPA 4WF2A 4AFUC 3GOXA 4M75E 2LQNA 2DLPA 3L42A 1LJOA 4JRQA 4M78A 1QVFA 1MMDA 1VQ4Q 5I11A 1SF9A 4VUBA 2RJEA 4L5GA 3OYEA 3LWIA 1VQMA 2EYZA 3G71T 1WX6A 1Q81C 1OU8A 2RJFA 5CKFA 5GAN5 5FU7B 1VUBA 3QIIA 2PQWA 1JRIA 3HRSA 3OSSC 1KC8C 1S72T 3JCMc 3PNWC 2HCKA 4RTVA 5A0DA 3URGA 2K3BA 3OY9A 2HSEB 2HSPA 1QQJA 1KIKA 3QXEB 3CBMA 2LMJA 4PJOF 2O9VA 5LJ3d 3JCMP 3I56A 2C06A 2HL3A 2DILA 2QYZA 1HXDA 4LXCA 3DB4A 5CCAA 3OS2A 3TREA 3A1PA 2DTOA 1X6BA 1JJ2S 2RHZA 5GANf 2QA4Q 4QKUA 3GBQA 2KBTA 5GAMj 5KE2A 2EWNA 5KYUB 3JCMd 3OYCA 3C0CA 1BI1A 1M3AA 2IVWA 1ZX6A 4K11A 1RI0A 4E47A 1KK7A 5KCOA 2AKKA 1WFWA 1WXBA 4A4FA 1QVGA 2PVOB 2X4JA 4JRIA 1OZ3A 5A0GA 4GBQA 4M78F 1D0YA 1K0XA 3U23A 2YXYA 1QCOA 2IPOB 1BK2A 2C0TA 1OU9A 5IHKA 1LOJA 3SHWA 2FYKA 2KR3A 2XHCA 1KQ1A 2QDLA 2LVMA 1PSFA 2DIGA 4F17A 5GAOr 4KGXB 2VGMA 4IUVA 3SWNC 5FRMA 1VQ6A 2MWPA 3V7RA 1YITQ 2HKQB 1BI0A 5KYYA 1NM7A 1M90C 1PNJA 2JTEA 4ZTFA 1NLOC 3WVDB 1MUZA 1U1SA 2ROTA 1YI2A 5IHNA 5C0MA 4EDUA 2LJ1A 2GQIA 1ZA1B 5J26A 1FXXA 4XTYA 2V8IA 1ABQA 4N4IA 5GMKj 3DLLA 1C0MA 2VKNA 3ZL7C 2E6NA 1BIBA 1VQLT 4BE2A 3H41A 1ZUUA 2CH4A 5GAOl 3UA7A 3PIOA 2D0QB 1T3LA 3ASKA 1VQ7A 3OYNA 4OB1B 4FYXB 5DY9A 3OB9A 3PT9A 3DKMA 1M8MA 1GCPA 1TOVA 2X4YA 4PFOA 4NS5A 4JLGA 1QWFA 5LL6S 2AK5A 4ESRA 5KYXB 2F2XA 3JCMX 1ZSGA 1MV0B 2OTLQ 3C94A 2RQUA 4D6WA 1M90R 4FL6A 1JBMA 4KBMB 4EMGA 4B9WA 1EZZB 3VS6A 3E2UA 3PVLA 3OW2S 4DBQA 3EG2A 1JU5C 4LD9K 3VRZA 4E7HA 4QW2A 3RKYA 1G5VA 2COYA 1QKXA 1U8RA 4XTXA 2ZGWA 1VQPQ 1VQ8A 3NTHA 1VQNA 4M7DC 1VQ9A 2VYTA 2ESWA 5IXFA 4ZGJB 1VQ7Q 2I2LA 1M9SA 4MMKA 4Y91A 4M77C 2I0NA 1UFFA 1K73U 1SPKA 2NWMA 5KE3A 2YUQA 2A37A 4OVAA 4PJNA 1NG2A 5LJ3e 2EGEA 2QQ9A 3CCSQ 3OYBA 1PWTA 4ZTJA 2HZYA 2JW4A 4DBFA 2L2PA 5LJ3h 1PC0A 2HNIA 3O5ZA 2EVRA 2L89A 2PNIA 3X20B 2HL5C 4O6JA 1IZ6A 2D0NA 4X9CA 4BACA 3I56T 4O5VA 4UC4A 2RI2A 1Q82R 4J7IA 2PU9B 3C95A 2EPDA 4HCKA 2ZPEB 4KRTA 3UATA 1ABOA 3UDCA 4Z8AA 2E6ZA 2GNCA 2P84A 4AFSC 3EFRA 2VXEA 1WHGA 4Z02A 2QQBA 2V8KA 1VYVA 2R5MA 3LH5A 1G3SA 1QP2A 2OI3A 4KUDK 3LLRA 4J6YA 2M0YA 4EPCA 4MDXA 1YHQQ 1UTIA 2QQAA 1Y07A 2VWFA 3OYFA 4FW1A 1Y57A 4M7DE 2GF7A 4A4GA 4IIMA 2A08A 3SB2A 2KEAA 2JS0A 1PHTA 2KY9A 3CC2T 4LDYA 2DXCA 2FZCB 2P0KA 2QAZA 3BW1A 2MMPA 3P8BB 3CMAA 4C0DB 2RM4A 2KGTA 4FW2A 2LCCA 1K8AC 1UGVA 1VYUA 1KSWA 3TSZA 3MPUB 4CC2A 3I56Q 3EAEA 4X1VA 2F5KA 2J6OA 1MGQA 2QDYB 1YHQA 2QI2A 4J5YA 5GANd 5I2MA 1KJWA 3BE3A 2GGRA 1MNDA 2DAQA 4OMPA 2CP7A 2DL7A 4M7AC 3CD6A 2BKDN 4HXJA 4B9XA 4M7AD 2RF0A 1YJNQ 3CCST 2CGHA 4D8KA 1CKBA 4M7DG 4J9GA 1GRIA 4M7AB 3CQTA 5FWCA 3V8KA 2EKOA 3GF5A 5GAMd 4OMLA 4PFZA 3UA6A 3CD6Q 5GJWB 1VQ4A 1FMVA 2RJDA 1M8VA 4LNPA 3TCJA 1KQ2A 2JTMA 5LJ5f 4M7AA 2Y4XA 4LDXA 5D6XA 1VQ6T 3Q1JA 2JZ2A 1E7OA 2K6DA 2DF6A 3KXTA 1AVZC 1ZSZB 1WJSA 1G83A 4MMLA 3CD6T 1W2BP 4C5EA 3JB9F 3A5ZB 1IO6A 1Z9QA 3PMTA 3G4SQ 2YUNA 1Q81R 3TSWA 4ZGDB 4M77A 1WHMA 3JCMh 1MMNA 1PKSA 2K4YA 1PRMC 1S1NA 2AKLA 1VQNQ 1NPPA 2EKHA 4LE9A 1YIJA 1RUWA 3QWXX 4BD3A 2RO0A 4XK8E 2X51A 3EGXB 3EG3A 1ZSZC 4M7AG 3CPWP 3QJ6A 2XK0A 4M78D 1UHFA 1SSHA 2C0IA 3RIRA 3VKIA 3GPLA 1G3TA 4MZPA 4ANJA 5D7UA 4YTLA 1NJIU 4OGCA 2D8HA 4Q5WA 2PZ1A 1AWXA 1M27C 4M77F 2M51A 1XJWB 2CT3A 5D6WA 1I07A 4RKUE 1NLPC 3MP6A 2AHJB 3SDZA 1KG1A 3CCUQ 4M7AF 1UGRB 3FRNA 4ZNXA 1S72Q 1X43A 1AZEA 3ZFJA 2E4HA 1I5OB 2JNGA 2K7AA 2XI9A 1VYTA 4PKCC 3OYJA 3QO3A 4A54A 3FDRA 2D6FA 1YJWQ 2CREA 1HJDA 4J9FA 3MJXA 3LGLA 1YBYA 4ME7A 1ARKA 4LDUA 3WXMB 2DRMA 1AOJA 1QLYA 2RI5A 2OTJA 2XG8D 4C92D 3AHUA 3FJ5A 3SFMA 2HQHA 4M78G 3CCUA 5GAN4 1U1TA 2HQEA 3OW2A 4HT8A 2VB6A 1VQ9Q 4AG1C 2LC4A 2EQIA 5GANh 5LJ5e 5GAN6 1R0BG 2NUZA 3NPFA 4E7ZA 1YCYA 2CUBA 4C8QD 1M90U 1BCOA 3M0SA 2J6KA 3KBGA 2ZPIB 2VASA 3VYHB 2GFUA 2LNHB 2KYMA 3LX7A 1FMKA 1ZQ1A 2E64A 2DO3A 2QQSA 5CKBA 3JCMg 5GAOq 1WPYA 4B6MA 1I4K1 2K2VA 1PD0A 2DEUA 5GAMg 4M77B 5ECAA 3BDUA 2NLUA 1UEBA 1XQHA 3H9NA 3OYDA 1WGSA 1Y96B 4C0DC 3CCJA 2ED0A 5FU7C 1IB8A 2BIVA 4QVCA 2Z0WA 2CP6A 8AT1B 1Y71A 2LRQA 2QTVA 2F69A 2CZ6B 3VYGA 1ZA2B 1LPLA 5EG2A 3OYKA 2VXFA 4BDYA 3I9QA 3CCLT 4PJLA 3DLMA 1K76A 3CC7A 2OAUA 1H641 2QXFA 4FIBA 1N9SA 1VQOT 4JS4A 4M75G 1D3BA 1YI2Q 4LN2A 4NOYA 3CCJQ 3GIBA 2BZYA 1WYXA 3VJPA 3SWNA 1RI9A 4XTVA 3VRYA 2LCSA 1B3QA 4A63B 1F1BB 3FB9A 3L2WA 1TUCA 2DJZA 2DE0X 4E7KA 4BE0A 2R58A 1N8RU 1VIFA 1YJNA 3M4GA 3REBB 1SKUB 2DJQA 1WA7A 5I2SA 3RESA 4RTXA 3OA6A 3HRTA 2DTHA 1WXTA 2NUPA 1WHKA 2OJ2A 2H3EB 4AFZC 2G3RA 4XAXB 3CBOA 3OYHA 2R5AA 4C92B 3A8GB 2V1QA 1D09B 2DXUA 1BU1A 1RAIB 2YT6A 4JZ4A 3QZ5B 3M56A 5GJVB 4JRKA 3CCQA 4ZN1A 4BY6B 4KGZB 3L2QA 4BB7A 2MK5A 3LW5E 4XQ3A 4JJCA 2QEXT 2YDLA 1U3OA 1TWBA 5DM7R 2XD0A 1YNZA 3FJPA 4RTYA 3MEUA 5FU6B 2DPPB 4KGVB 3L2VA 2V8JA 2EQUA 1D0XA 2QA4A 1BB9A 3M59A 6AT1B 5GMKe 2ATCB 3GLXA 1TU0B 1Y7XA 2KE9A 1K9MR 5J39A 2CZ7B 4PJOA 3CPFA 1JXMA 4PLLA 3QUIA 4CC7A 4DQ2A 4RCBA 3SEMA 2DM1A 2JM8A 2ABLA 5LJ3f 4TVRA 3QSUA 1FYNA 1PRLC 2DYBA 2CKKA 1BBZA 2XICA 2HD0A 4J6WA 4LUEA 2RQVA 4PFPA 4KH1B 1MMAA 3LYIA 2J06A 4HCBA 4JPBW 3THKA 1YHQT 1IXDA 2JTFA 3JCMV 3M0TA 3EG1A 5CVIA 2ENMA 5GAOp 4E7LA 4C92E 3M58A 5GAOm 5GMKm 4M78C 1Q86U 1UB4A 2WSEE 3CCVT 2PVDB 2AT1B 1YIJQ 2JOYA 2JM9A 2KXDA 5FRNA 2B86A 1R0CB 1IHVA 2COZA 1K9MC 2L3RA 1WZOA 3NTKA 2MAMA 1GCQA 2FPEA 3UT1A 5HK3A 3OYAA 2EJFA 4F7UG 1C6VX 4F04B 1QP3A 4GLKA 2QGGA 3M5AA 2M02A 1K9MU 1PSEA 1X01A 1VQ4T 4GY5A 2ZZDA 4PJMA 4WTOB 1ZBJA 1V1CA 5GANe 3EFOA 3RKXA 2GTJA 4OMMA 3HFNA 4RUGA 2OAWA 2YHTA 2EIFA 2HAXA 3G4ST 1VQ5A 2QK0A 5I22A 2CSIA 1RAEB 1VQPT 2DYIA 4M4ZA 4KT0E 3A8MB 4XTUA 1OULA 3AT1B 1K9AA 5CKEA 3A98A 5KYYB 4IURA 2D1XA 2DVJA 5CO7A 1YP5A 2FEIA 4J6XA 3REAB 2X3WD 4QQ6A 1WI7A 2CP0A 2OTLT 2OTJT 4E2FB 2BE7D 4M7AE 2SRCA 3CMAT 4F7UB 2DIQA 4J9BA 1VQ8T 3PIPA 1M1GA 5FWBA 4XU2A 2Y4YA 4J9DA 1M3CA 1BI3A 1RACB 1VQKT 1SHFA 5GAOn 4BI4A 1KQSA 1JEGA 4R56A 3ZEHA 3CCLQ 3X25B 1W1FA 5C6SA 3OW2P 3G71Q 2A7YA 3G71A 1OQKA 2O4XB 1KD1C 4FSXA 4DOWA 1W2BS 2V1RA 3OS5A 2EQKA 5D6YA 1N6AA 3HP9A 2RQRA 3I55Q 2DL3A 2EYYA 4C8QF 2EYXA 3RERA 2R57A 2YUPA 2CDTA 1SHGA 1J3TA 3M57A 1BKBA 1BCMA 2RH2A 1M1KR 1V29B 1FWZA 1GFCA 4MDWA 2DETA 1NJIC 2K3XA 2DL8A 2KXCA 2EBPA 3JSCA 2D9TA 2LJ3A 1UDLA 3M0PA 2LP5A 2RB6A 2RHUA 2DFUA 1V76A 4GLMA 2A28A 1GL5A 3QKJA 1JXOA 4KULA 1YI2T 2KK4A 4LDVA 1M1KU 4DBHA 3E9GA 1D0ZA 1IGUA 3NTIA 1VIEA 2E12A 3J80E 4KUIA 1TSFA 3CC7Q 4LD6A 1UG1A 2ZPHB 1I1JA 1K8AR 5IXBA 1K4US 2KAFA 2HMAA 2HBPA 2QGFB 3VUZA 2SEMA 2KNBB 2ZPFB 3CCMT 2COWA 2CZ1B 2MOXA 5IHIA 3EGDA 4ZGEB 5CK9A 2LCLA 4HVVA 2K5FA 5FW9A 2MPXC 1VQ8Q 2K5LA 2M1HA 1OOTA 1OV3A 2KRMA 1UUEA 1UGQB 2L0AA 1A0NB 3QDRB 4EIKA 4RG2A 5GMKh 4ELYC 5GANj 4HT9A 3TU4K 2EAYA 1K73R 1VQ7T 5AT1B 1WNLA 2F1LA 1M2VB 4QVDA 3EH2A 4C5HA 2ZAEA 1JJ2P 1UHCA 2VV5A 1OEBA 3S3OA 2BZ8A 2E41A 1W2BA 3BDLA 1BI2A 4CC4B 2L3QA 1OPKA 2GTOA 3QYHB 1WHHA 4J8OA 5CIUA 4HCCA 2VUBA 1VQNT 2JXBA 2K3YA 3JCMW 2VVKA 2AZVA 2L3PA 2KT8A 3PVQA 4NL3A 2H3JA 4PL6A 4J9EA 1GBRA 1R77A 2F2VA 4F7UF 1D1BA 2FZGB 1YJ9A 3QG1A 4M77D 2YLBA 1AEYA 3FLGA 5KYXA 2CP5A 4F16A 3CC4A 2LDMA 5KCHA 2H8HA 3V7SA 1JO8A 3MEWA 8ATCB 2O2OA 1SRMA 2K57A 1S72A 3RNJA 3C12A 2ZPGB 3JB9H 3NGPA 3EH1A 4L6V5 4AG2C 5LJ5g 3CCQQ 1N8RC 1YN8A 2KSSA 2QEXA 1KQSS 5CQXA 4CI0C 3L1AA 3P8DA 5I21A 1QVPA 2RPNA 4IKFA 3FEOA 3CXCA 2AZSA 3I55T 2LZ6B 3F70A 2E10A 1RL2A 2QTXA 3SWNB 1HYOA 3EGDB 1W4SA 2FRWA 1G3YA 4JJNK 4Y92A 4P5NA 4II1A 3VV0A 1HD3A 1U06A 2YUOA 3HL8A 1KC8R 2DXBA 2NUPB 4EMHA 1B34B 4XTWA 4R0KA 1IRXA 3OYGA 1K1ZA 2DA9A 1Q7YC 1Q95G 3G4SA 2YWWA 3CMEQ 3I5SA 3OBWA 4XU0A 2DL5A 2Y90A 3JCMJ 3JB9G 2L3SA 1X2KA 4C92G 2QQRA 2RK1A 3VS0A 3CMEA 2LQ8A 4N0AA 3O8VA 4PNOA 1VQLQ 5FROA 3RKWA 3E19A 2JMCA 2V26A 4LDWA 3JRZA 4BE1A 3JB9J 4QQDA 2MF2A 2GFAA 4CRIA 1RABB 1OI1A 5J3BA 5DLQE 1N5ZA 4OB0B 2HBWA 2P4TA 1M4ZA 4OMFB 1G8XA 2EW3A 2DL4A 2FZKB 1GFDA 1VQMQ 4M7DD 4PJOB 4JUVA 4N0AC 1WJRA 3S3MA 3M53A 1BYMA 3CCRT 4HA8A 1WDXA 5IT9E 3L2RA 3MP1A 2ZPBB 1SG5A 3PMIA 2GBQA 9ATCB 2FG0A 3CCMQ 3I5RA 3QBYA 5CAIA 4IUPA 4OMQA 3JCMQ 2DZCA 1FMWA 2ZCFB 1KHCA 1MHNA 2DD5A 4ATOA 3RBBB 2YSQA 2JJ9A 2O31A 4E6RA 3HHTB 3QJYA 2MWOA 3A8LB 5KYWB 1KFZA 3CCRQ 2X35A 1VQOQ 1OX8A 1TUGB 1TTHB 2CP3A 2LX9A 3CEYA 5CR2A 2OTJQ 1G3WA 3ER0A 3T9NA 2KRNA 3HSBA 4OB3B 1PCXA 2M0OA 3UF4A 1AWJA 3H6ZA 3EG9A 1OZ2A 3CCLA 1NJIR 2KRSA 3HTRA 4AFQC 2EQJA 4J9HA 4ELZC 1ZUYA 4V2SA 2HEQA 4PJJA 1YJ9Q 2YRVA 1JB0E 1MV3A 4BI8B 1M2OA 3HKSA 1RAGB 1AT1B 4FYWB 4FT2A 2XIDA 2YRDA 3GP8A 1UGSB 4PJOG 4C8QE 4OF1A 4J83A 2O01E 2PVGB 4EMKC 5GAMf 2QASA 2HDAA 2RMOA 2RA2A 2FO0A 3M54A 3R6NA 2JS2A 4A53A 1QVGS 4M77E 4EMKB 1WLPB 4C0FA 2J6FA 2KDSA 3TVTA 1N9RA 1P92A 1UECA 4D8DA 3EGUA 2FL7A 3GNGA 1OYXA 4CC3A 1Y96A 1PG5B 2RK2A 1GXIE 4EMKA 5AYFA 2RQTA 4C5IA 2K9GA 1RLQC 2M9UA 2MI6A 4FYVB 1NZ9A 3A8OB 4F7UA 4N4HA 3J81E 4J9CA 4RTWA 1T0JA 1QCFA 4M78B 1NYFA 3OYYA 2W10A 2JVVA 4DEXA 2XDDA 1CSKA 1OX9A 4RCCA 1U5SA 1VQOA 1ZLMA 4OGEA 3CCRA 2LTOA 3QPHA 1UE9A 2CYZB 4FU6A 2MYSA 1N27A 4PJOD 2FPDA 4QQGA 3CXCP 4OP0A 3MEVA 5GMKl 5LJ3j 2F2WA 2E65A 1YCSB 1I5LA 4NL2A 2D8JA 2DBKA 1QKWA 2DNUA 2XKOC 3G1JA 3M0UA 2NUTB 1QCNA 2OTLA 2XU8A 3EG9B 4C92A 3EHRA 4A4EA 3CCJT 3CMET 4JJBA 3BY7A 1FX7A 2E3HA 2JN0A 1QVGP 2WACA 2CZ0B 1M5Q1 1M3BA 4R55A 5IN1A 1TG0A 4XU1A 4JLIA 1G2BA 1SEMA 3PGGA 2DERA 3RMQA 4IUQA 2W0ZA 1TS9A 1GBQA 3EHQA 4PLIA 4DOVA 5L23A 3QZ9B 3VS2A 5A0LA 2KMTA 1O9SA 2EYWA 4M75A 1HSQA 4PJOE 4F7UE 3OMGA 3VU3C 1X75C 1XTDA 1Q86R 2RHXA 2C0OA 4OB2B 5HCKA 3L2ZA 5LJ5j 4C92F 2DKGA 1H3ZA 4BY6C 1PM3A 3CMAQ 2EFIA 2K79A 3EG0A 4KH0B 5HY6A 3SD4A 2DZ9A 2BUDA 3QHSA 3R6OA 2XDPA 1NPRA 3V8JA 3TQ7P 3J7AF 2PUKB 4M75D 4BI3A 2CUDA 5FU6C 1AZGB 2MIOA 4AMCA 1QWEA 3MP8A 3CC2A 1VQ6Q 3I35A 3MCAB 5GMKi 4XTZA 2A0FB 3L2UA 1NEGA 1QVFP 2DXTA 3CCMA 3CCVA 1MNEA 2HQXA 2LNVA 1M1KC 3G6ET 1YJ9T 4M7DA 1K0SA 1B34A 4X9DA 4OMNA 2F5TX 2RHYA 2JMAA 2RD1A 2A3LA 1LNXA 3LGFA 4HCZA 3QDFA 2XDBA 4RTZA 3H8ZA 1Q7YR 3HFOA 1PD1A 3RMSA 1TXQA 1WHLA 3A8HB 2KYBA 1TH7A 3RR6A 3EGXA 1D1CA 1D3BB 5L8RE 4DBRA 4C0ZA 2X9HA 2CH4W 1M2VA 4C8QC 1H3HA 3ZBDA 3HRUA 1VQLA 5LJ3g 1IHWA 4JJDA 4XU3A 1XNIA 5CQYA 1KD1R 4E7IA 1MMGA 1Q81U 1WQ7A 5IAYA 2DD4A 3E9FA 1YIJT 3VS1A 4X34A 2LT4A 3EFOB 2E1HA 1AWWA 5KYUA 1KC8U 4FT4A 1X2QA 2FPFA 4FM4B 5CKDA 2WSCE 3NMZC 1QMCA 2LQWA 3H0HA 2KVQG 3META 3G6EA 2JUFA 4L59A 2CP2A 1Y0MA 1I8FA 1AWOA 1C1AA 4N4GA 4RTUA 4M75F 5GAN2 2KQWA 3OYIA 3OSVA 1B7TA 4MZTA 1QVFS 1EIFA 1AHJB 3VUBA 1VQ9T 1AD5A 4Y28E 2RNAA 2A36A 3VS4A 1Q7YU 2J7IA 2HKNA 2BE9B 1UJYA 2YRCA 1X27A 1T3SA 4J7FA 1W6XA 4RMOA 2X4WA 2VGNA 2CSQA 1LVKA 1HK9A 3G7ZA 3TEEA 4BUGA 2L5QA 3QYGB 4ORZA 2EGCA 4A4KA 1SRLA 3MHXA 3G6EQ 2RQWA 1B07A 2YLCA 5M9OA 3M55A 4M7DF 3P8HA 3CPWS 3CCET 5CKHA 3VS5A 3CCUT 3CC4Q 3M4YA 2QG9B 4IUUA 4BDZA 1YJWA 5DLOA 4JS5A 2X4XA 3OS1A 1I0CA 4FSSA 1UJ0A 2M16A 2E5KA
chains in the Genus database with same CATH topology
4JRKA 3CCQA 4XU0A 5GANg 3C94A 4ZN1A 4D6WA 4MZMA 1BIAA 2Y90A 4BY6B 4FL6A 3LH0A 3CXCS 3JCMJ 3JB9G 1JBMA 3L2QA 4BB7A 1DJ7B 4KBMB 4EMGA 1K73C 4B9WA 3LW5E 4QVZA 4C5GA 3OYLA 4XQ3A 4C92G 1YITA 1YITT 2QQRA 2FHDA 2RK1A 2EJ9A 3V8LA 5DM7R 2QEXT 3CMEA 2XD0A 2LQ8A 4N0AA 3OW2S 1NE8A 3FJPA 3O8VA 3MEUA 5FU6B 2DPPB 3MEAA 4PNOA 3GNFB 5FROA 4LD9K 1R8OB 3RKWA 3L2VA 4E7HA 4QW2A 3E19A 3RKYA 1G5VA 2V8JA 1U8RA 4LDWA 2EQUA 2ZGWA 3JRZA 4XTXA 4BE1A 1VQ8A 3NTHA 3JB9J 1VQNA 4QQDA 2QA4A 4M7DC 3OS0A 2MF2A 1VQ9A 2VYTA 2GFAA 3JCMb 4CRIA 4ZGJB 5LJ5d 2I2LA 2CS7A 3M59A 1OI1A 5J3BA 5GMKe 1M9SA 5DLQE 4E7JA 4MMKA 3GLXA 4OB0B 4Y91A 2P4TA 5GAN7 4M77C 1Y7XA 3X28B 1K73U 1M4ZA 5KE3A 2CZ7B 5J39A 4OMFB 3MO8A 4OVAA 5LJ3e 4JDSA 2QQ9A 3OYBA 2VC8A 3CPFA 4M7DD 4PJOA 1UGPB 4JUVA 3QUIA 4PLLA 4N0AC 4ZTJA 4PJOB 1WJRA 4DQ2A 4RCBA 3S3MA 3M53A 1BYMA 5LJ3f 4TVRA 5LJ3h 3QSUA 3CCRT 2HNIA 4HA8A 2CKKA 3L2RA 5IT9E 2EJGA 2XICA 2HD0A 2L89A 3MP1A 3X20B 2ZPBB 4RG8A 3PMIA 4J6WA 4O6JA 1IZ6A 3OQ5A 3UPUA 4X9CA 4BACA 4M77G 1M1FA 3I56T 4O5VA 3JB9I 3QBYA 5FLXE 3LYIA 4UC4A 3CBPA 5CAIA 2RI2A 4IUPA 3JCMQ 2DZCA 4J7IA 2PU9B 1KHCA 2ZCFB 1MHNA 3C95A 2DD5A 2ZPEB 2QA4T 1YHQT 4HCBA 2JTFA 3NFCA 3JCMV 4ATOA 3HHTB 3QJYA 3UDCA 2MWOA 3A8LB 3EFSA 5CVIA 2FVUA 2E6ZA 5GAOp 2X35A 3PFSA 4E7LA 4C92E 3M58A 1ZHIA 3FIFA 3EFRA 2LX9A 2VXEA 3CEYA 5CR2A 5GAOm 4Z02A 1G3WA 3ER0A 3T9NA 2QQBA 5HKCA 1YJNT 3HSBA 3OYMA 1XOVA 4OB3B 2V8KA 5GMKm 4M78C 2M0OA 2R5MA 1Q86U 1UB4A 3H6ZA 3CCLA 1OZ2A 2WSEE 1G3SA 3CCVT 1QP2A 2K5IA 2PVDB 2EYQA 3JCMe 4KUDK 3KUFA 1VQ5T 2JOYA 2O4XA 2EQJA 3LLRA 4J6YA 3S6WA 3X24B 4ELZC 3JAME 4EPCA 4MDXA 1WJQA 4V2SA 5FRNA 1SSFA 2YRVA 2QQAA 4M75B 1Y07A 1ZBXA 3OYFA 1K9MC 1JB0E 2L3RA 4BI8B 5HK0A 3HKSA 3WVEB 4M7DE 2GF7A 3NTKA 2MAMA 2PUOB 4FT2A 2XIDA 3OYAA 3UT1A 1UGSB 4A4GA 5HK3A 3INZA 2EJFA 4PJOG 4F7UG 3GP8A 4C8QE 4HKEA 4OF1A 4J83A 1K8AU 1QP3A 4GLKA 4C8QB 5GAMe 3SB2A 3M5AA 2O01E 2PVGB 1K9MU 1PSEA 1X01A 2FB7A 4A4HA 5GAN3 1IREB 4GY5A 2KY9A 4EMKC 3FC3A 1VQ4T 3CC7T 2ZZDA 5GAMf 5GAMh 2RA2A 3LWHA 3M54A 5GANe 1X6OA 4PJOC 3RKXA 1VQMT 4LDYA 3CC2T 4A53A 3HFNA 2DXCA 2P0KA 1QVGS 4JRPA 4M77E 3BW1A 2MMPA 3C4SA 3P8BB 4EMKB 3CMAA 2LQKA 4C0DB 2RM4A 2YHTA 4C0FA 2EIFA 2KDSA 1Q82C 2E70A 1N9RA 3G4ST 2HAXA 1P92A 4ZN3A 5A2QE 3I55A 1VQ5A 2LCCA 1K8AC 2GQVA 1WQWA 3GNGA 2FL7A 3CC4T 1YJWT 1OYXA 2DEQA 1Y96A 2P0PA 5KH6A 2LT1A 1VQPT 2DVEA 3V7CA 2RK2A 1Q82U 1GXIE 4KT0E 3A8MB 4EMKA 5AYFA 3EAEA 4XTUA 3DB3A 4M7DB 4C5IA 5CKEA 2F5KA 1MGQA 2M9UA 4IURA 2MI6A 3CCEA 2QDYB 1YHQA 1NZ9A 2WSFE 3A8OB 2QI2A 4F7UA 4N4HA 4J5YA 3JB9D 5GANd 5CO7A 4J6XA 5I2MA 3J81E 2P0QA 2DAQA 2RHIA 4M7AC 4QQ6A 3CD6A 2BKDN 4B9XA 4M78B 2OTLT 4M7AD 3CCST 2CGHA 2OTJT 3OYYA 2JVVA 2XDDA 4M7AE 4M7DG 3N5BB 3CMAT 4RCCA 4M7AB 1VQOA 4OGEA 4F7UB 3V8KA 2DIQA 2EKOA 2LTOA 3PIPA 1M1GA 3GF5A 3QPHA 4C8QG 3CCRA 1VQ8T 4M78E 5GAMd 4XU2A 1O75A 2CYZB 2Y4YA 4FU6A 4C0GA 1N27A 1Q86C 4PJOD 1BI3A 1VQKA 1VQKT 5GAOn 1VQ4A 4BI4A 1KQSA 4QQGA 2RJDA 1M8VA 3UWNA 4R56A 3TCJA 3ZEHA 2JTMA 1KQ2A 3X25B 4OP0A 5LJ5f 5LJ5h 3MEVA 5C6SA 4M7AA 2Y4XA 3E1SA 5D6XA 5GMKl 2A7YA 5LJ3j 2L8DA 3G71A 4LDXA 2DTIA 1VQ6T 2E65A 2O4XB 3PTAA 3Q1JA 1I5LA 2JZ2A 4NL2A 1KD1C 4FSXA 3KXTA 2B8AA 4DOWA 1W2BS 2XKOC 3OS5A 2EQKA 5D6YA 1N6AA 1WJSA 3HP9A 2OTLA 2XU8A 3M9QA 4MMLA 3CD6T 4C5EA 4C92A 4C8QF 4A4EA 3X26B 3CCJT 3CMET 3JB9F 3RERA 3A5ZB 3BY7A 3ME9A 2R57A 1KD1U 3PMTA 1FX7A 4ZGDB 5GAN8 2JN0A 4M77A 2WACA 3M57A 2CZ0B 1M5Q1 2E5QA 1BKBA 3OBYA 3JCMh 3JCMf 2RH2A 5IN1A 4R55A 1V29B 1FWZA 4XU1A 2K4YA 4C92C 4MDWA 4JLIA 1NJIC 3CCQT 1JJ2A 3PGGA 3CPWA 3RMQA 2K3XA 4IUQA 4IUTA 1NPPA 1YIJA 4PLIA 4DOVA 4BD3A 2RO0A 4XK8E 3JSCA 2D9TA 3QZ9B 3CCSA 2RJCA 1I81A 2DK3A 2EQMA 3S3NA 4M7AG 3QJ6A 5A0LA 1KHIA 2XK0A 1QW1A 4M78D 2KMTA 2RB6A 3BFMA 1O9SA 4M75A 2RHUA 4PJOE 4M75C 4F7UE 3OMGA 3QZ5B 3RIRA 3VKIA 3VU3C 3RUXA 3GPLA 1G3TA 4MZPA 3QKJA 1X75C 2GCXA 1XTDA 3HPWA 2RHXA 4OB2B 4KULA 2IG0A 3OMCA 4DA4A 3L2ZA 4YTLA 4C92F 2RI3A 5LJ5j 4C8QA 1NJIU 4OGCA 2DKGA 1VQPA 4WF2A 2KK4A 4Q5WA 1YI2T 1H3ZA 4LDVA 4BY6C 1M1KU 2EFIA 3E9GA 4M77F 5HY6A 3GOXA 3NTIA 5D6WA 1VIEA 4M75E 3SD4A 2DZ9A 2BUDA 3L42A 4RKUE 2E12A 3QHSA 3R6OA 2XDPA 1NPRA 3V8JA 3J80E 1LJOA 3MP6A 4JRQA 4KUIA 4M78A 3J7AF 2AHJB 2PUKB 4M75D 3SDZA 1KG1A 4BI3A 1QVFA 4M7AF 5FU6C 4LD6A 1UGRB 2ZPHB 3FRNA 4VUBA 2RJEA 4L5GA 3MP8A 3OYEA 2KAFA 3LWIA 3ZFJA 1VQMA 3CC2A 3G71T 2HBPA 3VUZA 3MCAB 5GMKi 4XTZA 3L2UA 1Q81C 2JNGA 2XI9A 4PKCC 2DXTA 2RJFA 5CKFA 3QO3A 5GAN5 3OYJA 3CCVA 2ZPFB 5FU7B 3CCMA 3CCMT 2HQXA 1VUBA 2LNVA 2CZ1B 4A54A 1M1KC 3G6ET 3FDRA 2D6FA 3QIIA 1YJ9T 4M7DA 5CK9A 4ZGEB 1B34A 2LCLA 1JRIA 2PQWA 3HRSA 3OSSC 4X9DA 1KC8C 2F5TX 2K5FA 1S72T 2RHYA 3JCMc 2RD1A 3PNWC 5A0DA 2A3LA 1LNXA 2K5LA 2M1HA 3LGFA 3LGLA 4HCZA 3URGA 1YBYA 4ME7A 3OY9A 4LDUA 3WXMB 2XDBA 2RI5A 3QXEB 3H8ZA 1UGQB 2OTJA 3HFOA 2XG8D 4C92D 3CBMA 3RMSA 4PJOF 5LJ3d 3JCMP 3QDRB 3AHUA 3I56A 3A8HB 4RG2A 5GMKh 2C06A 1TH7A 3SFMA 1HXDA 4ELYC 3DB4A 5GANj 4M78G 4HT9A 5CCAA 3OS2A 3CCUA 3TU4K 5GAN4 1D3BB 1U1TA 3TREA 2HQEA 5L8RE 3OW2A 2DTOA 2EAYA 1JJ2S 2RHZA 1VQ7T 4HT8A 4C0ZA 2LC4A 1WNLA 5GANf 5LJ5e 5GANh 5GAN6 4QVDA 4C5HA 4C8QC 2VV5A 5GAMj 1YCYA 3ZBDA 5KE2A 3HRUA 4C8QD 2EWNA 3JCMd 3OYCA 1M90U 1VQLA 5LJ3g 3S3OA 2E41A 4XU3A 1XNIA 3BDLA 5CQYA 1BI1A 1W2BA 1BI2A 3KBGA 2ZPIB 2IVWA 4E7IA 1Q81U 1WQ7A 3VYHB 1RI0A 2GFUA 4E47A 5IAYA 5KCOA 2DD4A 3E9FA 3LX7A 3QYHB 1ZQ1A 4A4FA 1YIJT 1QVGA 4J8OA 5CIUA 2PVOB 4X34A 2VUBA 2X4JA 2LT4A 2E64A 2DO3A 2QQSA 4HCCA 1VQNT 2E1HA 4JRIA 1OZ3A 5CKBA 5A0GA 3JCMg 2K3YA 4M78F 1KC8U 3JCMW 4FT4A 5GAOq 1WPYA 1I4K1 2K2VA 4NL3A 4FM4B 5CKDA 2H3JA 2WSCE 4PL6A 1LOJA 2FYKA 4F7UF 1YJ9A 3QG1A 2XHCA 2KVQG 2YLBA 4M77D 3META 4M77B 5GAMg 3G6EA 2JUFA 3BDUA 3FLGA 4L59A 2NLUA 1UEBA 1XQHA 1I8FA 3OYDA 1KQ1A 1WGSA 3CC4A 2LDMA 5KCHA 1Y96B 4C0DC 3CCJA 5FU7C 4N4GA 2LVMA 4M75F 3V7SA 5GAN2 1PSFA 3MEWA 2BIVA 4QVCA 2DIGA 5GAOr 2KQWA 3OYIA 3OSVA 4MZTA 1QVFS 1Y71A 2VGMA 2LRQA 1EIFA 2F69A 4IUVA 1AHJB 2CZ6B 3SWNC 3VUBA 5FRMA 3VYGA 1VQ6A 2K57A 2MWPA 3V7RA 1VQ9T 1S72A 4Y28E 5EG2A 1BI0A 3OYKA 3C12A 2ZPGB 2VXFA 4BDYA 3CCLT 3JB9H 1M90C 3DLMA 4L6V5 3CC7A 1Q7YU 2OAUA 5LJ5g 4ZTFA 1H641 2QXFA 1N8RC 2KSSA 3WVDB 2QEXA 4FIBA 1U1SA 1KQSS 1YI2A 5CQXA 4CI0C 5C0MA 4EDUA 3L1AA 1N9SA 3P8DA 4J7FA 4RMOA 1VQOT 5I21A 1QVPA 4IKFA 4JS4A 4M75G 2X4WA 1D3BA 5J26A 2VGNA 3FEOA 1FXXA 4XTYA 1HK9A 2V8IA 3G7ZA 4NOYA 3TEEA 4BUGA 3CXCA 3GIBA 2L5QA 3QYGB 3I55T 3VJPA 3SWNA 4N4IA 3F70A 2E10A 1RL2A 2QTXA 3MHXA 4XTVA 3SWNB 4A4KA 5GMKj 3DLLA 3FB9A 3L2WA 2E6NA 2DJZA 1BIBA 2YLCA 5M9OA 3M55A 1W4SA 4M7DF 1G3YA 4JJNK 1VQLT 3P8HA 4BE2A 4E7KA 4BE0A 2R58A 4P5NA 3CPWS 1N8RU 4II1A 1VIFA 5GAOl 1YJNA 3CCET 3M4GA 3VV0A 5CKHA 5I2SA 3RESA 3HL8A 3HRTA 3PIOA 3OA6A 3CCUT 2DTHA 2D0QB 3ASKA 1VQ7A 2DXBA 4OB1B 3OYNA 3M4YA 4EMHA 2G3RA 3OB9A 3PT9A 1B34B 4XAXB 5DY9A 3CBOA 3DKMA 2R5AA 4IUUA 4XTWA 3OYHA 4BDZA 4C92B 1YJWA 2X4YA 3A8GB 5DLOA 3OYGA 4JS5A 4NS5A 4JLGA 2DXUA 2X4XA 3OS1A 1Q7YC 5LL6S 3G4SA 3JCMX 3OBWA 2M16A 3M56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPB B;  2ZPI B;  4ZGJ B;  4OB3 B;  2O01 E;  2PVG B;  3VYH B;  2WSE E;  1PSE A;  1PSF A;  3A8H B;  4OB0 B;  2DD4 A;  1QP2 A;  1IRE B;  2PVD B;  3QYH B;  2ZPF B;  1GXI E;  4KT0 E;  2ZZD A;  3A8M B;  1DJ7 B;  2PVO B;  2CZ1 B;  4XK8 E;  2D0Q B;  3X28 B;  2CZ7 B;  3X24 B;  3LW5 E;  2DXB A;  4OB1 B;  5L8R E;  4ZGE B;  3QZ9 B;  3X20 B;  1AHJ B;  2CZ6 B;  2PU9 B;  2ZCF B;  3QYG B;  2CYZ B;  4RKU E;  2DD5 A;  2ZPE B;  3VYG A;  2DXC A;  4Y28 E;  2QDY B;  3X26 B;  1UGP B;  2WSF E;  3A8O B;  2DPP B;  2ZPG B;  3A8G B;  3HHT B;  4FM4 B;  2AHJ B;  2PUK B;  3A8L B;  1JB0 E;  2WSC E;  4ZGD B;  1UGR B;  4L6V 5;  2ZPH B;  4OB2 B;  3WVE B;  3X25 B;  2CZ0 B;  2PUO B;  1UGS B;  3QXE B;  1V29 B;  1UGQ B;  3QZ5 B;  3WVD B;  1QP3 A; 
#chains in the Genus database with same CATH topology
 5GAN g;  4LUD A;  4MZM A;  1BIA A;  3LH0 A;  3CXC S;  5EC7 A;  1DJ7 B;  1K73 C;  2RN8 A;  2BTT A;  1RAA B;  1PKT A;  4QVZ A;  4C5G A;  3OYL A;  1YIT A;  1YIT T;  3NHN A;  3V8L A;  2FHD A;  2EJ9 A;  1E6H A;  1NE8 A;  3MEA A;  3GNF B;  1R8O B;  2KRO A;  2NYS A;  4E7S A;  3OS0 A;  3JCM b;  5LJ5 d;  2CS7 A;  3M0Q A;  2EGA A;  4E7J A;  5GAN 7;  2K2M A;  3X28 B;  3CCV Q;  1GCQ C;  3IQL A;  3MO8 A;  4JDS A;  3CC2 Q;  2VC8 A;  1UGP B;  2E3I A;  2ED1 A;  2FRY A;  2EJG A;  3VS7 A;  5KYW A;  2G6F X;  4RG8 A;  1RLP C;  3OQ5 A;  1X69 A;  3UPU A;  2XMF A;  4M77 G;  1M1F A;  4DEY A;  3JB9 I;  5FLX E;  3CBP A;  2NUT A;  2QA4 T;  2IIM A;  5IH2 A;  3NFC A;  3EFS A;  2FVU A;  3PFS A;  1ZHI A;  3FIF A;  1X6G A;  5HKC A;  1YJN T;  3OYM A;  1XOV A;  1KQS P;  1OPL A;  1WHJ A;  2PTK A;  2K5I A;  2EYQ A;  2DRK A;  3H0F A;  3JCM e;  3KUF A;  1VQ5 T;  2O4X A;  3S6W A;  3X24 B;  3JAM E;  1NBE B;  1WJQ A;  1SSF A;  4Z89 A;  4HVW A;  1RAD B;  4M75 B;  1ZBX A;  1YFN A;  2O9S A;  5HK0 A;  3WVE B;  1H92 A;  1JQQ A;  2PUO B;  3RDV A;  3JV3 A;  3INZ A;  1T0H A;  1K8A U;  4HKE A;  2X3X D;  5GAM e;  4C8Q B;  1CKA A;  1VQ5 Q;  4PK4 A;  2FB7 A;  4A4H A;  5GAN 3;  3FC3 A;  1IRE B;  3CC7 T;  5GAM h;  4Z88 A;  2OX7 A;  3LWH A;  4FCY A;  1ZSZ A;  1ACM B;  1X6O A;  4PJO C;  1ZUK A;  1VQM T;  5KYN A;  3MKD A;  1TUD A;  4OMO A;  4JRP A;  1NEB A;  3C4S A;  2LQK A;  1IGQ A;  1Q82 C;  2MCN A;  2E70 A;  4JZ3 A;  3H0I A;  4ZN3 A;  1VOM A;  5A2Q E;  3I55 A;  2BZX A;  2DMO A;  2GQV A;  1WQW A;  1YWO A;  3CC4 T;  1YJW T;  2DEQ A;  2DX1 A;  2P0P A;  5KH6 A;  2LT1 A;  1WIE A;  2DVE A;  3V7C A;  1Q82 U;  4QT7 A;  4M7D B;  3DB3 A;  2JT4 A;  3CCE A;  3ULR B;  2WSF E;  3JB9 D;  3VS3 A;  2KI7 A;  4AT1 B;  4FYY B;  2P0Q A;  1NYG A;  3M0R A;  2RHI A;  4J9I A;  1YWP A;  3KFV A;  7AT1 B;  3N5B B;  2ROL A;  2LJ0 A;  4F14 A;  2P4R A;  3PE0 A;  4C8Q G;  1D1A A;  4M78 E;  1O75 A;  4C0G A;  1Q86 C;  1VQK A;  1VA7 A;  3D7S B;  1RAF B;  3UWN A;  5LJ5 h;  3E1S A;  4IIO A;  2L8D A;  2DTI A;  2QEX Q;  3PTA A;  2B8A A;  1LCK A;  1VQK Q;  1Z9Z A;  1H8K A;  1WXU A;  3M9Q A;  1EX4 A;  3X26 B;  2O88 A;  3ME9 A;  1KD1 U;  2DBM A;  5GAN 8;  2J05 A;  2E5Q A;  1EFN A;  3OBY A;  3JCM f;  2ECZ A;  4C92 C;  3CCQ T;  1JJ2 A;  3CPW A;  4IUT A;  1E6G A;  4RTT A;  3CCE Q;  1W70 A;  1RAH B;  3CCS A;  2RJC A;  1I81 A;  1M30 A;  2DK3 A;  2EQM A;  2KT1 A;  3S3N A;  2CT4 A;  3QWY A;  1KHI A;  1QW1 A;  3BFM A;  2LX7 A;  4HVU A;  4M75 C;  2AIR B;  3RUX A;  2GCX A;  3HPW A;  2IG0 A;  3OMC A;  4DA4 A;  2RI3 A;  4C8Q A;  1N8R R;  4WCI A;  1VQP A;  4WF2 A;  4AFU C;  3GOX A;  4M75 E;  2LQN A;  2DLP A;  3L42 A;  1LJO A;  4JRQ A;  4M78 A;  1QVF A;  1MMD A;  1VQ4 Q;  5I11 A;  1SF9 A;  4VUB A;  2RJE A;  4L5G A;  3OYE A;  3LWI A;  1VQM A;  2EYZ A;  3G71 T;  1WX6 A;  1Q81 C;  1OU8 A;  2RJF A;  5CKF A;  5GAN 5;  5FU7 B;  1VUB A;  3QII A;  2PQW A;  1JRI A;  3HRS A;  3OSS C;  1KC8 C;  1S72 T;  3JCM c;  3PNW C;  2HCK A;  4RTV A;  5A0D A;  3URG A;  2K3B A;  3OY9 A;  2HSE B;  2HSP A;  1QQJ A;  1KIK A;  3QXE B;  3CBM A;  2LMJ A;  4PJO F;  2O9V A;  5LJ3 d;  3JCM P;  3I56 A;  2C06 A;  2HL3 A;  2DIL A;  2QYZ A;  1HXD A;  4LXC A;  3DB4 A;  5CCA A;  3OS2 A;  3TRE A;  3A1P A;  2DTO A;  1X6B A;  1JJ2 S;  2RHZ A;  5GAN f;  2QA4 Q;  4QKU A;  3GBQ A;  2KBT A;  5GAM j;  5KE2 A;  2EWN A;  5KYU B;  3JCM d;  3OYC A;  3C0C A;  1BI1 A;  1M3A A;  2IVW A;  1ZX6 A;  4K11 A;  1RI0 A;  4E47 A;  1KK7 A;  5KCO A;  2AKK A;  1WFW A;  1WXB A;  4A4F A;  1QVG A;  2PVO B;  2X4J A;  4JRI A;  1OZ3 A;  5A0G A;  4GBQ A;  4M78 F;  1D0Y A;  1K0X A;  3U23 A;  2YXY A;  1QCO A;  2IPO B;  1BK2 A;  2C0T A;  1OU9 A;  5IHK A;  1LOJ A;  3SHW A;  2FYK A;  2KR3 A;  2XHC A;  1KQ1 A;  2QDL A;  2LVM A;  1PSF A;  2DIG A;  4F17 A;  5GAO r;  4KGX B;  2VGM A;  4IUV A;  3SWN C;  5FRM A;  1VQ6 A;  2MWP A;  3V7R A;  1YIT Q;  2HKQ B;  1BI0 A;  5KYY A;  1NM7 A;  1M90 C;  1PNJ A;  2JTE A;  4ZTF A;  1NLO C;  3WVD B;  1MUZ A;  1U1S A;  2ROT A;  1YI2 A;  5IHN A;  5C0M A;  4EDU A;  2LJ1 A;  2GQI A;  1ZA1 B;  5J26 A;  1FXX A;  4XTY A;  2V8I A;  1ABQ A;  4N4I A;  5GMK j;  3DLL A;  1C0M A;  2VKN A;  3ZL7 C;  2E6N A;  1BIB A;  1VQL T;  4BE2 A;  3H41 A;  1ZUU A;  2CH4 A;  5GAO l;  3UA7 A;  3PIO A;  2D0Q B;  1T3L A;  3ASK A;  1VQ7 A;  3OYN A;  4OB1 B;  4FYX B;  5DY9 A;  3OB9 A;  3PT9 A;  3DKM A;  1M8M A;  1GCP A;  1TOV A;  2X4Y A;  4PFO A;  4NS5 A;  4JLG A;  1QWF A;  5LL6 S;  2AK5 A;  4ESR A;  5KYX B;  2F2X A;  3JCM X;  1ZSG A;  1MV0 B;  2OTL Q;  3C94 A;  2RQU A;  4D6W A;  1M90 R;  4FL6 A;  1JBM A;  4KBM B;  4EMG A;  4B9W A;  1EZZ B;  3VS6 A;  3E2U A;  3PVL A;  3OW2 S;  4DBQ A;  3EG2 A;  1JU5 C;  4LD9 K;  3VRZ A;  4E7H A;  4QW2 A;  3RKY A;  1G5V A;  2COY A;  1QKX A;  1U8R A;  4XTX A;  2ZGW A;  1VQP Q;  1VQ8 A;  3NTH A;  1VQN A;  4M7D C;  1VQ9 A;  2VYT A;  2ESW A;  5IXF A;  4ZGJ B;  1VQ7 Q;  2I2L A;  1M9S A;  4MMK A;  4Y91 A;  4M77 C;  2I0N A;  1UFF A;  1K73 U;  1SPK A;  2NWM A;  5KE3 A;  2YUQ A;  2A37 A;  4OVA A;  4PJN A;  1NG2 A;  5LJ3 e;  2EGE A;  2QQ9 A;  3CCS Q;  3OYB A;  1PWT A;  4ZTJ A;  2HZY A;  2JW4 A;  4DBF A;  2L2P A;  5LJ3 h;  1PC0 A;  2HNI A;  3O5Z A;  2EVR A;  2L89 A;  2PNI A;  3X20 B;  2HL5 C;  4O6J A;  1IZ6 A;  2D0N A;  4X9C A;  4BAC A;  3I56 T;  4O5V A;  4UC4 A;  2RI2 A;  1Q82 R;  4J7I A;  2PU9 B;  3C95 A;  2EPD A;  4HCK A;  2ZPE B;  4KRT A;  3UAT A;  1ABO A;  3UDC A;  4Z8A A;  2E6Z A;  2GNC A;  2P84 A;  4AFS C;  3EFR A;  2VXE A;  1WHG A;  4Z02 A;  2QQB A;  2V8K A;  1VYV A;  2R5M A;  3LH5 A;  1G3S A;  1QP2 A;  2OI3 A;  4KUD K;  3LLR A;  4J6Y A;  2M0Y A;  4EPC A;  4MDX A;  1YHQ Q;  1UTI A;  2QQA A;  1Y07 A;  2VWF A;  3OYF A;  4FW1 A;  1Y57 A;  4M7D E;  2GF7 A;  4A4G A;  4IIM A;  2A08 A;  3SB2 A;  2KEA A;  2JS0 A;  1PHT A;  2KY9 A;  3CC2 T;  4LDY A;  2DXC A;  2FZC B;  2P0K A;  2QAZ A;  3BW1 A;  2MMP A;  3P8B B;  3CMA A;  4C0D B;  2RM4 A;  2KGT A;  4FW2 A;  2LCC A;  1K8A C;  1UGV A;  1VYU A;  1KSW A;  3TSZ A;  3MPU B;  4CC2 A;  3I56 Q;  3EAE A;  4X1V A;  2F5K A;  2J6O A;  1MGQ A;  2QDY B;  1YHQ A;  2QI2 A;  4J5Y A;  5GAN d;  5I2M A;  1KJW A;  3BE3 A;  2GGR A;  1MND A;  2DAQ A;  4OMP A;  2CP7 A;  2DL7 A;  4M7A C;  3CD6 A;  2BKD N;  4HXJ A;  4B9X A;  4M7A D;  2RF0 A;  1YJN Q;  3CCS T;  2CGH A;  4D8K A;  1CKB A;  4M7D G;  4J9G A;  1GRI A;  4M7A B;  3CQT A;  5FWC A;  3V8K A;  2EKO A;  3GF5 A;  5GAM d;  4OML A;  4PFZ A;  3UA6 A;  3CD6 Q;  5GJW B;  1VQ4 A;  1FMV A;  2RJD A;  1M8V A;  4LNP A;  3TCJ A;  1KQ2 A;  2JTM A;  5LJ5 f;  4M7A A;  2Y4X A;  4LDX A;  5D6X A;  1VQ6 T;  3Q1J A;  2JZ2 A;  1E7O A;  2K6D A;  2DF6 A;  3KXT A;  1AVZ C;  1ZSZ B;  1WJS A;  1G83 A;  4MML A;  3CD6 T;  1W2B P;  4C5E A;  3JB9 F;  3A5Z B;  1IO6 A;  1Z9Q A;  3PMT A;  3G4S Q;  2YUN A;  1Q81 R;  3TSW A;  4ZGD B;  4M77 A;  1WHM A;  3JCM h;  1MMN A;  1PKS A;  2K4Y A;  1PRM C;  1S1N A;  2AKL A;  1VQN Q;  1NPP A;  2EKH A;  4LE9 A;  1YIJ A;  1RUW A;  3QWX X;  4BD3 A;  2RO0 A;  4XK8 E;  2X51 A;  3EGX B;  3EG3 A;  1ZSZ C;  4M7A G;  3CPW P;  3QJ6 A;  2XK0 A;  4M78 D;  1UHF A;  1SSH A;  2C0I A;  3RIR A;  3VKI A;  3GPL A;  1G3T A;  4MZP A;  4ANJ A;  5D7U A;  4YTL A;  1NJI U;  4OGC A;  2D8H A;  4Q5W A;  2PZ1 A;  1AWX A;  1M27 C;  4M77 F;  2M51 A;  1XJW B;  2CT3 A;  5D6W A;  1I07 A;  4RKU E;  1NLP C;  3MP6 A;  2AHJ B;  3SDZ A;  1KG1 A;  3CCU Q;  4M7A F;  1UGR B;  3FRN A;  4ZNX A;  1S72 Q;  1X43 A;  1AZE A;  3ZFJ A;  2E4H A;  1I5O B;  2JNG A;  2K7A A;  2XI9 A;  1VYT A;  4PKC C;  3OYJ A;  3QO3 A;  4A54 A;  3FDR A;  2D6F A;  1YJW Q;  2CRE A;  1HJD A;  4J9F A;  3MJX A;  3LGL A;  1YBY A;  4ME7 A;  1ARK A;  4LDU A;  3WXM B;  2DRM A;  1AOJ A;  1QLY A;  2RI5 A;  2OTJ A;  2XG8 D;  4C92 D;  3AHU A;  3FJ5 A;  3SFM A;  2HQH A;  4M78 G;  3CCU A;  5GAN 4;  1U1T A;  2HQE A;  3OW2 A;  4HT8 A;  2VB6 A;  1VQ9 Q;  4AG1 C;  2LC4 A;  2EQI A;  5GAN h;  5LJ5 e;  5GAN 6;  1R0B G;  2NUZ A;  3NPF A;  4E7Z A;  1YCY A;  2CUB A;  4C8Q D;  1M90 U;  1BCO A;  3M0S A;  2J6K A;  3KBG A;  2ZPI B;  2VAS A;  3VYH B;  2GFU A;  2LNH B;  2KYM A;  3LX7 A;  1FMK A;  1ZQ1 A;  2E64 A;  2DO3 A;  2QQS A;  5CKB A;  3JCM g;  5GAO q;  1WPY A;  4B6M A;  1I4K 1;  2K2V A;  1PD0 A;  2DEU A;  5GAM g;  4M77 B;  5ECA A;  3BDU A;  2NLU A;  1UEB A;  1XQH A;  3H9N A;  3OYD A;  1WGS A;  1Y96 B;  4C0D C;  3CCJ A;  2ED0 A;  5FU7 C;  1IB8 A;  2BIV A;  4QVC A;  2Z0W A;  2CP6 A;  8AT1 B;  1Y71 A;  2LRQ A;  2QTV A;  2F69 A;  2CZ6 B;  3VYG A;  1ZA2 B;  1LPL A;  5EG2 A;  3OYK A;  2VXF A;  4BDY A;  3I9Q A;  3CCL T;  4PJL A;  3DLM A;  1K76 A;  3CC7 A;  2OAU A;  1H64 1;  2QXF A;  4FIB A;  1N9S A;  1VQO T;  4JS4 A;  4M75 G;  1D3B A;  1YI2 Q;  4LN2 A;  4NOY A;  3CCJ Q;  3GIB A;  2BZY A;  1WYX A;  3VJP A;  3SWN A;  1RI9 A;  4XTV A;  3VRY A;  2LCS A;  1B3Q A;  4A63 B;  1F1B B;  3FB9 A;  3L2W A;  1TUC A;  2DJZ A;  2DE0 X;  4E7K A;  4BE0 A;  2R58 A;  1N8R U;  1VIF A;  1YJN A;  3M4G A;  3REB B;  1SKU B;  2DJQ A;  1WA7 A;  5I2S A;  3RES A;  4RTX A;  3OA6 A;  3HRT A;  2DTH A;  1WXT A;  2NUP A;  1WHK A;  2OJ2 A;  2H3E B;  4AFZ C;  2G3R A;  4XAX B;  3CBO A;  3OYH A;  2R5A A;  4C92 B;  3A8G B;  2V1Q A;  1D09 B;  2DXU A;  1BU1 A;  1RAI B;  2YT6 A;  4JZ4 A;  3QZ5 B;  3M56 A;  5GJV B;  4JRK A;  3CCQ A;  4ZN1 A;  4BY6 B;  4KGZ B;  3L2Q A;  4BB7 A;  2MK5 A;  3LW5 E;  4XQ3 A;  4JJC A;  2QEX T;  2YDL A;  1U3O A;  1TWB A;  5DM7 R;  2XD0 A;  1YNZ A;  3FJP A;  4RTY A;  3MEU A;  5FU6 B;  2DPP B;  4KGV B;  3L2V A;  2V8J A;  2EQU A;  1D0X A;  2QA4 A;  1BB9 A;  3M59 A;  6AT1 B;  5GMK e;  2ATC B;  3GLX A;  1TU0 B;  1Y7X A;  2KE9 A;  1K9M R;  5J39 A;  2CZ7 B;  4PJO A;  3CPF A;  1JXM A;  4PLL A;  3QUI A;  4CC7 A;  4DQ2 A;  4RCB A;  3SEM A;  2DM1 A;  2JM8 A;  2ABL A;  5LJ3 f;  4TVR A;  3QSU A;  1FYN A;  1PRL C;  2DYB A;  2CKK A;  1BBZ A;  2XIC A;  2HD0 A;  4J6W A;  4LUE A;  2RQV A;  4PFP A;  4KH1 B;  1MMA A;  3LYI A;  2J06 A;  4HCB A;  4JPB W;  3THK A;  1YHQ T;  1IXD A;  2JTF A;  3JCM V;  3M0T A;  3EG1 A;  5CVI A;  2ENM A;  5GAO p;  4E7L A;  4C92 E;  3M58 A;  5GAO m;  5GMK m;  4M78 C;  1Q86 U;  1UB4 A;  2WSE E;  3CCV T;  2PVD B;  2AT1 B;  1YIJ Q;  2JOY A;  2JM9 A;  2KXD A;  5FRN A;  2B86 A;  1R0C B;  1IHV A;  2COZ A;  1K9M C;  2L3R A;  1WZO A;  3NTK A;  2MAM A;  1GCQ A;  2FPE A;  3UT1 A;  5HK3 A;  3OYA A;  2EJF A;  4F7U G;  1C6V X;  4F04 B;  1QP3 A;  4GLK A;  2QGG A;  3M5A A;  2M02 A;  1K9M U;  1PSE A;  1X01 A;  1VQ4 T;  4GY5 A;  2ZZD A;  4PJM A;  4WTO B;  1ZBJ A;  1V1C A;  5GAN e;  3EFO A;  3RKX A;  2GTJ A;  4OMM A;  3HFN A;  4RUG A;  2OAW A;  2YHT A;  2EIF A;  2HAX A;  3G4S T;  1VQ5 A;  2QK0 A;  5I22 A;  2CSI A;  1RAE B;  1VQP T;  2DYI A;  4M4Z A;  4KT0 E;  3A8M B;  4XTU A;  1OUL A;  3AT1 B;  1K9A A;  5CKE A;  3A98 A;  5KYY B;  4IUR A;  2D1X A;  2DVJ A;  5CO7 A;  1YP5 A;  2FEI A;  4J6X A;  3REA B;  2X3W D;  4QQ6 A;  1WI7 A;  2CP0 A;  2OTL T;  2OTJ T;  4E2F B;  2BE7 D;  4M7A E;  2SRC A;  3CMA T;  4F7U B;  2DIQ A;  4J9B A;  1VQ8 T;  3PIP A;  1M1G A;  5FWB A;  4XU2 A;  2Y4Y A;  4J9D A;  1M3C A;  1BI3 A;  1RAC B;  1VQK T;  1SHF A;  5GAO n;  4BI4 A;  1KQS A;  1JEG A;  4R56 A;  3ZEH A;  3CCL Q;  3X25 B;  1W1F A;  5C6S A;  3OW2 P;  3G71 Q;  2A7Y A;  3G71 A;  1OQK A;  2O4X B;  1KD1 C;  4FSX A;  4DOW A;  1W2B S;  2V1R A;  3OS5 A;  2EQK A;  5D6Y A;  1N6A A;  3HP9 A;  2RQR A;  3I55 Q;  2DL3 A;  2EYY A;  4C8Q F;  2EYX A;  3RER A;  2R57 A;  2YUP A;  2CDT A;  1SHG A;  1J3T A;  3M57 A;  1BKB A;  1BCM A;  2RH2 A;  1M1K R;  1V29 B;  1FWZ A;  1GFC A;  4MDW A;  2DET A;  1NJI C;  2K3X A;  2DL8 A;  2KXC A;  2EBP A;  3JSC A;  2D9T A;  2LJ3 A;  1UDL A;  3M0P A;  2LP5 A;  2RB6 A;  2RHU A;  2DFU A;  1V76 A;  4GLM A;  2A28 A;  1GL5 A;  3QKJ A;  1JXO A;  4KUL A;  1YI2 T;  2KK4 A;  4LDV A;  1M1K U;  4DBH A;  3E9G A;  1D0Z A;  1IGU A;  3NTI A;  1VIE A;  2E12 A;  3J80 E;  4KUI A;  1TSF A;  3CC7 Q;  4LD6 A;  1UG1 A;  2ZPH B;  1I1J A;  1K8A R;  5IXB A;  1K4U S;  2KAF A;  2HMA A;  2HBP A;  2QGF B;  3VUZ A;  2SEM A;  2KNB B;  2ZPF B;  3CCM T;  2COW A;  2CZ1 B;  2MOX A;  5IHI A;  3EGD A;  4ZGE B;  5CK9 A;  2LCL A;  4HVV A;  2K5F A;  5FW9 A;  2MPX C;  1VQ8 Q;  2K5L A;  2M1H A;  1OOT A;  1OV3 A;  2KRM A;  1UUE A;  1UGQ B;  2L0A A;  1A0N B;  3QDR B;  4EIK A;  4RG2 A;  5GMK h;  4ELY C;  5GAN j;  4HT9 A;  3TU4 K;  2EAY A;  1K73 R;  1VQ7 T;  5AT1 B;  1WNL A;  2F1L A;  1M2V B;  4QVD A;  3EH2 A;  4C5H A;  2ZAE A;  1JJ2 P;  1UHC A;  2VV5 A;  1OEB A;  3S3O A;  2BZ8 A;  2E41 A;  1W2B A;  3BDL A;  1BI2 A;  4CC4 B;  2L3Q A;  1OPK A;  2GTO A;  3QYH B;  1WHH A;  4J8O A;  5CIU A;  4HCC A;  2VUB A;  1VQN T;  2JXB A;  2K3Y A;  3JCM W;  2VVK A;  2AZV A;  2L3P A;  2KT8 A;  3PVQ A;  4NL3 A;  2H3J A;  4PL6 A;  4J9E A;  1GBR A;  1R77 A;  2F2V A;  4F7U F;  1D1B A;  2FZG B;  1YJ9 A;  3QG1 A;  4M77 D;  2YLB A;  1AEY A;  3FLG A;  5KYX A;  2CP5 A;  4F16 A;  3CC4 A;  2LDM A;  5KCH A;  2H8H A;  3V7S A;  1JO8 A;  3MEW A;  8ATC B;  2O2O A;  1SRM A;  2K57 A;  1S72 A;  3RNJ A;  3C12 A;  2ZPG B;  3JB9 H;  3NGP A;  3EH1 A;  4L6V 5;  4AG2 C;  5LJ5 g;  3CCQ Q;  1N8R C;  1YN8 A;  2KSS A;  2QEX A;  1KQS S;  5CQX A;  4CI0 C;  3L1A A;  3P8D A;  5I21 A;  1QVP A;  2RPN A;  4IKF A;  3FEO A;  3CXC A;  2AZS A;  3I55 T;  2LZ6 B;  3F70 A;  2E10 A;  1RL2 A;  2QTX A;  3SWN B;  1HYO A;  3EGD B;  1W4S A;  2FRW A;  1G3Y A;  4JJN K;  4Y92 A;  4P5N A;  4II1 A;  3VV0 A;  1HD3 A;  1U06 A;  2YUO A;  3HL8 A;  1KC8 R;  2DXB A;  2NUP B;  4EMH A;  1B34 B;  4XTW A;  4R0K A;  1IRX A;  3OYG A;  1K1Z A;  2DA9 A;  1Q7Y C;  1Q95 G;  3G4S A;  2YWW A;  3CME Q;  3I5S A;  3OBW A;  4XU0 A;  2DL5 A;  2Y90 A;  3JCM J;  3JB9 G;  2L3S A;  1X2K A;  4C92 G;  2QQR A;  2RK1 A;  3VS0 A;  3CME A;  2LQ8 A;  4N0A A;  3O8V A;  4PNO A;  1VQL Q;  5FRO A;  3RKW A;  3E19 A;  2JMC A;  2V26 A;  4LDW A;  3JRZ A;  4BE1 A;  3JB9 J;  4QQD A;  2MF2 A;  2GFA A;  4CRI A;  1RAB B;  1OI1 A;  5J3B A;  5DLQ E;  1N5Z A;  4OB0 B;  2HBW A;  2P4T A;  1M4Z A;  4OMF B;  1G8X A;  2EW3 A;  2DL4 A;  2FZK B;  1GFD A;  1VQM Q;  4M7D D;  4PJO B;  4JUV A;  4N0A C;  1WJR A;  3S3M A;  3M53 A;  1BYM A;  3CCR T;  4HA8 A;  1WDX A;  5IT9 E;  3L2R A;  3MP1 A;  2ZPB B;  1SG5 A;  3PMI A;  2GBQ A;  9ATC B;  2FG0 A;  3CCM Q;  3I5R A;  3QBY A;  5CAI A;  4IUP A;  4OMQ A;  3JCM Q;  2DZC A;  1FMW A;  2ZCF B;  1KHC A;  1MHN A;  2DD5 A;  4ATO A;  3RBB B;  2YSQ A;  2JJ9 A;  2O31 A;  4E6R A;  3HHT B;  3QJY A;  2MWO A;  3A8L B;  5KYW B;  1KFZ A;  3CCR Q;  2X35 A;  1VQO Q;  1OX8 A;  1TUG B;  1TTH B;  2CP3 A;  2LX9 A;  3CEY A;  5CR2 A;  2OTJ Q;  1G3W A;  3ER0 A;  3T9N A;  2KRN A;  3HSB A;  4OB3 B;  1PCX A;  2M0O A;  3UF4 A;  1AWJ A;  3H6Z A;  3EG9 A;  1OZ2 A;  3CCL A;  1NJI R;  2KRS A;  3HTR A;  4AFQ C;  2EQJ A;  4J9H A;  4ELZ C;  1ZUY A;  4V2S A;  2HEQ A;  4PJJ A;  1YJ9 Q;  2YRV A;  1JB0 E;  1MV3 A;  4BI8 B;  1M2O A;  3HKS A;  1RAG B;  1AT1 B;  4FYW B;  4FT2 A;  2XID A;  2YRD A;  3GP8 A;  1UGS B;  4PJO G;  4C8Q E;  4OF1 A;  4J83 A;  2O01 E;  2PVG B;  4EMK C;  5GAM f;  2QAS A;  2HDA A;  2RMO A;  2RA2 A;  2FO0 A;  3M54 A;  3R6N A;  2JS2 A;  4A53 A;  1QVG S;  4M77 E;  4EMK B;  1WLP B;  4C0F A;  2J6F A;  2KDS A;  3TVT A;  1N9R A;  1P92 A;  1UEC A;  4D8D A;  3EGU A;  2FL7 A;  3GNG A;  1OYX A;  4CC3 A;  1Y96 A;  1PG5 B;  2RK2 A;  1GXI E;  4EMK A;  5AYF A;  2RQT A;  4C5I A;  2K9G A;  1RLQ C;  2M9U A;  2MI6 A;  4FYV B;  1NZ9 A;  3A8O B;  4F7U A;  4N4H A;  3J81 E;  4J9C A;  4RTW A;  1T0J A;  1QCF A;  4M78 B;  1NYF A;  3OYY A;  2W10 A;  2JVV A;  4DEX A;  2XDD A;  1CSK A;  1OX9 A;  4RCC A;  1U5S A;  1VQO A;  1ZLM A;  4OGE A;  3CCR A;  2LTO A;  3QPH A;  1UE9 A;  2CYZ B;  4FU6 A;  2MYS A;  1N27 A;  4PJO D;  2FPD A;  4QQG A;  3CXC P;  4OP0 A;  3MEV A;  5GMK l;  5LJ3 j;  2F2W A;  2E65 A;  1YCS B;  1I5L A;  4NL2 A;  2D8J A;  2DBK A;  1QKW A;  2DNU A;  2XKO C;  3G1J A;  3M0U A;  2NUT B;  1QCN A;  2OTL A;  2XU8 A;  3EG9 B;  4C92 A;  3EHR A;  4A4E A;  3CCJ T;  3CME T;  4JJB A;  3BY7 A;  1FX7 A;  2E3H A;  2JN0 A;  1QVG P;  2WAC A;  2CZ0 B;  1M5Q 1;  1M3B A;  4R55 A;  5IN1 A;  1TG0 A;  4XU1 A;  4JLI A;  1G2B A;  1SEM A;  3PGG A;  2DER A;  3RMQ A;  4IUQ A;  2W0Z A;  1TS9 A;  1GBQ A;  3EHQ A;  4PLI A;  4DOV A;  5L23 A;  3QZ9 B;  3VS2 A;  5A0L A;  2KMT A;  1O9S A;  2EYW A;  4M75 A;  1HSQ A;  4PJO E;  4F7U E;  3OMG A;  3VU3 C;  1X75 C;  1XTD A;  1Q86 R;  2RHX A;  2C0O A;  4OB2 B;  5HCK A;  3L2Z A;  5LJ5 j;  4C92 F;  2DKG A;  1H3Z A;  4BY6 C;  1PM3 A;  3CMA Q;  2EFI A;  2K79 A;  3EG0 A;  4KH0 B;  5HY6 A;  3SD4 A;  2DZ9 A;  2BUD A;  3QHS A;  3R6O A;  2XDP A;  1NPR A;  3V8J A;  3TQ7 P;  3J7A F;  2PUK B;  4M75 D;  4BI3 A;  2CUD A;  5FU6 C;  1AZG B;  2MIO A;  4AMC A;  1QWE A;  3MP8 A;  3CC2 A;  1VQ6 Q;  3I35 A;  3MCA B;  5GMK i;  4XTZ A;  2A0F B;  3L2U A;  1NEG A;  1QVF P;  2DXT A;  3CCM A;  3CCV A;  1MNE A;  2HQX A;  2LNV A;  1M1K C;  3G6E T;  1YJ9 T;  4M7D A;  1K0S A;  1B34 A;  4X9D A;  4OMN A;  2F5T X;  2RHY A;  2JMA A;  2RD1 A;  2A3L A;  1LNX A;  3LGF A;  4HCZ A;  3QDF A;  2XDB A;  4RTZ A;  3H8Z A;  1Q7Y R;  3HFO A;  1PD1 A;  3RMS A;  1TXQ A;  1WHL A;  3A8H B;  2KYB A;  1TH7 A;  3RR6 A;  3EGX A;  1D1C A;  1D3B B;  5L8R E;  4DBR A;  4C0Z A;  2X9H A;  2CH4 W;  1M2V A;  4C8Q C;  1H3H A;  3ZBD A;  3HRU A;  1VQL A;  5LJ3 g;  1IHW A;  4JJD A;  4XU3 A;  1XNI A;  5CQY A;  1KD1 R;  4E7I A;  1MMG A;  1Q81 U;  1WQ7 A;  5IAY A;  2DD4 A;  3E9F A;  1YIJ T;  3VS1 A;  4X34 A;  2LT4 A;  3EFO B;  2E1H A;  1AWW A;  5KYU A;  1KC8 U;  4FT4 A;  1X2Q A;  2FPF A;  4FM4 B;  5CKD A;  2WSC E;  3NMZ C;  1QMC A;  2LQW A;  3H0H A;  2KVQ G;  3MET A;  3G6E A;  2JUF A;  4L59 A;  2CP2 A;  1Y0M A;  1I8F A;  1AWO A;  1C1A A;  4N4G A;  4RTU A;  4M75 F;  5GAN 2;  2KQW A;  3OYI A;  3OSV A;  1B7T A;  4MZT A;  1QVF S;  1EIF A;  1AHJ B;  3VUB A;  1VQ9 T;  1AD5 A;  4Y28 E;  2RNA A;  2A36 A;  3VS4 A;  1Q7Y U;  2J7I A;  2HKN A;  2BE9 B;  1UJY A;  2YRC A;  1X27 A;  1T3S A;  4J7F A;  1W6X A;  4RMO A;  2X4W A;  2VGN A;  2CSQ A;  1LVK A;  1HK9 A;  3G7Z A;  3TEE A;  4BUG A;  2L5Q A;  3QYG B;  4ORZ A;  2EGC A;  4A4K A;  1SRL A;  3MHX A;  3G6E Q;  2RQW A;  1B07 A;  2YLC A;  5M9O A;  3M55 A;  4M7D F;  3P8H A;  3CPW S;  3CCE T;  5CKH A;  3VS5 A;  3CCU T;  3CC4 Q;  3M4Y A;  2QG9 B;  4IUU A;  4BDZ A;  1YJW A;  5DLO A;  4JS5 A;  2X4X A;  3OS1 A;  1I0C A;  4FSS A;  1UJ0 A;  2M16 A;  2E5K A; 
#chains in the Genus database with same CATH homology
 4JRK A;  3CCQ A;  4XU0 A;  5GAN g;  3C94 A;  4ZN1 A;  4D6W A;  4MZM A;  1BIA A;  2Y90 A;  4BY6 B;  4FL6 A;  3LH0 A;  3CXC S;  3JCM J;  3JB9 G;  1JBM A;  3L2Q A;  4BB7 A;  1DJ7 B;  4KBM B;  4EMG A;  1K73 C;  4B9W A;  3LW5 E;  4QVZ A;  4C5G A;  3OYL A;  4XQ3 A;  4C92 G;  1YIT A;  1YIT T;  2QQR A;  2FHD A;  2RK1 A;  2EJ9 A;  3V8L A;  5DM7 R;  2QEX T;  3CME A;  2XD0 A;  2LQ8 A;  4N0A A;  3OW2 S;  1NE8 A;  3FJP A;  3O8V A;  3MEU A;  5FU6 B;  2DPP B;  3MEA A;  4PNO A;  3GNF B;  5FRO A;  4LD9 K;  1R8O B;  3RKW A;  3L2V A;  4E7H A;  4QW2 A;  3E19 A;  3RKY A;  1G5V A;  2V8J A;  1U8R A;  4LDW A;  2EQU A;  2ZGW A;  3JRZ A;  4XTX A;  4BE1 A;  1VQ8 A;  3NTH A;  3JB9 J;  1VQN A;  4QQD A;  2QA4 A;  4M7D C;  3OS0 A;  2MF2 A;  1VQ9 A;  2VYT A;  2GFA A;  3JCM b;  4CRI A;  4ZGJ B;  5LJ5 d;  2I2L A;  2CS7 A;  3M59 A;  1OI1 A;  5J3B A;  5GMK e;  1M9S A;  5DLQ E;  4E7J A;  4MMK A;  3GLX A;  4OB0 B;  4Y91 A;  2P4T A;  5GAN 7;  4M77 C;  1Y7X A;  3X28 B;  1K73 U;  1M4Z A;  5KE3 A;  2CZ7 B;  5J39 A;  4OMF B;  3MO8 A;  4OVA A;  5LJ3 e;  4JDS A;  2QQ9 A;  3OYB A;  2VC8 A;  3CPF A;  4M7D D;  4PJO A;  1UGP B;  4JUV A;  3QUI A;  4PLL A;  4N0A C;  4ZTJ A;  4PJO B;  1WJR A;  4DQ2 A;  4RCB A;  3S3M A;  3M53 A;  1BYM A;  5LJ3 f;  4TVR A;  5LJ3 h;  3QSU A;  3CCR T;  2HNI A;  4HA8 A;  2CKK A;  3L2R A;  5IT9 E;  2EJG A;  2XIC A;  2HD0 A;  2L89 A;  3MP1 A;  3X20 B;  2ZPB B;  4RG8 A;  3PMI A;  4J6W A;  4O6J A;  1IZ6 A;  3OQ5 A;  3UPU A;  4X9C A;  4BAC A;  4M77 G;  1M1F A;  3I56 T;  4O5V A;  3JB9 I;  3QBY A;  5FLX E;  3LYI A;  4UC4 A;  3CBP A;  5CAI A;  2RI2 A;  4IUP A;  3JCM Q;  2DZC A;  4J7I A;  2PU9 B;  1KHC A;  2ZCF B;  1MHN A;  3C95 A;  2DD5 A;  2ZPE B;  2QA4 T;  1YHQ T;  4HCB A;  2JTF A;  3NFC A;  3JCM V;  4ATO A;  3HHT B;  3QJY A;  3UDC A;  2MWO A;  3A8L B;  3EFS A;  5CVI A;  2FVU A;  2E6Z A;  5GAO p;  2X35 A;  3PFS A;  4E7L A;  4C92 E;  3M58 A;  1ZHI A;  3FIF A;  3EFR A;  2LX9 A;  2VXE A;  3CEY A;  5CR2 A;  5GAO m;  4Z02 A;  1G3W A;  3ER0 A;  3T9N A;  2QQB A;  5HKC A;  1YJN T;  3HSB A;  3OYM A;  1XOV A;  4OB3 B;  2V8K A;  5GMK m;  4M78 C;  2M0O A;  2R5M A;  1Q86 U;  1UB4 A;  3H6Z A;  3CCL A;  1OZ2 A;  2WSE E;  1G3S A;  3CCV T;  1QP2 A;  2K5I A;  2PVD B;  2EYQ A;  3JCM e;  4KUD K;  3KUF A;  1VQ5 T;  2JOY A;  2O4X A;  2EQJ A;  3LLR A;  4J6Y A;  3S6W A;  3X24 B;  4ELZ C;  3JAM E;  4EPC A;  4MDX A;  1WJQ A;  4V2S A;  5FRN A;  1SSF A;  2YRV A;  2QQA A;  4M75 B;  1Y07 A;  1ZBX A;  3OYF A;  1K9M C;  1JB0 E;  2L3R A;  4BI8 B;  5HK0 A;  3HKS A;  3WVE B;  4M7D E;  2GF7 A;  3NTK A;  2MAM A;  2PUO B;  4FT2 A;  2XID A;  3OYA A;  3UT1 A;  1UGS B;  4A4G A;  5HK3 A;  3INZ A;  2EJF A;  4PJO G;  4F7U G;  3GP8 A;  4C8Q E;  4HKE A;  4OF1 A;  4J83 A;  1K8A U;  1QP3 A;  4GLK A;  4C8Q B;  5GAM e;  3SB2 A;  3M5A A;  2O01 E;  2PVG B;  1K9M U;  1PSE A;  1X01 A;  2FB7 A;  4A4H A;  5GAN 3;  1IRE B;  4GY5 A;  2KY9 A;  4EMK C;  3FC3 A;  1VQ4 T;  3CC7 T;  2ZZD A;  5GAM f;  5GAM h;  2RA2 A;  3LWH A;  3M54 A;  5GAN e;  1X6O A;  4PJO C;  3RKX A;  1VQM T;  4LDY A;  3CC2 T;  4A53 A;  3HFN A;  2DXC A;  2P0K A;  1QVG S;  4JRP A;  4M77 E;  3BW1 A;  2MMP A;  3C4S A;  3P8B B;  4EMK B;  3CMA A;  2LQK A;  4C0D B;  2RM4 A;  2YHT A;  4C0F A;  2EIF A;  2KDS A;  1Q82 C;  2E70 A;  1N9R A;  3G4S T;  2HAX A;  1P92 A;  4ZN3 A;  5A2Q E;  3I55 A;  1VQ5 A;  2LCC A;  1K8A C;  2GQV A;  1WQW A;  3GNG A;  2FL7 A;  3CC4 T;  1YJW T;  1OYX A;  2DEQ A;  1Y96 A;  2P0P A;  5KH6 A;  2LT1 A;  1VQP T;  2DVE A;  3V7C A;  2RK2 A;  1Q82 U;  1GXI E;  4KT0 E;  3A8M B;  4EMK A;  5AYF A;  3EAE A;  4XTU A;  3DB3 A;  4M7D B;  4C5I A;  5CKE A;  2F5K A;  1MGQ A;  2M9U A;  4IUR A;  2MI6 A;  3CCE A;  2QDY B;  1YHQ A;  1NZ9 A;  2WSF E;  3A8O B;  2QI2 A;  4F7U A;  4N4H A;  4J5Y A;  3JB9 D;  5GAN d;  5CO7 A;  4J6X A;  5I2M A;  3J81 E;  2P0Q A;  2DAQ A;  2RHI A;  4M7A C;  4QQ6 A;  3CD6 A;  2BKD N;  4B9X A;  4M78 B;  2OTL T;  4M7A D;  3CCS T;  2CGH A;  2OTJ T;  3OYY A;  2JVV A;  2XDD A;  4M7A E;  4M7D G;  3N5B B;  3CMA T;  4RCC A;  4M7A B;  1VQO A;  4OGE A;  4F7U B;  3V8K A;  2DIQ A;  2EKO A;  2LTO A;  3PIP A;  1M1G A;  3GF5 A;  3QPH A;  4C8Q G;  3CCR A;  1VQ8 T;  4M78 E;  5GAM d;  4XU2 A;  1O75 A;  2CYZ B;  2Y4Y A;  4FU6 A;  4C0G A;  1N27 A;  1Q86 C;  4PJO D;  1BI3 A;  1VQK A;  1VQK T;  5GAO n;  1VQ4 A;  4BI4 A;  1KQS A;  4QQG A;  2RJD A;  1M8V A;  3UWN A;  4R56 A;  3TCJ A;  3ZEH A;  2JTM A;  1KQ2 A;  3X25 B;  4OP0 A;  5LJ5 f;  5LJ5 h;  3MEV A;  5C6S A;  4M7A A;  2Y4X A;  3E1S A;  5D6X A;  5GMK l;  2A7Y A;  5LJ3 j;  2L8D A;  3G71 A;  4LDX A;  2DTI A;  1VQ6 T;  2E65 A;  2O4X B;  3PTA A;  3Q1J A;  1I5L A;  2JZ2 A;  4NL2 A;  1KD1 C;  4FSX A;  3KXT A;  2B8A A;  4DOW A;  1W2B S;  2XKO C;  3OS5 A;  2EQK A;  5D6Y A;  1N6A A;  1WJS A;  3HP9 A;  2OTL A;  2XU8 A;  3M9Q A;  4MML A;  3CD6 T;  4C5E A;  4C92 A;  4C8Q F;  4A4E A;  3X26 B;  3CCJ T;  3CME T;  3JB9 F;  3RER A;  3A5Z B;  3BY7 A;  3ME9 A;  2R57 A;  1KD1 U;  3PMT A;  1FX7 A;  4ZGD B;  5GAN 8;  2JN0 A;  4M77 A;  2WAC A;  3M57 A;  2CZ0 B;  1M5Q 1;  2E5Q A;  1BKB A;  3OBY A;  3JCM h;  3JCM f;  2RH2 A;  5IN1 A;  4R55 A;  1V29 B;  1FWZ A;  4XU1 A;  2K4Y A;  4C92 C;  4MDW A;  4JLI A;  1NJI C;  3CCQ T;  1JJ2 A;  3PGG A;  3CPW A;  3RMQ A;  2K3X A;  4IUQ A;  4IUT A;  1NPP A;  1YIJ A;  4PLI A;  4DOV A;  4BD3 A;  2RO0 A;  4XK8 E;  3JSC A;  2D9T A;  3QZ9 B;  3CCS A;  2RJC A;  1I81 A;  2DK3 A;  2EQM A;  3S3N A;  4M7A G;  3QJ6 A;  5A0L A;  1KHI A;  2XK0 A;  1QW1 A;  4M78 D;  2KMT A;  2RB6 A;  3BFM A;  1O9S A;  4M75 A;  2RHU A;  4PJO E;  4M75 C;  4F7U E;  3OMG A;  3QZ5 B;  3RIR A;  3VKI A;  3VU3 C;  3RUX A;  3GPL A;  1G3T A;  4MZP A;  3QKJ A;  1X75 C;  2GCX A;  1XTD A;  3HPW A;  2RHX A;  4OB2 B;  4KUL A;  2IG0 A;  3OMC A;  4DA4 A;  3L2Z A;  4YTL A;  4C92 F;  2RI3 A;  5LJ5 j;  4C8Q A;  1NJI U;  4OGC A;  2DKG A;  1VQP A;  4WF2 A;  2KK4 A;  4Q5W A;  1YI2 T;  1H3Z A;  4LDV A;  4BY6 C;  1M1K U;  2EFI A;  3E9G A;  4M77 F;  5HY6 A;  3GOX A;  3NTI A;  5D6W A;  1VIE A;  4M75 E;  3SD4 A;  2DZ9 A;  2BUD A;  3L42 A;  4RKU E;  2E12 A;  3QHS A;  3R6O A;  2XDP A;  1NPR A;  3V8J A;  3J80 E;  1LJO A;  3MP6 A;  4JRQ A;  4KUI A;  4M78 A;  3J7A F;  2AHJ B;  2PUK B;  4M75 D;  3SDZ A;  1KG1 A;  4BI3 A;  1QVF A;  4M7A F;  5FU6 C;  4LD6 A;  1UGR B;  2ZPH B;  3FRN A;  4VUB A;  2RJE A;  4L5G A;  3MP8 A;  3OYE A;  2KAF A;  3LWI A;  3ZFJ A;  1VQM A;  3CC2 A;  3G71 T;  2HBP A;  3VUZ A;  3MCA B;  5GMK i;  4XTZ A;  3L2U A;  1Q81 C;  2JNG A;  2XI9 A;  4PKC C;  2DXT A;  2RJF A;  5CKF A;  3QO3 A;  5GAN 5;  3OYJ A;  3CCV A;  2ZPF B;  5FU7 B;  3CCM A;  3CCM T;  2HQX A;  1VUB A;  2LNV A;  2CZ1 B;  4A54 A;  1M1K C;  3G6E T;  3FDR A;  2D6F A;  3QII A;  1YJ9 T;  4M7D A;  5CK9 A;  4ZGE B;  1B34 A;  2LCL A;  1JRI A;  2PQW A;  3HRS A;  3OSS C;  4X9D A;  1KC8 C;  2F5T X;  2K5F A;  1S72 T;  2RHY A;  3JCM c;  2RD1 A;  3PNW C;  5A0D A;  2A3L A;  1LNX A;  2K5L A;  2M1H A;  3LGF A;  3LGL A;  4HCZ A;  3URG A;  1YBY A;  4ME7 A;  3OY9 A;  4LDU A;  3WXM B;  2XDB A;  2RI5 A;  3QXE B;  3H8Z A;  1UGQ B;  2OTJ A;  3HFO A;  2XG8 D;  4C92 D;  3CBM A;  3RMS A;  4PJO F;  5LJ3 d;  3JCM P;  3QDR B;  3AHU A;  3I56 A;  3A8H B;  4RG2 A;  5GMK h;  2C06 A;  1TH7 A;  3SFM A;  1HXD A;  4ELY C;  3DB4 A;  5GAN j;  4M78 G;  4HT9 A;  5CCA A;  3OS2 A;  3CCU A;  3TU4 K;  5GAN 4;  1D3B B;  1U1T A;  3TRE A;  2HQE A;  5L8R E;  3OW2 A;  2DTO A;  2EAY A;  1JJ2 S;  2RHZ A;  1VQ7 T;  4HT8 A;  4C0Z A;  2LC4 A;  1WNL A;  5GAN f;  5LJ5 e;  5GAN h;  5GAN 6;  4QVD A;  4C5H A;  4C8Q C;  2VV5 A;  5GAM j;  1YCY A;  3ZBD A;  5KE2 A;  3HRU A;  4C8Q D;  2EWN A;  3JCM d;  3OYC A;  1M90 U;  1VQL A;  5LJ3 g;  3S3O A;  2E41 A;  4XU3 A;  1XNI A;  3BDL A;  5CQY A;  1BI1 A;  1W2B A;  1BI2 A;  3KBG A;  2ZPI B;  2IVW A;  4E7I A;  1Q81 U;  1WQ7 A;  3VYH B;  1RI0 A;  2GFU A;  4E47 A;  5IAY A;  5KCO A;  2DD4 A;  3E9F A;  3LX7 A;  3QYH B;  1ZQ1 A;  4A4F A;  1YIJ T;  1QVG A;  4J8O A;  5CIU A;  2PVO B;  4X34 A;  2VUB A;  2X4J A;  2LT4 A;  2E64 A;  2DO3 A;  2QQS A;  4HCC A;  1VQN T;  2E1H A;  4JRI A;  1OZ3 A;  5CKB A;  5A0G A;  3JCM g;  2K3Y A;  4M78 F;  1KC8 U;  3JCM W;  4FT4 A;  5GAO q;  1WPY A;  1I4K 1;  2K2V A;  4NL3 A;  4FM4 B;  5CKD A;  2H3J A;  2WSC E;  4PL6 A;  1LOJ A;  2FYK A;  4F7U F;  1YJ9 A;  3QG1 A;  2XHC A;  2KVQ G;  2YLB A;  4M77 D;  3MET A;  4M77 B;  5GAM g;  3G6E A;  2JUF A;  3BDU A;  3FLG A;  4L59 A;  2NLU A;  1UEB A;  1XQH A;  1I8F A;  3OYD A;  1KQ1 A;  1WGS A;  3CC4 A;  2LDM A;  5KCH A;  1Y96 B;  4C0D C;  3CCJ A;  5FU7 C;  4N4G A;  2LVM A;  4M75 F;  3V7S A;  5GAN 2;  1PSF A;  3MEW A;  2BIV A;  4QVC A;  2DIG A;  5GAO r;  2KQW A;  3OYI A;  3OSV A;  4MZT A;  1QVF S;  1Y71 A;  2VGM A;  2LRQ A;  1EIF A;  2F69 A;  4IUV A;  1AHJ B;  2CZ6 B;  3SWN C;  3VUB A;  5FRM A;  3VYG A;  1VQ6 A;  2K57 A;  2MWP A;  3V7R A;  1VQ9 T;  1S72 A;  4Y28 E;  5EG2 A;  1BI0 A;  3OYK A;  3C12 A;  2ZPG B;  2VXF A;  4BDY A;  3CCL T;  3JB9 H;  1M90 C;  3DLM A;  4L6V 5;  3CC7 A;  1Q7Y U;  2OAU A;  5LJ5 g;  4ZTF A;  1H64 1;  2QXF A;  1N8R C;  2KSS A;  3WVD B;  2QEX A;  4FIB A;  1U1S A;  1KQS S;  1YI2 A;  5CQX A;  4CI0 C;  5C0M A;  4EDU A;  3L1A A;  1N9S A;  3P8D A;  4J7F A;  4RMO A;  1VQO T;  5I21 A;  1QVP A;  4IKF A;  4JS4 A;  4M75 G;  2X4W A;  1D3B A;  5J26 A;  2VGN A;  3FEO A;  1FXX A;  4XTY A;  1HK9 A;  2V8I A;  3G7Z A;  4NOY A;  3TEE A;  4BUG A;  3CXC A;  3GIB A;  2L5Q A;  3QYG B;  3I55 T;  3VJP A;  3SWN A;  4N4I A;  3F70 A;  2E10 A;  1RL2 A;  2QTX A;  3MHX A;  4XTV A;  3SWN B;  4A4K A;  5GMK j;  3DLL A;  3FB9 A;  3L2W A;  2E6N A;  2DJZ A;  1BIB A;  2YLC A;  5M9O A;  3M55 A;  1W4S A;  4M7D F;  1G3Y A;  4JJN K;  1VQL T;  3P8H A;  4BE2 A;  4E7K A;  4BE0 A;  2R58 A;  4P5N A;  3CPW S;  1N8R U;  4II1 A;  1VIF A;  5GAO l;  1YJN A;  3CCE T;  3M4G A;  3VV0 A;  5CKH A;  5I2S A;  3RES A;  3HL8 A;  3HRT A;  3PIO A;  3OA6 A;  3CCU T;  2DTH A;  2D0Q B;  3ASK A;  1VQ7 A;  2DXB A;  4OB1 B;  3OYN A;  3M4Y A;  4EMH A;  2G3R A;  3OB9 A;  3PT9 A;  1B34 B;  4XAX B;  5DY9 A;  3CBO A;  3DKM A;  2R5A A;  4IUU A;  4XTW A;  3OYH A;  4BDZ A;  4C92 B;  1YJW A;  2X4Y A;  3A8G B;  5DLO A;  3OYG A;  4JS5 A;  4NS5 A;  4JLG A;  2DXU A;  2X4X A;  3OS1 A;  1Q7Y C;  5LL6 S;  3G4S A;  3JCM X;  3OBW A;  2M16 A;  3M56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...