2DXBA

Recombinant thiocyanate hydrolase comprising partially-modified cobalt centers
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
VWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thiocyanate hydrolase subunit alpha
publication title Structural Basis for Catalytic Activation of Thiocyanate Hydrolase Involving Metal-Ligated Cysteine Modification
pubmed doi rcsb
source organism Thiobacillus thioparus
total genus 28
structure length 118
sequence length 118
chains with identical sequence D, G, J, M, P, S, V
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxbA00
3VYHB 2CZ1B 3HHTB 3A8MB 1JB0E 2ZPGB 3A8HB 4OB0B 3VYGA 1DJ7B 2ZZDA 2O01E 1PSFA 4Y28E 4ZGDB 4FM4B 2ZPBB 3A8GB 2WSCE 2PVGB 1V29B 2WSFE 3QYHB 2DD4A 2PUOB 4ZGEB 3X24B 3LW5E 3X26B 2PU9B 2ZPHB 2PVDB 2CZ6B 3WVEB 3A8OB 1QP3A 3X25B 2DD5A 2CYZB 4OB1B 2ZCFB 4RKUE 4KT0E 3QZ9B 2ZPEB 4OB3B 1UGQB 1PSEA 2D0QB 3QYGB 4ZGJB 4OB2B 2CZ7B 5L8RE 1QP2A 1UGPB 2CZ0B 2AHJB 3A8LB 1UGSB 1AHJB 2ZPIB 1IREB 2DXBA 2DXCA 2DPPB 2WSEE 3X28B 4XK8E 4L6V5 3X20B 2QDYB 2PUKB 1GXIE 2PVOB 3QZ5B 2ZPFB 3QXEB 1UGRB 3WVDB
chains in the Genus database with same CATH superfamily
3VYHB 4J8OA 3CCQA 3I5SA 4XU3A 4LDXA 4XTWA 2L3RA 2LP5A 3CCJA 3VUBA 2EQIA 1XOVA 3V8LA 1VQNQ 3HL8A 1WGSA 1BKBA 2V8KA 2QAZA 1EX4A 3EFSA 1GRIA 3LH0A 3QO3A 4WF2A 1H3HA 3H41A 5GAOl 2MCNA 1I8FA 2CUBA 2FO0A 4M78B 3ZFJA 4M78A 5FWCA 2MWOA 1U1SA 2WACA 4BDYA 2P0PA 1TU0B 2ZPHB 1GCQC 2GFUA 1T0JA 3LGFA 2FZCB 2RF0A 2CYZB 1M90R 2X9HA 3QZ9B 2VYTA 2ATCB 4DEXA 4J9EA 5KCOA 1OYXA 2X3XD 3CMEQ 1ZA1B 2QYZA 1GL5A 1ZSZB 1WA7A 1ZSZA 3MJXA 1JQQA 1YCYA 1EIFA 1VIFA 5FU7B 2A08A 2JN0A 1FXXA 3OYGA 1UGVA 2YT6A 3UWNA 3CCUA 4IUVA 3X20B 5GAMf 3BDUA 3CCST 4ELZC 3CCRT 4BUGA 4Z02A 4BY6B 2KAFA 1HSQA 1D0XA 1W70A 2E3IA 3DLLA 4JUVA 3RMSA 1WJSA 2YXYA 1QCNA 3FRNA 4RCBA 2HBPA 1Q86C 2E41A 2KXCA 3R6OA 1AD5A 1SRLA 1UGRB 3CCRA 2GGRA 1K4US 3CEYA 2DTHA 1FMWA 4IURA 5LJ5j 3GNGA 5FU6B 1PSFA 2QQSA 1ARKA 2K3BA 2GBQA 2K5FA 1TS9A 2E6ZA 1LJOA 2EQUA 3M4YA 4F7UE 1AOJA 1KD1C 3X24B 4O5VA 2YWWA 3M0QA 1U8RA 2CH4W 2LJ3A 2KSSA 1TH7A 1V76A 1VIEA 1QP3A 2HKNA 5KYXA 2DYBA 4GBQA 3V8KA 3CCMT 2HZYA 2JW4A 1K8AR 2V1RA 2HL5C 1ABOA 3GIBA 1C1AA 1MV3A 2O2OA 2EVRA 2LQ8A 1MHNA 3FIFA 3M59A 3CMEA 4CC2A 1M4ZA 2COWA 2L3SA 4EIKA 1WLPB 4OMLA 3A8LB 2NYSA 4E7KA 4Z88A 2JM9A 5D7UA 4ORZA 4C92E 1RI9A 1RL2A 1MGQA 5CKDA 1MMAA 2XDBA 3VS0A 1UHFA 3PMIA 2X51A 4E7SA 3UA7A 1UG1A 2DEQA 3EFRA 5L23A 4J9GA 3TEEA 4ESRA 2QEXQ 4HVVA 1ZUUA 2YUOA 3EG1A 3PVQA 3GP8A 4LD6A 2ZPFB 2D8JA 3VS6A 3MO8A 1AT1B 1OQKA 1IHWA 2CZ1B 2ZPGB 3HPWA 3I55Q 1M9SA 1MNDA 2F2VA 4M75D 3CMAA 2RQTA 3CD6Q 3EAEA 2EGEA 1UHCA 2OTLT 3M57A 3A8GB 4M7DE 1VYUA 2LX9A 5GAN8 1WXUA 1JJ2P 4B9XA 2CREA 2WSFE 1ABQA 2F1LA 2HEQA 5J3BA 4QW2A 4LDUA 2L0AA 4E2FB 2AZVA 1YCSB 2M0YA 5GAN3 1OX9A 3M9QA 2HSPA 2FZKB 1I1JA 3A8OB 1GCQA 1CKBA 3SDZA 1K1ZA 4HCZA 2GQVA 4RKUE 2XU8A 5HK0A 1BI1A 1UFFA 3OSSC 4JRIA 3MPUB 2DILA 3JB9I 4C92C 3EH2A 3V7RA 2O31A 2BKDN 4WCIA 1LNXA 2GNCA 4PL6A 4RTWA 1Z9QA 4PLIA 2EQMA 4FYYB 3JB9J 1BIBA 3TSWA 1RABB 4C8QE 3M0UA 3HRTA 4JDSA 2RHXA 2R5AA 2E70A 3OA6A 4BE1A 4JPBW 3ME9A 4MZPA 4DOVA 1K9MC 1AWJA 5GANh 1QVGP 4A4FA 3SB2A 4OMMA 4RCCA 1GBQA 1RAIB 2MMPA 5GMKm 2KMTA 2DJQA 3JB9H 2RQVA 3OQ5A 2EGCA 1EFNA 1W2BP 4DQ2A 2QEXA 3HRUA 2RB6A 2PVOB 3KXTA 2HBWA 2X4JA 1YITQ 1UJ0A 3OYIA 2DLPA 3JCMW 1OPLA 3LWHA 5GANj 3QWYA 1PM3A 4PNOA 1ZBXA 4BI4A 3I55A 1WHHA 2D1XA 3OW2A 2JTMA 1N8RU 2NLUA 1OU9A 3CD6A 4F04B 2JM8A 3OW2S 2ZPBB 4ANJA 2K9GA 4HVUA 2G6FX 2IG0A 2EBPA 1VQ6T 4PK4A 3P8DA 3RKWA 8ATCB 3CBMA 3M56A 1UECA 4ZGEB 1X2KA 5GAOq 2QGGA 1K76A 3A1PA 4R0KA 1H8KA 3BW1A 3L2QA 4BDZA 1VQ6A 5FWBA 4QVDA 1B34B 4KGXB 1TUGB 3PIOA 4J6YA 1B34A 1UB4A 3CCVQ 4XTVA 2C0IA 2V1QA 2FRYA 3EFOB 2DJZA 1ZHIA 3EFOA 3INZA 4C8QC 4LXCA 4M7AD 4M7DD 1J3TA 1QWEA 4HCCA 3OYEA 4C5IA 3M0PA 3OS5A 1UE9A 2JS2A 3JCMX 3VS1A 4C5HA 2L3PA 1NLOC 1AWWA 3QWXX 4PJOG 5GAN6 4EMKC 3CXCS 3JCMg 2KBTA 1HK9A 1KJWA 1Q81R 2OI3A 2DVEA 3OB9A 4C92F 3MP6A 5AYFA 3VS7A 4PFOA 4QVZA 2CGHA 3TSZA 3VUZA 5LJ3g 3URGA 3ULRB 3RKYA 1WX6A 1Y07A 1I5OB 1AWOA 4QT7A 3CC7T 2QTXA 2RA2A 2LT4A 1R0CB 2JVVA 3H9NA 2LCCA 2I0NA 2JTFA 4P5NA 1YITA 1NLPC 1IGUA 2QI2A 1E6GA 5IHNA 1N27A 1WDXA 4JJBA 1JB0E 2JMAA 4LDVA 3TVTA 1X01A 4AG2C 2F2XA 1Z9ZA 4RTUA 3V8JA 1MV0B 1NZ9A 5IXFA 4JRQA 3THKA 1G3SA 3MEUA 4IIMA 2KDSA 5GAN7 3G71T 4OMQA 4HT8A 1Q82R 1VYVA 1OOTA 1BIAA 1M30A 3CCQQ 2DD4A 1WYXA 2O88A 3AHUA 5DLOA 3QPHA 3QG1A 3CCJQ 4M77G 2KR3A 3JCMe 1BB9A 4BACA 1Y71A 1PD0A 3HTRA 3TQ7P 4VUBA 2MOXA 2D6FA 1BCMA 5AT1B 3JCMf 3GOXA 5LJ3e 6AT1B 3LWIA 3CCVA 2M1HA 1KHIA 2V26A 3OSVA 3PFSA 1OPKA 3NMZC 4BE0A 2QK0A 1M27C 2GTOA 4C92B 2X3WD 1S1NA 4C92A 4HVWA 2X4WA 2DX1A 2KRSA 4A4HA 2D0NA 3CC2T 2CP7A 2MIOA 2JT4A 3OS1A 4OMNA 2LC4A 1I0CA 2ESWA 3OS0A 4C8QF 1YFNA 3G1JA 2M16A 2QA4T 4FYWB 3WXMB 2NUPB 4RG8A 2NUPA 4L6V5 4Q5WA 3G6ET 3CC2A 3JV3A 3EGUA 2VGNA 9ATCB 1IZ6A 1QW1A 2BIVA 5KE2A 3JCMJ 3MP1A 3JCMd 4E7ZA 1VQMA 2K3YA 4QVCA 1VA7A 2P0KA 2HMAA 5LJ3d 2CT3A 2EYZA 3DLMA 5C6SA 4RTTA 1AZGB 2VVKA 3SFMA 3JCMb 3MEWA 1RACB 1Y96B 2FVUA 3A8HB 1Y96A 2M0OA 3EHRA 2L8DA 5A2QE 1VQ8T 4CI0C 2ROLA 1N8RR 1NJIU 2L89A 4F14A 1D1CA 1M1KU 1X43A 4OF1A 2LNVA 3GNFB 4MZTA 5D6WA 1KG1A 1OEBA 3CCSQ 1Q7YU 1BI0A 3CCRQ 3QHSA 1NEBA 2ZAEA 3SEMA 2DYIA 2FHDA 4E7HA 5GAMg 2K2MA 5DLQE 3VRZA 3L42A 2DO3A 2EJFA 3VV0A 2DZCA 1UTIA 4IKFA 4TVRA 5KYUB 1NYGA 4IUTA 5KYUA 2KYMA 4JZ4A 8AT1B 1MNEA 1K73U 1K0XA 2EIFA 1FYNA 4PJJA 2E5QA 4KT0E 3PGGA 2ZPEB 3PIPA 1TWBA 4C0FA 4C8QB 2L3QA 1TUDA 4C8QA 2DNUA 2KK4A 4ZGJB 4X1VA 4OB2B 4QKUA 4IIOA 1M3AA 3CCLT 3OYAA 2MK5A 1M2OA 1LCKA 4ZNXA 4J5YA 1TOVA 4FSXA 5KYYB 5KYYA 2H8HA 2COYA 2DE0X 2JUFA 3BY7A 2DA9A 4EMKB 1WQWA 2DMOA 4EMKA 4ME7A 3HRSA 2HAXA 5CK9A 1D0ZA 3M0TA 2ED1A 1PRMC 4RTVA 4X9DA 4RTZA 1D0YA 2LQWA 1X6GA 2KY9A 3CCMQ 2W0ZA 4M78G 5CR2A 3E9FA 3OYDA 4K11A 1S72T 2MYSA 3VS3A 2DBMA 2CT4A 5GAMe 4M75E 1BCOA 3IQLA 5J26A 3VU3C 5CQYA 3WVDB 5CKEA 1QKWA 4EPCA 2RMOA 3BDLA 4JJNK 3VJPA 4R56A 3C95A 3I35A 5GMKe 1NM7A 3VS4A 1WHMA 4J7IA 5GMKl 2MF2A 3UF4A 4RUGA 1VQOT 2XDPA 5FRNA 1RUWA 3A98A 5EG2A 2RNAA 3D7SB 5M9OA 3CCSA 1KHCA 4J9CA 2A7YA 2Y4XA 1RLQC 4ZN3A 1VQ7T 3CMAQ 2KEAA 3FC3A 1NBEB 1Y7XA 2PVDB 3FEOA 2JNGA 3WVEB 3GF5A 1EZZB 1YJWT 2VB6A 4AT1B 1I07A 4C0DC 3JCMP 2DL8A 4J9DA 3SWNC 3C0CA 1LVKA 4JLGA 2PNIA 2J6FA 2B86A 1PSEA 2VGMA 4XTXA 1Q86U 1VQ5T 5GAMd 2PZ1A 2OX7A 2OTLQ 1QP2A 3UA6A 1ZUYA 2LVMA 4LUEA 2KQWA 4KH1B 4XTZA 2EYQA 1YJ9T 1VYTA 5KYXB 3MP8A 5LJ5e 4KH0B 3M54A 2HCKA 4N0AA 1N9SA 5LJ5f 1PRLC 1ZLMA 2BE9B 4BE2A 1BYMA 3M0SA 2AK5A 4RTXA 1WZOA 2C0OA 4M75C 4D8KA 3LH5A 2FEIA 2E65A 2HD0A 2A0FB 2VUBA 1KD1U 5CCAA 2EJGA 2RI3A 2DK3A 1GXIE 3CCMA 2YLBA 3PVLA 3QZ5B 1KC8R 3LGLA 4AFSC 4A63B 2RJCA 3OYKA 3VKIA 4A4GA 3CCET 2KRMA 2E3HA 3GPLA 2SEMA 4DEYA 2E4HA 2DRKA 4DBQA 2A36A 2RJDA 1VQ4T 1K9AA 1NYFA 1NJIR 2DIGA 4AFQC 4HCKA 1M1KR 3L2UA 4KUIA 4M4ZA 2EKHA 3QDRB 1BK2A 2FPEA 4PJOD 4PJMA 2DERA 3QYHB 4HT9A 5LJ5d 4ZN1A 1Q7YR 7AT1B 1AEYA 5CIUA 1VQPT 5KYWB 2DF6A 2MAMA 4DOWA 5KYWA 5CKHA 3JB9D 2CS7A 1X69A 2RK2A 3EG0A 4M7AE 2M02A 4L5GA 1N6AA 1K73R 3AT1B 2RQRA 1QKXA 1LPLA 1UDLA 2QQAA 2K3XA 1D1AA 4CC7A 4F17A 1SSFA 1RAHB 2CDTA 1E6HA 1OZ3A 2D9TA 2H3JA 2HQEA 2LQNA 4Z8AA 2OTLA 1VQ6Q 1M3CA 1HXDA 2EGAA 3F70A 3N5BB 1UGSB 2HQXA 1SEMA 3T9NA 2EPDA 4FW1A 1OU8A 3PE0A 1I81A 3EG2A 3UDCA 1T3LA 5HK3A 4XK8E 5IT9E 3CBOA 5IH2A 1VQ9T 1TUCA 1KIKA 2GQIA 3HKSA 3L2VA 2K79A 1QMCA 3EGDB 2E6NA 3EGDA 1X2QA 2EQJA 2BTTA 1VQ9A 4L59A 1OI1A 2CP6A 4M75F 1W6XA 3QDFA 4FW2A 3I56T 1YP5A 2FL7A 4FM4B 4M78E 1WJQA 1NG2A 3OYYA 1V1CA 4M7AC 4M7DC 1VQLT 2MWPA 2QQ9A 1IGQA 1KQSA 3O8VA 2XDDA 3CC7Q 3VRYA 1SHGA 2XI9A 3M0RA 2E12A 2RHUA 3X26B 4EMGA 1KQSS 1K9MU 2DXTA 2CZ6B 2DTOA 1YHQT 2OAWA 4XU2A 4C0DB 1PC0A 2YUQA 1F1BB 3SWNB 3SWNA 4OB3B 2QG9B 1QVFA 3G4ST 3NGPA 2V8JA 1PG5B 2KI7A 2AKLA 1QVFS 3EHQA 1Q86R 4OMPA 1A0NB 1YHQA 5I2SA 4F7UF 1WHJA 3OYLA 4ELYC 2FPDA 3G71Q 1D1BA 5IXBA 2EW3A 4E7JA 3J80E 2ZPIB 1UUEA 5GANf 3JSCA 4JRPA 2VXEA 3NTKA 4FIBA 3RNJA 2DPPB 1YI2T 4HA8A 2L2PA 2ENMA 3MEVA 4WTOB 2V8IA 2J05A 5D6XA 1M90C 1ZBJA 4M75B 2YUPA 4M75A 3CXCA 1KD1R 4D8DA 3NTIA 1NPRA 2MI6A 3H6ZA 1SKUB 2DL4A 2RM4A 2LJ0A 1YI2A 2A3LA 3HP9A 2JTEA 2E64A 2EFIA 1PKSA 1RAEB 3CC2Q 1E7OA 1WXBA 2LCLA 2KRNA 1AVZC 4LE9A 4RG2A 5C0MA 3OW2P 2AIRB 1G83A 2K6DA 5EC7A 2CSQA 4ZGDB 4J9FA 4X9CA 2QA4Q 1VQMQ 1TTHB 1M1GA 1QVPA 4C5GA 1YWPA 2RJFA 2XG8D 2DM1A 4LNPA 3G6EQ 3JCMh 4QQ6A 2E1HA 2YRDA 3H0HA 4UC4A 2PUOB 1FWZA 2LCSA 3QSUA 5LJ3h 3CC7A 4LDWA 2LX7A 2LDMA 4F7UB 4F7UA 3CPWP 1JXOA 5HCKA 1MMDA 1GFDA 2DD5A 1O9SA 1AZEA 2LQKA 2NWMA 2ED0A 1VQKT 4M78D 4M7AF 1VQ8Q 4M7DF 1RAFB 1ZSGA 3CC4T 5GAOp 4BY6C 4LDYA 5LJ3j 2NUTB 2NUTA 2Y90A 2CP0A 1WQ7A 2KNBB 1WHGA 2XIDA 3G71A 2OTJT 2BUDA 1AHJB 5GMKi 1IREB 2J06A 3HFNA 4E7LA 4JLIA 1T3SA 2RHYA 1G5VA 4F7UG 5CO7A 5HKCA 3JAME 1JBMA 1RI0A 1ZUKA 3UATA 2QDYB 2DZ9A 2K57A 4YTLA 2KE9A 1K8AC 2LTOA 1YIJT 2K7AA 3RUXA 3BE3A 4NS5A 3LLRA 4JZ3A 3E19A 5FRMA 1G3YA 3CCLQ 2RHIA 2DTIA 4J9IA 3GLXA 1DJ7B 1WFWA 2QTVA 1M8MA 1KC8C 2O9VA 4CC3A 1K0SA 2CUDA 3TU4K 2QA4A 1JRIA 2M9UA 4C92G 3EH1A 4AFZC 2O4XB 2KT1A 3OYHA 2O4XA 2HSEB 3G6EA 2QXFA 4KBMB 2YUNA 4M7AB 2SRCA 4M7DB 2FRWA 4M7AA 4M7DA 4F16A 2XK0A 3L1AA 4OGCA 2XD0A 1S72Q 1BBZA 3OMGA 1MMNA 4JS5A 5CVIA 2H3EB 1VQ8A 1IHVA 1YJNT 4KGZB 4AG1C 2XHCA 2RQWA 2F5KA 3G7ZA 1IXDA 3CCQT 1P92A 1VQOQ 1HJDA 2DVJA 2P0QA 3C12A 2J7IA 1SRMA 5IHKA 4N4HA 1HYOA 4FSSA 1O75A 1HD3A 5A0DA 3NTHA 2FPFA 1VQ7Q 4OVAA 4MDXA 1T0HA 2R5MA 5IHIA 2EQKA 4XU0A 3X28B 4GY5A 2AZSA 1G8XA 1U1TA 1YJWQ 5I22A 2JMCA 1RADB 2ZGWA 1I5LA 5GAMh 2CSIA 3Q1JA 3REAB 1VQ5Q 2COZA 1D09B 5GMKh 1SHFA 3MHXA 1CSKA 3A5ZB 3ER0A 3META 3A8MB 5GAN5 1BU1A 3CCLA 2XICA 4FYXB 3E2UA 1YJ9Q 3EG9B 3EG9A 4XU1A 1WPYA 3GBQA 5GAMj 2AKKA 2P4RA 4PJOE 4C8QG 2PVGB 4Y92A 2EKOA 3S3MA 2BE7D 5GMKj 2C06A 4ATOA 2GTJA 5LJ5g 2K4YA 3ZEHA 4A53A 3H8ZA 3CCUT 3DB4A 3NPFA 3HFOA 4JS4A 3JCMV 3KFVA 2KROA 3I9QA 4PLLA 4EDUA 1S72A 3CCEQ 1M8VA 5I11A 3OYNA 2ZCFB 4FCYA 1XNIA 2EJ9A 2F2WA 3MCAB 1VQ4Q 2D0QB 4D6WA 5LJ5h 1WHKA 2BZXA 4PJLA 3RMQA 2NUZA 1UGPB 1VQOA 3M55A 1OZ2A 2C0TA 4E47A 3OYBA 1Y57A 1VQPQ 3M4GA 4PFPA 1VQNT 2GCXA 4LN2A 1ZA2B 1KQ2A 3S6WA 2EYYA 1VQ7A 3J81E 1B07A 2IPOB 2LJ1A 2VV5A 1SF9A 2YSQA 4QQGA 4M77E 2X35A 1YJWA 1FMVA 1OX8A 5IN1A 1X6BA 2PUKB 1VQNA 3J7AF 4C0GA 1U5SA 2LT1A 1BI3A 3JRZA 4QQDA 4PJOC 1VQ5A 3OYMA 3S3NA 3DB3A 3HHTB 3M5AA 4EMHA 3OYJA 1SPKA 3M58A 1M5Q1 1FMKA 1WJRA 4BI3A 2EYXA 1ZQ1A 1YJ9A 2LNHB 1Q81C 3L2ZA 5I21A 3RR6A 3CMET 1G2BA 4N4GA 2VWFA 1VOMA 1JJ2A 1JU5C 3TCJA 5CKFA 2DETA 2BZYA 5GAN4 2HL3A 2JZ2A 1VQ9Q 1JJ2S 4A4EA 3CPFA 3L2WA 4MMLA 4O6JA 2RI2A 4Y91A 2IIMA 3OBWA 2Y4YA 2PU9B 4RTYA 1LOJA 3PNWC 5ECAA 4DBFA 3P8BB 4JJCA 4OP0A 3X25B 4GLKA 5A0LA 1KSWA 1OV3A 1Q81U 3CCEA 3E1SA 4XQ3A 2HKQB 2PTKA 2CKKA 1QCFA 1RAGB 3I56Q 1TG0A 2VXFA 1VQ4A 1N9RA 1CKAA 1KFZA 5L8RE 5KCHA 2JJ9A 4GLMA 1U06A 1YN8A 1Q82C 3RIRA 3CMAT 3ASKA 1WNLA 1XQHA 4M77C 2LZ6B 1VQLQ 2YRVA 3DKMA 1TSFA 1VQPA 4JRKA 1MMGA 1QVGA 1U3OA 4FU6A 1D3BB 3V7CA 1D3BA 4FL6A 4OGEA 2RPNA 1YHQQ 1IRXA 1QVGS 1XTDA 1W2BA 2DRMA 1QLYA 1SG5A 4FYVB 2GF7A 3NHNA 3V7SA 3G4SQ 1W2BS 2YDLA 4MMKA 5KE3A 4ZTJA 1Q82U 3REBB 1WI7A 1YBYA 2DL7A 5GAOm 3RDVA 2G3RA 2DIQA 3QJYA 3TREA 2MPXC 2HDAA 2J6KA 4E7IA 5DY9A 3MEAA 4II1A 4V2SA 4OB0B 3VYGA 2ZZDA 3FB9A 5GJVB 1IO6A 4IUUA 3OS2A 4FT4A 2W10A 3OY9A 4M77D 1R8OB 3FDRA 2EAYA 3H0IA 3BFMA 5GJWB 3CBPA 4PJOF 1YI2Q 2QQRA 2KVQG 5GANg 5LL6S 5GAN2 4DBHA 3OBYA 2DKGA 1H92A 3JB9F 2E10A 2ROTA 2A37A 4HKEA 1VUBA 2A28A 3FJPA 4C5EA 1B3QA 1NE8A 2CP2A 2FB7A 3OYCA 2EYWA 5I2MA 2HQHA 4OB1B 2QEXT 2O9SA 4HCBA 3CQTA 2EWNA 2GFAA 2VASA 4C0ZA 1N8RC 1WIEA 4J9BA 4BB7A 4ZTFA 1GCPA 3I56A 4CRIA 2RI5A 4PKCC 3I5RA 2X4YA 2VKNA 4MDWA 3QIIA 2DBKA 5CAIA 3I55T 2XMFA 2CP3A 2CZ0B 2AHJB 2JS0A 3CD6T 2ABLA 4CC4B 1VQLA 3ZBDA 4IUPA 4DBRA 1QWFA 4PJNA 4C92D 2DXCA 2OJ2A 1JO8A 1G3WA 4BD3A 4AFUC 3KUFA 4Z89A 2F69A 2KXDA 2IVWA 5CKBA 3ZL7C 1Q95G 1VQKQ 1NPPA 4M77F 5GANe 3SHWA 4OMOA 1BI2A 3S3OA 4OMFB 4B6MA 1OULA 3G4SA 3CC4Q 2YLCA 4MZMA 2QQBA 2P84A 4E6RA 1MUZA 2VC8A 2M51A 4PJOB 4PJOA 2DFUA 1JEGA 1KQ1A 2ECZA 1H3ZA 1M3BA 5GAOn 2OTJQ 4B9WA 2O01E 2P4TA 3M53A 3CPWA 3RESA 2FZGB 4KRTA 3RERA 3UT1A 2E5KA 1PCXA 5J39A 2L5QA 2X4XA 3CPWS 1PWTA 4XTUA 1NEGA 3HSBA 4AMCA 4M78C 4XAXB 4KULA 1SSHA 4R55A 2PQWA 5CQXA 1KQSP 3FJ5A 1GBRA 1PKTA 1YIJQ 1Y0MA 4JJDA 2DXUA 2YHTA 2FG0A 4A54A 3SD4A 1X6OA 3VS2A 1N5ZA 3QKJA 1GFCA 2JXBA 5IAYA 3UPUA 1AWXA 1X75C 2QASA 5GANd 1M90U 1QCOA 3H0FA 3JB9G 1UGQB 1QVFP 4M75G 4X34A 3QYGB 4XTYA 1YITT 1XJWB 2CZ7B 2CP5A 1ZSZC 1FX7A 2HNIA 2K5LA 3EG3A 5FU7C 3P8HA 4M77B 1WHLA 3FLGA 4M77A 4C8QD 1R77A 4DA4A 2CH4A 3C4SA 1M1FA 1IB8A 4NOYA 4IUQA 1PD1A 1TXQA 2RO0A 2J6OA 1UEBA 1PHTA 1PNJA 1YWOA 2JOYA 4BI8B 5FW9A 1JXMA 3OMCA 2DL3A 3CXCP 1I4K1 2B8AA 2LRQA 2AT1B 5HY6A 1VQKA 3PT9A 1YJNQ 3CC4A 3QXEB 3E9GA 3VS5A 3CCVT 2RK1A 2D8HA 3O5ZA 3PMTA 5FU6C 2R57A 3QUIA 5DM7R 2OTJA 4J9HA 2F5TX 5FLXE 4Y28E 4A4KA 2RQUA 2KYBA 2WSCE 5KYNA 4N4IA 4KUDK 1V29B 2RH2A 2Z0WA 1WXTA 3JCMc 3MKDA 5LJ3f 3RKXA 1M2VB 3U23A 1M2VA 1W4SA 2K5IA 1B7TA 3LW5E 2YRCA 1G3TA 2LMJA 1YIJA 3RBBB 1W1FA 3JCMQ 4J6WA 1R0BG 1RAAB 3KBGA 4J6XA 4LUDA 2RN8A 3PTAA 4N0AC 2I2LA 4NL2A 3LYIA 4KGVB 5D6YA 4M78F 1VQMT 1K8AU 4LD9K 3QJ6A 2RJEA 4NL3A 1UJYA 1NJIC 1YNZA 1ZX6A 1M1KC 5GAOr 3OYFA 3R6NA 5A0GA 4FT2A 3EGXB 1K9MR 3EGXA 2BZ8A 1Q7YC 2KGTA 1KC8U 1C6VX 1QQJA 4J83A 2DXBA 3C94A 3L2RA 2R58A 2OAUA 3CCUQ 2FYKA 1H641 1KK7A 2DAQA 2WSEE 1ACMB 3LX7A 2RHZA 5KH6A 5FROA 1K73C 4RMOA 2DEUA 3QBYA 1X27A 2QDLA 3CCJT 4J7FA 1RLPC 4M7AG 4M7DG 2K2VA 2RD1A 2DL5A 2XKOC 4PFZA 1C0MA 2QGFB 1YJNA 3NFCA 2KT8A 4HXJA
chains in the Genus database with same CATH topology
3VYHB 1N27A 3HHTB 3M5AA 4J8OA 4EMHA 3CCQA 3OYJA 4L59A 1JB0E 4LDVA 1OI1A 3M58A 4M75F 1X01A 1M5Q1 4XU3A 1WJRA 4LDXA 4BI3A 4XTWA 2L3RA 3I56T 3CCJA 1ZQ1A 3VUBA 1YJ9A 1XOVA 3V8LA 1Q81C 4V2SA 2FL7A 3V8JA 3L2ZA 5I21A 3HL8A 1NZ9A 1BKBA 1WGSA 2V8KA 4FM4B 3CMET 4M78E 4N4GA 4JRQA 3EFSA 1WJQA 1G3SA 3LH0A 3MEUA 3QO3A 4WF2A 1JJ2A 3TCJA 5CKFA 2KDSA 5GAN7 5GAN4 3G71T 4HT8A 3OYYA 2JZ2A 1JJ2S 4A4EA 3CPFA 3L2WA 4M7AC 4M7DC 5GAOl 1VQLT 1BIAA 4MMLA 1I8FA 2DD4A 2MWPA 2QQ9A 1KQSA 4O6JA 4M78B 3ZFJA 2RI2A 3O8VA 3AHUA 4M78A 4Y91A 3OBWA 2XDDA 2MWOA 5DLOA 1U1SA 2WACA 2Y4YA 3QPHA 2XI9A 3QG1A 4BDYA 2E12A 2RHUA 2P0PA 4M77G 3X26B 4EMGA 2PU9B 1KQSS 1LOJA 1K9MU 3JCMe 2ZPHB 4BACA 1Y71A 2GFUA 2DXTA 2CZ6B 2DTOA 3P8BB 3PNWC 1YHQT 4OP0A 4VUBA 2D6FA 3LGFA 3X25B 4GLKA 5A0LA 3JCMf 3GOXA 5LJ3e 1Q81U 4XU2A 3CCEA 4C0DB 2CYZB 3LWIA 3CCVA 3E1SA 4XQ3A 2M1HA 3SWNB 3QZ9B 1KHIA 2VYTA 3SWNA 3OSVA 3PFSA 4OB3B 2CKKA 3G4ST 1QVFA 4BE0A 2V8JA 5KCOA 2VXFA 1VQ4A 1OYXA 1N9RA 4C92B 1QVFS 5L8RE 4C92A 1YHQA 5I2SA 4F7UF 5KCHA 2X4WA 3OYLA 4ELYC 4A4HA 1Q82C 3RIRA 1YCYA 3CC2T 3CMAT 3ASKA 1WNLA 1EIFA 1XQHA 4M77C 4E7JA 1VIFA 3OS1A 3J80E 2ZPIB 5FU7B 2YRVA 2LC4A 3DKMA 5GANf 3OS0A 4C8QF 3JSCA 1VQPA 2M16A 2JN0A 2QA4T 4JRPA 2VXEA 4JRKA 3WXMB 4RG8A 1FXXA 3NTKA 4FIBA 3OYGA 1QVGA 2DPPB 4FU6A 1D3BB 3UWNA 3V7CA 1D3BA 4HA8A 4IUVA 4L6V5 3CCUA 3X20B 5GAMf 3BDUA 3MEVA 4FL6A 4OGEA 4Q5WA 3G6ET 3CCST 4ELZC 3CCRT 4BUGA 1QVGS 3CC2A 4Z02A 2V8IA 4BY6B 2KAFA 2VGNA 1XTDA 5D6XA 1M90C 1W2BA 1IZ6A 4M75B 3DLLA 4JUVA 1QW1A 2BIVA 4M75A 3RMSA 1WJSA 5KE2A 3CXCA 3JCMJ 3MP1A 2GF7A 3JCMd 3FRNA 3V7SA 3NTIA 1W2BS 4MMKA 4RCBA 5KE3A 1VQMA 1NPRA 2MI6A 4ZTJA 2HBPA 2K3YA 1Q82U 1Q86C 3H6ZA 2E41A 1YBYA 4QVCA 3R6OA 2P0KA 2RM4A 5GAOm 1YI2A 2A3LA 3HP9A 5LJ3d 3DLMA 2G3RA 2E64A 1UGRB 5C6SA 3CCRA 2DIQA 3QJYA 2EFIA 3CEYA 2DTHA 3TREA 3SFMA 3JCMb 5DY9A 4E7IA 3MEWA 1Y96B 2FVUA 3MEAA 4IURA 4II1A 3A8HB 1Y96A 2M0OA 4OB0B 2L8DA 3VYGA 5LJ5j 3GNGA 5A2QE 1VQ8T 2LCLA 2ZZDA 5FU6B 3FB9A 4CI0C 4RG2A 5C0MA 1NJIU 1PSFA 1YI2T 4IUUA 2QQSA 3OS2A 2L89A 4ZGDB 4FT4A 4X9CA 3OY9A 4M77D 1M1KU 4OF1A 2LNVA 3GNFB 1M1GA 1R8OB 4MZTA 3FDRA 5D6WA 1QVPA 2EAYA 3BFMA 4C5GA 2RJFA 3CBPA 4PJOF 2XG8D 1KG1A 2K5FA 2E6ZA 1LJOA 2EQUA 2QQRA 1Q7YU 2KVQG 4QQ6A 3JCMh 1BI0A 3M4YA 5LL6S 5GANg 2E1HA 5GAN2 4F7UE 3QHSA 4UC4A 3OBYA 2DKGA 2PUOB 1KD1C 3X24B 4O5VA 1FWZA 3JB9F 3QSUA 2E10A 5LJ3h 2FHDA 3CC7A 4LDWA 4E7HA 5GAMg 4HKEA 1U8RA 5DLQE 3L42A 2DO3A 1VUBA 1TH7A 2EJFA 2LDMA 2KSSA 3FJPA 1NE8A 3VV0A 1VIEA 2DZCA 2FB7A 4C5EA 4F7UB 4IKFA 1QP3A 4TVRA 4F7UA 4IUTA 3OYCA 1VQLA 5I2MA 1K73U 2DD5A 1O9SA 4OB1B 2LQKA 2EIFA 3V8KA 2QEXT 2E5QA 4KT0E 1VQKT 4HCBA 3PGGA 2ZPEB 4M78D 2EWNA 3PIPA 3CCMT 2GFAA 4M7DF 4M7AF 4C0ZA 4C0FA 1N8RC 4C8QB 3GIBA 3CC4T 4C8QA 2KK4A 5GAOp 4BB7A 4BY6C 4LDYA 4ZGJB 3I56A 4ZTFA 4CRIA 2RI5A 4OB2B 5LJ3j 4PKCC 2Y90A 2LQ8A 1MHNA 2X4YA 3FIFA 3M59A 3CMEA 3CCLT 1WQ7A 4MDWA 3QIIA 3OYAA 1M4ZA 5CAIA 3I55T 4J5YA 2XIDA 2CZ0B 4FSXA 4E7KA 2AHJB 3A8LB 3G71A 2OTJT 2BUDA 1AHJB 5GMKi 2JUFA 4C92E 1IREB 3CD6T 3BY7A 3HFNA 4EMKB 4E7LA 1RL2A 1WQWA 4JLIA 3ZBDA 1MGQA 4EMKA 4ME7A 4IUPA 5CKDA 2XDBA 2RHYA 4C92D 3PMIA 1G5VA 3HRSA 2DXCA 4F7UG 5CO7A 5HKCA 2HAXA 4BD3A 1G3WA 5CK9A 3KUFA 3JAME 1JBMA 2F69A 1RI0A 2DEQA 2IVWA 3EFRA 2QDYB 2DZ9A 5CKBA 2K57A 3TEEA 4X9DA 4YTLA 1K8AC 1NPPA 4M77F 2LTOA 5GANe 1YIJT 2KY9A 3RUXA 4M78G 5CR2A 1BI2A 3S3OA 4NS5A 4OMFB 3G4SA 3E9FA 3OYDA 3GP8A 2YLCA 4MZMA 2QQBA 4LD6A 1S72T 3LLRA 2ZPFB 3MO8A 3E19A 4M75E 2VC8A 5J26A 1G3YA 3VU3C 5CQYA 3WVDB 5GAMe 5CKEA 5FRMA 4PJOB 2CZ1B 4EPCA 4PJOA 2ZPGB 1KQ1A 2RHIA 3HPWA 3BDLA 1H3ZA 4JJNK 2DTIA 3VJPA 1M9SA 3C95A 3GLXA 4M75D 4R56A 5GAOn 1DJ7B 5GMKe 4B9WA 3CMAA 1KC8C 2O01E 3EAEA 4J7IA 5GMKl 2MF2A 2P4TA 3M53A 3RESA 3CPWA 3RERA 2OTLT 3TU4K 3M57A 3A8GB 4M7DE 3UT1A 1VQOT 2LX9A 2QA4A 2XDPA 1JRIA 2M9UA 2L5QA 2X4XA 5J39A 4C92G 5GAN8 3CPWS 4B9XA 2WSFE 5FRNA 4XTUA 5EG2A 5J3BA 2O4XB 4QW2A 3OYHA 4LDUA 2O4XA 3HSBA 4M78C 5M9OA 3CCSA 1KHCA 3G6EA 2QXFA 4XAXB 4KULA 2A7YA 4R55A 2PQWA 2Y4XA 4KBMB 5CQXA 5GAN3 4M7AB 4M7DB 4ZN3A 4M7AA 1VQ7T 4M7DA 3M9QA 2DXUA 2YHTA 2XK0A 4A54A 3L1AA 3SD4A 1X6OA 3FC3A 1Y7XA 2PVDB 4OGCA 3FEOA 3QKJA 2JNGA 3WVEB 3A8OB 2XD0A 3GF5A 5IAYA 1YJWT 4C0DC 3OMGA 3UPUA 3JCMP 3SDZA 3SWNC 1X75C 5GANd 4HCZA 1M90U 2GQVA 4RKUE 2XU8A 5HK0A 1BI1A 4JS5A 4JLGA 3OSSC 4JRIA 5CVIA 3JB9G 1UGQB 3JB9I 4M75G 4X34A 1VQ8A 4C92C 1PSEA 2VGMA 3QYGB 4XTXA 4XTYA 3V7RA 1YITT 1Q86U 1VQ5T 5GAMd 1YJNT 2BKDN 2CZ7B 1LNXA 2XHCA 2F5KA 1FX7A 3G7ZA 4PL6A 3CCQT 1P92A 4PLIA 2EQMA 2HNIA 1QP2A 2K5LA 3JB9J 1BIBA 2LVMA 2P0QA 2KQWA 4XTZA 3C12A 2EYQA 4C8QE 1YJ9T 5FU7C 4N4HA 1O75A 3HRTA 4JDSA 3MP8A 2RHXA 5LJ5e 2R5AA 2E70A 3P8HA 4M77B 3OA6A 5A0DA 4BE1A 3FLGA 3NTHA 4M77A 3M54A 4C8QD 4DA4A 4OVAA 4MDXA 2R5MA 4N0AA 1N9SA 3ME9A 4MZPA 4DOVA 3C4SA 5LJ5f 1M1FA 4BE2A 2EQKA 1K9MC 1BYMA 5GANh 4XU0A 4A4FA 4NOYA 3X28B 4IUQA 3SB2A 4GY5A 4RCCA 2RO0A 1U1TA 2MMPA 5GMKm 2KMTA 2ZGWA 4M75C 1UEBA 3JB9H 2JOYA 2E65A 2HD0A 3OQ5A 4BI8B 1I5LA 3OMCA 2VUBA 5GAMh 1KD1U 5CCAA 4DQ2A 1I4K1 2QEXA 2B8AA 2EJGA 2LRQA 3HRUA 2RB6A 5HY6A 1VQKA 2RI3A 2DK3A 1GXIE 3CCMA 2YLBA 2PVOB 3KXTA 3Q1JA 2X4JA 3QZ5B 5GMKh 3LGLA 3MHXA 3PT9A 3CC4A 3OYKA 2RJCA 3QXEB 3VKIA 3A5ZB 3ER0A 4A4GA 3OYIA 3CCET 3E9GA 3CCVT 3JCMW 2RK1A 3LWHA 5GANj 3META 3GPLA 3A8MB 5GAN5 3PMTA 5FU6C 3CCLA 2XICA 4PNOA 2R57A 3QUIA 1ZBXA 4BI4A 3I55A 3OW2A 2JTMA 2RJDA 4XU1A 5DM7R 1VQ4T 1WPYA 2NLUA 1N8RU 2OTJA 5GAMj 2F5TX 5FLXE 3CD6A 2DIGA 4Y28E 4A4KA 4PJOE 3OW2S 2ZPBB 4C8QG 2WSCE 2PVGB 4N4IA 2IG0A 4KUDK 3L2UA 4KUIA 1V29B 2EKOA 1VQ6T 3QDRB 3S3MA 2RH2A 3P8DA 5GMKj 3RKWA 4PJOD 2C06A 3CBMA 3QYHB 3JCMc 4HT9A 5LJ5d 5LJ3f 4ZN1A 3RKXA 5CIUA 4ATOA 3M56A 1VQPT 4DOWA 2MAMA 1W4SA 4ZGEB 2K5IA 5LJ5g 2K4YA 5GAOq 5CKHA 3JB9D 3LW5E 2CS7A 3ZEHA 1G3TA 4A53A 3H8ZA 3CCUT 1YIJA 3DB4A 3BW1A 3L2QA 3HFOA 4BDZA 1VQ6A 4JS4A 3JCMV 3JCMQ 2RK2A 4QVDA 4J6WA 1B34B 3PIOA 4J6YA 1B34A 3KBGA 4PLLA 4EDUA 4J6XA 1S72A 1UB4A 4M7AE 4L5GA 4XTVA 1M8VA 3PTAA 1N6AA 4N0AC 3OYNA 2ZCFB 2DJZA 2I2LA 3LYIA 4NL2A 1ZHIA 3INZA 1XNIA 4M78F 5D6YA 4C8QC 1VQMT 1K8AU 4LD9K 4M7AD 2EJ9A 3QJ6A 4M7DD 2QQAA 2K3XA 3MCAB 2RJEA 4NL3A 2D0QB 1NJIC 1SSFA 4HCCA 3OYEA 4C5IA 4D6WA 3OS5A 5LJ5h 1M1KC 1OZ3A 2D9TA 2H3JA 2HQEA 3OYFA 5GAOr 2OTLA 5A0GA 3RMQA 3JCMX 4C5HA 4FT2A 1UGPB 1HXDA 3F70A 3M55A 3N5BB 1VQOA 1OZ2A 1Q7YC 4E47A 4PJOG 3OYBA 1UGSB 5GAN6 4EMKC 3CXCS 1KC8U 2HQXA 3M4GA 3T9NA 4J83A 1HK9A 2DXBA 3C94A 3JCMg 3L2RA 1VQNT 2GCXA 1KQ2A 2R58A 3S6WA 2DVEA 1I81A 3OB9A 4C92F 3MP6A 5AYFA 1VQ7A 3J81E 2OAUA 3UDCA 2CGHA 2FYKA 1H641 4QVZA 2DAQA 3VUZA 3URGA 5LJ3g 2WSEE 2VV5A 5HK3A 4XK8E 3RKYA 5IT9E 3CBOA 3LX7A 1Y07A 2RHZA 1VQ9T 4QQGA 4M77E 2X35A 5FROA 5KH6A 1YJWA 1K73C 5IN1A 4RMOA 3QBYA 2PUKB 3CC7T 1VQNA 2QTXA 2RA2A 2LT4A 3CCJT 3HKSA 4J7FA 3L2VA 3J7AF 2JVVA 4M7AG 4C0GA 4M7DG 2LCCA 2K2VA 2JTFA 2E6NA 2RD1A 4P5NA 2LT1A 2EQJA 1BI3A 2XKOC 3JRZA 4QQDA 1YITA 1VQ5A 3OYMA 4PJOC 1VQ9A 1YJNA 3S3NA 3NFCA 3DB3A 2QI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYH B;  2CZ1 B;  3HHT B;  3A8M B;  1JB0 E;  2ZPG B;  3A8H B;  4OB0 B;  3VYG A;  1DJ7 B;  2ZZD A;  2O01 E;  1PSF A;  4Y28 E;  4ZGD B;  4FM4 B;  2ZPB B;  3A8G B;  2WSC E;  2PVG B;  1V29 B;  2WSF E;  3QYH B;  2DD4 A;  2PUO B;  4ZGE B;  3X24 B;  3LW5 E;  3X26 B;  2PU9 B;  2ZPH B;  2PVD B;  2CZ6 B;  3WVE B;  3A8O B;  1QP3 A;  3X25 B;  2DD5 A;  2CYZ B;  4OB1 B;  2ZCF B;  4RKU E;  4KT0 E;  3QZ9 B;  2ZPE B;  4OB3 B;  1UGQ B;  1PSE A;  2D0Q B;  3QYG B;  4ZGJ B;  4OB2 B;  2CZ7 B;  5L8R E;  1QP2 A;  1UGP B;  2CZ0 B;  2AHJ B;  3A8L B;  1UGS B;  1AHJ B;  2ZPI B;  1IRE B;  2DXB A;  2DXC A;  2DPP B;  2WSE E;  3X28 B;  4XK8 E;  4L6V 5;  3X20 B;  2QDY B;  2PUK B;  1GXI E;  2PVO B;  3QZ5 B;  2ZPF B;  3QXE B;  1UGR B;  3WVD B; 
#chains in the Genus database with same CATH topology
 3VYH B;  4J8O A;  3CCQ A;  3I5S A;  4XU3 A;  4LDX A;  4XTW A;  2L3R A;  2LP5 A;  3CCJ A;  3VUB A;  2EQI A;  1XOV A;  3V8L A;  1VQN Q;  3HL8 A;  1WGS A;  1BKB A;  2V8K A;  2QAZ A;  1EX4 A;  3EFS A;  1GRI A;  3LH0 A;  3QO3 A;  4WF2 A;  1H3H A;  3H41 A;  5GAO l;  2MCN A;  1I8F A;  2CUB A;  2FO0 A;  4M78 B;  3ZFJ A;  4M78 A;  5FWC A;  2MWO A;  1U1S A;  2WAC A;  4BDY A;  2P0P A;  1TU0 B;  2ZPH B;  1GCQ C;  2GFU A;  1T0J A;  3LGF A;  2FZC B;  2RF0 A;  2CYZ B;  1M90 R;  2X9H A;  3QZ9 B;  2VYT A;  2ATC B;  4DEX A;  4J9E A;  5KCO A;  1OYX A;  2X3X D;  3CME Q;  1ZA1 B;  2QYZ A;  1GL5 A;  1ZSZ B;  1WA7 A;  1ZSZ A;  3MJX A;  1JQQ A;  1YCY A;  1EIF A;  1VIF A;  5FU7 B;  2A08 A;  2JN0 A;  1FXX A;  3OYG A;  1UGV A;  2YT6 A;  3UWN A;  3CCU A;  4IUV A;  3X20 B;  5GAM f;  3BDU A;  3CCS T;  4ELZ C;  3CCR T;  4BUG A;  4Z02 A;  4BY6 B;  2KAF A;  1HSQ A;  1D0X A;  1W70 A;  2E3I A;  3DLL A;  4JUV A;  3RMS A;  1WJS A;  2YXY A;  1QCN A;  3FRN A;  4RCB A;  2HBP A;  1Q86 C;  2E41 A;  2KXC A;  3R6O A;  1AD5 A;  1SRL A;  1UGR B;  3CCR A;  2GGR A;  1K4U S;  3CEY A;  2DTH A;  1FMW A;  4IUR A;  5LJ5 j;  3GNG A;  5FU6 B;  1PSF A;  2QQS A;  1ARK A;  2K3B A;  2GBQ A;  2K5F A;  1TS9 A;  2E6Z A;  1LJO A;  2EQU A;  3M4Y A;  4F7U E;  1AOJ A;  1KD1 C;  3X24 B;  4O5V A;  2YWW A;  3M0Q A;  1U8R A;  2CH4 W;  2LJ3 A;  2KSS A;  1TH7 A;  1V76 A;  1VIE A;  1QP3 A;  2HKN A;  5KYX A;  2DYB A;  4GBQ A;  3V8K A;  3CCM T;  2HZY A;  2JW4 A;  1K8A R;  2V1R A;  2HL5 C;  1ABO A;  3GIB A;  1C1A A;  1MV3 A;  2O2O A;  2EVR A;  2LQ8 A;  1MHN A;  3FIF A;  3M59 A;  3CME A;  4CC2 A;  1M4Z A;  2COW A;  2L3S A;  4EIK A;  1WLP B;  4OML A;  3A8L B;  2NYS A;  4E7K A;  4Z88 A;  2JM9 A;  5D7U A;  4ORZ A;  4C92 E;  1RI9 A;  1RL2 A;  1MGQ A;  5CKD A;  1MMA A;  2XDB A;  3VS0 A;  1UHF A;  3PMI A;  2X51 A;  4E7S A;  3UA7 A;  1UG1 A;  2DEQ A;  3EFR A;  5L23 A;  4J9G A;  3TEE A;  4ESR A;  2QEX Q;  4HVV A;  1ZUU A;  2YUO A;  3EG1 A;  3PVQ A;  3GP8 A;  4LD6 A;  2ZPF B;  2D8J A;  3VS6 A;  3MO8 A;  1AT1 B;  1OQK A;  1IHW A;  2CZ1 B;  2ZPG B;  3HPW A;  3I55 Q;  1M9S A;  1MND A;  2F2V A;  4M75 D;  3CMA A;  2RQT A;  3CD6 Q;  3EAE A;  2EGE A;  1UHC A;  2OTL T;  3M57 A;  3A8G B;  4M7D E;  1VYU A;  2LX9 A;  5GAN 8;  1WXU A;  1JJ2 P;  4B9X A;  2CRE A;  2WSF E;  1ABQ A;  2F1L A;  2HEQ A;  5J3B A;  4QW2 A;  4LDU A;  2L0A A;  4E2F B;  2AZV A;  1YCS B;  2M0Y A;  5GAN 3;  1OX9 A;  3M9Q A;  2HSP A;  2FZK B;  1I1J A;  3A8O B;  1GCQ A;  1CKB A;  3SDZ A;  1K1Z A;  4HCZ A;  2GQV A;  4RKU E;  2XU8 A;  5HK0 A;  1BI1 A;  1UFF A;  3OSS C;  4JRI A;  3MPU B;  2DIL A;  3JB9 I;  4C92 C;  3EH2 A;  3V7R A;  2O31 A;  2BKD N;  4WCI A;  1LNX A;  2GNC A;  4PL6 A;  4RTW A;  1Z9Q A;  4PLI A;  2EQM A;  4FYY B;  3JB9 J;  1BIB A;  3TSW A;  1RAB B;  4C8Q E;  3M0U A;  3HRT A;  4JDS A;  2RHX A;  2R5A A;  2E70 A;  3OA6 A;  4BE1 A;  4JPB W;  3ME9 A;  4MZP A;  4DOV A;  1K9M C;  1AWJ A;  5GAN h;  1QVG P;  4A4F A;  3SB2 A;  4OMM A;  4RCC A;  1GBQ A;  1RAI B;  2MMP A;  5GMK m;  2KMT A;  2DJQ A;  3JB9 H;  2RQV A;  3OQ5 A;  2EGC A;  1EFN A;  1W2B P;  4DQ2 A;  2QEX A;  3HRU A;  2RB6 A;  2PVO B;  3KXT A;  2HBW A;  2X4J A;  1YIT Q;  1UJ0 A;  3OYI A;  2DLP A;  3JCM W;  1OPL A;  3LWH A;  5GAN j;  3QWY A;  1PM3 A;  4PNO A;  1ZBX A;  4BI4 A;  3I55 A;  1WHH A;  2D1X A;  3OW2 A;  2JTM A;  1N8R U;  2NLU A;  1OU9 A;  3CD6 A;  4F04 B;  2JM8 A;  3OW2 S;  2ZPB B;  4ANJ A;  2K9G A;  4HVU A;  2G6F X;  2IG0 A;  2EBP A;  1VQ6 T;  4PK4 A;  3P8D A;  3RKW A;  8ATC B;  3CBM A;  3M56 A;  1UEC A;  4ZGE B;  1X2K A;  5GAO q;  2QGG A;  1K76 A;  3A1P A;  4R0K A;  1H8K A;  3BW1 A;  3L2Q A;  4BDZ A;  1VQ6 A;  5FWB A;  4QVD A;  1B34 B;  4KGX B;  1TUG B;  3PIO A;  4J6Y A;  1B34 A;  1UB4 A;  3CCV Q;  4XTV A;  2C0I A;  2V1Q A;  2FRY A;  3EFO B;  2DJZ A;  1ZHI A;  3EFO A;  3INZ A;  4C8Q C;  4LXC A;  4M7A D;  4M7D D;  1J3T A;  1QWE A;  4HCC A;  3OYE A;  4C5I A;  3M0P A;  3OS5 A;  1UE9 A;  2JS2 A;  3JCM X;  3VS1 A;  4C5H A;  2L3P A;  1NLO C;  1AWW A;  3QWX X;  4PJO G;  5GAN 6;  4EMK C;  3CXC S;  3JCM g;  2KBT A;  1HK9 A;  1KJW A;  1Q81 R;  2OI3 A;  2DVE A;  3OB9 A;  4C92 F;  3MP6 A;  5AYF A;  3VS7 A;  4PFO A;  4QVZ A;  2CGH A;  3TSZ A;  3VUZ A;  5LJ3 g;  3URG A;  3ULR B;  3RKY A;  1WX6 A;  1Y07 A;  1I5O B;  1AWO A;  4QT7 A;  3CC7 T;  2QTX A;  2RA2 A;  2LT4 A;  1R0C B;  2JVV A;  3H9N A;  2LCC A;  2I0N A;  2JTF A;  4P5N A;  1YIT A;  1NLP C;  1IGU A;  2QI2 A;  1E6G A;  5IHN A;  1N27 A;  1WDX A;  4JJB A;  1JB0 E;  2JMA A;  4LDV A;  3TVT A;  1X01 A;  4AG2 C;  2F2X A;  1Z9Z A;  4RTU A;  3V8J A;  1MV0 B;  1NZ9 A;  5IXF A;  4JRQ A;  3THK A;  1G3S A;  3MEU A;  4IIM A;  2KDS A;  5GAN 7;  3G71 T;  4OMQ A;  4HT8 A;  1Q82 R;  1VYV A;  1OOT A;  1BIA A;  1M30 A;  3CCQ Q;  2DD4 A;  1WYX A;  2O88 A;  3AHU A;  5DLO A;  3QPH A;  3QG1 A;  3CCJ Q;  4M77 G;  2KR3 A;  3JCM e;  1BB9 A;  4BAC A;  1Y71 A;  1PD0 A;  3HTR A;  3TQ7 P;  4VUB A;  2MOX A;  2D6F A;  1BCM A;  5AT1 B;  3JCM f;  3GOX A;  5LJ3 e;  6AT1 B;  3LWI A;  3CCV A;  2M1H A;  1KHI A;  2V26 A;  3OSV A;  3PFS A;  1OPK A;  3NMZ C;  4BE0 A;  2QK0 A;  1M27 C;  2GTO A;  4C92 B;  2X3W D;  1S1N A;  4C92 A;  4HVW A;  2X4W A;  2DX1 A;  2KRS A;  4A4H A;  2D0N A;  3CC2 T;  2CP7 A;  2MIO A;  2JT4 A;  3OS1 A;  4OMN A;  2LC4 A;  1I0C A;  2ESW A;  3OS0 A;  4C8Q F;  1YFN A;  3G1J A;  2M16 A;  2QA4 T;  4FYW B;  3WXM B;  2NUP B;  4RG8 A;  2NUP A;  4L6V 5;  4Q5W A;  3G6E T;  3CC2 A;  3JV3 A;  3EGU A;  2VGN A;  9ATC B;  1IZ6 A;  1QW1 A;  2BIV A;  5KE2 A;  3JCM J;  3MP1 A;  3JCM d;  4E7Z A;  1VQM A;  2K3Y A;  4QVC A;  1VA7 A;  2P0K A;  2HMA A;  5LJ3 d;  2CT3 A;  2EYZ A;  3DLM A;  5C6S A;  4RTT A;  1AZG B;  2VVK A;  3SFM A;  3JCM b;  3MEW A;  1RAC B;  1Y96 B;  2FVU A;  3A8H B;  1Y96 A;  2M0O A;  3EHR A;  2L8D A;  5A2Q E;  1VQ8 T;  4CI0 C;  2ROL A;  1N8R R;  1NJI U;  2L89 A;  4F14 A;  1D1C A;  1M1K U;  1X43 A;  4OF1 A;  2LNV A;  3GNF B;  4MZT A;  5D6W A;  1KG1 A;  1OEB A;  3CCS Q;  1Q7Y U;  1BI0 A;  3CCR Q;  3QHS A;  1NEB A;  2ZAE A;  3SEM A;  2DYI A;  2FHD A;  4E7H A;  5GAM g;  2K2M A;  5DLQ E;  3VRZ A;  3L42 A;  2DO3 A;  2EJF A;  3VV0 A;  2DZC A;  1UTI A;  4IKF A;  4TVR A;  5KYU B;  1NYG A;  4IUT A;  5KYU A;  2KYM A;  4JZ4 A;  8AT1 B;  1MNE A;  1K73 U;  1K0X A;  2EIF A;  1FYN A;  4PJJ A;  2E5Q A;  4KT0 E;  3PGG A;  2ZPE B;  3PIP A;  1TWB A;  4C0F A;  4C8Q B;  2L3Q A;  1TUD A;  4C8Q A;  2DNU A;  2KK4 A;  4ZGJ B;  4X1V A;  4OB2 B;  4QKU A;  4IIO A;  1M3A A;  3CCL T;  3OYA A;  2MK5 A;  1M2O A;  1LCK A;  4ZNX A;  4J5Y A;  1TOV A;  4FSX A;  5KYY B;  5KYY A;  2H8H A;  2COY A;  2DE0 X;  2JUF A;  3BY7 A;  2DA9 A;  4EMK B;  1WQW A;  2DMO A;  4EMK A;  4ME7 A;  3HRS A;  2HAX A;  5CK9 A;  1D0Z A;  3M0T A;  2ED1 A;  1PRM C;  4RTV A;  4X9D A;  4RTZ A;  1D0Y A;  2LQW A;  1X6G A;  2KY9 A;  3CCM Q;  2W0Z A;  4M78 G;  5CR2 A;  3E9F A;  3OYD A;  4K11 A;  1S72 T;  2MYS A;  3VS3 A;  2DBM A;  2CT4 A;  5GAM e;  4M75 E;  1BCO A;  3IQL A;  5J26 A;  3VU3 C;  5CQY A;  3WVD B;  5CKE A;  1QKW A;  4EPC A;  2RMO A;  3BDL A;  4JJN K;  3VJP A;  4R56 A;  3C95 A;  3I35 A;  5GMK e;  1NM7 A;  3VS4 A;  1WHM A;  4J7I A;  5GMK l;  2MF2 A;  3UF4 A;  4RUG A;  1VQO T;  2XDP A;  5FRN A;  1RUW A;  3A98 A;  5EG2 A;  2RNA A;  3D7S B;  5M9O A;  3CCS A;  1KHC A;  4J9C A;  2A7Y A;  2Y4X A;  1RLQ C;  4ZN3 A;  1VQ7 T;  3CMA Q;  2KEA A;  3FC3 A;  1NBE B;  1Y7X A;  2PVD B;  3FEO A;  2JNG A;  3WVE B;  3GF5 A;  1EZZ B;  1YJW T;  2VB6 A;  4AT1 B;  1I07 A;  4C0D C;  3JCM P;  2DL8 A;  4J9D A;  3SWN C;  3C0C A;  1LVK A;  4JLG A;  2PNI A;  2J6F A;  2B86 A;  1PSE A;  2VGM A;  4XTX A;  1Q86 U;  1VQ5 T;  5GAM d;  2PZ1 A;  2OX7 A;  2OTL Q;  1QP2 A;  3UA6 A;  1ZUY A;  2LVM A;  4LUE A;  2KQW A;  4KH1 B;  4XTZ A;  2EYQ A;  1YJ9 T;  1VYT A;  5KYX B;  3MP8 A;  5LJ5 e;  4KH0 B;  3M54 A;  2HCK A;  4N0A A;  1N9S A;  5LJ5 f;  1PRL C;  1ZLM A;  2BE9 B;  4BE2 A;  1BYM A;  3M0S A;  2AK5 A;  4RTX A;  1WZO A;  2C0O A;  4M75 C;  4D8K A;  3LH5 A;  2FEI A;  2E65 A;  2HD0 A;  2A0F B;  2VUB A;  1KD1 U;  5CCA A;  2EJG A;  2RI3 A;  2DK3 A;  1GXI E;  3CCM A;  2YLB A;  3PVL A;  3QZ5 B;  1KC8 R;  3LGL A;  4AFS C;  4A63 B;  2RJC A;  3OYK A;  3VKI A;  4A4G A;  3CCE T;  2KRM A;  2E3H A;  3GPL A;  2SEM A;  4DEY A;  2E4H A;  2DRK A;  4DBQ A;  2A36 A;  2RJD A;  1VQ4 T;  1K9A A;  1NYF A;  1NJI R;  2DIG A;  4AFQ C;  4HCK A;  1M1K R;  3L2U A;  4KUI A;  4M4Z A;  2EKH A;  3QDR B;  1BK2 A;  2FPE A;  4PJO D;  4PJM A;  2DER A;  3QYH B;  4HT9 A;  5LJ5 d;  4ZN1 A;  1Q7Y R;  7AT1 B;  1AEY A;  5CIU A;  1VQP T;  5KYW B;  2DF6 A;  2MAM A;  4DOW A;  5KYW A;  5CKH A;  3JB9 D;  2CS7 A;  1X69 A;  2RK2 A;  3EG0 A;  4M7A E;  2M02 A;  4L5G A;  1N6A A;  1K73 R;  3AT1 B;  2RQR A;  1QKX A;  1LPL A;  1UDL A;  2QQA A;  2K3X A;  1D1A A;  4CC7 A;  4F17 A;  1SSF A;  1RAH B;  2CDT A;  1E6H A;  1OZ3 A;  2D9T A;  2H3J A;  2HQE A;  2LQN A;  4Z8A A;  2OTL A;  1VQ6 Q;  1M3C A;  1HXD A;  2EGA A;  3F70 A;  3N5B B;  1UGS B;  2HQX A;  1SEM A;  3T9N A;  2EPD A;  4FW1 A;  1OU8 A;  3PE0 A;  1I81 A;  3EG2 A;  3UDC A;  1T3L A;  5HK3 A;  4XK8 E;  5IT9 E;  3CBO A;  5IH2 A;  1VQ9 T;  1TUC A;  1KIK A;  2GQI A;  3HKS A;  3L2V A;  2K79 A;  1QMC A;  3EGD B;  2E6N A;  3EGD A;  1X2Q A;  2EQJ A;  2BTT A;  1VQ9 A;  4L59 A;  1OI1 A;  2CP6 A;  4M75 F;  1W6X A;  3QDF A;  4FW2 A;  3I56 T;  1YP5 A;  2FL7 A;  4FM4 B;  4M78 E;  1WJQ A;  1NG2 A;  3OYY A;  1V1C A;  4M7A C;  4M7D C;  1VQL T;  2MWP A;  2QQ9 A;  1IGQ A;  1KQS A;  3O8V A;  2XDD A;  3CC7 Q;  3VRY A;  1SHG A;  2XI9 A;  3M0R A;  2E12 A;  2RHU A;  3X26 B;  4EMG A;  1KQS S;  1K9M U;  2DXT A;  2CZ6 B;  2DTO A;  1YHQ T;  2OAW A;  4XU2 A;  4C0D B;  1PC0 A;  2YUQ A;  1F1B B;  3SWN B;  3SWN A;  4OB3 B;  2QG9 B;  1QVF A;  3G4S T;  3NGP A;  2V8J A;  1PG5 B;  2KI7 A;  2AKL A;  1QVF S;  3EHQ A;  1Q86 R;  4OMP A;  1A0N B;  1YHQ A;  5I2S A;  4F7U F;  1WHJ A;  3OYL A;  4ELY C;  2FPD A;  3G71 Q;  1D1B A;  5IXB A;  2EW3 A;  4E7J A;  3J80 E;  2ZPI B;  1UUE A;  5GAN f;  3JSC A;  4JRP A;  2VXE A;  3NTK A;  4FIB A;  3RNJ A;  2DPP B;  1YI2 T;  4HA8 A;  2L2P A;  2ENM A;  3MEV A;  4WTO B;  2V8I A;  2J05 A;  5D6X A;  1M90 C;  1ZBJ A;  4M75 B;  2YUP A;  4M75 A;  3CXC A;  1KD1 R;  4D8D A;  3NTI A;  1NPR A;  2MI6 A;  3H6Z A;  1SKU B;  2DL4 A;  2RM4 A;  2LJ0 A;  1YI2 A;  2A3L A;  3HP9 A;  2JTE A;  2E64 A;  2EFI A;  1PKS A;  1RAE B;  3CC2 Q;  1E7O A;  1WXB A;  2LCL A;  2KRN A;  1AVZ C;  4LE9 A;  4RG2 A;  5C0M A;  3OW2 P;  2AIR B;  1G83 A;  2K6D A;  5EC7 A;  2CSQ A;  4ZGD B;  4J9F A;  4X9C A;  2QA4 Q;  1VQM Q;  1TTH B;  1M1G A;  1QVP A;  4C5G A;  1YWP A;  2RJF A;  2XG8 D;  2DM1 A;  4LNP A;  3G6E Q;  3JCM h;  4QQ6 A;  2E1H A;  2YRD A;  3H0H A;  4UC4 A;  2PUO B;  1FWZ A;  2LCS A;  3QSU A;  5LJ3 h;  3CC7 A;  4LDW A;  2LX7 A;  2LDM A;  4F7U B;  4F7U A;  3CPW P;  1JXO A;  5HCK A;  1MMD A;  1GFD A;  2DD5 A;  1O9S A;  1AZE A;  2LQK A;  2NWM A;  2ED0 A;  1VQK T;  4M78 D;  4M7A F;  1VQ8 Q;  4M7D F;  1RAF B;  1ZSG A;  3CC4 T;  5GAO p;  4BY6 C;  4LDY A;  5LJ3 j;  2NUT B;  2NUT A;  2Y90 A;  2CP0 A;  1WQ7 A;  2KNB B;  1WHG A;  2XID A;  3G71 A;  2OTJ T;  2BUD A;  1AHJ B;  5GMK i;  1IRE B;  2J06 A;  3HFN A;  4E7L A;  4JLI A;  1T3S A;  2RHY A;  1G5V A;  4F7U G;  5CO7 A;  5HKC A;  3JAM E;  1JBM A;  1RI0 A;  1ZUK A;  3UAT A;  2QDY B;  2DZ9 A;  2K57 A;  4YTL A;  2KE9 A;  1K8A C;  2LTO A;  1YIJ T;  2K7A A;  3RUX A;  3BE3 A;  4NS5 A;  3LLR A;  4JZ3 A;  3E19 A;  5FRM A;  1G3Y A;  3CCL Q;  2RHI A;  2DTI A;  4J9I A;  3GLX A;  1DJ7 B;  1WFW A;  2QTV A;  1M8M A;  1KC8 C;  2O9V A;  4CC3 A;  1K0S A;  2CUD A;  3TU4 K;  2QA4 A;  1JRI A;  2M9U A;  4C92 G;  3EH1 A;  4AFZ C;  2O4X B;  2KT1 A;  3OYH A;  2O4X A;  2HSE B;  3G6E A;  2QXF A;  4KBM B;  2YUN A;  4M7A B;  2SRC A;  4M7D B;  2FRW A;  4M7A A;  4M7D A;  4F16 A;  2XK0 A;  3L1A A;  4OGC A;  2XD0 A;  1S72 Q;  1BBZ A;  3OMG A;  1MMN A;  4JS5 A;  5CVI A;  2H3E B;  1VQ8 A;  1IHV A;  1YJN T;  4KGZ B;  4AG1 C;  2XHC A;  2RQW A;  2F5K A;  3G7Z A;  1IXD A;  3CCQ T;  1P92 A;  1VQO Q;  1HJD A;  2DVJ A;  2P0Q A;  3C12 A;  2J7I A;  1SRM A;  5IHK A;  4N4H A;  1HYO A;  4FSS A;  1O75 A;  1HD3 A;  5A0D A;  3NTH A;  2FPF A;  1VQ7 Q;  4OVA A;  4MDX A;  1T0H A;  2R5M A;  5IHI A;  2EQK A;  4XU0 A;  3X28 B;  4GY5 A;  2AZS A;  1G8X A;  1U1T A;  1YJW Q;  5I22 A;  2JMC A;  1RAD B;  2ZGW A;  1I5L A;  5GAM h;  2CSI A;  3Q1J A;  3REA B;  1VQ5 Q;  2COZ A;  1D09 B;  5GMK h;  1SHF A;  3MHX A;  1CSK A;  3A5Z B;  3ER0 A;  3MET A;  3A8M B;  5GAN 5;  1BU1 A;  3CCL A;  2XIC A;  4FYX B;  3E2U A;  1YJ9 Q;  3EG9 B;  3EG9 A;  4XU1 A;  1WPY A;  3GBQ A;  5GAM j;  2AKK A;  2P4R A;  4PJO E;  4C8Q G;  2PVG B;  4Y92 A;  2EKO A;  3S3M A;  2BE7 D;  5GMK j;  2C06 A;  4ATO A;  2GTJ A;  5LJ5 g;  2K4Y A;  3ZEH A;  4A53 A;  3H8Z A;  3CCU T;  3DB4 A;  3NPF A;  3HFO A;  4JS4 A;  3JCM V;  3KFV A;  2KRO A;  3I9Q A;  4PLL A;  4EDU A;  1S72 A;  3CCE Q;  1M8V A;  5I11 A;  3OYN A;  2ZCF B;  4FCY A;  1XNI A;  2EJ9 A;  2F2W A;  3MCA B;  1VQ4 Q;  2D0Q B;  4D6W A;  5LJ5 h;  1WHK A;  2BZX A;  4PJL A;  3RMQ A;  2NUZ A;  1UGP B;  1VQO A;  3M55 A;  1OZ2 A;  2C0T A;  4E47 A;  3OYB A;  1Y57 A;  1VQP Q;  3M4G A;  4PFP A;  1VQN T;  2GCX A;  4LN2 A;  1ZA2 B;  1KQ2 A;  3S6W A;  2EYY A;  1VQ7 A;  3J81 E;  1B07 A;  2IPO B;  2LJ1 A;  2VV5 A;  1SF9 A;  2YSQ A;  4QQG A;  4M77 E;  2X35 A;  1YJW A;  1FMV A;  1OX8 A;  5IN1 A;  1X6B A;  2PUK B;  1VQN A;  3J7A F;  4C0G A;  1U5S A;  2LT1 A;  1BI3 A;  3JRZ A;  4QQD A;  4PJO C;  1VQ5 A;  3OYM A;  3S3N A;  3DB3 A;  3HHT B;  3M5A A;  4EMH A;  3OYJ A;  1SPK A;  3M58 A;  1M5Q 1;  1FMK A;  1WJR A;  4BI3 A;  2EYX A;  1ZQ1 A;  1YJ9 A;  2LNH B;  1Q81 C;  3L2Z A;  5I21 A;  3RR6 A;  3CME T;  1G2B A;  4N4G A;  2VWF A;  1VOM A;  1JJ2 A;  1JU5 C;  3TCJ A;  5CKF A;  2DET A;  2BZY A;  5GAN 4;  2HL3 A;  2JZ2 A;  1VQ9 Q;  1JJ2 S;  4A4E A;  3CPF A;  3L2W A;  4MML A;  4O6J A;  2RI2 A;  4Y91 A;  2IIM A;  3OBW A;  2Y4Y A;  2PU9 B;  4RTY A;  1LOJ A;  3PNW C;  5ECA A;  4DBF A;  3P8B B;  4JJC A;  4OP0 A;  3X25 B;  4GLK A;  5A0L A;  1KSW A;  1OV3 A;  1Q81 U;  3CCE A;  3E1S A;  4XQ3 A;  2HKQ B;  2PTK A;  2CKK A;  1QCF A;  1RAG B;  3I56 Q;  1TG0 A;  2VXF A;  1VQ4 A;  1N9R A;  1CKA A;  1KFZ A;  5L8R E;  5KCH A;  2JJ9 A;  4GLM A;  1U06 A;  1YN8 A;  1Q82 C;  3RIR A;  3CMA T;  3ASK A;  1WNL A;  1XQH A;  4M77 C;  2LZ6 B;  1VQL Q;  2YRV A;  3DKM A;  1TSF A;  1VQP A;  4JRK A;  1MMG A;  1QVG A;  1U3O A;  4FU6 A;  1D3B B;  3V7C A;  1D3B A;  4FL6 A;  4OGE A;  2RPN A;  1YHQ Q;  1IRX A;  1QVG S;  1XTD A;  1W2B A;  2DRM A;  1QLY A;  1SG5 A;  4FYV B;  2GF7 A;  3NHN A;  3V7S A;  3G4S Q;  1W2B S;  2YDL A;  4MMK A;  5KE3 A;  4ZTJ A;  1Q82 U;  3REB B;  1WI7 A;  1YBY A;  2DL7 A;  5GAO m;  3RDV A;  2G3R A;  2DIQ A;  3QJY A;  3TRE A;  2MPX C;  2HDA A;  2J6K A;  4E7I A;  5DY9 A;  3MEA A;  4II1 A;  4V2S A;  4OB0 B;  3VYG A;  2ZZD A;  3FB9 A;  5GJV B;  1IO6 A;  4IUU A;  3OS2 A;  4FT4 A;  2W10 A;  3OY9 A;  4M77 D;  1R8O B;  3FDR A;  2EAY A;  3H0I A;  3BFM A;  5GJW B;  3CBP A;  4PJO F;  1YI2 Q;  2QQR A;  2KVQ G;  5GAN g;  5LL6 S;  5GAN 2;  4DBH A;  3OBY A;  2DKG A;  1H92 A;  3JB9 F;  2E10 A;  2ROT A;  2A37 A;  4HKE A;  1VUB A;  2A28 A;  3FJP A;  4C5E A;  1B3Q A;  1NE8 A;  2CP2 A;  2FB7 A;  3OYC A;  2EYW A;  5I2M A;  2HQH A;  4OB1 B;  2QEX T;  2O9S A;  4HCB A;  3CQT A;  2EWN A;  2GFA A;  2VAS A;  4C0Z A;  1N8R C;  1WIE A;  4J9B A;  4BB7 A;  4ZTF A;  1GCP A;  3I56 A;  4CRI A;  2RI5 A;  4PKC C;  3I5R A;  2X4Y A;  2VKN A;  4MDW A;  3QII A;  2DBK A;  5CAI A;  3I55 T;  2XMF A;  2CP3 A;  2CZ0 B;  2AHJ B;  2JS0 A;  3CD6 T;  2ABL A;  4CC4 B;  1VQL A;  3ZBD A;  4IUP A;  4DBR A;  1QWF A;  4PJN A;  4C92 D;  2DXC A;  2OJ2 A;  1JO8 A;  1G3W A;  4BD3 A;  4AFU C;  3KUF A;  4Z89 A;  2F69 A;  2KXD A;  2IVW A;  5CKB A;  3ZL7 C;  1Q95 G;  1VQK Q;  1NPP A;  4M77 F;  5GAN e;  3SHW A;  4OMO A;  1BI2 A;  3S3O A;  4OMF B;  4B6M A;  1OUL A;  3G4S A;  3CC4 Q;  2YLC A;  4MZM A;  2QQB A;  2P84 A;  4E6R A;  1MUZ A;  2VC8 A;  2M51 A;  4PJO B;  4PJO A;  2DFU A;  1JEG A;  1KQ1 A;  2ECZ A;  1H3Z A;  1M3B A;  5GAO n;  2OTJ Q;  4B9W A;  2O01 E;  2P4T A;  3M53 A;  3CPW A;  3RES A;  2FZG B;  4KRT A;  3RER A;  3UT1 A;  2E5K A;  1PCX A;  5J39 A;  2L5Q A;  2X4X A;  3CPW S;  1PWT A;  4XTU A;  1NEG A;  3HSB A;  4AMC A;  4M78 C;  4XAX B;  4KUL A;  1SSH A;  4R55 A;  2PQW A;  5CQX A;  1KQS P;  3FJ5 A;  1GBR A;  1PKT A;  1YIJ Q;  1Y0M A;  4JJD A;  2DXU A;  2YHT A;  2FG0 A;  4A54 A;  3SD4 A;  1X6O A;  3VS2 A;  1N5Z A;  3QKJ A;  1GFC A;  2JXB A;  5IAY A;  3UPU A;  1AWX A;  1X75 C;  2QAS A;  5GAN d;  1M90 U;  1QCO A;  3H0F A;  3JB9 G;  1UGQ B;  1QVF P;  4M75 G;  4X34 A;  3QYG B;  4XTY A;  1YIT T;  1XJW B;  2CZ7 B;  2CP5 A;  1ZSZ C;  1FX7 A;  2HNI A;  2K5L A;  3EG3 A;  5FU7 C;  3P8H A;  4M77 B;  1WHL A;  3FLG A;  4M77 A;  4C8Q D;  1R77 A;  4DA4 A;  2CH4 A;  3C4S A;  1M1F A;  1IB8 A;  4NOY A;  4IUQ A;  1PD1 A;  1TXQ A;  2RO0 A;  2J6O A;  1UEB A;  1PHT A;  1PNJ A;  1YWO A;  2JOY A;  4BI8 B;  5FW9 A;  1JXM A;  3OMC A;  2DL3 A;  3CXC P;  1I4K 1;  2B8A A;  2LRQ A;  2AT1 B;  5HY6 A;  1VQK A;  3PT9 A;  1YJN Q;  3CC4 A;  3QXE B;  3E9G A;  3VS5 A;  3CCV T;  2RK1 A;  2D8H A;  3O5Z A;  3PMT A;  5FU6 C;  2R57 A;  3QUI A;  5DM7 R;  2OTJ A;  4J9H A;  2F5T X;  5FLX E;  4Y28 E;  4A4K A;  2RQU A;  2KYB A;  2WSC E;  5KYN A;  4N4I A;  4KUD K;  1V29 B;  2RH2 A;  2Z0W A;  1WXT A;  3JCM c;  3MKD A;  5LJ3 f;  3RKX A;  1M2V B;  3U23 A;  1M2V A;  1W4S A;  2K5I A;  1B7T A;  3LW5 E;  2YRC A;  1G3T A;  2LMJ A;  1YIJ A;  3RBB B;  1W1F A;  3JCM Q;  4J6W A;  1R0B G;  1RAA B;  3KBG A;  4J6X A;  4LUD A;  2RN8 A;  3PTA A;  4N0A C;  2I2L A;  4NL2 A;  3LYI A;  4KGV B;  5D6Y A;  4M78 F;  1VQM T;  1K8A U;  4LD9 K;  3QJ6 A;  2RJE A;  4NL3 A;  1UJY A;  1NJI C;  1YNZ A;  1ZX6 A;  1M1K C;  5GAO r;  3OYF A;  3R6N A;  5A0G A;  4FT2 A;  3EGX B;  1K9M R;  3EGX A;  2BZ8 A;  1Q7Y C;  2KGT A;  1KC8 U;  1C6V X;  1QQJ A;  4J83 A;  2DXB A;  3C94 A;  3L2R A;  2R58 A;  2OAU A;  3CCU Q;  2FYK A;  1H64 1;  1KK7 A;  2DAQ A;  2WSE E;  1ACM B;  3LX7 A;  2RHZ A;  5KH6 A;  5FRO A;  1K73 C;  4RMO A;  2DEU A;  3QBY A;  1X27 A;  2QDL A;  3CCJ T;  4J7F A;  1RLP C;  4M7A G;  4M7D G;  2K2V A;  2RD1 A;  2DL5 A;  2XKO C;  4PFZ A;  1C0M A;  2QGF B;  1YJN A;  3NFC A;  2KT8 A;  4HXJ A; 
#chains in the Genus database with same CATH homology
 3VYH B;  1N27 A;  3HHT B;  3M5A A;  4J8O A;  4EMH A;  3CCQ A;  3OYJ A;  4L59 A;  1JB0 E;  4LDV A;  1OI1 A;  3M58 A;  4M75 F;  1X01 A;  1M5Q 1;  4XU3 A;  1WJR A;  4LDX A;  4BI3 A;  4XTW A;  2L3R A;  3I56 T;  3CCJ A;  1ZQ1 A;  3VUB A;  1YJ9 A;  1XOV A;  3V8L A;  1Q81 C;  4V2S A;  2FL7 A;  3V8J A;  3L2Z A;  5I21 A;  3HL8 A;  1NZ9 A;  1BKB A;  1WGS A;  2V8K A;  4FM4 B;  3CME T;  4M78 E;  4N4G A;  4JRQ A;  3EFS A;  1WJQ A;  1G3S A;  3LH0 A;  3MEU A;  3QO3 A;  4WF2 A;  1JJ2 A;  3TCJ A;  5CKF A;  2KDS A;  5GAN 7;  5GAN 4;  3G71 T;  4HT8 A;  3OYY A;  2JZ2 A;  1JJ2 S;  4A4E A;  3CPF A;  3L2W A;  4M7A C;  4M7D C;  5GAO l;  1VQL T;  1BIA A;  4MML A;  1I8F A;  2DD4 A;  2MWP A;  2QQ9 A;  1KQS A;  4O6J A;  4M78 B;  3ZFJ A;  2RI2 A;  3O8V A;  3AHU A;  4M78 A;  4Y91 A;  3OBW A;  2XDD A;  2MWO A;  5DLO A;  1U1S A;  2WAC A;  2Y4Y A;  3QPH A;  2XI9 A;  3QG1 A;  4BDY A;  2E12 A;  2RHU A;  2P0P A;  4M77 G;  3X26 B;  4EMG A;  2PU9 B;  1KQS S;  1LOJ A;  1K9M U;  3JCM e;  2ZPH B;  4BAC A;  1Y71 A;  2GFU A;  2DXT A;  2CZ6 B;  2DTO A;  3P8B B;  3PNW C;  1YHQ T;  4OP0 A;  4VUB A;  2D6F A;  3LGF A;  3X25 B;  4GLK A;  5A0L A;  3JCM f;  3GOX A;  5LJ3 e;  1Q81 U;  4XU2 A;  3CCE A;  4C0D B;  2CYZ B;  3LWI A;  3CCV A;  3E1S A;  4XQ3 A;  2M1H A;  3SWN B;  3QZ9 B;  1KHI A;  2VYT A;  3SWN A;  3OSV A;  3PFS A;  4OB3 B;  2CKK A;  3G4S T;  1QVF A;  4BE0 A;  2V8J A;  5KCO A;  2VXF A;  1VQ4 A;  1OYX A;  1N9R A;  4C92 B;  1QVF S;  5L8R E;  4C92 A;  1YHQ A;  5I2S A;  4F7U F;  5KCH A;  2X4W A;  3OYL A;  4ELY C;  4A4H A;  1Q82 C;  3RIR A;  1YCY A;  3CC2 T;  3CMA T;  3ASK A;  1WNL A;  1EIF A;  1XQH A;  4M77 C;  4E7J A;  1VIF A;  3OS1 A;  3J80 E;  2ZPI B;  5FU7 B;  2YRV A;  2LC4 A;  3DKM A;  5GAN f;  3OS0 A;  4C8Q F;  3JSC A;  1VQP A;  2M16 A;  2JN0 A;  2QA4 T;  4JRP A;  2VXE A;  4JRK A;  3WXM B;  4RG8 A;  1FXX A;  3NTK A;  4FIB A;  3OYG A;  1QVG A;  2DPP B;  4FU6 A;  1D3B B;  3UWN A;  3V7C A;  1D3B A;  4HA8 A;  4IUV A;  4L6V 5;  3CCU A;  3X20 B;  5GAM f;  3BDU A;  3MEV A;  4FL6 A;  4OGE A;  4Q5W A;  3G6E T;  3CCS T;  4ELZ C;  3CCR T;  4BUG A;  1QVG S;  3CC2 A;  4Z02 A;  2V8I A;  4BY6 B;  2KAF A;  2VGN A;  1XTD A;  5D6X A;  1M90 C;  1W2B A;  1IZ6 A;  4M75 B;  3DLL A;  4JUV A;  1QW1 A;  2BIV A;  4M75 A;  3RMS A;  1WJS A;  5KE2 A;  3CXC A;  3JCM J;  3MP1 A;  2GF7 A;  3JCM d;  3FRN A;  3V7S A;  3NTI A;  1W2B S;  4MMK A;  4RCB A;  5KE3 A;  1VQM A;  1NPR A;  2MI6 A;  4ZTJ A;  2HBP A;  2K3Y A;  1Q82 U;  1Q86 C;  3H6Z A;  2E41 A;  1YBY A;  4QVC A;  3R6O A;  2P0K A;  2RM4 A;  5GAO m;  1YI2 A;  2A3L A;  3HP9 A;  5LJ3 d;  3DLM A;  2G3R A;  2E64 A;  1UGR B;  5C6S A;  3CCR A;  2DIQ A;  3QJY A;  2EFI A;  3CEY A;  2DTH A;  3TRE A;  3SFM A;  3JCM b;  5DY9 A;  4E7I A;  3MEW A;  1Y96 B;  2FVU A;  3MEA A;  4IUR A;  4II1 A;  3A8H B;  1Y96 A;  2M0O A;  4OB0 B;  2L8D A;  3VYG A;  5LJ5 j;  3GNG A;  5A2Q E;  1VQ8 T;  2LCL A;  2ZZD A;  5FU6 B;  3FB9 A;  4CI0 C;  4RG2 A;  5C0M A;  1NJI U;  1PSF A;  1YI2 T;  4IUU A;  2QQS A;  3OS2 A;  2L89 A;  4ZGD B;  4FT4 A;  4X9C A;  3OY9 A;  4M77 D;  1M1K U;  4OF1 A;  2LNV A;  3GNF B;  1M1G A;  1R8O B;  4MZT A;  3FDR A;  5D6W A;  1QVP A;  2EAY A;  3BFM A;  4C5G A;  2RJF A;  3CBP A;  4PJO F;  2XG8 D;  1KG1 A;  2K5F A;  2E6Z A;  1LJO A;  2EQU A;  2QQR A;  1Q7Y U;  2KVQ G;  4QQ6 A;  3JCM h;  1BI0 A;  3M4Y A;  5LL6 S;  5GAN g;  2E1H A;  5GAN 2;  4F7U E;  3QHS A;  4UC4 A;  3OBY A;  2DKG A;  2PUO B;  1KD1 C;  3X24 B;  4O5V A;  1FWZ A;  3JB9 F;  3QSU A;  2E10 A;  5LJ3 h;  2FHD A;  3CC7 A;  4LDW A;  4E7H A;  5GAM g;  4HKE A;  1U8R A;  5DLQ E;  3L42 A;  2DO3 A;  1VUB A;  1TH7 A;  2EJF A;  2LDM A;  2KSS A;  3FJP A;  1NE8 A;  3VV0 A;  1VIE A;  2DZC A;  2FB7 A;  4C5E A;  4F7U B;  4IKF A;  1QP3 A;  4TVR A;  4F7U A;  4IUT A;  3OYC A;  1VQL A;  5I2M A;  1K73 U;  2DD5 A;  1O9S A;  4OB1 B;  2LQK A;  2EIF A;  3V8K A;  2QEX T;  2E5Q A;  4KT0 E;  1VQK T;  4HCB A;  3PGG A;  2ZPE B;  4M78 D;  2EWN A;  3PIP A;  3CCM T;  2GFA A;  4M7D F;  4M7A F;  4C0Z A;  4C0F A;  1N8R C;  4C8Q B;  3GIB A;  3CC4 T;  4C8Q A;  2KK4 A;  5GAO p;  4BB7 A;  4BY6 C;  4LDY A;  4ZGJ B;  3I56 A;  4ZTF A;  4CRI A;  2RI5 A;  4OB2 B;  5LJ3 j;  4PKC C;  2Y90 A;  2LQ8 A;  1MHN A;  2X4Y A;  3FIF A;  3M59 A;  3CME A;  3CCL T;  1WQ7 A;  4MDW A;  3QII A;  3OYA A;  1M4Z A;  5CAI A;  3I55 T;  4J5Y A;  2XID A;  2CZ0 B;  4FSX A;  4E7K A;  2AHJ B;  3A8L B;  3G71 A;  2OTJ T;  2BUD A;  1AHJ B;  5GMK i;  2JUF A;  4C92 E;  1IRE B;  3CD6 T;  3BY7 A;  3HFN A;  4EMK B;  4E7L A;  1RL2 A;  1WQW A;  4JLI A;  3ZBD A;  1MGQ A;  4EMK A;  4ME7 A;  4IUP A;  5CKD A;  2XDB A;  2RHY A;  4C92 D;  3PMI A;  1G5V A;  3HRS A;  2DXC A;  4F7U G;  5CO7 A;  5HKC A;  2HAX A;  4BD3 A;  1G3W A;  5CK9 A;  3KUF A;  3JAM E;  1JBM A;  2F69 A;  1RI0 A;  2DEQ A;  2IVW A;  3EFR A;  2QDY B;  2DZ9 A;  5CKB A;  2K57 A;  3TEE A;  4X9D A;  4YTL A;  1K8A C;  1NPP A;  4M77 F;  2LTO A;  5GAN e;  1YIJ T;  2KY9 A;  3RUX A;  4M78 G;  5CR2 A;  1BI2 A;  3S3O A;  4NS5 A;  4OMF B;  3G4S A;  3E9F A;  3OYD A;  3GP8 A;  2YLC A;  4MZM A;  2QQB A;  4LD6 A;  1S72 T;  3LLR A;  2ZPF B;  3MO8 A;  3E19 A;  4M75 E;  2VC8 A;  5J26 A;  1G3Y A;  3VU3 C;  5CQY A;  3WVD B;  5GAM e;  5CKE A;  5FRM A;  4PJO B;  2CZ1 B;  4EPC A;  4PJO A;  2ZPG B;  1KQ1 A;  2RHI A;  3HPW A;  3BDL A;  1H3Z A;  4JJN K;  2DTI A;  3VJP A;  1M9S A;  3C95 A;  3GLX A;  4M75 D;  4R56 A;  5GAO n;  1DJ7 B;  5GMK e;  4B9W A;  3CMA A;  1KC8 C;  2O01 E;  3EAE A;  4J7I A;  5GMK l;  2MF2 A;  2P4T A;  3M53 A;  3RES A;  3CPW A;  3RER A;  2OTL T;  3TU4 K;  3M57 A;  3A8G B;  4M7D E;  3UT1 A;  1VQO T;  2LX9 A;  2QA4 A;  2XDP A;  1JRI A;  2M9U A;  2L5Q A;  2X4X A;  5J39 A;  4C92 G;  5GAN 8;  3CPW S;  4B9X A;  2WSF E;  5FRN A;  4XTU A;  5EG2 A;  5J3B A;  2O4X B;  4QW2 A;  3OYH A;  4LDU A;  2O4X A;  3HSB A;  4M78 C;  5M9O A;  3CCS A;  1KHC A;  3G6E A;  2QXF A;  4XAX B;  4KUL A;  2A7Y A;  4R55 A;  2PQW A;  2Y4X A;  4KBM B;  5CQX A;  5GAN 3;  4M7A B;  4M7D B;  4ZN3 A;  4M7A A;  1VQ7 T;  4M7D A;  3M9Q A;  2DXU A;  2YHT A;  2XK0 A;  4A54 A;  3L1A A;  3SD4 A;  1X6O A;  3FC3 A;  1Y7X A;  2PVD B;  4OGC A;  3FEO A;  3QKJ A;  2JNG A;  3WVE B;  3A8O B;  2XD0 A;  3GF5 A;  5IAY A;  1YJW T;  4C0D C;  3OMG A;  3UPU A;  3JCM P;  3SDZ A;  3SWN C;  1X75 C;  5GAN d;  4HCZ A;  1M90 U;  2GQV A;  4RKU E;  2XU8 A;  5HK0 A;  1BI1 A;  4JS5 A;  4JLG A;  3OSS C;  4JRI A;  5CVI A;  3JB9 G;  1UGQ B;  3JB9 I;  4M75 G;  4X34 A;  1VQ8 A;  4C92 C;  1PSE A;  2VGM A;  3QYG B;  4XTX A;  4XTY A;  3V7R A;  1YIT T;  1Q86 U;  1VQ5 T;  5GAM d;  1YJN T;  2BKD N;  2CZ7 B;  1LNX A;  2XHC A;  2F5K A;  1FX7 A;  3G7Z A;  4PL6 A;  3CCQ T;  1P92 A;  4PLI A;  2EQM A;  2HNI A;  1QP2 A;  2K5L A;  3JB9 J;  1BIB A;  2LVM A;  2P0Q A;  2KQW A;  4XTZ A;  3C12 A;  2EYQ A;  4C8Q E;  1YJ9 T;  5FU7 C;  4N4H A;  1O75 A;  3HRT A;  4JDS A;  3MP8 A;  2RHX A;  5LJ5 e;  2R5A A;  2E70 A;  3P8H A;  4M77 B;  3OA6 A;  5A0D A;  4BE1 A;  3FLG A;  3NTH A;  4M77 A;  3M54 A;  4C8Q D;  4DA4 A;  4OVA A;  4MDX A;  2R5M A;  4N0A A;  1N9S A;  3ME9 A;  4MZP A;  4DOV A;  3C4S A;  5LJ5 f;  1M1F A;  4BE2 A;  2EQK A;  1K9M C;  1BYM A;  5GAN h;  4XU0 A;  4A4F A;  4NOY A;  3X28 B;  4IUQ A;  3SB2 A;  4GY5 A;  4RCC A;  2RO0 A;  1U1T A;  2MMP A;  5GMK m;  2KMT A;  2ZGW A;  4M75 C;  1UEB A;  3JB9 H;  2JOY A;  2E65 A;  2HD0 A;  3OQ5 A;  4BI8 B;  1I5L A;  3OMC A;  2VUB A;  5GAM h;  1KD1 U;  5CCA A;  4DQ2 A;  1I4K 1;  2QEX A;  2B8A A;  2EJG A;  2LRQ A;  3HRU A;  2RB6 A;  5HY6 A;  1VQK A;  2RI3 A;  2DK3 A;  1GXI E;  3CCM A;  2YLB A;  2PVO B;  3KXT A;  3Q1J A;  2X4J A;  3QZ5 B;  5GMK h;  3LGL A;  3MHX A;  3PT9 A;  3CC4 A;  3OYK A;  2RJC A;  3QXE B;  3VKI A;  3A5Z B;  3ER0 A;  4A4G A;  3OYI A;  3CCE T;  3E9G A;  3CCV T;  3JCM W;  2RK1 A;  3LWH A;  5GAN j;  3MET A;  3GPL A;  3A8M B;  5GAN 5;  3PMT A;  5FU6 C;  3CCL A;  2XIC A;  4PNO A;  2R57 A;  3QUI A;  1ZBX A;  4BI4 A;  3I55 A;  3OW2 A;  2JTM A;  2RJD A;  4XU1 A;  5DM7 R;  1VQ4 T;  1WPY A;  2NLU A;  1N8R U;  2OTJ A;  5GAM j;  2F5T X;  5FLX E;  3CD6 A;  2DIG A;  4Y28 E;  4A4K A;  4PJO E;  3OW2 S;  2ZPB B;  4C8Q G;  2WSC E;  2PVG B;  4N4I A;  2IG0 A;  4KUD K;  3L2U A;  4KUI A;  1V29 B;  2EKO A;  1VQ6 T;  3QDR B;  3S3M A;  2RH2 A;  3P8D A;  5GMK j;  3RKW A;  4PJO D;  2C06 A;  3CBM A;  3QYH B;  3JCM c;  4HT9 A;  5LJ5 d;  5LJ3 f;  4ZN1 A;  3RKX A;  5CIU A;  4ATO A;  3M56 A;  1VQP T;  4DOW A;  2MAM A;  1W4S A;  4ZGE B;  2K5I A;  5LJ5 g;  2K4Y A;  5GAO q;  5CKH A;  3JB9 D;  3LW5 E;  2CS7 A;  3ZEH A;  1G3T A;  4A53 A;  3H8Z A;  3CCU T;  1YIJ A;  3DB4 A;  3BW1 A;  3L2Q A;  3HFO A;  4BDZ A;  1VQ6 A;  4JS4 A;  3JCM V;  3JCM Q;  2RK2 A;  4QVD A;  4J6W A;  1B34 B;  3PIO A;  4J6Y A;  1B34 A;  3KBG A;  4PLL A;  4EDU A;  4J6X A;  1S72 A;  1UB4 A;  4M7A E;  4L5G A;  4XTV A;  1M8V A;  3PTA A;  1N6A A;  4N0A C;  3OYN A;  2ZCF B;  2DJZ A;  2I2L A;  3LYI A;  4NL2 A;  1ZHI A;  3INZ A;  1XNI A;  4M78 F;  5D6Y A;  4C8Q C;  1VQM T;  1K8A U;  4LD9 K;  4M7A D;  2EJ9 A;  3QJ6 A;  4M7D D;  2QQA A;  2K3X A;  3MCA B;  2RJE A;  4NL3 A;  2D0Q B;  1NJI C;  1SSF A;  4HCC A;  3OYE A;  4C5I A;  4D6W A;  3OS5 A;  5LJ5 h;  1M1K C;  1OZ3 A;  2D9T A;  2H3J A;  2HQE A;  3OYF A;  5GAO r;  2OTL A;  5A0G A;  3RMQ A;  3JCM X;  4C5H A;  4FT2 A;  1UGP B;  1HXD A;  3F70 A;  3M55 A;  3N5B B;  1VQO A;  1OZ2 A;  1Q7Y C;  4E47 A;  4PJO G;  3OYB A;  1UGS B;  5GAN 6;  4EMK C;  3CXC S;  1KC8 U;  2HQX A;  3M4G A;  3T9N A;  4J83 A;  1HK9 A;  2DXB A;  3C94 A;  3JCM g;  3L2R A;  1VQN T;  2GCX A;  1KQ2 A;  2R58 A;  3S6W A;  2DVE A;  1I81 A;  3OB9 A;  4C92 F;  3MP6 A;  5AYF A;  1VQ7 A;  3J81 E;  2OAU A;  3UDC A;  2CGH A;  2FYK A;  1H64 1;  4QVZ A;  2DAQ A;  3VUZ A;  3URG A;  5LJ3 g;  2WSE E;  2VV5 A;  5HK3 A;  4XK8 E;  3RKY A;  5IT9 E;  3CBO A;  3LX7 A;  1Y07 A;  2RHZ A;  1VQ9 T;  4QQG A;  4M77 E;  2X35 A;  5FRO A;  5KH6 A;  1YJW A;  1K73 C;  5IN1 A;  4RMO A;  3QBY A;  2PUK B;  3CC7 T;  1VQN A;  2QTX A;  2RA2 A;  2LT4 A;  3CCJ T;  3HKS A;  4J7F A;  3L2V A;  3J7A F;  2JVV A;  4M7A G;  4C0G A;  4M7D G;  2LCC A;  2K2V A;  2JTF A;  2E6N A;  2RD1 A;  4P5N A;  2LT1 A;  2EQJ A;  1BI3 A;  2XKO C;  3JRZ A;  4QQD A;  1YIT A;  1VQ5 A;  3OYM A;  4PJO C;  1VQ9 A;  1YJN A;  3S3N A;  3NFC A;  3DB3 A;  2QI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...