2DXBA

Recombinant thiocyanate hydrolase comprising partially-modified cobalt centers
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
VWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase subunit alpha
publication title Structural Basis for Catalytic Activation of Thiocyanate Hydrolase Involving Metal-Ligated Cysteine Modification
pubmed doi rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
total genus 28
structure length 118
sequence length 118
chains with identical sequence D, G, J, M, P, S, V
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxbA00
2CYZB 1PSFA 1QP2A 5L8RE 3X26B 1AHJB 2DPPB 2QDYB 2DD4A 4XK8E 3WVEB 4L6V5 2WSFE 1PSEA 4OB0B 1JB0E 2DXCA 3X28B 3HHTB 3X20B 2CZ1B 4ZGJB 3A8GB 2ZPFB 1QP3A 4KT0E 2ZPIB 2DXBA 1V29B 2PVDB 1UGQB 3QZ5B 1GXIE 2O01E 4OB1B 3LW5E 3X25B 2WSEE 1UGPB 2ZPHB 3A8LB 3QZ9B 2PUKB 2D0QB 3A8OB 2PU9B 3X24B 3VYHB 4RKUE 2ZPBB 3QYHB 2ZCFB 2AHJB 2ZPGB 3WVDB 4ZGDB 2ZPEB 4OB3B 2CZ6B 2DD5A 4ZGEB 3VYGA 2WSCE 3QYGB 1IREB 1UGSB 2PVGB 4FM4B 3A8MB 2CZ0B 2PVOB 2CZ7B 2PUOB 2ZZDA 1DJ7B 1UGRB 4Y28E 3QXEB 3A8HB 4OB2B
chains in the Genus database with same CATH superfamily
2H3EB 5IH2A 2D0NA 2MWOA 2GQVA 1M2VA 3C12A 1HJDA 1YI2Q 2ENMA 5GAN3 1KJWA 1RAIB 2C06A 2F2VA 2D8HA 2DILA 3P8DA 1X2QA 5CR2A 2HAXA 1JQQA 3RR6A 1KD1R 3BW1A 2LX9A 4J9DA 1M3AA 3EH1A 2ZPFB 4M75G 1N9SA 2JN0A 5GAOl 1VYVA 3RKXA 3DB4A 2JM9A 1QVPA 3E2UA 1UGPB 2RI3A 3EH2A 2CDTA 4J9IA 1QW1A 1WPYA 2FVUA 1LVKA 1X6BA 2VASA 3EAEA 2HSPA 3EGUA 3QYHB 1K9MR 4QQGA 4BY6B 2QTVA 3JRZA 1G8XA 2RK1A 1S1NA 1SF9A 1Y96B 1BI3A 3RUXA 1YJWT 2DJZA 2HQEA 1M30A 1VQLT 1IREB 4O6JA 1I1JA 1F1BB 5KYNA 3CMEA 2VXEA 1KQ2A 3HRTA 3CMEQ 5A0LA 3J80E 5LJ5j 2W10A 1RACB 1U1TA 1BI1A 1RAHB 4J6YA 2H3JA 1RI0A 5I2SA 4RCBA 2Y4XA 3I35A 4PJOD 2QQSA 3OYGA 2EYXA 3S3OA 3DKMA 1QP2A 1OX9A 2DRMA 3OYBA 3UDCA 2CP5A 4FCYA 5GAOr 5KYYB 5GMKh 1JEGA 3WVEB 1FXXA 3L2ZA 1R0CB 3M0UA 2E1HA 1G5VA 5HKCA 4BDZA 1KFZA 2XU8A 1YP5A 1YIJT 1M27C 1ZX6A 3JCMP 1RI9A 4BE1A 4IKFA 3QJ6A 2L2PA 2YLCA 4E6RA 4HVWA 1OI1A 2RHYA 3A8GB 2KY9A 1VIEA 1N9RA 2EIFA 4ELZC 4BE0A 3OW2S 3OA6A 2LTOA 3CBMA 2ED0A 1GXIE 1UGVA 1ZSZC 3S6WA 4F7UA 2CH4A 3LW5E 2E64A 2JOYA 5HCKA 1PD0A 5A0GA 1VQOA 3G4SA 2DBMA 2RJFA 4E7SA 1K8AC 4QQ6A 5CKDA 3MPUB 2FZKB 4FL6A 2CGHA 2YRCA 1H3HA 1M3BA 2V1QA 5LJ3j 3SWNA 1T0HA 3C0CA 1J3TA 1MV3A 5GAN4 3GPLA 2I0NA 3E9GA 4MMLA 2X51A 5CKEA 2X4XA 3VS3A 3CCJA 5CVIA 1WA7A 3EHRA 4ESRA 3EFRA 2LP5A 3CCJQ 3CCSA 1TXQA 2KXDA 1E6HA 4FW1A 3I5SA 1PD1A 1M90C 2HDAA 2H8HA 2FPFA 1BYMA 4IUUA 4LDXA 1T3SA 5CCAA 4N0AA 2RI5A 1FMVA 4J9EA 4M77G 3AHUA 3EHQA 4QVZA 1M1FA 2RHZA 1NPRA 3TEEA 2EFIA 1CKBA 2DVJA 4C5IA 3CPWP 3UF4A 1NJIC 2VUBA 2CSIA 2XICA 2DM1A 4JRQA 3V8LA 1KD1U 1HK9A 2JMAA 4X34A 4M7DA 2IVWA 2YRVA 4LN2A 1U3OA 3LH0A 4J9HA 2QQRA 2DYIA 1S72T 1M1KR 3CC7A 4PK4A 3SWNC 5GANj 2DKGA 4C5GA 1UHCA 3CCEQ 8AT1B 1Z9ZA 1H8KA 2EJ9A 2K5FA 1TTHB 2GTOA 1JBMA 1I5OB 2K2VA 5J26A 3CCUQ 2CSQA 2RQRA 1LNXA 2RO0A 3X24B 1WJRA 3M0RA 2ED1A 1U06A 3I55Q 4N0AC 3OS5A 3LGLA 3M0PA 3ER0A 1N27A 2DTHA 1ZUUA 2X3XD 4ZNXA 1Q7YC 3MP8A 4M7AB 4FT4A 4OP0A 5CKBA 2EGEA 1VQKA 4EIKA 2KRSA 2KGTA 1I5LA 1Q81R 3JB9F 1VQKQ 4LUDA 3I9QA 5EC7A 3PMTA 1Y57A 4HKEA 2PTKA 1W70A 1RAEB 3CQTA 1LJOA 3JCMQ 4C8QA 3FJ5A 4C8QD 1RAFB 1YJNQ 4DEXA 5A0DA 1QVFS 3UA6A 1OV3A 4C5EA 1VQNQ 2QI2A 3CCQT 2QA4Q 1MMDA 1SKUB 1JU5C 4F16A 1UJ0A 1YJ9Q 5L8RE 3TSWA 2VGNA 2QDYB 5I21A 4PNOA 2VGMA 4RTZA 3V7CA 5LJ3e 1B07A 1D1CA 1E6GA 3M54A 2K4YA 4L6V5 2RQVA 3MEWA 3CBPA 1CSKA 4F7UF 4FYVB 2QGGA 1NLPC 1YNZA 4F14A 2MPXC 3HFOA 1WI7A 4J9CA 4BDYA 4ME7A 2M51A 4E47A 5CQXA 2GTJA 4F17A 4K11A 4M78B 2HQXA 3NHNA 2EJGA 1EIFA 2HKQB 2DVEA 2MYSA 1OPLA 1RL2A 3URGA 3QSUA 1P92A 4BUGA 1G2BA 1VQ6A 3DLLA 4PJNA 3EFOB 1C0MA 1IHVA 2FL7A 3A8OB 2PU9B 3VYHB 3CMAA 1EX4A 4A4EA 5KE2A 4C8QC 2QQAA 3I56T 3CMAQ 2JVVA 2AZVA 1Q86R 2QDLA 2GCXA 2MOXA 3THKA 1VQ9Q 5C0MA 2OX7A 4ATOA 1PKTA 4HCCA 1X43A 2DD5A 4XAXB 4PFPA 3RERA 1VQ5Q 5GANe 1Q82R 2PVGB 1W2BA 1IZ6A 4GLMA 2DAQA 1KC8C 3PMIA 4JUVA 4OMPA 4DA4A 4D8KA 9ATCB 2ZZDA 2RI2A 1MMAA 2RM4A 1IHWA 1HYOA 2M16A 4N4IA 2C0OA 4OMLA 3QXEB 1Y96A 1OPKA 2X4YA 1YN8A 2GFAA 2L3SA 1X75C 1AWOA 2EVRA 2COZA 4FW2A 3INZA 2F1LA 4C92B 1VUBA 3QWXX 3CCRT 4PJOG 3HTRA 2FZGB 3NTHA 4A4GA 4NL2A 4ANJA 3M59A 3V8KA 1LCKA 1GRIA 3OMGA 3CCMT 1NPPA 1RLQC 5GANh 1UE9A 5IN1A 4M7DB 1TU0B 1M1KU 4LDWA 4B9XA 3LWIA 2EYWA 1RUWA 1IRXA 1GCPA 2BZYA 3S3MA 3LH5A 2KE9A 4QT7A 5KYYA 3EGXB 4GY5A 2O31A 3OYDA 1M5Q1 4FYXB 2C0TA 3CC2T 1GCQA 2AZSA 4PKCC 3OS1A 1VQ6T 1K9AA 4ZTFA 3DLMA 4BY6C 5CO7A 1WQ7A 2DERA 4AMCA 1KQSA 1EZZB 4DEYA 2NUTA 1VIFA 2R58A 2V8IA 4M75B 4M4ZA 1AOJA 2DTIA 2QGFB 4C8QF 2DE0X 1KK7A 1Y0MA 3OYNA 2JT4A 1YITT 1QVGS 1MUZA 1Q81U 1M8VA 2DL3A 4J7IA 2F5TX 2HBWA 5FWBA 2HSEB 1UJYA 1TWBA 1IGQA 3PTAA 5KCHA 3EG2A 4UC4A 2LT1A 2E10A 1VQPT 4HT8A 2CP3A 4JZ4A 3A8HB 4OB2B 1YJWQ 2K79A 3J7AF 4QVDA 5KE3A 4KBMB 3E9FA 1VQLQ 1OZ3A 2Z0WA 4Y92A 5GAMh 4IUTA 1Q95G 1BI0A 4LDUA 4JDSA 5DM7R 4XK8E 5KYXB 3VS5A 2J7IA 3CXCP 3LLRA 2WSFE 3MCAB 1GCQC 1R77A 5CQYA 2MF2A 1QKWA 2P84A 2MAMA 1JRIA 1UB4A 1N5ZA 2YUNA 2EGAA 3QBYA 4FYWB 5FW9A 1XJWB 2K9GA 2MK5A 1PG5B 1QWEA 4WTOB 1MNEA 5GAN7 1NBEB 1BIBA 3HKSA 2KNBB 2MCNA 3VRZA 2CP6A 1UECA 2XI9A 4D8DA 1YIJA 1R0BG 4F7UE 4KH1B 1WHHA 1YHQT 3KBGA 1ZSGA 1YIJQ 2M0OA 4XTVA 2M9UA 3FDRA 1OQKA 1VA7A 1G83A 3O8VA 1M2OA 3JCMe 3OY9A 1Q86U 1VQMT 2EYYA 2AHJB 4DBFA 2DXUA 3RMQA 1KD1C 2NYSA 4J8OA 1T3LA 1SHGA 3PVLA 4XU0A 1KG1A 1A0NB 3VYGA 2L0AA 2JJ9A 2DRKA 1Q82U 2KYBA 1BCMA 2SRCA 1RAGB 1Y07A 2DXTA 3OYLA 3CBOA 2FEIA 3H0FA 2PVOB 4KGVB 1UEBA 1M8MA 2RD1A 2M0YA 3GNFB 1VQ8A 3CC4T 1PC0A 1ZUKA 3JCMh 1TG0A 3N5BB 4MZPA 4A4KA 1K9MC 4M7AA 4HCZA 2YRDA 2CT3A 5CKHA 3M57A 2L89A 2HBPA 4ZN3A 4C8QG 3SHWA 3M4GA 1WQWA 2HQHA 2DL4A 3M58A 4B9WA 4MMKA 3WXMB 4IIMA 2DEQA 5DY9A 3JB9J 2HZYA 1VQ4T 4OB0B 1TH7A 4XU1A 3OYEA 1HD3A 4BE2A 2R57A 4HCBA 5KYWB 5D6WA 2J06A 2RPNA 3TU4K 4ZGJB 4M7DE 1RLPC 5HK0A 1ZA2B 1WJQA 4M77B 2PNIA 4KT0E 3VS0A 3GIBA 5A2QE 4XU3A 3JB9D 1C6VX 2BKDN 2JZ2A 5GAMd 3KFVA 4L5GA 1N8RC 3RIRA 3X25B 4DBHA 1U1SA 2LCCA 1S72A 3OYAA 2IG0A 4NOYA 2DJQA 2LCLA 2YXYA 3UPUA 2DX1A 1YI2T 3MKDA 2NWMA 3FEOA 4AT1B 4C0DB 2ABLA 4JJDA 2IIMA 4M78A 2F5KA 2V26A 4M78D 2NUTB 5EG2A 2XDDA 4M7AC 2K7AA 1Y7XA 4DOWA 5IXFA 3CXCA 2X4WA 1FX7A 2P4TA 5FU7B 3OW2P 2O9VA 1ABOA 2BE7D 3EFOA 2XIDA 1TS9A 1UGSB 4Z89A 3M0SA 5FRNA 1B34A 4DBRA 1VQOQ 3G4SQ 3REAB 2RHXA 2FB7A 2OAWA 2VVKA 2CZ7B 2LX7A 2PUOB 1WHLA 2DYBA 5CAIA 1AZEA 1BI2A 5KH6A 4C8QE 4LNPA 3M0TA 2HL3A 3OB9A 1VQ8T 2HCKA 3A1PA 4JJNK 1PRLC 3CD6A 2LQ8A 4RTXA 2K5IA 5IXBA 2QG9B 4ZTJA 3C4SA 2JMCA 1PKSA 3U23A 3GP8A 3OQ5A 3P8HA 3CCSQ 4VUBA 2COWA 4BI8B 2RA2A 3JCMb 1OULA 2DXCA 3M56A 3HHTB 2BTTA 3CCQA 3MP1A 2CS7A 4QKUA 3BDLA 4M78C 1EFNA 3JCMd 1XNIA 3OYKA 4C92A 2PZ1A 4HT9A 2ZPIB 2OTLA 3NTKA 4OF1A 3JCMc 2NUPB 4KRTA 3OYMA 1JJ2S 3CPWS 3E1SA 3JB9H 2ZPHB 4JZ3A 1ARKA 4EMHA 1NJIR 1W2BP 2D0QB 2MMPA 4M7DD 4IIOA 2LQNA 1OU8A 3H0HA 5J39A 3SDZA 1GFCA 2CP0A 3CC7Q 4IUPA 2EBPA 3V7SA 4NS5A 1OU9A 2E65A 5LJ5e 3EGXA 1NE8A 5KCOA 1M1KC 5GANg 3L2UA 4KUIA 3TSZA 3SB2A 5FWCA 1D1AA 4M7AF 4EMGA 3QG1A 3A98A 3L42A 2XKOC 4A63B 3I56A 2DIQA 1D3BB 1VQ7A 5GMKm 3JCMJ 1BK2A 4M75A 2E3HA 8ATCB 4M75D 1X01A 1W4SA 4NL3A 5KYUB 2JM8A 4P5NA 5C6SA 2K6DA 1B3QA 2EKOA 2KYMA 3L1AA 1K73R 2OTJT 1Q7YR 5LJ5h 3CEYA 4LXCA 2GNCA 2LJ1A 2E12A 3CD6T 2D6FA 1WXBA 2CH4W 2FRYA 5GAN2 1GBRA 1GFDA 4M7DC 1WJSA 2GF7A 4PLLA 2KROA 1TSFA 1Q81C 3JAME 2AIRB 5CIUA 2RF0A 2F69A 2CP7A 1KQSP 1Z9QA 1ZQ1A 1FYNA 3OS0A 2HMAA 2K3YA 3CCRA 3M5AA 2L3RA 5GAN8 3OW2A 5KYXA 5FRMA 2RNAA 3QKJA 4M78F 4LUEA 2J05A 4JJCA 4BB7A 3CCMA 2HL5C 3JV3A 1KHCA 2OTLT 3BY7A 3V7RA 5GAOm 4OB1B 4PJOB 3CCMQ 4EMKB 3UA7A 1OEBA 2QTXA 4FSXA 4PL6A 1K1ZA 3GBQA 5L23A 4O5VA 2A37A 3SD4A 2DK3A 5GAMg 4CC7A 3UT1A 2G6FX 4M75C 2YT6A 2NUZA 3ASKA 3VS2A 3PFSA 3FIFA 2EQKA 3QO3A 4PJMA 1N6AA 5I2MA 3CC2A 4OB3B 2A08A 4KGZB 1IO6A 3HRUA 2FPEA 3CC2Q 4J9BA 3QYGB 3OYCA 3FLGA 5LJ3h 1HXDA 1VQ6Q 2V1RA 2VB6A 1KQ1A 2MI6A 1B34B 3TREA 2ROLA 2RHIA 4L59A 3VRYA 2M02A 1SG5A 1PCXA 1JO8A 4AFUC 1QCFA 1SSFA 1VYUA 1YITA 5IHNA 1VQ7T 2B86A 2EQMA 4PFOA 3CCLT 3CCUT 4BI4A 2YLBA 1YWOA 3LYIA 4QQDA 4XTWA 2CUDA 2LQWA 1Q86C 2CREA 2DL8A 3LX7A 3X26B 1TOVA 1IXDA 2DPPB 3M0QA 2DD4A 3I55T 4X1VA 7AT1B 3G6EA 2W0ZA 1AT1B 3D7SB 1VQPA 4FIBA 3VU3C 1WFWA 1TUCA 2YUOA 2LRQA 5IHIA 3H41A 3OSVA 3R6NA 2GFUA 2GGRA 5D6XA 1Q82C 1XTDA 2DFUA 5GANf 4KULA 4M7DF 2JNGA 2KDSA 4J9FA 2KEAA 1V1CA 1I8FA 2VXFA 2KI7A 4J9GA 2DXBA 2COYA 1UTIA 5LJ5d 3VS1A 3G71A 2QAZA 1FMWA 2O01E 3O5ZA 1YJNT 2HEQA 1NJIU 4MZMA 2LMJA 1U8RA 3JCMg 5KYWA 1IGUA 3A8LB 3JB9G 3OYYA 2QA4T 1K76A 3NPFA 1JXOA 2A36A 3GLXA 1BCOA 3JCMW 2LNVA 1YJ9T 2E4HA 3E19A 2JUFA 4QVCA 2RK2A 4M77A 2JTMA 3MO8A 2RB6A 2KAFA 2PQWA 1SPKA 5AT1B 3R6OA 2JS2A 3BFMA 1SEMA 3WVDB 1YHQA 1JXMA 4M75F 4OVAA 2BZXA 4ZGDB 2ZPEB 4A53A 3ZL7C 1ACMB 1WNLA 1YHQQ 2K2MA 4IUQA 2P0PA 2XK0A 4OMQA 2ROTA 2EPDA 1VQMA 1D0YA 4IUVA 3LGFA 1AD5A 2RQWA 3M4YA 4F7UG 3HFNA 1VYTA 3H9NA 4A4HA 3PNWC 1MGQA 1GBQA 1E7OA 1AWXA 4E7JA 2O4XB 2R5MA 2FZCB 3TQ7P 5GMKj 3LWHA 1OX8A 1K73U 1Q7YU 1QVFA 1PM3A 2EJFA 3CCVT 4M7AE 2MIOA 1R8OB 3L2VA 5GAMf 2D1XA 3J81E 3PIPA 4J7FA 2KRNA 5LJ3d 4PJLA 1QVGP 1B7TA 3CC4A 2V8KA 5FLXE 1VQ9T 3G6ET 4JRIA 3TCJA 2KXCA 2D9TA 3CC4Q 3JCMV 1W6XA 1MNDA 2AKKA 4B6MA 1QP3A 4JRKA 1VQ4A 1M3CA 3JSCA 2GBQA 2Y4YA 5DLQE 3PT9A 3S3NA 1VQ4Q 4RTVA 1BU1A 4CC3A 3QJYA 3G71T 3I5RA 1QQJA 4C0DC 4RKUE 2RN8A 4RG8A 3QHSA 2IPOB 4Z8AA 4HA8A 1H92A 4M7DG 1NZ9A 2A3LA 5FU7C 4M78E 1PHTA 4HXJA 2NUPA 2DIGA 4JLIA 2AK5A 2CZ6B 5D7UA 4KUDK 3UWNA 5FROA 2KR3A 4ZGEB 5GAOn 4LD6A 3ME9A 3RMSA 1YI2A 1NYGA 2RHUA 4GLKA 5GANd 5FU6B 2X3WD 2FRWA 2F2WA 5GMKi 3FJPA 4R0KA 3EG9B 3SFMA 3A8MB 2OJ2A 2EQUA 3HP9A 2VV5A 1OYXA 4MDWA 1NEGA 2BIVA 1X69A 3P8BB 2Y90A 3IQLA 2BE9B 2XG8D 3JCMf 2O9SA 2LVMA 1ZBXA 3Q1JA 2VYTA 4AFQC 2E6NA 1T0JA 2FG0A 3EGDB 1QCNA 4C0GA 5CK9A 1D3BA 1KC8U 3V8JA 3ULRB 4E7HA 2WACA 2L8DA 1K0SA 5KYUA 3DB3A 1VQ8Q 3OS2A 4M7AD 1QLYA 2DZ9A 4FYYB 1YWPA 1WIEA 3C95A 2X9HA 2QEXT 2XHCA 4M77F 3H0IA 1O9SA 1G3WA 3A5ZB 4C92E 3QZ5B 1OOTA 1FMKA 1WHKA 4ZN1A 5GMKe 2BUDA 2DMOA 1ZSZA 4JPBW 2KVQG 4JS4A 5LJ5g 1ZLMA 3OBWA 3HRSA 2RMOA 4GBQA 2YHTA 4ORZA 3FB9A 4WCIA 2A0FB 4E2FB 4X9CA 3VUBA 5AYFA 4J6XA 4PJOA 1PRMC 4EMKA 4PFZA 4LDYA 2QASA 1UDLA 1QVGA 4DOVA 4DQ2A 2AKLA 4BI3A 1N8RR 2KBTA 2EWNA 2QYZA 3QDFA 1S72Q 1RADB 3NGPA 3M53A 2DZCA 1I4K1 1WX6A 3REBB 2CP2A 1QMCA 1WYXA 2K3XA 4MZTA 4CRIA 3JCMX 1YCSB 4M75E 3RKWA 1D1BA 3MP6A 3G7ZA 1YFNA 2FHDA 1WHGA 1C1AA 4AG2C 1D0XA 4XTYA 4II1A 2LQKA 2DEUA 1FWZA 1M1GA 1M9SA 3MEUA 1KSWA 1ZUYA 3OYJA 2K3BA 1K8AR 1KHIA 1JB0E 4D6WA 2E5KA 3HPWA 3META 3EG0A 1AZGB 3JB9I 4Z02A 2LZ6B 5HK3A 4N4GA 3RDVA 1MV0B 1WXUA 4R56A 3ZBDA 2OTJA 4XTZA 3VS6A 3QPHA 4C0ZA 2CZ1B 4LE9A 2CKKA 2QQBA 5LJ3g 1AEYA 1AVZC 3G1JA 1KIKA 2OTJQ 2HNIA 2YUQA 4OGEA 1H641 3NMZC 3CD6Q 1V29B 4RTUA 2ECZA 1K4US 4PJOC 2ATCB 4EMKC 3MHXA 1XQHA 2E70A 2XD0A 3H6ZA 3MEAA 2E3IA 4BD3A 1WGSA 1SSHA 1M90R 4J5YA 3MJXA 4JLGA 2O88A 4OMFB 4AFZC 1NEBA 2DL5A 4EPCA 3CCQQ 5GJWB 3GNGA 3F70A 4E7LA 3CMET 3L2RA 3EFSA 4C92D 1G3YA 3NFCA 2ZPGB 1MMNA 2EGCA 2RJEA 1AWWA 2L3QA 2EYZA 2OTLQ 1D0ZA 1K0XA 3VS4A 2EKHA 1ZHIA 2MWPA 3PIOA 3PVQA 3SEMA 1UUEA 2ZAEA 1I07A 4QW2A 1M2VB 1W2BS 1JJ2P 3QWYA 5LL6S 1ABQA 4CI0C 2CUBA 4CC2A 1AWJA 4RUGA 4A4FA 4JJBA 2CYZB 2EAYA 2LJ0A 3NTIA 2C0IA 5GAOq 5LJ5f 5IHKA 1LOJA 3CCEA 1BKBA 5I22A 2DO3A 1HSQA 2P4RA 2KSSA 2DA9A 3I56Q 1MMGA 2A7YA 2O4XA 2RQUA 3CCLA 2LDMA 2JTFA 3L2QA 3CCUA 4PLIA 2ZGWA 4EDUA 1VQ7Q 1UHFA 5DLOA 3CCLQ 4C92C 1YCYA 2VWFA 4Q5WA 3I55A 1K9MU 2OI3A 4N4HA 1VQOT 1WXTA 1UFFA 3G4ST 2YWWA 2J6OA 2DTOA 3C94A 4FSSA 2LT4A 1TUGB 2EW3A 2KT1A 1K73C 4PJOF 2DF6A 4OMNA 1BB9A 2J6KA 1WHJA 1ZSZB 3HSBA 1I81A 1NYFA 1Y71A 3CCJT 2K5LA 2VKNA 5HY6A 4M77E 1UG1A 1KQSS 1XOVA 3CCST 2KT8A 2EYQA 3CCRQ 1YJNA 2K57A 1QVFP 2D8JA 1VQNA 1U5SA 4J6WA 4E7IA 2QA4A 3ZFJA 1YJ9A 1N8RU 2R5AA 2A28A 2WSCE 2DL7A 4V2SA 5LJ3f 4R55A 4OGCA 3KXTA 4FM4B 1SRMA 2O2OA 3M55A 2CZ0B 2LCSA 1WLPB 5GAMj 2XMFA 3OYIA 4LD9K 1UGRB 4JS5A 2FO0A 3PE0A 2FYKA 1G3SA 1NLOC 3AT1B 2M1HA 2XDBA 3TVTA 2HD0A 2L3PA 1PSFA 5ECAA 3H8ZA 1O75A 4AG1C 3BE3A 3CC7T 1K8AU 3EG9A 3ZEHA 3RKYA 3CCET 3VS7A 1PSEA 4F7UB 3FC3A 1IB8A 2QXFA 3EG3A 2YDLA 2EQIA 1QKXA 5I11A 3CCVA 3RNJA 4FU6A 1X27A 1YITQ 2NLUA 1PWTA 2DNUA 1QWFA 3QUIA 3CCVQ 2LJ3A 3T9NA 2G3RA 4DBQA 1BBZA 1X2KA 4RTYA 1WDXA 4HCKA 3EGDA 3GF5A 2V8JA 4C92F 1VQ9A 2FPDA 3SWNB 6AT1B 1UGQB 2QK0A 2HKNA 4M7AG 1M90U 3OYHA 2I2LA 3G6EQ 2DETA 1JJ2A 3OSSC 2WSEE 1VQPQ 3CPWA 1KC8R 4CC4B 2X35A 1VQ5A 1X6GA 2PUKB 3QDRB 4MDXA 3L2WA 2L5QA 4Y91A 3OYFA 2XDPA 1D09B 2ZPBB 1VQKT 2KQWA 5CKFA 5GAOp 4A54A 5GAN5 2J6FA 3UATA 1BIAA 4YTLA 3MEVA 4AFSC 4KGXB 2DLPA 3G71Q 4TVRA 2BZ8A 5FU6C 1VQNT 4JRPA 3FRNA 3HL8A 1M4ZA 2F2XA 2RH2A 1W1FA 4X9DA 3VV0A 2YSQA 1ZA1B 1SHFA 3QIIA 4XQ3A 5GAN6 4RG2A 1RABB 2DBKA 4M77D 1QCOA 2LC4A 4HVUA 4RCCA 2JXBA 1OZ2A 2P0KA 5J3BA 2KK4A 4RTTA 2ESWA 1PNJA 4WF2A 1YBYA 2KMTA 2GQIA 4M78G 1H3ZA 3BDUA 1AHJB 3RESA 1GL5A 4BACA 2E5QA 2LNHB 3RBBB 1WZOA 4RMOA 1VQMQ 5D6YA 4PJJA 2VC8A 5GJVB 3KUFA 3X28B 2SEMA 4XTXA 2RJCA 4LDVA 4E7KA 1MHNA 3X20B 2CT4A 4IURA 4OMMA 2P0QA 2E6ZA 2JTEA 3OBYA 2PVDB 1NG2A 3CMAT 1I0CA 5GAMe 3PGGA 4RTWA 1ZBJA 2B8AA 3M9QA 1WHMA 3VJPA 2AT1B 3OMCA 4ELYC 3QZ9B 4FT2A 4HVVA 4C5HA 4F04B 1V76A 4M77C 2QEXA 1TUDA 1VQ5T 5IAYA 4C0FA 2QEXQ 2X4JA 2E41A 4XU2A 2ZCFB 1CKAA 1SRLA 1YJWA 3EG1A 2JW4A 4C8QB 1VQLA 2KRMA 3CXCS 2RJDA 3VKIA 2RQTA 2YUPA 5IT9E 4PJOE 4C92G 3CPFA 2QQ9A 4E7ZA 2OAUA 1X6OA 4Z88A 4XTUA 1NM7A 5GMKl 2JS0A 4OMOA 1LPLA 4KH0B 5M9OA 1DJ7B 3VUZA 4Y28E 3GOXA 4J83A 1RAAB 1VOMA 2EQJA 1G3TA
chains in the Genus database with same CATH topology
1X75C 2EKOA 4XTYA 3L1AA 4II1A 2LQKA 2OTJT 3INZA 5LJ5h 2MWOA 1FWZA 1M1GA 3CEYA 2GQVA 1M9SA 4C92B 3C12A 2E12A 1VUBA 3CD6T 2D6FA 3MEUA 3CCRT 5GAN2 4PJOG 4A4GA 3NTHA 5GAN3 3OYJA 4M7DC 1KHIA 1JB0E 1WJSA 2GF7A 4NL2A 3HPWA 3M59A 3META 3V8KA 4D6WA 2C06A 4PLLA 3OMGA 3JB9I 4Z02A 5HK3A 3P8DA 1NPPA 4N4GA 3CCMT 3JAME 1Q81C 5GANh 5CR2A 5IN1A 2HAXA 4R56A 3ZBDA 4M7DB 2OTJA 4XTZA 5CIUA 3QPHA 4C0ZA 2CZ1B 4LDWA 1M1KU 2CKKA 2QQBA 5LJ3g 2F69A 3BW1A 2LX9A 1ZQ1A 4B9XA 3OS0A 3LWIA 2HNIA 2K3YA 4OGEA 3CCRA 1H641 2ZPFB 3M5AA 4M75G 2L3RA 3S3MA 5GAN8 3OW2A 1V29B 5FRMA 3QKJA 4PJOC 1N9SA 4M78F 4EMKC 2JN0A 3MHXA 4GY5A 4BB7A 5GAOl 3CCMA 1XQHA 2E70A 2XD0A 1KHCA 3H6ZA 3MEAA 3BY7A 3DB4A 3RKXA 3V7RA 2OTLT 5GAOm 1QVPA 4OB1B 3OYDA 1M5Q1 4PJOB 1UGPB 1WGSA 4BD3A 4EMKB 2RI3A 4J5YA 3CC2T 4JLGA 2QTXA 4FSXA 4PL6A 1QW1A 4OMFB 4O5VA 4PKCC 4EPCA 3OS1A 1VQ6T 1WPYA 2FVUA 2DK3A 3F70A 3GNGA 3SD4A 5GAMg 4ZTFA 3DLMA 3UT1A 4BY6C 4E7LA 5CO7A 1WQ7A 3EAEA 4M75C 1QVFS 3CMET 3ASKA 3QYHB 1KQSA 4QQGA 3PFSA 3L2RA 3EFSA 4C92D 1G3YA 3NFCA 2ZPGB 3FIFA 2EQKA 3QO3A 4BY6B 1VIFA 2R58A 1N6AA 2RJEA 2V8IA 4M75B 5I2MA 2DTIA 3JRZA 4C8QF 3CC2A 2RK1A 4OB3B 1Y96B 1BI3A 3RUXA 1YJWT 3OYNA 2DJZA 3HRUA 1ZHIA 2MWPA 2HQEA 1YITT 1QVGS 3PIOA 3QYGB 1VQLT 1IREB 4O6JA 1Q81U 1M8VA 3OYCA 3FLGA 5LJ3h 1HXDA 4J7IA 3CMEA 2F5TX 2VXEA 4QW2A 1KQ2A 1KQ1A 2MI6A 1B34B 3HRTA 3TREA 1W2BS 2RHIA 4L59A 5A0LA 3J80E 5LL6S 5LJ5j 3PTAA 5KCHA 1U1TA 4UC4A 2LT1A 1BI1A 4J6YA 1SSFA 4CI0C 2H3JA 2E10A 1VQPT 4HT8A 1YITA 1VQ7T 3A8HB 1RI0A 5I2SA 4RCBA 3CCLT 2EQMA 4OB2B 2Y4XA 3J7AF 3CCUT 4BI4A 4PJOD 4A4FA 4QVDA 2CYZB 2QQSA 2YLBA 5KE3A 3LYIA 4KBMB 3OYGA 4QQDA 3E9FA 1OZ3A 2EAYA 4XTWA 3S3OA 3DKMA 3NTIA 1QP2A 5GAOq 1Q86C 5LJ5f 3LX7A 1LOJA 3CCEA 3X26B 4IUTA 1BKBA 3UDCA 5GAMh 3OYBA 1BI0A 2DPPB 2DO3A 4JDSA 2DD4A 4LDUA 5DM7R 4XK8E 3I55T 5GAOr 3G6EA 2KSSA 5GMKh 3LLRA 1VQPA 3WVEB 2WSFE 3MCAB 4FIBA 1FXXA 3VU3C 2A7YA 2O4XA 3CCLA 5CQYA 3L2ZA 2LRQA 2LDMA 2JTFA 3L2QA 3OSVA 4PLIA 2ZGWA 2GFUA 4EDUA 2MF2A 3CCUA 2E1HA 5D6XA 1Q82C 1XTDA 1G5VA 5GANf 5HKCA 4KULA 4BDZA 2XU8A 5DLOA 2MAMA 3GOXA 1YIJT 4M7DF 1JRIA 2JNGA 2KDSA 3JCMP 4BE1A 1UB4A 3QJ6A 4C92C 4IKFA 1YCYA 2YLCA 4Q5WA 3I55A 1K9MU 1OI1A 1I8FA 2RHYA 2VXFA 3A8GB 3QBYA 4N4HA 1VQOT 2KY9A 3G4ST 1VIEA 1N9RA 2EIFA 4ELZC 4BE0A 3OW2S 3OA6A 2DXBA 2LTOA 3CBMA 2DTOA 3C94A 5LJ5d 5GAN7 3G71A 1BIBA 2LT4A 3HKSA 1K73C 1GXIE 2O01E 4F7UA 3S6WA 2XI9A 1YIJA 1YJNT 1NJIU 3LW5E 4MZMA 4F7UE 1U8RA 3JCMg 2E64A 1YHQT 4PJOF 2JOYA 3A8LB 3KBGA 3JB9G 3OYYA 2QA4T 3HSBA 2M0OA 5A0GA 1VQOA 4XTVA 1I81A 3G4SA 3GLXA 1YJ9T 2RJFA 2M9UA 2LNVA 1Y71A 3FDRA 3CCJT 2K5LA 3JCMW 3E19A 4QQ6A 2JUFA 5CKDA 1K8AC 5HY6A 4QVCA 3O8VA 2RK2A 4FL6A 4M77A 2CGHA 2JTMA 3MO8A 2RB6A 3JCMe 3OY9A 2KAFA 1Q86U 4M77E 2PQWA 1KQSS 1XOVA 5LJ3j 3CCST 3R6OA 1VQMT 2AHJB 2EYQA 3SWNA 2DXUA 1YJNA 3RMQA 3BFMA 1KD1C 5GAN4 3WVDB 1YHQA 2K57A 4J8OA 3GPLA 4M75F 4OVAA 1VQNA 4J6WA 4E7IA 3E9GA 4ZGDB 2ZPEB 4MMLA 5CKEA 2QA4A 4XU0A 1KG1A 3ZFJA 4A53A 2X4XA 1WNLA 1YJ9A 4IUQA 1N8RU 2P0PA 2R5AA 3VYGA 3CCJA 2XK0A 2WSCE 5CVIA 1Q82U 3EFRA 4V2SA 5LJ3f 4R55A 4OGCA 3CCSA 1Y07A 2DXTA 3KXTA 4IUVA 1VQMA 3LGFA 4FM4B 3M4YA 4F7UG 3HFNA 1M90C 4A4HA 3OYLA 3PNWC 1MGQA 3M55A 2CZ0B 3CBOA 5GAMj 2PVOB 4E7JA 2O4XB 2R5MA 3OYIA 1UEBA 2RD1A 4LD9K 1BYMA 3GNFB 4IUUA 1UGRB 1VQ8A 4LDXA 4JS5A 5GMKj 5CCAA 3LWHA 4N0AA 3CC4T 2RI5A 2FYKA 1G3SA 1K73U 4M77G 3JCMh 3N5BB 4MZPA 4A4KA 1Q7YU 1K9MC 4HCZA 3AHUA 1QVFA 4M7AA 2M1HA 2XDBA 2HD0A 4QVZA 1M1FA 2EJFA 1PSFA 3CCVT 4M7AE 2RHZA 1NPRA 5CKHA 3M57A 3TEEA 2L89A 1R8OB 2HBPA 3L2VA 3H8ZA 2EFIA 5GAMf 4ZN3A 1O75A 4C8QG 3J81E 3M4GA 3PIPA 4J7FA 3CC7T 1WQWA 1K8AU 5LJ3d 3M58A 4B9WA 4MMKA 3WXMB 3ZEHA 3RKYA 4C5IA 2DEQA 5DY9A 3JB9J 3CCET 1PSEA 1VQ4T 4OB0B 1NJIC 3CC4A 1TH7A 2V8KA 4XU1A 5FLXE 4F7UB 2VUBA 3FC3A 3G6ET 4JRIA 3OYEA 1VQ9T 2XICA 3TCJA 4BE2A 2QXFA 2R57A 4HCBA 4JRQA 3V8LA 2D9TA 1KD1U 1HK9A 4X34A 5D6WA 2IVWA 4M7DA 3CCVA 2YRVA 4FU6A 3JCMV 3TU4K 4ZGJB 4M7DE 3LH0A 2NLUA 2QQRA 3QUIA 1S72T 5HK0A 3SWNC 3CC7A 3T9NA 2G3RA 5GANj 1WJQA 4M77B 1QP3A 4KT0E 3GIBA 3GF5A 4JRKA 5A2QE 2V8JA 4XU3A 1VQ4A 3JB9D 4C92F 2DKGA 1VQ9A 2BKDN 2JZ2A 3JSCA 3SWNB 4C5GA 5GAMd 1UGQB 2Y4YA 5DLQE 3PT9A 4L5GA 3S3NA 4M7AG 1M90U 3OYHA 2I2LA 2EJ9A 1N8RC 2K5FA 3RIRA 1JJ2A 3OSSC 3QJYA 2WSEE 3X25B 1JBMA 2K2VA 3G71T 3CPWA 1U1SA 2X35A 2LCCA 1VQ5A 1S72A 2PUKB 3OYAA 2IG0A 5J26A 3QDRB 4C0DC 4MDXA 3L2WA 4NOYA 2LCLA 3UPUA 1LNXA 2RO0A 2L5QA 3X24B 1WJRA 1YI2T 4RKUE 4Y91A 3OYFA 2XDPA 2ZPBB 4C0DB 3FEOA 1VQKT 2KQWA 5CKFA 4RG8A 3QHSA 5GAOp 4A54A 5GAN5 4N0AC 4M78A 3OS5A 2F5KA 4HA8A 4M7DG 1BIAA 4M78D 1NZ9A 2A3LA 3LGLA 5FU7C 3ER0A 4M78E 5EG2A 1N27A 2DTHA 2XDDA 4YTLA 4M7AC 3MEVA 1Y7XA 2DIGA 4JLIA 1Q7YC 2CZ6B 4DOWA 4KUDK 3UWNA 3MP8A 3CXCA 2X4WA 1FX7A 2P4TA 4TVRA 5FU7B 5FROA 4ZGEB 5FU6C 5GAOn 4M7AB 1VQNT 4FT4A 4OP0A 5CKBA 4LD6A 3FRNA 3ME9A 3RMSA 4JRPA 3HL8A 1YI2A 2XIDA 1UGSB 1M4ZA 2RH2A 1VQKA 4X9DA 2RHUA 4GLKA 3VV0A 5GANd 3QIIA 5FU6B 1I5LA 4XQ3A 5GAN6 1B34A 5FRNA 4RG2A 5GMKi 3JB9F 3FJPA 4M77D 3SFMA 3A8MB 3PMTA 4HKEA 2RHXA 2EQUA 2FB7A 1OYXA 2VV5A 3HP9A 4MDWA 2BIVA 2LC4A 2CZ7B 2PUOB 3P8BB 1LJOA 3JCMQ 4C8QA 4RCCA 2Y90A 5CAIA 1OZ2A 2P0KA 1BI2A 4C8QD 5KH6A 5J3BA 2KK4A 4C8QE 2XG8D 5A0DA 3JCMf 2LVMA 3OB9A 4WF2A 1ZBXA 4C5EA 1VQ8T 2QI2A 3Q1JA 3CCQT 4JJNK 1YBYA 3CD6A 2KMTA 2LQ8A 4M78G 2VYTA 2K5IA 2E6NA 1H3ZA 4ZTJA 5L8RE 3BDUA 1AHJB 3C4SA 3RESA 2VGNA 2QDYB 5I21A 4PNOA 2E5QA 4BACA 3GP8A 4C0GA 2VGMA 3V7CA 5LJ3e 3OQ5A 3P8HA 4RMOA 3M54A 2K4YA 1D3BA 5CK9A 1KC8U 4L6V5 4VUBA 3MEWA 3CBPA 5D6YA 2VC8A 3V8JA 4BI8B 2RA2A 3JCMb 4E7HA 4F7UF 2DXCA 3KUFA 2WACA 3M56A 2L8DA 3X28B 3HHTB 4XTXA 3CCQA 2RJCA 3MP1A 4LDVA 1MHNA 4E7KA 2CS7A 3X20B 3DB3A 3BDLA 3HFOA 4BDYA 4IURA 3OS2A 4M7AD 4ME7A 2DZ9A 4M78C 3C95A 4E47A 3JCMd 2QEXT 1XNIA 3OYKA 2XHCA 2P0QA 4M77F 1O9SA 2E6ZA 4C92A 4HT9A 1G3WA 2ZPIB 3A5ZB 5CQXA 3OBYA 2OTLA 2PVDB 4M78B 4C92E 3CMAT 3NTKA 2HQXA 2EJGA 3QZ5B 1EIFA 3PGGA 5GAMe 4OF1A 2B8AA 3M9QA 2DVEA 3JCMc 3OYMA 1JJ2S 3VJPA 1RL2A 3CPWS 3E1SA 3OMCA 3URGA 4ZN1A 5GMKe 3JB9H 3QSUA 1P92A 4BUGA 2ZPHB 4ELYC 2BUDA 3QZ9B 1VQ6A 4FT2A 4C5HA 3DLLA 4EMHA 4M77C 2D0QB 2MMPA 4M7DD 2QEXA 2KVQG 4JS4A 5LJ5g 1VQ5T 2FL7A 3A8OB 2PU9B 5IAYA 3OBWA 4C0FA 3HRSA 3VYHB 3CMAA 2X4JA 4A4EA 5KE2A 5J39A 3SDZA 2E41A 4C8QC 2QQAA 4XU2A 2ZCFB 4IUPA 3I56T 3V7SA 4NS5A 2JVVA 2E65A 5LJ5e 2YHTA 1YJWA 3FB9A 2GCXA 1NE8A 5KCOA 4C8QB 1M1KC 5GANg 1VQLA 5C0MA 3L2UA 4KUIA 4X9CA 5AYFA 3VUBA 4J6XA 2RJDA 3CXCS 4HCCA 4EMKA 4ATOA 4PJOA 3SB2A 3VKIA 5IT9E 2DD5A 4LDYA 4PJOE 4C92G 1QVGA 4M7AF 4EMGA 3QG1A 4DOVA 4DQ2A 3CPFA 4XAXB 4BI3A 3RERA 2QQ9A 3L42A 5GANe 2EWNA 2XKOC 2OAUA 1X6OA 3I56A 2PVGB 4XTUA 1W2BA 1IZ6A 1KC8C 2DAQA 3PMIA 3M53A 4JUVA 5GMKl 2DIQA 2DZCA 1I4K1 4DA4A 1D3BB 1VQ7A 5GMKm 2ZZDA 2K3XA 3JCMJ 2RI2A 2RM4A 4M75A 1DJ7B 4MZTA 3VUZA 4CRIA 5M9OA 4Y28E 4M75D 2M16A 4N4IA 1X01A 3JCMX 1W4SA 4M75E 3QXEB 4J83A 3MP6A 3RKWA 4NL3A 3G7ZA 4P5NA 5C6SA 1Y96A 2X4YA 2EQJA 2FHDA 2GFAA 1G3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYZ B;  1PSF A;  1QP2 A;  5L8R E;  3X26 B;  1AHJ B;  2DPP B;  2QDY B;  2DD4 A;  4XK8 E;  3WVE B;  4L6V 5;  2WSF E;  1PSE A;  4OB0 B;  1JB0 E;  2DXC A;  3X28 B;  3HHT B;  3X20 B;  2CZ1 B;  4ZGJ B;  3A8G B;  2ZPF B;  1QP3 A;  4KT0 E;  2ZPI B;  2DXB A;  1V29 B;  2PVD B;  1UGQ B;  3QZ5 B;  1GXI E;  2O01 E;  4OB1 B;  3LW5 E;  3X25 B;  2WSE E;  1UGP B;  2ZPH B;  3A8L B;  3QZ9 B;  2PUK B;  2D0Q B;  3A8O B;  2PU9 B;  3X24 B;  3VYH B;  4RKU E;  2ZPB B;  3QYH B;  2ZCF B;  2AHJ B;  2ZPG B;  3WVD B;  4ZGD B;  2ZPE B;  4OB3 B;  2CZ6 B;  2DD5 A;  4ZGE B;  3VYG A;  2WSC E;  3QYG B;  1IRE B;  1UGS B;  2PVG B;  4FM4 B;  3A8M B;  2CZ0 B;  2PVO B;  2CZ7 B;  2PUO B;  2ZZD A;  1DJ7 B;  1UGR B;  4Y28 E;  3QXE B;  3A8H B;  4OB2 B; 
#chains in the Genus database with same CATH topology
 2H3E B;  5IH2 A;  2D0N A;  2MWO A;  2GQV A;  1M2V A;  3C12 A;  1HJD A;  1YI2 Q;  2ENM A;  5GAN 3;  1KJW A;  1RAI B;  2C06 A;  2F2V A;  2D8H A;  2DIL A;  3P8D A;  1X2Q A;  5CR2 A;  2HAX A;  1JQQ A;  3RR6 A;  1KD1 R;  3BW1 A;  2LX9 A;  4J9D A;  1M3A A;  3EH1 A;  2ZPF B;  4M75 G;  1N9S A;  2JN0 A;  5GAO l;  1VYV A;  3RKX A;  3DB4 A;  2JM9 A;  1QVP A;  3E2U A;  1UGP B;  2RI3 A;  3EH2 A;  2CDT A;  4J9I A;  1QW1 A;  1WPY A;  2FVU A;  1LVK A;  1X6B A;  2VAS A;  3EAE A;  2HSP A;  3EGU A;  3QYH B;  1K9M R;  4QQG A;  4BY6 B;  2QTV A;  3JRZ A;  1G8X A;  2RK1 A;  1S1N A;  1SF9 A;  1Y96 B;  1BI3 A;  3RUX A;  1YJW T;  2DJZ A;  2HQE A;  1M30 A;  1VQL T;  1IRE B;  4O6J A;  1I1J A;  1F1B B;  5KYN A;  3CME A;  2VXE A;  1KQ2 A;  3HRT A;  3CME Q;  5A0L A;  3J80 E;  5LJ5 j;  2W10 A;  1RAC B;  1U1T A;  1BI1 A;  1RAH B;  4J6Y A;  2H3J A;  1RI0 A;  5I2S A;  4RCB A;  2Y4X A;  3I35 A;  4PJO D;  2QQS A;  3OYG A;  2EYX A;  3S3O A;  3DKM A;  1QP2 A;  1OX9 A;  2DRM A;  3OYB A;  3UDC A;  2CP5 A;  4FCY A;  5GAO r;  5KYY B;  5GMK h;  1JEG A;  3WVE B;  1FXX A;  3L2Z A;  1R0C B;  3M0U A;  2E1H A;  1G5V A;  5HKC A;  4BDZ A;  1KFZ A;  2XU8 A;  1YP5 A;  1YIJ T;  1M27 C;  1ZX6 A;  3JCM P;  1RI9 A;  4BE1 A;  4IKF A;  3QJ6 A;  2L2P A;  2YLC A;  4E6R A;  4HVW A;  1OI1 A;  2RHY A;  3A8G B;  2KY9 A;  1VIE A;  1N9R A;  2EIF A;  4ELZ C;  4BE0 A;  3OW2 S;  3OA6 A;  2LTO A;  3CBM A;  2ED0 A;  1GXI E;  1UGV A;  1ZSZ C;  3S6W A;  4F7U A;  2CH4 A;  3LW5 E;  2E64 A;  2JOY A;  5HCK A;  1PD0 A;  5A0G A;  1VQO A;  3G4S A;  2DBM A;  2RJF A;  4E7S A;  1K8A C;  4QQ6 A;  5CKD A;  3MPU B;  2FZK B;  4FL6 A;  2CGH A;  2YRC A;  1H3H A;  1M3B A;  2V1Q A;  5LJ3 j;  3SWN A;  1T0H A;  3C0C A;  1J3T A;  1MV3 A;  5GAN 4;  3GPL A;  2I0N A;  3E9G A;  4MML A;  2X51 A;  5CKE A;  2X4X A;  3VS3 A;  3CCJ A;  5CVI A;  1WA7 A;  3EHR A;  4ESR A;  3EFR A;  2LP5 A;  3CCJ Q;  3CCS A;  1TXQ A;  2KXD A;  1E6H A;  4FW1 A;  3I5S A;  1PD1 A;  1M90 C;  2HDA A;  2H8H A;  2FPF A;  1BYM A;  4IUU A;  4LDX A;  1T3S A;  5CCA A;  4N0A A;  2RI5 A;  1FMV A;  4J9E A;  4M77 G;  3AHU A;  3EHQ A;  4QVZ A;  1M1F A;  2RHZ A;  1NPR A;  3TEE A;  2EFI A;  1CKB A;  2DVJ A;  4C5I A;  3CPW P;  3UF4 A;  1NJI C;  2VUB A;  2CSI A;  2XIC A;  2DM1 A;  4JRQ A;  3V8L A;  1KD1 U;  1HK9 A;  2JMA A;  4X34 A;  4M7D A;  2IVW A;  2YRV A;  4LN2 A;  1U3O A;  3LH0 A;  4J9H A;  2QQR A;  2DYI A;  1S72 T;  1M1K R;  3CC7 A;  4PK4 A;  3SWN C;  5GAN j;  2DKG A;  4C5G A;  1UHC A;  3CCE Q;  8AT1 B;  1Z9Z A;  1H8K A;  2EJ9 A;  2K5F A;  1TTH B;  2GTO A;  1JBM A;  1I5O B;  2K2V A;  5J26 A;  3CCU Q;  2CSQ A;  2RQR A;  1LNX A;  2RO0 A;  3X24 B;  1WJR A;  3M0R A;  2ED1 A;  1U06 A;  3I55 Q;  4N0A C;  3OS5 A;  3LGL A;  3M0P A;  3ER0 A;  1N27 A;  2DTH A;  1ZUU A;  2X3X D;  4ZNX A;  1Q7Y C;  3MP8 A;  4M7A B;  4FT4 A;  4OP0 A;  5CKB A;  2EGE A;  1VQK A;  4EIK A;  2KRS A;  2KGT A;  1I5L A;  1Q81 R;  3JB9 F;  1VQK Q;  4LUD A;  3I9Q A;  5EC7 A;  3PMT A;  1Y57 A;  4HKE A;  2PTK A;  1W70 A;  1RAE B;  3CQT A;  1LJO A;  3JCM Q;  4C8Q A;  3FJ5 A;  4C8Q D;  1RAF B;  1YJN Q;  4DEX A;  5A0D A;  1QVF S;  3UA6 A;  1OV3 A;  4C5E A;  1VQN Q;  2QI2 A;  3CCQ T;  2QA4 Q;  1MMD A;  1SKU B;  1JU5 C;  4F16 A;  1UJ0 A;  1YJ9 Q;  5L8R E;  3TSW A;  2VGN A;  2QDY B;  5I21 A;  4PNO A;  2VGM A;  4RTZ A;  3V7C A;  5LJ3 e;  1B07 A;  1D1C A;  1E6G A;  3M54 A;  2K4Y A;  4L6V 5;  2RQV A;  3MEW A;  3CBP A;  1CSK A;  4F7U F;  4FYV B;  2QGG A;  1NLP C;  1YNZ A;  4F14 A;  2MPX C;  3HFO A;  1WI7 A;  4J9C A;  4BDY A;  4ME7 A;  2M51 A;  4E47 A;  5CQX A;  2GTJ A;  4F17 A;  4K11 A;  4M78 B;  2HQX A;  3NHN A;  2EJG A;  1EIF A;  2HKQ B;  2DVE A;  2MYS A;  1OPL A;  1RL2 A;  3URG A;  3QSU A;  1P92 A;  4BUG A;  1G2B A;  1VQ6 A;  3DLL A;  4PJN A;  3EFO B;  1C0M A;  1IHV A;  2FL7 A;  3A8O B;  2PU9 B;  3VYH B;  3CMA A;  1EX4 A;  4A4E A;  5KE2 A;  4C8Q C;  2QQA A;  3I56 T;  3CMA Q;  2JVV A;  2AZV A;  1Q86 R;  2QDL A;  2GCX A;  2MOX A;  3THK A;  1VQ9 Q;  5C0M A;  2OX7 A;  4ATO A;  1PKT A;  4HCC A;  1X43 A;  2DD5 A;  4XAX B;  4PFP A;  3RER A;  1VQ5 Q;  5GAN e;  1Q82 R;  2PVG B;  1W2B A;  1IZ6 A;  4GLM A;  2DAQ A;  1KC8 C;  3PMI A;  4JUV A;  4OMP A;  4DA4 A;  4D8K A;  9ATC B;  2ZZD A;  2RI2 A;  1MMA A;  2RM4 A;  1IHW A;  1HYO A;  2M16 A;  4N4I A;  2C0O A;  4OML A;  3QXE B;  1Y96 A;  1OPK A;  2X4Y A;  1YN8 A;  2GFA A;  2L3S A;  1X75 C;  1AWO A;  2EVR A;  2COZ A;  4FW2 A;  3INZ A;  2F1L A;  4C92 B;  1VUB A;  3QWX X;  3CCR T;  4PJO G;  3HTR A;  2FZG B;  3NTH A;  4A4G A;  4NL2 A;  4ANJ A;  3M59 A;  3V8K A;  1LCK A;  1GRI A;  3OMG A;  3CCM T;  1NPP A;  1RLQ C;  5GAN h;  1UE9 A;  5IN1 A;  4M7D B;  1TU0 B;  1M1K U;  4LDW A;  4B9X A;  3LWI A;  2EYW A;  1RUW A;  1IRX A;  1GCP A;  2BZY A;  3S3M A;  3LH5 A;  2KE9 A;  4QT7 A;  5KYY A;  3EGX B;  4GY5 A;  2O31 A;  3OYD A;  1M5Q 1;  4FYX B;  2C0T A;  3CC2 T;  1GCQ A;  2AZS A;  4PKC C;  3OS1 A;  1VQ6 T;  1K9A A;  4ZTF A;  3DLM A;  4BY6 C;  5CO7 A;  1WQ7 A;  2DER A;  4AMC A;  1KQS A;  1EZZ B;  4DEY A;  2NUT A;  1VIF A;  2R58 A;  2V8I A;  4M75 B;  4M4Z A;  1AOJ A;  2DTI A;  2QGF B;  4C8Q F;  2DE0 X;  1KK7 A;  1Y0M A;  3OYN A;  2JT4 A;  1YIT T;  1QVG S;  1MUZ A;  1Q81 U;  1M8V A;  2DL3 A;  4J7I A;  2F5T X;  2HBW A;  5FWB A;  2HSE B;  1UJY A;  1TWB A;  1IGQ A;  3PTA A;  5KCH A;  3EG2 A;  4UC4 A;  2LT1 A;  2E10 A;  1VQP T;  4HT8 A;  2CP3 A;  4JZ4 A;  3A8H B;  4OB2 B;  1YJW Q;  2K79 A;  3J7A F;  4QVD A;  5KE3 A;  4KBM B;  3E9F A;  1VQL Q;  1OZ3 A;  2Z0W A;  4Y92 A;  5GAM h;  4IUT A;  1Q95 G;  1BI0 A;  4LDU A;  4JDS A;  5DM7 R;  4XK8 E;  5KYX B;  3VS5 A;  2J7I A;  3CXC P;  3LLR A;  2WSF E;  3MCA B;  1GCQ C;  1R77 A;  5CQY A;  2MF2 A;  1QKW A;  2P84 A;  2MAM A;  1JRI A;  1UB4 A;  1N5Z A;  2YUN A;  2EGA A;  3QBY A;  4FYW B;  5FW9 A;  1XJW B;  2K9G A;  2MK5 A;  1PG5 B;  1QWE A;  4WTO B;  1MNE A;  5GAN 7;  1NBE B;  1BIB A;  3HKS A;  2KNB B;  2MCN A;  3VRZ A;  2CP6 A;  1UEC A;  2XI9 A;  4D8D A;  1YIJ A;  1R0B G;  4F7U E;  4KH1 B;  1WHH A;  1YHQ T;  3KBG A;  1ZSG A;  1YIJ Q;  2M0O A;  4XTV A;  2M9U A;  3FDR A;  1OQK A;  1VA7 A;  1G83 A;  3O8V A;  1M2O A;  3JCM e;  3OY9 A;  1Q86 U;  1VQM T;  2EYY A;  2AHJ B;  4DBF A;  2DXU A;  3RMQ A;  1KD1 C;  2NYS A;  4J8O A;  1T3L A;  1SHG A;  3PVL A;  4XU0 A;  1KG1 A;  1A0N B;  3VYG A;  2L0A A;  2JJ9 A;  2DRK A;  1Q82 U;  2KYB A;  1BCM A;  2SRC A;  1RAG B;  1Y07 A;  2DXT A;  3OYL A;  3CBO A;  2FEI A;  3H0F A;  2PVO B;  4KGV B;  1UEB A;  1M8M A;  2RD1 A;  2M0Y A;  3GNF B;  1VQ8 A;  3CC4 T;  1PC0 A;  1ZUK A;  3JCM h;  1TG0 A;  3N5B B;  4MZP A;  4A4K A;  1K9M C;  4M7A A;  4HCZ A;  2YRD A;  2CT3 A;  5CKH A;  3M57 A;  2L89 A;  2HBP A;  4ZN3 A;  4C8Q G;  3SHW A;  3M4G A;  1WQW A;  2HQH A;  2DL4 A;  3M58 A;  4B9W A;  4MMK A;  3WXM B;  4IIM A;  2DEQ A;  5DY9 A;  3JB9 J;  2HZY A;  1VQ4 T;  4OB0 B;  1TH7 A;  4XU1 A;  3OYE A;  1HD3 A;  4BE2 A;  2R57 A;  4HCB A;  5KYW B;  5D6W A;  2J06 A;  2RPN A;  3TU4 K;  4ZGJ B;  4M7D E;  1RLP C;  5HK0 A;  1ZA2 B;  1WJQ A;  4M77 B;  2PNI A;  4KT0 E;  3VS0 A;  3GIB A;  5A2Q E;  4XU3 A;  3JB9 D;  1C6V X;  2BKD N;  2JZ2 A;  5GAM d;  3KFV A;  4L5G A;  1N8R C;  3RIR A;  3X25 B;  4DBH A;  1U1S A;  2LCC A;  1S72 A;  3OYA A;  2IG0 A;  4NOY A;  2DJQ A;  2LCL A;  2YXY A;  3UPU A;  2DX1 A;  1YI2 T;  3MKD A;  2NWM A;  3FEO A;  4AT1 B;  4C0D B;  2ABL A;  4JJD A;  2IIM A;  4M78 A;  2F5K A;  2V26 A;  4M78 D;  2NUT B;  5EG2 A;  2XDD A;  4M7A C;  2K7A A;  1Y7X A;  4DOW A;  5IXF A;  3CXC A;  2X4W A;  1FX7 A;  2P4T A;  5FU7 B;  3OW2 P;  2O9V A;  1ABO A;  2BE7 D;  3EFO A;  2XID A;  1TS9 A;  1UGS B;  4Z89 A;  3M0S A;  5FRN A;  1B34 A;  4DBR A;  1VQO Q;  3G4S Q;  3REA B;  2RHX A;  2FB7 A;  2OAW A;  2VVK A;  2CZ7 B;  2LX7 A;  2PUO B;  1WHL A;  2DYB A;  5CAI A;  1AZE A;  1BI2 A;  5KH6 A;  4C8Q E;  4LNP A;  3M0T A;  2HL3 A;  3OB9 A;  1VQ8 T;  2HCK A;  3A1P A;  4JJN K;  1PRL C;  3CD6 A;  2LQ8 A;  4RTX A;  2K5I A;  5IXB A;  2QG9 B;  4ZTJ A;  3C4S A;  2JMC A;  1PKS A;  3U23 A;  3GP8 A;  3OQ5 A;  3P8H A;  3CCS Q;  4VUB A;  2COW A;  4BI8 B;  2RA2 A;  3JCM b;  1OUL A;  2DXC A;  3M56 A;  3HHT B;  2BTT A;  3CCQ A;  3MP1 A;  2CS7 A;  4QKU A;  3BDL A;  4M78 C;  1EFN A;  3JCM d;  1XNI A;  3OYK A;  4C92 A;  2PZ1 A;  4HT9 A;  2ZPI B;  2OTL A;  3NTK A;  4OF1 A;  3JCM c;  2NUP B;  4KRT A;  3OYM A;  1JJ2 S;  3CPW S;  3E1S A;  3JB9 H;  2ZPH B;  4JZ3 A;  1ARK A;  4EMH A;  1NJI R;  1W2B P;  2D0Q B;  2MMP A;  4M7D D;  4IIO A;  2LQN A;  1OU8 A;  3H0H A;  5J39 A;  3SDZ A;  1GFC A;  2CP0 A;  3CC7 Q;  4IUP A;  2EBP A;  3V7S A;  4NS5 A;  1OU9 A;  2E65 A;  5LJ5 e;  3EGX A;  1NE8 A;  5KCO A;  1M1K C;  5GAN g;  3L2U A;  4KUI A;  3TSZ A;  3SB2 A;  5FWC A;  1D1A A;  4M7A F;  4EMG A;  3QG1 A;  3A98 A;  3L42 A;  2XKO C;  4A63 B;  3I56 A;  2DIQ A;  1D3B B;  1VQ7 A;  5GMK m;  3JCM J;  1BK2 A;  4M75 A;  2E3H A;  8ATC B;  4M75 D;  1X01 A;  1W4S A;  4NL3 A;  5KYU B;  2JM8 A;  4P5N A;  5C6S A;  2K6D A;  1B3Q A;  2EKO A;  2KYM A;  3L1A A;  1K73 R;  2OTJ T;  1Q7Y R;  5LJ5 h;  3CEY A;  4LXC A;  2GNC A;  2LJ1 A;  2E12 A;  3CD6 T;  2D6F A;  1WXB A;  2CH4 W;  2FRY A;  5GAN 2;  1GBR A;  1GFD A;  4M7D C;  1WJS A;  2GF7 A;  4PLL A;  2KRO A;  1TSF A;  1Q81 C;  3JAM E;  2AIR B;  5CIU A;  2RF0 A;  2F69 A;  2CP7 A;  1KQS P;  1Z9Q A;  1ZQ1 A;  1FYN A;  3OS0 A;  2HMA A;  2K3Y A;  3CCR A;  3M5A A;  2L3R A;  5GAN 8;  3OW2 A;  5KYX A;  5FRM A;  2RNA A;  3QKJ A;  4M78 F;  4LUE A;  2J05 A;  4JJC A;  4BB7 A;  3CCM A;  2HL5 C;  3JV3 A;  1KHC A;  2OTL T;  3BY7 A;  3V7R A;  5GAO m;  4OB1 B;  4PJO B;  3CCM Q;  4EMK B;  3UA7 A;  1OEB A;  2QTX A;  4FSX A;  4PL6 A;  1K1Z A;  3GBQ A;  5L23 A;  4O5V A;  2A37 A;  3SD4 A;  2DK3 A;  5GAM g;  4CC7 A;  3UT1 A;  2G6F X;  4M75 C;  2YT6 A;  2NUZ A;  3ASK A;  3VS2 A;  3PFS A;  3FIF A;  2EQK A;  3QO3 A;  4PJM A;  1N6A A;  5I2M A;  3CC2 A;  4OB3 B;  2A08 A;  4KGZ B;  1IO6 A;  3HRU A;  2FPE A;  3CC2 Q;  4J9B A;  3QYG B;  3OYC A;  3FLG A;  5LJ3 h;  1HXD A;  1VQ6 Q;  2V1R A;  2VB6 A;  1KQ1 A;  2MI6 A;  1B34 B;  3TRE A;  2ROL A;  2RHI A;  4L59 A;  3VRY A;  2M02 A;  1SG5 A;  1PCX A;  1JO8 A;  4AFU C;  1QCF A;  1SSF A;  1VYU A;  1YIT A;  5IHN A;  1VQ7 T;  2B86 A;  2EQM A;  4PFO A;  3CCL T;  3CCU T;  4BI4 A;  2YLB A;  1YWO A;  3LYI A;  4QQD A;  4XTW A;  2CUD A;  2LQW A;  1Q86 C;  2CRE A;  2DL8 A;  3LX7 A;  3X26 B;  1TOV A;  1IXD A;  2DPP B;  3M0Q A;  2DD4 A;  3I55 T;  4X1V A;  7AT1 B;  3G6E A;  2W0Z A;  1AT1 B;  3D7S B;  1VQP A;  4FIB A;  3VU3 C;  1WFW A;  1TUC A;  2YUO A;  2LRQ A;  5IHI A;  3H41 A;  3OSV A;  3R6N A;  2GFU A;  2GGR A;  5D6X A;  1Q82 C;  1XTD A;  2DFU A;  5GAN f;  4KUL A;  4M7D F;  2JNG A;  2KDS A;  4J9F A;  2KEA A;  1V1C A;  1I8F A;  2VXF A;  2KI7 A;  4J9G A;  2DXB A;  2COY A;  1UTI A;  5LJ5 d;  3VS1 A;  3G71 A;  2QAZ A;  1FMW A;  2O01 E;  3O5Z A;  1YJN T;  2HEQ A;  1NJI U;  4MZM A;  2LMJ A;  1U8R A;  3JCM g;  5KYW A;  1IGU A;  3A8L B;  3JB9 G;  3OYY A;  2QA4 T;  1K76 A;  3NPF A;  1JXO A;  2A36 A;  3GLX A;  1BCO A;  3JCM W;  2LNV A;  1YJ9 T;  2E4H A;  3E19 A;  2JUF A;  4QVC A;  2RK2 A;  4M77 A;  2JTM A;  3MO8 A;  2RB6 A;  2KAF A;  2PQW A;  1SPK A;  5AT1 B;  3R6O A;  2JS2 A;  3BFM A;  1SEM A;  3WVD B;  1YHQ A;  1JXM A;  4M75 F;  4OVA A;  2BZX A;  4ZGD B;  2ZPE B;  4A53 A;  3ZL7 C;  1ACM B;  1WNL A;  1YHQ Q;  2K2M A;  4IUQ A;  2P0P A;  2XK0 A;  4OMQ A;  2ROT A;  2EPD A;  1VQM A;  1D0Y A;  4IUV A;  3LGF A;  1AD5 A;  2RQW A;  3M4Y A;  4F7U G;  3HFN A;  1VYT A;  3H9N A;  4A4H A;  3PNW C;  1MGQ A;  1GBQ A;  1E7O A;  1AWX A;  4E7J A;  2O4X B;  2R5M A;  2FZC B;  3TQ7 P;  5GMK j;  3LWH A;  1OX8 A;  1K73 U;  1Q7Y U;  1QVF A;  1PM3 A;  2EJF A;  3CCV T;  4M7A E;  2MIO A;  1R8O B;  3L2V A;  5GAM f;  2D1X A;  3J81 E;  3PIP A;  4J7F A;  2KRN A;  5LJ3 d;  4PJL A;  1QVG P;  1B7T A;  3CC4 A;  2V8K A;  5FLX E;  1VQ9 T;  3G6E T;  4JRI A;  3TCJ A;  2KXC A;  2D9T A;  3CC4 Q;  3JCM V;  1W6X A;  1MND A;  2AKK A;  4B6M A;  1QP3 A;  4JRK A;  1VQ4 A;  1M3C A;  3JSC A;  2GBQ A;  2Y4Y A;  5DLQ E;  3PT9 A;  3S3N A;  1VQ4 Q;  4RTV A;  1BU1 A;  4CC3 A;  3QJY A;  3G71 T;  3I5R A;  1QQJ A;  4C0D C;  4RKU E;  2RN8 A;  4RG8 A;  3QHS A;  2IPO B;  4Z8A A;  4HA8 A;  1H92 A;  4M7D G;  1NZ9 A;  2A3L A;  5FU7 C;  4M78 E;  1PHT A;  4HXJ A;  2NUP A;  2DIG A;  4JLI A;  2AK5 A;  2CZ6 B;  5D7U A;  4KUD K;  3UWN A;  5FRO A;  2KR3 A;  4ZGE B;  5GAO n;  4LD6 A;  3ME9 A;  3RMS A;  1YI2 A;  1NYG A;  2RHU A;  4GLK A;  5GAN d;  5FU6 B;  2X3W D;  2FRW A;  2F2W A;  5GMK i;  3FJP A;  4R0K A;  3EG9 B;  3SFM A;  3A8M B;  2OJ2 A;  2EQU A;  3HP9 A;  2VV5 A;  1OYX A;  4MDW A;  1NEG A;  2BIV A;  1X69 A;  3P8B B;  2Y90 A;  3IQL A;  2BE9 B;  2XG8 D;  3JCM f;  2O9S A;  2LVM A;  1ZBX A;  3Q1J A;  2VYT A;  4AFQ C;  2E6N A;  1T0J A;  2FG0 A;  3EGD B;  1QCN A;  4C0G A;  5CK9 A;  1D3B A;  1KC8 U;  3V8J A;  3ULR B;  4E7H A;  2WAC A;  2L8D A;  1K0S A;  5KYU A;  3DB3 A;  1VQ8 Q;  3OS2 A;  4M7A D;  1QLY A;  2DZ9 A;  4FYY B;  1YWP A;  1WIE A;  3C95 A;  2X9H A;  2QEX T;  2XHC A;  4M77 F;  3H0I A;  1O9S A;  1G3W A;  3A5Z B;  4C92 E;  3QZ5 B;  1OOT A;  1FMK A;  1WHK A;  4ZN1 A;  5GMK e;  2BUD A;  2DMO A;  1ZSZ A;  4JPB W;  2KVQ G;  4JS4 A;  5LJ5 g;  1ZLM A;  3OBW A;  3HRS A;  2RMO A;  4GBQ A;  2YHT A;  4ORZ A;  3FB9 A;  4WCI A;  2A0F B;  4E2F B;  4X9C A;  3VUB A;  5AYF A;  4J6X A;  4PJO A;  1PRM C;  4EMK A;  4PFZ A;  4LDY A;  2QAS A;  1UDL A;  1QVG A;  4DOV A;  4DQ2 A;  2AKL A;  4BI3 A;  1N8R R;  2KBT A;  2EWN A;  2QYZ A;  3QDF A;  1S72 Q;  1RAD B;  3NGP A;  3M53 A;  2DZC A;  1I4K 1;  1WX6 A;  3REB B;  2CP2 A;  1QMC A;  1WYX A;  2K3X A;  4MZT A;  4CRI A;  3JCM X;  1YCS B;  4M75 E;  3RKW A;  1D1B A;  3MP6 A;  3G7Z A;  1YFN A;  2FHD A;  1WHG A;  1C1A A;  4AG2 C;  1D0X A;  4XTY A;  4II1 A;  2LQK A;  2DEU A;  1FWZ A;  1M1G A;  1M9S A;  3MEU A;  1KSW A;  1ZUY A;  3OYJ A;  2K3B A;  1K8A R;  1KHI A;  1JB0 E;  4D6W A;  2E5K A;  3HPW A;  3MET A;  3EG0 A;  1AZG B;  3JB9 I;  4Z02 A;  2LZ6 B;  5HK3 A;  4N4G A;  3RDV A;  1MV0 B;  1WXU A;  4R56 A;  3ZBD A;  2OTJ A;  4XTZ A;  3VS6 A;  3QPH A;  4C0Z A;  2CZ1 B;  4LE9 A;  2CKK A;  2QQB A;  5LJ3 g;  1AEY A;  1AVZ C;  3G1J A;  1KIK A;  2OTJ Q;  2HNI A;  2YUQ A;  4OGE A;  1H64 1;  3NMZ C;  3CD6 Q;  1V29 B;  4RTU A;  2ECZ A;  1K4U S;  4PJO C;  2ATC B;  4EMK C;  3MHX A;  1XQH A;  2E70 A;  2XD0 A;  3H6Z A;  3MEA A;  2E3I A;  4BD3 A;  1WGS A;  1SSH A;  1M90 R;  4J5Y A;  3MJX A;  4JLG A;  2O88 A;  4OMF B;  4AFZ C;  1NEB A;  2DL5 A;  4EPC A;  3CCQ Q;  5GJW B;  3GNG A;  3F70 A;  4E7L A;  3CME T;  3L2R A;  3EFS A;  4C92 D;  1G3Y A;  3NFC A;  2ZPG B;  1MMN A;  2EGC A;  2RJE A;  1AWW A;  2L3Q A;  2EYZ A;  2OTL Q;  1D0Z A;  1K0X A;  3VS4 A;  2EKH A;  1ZHI A;  2MWP A;  3PIO A;  3PVQ A;  3SEM A;  1UUE A;  2ZAE A;  1I07 A;  4QW2 A;  1M2V B;  1W2B S;  1JJ2 P;  3QWY A;  5LL6 S;  1ABQ A;  4CI0 C;  2CUB A;  4CC2 A;  1AWJ A;  4RUG A;  4A4F A;  4JJB A;  2CYZ B;  2EAY A;  2LJ0 A;  3NTI A;  2C0I A;  5GAO q;  5LJ5 f;  5IHK A;  1LOJ A;  3CCE A;  1BKB A;  5I22 A;  2DO3 A;  1HSQ A;  2P4R A;  2KSS A;  2DA9 A;  3I56 Q;  1MMG A;  2A7Y A;  2O4X A;  2RQU A;  3CCL A;  2LDM A;  2JTF A;  3L2Q A;  3CCU A;  4PLI A;  2ZGW A;  4EDU A;  1VQ7 Q;  1UHF A;  5DLO A;  3CCL Q;  4C92 C;  1YCY A;  2VWF A;  4Q5W A;  3I55 A;  1K9M U;  2OI3 A;  4N4H A;  1VQO T;  1WXT A;  1UFF A;  3G4S T;  2YWW A;  2J6O A;  2DTO A;  3C94 A;  4FSS A;  2LT4 A;  1TUG B;  2EW3 A;  2KT1 A;  1K73 C;  4PJO F;  2DF6 A;  4OMN A;  1BB9 A;  2J6K A;  1WHJ A;  1ZSZ B;  3HSB A;  1I81 A;  1NYF A;  1Y71 A;  3CCJ T;  2K5L A;  2VKN A;  5HY6 A;  4M77 E;  1UG1 A;  1KQS S;  1XOV A;  3CCS T;  2KT8 A;  2EYQ A;  3CCR Q;  1YJN A;  2K57 A;  1QVF P;  2D8J A;  1VQN A;  1U5S A;  4J6W A;  4E7I A;  2QA4 A;  3ZFJ A;  1YJ9 A;  1N8R U;  2R5A A;  2A28 A;  2WSC E;  2DL7 A;  4V2S A;  5LJ3 f;  4R55 A;  4OGC A;  3KXT A;  4FM4 B;  1SRM A;  2O2O A;  3M55 A;  2CZ0 B;  2LCS A;  1WLP B;  5GAM j;  2XMF A;  3OYI A;  4LD9 K;  1UGR B;  4JS5 A;  2FO0 A;  3PE0 A;  2FYK A;  1G3S A;  1NLO C;  3AT1 B;  2M1H A;  2XDB A;  3TVT A;  2HD0 A;  2L3P A;  1PSF A;  5ECA A;  3H8Z A;  1O75 A;  4AG1 C;  3BE3 A;  3CC7 T;  1K8A U;  3EG9 A;  3ZEH A;  3RKY A;  3CCE T;  3VS7 A;  1PSE A;  4F7U B;  3FC3 A;  1IB8 A;  2QXF A;  3EG3 A;  2YDL A;  2EQI A;  1QKX A;  5I11 A;  3CCV A;  3RNJ A;  4FU6 A;  1X27 A;  1YIT Q;  2NLU A;  1PWT A;  2DNU A;  1QWF A;  3QUI A;  3CCV Q;  2LJ3 A;  3T9N A;  2G3R A;  4DBQ A;  1BBZ A;  1X2K A;  4RTY A;  1WDX A;  4HCK A;  3EGD A;  3GF5 A;  2V8J A;  4C92 F;  1VQ9 A;  2FPD A;  3SWN B;  6AT1 B;  1UGQ B;  2QK0 A;  2HKN A;  4M7A G;  1M90 U;  3OYH A;  2I2L A;  3G6E Q;  2DET A;  1JJ2 A;  3OSS C;  2WSE E;  1VQP Q;  3CPW A;  1KC8 R;  4CC4 B;  2X35 A;  1VQ5 A;  1X6G A;  2PUK B;  3QDR B;  4MDX A;  3L2W A;  2L5Q A;  4Y91 A;  3OYF A;  2XDP A;  1D09 B;  2ZPB B;  1VQK T;  2KQW A;  5CKF A;  5GAO p;  4A54 A;  5GAN 5;  2J6F A;  3UAT A;  1BIA A;  4YTL A;  3MEV A;  4AFS C;  4KGX B;  2DLP A;  3G71 Q;  4TVR A;  2BZ8 A;  5FU6 C;  1VQN T;  4JRP A;  3FRN A;  3HL8 A;  1M4Z A;  2F2X A;  2RH2 A;  1W1F A;  4X9D A;  3VV0 A;  2YSQ A;  1ZA1 B;  1SHF A;  3QII A;  4XQ3 A;  5GAN 6;  4RG2 A;  1RAB B;  2DBK A;  4M77 D;  1QCO A;  2LC4 A;  4HVU A;  4RCC A;  2JXB A;  1OZ2 A;  2P0K A;  5J3B A;  2KK4 A;  4RTT A;  2ESW A;  1PNJ A;  4WF2 A;  1YBY A;  2KMT A;  2GQI A;  4M78 G;  1H3Z A;  3BDU A;  1AHJ B;  3RES A;  1GL5 A;  4BAC A;  2E5Q A;  2LNH B;  3RBB B;  1WZO A;  4RMO A;  1VQM Q;  5D6Y A;  4PJJ A;  2VC8 A;  5GJV B;  3KUF A;  3X28 B;  2SEM A;  4XTX A;  2RJC A;  4LDV A;  4E7K A;  1MHN A;  3X20 B;  2CT4 A;  4IUR A;  4OMM A;  2P0Q A;  2E6Z A;  2JTE A;  3OBY A;  2PVD B;  1NG2 A;  3CMA T;  1I0C A;  5GAM e;  3PGG A;  4RTW A;  1ZBJ A;  2B8A A;  3M9Q A;  1WHM A;  3VJP A;  2AT1 B;  3OMC A;  4ELY C;  3QZ9 B;  4FT2 A;  4HVV A;  4C5H A;  4F04 B;  1V76 A;  4M77 C;  2QEX A;  1TUD A;  1VQ5 T;  5IAY A;  4C0F A;  2QEX Q;  2X4J A;  2E41 A;  4XU2 A;  2ZCF B;  1CKA A;  1SRL A;  1YJW A;  3EG1 A;  2JW4 A;  4C8Q B;  1VQL A;  2KRM A;  3CXC S;  2RJD A;  3VKI A;  2RQT A;  2YUP A;  5IT9 E;  4PJO E;  4C92 G;  3CPF A;  2QQ9 A;  4E7Z A;  2OAU A;  1X6O A;  4Z88 A;  4XTU A;  1NM7 A;  5GMK l;  2JS0 A;  4OMO A;  1LPL A;  4KH0 B;  5M9O A;  1DJ7 B;  3VUZ A;  4Y28 E;  3GOX A;  4J83 A;  1RAA B;  1VOM A;  2EQJ A;  1G3T A; 
#chains in the Genus database with same CATH homology
 1X75 C;  2EKO A;  4XTY A;  3L1A A;  4II1 A;  2LQK A;  2OTJ T;  3INZ A;  5LJ5 h;  2MWO A;  1FWZ A;  1M1G A;  3CEY A;  2GQV A;  1M9S A;  4C92 B;  3C12 A;  2E12 A;  1VUB A;  3CD6 T;  2D6F A;  3MEU A;  3CCR T;  5GAN 2;  4PJO G;  4A4G A;  3NTH A;  5GAN 3;  3OYJ A;  4M7D C;  1KHI A;  1JB0 E;  1WJS A;  2GF7 A;  4NL2 A;  3HPW A;  3M59 A;  3MET A;  3V8K A;  4D6W A;  2C06 A;  4PLL A;  3OMG A;  3JB9 I;  4Z02 A;  5HK3 A;  3P8D A;  1NPP A;  4N4G A;  3CCM T;  3JAM E;  1Q81 C;  5GAN h;  5CR2 A;  5IN1 A;  2HAX A;  4R56 A;  3ZBD A;  4M7D B;  2OTJ A;  4XTZ A;  5CIU A;  3QPH A;  4C0Z A;  2CZ1 B;  4LDW A;  1M1K U;  2CKK A;  2QQB A;  5LJ3 g;  2F69 A;  3BW1 A;  2LX9 A;  1ZQ1 A;  4B9X A;  3OS0 A;  3LWI A;  2HNI A;  2K3Y A;  4OGE A;  3CCR A;  1H64 1;  2ZPF B;  3M5A A;  4M75 G;  2L3R A;  3S3M A;  5GAN 8;  3OW2 A;  1V29 B;  5FRM A;  3QKJ A;  4PJO C;  1N9S A;  4M78 F;  4EMK C;  2JN0 A;  3MHX A;  4GY5 A;  4BB7 A;  5GAO l;  3CCM A;  1XQH A;  2E70 A;  2XD0 A;  1KHC A;  3H6Z A;  3MEA A;  3BY7 A;  3DB4 A;  3RKX A;  3V7R A;  2OTL T;  5GAO m;  1QVP A;  4OB1 B;  3OYD A;  1M5Q 1;  4PJO B;  1UGP B;  1WGS A;  4BD3 A;  4EMK B;  2RI3 A;  4J5Y A;  3CC2 T;  4JLG A;  2QTX A;  4FSX A;  4PL6 A;  1QW1 A;  4OMF B;  4O5V A;  4PKC C;  4EPC A;  3OS1 A;  1VQ6 T;  1WPY A;  2FVU A;  2DK3 A;  3F70 A;  3GNG A;  3SD4 A;  5GAM g;  4ZTF A;  3DLM A;  3UT1 A;  4BY6 C;  4E7L A;  5CO7 A;  1WQ7 A;  3EAE A;  4M75 C;  1QVF S;  3CME T;  3ASK A;  3QYH B;  1KQS A;  4QQG A;  3PFS A;  3L2R A;  3EFS A;  4C92 D;  1G3Y A;  3NFC A;  2ZPG B;  3FIF A;  2EQK A;  3QO3 A;  4BY6 B;  1VIF A;  2R58 A;  1N6A A;  2RJE A;  2V8I A;  4M75 B;  5I2M A;  2DTI A;  3JRZ A;  4C8Q F;  3CC2 A;  2RK1 A;  4OB3 B;  1Y96 B;  1BI3 A;  3RUX A;  1YJW T;  3OYN A;  2DJZ A;  3HRU A;  1ZHI A;  2MWP A;  2HQE A;  1YIT T;  1QVG S;  3PIO A;  3QYG B;  1VQL T;  1IRE B;  4O6J A;  1Q81 U;  1M8V A;  3OYC A;  3FLG A;  5LJ3 h;  1HXD A;  4J7I A;  3CME A;  2F5T X;  2VXE A;  4QW2 A;  1KQ2 A;  1KQ1 A;  2MI6 A;  1B34 B;  3HRT A;  3TRE A;  1W2B S;  2RHI A;  4L59 A;  5A0L A;  3J80 E;  5LL6 S;  5LJ5 j;  3PTA A;  5KCH A;  1U1T A;  4UC4 A;  2LT1 A;  1BI1 A;  4J6Y A;  1SSF A;  4CI0 C;  2H3J A;  2E10 A;  1VQP T;  4HT8 A;  1YIT A;  1VQ7 T;  3A8H B;  1RI0 A;  5I2S A;  4RCB A;  3CCL T;  2EQM A;  4OB2 B;  2Y4X A;  3J7A F;  3CCU T;  4BI4 A;  4PJO D;  4A4F A;  4QVD A;  2CYZ B;  2QQS A;  2YLB A;  5KE3 A;  3LYI A;  4KBM B;  3OYG A;  4QQD A;  3E9F A;  1OZ3 A;  2EAY A;  4XTW A;  3S3O A;  3DKM A;  3NTI A;  1QP2 A;  5GAO q;  1Q86 C;  5LJ5 f;  3LX7 A;  1LOJ A;  3CCE A;  3X26 B;  4IUT A;  1BKB A;  3UDC A;  5GAM h;  3OYB A;  1BI0 A;  2DPP B;  2DO3 A;  4JDS A;  2DD4 A;  4LDU A;  5DM7 R;  4XK8 E;  3I55 T;  5GAO r;  3G6E A;  2KSS A;  5GMK h;  3LLR A;  1VQP A;  3WVE B;  2WSF E;  3MCA B;  4FIB A;  1FXX A;  3VU3 C;  2A7Y A;  2O4X A;  3CCL A;  5CQY A;  3L2Z A;  2LRQ A;  2LDM A;  2JTF A;  3L2Q A;  3OSV A;  4PLI A;  2ZGW A;  2GFU A;  4EDU A;  2MF2 A;  3CCU A;  2E1H A;  5D6X A;  1Q82 C;  1XTD A;  1G5V A;  5GAN f;  5HKC A;  4KUL A;  4BDZ A;  2XU8 A;  5DLO A;  2MAM A;  3GOX A;  1YIJ T;  4M7D F;  1JRI A;  2JNG A;  2KDS A;  3JCM P;  4BE1 A;  1UB4 A;  3QJ6 A;  4C92 C;  4IKF A;  1YCY A;  2YLC A;  4Q5W A;  3I55 A;  1K9M U;  1OI1 A;  1I8F A;  2RHY A;  2VXF A;  3A8G B;  3QBY A;  4N4H A;  1VQO T;  2KY9 A;  3G4S T;  1VIE A;  1N9R A;  2EIF A;  4ELZ C;  4BE0 A;  3OW2 S;  3OA6 A;  2DXB A;  2LTO A;  3CBM A;  2DTO A;  3C94 A;  5LJ5 d;  5GAN 7;  3G71 A;  1BIB A;  2LT4 A;  3HKS A;  1K73 C;  1GXI E;  2O01 E;  4F7U A;  3S6W A;  2XI9 A;  1YIJ A;  1YJN T;  1NJI U;  3LW5 E;  4MZM A;  4F7U E;  1U8R A;  3JCM g;  2E64 A;  1YHQ T;  4PJO F;  2JOY A;  3A8L B;  3KBG A;  3JB9 G;  3OYY A;  2QA4 T;  3HSB A;  2M0O A;  5A0G A;  1VQO A;  4XTV A;  1I81 A;  3G4S A;  3GLX A;  1YJ9 T;  2RJF A;  2M9U A;  2LNV A;  1Y71 A;  3FDR A;  3CCJ T;  2K5L A;  3JCM W;  3E19 A;  4QQ6 A;  2JUF A;  5CKD A;  1K8A C;  5HY6 A;  4QVC A;  3O8V A;  2RK2 A;  4FL6 A;  4M77 A;  2CGH A;  2JTM A;  3MO8 A;  2RB6 A;  3JCM e;  3OY9 A;  2KAF A;  1Q86 U;  4M77 E;  2PQW A;  1KQS S;  1XOV A;  5LJ3 j;  3CCS T;  3R6O A;  1VQM T;  2AHJ B;  2EYQ A;  3SWN A;  2DXU A;  1YJN A;  3RMQ A;  3BFM A;  1KD1 C;  5GAN 4;  3WVD B;  1YHQ A;  2K57 A;  4J8O A;  3GPL A;  4M75 F;  4OVA A;  1VQN A;  4J6W A;  4E7I A;  3E9G A;  4ZGD B;  2ZPE B;  4MML A;  5CKE A;  2QA4 A;  4XU0 A;  1KG1 A;  3ZFJ A;  4A53 A;  2X4X A;  1WNL A;  1YJ9 A;  4IUQ A;  1N8R U;  2P0P A;  2R5A A;  3VYG A;  3CCJ A;  2XK0 A;  2WSC E;  5CVI A;  1Q82 U;  3EFR A;  4V2S A;  5LJ3 f;  4R55 A;  4OGC A;  3CCS A;  1Y07 A;  2DXT A;  3KXT A;  4IUV A;  1VQM A;  3LGF A;  4FM4 B;  3M4Y A;  4F7U G;  3HFN A;  1M90 C;  4A4H A;  3OYL A;  3PNW C;  1MGQ A;  3M55 A;  2CZ0 B;  3CBO A;  5GAM j;  2PVO B;  4E7J A;  2O4X B;  2R5M A;  3OYI A;  1UEB A;  2RD1 A;  4LD9 K;  1BYM A;  3GNF B;  4IUU A;  1UGR B;  1VQ8 A;  4LDX A;  4JS5 A;  5GMK j;  5CCA A;  3LWH A;  4N0A A;  3CC4 T;  2RI5 A;  2FYK A;  1G3S A;  1K73 U;  4M77 G;  3JCM h;  3N5B B;  4MZP A;  4A4K A;  1Q7Y U;  1K9M C;  4HCZ A;  3AHU A;  1QVF A;  4M7A A;  2M1H A;  2XDB A;  2HD0 A;  4QVZ A;  1M1F A;  2EJF A;  1PSF A;  3CCV T;  4M7A E;  2RHZ A;  1NPR A;  5CKH A;  3M57 A;  3TEE A;  2L89 A;  1R8O B;  2HBP A;  3L2V A;  3H8Z A;  2EFI A;  5GAM f;  4ZN3 A;  1O75 A;  4C8Q G;  3J81 E;  3M4G A;  3PIP A;  4J7F A;  3CC7 T;  1WQW A;  1K8A U;  5LJ3 d;  3M58 A;  4B9W A;  4MMK A;  3WXM B;  3ZEH A;  3RKY A;  4C5I A;  2DEQ A;  5DY9 A;  3JB9 J;  3CCE T;  1PSE A;  1VQ4 T;  4OB0 B;  1NJI C;  3CC4 A;  1TH7 A;  2V8K A;  4XU1 A;  5FLX E;  4F7U B;  2VUB A;  3FC3 A;  3G6E T;  4JRI A;  3OYE A;  1VQ9 T;  2XIC A;  3TCJ A;  4BE2 A;  2QXF A;  2R57 A;  4HCB A;  4JRQ A;  3V8L A;  2D9T A;  1KD1 U;  1HK9 A;  4X34 A;  5D6W A;  2IVW A;  4M7D A;  3CCV A;  2YRV A;  4FU6 A;  3JCM V;  3TU4 K;  4ZGJ B;  4M7D E;  3LH0 A;  2NLU A;  2QQR A;  3QUI A;  1S72 T;  5HK0 A;  3SWN C;  3CC7 A;  3T9N A;  2G3R A;  5GAN j;  1WJQ A;  4M77 B;  1QP3 A;  4KT0 E;  3GIB A;  3GF5 A;  4JRK A;  5A2Q E;  2V8J A;  4XU3 A;  1VQ4 A;  3JB9 D;  4C92 F;  2DKG A;  1VQ9 A;  2BKD N;  2JZ2 A;  3JSC A;  3SWN B;  4C5G A;  5GAM d;  1UGQ B;  2Y4Y A;  5DLQ E;  3PT9 A;  4L5G A;  3S3N A;  4M7A G;  1M90 U;  3OYH A;  2I2L A;  2EJ9 A;  1N8R C;  2K5F A;  3RIR A;  1JJ2 A;  3OSS C;  3QJY A;  2WSE E;  3X25 B;  1JBM A;  2K2V A;  3G71 T;  3CPW A;  1U1S A;  2X35 A;  2LCC A;  1VQ5 A;  1S72 A;  2PUK B;  3OYA A;  2IG0 A;  5J26 A;  3QDR B;  4C0D C;  4MDX A;  3L2W A;  4NOY A;  2LCL A;  3UPU A;  1LNX A;  2RO0 A;  2L5Q A;  3X24 B;  1WJR A;  1YI2 T;  4RKU E;  4Y91 A;  3OYF A;  2XDP A;  2ZPB B;  4C0D B;  3FEO A;  1VQK T;  2KQW A;  5CKF A;  4RG8 A;  3QHS A;  5GAO p;  4A54 A;  5GAN 5;  4N0A C;  4M78 A;  3OS5 A;  2F5K A;  4HA8 A;  4M7D G;  1BIA A;  4M78 D;  1NZ9 A;  2A3L A;  3LGL A;  5FU7 C;  3ER0 A;  4M78 E;  5EG2 A;  1N27 A;  2DTH A;  2XDD A;  4YTL A;  4M7A C;  3MEV A;  1Y7X A;  2DIG A;  4JLI A;  1Q7Y C;  2CZ6 B;  4DOW A;  4KUD K;  3UWN A;  3MP8 A;  3CXC A;  2X4W A;  1FX7 A;  2P4T A;  4TVR A;  5FU7 B;  5FRO A;  4ZGE B;  5FU6 C;  5GAO n;  4M7A B;  1VQN T;  4FT4 A;  4OP0 A;  5CKB A;  4LD6 A;  3FRN A;  3ME9 A;  3RMS A;  4JRP A;  3HL8 A;  1YI2 A;  2XID A;  1UGS B;  1M4Z A;  2RH2 A;  1VQK A;  4X9D A;  2RHU A;  4GLK A;  3VV0 A;  5GAN d;  3QII A;  5FU6 B;  1I5L A;  4XQ3 A;  5GAN 6;  1B34 A;  5FRN A;  4RG2 A;  5GMK i;  3JB9 F;  3FJP A;  4M77 D;  3SFM A;  3A8M B;  3PMT A;  4HKE A;  2RHX A;  2EQU A;  2FB7 A;  1OYX A;  2VV5 A;  3HP9 A;  4MDW A;  2BIV A;  2LC4 A;  2CZ7 B;  2PUO B;  3P8B B;  1LJO A;  3JCM Q;  4C8Q A;  4RCC A;  2Y90 A;  5CAI A;  1OZ2 A;  2P0K A;  1BI2 A;  4C8Q D;  5KH6 A;  5J3B A;  2KK4 A;  4C8Q E;  2XG8 D;  5A0D A;  3JCM f;  2LVM A;  3OB9 A;  4WF2 A;  1ZBX A;  4C5E A;  1VQ8 T;  2QI2 A;  3Q1J A;  3CCQ T;  4JJN K;  1YBY A;  3CD6 A;  2KMT A;  2LQ8 A;  4M78 G;  2VYT A;  2K5I A;  2E6N A;  1H3Z A;  4ZTJ A;  5L8R E;  3BDU A;  1AHJ B;  3C4S A;  3RES A;  2VGN A;  2QDY B;  5I21 A;  4PNO A;  2E5Q A;  4BAC A;  3GP8 A;  4C0G A;  2VGM A;  3V7C A;  5LJ3 e;  3OQ5 A;  3P8H A;  4RMO A;  3M54 A;  2K4Y A;  1D3B A;  5CK9 A;  1KC8 U;  4L6V 5;  4VUB A;  3MEW A;  3CBP A;  5D6Y A;  2VC8 A;  3V8J A;  4BI8 B;  2RA2 A;  3JCM b;  4E7H A;  4F7U F;  2DXC A;  3KUF A;  2WAC A;  3M56 A;  2L8D A;  3X28 B;  3HHT B;  4XTX A;  3CCQ A;  2RJC A;  3MP1 A;  4LDV A;  1MHN A;  4E7K A;  2CS7 A;  3X20 B;  3DB3 A;  3BDL A;  3HFO A;  4BDY A;  4IUR A;  3OS2 A;  4M7A D;  4ME7 A;  2DZ9 A;  4M78 C;  3C95 A;  4E47 A;  3JCM d;  2QEX T;  1XNI A;  3OYK A;  2XHC A;  2P0Q A;  4M77 F;  1O9S A;  2E6Z A;  4C92 A;  4HT9 A;  1G3W A;  2ZPI B;  3A5Z B;  5CQX A;  3OBY A;  2OTL A;  2PVD B;  4M78 B;  4C92 E;  3CMA T;  3NTK A;  2HQX A;  2EJG A;  3QZ5 B;  1EIF A;  3PGG A;  5GAM e;  4OF1 A;  2B8A A;  3M9Q A;  2DVE A;  3JCM c;  3OYM A;  1JJ2 S;  3VJP A;  1RL2 A;  3CPW S;  3E1S A;  3OMC A;  3URG A;  4ZN1 A;  5GMK e;  3JB9 H;  3QSU A;  1P92 A;  4BUG A;  2ZPH B;  4ELY C;  2BUD A;  3QZ9 B;  1VQ6 A;  4FT2 A;  4C5H A;  3DLL A;  4EMH A;  4M77 C;  2D0Q B;  2MMP A;  4M7D D;  2QEX A;  2KVQ G;  4JS4 A;  5LJ5 g;  1VQ5 T;  2FL7 A;  3A8O B;  2PU9 B;  5IAY A;  3OBW A;  4C0F A;  3HRS A;  3VYH B;  3CMA A;  2X4J A;  4A4E A;  5KE2 A;  5J39 A;  3SDZ A;  2E41 A;  4C8Q C;  2QQA A;  4XU2 A;  2ZCF B;  4IUP A;  3I56 T;  3V7S A;  4NS5 A;  2JVV A;  2E65 A;  5LJ5 e;  2YHT A;  1YJW A;  3FB9 A;  2GCX A;  1NE8 A;  5KCO A;  4C8Q B;  1M1K C;  5GAN g;  1VQL A;  5C0M A;  3L2U A;  4KUI A;  4X9C A;  5AYF A;  3VUB A;  4J6X A;  2RJD A;  3CXC S;  4HCC A;  4EMK A;  4ATO A;  4PJO A;  3SB2 A;  3VKI A;  5IT9 E;  2DD5 A;  4LDY A;  4PJO E;  4C92 G;  1QVG A;  4M7A F;  4EMG A;  3QG1 A;  4DOV A;  4DQ2 A;  3CPF A;  4XAX B;  4BI3 A;  3RER A;  2QQ9 A;  3L42 A;  5GAN e;  2EWN A;  2XKO C;  2OAU A;  1X6O A;  3I56 A;  2PVG B;  4XTU A;  1W2B A;  1IZ6 A;  1KC8 C;  2DAQ A;  3PMI A;  3M53 A;  4JUV A;  5GMK l;  2DIQ A;  2DZC A;  1I4K 1;  4DA4 A;  1D3B B;  1VQ7 A;  5GMK m;  2ZZD A;  2K3X A;  3JCM J;  2RI2 A;  2RM4 A;  4M75 A;  1DJ7 B;  4MZT A;  3VUZ A;  4CRI A;  5M9O A;  4Y28 E;  4M75 D;  2M16 A;  4N4I A;  1X01 A;  3JCM X;  1W4S A;  4M75 E;  3QXE B;  4J83 A;  3MP6 A;  3RKW A;  4NL3 A;  3G7Z A;  4P5N A;  5C6S A;  1Y96 A;  2X4Y A;  2EQJ A;  2FHD A;  2GFA A;  1G3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...